3S2SA

The crystal structure of pyrazinamidase/nicotinamidase from streptococcus mutans ua159
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
182
structure length
182
Chain Sequence
SKALISIDYTYDFVADDGKLTAGKPAQAISKAIAQVTQKAYDNGDYIFFTIDGHDEGDDFHPETKLFPPHNIKGTSGRDLYGALADFYQKHENDKRVFWMDKRHYSAFSGTDLDIRLRERRVDTVVLTGVLTDICVLHTAIDAYNLGYQIEVVQSAVASLSQENHQFALNHLQNVLGATIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Get phases from arsenic anomalous scattering: de novo SAD phasing of two protein structures crystallized in cacodylate buffer
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords Putative pyrazinamidase/nicotinamidase
total genus 72
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3s2sA00
2WT9A 3OT4A 3TXYA 3OQPA 1NF8A 2B34A 2WTAA 3O90A 4L08A 3V8EA 3LQYA 3S2SA 3EEFA 1YACA 3TB4A 2FQ1A 1J2RA 3O93A 1YZVA 3R2JA 3HU5A 3TG2A 3IRVA 1NF9A 4WH0A 3PL1A 2A67A 3MCWA 3O92A 3KL2A 3R77A 1X9GA 4WGFA 3HB7A 3O94A 4H17A 1ILWA 1NBAA 3UAOA 1IM5A 4L07A 1XN4A 2H0RA 3O91A
chains in the Genus database with same CATH superfamily
3KUUA 1FSFA 1I0ZA 2WJJA 3JVDA 4S05A 1VI5A 1E8NA 3PIDA 3R3ZA 3KUXA 3TE6A 2VZ8A 3NYQA 4QYSA 2XCRB 1Y37A 2OOKA 2G9NA 1GG8A 3PQ3A 3IAM1 5J23A 1WZUA 4TQUS 1C9JA 1OVGA 4CTOA 5JSUA 1ECFA 4KR3A 4R81A 3PLRA 5EIBD 1QOPB 2AXNA 5IC6A 1RAEA 4I55B 3TLZA 3GPBA 1ZOPA 2C2ZA 4M9UA 3RU9A 3AR9A 1G7RA 2BHTA 1NAHA 3EIHA 4G1EB 1Y1KE 4OOFA 4YALA 3S1SA 3E1SA 1XEFA 2PZAA 3ZIAA 3RS3A 1NR1A 3VU9B 1E4YA 5AUNB 3QQPA 4UM9D 3CR8A 3SR4A 1UDRA 1NPDA 1UL1X 5FWAA 2E5WA 4AP6A 1Q0UA 1GUBA 1VGQA 2ZUVA 4Z2AA 2OOSA 1KRXA 1DTEA 4BX8A 1QO0D 2ETVA 4V3BA 1EK2A 1Z22A 1JHAA 1HOXA 2C88A 2Z8YA 4NECA 5SZKB 5GM2A 4JKIA 4B7UA 4R1TA 1ZD3A 3JQ7A 5AJZA 3IJ5A 3AEQB 4Z5XA 1ANKA 4A8TA 3OESA 2Y66A 1CUXA 2QLFA 3HADA 4DV6B 2QRPA 4RHUA 1KHTA 4Y7DA 5T8KC 1R88A 1GCUA 1DXOA 3MMNA 2WUWE 1V47A 4OUDA 4ECEA 3U37A 2QPAA 1ZD2P 1XROA 3TLBA 2CL0X 3LHDA 4EW2A 1P60A 2QM7A 5D87A 3T5BA 4G01B 5DTIA 4FDAA 1RQXA 4BVJA 1SBTA 2XDQA 4Z49A 3PT5A 4HZUA 3I32A 5ER6A 1S3FA 3RHTA 3H4TA 4BMYA 2EEZA 4YV0A 1BS9A 4ALIA 4CKYA 4UAJA 4I81A 2EJCA 1QRDA 1XTBA 4UBJA 4ZODA 3AM5A 4ITRC 4DCOA 2C99A 1K4YA 1NW4A 1H65A 3IV6A 1RKUA 1P4RA 5ALGA 4WXEA 3GJ6A 1RIIA 2NGRA 3N07A 2WUGA 4YMGA 1JKFA 1DAHA 1DWQA 1RWQA 1T3SA 1Q19A 2QLTA 4R1MA 4C2UA 4H6XA 5K0NA 5EJ4A 3PUIA 2HHCA 3IVXA 2AFIE 4TS1A 2ZIZA 1NULA 3IDQA 1GQ2A 2RGRA 3K09C 3PJFA 4BWFB 4PBSA 4Q7KA 3UK1A 1HORA 5K8VA 3PJRA 3Q3JB 1BOOA 4K6GA 1CRLA 1RWNA 1XK7A 2I54A 2R4TA 1NYTA 1F8UA 2X7XA 3IVCA 3UGTA 3CLTD 3L4BC 2V7EA 4I55A 4MGYR 4PPFA 5H9VA 1E4OA 5DHSA 4ESEA 5EI5A 3VR2D 1ZUD1 1MAHA 3HY6A 1JU3A 2QUAA 3AOGA 3AOEA 3SYTA 3E9QA 3C8MA 5F78A 3MTDA 1DHRA 1OT3A 4JXJA 3RGGA 1Z9BA 3GGSA 1CVRA 1N92A 3CVXA 1YJXA 1NL3A 3EVCA 2F64A 1JJFA 1FFBA 2JBWA 2NWQA 3NYIA 5DM1A 5E1OA 2DSNA 1QH1B 2WIKA 3V97A 1D2CA 4HEA6 5MN4A 2PX3A 1UDCA 5IJWA 1TQ8A 3KQKA 1P5ZB 1P2UA 5K8LA 4QGGA 2GDZA 4PYIA 4D46A 4YJ3B 1PFKA 3OZWA 3PGMA 4X94A 3HB7A 2WYVA 3W5IA 1RPZA 2Q5HA 1A8IA 2AV6A 3HJAA 4E6EA 1K6EA 2IZ1A 4EG6A 1N2CA 3BULA 3I8SA 2G71A 4MYTA 1VQ1A 4G5XA 2OZEA 1KR2A 2NZJA 3I2KA 2QBYA 5TPZA 1YKSA 2OO3A 1CJCA 4FK8A 4GE3A 2BZ1A 5BQ5A 2YV1A 1T1GA 3IAAA 2W2PA 2YYAA 4M1KA 4Y0VA 2YV4A 4IOKA 4IV8A 4RHYA 1V7PC 1R0LA 1V8PA 1MO6A 1Z2DA 3MILA 4LECA 3GCXA 4JC0A 2XKJE 3VC7A 5CA0B 1E9SA 1RACA 5TGTA 4M87A 3W2FA 4NAHA 1A9YA 3GGPA 3JAMA 1S5PA 1U3FA 4P38A 2OCIA 1O03A 2XJ4A 4EF5A 5HIJA 1ZNQO 2MSDB 2E1PA 2X6RA 1V9CA 5GQSA 1P4JA 4AY3A 1VE9A 1N5MA 1GFWA 4GF5A 2VTKA 2C7PA 1OTXA 1TYBE 2EKBA 3R7DA 2C7GA 3G9XA 2HM7A 3ZY2A 3MUFA 4HQOA 3LC2O 4OQNA 4IVRA 4NCIA 5INTA 1W88A 1E32A 4PIPA 3IEMA 3CN7A 3NB0A 5B3JA 3R7AA 4XQEA 4OGKA 1M6WA 3D7NA 3NDJA 4REQB 2UZ0A 4JB2A 2Z8XA 3DEKA 4FSDA 1CHNA 1R3DA 1MVNA 4OXYA 2WJPA 4C08A 3A9RA 2J3EA 4G0NA 4L5BA 2XTAA 2ADOA 2W8ZA 3SMVA 3VJMA 3VPGA 4EUEA 2J45A 4FMPA 4AB1A 5K09A 2G40A 1K6XA 2E3JA 3W7BA 3LRXA 4D3XA 1U8XX 4FFLA 1NVXQ 2NUBA 3H17A 1E2PA 2V7UA 2XCQA 4ZYUA 2Z3ZA 5A3QA 3EIXA 2G5GX 2GN9A 5HFJA 1TT5A 3LGAA 1GA6A 1T2NA 2FEKA 2JA1A 3AFOA 3U40A 4ARVA 3T9EA 1EHYA 1IN1A 4JSYA 3C1UA 1Z28A 2GUGA 2ZPTX 3KRTA 4K86A 4UBOA 3RS7A 4GR5A 2PMBA 1QQ5A 4M8SA 4ZP1A 3W4IA 2PKQP 2X15A 4A0GA 1T8UA 3B12A 5IX8A 5G53C 2FF5A 1E64A 2PGOA 4WK6A 3NNSA 3FPJA 1VHJA 3IAHA 1T4GA 4GT1A 4NDAA 4OM8A 4W6ZA 5T5QA 1WXGA 3DFKA 4OHMA 2H18A 3ZUPA 2I2CA 3NXKA 1F8YA 5KQGA 5TPWA 2FFRA 4PLTA 1K6MA 3OEYA 4PY2A 3W06A 2FPMA 2H1CA 3RU7A 4X8OA 4KPEC 3OHPA 1I7NA 1LLDA 5K05A 2JFBA 3O8QB 1PBNA 1SCJA 1U28C 2EJTA 4QTXA 5GJVC 1CFJA 1T4CB 2O8VA 3BRCA 3VH2A 2CSXA 2PLAA 3OZXA 5JCJA 3IEUA 4M22A 4F2DA 3QOWA 4BB5A 2IEDA 4QREA 4U1RA 4KG7A 1XEAA 4YJGB 2W2NA 5I3ZA 3FPEA 4H6WA 1Q0SA 5F21A 1LV7A 3MWDB 3CSSA 2E89A 2Z98A 5LP6B 2ODWA 1IFXA 2IK8A 4HVAA 4QLOA 3RIMA 1RKQA 1TW2A 2BPOA 3VR0A 3H2ZA 4LHZA 421PA 1OLUA 3UB2A 2F3PA 3KPUA 1BXGA 2A4KA 4JI2B 2Q1SA 4Q34A 1THZA 1UBEA 3BWYA 4XX1A 2PX6A 1IXSB 5F7XA 3K6SB 4HXYA 1V4NA 2DHCA 2OB2A 1GA4A 2R9VA 3KKPA 3OD1A 5AVSA 1YBVA 1FP7A 1PCXA 3LQKA 1N8SA 4P92A 2VF8A 1JDTA 1QLJA 3PU6A 3PNYA 1A8UA 1D6JA 1E6UA 2ZRNA 3GMSA 3K8QA 4KLRA 3VYUB 1QP7A 1DL5A 2HMSA 1U7DA 5B1SA 1VL1A 3QHAA 4O5OA 5BR8B 2HY7A 1C4OA 3BRWD 3LFHA 3MC1A 1OU4A 1U02A 2WF9A 3LT4A 4GP7A 1WCIB 1EFRD 1FJXA 3AUUA 4E11A 4WRRA 4O4IB 3IQHX 2EF1A 4JROA 4MP3A 4Q47A 2IW3A 3VZSA 2I9PA 3CONA 3G5MA 1Z2CA 2ZT7A 3KELA 4TTSA 3TTVA 3W90A 1X1TA 2BGJA 2P8JA 3G2QA 2ZIAA 3R0ZA 1L5WA 4ZANA 3DDWA 3AONB 5FPTA 4YPFA 1A8SA 1ZNXA 5ITVA 2V3CC 1P17A 1GA1A 1R0KA 2R7KA 3GT4A 3TBFA 2YWRA 3KZKA 2FEWB 3P2KA 3FFAA 1AIPA 1JJBA 1SJ9A 3IRUA 5AW7A 2L17A 1A9OA 2IV2X 4CDRA 1YZTA 4KBFA 5AKGA 5EIBC 3DD5A 4KK3A 1JR4A 1C0KA 3H0EA 3GJ3A 2CNWD 3H5RA 1WY5A 1DV1A 3P1JA 1JBKA 4L2IA 1UZLA 4TS4A 5H82A 4EFLA 2PFSA 1LBQA 5CIWA 4MMZB 1HZZC 2XNDD 4LHVA 3PJDA 3P8ZA 1RJFA 4HX5A 4ND2A 4WCFC 2MSCB 4Y6OA 2OYCA 3ONVA 2OGZA 2PSDA 1A1SA 1R0YA 5D01A 5L40A 1F2UB 1GLVA 4A2QA 3NDRA 1U28A 4PS1A 2ZIXB 3K92A 4KNWA 1BS2A 3QWBA 5DXJA 4LWQA 1H8HA 1Q0RA 4E2FA 3UMCA 1W47A 4UW9A 4Q9LA 1R5JA 3THYB 3LDUA 3EH1A 4NS1A 2RHJA 1F6DA 3AERB 4PICA 4Q7JB 5LJIA 2WDZA 4ZZ0A 5D2CA 4BE7B 3KCQA 1M7HA 3MQ4A 1PW5A 4RMHA 1S7CA 2ZWAA 3NIGB 5HCUA 4B3JA 1M0EA 2YRWA 4KX5A 3MWJA 4C4SA 2J07A 5KTNA 4PG4A 4YJ3F 4OQMA 5MFZA 1K8YB 5BOVA 4OMUA 1CX9B 2H4HA 2I6SA 1RCFA 2B37A 2PRJA 3IAFA 1EA7A 3AHGA 4K2HA 4N5MA 1S8FA 1EGVB 4BECA 1IQPA 4KQJA 4WY8A 3AJEA 1OIVA 1EBFA 2WA2A 1UOEA 2YFYA 2PGLA 3AUYA 3AZOA 3N8GA 4L9SA 3RBZA 3F6RA 3SCZA 1R66A 4YQFA 4Q18A 2CK3D 1EUDB 3UZUA 3EQ6A 1Q0LA 3ZC3A 2OBFA 3M70A 4N18A 5JV5A 2RHHA 1U98A 1LTHR 1YQGA 5DNCA 1XVAA 4OKSA 3UOAB 2EFDB 4BZXA 4HT3B 3DMDA 2NZUG 3MZ0A 3TXYA 4CM8B 3EGIA 5FBZA 4YCSA 4RL6A 5MDHA 4EABA 1II8B 3AVOA 4E07A 3PGKA 4R2JA 2HA4A 3EC1A 4C3ZA 4A15A 3T1TA 3JYPA 5JDIA 2V8BA 5K99A 4MPRA 5GY7A 2PS1A 1TADA 1QB8A 1OXBB 3D8UA 3W9SA 4NCJA 5AMXA 3ZWCA 1U90A 3TCKA 3FGZA 1KK0A 1Z0KA 1P33A 3NFYA 1QDEA 1TEVA 2QIPA 2J7KA 1VHLA 4DCNA 4BX9A 2BAGA 3O8CA 3NEAA 1O0SA 5LD2B 2J5XA 1OXUA 1HYHA 2HUPA 3I9KA 4QBKA 3OH8A 1JAZA 1II0A 3RO7A 1W0JD 4ZDKA 4N8DA 5IDQA 3OIFA 3IE2A 3KJIA 5LNK6 1QJCA 2VK1A 4BFYA 1JQ3A 1ODFA 2ZBGA 2LV8A 2RGNA 3R7SA 4LVOA 2D0DA 2GEUA 4RPLA 2WF6A 4PE5B 5L4LA 4X5OA 1Y1SA 3GEDA 4L3OA 4ETMA 5C1IA 3MT9A 1SR8A 2Z2ZA 3V9AA 4EIWA 4G63A 2H2AA 2ZWMA 2P41A 2RK4A 2AN5A 3W7AA 2GEBA 4U5QA 4A6EA 5BWOA 4D41A 4P7FA 4MVYA 4YDHB 4AU1A 4CKZA 1ZN8A 1TE2A 2ZWVA 1CDDA 1FTYA 2Q7XA 2W37A 4G26A 5K8JB 3LKBA 3K30A 4H17A 2NUAA 4EJ2A 5LFAA 2CW5A 2RHGB 4XYGA 4ATNA 4J1SA 1PQ4A 3FPFA 2AW5A 4U7GA 5IVDA 5I4IA 1KFKB 1TM2A 2GJAA 1MHPA 1LNZA 5EIFA 1YE8A 3DJYA 4GXQA 1TLLA 2I2DA 4TRNA 3RT7A 3WTCA 1DPFA 4COOA 1AUOA 2EZTA 3LFTA 5DNWA 5KNDA 4WY2A 1TGYA 4V0SA 5AT1A 1I4EB 1XU9A 1KMNA 1F0NA 2Q07A 3L8HA 3PCRB 3W6UA 1NXOA 4FKMA 5B6PA 4R9NA 1K2WA 3B5IA 2ZRFA 3LC7O 1TUBB 4TL8A 4R6WA 5BURA 3K0CC 4FGLA 4CU2A 1CUWA 1UBNA 3ENZA 4TVBA 13PKA 2WJVA 3DV9A 1FW6A 2PLNA 1IUKA 1G8PA 3BH6A 3ZJYA 1KQPA 3NJ8A 4RMNA 3ZZNA 5CLJA 1QRAA 4GX0A 3EIQA 4YJHB 3NHWA 3VHXB 3RARA 2VBIA 1JF8A 1M73E 2Y05A 3KQMA 4NK4A 5HKLA 2AC2A 2WT9A 1QYCA 4F3KA 4FINA 1K0UA 1O4VA 4OCZA 5KTPA 1EDBA 1OLUB 3LP6A 4E5SA 3KHSA 5TE9A 2I8LA 4P0PB 1JHZA 2VQ3A 3E22B 5CLHA 5DYIA 1UBSB 3K96A 3WFJA 2XZDA 3GEEA 3RC8A 4PYNA 3EBPA 4QFDA 1FU7A 1GRQA 3E9MA 1SBCA 1VE7A 3TL6A 1XRSB 1WXHA 5IN4A 4M7WA 3FBWA 3S44A 5C32A 4YMSA 3OVMA 1MT3A 4J9UE 1H85A 2AVDA 4NLLA 2QGNA 4NYIQ 5BWMA 1XQ6A 3F98A 4YP5A 5GIOE 3MAGA 1Z5NA 2I22A 4OFZA 2FPGB 3IPYA 3NC0C 1T5IA 4Q9NA 1E9AA 4I2NA 5K7SA 2C2WA 4MV0A 2Q9BA 3DMNA 4XWYA 4OQQA 2ZPUA 4QPCA 1GV0A 4Y1RB 4M88A 4Z1OA 5IXJA 2AK2A 3IC5A 2RCNA 2YHSA 3JRXA 1CJVC 1O95C 3LBIA 2F8LA 4NV0A 2HU8A 3BICA 3ELUA 4UBLA 2LXNA 1DKRA 4NCNA 4P4SA 3ABOB 3K05A 3T7CA 1OWPA 3H4VA 2R6FA 1SULA 4C0HA 3TR6A 1L1EA 4KQHA 1O2DA 3X2FA 1IRXA 2XLBA 1P45A 3C6QA 4O4IF 5FQOA 1HLPA 4H60A 2Q46A 3SJUA 3C7TA 1YVDA 2NG1A 2NZXA 1SQ6A 5GVRA 3UV7A 1TPZA 2FGKA 1CSEE 1Z16A 2DCUA 3EE6A 2QDXA 1HMYA 5FEMA 5LIRA 5A2GA 3T0FA 4BYMA 4MHOA 4Q3EA 4EYSA 3DW1X 1NP6A 2IY7A 4PZEA 4HGQA 3I8OA 3MMPA 5HMLA 1XYVA 3I05A 3WB2A 3H5TA 2XWPA 3QBVA 5LYJB 3OKCA 1VIAA 5K3DA 2YHUA 3RYIB 3TSCA 1HXHA 3L7NA 4ZALA 2NZWA 3M1LA 4Q24A 5JZVA 3HL4A 4TROA 2ZYAA 1AKUA 1XRNA 2XMCA 4EHFA 3Q8KA 1OB5A 1M54A 2YJZA 2ZB8A 3DPIA 4YDSA 1Z5WA 3L4EA 2IOFA 3DAFA 2DYKA 4WBSA 1DTWA 3IAS6 5I5GA 3P9KA 4BB0A 1DI0A 2ZWIA 2DUWA 2OP1A 1PL7A 2J0UB 1A9SA 1U4OA 2VDQB 2WIAA 4XCQA 3SAJA 4EQ6B 2WTNA 3DTTA 1GTG1 1PN3A 3L49A 1Z8HA 4AZ3B 3VISA 3QITA 1C1DA 4TTTS 3T1VA 1KDYA 3P20A 1PWHA 1MJGA 5CFNA 1PT5A 1H0RA 4Q3OA 1JHVA 2Q6IA 1JW9B 1W6RA 2SKEA 3AP1A 4K2AA 4R8MA 4V0ME 1VRWA 3N1UA 5IC4A 5C51B 3RTEA 1US8B 1LD3A 2FN3A 3BSSA 1T0UA 4LA4A 2XUQA 2C84A 2ECQA 3DVAB 3M33A 2JCYA 3W9YA 4XUCA 4BFSA 1CIJA 5AQ1A 3T9CA 1ZNWA 1GD1O 3ITEA 4I2VA 1JMYA 1SVLA 2QEQA 3NVDA 3OEWA 4HDAA 3CPJB 5CFMA 4CR6A 3EBOA 3FMGA 2WU1A 4KMSA 1C1YA 1IPEA 4PLWA 4UOEA 3ZBQA 1TKRA 2GHTA 5C4GB 3TEJA 5EC8A 2ZAGA 3E2PA 3ESRA 3OX2A 4C20A 1GNLA 4AY6A 5CYPA 2RG7A 3WYEA 3GY0A 3W1EA 2OXIA 3JSXA 3WIVA 3FSRA 1DZIA 1WCYA 3ANYB 4R0NA 5C46F 4M9ZA 4FW8A 4E4RA 2X3FA 4DLRA 1QOZA 5BQXA 1X80A 5JAPA 4IHQA 4KYTA 3VKHA 4RJTA 4GNKA 2ZKIA 4G2TA 4KAJA 3B89A 3OJXA 4LVNA 4L0MA 2Q2NA 4UBNA 2VJBA 4I14A 3T4XA 3NM5A 1KO8A 1J90A 1JIXA 5DHUA 4HN2A 3OUUA 3WDLA 4HH3C 1P31A 2X5OA 2EG5A 2B5VA 2F9MA 2I0FA 2JFOA 1QHEA 3ERCA 3PWTA 4HP8A 1ETHA 1UEIA 4NNJA 1Q1BA 4X90A 2WWIA 2GK3A 1EVIA 2BZ0A 3MBIA 4NC9A 1H93A 3K5PA 5EZ5A 5JCOA 3AL2A 4MQUA 4CQMB 5T41A 1F9EA 2QX4A 1VHTA 1XZFA 1KFEB 2AQIA 2FW7A 3I42A 5GOZA 4BXOA 1N1DA 2CVZA 3HB9A 4KR2A 2XT9A 2QTGA 1PUXA 3R9XB 3T7EA 1AJEA 1EAYA 4L7VA 3A6ZA 1FTWA 4MQ4A 1QTRA 4QVKA 3K6KA 5AVWA 1KPIA 3A1NA 3EDMA 1CCWA 4E31A 4Q9DA 1FU8A 3OD5A 4GZMA 1XO1A 3V7YA 4MAAA 2VXOA 3BE4A 4MQEA 3QKTA 4L50A 3L8ZA 2X0JA 3AV3A 4M21A 4G4SO 4BNGA 4QHSA 2CUNA 4IM7A 1NVUQ 1WZCA 1ZKDA 3OO1A 3M5WA 1KEWA 2ZRBA 3BWXA 1QH0A 3OSZA 1N6RA 4QQ8A 4FYVA 1B73A 5HR5A 3WRWA 1JKXA 3R3VA 2M1XA 2NZ8A 5GJBA 2ZI4A 3VGJA 3NWJA 3W8DA 1AS0A 2DOKA 3N74A 3KLPX 1V2GA 3F3MA 2NU8B 1HL3A 1J70A 2G8LA 3M9WA 3JAWB 4ZRDA 3ZE8A 4EKGA 5JQGA 3LH5A 3PNMA 5I7OA 3QXSA 4N40A 3TSZA 4DHEA 2V4UA 3ROQA 3V1UA 2ZBFA 3DVQX 4LEIA 2GPNA 4MO2A 4CUZA 4IIDA 4EB6B 3ZWYA 4ZKDA 2O4CA 5IVPA 3FPSA 1GYRA 3HZRA 3D6MA 2QG6A 3IO5A 3S2ZA 3KOWA 1LBTA 4DSNA 1NIPA 1K3UB 1NW6A 4B82A 2XVZA 1QK5A 1WSBA 2Z2YA 2GPTA 4D6PA 3HVRA 4PZYA 3D59A 1QYVA 2XUJA 1MAVA 5AHXA 3Q1LA 1BHO1 2JGJA 2M6RA 4P5PA 2V54A 1PU2A 5E6UA 4MI1A 4IXWA 4IDGA 1VPLA 3HCNA 1JEYB 1RAAA 3OOSA 1DIAA 5B36A 3KTOA 5D3ZA 2QS9A 1FE8A 3LHSA 4P2GA 3MCTA 2OGWA 2COUA 4JBIA 2CNOA 2XUDA 4YLGA 4M8IA 2O0LA 2BKUA 5DI3A 3LPAA 2VT3A 4I1VA 1DKMA 4EB3A 4XM0A 3O8DA 4OG2A 3VJKA 5E4YA 1D2RA 2EHJA 2XUZA 4ZGGA 2QT0A 1CJMA 4JC4A 2VAMA 2ORWA 2DUJA 4E08A 2PMWB 4OX9B 4CNBA 3STHA 2BM9A 1DBSA 2FWNA 3ZE1B 2HIHA 4YYZA 5JO0A 1P9OA 1XEWY 1A9QA 3DDCA 1KRWA 2WK1A 1C7IA 4F5DA 2HV9A 3ICPA 1NU6A 1QUFA 4J7XA 1N9GA 4KQEA 4I8IA 4CNQA 4DARA 2PEYA 1QP0A 1NATA 1KP9A 3BH7A 3C3BA 5HVNA 2AG0A 4B8ZA 2J3MA 3OZTA 1URPA 1RKXA 4XIIA 5AKZA 4RTOA 2NPOA 2C95A 1UIMA 2AC7A 4C4YA 4YLEA 1FBNA 4MINA 4QODA 4MQBA 1FS4A 4DT1A 3PDUA 3FCCA 4V0QA 2QMQA 3MJVA 1ORDA 1ZUNB 3D5EA 4KIJA 2RHTA 2P0EA 3DBHB 3PPIA 4O08A 4W7IA 1VYTA 5TY0A 5HQ3A 4D9JA 1NJ1A 1DQNA 2VJPA 1K3FA 2RC6A 3BWDD 3GT0A 4GYKA 4Y9SA 5EQTA 2PGNA 4K6KA 4RGQA 2J85A 1LPSA 2JF0A 5FBKA 3CKKA 2BI8A 3T9BA 4C4TA 3DCJA 5LZ4A 1Y1LA 1OHHA 2R84A 3DSRA 3M34A 4HH0A 4O1IA 1B8OA 1TRHA 1ECGA 4EY5A 1I51A 1D1SA 2NTYC 4LAFA 1S2NA 1JWLA 2NYAA 2CD9A 2PNJA 3KQLA 3G2PA 1F2TA 1VECA 3U26A 4ER6A 5IZCA 3B1KA 5CPBA 1BU5A 2XTZA 3WLQA 1T0IA 1EX9A 1UDXA 3R7WA 1CBUA 3P9XA 3T06B 2IF2A 4BGVA 4BGUA 4C87A 2IYRA 5JSHA 3BH0A 4MJ7A 4BPBA 4GM4A 3ZD6A 1NYQA 4Y98A 3A0RB 5KTMA 1CZHA 1CEXA 1WSWA 2NV0A 4MVJP 1M1NB 2LKCA 3VZQA 1Q0TA 1HTBA 4ZCLA 3V4PB 3IH5A 1OBFO 3LQYA 4IHKA 1GPBA 4QJ4A 1E9DA 2C5FA 5B3JC 4BKRA 4NCBA 1PT6A 4UPEA 1M7BA 3B20A 3RG2A 4PN7A 1LKZA 2O3TA 4CKXA 1CTQA 1JG2A 5TPWB 3V4VB 5A9RA 4MQLA 1IBRA 2WINI 4UU7A 3EIEA 4IO1A 1UDWA 1XNHA 2P2CA 3AW9A 3FHCB 1AC5A 3N39C 1JHQA 2GCOA 2H8GA 1RHKA 3KG2A 4QHTA 1KMCA 1YZKA 3UJ3X 4QYWA 1HC7A 4U5XA 3EZNA 2CZCA 3TRFA 5CVCA 1GYQA 3H18A 1NHWA 3ICOA 3KB2A 3NGMA 3QOFA 2NW6A 1C7ZA 3Q7IA 3UQYS 2QVYX 4WXRA 3AIIA 3INNA 4HQRA 5CXQA 5JSZB 5C4IA 1RAGA 3IOBA 2GN6A 3W34A 1BXKA 4I1OA 5KVQA 2Q3EA 4LOLA 4ZEXA 1Y5LA 3LBNA 1U1CA 1QBKC 4D1YA 5GTDA 4N7MA 1HT1E 3PJEA 1MN6A 1S4MA 2VJLA 4HVCA 3ELDA 1QIMA 4C4XA 4NABA 4RX1A 3TQOA 3N8HA 1JVNA 3QV2A 4KXFB 3QWIA 3I4LA 4MGEA 4N7JA 1CERA 2GF2A 2WKSA 2GPSA 4N4AA 3AF2A 4QSHA 3V4FA 3D2LA 3X2EA 5EGNA 5JFGA 3OIYA 5LIPA 4KZPA 1Q7BA 2ODAA 3DXFA 5I3CA 3O1HB 4H7KA 4ECAA 4CLXA 5IMBA 3P0IA 1WBBA 3KEMA 4OQYA 1JU4A 3N87A 2JJ8A 3NHZA 1W8DA 4MYUA 4E0BA 4E2WA 2XZOA 1VLZA 3NVAA 2XEDA 3TUIC 2NO4A 1KYIA 3C8HA 3ESDA 3JATA 3SOZA 3UT5B 1HDXA 2FDXA 2OZLA 5EE0A 5BV1A 3WJ7A 1R9GA 2WNIA 4BGEA 1YK1A 5H8WA 2EU8A 2Q4OA 4V2IA 2WI8A 4WW0A 1GN9A 3ZOZA 1RE0A 3LX4A 1Z4QA 2VSFA 3LYUA 2PLRA 3P26A 4ZHQA 4NVRA 3W05A 2JS7A 3KQUA 2IHUA 3KKOA 2Y2UA 4LK3A 3LMKA 4GIBA 3SSMA 1SD5A 2E37A 4X61A 3N9IA 4HADA 4D3FA 1G6KA 4ZQHA 4PQRA 3UHPA 1D2AA 3BHJA 1GN8A 1WPRA 3GQVA 1JMKC 4LRTB 4WASA 2PUTA 5J4VA 2Q62A 1GSIA 3MS7A 4HYQA 2ZSDA 1N75A 3IBCA 2J0QA 1IWBB 2XDYA 5GMOA 3UGKA 5HTOA 5KPJA 4MYSA 3AILA 2P2GA 2QZZA 3R20A 4FYJA 1PI3A 2P35A 4TVOA 1AH2A 5KVCA 2FMIA 2JZOA 1M2OB 3DZIA 1KETA 5DHAA 3OZSA 1OLSB 1XMJA 3PDIA 3KETA 1DRWA 4MDFA 3ZCUA 1OWMA 3I6QA 1M2NA 3BFVA 2C98A 5DX0A 3G82C 2R6HA 3PK0A 1O7JA 1CUAA 3T61A 2V6JA 1XWIA 5EYPB 1UPXA 2IYPA 3HYRA 4BNYA 2DTXA 2IW1A 3HCWA 1XDGA 2G6BA 1BA2A 2P91A 3JTEA 4PQYA 4B6JA 3PUWA 5AESA 2WWYA 3L7AA 1K8RA 3O74A 1RIFA 1JHOA 1RXWA 1OW3B 1L4GA 2VJMA 3IP9A 3G2MA 4KPFC 3SI7A 1DVRA 2GCIA 4J1TA 3CT4A 5CH8A 1XI2A 1T0JB 2H48A 4MUYA 5EXDA 5I9BA 4IRMA 5BW6B 1PFUA 4XTRA 3Q3VA 1MORA 4RIGA 3WJ2A 1BX0A 4V39A 2V7XA 2I91A 2VXBA 3D1JA 4FQ8A 1GG5A 4HS9A 3PFGA 2WSLA 2RHCA 3QU7A 1TK2A 2R97A 4M1YA 2WYUA 1ZUNA 5DPMA 3WLRA 5BSKA 3FLAA 4FFVA 1HZJA 1ZXLA 1V43A 1O0CA 5EWJA 1P0FA 1VHQA 2HJHA 3AEKA 4GBMA 4B43A 5HZKA 3EULA 3QIVA 4X7MA 3W3AH 1L7MA 3L4SO 2FH5B 3ZS8A 1JJIA 2PX0A 1X70A 1SBIA 1ZHHA 4G0PA 3KLNA 1KC1A 2PRSA 2DQZA 2AMVA 2OV3A 1SC1A 4EDFA 3ES9A 3I34X 3KU4A 3KWMA 1PG5A 1OWNA 2YWJA 5BW4A 2XOKD 4WD3A 4M9RA 5JSZA 3I0MA 3KR2A 4BBJA 5J63A 2PZKA 1E2QA 2Q9AA 3NOXA 4EVIA 3RFXA 5EWLA 1ACMA 3CCCA 3QSGA 3DAHA 1V2HE 2QUJA 3VR5A 4FE3A 1T4BA 1KZ9A 3H6HA 4BU0A 1DEXA 2ZR7A 5HYVA 1SKYB 1RSZA 2GQ0A 1E94E 2FWPA 3AUSA 4FWIB 4A2CA 2HA6A 3LCRA 2P9JA 4GMXA 3BTVA 2GZ3A 3E48A 4NFHA 4O4LA 2QF7A 5AJVB 1I2MA 2BGTA 2YIVX 2ZWOA 4IHJA 4RYLA 1YDMA 3U4CA 4LJRA 2A9QA 2ZUUA 1HSOA 5EJ2A 3RSZA 3LQRA 4BQIA 1I6WA 2HMVA 3UWSA 4MDHA 3UJDA 2BVNA 1PWEA 3PDWA 4B46A 4UDXX 4WGGA 3W3AA 1CZLA 3A70A 2JFPA 3VAYA 2EZ9A 3GLHB 2FMKA 2OTCA 3FN4A 4LNUB 5AI6A 2INGX 3FDZB 3KJZA 4MV9A 3ETCA 4JP3A 3ESXA 4LGCA 1ZP6A 1Q0HA 1TIBA 4P4NA 2R85A 3C3PA 3R7NA 1E6CA 1KOJA 1OILA 1TAGA 1YS6A 2AMLA 2WYWA 3D64A 3OPXA 3LQQA 3INGA 3UCXA 1WVMA 4BGIA 3FKSA 4PYRA 1JRLA 1KDTA 1D03A 4RXTA 2IYNA 2WG0A 3ER6A 4GYWA 3VC3A 1NN0A 3EXAA 3IMKA 5ANRB 5H59A 4PVDA 2BBSA 4PBRA 5U4QA 2Y1GA 4O2LA 1YHZA 1TAQA 2PUVA 4QTUB 5D51S 3P9SA 1E5TA 5HHTA 1EVEA 4MITA 4QOEA 3IQWA 3S27A 5DXAA 1XJ5A 1K97A 4BFXA 3IV9A 5K4GA 1VCIA 4TUYA 1SO8A 4MUNA 3ST7A 1BU8A 1PT9A 3ZDEA 2NUPB 3KSBC 1JQBA 1Q0PA 3KZNA 1JAHA 5PGMA 4JNKA 3S1LA 4FX2A 5BSUA 1T3TA 2YXLA 2CNLA 3DE0X 1MO2A 3KNZA 3OWHA 3LFUA 2O2DA 5IUKC 2BEKA 3WB0A 4FUQA 2NO7A 4RJIA 3CA8A 3QVKA 3ZXSA 5ALFA 4BB9A 3JQPA 1UKEA 2WM8A 2XI4A 3EXFA 5CT5A 4J1NA 5EQFA 1QPGA 3RUDA 3TTXA 3LZCA 1I80A 1JPNA 2C29D 5BN3B 1A50B 2JDIA 2PXCA 5J1TB 3WISA 2O2GA 4IQ8A 5EWJB 4JFAA 4BMXA 5K5EA 1H0KA 4GLOA 1N0VC 5KTTA 2EERA 2FI1A 1YAHA 1B0UA 1C7RA 1HQYE 2Q9CA 3DMHA 4ZOQI 4V0LA 4V2UA 3A2NA 3IB6A 2ANCA 2VNSA 4G4SP 3DTNA 5FBHA 3EPPA 1RI3A 3N6RA 2P40A 4I08A 1DKUA 1WHSB 5CGQB 2QUZA 1IMJA 2BHLA 1RT9A 4YQEA 1SKQA 1G41A 3THXB 2PBFA 1Z8NA 5A1TA 1MVLA 3AIMA 1AQUA 3W5UA 5CHYA 3N0RA 4MA0A 2FW6A 3OQIA 1I5OA 1C0EA 2XB8A 3BIJA 5KVVA 4H4DA 1O5OA 3L2OB 3PKIA 3LBHA 5CDHA 4MSUA 1AUXA 1SWVA 2N0SA 4ND8A 5EE3A 4CKEA 4XGRA 1US8A 5HOQA 2LDBA 3QVGA 1E96A 1TJYA 3C3DA 1KVQA 3HCOA 1U2ZA 4JT4A 4HQNA 4RJ2A 4EUNA 3FR7A 3M89A 4UU8A 1LUAA 1T26A 1YR6A 4ARIA 3LCCA 3PLNA 2OXEA 1G98A 3CLUD 2HL6A 2P4EA 2MMGA 3QF4B 4GZ6A 1LDBA 1N2BA 2ZSEA 1S2DA 4NFYA 4Q4AA 1CG6A 5L51A 4PIMA 4Z53A 5L4SA 2E6KA 1EKXA 2LZ0A 3D2BA 2ZU6A 3DTYA 5D86A 1PZEA 2YTZA 4Q4JA 2Q6OA 1JH8A 3AGQA 3WGVA 4TXMA 3FTPA 5I9TA 5C81A 3LY9A 3TXAA 2JAPA 4P7KA 5JRJA 3VSEA 3VPCA 4PO9A 1CY0A 2HEIA 4POAA 5LL6P 3FMVA 2OD7A 2GGSA 2XT6A 3DMFA 4EITA 1N2CE 2FUCA 2Y92A 5TJHA 4YUZA 1DDIA 1ZBQA 1AUVA 3DO8A 1JWAB 4B84A 4R71A 1P1FA 2ZWPA 4MRMA 3EVDA 4C0AC 1D5WA 2A0WA 1C1DB 3RASA 1O87A 1B14A 2AI2A 2NZYA 1NN3A 3G9TA 4NI5A 4RABA 5P21A 3JWHA 4M2LA 1XRLA 1T36A 4NE9A 3DL0A 4PO8A 1I24A 3JYLA 3OIGA 1H3FA 2ZZNA 5FTLA 4C7XA 1KA9H 2OBBA 1ZVJA 2CYBA 3G0DA 4Q1CA 5KOYA 4ND1A 3GFFA 3GMDA 3LUGA 1WB5A 4CG1A 4DLTA 4MV4A 4IGEA 4BV3A 1VLQA 4RIEA 4PX3A 3RJMA 4TXLA 3THXA 3GDFA 2IPXA 3AINA 4HNSA 3SHQA 1HYQA 3ZLUA 3STVA 4C4ZA 4U2BA 4YCDA 2VNIA 4B85A 2GVZC 1KP2A 2QR5A 4E2YA 5EP4A 2OHOA 4CHGA 4PWZA 2O0MA 3NKVA 2TMDA 2JBHA 1OI2A 5K20A 4OXXA 2PQ2A 3CX6A 4Y2UA 1L5VA 2W7TA 3R0JA 4EKEA 1WF3A 4Z9XA 5CFOA 4PNHA 5HM6A 4I4LA 3DYVA 3H2SA 4C0SA 1W59A 4G89A 3RADC 3GFSA 3IKLA 1M2VB 2ACKA 3DL7A 5AJHA 4R01A 1B3RA 3FMFA 1LFDB 2PD3A 3SVZA 3QSYA 3QYJA 2VHZA 1I94B 1TIKA 4UEOA 1Y8QB 1KJYA 1ZINA 3TM4A 1Q1EA 1SOMA 5JYCA 5CIQA 3W5AA 3UUFA 2Q3MA 1PJAA 4F9GA 1I9CA 2X0NA 4W99A 1DUSA 1ZK0A 1PFQA 2BFEB 4NJOA 2CB0A 5TEVA 3AH8A 4ARZA 1D9ZA 1JYEA 3A1UA 1G16A 5DRYA 1EVZA 2QVCA 3SYNA 3HMKA 5ED4A 4D26A 3QV1A 4LJ6A 4PNZA 1XNQB 1B00A 5F1KA 1L7EA 1VJDA 3QW2A 3K6JA 3O2SB 4INZA 4MQFB 5IKXA 1CUCA 2UYQA 2ZREA 3A32A 4CL0A 4DZZA 1FB5A 2YICA 4EPRA 4LMBA 1BVRA 1C14A 1XRMA 2RAUA 1RTTA 4MVJI 4EM6A 4EY7A 2NVOA 1FEZA 2IA5A 3E05A 3NEJA 3CZ4A 1P2TA 4RZXA 5GGYA 3CO0S 1FL9A 1DAGA 2NUPA 3D6AA 4CL8A 1VHDA 3OIWA 3L7MA 2J9YB 2P2YA 4N5HX 4NBKA 1NI3A 3OWXA 2AJCA 2DF8A 5DSXA 2RFLA 3RVOA 1RKBA 3OZAA 3VSBA 2M98A 2XTJA 1V8ZA 1PJTA 2XYPA 4HEA1 2HEGA 3GP5A 5BOSA 1HDZA 4M89A 4YI5A 2GYVA 1G0NA 2R44A 1CWUA 2XADA 4MB2A 4ZVPA 3UOGA 3BXGA 4B75A 4DA4A 4PGAA 1FTQA 1EUCB 1S9HA 2GN4A 1SXGA 3DAGA 4QM7A 2ZIFA 1VCHA 3S1AB 4JSRA 3TB6A 1YR3A 1Z4NA 3SF0A 2QE7D 1WETA 1YUBA 5EEGA 4TKVA 3V1TC 2P6PA 2DEUA 1IG3A 4MS1B 1DIOB 3KJGA 3PUYA 5A5VA 3HNOA 2ZW9A 3MTJA 1A5AB 1E0DA 2V59A 3FB1A 4FTWA 3WGJA 1QP4A 1NY5A 4Z0HO 3CVYA 4AI6A 5DEOA 3AETA 3L1HA 1G9SA 4LJ8A 3SXUA 3GQBB 4Q1BA 1HLFA 4QKQA 4J3JA 2JLQA 3HGMA 3CLKA 1ONOA 1I2DA 1T3LA 2X7JA 2JD0A 1XDZA 1JQKA 3ESCA 4ZC1A 4AZ0B 4QUJA 2PFKA 3A28A 4ABYA 2GRUA 4RA6B 5J2TB 3R8FA 2O3JA 2QM8A 2EKDA 2PL3A 4G0MA 3T5GA 3GRRA 4P8RA 3KVYA 4MUAA 3VZCA 1IHYA 4ZK6A 2O8EA 3GQBA 4KQGA 1QUEA 4BZPA 1OXSC 3MA0A 1YVPA 3AVTA 2P30A 4G5HA 2OO5A 3RSLA 2YR0A 2L2QA 2QORA 3KXPA 3AHIA 4GSLA 3O8OA 4HNAA 4LG1A 3UXMA 5NULA 2YUTA 1CRQA 1IZ0A 2C5SA 1QRRA 3U7HB 2GFIA 4IJUA 2PL9A 5JVDF 3T99A 2J9ZB 1ZICA 4LRSB 4PLYA 4KE8A 4FFMA 4NMLA 1LZKA 3W04A 3EQ9A 3EF3A 1XJ0A 3ANSA 1OX4B 1V95A 4RACA 4Y2XA 5H4HA 1NVMB 3DBLB 3CZQA 3THYA 1X7GA 4LIPD 1TZBA 2QMYA 2CMFA 1SOAA 3FROA 3I4CA 3PA6A 3KR0A 1H5NA 1CIVA 4FBMA 4Z7NB 3AHJA 2NU9A 3TOCA 5C18A 2GZDA 5KNBD 4NNOA 1M5RA 1QCCA 2E9SA 3GUVA 4EOGA 3H2HA 1A71A 2JI8A 3RS9A 1KIFA 1VL0A 3U7GA 1OXMA 2FR0A 1RJWA 5HKAA 4HX2A 3KO8A 3KVVA 1HE1C 5MN6A 4RZ2A 3DVLA 1LDEA 1T3HA 3MYYA 3T1OA 8AT1A 5JQWA 3B5JA 1SXHA 1U2GA 1Z35A 2LW7A 3JARA 1RXCA 2FG6C 3T9DA 2NV2B 3OJWA 3LUBA 1GCAA 4BLQA 5ICSA 1K1EA 4FPXA 1WXFA 5BRNA 1H69A 2AG8A 3CM0A 1BX1A 2OHVA 2Z57A 2W6MA 5AWFC 3TKYA 4PG5A 4YYEA 3PEFA 3W2HA 1RI1A 3CEHA 2EQAA 4O0LA 3Q8MA 1HKHA 4Z9AA 5B1DA 3OHSX 3E3LA 2WWVD 4ALKA 3KQNA 2AFHA 1ACJA 3AEQA 3HYCA 3I2FA 5BVGA 3IAM6 2QMOA 2Q8PA 3OX3A 1W46A 2ENWA 2EKLA 2CHGA 2MIIA 3OJCA 5HKBA 2J48A 2O3RA 1WPXA 3KAKA 1G8KA 2H51A 4L28A 5D85A 3ZWBA 3HY4A 4B7AA 3L7LA 1PKXA 5ALDA 3HLKA 4O2AB 5CFRA 3DAPA 3M2TA 4GGPA 3WGOA 3A4TA 5LQDA 1A5ZA 1HV8A 1KVUA 3OO0A 1FXWF 1KGSA 2JIDA 2OHIA 4ERXA 3FJOA 3LHFA 1JJAA 1MC5A 4GQAA 4LXYA 2IIVA 5FFMA 2PQ0A 2GEDA 2C2HA 3EJWA 3B36A 1A8QA 4XSHA 2V65A 4HDRA 3UAVA 2WV9A 4UKDA 3CC8A 3HYSA 2GKSA 4Y0AA 3AB7A 2HRBA 2XGOA 4CUJA 2CV2A 4WWHA 3FRIA 4MR9B 4X41A 3GEBA 3EA4A 3I37X 3IQFA 2P5TB 1V16B 2PMKA 4KODA 4TRJA 3KKLA 1AHNA 1HA3A 1USUA 2W6IA 4KXLA 3DCYA 3ZCTA 3C39A 2GN2A 1QR6A 1LJ8A 4OHPA 3IQGX 4QUAA 3VYTB 5LU9A 3UW1A 1SUCA 4ZV7A 2PZBA 3TRKA 4FSHA 4KZKA 2G09A 3B9RA 3I73A 4N49A 3WVNA 5C3MA 4JZKA 4N5DA 5ALXA 3NALA 1ID8A 3RC3A 4AMBA 1FOEB 1M6EX 5AI4A 3GRUA 5BNFA 3COJA 5JUWA 4DRXB 4NWIA 3VR5D 4DUPA 1G2PA 4X63A 3WIUA 4ES6A 3RS4A 4TZKA 1DUIA 4CQLB 3UAOA 4LDZA 3U7FB 1XHFA 2O2JA 5EQJB 4CM4B 2I5PO 3W5CA 4IH9A 3NIFB 4MP6A 1XA3A 4M0CA 3DLBA 2WD7A 1KO1A 3SBXA 1GGVA 2FQXA 3EVFA 2YZMA 3CLSC 3LECA 3O4JA 4YCLA 3GA0A 4S24A 1PJSA 3B2QA 2HK6A 1AF4A 1ZQ1A 3DEJA 1E7QA 1FP6A 1ULHA 4M38A 3U9LA 2FWAA 1AXGA 2ACVA 1PR4A 3QFHA 4IDDA 4I6EA 1Z25A 2ONZA 2X5NA 1SOUA 5I9MA 2GYYA 4W7HA 4GLFA 1GGEA 1RM0A 3I9MA 3IPCA 3ND9A 3V1LA 4ZDIA 4GZ3A 1RHQA 1V9LA 3O8OB 4XQ0A 3B6ZA 4X7PA 5DOVA 4NSNA 1KO5A 1NMYA 3T0GA 3M2PA 2BW0A 5CNKA 3QPUA 3RKSA 5I8PA 3HYNA 3AF0A 3IE0A 1LLUA 4C0KA 5E9JA 2CNWA 4OXQA 3FUTA 3H1BA 3WLOA 1D09A 5FUBA 3QE9Y 4CM6A 4W5TA 4WZBA 3Q2IA 3A6DA 3GW8A 4YP7A 4W5QA 3H5WA 1P2SA 1ISPA 3O90A 4OVKA 4ZVTA 1BYIA 4ZYWA 3HKCB 4KR9A 2FX3A 2W4QA 3HUTA 2WF7A 2WHPB 3ZWKA 2H1WA 3I12A 1ZCJA 2QSYA 3AETB 5GIPE 4CLDA 1NJ2A 1WPQA 1J8FA 3WSWA 4HUTA 1WS6A 2OSBA 3HJGA 3MSCA 5FTJA 5IMSA 5BR1A 2BM1A 4G09A 3L07A 4TQGA 1G6OA 3K9QO 4LGYA 4C6TA 2D4HA 4D9EA 3RYHB 5E38A 3I04A 4OHFA 3A6EA 4I55F 4TSFA 4Z7JA 5MHTA 1Z34A 2GKGA 3R44A 1ZN7A 4NHOA 4YRQA 3FCUB 4L6CA 1WZEA 3V8VA 1SAYA 5DHRA 4EO7A 1M34A 1J5EB 2OXRA 3G5LA 3KJEA 4EHLA 5FB3A 3DZ8A 4L4UA 2PFGA 2W83A 1XMOB 1JKIA 3WA7A 5TQ0A 2GZSA 3H5VA 2A35A 4BBAA 4PGFA 1U1IA 4H35A 4OB6A 1IQRA 1H8EA 2EC5A 3A06A 3V4OA 3CMCO 2X6TA 1R6VA 3CN9A 2WTBA 3QZUA 5I7FA 1UAAA 4MTCA 4NPHA 3HQ4O 2IS4A 2BP7B 2O57A 4GRAA 4NZMA 2O5VA 5JSKA 5B1YA 4R05A 1ETUA 2UYCA 1MR3F 3H5IA 5FIUA 1QGED 1Q95A 3ID6C 4C0WA 3WL6A 3C85A 5FWXB 1I3KA 4R9UC 4U7DA 4G5YA 5CA0F 1HNXB 2VK2A 4BU1A 4D5GA 3BRSA 4DSUA 1EK6A 3HVKA 3LNCA 4FGZA 3BDAA 4GZ5A 2YXPX 1IXZA 4X1YA 4EUSA 4J94A 1Z0AA 2B36A 5CT6A 2RSLA 4Q9JA 1ISSA 4WLNA 3PS9A 1PZGA 1J0BA 2AWOA 2BT4A 1LJUA 2AR0A 3EZ9A 4UASA 5J2UB 5CA0A 2G7ZA 2Q7DA 3SGLA 3AHEA 3ND5A 3RYIA 2D1FA 3NRCA 1QX4A 4LZOA 4PAMA 2Y4OA 2OAQ1 3ESZA 4B3GA 1UXGA 2RH8A 1MA3A 2PA0A 4DVGA 2MSNA 4BKPA 3O2NA 1BE8A 1F06A 1Q3HA 5BV8A 1RHRA 2AL7A 3CUWA 3BD6A 3GLFB 1FLNA 2WILA 3ZDDA 2AH5A 1L4EA 3NG1A 3VNBA 4DMFA 4ZU6X 2FU5C 1DT5A 5IDVA 1GYPA 5JLAA 1NJ6A 3ND8A 5DMXA 4DIEA 2Q1XA 3V8BA 3WB1A 4CCSA 5KKNB 1F1JA 4HI0E 4CLHA 5I4KA 2M6LA 3USZA 1HNNA 2J46A 4ILKA 4LMAA 4MUJA 2AJBA 3QPWA 4HJRA 3RT1A 4NBRA 5BORA 5KYXB 5JNLA 3WS7A 2IUTA 4YT2A 2Y1KA 2NTJA 1AQNA 4AZSA 2ONYA 2CHVA 5EOVA 1OI3A 1RE1A 3GRKA 4UHKA 2P62A 3MCAA 2HWWA 1CUUA 3ORFA 2C8JA 2VRNA 2YV5A 2NVUA 2OQRA 4CWAA 3ZGZA 1PZXA 3AKEA 5AHKA 4GL4A 1D1TA 1KDRA 2BF7A 2VKTA 3KEGA 5ENDA 1GTZA 4DJTA 2C2YA 1R4AA 1V9SA 3O4RA 4LXGA 1D2GA 4D4JA 1XN1A 3B6EA 1IY2A 4OREX 2C3UA 3BEDA 5ALIA 5LP6C 2ORYA 3QE0A 5CB8A 2VRCD 3RJZA 6REQB 1IJKA 3LWNA 5TDHA 1DMSA 1RPAA 3GGOA 1H4SA 3V8RA 1BN7A 1QHHA 1U9JA 2DPHA 1OUMA 1NTOA 4C0XA 5K0TA 1QTIA 2GRAA 3BIXA 2FP3A 3HHEA 1MEJA 4TKUB 5FYDA 1G9XA 2CE7A 2VDJA 1ZJ6A 2GA8A 3JQCA 4RHTA 3N76A 3NO4A 1RAHA 5K0GA 3KXKA 2QM0A 2Z6AA 2Q4DA 1IIRA 1X1AA 3H0KA 1X8JA 2ZYHA 2HIAA 3PC7A 1CUYA 4UUNA 5LP6F 1UUFA 3ZR4B 4D4IA 2ZJ5A 2XLCA 3RIHA 2P9QA 2QMHA 2IEIA 3DBIA 3I1IA 3B60A 4HPXB 4L74A 2ZVQX 2VNAA 5D5HA 5BSHA 1U5BB 5KOHB 2OLEA 1MJ5A 1OH8A 1Y4DE 4YRTA 1K6IA 4MS3B 3WGYA 3I6ZA 4PXSA 2AD5A 1HE2A 2ZROA 1HYEA 3I6IA 4FOSA 3QE4A 1HBJA 4HWPA 4HNUA 3ZZUA 1YBMA 3D7MA 2NPFA 1D4OA 1BC5A 2HDNB 4MEJA 1NT2A 3GEGA 2EDCA 4HGPA 1QIHA 3TNDA 1PWYE 2OYSA 2X9GA 4OF4A 1ZHOA 2QN9A 4KAXA 2GTIA 3JD2A 3DWEX 1XQ1A 5EPUA 5SYAA 4XIYA 1ZU5A 1R6DA 3CHYA 3IULA 3UBMA 4MYCA 2UZ1B 3A1TA 3RSOA 4Q82A 1BRTA 1ZM7A 4GBJA 4LBZA 2AG5A 5IM4F 3R74A 5IT9A 1FQJA 2R8RA 1R2QA 1FS5A 3ZU3A 3A2LA 3QP9A 2WZDA 4BVEA 1ODSA 1NASA 2J4FA 4HNHA 1QX3A 4MS4B 3ULKA 1VIYA 3MF4A 2WU8A 2Y3IA 3AP3A 3FYCA 2B9VA 1U8YA 4EGSA 1WEHA 2PUCA 1JHMA 2A9OA 1SVSA 3RIYA 4DEYA 4LDJA 2GASA 3WLFA 2I6TA 2DHRA 1BDMA 1XZ8A 3GJZA 4OSEA 2QZ9A 5JJLA 3HDYA 5DF1A 2G4CA 1NI4A 2PX8A 2WHYA 2WAAA 2OHHA 3C8UA 4O2RA 2JI9A 4RCZA 4YK7A 3SKXA 4EHJA 1SPBS 4F3CA 1U2EA 1BW9B 3WKBA 5JFTA 1Y7LA 4DG5A 4EHDA 1W5EA 3MBOA 4LC9A 4PLVA 5C31A 1HDYA 1MUUA 2ZATA 1PL0A 3W8RA 2NTNA 3ENKA 1OREA 3BOSA 2GAOA 4ODIA 3SJ7A 1L7BA 3TLJA 2B4QA 2D3TA 4MR9A 3VR3A 2GLTA 5E6RB 1FJ2A 1CS0B 2G07A 2RJ3A 1EVLA 3ABZA 1XZBA 1VZ2A 4BAGA 3QFRA 1EXVA 1SVWA 2ZTVA 3GA5A 2I1WA 3U9SA 2H06A 1AA9A 2AX4A 3WDKA 4V38A 1JR3A 5KYTA 2IEGA 2WUDA 3HXKA 3H87A 2FPUA 2JKZA 4TV8B 1PL6A 4LF4B 4E03A 2PUHA 4FKZA 3BF7A 1E99A 3T1QA 1I9GA 4YWJA 3RUPA 2Z95A 3AF4A 1XFDA 3EY4A 3H99A 5CBKA 4CLRA 2OR3A 3TRHA 2FLVA 2OAP1 3CV3A 5DM0A 5KYYA 2I8AA 3EQ8A 4MRVA 4A3SA 2HWKA 2HA7A 3H9CA 4NYIR 2VYQA 3LP5A 1WP9A 2AG1A 2BFFA 1G1MA 2AXPA 2P4HX 5HQJA 3BD8A 1AO3A 3T7AA 4HLQB 4URFA 1FSPA 1ZITA 4MIOA 2V4MA 3DV0B 2CLHB 2HYDA 5JAMA 2ES4A 2RARA 4R7TA 4CMCA 2OZVA 4DLAA 4LN1A 1KP3A 2H1IA 3UJAA 4NS4A 1DC3A 3TVDA 1A82A 1ZM9A 2QZJA 4F46A 1JV2B 2Y99A 1BWPA 1GUAA 2Q3LA 2YDXA 1ZGHA 1ZH4A 1U04A 1E1LA 1EQ2A 2P69A 2R11A 2R8YA 3O2JA 4H4CA 2H4YA 1CRPA 3GVPA 4GRDA 1O97C 4IG4A 3VO2A 4KTTE 2HRDA 1M0WA 3MINB 2ROQA 4LBWA 3K72B 4QAJA 4NH4A 1NXVA 2VPXA 1IHUA 3OJLA 4FU0A 4G81A 4Q9HA 1JU9A 1VE5A 3FVVA 1Z6YA 5BYBA 1MJFA 1RYFA 1CRZA 3VO8A 1B6SA 4FLEA 3JQ7B 1T6XA 1ZC4A 1XA4A 2BKLA 3KSUA 1CQPA 4BMDA 2YXBA 3IMCA 4WQMA 3ZY3A 2W6CX 3IIEA 5GVSA 2ZUFA 1VP3A 4EVQA 1NC3A 1XTJA 1A69A 1F4LA 2VK8A 2CKMA 2OPBA 3HYLA 3JQGB 1SKUA 4HDSA 2GZAA 1HTWA 4DJDC 3EXIB 1KEEB 2H2GA 3NHAA 5DIZA 1GRNA 1P7PA 2IUEA 4ND6A 2LTAA 3D0KA 2NIPA 1GUYA 3ZHQA 3E3MA 1FFHA 2JFXA 3TR0A 3AEUA 2J4CA 1YCHA 5B4VA 3OY7A 5CURA 4CM9A 5C34B 1N4AA 3U56A 3QE3A 1NDQA 2VATA 4FI3F 1TMOA 4U9HS 5E4TA 3SHFA 2GM4A 5ELXA 1ZD1A 1BKSB 2A67A 5CK4A 5A9TA 2H4FA 1GAJA 1B3BA 2CYCA 1YRAA 4KUGA 1CQXA 1GL9B 5B4UA 3JZDA 1J4AA 1T9CA 3AR5A 1KFCB 2NYVA 1PGQA 2JHPA 4ZAZA 2V5VA 1WKCA 4NCHA 1LDGA 4IIEA 4ZVSA 1PV1A 2GO1A 5BV2P 5I9IA 1VCMA 3I0NA 4ARCA 4PNEA 3KOOA 1JKJA 1QIIA 1GGKA 4UUPA 2DR2A 2GI4A 2DXIA 3AJDA 3WC4A 3ZWPA 1R6BX 5KJFA 3E53A 1GR1A 4LTDA 5I9SA 4MGHA 4URVR 1JB1A 2XEXA 3TI7A 2OWDA 3O0DA 3VNQA 2F1OA 1XJQA 4XB6B 3SC2A 3U7IA 1GKUB 2PG3A 3O2QB 3KT3A 4JBHA 4RAQA 3QJYA 5IAGA 5DULA 1KEZA 4JDPA 3R40A 2RAPA 3MHPA 2V7VA 2D2VA 3F3KA 3SZUA 1W36D 2BHRA 4IGAA 2IOQA 1PEKE 3O91A 2HU2A 1GSHA 1K5PA 2GMWA 1KOLA 4F92B 1IJEA 2W8BB 3GZNA 3ER9A 4TLLB 3IP5A 2IBMA 3IHWA 3O1IC 4Y9TA 2RIPA 3EZYA 5JASA 2OCYC 2QI9C 4C4RA 3H86A 4BVHA 4Q16A 2IZOA 3VU0A 4BFTA 5FWYA 1EQAA 3DF9A 1UP7A 2VF7A 4R8KA 2PE5A 4GD3Q 1YB7A 1E1QD 1T34A 2WJ3A 4BMVA 2H65A 1WMDA 4UVIA 3FFBA 3D8SA 3K0EA 3PIIA 3SZ3A 3SHOA 5IFLA 4S1VA 5I01A 4O0MA 3U49A 5F4BA 1KAMA 4FP9A 1DKLA 3H9JA 2JLRA 2XXBA 2AKYA 1W85B 1WB6A 4IDAA 3ZWQA 5DDIP 2R0QC 4HDNA 2IU3A 3GK3A 5IZ4A 1P75A 3THRA 3S2EA 1IUPA 2QTMA 4Q4CA 5LQSA 4KV9A 3GAAA 4ZOCA 3TFQA 2ZYTX 1KE1A 4RTMA 2FE4A 4UU1A 1AGYA 2FWRA 2YN2A 2ZJ1A 4YVFA 3UKOA 3KAPA 4Y0NA 4AT1A 2H52A 3OTOB 3UXHA 1JLRA 2WSSD 4GGOA 1X9IA 4PX2A 4UNQA 4PYJA 1VLJA 1BGWA 3ZDRA 3GLSA 3F6EX 1D2MA 1OLSA 3PDIB 2PXHA 1TK9A 1Q57A 2ZXUA 1BEZA 3L79A 1KI4A 4IIJA 1G20E 3V5NA 4CTKA 2A9RA 2ZJOA 4EI2A 4K28A 5IDXA 1NZDA 2VOJA 3AGPA 1EGQA 3LSYA 3S8MA 4BLUA 4NOJA 3V2GA 4IH4A 2CGEA 3A2KA 1FSSA 2YOGA 2G0NA 1SBZA 2XDWA 3PGXA 3D3KA 2HRQA 3Q5EA 4L9RA 5HF8A 3SQNA 3VPDA 5KHOC 1Y6GA 1Y3HA 3OFND 1NA5A 1K89A 5A2QA 1I7DA 2IVFA 3JASA 3WK7A 4P81A 2ALJA 4KWHA 4KSYA 1E6WA 1W44A 2A1UB 2QYTA 3HFGA 2O8BA 5AFSA 4HNVA 3GFRA 4GXNA 4MPPA 2QTAA 5KYKA 1JTVA 5EUBA 3T52A 4UCFA 1Y9JA 2EGGA 1SU7A 2C1ZA 1A96A 3F0TA 2QGFA 1NLMA 3C16C 4GBED 3DV0A 4HTFB 5AI9A 1YRLA 2BFMA 4ZC8A 1CDOA 3UKDA 2APJA 4EATA 1EFCA 4XM2A 1C3OB 2XODA 2VF5X 4CU5A 1GTL1 3A1DA 2P6OA 2VDNB 4NIMA 3OC6A 4HAIA 1IL0A 4LYFA 4QNNA 4RL4A 1ZH0A 1CZOA 2V98A 2J0SA 1G66A 4E3ZA 3T94A 3GYGA 2EX0A 3INRA 4PPGA 5HK8A 2WOJA 1U5AA 2FDRA 2ETXA 4ZZ3A 3VHRA 4DV5B 1Z3IX 1SK8A 3R0IA 4RORA 1ZM4A 3AY3A 3KKEA 4OP1A 4BLPA 4CW7A 1ZA1A 3REFA 2CNKA 5FOSA 2QYHA 1Y0BA 1V5EA 1G7TA 3P0RA 5TVKA 4XW2A 2CJFA 3KX2A 3SEZA 4ML3A 4REOA 1YHNA 3Q5DA 4DBZA 1WQ3A 1DO0A 1QU3A 1EU1A 2XUPA 2PD4A 1RXYA 2PM8A 3CPHA 4BVFA 3T6KA 3UXYA 3WA6A 3THWA 3GNLA 4N3BA 2KBEA 2Z58A 3F3YA 3RH0A 2DT8A 2ZBDA 4BDSA 1H05A 3BXOA 1SMKA 4OQZA 2IH2A 2NXWA 2ZSJA 3F46A 3GNQA 4JHXA 5KU7A 3GNSA 3C2QA 4I1IA 2EGHA 1C4KA 4TOIA 1R16A 4IOLA 4LRQA 4TN1A 1D7AA 4B3DA 3QBDA 1PUIA 2WAYA 2QVXX 3K70C 1ESZA 3OF3A 2IYYA 4ZAVA 2P5YA 3JRNA 5KI6A 3X1JA 4K81B 4PC6A 1I3OA 1ZCFA 1GZ6A 2R7LA 5JH7F 1YJ8A 3HR8A 1ZJWA 3JZAA 4QZVA 2UZ3A 3Q3CA 3R9KA 1CXZA 3NUZA 4J0HA 1N6PA 3CJRA 2WM2A 4QM6A 5DM4A 1SHJA 1SB9A 3ROMA 3OT1B 4DEVA 4J8PA 3UJPA 1PVOA 2ZBVA 3IS3A 5K0BA 1T0PA 3MLBA 1JALA 4KJZA 4GVPA 3VI4B 4EPVA 3KT8A 2VT7A 2EHDA 1Z39A 2CVFA 2J5KA 4OAQA 3FYUB 1J5PA 1RMQA 5J3JA 2VQEB 3R9WA 1A8HA 3SYKA 4GOKA 1PJLA 1WIWA 1UFQA 3DXZA 3L84A 4NARA 4KPUB 1YQXA 4OGGA 2ZDGA 4U9UA 4CQMA 2PKCA 1PHRA 1CJKC 1NKTA 2C4HA 2YV3A 3E84A 3HA7A 1DFHA 5F77A 2JGDB 4GOLD 3CRMA 3EZFA 5CCXA 1QYDA 5AXCA 3AW8A 1ZJYA 2G80A 2CDCA 2LBPA 2WTAA 2QN3A 2Z8ZA 2VXCA 3M9XA 5FHRA 1KVTA 2HCBA 5TQ2A 2E1RA 2GCNA 3ZV4A 2FF7A 4EPTA 3QIAA 2VIIA 3E61A 2ID8A 3A6HA 2P6UA 3ZVLA 2CCKA 3G17A 5TS2A 1QTNA 3ETHA 4FILA 4DLYA 4PXYA 1DJPA 4OJMX 3SIPA 5BRJA 1MJHA 4IKEA 1P2VA 1FS6A 3D4IA 4TT8A 2B21A 4LX8A 2GPWA 3NCTA 3LHIA 1PQUA 1MX5A 1KQNA 3DPSA 5F7OA 2Q6LA 3HBAA 2I34A 2NXNA 2Q6KA 4FN4A 3HJRA 4IY1A 2HPZA 1ZRHA 4RF3A 1UXJA 5CCDA 2YVUA 2W6NA 5CXUA 2BFWA 5LUAA 4TRMA 1L4UA 4INJA 3RHFA 3JARB 4PC7A 2DGDA 2BTEA 1IZZA 3SDBA 1JG3A 1LCIA 2KQUA 1ND5A 1OY1A 2Z04A 4LF8B 3MMXA 1CUDA 2W2TA 3HVJA 5F51A 1KO4A 3ZIUA 1J0AA 4F8EA 2ISQA 2QTLA 2JKVA 3NKLA 3FM9A 3TR5A 4JQYA 1Z0UA 3OM8A 4KGVA 2G6TA 3N6VA 3TGPA 3GXBA 1TXGA 1GL6A 5AHWA 3UWOA 4E1VA 4WKBA 3TAHA 4AJ4A 2FZCA 2JG3A 4MJ3A 3KUDA 1EP9A 1XNGA 4HYEA 5EJIA 1JHPA 1WBJB 5AW6A 2QYOA 1KAOA 4OUKX 1CULC 1QH8A 1R74A 2MMCA 1MX9A 3BWMA 2L0XA 2O7RA 3EVBA 3EBLA 3FPLA 3MOIA 4IDEA 3UV6A 2DE0X 5AW1A 1GIAA 2IIBA 3OT4A 4XSGA 5DNDA 3M6AA 1NSFA 1O08A 1U3UA 2D2XA 1XTTA 3IBGA 4IIXA 1O0BA 3QU5A 2JNWA 3QLVC 3RVMA 4IDBA 1TYDE 3NP9A 1JHXA 3E1KA 1IBMB 4JI0B 3IVGA 1A1VA 4NJEA 3PENA 3TG2A 3KZCA 1DBVO 1V7ZA 3RSFA 2G9ZA 3WNCA 3LUCA 2JLVA 1HL7A 5CAEB 2O19A 4PTLA 4YN3A 5HIMA 2W6ZA 3ZW8A 1XDBA 2PWZA 2HPAA 5AD1A 1TTPB 3QVWA 4OYHA 4RJKA 3DOIA 4WGFA 5PNTA 2GPAA 3K1AB 4KVAA 4JB0A 3SX0A 5ALKA 1P6QA 4AN0A 2HTEA 4B3XA 2Z1MA 3BHNA 1R4NA 4M0LA 3E35A 5LQUA 1MBZA 4KRYA 2IIPA 4CKCB 1NLYA 1BJKA 1WD7A 4JB8A 3OEHD 2BJVA 4XPIB 4FFBB 1TYZA 1PJQA 2I87A 4ALNA 3NTUA 1DAOA 5T6MA 5IUNC 1Z74A 3WHLA 4ENQA 4U00A 2WPDA 3AKDA 4LGMA 2R96A 4BLWA 4LDRA 3HBFA 5E95A 4RCYA 4CF7A 3GVHA 5CD1A 3ZDXB 1TQDA 5BT8A 1QFJA 4YX9A 4F21A 4PCAA 4X93A 2F00A 1QO0A 1EQUA 2A94A 3BS4A 1I4WA 3UJNA 2AR7A 1TI7A 3ZE6A 1UBJS 2IF0A 2P9BA 2CVHA 2D8AA 2HXYA 5CDFE 1AG9A 1IU9A 3E9DA 3VTZA 1GZ3A 5B64A 4C7BA 1XKLA 1O9BA 3LG2A 4GC5A 4EG1A 4O59O 5AOVA 2NUAB 1K7FB 5ELLA 1EGMB 1LF5A 1D3AA 1Z0JA 2O20A 2GAIA 3LUAA 2FPWA 1FX0A 2VK4A 4NAUA 5J43A 2R2AA 4RTPA 3LYLA 5FAKA 3RYCA 3A1FA 3QVTA 4MW6A 2I1VB 5I9NA 5LMNB 4N7RA 2Q5CA 2Q28A 3ZOKA 3L7BA 5IAOA 4OGWA 1UFOA 3BCUA 3EG9A 3OZVA 3ZI0A 2YMPA 3L0OA 2JEYA 1XPJA 5JAHA 4DIDA 2JLWA 2CBXA 2EP7A 1I7QB 3WYDA 2XVMA 2P2SA 2W00A 4MZDA 1SZCA 3AIOA 2CLEB 4NTZA 4TV9F 1XZQA 2PR2A 2W2KA 4MDYA 4Z4GA 3DDUA 4H0FA 1KYXA 2VPIA 2Q7OE 4QYXA 3DYBA 5FT9A 1LU9A 1W52X 1JYFA 3S4YA 3VFDA 2DQKA 1ATZA 3PHLA 3T5TA 4X1IB 2YVAA 1NBMD 1EJ0A 1Z6XA 4YDRA 3AWIA 3TZLA 3C15C 4B45A 1AN0A 1Q6YA 5CD9A 1AOXA 1ZH6A 3KT0A 1KZ6A 3L05A 4LZLA 4NMXB 4C21A 4EK9A 1L5HA 1LSOA 1C9YA 2PKXA 3GO4A 3QH4A 3U4GA 4A0FA 3NT5A 1L5KA 4BNLA 2IXFA 2Y6UA 4DRYA 1C8LA 4RVUA 2IPOA 2HQRA 5CIYA 2ZJ6A 3DVSX 2FFJA 3RFTA 3DFUA 1X2EA 2W6PA 1CR2A 1TYCA 4IJVA 5JDCC 2VYVD 3NW9A 5KYNA 4QSMA 3RROA 5TQ0B 2IS1A 3HKDA 4JYCA 5DK6A 5K0EA 4IOJA 3DOHA 2VAWA 3T0IA 4DHWA 3AUKA 3NDPA 1N1GA 2I2AA 1AUQA 2X58A 1FRFS 1WEKA 1RHMA 4MV5A 1CQWA 4HHEA 4I46A 1F48A 4MVJF 1V0JA 3M49A 4CFZA 5HS4A 4LSZA 2JRCA 2YKGA 1Z4OA 2Z5GA 1X1CA 4XASA 5UKDA 2FSFA 4IIGA 2ZIEA 1T2DA 2JGDA 1YWGO 2PKQO 1OGYA 3CE9A 4TMTA 5AKLA 1N5RA 5FORA 4PRYA 3HS3A 3HN7A 4R2LA 4BFLA 1U80A 1K08A 1TM5E 2VHYA 3ZG6A 2AXEA 3UPTA 4RFVA 5JPIA 5KSZA 1B8NA 3MINA 3L9XA 4IFIA 4XWTA 2GHRA 5H68A 5FNZA 1XL1A 1ENZA 4U6SA 2GNOA 1CZUA 3K9GA 4CJXA 5THKA 1HOTA 4OLHA 3H2IA 4ZVVA 1BXRB 1XD2B 2N75A 2GJ4A 2QRNA 4Y67A 4R0VA 1MB3A 5ALJA 2GBLC 3LPNA 1NF3A 1UT6A 1VSUA 3ROXA 1T3GA 2FEPA 4OYRA 5TT0A 2A88A 4RW0A 3SMQA 4I8DA 5I48A 2BFPA 3LLUA 2JW5A 1V3TA 3RI3A 5IAAA 4U7TB 2QROA 3BXZA 1TYEB 3O21A 4CR7A 2B94A 2BGIA 4IBOA 2J09A 3SM3A 3T7RA 3P4XA 2ADFA 3R6TA 1SUAA 2ILVA 3DULA 1BCSA 1RYEA 4CDGA 3QLUA 4J2TA 1EP3B 3TX6A 1XP5A 4ZCMA 2ZJ8A 3KL4A 4DLXA 1IDOA 1IUNA 2AFHE 3HABA 4R9RA 3FYDA 1Z5ZA 2J6BA 5FFFA 5JD3A 4H1HA 1AKQA 4J4BA 3K2QA 3U3RA 3TFOA 3F7TA 4NU0A 3RYHA 1NVWQ 1YB5A 4LJ5A 5JZBA 5KBYA 3Q9SA 4FXOA 4G5GA 5T3YA 4LF7B 2BH9A 3FGNA 4MEAA 5IKMA 5TGDA 2O50A 3SXPA 1T0HB 5DK4A 4LDNA 1GDHA 3K1AA 5D5QA 2EDAA 3JWPA 3USES 4HY3A 2GNPA 3VV2A 1X19A 4G0XA 1JZSA 1XD8A 3I64A 3LLVA 3MJFA 3QYPA 3C7KA 4YRCA 2J3IA 4FX5A 4DM7A 2A9KA 3KOZA 1QHFA 4GYYA 1E63A 3O94A 2VA9A 5GONA 4KPYA 4HB2A 4RM2A 2CLFB 3JPYA 1VA4A 4CTMA 1N2GA 2PS9A 4RVHA 4BKMA 1L4YA 1FJHA 2E4VA 4NDNE 3B1XA 3FNFA 2H1LA 4F96A 2D5BA 3JWIA 4LOAA 2O1EA 3FKQA 3IDAA 3TDKA 1LDMA 2DQYA 5C7OO 3PP8A 4D9KA 1U0RA 1PEDA 1KY3A 1RMTA 1TEZA 3VO9A 3TYXA 5SYNA 3LUPA 1FRNA 3G8AA 4Q7MB 4UU0A 1H94A 2CF6A 2GYWA 2WMDA 3HB0A 1Y3BE 2EFYA 1MABA 5LBIA 2FN9A 3C45A 3A1CA 1JI0A 2IXGA 1PHPA 1GPH1 2OCDA 1E18A 2ON6A 3ANLA 3C6YA 3T38A 1DQSA 3HACA 5JYDA 2OFPA 3OE7D 4WXPA 2OILA 2V7BA 4CETA 3DZBA 2ZGVA 2H3HA 3SZGA 1RBQA 4AO8A 3V00A 3W3AD 3ZCXA 5I8ZA 2JZNA 4RDCA 3ECCA 1V8BA 3DGEC 2QM3A 5L3SB 2A2ZA 1OI4A 2CXQA 1W9HA 3NV7A 3HP4A 4J49A 3VU3A 4ACBA 1V4BA 3CS3A 2YL2A 4F5ZA 4LQ4A 2GCEA 3CX7A 1OZHA 5FUVA 3W5HA 1YNOA 2WSSA 3OZIA 2WJYA 2ZB2A 3D7RA 4D0GA 3U16A 5CM9C 4AX8A 1WMEA 1CLUA 2V7QD 2D74A 4MRAA 4H1TA 3IILA 1Y98A 2VHTA 5E6SB 5F5LA 1QHIA 1FMTA 3HEAA 3TIFA 2W0SA 3DKVA 4ZAYA 4RTRA 1O57A 2IEAA 4CKBB 1G63A 1WXIA 4K87A 5BVHA 1VI2A 2L42A 5ESRA 2YW9A 5M7EA 4JMPA 4IIJB 3KLOA 4RVOA 2AHRA 3MJTA 5C80A 3GI1A 1UM9B 3IP6A 1ZAKA 3IUYA 5DYYA 3VPFA 1SD2A 2O8DA 4RXUA 4DLVA 3GJTA 3LQ2A 2YVLA 4RKFA 1KTVA 3VTKA 3PI6A 4ZTBA 3RCBA 1BMQA 1BXGB 1D6SA 1UMBB 1MRZA 3LVBA 3B3AA 4MKRA 4N39A 1MO4A 4PHGA 2X0FA 5JXIA 3VBEA 2WWFA 1P5RA 2FOIA 5G4KA 4WDQA 3RUEA 1RI2A 5GONF 5CFPA 1L4KA 3HU3A 1R8XA 1ZGJA 4P3XA 4ARUA 4BUZA 1GZ7A 2IYQA 2JDID 4F1JA 5A3VA 2I67A 2C3YA 3GAFA 5HUJA 3NDBB 3EGCA 1TW3A 4MVJA 5I4CA 3E22A 3QVUA 4S04A 3BA6A 2O8EB 3P0JA 2VLIA 1WZIA 5NLLA 1J00A 4XFJA 4FYPA 3RRXA 2FQWA 2GJ8A 2X0DA 1U0JA 3OT1A 4TN5A 4IJWA 2O07A 5K03A 3SICE 1DB3A 3LOQA 4CFSA 4EGCB 2F3TA 2RGWA 1GU0A 1M2GA 3IEPA 4HEJA 4JP8A 4HMQA 4O4HF 4PHTA 4J75A 4MX8A 1Y8RA 3WIOA 1O77A 3AEZA 2Q3FA 1LPMA 3OQMA 4XKJA 2O8FA 2G17A 4RZUA 4ARAA 5JCOC 1PEAA 1TO1E 1TM4E 4Q66C 1CETA 4ZGBA 1LVHA 1G8MA 2H4WA 3WBJA 1Y80A 4CMHA 5L6LB 4PSCA 1PG0A 4L16A 4NOKA 1J7JA 5GV8A 4YDQA 3U39A 3OLCX 4X20A 4EL0A 2WB2A 3IURA 2Q1TA 3LX5A 3AFGA 3VC2A 3AERA 1XKQA 2V6IA 3EZXA 2VCYA 3IBSA 4HAYA 4N8SA 4RD0A 5E1BA 1LPNA 4I1SA 4J9VA 4N6NA 3MGKA 1N2OA 2A86A 2PGIA 5AK4A 3OUTA 2YIDA 2ZK7A 5EKTA 4E13A 2WKQA 1N9KA 4Q19A 5KS2A 3MBKA 4ERNA 3ODPA 4QUIA 2IT1A 2X4LA 4RKQA 2BR3A 4RMGA 4XVQA 4H7FA 3LT1A 1CY4A 5FAXA 2Z1DA 4JENA 2ZAYA 1E7SA 4EGFA 4ZMRA 2J30A 4RNCA 5ECDA 2UAGA 4GG1A 1D4ZA 3GLVA 3LXUX 5ABPA 1YD7A 2O2SA 5J2UA 1R15A 2UXDB 1Y7TA 1IEXA 3UAZA 4DRZA 1BTOA 3V8MA 1I32A 1XMSA 5KQMA 4XGNA 1XPRA 1RABA 1C3OA 4LY6A 1J2TA 3QKSB 3B2EA 4OBWA 3ZZ0A 1U6JA 2JIZA 5WRFA 4W9NC 1EB8A 4ZVNA 3FTNA 2UVPB 3DVAA 4KGDA 1SBHA 2QRJA 4MI9A 1FFDA 5B30A 4O02B 5K8TA 1A2KC 1MB0A 1TJ5A 3FZGA 1TO6A 2IHBA 2A5DA 2B20A 3OMLA 4ZO9A 3SXUB 2B5OA 5G3YA 4IVQA 2VAVA 4AP5A 1LPPA 2WAMA 4HEHA 4YV1A 2FZ5A 2ZRAA 1FPQA 4A92A 2DCMA 4JLVA 4ZHSA 4B6PA 1QVRA 1O54A 3X1MA 4QG3A 1XAJA 2IYVA 3TD2A 4R31A 1RPNA 2GRJA 2NU6B 1J56A 2VSXA 3KTAB 3N7TA 1MZPA 2ZRDA 1DG9A 1C0PA 2I7VA 2QD2A 3EODA 1FU4A 2MSWA 4D7AA 4EKNB 4D8UA 3JTMA 4MICA 3JAWA 1U8ZA 5JQGB 3QKRB 1L7QA 3I2GA 4L0QA 3EEQA 3M6XA 4ZCTA 3PD1A 5CH3A 3NOVA 2XZLA 2A0UA 3MWEB 3VPXA 4IQFA 4HBZA 4IX1A 3JAKB 4IAOA 3TXXA 2RE8A 1WMBA 2PGDA 1XRJA 2HQBA 2PHZA 4QASA 3SHTA 5DN9A 1QS0A 1Q0QA 1JPVA 1OYWA 3QWAA 5C5DA 5JS8A 4Q1DA 1PSDA 2D8MA 2GCOB 2AJTA 3D02A 4A27A 2WHXA 4DT1B 2I7XA 5D3MB 2QP4A 4CV3A 1U8FO 3PPWA 4MQFA 4PZUA 3OMXA 1JIVA 1OGIA 4KN9S 5F2EA 1H66A 2VT2A 4GL2A 4EZBA 1JA0A 5JADA 3IAEA 3WLEA 3OSUA 4IZ6A 5ALQA 1GHTA 3ZHBA 4AJPA 9MHTA 1U5CA 2ERXA 3KBBA 2X22A 3S7TA 4YAWA 4ROSA 2KYRA 3M4ZA 4I36A 1KDOA 1G8JA 2VNJA 3FDJA 5E2AA 3ELYA 4ZOLB 5JNTA 2Z8YM 3QMWA 3EPKA 1QG2A 2V45A 1Y42X 2J6HA 3HFRA 4UUAA 4RCVA 3O92A 3S7ZA 2FN4A 1DXYA 5IF9A 2HDWA 2VDMB 2XDAA 4BEVA 2AFIB 3BK2A 3BB4A 3D4BA 3PWSA 4E33A 5KWIA 1B8UA 2QY9A 1MX1A 1EDOA 1Y4ZA 3D1LA 2G4LA 2EYQA 2BSAA 3LUFA 1B8VA 3QUBA 1SVUA 2OB1A 3BCRA 3QVVA 1COZA 3M4JA 1YULA 4IVNA 4YI3A 3WNQA 4E2XA 3EGWA 3P4UA 4MWOA 5U1PA 3L1JA 2YZGA 3TPFA 1SB8A 1UQUA 3L02A 4PZDA 2H85A 3FOEC 2I33A 2ZTMA 2Y0PA 3ZWWA 5E3IA 3QI7A 3DB2A 5BRAA 1DKPA 3LF2A 5FL3A 4ITUA 4EI9A 5J1SB 1BXZA 2NYUA 3VPAA 4QBTA 2P2LA 4FE7A 1KAEA 4BP1A 1JE0A 1E6LA 1SQGA 2WYHA 1DO2A 1D1PA 5F98A 4DA9A 4W7SA 1NM5C 5AR1A 3G1WA 4GMDA 4D4MA 1VI6A 4J0EA 1SEVA 2YN4A 5LM3A 4E5PA 4Y2TA 3M6UA 2Z6VA 2ZT8A 4DPLA 2A3NA 4ZVRA 1XXLA 5BSMA 4IF6A 1JQAA 2A5JA 4LNHA 4IL5A 2C1EA 2MT9A 3CZ9A 5K51A 2G72A 1U2RA 3PQ7A 4F3TA 1ZMTA 2QSJA 2EZ4A 3G88A 4R7ZA 5JC1A 2BFNA 3G89A 1MQAA 2AI3A 5ALTA 4P0TA 4RZSA 1KS2A 4WOJA 4DV0B 1YOVA 4MYRA 4DKJA 4BLSA 1CS4C 5IC5A 3RHZA 3FDZA 3KYDA 3IV7A 1SVNA 3MD0A 2DWPA 1IBSA 1NI4B 1PFVA 1XX6A 2HJVA 3IOCA 4JCCA 4CEIA 4C05A 5KYUB 3CBQA 1S3IA 3DQQA 5A0FA 5BNIA 3R7WB 2O2IA 1AXRA 3QU9A 3W6NA 1ZSYA 2CXSA 2ATXA 2ZSAA 3WWOA 4FW9A 4WIAA 4AUMA 3FZEA 3R6DA 4RQBA 3IVMA 5SZJA 4Q02A 5EXXA 4LVCA 4V1CI 2V0CA 1CQIB 2FPPB 3ZN2A 3BSWA 3HRHA 5L3RA 4CF5A 2QBYB 3BMCA 1HRKA 2AWNA 2FPIA 4N3GA 3BL5A 2OBNA 3P9QA 2HZ7A 4NE7A 1OASA 4YRPA 3PQ6A 4Q7LA 3I62A 1Y1RA 1WQ4A 5LQCA 4LXUA 3U4QA 2JLAA 5DHFA 3L0BA 3VU9A 1EFDN 4BZZA 4D3SA 1EHIA 2F1HA 1Z5UA 4MNTA 4WVFA 5ERGB 4AJ9A 5KNDD 4ON9A 5ERXA 4GW3A 1DAFA 4DXHA 2HNKA 3IL2A 4AQ7A 1KGDA 1ZOSA 2OZPA 4WCVA 2ZSUA 3BGSA 1A04A 4C03A 3RVJA 2WZCA 2DLDA 4RZHA 1EFVA 4AC9A 1J22A 4R54A 3RANA 6NULA 2FMTA 1NBEA 3FETA 2HXGA 1Z36A 4EHIA 5KX5F 1E1YA 3BMOB 4EEZA 4D79A 3CZAA 5A06A 2Z09A 3F8WA 2JFWA 2LWIA 3PD0A 2HK9A 1NNLA 4D8XA 2HNAA 1BVYF 4MMYB 4OATA 4EJSA 1YZFA 4RF2A 2CJXA 1XYYA 5KYWB 2UVQA 2DFNA 5I47A 1G21A 1HY3A 5EE5B 3SS7X 4UDNA 1IWOA 1GV1A 4MXDA 4WOCA 3G9QA 1W9MA 2RI1A 3K53A 4FLMA 3OOEA 3ZDYB 3IUEA 1J8VA 4E15A 1U3VA 3TLCA 1HQKA 1G2QA 3EK2A 2PX4A 1D6MA 1JTFA 1EIZA 1VL2A 2YQ4A 4IOMA 4ZYTA 3O31A 1OFUA 2PX5A 2Y1DA 3WGHA 2OMKA 2OCAA 4LFBB 3EOBI 4E1BA 5B6IA 3X1ZA 1H6BA 5AJUA 1BG6A 3UENA 5CCEA 4LW8A 2OP0A 3LP8A 4M0EA 1JEYA 2FPSA 1BE6A 1X7ZA 3WNBA 5BN1A 5KPDA 4UM8B 3SNKA 3Q88A 1HDCA 1RKVA 2Q3HA 2VSNA 2Z9BA 3CEPB 5EZYB 4ZIRA 4G23A 2QK4A 4JLMA 4OSOA 4AWXA 1IULA 1MFZA 1WABA 4H1UA 1P1BA 2RAVA 5L7WA 1OFUX 5JIBA 4RZIA 3OTQA 1H4QA 2NQ2C 2VBGA 2QZ4A 3UAXA 2VUTA 3DB1A 4U2KA 5EAIA 4GQIA 4LF9B 2GOYA 1SIWA 4YJ2B 4BC1A 2HLNA 5HF6A 2WYIA 2C00A 3DKRA 3I6BA 3PRJA 4KR7A 2XXJA 1DPGA 2ZE5A 4K9NA 4BWVA 5EZSA 4ALJA 1PNTA 3U6KA 5TQ2B 4R9SA 5BYKA 2W98A 1M3SA 3A9CA 4MKHA 2FPLA 5JJKA 3P5SA 1BJTA 2GZ2A 4JJAA 1TKAA 1UADA 4IDPA 2PR7A 4CT5A 2BRUA 1O1YA 3ZZMA 4YJ2A 4AJHA 3BK7A 3GEIA 3FE2A 1ENPA 1UBFA 3TLAA 1P9WA 4I1YA 1D8TA 1IMOA 1YASA 3PXEA 4OKIA 3BL6A 4AECA 1Z2PX 3CH7A 1JR2A 4ZO8A 2JJ2A 2RKBA 1DJLA 5KIAA 2I9KA 2GK4A 1XAHA 2QLMA 3WDMA 1WJGA 3D5TA 4RSGA 2E85A 3RVPA 1X1EA 2F8MA 5DNYB 2XMDA 1G291 1MKYA 4BLTA 1UZUA 2OGTA 2REOA 2VJMB 1OLOA 2QE6A 2XZPA 4INOA <