3S2SA

The crystal structure of pyrazinamidase/nicotinamidase from streptococcus mutans ua159
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
182
structure length
182
Chain Sequence
SKALISIDYTYDFVADDGKLTAGKPAQAISKAIAQVTQKAYDNGDYIFFTIDGHDEGDDFHPETKLFPPHNIKGTSGRDLYGALADFYQKHENDKRVFWMDKRHYSAFSGTDLDIRLRERRVDTVVLTGVLTDICVLHTAIDAYNLGYQIEVVQSAVASLSQENHQFALNHLQNVLGATIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative pyrazinamidase/nicotinamidase
publication title Get phases from arsenic anomalous scattering: de novo SAD phasing of two protein structures crystallized in cacodylate buffer
pubmed doi rcsb
source organism Streptococcus mutans
total genus 72
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3s2sA00
1YZVA 3HU5A 3EEFA 3UAOA 3R77A 3KL2A 2H0RA 4L08A 3IRVA 1NF9A 1IM5A 1YACA 3V8EA 1X9GA 3O94A 3OQPA 3OT4A 3TB4A 3LQYA 3O91A 4WGFA 3O90A 2WT9A 1NF8A 2WTAA 3HB7A 3O93A 3S2SA 2FQ1A 1ILWA 2B34A 1J2RA 3O92A 4H17A 1NBAA 3TXYA 3TG2A 3PL1A 4WH0A 3R2JA 3MCWA 4L07A 2A67A 1XN4A
chains in the Genus database with same CATH superfamily
4TL7A 1AG9A 4JUIA 2QXYA 2QAGA 1OLOA 2CGEA 4FWBA 2CNWD 4CKYA 1EK0A 2ZVQX 3I72A 3PI6A 4A6EA 1MQSA 4GL2A 1JXAA 2A78A 2XKAA 4BATA 3HKEA 4X64B 1Y8CA 2B7LA 1SBYA 2PO7A 1W5FA 3CE9A 3OM1A 4O08A 3TXXA 1M5RA 2WVJA 3ICPA 3VFDA 4EBBA 1G55A 3ELYA 4UJ5A 4L5CA 1XDGA 1IULA 3RD5A 3MWEA 1J07A 1OI3A 4BNKA 3K0FB 2A0UA 3EVBA 3OOHA 4DV7B 2B36A 4G5XA 4GX5A 3PZRA 4M36A 5E6RA 3E9MA 4E13A 4LF8B 2O14A 5F33A 4HB2A 3OM0A 2Y6UA 4IFIA 2Q21A 2X6RA 4A1OA 2VP3A 3VYWA 5CA0A 2BEUA 2A4MA 4M0MA 1BVYF 4W5JA 5DK6A 5GZ1A 2R6FA 4J0GA 3U17A 1LJLA 4FR2A 4IIJA 4B1FA 4QAQA 3MTIA 4CNQA 1R64A 1BDJA 3KZOA 3CLSD 3QX3A 4L0DA 1AUOA 2PL1A 6YASA 4QGGA 3BCRA 5LQUA 4B76A 4F3NA 1XAIA 4FOLA 4G24A 2D2IA 4E1VA 2RGRA 4HFMA 4N8SA 4CXMA 2OHHA 4RESA 1QGED 1QGAA 1YQXA 4M4SA 4PR0A 1KYWA 3NMUF 3PF9A 2H2DA 1AK2A 2M6KA 5JNRA 2JAWA 3C3KA 3HJNA 5CNMA 2YINC 3LH5A 2ZKLA 1EP1B 4JBHA 1JN0A 3QUTA 2VRWA 1W85A 4JI7B 4JBIA 1RZUA 3NVKI 3JQBA 5DDIP 1M2KA 2ZTSA 1V8DA 5F7OA 3U1BA 2Q2VA 3ANMA 3BXPA 4FGWA 1V1JA 3HCWA 3L7AA 4PPQA 4AP5A 1QQAA 2GCEA 3PSAA 1HETA 3EXFA 1X92A 1G21A 3TKYA 4UTNA 4R8KA 3URMA 5I7OA 1RRFA 1PK8A 4EYQA 4JI8B 2PNFA 4PZYA 5DTIA 4IDHA 1ZN2A 3DOJA 1FU4A 4XAQA 2Q45A 1H93A 3HFGA 1OXBB 4BQSA 1DBIA 3L77A 1FX0A 1B74A 1G8FA 4WNIA 5B1EA 1N4DA 4H3KB 3OZRA 4LDZA 5F76A 3U40A 1X7WA 1LC3A 2PKEA 4XWKA 1N3BA 2B2NA 1YZVA 3PJDA 2R5NA 2ZIFA 2G63A 3BFPA 3FMIA 5E9JA 5HF6A 4NBTA 3U31A 5B58C 1FVOA 2BFMA 2C61A 3LY7A 1H2EA 3H9GA 2YWDA 1VBFA 4RD6A 1PWYE 3PGA1 4RJLA 5AVKA 1TADA 2BV3A 3HC7A 1HDXA 5E6UB 5FUXA 5HKLA 4ZI5A 3A4IA 4JT2A 2I80A 2MYNA 1EFRD 2GTPA 3LKBA 3FB4A 4PY2A 4NFYA 3FSRA 1YBHA 2JLYA 4HDCA 3O8DA 5CK5A 2QLFA 1IRXA 1X8JA 2BRUC 2BF7A 1IU9A 2ADMA 1NR1A 2WTAA 1PZMA 1EAYA 2HPZA 4YP1A 3SF0A 5HUJA 4FGZA 1T36A 1Y3DE 1RPNA 5A4FS 1O8BA 2WFLA 1A9PA 1RZRA 1B6TA 1R0ZA 3QEMB 5B37A 1DRUA 3UGJA 4LHZA 3ASUA 2OLEA 3HZZA 2ID8A 3MVEA 4EZEA 5AKZA 5C0OE 1OKKD 1WV0A 3D0KA 1GPYA 2H1CA 4R16A 4WW0A 1FNNA 1P2SA 2G4CA 3U49A 1SXHA 3OZDA 1GXSA 4KPUA 1Z0IA 1ZD4A 1ZH2A 3RUCA 3NP9A 3EG9B 5JXGA 4UPDA 4HWPA 5FBRB 3CPJB 4HUQA 1P0FA 2H1VA 4RK0A 4KR7A 1AHIA 3CRVA 2XKJE 1KJ8A 1XMIA 1XJCA 2QD3A 3QMPA 1JEAA 4ZVQA 1XF9A 5K6AC 2HU7A 1P0IA 4P4LA 1EFPB 5JSYA 4ZI7F 4KB5A 1U5BB 2D0IA 4TMFA 4DLZA 5FTJA 2XE4A 4YUAA 3TR6A 2X2EA 3T61A 4BNFA 3IT0A 3IIMA 3OMXA 4I2VA 3ZWKA 3P52A 5EXTA 1X13A 3IGFA 3WISA 1QLJA 2AG8A 2B83A 4LWZA 2QRGA 1WB5A 2HFKA 3P4XA 1DOHA 1J0CA 3FVTA 4YJ3A 3GYGA 4M55A 4C4YA 4Z2YA 4BO7A 1DPFA 3JVEA 1AM4D 4TT8A 4G6ZA 1W88A 1RJWA 4QQ8A 1BVRA 2VAVA 1I0IA 1PR4A 3UC9A 4LGVA 1GDTA 1P0MA 1E64A 1VHJA 5BORA 3FTFA 3S8EA 3FSEA 4PYNA 1Q3HA 1Z88A 5AW9A 3KD3A 3AHCA 3OAAA 3VI3B 1VPVA 2QOEA 1GNQA 1I10A 3FDFA 3THRA 1VSVA 1E4EB 3WJ7A 3AEUB 1YRHA 1ZN7A 4MA5A 4NARA 4KK3A 4PN3A 1GUAA 1RWBA 2QX4A 2V98A 4AYXA 1YONA 1SPXA 5B1SA 3LBAA 1YR2A 4GF5A 1G1MA 2DHDA 4D42A 2JJ8A 2BMEA 3WQSB 1CYEA 4J2OA 2Q7OE 3N0TA 4H0NA 4IUCS 1RXEA 2VUSA 3LBYA 4AIRA 4UHDA 4KV9A 3OOYA 1WUIS 3F5QA 3L7JA 3GGSA 4O4HB 1FB5A 1GQRA 2X22A 2FPRA 3NT4A 3PC6A 2RC5A 3LXXA 4IDDA 5JH7F 3PXCX 5F5XA 2WRZA 3IMCA 4HV4A 2P9QA 4G0ZA 3KPWA 1HO3A 1WCIA 2YXEA 4EKYA 5HBGA 2QI9C 3G1UA 4RKQA 3LBIA 2ZETA 2LKCA 4L07A 4LYFA 4M9SA 4J3NA 1KMMA 5AVWA 3IP1A 3ICVA 5KUTA 4X45A 5FAXA 2CDRA 2H1FA 2AUNA 3BH6A 4FYYA 5I7VA 4DWVA 3HL0A 3TQRA 3DP7A 4LS3A 1TJNA 3WB9A 3F5MA 2YXBA 4BJ5A 1YAHA 2V59A 4YI3A 3R6WA 5ICFA 3R7BA 3T7EA 3R0XA 4F71A 3NGLA 1RPAA 3CIFA 5ECYA 3RODA 1P61B 1IN1A 4S2EA 4PYQA 3ASVA 2H18A 2VJMB 3GFSA 4FFWA 2NO5A 3LHSA 3I30X 3FFWA 5AK3A 2XE8A 3U7EB 4DNOA 1U7OA 2G8NA 2JH3A 3IUNA 3MS7A 2YHIA 1Z6AA 4FWTA 4ENVA 3RC7A 3OZCA 3GG2A 1WETA 1N0WA 1PTKA 4ZALA 3FPCA 3UYKA 1NBMA 3F90A 3I64A 3T1VA 1P39A 2P6PA 3Q7SA 1MB9A 1G6HA 5T4HA 1Z5UA 5KOIA 3LUKA 2W9XA 3BEDA 4PRKA 5CW1A 1FQWA 1FFGA 3MBIA 5IKMA 1URPA 2X6TA 2OM6A 3R24A 3CG0A 1PN3A 1JF8A 4RLHA 3V4ZA 1BVUA 2VNKA 4I8IA 4RLQA 1KZ9A 4QWWA 4G25A 4A2PA 4NBKA 5FYQA 3ZY4A 4QJ5A 3CF6R 3SQNA 1R9JA 2LXNA 2VP4A 1Y5LA 3HCOA 3LA8A 4H7KA 4UXIA 1PUJA 1UEXC 4G0XA 3DEAA 2AFVA 3JWIA 3TLMA 521PA 1RYMA 5LWHA 3SQXA 4L95C 4F5ZA 3GP8A 1CJKC 4K87A 3GGGA 1NFQA 3G0HA 2O07A 2ZJOA 4PLYA 2AC4A 3AL2A 4NMMA 4AG6A 1XE3A 3FNEA 4RSHA 5BWCA 5HYVA 2V7EA 2C98A 2A94A 3QOXA 4BNGA 1FNMA 1VXOA 2O6LA 1H1LA 3HVHA 1COWA 2XWBF 3P0EA 4MRMA 1MOZA 3R6GA 4MQ4A 1G8PA 2FUG6 2H2FA 2H0RA 1AS0A 4U2CA 2PJUA 4HAZA 1DU4A 2ANCA 2RKBA 2Z1DA 4HGQA 2KS6A 2ERXA 1MTZA 3GJYA 3BHMA 2PZFA 2AFHB 2AZMA 3IO5A 1NMEA 3E7FA 4J9VA 4RHTA 5KYXB 4W9RA 3H9EO 2FN7A 3EDQA 4GR9A 3CWCA 3N7UA 3OOJA 1FJHA 1A9TA 2QRZA 1KQ3A 1TTQB 1EX1A 2PZBA 3G2IA 5K8TA 4D26A 5JSFA 2JZOA 4HSEA 3TXYA 4GNKA 4IDNA 2Q6OA 5L95A 1Z8DA 2O8VA 4NONA 2W6JA 4Y67A 3EOAI 2GZDA 4UARA 4DRXA 2FGKA 1QOZA 1WKCA 3FBTA 5CNKA 1E0SA 3QP9A 1DQZA 2I54A 3DDWA 3LXMA 1Q50A 5B7PA 1QYVA 1ZCBA 2Y0CA 4O63O 1JHQA 4IJ5A 4URWR 4BYGA 1Y9JA 2IYTA 3R3YA 3UJNA 2H1WA 3HWSA 1E5DA 1TJ3A 1UOPA 2J4CA 3B70A 4NRDA 5GV7A 5IJZA 5K5EA 2YZKA 4OJNA 4DV1B 3D3WB 4FHGA 1LX6A 4P3XA 2DAPA 2XNSA 2ZTMA 2OCXA 3G5UA 3Q72A 1YE5A 4MGIR 3KOMA 3D2BA 4G2TA 4G1EB 2ZBQA 3K6RA 1Z5NA 4KWTA 5JC8A 1DBPA 4BN4A 1F5SA 1HYHA 3G2KA 1J5PA 1AOXA 1RPTA 2EWWA 2WABA 3HRHA 3V8BA 1KOJA 1IJKA 1PL7A 3KT0A 3NAMA 2ZJFA 4J2HA 4K9KA 1C1XB 3FJOA 3WO0A 4D45A 2ZYHA 1JG3A 1POWA 2P90A 3DE6X 4FBLA 4K8OA 3SKXA 1PT7A 2WD7B 3FTNA 1M8PA 2ZANA 4FZJA 3WGYA 2VRBA 2O0MA 3JY6A 3HXLA 5IAJA 1RDFA 1TK3A 4V0MA 3IODA 1RKQA 1BZYA 1PFWA 1WY7A 5I7AA 2HYIC 4Q4HB 5HFAA 4OBEA 2A1UB 4O8ZA 1HYBA 3A3KA 5CLIA 4HGPA 4J7AA 2I91A 2EJVA 1KTIA 2NACA 1ZUHA 2ZBPA 3LQYA 4YXWD 3RRMA 3FCOA 4IH4A 2Y4OA 1XA4A 3VZRA 4F4FA 2OHJA 3AVWA 3STHA 2Q3MA 3PUXA 4GGPA 1DB3A 4IH1A 4TLAA 1E9BA 1QJCA 4G9BA 3ENWA 2QZZA 4XB2A 2OHOA 2QGZA 1GITA 3FNFA 5ITVA 1L4LA 1YXMA 5I4BA 2GFQA 2BKLA 1QS0A 1A5AB 1N6KA 2NU6B 1B8UA 2Q3DA 2QTBA 2UYQA 3IVRA 3OICA 4Q7MB 4D4MA 1FSZA 1IONA 3KFLA 1UPXA 1V3VA 4BFXA 3DEHA 1E6CA 3BKXA 4YRRA 1OFUA 1T8YA 2WM2A 1TUBA 3NYWA 1NBWB 2HGSA 1A96A 1CVIA 2EJCA 1T9GR 1R6XA 5AVOA 5JVDF 2L69A 2ZRLA 3AO0B 4FFOA 1BS9A 4HVLA 4CF5A 4CRWB 5TF0A 2QU8A 5B4TA 1L9XA 1Q3KA 3LLSA 2WW8A 4HXFB 4ARBA 4EVIA 3GELA 5I9TA 1IQRA 3NJRA 1BFDA 1RM5A 2WJIA 3ZKAA 5LZ7A 2B7CA 1V6AA 4ZGBA 3W77A 3CH4B 1QIKA 1EM6A 2DFPA 1RJGA 4X6UA 5AESA 4GOKA 3QKTA 5A7HA 3BWCA 1W4ZA 1KVRA 4X71A 3ET4A 3JWHA 1IY0A 3P2YA 4JX8A 5HIIA 1UDXA 2GJ4A 3PIIA 1CY8A 4H6XA 4INAA 4L2IB 1Y3HA 4I46A 1LBEA 9ABPA 3D5QA 4I08A 3M4YA 1JQAA 4OU5A 8AT1A 4IJMA 1Z45A 4BB0A 2BFCA 4EZIA 1PVOA 1EVJA 1JS1X 3NUZA 3TFQA 3EOBI 3WLQA 3DGEC 2P68A 4AO7A 4C5BA 2WU8A 1P3DA 2VJQA 1YQDA 2DFVA 3OPYB 4LJ9A 1ORWA 4BO9A 3T9EA 4ES6A 5JALA 3GPCA 5EMNA 5T67A 3HB9A 4PQGA 3C3WA 3LYHA 5FQOA 3SHVA 3Q3JB 2H1OA 2I6TA 4PSKA 1CJVC 2HQ1A 3C5EA 2WHRA 4ZOLA 5DBGA 3P9KA 3BB4A 1NVVQ 3N9IA 1GUYA 5EIBC 1OB5A 4NEGA 1F2TB 1RQLA 4HT3B 5DLYA 1EGVB 3T7TA 1NBEA 3EBLA 1I14A 2R4TA 4HPJB 3LL7A 1ZK1A 5INTA 2R8EA 3M3HA 1Q12A 5IXYA 1B15A 5KNCD 5J3JA 2WUWE 3U6KA 1CUXA 4WK2B 3HVUA 3ZV6A 2NNLD 1CERA 1ZK3A 1Y1TA 1XRSB 2C7OA 5BV0A 2VHQA 3DOHA 1WMDA 4NKRA 3EBPA 2OK8A 2HNAA 5IYZA 1C80A 1V71A 3JAMA 5G1OA 2CXXA 1IHPA 5DTEA 2LP4Y 1F5NA 5TMDA 2LDXA 4D9HA 2CLHB 1DV2A 1QH8B 1VECA 2JH8A 1PWZA 1DKMA 2NT4A 3MFYA 4J94A 1ZUIA 3U44B 3PIRA 3PQ8A 3H11B 5ILGA 1A9SA 3WGHA 2IV3A 2MR5A 1UKAA 2VP5A 2HC9A 4OMDA 4MHSA 5LVAA 2CLLB 1FNDA 2HRQA 3GJ7A 3QLVA 4F2DA 4ZGGA 1U0LA 4ABTA 2J6CA 4B4KA 2CEKA 1QQTA 1UJ5A 1W47A 3MJDA 3ONVA 4FLFA 4DG9A 1C81A 3HVKA 2P41A 2B5VA 3K1ZA 2ZYRA 4M22A 4TTJA 1ORDA 3HR7A 2YWHA 3MWGA 3KBOA 1T3TA 3Q1KA 3VDQA 3ZGNA 5CDGA 1NQAO 4HRVA 2WSSD 3I39X 1L7XA 1CQXA 2IYLD 2UKDA 3WDSA 3T34A 1VE3A 3G49A 4COOA 3N07A 5ADVA 3OCCA 4PFSA 2ONCA 2X1HA 3QBJA 4XOIA 1SKMA 2ZUDA 3H16A 4OI4A 4BFUA 4DT1A 4RTKA 1EP9A 4LOIA 1Z83A 1V5FA 3JYLA 5F5NA 3KB8A 2X3FA 5KAPA 5B1DA 3PXUA 1MW8X 2PWZA 1EAMA 2IBSA 1ZSNA 5ULLA 5C32A 4KI7A 5A0TA 1OC4A 1Z6ZA 1JT9A 3F98A 4NOJA 4BQEA 3AWDA 1VLMA 3WO1A 1MAHA 3VKGA 4BB6A 1HDGO 4QBIA 5FA8A 2G17A 4PYRA 3WNVA 4CUJA 2WAXA 1R6AA 2BKAA 1ZRHA 3OPYI 4ZAVA 2LCIA 2RKWA 1UZAA 1W5SA 3QU4A 4BAZA 1NULA 3UCFA 1WF3A 3DCIA 3NWOA 4P4UA 2HWWA 4TUYA 5HRCA 3AVPA 8ATCA 4YPOA 5JMWA 1WDLA 4DKJA 1MNAA 2E21A 3L7YA 1AUQA 1W6UA 3A9SA 1Q21A 1PHRA 2VYVA 3ICCA 3M33A 1PG5A 4K9QA 4ZOEA 4CF3A 2OCBA 3EQ8A 4JBWA 4M7RA 5EWJA 1P5HA 3ZGLA 2KLHA 1WP9A 3OZTA 4IG4A 4LJSA 4EVSA 1EVIA 3U0VA 3SCZA 1OMOA 3NT2A 3UWKA 4D9EA 1DAFA 4PCUA 5T41A 4AWBA 3VVBA 3AR7A 3BWMA 3DZIA 3RSHA 1SA0A 2OV6A 4YMVA 1SXQA 1XOIA 1ZH8A 3AJ9A 3PKJA 2FG5A 4ND3A 5TSDA 1R4NB 3L7KA 4JVMA 2W98A 1GILA 2DH6A 3E9RA 4N3GA 1Y7IA 1KYZA 2O7VA 2G9QA 3ZUPA 2P8JA 2FRDC 1EG7A 3FZNA 1T3ZA 4UUQA 2QMYA 5EIFA 4UNIA 4BNXA 3MLEA 4FDAA 1CUGA 2DFTA 3EIWA 1XO1A 2I7VA 1DC7A 2E18A 2WWGA 1XU7A 3OBBA 3RROA 5IDYA 3NATA 4JC0A 4M8IA 3Q3HA 4UNSA 3ZDBA 2ZBEA 1ST3A 3G2JA 4M1EA 4ND2A 4J03A 2B2XA 4DV3B 3KX2A 1UJ6A 3GLFB 1XP5A 5EIXA 1YC5A 4US1R 1HFEL 3EUAA 2GR9A 2W93A 1U3FA 4NBUA 4BO8A 4DPKA 1MKYA 2CNLA 2QENA 5LXTB 3MUEA 1ZOSA 1D2HA 1SCUA 1KE1A 1LKZA 2WU4A 5ADUS 1BTOA 4ERXA 5DM60 3B60A 1NPDA 5DPMA 1SXJB 3BG5A 3GROA 3O83A 1ECFA 1IUPA 2APJA 4CT4B 3PDIA 1BKDR 2WJGA 3E1KA 3T3MB 1ZFNA 3HACA 1MX5A 1J0EA 1L5FA 2ZFUA 1JJBA 1YKSA 5FNVB 4BVKA 4MVCA 1THGA 1ZJZA 1IXRC 1HSZA 4UDOA 1QR6A 4RTRA 1ZXBA 2JFXA 5ALLA 1TPZA 4MV3A 4P7BA 2R6ZA 4UATA 2BC9A 2GEBA 3BERA 2JI7A 3I62A 3BYZA 3SFVA 1H4VB 4EA7A 4LY9A 5ERGB 1VYUA 2CMGA 4U02A 4GGMX 4DLBA 2N0SA 5E7IA 3UAZA 7AT1A 4TSFA 4HRYA 4EW3A 4F3YA 1BS2A 2HLDD 3T5PA 2GFHA 3M6WA 3OHSX 4I4NA 2QSJA 3FPGA 3WK4A 1JKMA 1RMYA 2HCBA 1U2ZA 1AHPA 4LXGA 9LDBA 3AY7A 1V5IA 4Q12A 4ZK6A 4MRAA 4YMWA 3PEYA 2QUAA 4EHJA 4AJ9A 1L7VC 1YZNA 2NSLA 3CF0A 4J91A 1IK4A 5DRYA 4CLOB 1OFHA 3WDLA 2BRUA 3ABQB 1YAJA 3ANNA 5CJPA 2CBGA 3GD5A 3IPCA 4ZWNA 4IRMA 1DEKA 4MB2A 3DAFA 2WICA 4UM7A 2A2ZA 2B82A 2GN0A 1T9AA 1VIVA 4D9IA 2GEVA 2A8YA 2C2BA 4MV5A 3RFTA 3URKA 4L75A 4CI0B 3PNSA 2YWBA 3FY4A 5C53B 2PGXA 1RXIA 4PX5A 4LHYA 1CZKA 4OB8A 4BVJA 4DCCA 3EXIA 3HJGA 3B5EA 1A0OA 1T5TA 2W2LD 4GG1A 4IX9A 2GDJA 4F04A 4WBSA 5E2BA 5H4GA 4LYGA 3TNLA 1GWNA 5FOWA 2ZPTX 4WECA 1TXGA 3I2HA 2EGGA 4NK5A 4P93A 1CY4A 1DVRA 1RM4A 1XLWA 4L6CA 4TKVB 5AI9A 5DYWA 1OLSA 4AMGA 1XXHE 1XVLA 5K6AA 2GWHA 2Q1XA 3MTBA 3GGPA 3QEOA 5DFAA 2PQ2A 2X2FA 3FKSD 5BW5A 2X8LA 1TZCA 3KC2A 4IQ0A 2P5UA 5J1TB 1JJAA 3VKWA 2Q5LA 4E6PA 5IKEA 2PL9A 2JDID 2ILTA 3OH8A 1WU8A 5CYFA 1VSUA 3NLLA 3QEJA 3AR9A 1WXHA 2OCKA 4MDYA 1JHMA 2D7CA 1J5EB 2PUCA 3RRYA 4G8DA 4O6VA 1FP6A 1O94C 3N3BC 4E94A 1M9NA 3CEJA 4JT4A 5C2JB 3Q0EA 3Q8KA 2O7QA 4QU0A 4KXLA 4YEDA 4MVJP 3BRQA 3C4QA 1NJ6A 2AFIB 2HM7A 4Q39A 5J43A 3QE2A 4N0DA 3SFTA 2Q2NA 3ZTWA 4EIWA 1Q6ZA 3QXXA 4IZOA 2PO5A 5A2GA 1UZMA 1SRRA 2R8PA 1YS9A 3DTTA 1N5RA 1VYTA 4LK2A 3UOGA 3ZIAD 4E4RA 4ENUA 3DLAA 1CCWA 2AH5A 3GUYA 2OR3A 3AFHA 4Q9DA 1EG2A 4U00A 2C4VA 1K8XB 1XCMA 1PJBA 2QYSA 1QZXA 2W00A 4ZI2A 2GN4A 2HFJA 2RIRA 2RK3A 5TC4A 4RA6A 5HJEA 3MC1A 5LP6F 3BILA 4PHCA 3UHFA 2VIIA 2AZXA 1WD5A 4INOA 2G6BA 2OBBA 2NVBA 1ADYA 1XK7A 3AONB 4BN5A 3CURA 3MLBA 3N0VA 2XUGA 4P34A 3UMBA 1CF2O 4RXMA 3B6ZA 4DMLA 3GT3A 5ICSA 4JC5A 2WC1A 4L5BA 1L5HB 4ETMA 1NX6A 2HOQA 1KDTA 2AOXA 2AMVA 2C57A 4QQKA 2H4ZA 1OIXA 4QOHA 1CR2A 3TL3A 1M8GA 2BGMA 4N41A 4WJZA 5KYUA 6AT1A 3LLMA 3OF5A 3JQ9A 2W2NA 3QHAA 4RHYA 2W7TA 1DJLA 2H3HA 3WNCA 4YV7A 3LT5A 1NDUA 4UHKA 3E15A 1BW9B 1T2EA 1XD2A 1NKTA 3UJBA 4B2IA 1HE8B 1M76A 1J49A 4XX0A 3UH1A 3HUUA 2H0QA 1QBKC 1MCZA 2IYRA 4FYWA 1QTQA 2PFKA 3TIVA 1RYFA 3CW9A 3PJGA 3Q87B 3HCAA 5HM8A 4BO4A 4QFMA 2D2FA 5EHQA 3THOA 1NSFA 1WEHA 2Q3JA 5SZIA 3D81A 5K0GA 3KKPA 621PA 3FFTA 3BTOA 3FFXA 4C0AC 4R98A 1ZW1A 3NEJA 4RJJA 2D0PB 3SGLA 4YRGA 2HTFA 3C3EA 4ZOBA 1RPJA 4MW1A 1K7YA 3N2ZB 5BSFA 3I2GA 1RM3A 2RI1A 1ZI9A 2HV9A 1Q1ZA 1S4QA 3FNIA 4JBXA 2DH5A 4XR4A 3ME5A 4FI3F 3QF4B 1K5GA 1KU6A 3HA2A 3HRKA 4LCJA 4U0JA 3SC4A 3O8QA 3SHWA 3KAPA 3F7MA 1H42A 1CLEA 2VCYA 1TEVA 1FYVA 1GYPA 2NUTB 2Z43A 5JISA 4AN4A 1XYVA 2FW7A 1FDWA 3L04A 5CDSA 2O2GA 2WJ3A 4TS1A 1U0NA 5BOVA 1QRAA 2IEAA 3OF2A 2V55B 2AMLA 1QGOA 4GM0A 4Q9KA 1A2OA 5DCLA 3OVMA 4Z1MA 3VQTA 2XECA 4O4JF 3L84A 4KVAA 4PAWA 2P79A 4JKIA 4UTZA 2XMPA 2BBOA 2XNDA 2P65A 3WGOA 3ET5A 4DIDA 5C4MA 2HADA 5I45A 3FPBA 2PZ8A 2O8CB 3CPHA 1N33B 3R77A 4D99A 4DCMA 1UFRA 3HVIA 4F4DA 3CVWA 5AW8A 5FUQA 1UT8A 1V0JA 4NCIA 2PBFA 4EEKA 1T2DA 2AKEA 1EGHA 1LWNA 2Q0XA 1OUMA 1GZVA 2BWJA 1XSEA 4O02B 4OHFA 2I33A 3E8SA 5FHRA 1YRYE 1BIFA 4YUWA 4K2HA 5JH7B 2IPOA 3LP5A 4RKEA 2WT8A 4TKZA 5LB4A 1Q1BA 2GYUA 3PDJA 1EK1A 1L2TA 5EIAA 3MJ4A 4NJEB 1EUCA 1MJGA 1LVHA 3ZBUA 4E70A 3AW8A 3FYUC 4WY8A 1WDTA 4EJSC 1QNLA 4J4HA 5B57C 3V2GA 1EK5A 3BRWD 3H9JA 4E51A 1JDJA 4FBGA 4WRRA 1SO8A 3AB7A 4JYMA 1XQWA 2B4AA 1F2VA 2G77B 2BMWA 2GSDA 3C48A 5FUWA 3SN6A 2FPKA 3LCMA 1Y7HA 4UNQA 5H68A 3DCYA 3L7LA 2QMHA 4HNRA 4HMQA 3ZDEA 5F64A 4IDOA 4Y3UA 4EKDA 1GKUB 2W4MA 3GEIA 3OEYA 2QL6A 1AKNA 1R37A 3EGDA 2EVWX 1N6RA 1FFCA 2FPSA 4Y2VA 2FFRA 3NAGA 1KP3A 4AJKA 3AMVA 3OOSA 2Q4OA 3BCUA 3CZMA 3G68A 4TQ9A 4RSRA 2BE7A 1PJ4A 1XA0A 2AXEA 1DAHA 2E1PA 3JQAD 3NXKA 1V26A 2YWJA 4MTCA 3D2CA 5EFZA 1M1NA 2QWXA 3CVOA 3DM9B 2D54A 4D9FA 3C0KA 1ZR4A 3WYDA 2FB9A 2PU7A 4JDPA 4LRWA 1IVSA 2NMVA 4MV6A 2E4UA 2F1IA 3RC3A 2ZTHA 1ABEA 1KS2A 2GD0A 4BVHA 1VL0A 4Z51A 5J2UF 3R3VA 1YBAA 2VDNB 3EDYA 2H48A 3HCCA 5DBHX 2XF8A 2ECOA 1F2DA 3VNUA 3PXDA 1KPGA 2HRZA 1P7YA 4S12A 5LLTA 3OWHA 1V95A 3DC2A 1P0QA 1T26A 3LUJA 4WLVA 4M37A 3KQVA 1E0KA 3SXJA 4GE0A 2BLLA 4N01A 4BJ1A 4FP9A 3WY9A 1NL3A 1Z0KA 1PYGA 1M2FA 1TYEB 3HE3A 3ROKA 3H4TA 4FGUA 5E95A 1TQDA 5C18A 3L5KA 2ZRJA 4DUZB 2QJFA 4RELA 1QH1A 4OQLA 2P9BA 1XC7A 2PKCA 4KXVA 4WACA 1KZ1A 5HM6A 5ALMA 1FMJA 2ZSKA 2GETA 2AN5A 4R6XA 1J1UA 2XUFA 1OAKA 2VRCA 3WWZA 2FXVA 4JYZA 1VIDA 1GKIA 1IM5A 2VUIB 4WKBA 1YDHA 1NF2A 4GMFA 3ZE6A 4BX8A 5JADA 1GGKA 4PAOA 3RUPA 1U7XA 2WYIA 2W71A 3TL6A 3FH0A 1K4YA 3R41A 3K5HA 5BOSA 1GSIA 1K5HA 3BMQB 2B8TA 4QO7A 1KEKA 2BFBB 1TM4E 1IWBB 2GD6A 1QHXA 4CQLA 5GTDA 3UK0A 1FMTA 1ODLA 2X23A 3B12A 2F67A 4JR0A 4MWEA 3IPAA 2Q2OA 1DQSA 3LO8A 1MT3A 4KDFA 4MJ7A 5DE3A 4A5OA 4AN0A 5CB4F 4UD2A 5K09A 3D64A 1ZM3A 3UWSA 3CNEA 1AKVA 4M54A 3ZVNA 3G6WA 1NI4B 4MSUA 1BD4A 3NR2A 1AU9A 2F3UA 2PHZA 2XGSA 1K2WA 1I4OA 4GXRA 5FTKA 3TOCA 1MVOA 1U9JA 4XB6B 2HRCA 4D98A 5FXMA 4MR7A 4HUTA 3V8MA 1N2JA 1TQ4A 1ZIXA 4ZVUA 2ESRA 1Y6FA 5C80A 4PPNA 2GTIA 4R3WA 5BUSA 4DEYA 3T5MA 4TQGA 3INYA 4JI3B 5CNJA 2GN8A 3KR1A 4F84A 4TMKA 1QQ6A 1RTKA 3M6XA 1WHTA 2D5AA 2Y76A 2BM9A 4XUCA 5JD5A 2I22A 1UH5A 1OXSC 4HDRA 4JR2A 4TMVA 2P2SA 1GUBA 3OP4A 3R4CA 4Q6BA 5IM4F 2WSYB 4BAGA 3EXEA 2HBYA 2QT9A 5JCOA 5JEDA 4UHHA 2FY8A 3PF8A 3UK6A 3QPCA 3QBEA 1BHJA 3A32A 3IBCA 1QP0A 4M8LA 5DN6D 2XZLA 3RYHA 2C2WA 3OBIA 4NMLA 4X1OA 1JR4A 4EO4A 1N36B 4BO2A 1A76A 4BQOA 3AR4A 1U0SY 3SS7X 5KNCH 2G70A 1KEEA 4CVNA 1QYXA 4XYMA 1APBA 1QYDA 2B2CA 1ZH6A 2PX0A 2ZE6A 3Q2IA 1Q2XA 3KQUA 2GQ0A 3PXAA 1K4MA 4N7BA 2JGNA 3JQ6A 1X70A 4YR7A 4YPFA 2ILVA 4BS9A 3LS2A 4IKPA 2SCUB 2I6QA 1PQWA 3E3MA 2E4VA 3ISTA 3OPXA 2QDXA 5FUVA 1I2ZA 1ZU4A 2XMZA 4GLBA 4U2FA 1VE5A 4LN1A 3RS2A 1QIJA 3OE7D 1DQRA 3FCUB 1U0HC 1GN9A 2DPYA 3LPNA 4MIYA 4ZVNA 3C3YA 3EXG2 4AD8A 2QT1A 4KCGA 3DLTA 4KH0A 4M60A 1RYDA 1XQVA 4FNMA 4L74A 4OBBA 5ALFA 1S1CA 1J8DA 4L4XA 5JVDB 2WIKA 1G6KA 4L4SA 3RJMA 5F7XA 1E8MA 4BNLA 1RP7A 1YFKA 3U1VA 2GX6A 5SY4A 4EJMA 1NG1A 4DE5A 2O7NA 4QGSA 1IY8A 3PGMA 5GJVC 4C07A 3HKBB 4BP8A 4PYJA 3JV7A 4OXIA 2BJHA 3LHDA 1SVSA 4G0NA 1YOVA 2QSUA 3LUHA 1DS6A 4BIMA 1R12A 5D51S 4F2HA 3R9XB 3ZQ6A 2IUYA 2NXEA 2VHWA 2JHFA 2QAIA 4KUEA 3KO8A 4YCSA 1HDRA 3R44A 3F6SA 4PGGA 2HIMA 1PS9A 4UMVA 3WRXC 3HCDA 4LWPA 1XXHA 1Z9BA 3NDPA 2HBZA 1GIAA 3ESRA 1H85A 1ISIA 3VMMA 4JLSA 2G25A 1RQ2A 4ND8B 3WBKA 2VHYA 2V74B 3OEEA 3R5KA 4IAOA 2I6UA 4JLBA 4K6FA 4XCXA 4LHSA 3IERA 1VYHA 1XD9A 2QUIA 3C6YA 2IYZA 2P2YA 2ZUBA 1A4IA 2VPPA 3I09A 3GJQA 1W4LA 2VDVE 2AYZA 1T5BA 4OFZA 3GVIA 4XGKA 3VOTA 5IJ0A 4KGZA 3IALA 2YBDA 3BC1A 1JWLA 1WQ1R 4TLMB 5BRJA 1RRVA 2IHKA 2E3JA 1U1CA 1PG0A 4RK6A 1KMIY 3BFXA 5GV8A 2VP2A 3KOOA 1ZN8A 3C3JA 1U2DC 1EFTA 2WD9A 3EPHA 2JEOA 4B3TB 4R7TA 4UVHA 4DNFA 2V97A 2IOQA 5G4KB 2EEZA 4XIGS 1NNLA 4R2IA 3ADCA 4F4UA 1Z6GA 1R1DA 1D03A 2WR8A 1WR8A 2WWRA 3BGOS 3U7QB 5HILA 1G0NA 3L46A 1W49A 3PUKA 2E48A 3ZD7A 2I66A 3CUEF 2JK1A 3RSLA 2OGWA 2Y71A 2R8ZA 3AVXA 3A0UA 1Y8QA 2OCGA 1SGWA 2VPQA 3K32A 2H7YA 3BD6A 3I9V6 4PNZA 4ROTA 3A1FA 3CR8A 4HF7A 5DWVA 2Z5FA 4AI6A 3F3SA 2WF5A 1ODJA 3L06A 3PGVA 2E5WA 3WJ2A 1MB2A 2OHXA 1U3GA 1Z4NA 2VJYA 5A0FA 4F8JA 1TKCA 4QECA 3ZDXB 1D2GA 4B4VA 5B1IA 5KYGA 2GBFA 3KLMX 3KFVA 2PBZA 4NVRA 1JNYA 1Q0SA 2VF4X 2AZDA 1NT4A 4JEHA 4LDQA 3KSDO 1VKNA 4KE7A 4TSKA 5AKEA 4BOYA 2Z6UA 1BEUB 4PIVA 1OWNA 2J7KA 2YWFA 1Q15A 3EC1A 1SD5A 4MIOA 3T8YA 2FRDA 1TYBE 2W8BB 4D92A 1E5VA 1M1YB 1FU7A 1XRPA 2WV7A 3KYDB 4M1WA 1YJBA 4FFMA 5LOVF 4MR8A 3GH1A 1RLJA 1JBQA 1WKVA 2C5BA 1OFTA 5DTMA 4LI0A 2E7ZA 4X00A 3PGJA 4AF8A 3QSYA 2VAMA 4PCLA 3WC4A 1CX9B 3E9CA 3RBXA 4JLVA 1WNTA 4O2BA 2HF2A 3TQIA 4YR9A 4HX2A 5DYIA 5F12A 1YL6A 1X1QA 3ZU6A 5K0CA 2FSVC 1ELOA 2FPIA 3RUIA 1IBRA 1JXQA 3CJRA 1FRQA 3LP8A 3QV1A 2YHBA 1Z15A 1E6EA 4IIUA 3TLGA 4WXYB 1I7PA 1U28A 3VPHA 3GFQA 1IIBA 2FG7C 4M0KA 1RYHA 4Y2UA 4F4CA 1L7BA 3F4BA 3WHKA 1GZSA 3IT3A 4FIZA 2H2HA 4EEZA 1SOVA 2XGMA 2ZRMA 2A92A 2IZOA 3OFKA 4V0KA 4YWJA 1Q92A 1Y9ZA 4YQYA 5HJ7A 4JZYA 4G9GA 2JCVA 1LY1A 5CAEB 5LQKA 4W1RA 3V1KA 4XLTA 4ZRDA 5A5FA 2Q28A 2OQ2A 3HEBA 5GJCA 4ZJUA 4J49A 3DFUA 3QLUC 4IG9A 2REOA 1NRIA 3A1VA 4EFDA 3CH6A 5SZHB 1DFGA 3IUPA 3LY5A 1T1JA 2NU8A 3RUFA 1XMXA 5B64A 5DBFA 3I9JA 3A25A 3KJGA 2QORA 2IHVA 5H3HA 3W34A 1H4SA 1L1QA 4OB6A 4LX0A 4PIPA 3K1JA 2P4SA 2O8EA 3TOVA 1S8AA 2QE7A 1T4MA 3ZBPA 2PS1A 5SYNA 2BBSA 1VG9B 1WOYA 3D3NA 4MITA 1SUPA 3RREA 2JGMA 4NTZA 3H2HA 4H4DA 3Q3GE 1F1BA 1MXFA 4OMUA 5CTJA 4ENRA 2RHJA 5LD2B 2JFQA 4JC8A 3QWBA 4EY7A 3ROFA 4HMPA 4O2LA 4BE4A 4YUXA 1CF4A 3CEHA 4HAIA 4A3SA 2EYUA 3FD8A 2AT1A 2F1OA 5CH5A 3PHIA 2ZS7A 3V8EA 4F5YA 1DC4A 3DE7X 3QENA 3FPSA 3X44A 4AJJA 2W22A 2X0RA 5A3QA 3BIFA 1MEJA 3U7HB 2WHEA 4R1OA 1K6JA 2NT3A 1GTMA 3OQVA 3PG5A 2JI8A 4W5WA 4KUHA 1WM1A 4NMXB 2HK6A 4ID3A 3VBEA 3OECA 4BNWA 1PV1A 1JLLB 1IMOA 1PEAA 4P81A 5EP2A 3SHFA 3ITKA 2CFCA 3AFNA 4K1XA 4C89A 3S81A 5AVUA 1MOSA 1ZIOA 3FFAA 3A7DA 4OGLA 1ZL2A 3UN1A 1ZUNA 2I3ZA 1QIGA 5IF3A 1A69A 1YA8A 3ZU4A 4CUZA 3RAEC 1Q1GA 4HMOA 2GJKA 4O3FA 4M0FA 4MVWA 1O2DA 3D6VA 2VSOA 3V1NA 4B31A 4F46A 1CZOA 4OQ4A 3D5EA 2I76A 4NS1A 4S0XA 5T3YA 4GRIA 3TZKA 1EWVA 3D43A 1XZKA 1GGFA 2X0FA 4IVRA 4ROSA 4Q9HA 5FBVB 5ABPA 3II6X 1PDWA 1AD2A 5KHOC 3K96A 3WL5A 4HQ0A 5HF9A 4LYYA 1K3TA 1X7XA 1FXWA 1O94A 4RS4A 1OH8A 3ZH9B 3PXGA 4EHFA 5EHZA 3IAUA 3KHUA 4RULA 4IMIB 3AETB 5FO0A 1GPWB 2M6RA 4G5SA 4C3VA 3W4JA 2ZPAA 4IIFA 1RLTA 1COZA 3DLBA 1EIZA 5FNZA 3D8UA 4XXHA 1RXCA 4JB2A 1U2SA 4IIGA 4G5RA 1L3BA 2VVTA 2ZJ3A 2MIIA 4NBSA 5FADA 1X87A 5AKIA 4BYMA 3UGQA 3IKMB 4EW1A 5H8WA 1XNJA 2GBCA 3TH5A 1SEVA 1OBCA 3I37X 3VO9A 2IH2A 5T8KC 4PICA 4M88A 3ZNPA 5CDUA 2Z30A 2X3UA 1C7QA 1Q19A 2PMFA 4R9NA 1GPBA 2B78A 2D7JA 5FBKA 3B53X 3LUGA 5JS8A 4PSUA 2RHGB 4XWGA 4RV5A 1SEPA 2IYFA 5LA6F 1GFZA 1AV7A 5ITZA 2FPWA 2WTUA 4BEVA 2IXBA 3QUAA 1KZGB 3K05A 4K28A 3DKIA 1L3IA 4WK4B 4QUEA 4Q3EA 2EV9A 1HT1E 1ITZA 4GBGA 3VTFA 1T1IA 3ANTA 1U1FA 1CUYA 1W2HA 1E4VA 1Z47A 4FMCF 2YN4A 1E5TA 2P69A 3H1BA 4JITA 3AKCA 5JZVA 4QRHA 2CMFA 4YLEA 3ZZNA 2ZJBA 3SM3A 2Q2QA 3KB6A 1T25A 1EVQA 2XR1A 4WN9A 4Q1BA 3M70A 1E2NA 1KJNA 1ZCZA 1XALA 3CUWA 3KCQA 4H08A 3TKLA 3ZE0B 3FZYA 4CCSA 4W7HA 4AY2A 4A6DA 3NIDB 1LRKA 1I4WA 1TO6A 4CM9D 2A84A 1EEHA 1JEEA 1CC1S 2QIPA 3TNYA 4DMHA 4MYTA 3CZ4A 3SSOA 1ZOLA 4PSDA 5ALDA 5A1JA 1ZD3A 3K8OE 2O3RA 4OP3A 2A3NA 1OHHA 3EMKA 4ICIA 3ADOA 3G23A 1UBJS 3I5UA 4LVUA 2BFPA 4FR0A 2WTXA 4F8EA 4A4DA 2JAPA 4BO1A 3AP2A 3DNFA 1O0SA 1USIA 1VBKA 4BV9A 1OBVA 3PX7A 4GXQA 5IJWA 3T7JA 4LJYA 3IVMA 3DHNA 4WZBB 1B14A 3GRPA 5ES4B 4OQNA 2QYOA 4L9WA 3UT5A 1H3EA 4KBYA 1XF1A 4RNCA 2FN3A 2W2KA 3Q3VA 3EUEA 3BRCA 3SKYA 5FQNA 1PJRA 4N8DA 3TPFA 2UDPA 1PRYA 4C29A 2I2CA 3OG9A 2OO3A 1QZUA 1BE6A 3DL0A 9LDTA 2LGJA 2QRQA 2XYQA 3L7OA 4QDUA 2AKYA 3EFOA 4RYLA 2L82A 5BN4B 3TZCA 3DZ8A 1RLIA 4ZCMA 1QRSA 2WSMA 1S2LA 2CUZA 1P1RA 1PBTA 3F6EX 3N2GA 1MEEA 3NEYA 3OHPA 4P7FA 1RWPA 1KJQA 2ZEJA 4J6FA 4J1QA 3EYAA 4WK0B 3ZEAA 4BX2A 5LP6B 2X40A 3KOYA 3QLJA 2NVUB 3NBFA 4RZUA 1WRBA 5KNDD 2Q27A 1IPEA 3OY7A 5IWCA 3DFKA 3KLBA 4GLFA 3DL7A 2QRKA 2YKGA 2IPAB 2FZKA 3FPEA 3UCXA 1ECGA 2R7NA 1EPUA 1ACJA 3A6HA 3UEOA 3P0IA 4L0CA 4KOEC 5MN4A 1NF8A 1ZOIA 2AUTA 2C94A 2KMLA 3MOSA 2PTGA 3S29A 3N87A 4DLWA 3I0NA 4K9LA 2JCSA 3HEMA 4DXDA 4FC7A 2J6IA 2PFSA 2RB5A 2YW2A 4XJTA 2DPXA 4LZPA 4EG0A 1E3DA 1DX6A 2BFFB 3E6AA 3FYUA 3MQ4A 4W9NA 3V1UA 1T91A 2JIMA 1CR4A 3DDCA 3G85A 3UUWA 3LTNC 1F9EA 1L5LA 3ISJA 4FN4A 1UWVA 2F8TA 1IZ9A 3BWEA 3DZDA 3E18A 4C0BA 3CUYA 4TYNA 4X8HA 5FH9A 2QQ0A 1MJGM 3AERB 4Q93A 2IYSA 3NIFB 3PHBE 4HZIA 4EECA 1UM8A 4B35A 1XXLA 1WBBA 3TQSA 3D4LA 5BVHB 2PUEA 4L3VA 2VT2A 1JPUA 2OORA 2RGXA 3D9QX 3GMTA 5HE9A 4CPDA 3PZBA 2IXTA 3KQWA 4XD7A 3EISA 2BI4A 1S2NA 3O8NA 2BFDA 5TMBA 4DDHA 2IVZA 1OXVA 3LC7O 1CJUC 4DFDA 3AINA 3RBZA 4FZRA 2NNWB 4NYJR 3OPMA 2G36A 1ZJ4A 2DFDA 1XDDA 2DULA 1KK2A 3BXXA 4K9RA 4LE2A 4OHWA 3T7RA 3VH2A 2V0NA 4CT5A 2ON6A 2UZIR 2XVAA 5JLJA 1XLTA 1MPTA 5LIPA 5HKKA 2Q49A 2X13A 3N59A 3SJBA 1NQOA 1TYAE 3H83A 4Z53A 5T6BA 4KX5A 4V0LA 5FPKA 2H8KA 2Q5JA 4NK4A 2O5RA 2GF0A 2XCTB 5HUHA 4O4JB 3UUGA 2GZMA 2OAEA 4XUDA 5BR4A 4GVXA 3VO2A 4AUKA 4ZN6A 4EHNA 4UOQA 3C24A 3EEYA 2J9GA 1X7GA 5J2TA 2DJIA 1C2TA 4O5AA 1X14A 1R0CA 3RABA 4A8HA 1I2CA 2YYAA 3N39C 2IF0A 5DASA 1JHPA 5F7ZA 2V6FA 2ZSAA 5BNFA 1JSZA 1W94A 3W0LB 1QRDA 4EA8A 2EAUA 3JCZA 5EQDA 4DBLC 4KBGA 2VAXA 1J33A 4XYEA 2DCUA 1L5ZA 3JTEA 3QBVA 3SZGA 3VMFA 1WUYA 2ZB8A 4YDRA 1C9EA 2CK3D 5JSZA 1IZ7A 3PTLA 4JBNA 3ITEA 4XSGA 4A8TA 2D2VA 3L7BA 3F6CA 1II8B 3HUEA 4DARA 5HJ5A 5I7HA 1ZMXA 5JSQA 4NCBA 1IUNA 1OVGA 3BFJA 3BHIA 3L1UA 1DRJA 1P1JA 3A6FA 2YICA 1YJ8A 1O95D 1FYDA 4I1YA 1UXHA 1R9NA 2QF7A 4UXJA 3KSBC 3D8SA 3QBTA 3TINA 4EFMA 3G59A 3SQWA 3CE6A 3UM9A 4BNDA 1OU0A 1J1IA 5LMZA 4LQDA 2WUFA 1RAIA 4CLRA 3C1AA 4GSLA 4C4AA 4UD6A 3OETA 1RRCA 2YTZA 2XNJA 4KQIA 1QVVA 1HTTA 2Q7DA 1BWRA 2QLNA 3WSTA 3DMTA 1JLSA 3CBQA 3TVYA 1PR2A 3VPDA 4DCUA 5J4KA 1F14A 5C1BA 3DBRB 2ZWVA 3PDHA 1ZXLA 3GJ8A 3HLTA 3G2PA 4GYJA 4CCWA 1E7RA 5EKDA 5LR6A 4NYMR 3WLNA 2CY0A 3LCRA 4PC7A 4XVUA 3EXG1 4FYIA 3TE7A 1NNUA 1DZIA 4ALKA 3FAKA 3DMRA 1M2OB 3W5DA 4NFHA 1ZONA 5A05A 2G06A 2IOFK 3F49S 1O4VA 3Q2OA 1L7OA 3KM0A 4PQRA 1ZUWA 4ZVMA 3HXPA 5HTKA 5TLSA 2I5PO 4IGKA 5J2UB 4NXNB 2C82A 1S8OA 3CEAA 3DV0A 1UM9A 1M2VA 3OOEA 4WY5A 3WR5A 4DIMA 5FUYA 2ENWA 1SB8A 2JI9A 3MTDA 4Q4DA 3SFZA 3VDNB 4C76A 4F6RA 2P9ZA 4FWIB 1RRGA 5TXGA 5EE3A 1MC5A 1OREA 2ZBUA 4DLYA 3AX6A 3S2ZA 2O52A 2QM0A 5PNTA 3WGIA 4K9PA 2WD8A 3DYBA 3FE2A 2Y66A 1P44A 2OE2A 1YRWA 4MS1A 3REOA 2FZWA 3L8DA 4EKNB 2G5TA 4WGGA 3QW4B 2HMSA 2C9YA 1TMYA 4EPYA 1Y8ZA 3E9EA 4FVTA 2ZXFA 3KYIB 3WK7A 4NP6A 3JQAB 2D00A 4OQYA 5CG2A 4YQZA 1HV8A 2ZCVA 3H4IA 4G1VA 4JEUA 1YRLA 5L7WA 1GL3A 1SUIA 1X80B 3KBBA 1VB5A 1JKJB 4HYQA 5IC6A 3VR2A 3GLGE 1NP3A 1PQYA 1G3UA 4UPVA 4YA6A 3FNGA 2A5YB 3LHFA 1VJCA 1Z6YA 1CUVA 2BGJA 3CUKA 4LYEA 3UZUA 4PW0A 4HNQA 3IP8A 4HDOB 4YVFA 2XXAB 2J0VA 3OO0A 1X0XA 2VUHB 4JHLA 1TA0A 4MAAA 2REXB 2VPXA 3TW8B 3AY6A 2Y1CA 4DCJA 3VH1A 2BCGY 4ND5A 4DQ0A 5CB4B 2FPUA 2O0HA 2PZJA 4YP7A 3GY0A 5FPSA 2R0QC 3P2MA 3DH0A 1V3QE 1QCYA 1LJUA 4ZC1A 4Q7LA 4JQZA 1E2IA 4H0CA 1WCWA 1A8SA 1F8FA 1P9LA 1ANKA 1U2RA 3FDIA 3UFXB 1UK6A 1UXIA 2BP7B 3EEFA 1EZ4A 1MRZA 4MKZA 1D04A 3G1WA 2QRNA 4S1PA 2VWGA 5G1PA 5LDGA 4Q66C 2R86A 5BW6B 1F7VA 3BTSA 5EYPA 5IUJC 4UEQA 4CEIB 3IPRA 4W8GA 3U7RA 4C0LA 4X66B 3VC2A 2QA5A 3E82A 2XA1A 1XJWA 2V7TA 1GLVA 1N8SA 3DOIA 3WLEA 3NHAA 5CA0F 3QG1A 4TRNA 4IIJF 5BSRA 1TF5A 2G80A 2IIBA 3CT4A 2CV0A 1L4YA 2O2HA 1QC5B 4JYBA 4E31A 3LDGA 3B78A 3LKVA 3C3CA 4AT1A 3COSA 3G7UA 3RYIB 3WKBA 1E8DA 3WGLA 3ZTTA 1H2HA 2DT5A 3PDWA 3PKZA 4AUNA 2CVFA 2WFMA 3WL4A 3TK1A 3O4GA 1QORA 4R3UC 2ZDQA 3TD9A 5CFQA 5EJ8A 1XEXB 2XNHA 3FHTA 3CZRA 2FP4B 1E1QA 3KU1A 3NP7A 1ZN9A 1CZNA 3KB2A 3GCXA 2WILA 2A1TS 4WGFA 5EMJA 1LLFA 2A0FA 2VBFA 5HUQA 5HRAA 2ZI5A 3HB7A 1TT5A 1UKYA 2YXDA 4DBLE 4RY0A 4CG0A 2IHNA 1KY5A 3VXKA 1SKBA 4X97A 2G72A 1EU1A 2R6HA 2HMWA 2NVWA 1P5JA 1RZRD 2Y8EA 4YRPA 1K7XB 1I7NA 2ACEA 3KTAA 4HEQA 3T1HB 4JP3A 3R3JA 1X1RA 4GDMA 4GEKA 2DRIA 3OMWA 2QN6A 3QHQA 3FBWA 3OQIB 5DTRA 3DT9A 3H5AA 4RM3A 4YRNA 2BKXA 5LQNA 1NVFA 3GUHA 3EA5A 4ZREA 1A2BA 1G0OA 2RDMA 1M0WA 1VHTA 1Q22A 1FTNA 1OAOC 3HNOA 3KP1A 4XOUA 1W581 3MTAA 1QIDA 5FR2A 3QFCA 3RK0A 4WA8A 1XI2A 2FEOA 3QVTA 5FO1A 4Z4CA 1YA6A 3LXRA 2OAQ1 4QUKA 1S1MA 4D2IA 1RJDA 1ECBA 1JSLA 3COZA 2EHDA 3BK7A 1ZAKA 4I8XA 3ICQB 1N6OA 4M1SA 1RAGA 2AUMA 1R5OA 4WADA 1T4GA 3K0BA 1ZU5A 3B1JA 3D6UA 4AX4A 1G16A 5FI5A 3ESBA 3FCCA 3TZHA 4OHXA 3GG9A 2AG0A 3KT3A 3A1SA 1QVAA 2C7VA 1TQ6A 1A9XB 2GJSA 3T1NA 3WSWA 3P9PA 4G8JA 1DOAA 1C4XA 1D07A 1TIPA 3AYXB 2GD2A 2I9KA 2BKEA 4OK5A 4OK3A 1RC0A 1F06A 2FSVA 4MKGA 1D4OA 2IV2X 3DMDA 2WG2A 2MINB 4QLOA 5IM5A 2D1YA 3BJMA 4I4TA 2F6RA 4GZMA 2CLOB 4ISBA 3S68A 3V2IA 5JJ5A 3KQLA 1TYDE 5TQ2A 3PYMA 4Y6OA 2VWPA 4YUZA 4B0OA 4V0NA 3N86A 2OFPA 2O0JA 2QHXA 3K4PA 2OZLA 1XYYA 3TJMA 5JNTA 1VMIA 3OAAD 3P0FA 4MJ3A 1WXIA 3HFSA 4HB3A 5H70A 1XTRA 3HU5A 3AJDA 1AXEA 3FM9A 5LYYA 3STVA 2NV2B 4IOMA 1R0BA 1IB0A 1TZBA 2C92A 2JCYA 3DV9A 1CY2A 2HNKA 3L0IB 4PGAA 5ELMA 3Q41A 4X3PA 5BSHA 3KWFA 4KRFA 3IUSA 5KDOA 5I9IA 3GXBA 2V3CC 1PDVA 3HJAA 2CFIA 2CFRA 4U7PB 1N2EA 4LYHA 2FJ0A 3P19A 4BP3A 4BVBA 4OJYA 1KPHA 2VDPB 1SIOA 2Z2ZA 3DR3A 3SD7A 3FTEA 4WCFB 3U9TA 2GKOA 1TLLA 3Q7QA 1Z2DA 3N7AA 3O2QB 4GOOD 4ILKA 4Y1RA 4YJ3F 5AJZA 4V1CB 4QUGA 3W2IA 4WLFA 3WNBA 5JHHB 3MWLA 1EK6A 3PNMA 4K6KA 3JAKB 1UBSB 2JGDB 1A98A 1E7SA 1S9DA 1F17A 2IFTA 3Q9LA 3QJ5A 1C14A 3UK1A 1N6PA 4RKYA 4YS6A 4COKA 5AVRA 2UUOA 3F6BX 3RASA 5JZOA 1KYVA 3L8YA 1NN0A 3PITA 5BT8A 3GMIA 3HY6A 2WUDA 2W90A 1UAAA 1RYNA 3H5OA 4ENPA 1QDEA 4MYDA 5KJ6A 2W2PA 2YFKA 2QTVB 5J59A 5LOVB 1MC8A 3MT9A 2XWJI 3CLRD 5C52B 4LY3A 1QFJA 4XDZA 3VNBA 1Q14A 3A4LA 2FUKA 2G1KA 1GG5A 2C3MA 2R7LA 2A57A 5CIQA 2I6SA 1NBAA 4IWNA 3BIXA 1ML4A 2AXQA 3PFKA 3S1AA 4CV3A 5AUNB 5ED4A 3X2FA 4JELA 2HK7A 4G81A 1USVA 2H16A 1A2KC 1CSEE 4JYPA 1NBMD 4B6PA 3K09C 4R5HA 2A0WA 1C4WA 3PFIA 3ROQA 2QRVA 4NE2A 5F1PA 2C7GA 4ZTZB 3I04A 5FFFA 3FMPB 1GDHA 2J9YB 2GLXA 2X8JA 3HJUA 3MMPA 1SU8A 2XUKA 4HEJA 4K7JA 3BHJA 2PGDA 1F8YA 1Z5ZA 4II2A 2RGDA 4MV8A 4QIHA 7MHTA 1NNI1 3F1KA 3H4VA 1Q83A 3KYBA 3HCNA 4Q7KA 2YXLA 5DM2A 5SZJA 4LMBA 1XZPA 3BXFA 5EP1A 2RMKA 2MSKA 3AZOA 3I42A 2XTAA 1IWOA 3FDZB 3KSUA 3MN1A 2B1RA 1Q0LA 2MDTA 3SR0A 3A9TA 4CCYB 1NMYA 3EVCA 1GOTA 4F60A 5IMSA 3S8YA 1JQ3A 1GLNA 2CWWA 3QPWA 2ZJYA 2QN3A 2C83A 2NO6A 3DHEA 1YB2A 4MEJA 3KJHA 4B6EA 3AJAA 4AZ3A 1FTWA 4X24A 5IH7A 1KMQA 2NXCA 2D5CA 4HDNB 4YY3B 1I6KA 1SK9A 3MFQA 1Z2NX 1COWD 3JZDA 5REQA 2QD1A 2V5UA 5T8KA 3TBKA 4ZKDA 2WG0A 2BEJA 1LRLA 3AEQB 4FZ3A 3BIOA 4H2DA 1QPBA 2CW5A 3A1CA 2AMYA 4L02A 4V0OA 1SU4A 2FLWA 2PUWA 2QP9X 5AJXA 4CFYA 4DC1A 5B1YA 3THWB 1A5TA 1HOTA 4J29A 2C2HA 5CT4A 3CRRA 3S27A 5I5EA 3ROGA 3VYRB 5K0BA 3BFKA 4M8KA 3QVUA 3AI2A 3AKEA 3QOWA 3NTUA 4P3PA 3R0ZA 1WB9A 4RGBA 2JEYA 4WOBA 4UULA 3TRFA 5LQAA 5NULA 3C5VA 4EY3A 4DV5B 3E58A 1MF7A 4TVKA 2CVQA 3NVAA 5CDHA 2W6JD 3WWEA 1HTWA 1UKZA 2XLBA 5IMBA 4FB4A 4N9QA 4CODB 4G0UA 1IEXA 1P33A 5TPWA 1AF7A 4OQDA 2IITA 4KXYA 1E92A 1D5CA 2J9FA 3H6HA 4Q9LA 4BMCA 1HH4A 3RI3A 2JKZA 1ADJA 3B5JA 2N47A 1CT9A 3P96A 4MLPA 2EG9A 4EKEA 1KK1A 4UKDA 1I4TD 3VJRA 3ZX5A 4F9EA 3G5TA 2R47A 1JLRA 5JUWA 3AJRA 4N0MA 1H2FA 1RLMA 4LJ7A 3WQQA 5CYGA 1JIUA 3HSKA 4OA8A 2QR5A 3IP7A 1FA9A 3N2KB 2X86A 3I12A 1A8HA 4QODA 2LDBA 3ESQA 3FDJA 3LT4A 1M75A 3PNBA 3LGXA 2XAAA 3GD7A 3IPLA 1VXRA 2OV2A 4WZAB 1UBCA 3TMYA 4B74A 4DVJA 4XWOA 1CDOA 1CRLA 4W6QA 2EJUA 2J0UB 3CRMA 4XGQA 5C5EA 3L4BC 4HQFA 3PQDA 4CI9A 5BP7A 4BXOA 5TJHA 3K4QA 3EHEA 4B5LA 2F90A 1L8XA 3BUSA 2GRJA 2Q6VA 5AM0A 4NESA 1Z0ZA 4PLWA 2A0KA 1KC1A 2ISSD 4AY4A 3U7FB 1IM8A 5IULC 2P4EA 4CM4B 4W1QA 2XEDA 3GRFA 2UAGA 4CMCA 4KR3A 4ESEA 1BRTA 2PH7A 3W04A 4PR3A 2FMUA 3I9LA 3FSGD 3MK31 3D7RA 1K97A 5KQGA 4K6HA 1A8PA 1Z6TA 4B2PA 7ADHA 2YIVX 3MPUA 1ZLXA 2JGAA 2RI0A 4WCVA 2PEYA 5A5DA 5KNDH 3SKVA 2E1RA 4MJLA 4YT2A 4AU1A 3OZUA 4Y2HA 1VLHA 3K8QA 3AVVA 5F73A 1K63A 2C8JA 2JJQA 2AC2A 4PWYA 3RVPA 1HSOA 4EX6A 2EQAA 4GGOA 4XI9A 3NIWA 3X1DA 5TIIA 1KFEB 1OY1A 3PPVA 3GWZA 1P9OA 3ASYA 4FKMA 2XDAA 1MT0A 2RGUA 1N9GB 4FMCB 4WE3A 3HM9A 1T3HA 2VDLB 2JAXA 3BTUA 4HBGA 1U6IA 3TSYA 5JLAA 4PG6A 2QTHA 2WAYA 5GONA 4EHDA 3GLGA 2ZUWA 3JD1A 3RAGA 1AQIA 2XHEA 3PC4A 5AUPB 3A1EA 4JHXA 5FOVA 3KEGA 4FONA 3FCXA 4QEKA 1M2NA 3DE1X 3REQA 2IBMA 1VJGA 3O9ZA 3GP3A 1QHYA 3BMCB 1OW3B 4LCEA 3WGVA 4PAQA 4UHJA 1G8AA 4B0PA 2WK1A 3O8BA 5KTKA 1Q1NA 2CJXA 1EQUA 4YJ2A 2PKRA 2WHQA 5BWLA 2ETVA 3WYBA 4G0VA 1YR9A 2D3WA 5JW6A 1G7RA 2UVQA 1O58A 3F3KA 3KDAA 4LXQA 4NBRA 4OXXA 5D3MB 4IXDA 3U6BA 5JPIA 3TEJA 1CIVA 1HLFA 1RJEA 1C7ZA 3MS4A 4IDGA 3FR7A 2V4ZA 4OM7A 1UC9A 2XD4A 1UJ4A 2BM0A 3PRKE 4I3FA 2QX9A 4A6PA 4UMFA 4BZPA 5LKRA 2Q50A 5AW2A 3T7AA 1NXPA 4EAQA 4QHSA 1UF9A 2IBTA 2FEKA 2ODEA 2XXBA 1S9HA 2O8NA 3L8EA 3PYLA 3W5AA 1X9HA 4M46A 4CTKA 3COJA 2ZT8A 3GLSA 4TVOA 2A30A 1OROA 4MKIA 3KFXA 1U9YA 4OK6A 2AOUB 4RQBA 4F12A 2O2SA 3AEZA 3GN1A 4MUIA 3UG7A 2NADA 2FWIA 3E3NA 4N0QA 4UAJA 2WQZA 4KN5A 3A3NA 3K1AA 1E5XA 2Q9BA 1DJQA 3CN9A 4II3A 1BCSA 4UZEA 1HLPA 1G2PA 1GPNA 2AEEA 1KYIA 4DTCA 1JHUA 2DE0X 1B1AA 1E2UA 4MRRA 1S3GA 4QDOA 4M7WA 4D57A 4X1YB 4MUBA 1JDSA 1SUBA 1UR5A 3GPDG 3P1JA 3IH5A 4CM8B 5KZMB 1VHDA 2C7RA 1U0BB 1ZSVA 2ZIUB 3T1TA 1WV1A 4H4EA 4Q5IA 1GAWA 1JA0A 1DTWA 2P0AA 3KTOA 4I9UA 1BN6A 2BR5A 3R3WA 5B2ZA 4EQ6B 2GZ2A 2PPLA 4N49A 4M1MA 3SS8A 3T9CA 5IJ0B 2CVPA 1CV2A 2V4MA 3E9NA 3UJ9A 4IRUB 3STYA 5AM4A 1SXIA 4AJIA 2HSZA 4B82A 3R7WB 1XVAA 2KBFA 3SHOA 4BO6A 4D3XA 1FYWA 1ZNZA 5C8XA 3ENQA 3NNDA 3LNTA 2WU0A 3IBTA 4RACA 1QOPB 3WMWA 3UHJA 1TVCA 3GB9A 1G9TA 1SHTX 2VAWA 5FOXA 4K6OA 3WFIA 1T0HB 1YL7A 3LCCA 4B7ZA 1YBFA 1OH7A 4YRAA 1W75A 4ZOLF 1W1WA 4IWYA 2V6BA 2X77A 4NCXA 4Y2QA 2CCJA 1LZKA 3H3FA 4Q1DA 1DRVA 2H63A 2DEUA 3BJEA 2AQ8A 4Y98A 4TVSA 5C7IO 1E3MA 3TRHA 2AMFA 1QLHA 4HKTA 1B8PA 1C3JA 3SXPA 1IN8A 3AWIA 4DLUA 1TA4A 1T10A 1UC4B 4PO1A 2C4UA 1BQ4A 3AF4A 2RAUA 4MKHA 4YASA 2JLAA 3D6TB 4HN2A 4ZRMA 5FR1A 2VDMB 4J0IA 1EQAA 2Z83A 2EFDB 3ZV3A 1TU3A 5CFOA 5KWSA 3B6EA 4JIMA 4PG4A 5IYZF 3AJ8A 4O29A 3I6YA 4WKPA 1NY6A 6ADHA 4EY6A 5EHGA 2VTKA 2RBGA 4B9AA 3U4MA 5IT0A 4AWAA 1DWPA 2V6IA 5D5PA 3ZWAA 1Z25A 2JCXA 2NZXA 1PD0A 1XRQA 2NTJA 1KRWA 3FRIA 2OMEA 3K0EA 3WK9A 3O4IA 1IN6A 3BL6A 4AROA 4OQZA 1VCOA 4H9GA 4LECA 4CWAA 1MDBA 2CWDA 1OE0A 1Z0AA 2H2IA 4JJZA 1P8JA 4JIGA 2FWRA 4KJZA 4KVGA 4LNHA 5BRAA 1SHZA 2XAUA 1J9ZA 1IG3A 3IE0A 2JK0A 1C9KA 3OE1A 3SR3A 4C87A 3U19A 2CV2A 2DKNA 2IL1A 5JCXA 1CNFA 3MJCA 3NBMA 3C7TA 2OAGA 5DHQA 3W9SA 3LHKA 5EA2A 1LVGA 1OYYA 4ATNA 4FBMA 1OGJA 1P73A 3RU3A 5G40A 2CHVA 3N05A 3CLKA 5JDCA 4DIEA 3IO3A 3L43A 4FFPA 1W0CA 1EHCA 2GDZA 3SS9X 4JH0A 2I67A 2M1ZA 2RH8A 3H19A 1AA9A 3P9YA 4XQCA 1Z62A 3D3QA 5A71A 2ZVPX 3SSMA 4Q0MA 4N6NA 1M34E 2I3GA 3BA6A 2IZ7A 4PZEA 5AKLA 5E0KB 5IBPA 3U4CA 5A7FA 2DB3A 2O0LA 2CZQA 5COQA 3D6HA 3DGFC 3EFHA 1UL1X 1B43A 4PHTA 2H07A 3PL5A 3FIJA 3HYCA 4NBWA 1J8MF 4Q00A 4M8NE 2OGZA 2PTHA 3R7NA 4IDEA 4DVGA 5JNLA 2ZIXA 4R1TA 5FPQA 3EXHB 3FPFA 1RPZA 1G4UR 3AJEA 3GNTA 3KE9A 5CLJA 3ZEIA 2YYSA 4OKSA 7ABPA 4D0SA 2MMCA 2WIAA 4TUYF 2OFOA 4O2AB 4FINA 3F6RA 1V11B 3V3KA 4NPAA 3VAAA 4MUYA 3PRHA 5EZYA 1KVSA 1ZOPA 2RAPA 1LQUA 3DUFB 3FHLA 4MYUA 4YNBA 3T99A 4IEIA 3OX1A 4UUPA 3S7TA 4B44A 5K8VA 3IP9A 4K1LA 4ZVVA 2EFGA 4UBNA 1RRKA 5KTMA 2AKAB 3PPXA 1NBIA 4HLDA 1E94E 1S89A 1HEUA 2VT3A 4BNHA 3RC8A 2PBRA 2RCYA 3PFHA 5B4UA 1EI9A 4XQGA 3CEMA 1G8GA 4OBXA 1T15A 2FE1A 3F0TA 3H05A 5CFLA 3A6PC 4C9BA 3AG6A 4EJ0A 2ORYA 5MN5A 4XIFA 4A73A 5BURA 6GPBA 2WT9A 1N5DA 2WVHA 3NCTA 2PGOA 4B7AA 4ZYWA 1BA2A 5KB3A 2PM8A 3E9QA 4LZAA 1Q11A 2JFOA 3RK1A 4TMYA 4U63A 5AVVA 4EA9A 1JDBB 4ECEA 4H3HB 2YYZA 1NQUA 3Q11A 4ACAA 3AF1A 2YOFA 3NGMA 3R0IA 2GZ1A 2PK3A 4G5FA 4KIJA 1Z5OA 3T54A 3VNAA 2JGLA 2EZ8A 3QV2A 2QTFA 1NW6A 5AJVB 5BUQA 3M82A 4YC7A 2HXGA 1QE3A 5L3SB 5HP4A 1SKYB 1FLAA 4F5EA 3A04A 2P9FA 5IS2A 3I8XA 4TS3A 2AHRA 4PZLA 5CVDA 4D5GA 4PXAA 2IXDA 4TSFD 1C9YA 1ECPA 1Z18A 5DF1A 5DWQA 1XDZA 3PKIA 3QE3A 2YRXA 3IXMA 4QUBA 4DV6B 3C16C 5TMEA 3TLYA 5A6SA 1RNLA 1UPAA 5ENVA 1HKUA 2PLAA 1WB6A 4UQLA 1IWPB 1MX9A 4UHCA 1AGPA 1VJRA 5IANA 4P2GA 2HF8A 3TTYA 1W93A 4ZCSA 1AY0A 4OLBA 8LDHA 1E96A 1RWQA 2B98A 1L7MA 1RCTE 2G82A 1DCKA 4RPCA 5M2QA 3VR6D 1RXVA 2PUFA 4P4SB 1OA0A 3OFND 4RGQA 2IX3A 1TM1E 3FRJA 1PKXA 5LCXA 4B34A 5FA6A 3WS7A 3BWYA 4NZZA 2AYXA 2BBWA 4NU0A 3ED1A 4M1ZA 3VOSA 4QOGA 1CEQA 1M83A 4ARZB 4HZUA 1L4GA 1T8RA 2Q4TA 3ILHA 5E6SA 4HWTA 1DBQA 3JPYA 1I01A 2QAGB 3LX8A 4TWAA 4DEVA 1TF2A 3UY4A 3HDJA 5B6IA 2IS4A 3NUGA 1OAOA 2AB0A 3NNSA 4J4TA 3MRVA 4OB7A 4BUJA 4EARA 4YCNA 3AEYA 4JL6A 3X1YA 3IL2A 1WBDA 3HKEB 2ZRHA 4RH1A 1K7CA 1UK9A 5AVZA 1FSFA 1YUNA 1R6DA 3ZQJA 2J0EA 3IELA 2OYRA 1T8UA 1ESDA 3MWEB 3R3ZA 1P2DA 1C0KA 1SOWA 2VNAA 3I3SR 3PD0A 4YMUA 5IJ9A 2XRYA 4P7GA 3ZCPA 4DCGA 5L4NA 4BU0A 1Z4OA 1EHIA 4FYPA 2DUJA 3AEKA 1G19A 5IT9A 1SUFA 5E6RB 4LBZA 4B48A 1VP3A 2KWIA 3PENA 1VE9A 1T5LA 1ZJJA 1Z82A 3AILA 3GFBA 4JEMA 4L4YA 3FMFA 3R0QA 4QSMA 4RO0A 5CM2Z 5FWXA 5JATA 5CA0B 2BEUB 3SE7A 3IQZA 1NV8A 4BCCA 1NXTA 3B52X 3CLTC 4DA6A 2XMRA 4IIJB 4ETNA 4JJ6A 1RWKA 1XCGB 2WYUA 1GCGA 4DG8A 2VF2A 2VDJA 2X5XA 4KYUA 5L7YA 1LXCA 1WDKA 4RLFA 3VAYA 1BG6A 1UMDA 1XTUA 1LQ2A 3OFSA 1G64A 4DBVO 2WVAA 1CG6A 3ZXYA 4BDSA 1F60A 2ZUVA 3V34A 2FX3A 2GS9A 5BN3A 5HVNA 2GB4A 1NLFA 1N57A 1CK4A 1S02A 2C7BA 3BRSA 5EFOA 4JAVC 3STUA 3UB2A 4B3SB 2AXPA 4N40A 1LF5A 2Z95A 3MGAA 4J07A 5FLYA 2GKGA 2PXHA 4XE5A 5HA5A 1Y4AE 2ZRFA 2C78A 1E3SA 5JQWA 2VXYA 1UEJA 4WNAA 2R65A 1ZNXA 1PJCA 2DU8A 4MV1A 5BSKA 4Q1EA 1P5RA 3BXOA 2R4QA 2FNAA 1FYXA 3HO6A 1EHYA 4GO1A 4EI9A 2IDJA 1JFFA 2AZTA 2WP8J 3GRKA 3K1YA 3MYYA 3RT9A 4LXTA 4ZAYA 2C4MA 1OYWA 3K0HA 4LY0A 4YI5A 3W1EA 4IV0A 1TMOA 3G02A 4P3YA 1G21B 3VKUA 1CR1A 1OZGA 2HTEA 1XWWA 4N5LA 5JS7A 1HQCA 3GLHE 4L50A 1YFZA 4BB9A 1EM8A 3GFOA 4M87A 1JHAA 2JD2A 2ZE7A 5JI3E 4INPA 1JHZA 1XPRA 4HB0A 2OOSA 4IJKA 4B7CA 3NAQA 2ORWA 1Y89A 3R3SA 3CKYA 4RVCA 2ORIA 5J5VA 2CXUA 1FX0B 5C31A 5AJUA 3WA7A 2ZSEA 3QPDA 2O8BB 3LFUA 1JAZA 5HFJA 4EYEA 4YAKA 1U0GA 1X7WB 3H2IA 3AYZB 1MU0A 2F1HA 4GQBA 2XOKA 4EM6A 2HREA 1WU7A 1JTFA 5D86A 5EERA 2VATA 2XB2A 2QL7A 3EVTA 3V8QA 2GYVA 3A9VA 4O3MA 2UXDB 2GNAA 5DISB 4CUKA 5K03A 1W25A 3O3NB 1LBHA 1QU3A 2C04A 1GCIA 2N1MA 1B93A 1GL6A 3NB0A 1GZ6A 1RACA 4HLUA 4M21A 4DHWA 1N34B 2NSHA 2X0KA 1JB9A 5J23A 4FOTA 2FEMA 5E8JA 4BQIA 4PG7A 1T36B 2P5TB 5M3BA 4INZA 2A14A 1V7CA 2WFLB 4NPHA 1I94B 1KI8A 1ORIA 1XDWA 2FZGA 2ZWOA 1OPXA 4FMPA 3K09A 5BQPA 5CHYA 5FULA 5LWQA 4JQOA 4FXOA 5I9SA 3FWYA 5HGJA 4DCSA 3UJPA 2V1XA 4O1IA 4QKQA 5C1OA 4KPUB 1FUUA 3C41J 2H29A 1QO7A 4UM5A 2JW5A 5I8ZA 1HMPA 3G3EA 2QI9F 2QJTA 2QVXX 4TM7A 3DBVO 1ADBA 4GWLA 2Z2KA 4DDMA 4M7OA 2P5SA 3AOGA 4QTZA 2PJDA 3RV4A 4D8TA 1SBIA 4EF5A 2OD9A 1U9CA 4L9SA 3VHXA 2HQRA 3I04M 2IWHA 2DMRA 4GPEA 2DX7A 4ISCA 5CGQB 1AXRA 2PX2A 2XNDD 3ETLA 3KVRA 2I55A 3W7VA 4OL9A 3IDAA 4J3FA 1SQSA 1A72A 2PIDA 2QUKA 3G0GA 1UWLA 1PGJA 4A9AA 1EK2A 1MC1A 2GN1A 4GZLA 4QVGA 4U7HA 4QASA 2JBAA 5B6JA 3DAPA 3LQRA 5C8YA 1MOPA 4KGDA 2J3IA 1GKKA 4XIYA 4YJ3B 3O8RA 1LSJA 3IBGA 4L0MA 4I1VA 3GNLA 4IDFA 3ZCSA 4HOYA 5K8UA 1J5XA 1WF6A 3EZNA 3NFYA 4ZA2A 2J3DA 2OYSA 1W88B 2I7CA 4GKVA 1K6XA 4AJNA 2O1XA 4UTXA 3AP3A 3I5MA 1YC2A 1LVUA 4TWBA 5K45A 2LUOA 2FKNA 3TLKA 4A0RA 2F9FA 3DJFA 1A04A 2Q0HA 3E1SA 1HG1A 1SH7A 2FE4A 2PKYX 1LTKA 3D8BA 2J07A 4G4SP 4C0KA 3VH3A 1SVNA 1TA9A 2V7QA 1IHDA 1ULHA 2A59A 2IZZA 2I03A 2OO5A 4R54A 3RRJA 1TVKA 2A1TR 1DDGA 5DCWA 3WGQA 5L4LA 3V4FA 5JASA 4IGIA 1XRJA 1Y37A 3P9CA 1JA1A 5IVKA 2C4WA 3JD0A 4RVOA 1MRSA 2YFHA 2Z3WA 1TJ5A 2VPIA 5FLKA 3GZTB 1KJZA 3LX4A 1DHRA 5D8DA 4CIDA 4RE5A 1T6XA 3DA8A 4CKXA 5CNIA 1AV6A 2QSYA 3RU9A 3GJXC 3L18A 3LVFO 3T3OA 2V3WA 5JYDA 5EJ9A 2K4MA 5K0FA 2ZSHA 4RJ2A 2HAEA 4KZPA 5EJ6A 4JL8A 1WCIB 1STOA 1B0AA 1RI1A 2OXEA 3FI0A 4R01A 4PTZA 3FLMA 4QU5A 5G0WA 5IAKA 1PD1A 1HX7A 1HFJA 1JVSA 1YJAA 4HXEB 3LPAA 4BWFB 3WRYC 2YV3A 5FJJA 2CF6A 3L6CA 2PZAA 3ZJ4A 4Q3NA 4JJEA 1SVUA 1WQ4A 3KLNA 1F9AA 3RUHA 2KPOA 5ERYA 4PO9A 2ZWMA 4RA9A 1N2XA 3L0YA 4HLNA 3SYNA 2GEKA 3VPAA 4BEWA 3RTEA 3ZOZA 2HMUA 4Z3OA 2J46A 1ISJA 1U04A 2BEVA 3ETNA 1FRVA 2EQBA 3UJ8A 1YQQA 3U16A 1SOMA 2FTKE 1CRZA 4K9DA 1UDWA 4UVIA 3GQBA 4IDAA 3CKMA 4FFBB 4MDFA 1NW4A 3G8DA 4QPZA 1FNCA 1LDEA 4NBNA 3EIUA 2VRCD 2FCAA 1T3LA 1KAHA 3HGTA 3HPRA 1T5DX 2PSDA 2J3LA 4JXKA 3L8FA 1Z5GA 3ZV5A 4BVEA 3G17A 1YVRA 1O0CA 1AJEA 3VOBA 1UKCA 1ZW6A 3SOZA 1SZJG 1C7EA 1OILA 2NZWA 3HBLA 1A9OA 3NANA 4QXMA 4CNBA 2NO0A 2VWHA 2XZPA 3IAAA 4Y7DA 2FYTA 2I4TA 2XVYA 2CXPA 3G8BA 1M34A 2DPMA 3LY8A 3A7EA 1T8SA 3O26A 2P2CA 5A9SA 1H0SA 1FQKA 2XY4A 3KJNA 4PTYA 3MWJA 2C1EA 1E0DA 1AS2A 3RU7A 1O5TA 2HIGA 3F7TA 3L6BA 5AK5A 4M49A 3EGVA 2GHIA 3I34X 1RI4A 2ZU0C 4URFA 2QP3A 4HLQB 3TMKA 2AGVA 4D81A 3UK2A 4XDHA 1HURA 2CFTA 4JLOA 4HYTA 4IL5A 1PR0A 3VR4D 3QY0A 2WKRA 4B3JA 4ENWA 4D8VA 5I9NA 4LTDA 3WAJA 4BV8A 4GEGA 5JYEA 2Z2JA 2W83A 3MOGA 2ZJ6A 4MRMB 1CUZA 1MO3A 1VGRA 4M6WA 4RPHA 2HY7A 1TB4A 3ZWYA 2H1IA 3C7KA 2Q4EA 3M8KA 4XSHA 4AIIA 3DTVA 3ZWNA 1U9IA 3B9PA 2BELA 5J4VA 1GKYA 1UMKA 2YY6A 4FTWA 2V3VA 1IOWA 2ECQA 4YJGA 1AVTA 1H9BA 2FHPA 5AQEA 3NHZA 2PRKA 5GM1A 1CBUA 2CV1A 5EHNA 1UK7A 4OQMA 5FWNA 4NMWA 5TQ0A 5HX7A 1RRMA 3FF1A 5K2OA 1QK3A 2PMEA 1DO2A 1DXOA 1U4SA 3MTGA 2K2QB 1JVBA 3DWFA 4Q01A 1JR3E 2B1QA 1B0PA 2C9BA 2B5OA 1A95A 4LC1A 4ZDJA 3N8NA 4EGFA 4DRXB 3F5FA 5KCMA 4KIWA 2D1FA 2Z9DA 2HSDA 1LI4A 3MG9A 1RT9A 1ISFA 3BWBA 5ADHA 4XTCS 4PNEA 4QLAA 2ZOSA 4V0QA 3OIFA 3EA0A 3LZDA 2OFFA 4BQFA 3ND6A 4I3GA 3LLUA 3EFEA 1SCNE 4K6MA 5EXSA 4PLCA 4ARAA 3U7GA 3HN6A 1Z22A 3OT1A 2DSNA 1ZEJA 2H1HA 2QXTA 4AM8A 3D2AA 3KKOA 4HNHA 3U5ZB 1QV7A 1JWAB 3LG2A 2GOYA 3IP3A 4R2KA 2C8KA 3DEFA 4LF9B 5ICEA 1R00A 4HJRA 1A5BB 5U1PA 4AF7A 4FJ0A 1MG5A 2Y27A 5BMOA 3NDBB 1FU8A 2JFYA 1ONPA 2H5JA 4FZVA 5D7BA 3S1SA 4IV5A 4YRQA 3EZFA 1SUEA 4LNUA 1YZQA 3FG9A 1CLUA 1PL8A 2B34A 5M5BA 2QBYA 2J4DA 1OXKB 3L92A 4KU4A 1H2BA 2GBLC 4DLNA 1W4RA 1SVWA 2UV8A 3AIIA 2B9EA 5KIAA 1U8EA 4LVOA 1OSNA 2D2EA 2PR2A 4TPKA 1GTVA 2Q8NA 2OG2A 3KT8A 5DHAA 2I7TA 5JANA 1Y5MA 3AUYA 1DWQA 2MSDB 1DEXA 4KRXA 4DMCA 1NMXA 1F2UA 4KBFA 1IB6A 3ZLUA 4ZC8A 4BBJA 3NRCA 4CT0A 4XYGA 2UXCB 4PQEA 2Y1OA 1L3CA 1IN7A 4BTVA 1XYGA 1O77A 2YL2A 3PHHA 4HUJA 3S7ZA 3W8RA 4IFTA 1KMNA 1P72A 3QEKA 5CLLA 5K3EA 4H7JA 1BWQA 4PC6A 4EKIA 4KLRA 1O3YA 1PGOA 3S2GA 1ICEA 1Y3AA 3OPQA 4WUTA 3S2SA 4ZCLA 3LY9A 4RXTA 2LPMA 2R751 4LX8A 3OEED 2GPNA 5BUZA 4D3YA 1JR6A 4RPLA 3MCTA 4MP8A 3R7SA 1BAPA 4NJMB 5TJ9A 1TUBB 1ZD8A 1SXJC 4ZU3A 2IU6A 4KQKA 4D8UA 4W7IA 3LGAA 4C88A 1DAMA 4UPEA 2D4HA 3NX4A 4KHZA 2B0JA 2G9UA 5K3BA 1HL7A 3R6TA 4Z8YA 2IOFA 5LOVA 4JWKA 4RV4A 3ADKA 1ULAA 2ZTVA 5JS2A 4EYKA 2ZJZA 3PHJA 4QJBA 1PT9A 4D9CA 1QIEA 3GQVA 4D9GA 1YMQA 1Z8FA 4LCBA 3NM4A 4HNAA 1RKBA 1V9SA 1OJ7A 2P3SA 3I8SA 3QMWA 4ZOQI 4NZPA 3GL9A 4QGBA 2OY0A 3BGDA 1Q5PA 2LIVA 2IEDA 4L16A 4PFQA 3QVKA 2Q6TA 3MB8A 1XJ5A 3IR7A 3G0OA 5HE8A 1EFLA 1UZUA 5JQGF 3OJLA 5AKYA 3JQFC 1E3LA 3GI1A 4LFAB 4KREA 2Z08A 4IEEA 5E7QA 4ABYA 3WLIA 2PY6A 3OQ6A 2IOHA 3R3XA 1IRIA 1D2CA 1TD9A 3TTXA 4XGRA 3TL2A 3VKVA 4A15A 2F1JA 4RK5A 5AUQA 3HWRA 2J30A 5HXAA 1T0UA 4CMKA 3P97A 4D46A 3M0EA 5ECWA 4D9BA 4IQGA 4XM0A 4QZVA 4F0JA 3ZDDA 3E1GA 1L6IA 2ODQA 1NU6A 7YASA 2ZGVA 4PC1A 3I53A 3M1LA 3QEMA 1VLZA 3FBGA 3G5LA 1CE8B 3CX7A 1H5UA 1OX6A 4JP8A 5E4TA 1P2VA 1PGNA 1I30A 1VJTA 2JGKA 3GLHA 1BX3A 4IZ6A 1JT2A 1JU4A 1XPOA 2AD1A 2H6EA 4C06A 5BNZA 3K1TA 5BXQC 3PLNA 1XZGA 1M6HA 1TAGA 3FNRA 3HJHA 1HE5A 2REBA 1XDBA 2OSBA 1LFAA 2R5FA 4M1KA 5GZ3A 5ELXA 4KAJA 4G4IA 1GGEA 3EG9A 5CEEA 2ORED 1BWPA 2VRNA 4YJDA 3TZBA 4G5OA 4HDSA 2BGIA 3CA8A 4FW9A 3GT4A 4AMVA 1S3SA 2HN9A 3T3DA 3P0HA 4TLDA 3AUTA 2H54A 3T7KA 3AGPA 1Q0ZA 5KVSA 1YDEA 5C81A 3CZCA 4IXNA 1U63A 3H4MA 4XGIA 1E2QA 1OI2A 3DPIA 4J1TC 4IIXA 1B73A 1B8OA 1Y4UA 1GU7A 2EHJA 2JHGA 2JJ2D 2UZAA 3BS4A 3V8NA 4AUMA