3S2SA

The crystal structure of pyrazinamidase/nicotinamidase from streptococcus mutans ua159
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
182
structure length
182
Chain Sequence
b'SKALISIDYTYDFVADDGKLTAGKPAQAISKAIAQVTQKAYDNGDYIFFTIDGHDEGDDFHPETKLFPPHNIKGTSGRDLYGALADFYQKHENDKRVFWMDKRHYSAFSGTDLDIRLRERRVDTVVLTGVLTDICVLHTAIDAYNLGYQIEVVQSAVASLSQENHQFALNHLQNVLGATIIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pyrazinamidase/nicotinamidase
publication title Get phases from arsenic anomalous scattering: de novo SAD phasing of two protein structures crystallized in cacodylate buffer
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 72
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3s2sA00
3EEFA 4H17A 1J2RA 3R77A 3KL2A 1NF8A 3HB7A 3UAOA 2FQ1A 1X9GA 3HU5A 1YACA 1ILWA 3O93A 3OT4A 3O91A 3TB4A 2A67A 3TXYA 3O90A 3O94A 3V8EA 1NBAA 3O92A 4L07A 3LQYA 1NF9A 1XN4A 4WH0A 3OQPA 3IRVA 3R2JA 1YZVA 3S2SA 3TG2A 1IM5A 2B34A 3MCWA 3PL1A 2H0RA 2WTAA 4WGFA 4L08A 2WT9A
chains in the Genus database with same CATH superfamily
5L45A 1FMJA 5J5CA 3DTVD 4C43A 3DTYA 2GA9A 2YHAA 1QIFA 3BA6A 4G89A 4DCNA 4R9RA 2VA9A 1UMBB 5KNDA 1N2CE 3N0XA 3V2HA 4F3TA 4FUTA 3TGWA 3WLJA 1W0KD 2AEFA 3TL3A 1Z18A 2H4XA 4MKFA 3U09A 1JB1A 2G8LA 4KYVA 5CT6A 4NWIA 4BQQA 2C3YA 3TVDA 1UODA 4N03A 3AI7A 4CM9A 2JJ2A 4RHYA 4PS0A 1KRWA 5ALQA 2D5CA 3OLYA 1U81A 1KZ7B 2ZR0A 1WR8A 2JFZA 3OBIA 3OTGA 4AKGA 1X7DA 3L7CA 4IGAA 5AO9A 4LE0A 2P11A 5F52A 4O4LA 1X80B 2V6JA 1CX9B 2XB8A 3WYBA 3PXXA 3OKAA 4RGYA 5T64A 2QVCA 3GU3A 2XHZA 2YW2A 4RZIA 4ZI7F 2YINC 1GRCA 2QP4A 3NBQA 3LLUA 4UFPA 5JFTA 2H1VA 1OSNA 3L7MA 2NQ8A 3K1TA 4HNAB 2IUUA 1FSZA 5A9SB 1ZD3A 1N4AA 3MSCA 3OCVA 2ODTX 1RMQA 1X9IA 4W5OA 5E9AA 2QXUA 4ZOLA 3EVCA 2W4MA 4KQ6A 4P84A 2BW0A 4QATA 4CIDA 2JIOA 1PT9A 4HMQA 1GG9A 2FG7C 2EBHX 1N2IA 3I52A 5AK3A 5FLYA 1Z4JA 2R5NA 2XOKD 3D4PA 3WWEA 3G5AA 5FUQA 2VPQA 2CLLB 3CC8A 4L28A 4DLVA 1AKVA 2BBWA 1K9SA 4LNUA 3V7NA 2Q6TA 4RTKA 5SZJA 1FA9A 2HCTA 3RBAA 3D5EA 3Q6IA 4AF6A 4HUQA 5CLIA 2OLKA 5TC4A 4BL5A 4EQ6B 3NALA 1GU0A 3CG0A 1JQLB 4FFMA 5HE8A 4FE7A 5K1ZA 3X1DA 4DNXA 1YAJA 3BD7A 4F85A 5KC8A 4JMLA 3SFTA 2CL6X 2QQ5A 4F4IA 4PM4A 3ND7A 2P9JA 1U2TA 3FRJA 3RRFA 4V39A 2G71A 4XUDA 3W3AD 5IT5A 2A1UB 2Z8ZA 4XXHA 2YV3A 3D3WA 2PA0A 3A11A 5CG1A 1GHTA 4O08A 5BN5A 2XMQA 4KHPB 2WC1A 3WDLA 3EXG2 4F3KA 1VHJA 1WXGA 4P54A 1B42A 4B3IA 3CLKA 5ALSA 4DV6B 3OU2A 3NYIA 2XUQA 4YV7A 2B8NA 1N25A 1KP2A 2GDJA 3FRIA 3R6GA 2G06A 4J0GA 1SU6A 3P5BA 5HF5A 4Y6QA 1Y63A 4TX1A 3HK2A 2ZYSA 2X2EA 3CW9A 3IQEA 5JE8A 4FI3F 3OIVA 1A69A 4TM8A 3CNOA 4EHLA 1ZJJA 3MFYA 4WECA 4YT2A 4ZARA 2P78A 2C9MA 3ZY2A 2PRSA 3D7RA 4LJ5A 4ZK2A 4O4JF 3X1XA 1XTZA 1OLSA 4JK3A 2H0QA 2G17A 1JSXA 3DBHA 1LLDA 4TYNA 3U3JA 1DV2A 1Z56C 1I6KA 2RAUA 4I08A 4AY3A 1NW5A 3ZHRA 1ADFA 2G5TA 5H4HA 1SVIA 1IUOA 2PR7A 3E8MA 2OFFA 2YDYA 2QJRA 1D2AA 1TQ4A 2UVDA 3U13A 1MW9X 2C78A 1QHFA 1Z35A 3AETA 2IHZA 3IP7A 3PT9A 4TT3D 1I7QB 3Q9NA 3R0VA 4DSNA 2ILTA 2DSTA 4Y67A 2N1MA 4GBGA 4Q02A 3D8TA 1HUQA 1ZVJA 5IEBA 1TAUA 3OBBA 4NPHA 2ZJ5A 4H7DA 2EKBA 3H05A 1USKA 3U48A 6PFKA 4ARZA 1DHTA 4LTNA 3PIRA 2QRMA 3LYUA 2N47A 4K6GA 1VMIA 4X44A 2AXQA 3VC7A 3VM6A 4GVPA 2PKEA 4LCJA 1ORWA 1UWVA 3CF0A 4YJ2B 4EKDA 3TZBA 3A4IA 3OA0A 1IRIA 4RVDA 2JFGA 4EY3A 3HVJA 1HT1E 2YH2A 5CVVA 2QMHA 1OGYA 4FNGA 4FVTA 5AWFC 4Q16A 3C2QA 5IDWA 4A6PA 1QGDA 3QFRA 3DCIA 1MFPA 2XXJA 4MYRA 1XPRA 2X8JA 3UG6A 3N2EA 1P7WA 4QFBA 3LLVA 1FFYA 2PUDA 4NDNE 3GAAA 4CR6A 1L3CA 4KO3S 4Y6GB 3KZCA 1GD1O 1GQSA 5EE0A 1H4SA 3N3AC 3RS8A 3HBAA 3BMXA 3GJQA 4DADA 3ZCQA 2C0PA 3HXMA 2WAOA 1K6EA 1EHYA 2P6OA 3LUJA 2X1HA 5LA6F 5EXDA 4DPKA 3ZGYA 4FYYA 4FFOA 4X7PA 1JTEA 1FZQA 3QLVC 5JC8A 1BROA 2DUJA 2EU8A 2P9EA 4K9PA 5ISMA 4DV7B 4FXOA 3WMFA 5LWHA 3KQSA 2B34A 3WKAA 1H05A 4O63O 1MMFB 5J9FA 1FVFA 3RC7A 3LECA 1J09A 1BJKA 4D82A 1Y6RA 4OXQA 3DE1X 2Y99A 3U7FB 2LGJA 2VHYA 3DQQA 3WHKA 4G56A 4BZPA 2O1WA 2R1UA 3H7AA 4I9FA 1NN0A 1U9YA 2JLVA 1U0HC 3OQNA 3DSRA 2OQRA 5CAEA 1F3OA 3SF8A 4BU1A 5IFKA 4N5HX 4FEYA 3R23A 1VL6A 4LDNA 1A2OA 1QFSA 2R751 3T6KA 2JEZA 3ZHVA 4Q93A 1Z37A 4AICA 3NDPA 2ZAYA 3FMVA 3ZV7A 3FZNA 3Q3HA 4IRMA 3OHSX 5GJVC 4QBTA 1A8PA 5BSUA 5HJEA 4RZ2A 3EDCA 4E11A 4F8YA 1U63A 3U7GA 2Z9DA 1VE5A 4OQEA 3BGIA 4CF3A 3THYA 1V4BA 1XZBA 1KZ4A 2HO4A 1D7OA 3R0XA 4WOKA 4XEHA 1P9OA 2QXYA 2UVQA 1Z5VA 3GCXA 1IHPA 1FMCA 1RBYA 1S0UA 2RBEA 3EBLA 4DMMA 1K88A 4GGPA 4KFCA 4IV0A 1HL3A 4JJAA 1TGYA 4NHEA 3SJCA 5E6RB 3G0HA 1HT2E 3KVRA 1BE0A 2O8EA 3HCRA 4LDPA 3L7YA 2PH1A 4BLQA 3PRHA 4G5FA 4W5WA 2PRYA 3I5UA 2HSDA 2AN3A 2H1SA 3E1KA 4TKLA 1E3QA 1RQNA 2AJBA 1B41A 2HK8A 2HU5A 1QVRA 1B8NA 1UKBA 1MB3A 1ONPA 3ERCA 3ASZA 4HCJA 3ECAA 1V6CA 2YVQA 1PFGA 1SGWA 4GMHA 4F6CA 1V41E 3TINA 1P2BA 4DBLE 2TECE 2QGNA 3IJEB 5KEIA 3L79A 1KJYA 1G6KA 1MJ5A 3OZGA 2B1GA 2GAOA 2JI6A 1IBRA 1A3CA 1G98A 3QLVA 3CH6A 5CLFA 4BKQA 3L04A 4UTZA 1EXDA 1QONA 1KVTA 3MJVA 1HX7A 1ABFA 5TB5A 3CUUA 4HZUA 1QK5A 4ND8A 2IKSA 3V7WA 5JZBA 2EF1A 1XQ6A 4AJIA 1N9GA 3P9NA 3K94A 2C20A 3UV3A 2ICAA 1NT4A 2FQYA 4ZVLA 1NUPA 4IIYA 4O1HA 4QTUB 4E03A 1WZIA 2J9ZB 2VH2A 3WGMA 4QYTA 2O2CA 1E96A 5JU6A 1PNQA 3AVUA 4B8WA 4EKYA 4AAYA 4BFWA 3PC2A 3QMVA 4G9BA 3PU6A 5HOQA 2KPOA 3EPPA 4WLVA 2WHPB 1CSEE 1TA0A 2OXFA 1Y98A 3LQ2A 5FH9A 1KVSA 8GPBA 3IPAA 4AO7A 3BWDD 2O2DA 2X9NA 3EVDA 1U4OA 4UE2A 1LQ2A 2NTVA 3NVAA 4MQEA 5FPQA 5JT1A 2ZIWB 3AERB 1ECPA 1KFCB 2VSXA 5TXGA 3MCTA 1N2SA 2VCYA 2GXQA 2Z2ZA 2G63A 3FPHA 1GNVA 1YDWA 4NBTA 4LX8A 2JHCA 3O75A 2OXIA 1G4AE 4DSZA 1QCYA 4NQZA 1L7OA 1SCUA 1XAIA 2PA3A 1LLCA 3C3EA 3MERA 3LPLA 3VX4A 4EDHA 3HYSA 4KQJA 3JQ8A 3WWPA 5I4CA 5KKNB 1NLFA 2J3DA 2PTHA 4KGDA 3L8GA 2ILVA 5TVGA 4ZZ1A 4MVYA 1N3BA 1VSUA 2I8AA 1PS0A 4PX3A 3W05A 3PC3A 2N42A 3IDFA 3NC0C 3VYVA 4MUJA 3PWTA 4PTYA 1QF7A 4IVPA 4IGEA 4UU7A 1UJ4A 1KQ3A 4JL8A 3TM5A 3N2LA 2FWRA 3TRHA 4KIJA 2FEMA 3GIWA 1PS8A 3QX9A 4XRRA 5AW0A 1S4QA 3BWCA 1OTYA 4GNRA 4IQ4A 5FBRB 2QLJA 1ISJA 2VYCA 2CDBA 4JMPA 1V11A 2D7JA 2WLSA 3AVQA 3QZUA 3OJWA 4RAQA 3W7AA 2PMFA 2HMAA 2L82A 1KEPA 2NO1A 4OF4A 4OYRA 3ZKWB 2O1XA 1ESDA 2XH8A 2AQKA 1Z13A 3IP1A 3VMMA 1B8OA 4BJ1A 4BUCA 3PB3A 4EY6A 5I7HA 3VYTB 1ESZA 1KDTA 3G2LA 2RGNC 3K53A 1ZUD1 2OUIA 5E2IA 1UH5A 1Y5IA 3CKKA 3MCUA 4HEJA 3STWA 5EXPA 3TNLA 3TO5A 5JCZA 3ULKA 2Q3HA 4RH0A 3VOAA 1WUYA 4FR5A 4DDWA 2HA2A 4FCWA 2W93A 2FPIB 4XX1A 3JW8A 1XUOA 4UEWA 1PZHA 3I76A 1E2HA 2J5RA 2WF9A 1LC0A 2SICE 4G0ZA 3A9SA 2PNFA 4WN9A 3L7DA 1RABA 4JSRA 3F6YA 5E4FA 3QE9Y 2QR5A 1N6RA 1L5WA 4IGKA 2WKPA 1DRKA 2WF5A 1W5EA 1QHNA 3HYTA 3H1PA 1Q19A 2NP7A 5KNCH 4LDAA 1U3GA 5K99A 3E0XA 1P6XA 1ADYA 3ENVA 1NMSA 1EDDA 3TRJA 3QJGA 3GR6A 1XLTA 3ZEIA 4RJ2A 4BMVA 4CKCA 4EIWA 4EKGA 4NYMQ 4E12A 3WB9A 1VL8A 5C80A 1UJBA 1AO3A 4DS3A 2AMLA 1L7PA 3H9GA 3URMA 5BOSB 4YJ3A 5FFMA 2F8SA 1RNLA 4HL6A 5K3FB 2PLRA 2ZB8A 2AZTA 3JX9A 3G5LA 1WM1A 1RRKA 2P9HA 4EMTA 1SKMA 1ZD1A 3HVKA 1ES9A 2I2AA 4EP1A 3M34A 4BFZA 1T4CB 2D2XA 3KFXA 4OP2A 4UAVA 4CKBA 2VDMB 1W19A 5DRYA 1W29A 4G9EA 1C9JA 1LWNA 2OHFA 3JQCA 2UZAA 3MT0A 4CNQA 5JTTA 4H7IA 3FOAA 2FZWA 3GJRA 4L0QA 2JJ1D 1P44A 1MC8A 1LTKA 5AM1A 3THWA 2Y1FA 4MAMA 4PCUA 4MLZA 3MUEA 4QYIA 2YWEA 3VYRB 1JXOA 2IEGA 4EB0A 1ZMRA 1UJMA 5BSEA 3LI2A 1AXEA 2PT9A 3HFGA 4ZRDA 2BF7A 4A03A 1EZZA 1L4KA 3JY6A 4TYMA 2R6DA 1TEXA 4J0EA 5PGMA 3SEZA 3BZUA 3JAMA 2VN8A 3DKPA 4AYXA 5REQB 5EQDA 2AD5A 4OJMX 1DAGA 3O6VA 1SPBS 3GPIA 3KKZA 1IVNA 3LC2O 1UXIA 4K6OA 5FXMA 3V4SA 2RGNA 1SIBE 2L19A 3UJPA 4WZAE 5JJ5A 4ND7A 3KWFA 5HCIA 1W36C 2RBGA 5FA5A 5TJ9A 2BGNA 2IJGX 1A4RA 2Y1WA 5E0KB 1EGMB 5EXTA 3OZAA 2P5TB 4I1UA 2QN7A 2PX0A 1NVDA 4DSUA 2OFWA 3R7FA 3NORA 5HXAA 3HB7A 5KU1A 2VJAA 3UAOA 1Y9ZA 2YZMA 2PKQP 4FDTA 5LP6C 1OT3A 2PSHA 4KTTE 4CFSA 3L05A 3JALA 3Q9SA 2HDHA 3PXDA 3W3AA 4K03A 1Z0SA 5DNWA 1Q7RA 1JA0A 1T8TA 2IXDA 5IKEA 3U9SA 1UJ2A 1Y8CA 1GU1A 1IXZA 3SYRA 3U40A 4PGGA 3A3NA 4IDBA 3S27A 4HVCA 4CL2A 3PEWA 4A2WA 5JEEA 4U2BA 1IHUA 1I3KA 1RKUA 2BEUB 2WSYB 3LVQE 2M6LA 4CM8A 4E7OA 2IHNA 3QU9A 3AWDA 1L4HA 2FZ4A 1Z28A 2FDRA 2XB9A 4V0MA 1U3DA 2Q4TA 1YASA 4REQA 1GLVA 2ZJAA 2RGCA 4BLPA 1IZZA 4ZQBA 1Z16A 5F7JA 1ZGCA 5JLAA 3TSYA 4EVQA 3NWJA 2WTEA 4AY6A 2V7QD 3DO6A 1QBGA 1BC5A 1NR1A 2PRJA 4TRNA 4BGEA 3E58A 1FDSA 1V35A 1FLNA 1NYTA 3GEDA 4WASA 3CUTA 5CG2A 1N3YA 2IXEA 1YB4A 4WY5A 2MMGA 1V2GA 3KB2A 3K9QO 3OOHA 2D62A 1PJ8A 4JJIA 4MQFA 2H5JA 1PT6A 5K51A 5LJIA 1HWYA 1O0SA 1WX1A 4GLBA 1M34A 2G08A 3HCPA 4EG5A 2FN7A 1QX4A 3T95A 2V1UA 3EGOA 5C8XA 3AFHA 4WCFB 2WFZA 3U9LA 6LDHA 5KYVA 3MWLA 4UJ5A 2XTZA 1E98A 3SHWA 4II7A 3GNTA 4HQ6A 5EEGA 3RHSA 3COJA 1DUIA 4QYSA 3EDMA 1DX9A 1P1KA 4RAOA 2Q6KA 5JSYA 1FS4A 4ZO9A 3SDSA 3UXMA 3T9AA 2ECPA 2JZNA 3B3GA 4RORA 1U9IC 4CMAA 2FF5A 4Y2RA 3WY9A 5E8RA 2DFNA 1JQEA 1KDPA 1UIMA 2VF2A 1QMPA 2NYRA 1XF1A 3EWAA 3GLVA 4RQTA 4V24A 1DAIA 5M3BA 3T12A 4DJJA 4ECAA 2CXXA 1UMCB 3JVIA 2GAAA 4OHZA 5FPPA 1H42A 5IYZB 2O7VA 2DGDA 1JT9A 3IMGA 1MO4A 1JIXA 3GPCA 4J4HA 3W34A 3GUVA 5LP6A 1Q0TA 3DDUA 4QELA 3LPCA 1T2VA 1Q7GA 4Y2XA 3C4JA 3ZE1B 3PWZA 4QBIA 1H1TA 1SY7A 1MOQA 1GPJA 1X86B 5A3VA 5KWEA 5CEFA 1ZH8A 3S99A 5BWCA 1QX3A 3AKDA 1PL7A 1U6JA 2QN1A 3D1VA 3I2YX 2B0CA 3QE4A 5E1DA 3KIPA 2YHUA 5DT2A 4RHTA 3V4FA 1VKOA 4B0OA 5FDFA 3LQ1A 5E3JA 2PBZA 1T1RA 2CUZA 5DGIA 3RJMA 5FCDA 2ONYA 1SCDA 2JS7A 2YN2A 2WWRA 3MUFA 4U2CA 2QE7A 1KGDA 1YVRA 4NBRA 4LRSB 1HRKA 4B32A 3SM3A 4JEHA 2N0SA 2NT3A 3UAZA 3DDWA 1GXSA 3OCZA 1CUHA 2RB5A 3KB8A 3SZOA 1LEHA 5K3CA 1QB8A 2P6UA 2WFLB 2HMSA 2BFEB 3GJ7A 3UT6A 3ZQUA 4BAZA 4W5JA 4PG7A 3HACA 4MNTA 4C4YA 2ZUSA 3BFKA 4ERNA 4M8KA 1JRLA 5CEJA 1OI2A 1SOVA 2P7IA 2QN9A 3P71T 4GR9A 2V5UA 2ZBDA 4P5PA 2PH7A 2CFIA 4M9ZA 3KEGA 1UUFA 4DCTA 2NU8A 1MT0A 5JECA 1ACMA 1UXHA 1JQKA 3SC6A 2NVWA 3B3JA 4RNCA 4MR8A 2PL3A 3ELYA 1XMXA 3SIRA 5HIKA 3KLMX 5IWAB 1GQ2A 2Y0PA 2IZ0A 4C4ZA 3K9BA 4FBLA 1WE2A 1MZVA 5DN9A 2O7NA 4JODA 3WOHA 2IBTA 1XZQA 2GZ3A 5ALFA 1L7BA 1U9IA 3MXTA 2ERYA 3V1MA 4B6GA 4D42A 4BS9A 1U0OC 2FH5B 1V45E 2PEZA 3IUEA 5EKSA 3H3FA 2ZXFA 1Z2EA 2ZZKA 4JBHA 3OWXA 2WD7A 2AZDA 2HB6A 3CGGA 1L5VA 3FD8A 5K8VA 1Z0DA 4TLBA 1K92A 3OZWA 4ZAGA 2JBWA 3KTDA 4CR7A 3R5KA 3H2SA 4Z8YA 4AF8A 3GT3A 2DFVA 1SA0A 2BMVA 1DT5A 2BVNA 1S9DA 2YFQA 4B2IA 3MHTA 3L6OO 1G60A 3N8IA 1L1EA 3FYHA 1ATIA 4LFCB 2YV1A 3COYA 4KNVA 4U9HS 5C3UA 1B8UA 3N8GA 1IATA 3I45A 4MDYA 4TN5A 4D3YA 3ZUPA 1KJ8A 3FCEA 4TMZA 2ORED 3GROA 3KQMA 4IEEA 2QRVA 2VQ6A 4GC9A 4XVHA 1QHHA 2GR9A 5EE3A 3KM0A 4Q3CA 2J3JA 2QTHA 4CDRA 4FLEA 3OJEA 4Q9HA 1K97A 3A31A 5DNDA 5KIAA 3W3ZB 4ENPA 1K8XB 2V74B 4XYGA 5JO0A 4IOKA 4NNJA 3UUEA 3A28A 3FBTA 4LOIA 1AIPA 4I3HA 3JQGB 2R6FA 2BY4A 1VGRA 3Q5EA 4QVKA 1XIVA 3TKAA 3LUHA 1BXZA 2QM7A 1W0CA 1YB6A 3HA2A 4FSXA 4OXRA 1JHPA 5ADUS 4L2IB 1B1AA 1K3UB 1Y3AA 2VXBA 2H07A 2GFHA 2XJ4A 3K4PA 3KEOA 2NVBA 3AR5A 1NIPA 3WQBA 5KNBA 4J76A 1ODTC 4EZIA 2HTFA 3HA5A 3QV1A 2ZT5A 3RSLA 3N7TA 3TSWA 4E5MA 4BX2A 2XZOA 1V95A 5A62A 2Q2WA 2Q5LA 3LX5A 1UPUA 3ZU3A 3H4VA 2CB0A 2NGRA 4X8LA 3QYAA 5C5EA 3VTAA 1LJLA 1XKLA 4LF5B 3ELWA 1XTTA 3EUAA 2IYYA 1GTVA 4HRXA 1W85A 3K5PA 3AVXA 2ZIXB 2FWIA 4HPXB 1TM5E 4Z9AA 1CZLA 1Y80A 3GGDA 3DBLB 1X0XA 3KOZA 2D5AA 3O03A 4MPRA 4DQXA 2N9UA 3S2ZA 4G8JA 5CFZA 1OH8A 3ED1A 2BRUA 4X7RA 4ZO4A 2EL7A 1JT2A 2ZJZA 5DI9A 4IO1A 1NUHA 4NMWA 5F5NA 1OBHA 1N6PA 2I4MA 3M70A 1Y3CE 3JARB 4ZHQB 5EIFA 4RVGA 5E8JA 3MTAA 3TL2A 3UMRA 3EXEB 4Y9DA 1GV0A 1GCGA 4CTJA 2SNIE 3JD3A 3FVTA 5DN6D 2QZPA 2XIQA 1CEYA 1J07A 1PZXA 1PQYA 1R74A 1RQ2A 2CE7A 3KZKA 3CXUA 1TNDA 3RT9A 3N07A 2V58A 1GVHA 1ORHA 3LLMA 1A9XB 2CCKA 1QH9A 4RKRA 3WLLA 4BWFB 4R4JA 1WEHA 3PPWA 1Y1SA 5KNLA 1G21B 3G5UA 3KX2A 4WKOA 3VPXA 1FP2A 4I4IA 5IVKA 2FDXA 4V2UA 1ZM2A 4YI3A 4ZOQI 1ESEA 1R6UA 3UPDA 4PC2A 3IPXA 1JHXA 3V4OA 5LNK6 5KMGA 4B7CA 3N6VA 3OOSA 1MOZA 4BO6A 4DG9A 4GQAA 2B8WA 3WNCA 2LNDA 3M6XA 4KDCA 4ZPJA 3VKVA 3W2HA 3CW2A 3U26A 1N7JA 1POXA 3GNQA 4EHJA 3TQTA 4HWKA 4KQFA 1CBUA 2G3YA 1R64A 5I7WA 5AJXA 2OECA 2BONA 3JD0A 3ETNA 3EZ7A 1AQUA 1EVKA 1XQXA 2FMXA 3IHTA 1JG3A 5K3AA 1NMQA 3I39X 4PQYA 4AJLA 5T57A 1Q84A 1J4AA 2ZYWX 4W7SA 5CJPA 3VNVA 1ZJ5A 4BFTA 3TSCA 3H1GA 5HF9A 5A9TA 4F3RA 4WV3A 3Q72A 2IYXA 4ARSA 2P6NA 1LTHR 2JBAB 3I1FA 3OZUA 1H2WA 4J0HA 3FAKA 5TS2A 3ACBA 2HW8A 2HBYA 5AVUA 4KYIB 6ADHA 4Q9NA 2FVXA 1O6GA 4A23A 4CW7A 3JRWA 1EEHA 4G9GA 1CVLA 5KKCA 2GNAA 3L46A 5CXUA 3DZDA 1V5EA 3T1QA 2O5RA 3KYBA 4JOBA 3JWIA 3VBCA 3ZWXA 1RXWA 5L3QA 5L9AA 3RQIA 3LQRA 4JUCA 4IH4A 1DVRA 1F4LA 2C94A 2C96A 2OHJA 4LY9A 4NZOA 1EIWA 5HFAA 4G1EB 1LLFA 1G291 1H6AA 1HRDA 2NG1A 3KE8A 4C2UA 2HR1A 5GONB 4I4TB 4EHIA 1FDWA 1QCZA 3KUUA 4X60A 2Q2QA 1BQ4A 3R3WA 4YRFA 2DWCA 3LDFA 2GJ9A 4RVFA 2VDJA 4RA6B 3T5CA 4HUTA 4QBGB 3U1VA 4Z9BA 3RJ5A 1TU4A 2P2LA 1ZHHA 2QUZA 2P6RA 3C7AA 3VUEA 4G0UA 2REBA 4GDFA 3AHDA 3WLFA 2H2IA 1VI5A 3A58B 3CURA 5D01A 5BT8A 3R9XB 5AVKA 2ESRA 3S6JA 1HG1A 2G8NA 4WH0A 4MW4A 3GCGA 4UZSA 1XZCA 2VS1A 4YP6A 4CIWA 5KX5A 1P3DA 2X2OA 2YZ2A 1ZBQA 1GN9A 3PCRB 2IE0A 4IR7A 2IU3A 4WRRA 3O8RA 1SVSA 3QX3A 5DX0A 4IFBA 2GZAA 4MUMA 4CLDA 1YMQA 1D2HA 1QIIA 4JLNA 4TZ6A 1QGAA 4MWBA 2AEJA 1NDUA 2BEVA 3DPSA 4K3VA 1VYTA 4LJYA 1TO6A 1UK6A 4BEVA 1ZONA 3FVVA 1J1UA 3TJMA 4RFVA 2NPIA 5DEIA 3SPXA 3GPBA 3K6KA 1SULA 2FRVA 4L6AA 5DHFA 4EY5A 3VJRA 4RADA 4UCQA 2E6UX 1ISMA 4QG3A 2WUEA 5AKJA 5AOVA 3CWZA 3TPZA 2HIAA 3EQ6A 2QTVB 2Y1LA 3LY7A 3QH4A 4Y6OA 1UFKA 5FWYB 1S02A 3GMSA 3JD2A 2REXB 2W6IA 1P74A 4G37A 4H0NA 2CSUA 1U5BA 2H59A 2COEA 3A6JA 1MO5A 2DUWA 3BFPA 2RI0A 4WN3A 3D9QX 3ZXXA 4D4GA 1T1IA 3K2BA 4CM4A 4DHEA 1EP9A 4MKHA 1Q16A 4IXMA 4TUYA 2FR1A 4M8IA 1NFRA 4YCDA 4ETWA 2AA3A 2AN5A 3JYHA 4XDGA 5TY0A 2A9OA 1ZZGA 1NZDA 4P4SA 3TIFA 4PSVA 3PJFA 4DLZA 4FZRA 5H82A 1LPPA 1NYRA 1YS4A 2V7XA 2YHIA 4TKUB 1ANKA 3TE7A 3ZZMA 2LBPA 2D4AA 3HGQA 5J4VA 2WSBA 3M5WA 4RTPA 4P1ZA 2BUAA 1W1UA 3LK6A 1ULAA 3C3WA 1ZCJA 3P2MA 4I2NA 2WWVD 4B45A 1K5DA 3IR5A 4MJ7A 2NO4A 1M72A 3L92A 4B81A 3HEMA 1O5TA 3SS9X 1GYQA 1ZJ6A 3Q0EA 2Q46A 2IXTA 3M3PA 5KDDA 1BH2A 1NLUA 1AKYA 1KAGA 1VB3A 1OA1A 2J6IA 5D3KA 2OAP1 1TK9A 5DP2A 3ZHXA 4B6JA 1T8WA 4R1LA 2VAPA 1NTRA 2ZRHA 4L85A 1FXWA 3DVAB 1TUBA 5H5JA 1EEXB 2X5OA 3G0DA 3FB1A 3IE0A 3M3DA 3GYGA 2HSWA 4J3NA 3RRNA 4P92A 3TRKA 3ICCA 4JLSA 2C2MA 4RFSB 3UHOA 4LG1A 3RS7A 2R8RA 2CJYA 3TQRA 2Q5FA 5FPTA 3NC4A 1Y3HA 1B2LA 3UHAA 4NDAA 4XLLA 2HMYB 2DEUA 2CDRA 1MR3F 1OUMA 1PG2A 2HUNA 2I6TA 3LZ6A 3NASA 4JHXA 1FP1D 1H6DA 4FGUA 4HS9A 3TAHA 4PXSA 2ZLBA 2HA6A 1KSGA 1FSGA 3ZJUA 2ACWA 5EINA 1S8OA 3CY6A 5I7VA 5KPJA 2ZPTX 1QFMA 1G5HA 2I71A 3NFYA 4ME6A 1NP7A 4BBPA 3GOQA 4RZ3A 5KYXB 3PZBA 4IJMA 2F1HA 1OASA 3IAS1 3H18A 3DS8A 3S70A 1OU4A 4RF3A 1C8KA 2BL4A 4UVEA 4YRMA 1PR4A 1YBAA 1I5OA 1T1GA 3NRCA 4J2HA 3T3OA 4OP1A 4EB6A 1KORA 3K4QA 5SZIA 3CZPA 1MNQA 4G0YA 1IUPA 2B37A 3TDMA 4QC2A 4BNFA 3NVDA 1NURA 2LCIA 4CTMA 1J6UA 1XJ5A 2GYYA 2R66A 2WUVA 1ESCA 2EP8A 5FBWB 2BFPA 1JPNA 4EDFA 5DM0A 2FZEA 3S40A 5K0SA 1OWNA 5MGNA 2W00A 2IS1A 4F06A 5A0VA 2C1XA 2QRUA 3ZHTA 5ITZB 2VYQA 1QAOA 5DYNA 1RU3A 1T3LA 3OFVA 2HQRA 1DTEA 1L4LA 2GQ0A 2P40A 1WOYA 2F9LA 2XRFA 4JROA 5GJCA 4N76A 1FJGB 2PZLA 1QYCA 4E4YA 1ODCA 2PRIA 1QP7A 3FM9A 3GVCA 1FVOA 1W0JA 3ADOA 2HT1A 1PZFA 1K6JA 2CNWD 3CNEA 2AFHB 3EQ8A 2VUTA 1M1ZA 1LS6A 4FEAA 3VOSA 1U8AA 1YDHA 5EMJA 1QIGA 1XZPA 1BEUB 3UAWA 4CCSA 2GN6A 3Q3VA 4V1CA 4H4DA 5DV9A 3P0HA 3AHFA 5KTOA 2AVNA 2BH2A 1R1DA 3K05A 2IWRA 5CDSA 1NI3A 5FOQA 1U9JA 2FEPA 1VLVA 2ODBA 1OKKA 1EXVA 2J6CA 4MW2A 1ISFA 2YZGA 3KB6A 3VC3A 5LKRA 2Y68A 1NQOA 3DPIA 4KQ2A 3IVMA 3O74A 3F1KA 1VLQA 2WWIA 4ENWA 1C1HA 1YACA 3EXFA 1S7CA 4M7PA 3GAMA 5EWMB 3FHOA 2BTOA 1HLPA 1LVUA 1JFFB 3PDJA 2EDCA 4ZJPA 2O2XA 2WTBA 1ICIA 2GCEA 2GTIA 2I62A 3EMVA 4JBYA 1M1NB 4W9MC 2QX9A 3AZQA 4RDCA 2PS9A 4LBVA 1OYWA 5I8WA 3ETEA 1GLGA 3ZJ5A 2Q0HA 2NTYC 3K0AB 5H3LA 3K6SB 1E9EA 4NY1A 2ZSBA 1CERA 3IA2A 2NQ2C 1HYEA 1QUEA 2J3EA 4RTQA 4D9EA 2IXBA 3TLMA 1SCAA 1R27A 1DLJA 1LPSA 2H4FA 1DL5A 2IYVA 3FDJA 2GZHA 2GM9A 2ZT6A 3H8SA 3IO5A 4FFBB 4HB0A 3STTA 4DQVA 4Z51A 4AY2A 3ICQB 3HZRA 2GJKA 2FKAA 5DLPA 1AUVA 1Q2XA 4CLHA 4HEQA 2O4CA 1GL3A 3ZY4A 4QT0A 4MVCA 2CJXA 4MZDA 3ZIAD 3FNQA 4E5VA 1AF4A 1P3JA 2LE0A 2Q21A 2O9JA 3PPIA 4IWYA 3RYHA 2GO1A 3CUVA 3QEMB 1Z6AA 2CNOA 5EP1A 3SQNA 4E14A 2CKDA 1AQNA 1O8CA 1DC7A 2PN1A 5IAJA 4X6LA 3H13A 4AT1A 3OE4A 1PWEA 1F2TA 4GMKA 4UD2A 4FCCA 5EKUA 3RHTA 3VHXB 3C24A 1NN5A 4P6VF 3OX2A 1MHTA 5DISB 4X1YB 1XT6A 4YDSA 4QU8A 1FDRA 1YBMA 2D1SA 2W8BA 3VC1A 3GUZA 3IQGX 3IQZA 4X45A 2ZE5A 1K4YA 1D5WA 2WEKA 4YALA 1RC8A 3LUFA 1VOTA 2TMYA 2YXBA 2G83A 3INGA 4TZKA 4TWRA 4FIZA 1A04A 4J1QA 3ZWMA 2PJUA 1PWYE 2EBFX 3LLSA 3UGTA 3BT7A 2CMHA 2EX4A 1Y33E 2QI9C 4MUXA 1TMGE 3WK4A 2BEWA 2PPVA 3I5AA 4CQMB 5IJZA 1M2GA 1YKFA 1FNSA 2PRKA 4AQYB 3K09C 3FOBA 4LW8A 5AKXA 2V54A 4Q24A 1IFXA 4EY8A 1P7VA 1VRCA 3DXZA 4LSMA 4UOZA 2P9YA 3IAHA 1EGHA 4UATA 2I6UA 4YDRA 3RB8A 3V4ZA 4ZAXA 1ZISA 3VNAA 3EXAA 2YQZA 1LWOA 4IDAA 3WRVA 3H75A 5AJTA 4NXMB 1FP4A 2R44A 4YAFA 4IGFA 4XTRA 5IBQA 1T0IA 2NU6A 2B9EA 3ACDA 2V97A 2OHGA 5I6DA 3RK1A 1OHHD 3SXUA 3ZQ4A 4GWLA 5HQ3A 3EVEA 4Q9IA 3BRQA 4F7DA 4PHFA 4LSGA 3CUYA 2CUNA 1YBVA 4I99A 5K4GA 4I50A 4PLYA 4MWOA 1A7JA 2GCNA 3JZDA 5IVHA 5F78A 2W2VA 3GRKA 1IUNA 3PYXA 1YD7A 1YA8A 3H2KA 2O8CB 2MMCA 4HTFB 4X41A 3RRMA 4RGQA 1PDVA 3ZE7A 1BWQA 3CONA 1IN6A 2HSJA 4JC4A 2P27A 3CKMA 1H93A 4AUNA 2GVZC 2WHXA 3Q8KA 1KO5A 5AM5A 5KSYA 4GSYA 2IEYA 3H4MA 3HCWA 5DYTA 2YUIA 2R7KA 2ZSIA 3QU5A 2Q3FA 2XCLA 3Q7EA 3TW8A 1KMCA 2DX7A 3RG8A 1CRPA 4TZTA 1ZMXA 3IAUA 4D41A 4CFYA 4X91A 1U0LA 2HF8A 3IELA 4RKQA 3OQIA 3RS9A 5HKAA 1D1SA 5ERXA 1N6OA 4F92B 5K0FA 3UWDA 1NSFA 4NZMA 4AJ4A 4WJLA 2HN9A 2JJQA 5LIRA 3PHHA 2UZ1A 3V34A 3K35A 4M22A 1RJDA 2G0NA 4ZU3A 3PA6A 3IILA 4OEHA 1ND6A 1QLHA 2P4SA 2V7BA 4ZYWA 2B1QA 4KU4A 2C9BA 4GIBA 1G3MA 2FOLA 3JCZA 2QVYX 1TM7E 3OZTA 2GN9A 3E35A 4MLCA 4BNDB 1E6KA 3Q7RA 3IHKA 1KVQA 1GJRA 3HVHA 5A2QA 3O8LA 4IIXA 3K09A 2OZLB 1A4XA 5E6UB 2O52A 3NU1A 3HY4A 3MTQA 3UATA 3BZBA 4ZN6A 4DBLC 1PFQA 1Y1KE 4BGVA 4OO3A 1P5FA 1IH8A 4LWOA 4LF9B 4DVGA 3HG7A 2W6JD 3OI7A 1D2GA 1B76A 2XYRA 4YJDA 2QPAA 1H5QA 1NVFA 3M6FA 2CCJA 3A04A 2A5JA 4D56A 1D4FA 2J08A 2J0EA 4QICA 4RMGA 1E3WA 1OF1A 1CJMA 5AXDA 3T38A 5IXYA 2YCBA 2R8OA 4K88A 1M7GA 2YUTA 2Q7DA 4BP3A 1BCRA 2PKYX 3VR2A 1ACJA 1W88B 1XCLA 1DWQA 1HFJA 1XTVA 1JNYA 2PGDA 3DV0A 2JHPA 3EVNA 1Q1GA 1Z6PA 1PR1A 3N75A 4EFKA 2IPNA 1ZUIA 3C43A 3T3PB 3TXAA 1EDZA 1UADA 4I1IA 3L6RA 4K28A 1C7FA 2M6SA 4UHEA 3EULA 1B6GA 2XRZA 2VUUA 4GLJA 4JR1A 1IBSA 1QJCA 2CHEA 3SE0A 2YIVX 3FE2A 4MKRA 4OH7A 3WC4A 1JYFA 1OCEA 3AB8A 3L07A 5EXSA 2H0AA 4AKIA 4B76A 5EZYF 1R10A 2FLKA 3KLPX 2JGIA 5DKFA 1BVYF 1Y8AA 1UQTA 4PZLA 5HJ2A 3NHZA 4Y1GA 3OF3A 5FEUA 4Z7OB 5LFAA 2X13A 3LZDA 5TPWB 4E08A 5DNUA 5J1SB 3LL7A 2C7QA 2JI9A 3CHYA 2YV5A 3KNZA 5CA0B 4CV2A 5DEOA 2VJMB 2QF7A 3W2FA 3R24A 5JZMA 4ENTA 2Y6UA 2PFGA 1PWXA 3E3LA 1SZCA 2WMYA 3I09A 2VDNB 3B7WA 1FYFA 4B09A 1J8MF 3H6HA 1NT2A 3II6X 1D2EA 3DD1A 4KXVA 4DLRA 1E2PA 4RXUA 3DLHA 4ZGWA 1ZGAA 4RABA 4QGHA 5TSDA 1NI5A 3DP9A 1XMIA 5K9ZA 4RD3A 1KBZA 1Q6ZA 3GEHA 2XSZA 3NHPA 1K7XB 1JLKA 1MF7A 1UXKA 4L9RA 5HILA 4LJ9A 4MULA 4A2PA 4DIOA 5K05A 1I4WA 1DKMA 2G67A 1ULTA 2QOEA 2VFAA 3AEZA 2B3TA 3TCNA 4B75A 4BFYA 1F8XA 5FWAA 2FWNA 4FZ3A 1XQVA 2IV2X 3U37A 1A96A 2ZB3A 5JD4A 4I1YA 4CQNA 1ZN9A 2SCUA 5CYFA 1BOFA 1JE0A 2ECOA 1WF3A 2D2FA 4F9GA 1FBTA 3NPMA 2EG5A 2YYAA 2I55A 1YR8A 1Z8DA 2UVPA 3BMOA 2X9QA 2IY9A 2MSEB 4X97A 4BMDA 1S2IA 2VA8A 3KPVA 2LWIA 5DOZA 4EY7A 3OLQA 4KN9S 3QKUA 2WKWA 2YWBA 4HAXA 3REOA 1Y3BE 5DBEX 1G55A 5CLHA 4DYVA 2JCYA 2VHEA 3FKSD 2PUTA 1VCNA 4A0HA 2IP4A 1GT6A 4JXJA 1A9QA 4RK6A 4I55B 1ZH4A 4I4NA 3AINA 4QXMA 5LOVF 3LNCA 4W99A 4XCVA 3WGIA 3I62A 1H5UA 3SX2A 4CM3A 4EI9A 3GA5A 2F3PA 4IOJA 5IW8A 5A1JA 1DUSA 1W581 4JJFA 4M1WA 4QDJA 5THKA 3GLIA 3U3XA 1A97A 3KQPA 1O58A 1CDOA 3FPLA 4Q1CA 1CNEA 3M1AA 1JDNA 3GP3A 4X1KB 1Y9AA 2VJKA 4EENA 1KXJA 1JAXA 1Z7GA 3VKWA 4KE6A 1KK3A 3HCNA 2ST1A 3I0MA 3PDIA 2DPYA 3HS3A 2I34A 2TMGA 1TGVA 4MS3A 3GP8A 4BNLA 4DMGA 3V4PB 3W0LB 1UKVY 4BFCA 1B15A 1E1CA 2DRIA 2FETA 4FD3A 4TSKA 4Q9KA 3WGJA 5TIIA 2IX3A 1SUSA 3ZWAA 1XMSA 2WYOA 4BGDA 5JD5A 4C30A 2VC2B 5KNCD 3E2PA 3FMIA 4PINA 2WUFA 1EM6A 3H2YA 3P7MA 2WA1A 3D2BA 3IP6A 4UTXA 3ICPA 3SXJA 3K4HA 1KDRA 5KYYB 4X6UA 1GYRA 2WJVA 1JA9A 1ADJA 3P2YA 5HUJA 1LSOA 4JX9A 2GPYA 3G0OA 1JN0A 1MC4A 4E2WA 1U4SA 1I4LD 5DN6A 3ZHYA 2C7GA 3LFUA 4X63A 5HSGA 1U1FA 2MR5A 2DUNA 1NONA 3LBHA 1SU8A 5EE5B 2DPLA 4GVXA 4P3OA 2EFEB 3R40A 2FFQA 1XWWA 2R8BA 3BCRA 5EFZA 5FJJA 1J97A 3CUKA 4UNQA 4RVNA 3VX3A 4DQDA 1VB5A 1YTUA 3PWSA 4CFZA 4RL4A 1RSZA 4O2BB 2FWJA 1FFXA 2C95A 3IDQA 5BV2P 3HKBA 1NQVA 3PQ2A 5ABPA 1ISHA 2NUAA 1OI4A 1OI7A 4F4JA 1W4CA 4DMUB 4I9UA 5IN4A 1BS9A 1ESMA 1YQGA 1RXVA 1SO8A 1SKYE 2D0OB 1DKUA 1SBTA 1J7JA 1NU8A 1MVOA 3FBGA 3PUXA 1XE3A 4HB3A 3RC3A 3SKXA 5K5EA 4G3XA 3L4KA 2IELA 1DV1A 1U28C 4R1UA 2CFRA 3SFZA 2ZBUA 3I04M 3LCMA 4MS1A 4Q3LA 4D8TA 2Q8PA 4L95C 1LPAB 4FUQA 5DLYA 2HBQA 3DDNA 2GNPA 3K0KA 3WYDA 3IALA 4A92A 2RHJA 4NX2A 1UDWA 2I6XA 1RYBA 4M1TA 5T4HA 4M9SA 1YONA 4DXAA 2W6MA 4E1VA 2X0KA 3H5IA 4K2HA 3FUUA 3AOEC 3KTOA 5EJ9A 2FQ1A 3EGCA 4I0WB 3F90A 5B2ZA 1C9MA 1HLFA 1GPLA 1JR4A 2EARA 4H59A 4LN1A 2WV7A 3F6CA 4D6YA 3RUCA 3HXQA 1JSLA 1C0IA 1XZKA 2V1XA 1KFEB 1LD3A 2BF4A 3S2EA 1NNSA 3VTKA 2XOXA 3E9ZA 5EHXA 4NE7A 4X8OA 1KE1A 1UQUA 2BFFA 1OFHA 2O5CA 2IX9A 1RAGA 2CYCA 4GOLD 4EZEA 2N75A 4ZCRA 4YCNA 2ZYDA 2XI4A 2DY1A 1ZM9A 2QUBA 1F06A 1FTGA 4KK3A 4QDKA 4YO7A 1ABBA 2O8DB 5ARCA 4NZYA 3OM1A 3E9NA 1J90A 2YVKA 4U63A 2NV6A 4URZR 2AQ8A 5DTIA 1G8PA 1YQUA 2IYZA 3L8HA 1WB4A 3SZLA 3DWGA 2ZJ7A 1KIAA 4FONA 4X71A 2CVFA 1XNHA 2A5GA 3PGLA 5CU7A 1KEUA 1G9SA 1N6KA 3DOIA 5H0IA 3ZTYA 1UBGA 3SNHA 4MGKR 3AZPA 3PTLA 1D6MA 4UU1A 3G7SA 5K0BA 1Y7PA 3TTWA 4BKUA 4N6NA 4HDKA 3L7BA 4WZAA 3GJTA 3ZD9A 1HTBA 1XN4A 4BGIA 4HGOA 1M54A 4CUKA 1DJLA 2PLNA 5IX8A 3ILVA 4I66A 1UM8A 4FOSA 3ZWVA 5A4IS 5KTKA 5LXTB 4NFHA 5ALTA 4K8OA 1UBMS 4Y1RA 2ACVA 5AJZA 3RG2A 4ZV4A 2XV1A 2WTAA 3M7IA 4WSOA 3C3BA 3NIWA 3W06A 3PUIA 4NR0A 5DNVA 3L1VA 4BDSA 4OUDB 1KQPA 1U8CB 4JT9A 5A5FA 2WQZA 3ZGNA 2J9RA 3S3TA 1QYDA 1YS1X 2PD4A 3N6RA 4WBSA 3WSVA 2IEBA 2OXTA 3GZNA 4R9NA 1BD3A 4WA7A 4MRRA 4X24A 1HQCA 3CRQA 3RD5A 1KS2A 3RVMA 2WUDA 2ES4A 3O3MB 4WNCA 5DSZA 2EKZA 3WLAA 3ND9A 4ROTA 2H08A 1BJRE 2WW8A 1E6WA 2HY7A 3AOEA 4LFBB 4B3JA 1ZK0A 3UNXA 1T9DA 4CT0A 1OGJA 1PIWA 1H8HD 4HGZA 4JLDA 4JUAA 4RSHA 3P94A 4CMIA 1EA5A 3QMWA 2G9RA 3BX1A 5FUWA 4LJ4A 2PX3A 4NZZA 4UASA 3S2FA 1BGVA 1S2MA 3I0NA 3T3MB 2YJNA 4NMXB 4QSHA 1GPKA 4CEJB 1UBTS 3NT4A 4QPJC 5ALXA 5IMBA 3CVYA 1MA0A 2XECA 3SN6A 5C2JB 2BE9A 2DT8A 2G5PA 3P4YA 2H57A 2G5CA 5DW3A 1U2DA 5BUQA 3A27A 5FL7D 2H4JA 4S2UA 5THXA 4OHKA 5EYPB 3R5FA 1T9GS 1QE5A 3GA7A 1SQGA 3CNNA 3WA6A 4X1IA 4IDQA 1WMAA 3G5MA 3ZV4A 5DM70 1TLTA 2H2FA 2VJYA 2YYYA 4UAUA 4OYYA 3FBWA 4TKVA 2ZRJA 1E2NA 1RHRA 2Q4OA 3T3GA 4C03A 2Y0DA 3Q11A 1DKRA 4YV0A 4PW0A 3L0SA 4YPVA 5C7IO 1UT5A 1C3OA 5BW8A 1IOVA 2JFWA 3B70A 4EY4A 1M2JA 4R3WA 3BJEA 5D86A 1TA4A 3BDVA 3T3IA 4FT4A 3TE6A 4RGBA 7MHTA 4F4HA 4BIIA 2LXNA 1PNVA 4X8MA 3VR4A 4B74A 3DMPA 2NX2A 1YV9A 2B21A 1XTKA 1ZNQO 4XWTA 4EBFA 1UWCA 4Q7KA 4U6SA 3DQZA 2VZ9A 5THQA 5HM6A 5EIWA 2RDMA 4G0PA 3ABRB 3NBFA 1L9KA 2P9QA 3EQ2A 4AN0A 1UBJS 3QLEA 3ZWBA 5F5XA 4QXQA 1QOZA 2QRHA 1AZLA 3BBPA 3DFKA 3EW7A 3NUZA 4JQCA 1GDHA 2BYTA 5EY5B 5KAMA 1JLLB 2VSQA 3I12A 4NZPA 1DUVG 5FV4A 5KSZA 2C99A 4UTNA 2Y1XA 4MP6A 1Y81A 4J90A 2F00A 4HT3B 5IJ9A 3UICA 5HIMA 3CLTD 1FTYA 1OH7A 3TDKA 5ADWA 3QTBA 1QVAA 5FFFA 1RIIA 4C3ZA 3PE4A 4U7HA 1L0BA 1PL6A 4JOSA 1AB5A 4DMHA 2XWSA 4MCHA 3QNWA 2Y4NA 1Z6YA 4QGFA 3TLAA 5ICSA 2VK8A 1GUDA 1DKQA 3OE1A 1I3OA 2C5SA 1I14A 3FPKA 5EMLA 2VKTA 4NBUA 2NAPA 2BTQB 2ZJOA 2O4UX 3BTUA 1E9BA 2XEXA 2HF9A 1XI2A 3HDTA 4GEGA 3ZD7A 2JH8A 1LDMA 4HDRB 3PEYA 5FA6A 1N2OA 3IVGA 5KTRA 3ZE0B 2QL5A 1CUDA 4C3UA 4CNBA 1PJLA 4XIFA 5K2MA 3WB0A 1R6AA 3ZBQA 3J81A 3I2HA 3HY3A 3T5BA 1QWSA 3QMPA 2A58A 3IKLA 4RY0A 4BB6A 2WT4A 2A3RA 2JGDB 3U3OA 1QFYA 1C80A 1WG8A 3GQBA 5DE3A 3K9GA 3TAUA 3ZEAA 4R69A 3C6BA 3RKUA 3J80A 4N5LA 5B3AA 5JROA 4RWEA 1E7RA 1H4QA 1C7EA 4JBNA 2PYDA 5GM1A 1JH8A 5AW4A 5IHXA 2HYDA 3MZ0A 2AFIB 2FW7A 3AF4A 3ZNPA 2J30A 3C4QA 5GVRA 1UM9A 1EFVB 4ZVPA 1EP1B 5B58T 7REQB 1U3WA 4K9QA 4IMRA 4OHVA 3BORA 1SC3A 2WIBA 3QIVA 1CQIA 4P98A 4AXXA 4DJAA 4A6DA 1VL1A 3L8CA 3PA8A 2P0YA 2PL5A 4ZOBA 3T3HA 2PKRA 3ICWA 4URXR 1IC6A 4D26A 3RVSA 4Z53A 2OXCA 3QF4B 4KYTA 3R0JA 4QWMA 1GSHA 4FFRA 4QU0A 3ESZA 3UIEA 5HTOA 3IIKA 3KLOA 4ID3A 2VP0A 3SC3A 2AJDA 1NKVA 4MUBA 3ZH9B 1G20B 1SKUA 3F49S 3LV8A 5COAA 3SZ3A 3EC7A 1IONA 1W5FA 2OMKA 1VJTA 4MW1A 2XW6A 3UW3A 3ECCA 1BN7A 5CB8A 5IBPA 1Q3TA 2V8OA 3HB1A 5FB3A 1MRZA 1JDUA 3AJ8A 4ZVMA 4K2AA 1Y48E 1ZU4A 2CLSA 2ODWA 2CLIB 4OK6A 3GLKA 4QQNA 2IH5A 4JELA 4XR9A 2GN1A 2J5QA 4NS4A 1JR2A 2IIBA 3SHQA 4BNXA 4OX9Y 5U9CA 3OD5A 4RZUA 4EA7A 3L7KA 4U2GA 3Q2IA 1EFDN 3AHJA 4JJ8A 4YDHB 4B7UA 5C3MA 3OAAA 4M87A 3KKNA 5F1YA 2HD4A 3X1ZA 1NLYA 3UW1A 3IB6A 4US2R 2BUBA 1UBHS 2EP5A 4OQDA 3SD7A 4ZAYA 4ZYYA 2YFHA 3QG5A 1IHOA 1OX6A 5H4GA 4UUBA 3EF0A 1DFGA 5TQ2B 3AF2A 1R4ZA 4O4IA 4H77A 5ECYA 2VLIA 3O2QB 3V7UA 4US0R 1TRHA 3HTXA 1FUUA 5K0ZA 5LYJA 5JNWA 5BOVA 3V1LA 1XRSB 1RTTA 5HHTA 2XYHA 1USGA 3I9MA 1CVRA 3MMXA 4S1PA 4BASA 3A3YA 2QUJA 4DOMA 1UZMA 4GBMA 3D1LA 3QBDA 4ZV7A 4BNUA 3ETJA 1Q3KA 3E3NA 4HQLA 2HADA 2FP3A 1XSEA 1ST3A 3AUXA 4H1VA 3WYGA 4G0WA 1EX1A 1Z12A 3VPDA 1S2LA 5BPHA 4KJZA 1FFGA 4JGBA 3A7EA 3S0JA 1T5DX 4ZVOA 4CG0A 1RYNA 2PX8A 5MF6A 2XXAB 3A0RB 4HLNA 3ZGXA 2Y6VA 3PXBA 4UDYX 1QG4A 4D9KA 3AF3A 2NZWA 3SLGA 2H9AA 1UPCA 3KDAA 3KZ1E 3QW4B 4NMHA 3T7CA 1HSOA 3AUUA 1V8ZA 2R97A 3HDQA 3ZZTA 3UXHA 3NPAA 4RPLA 4DLTA 4OQZA 3FOEC 4UPDA 3N2GB 4RQBA 5FPSA 3MGGA 1ZR4A 1CUXA 1R6XA 1OGIA 4C3OB 1PE0A 2X77A 5BQOA 5JPIA 4CIYA 2ASVA 4ZC1A 4KGXA 1K7FB 2XMSA 4CL0A 1Z6GA 5FWDA 4U7WA 3SDZA 4KODA 3KSZO 4GQBA 3L8FA 2YN0A 1TE2A 3ZGVA 3TAXA 1ZD9A 2ZYUX 4ND6A 4QOIA 2OG2A 2YV4A 1B6RA 1FFAA 5BYAA 5C8YA 3UB2A 4YPOA 4ZTZB 1TYAE 1P9WA 4AX8A 4R54A 3A6DA 3BSSA 1Y1QA 3E2MA 4TL8A 5EZSA 1I7NA 4NE9A 4EL0A 3C7DB 4L22A 6REQB 1T9ZA 1SQ6A 2VRCD 3GYBA 4KBYA 4NKRA 4Q47A 1YRHA 1W4RA 1T13A 1CP2A 3RVPA 1PFWA 2UYOA 1XXHB 4C0WA 3B89A 3H16A 5H80A 3HU2A 1COWD 5HBRA 3NFRA 4E5DA 4A10A 2PBFA 4Y2UA 1PK8A 2QJWA 2B5OA 2XZTA 3NGLA 1Q0RA 2GM5A 3NBMA 5CYOA 5IKOA 4YAKA 3EIFA 2H18A 2FP4A 2GBCA 2J7KA 2OD9A 3PE6A 3QXXA 2AMVA 2ABWA 3ET5A 4HNGA 2O3UA 5IKMA 4J4BA 3KKQA 4DIEA 3NZEA 1EU1A 1NIJA 3VNQA 4J9UE 1ZUWA 1JHUA 3J7TA 1I36A 1XCOA 4IKEA 4IIUA 4WL0A 5ALVA 3AM4A 3RW9A 1IEQA 1DG9A 2LP4Y 2O2JA 1BS1A 3PUKA 1KO1A 1S8AA 2ZTLA 1AMUA 2O0LA 3FF1A 3NIBA 1EM8A 5FFNA 3SSOA 2YRFA 3D02A 3GF4A 1JZSA 2BMEA 1UJNA 3Q0TA 1ISSA 1I10A 4JBWA 3TX2A 4OREX 1LF0A 5BPFA 1E0AA 3MMSA 1VJDA 4RXMA 3TLCA 5JVDF 2G07A 4J3FA 4QFDA 2K4MA 5JI2E 1QHXA 1IL0A 1SWWA 4K5QA 1A5AB 1A95A 3IQXA 5SV2A 3M89A 4RJIA 3DTVB 4IJUA 2PBLA 1D03A 3AFIA 3K0FB 3QF7A 3WWYA 2AZXA 5E38A 5AI8A 5KINB 2GRUA 2N1BA 1CZUA 4AYWA 3M4ZA 1HG0A 3OFJA 2JIPA 4Y30A 2FI1A 5TPZA 3A4LA 3PTZA 4MV6A 3PQCA 3Q88A 5TJHA 4W1PA 2DHCA 1O94D 2ZQZA 1ZIDA 2R1TA 3DNPA 2H7XA 1X70A 2CKMA 2Z43A 1W6RA 2H85A 2YTZA 4NBWA 1L3BA 2FW1A 3NTQA 2O0JA 3Q12A 1CLUA 4YJFA 1UKYA 1MXHA 1CQJA 2YV2A 4F38A 3OSZA 1MV8A 1OAOA 1PVVA 2ENUA 3JAWB 3Q7QA 1FRQA 4RVHA 4YJHB 5IJAA 1Q57A 4B35A 4C88A 4HAZA 3OWHA 3ELDA 3FIJA 3GJ8A 4X5OA 4DQLA 1K7YA 3OMWA 3TSZA 2W70A 2JKYA 1OLOA 2KI5A 2RHTA 2XZLA 1RKXA 1UKCA 2CLKB 3L0OA 3C6YA 1FZTA 1Q0PA 1VMKA 3G88A 5J63A 2JNWA 4GE0A 4L8LA 1UANA 4MWSA 2QSYA 1A5BB 2I6SA 3IBGA 2GFQA 3UFXA 2JLUA 4OLFA 1UF9A 1BXRB 1YR9A 5C1IA 4DL9A 3UK0A 1VKNA 5DSTA 4X65B 2P90A 3AJ9A 3M1LA 5DFAA 5DZSA 1E58A 3UJBA 2ZKIA 1VE7A 5EJFA 8ATCA 2BGLA 4JKYA 5C1DA 2CSXA 5J2TB 3KETA 3U81A 3B2EA 2ZR9A 4XR4A 4PAGA 4ARCA 2L2QA 2UV8A 2P8SA 4I8IA 4RLFA 4CQLA 1ZCFA 2OCGA 3IV9A 1LW6E 2B69A 1U04A 2E2WA 1M1YB 2FPGB 2GPAA 2J3KA 2QZSA 1H2ZA 4G8DA 2XODA 1RM3A 4CT4B 4NATA 3C3KA 1UFQA 4XFDA 2CJWA 3DMTC 1N2ZA 3FYDA 4OLHA 4UNPA 5U4XA 1TT7A 2HMWA 3HMQA 3GCWA 4Q12A 3HP7A 1EFKA 4UAJA 3VYSB 1X7HA 4QE3A 4YAGA 3E2IA 4X3CA 5T3UA 1EG2A 3H19A 3E22A 5SY6A 2GEDA 1ONSA 1TAGA 1IZ0A 1LCIA 3CLTC 3HDJA 3QQ5A 4G07A 4R8LA 4S0XA 3TXXA 4Q4AA 4PZCA 3VU1A 1II8B 3PI6A 3PHLA 3VSEA 4TROA 4ESVA 2GCOA 3FUCA 5A5DA 3PBKA 4QHYA 2BN4A 4YP0A 2WJIA 3S2YA 1T29A 3ZZ1A 5M34A 3TQIA 4N5NA 3DWFA 3A1NA 4Q3AA 1TVKB 2H1CA 1VBMA 4KN5A 4M99A 5JMWA 3FZEA 2FW6A 1KMHA 2PU5A 1T5LA 4LECA 2JD0A 3LY9A 4F21A 3CRNA 1OX4B 3OIFA 1MQAA 2OGWA 3DTNA 1OXKB 1GFSA 2Q7XA 1ZNWA 3KPUA 3ZK9A 2JFOA 1P4SA 4JSYA 2CK3A 3AM5A 2CFTA 3GVIA 2YJ3A 4QGGA 2W6CX 1SAYA 3OCJA 1IN1A 2RBKA 4K40A 3OU7A 1M8KA 1L8QA 1YZVA 4G4SO 3RDPA 3GLSA 3W8FA 4CCYA 4II3A 3E9QA 1C1YA 3A6ZA 4ER6A 2PKXA 2VLBA 3LPDA 3NQ41 1LDEA 4XX0A 3AUKA 4D4LA 4J49A 4WEQA 2FUKA 2P41A 1QTIA 5BVGB 1BDHA 5D7BA 4CCAA 1P5ZB 1A77A 1M6VA 3KVNA 4RKYA 5FTKA 2JFVA 4M38A 3I9OA 3IEKA 2VTBB 1QZZA 2CBXA 1H4VB 2GWRA 2HC9A 2R7AA 3HZZA 1Z82A 5A6SB 4OXNA 4AMBA 1GGKA 2BFDB 2I2XB 2ZWAA 3T1TA 4IIJF 3UCFA 1WDLA 2BM0A 4M55A 3LD9A 2VSYA 3C3XA 3DM5A 3P8ZA 4YASA 1C8VB 1W46A 2JD2A 4UEJA 2ONJA 4D4MA 4LK2A 3UWMA 3LIPA 4B7ZA 3DMTA 4BQNA 1Z4PX 4GMXA 4GI2A 4PANA 4NFLA 1NOKA 2D1FA 4HQFA 2HMVA 3T5AA 3CNQS 2AQHA 2WE7A 3GA0A 1MAWA 4MMXB 3UO8B 3RAGA 3DFZA 3TUIC 1AKUA 1DBPA 2AE1A 2YICA 2ADOA 4IHJB 3LF2A 5LBTA 2ZSAA 4URVR 1JFTA 5JUWA 4U4AA 1G0OA 1PZEA 1E9FA 3B3AA 5D3MB 4HNQA 1C1DB 3UJCA 2FPPB 4CF4A 5AVOA 2VHUA 1SCIA 3DV2A 3DXYA 3N58A 1TIPA 1U1IA 3OLCX 2Z98A 4GM0A 4D4KA 1YZFA 2DHRA 1U90A 4JXKA 4KQ1A 2CD7A 4FJ0A 4LISA 5LZ9A 4YRAA 2VYNA 2IZ1A 3IKJA 3U39A 2NP6A 5BMOA 4G5RA 2UAGA 3EMKA 4G1FA 1N5RA 5FQOA 2GHRA 1IWBB 4OFZA 4JBIA 1PP4A 1GRNA 3A26A 4HNRA 3L93A 2QE6A 1BHQ1 5LIPA 2EBWA 2G6BA 2XDQA 3M6IA 3K31A 2R1ZA 2Z9CA 4WBNB 1CUFA 3VPBA 4ZEVA 1C4XA 3O2SB 3IB3A 2HJHA 2F43A 2JIZD 3H9UA 2EJBA 4ZYTA 3GLGA 2O3QA 1UWLA 4AWBA 5E4JA 2DULA 4EFNA 1C30A 1GDDA 2V7UA 2WZDA 3GUUA 4KLRA 4ZVUA 1SJ9A 2OSVA 3HZOA 2W6PA 3PFCA 4ALKA 3QPBA 4DLUA 3U49A 1P6QA 4PLPA 1F2UA 1ZN7A 2YNMD 2PBRA 4NFYA 3BERA 1OB2A 2GDZA 2QGZA 1YGPA 3A1WA 2CW5A 4LHWA 5CX1A 4A8JB 1NC3A 1QG0A 1L1FA 1OJ7A 2QD5A 5CA1A 2C00A 1P8AA 4JU9A 4DCVA 4GOMD 4G5XA 4NJOA 5CPFA 4TLAA 3B5EA 4F5DA 3PX3A 2BBSA 1RYDA 4E5KA 1SG9A 2FA9A 2WABA 4PAOA 2ZUDA 1WUHS 4L08A 4ANFA 4BFSA 5LPNA 2V4ZA 2YASA 3B9BA 3LT2A 3OUTA 2IHUA 5BWBA 4GS5A 1YE8A 3D54D 1KQFA 1M2NA 2OORC 5BW4A 5ETJA 5AVQA 1GZSA 4GMDA 3JTEA 2BT4A 4JLOA 2IZOA 2ORVA 3MJHA 4PQGA 3KQYA 4D6PA 5AVVA 2D0IA 5ECWA 5H70A 5EL0A 1C50A 3PNOA 1J5EB 1N78A 1E9RA 1SIOA 3ZWCA 1Z2CA 4H18A 2COKA 2QM3A 4R5MA 2QIPA 3S2IA 3TG2A 1K6XA 1Q12A 1TU0A 2QGFA 4JLPA 2GOYA 1XLUA 4WXPA 1HY3A 3ZY6A 4JNCA 1BWPA 3E9MA 5BN4B 3K5IA 1EMDA 2Z2IA 4IQGA 4RY9A 4IHKA 1FLAA 4JP5A 4TLEA 2Y66A 3WIBA 4FSDA 4F8EA 1G8HA 3VH1A 5BW5A 4ZOAA 4HLCA 4CKZA 1IRXA 1Y1TA 4QDXA 1AKMA 4JUIA 5HW0A 4NBNA 1TF2A 3MJTA 4WEOA 1GA1A 1E63A 1BYIA 5GOTA 3V1NA 5BO5A 4XEUA 1E18A 4N0MA 5LLDA 2AG0A 3SZMA 3WA7A 2JLCA 4XM0A 1O5OA 5HKBA 4DV4B 1BEZA 1KI6A 4ZXFA 3NDBB 1E4VA 2QL7A 4F4UA 3H1TA 1W4ZA 2CNBA 4C1NA 3RAJA 2OV3A 1EFPA 5A7HA 1M2VB 2X5JO 4NU5A 1ZI9A 5IULC 4FEEA 4JY7A 3SK0A 4FHCA 3ZW8A 1QH8B 5JC1A 1YZGA 3I4CA 2GPTA 3C7KA 2QK4A 5DBIA 3TL6A 3QM1A 2I66A 4KVGA 2B0JA 3STXA 2VJOA 1VFPA 3I6MA 5K3BA 4FBMA 1LJ8A 4XGQA 1I0ZA 4ZGBA 1HLGA 2WIJA 4FS8A 1DTWA 5TF0A 2J9FA 1TYCA 2PH3A 4M86A 2YWGA 1IEXA 3SBOA 2GLTA 3U6BA 3R5TA 4QQFA 1BXKA 1JSCA 1V7QA 2AUTA 3T41A 4U7FA 5DNYB 5ITWA 2UYHA 3QHPA 3JPYA 4KQGA 4Q3OA 2WICA 1C4WA 1TCAA 1H2XA 2H1OA 4NFSA 1JAZA 4Q3BA 4BO8A 3FPSA 1T5TA 2RGGA 4F46A 1O9GA 5B7PA 4HOYA 3V2UA 3WK9A 1MA3A 1O94C 1VECA 2GHTA 4N0EA 1PR0A 3C1UA 3RUAA 2O05A 2GSDA 4BGUA 1DT3A 4PQRA 5C31A 5IVIA 5BVHB 3KJQA 3UWKA 2AX4A 2R00A 4QJ5A 4R40A 3JD4A 4UUQA 2QJTA 2ZTUA 3UMYA 2AXNA 4WFKA 4LY0A 1SVLA 3G1UA 3AY7A 3AB3A 1N5DA 2HH9A 3QE3A 4U2FA 3OTWA 5JRJA 1K86A 5F35A 3QVOA 5FOUA 3UPUA 1NF3A 4XB1A 3EBOA 3IR6A 2AFHE 5BV7A 3HN2A 4X61A 1BXGB 2RHOA 1R18A 5JO9A 5C5IA 1I1OA 2FDCA 2HJGA 5I8PA 3S81A 2RD2A 2REQB 2CBZA 3H1EA 5FHRA 5FWYA 4PX5A 2FW0A 2C77A 1MQ8B 1H2AS 3COPA 2GEKA 3PPXA 1XG5A 4BEJA 5EHGA 3AUJB 2KLBA 1MJGA 4KLAA 1UMBA 2GUGA 3U62A 3HFRA 2E1PA 4IDDA 4J6EA 2HZBA 2JLAA 4UDNA 1M0TA 3VC2A 4Z7QB 1HDZA 4UFNA 1FNMA 2FK7A 2ZS7A 3FFXA 3RREA 5EJ7A 4FT2A 1JQJC 1NJ6A 2IK8A 2RH4A 4DEXA 3W1WA 5KREA 1NJGA 1UXOA 3BRCA 1JU4A 1N8TA 1REQB 4R7ZA 1PT5A 1X80A 4EG0A 1XRNA 1GCUA 1U7TA 4FINA 1TQHA 1J20A 2CMFA 4RA9B 2M6RA 3UGKA 3UMGA 4N12A 4EJSC 3MELA 5C8ZA 3AY0A 3L0PA 4FYVA 4WJKB 1DZ3A 3I3SR 3ZWYA 3RVNA 1J0DA 3V6LA 3NOQA 3QELB 4HNAA 5F5LA 5A9SA 3OPXA 3Q3EA 4G5OA 4Q6BA 4HNHA 3ZZ0A 2YVUA 4WK6A 2IU0A 2R85A 2AG5A 1AGXA 5HR5A 3KFVA 2Z0MA 4QZVA 5KOJB 4FLFA 2GT1A 3ZK7A 5JJBA 4KO2S 3UBMA 1A98A 1KQGA 4EVSA 1T6XA 4IIEA 4KE8A 3MINB 5KBYA 4GKJB 4ZYUA 3W4IA 3ANLA 4ZT7A 3G59A 3GB9A 3L77A 5CHEA 1WQ4A 1KDZA 4E21A 5F3DA 3EFOA 3S55A 2GVNA 3MGBA 1LSUA 1UOEA 4MRAA 3ANSA 3GZTB 4EF5A 2H65A 1KU0A 3D43A 3GI1A 4E32A 3KSMA 4W6QA 4EQ6A 4PYQA 3CX6A 5EQTA 4ZI3A 3R77A 3BJZA 4ALNA 3KBOA 4L0MA 1HZZC 1XBTA 3WFZA 1ISGA 3I8XA 3IOYA 5B1DA 5TGZA 1A9RA 4DIBA 2A1UA 2H5IA 5D84A 3EY9A 3AEQB 3MBIA 1ORIA 2CL5A 4G01B 5CM8B 3REQA 3IAFA 3PHIA 2DKNA 3NWPA 1U80A 1BA2A 2LPMA 3AHGA 3CNLA 3FZQA 2J87A 4Q7LA 4NQRA 4EW3A 4NCBA 1V25A 2GKSA 3P4XA 1D4AA 1J23A 4Q3KA 4TMTA 5GP1A 3F6PA 4POOA 4OI1A 4R3NA 2QTBA 4AJOA 4HPWA 4JJZA 2AD1A 3VR6A 1RWBA 1W9HA 1CP3A 2F1RA 4P93A 1KA9H 2Z30A 3L6DA 2V0CA 3ZJYA 3IGFA 2HCRA 1X7GA 1N6NA 3RI3A 5CB4F 4HLUA 1RWMA 1DAFA 5F2EA 4H1HA 2IPMA 3LCRA 3G5TA 1LU9A 4TQAA 5J43A 1T26A 3FNIA 4H6WA 3VZRA 2IUEA 3X1KA 3ODPA 1JTFA 1KTVA 3ZE2B 1EFHA 1KAMA 4L5JA 2OV8A 1GTG1 2R8YA 4INOA 3GN1A 2QLMA 5SYMA 5IEJA 3BOSA 3E1GA 3V3TA 3RIXA 3LUDA 5ECGC 1GVNB 3D6FA 4H2DA 3U4MA 3ZLUA 4EPYA 3I58A 1E7WA 1K8YB 3FROA 4J1SA 1IK6A 1WKCA 1J9EA 2Q3CA 1PUXA 2GFIA 1WU7A 3WKEA 1XJCA 4MGIR 1ZDMA 4OB7A 1O95D 2HCBA 2HA0A 4IYRA 3V3KA 4OXYA 1O4VA 4WLFA 4DC0A 4ARBA 2J3QA 1H3FA 4JC0A 2JHAA 1JYEA 1YHYA 3D59A 4NP6A 4MIKA 4B6EA 4E6PA 2UUBB 2BBOA 4YJ2A 3OQVA 4R2IA 3LW8A 2RHLA 3HLTA 2EATA 3IYLW 2ZRCA 1E2KA 2CVQA 3ORHA 3HO6A 3RVDA 3F1LA 1O77A 1AC5A 2I65A 4HYYA 4DGQA 3A3PA 5JXHA 2GGSA 1XK7A 1E3SA 1DTSA 1T36B 4JT4A 4UBLA 4D7AA 1H8EA 3UH0A 3R1IA 2ZZMA 4YTEA 2M6KA 2YNMC 3KJEA 1JHVA 1GQOA 1KZ6A 2G9QA 4J1NA 1Y34E 1RHQA 2X8LA 4KMSA 3RVLA 3SZGA 3FUXA 1CG6A 4CMCA 2AKYA 1P31A 4PE5B 4YEDA 4BEWA 4CV0A 1H3EA 5B4VA 2F3TA 1E5QA 2GBGA 2PHZA 4AYTA 4OQXA 2OWEA 3NKFA 4UUOA 4DTIA 1FSPA 4Q5IA 2MHCA 2BM9A 2XQJA 3L3BA 4NTZA 2X4DA 4KIGA 1TVEA 2OHOA 1R9NA 3CPSA 4REMA 4ZV9A 3PD1A 4YNBA 2ZW9A 2IOFA 1BFDA 4Q1AA 3EXIB 1UOOA 4BAUA 3PTAA 1A9ZA 3E9YA 2EDAA 2PJDA 2XGMA 3EGIA 4RLSA 1X14A 4CF6A 4DMKA 4CGZA 2OAQ1 3I2GA 1NXXA 3AKCA 3AU8A 3PZRA 3LQKA 3QOXA 1IXKA 4OVKA 5L4LA 3RVRA 3Q3IA 4HDOB 2EX1A 1PFVA 2GD0A 1AN0A 3WLQA 5EUMA 1X7XB 3AT1A 4IMPA 1P1FA 1U8UA 5BNFA 3RS0A 1G19A 1MV5A 1CE8B 1R0CA 1VJGA 1Z7YA 1ZQ1A 2I0FA 4DEYA 1QQ6A 1VGQA 1VM6A 5JCJD 1EQ2A 2Y71A 5TGTA 3TJRA 4BV2A 4O2AF 1IPHA 4W6ZA 1KOLA 3BGDA 4XPIB 4EX7A 1HE8B 1XTBA 5EG5A 3G8AA 2WJHA 3V97A 2C5LA 5TARA 1TJ4A 3INTA 1Z3CA 3L0CA 3FJYA 2YBEA 3MOGA 3AM3A 3FSRA 3JZIA 1L5OA 2VDPB 4N1AA 1WZ2A 4RKEA 5E1MA 4ALJA 2WTUA 1CY8A 2DC1A 3OTQA 4BNWA 2BM1A 2HA5A 3O9ZA 1CJSA 4FKBA 2X0DA 1CUGA 4FWTA 3MGCA 5EJ2A 4H27A 2FRXA 5EUBA 1L4UA 4BN5A 4BFVA 5L3VA 2GVDC 4JIGA 5B6JA 5AM0A 1TQ2A 4X7BA 1N2CB 3MIZA 5IM4F 4TWBA 3R74A 4AKHA 1WW2A 2H00A 2BGTA 4PRLA 5TMBA 3MLBA 1NBMA 4JI3B 3WGKA 3DKRA 3QWBA 4LDQA 1SHLA 2WE8A 4ZREA 5E6RA 1RWXA 4E31A 3FTPA 4MW6A 4JC5A 3KU4A 2WHQA 2X8WA 4Y2JA 3AV0B 4IF4A 4FWIB 4R1OA 1JEYB 4M60A 2ZTSA 4P4GA 5EIBC 2ZTMA 2Z4SA 3QBJA 1N2GA 2D7DA 2JFPA 3AOGA 1K5PA 3PHCA 5J4HA 4KV9A 2EX0A 1T91A 2CFSA 4TTAA 3WBBA 1WRBA 1YT5A 2ZP1A 1EBFA 2UYGA 1NPYA 3KR2A 1EVYA 3MRXA 1U0BB 3BXEA 2ZI3A 1JKFA 2A0XA 4BFUA 1R3UA 4D96A 4WBNF 4BNKA 1YFLA 3I05A 1P75A 3TZLA 1IDN1 1DRUA 1QDEA 2AUNA 3H9QA 1KSFX 3KYDB 4FGJA 4GPAA 3FB4A 2QLNA 2RK3A 2BE7A 1U2SA 5SY9A 2RHMA 2IT1A 1PQUA 1H5NA 3GRCA 1RVDA 2X23A 3IDSA 4W8HA 3LHFA 5AHKA 3WMEA 1Z26A 5IT9A 5LQDA 3L6UA 2XITA 2M2IA 1E5LA 1JG1A 2O2IA 3ZZUA 2A5YB 5LNK1 1VKRA 4RULA 3SX0A 1WABA 5JAUA 1UFRA 4PG6A 1NTOA 2HXYA 4CF5A 2HU2A 2RGYA 1XNGA 2QZ4A 3BWEA 4FJ2A 3A70A 2QVXX 4BO5A 4ZZIA 3G6WA 1MB2A 5LM3A 1PCXA 2FMFA 1FS6A 2FCRA 4RV9A 2AR7A 4C7JA 2W2NA 1DEHA 2WVHA 3NBKA 1BX0A 1WLYA 3Q87B 1ZVMA 3BDAA 5A71A 2WHPA 2FSSA 1D4ZA 1SK9A 2OBLA 3L41A 3Q9LA 5C0OE 4C22A 3AYZB 1GGEA 1YR7A 2E4UA 1G7TA 4AO8A 5BWLA 4FZVA 4MP8A 5CLGA 5BMVF 1PD0A 2H3EA 1NNUA 2VUSA 4ARIA 2JBHA 1E1RD 5TMDA 5EUCA 1LX7A 3AERA 3KKMA 4B7XA 2SKCA 5JSQA 4FYIA 4KDRA 4CEIB 3G2IA 5FTWA 4RIEA 5TV2A 4E5NA 1LSSA 1SEPA 2ZBQA 1P2DA 5J59A 1NNLA 1BMFD 2P1RA 4RE6A 2LV8A 4LJAA 1PX2A 1MTZA 4CMKA 2QJFA 4YCAA 5F1KA 3NATA 3O8OB 3VDXA 1BWSA 1KF0A 2XVZA 3U4AA 2RKBA 2BKLA 1NJ1A 3QVMA 3CEJA 4L6CA 2A35A 5DW0A 1CDEA 2PLWA 1OZ0A 4Y98A 2XT6A 1L4MA 1T6ZA 3VU3A 4TMFA 3GLFB 4TWJA 4Y9UA 2EW2A 4IOMA 1GPDG 5C8VA 4H7PA 5CVJA 4GXRA 1OZAA 3F4LA 1L5HB 3FFWA 3TCKA 3R3YA 3B1YA 3ZGOA 3WWDA 2KW5A 1DGQA 1FU4A 4GPBA 3UG7A 1R5OA 3PKIA 5ALWA 3RASA 3SQDA 2DKFA 2EL9A 4LF6B 1A9YA 3BCSA 1SUFA 2WU0A 3HNPA 3NJRA 1T9KA 1A72A 2K5UA 2I22A 2PXAA 1F5SA 1GG5A 1M2HA 2FPUA 4M8LA 3H4TA 4Z1MA 4EECA 1P4RA 4AW9A 2IW3A 3QKSB 4F5YA 3N74A 3VTFA 1QZXA 1X1AA 3ZKWA 4BN0A 4UM8B 5JR3A 3G0BA 5AW3A 4AKSA 3DXFA 3P2KA 1C8LA 3DAGA 1JEAA 5A05A 1I2BA 3UENA 1KDOA 5FEMA 4KSCA 2CLOB 2FZKA 2BMWA 4KPFC 3SQOA 5LP1A 1BO6A 3SJZA 1OLUB 2AZMA 2OE2A 2PUWA 5M04A 3W4KA 1NE7A 1C3JA 5DTQA 2CUTA 1EYZA 2FPIA 1CS4C 1D6JA 2OUKA 1K98A 3E03A 3MFQA 4M8SA 5CITA 4XYLA 2YXLA 2OFPA 2WKSA 2WLTA 3LDAA 3HB0A 1TIKA 1XTRA 1BE6A 3RUIA 5G4LA 3BSYA 4OI0A 1BHSA 4FZJA 4ISCA 3RAPR 5JXGA 1Q11A 5KU7A 4G0XA 2B1RA 3ZXIA 4FDVA 3KQLA 3SVZA 1EDEA 4MEJA 1WCYA 4KE9A 2PYZA 5DHRA 2GHIA 5I5GA 2IS4A 2ZE6A 3TR5A 4YCJA 3PGXA 3ZKAA 4URHA 4LRYA 2PZKA 1QKIA 1FDTA 2W0SA 3N05A 3D5QA 3H99A 3E5RA 3KQOA 1R8JA 4YONB 2EJWA 5K3FA 1GG8A 3WZMA 2YWCA 5JPCA 1PZNA 2QN2A 2GERA 2VUIB 2ZWIA 3KJZA 4JJ4A 4C05A 1Q83A 4M46A 3EWNA 5D00A 2RC5A 3B2QA 4MR7B 1MPTA 1ITZA 1CZHA 1HE1C 4NU0A 5K4AA 2XDYA 3AR3A 4YRJA 3EH2A 3UJNA 5AW5A 1NBEA 2P65A 3FR8A 1TZ2A 4O3FA 2Q29A 5EMMA 1VG1A 1Z5NA 3ENZA 1D2RA 3JV7A 5A4FS 3FZGA 2X4IA 1NX9A 1W2HA 3ZY3A 1UK8A 2HLHA 2VYVA 3EGEA 2F1IA 1GG2A 1J8YF 1H0HA 1ISIA 2F17A 2VP2A 3AYXB 4IYJA 3MB5A 5D1HA 1YRLA 4E15A 5CLJA 4I5IA 2QTGA 3FYUB 4DDVA 4C4AA 3I1JA 2HA4A 3EIUA 4FX2A 4HWTA 5I9MA 1RBQA 1M67A 5REQA 1JU9A 4HC4A 1D8TA 3KLBA 1WZCA 5T4FA 2HMUA 1SPXA 1MG0A 1O95C 2CBGA 1YK1A 4OFWA 1NMXA 1KI4A 3S28A 1GNTA 3PKJA 1QGYA 2JGFA 4BMNA 4E70A 4C7OA 4DIMA 1GUAA 4NU8X 1YUNA 2DHEA 3HWSA 4Z4EA 5EIEA 4TV9B 1CPYA 5D85A 4OX9B 4ZJYA 2OP0A 3OY2A 3Q3GE 4BAGA 2O2GA 1NDHA 3FWYA 3IT1A 3QXHA 1DIRA 3R8CA 1AVTA 3NM5A 4PC1A 4UQPA 3BXGA 2OQ2A 1BA3A 4LOJA 3ZBUA 2V6GA 5F73A 3NCHA 3NTRA 5C4MA 2PV7A 1NNEA 4KFTA 2MSWA 1ZITA 5AP9A 3OTIA 4MXDA 5BQFA 1Y6GA 3G8DA 1KZ9A 5SYNA 3RYIA 2O07A 3LKVA 1RWOA 1F4PA 4EM6A 1Z68A 3BE5A 3EJ6A 3NHLA 1DXHA 3M4JA 1MB4A 2BEUA 2FLWA 4X94A 1G6Q1 3T7TA 4QPDA 3HXLA 3WIOA 4KWCA 3DCYA 1T34A 3K1AB 3GEPA 1NVWQ 1W75A 4UC0A 4CMEA 4P9NA 2ZIEA 4DLBA 4A0RA 3WKDA 3T1OA 2XNJA 4PSUA 5J2UF 1EK6A 1V8BA 3OJOA 2QA5A 3PF8A 1XTUA 2CXSA 4RF4A 2CXRA 2Q1TA 5IXJA 4U3JA 1MX3A 1T1EA 2PIDA 4R1SA 1DINA 2GAIA 4TN1A 1Q20A 1CR0A 3KAPA 5K3SA 3D31A 4M1EA 5B55A 5KVVA 1U0GA 1FFBA 3PJGA 3QE0A 2ZJYA 5K01A 2B30A 4NICA 1K5HA 3IJRA 3P52A 1R8YA 3LQYA 4L5IA 4WCFA 4EK9A 3HGTA 4GZ3A 1BQ3A 3FUWA 1Q1QA 1YFKA 2ZI9A 3DOJA 2VPZA 2YVLA 3E15A 2BKAA 4QBHA 1YQEA 1NHWA 5CYPA 5JS8A 2OCXA 5DWVA 3W8RA 3JWPA 5SICE 1P5JA 4LCBA 5CIQA 1AXGA 3GFSA 4ND3A 3NANA 3QPUA 1RI2A 1ZXLA 4NAVA 1GADO 3TR0A 4HFNA 1FFDA 1OBCA 4U0KA 1E1QA 4RTNA 4HF7A 2XYVA 4Z5XA 2HHAA 1XV5A 3D6VA 4KDEA 5EKXA 2MR6A 4MR9B 1O95A 4CL8A 5CB6A 4N9QA 1ZOSA 4BVBA 1JAIA 3KD2A 1LPNA 2ZAIA 3IDOA 2NXWA 4CKWB 1IBKB 3ZWWA 3DR5A 3HFSA 1UMCA 1R4MB 4H6XA 2Y1DA 2NPFA 5IYZA 3BB3A 1NSYA 1RPNA 1ST2A 2BZGA 2NN3C 3KSRA 4ZICA 3VR5H 3AF6A 3QWHA 2CEKA 2ZXUA 2XBUA 1U7DA 9MHTA 2R8ZA 4J2OA 4CLOB 3MW8A 4MOWA 2X0FA 5HUHA 3LW7A 3P0RA 1NQXA 1FUKA 4BO9A 1S2DA 2BGWA 1W49A 4KLZA 4OBWA 2PZGA 3PUZA 4DLNA 3ZDFA 2Y92A 1UT6A 3C3JA 1G9XA 1A76A 1TAQA 2XUJA 1K5GA 3GDGA 2DAPA 3H04A 2FSVC 5T3YA 4E88A 5UKDA 4KNWA 2UZ4A 2IHVA 3U44B 2Q4RA 3R7AA 4FB4A 3N0WA 3ZWNA 2GRAA 3E81A 1CLEA 3EIWA 4EUEA 4DZTA 1U2PA 2CDCA 2PGXA 4JJ6A 4UQOA 2A9PA 1CT9A 5IHPA 2WFLA 3JPWA 2BFEA 1ZCZA 2R25B 3JQDA 4DY6A 1Z0UA 2CXHA 4YVFA 3ZV3A 3FWHA 4J9VA 2RG1A 4OQNA 1IJKA 3BE4A 2F9MA 4HDMB 5JQGF 1LTQA 1AD2A 1NLZA 1N2XA 1USIA 2C97A 3H5VA 4IILA 4NV1A 5JAMA 2VZ0A 1PDWA 3UMCA 4HDNA 1YXMA 3BGWA 3WFJA 1LVGA 2NZYA 4CTNA 3V6MA 2ACKA 2VDLB 2ZS8A 3C5CA 3T15A 2FWAA 4DQKA 1E2MA 1VYVA 1E3JA 2DSNA 2Z57A 4RU1A 2AKAB 3WL6A 4CRWB 4IF6A 5B64A 3ZE8A 1U0SY 1SXHA 1LRKA 2H7YA 3ZY5A 1Z47A 4EJFA 1SZDA 2ZJ1A 2RAPA 3KOUA 3HVRA 2JCBA 1ZMBA 1UDBA 3OQPA 4AJJA 1SRQA 2X15A 2FUCA 4NPAA 1KHTA 4GYKA 2Z5LA 4BDTA 4TYWA 5AXAA 4G5GA 5EVCA 4EFDA 5C37A 4L8YA 1K7SN 4F9TA 3OE7A 2P79A 2VF5X 1G1AA 5DWQA 4M0PA 3ZYZA 2AFIE 2UZIR 1XVTA 3PNKA 2DHDA 1PEDA 3A9CA 3C3CA 4DIUA 1FY2A 3G8YA 2P2SA 2J9GA 4DCPA 3NHKA 2Y3IA 4LNAA 4UXHA 4MWZA 2E49A 4RFLA 1P5HA 4GNKA 1JHDA 3HKDA 4GI3A 3GNLA 5ITVA 3O8CA 3EAFA 1EUYA 3EZFA 1YMUA 1U0NA 1ML4A 1D1PA 4TKMA 2QVGA