3S2SA

The crystal structure of pyrazinamidase/nicotinamidase from streptococcus mutans ua159
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
182
structure length
182
Chain Sequence
SKALISIDYTYDFVADDGKLTAGKPAQAISKAIAQVTQKAYDNGDYIFFTIDGHDEGDDFHPETKLFPPHNIKGTSGRDLYGALADFYQKHENDKRVFWMDKRHYSAFSGTDLDIRLRERRVDTVVLTGVLTDICVLHTAIDAYNLGYQIEVVQSAVASLSQENHQFALNHLQNVLGATIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pyrazinamidase/nicotinamidase
publication title Get phases from arsenic anomalous scattering: de novo SAD phasing of two protein structures crystallized in cacodylate buffer
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 72
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3s2sA00
3V8EA 2A67A 3OT4A 4L07A 1ILWA 3R77A 2FQ1A 4H17A 3O94A 2WT9A 1NF9A 3HB7A 3TG2A 1IM5A 3TB4A 3TXYA 3MCWA 2WTAA 2B34A 3UAOA 1YACA 3EEFA 3S2SA 3OQPA 4L08A 1XN4A 3KL2A 4WGFA 1NBAA 3O92A 3LQYA 3O90A 1YZVA 2H0RA 3O91A 3R2JA 3IRVA 3PL1A 4WH0A 1NF8A 3HU5A 1X9GA 1J2RA 3O93A
chains in the Genus database with same CATH superfamily
1R4ZA 1QE0A 5DK4A 1QP8A 2IYPA 3PNMA 1JJVA 1HTTA 2H31A 3LKVA 3P9XA 2PX5A 3QBDA 2DHQA 4MARA 5BN4B 1KQFA 2X42A 1M1NB 5J43A 3HTXA 4W63A 3VYVA 1AHIA 1N2ZA 1TM3E 4J1TA 2OPHA 1U63A 1PU2A 3LO8A 1NJ2A 1O5TA 5JHHB 5LZ5A 2K7ZA 3KLMX 4M46A 2MINB 4Q4HB 3HABA 4U63A 1XGKA 3LVQE 3N53A 3JU3A 4RETA 3E9NA 4UUAA 5JZMA 3ENQA 4MQUA 5FNVF 2WJHA 1N3YA 2AZTA 4GR9A 5IM4A 3LP6A 2AQKA 1DUSA 2EZ4A 2HRCA 2Y0PA 4PYMA 2QVGA 3GG2A 2EJBA 4AQ7A 1XZLA 3BXEA 3IDOA 4FT4A 2D8MA 1L5HA 3FUXA 2RH9B 3IP8A 4C2BA 5AIBA 1ILWA 2R65A 5BN1A 3QLVC 221PA 5DN9A 4WKGA 4PLVA 2CJYA 2IXGA 4LV5B 5AJUA 4QTYA 4F5WA 2ATCA 3RSHA 4B09A 3L7MA 4B5KA 4MVJG 2JFHA 3B6KA 3TRDA 1B8PA 1EVQA 3RD5A 3TTSA 3UOGA 4BLTA 2CKDA 1XTKA 4O2BF 2P7HA 1U3CA 3TZKA 3JS5A 4IL5A 4GSLA 1E69A 4HAXA 3LVBA 2DTEA 4R81A 1XMOB 4QQNA 1W5FA 1VFNA 2HQRA 5FA5A 2TMGA 4JKYA 2Q2VA 2VO1A 3UK1A 3D7NA 3DBLA 2NZYA 3HXTA 3B36A 4YALA 4YI3A 3ZV5A 3K70B 4PC7A 3A6EA 5ALJA 3IAAA 2BGRA 4U7WA 4F4CA 1F20A 5DGIA 4ZA2A 3N05A 3EVGA 1G17A 3IP6A 1UOOA 4JI1B 3V8RA 3ETNA 2GXAA 3AW8A 3AVVA 1QGYA 1RWXA 1UP4A 2B3DA 2CLEB 3UQZA 2AXQA 4K6GA 1EXDA 3B1VA 3CW9A 3K6RA 4EFLA 4I66A 1QH0A 2OCPA 4LBZA 1V16B 4CZ2A 1Q2XA 3HVIA 4NFSA 4COOA 5DSTA 2E4WA 3K94A 3UAXA 2ZSKA 4V0LA 5BW5A 3DA8A 3MXTA 2X1MA 3A1TA 3IQWA 3TEMA 2QMQA 3ANSA 1V71A 1D6MA 1RHKA 3KL2A 4AF8A 3VH1A 3STXA 1XA0A 2A5YB 1T3LA 1PFGA 4KDCA 2VDWB 5FO0A 1OXMA 4WNAA 1ML4A 1JG3A 2RAFA 2RKWA 4LBVA 4V0SA 5COBA 2GTPA 2ZM6B 1LVUA 2JLVA 1E4EA 5H3LA 1JZTA 1I33A 3X1ZA 1SXIA 1O0CA 1MKYA 5EERA 3UHOA 1YHYA 2C31A 2VHJA 3IE0A 4PTLA 4R2JA 5EWJA 3O84A 2B7BA 5LR6A 1JPUA 4OH1A 2G0TA 3UOWA 1CY0A 1CZHA 3M0EA 3RVKA 1MENA 3ZTWA 4QULA 4WY5A 2EGUA 3HKEA 3BKWA 1EVZA 4XWKA 3R7WA 3G3EA 2O7VA 4QU9A 3VHLB 2FEAA 3I4LA 3K15A 4ZAFA 4AKSA 3WL6A 1TGVA 2WD8A 3EBPA 2H1FA 3RTCA 1X1CA 3CG0A 1ZJWA 3BJMA 2PX3A 2NUAA 4URXR 3LRXA 4FLMA 2JKVA 1E6LA 4AXXA 1QFJA 1PT8A 4PN3A 3SVLA 3MMSA 4MYSA 5CB6A 1T1GA 4QZVA 2ZKIA 2ON6A 3EDRA 3IAS6 1WVGA 5IK2A 1MX3A 2UYHA 2RFLA 2R7KA 3DBHB 2Q1YA 1G18A 2WNSA 3JARA 2VJLA 3LTEA 4TL9A 4JFAA 3L84A 4NU8X 4HWGA 3V33A 3I76A 4AJ9A 1E63A 3WL4A 3ZY3A 4Q1BA 2ZI6A 2YZ7A 3PX2A 3I2FA 3E9ZA 1DJOA 1GUZA 4EVQA 2FR1A 5F1OA 1T2CA 3A6GA 3UFXA 3GJ6A 1YR7A 3HRIA 4MW2A 2A9FA 4QGFA 4Y2XA 4BE4A 3Q87B 3ZE0B 1JALA 1K27A 5LQAA 1NW6A 5GWXA 5DXJA 5ADUS 2D4HA 1OFTA 4FNGA 3IQDB 3PGA1 3RTGA 1UJNA 2DPXA 4K03A 3H4MA 4GYJA 4YRQA 3E3AA 1EPUA 2EP5A 5LYJF 3F47A 3ONNA 4AUMA 3BJEA 1VP3A 4BEBA 1T1JA 2APJA 3PPYA 3TLZA 5JOQA 4CM8A 3L40A 1LC0A 3L9XA 4AG6A 1U6KA 3W8NA 1DINA 2PGLA 2ODEA 2BMWA 3I6YA 1JAIA 1H2EA 3E3OA 3DKKA 3I6IA 3OIWA 4WECA 5K09A 1EAMA 3IELA 1FXWA 1RAHA 1XZKA 2V45A 3C24A 1UFRA 1Q16A 3OLWA 4H3VA 4F9EA 1PSZA 1VKRA 2FLKA 3KAPA 2RK6A 1M2FA 3ITKA 4JVLA 2D7JA 2NQ8A 3L46A 2BHLA 2OFFA 2FEWB 3B1WA 3FYCA 3IBCA 3LDUA 4RSMA 4FMDF 1T5TA 3KZCA 2G70A 1FSSA 1I2DA 1MZVA 2A4KA 3PENA 3WGNA 4YUXA 2P65A 1EUQA 1KZ4A 2D0PB 1EINA 2IXTA 4YGXB 5EJ9A 5K3OA 4EH1A 4ZTUB 1OWLA 3ID6C 5BPHA 1UQUA 10MHA 4Y9RA 2AFHE 2JEOA 5JUWA 1JEQA 1RJDA 3W8FA 3DDSA 4D02A 2LPMA 3E9MA 2NVOA 5KOIA 4R01A 4TKZA 2YDYA 5MF6A 2NP7A 4G36A 3EULA 3BJRA 1ZLXA 3E3NA 1GTSA 1NMSA 1SVSA 4I0WB 4REMA 5C5IA 2WZBA 4WTOA 5F73A 2YNMD 3TCKA 2OG1A 1L0BA 2R6DA 2YRXA 3BTVA 1FUKA 4JKOA 1YB7A 5CB8A 1A2QA 4MGYR 4S35A 2YYYA 4E2YA 1WCXA 4DIUA 2YFHA 3D6HA 1ZGHA 1V1MB 2G1PA 1RXIA 4S1OA 1MH1A 1Y5RA 1UXHA 1NLZA 3W1EA 1HV8A 4K9NA 5TF0A 4CV2A 2QX9A 4Q3KA 4I4TB 1K5GA 1Q7GA 4V3CA 4DG9A 4HNVA 3KC2A 2PSHA 1FU7A 2F3PA 3E23A 3RIXA 3J81A 3WZ2A 5AOCA 3VAYA 4N82A 4QLAA 3X3HA 2P1DA 4E2FA 2PD4A 4DARA 2ZRMA 1ULBA 1N0HA 1JG7A 2V4UA 4E5SA 3UNXA 1H1LB 1NL3A 1AZSC 1Z56C 2P3OA 3OPQA 1GGMA 4Q66C 3V8VA 1OB2A 1FBNA 4MUFA 3HYCA 1MB3A 2UVQA 2FPOA 1JVBA 4F92B 2ESRA 2I66A 3AWDA 1CUCA 3B70A 2C9OA 2WMDA 2C0PA 3VR5A 1GFSA 2RHHA 2AI3A 3B13B 2OV6A 3EVNA 4RY0A 5KYWB 4ZANA 3OOWA 2BUCA 3B9RA 3OKFA 1GKYA 2E49A 3BEOA 1I3LA 3M4YA 4IFTA 2ALJA 5CX4A 3PR2B 4UJ3A 4IHJB 3DUFA 3CTPA 2JJ8A 3VNRA 3HA7A 3FM9A 1YKGA 4ZAZA 4CMHA 4BLSA 4GG1A 3SE0A 4FUTA 3BXPA 2QUBA 4WACA 1BX1A 3UMYA 1F4VA 4DYHA 3LH5A 2D74A 2XQFA 1JU9A 4Q3NA 3S28A 1CUUA 3UB4A 2EFJA 4X66B 1AKWA 2B98A 2QL5A 5EQTA 1P0CA 4ARUA 1O7JA 5AUQA 1XLWA 5E9AA 3EHDA 3E82A 5AUOB 1NKSA 1V3QE 2PV7A 2Q0QA 2O2ZA 3VTKA 3EGVA 4QRDA 3KSUA 4PINA 3R7AA 3DFMA 1XNGA 1W7AA 3GQBB 3NRCA 5LA6A 1YRBA 2RC6A 4FGSA 5CDHA 3CCFA 4QM6A 3H1FA 4I9FA 1ORRA 4QJ3A 1SZJG 3HBAA 1RHQA 3G0DA 3CEPB 2YIDA 3TZLA 5K20A 4B3SB 4ZCPA 2NP6A 2IQ5A 1ZI6A 1IM8A 5DH9A 5KKCA 3PBKA 3A04A 3K4HA 3NH6A 1JXAA 3I9NA 2Q9BA 4U6NA 2WMOB 3COPA 4C7OB 5DKFA 2PFKA 5K01A 1HDEA 4OREX 4ESVA 1OAOC 2YJ3A 5AH0A 4W6QA 3BCSA 3UH1A 1JIQA 1N5DA 5AVQA 3OQVA 5JNLA 1MC1A 2PUAA 5DASA 4HFNA 4GVXA 4J9VA 2OQIA 4AT1A 3W8DA 4QICA 4PRYA 1J2TA 2O5RA 4L78A 3L02A 5DGDA 5TF4A 4KLZA 1CEYA 2E1RA 3ESXA 1Y82A 5CLFA 1F60A 3JSAA 3ZDCA 4R1OA 3MOSA 1KYWA 1Y8QB 1E2LA 1CX9B 4DPKA 2I4RA 2IDZA 2CGEA 4G4SO 2QQEA 3AIIA 2IELA 3FUCA 2YIVX 3BMOB 3GXBA 3W9SA 2NIPA 2PEZA 3G5TA 1PF7E 1KFBB 5ECDA 4ZT5A 5JHGB 3EIFA 2RHCA 2ZRFA 3KWMA 4B9EA 3HJFA 3F5QA 4Q1EA 4OB6A 4ZVTA 1L5KA 3SPXA 3UY4A 3R3ZA 2RHGB 4YJHA 3SX0A 1IE3A 1LK7A 2B1QA 3FPAA 4RPCA 3E48A 1VB3A 2PMFA 1Y3IA 3OFND 3GUUA 4J4BA 1RZ3A 1EM8B 4NCXA 4OJMX 4UBOA 1KMNA 3KOOA 3ROKA 1ISGA 2Z1NA 3EQ9A 4X44A 2Q6LA 1A9SA 4HLQB 5DHUA 3C3EA 1TLTA 3OM8A 3GJ3A 3NORA 2FW8A 2H9IA 3G68A 4M9XA 1M2VA 2MYNA 3ONEA 5L53A 2VP3A 3TGWA 3RIHA 5KHOC 4DUYB 3P0FA 1KU0A 3PQ7A 4HLUA 4J1QA 2M6KA 3MS4A 3WGTA 5IJ0A 2X2PA 2JFQA 5JG7A 3SOZA 2GXUA 5CA1F 1CZUA 2D5AA 4B76A 2VA8A 4X63A 2O20A 3I3SR 4NJEB 1GNSA 2JAXA 4UEQA 2ZIZA 4EZEA 2M6SA 2OOSA 3C5CA 4P6VF 5C8DA 4JQCA 4GWGA 1ZSVA 2HIGA 2J5RA 1Y1RA 1RCTE 4FYKA 1DOAA 5B3LA 5JI2E 3KYBA 1EFCA 1RT9A 1X2BA 2Q1UA 3HJBA 4D81A 2JPDA 1CB7A 5CXUA 3R3VA 3U3KA 1JH8A 1UOPA 1W44A 4ZMRA 3EVAA 3SZRA 1XPRA 1HLPA 4F3RA 4XM1A 5CXSA 1U0FA 5DLEA 5KYXB 2FE4A 2H1RA 1D3AA 5DW3A 5K1ZA 3ENNA 1XCPA 1JYSA 1PZNA 1ZPDA 3B12A 3FF4A 3H8JA 4WLVA 4YV0A 1WF3A 1AC5A 5DT2A 4DDKA 2AK2A 2OMKA 2BYTA 2Z4SA 2QSUA 4YRAA 3E35A 2QX8A 4C1NA 3IH5A 5ABPA 1YO6A 2DR3A 4RNDB 3U49A 5CB4F 3BEDA 3QTTA 4R1MA 4MQEB 5BQFA 2HXYA 3SQMA 2IT1A 3T5GA 4GXQA 1JR3D 4Q4JB 1Z5WA 1U3WA 1J9ZA 4BQRA 1QNFA 1HE8B 1MOPA 3V4VB 1RIFA 3MQ4A 3R23A 2RHMA 5ALKA 1E0SA 4RHXA 4JLUA 1KI6B 1O94A 1QIEA 1UK7A 4RW0A 4ZVRA 1JIUA 3WQSB 2EWMA 4XD2A 5BRNA 1POWA 3EDOA 2W6ID 4PO9A 3ZE9A 5BSHA 1DELA 4PHHA 1RQRA 2I6GA 2OGWA 1PT5A 1QH9A 3EH1A 4HUJA 4KJZA 3MWDA 1U2RA 2CSUA 1Q7EA 3QXSA 2QLFA 4CGYA 2BGTA 4LOLA 4FYVA 3SYMA 4ESOA 4ALMA 4WZZA 1KK2A 1C9MA 3IIKA 1H4QA 1YMQA 1K4YA 1XYVA 4DSNA 1JE0A 3E4DA 3GRRA 1T1IA 1T5IA 5B2FA 4HQ6A 4BNZA 2VJYA 2AJLI 4W9NA 4MUHA 2YHSA 1QVRA 2BFPA 3AIMA 5FORA 2AVNA 2J33A 1RYZA 2ZWVA 3KNZA 5FBWB 1KIMA 1E3JA 5LWHA 3H9CA 3HGMA 4FC7A 2ZT7A 1GZVA 1D09A 2CYCA 4GR4A 1C2YA 1RZVA 2QTVA 3TX2A 4CF7A 1EWKA 4OSOA 1WEHA 2V6GA 3HXKA 4R5MA 5JY1A 2KMLA 5AJZA 1C8KA 4A8TA 3NO4A 4IDFA 3CXRA 4AXBA 4BNTA 3MERA 4MEJA 1K0FA 1KRXA 4LECA 2ZJFA 3EH2A 4S0ZA 2OHVA 3CVVA 4WA7A 4DDWA 1J49A 1O58A 3GW8A 3L7CA 4GH5A 4DABA 5CA1B 4RTMA 1QP7A 2NVBA 4JC0A 1K68A 2PH5A 3OFKA 3Q7RA 4Q03A 3RVSA 3UGKA 3W7BA 2H18A 4DY4A 1NW4A 4PZAA 3ZEAA 4IEEA 1RQGA 5FCDA 2VTKA 4MINA 5KI6A 1TF7A 1Z4KA 1P73A 4R51A 1K4KA 4S1VA 4NCJA 4BTEA 5JNRA 3THXA 3RKSA 4HQOA 4ZYVA 1Z2OX 4MW9A 1Z8HA 3B1JA 4ZPXA 1YONA 1IHUA 1K7YA 4UQOA 5E6UB 3G85A 1D4AA 2H1VA 2XECA 2QX6A 4N47A 3DP9A 1OREA 5DNVA 3SKYA 4B9AA 2VJMA 3MWEB 3OZVA 4V0MA 3IPAA 2CDRA 1O57A 1R9GA 3KPJA 1I2ZA 1QRAA 3TK1A 2CLCX 5JS7A 1KQ3A 3NWEA 1GTMA 4X97A 3G2PA 4PPGA 3IEXA 4P54A 3WLMA 5L4LA 1Z12A 1Z5OA 3UXYA 3OT5A 1JDNA 2WWFA 1GNVA 1FBTA 4LI3X 5COAA 2CYBA 1HQDA 1MJGA 2QTZA 2JIMA 3IEPA 1JMVA 2QROA 4WZAB 3CCCA 4KPEC 1DDIA 1WUHS 2CXRA 3LNTA 3THWB 1A9ZA 4U2DA 1PFVA 1SXJD 2UYOA 2R1VB 3OM1A 5KVAA 4HRXA 2F3UA 7MDHA 2EGHA 8ATCA 1TFRA 3KQQA 3ZPXA 2PZ8A 2ENWA 4L72A 3TQOA 2QVCA 1COZA 3VZRA 2C1EA 3K73O 2YBDA 4H6PA 4KPFC 2G9NA 2XWPA 2QJTA 3QY9A 4QXOA 3ZKWA 3TTTA 2HHCA 2LVBA 2YTZA 3B5IA 1CNMA 1MQ9A 1BVUA 1M33A 2B2XA 2BM0A 4FEEA 4I14A 4P34A 4PYOA 3GB9A 4PGGA 1KQOA 3WK4A 1RYYA 4FLEA 1JXQA 4BN4A 4BFVA 3G5AA 1YOBA 3GAFA 1USKA 1N32B 4YRMA 3RF7A 3TTVA 3ZU3A 1VYTA 3AOEA 3G8AA 2QMHA 3TJMA 5MN4A 3GT7A 3EMKA 1NNUA 1JT9A 3RAGA 1CB0A 5DHTA 2Q8QA 5FF9A 1SU4A 1XDGA 4C4OA 4EJSA 4EY3A 4A91A 3ABQB 1XX6A 1XMIA 4TTSA 4AWAA 2E85A 1A7AA 5KX5A 4EFMA 3FNRA 1JHOA 5IWAB 4RULA 3H7AA 3MUEA 5D1NA 3D4PA 2FG6C 1S9HA 1RJFA 1GOTA 3KDAA 4CDRA 1PJAA 2W5UA 4LYAA 2G28A 3KUKA 1AB5A 3DOHA 1YACA 1HT0A 4JSRA 5EPOA 3WIDA 2XMBA 3I05A 4GECA 4DQUA 4IV0A 5K3SA 4GMFA 3U7JA 3LQYA 1CY1A 5DCLA 1CTQA 4WXYB 2XUOA 5F7JA 4BMYA 3OURA 3QELA 2DLDA 5TMDA 4ID3A 2D3TA 1SBTA 1T4DA 4YJFB 3O8QA 3Q10A 2BRUA 3H3XA 2I7XA 5HXAA 3WNBA 3C1TA 3PDCA 4H59A 1Q7TA 1N2CB 2V0NA 3SYKA 2PBZA 4BB0A 4Y0VA 2XKBA 2P1RA 3HHEA 2Q5JA 4OAPA 5GZ3A 1AGXA 2UXBB 1KI7A 1XRJA 3H2HA 4LWPA 3RIEA 3NYRA 4DSOA 5IEJA 4EUNA 4KIWA 1D6SA 1QC5A 1DEXA 4Y2TA 1NV9A 2PYDA 3OU6A 1MC4A 1RDFA 2BZ1A 3P45A 4YECA 4XLLA 4QOIA 3KQTA 2VZLA 5IYZA 4ES6A 4YRJA 4FW9A 4AJPA 2XLBA 3W5SA 1E2DA 1OZAA 2VC2B 4WJKB 5U1PA 3W34A 3NETA 1ZESA 4HNAA 5KYNA 3MRTA 4L28A 4RX1A 3D9QX 2GM3A 1OT3A 5A6VA 4MUGA 5FWYB 4Q1FA 4ZCIA 2BDEA 5BMVA 5IDXA 4OJNA 4MUEA 2JAWA 3U7QA 1FA9A 1Z7EA 4I4IA 4XPIB 1RFGE 4JKIA 1ZWLA 2I7VA 5FNVB 3QWIA 3ACDA 4MCAA 3V4SA 2VDMB 4CM1A 2GN8A 3D5EA 4HGNA 3FZYA 4CM5A 4DRZA 5A0VA 4ENQA 2YVQA 1N0IA 3I9LA 3LCMA 4KXVA 1QOPB 3JD0A 1ZMRA 3QEBZ 1DMSA 2I6QA 3EXG1 4JLBA 5DVZA 1J70A 3T7AA 4MMXB 4Q0MA 2O8EA 2AW3A 4CDGA 1DWUA 2BVNA 1NVUQ 2DFPA 2H1IA 2QORA 5DYWA 5LD2C 4TRMA 3LWDA 3EX7C 4G23A 4G5YA 4K87A 4KXFB 2WIGA 5F1KA 2J31A 1QIMA 3ZCRA 4DANA 1RC1A 4O2BB 1CEXA 1E6KA 1PJLA 3WSTA 1SOUA 3OTWA 3QU7A 2FOLA 4A0FA 4DIFA 1CF4A 2ZSHA 1KY2A 3IHWA 1T5OA 4D8WA 2NAPA 1AQLA 1E1RA 1VJGA 3IVRA 4RGBA 1MT3A 1T3TA 5AJWA 4NMXB 1P1FA 3LXUX 3T9DA 3X1YA 1MN6A 1MOQA 1Y8RB 3GJZA 1T4CA 1A69A 1IM5A 3HYSA 3WLIA 4PNHA 2XCTB 5KWEA 2CXOA 2HBQA 1BEZA 3C1UA 2J07A 3A11A 1KBZA 3C41J 4R8VA 2VPPA 1AGRA 1GRQA 3HR8A 1EBUA 2P40A 4GO1A 2FMHA 2YZ2A 4L0CA 1FP4B 4PHCA 4CNQA 5I47A 4WXEA 4TS3A 4L08A 2JK0A 1J0CA 2GYVA 4DAOA 2EJVA 4Q16A 5CXXA 4RU1A 3NTVA 1BOFA 2EFCB 1PS0A 4N9WA 1AA9A 2OFPA 3L7IA 1CQWA 1T2UA 3FMOB 4MV5A 4PYNA 2BC9A 3OIVA 3HCRA 4BUJA 1BWQA 1C0KA 2A30A 2RHOA 3CPEA 5DOVA 3S55A 3TLGB 1TPZA 3ZX4A 4BVLA 4JBXA 3K16A 3P94A 3OFVA 1BWPA 2F90A 3L4SO 4M37A 1MG0A 1V1RA 1OLUA 2HDWA 3WNVA 2QRKA 1YULA 1BWRA 2ZSIA 2P1ZA 4KQ9A 4BGDA 1M7BA 4Y9TA 1ETUA 1T2NA 2D5LA 2ZJ3A 4IIGA 3WMFA 1WCYA 4PQFA 5C7IO 1C9NA 1J39A 4B80A 4W4TA 3EZ7A 4P4GA 3T7SA 4DT1A 1L4BA 3RSLA 1T3SA 5JNSA 1JP7A 1SKBA 4GGOA 4N40A 4WAUA 4ZQFA 4BKOA 3R6LA 2ZROA 3TLXA 1JAHA 1PJQA 4QSMA 2OCLA 4QOFA 4MB6A 5JS2A 5BV8A 5BRJA 1IG0A 4ZQGA 3QLTA 2ORWA 4ZCSA 4G0OA 2BEUA 1DWOA 1ZKDA 1CNFA 5TE9A 5EJIA 2DUUA 2R66A 3GLGA 1O9GA 1QE3A 2QZPA 5H59A 3HXOA 1UOEA 1GSIA 4IICA 1C9DB 4DUGA 1MA3A 2X6QA 1PJ3A 3AUSA 3U37A 1OFVA 4JQZA 3AVUA 3KFVA 2GM4A 1NDUA 4CT0A 3FG9A 1F17A 1R6DA 5HILA 3UHAA 3ZLVA 2FMXA 4F86A 3VA7A 2P8JA 5B3JA 1QDEA 4OK3A 2Q4BA 2WWHA 3IT0A 3DV9A 3PUKA 6REQB 4TWZA 2O2YA 2A59A 4ILEA 5FLEX 1L1FA 3TQHA 3NWOA 4IHKA 1CUHA 4NEQA 1EDBA 3C6YA 3FNIA 3RJ5A 2VWGA 2HHAA 1HEYA 2ZVQX 3W4IA 2RHBA 4C14A 1PEYA 5JJBA 2PKWA 2PPVA 1WCV1 3HDHA 4P5PA 4ALJA 2AX3A 3A26A 2QTTA 1NMZA 1T5SA 2ZBGA 3D54D 4GI7A 4JJ8A 4NMMA 4QPDA 2PUVA 5AM1A 1PYOA 2P5TB 1QTNA 3UB2A 3WBFA 4AKEA 5LYJB 4A1FA 2WB2A 4H3SA 5FO1A 3P0JA 2R48A 3EPLA 3WKCA 1NXVA 2YHIB 2MMCA 4WN9A 3K1TA 1Z5ZA 2AYZA 2XVZA 3A05A 4PLYA 1ZR2A 4LJ9A 1E2EA 2FZWA 5B1DA 3UM9A 2BZGA 3I32A 4MUNA 5JPIA 1QANA 5HCIA 1CZRA 1C9EA 3AHDA 2UUBB 1BDIA 2NYRA 3QSGA 1FQOA 5ENDA 3EODA 1RMYA 3FMGA 4IIYA 3WMXA 4ZAGA 5C53B 1GTJ1 3Q3VA 1H6BA 1PJBA 1TK9A 3EPPA 1T9AA 1GILA 2BDUA 1XFDA 3BH6A 3IIEA 1MORA 3ANLA 2NO9A 3LBFA 4FMDB 5M2QA 1ZJYA 1LY1A 1AF4A 2C7VA 4NYMR 1JBKA 4D2IA 4F5ZA 4DC9A 5FV7A 5DSZA 2X0NA 4ODIA 2CNWA 3ZW9A 2PNJA 2CLSA 3GLFE 1HRKA 4E32A 5AD1A 1N92A 4LMPA 4R7TA 1RRCA 4GVLA 3I9FA 2FPGB 4LHVA 1ORDA 5EEGA 1MP0A 4LTDA 1U8EA 2BHSA 4QC2A 3KQNA 1C3EA 2C54A 4EUKA 1H0KA 3FDJA 4H1UA 2OLJA 4BZPA 5M3BA 5C2JB 4W1RA 4DWWA 4EDFA 1HA3A 4DCJA 2JLYA 4G25A 1PJCA 4ON9A 3QHQA 4ZU3A 3QHPA 4OF4A 2I76A 1GAWA 2AF3C 3MTQA 4NMHA 5AI8A 5K45A 3BMXA 4CG1A 3JQPA 9GPBA 5AJYA 1D4OA 2G17A 2IEZA 1F8GA 3G0GA 3BD7A 4KLAA 4RK4A 5CYOA 1PQUA 4H1VA 1BSVA 1T0BA 2R8OA 3W9YA 1WM1A 4C5CA 1WZ2A 4HR7A 5DHPA 1U11A 3O4GA 3V4RA 1ONBA 2XB4A 3VGJA 1K9VF 1RAFA 3DTYA 4KZPA 3N28A 4N0DA 5EPUA 5JSHA 1XPJA 3OLVA 4LSGA 4YMSA 4AMBA 3O2NA 4Y2PA 5JSZB 1OFHA 4X5OA 3WR5A 3QKRB 4GPZA 4KR9A 4DNXA 3FR7A 4HX5A 5HUQA 3DLHA 2PGXA 3B5JA 5KYUA 4O4HA 3IUYA 5HRUA 1J22A 1TEXA 1Q0PA 4INZA 4DB4A 4HUQB 1RKBA 1E64A 1R15A 3LDFA 4GBED 4HRYA 2X5NA 1RKQA 1STOA 5KTRA 2O2JA 3JQBA 1WUIS 3HY4A 4J94A 3FE2A 4KI7A 5JPDA 1VJTA 3OZDA 2VAMA 5FPYA 3K9BA 1YOVB 4RJJA 5LP1A 4G0YA 3VO1A 1DBQA 1SB8A 5F5NA 2EL7A 1OW3B 3WFIA 5KTSA 2IUYA 4V39A 4LRSB 1JFVA 1W5BA 3ELUA 3T7KA 3ZCVA 3JQ9A 2JH9A 4ARZA 1XQ1A 4JCCA 1HOTA 1X7GA 3FI0A 4LJ4A 3R7LA 4ASUA 4YPOA 4CTJA 1LWNA 5BWCA 1DEAA 2QG6A 3BCUA 4XQ9A 1UH5A 1WQ4A 2EW2A 4H4DA 4G1FA 5AK0A 1T15A 4CTMA 3OFJA 3T3HA 3LUCA 5A5GA 1ORTA 4R3WA 3TB6A 1PJ4A 4CIWA 2J5QA 2WYOA 5IDYA 3FX2A 3K3PA 4D99A 1ZUD1 621PA 2ZXFA 1EUYA 4ADSG 4BPRA 3TOZA 4MDFA 3TR5A 3V32A 3GUYA 4K6KA 4E1VA 1T36B 1LPPA 2ZRKA 5FHRA 3EWNA 4EYSA 4R5HA 5C81A 5HZKA 2GCEA 1CQIA 3MUOA 4D1YA 1CP3A 3PWZA 3DBRB 2A3NA 3OIDA 4RLSA 9ABPA 1ZH6A 2AC7A 5IU6A 1SKYE 2AOUB 3WQRA 3DV0A 4JVSB 1TO6A 5K0FA 5FQNA 1B0ZA 4YT2A 3GHYA 2XUAA 3MT7A 2H0RA 1WETA 1GKUB 1M8JA 1B2LA 4B8YA 2NUPB 3OIYA 3IRVA 1G5PA 1O94D 4N76A 2PAFA 1N77A 3UHPA 5P8WA 5JDIA 4IQ4A 4W9MC 4XTCS 1CV2A 5I7SA 2IYAA 3B2EA 4WQMA 3BAFA 1WCWA 2PGDA 1IN1A 4WLUA 3ZH2A 3OKPA 3CJTA 3O31A 1EFAA 3JQAB 1IZZA 2IWHA 1XZPA 1LV8A 3BG5A 1OX4B 2R00C 1E2HA 4EHNA 1XNJA 1ZCAA 1EESA 5HIIA 2BGNA 1MHTA 1KP3A 1JKJA 2HF2A 4RTSA 4IJ5A 3U0VA 3UATA 4D6XA 1K92A 1JZQA 3OEED 3CTMA 1L7BA 2GHRA 2X8JA 3BWXA 4OMFG 1AX9A 4YO7A 4BNNA 4MWDA 4V1CB 3VVLA 1B15A 1GKKA 2XX3A 3ITDA 1IZ7A 3N2EA 4TMYA 3MGCA 1ORWA 4Q19A 2FZ5A 3IUBA 3PDUA 5FBHA 5IDQA 3ZYCA 1HNXB 2YXPX 3AEXA 4X1KB 3D7RA 3AO0B 2B83A 3MTGA 3NEPX 4I3GA 3R5TA 3SS9X 1R66A 3WB1A 1RPTA 3OT1A 4CVNA 5EHGA 5IBCA 1QRUA 4CKWA 1J8MF 3H17A 2N0SA 2VPYA 1IVYA 4EJ0A 5JMWA 1FZTA 4YTEA 2YWHA 3D4OA 3NIFB 5HKOA 1JA0A 3KZNA 1N9GB 4A2QA 3UCEA 2RCNA 4LI0A 1LCIA 5KJEA 1B42A 2DTDA 3F6YA 5L9AA 1R8XA 1PV1A 2GTHA 3L6OO 1UUFA 3ML1A 1W1IA 1ZOPA 1RYMA 3IEKA 1WKCA 3JAMA 4TYYA 1AG9A 3SF8A 1PRYA 3EIUA 3GEMA 4XIYA 3MBIA 5K0NA 3PRKE 1QK4A 5IJ9A 1TCAA 3CNOA 1JB9A 1W5SA 5ITZB 3E22A 3ITEA 1CUJA 1U9CA 1E9VA 2ID8A 1ZGBA 3MRXA 3QIAA 4PAWA 4IDDA 3UGQA 3NOVA 3D5QA 3KWLA 3QWAA 3A3NA 5HKKA 4DMRA 2QAGC 4NZPA 4UQPA 3U3DA 1HDZA 1D4FA 1MGPA 2WM9B 3QZUA 4QJBA 2XAAA 5AI4A 1OX5A 1XO1A 4B33A 4B7AA 2QVZX 5JALA 2HW8A 1WHSB 5EJMA 2I65A 1U0GA 2JDID 1PNRA 1X8XA 2QD2A 1CE8B 3G9QA 3IBYA 2FUEA 3IURA 2QSJA 4C3VA 2ZTVA 1KARA 4DUPA 3LSYA 4IOLA 4JJGA 2C2ZA 2ID4A 5B36A 1BU8A 3SLGA 1GGHA 2D5IA 2W6QA 4MEAA 1TNDA 4OHZA 5HZGA 9LDBA 4NJMA 4AJKA 2CZCA 1K5DA 3N75A 4JLNA 1JDTA 3E2IA 4MWOA 5NULA 1NX6A 2VJBA 3KPYA 2LE0A 4IMJB 4DNOA 1L4LA 3Q0EA 1UBOS 2YWJA 4X1YB 4D98A 1EM6A 4F4HA 2IHZA 2ZJ0A 6NULA 4OQNA 3B53X 5CBPA 3LA6A 2EKQA 5J4LA 2R6FA 1ENOA 3REQB 5B12A 1FJXA 1E59A 1NJ1A 2REBA 3LBIA 1V5IA 2XCIA 2FSVA 1U2EA 3EG9A 3AERA 4WXHA 4JYAB 3F6CA 1ZVMA 1Z3CA 3CC8A 2CVHA 3SEZA 1T0HB 4CUKA 4P4TA 3P9PA 5B3KA 1L7DA 3A7EA 3T54A 3TLAA 2PMCA 4F2GA 1P8JA 4Z7OB 2GJ9A 4A0RA 1MAAA 4BFTA 3H2BA 5TQ2B 1TOAA 1HI9A 1TJYA 4NYIQ 4K1XA 4UU8A 3GOHA 4PTYA 5EZYF 1RWVA 2BTQB 5CITA 5JZOA 2IZ6A 2W8ZA 2G4VA 4B73A 1Y4SA 1LX6A 3ZWPA 3BREA 2JH3A 3OZIA 5BW8A 5CCXA 3NIWA 1JX6A 5IRCD 4X54A 2YMLA 2IYXA 2EKBA 2FZ4A 4ZQBA 4KUHA 4LJYA 1R5OA 4F91B 3ON5A 4A4DA 2OBLA 4EBFA 2VXCA 2JZCA 2HK6A 3IJEB 2DFNA 2DYKA 1XALA 5CLIA 3RLIA 2QN7A 2FJUA 3THYA 1ZVJA 2WF8A 1X38A 3O91A 3JXEA 5GZ1A 4H1HA 1XZGA 3FOZA 2NVUA 1M1YB 4JQOA 3RDPA 1E2BA 2F7SA 4JD5A 3IPRA 4LZAA 4PZDA 3V46A 1DBRA 2BL4A 1S2GA 2XSZA 2Y3IA 1R6XA 1C4KA 3IBSA 4NCKA 3K1YA 1WQ3A 5ANRB 4IIVA 4M98A 4B0PA 4KOEC 2FXIA 5ES3A 1EJ6A 3HHPA 4HDRB 4QDXA 2NZUG 3ZGYA 3P8ZA 3JPWA 4D0SA 5JD5A 5CW2A 4U3JB 1SHTX 3G0OA 2ZITA 1OXVA 3TDNA 4EEXA 1FNSA 3M89A 4N7BA 4QO8A 1JMKC 1ZITA 3SR4A 4HMPA 4PV7A 4N5LA 1ZW1A 1TYZA 3OEHA 4G8BA 4Q01A 5HA5A 3VH2A 4BNGA 3AOGA 2YFQA 1KO1A 5FADA 1N5OX 2IEBA 4BCCA 1DHRA 2IHKA 3LXXA 1OA0A 4KBGA 4RFLA 3TNYA 2IW3A 4J07A 1EVKA 1U94A 5HQTA 5CJJA 2X1LA 3LOUA 4NFYA 4TXHA 4YQZA 1VHDA 4YJGB 2W2PA 4LHEA 3GA5A 1I4EB 2OTCA 2UZ3A 4YGYA 1SUDA 3RYIB 4BKMA 2XNKA 2COKA 1IH8A 3F6BX 3GLHE 3H4TA 2PHZA 4ITRC 2VEDA 1QMPA 4UOZA 1XP8A 5ICMA 4BMZA 2BGJA 1Y8AA 1UADA 3B8HA 1T9DA 3NBXX 4QDTA 4HYEA 1SURA 4HRAA 3RVMA 2BW0A 3FJ1A 1SEPA 1MB4A 3D2AA 2C4VA 3GU3A 1NY5A 1UAAA 1D4ZA 3Q7PA 1TJ4A 1VHWA 3SYRA 1YQUA 4JXXA 2W2XA 4BQNA 2OVBA 2OXRA 4GPBA 1II9A 1URPA 2WFLB 4JASB 4YXFA 3QYJA 4WLEA 4R1TA 2H59A 3L06A 4LKRA 3TCXB 3UKJA 3HL4A 2VSXA 1KYZA 1ZISA 4GW3A 3LY8A 1J1IA 2OO3A 4HB0A 1E1RD 1UDWA 1L5RA 3DAPA 3EEYA 1CBUA 3BSYA 3SWWA 4MQFB 3QPWA 1ZR4A 2IYOA 1QH8A 3ELBA 5I48A 2O2XA 1V11A 2C00A 2EYUA 1ATIA 3B78A 1FYXA 2R1TB 4OUDB 4A15A 5BW4A 5JANA 1N7IA 1ORVA 3FFBA 1D0SA 1SNYA 3F7NA 3KJIA 1N1DA 3FWPA 4LNUA 1EFRA 3FLAA 1XXHA 1K4MA 2FLWA 3FLMA 3I0NA 3KUCA 3OCCA 4MLZA 2DJIA 2Q3BA 5CTAA 4URZR 3R40A 4FT2A 4E14A 4LGMA 3FTNA 2DX7A 1A98A 5TGZA 3QEAZ 4KQFA 1EFPA 4NULA 2GETA 1J2RA 2BFMA 2H06A 4LTMA 5DULA 4NCHA 5EXSA 1CRWG 4R83A 3C3WA 5CX1B 5SY9A 4DLLA 2V98A 1LU9A 4ATNA 1PVDA 4EJMA 3VX3A 1PP4A 1XV5A 3DLIA 1Y8CA 2Z2KA 1I7LA 4LQ4A 2DWUA 3MUFA 4TMTA 5EIHA 5FX2A 4EG0A 2O1WA 2OQVA 3ACCA 1U8TA 1XWIA 3FYDA 3ZE6A 3UBMA 4KITB 3AH8A 1MVLA 4EPYA 4QFBA 2PY6A 1EVYA 1KKMA 2LP4Y 3GFOA 5DGXA 5DSXA 1IZYA 1I30A 1P9WA 3RKUA 4QFMA 2C9ZA 2CVFA 3GLHA 3FHJA 1EZZA 3K8QA 1MQ8B 3RFUA 5TGDA 3FCUB 2RAUA 3ILYA 4OJKA 3WGKA 2HZBA 3UTCA 1PSDA 1QIJA 1OBVA 4MGKR 2J0UA 3RU7A 4KZKA 4C21A 4J03A 4CQMA 4YJ2A 3VPFA 1E9FA 3EASA 3G13A 1LPOA 2JBAB 4DVGA 5HJEA 4D4JA 2OC4A 2IH2A 2HRQA 2Q7XA 2A14A 1ECGA 4DUGD 1RQ2A 2QZ9A 3WI7A 4KDEA 1ACMA 2D0IA 4JYBA 4LXTA 5LQKA 3ICEA 4AIRA 2GEVA 3PUYA 4MQ4A 5BVGA 3DW1X 1WABA 2JGKA 2AE1A 2H16A 4F3CA 1OV4A 2YZMA 3F4LA 1ZDMA 4V38A 1LZKA 3F5DA 3OHMA 3QFHA 1TAGA 2JH8A 1ZCJA 3VZPA 2G0AA 2CV1A 2ZSUA 1LLDA 2G5PA 4IRXA 4REQB 2OWDA 2Q49A 1CNEA 3C3BA 3IBTA 3I9JA 3UANA 4BJ5A 5JCOC 1IXKA 1L5OA 4DQXA 3IKMB 4TKUB 1X1DA 3LGSA 3D8SA 3D3WA 1E3DA 2AOVA 4EECA 2Q5OA 1VOTA 5L4NA 1Z6GA 3RREA 3NT5A 5BSKA 4FHZA 2SKCA 1VJRA 2EX4A 2QBYB 2VYFA 2CJWB 3DNPA 3SJAA 1WDWB 3ND8A 5BN4A 2LGJA 4G4JA 3RFTA 3P5SA 2ZR8A 1M1NA 1R0YA 1VCNA 3WRWA 2QMZA 1MV5A 3DOFA 5BR4A 4G0MA 5ADHA 1G64A 1P2GA 3FPBA 1T26A 2OWEA 1RU3A 3KQWA 1E3TA 3ABRB 2MINA 3OC6A 4Q4HA 4YPVA 2XKKA 3DCNA 1OILA 3C0KA 3ZC3A 3OTOB 4RIHA 4R1UA 1HZZA 1O03A 2WJZB 3FDFA 3IAXA 4Z0HO 5K8TA 1W76A 2Q3EA 3BQ9A 3MFQA 1SC1A 3R3UA 4WCVA 1N6PA 3I12A 3VU9B 1OSNA 1U6JA 1VJ5A 5C9ZA 4MLCA 5EI5A 4RM2A 4U8HA 3ANMA 4MW7A 1FPQA 1U9JA 3FW1A 5FDFA 2CNWD 1PYDA 2AEJA 2IU0A 3WLPA 3HO1A 2E4XA 1ZCBA 1CUBA 1W19A 4GYKA 2Z0MA 4Z53A 3D43A 1W2GA 3DMTA 2NZ8A 2WHXA 3K9WA 1ELOA 1YZUA 1QGDA 2WEKA 2JBWA 2NT3A 3ZOZA 4BUZA 3PGJA 4J0EA 4AMVA 4EVSA 2C2YA 4MX8A 4XRRA 1P77A 1USIA 2O2EA 2XUZA 4UQLA 5T6BA 1IXSB 1HKUA 1E7WA 4J29A 1IC6A 5A5EA 1K5PA 5TT0A 2ZZMA 5LB4A 1HDCA 4UVIA 4U00A 1ABFA 1XZJA 2ECFA 1J4AA 4FFRA 3SJUA 5BMOA 1S96A 3PPXA 1WB5A 1JDPA 4RVCA 4QIHA 4W8GA 4QNRA 1ZICA 3ZZMA 3IQIX 3EN0A 1UBJS 1WOYA 1IWBB 3I53A 4LXYA 3L05A 1EU1A 2E55A 1V16A 1SCKA 3I2KA 4G6ZA 3ETDA 5KDDA 3CEAA 1YU6A 3KQYA 5B64A 2F8LA 1GA6A 4UVGA 4YQYA 1QR6A 1MC8A 4N7JA 3GH3A 2GF0A 1ZJ5A 1E6CA 4B47A 1QH1B 3PEEA 2J59A 2YVLA 1SVWA 2VDWA 4FN4A 4RF5A 5JXJA 1P61B 2PH3A 3B9PA 3SS7X 4QG3A 1SRRA 4AZVA 1H3EA 3NDBB 1EE1A 3NAQA 4IAOA 2E37A 3ULKA 4BQFA 4W1PA 3L4KA 4UD6A 5EINA 1ZOIA 3QLVA 3SGLA 3UAOA 5CPBA 4Z4QA 3RIYA 1L4NA 1LDYA 1Q7CA 4AM8A 3JWHA 1KAOA 3QLUC 4G4IA 3LS2A 1E99A 4WDRA 3AZQA 3S5UA 4D26A 2BUBA 2G9RA 4G4SP 3RAJA 3W5BA 1BS9A 3UV3A 4C7VA 2RBEA 2ZRNA 1G0NA 3QI2A 1K98A 1UBMS 3C7AA 3E9EA 4AY6A 3PHLA 3RBAA 5LMNB 2CY0A 1R8YA 3P71T 1R4NB 1WPGA 1VSBA 2XNDA 3G17A 4X64B 1U5AA 1QTRA 2H92A 5LOVF 3FMVA 2TSYB 4JV5B 1C0IA 5A04A 3DBHA 3GEDA 4DLUA 4MI3A 4AS2A 3H6HA 1EGMB 1CVLA 1GPKA 1H2AS 5IFKA 1G20E 3GUHA 1QKIA 3DDHA 3HBMA 1D1SA 3IR6A 3WYNA 4LGVA 3RABA 2B4QA 4WOBA 2EF1A 1XROA 5FJJA 5CA0F 4C29A 1DJPA 4HX9A 3PUXA 4GZ3A 2X86A 3O8CA 2DRIA 3AV3A 4ZZ1A 4M88A 4IHAA 4BKPA 1Z6PA 3ZY2A 2WOJA 4INJA 2NW6A 4MRNA 2HMYB 1UMDB 3U80A 3GC6A 4ZDJA 1H4VB 4Q1VA 1TJ5A 3LLCA 7GPBA 1ZJ6A 2HDOA 3W04A 3A3PA 4TYQA 1NWHA 3TLYA 4EITA 5A3RA 2OP0A 2ODAA 1MRNA 4QQFA 2IXDA 2COEA 5M29A 4H3KB 4R4JA 4U39A 1MGOA 3A2NA 4K6MA 3WY9A 1I3CA 2CFIA 1T8SA 2E4ZA 2IOQA 3OPMA 4FHGA 4I1RA 5ETJA 2FMKA 1BKYA 4NLLA 1F8YA 2RAVA 4FCTA 4HEJA 4LFBB 3R7NA 4GWKA 5ITWA 4B84A 1MUUA 1MTZA 2BFCB 1VPWA 1RFLA 1QV6A 2C5EA 3JZFA 1PFYA 1EJBA 5JWRA 4WIAA 3EZFA 1Z7GA 3DBOB 4CL2A 4B6QA 1MTOA 2VL7A 4BNDB 1P6UA 2O3QA 5EIWA 3W5HA 3GT4A 2HGSA 3IPCA 5SYNA 3W2HA 1DKLA 3E2PA 4INAA 1Z8NA 2C61A 2GVNA 5C3MA 2DPMA 3GGSA 1V8FA 2XUQA 4P3YA 5EUMA 3WQQA 3JAKB 3HEBA 1OH5A 1AV6A 3OJOA 1FY2A 5GV8A 5ILGA 3P9NA 2CLHB 1Z4MA 1MO6A 4XM2A 1R6TA 1XVLA 3QP9A 4WSOA 5LD2B 4PZ0A 1N2IA 2MSLA 5F33A 4DF3A 3JW8A 3FMPB 4RK6A 1G7SA 2ATEA 2C03A 2HJWA 3QVOA 5A1TA 1Q22A 3ZVRA 3AL0C 3HS3A 4BNUA 1YFLA 4IWNA 5E2BA 3VJLA 1DJMA 4HB4A 1GV0A 2JLAA 2WAAA 1Z8DA 1C9KA 3GPBA 4KVZA 5HKKD 2L18A 3R7DA 4ZCMA 1UKEA 2D2EA 4K1LA 2WFAA 1RQNA 2YY6A 4IFBA 3T0FA 6GPBA 1R10A 1V1MA 2XQJA 3IDZA 1TF5A 4HBGA 3ZWMA 3RF6A 3ZCSA 3IX7A 4GRDA 1D0IA 4JY7A 2G7ZA 3LVRE 2C57A 4CLDA 2HF9A 3BBPA 4G09A 1Y1KE 4I4TA 2HKIA 4Y0NA 2GZAA 1AU9A 1WRBA 2YMMA 3N8NA 4HQNA 4LVOA 2B8WA 3HZRA 2O0MA 3DYVA 1NQUA 4LDZA 4IYRA 5DRYA 1MMFB 1SHZA 5JAQA 1E7RA 2D3WA 3ABSB 3AHHA 1H1LA 2EQBA 2ARKA 4JQSA 1NU6A 4OM7A 3OE7A 4IJKA 1GZ7A 1E8DA 4L02A 4RVOA 3AVWA 5DCWA 3ZHYA 5TLSA 5CGZA 4DR4B 1G8KA 2AG6A 2PJZA 4P22A 1QZZA 5AKLA 5BWLA 1FZQA 5J23A 4L9SA 5ARDA 3ZQ6A 4MV7A 1VCMA 1H85A 5KYWA 4RESA 3S29A 5I9LA 1T5BA 3HNOA 5BSVA 5JC8A 2HJRA 1N75A 2IYRA 4IHJA 4MO2A 3VDRA 3VSCA 3GLIE 4MV4A 1VYUA 2XZOA 2EVWX 1PZMA 4I5GA 5G0VA 4LSZA 4AZ3B 3KQMA 2ID9A 4BWVA 3IEMA 2JNWA 3HI4A 4B6EA 5C1PA 5EXEA 1HBJA 1ZM7A 2MR5A 1G7RA 1P0FA 4HTAA 1N36B 5DB4A 5KNCH 3VDMA 3FBGA 3GOQA 3QJYA 1R3UA 3B6JA 5LZ2A 4NXNB 2QAIA 4X71A 4F1KA 3NTQA 1EVIA 3K5IA 4I08A 4BQSA 1M6WA 4A1OA 1PJ2A 2XWJI 1FLNA 3X44A 4ERXA 3FPEA 2XGGA 5TIIA 3D8UA 4RHYA 5AVZA 3GQBA 2PX4A 3RJZA 2WDZA 3GIWA 3S2IA 4UNNA 2WA2A 3W3AH 2OOKA 2F3TA 4TRJA 4YIKA 4BWYA 2QIOA 3L7YA 4DCUA 1KI8A 2ZGVA 3DL7A 2FQQA 4YAKA 4YRZA 4N0PA 4ZQEA 5JECA 1PW5A 3ODPA 1G8PA 2DHEA 2VFAA 1DCTA 1HNZB 3QUAA 3LLMA 2WJPA 1D7OA 4BE7B 4EO4A 4R9RA 4RK0A 5JD6A 4C7OA 1RP7A 3C87A 3QVTA 3LCCA 1NGSA 4QGSA 2XSZD 4MVYA 4IDEA 4NY1A 5FBKA 2YWBA 3RR2A 4YYZA 1K06A 1FMLA 2J9ZB 4L5CA 3TXXA 2AJBA 4WD3A 3J81k 1IY2A 3R0IA 5JARA 1ILEA 1B6SA 1Z0KA 3VR0A 1H8HD 2ODPA 2AUTA 4UHFA 1F14A 1KDOA 3AZPA 5D5PA 4DADA 2R6R1 2FVYA 3OCVA 3OEHD 1L5NA 1O5IA 1UBNA 2WZQA 1Y8QA 1E3IA 1R74A 1HT2E 2XKAA 1Y9JA 2QD5A 1EJ2A 1Q0RA 3P2EA 4URWR 5EESA 4A8JB 2XPCA 3UEOA 5B1YA 1ZXLA 3HBLA 1KXJA 1Q12A 1RPAA 3FYUC 3BMOA 3OOEA 4NOLA 4F2WA 1PEAA 4E5VA 2E5WA 1YBHA 4M9CA 3EF1A 4F3YA 4JI7B 1LFAA 1OBCA 1YZGA 4OI1A 5CJ2A 2Z4TA 1X2EA 1YZHA 4L4YA 2EFEB 4WNYA 1UT5A 2XBUA 3AGPA 5JAUA 1PJZA 3KEQA 4B4KA 2XGOA 1TVCA 1EFVA 1EM8A 4FBMA 3CZ4A 4Q3LA 2MOKA 2QP4A 3VZSA 3EPRA 1GEGA 4RZIA 4OIMA 1Z34A 4D8XA 3BJZA 1SUPA 3F5SA 2M6LA 2XZTA 2ZAYA 2P7IA 2YMPA 3BZWA 3EG5A 2QT1A 3AIKA 2JLRA 3PZRA 3CF0A 4G5RA 4BP3A 3ZWVA 3RJTA 1FX1A 3P20A 1SHKA 4TUYF 4WFIA 2HFJA 5EZ6B 4HXYA 3RVDA 3TYXA 5JAOA 1QCCA 3HCBA 4LOAA 3PKZA 4M1TA 4DEXA 4Y7CA 2P2LA 4NJEA 3R9IA 4E5UA 3ET5A 1XL0A 2NXEA 2E7ZA 2PBRA 3OJWA 4HZUB 4MTLA 5C46F 3NMUF 1W0CA 3QY0A 3TZBA 3CLKA 3L6CA 3IP5A 1XVIA 4FNMA 2PDAA 1OC2A 2BZ0A 1O9HA 3DQPA 2QVYX 4IF6A 4CIVA 1IMOA 1FJHA 2H5LA 2AHOA 3FOAA 2W6ZA 1A0OA 4ND3A 16PKA 1IUOA 3CB4A 1BHQ1 2LDXA 4G5SA 1S3SA 2AT1A 4NQZA 1SC4A 1A5TA 4DHWA 1V41E 4CEIB 5EZYB 3LFHA 4DLSA 1EFRD 4Q7JB 3QQPA 1NNI1 5D84A 3PC2A 4AJ1A 3C1AA 2ZRHA 1GVHA 2ZJ8A 4M55A 5CT4A 3BD6A 4KXWA 3UMGA 1A4XA 2G6TA 4QHYA 1Y81A 4MQEA 1L4MA 5DEOA 2IS4A 2QPOA 3D6UA 5B53A 4WCDA 2IXFA 4Q4JA 1A4IA 3QVVA 2EBWA 5F76A 2YXBA 1ICIA 5D87A 5GM1A 4A03A 4YRCA 1KI6A 4AJHA 2Y66A 4Y18A 3RT7A 2O5VA 3LK7A 1U8XX 1Y6ZA 1R9NA 1N8KA 2BEVB 3LOPA 2XNCA 5I7AA 1YFZA 3UMJA 1NR7A 1FS6A 2CDCA 3SZGA 1NZDA 3VSBA 4DEVA 1PEDA 5CBKA 3EPJA 2JL1A 1B43A 1YTUA 3VJRA 3HDQA 3HWSA 2QVXX 4ND6A 3VX4A 3NAMA 4KAFA 1BHJA 3G6WA 3KOZA 2IE8A 1AZTA 1Z2CA 2JGIA 1OLOA 1D7AA 1K8RA 1NBME 5B6PA 2F1HA 4TZ0A 2OESA 4RPHA 4UREA 1ZVQA 4U0KA 3RK1A 2R97A 3CRZA 4CQMD 5F98A 1J00A 2COUA 1ZO8A 3A9CA 3IC5A 4HG2A 4G2TA 5FFFA 1EFTA 5DGTA 5A3JA 5DTIA 1V48A 3G2HA 3ZLTA 2HA7A 4XARA 2IFTA 2JHFA 1P60A 4KGZA 1H66A 1FQJA 1TJNA 4K0KB 1J8QA 2IQIA 2BKVA 4LC1A 3TRIA 4WK2B 4FSHA 3TE6A 2YRWA 5ALSA 3E8MA 4JOSA 4L4SA 1A5SB 1K2WA 3LW8A 1NP3A 3E2MA 5ESXA 2B20A 4QOGA 3ROMA 3RUEA 1EFLA 1PJSA 1NVVQ 1RI2A 2C4NA 3GBPA 4QHSA 4HAIA 4DQKA 3U1TA 4IQFA 1SC3A 1FTNA 2WZCA 3Q8WA 5E4TA 3Q9UA 1H2ZA 3K5WA 2HT6A 3IHLA 3IL2A 1YR8A 2W6CX 1CS0B 3DQQA 4K9KA 3MJTA 4PPNA 2HRRA 2UUPA 3GUZA 3MNFA 1HF3A 1DKOA 3HXQA 3L7LA 4NBLA 1PEKE 1RLIA 5HW0A 4TLAA 3C8MA 2FQYA 5E6UA 3G1TA 3Q5GA 1LLCA 1OCEA 2X9VA 3C7CB 3DO6A 4ZVQA 3T61A 1NXXA 1QQ7A 3A4IA 3EEOA 2DERA 3MWEA 1SJ9A 3N0XA 4OHUA 5LC1A 3ZHVA 3K4PA 5I01A 2D00A 4HH1A 1AGNA 1ZD3A 4O3MA 4F4UA 4D80A 3OF2A 4HYQA 5C4GB 4UE2A 4KN8A 1U65A 2F9FA 3ECAA 2A1UB 3BWMA 1N2CE 1KK0A 5AICA 2VNJA 4AJ2A 1W5AA 1FU8A 1N6NA 1JHYA 2H4FA 2VUIB 4R0VA 3AWIA 4WZAA 2GNAA 2ONZA 4B5LA 2FVXA 1CEQA 5I9NA 3THWA 4JUBA 3LP8A 3CR8A 5LBIA 3EZGA 2QMUA 5H7XA 2R1VA 4NFHA 1ZD2P 2QU8A 5C8VA 5C8ZA 2IS2A 2IP2A 4OQFA 4LXUA 1M5TA 1JFRA 3FVWA 2GN4A 3QG5A 4JVNA 2FN9A 1NVTA 1YIDA 4P7GA 1GZ6A 1UEIA 3ZGXA 4CHTA 5KYXA 3H16A 1GTZA 3WIVA 2PZFA 3EXEB 4E1AA 6PFKA 4IJWA 1V7ZA 2QN1A 3BAZA 4FNAA 4DLWA 4R3UC 4WZ6A 1Z2AA 2QTNA 5LWQA 4Q3EA 3WA7A 1Q0QA 1TTPB 3PTZA 4AO7A 3U81A 4CKZA 2ZUFA 2YFYA 3GFRA 3OIFA 3AEQB 4FMBB 1K97A 2AWNA 2KQUA 4KG7A 4NWIA 2IP1A 4P58A 4XWGA 1XNHA 3TRKA 4CBVA 3K70D 1SULA 1XTPA 1IQRA 2A0XA 2B0CA 1XDBA 3VHQA 3TNFA 1US8B 1BJRE 3H9QA 3M3PA 3QV1A 4HADA 1AUQA 2C2BA 2KLHA 4QUJA 5ALQA 3KALA 1T2EA 3N0RA 1MJFA 2CNOA 4IJUA 1ZQ9A 5CVTA 3H6KA 3BTSA 4KGDA 5IG2A 5KAPA 2N3ZA 2CMGA 3TMAA 1EK2A 4IDOA 1A7JA 3KTFA 3KHUA 3R0QA 5CVEA 3K72B 4RD1A 4UBJA 2JFBA 3WL8A 4L73A 3WBBA 1X0XA 1SC6A 5KNCA 1DAPA 4V0QA 1GGNA 1WUYA 1GIAA 4OQYA 4DYVA 2HLDA 2VR1A 4Q21A 4EGAA 3TBHA 2VATA 4OFXA 1P3JA 1QJCA 2P3SA 4IGAA 1KAHA 4MCHA 5T4HA 2J6BA 3SI7A 4N5IX 3TLKA 2ZIVB 4MYUA 2R8YA 3AKCA 4YJFA 4TL8A 4PXAA 3R8CA 3W3AA 3PHBE 1X9HA 1IY0A 1N2CA 1RBZA 2P9HA 1E2GA 4RUKA 4UMFA 3DCJA 9ATCA 4L5YA 3CKYA 4NZMA 4UATA 3DZJA 1D1PA 2FN3A 5B4VA 5J47A 4YHBA 4WESA 1G6Q1 5HKBA 1UBCA 3KPVA 3G59A 5K9ZA 2G1JA 3VR3D 1BCRB 2REQB 2OAQ1 3GEHA 3TOSA 5IN4A 3PUWA 2A1IA 4AMZA 5F1PA 2C3OA 3PL5A 2IF0A 4UHDA 3GJRA 2K2QB 2XBMA 4QYMA 5CIYA 4LNAA 3VOSA 3S81A 4ZT4A 2ZRBA 1C7JA 1YZTA 3O5AA 3QPDA 4GXNA 5CHYA 3RWMB 5LQCA 4NX2A 1RWMA 1GCUA 4KREA 3IQXA 2BEKA 1JEAA 4CNBA 3CZPA 3PR3A 4BLQA 4U6QA 3VYWA 3EXHB 3TUIC 5FWYA 1PG5A 3AF4A 3KQOA 3FOWA 1FP6A 1VHJA 5HWSA 5JEDA 3DAOA 1E66A 3PQFA 1P4HA 4XPIA 1GDDA 3AR3A 2WC1A 5JMPA 1CRZA 1N2OA 2G3YA 4M0EA 4AN0A 4DJ5X 1UXIA 5FNVA 1ODTC 3DSRA 5DHFA 1VLZA 1UXKA 1NI3A 2HNKA 4HAOA 2IY9A 2WIAA 4RH0A 3FIJA 2FPLA 2FRVA 3O2SB 3OJ0A 3PFKA 3OKAA 4GSYA 2ERXA 4EA9A 1FRFS 4B85A 4OJYA 3S7TA 1S89A 4BNKA 3F3MA 4CLRB 1ISHA 1T9GR 2Q7OE 1Z7YA 1DTWB 3TQSA 3V2GA 3DFUA 2AF4C 4ZYWA 4XCXA 3ME5A 4B34A 4B81A 1TRHA 4O2BA 1WBJB 3WLHA 2C5LA 3W5AA 3I6ZA 2W98A 4DMLA 3KQHA 2EOAA 2VJNA 3HYTA 2VRWA 3L93A 5KNLA 5DRTA 3FB4A 4UZFA 2DULA 4DIOA 1JEOA 2HSEA 1H5QA 4N01A 4Q12A 1MG5A 3R75A 5DTRA 3ICPA 1PR2A 1J90A 2IU3A 2B34A 3ZK8A 1Y8RA 4AWBA 4N3CA 1GTRA 2IPLA 1L4UA 1ULUA 1ZM9A 1TZBA 3DMPA 2CMDA 3LRTA 4KRYA 2GKSA 3P2OA 1NVFA 2EU8A 3PHCA 1AS0A 4M2LA 4CMEA 5JAZA 4DWJA 3F8TA 2JIRA 1FP4A 1CIJA 1U31A 3MMZA 5D3KA 2BI7A 1NY6A 2KJQA 1MZPA 4FGWA 4J0CA 4YT5A 4LDRA 4R8LA 3NVKI 3K09C 1H6DA 4YCSA 4I3FA 4J7CA 4NBKA 1PE0A 4X7MA 2HPAA 1PQYA 1DT3A 2IYNA 2IP4A 3HXMA 1N34B 3TLGA 1TVMA 2D2FA 1PR9A 3H2GA 4LJLA 2YV1A 1EKXA 4I55F 1LTKA 5AVXA 1TDJA 3TSAA 1KSJA 1GU7A 3DFIA 1OH6A 3S3TA 4ZO9A 1AN9A 3LUHA 1UBHS 1PNQA 1E2JA 1LV7A 3NVDA 2P9BA 1U7PA 1OPRA 3A70A 3S2YA 1OYYA 2CVOA 3BMNB 4IH1A 1SBIA 3LM8A 1PCXA 4GICA 1ZXBA 5CT6A 3UAZA 4M3NA 3WSVA 4ZJZA 3MQFA 1I36A 1BEUB 2B94A 2E4YA 2RAPA 3K05A 2Y1WA 3KCQA 1BO6A 2IHTA 1T2VA 1SAYA 2VPQA 5H68A 1LQTA 4IEIA 5DNCA 4JJAA 3SJZA 1CJCA 1UBSB 4CFSA 4R2HA 1DU4A 4YRLA 2Q2OA 2IVFA 3HI6A 3VDQA 1ADYA 2Q28A 4AMUA 1PNOA 1E32A 3RASA 3PLRA 4AL4A 2YY7A 4INOA 2EIHA 4BP1A 1C3OB 5IKXA 3J80A 4EHHA 5FBVB 5KBYA 3HH8A 4AB1A 1K6MA 2FF7A 5D6OA 3MN1A 2LV8A 4O8CA 4Z0NA 2VSQA 5LOVB 2ZYAA 4PLFA 1RJ9B 3JY6A 3U6BA 4N8SA 4RIEA 5CLLA 5HPYB 4D57A 2IX3A 4OLAA 1F3OA 1T3GA 2DWQA 1RM4A 1K7EB 2HWKA 1DV1A 3JYNA 1QG4A 3OE7D 2ORVA 3PE3A 1GXSB 3SYTA 6REQA 3G9TA 1XZIA 4PLZA 4KR2A 2F59A 2CHQA 3KAJA 5D6NA 1O1YA 3ZW7A 3UZUA 2JGFA 4CCWA 3AKZA 2Z6AA 1U2SA 3L92A 1ZA1A 5CA0B 4CIBA 2Q4TA 1XRPA 3ISJA 1AE1A 4GLFA 4EHKA 2GK3A 5IMSA 2XODA 1BN7A 3TW0A 3WYAA 4XGNA 1ISSA 1YS2X 2OHOA 4IX1A 1WCIB 4Y6QA 5UKDA 3TB4A 1YCDA 2AC4A 5H83A 2ZJOA 3RUAA 4DSUA 1ZM3A 4GBJA 2Z2JA 1T24A 2HIHA 2B8TA 2VEOA 5BUSA 2REOA 3B60A 1XU7A 2XY4A 3DLTA 3G2IA 4XDGA 5LYJA 4RDHA 1SRQA 3PXAA 3ZJUA 4N5HX 3TLMA 3G79A 1E77A 4KP7A 3LWBA 3MWJA 2LTAA 4BEJA 1CJBA 5C34B 2PKEA 2DBZA 2YHIA 3RRXA 3TZEA 4B83A 2DUJA 3DMRA 1EFDN 1NVGA 4OHCA 3AYZB 4R2LA 2AA3A 3CE9A 2WYHA 3BM5A 2QTMA 1P6XA 3JQ8B 5A3VA 2R6JA 3KZOA 1TAUA 4L7QA 4QXAA 1W9MA 5C7LO 4E09A 5HK9A 2JFXA 3RT9A 4J91A 2CWWA 4GOKA 3RSCA 5BUZA 1F2TB 1OI7A 3AEUB 4I8DA 2ZYRA 4PNPA 5G3ZA 2HQ1A 7YASA 3NTOA 4RGVA 2F9LA 4DPMA 3LA8A 4U7FA 1N9KA 3CISA 4H18A 4QAQA 1OXUA 3BMQB 1W4BA 3OQ6A 1AUVA 4W8HA 5AW7A 1NU8A 1E2KA 1DO2A 2Q41A 3TPCA 5EHZA 1HDYA 2MHCA 3KZKA 1J1ZA 1JLMA 3M5PA 4P92A 3CSDA 4FYYA 1QHNA 2FPGA 4J75A 4KQCA 3PJDA 3CY6A 4YT4A 5J59A 1JDJA 1X9GA 2ANCA 4Z5XA 4WHMA 2IS1A 1HE5A 3QBEA 4QA9A 1E5TA 3A4YA 4NPCA 1NYQA 3BIJA 2WI8A 5EIAA 5F2KA 1PV2A 4PBSA 3ZQKA 4DE5A 1N8NA 1XZBA 3N2ZB 4PICA 3UHFA 1L5LA 2AN9A 4WW0A 4E51A 1NIPA 2PG3A 3MCWA 2VKQA 3PUJA 3JRNA 3L7OA 4RJLA 2ZPUA 2ISSD 4L22A 3KHKA 2HQBA 3H0KA 4GKBA 1GQRA 2GF9A 4QYXA 5H4GA 1FYFA 4OKNA 4HNUA 4YB8A 4JUCA 2W8BB 4QNMA 4LJRA 2A9RA 3D3JA 3HCPA 3NB0A 3SQDA 3D4IA 1PBNA 2QUKA 1PD0A 5JMTA 1P7VA 2C99A 2JGLA 2XRFA 4PQEA 5IVIA 3RRZA 5A4JA 5JSZA 3QKRA 3RLFA 3IBGA 2ODTX 5D7NA 3HLYA 3SYLA 3C43A 3W79A 2IPXA 3CNLA 1H1TA 3ROZA 2JI6A 4Z4HA 1C4OA 1YUMA 2IZ1A 2OM6A 1ZNXA 3L1KA 2XJ9A 4HUQA 4MR8B 2IGBA 2J32A 1QYRA 5EA2A 2V7VA 3DDUA 4L27A 2HPZA 4XZ3A 4FZRA 1W46A 2IDKA 5E3HA 5JCZA 3K0AB 1ISMA 1KZ7B 4AVYA 4D3XA 1Z8FA 2DR0A 1YOVA 1JNYA 1JLSA 1FS4A 1BNCA 1V5EA 2P3QA 4QFCA 3MJVA 5HOEA 5KJ6A 1DJQA 1Z07A 3MSXA 1TGYA 2R7NA 3EYWA 2ZB8A 2I7CA 3MTBA 3OQOA 2WJIA 4XQGA 1P80A 3UW3A 3R8FA 2UYYA 4G0ZA 4XE5A 4KBFA 3TUJC 3KO8A 1XZFA 2E3JA 3BIFA 1VE1A 2VPZA 4CL8A 1THZA 4X65B 4GIBA 1NDHA 5IAOA 1UKAA 4GUAA 3PE4A 3BPSA 3QTBA 4IIDA 3OJEA 4XVUA 2FW9A 4NNOA 1VRCA 2PSJA 4NZZA 3P52A 2CVQA 3BA6A 4TSFD 4PO1A 3WXMA 3UWOA 2P9JA 4Z9FA 2IZ0A 2R6GA 1W48A 1ZKMA 1T6NA 3F1LA 2G4LA 3I73A 4RGYA 4UPDA 1ZRHA 5DGHA 1T36A 5TRTA 3EGDB 3PDIB 3WWCA 2OLEA 3TIGA 4NP6A 2P2NA 2QW1A 4PHTA 3Q1KA 3C3MA 3DBRA 5CURA 1B8NA 3M3HA 2AOUA 4FMCF 4CDMA 4E08A 3DMNA 3MMPA 2QX7A 3A6DA 1TYBE 1FMTA 3VUFA 2O1SA 4ARVA 3GK3A 4RZXA 1H0RA 2NUPA 1TTQB 4XQ0A 4MLPA 3HADA 4IEFB 2IV7A 5ADWA 2Y71A 1KJIA 2GRJA 4RVHA 1KI4A 5AJTA 5EUBA 2G80A 3DAFA 4IKEA 4O2AF 2Z5VA 2AWOA 4YRSA 5NLLA 4W5JA 3ICVA 1E18A 1H2BA 1R0XA 3QVSA 1F5SA 4OQMA 1Z16A 5B1HA 4E7PA 1XBTA 1S7CA 3ZHXA 3JQAA 1G63A 2JA2A 4KQEA 5BSEA 3GT3A 1OX4A 5JI3E 2GZ1A 2H52A 4AW9A 4XWTA 3D7KA 4EPXA 1JLHA 1SFRA 4JOBA 5EJEA 3D1VA 1JLLB 2AJDA 3K9GA 3QMWA 4EW1A 1Y5IA 721PA 3D2LA 2WSMA 3ROPA 3K32A 4E4TA 3K9FC 3JZDA 3T3GA 4CUZA 2WTXA 1XTRA 3COZA 4V1CA 1TA9A 4MAAA 4Z51A 4Y2SA 2IZZA 2QXUA 4HH0A 4O8ZA 5B3AA 2JCXA 2PT5A 1IK4A 3KJHA 3C14C 1KAGA 3R4CA 5HRCA 1JS1X 4H6WA 4K9DA 1S6YA 2O3SA 4MYHA 4X1KA 2YVUA 2QQFA 1JR2A 2KS6A 2II6A 4KIUA 4N0QA 1NMYA 1SBQA 1P3Y1 2HA3A 1M74A 1YRWA 3DKIA 4HFJA 4HNSA 4J3FA 4QPJC 3PNOA 1LH0A 3UAYA 3L7NA 3ZCPA 4YMTA 3CH6A 4RVFA 5JDCC 4U5XA 4MUKA 3GEPA 1O97C 5BXYA 1N9GA 1P4AA 2QUZA 2PQMA 1G21B 3L0BA 4KQ1A 5J1TB 1O89A 3WADA 4LHYA 2B0JA 3CYFA 4BP8A 4CCAA 5B6IA 1ENPA 2BKEA 4DZTA 1S3FA 2O23A 3P2YA 5H3HA 4MVJM 2ECQA 3BDVA 3KLPX 4DIDA 1KEPA 2C4TA 2XR1A 4YR9A 4RANA 4ZODA 2JIDA 3KAQA 1CDDA 2A9VA 4QTZA 4TUYB 3TTWA 3W2GA 5ITZA 5CA1A 5IULC 4D8YA 2D5BA 2ZANA 2DHDA 5IJZA 2IZ5A 2GGSA 3LUBA 3EDMA 2EJCA 4KN9S 4PIMA 4Y2GA 1BA3A 2IW1A 5IAKA 5IVKA 2Q1SA 4J49A 2CL5A 3T06B 5L7TA 2R4TA 2NM0A 3AY0A 4U5QA 3W5CA 5LZ8A 4Q39A 1WHSA 1XN4A 2G1AA 2J3JA 3EIHA 3M4ZA 3QFTA 4GZMA 1KNXA 1RS0A 1OZFA 2B5WA 1M1YE 5HJ2A 5KAMA 5K2OA 4E31A 1CE8A 2BFBB 3K35A 2ZREA 5ALWA 5IYZF 3DMDA 1WXQA 1H4TA 2CUKA 2ZRGA 1YI8A 3RSQA 1ZD9A 1L8XA 2Q6KA 1M66A 2D1RA 1LD3A 4PVCA 5EIBC 1LW7A 2TMKA 3EW9A 1W581 2WM2A 3PWKA 1C1YA 2WQ6A 4B3GA 3BIXA 1NBMD 3ZWYA 5BMVF 2NGRA 1E62A 3G2LA 2CBZA 2CFSA 3C6KA 4X1YA 3Q8KA 1ESEA 2I6TA 2UDPA 1ZD5A 2MCFA 5A71A 4HVCA 4YBRA 1OH7A 2JAQA 1D8TA 4RVNA 1YFJA 2C8LA 4QOJA 3REQA 3HFJA 3SQLA 4BX8A 4R68A 3DZKA 1U0NA 3WHLA 3FCEA 4OXRA 1RD4A 4Q4LA 3C48A 4XVCA 2Q2NA 4D9CA 1SXJB 2OVFA 1AV7A 3NNSA 4G84A 3RV4A 2A9KA 1H2HA 1CPYA 5A5VA 2XHEA 1EX7A 2EHJA 2RBGA 5KTOA 1MRSA 1TCBA 1YZKA 2P6UA 3W9UA 4M86A 3PNQA 2V6BA 2N46A 1GAQA 1W1UA 5TQ2A 4KO3S 1E4OA 1IULA 3COWA 4G3XA 3V97A 1PUIA 5FRDA 4YUAA 1JFTA 1JPVA 2R8RA 1XJ5A 4FEAA 1JHVA 5MGBA 1DCMA 4P9NA 1P7ZA 1QFSA 2W37A 3N0VA 4HWKA 5CH5A 1R7RA 5F52A 3WBKA 2CFOA 4IBOA 5BN5B 5PNTA 2KYRA 1EK5A 1GQFA 3KPUA 5EZQA 5KNCD 2CVZA 2MSDB 1TQ2A 4MUYA 1I32A 1N0UA 5G1OA 2Y1DA 3EZ2A 4XX0B 3C3XA 4YMIA 4UOQA 3ZHCA 4UE3S 4DV2B 1KDPA 1AXEA 5BYBA 4RCYA 1U98A 2JLXA 4Z9BA 4HWPA 1QP4A 1N5LA 1UC9A 5K8VA 4M7WA 1M1YA 1ODCA 3V7UA 4NZYA 3W3AD 2Q5LA 1U1GA 3A31A 1U80A 2IEAA 2CB0A 5GZ6A 4JJIA 5CXQA 2FQWA 3BTUA 4IZ6A 1JL3A 3NBUA 3QBVA 4AS1A 2G76A 4HDRA 3I01A 4YMGA 4X6XA 1B8OA 1B3BA 3CONA 4U3JA 1DAGA 1Y3CE 2DFDA 2HTFA 4MUAA 1WSWA 2RHJA 4W7IA 4MUIA 5A9TA 4JI2B 2VYVD 1PR5A 2VDVE 3NXSA 3DZ8A 4BPBA 4FR2A 4ILKA 2K2WA 2IS6A 3VKHA 3P27A 2KPOA 1EI9A 1FE8A 4ER3A 4F2DA 2OV3A 3WKEA 2JFPA 2VNIA 3DOUA 2HAEA 2DE0X 1X0VA 4O25A 5HDQA 4WXMA 2I99A 2HRBA 5DW0A 1TT5B 1QAQA 5CNMA 3HSYA 4YJGA 5E7QA 3TN7A 4DMKA 2IWRA 1J5PA 2VJCA 3KKPA 3OUTA 4B44A 4U9HS 1DWQA 4AP5A 1JJIA 3DBVO 3KKKA 3RYIA 3ZGOA 3VVBA 1W0KA 1YJXA 1THTA 1RI3A 1JU4A 3L4EA 5EMMA 5AVSA 3WDSA 2YINC 2FU5C 3A9SA 3P9CA 2K4MA 5CDSA 2VAXA 3N8DA 3RUIA 5EQFA 1WSBA 3BYZA 3OCXA 4Q4DA 4QUEA 5IDVA 3A1DA 4QVGA 3DVLA 1Q20A 2KM1A 3I34X 4V0KA 4IIHA 2I78A 5BRAA 3FYHA 1PIWA 1C3LA 2VZ0A 4DCPA 4QU5A 2WFLA 4UUNA 1K9SA 2LZ0A 3FWZA 3R6GA 1Z73A 1RWPA 5TQVA 2AMLA 2H1WA 3OSZA 1ZEJA 2HN9A 3ONDA 5FH9A 1NTRA 2I03A 1EDOA 5J58A 1ZK0A 4WERA 4YUVA 1YRHA 2P75A 2P4EA 3FI9A 5ALGA 3WWEA 2ROQA 3BSWA 4LF4B 1JHUA 3WHPA 4C7XA 3U1BA 4NPHA 4UVDA 4M0FA 4MQFA 5A03A 3KJFA 2BFAA 4UEKA 2R1TA 3HB0A 4XVHA 4QKQA 3D0KA 2VP6A 3A4VA 4R3NA 3A1SA 3MTAA 2W0SA 3UT6A 4QDUA 3U4MA 2DWCA 2LCIA 2L42A 5HMLA 4JLDA 4J0GA 4TROA 4PYKA 2V65A 2HMAA 1KY3A 4Q7KA 4RYDA 3ZGZA 2VBIA 4EUEA 4Q9AA 5AW9A 2GPSA 2D7DA 4RMJA 1PR4A 2VAPA 1VCIA 3ZS8A 1ICEA 2EKLA 3C8HA 1NQAO 1WV1A 4DL9A 3AK4A 2XOEA 3KLNA 3WGJA 2IH4A 1AKNA 5BNFA 1VG1A 5CX1A 2I2CA 5FOVA 3UWSA 1DKRA 1KEEB 2W2TA 1V7QA 5DMXA 2X5KO 4ISCA 1L8QA 4MPDA 4LF7B 1HNWB 3LECA 2O0KA 1CS4C 4DLTA 2SCUB 5HR5A 1Y6RA 4LHZA 3ZDEA 5K3BA 4BGEA 1V45E 3RU3A 3IS3A 3L1HA 3SC2B 3L0IB 1YHNA 2FRXA 2Z8XA 1PSWA 3PI6A 3T7RA 1EA7A 1L8OA 4M1KA 4JI6B 5IDWA 2FEKA 1Z18A 4KXLA 2RBKA 3KJZA 1MT0A 1U1CA 3LT0A 2CZGA 4N3BA 1F0PA 1WG8A 5GM2A 1KOGA 1NMEA 3KHTA 4BLVA 3Q72A 2BP7B 1CUYA 3EK2A 4IUYA 2JFGA 4MVCA 5DTQA 3ZHBA 4DR6B 1WXWA 4UU7A 5I9SA 3O8NA 2WQ7A 2JBAA 1H2WA 1J20A 4HDOB 2RGAA 1QAOA 1YDFA 4O59O 2JHAA 3T38A 4D4GA 2VK4A 1S01A 2PH7A 3PSAA 4MQ5A 4EG7A 5E4JA 5ES4B 4KN6A 1ANKA 1QP0A 1ZP6A 2LUOA 3QWBA 2H08A 3V1KA 1JH9A 4U4AA 1OBFO 3TSZA 4LVUA 2BT4A 2PANA 3M1AA 5FUYA 5IUKC 4RH3A 4OI0A 1HDGO 1Q0ZA 2ACVA 4D92A 4GL4A 3R6WA 2X7XA 5K4AA 8MHTA 1B73A 4A8PA 1DTEA 3DT9A 1W6RA 1W0JD 4REQA 2JHCA 1CVIA 1EBFA 3OPYB 4OQLA 1ISJA 2J9RA 4WEQA 4TKUA 1JQ3A 2VHTA 4DYDA 1JSCA 8ABPA 5KMGB 2ZYIA 2YS6A 4DMFA 5IVPA 1GZ3A 3T9EA 3GVCA 4WXRA 1WB9A 2GVZC 4QUGA 2JIZA 1VLLA 4JXKA 2CF6A 5D8DA 5FTLA 4J7UA 2YN0A 2H2IA 2QBYA 1L6IA 1QQ6A 2CJWA 2SBTA 2YHAA 2YJTD 3P32A 3QU2A 3EAGA 1JG1A 3TZHA 4BQIA 4MUJA 4ZQCB 5HBGA 2BSAA 2I9KA 1X74A 3R76A 1G1MA 3MLAA 3KHSA 1VIAA 2WU8A 4FE3A 3B38A 2PKQO 2ZB4A 4ZI7F 5T57A 1HDOA 4L51A 5T3UA 1J8FA 3ESYA 4PRKA 3W5DA 3GGOA 3N5KA 1L5ZA 2ZT5A 5ER9A 2C7RA 3ZJVA 3GR6A 4FGZA 1K8ZB 4M89A 1HYGA 1IDN1 3UT5B 2GZ2A 3LDGA 3BQMB 5LU9A 4BKRA 5FBZA 4UTRA 1U0BB 3VU9A 2AFHB 1EHYA 2I2DA 2PVSA 2XLCA 3VXKA 3HC7A 4FU0A 4PZ9A 2Z57A 4FKZA 1HG1A 4EUFA 5ESDA 4BC0A 5KQSA 4DKJA 4I55B 3E6AA 3V4PB 3TW6A 5LQJA 4NCBA 1HZJA 1UPUA 1WMFA 1U2ZA 3WG9A 1R88A 4DTCA 4IOJA 1MXHA 4K6FA 3ZQ4A 4I46A 4DG8A 4X9XA 5KQRA 5K6AC 4ND5A 5CDTA 1BD4A 4GS5A 3P9IA 4GR5A 2ZI7A 1L5MA 2M32A 3HBFA 3TW4A 3LX6A 4YRBA 2J4DA 4DLZA 5JCOA 3VPDA 4XGKA 3HJHA 5KOHA 2HHJA 5I8PA 2P6NA 3PQCA 1U3GA 3EZNA 1DLIA 4G1VA 2PUFA 1HQYE 3DEAA 3DOJA 1R0RE 3G8BA 1QYXA 4Z3OA 5DJ5A 2Q3JA 2QOEA 3U4HA 4NU5A 3EIWA 3NZEA 2WD9A 3X2FA 4C0BA 3RFCA 1R8SA 3FVRA 2NTYC 5K03A 1CUEA 3DZBA 1DKQA 4MZXA 1T35A 1JJFA 1FFAA 4FWTA 4HXEB 2CXTA 4ERNA 1KOJA 3LYAA 1QH1A 4QTXA 2P62A 3OOYA 4X3CA 5F4BA 2BE9A 3PPWA 1KPIA 1P0QA 3EAFA 3GAZA 1JKFA 3V2HA 5IT9A 1NNEA 3E3LA 4BP9A 3I1FA 3CZCA 4BS9A 1ECFA 2OO5C 5WRFA 3BFVA 4HHEA 3TSYA 2H57A 1X7YB 3ZIAA 1PQ4A 3VNUA 4Q1AA 4J1SA 1OWNA 4DCTA 5AOVA 3IR5A 4OP1A 2XQIA 5B1EA 2Q9AA 2HK9A 3EGXB 2WTUA 2J0QA 3M34A 1UF9A 1NKTA 1OFGA 1O9BA 2GB4A 2N75A 1HE3A 1FQWA 2B30A 2VWQA 2Z3VA 3VYTB 3ZU2A 1Q0TA 1ZAYA 4PYLA 4ZAVA 1AQUA 2AG0A 2IU6A 4GWLA 2Q3MA 4K05A 3GFTA 1VLVA 2DFLA 2YC4C 3BF7A 2PN1A 3CWCA 2V7TA 5FBLB 2DFKB 2H0AA 3DNMA 3V8PA 5B1SA 2X3UA 1M6NA 2C2GA 4RIFA 3G5MA 1VYHA 2ZDQA 3GMIA 4YAIA 3F49S 4WT7A 2RH8A 4KXMA 1R4NA 2OKGA 3M5DA 2V55B 4JCOA 4R41A 3ER9A 3PF9A 2BCGY 1IEWA 1WBBA 2WNIA 2XT6A 4M7RA 1OR8A 2EBUA 2NVWA 4FR5A 4UJ5A 4MKGA 3PJEA 1MQAA 2FCRA 4ZYTA 1GPMA 3TZ6A 3AU9A 3T95A 1NOIA 2Z09A 1EHIA 4L57A 3FUUA 4C6RA 4US0R 4ETNA 2GYWA 3K9CA 1B74A 4ZQIA 1J8DA 2BGWA 3JRXA 3ED1A 4D43A 4KE7A 1WU8A 3KTAB 3VO8A 4BX0A 2QM0A 1I6LA 4EKGA 1FVOA 4CL0A 1DAEA 2GLXA 2Y1OA 2ATXA 3FTCA 1Z6YA 4OHRA 2WSSA 1PYGA 4PWYA 4RY9A 4D9JA 4B3HA 2GBLA 3OFSA 4YH1A 4NH4A 2Q5IA 1DFHA 2W2KB 4H60A 1IVNA 1UMDA 2QQGA 1QO0D 4HWSA 3DDOA 5CVJA 1E1YA 5DHSA 1MD9A 1CSEE 4C4XA 3JZIA 4XDHA 1YCFA 4NBNA 2FWPA 3JQAD 3F73A 1Z4QA 1QK3A 2KLBA 4FHCA 3DO8A 5GTDA 1U90A 4CM4A 2V7WA 3V1MA 3LC1O 2XTMA 3AT1A 4GT1A 4JC8A 4UUOA 5AK4A 3QEMB 1XHFA 2FWBA 1X1RA 2JAOA 3HUTA 4A0HA 3VKFA 5C35A 2BFCA 1ZONA 4FDUA 3EUWA 3KXLA 5E95A 1K86A 3GPCA 4L4UA 3BFPA 4AJEA 7ADHA 1Y9EA 3TEJA 1IUPA 3MGBA 3M81A 4XUGB 3KT6A 1KORA 4BNDA 1A95A 1FNNA 1K1EA 5EJGA 1W47A 1ZBDA 1YAHA 2ZJYA 3EEQA 4Z7JA 4JLPA 3O2QB 3I9V6 1ISFA 1MNAA 2XNJA 4RA9B 3C5VA 2FFAA 3M4NA 3OQ1A 4KBYA 3U39A 5BWBA 4NV3A 2VCYA 1ZK1A 2X9LA 3HCOA 4IG9A 4FZJA 4MHSA 4QTUB 1QX3A 3JAKA 4MW5A 3LBAA 3V5NA 2IYVA 3CN7A 4NS4A 1LK0A 1PR6A 3L5OA 4YMWA 1VTKA 4LF6B 1NOJA 3M3DA 1JBQA 1T4MA 1DEHA 4II3A 3O47A 2W4QA 4FFVA 2IF2A 2YZGA 4EI7A 4QBIA 4BY9E 4X7PA 3CPSA 3FRIA 1E0KA 1PWZA 3M5WA 4YAFA 4JU9A 5IVDA 5BV2P 5TNXA 4Z6KA 5CLGA 2GESA 1VXRA 3NBZC 2C98A 4GC9A 4XGRA 2XB2A 2VH2A 4H3HB 1SCAA 1B41A 1B26A 4ZO8A 2JAPA 4D97A 3PEVA 3RYFB 4YAOA 2X2FA 3SMQA 4NR0A 1D5WA 3VPXA 3GRYA 1CCWA 3OCUA 4YV2A 5BOVA 1E9BA 5IZ4A 5JYCA 2OFOA 5I45A 1KQPA 4RACA 1ST3A 2WVHA 3V8QA 1UWCA 1L5WA 3ZWNA 3KV3O 3ICCA 4D3FA 5IJWA 2A88A 1W75A 1XLTC 1LDGA 4D3YA 3QSYA 4NARA 5FL7A 4BFLA 2PAAA 3C5WP 1OLXB 1XYYA 3H7IA 3I8OA 4HNRA 4K86A 3DEYX 3LK6A 4C43A