3S2SA

The crystal structure of pyrazinamidase/nicotinamidase from streptococcus mutans ua159
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
182
structure length
182
Chain Sequence
SKALISIDYTYDFVADDGKLTAGKPAQAISKAIAQVTQKAYDNGDYIFFTIDGHDEGDDFHPETKLFPPHNIKGTSGRDLYGALADFYQKHENDKRVFWMDKRHYSAFSGTDLDIRLRERRVDTVVLTGVLTDICVLHTAIDAYNLGYQIEVVQSAVASLSQENHQFALNHLQNVLGATIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pyrazinamidase/nicotinamidase
publication title Get phases from arsenic anomalous scattering: de novo SAD phasing of two protein structures crystallized in cacodylate buffer
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 72
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3s2sA00
2A67A 3V8EA 2H0RA 3TB4A 3S2SA 1XN4A 1IM5A 3O94A 1J2RA 3MCWA 3HB7A 3HU5A 1NF9A 1NBAA 3UAOA 1X9GA 3O92A 3OQPA 3IRVA 3LQYA 2B34A 3O90A 3R2JA 4L08A 3R77A 1YACA 1YZVA 2WT9A 4H17A 1ILWA 3OT4A 3O93A 4WGFA 2WTAA 4L07A 4WH0A 3O91A 3EEFA 3TXYA 1NF8A 3KL2A 3PL1A 2FQ1A 3TG2A
chains in the Genus database with same CATH superfamily
2RK3A 4KO1S 4GMGA 4WESA 3PYLA 2Q2NA 1ZHHA 3DEKA 4LSZA 2XMCA 5A5DA 3LGSA 2GBGA 2XT0A 3HHEA 3GWGA 2X9LA 2ZDHA 1I13A 1AOXA 1EE2A 3KHUA 1TLLA 3LYUA 3WLSA 4CM7A 2HLDD 3G2IA 7ABPA 1V8BA 5KX5F 1E3LA 2R25B 4PLWA 3K7EA 5TSDA 4A0RA 4WKPA 2XCQA 5E1DA 2UYOA 1KK0A 3K3PA 5HS6A 1JHMA 2GK6A 2JH3A 2Y1CA 2EHDA 3B1KA 2OYRA 3T9FA 2XODA 4DIOA 1LDNA 2QYTA 3Q8XB 4YXWA 1F48A 3DC7A 1QFYA 2QL6A 1U0OC 2K7FA 2AA3A 5MN6A 4E15A 1EX6A 2ZJAA 2C84A 4J6FA 3OPYB 2RI6A 3B1XA 4XPIB 1I3CA 1NVXQ 3OUUA 1XZCA 5FOXA 2EKLA 2JFQA 2DP4E 5FTNA 3NBAA 4IVPA 3HVHA 3OCWA 3O4IA 2I6GA 2EFGA 2R6HA 4EDFA 5HKOA 1JG4A 3GT3A 2JAUA 2WJHA 2ZYIA 4EWLA 3H1BA 4XCQA 3K6SB 2CZQA 3L7LA 2OESA 2HA4A 4ARCA 1Y7HA 3EXEA 4RZQA 1KH2A 1B3RA 4M9RA 3A0RB 4DLWA 3GFRA 1ILWA 5CAEB 4M9SA 3DBRA 1WB9A 1NR1A 3OIVA 2JZNA 3KEGA 4AJKA 4LHXA 3DOFA 2YS7A 2Q1XA 2GPNA 3KXIA 3ZHSA 3KKNA 2CFOA 2XHZA 4KXVA 3RBXA 3NETA 5F77A 2NVUB 4J6EA 4XIIA 5LN1A 4HAXA 3W1WA 4FMDF 3OQJA 4R1LA 4Q9KA 5MN4A 4KQJA 4OD0A 4DBLE 1RM3A 1Z5NA 1FXWF 4K6MA 4ZTZB 4C14A 2YOFA 4Q3CA 4LXIA 4V0MA 4NP6A 2SKDA 3GJTA 2WABA 4DPKA 1GRRA 2XMSA 2EX1A 2UXBB 2HK7A 3FNEA 3H2SA 1W4CA 1PJZA 1GCIA 2Z5GA 3HCNA 1U2PA 3QFCA 2FMHA 2PXXA 4PSVA 2UDPA 3GQBB 3L06A 1X1AA 2C7VA 3BWEA 3RJ9A 3BGIA 1SWWA 4NK5A 4TM7A 5AHKA 4DIMA 3GAFA 3KTAA 3AQ4A 3RS7A 1OD6A 3GYGA 2C9BA 3ND5A 4NMWA 2XXBA 3VYWA 3G9TA 3UB3A 5FJIA 2PUBA 6NULA 2ZRMA 1H0KA 2B5VA 4JC4A 4QQNA 4UTPA 3OCUA 1F1JA 4X97A 1TPZA 4R84A 5DNUA 3PWSA 5AI9A 1ZJ4A 3G79A 3LPDA 4OQFA 1ZRHA 3QXSA 4BNYA 1E1CB 1V7ZA 1WCXA 2OGUA 3SC2A 3RVKA 2QSUA 1EEXB 2HU8A 5EVJA 1RW4A 3OLVA 4Y0NA 1IZZA 3PUZA 1UM8A 4LF9B 1YB5A 2QTVA 5C5EA 1U8ZA 4KG7A 5BMVA 3G2HA 1CY4A 5KHLB 1RU3A 4HX9A 3UMMA 3SE7A 4A92A 3DDSA 1J2EA 3WWEA 1W0KD 3FZEA 1VGRA 4XFDA 5K51A 2WSSD 4ES6A 5JNTA 1RYZA 1CV2A 3HMQA 3JAWB 3RG2A 5DBEX 1JHYA 2PZAA 3I4CA 3SHVA 4RVUA 2WNHA 3CTMA 2GZDA 2KI5A 3DM5A 2E4UA 4J0JA 2DQKA 1QP7A 3MT8A 5BRAA 5JBQA 1KI8A 1CEQA 1USWA 2PSSA 3H1PA 4HNTA 3O7MA 1U5CA 3M5DA 4GLJA 4N6NA 1GG9A 2I1QA 2D1FA 2QLMA 5GGYA 4X1OA 3OQPA 4JA2A 2D0PB 1HE5A 1EIWA 1T8RA 3S2ZA 1CSEE 2IU4A 2OECA 1JFVA 1A2BA 3LUPA 3QEOA 1AGYA 3H1GA 3UJBA 2QXUA 5B4VA 1D1TA 1GAJA 2G4CA 3CNEA 1VHWA 3GDOA 4R3NA 5AK3A 5EUQB 4CTJA 4EL5A 2PQ6A 3JV7A 1C8LA 1DPFA 1QU2A 1DDGA 3OTOB 4DR2B 1IL0A 1EXNA 1VSVA 3D7LA 1EA7A 4PZPA 5JCOA 4C5AA 1UQUA 1R9MA 4G5QA 5AP9A 1NPTO 1JHOA 1K6JA 1KXJA 3LHIA 2IPAB 3UJHA 2B94A 2UYQA 3L1UA 3GPCA 1DBQA 2ACWA 1AGRA 3F67A 4I1SA 4AC9A 4AMBA 3PNKA 5I8ZA 3T1TA 3QG5A 3QUBA 1NA5A 3UWOA 3GMIA 2WMYA 1CNEA 2OBYA 5BSHA 4IJWA 4S04A 2PV0A 3EDQA 2OGWA 2HCFA 4U7JA 3D4IA 3BWMA 3KYCA 3EC7A 3GMDA 3QE2A 1JDNA 1SJ9A 3UWMA 3LPNA 1QH1A 2DWQA 3CUUA 3IIEA 3OEED 4XLTA 1VG9B 2X76A 3KPWA 5DM4A 1YO6A 4B40A 4RF3A 3P0IA 4ZVQA 1NDHA 3CUVA 4AAYA 4G0YA 5ICEA 3L4SO 1UXJA 3LSTA 4X20B 3QWHA 1S2GA 2XKBA 4C7OA 2PDAA 1OI4A 3U6BA 3LUHA 2X8WA 3EODA 1KYWA 2N1BA 4CMBA 2FSPA 3PQDA 4LDPA 3TB4A 5SY4A 4C1NA 5BN1A 1GCOA 1MEJA 4JFRA 1W4ZA 2R79A 3QW4B 1PJLA 3FMPB 2TYSB 3MS2A 4RKFA 5JSZA 4KHPB 1FFBA 1ZP6A 3KWJA 4J07A 3I8OA 3W7AA 1QZ3A 2X15A 5E4JA 1KEEA 3TINA 1ODCA 4FDMA 2YNMA 1JNXX 2P11A 1YS9A 3FOZA 3VMFA 1DX6A 2L2QA 2FKAA 2O1XA 2OHXA 2ZEJA 3A1SA 4BFVA 4BUZA 1F17A 3TLEA 3V4ZA 1UPFA 2VUHB 3K4HA 1NVFA 1YA4A 4MEAA 2XIJA 5HTKA 2J48A 1VJGA 3EDYA 2D1TA 4WKCA 4GEGA 3TOXA 4CFZA 1PFYA 1V16B 3HJHA 4AZ3A 1M67A 5DP1A 4QUBA 4L0MA 4EHHA 5BMVF 3ZLUA 5H1YA 4JJ6A 4BVLA 2ACVA 4WY5A 3QVTA 4U3JA 2NZXA 2R751 3NKFA 3G82C 2H4ZA 1PZEA 1ZW1A 2VYFA 1VKRA 2FXIA 2G28A 3MMXA 5F3WB 4A2PA 4WN9B 4U2KA 2O8VA 3KYBA 4X6LA 5IBPA 5AMXA 1PL6A 1Z56C 4DA6A 4OHYA 3F8SA 5JR3A 2HZBA 2QUJA 1ID1A 2E1RA 4MJXA 5GY7A 1YTUA 1B42A 1CUVA 2N42A 2OD7A 5HF5A 1QTRA 1LJUA 3HDYA 1O57A 2DTDA 2QRZA 4NMLA 2VUIB 1WXDA 4O4LB 4P86A 1PG2A 2K4MA 1ZFNA 4IDPA 1ZOOA 3UXEA 3IO3A 2HWXA 3DVSX 1BROA 4K6OA 4CDMA 2WW8A 3R0JA 5C37A 3DMGA 1WEKA 3QF4B 4FGKA 4OM8A 2XB4A 2CKDA 5LDDC 1L8QA 1JXMA 5AM4A 3HU2A 4H0CA 4ZHSA 1RM5A 4FCCA 1DIAA 1BX1A 3CC8A 1UBLS 3TR5A 4NMXB 3GDFA 3K2BA 1I9GA 1J5PA 3KWMA 3P9RA 4N7RA 5C3UA 5BT8A 4TXMA 4ARVA 3A4YA 4JH0A 2Z6QA 2P3SA 4II3A 2FOLA 3IOCA 1YK1A 1GAQA 3GPDG 4ZDWA 1M10A 5JISA 4AICA 1YCDA 1T2UA 1K3FA 1DRVA 1NW6A 2WJAA 3G5TA 1PL0A 1IXZA 1ITZA 4FMPA 1PWYE 1T6YA 4PBTA 4EPVA 1B23P 1XZAA 3BXGA 5IN5A 5DYNA 1H0SA 2D5LA 3A05A 4NK4A 1I3NA 5ADUS 3A9TA 1I0IA 3GPBA 4DLBA 2IYZA 1J0BA 2Q9CA 4ZT5A 5AW9A 2CNLA 3CRRA 4P32A 3RAFC 4TYNA 1VIDA 4DC0A 1VI5A 1GUAA 1E60A 3C4VA 1UXKA 1ISGA 3D4LA 5FPHA 1FL9A 4JI5B 3QUSA 3MFQA 1E3EA 1EM8A 4KGVA 3IPRA 1LSSA 2WJYA 1ZVJA 1ID8A 1JLLA 1YASA 1WF6A 3PVZA 1XUOA 1W9HA 2ZETA 4FYYA 3FWPA 1M5TA 4HATA 4L9RA 4H3KB 3T3HA 5AXDA 4MI9A 3CVVA 5JZOA 2JFWA 1G55A 1PJ2A 4IQ0A 3KSRA 3IAHA 3LD9A 3D6FA 4M7RA 1GKIA 3KZCA 5TVGA 8OHMA 2JAOA 1TZCA 3NC1C 2BLLA 2P2CA 4GBMA 5TS3A 5DGCA 2JB9A 4AP5A 5K99A 4F12A 5BVHA 4QXMA 4YLEA 4HB3A 4NYIR 5L3SB 6GPBA 1E59A 3QF7A 1KMIY 2QLFA 3N76A 4Z53A 1XEWY 3GLHE 5IKPA 4B47A 4Z4GA 4MVJP 5CK4A 1G98A 4HNAA 1EFKA 1W96A 4J7XA 4IJ5A 2M9MA 2R00A 2OK7A 3FIUA 3NXKA 5COQA 1D5WA 2CYBA 3ONEA 16PKA 1I2CA 2CZGA 3B9QA 5KQGA 3UUWA 3KKKA 1EM6A 2YASA 2X5JO 2GCPA 2MOKA 3B7PA 4TQGA 3BRWA 4KR9A 4EJSC 2V7GA 4AM8A 2BOVA 2WYUA 3EGXB 4OXYA 5GJVC 4YT4A 5JC8A 1E6UA 3C7AA 3IMFA 3OZRA 2I3AA 3FUCA 4BIIA 3RAEC 1I1OA 2CWWA 2WBLC 2X6RA 4MPPA 4BE7B 1Z63A 4EBFA 4E14A 4DHWA 2PEYA 5AJTA 3U44A 2JVIA 2Y4OA 1MXHA 2Q7XA 3B52X 5COAA 1P5HA 3B82A 3EVZA 3IBSA 4TTQA 5KNCH 1T5TA 1XDWA 2VZEA 3ZHTA 2AFRA 4JX9A 3RVOA 5LQSA 3ZWQA 4XQCA 2PGXA 1T3TA 1D4OA 1LW6E 1X0VA 2APJA 2YN0A 4GECA 5JIBA 1O6CA 2OV8A 1ZUNA 3BYZA 3HRHA 3RYFA 1A8PA 2JBHA 5JH7A 3T5PA 2W2MA 4QVIA 4B75A 4YQFA 4KO3S 1JL3A 1FSGA 2Z4RA 3OFSA 1FNMA 3BA1A 1QIJA 3PNQA 2MYNA 1X9IA 2XNSA 1G18A 3ISJA 5KYUA 1CVIA 1NBHA 4KRGA 5JHHB 4G65A 1PS8A 1MX1A 3HJGA 3IHWA 2NVWA 2I8CA 4R0NA 3SOPA 5EJ5A 2JGEA 1K7CA 1EWYA 3L1VA 5EWMB 3ZI7A 3TR0A 5IU6A 1ZX1A 4DV3B 3ZIDA 3ETCA 4IIUA 1XJCA 1P7ZA 1WAMA 2VNAA 4JQSA 4XSGA 4MRPA 3WY9A 5AUOB 1AS2A 1H5UA 1JV2B 1PHPA 2WMOB 3HRKA 4Q4LA 1ZIOA 4FINA 5EWJA 1VL1A 1G7CA 4G0PA 2GO7A 1H23A 4PZYA 5JFOA 1IHYA 3D3WA 4MLCA 1FZTA 2IITA 2WPNA 4MW6A 4MQFB 3RTDA 1Y1TA 4WECA 4ZARA 4D0RA 3WAJA 1RZRA 4JR1A 2AV6A 3QE3A 2HCTA 2LIVA 4CLHA 2IW1A 2BGWA 3PFNA 2HM7A 2Y6UA 3FLAA 3WFJA 1D2NA 4GYJA 3JQDA 3WJ1A 5A2QA 1U7ZA 4HDAA 1EGMB 4N82A 1KYVA 4CKEA 1GAEO 3PNVA 1IQPA 5EQJB 2P4EA 1UBKS 2RJNA 5KHAA 3WKCA 3ZW8A 1KKMA 1T4CA 1R0YA 4AN4A 1TW2A 2R65A 3CZMA 4RTRA 4A36A 2W90A 3I6IA 4XSHA 2AG6A 1EVYA 2PSEA 3KV3O 5ILGA 4BEBA 1B0AA 1Y1SA 4IIGA 1MRZA 4WOJA 1TIBA 3VH4A 4Z4EA 1XXHB 3ZE6A 1KEUA 4LNUB 3FPKA 4RKEA 1UDCA 1KFCB 1UKYA 3R20A 1NVKA 2WEKA 3CH5A 4PAOA 4U2FA 3VDQA 1WP4A 1M2HA 1L9KA 1TRHA 2O7SA 2IHYA 4K9MA 1XCLA 4M1YA 5KTNA 1Q21A 4GOMD 5F5XA 1ATIA 5KQPA 3O26A 3ZGZA 4NE9A 2WTAA 3CEHA 3EH2A 2X1MA 3KJXA 2HGZA 1HSZA 5JNWA 1XKLA 2IEAA 5EWJB 5AW2A 2P77A 2H4XA 1YR8A 3GNTA 3I1JA 1PDOA 4XI9A 3TCXB 1HYQA 4D3DA 3KUDA 1RTKA 3LDFA 4W1SA 2P40A 3PI6A 4ZK6A 3PTAA 4LW8A 1TTTA 2FLWA 4R3WA 3WQQA 3KQNA 1OLUB 2UYYA 1FMCA 2YJ6A 2ZUFA 2IUYA 3DEAA 3TZQA 4HL6A 2MCFA 8GPBA 4OXRA 1I0LA 3GCWA 2C2KA 1QHGA 1P1KA 4U5QA 4RLQA 2I6SA 4CQJA 1K3UB 4YRPA 4AUKA 3WMGA 4BVGA 2AQKA 5DP2A 5AJVB 1CPYA 1MH1A 2CVOA 3BFJA 2YZGA 4RFVA 4AYXA 3EZYA 3OD1A 1G20B 2GNPA 1XQ9A 3H65A 3FFXA 3FYDA 1XMVA 2KW5A 2Q3CA 4LTMA 2KMLA 3K94A 3TNJA 2Y6VA 4BCBA 1UC4B 3H2BA 4D92A 1O4WA 2BEUB 4EG3A 3U4IA 1M5RA 2ZUTA 1Z6AA 3JX9A 1ZMXA 3URKA 1P62B 1AQLA 1JKJB 2GRJA 4JC5A 5JH7F 3KJHA 5JJLA 4F1KA 3TIVA 1CJVC 2HSGA 4Y7CA 2GN6A 1DKMA 4D6YA 1DU4A 3QLUC 3E3MA 1TDJA 3OCZA 4DLSA 5L4SA 1KY4A 5YASA 1CD5A 4BMVA 4ZICA 4U7FA 3ILYA 1IH8A 3JD2A 5FD8A 2GFQA 2ZVJA 1I2ZA 1PYDA 2FUG1 1Z0UA 3WL4A 1ORIA 5IMSA 1RD4A 3HKBA 1CZRA 4DLTA 3RSSA 3PNPA 4KPUA 3TQCA 1C7RA 1HURA 2I6FA 4I19A 4IIJB 2PUCA 2PT5A 2ZBPA 3EW9A 2EARA 4HXYA 3H2ZA 5TGZA 2YIVX 4OO3A 4HSEA 3SYMA 5GJCA 2VOEA 3P0JA 1FTQA 2DM6A 4DQVA 4XE5A 2DR3A 4DXDA 3BMNA 5I9IA 3SYKA 2JASA 1CZHA 4PTLA 4ZC8A 3KUXA 4GQAA 3GLIA 4MQLA 5JWHA 4HGOA 1XLVA 1YZ3A 1Q1ZA 2OZKA 1LCIA 2P6PA 3II6X 3K31A 3HSKA 3L5OA 1GGMA 1K5PA 2V03A 3Q3JB 4XLZA 3O4HA 5DFAA 1Q14A 1ZK4A 5T5QA 1NVUQ 1QGUB 1MRSA 3DONA 4D7AA 1EFPA 1O03A 1SD1A 2VPPA 4RFSA 2BJWA 4X1IA 5HP4A 4R5MA 3WYNA 1KQNA 4EUNA 4AO7A 4ETIA 1FE8A 2GJ4A 3IKMB 4JLMA 2ST1A 4MIEA 1IEQA 1SUEA 3KR1A 4K9RA 3IPXA 3HMKA 1NV9A 3HU1A 3N0XA 1NRWA 4XUEA 3K0SA 4YRLA 4HLUC 2ZB2A 4F3NA 3F96A 3RRZA 3KHTA 4PQYA 5LCXA 4HTAA 3UA4A 2XA2A 1BH6A 1ZK1A 3M5CA 4U0KA 2Y1EA 1E2EA 4R2IA 2CHEA 1UC8A 4LWOA 3RVNA 3GJ3A 1DDIA 1KZ1A 2H57A 3K6KA 1ZONA 3LFTA 3DVLA 5EHQA 2FDCA 2F8LA 2DEUA 5KZMB 2PTGA 3REQA 3WP1B 3MWDA 5LJIA 3JZIA 1A7AA 4CW7A 3WLOA 3H87A 3OQBA 3FI9A 3E9YA 1A2OA 1B3BA 2CFRA 2HRCA 5UKDA 3TZ6A 1PE0A 3U1VA 1JALA 2EJVA 4BP1A 3EVDA 2FP4A 2X6TA 4Z4FA 1F7UA 2Z2JA 3S81A 5L3RA 3UWSA 1E1RD 2C3PA 4OK6A 1QTIA 1WE2A 3HNPA 7YASA 5ERXA 1R5NA 4G5GA 2VDRB 4HQ6A 1FDUA 1U0GA 2OCIA 3LX8A 2IBMA 3FETA 3C2QA 2GNOA 5TMPA 2ZIAA 4RFSB 4MVJA 2O1WA 4X1IB 5G1PA 1Z3IX 4JLPA 3DEFA 2NU7A 3P9QA 4UAUA 2AMVA 4QYWA 1Q1BA 3TK1A 4DUPA 4L5IA 3F98A 1XL1A 1T1IA 2SCUA 3CZQA 5LQAA 2G77B 4HPJB 1LI4A 4LPSA 5IAOA 1RQRA 1G59A 4UNSA 3F90A 3R3HA 5BYJA 3X2SA 1TLTA 2CLHB 3BOSA 3UAZA 5A0TA 1L4BA 1Q6ZA 3G7NA 4Q4JA 3SS8A 3OF3A 1E2JA 4M21A 1AQIA 3AHGA 5DZSA 2GAJA 3R4VA 3E2MA 3ZDBA 4ZWNA 2XEXA 4B9EA 3I92A 5JS6A 2PRYA 1M66A 3BTVA 4IS3A 1RI3A 2CV1A 1UMCA 4QQKA 1IOLA 4BQRA 2PUHA 4DQXA 2V58A 4LS3A 4P53A 4WBNA 2JS7A 4CUZA 5C32A 5JC1A 1H4QA 1V37A 4XWTA 5JYDA 4YK7A 2HWWA 3R7BA 3QJ5A 4H1WA 4LQCA 1I1HA 1HTTA 1Q3HA 3LDHA 1WKVA 2Z2YA 3D2BA 4X85A 3HK2A 1TK3A 4L7QA 3RB8A 3WYDA 1WBJB 5IUJC 3RUCA 4RZ3A 4KXWA 3I2GA 4I2VA 2DQYA 4IWXA 5ERYA 3ZWYA 4IXMA 4B85A 1K66A 5EMMA 1DC7A 2C97A 2VTVA 4LQ4A 4O4HB 4F5EA 5LL6P 1Q1EA 1SURA 1FNBA 4MINA 1NE2A 1DCFA 2EP5A 3NPMA 4OSPA 1OSNA 3AF2A 1WQ4A 2D1SA 4I4NA 3T06B 4NDZA 1C3JA 2NU7B 2X7XA 2E9SA 4KDCA 2BGNA 2WE8A 4QRDA 4EHLA 1LEHA 1L6RA 4DM3A 4DM4A 1XKQA 1Z0DA 2O0HA 1J70A 3M9WA 2ZSJA 8ABPA 2P2SA 5E6RB 1HFJA 4B4KA 3OFNA 3OJXA 4FK8A 1D7OA 5JOQA 3C3KA 3QU2A 4UW9A 4MIKA 2OHJA 4W5WA 4FCVA 1C9JA 3BSYA 1DJQA 2GLXA 2RH5A 3P9YA 4JJIA 4PU0A 2RI1A 1IY0A 1F3OA 2ZVPX 1NRIA 2ZQ5A 3ZHUA 2CF6A 4WDQA 5BUSA 1P4GA 3LC2O 3HGTA 1U1GA 5JS7A 2Y9PB 1PW5A 1AK2A 3L4EA 2QSYA 3UQYS 2Q41A 5AKKA 1NL3A 1A2KC 2QPAA 1ZNWA 4RJTA 2W4MA 3BMQB 5CEFA 5KYXA 3OM8A 5K0LA 1WTAA 3OZDA 3FNQA 1UH5A 1UPUA 3O90A 1I7QB 4N4AA 2WUWE 4I0WB 1FSPA 2K6GA 3KT6A 4YHBA 2X77A 3JWEA 5F2NA 2NAPA 2PIAA 5A4KA 5LIRA 1X7HA 2VF8A 1KK1A 1U99A 3R5XA 1D9ZA 3BM5A 3BPSA 1AV7A 4MVJF 3HFJA 1Y7IA 3O8DA 2H4YA 2ZSBA 3VYTB 2QRQA 2EJCA 2DU8A 4KPFC 2ZBGA 1UAAA 4GBJA 1QQ7A 1W2HA 3IVXA 4RLHA 1WV1A 5GWXA 5NULA 3W34A 4D9KA 1K4KA 3LXUX 2Q3MA 1R4AA 3PTZA 5EIXA 1H8EA 3GEHA 3M9XA 4I3GA 3IKVA 2I6XA 4ALKA 1N2JA 3EOZA 3P9XA 3KOUA 4UCWA 4OH7A 3TXXA 4EFLA 4XQ0A 2YINC 3RS4A 2DOKA 2XTJA 1UWLA 4CFYA 4WCVA 4Z49A 1RAHA 2BCEA 1C7ZA 2E21A 2SKEA 2GJ8A 3NYWA 3PEWA 4QO8A 1E4VA 5DK6A 2NXNA 4WBNF 2WMDA 3E9CA 2CLIB 3EEFA 3JVUA 4RZIA 4BB5A 5EERA 4HYYA 1DT5A 5BV8A 2FB9A 1Y6JA 3A28A 3KL2A 4MCIA 1VJCA 1J7KA 1SKYB 1U5AA 4AP9A 4RHFA 4E07A 3IP8A 4G0VA 3VVMA 1N5IA 5EIWA 4YMIA 4RACA 3ZXXA 1Q0TA 5D3MB 2NU9A 2XLCA 1U9IC 2OFFA 4XWKA 1N2ZA 3JAKA 1H2ZA 2MSCB 3BFKA 3R9WA 4BS9A 1XZBA 1QB7A 1A9XB 2B9EA 3E35A 4F4FA 3VYUB 2FE1A 1EFHA 2FW9A 3MAGA 1GPDG 1PQUA 4JT2A 5AW0A 4YVFA 1Z4OA 2CN1A 4ZQFA 4R71A 4RYDA 4UJ3A 1V2GA 5ELMA 3FTEA 4BVHA 1FVOA 2PX5A 4MA5A 1LK5A 3ABIA 2C4MA 2YYSA 3QVMA 1W88B 5FFMA 2GZHA 1QDUA 4IHAA 2DUMA 2QZJA 4EJSA 2Z43A 3F6BX 4F8EA 2FPOA 2CXXA 1XTQA 2GN9A 4LN1A 1T5IA 2J3KA 1E32A 1LPNA 4ALNA 4HUQA 2C7GA 3O84A 4DW8A 4LMPA 2C95A 4FT2A 1BHQ1 3JVVA 2BKXA 3ZWNA 1YBAA 2YCBA 2I3DA 5ICCA 5J40A 4EUSA 2AJ8A 2HA2A 1G1AA 3HUFA 4MV5A 4X20A 2CMDA 5KOHB 3QXCA 1ZN2A 4BO4A 2P75A 3H5TA 4M2LA 4F9FA 1EZ4A 3H6HA 4UOEA 1NXVA 3VU8A 3QYAA 3ITDA 1W87A 2FPIA 3QQ5A 4DNFA 3L92A 2ILVA 1NNEA 4LF5B 2V5VA 1BE6A 1ESZA 2NG1A 3E15A 4IDDA 4IMJB 4ZQGA 1ILEA 1IHUA 5E2AA 3U7JA 1HYHA 3PQ7A 1YS2X 2OBMA 1ULAA 3EWAA 2BMAA 4JXKA 4KE8A 1JR3E 1T10A 2ECPA 3U6KA 1EXDA 3OQIA 1S2DA 5T67A 1NOJA 2B2NA 4Q1BA 4OIFA 4CKWA 1KJZA 4GLFA 2FPSA 4B7UA 2OD9A 1M76A 1BU5A 2ZWVA 4M86A 4PYIA 4RDIA 3RJMA 4B6OA 1JG3A 2HCBA 2FGKA 4LV5B 3GRZA 1YZFA 4ZK2A 1W5TA 5CFRA 1SBCA 2CK3A 1WZ2A 3I32A 4I9GA 4IVRA 3VNRA 2ZT8A 2ZPAA 3QBEA 1CDDA 4JJZA 3C3WA 1XTUA 5T3UA 3PFGA 1QZUA 3CLUD 1S2NA 3G2NA 1LQTA 2QP4A 3HB5X 3OPQA 3UBMA 3KOMA 4Q7JB 4M0CA 3E7WA 1CJCA 3OJ0A 4M9QA 4EJSB 4IX1A 1IK6A 3U9TA 4CMGA 1GT91 3T7TA 2WJGA 3F3YA 4UNNA 1ORDA 3ZOKA 4CQLA 3K5IA 1L7OA 4ADSG 1MOQA 3T7DA 4ZCMA 2H5IA 2CF5A 2PJUA 4NCAA 2NSYA 4JKIA 1S3IA 1HQKA 4GPTA 1QVVA 4BQFA 1ENZA 3IDSA 5E38A 5LNK1 3O95A 3NHFA 1AKNA 3NFYA 3VR4A 3ONNA 3QVKA 4JJKA 4CJXA 1ZVVA 1SHZA 1Z47A 2BFPA 2P68A 3Q7PA 4L75A 2PD4A 3DE4X 4G1MB 4CQMD 4Q1CA 3NBXX 2CXTA 3T7KA 4DLYA 2P9YA 3W5IA 1SZJG 1HGXA 2JPDA 3B13B 2DWUA 4J0CA 4MDYA 3D3JA 4GGPA 5LMCA 3EDRA 4QQRA 5DBIA 7REQB 1N75A 2NP7A 2P9BA 1YZTA 1V39A 2ARKA 2EFEB 3DZHA 2QM8A 4WFQA 1JF8A 3DMFA 3RFVA 1KFJB 4AMYA 1L5WA 2FWPA 3I04A 3OQIB 1QZXA 3N2EA 4AWXA 3QE4A 2VNJA 4H3HB 2W6MA 4FCTA 3SJUA 221PA 3AP1A 2V65A 1ZSVA 4KAJA 1K7XB 4IDHA 4XTRA 1VPEA 3U16A 1Q2UA 3IS3A 4NJMB 3FE2A 3BGWA 5MDHA 2JEYA 4BV3A 5IFLA 3MRVA 4RF4A 4WERA 2XCRB 4GMFA 4HDSB 4MJLA 3HBFA 2HV9A 5EHIA 4D42A 5H68A 3U09A 4W99A 2AMFA 4CIBA 3USZA 2XVMA 2JLXA 3AB7A 3DP9A 5C1BA 2IYQA 5J4KA 3U4QA 3DVQX 2X2PA 5JCXA 4CQLB 2QAGB 1HT3A 3GJ5A 2VDWA 4PSAA 1SUWA 3JXEA 4G0XA 4RA9B 1T0IA 4IF4A 4FHGA 2R1TA 3SSAA 3VUFA 4LGVA 4RPGA 4R9RA 2OZLA 5DYGA 4YFVA 2QT1A 5D2CA 2C3UA 4B6JA 2PT7A 3VR0A 1IWOA 3U7QA 4CT5A 2RG7A 3G6WA 4G8DA 5FNZA 5EP3A 4BN0A 1CKEA 3O5AA 3DE6X 5K3CA 5CBKA 2ZDQA 3EGIA 3GIWA 3GW8A 4MS1A 4PONA 3W4KA 2VHXA 1VIVA 2OSBA 5ESDA 4NAVA 3RUEA 2NNWB 2Z8YM 2BKVA 4OP3A 1LBEA 2JEOA 1MIOA 2H1WA 4F93B 3I8SA 5A6VA 1IATA 3T61A 5AI5A 2GDZA 3PC7A 1EP3B 1SXJC 1JG2A 1V11B 4FKBA 4GUDA 1TGYA 3F0TA 5JD3A 4EW2A 2WTXA 1SU8A 1JQKA 3E2PA 3CO0S 3F1KA 3KTDA 4JZKA 1ODJA 1KOLA 4EG4A 5IUNC 4F4IA 2CXOA 1WXHA 1NLUA 2OCKA 2X42A 1M2VB 2XLBA 3ZKAA 4E5KA 1WDTA 3LCVB 2ENUA 3PDIB 4MQUA 1X9HA 3ROTA 3E0XA 4RC9A 2P5UA 5IHPA 2DUWA 1WMBA 2VYVA 1UT6A 4IUDS 2ZR0A 3IR7A 1N6LA 1Q0UA 3QLUA 4HQNA 1CQJA 4AUMA 1T5OA 3VZRA 1GYQA 4OK5A 4MR7B 3UK7A 3TFOA 1NFRA 3Q1LA 1JDJA 4YCNA 1X7YA 4KK4A 2QT0A 4B81A 2GHQA 4UCFA 5K4GA 3HR8A 4OP2A 1O5OA 3WAKA 3TSCA 3UQZA 2AFHB 2HB6A 4YFYA 2ORED 3CX7A 3GEPA 3FF4A 4KLRA 2ONJA 5BWOA 3MT9A 3RTCA 2RCNA 1JB9A 4P3OA 3PCXA 1AB6A 1FQJA 4D4HA 3CCFA 5F5NA 1GA4A 3BRSA 3WK6A 1WRBA 4YQYA 1QJ4A 3A9SA 3JQAA 2O5CA 3USCS 3QEJA 4UNIA 1DMRA 1RPAA 3LF2A 5IS2A 3GFGA 3LZCA 4RGBA 4DFDA 1AUVA 4AXBA 4BTLA 5CA0F 5DGHA 2Q4EA 2OAP1 4G25A 4KXQA 4QYMA 3T7EA 3R3JA 3H8JA 1GL9B 2BBSA 2P65A 4WIAA 5B58T 4I1UA 4MWBA 2IFTA 1HLGA 4MGYR 3NDPA 4GL2A 1OU0A 1HTWA 1T5DX 1UK9A 4P7KA 5ITWA 3Q7RA 3KQPA 4P7JA 2JGAA 1FFHA 1RKVA 1DG3A 2CD9A 3FMVA 3TAHA 4A1OA 4BNUA 2BFBA 3I1IA 2A1TS 3SM3A 4R05A 4O1IA 1CIPA 3PX2A 1TGVA 2RHLA 4HLUA 3TQIA 2UAGA 1CQZA 4DCSA 1IXSB 3BC1A 3GPIA 4DCNA 1Y3BE 4MTLA 4DR7B 9LDBA 2CJWA 1MJGM 4RELA 3H5NA 2OCYC 3PXXA 1MX5A 4NZ9A 1NAIA 1YRAA 4EECA 3VXKA 3CSSA 4Z0TA 1WSAA 1G5HA 5SYNA 4YALA 4KV7A 4G4GA 4A82A 3F5QA 1KR5A 1A7KA 4ZJZA 2QLLA 1P1JA 2FPUA 4K6HA 1U2GA 4V1CB 3QWAA 2DHRA 1CR0A 4KQ1A 3NIFB 1EFCA 2G5GX 3IAS6 2OILA 3CNBA 3KZXA 4BRSA 4CIAA 3ZVKA 1UBRS 2Q2OA 1A9PA 1L1QA 3GAZA 3FZNA 2QRVB 1L7RA 5HKLA 2BEWB 4J49A 5EHNA 4GKKB 1KGDA 3E6AA 5I4CA 3U3OA 1IZ9A 4F5ZA 3CKKA 5IM4A 3PGKA 1S4MA 1DMSA 2RGDA 5DIFA 3DL4A 3DUFA 4M1KA 2D7DA 1I7LA 1T1SA 1CUBA 4BO3A 3ZCSA 2DKFA 4TWBA 2Q0XA 2J30A 4IXDA 2XZTA 1T9DA 4I9HA 2V3VA 4YDSA 5AM2A 2JLWA 3R1IA 4QNRA 2AZTA 1MH9A 3W6NA 3R0ZA 1CY0A 1NMQA 5HF9A 1VCMA 3ZWPA 3QPCA 4CDGA 4U9UA 3RCBA 2A78A 2X8AA 3CKYA 3AM5A 2JGKA 1KOGA 3VMMA 4ILEA 5DNAA 2X8JB 5J58A 5KJ6A 5EQDA 5KTPA 5HE8A 1KSGA 5CT4A 1FFXA 1NU6A 1NG1A 3OU2A 3IAUA 2I76A 2Y0PA 3NGLA 2P9ZA 2M1XA 2O3QA 2VSFA 5TVKA 1Y9JA 3DDZX 3H83A 4TV8A 1G42A 1NF2A 2XUOA 3V2UA 5IJWA 2OEPA 5TQ0B 3G7UA 1G8PA 4OJNA 3HEAA 4JN6B 1Y3HA 1NF8A 2ZBUA 3IP1A 5FTKA 4YLYA 4QU0A 4YASA 5JNSA 4BXOA 1DADA 5DHAA 1R6XA 2QUIA 3E7FA 1F8FA 4AVYA 1PVDA 3S2SA 3T7RA 1KY2A 2FQQA 3KU1A 2A88A 2PT6A 4ND8A 1ZHFA 3C7TA 3I0MA 3ZD9A 2AG8A 3MD9A 1K08A 2A9OA 3DXYA 5CX1B 4TSFA 4IMIB 1EESA 5CHYA 2LV8A 3CRNA 1VE3A 2CNBA 3ZH9B 1NN3A 5AJUA 1EP9A 3WGJA 1NVTA 5JADA 2XRFA 4RZ2A 5AIBA 4E5UA 1KYTA 3NRCA 3OCYA 1JI3A 1OGYA 4O4JF 4ZQHA 1UPBA 1F2UB 3SNKA 4EX6A 1RAIA 3PF8A 1JEJA 3W3ZB 3WIUA 1WMFA 2WKQA 3ZJ5A 1C7IA 1VP3A 1WHSB 4UZFA 4AJHA 2WZDA 2A0UA 2P3LA 4JI7B 4MVJG 2VK8A 1JH8A 1LXCA 3G5AA 5DX8A 1T0BA 1YOVA 3UWPA 2CBZA 2UUAB 1QHSA 2ZU0C 5EIHA 5EQTA 1GTZA 3ZCQA 4XYLA 2IY7A 1BN6A 3QE0A 1Y5MA 4Y6SA 1H0RA 3AWDA 4KU4A 3IV9A 1BMQA 4CT4B 2DPGA 1L5RA 3EVCA 1YS4A 5AVVA 4BNDA 1M2JA 2OO5C 2WD7B 2WSBA 3DV0A 2XR1A 3O82A 4DRXB 2R6DA 1N7GA 1VLQA 2FQ1A 2Q1SA 1UBHS 1Z33A 2Q6TA 3EG9A 1QO7A 3JALB 5L7YA 3WIEA 3WLQA 3JZAA 1Z8FA 1QIDA 1K6EA 3R0IA 3NR2A 5A4FS 2F43A 2OE2A 2X7JA 2NUTA 4F6RB 4WK0B 2BM9A 4XW2A 4B45A 5ALVA 2BN4A 1FFCA 1FW8A 1EDDA 3DKPA 1BWQA 2J9RA 2JDID 2ID9A 1L2TA 3NWJA 3VSEA 3DW3X 3HXTA 1MAWA 1JI0A 3CMMA 5JATA 1NUAA 1L4YA 4ZAFA 4AKIA 1JQLB 4YCBA 1AKQA 2RHWA 4CPDA 1NW3A 2FZCA 1NY5A 1TQHA 1IPHA 2E5LB 1A7UA 1XZHA 4C5BA 1DI0A 4MPDA 1VHQA 1EGVB 1GTJ1 3CCCA 4LY6A 2XAUA 1J25A 1G6KA 4EW3A 4E09A 1VQ1A 4WMLA 4ZV9A 1VSUA 4YJGA 2XCIA 2W71A 3HWWA 3EK2A 2WB2A 1QQTA 1M0SA 4GMKA 3WVNA 4N65A 5BNTA 3BHNA 7AT1A 2EATA 3M8KA 1F6BA 5ADHA 2PHZA 2VDPB 3TKLA 4MYUA 4TV8F 3GFSA 2G8NA 1DWQA 1HT1E 4K9NA 2RE8A 5E4FA 2AUMA 5IZCC 3VGJA 4B7ZA 3PCRB 5GAJA 4CEIA 1GKKA 1PFVA 1G8SA 2W6PA 3KAJA 4J4TA 3N8NA 1CUXA 3V1NA 3NHAA 5CJ2A 4DHEA 3CW2A 1YJAA 4QTZA 2EFJA 3QPWA 1OFUX 1ATZA 4HK4A 4TUYA 1U9IA 5TQ2B 5A05A 2G67A 5I9SA 1FF9A 2DXIA 2HHHB 3RSLA 3Q9SA 4DM7A 2A8YA 1RWPA 2NO1A 3U31A 3PFWO 4PGFA 4AWBA 2RGYA 1VZ2A 4GXTA 3A4NA 3ZIUA 2IPMA 2AK3A 4MAMA 4QODA 4CWAA 2R0QC 4M88A 1V8DA 2BFNA 4MUMA 1KJ8A 1HFEL 1QVZA 3R3VA 3UUGA 1QQAA 2PS3A 4R0VA 1CUZA 3OX4A 1Z6ZA 4G85A 5REQB 1IWPB 1ZC3A 2A0XA 3LUDA 2AD5A 2A4KA 2AJBA 2PWAA 3I3OA 2JA2A 2VA9A 3DAGA 4LQLA 1JXOA 2Y2VA 3OOYA 3Q0TA 2JZOA 4AF6A 4CM8B 4FUTA 5C8YB 2I4RA 4KX3A 5FOUA 5CFQA 1P2TA 5ALUA 2N47A 4KKVA 2UZ1A 1MABB 5HIKA 3CLRC 3V7WA 1EMDA 3IAS1 5B37A 3CPHA 1GDDA 1YKFA 2GD1O 4DSOA 4TKUA 3LHSA 1GNSA 3MB5A 4R1OA 5KJCA 3BIWA 3C6XA 3PNYA 2PO5A 2UVPB 4FGSA 1MTOA 4NOJA 3PJRA 2GB4A 2VYCA 1SG6A 1AKUA 1OIXA 2ZTVA 3PPWA 4EA9A 2C4WA 4AXXA 4BX0A 4A15A 4JR2A 1E99A 2O0MA 2M6KA 1P91A 1J0EA 1T5LA 1WU8A 4MI3A 1OZAA 5SZHB 3K70D 1TI7A 1PNVA 4I4IA 4KJZA 3I01M 2H2IA 3AWIA 3G85A 3WMFA 4QOJA 2FX3A 3G2MA 5ALSA 3JPWA 3ZWVA 2F8MA 2PZBA 4ENPA 4BTVA 5I7RA 3ZBQA 4E4RA 4OBWA 2F7SA 1UAGA 2GD0A 3L6BA 3Q12A 1DQSA 2PVSA 4MVJD 4F2HA 4KWTA 3RSGA 3B9BA 5EAIA 3S68A 1EFUA 1N2GA 3T3EA 1FJ2A 2ZKIA 4JYZA 2FY8A 2QM3A 5CLHA 5JW6A 3DE5X 4WEOA 3REGA 1FTSA 2GZRA 4NCNA 1Z2EA 3PENA 1NYRA 5EYPA 4ZT3A 1RLJA 4TL8A 4C0SA 4EJMA 4PCVA 5FBZA 3SJZA 4QJ3A 5TGDA 3E8MA 1HYBA 5FI0B 1EA5A 3SMQA 3QHQA 1YCGA 3T3NA 1CYEA 5CVEA 3X0DA 3LYHA 4FKZA 4K46A 4I66A 3ROXA 4TYWA 1HEIA 5AUPB 3FVTA 4RTKA 2ZI9A 5DYYA 3C39A 2UZ1B 3KKEA 3LUKA 4HDKB 5CNJA 2FV8A 3ZJTA 4PX3A 2HFJA 1NU8A 1P1HA 4GMHA 1EU1A 2WU0A 5KX5B 4V38A 1BU8A 2OP0A 4GI3A 2ID8A 4RABA 3R3YA 2QVXX 1YUMA 2GZAA 4R2XA 1IAVA 1U5BB 3DOUA 3NAMA 3PQ8A 3UT5B 1FDRA 4WGFA 1MAUA 2H5EA 3H99A 4L6AA 2C4HA 3O4GA 4IIHA 3TFWA 4GI7A 5LOVA 2XUGA 2PZFA 2BE9A 4BQIA 5JQGA 1U7UA 3O3OB 1R8XA 2B1QA 1K7EB 4CNBA 3WA7A 1KARA 2E18A 1X7XA 3R5TA 4GT1A 4R8MA 3V46A 2A1UA 1KJQA 3UMSA 2UUOA 1G3MA 2ESRA 1W7AA 1PR6A 1XDUA 2CLOB 3EXFB 4NAHA 3E7DA 4AY2A 4EYOA 4TUYF 4GOKA 4LZNA 1PQ4A 4EKIA 4RCVA 4PFQA 4X6YA 3E1KA 2D7JA 3L8CA 4BE9A 4HFJA 4WLOA 3M82A 5AI6A 1RNLA 2AD1A 3GLHB 1MOPA 1PTJC 3BX1A 1HEUA 4RA6A 4C78A 3AKDA 3OP1A 4TS4A 5K3FA 4MVJI 3STHA 1LH0A 1USKA 2D59A 5DO9A 4F5YA 5I4KA 3NATA 2JZCA 2WUDA 5LDGA 4EEXA 4BCCA 1G4AE 1O5IA 3KX2A 1ZESA 1KEWA 4QUIA 2W2KA 1YMVA 2ONYA 4FJ1A 2WIBA 4TLBA 2GPJA 4D56A 1GGFA 2I4NA 1BRTA 1O54A 2IXBA 2M98A 3G0OA 2PJDA 3GRVA 4RD4A 4U9IS 4G37A 3RU9A 4PX2A 4DV0B 1ZI6A 1RYYA 1U7DA 2W43A 4FFRA 1POWA 4FMDB 3W05A 3B48A 1XHEA 3VZPA 3AF5A 4YMVA 5C31A 1JFFB 3N28A 5KVQA 4Y3UA 2PXHA 1GZUA 1FFYA 4LTNA 5CLLA 1KI4A 2WKPA 2H65A 3C45A 5HKAA 1OBVA 4YLGA 5JI3E 5CG1A 5JQGB 5DT2A 2OD2A 1VL6A 1VYTA 4FDVA 3D3NA 4MW0A 3U2QA 3BWXA 1QMGA 5AW1A 4LIPD 1S8NA 1QHHA 4OI4A 2C2ZA 4ZCIA 1SXJA 1CUJA 3GY0A 3H5LA 4JC8A 5IAGA 1WDWB 2HJWA 1AQNA 1SCUB 1YQXA 4X92A 1GGVA 2IHKA 3WYCA 2BUCA 3EIXA 3QH4A 1ZPDA 4YJKA 4DGQA 1UXGA 3VR6A 2V96A 3SJAA 3IBTA 5LM3A 3NPAA 3ZTTA 1RC1A 2OXFA 4ZZ3A 4DCJA 1OH7A 4EY6A 4ZOCA 1GSHA 2VJYA 5BSRA 5HM8A 4BAGA 1TMYA 3P1JA 2KYRA 4MMYB 2IOYA 3TQFA 1H8ED 2MDTA 4LZLA 1ADJA 3T94A 3DMNA 3T4XA 3IP7A 2B20A 3TPFA 4OX9Y 1N1DA 3L0YA 3WRXC 3TDMA 3CG4A 3ROKA 4ROTA 2V7PA 3H05A 1CBUA 4QXRA 1RJGA 4O08A 1W36C 3QKTA 1KIAA 1JU3A 1MGOA 4LY0A 4X8OA 1USUA 3LY7A 1DSSG 3PT5A 5H7XA 1O9BA 3WKEA 1ZEJA 3HM2A 3AEYA 1MC1A 2HMSA 2I66A 2VPZA 9GPBA 1DIBA 2O4CA 4N0DA 1IMJA 3GJ6A 1YE3A 3A9VA 1ICIA 3H42B 2D5IA 2IK8A 2GZSA 1PAUA 3ZV6A 2NZWA 2BZSA 3QUAA 2W4IA 2OCBA 2ZR8A 1IBRA 3A26A 1JDBB 1DO0A 3MQFA 1VE9A 3PQ3A 4MJ7A 3C7CB 2VK4A 3A6EA 3PJFA 5C80A 3BXXA 1CQWA 3Q2KA 3PQFA 1K06A 2II6A 3MS7A 4NU8X 1NVGA 1ISIA 4IZIA 1RCUA 1KYQA 3O74A 4PXSA 1DIRA 1PQWA 1QHFA 4PZCA 2PXAA 3RYHB 2IYFA 1YR6A 4C06A 4ZANA 2QA5A 1ZMRA 4XTCS 3ILHA 1NX9A 2R8RA 3MMPA 2EBUA 4NXNB 5KYNA 4CGZA 4ZAXA 3PSHA 1FJHA 2ANCA 2VJAA 4XDGA 4Y6PA 2EFHB 3M2PA 1WCYA 4AX8A 2O07A 2O8CB 5B1SA 2REQA 3OO0A 1P2FA 3QEMA 1ZU4A 4Y67A 5LQCA 1XCMA 1EFVB 1IN5A 4H7HA 3PKJA 1A97A 2ZYWX 4JYMA 5E9AA 3RIEA 5TDHA 5EXEA 4DCPA 1PRYA 2GESA 4EW6A 4GSYA 4KIUA 5FRDA 5J47A 2G36A 4IFBA 2WSMA 3LFUA 4YQEA 3C1OA 2WJPA 1M74A 4EKDA 1NVWQ 5G41A 3LO8A 3PWTA 2PR7A 4C4AA 1T3ZA 1IK4A 2JJYA 2R6GA 5EFZA 1IQRA 4F3RA 1KTIA 3DKVA 2J7KA 2QLNA 2V6BA 3L7KA 3NORA 5TMBA 3FCXA 3W1VA 1C80A 2C78A 3IYLW 4FE7A 4RKYA 5FTWA 1GFSA 3WGVA 2FEWB 2ZJ7A 3I9FA 4EA6A 5C1OA 2PWBA 3NH9A 4ZOLF 4XOUA 5K8UA 4DIEA 4HEA1 4Q7QA 1NSTA 3DZ8A 5IP5A 4EFDA 3LE8A 2PL3A 4OM7A 3DZIA 3A10A 3COVA 3TSAA 2CK3D 3I4FA 3T4UA 1OWPA 4CLDA 2UYHA 3L77A 3O0DA 3CW9A 4Y2HA 2P4QA 5H80A 4I9UA 3LXMA 1ZMTA 3NIGB 3P9PA 4FFVA 5KWEA 3H13A 3PS9A 1ELOA 1YRYE 4Q02A 2ZBVA 1CW2B 4GPD1 4J7CA 3OQMA 5JANA 3HE3A 1ZWLA 4BECA 4JVNA 1SBIA 1WABA 4P34A 1E58A 3RYCA 2B2CA 2R8YA 4LBZA 1UINA 2WAXA 1YSCA 2QUHA 2I1WA 2ZRKA 3HDTA 4DDWA 4EK9A 2YV1A 2FDXA 2Z2XA 4Y9RA 3GJ4A 3Q1KA 5BYBA 5LP6B 4Q0MA 2WTUA 2ZTSA 4U1RA 3VR4D 5IVHA 1E4EA 1N9GA 2QN1A 1WPRA 4O2AB 4MWCA 1M6VB 1WXWA 2BF7A 4WNYA 5FULA 4X62B 3KQTA 3KQUA 2Q6KA 3TE7A 3GDHA 3WHIA 3OE4A 2Q3BA 5KMGB 1ULSA 2XJ4A 1YNSA 2R8EA 3AVVA 1UBTS 1N5KA 3WB2A 3NS7A 1T9ZA 3S1AA 3BTOA 3SLGA 4WV3A 3QHAA 5ULLA 1AS3A 2W2XA 3L1KA 5FFFA 3LA8A 3KCNA 3VHRA 4OKNA 4DR5B 4L6IA 5TC4A 4UEKA 5EWLB 1NSYA 2V7UA 3E23A 3OFKA 4LVUA 4GPZA 4BFZA 4Q7EA 4D46A 4EQ6A 4EHKA 1CZNA 4GGOA 3W7VA 4P5PA 2E7ZA 1QIKA 3D8UA 5JG7A 4MRMB 4RX1A 3SMVA 4D3FA 1ADCA 1RMYA 5J2TA 3Q11A 1QO9A 3SC4A 2G63A 2XV1A 1U2QA 3GDGA 1GPLA 1NNSA 3E4CA 5LC1A 5BWCA 4LJAA 3VOBA 5I3CA 4UHHA 3LRPA 4U63A 1G8FA 5EZYB 2BFOA 5CT8A 4QSHA 4PO3X 2WLSA 4JODA 1XD8A 2X13A 3MQ2A 1GPUA 4ZDKA 2JLBA 4FW8A 1JWAB 2ZM5A 1OYWA 3DS8A 3ZK9A 1WXEA 4R98A 1JX6A 2BFMA 4LY3A 4EO9A 5C52B 4YV1A 4CF6A 1D6NA 8ATCA 2OCDA 4CXMA 1CT9A 3A37A 1HORA 1BXRA 3CNOA 4IV5A 1I6WA 4LSWA 4Q4HA 1J2UA 3CRQA 4E6EA 3GLVA 4JUFA 4C9BA 1SA0B 4OH1A 3PEYA 1MKYA 3NBQA 1BQEA 2QX8A 3GOQA 3EISA 3T99A 4HGQA 3WJ7A 5BV7A 2OO5A 3ZJYA 4NABA 2QNBA 3UOWA 4RV5A 1OXMA 1IPEA 3WLFA 3DULA 4LRWA 1VLVA 4DVJA 3KUUA 1B6TA 2QKYA 2X40A 2ODTX 4ZQBA 1NUQA 3WGIA 2XA9A 3P4XA 4BNKA 2PFGA 1SIBE 1C4XA 1NQTA 2QN9A 4WWHA 4QA9A 1IE3A 1RAEA 4XJTA 4YGYA 4KEAA 4QARA 3WRYC 1NW9B 3D8HA 2PKYX 1FBTA 2VYVD 1F8XA 1GILA 1GZHB 3HZRA 3PWKA 2IVFA 3Q2OA 3QU9A 4DQUA 3SZLA 1YZHA 2ZJ5A 2WKWA 4HH4A 3BIFA 4MP8A 1KQGA 4GHWA 1P9OA 4UVIA 5DHQA 1B6SA 1ADFA 1LC3A 3D6AA 3LWZA 1QWOA 3KQWA 4LNAA 1ODFA 3H18A 1OT5A 3PC8A 3SZOA 2Z04A 4E33A 3A31A 5FF9A 5ERGB 3WWPA 3PUJA 1FX0A 2OO7A 2WHXA 2XCUA 4IWNA 2ISSD 1XJ0A 3DEYX 5E8RA 3NDJA 4YQZA 1UBEA 5H70A 3GF4A 2GCOB 5AVWA 2IY9A 2J8ZA 3DLPX 2PE5A 1IY9A 2BCGY 5K0CA 1FBNA 1XVTA 2INGX 3JQAD 2YHSA 3AI1A 3K0CC 4L28A 4R9VA 3UUEA 3EQ6A 1HM5A 4JKYA 4YACA 1U7XA 2OP1A 3SIPA 1GQ2A 2QEQA 5IZCA 1U3FA 2V6JA 4KMSA 1TAGA 4A0HA 3SVTA 4CQMB 2V7XA 1PEAA 2F2TA 3L6UA 3TW8A 2OG2A 1RYMA 2HY7A 3MJCA 1P44A 1V96A 4GOXA 2E82A 1DBVO 1L7PA 2Z4TA 1FMLA 3O03A 2P4HX 4FGJA 4QEZA 4RVHA 4UARA 4KO8A 2QL5A 4LV8B 4TL9A 4V0OA 5ALIA 3SDBA 2WUVA 2EP7A 4WN3A 3JWPA 1Z0IA 2EDCA 3CB2A 1PO7A 2JHFA 3WK9A 3JSXA 4UTNA 3B2NA 2WTMA 4KE9A 2Q5CA 1U0HC 2HQBA 2QTTA 1F60A 3PQ4A 3R5FA 1QPZA 3OKFA 3GFPA 4ZKDA 2WYOA 3AH8A 4H77A 4NIMA 1DUSA 2C99A 2H1LA 2XTAA 2I7CA 3IRUA 2AW3A 3KKMA 4N3NA 1N9ZA 1UPCA 4OA5A 3ANSA 3EMDA 4WJKB 1ZD1A 2YHUA 5EI5A 5J2TF 3UMFA 1O97C 3G2LA 1DXHA 3OBBA 2O2XA 1LBHA 1VIAA 4R4JA 4RLFA 1K89A 2JF0A 3BWCA 2JHPA 4OAOA 1S4QA 1I1NA 2BGGA 2QT9A 2HHJA 4MITA 1LBQA 2HPHA 5TT0A 3NTVA 2AN1A 4DANA 1U0FA 1ADBA 1TMKA 1V4VA 5GINE 3R9XB 1UJCA 2I6TA 5JSHA 2J0QA 2P9CA 4KLCA 3QEAZ 5EPOA 1KGSA 5KEIA 1LW7A 5B36A 1P1CA 4X1YB 2XPCA 4ZC1A 3SM9A 3N6XA 2ZPUA 1LJ8A 2VT2A 4LSMA 2PM8A 3B5IA 1J24A 5HRCA 3AHCA 4IJUA 4DR4B 2WQ6A 4LISA 1CC1S 1UJ2A 4M8SA 2OGTA 3HLYA 3Q5DA 1CP2A 2YWBA 4B76A 3ML1A 1X7ZA 3HBMA 1YDEA 3A4IA 2NUAA 4BLRA 1KXZA 1Z5UA 2ZJFA 5E6UA 3SQNA 3ZNPA 4MULA 4UKDA 2IYWA 3TSOA 4KFUA 2HC9A 5JBNA 1HYGA 2P67A 1MQ9A 3FPLA 1QS0A 4L5YA 3C6MA 4FE4A 4QYTA 2W6JA 1WF3A 3FYTA 4X3PA 3C43A 1A5ZA 4K0RA 3SQMA 1DT3A 1FTNA 2WILA 4JI2B 4IJVA 1WLYA 3FPAA 4X91A 1OAOC 4LRUA 3Q72A 2ZUBA 3N0TA 3LVBA 3GBSA 4KCGA 2PCLA 4TKVB 2VHZA 4MKRA 4REQA 5KPDA 4AL4A 1QRUA 4G81A 4ECAA 4HY3A 4WLVA 3QV1A 2DT8A 1BCRB 2FEMA 4EDHA 4OGLA 3KBBA 3BORA 1K2WA 1QRDA 5TPWB 1L8AA 3N6RA 1BVHA 4XARA 2DVMA 2JRLA 1OYYA 1VDMA 3QVSA 1WCWA 3O4FA 3WR5A 3MIIA 4WW0A 4TSFD 1CXZA 3EC2A 1HL3A 2ZI3A 2CFIA 4MK4A 3H8VA 3LYAA 1PNOA 4G63A 5GTDA 1R6AA 4FYHA 5EXTA 3RKUA 1ZISA 2Q6IA 4JVSB 1OROA 1UJ6A 1OXVA 2QVCA 3LWDA 3Q9UA 2WYHA 2Y66A 4M3NA 1V5GA 3PQ2A 4V2UA 5CURA 1S01A 4JR0A 3WK4A 4B17A 5F2EA 2Z30A 1JR3A 4II2A 3NDBB 1M6WA 1T3HA 3ZY6A 4RWZA 1PTJA 3ND8A 2OXTA 2MU1A 1ECGA 2ZT6A 3FOAA 3JR3A 1RQXA 1YZYA 1EK2A 2J41A 3C1AA 3LCJA 4D0NA 5IX8A 3C6QA 5FTJA 1BGVA 3AL2A 3PR2B 2BYTA 4MV6A 3NNDA 2BSAA 4O0MA 1XT6A 2RFLA 4JUBA 1RC8A 1MO4A 4I36A 3R77A 2WJZB 4UNQA 5DXJA 2OBXA 3QKWA 1R10A 4WLNA 4C2UA 2R1ZA 4TLMB 1U0RA 5D87A 4QTUB 1XJ5A 3N59A 4KWIA 2YN2A 1FPQA 3IE0A 2W8BA 1TYEB 3N7UA 4HNUA 3BD7A 1HDZA 2WIDA 3W5CA 1GUYA 2RHTA 3GT7A 4OLAA 3X1XA 5KJFA 4ZI7A 3HA3A 3IJRA 1COZA 5AXCA 3MGCA 2QVGA 3PE3A 4PPNA 4REQB 4B6FA 2FX2A 5J9FA 3GEBA 1AMNA 2PKRA 4G24A 4NJEA 5EOVA 5BORA 2WWTA 1U8XX 1PJAA 4N40A 4TKZA 4F4HA 2GASA 1SHUX 2Q5OA 3NIDB 5I9BA 3VSCA 5ADVA 5IASA 3LPMA 4YV0A 4JLKA 2OG1A 1E3MA 4LCJA 3RS2A 1RLIA 1UZLA 2L18A 3CJTA 3QLJA 4GVLA 4O3FA 1N6IA 4PRLA 3UGTA 4IO1A 5IEJA 1WCIA 4QEKA 4B3XA 5BSWA 2E4XA 2FMKA 3B12A 4ZJPA 2AT1A 3AESB 3TRDA 4F6LA 2B3DA 5TEVA 1R0KA 1GAXA 2HRBA 3RWOA 1XTKA 1Y3DE 3VPFA 1ZL0A 1DLIA 3ZWCA 3B3AA 1F12A 1YUNA 2B8TA 5ER9A 1X92A 2FEKA 1HLPA 1ANKA 3UJCA 5F9HA 4GKVA 4IQ4A 3KQKA 4FOPA 2R4UA 1OZGA 3OEWA 4EGFA 4PHGA 1JIXA 1EGAA 2ZB7A 5C3MA 5HQTA 4EM6A 1BHJA 4XXHA 4PN3A 3WRXA 4W9NC 4ZJUA 3V4VB 1LZKA 1UZAA 2FW8A 2OVBA 2W11A 3GZ4A 4TWRA 3WL6A 2B36A 3BD6A 4A73A 2LWIA 4D9BA 1NW4A 3ZWDA 5HZHA 2Q0HA 4IXTA 2QY9A 3L18A 1ZK2A 5HYVA 1Z08A 3M5WA 1SCQA 2Z08A 3DTTA 2JKZA 3SF0A 3L7BA 3D5TA 2CHGA 1T8PA 1Z0JA 3AUJB 5HOQA 2GSWA 4FIDA 1LFDB 1FJXA 1NN0A 2QLBA 1T0UA 2M6LA 4QNNA 5F23A 3RS0A 3G88A 4HYEA 1JJFA 2C0PA 5GM2A 2JH8A 1GT6A 5LMZA 4CUKA 2Y4NA 5EE9A 2FVYA 2WHYA 2D5AA 3BJEA 1LS1A 1LRJA 1WB5A 2IGTA 3KR0A 3QPUA 4BLVA 1U0NA 1TT5A 2P8SA 1EUCA 3WIOA 4GZMA 2IP1A 4NZYA 4S1OA 1BW9A 1M33A 5A3SA 4YRZA 1B6GA 1P77A 3F47A 3KQHA 4UBLA 2I2CA 2ATIA 3IEVA 1WCIB 4AJNA 1YL5A 3THRA 5B1IA 2Y1FA 1XRSB 1RLOA 2IU6A 5EZQA 5FBLB 1TOAA 3B53X 4YRCA 4CV2A 2O8NA 4NPAA 1NFFA 2AQ8A 4JSRA 4MLZA 1NLZA 4B31A 1R8YA 4L72A 2HHAA 3LX6A 4OXKA 4TSRA 3SJ7A 3D2AA 2FG6C 2FETA 2IXGA 1Y7LA 3A4LA 4FHFA 4RY9A 4Y2VA 4BNWA 1GTMA 3D7RA 2C9DA 1SUAA 4DGSA 5AQEA 4XEUA 2YH2A 1AH2A 4UZSA 4WFIA 1VSBA 2NYUA 2VYQA 3UKJA 3B78A 1FA9A 3MRTA 2DFTA 1GRVA 3I37X 4XASA 1OI2A 4BZZA 3K5WA 2CVQA 1B76A 1PLJA 4Y2XA 1W36B 3F74A 2XGJA 4KV9A 1OXXK 4LXHA 3A3YA 3L1IA 3EFOA 5L7WA 4C6TA 2GZ3A 4QOSA 4PIMA 3DR3A 2B1RA 3PPIA 1UQTA 3GZTB 1M1ZA 5LWQA 4XAQA 1VJ1A 4MYRA 1TQ8A 4OGKA 4D96A 4ZI7F 1JJAA 2GF0A 3SX0A 2G1KA 3WL8A 4PEVA 2ZPTX 2P2GA 3C3PA 2QV7A 4I5FA 2VPIA 4WZZA 3MHPA 3A6ZA 3SBDA 4KXUA 3C0KA 4EY7A 1SZCA 4W5TA 5KNCA 3EA4A 3L49A 4OJTA 1HG1A 4M55A 1BW9B 2EBFX 1JG7A 2JK0A 3DEHA 5JJCA 3LUAA 2X1HA 4DF3A 3REFA 2IDKA 5IJ0A 2QTZA 1QVRA 1UJBA 1N1GA 1BE0A 2CXSA 5TMEA 4ECEA 5IANA 1GTSA 1N0IA 2D4HA 3DZCA 5JXHA 4B84A 2PBFA 3Q7QA 4RDHA 3T3IA 3UFBA 1IVYA 1M6EX 1NVBA 4EB6B 3DTNA 5JQWA 1ZA2A 2IC5A 3Q6IA 3WLNA 5FAXA 4FT4A 1XVVA 3ADOA 2XMQA 4KBYA 1MVLA 4MB0A 3QJGA 3W5SA 4JUDX 4CLRA 1FW6A 1IEWA 2GEFA 1DTSA 3DJFA 4OMUA 1NVEA 3AM4A 2YMMA 4NE7A 4RIHA 3T9AA 5HIMA 5JNLA 4PNZA 5TARA 3TI9A 3BGVA 4Y8VA 4I55A 4KRXA 4NQZA 1PR0A 3OOJA 4DKJA 1Y4ZA 2P2DA 4G5YA 4RFLA 4UD6A 4AUEA 1EWTA 3WGUA 2WSLA 1Z16A 4EB0A 4Q3AA 4ZAZA 2OFWA 2PSHA 1OXTA 2CJYA 4XD2A 1QHXA 2F00A 3NG1A 4GX2A 5GZ6A 1DARA 4ZI3A 4F91B 4A8JB 4D74A 1EBFA 1WXXA 3MTEA 3TQSA 3N8DA 2VHJA 1GOTA 5KQSA 3EEBA 4JL5A 1KS9A 3WDSA 5I5EA 5I7HA 3K0FA 2YX1A 4ZHQA 1PP4A 2Z1DA 3E3OA 4G5FA 1GITA 4Q00A 5EGSA 3LT4A 5KIAA 2GCGA 2RHDA 1BXGB 1SIOA 4ETWA 1QZZA 2F3TA 3AVOA 3MGBA 1RCFA 5PGMA 1GM5A 3W5AA 1LQ2A 4W5JA 2IQIA 2IHUA 1NQUA 2R62A 3DVAB 3KSUA 3LQKA 1R6VA 1MRNA 1VL0A 5LXTF 3ZE2B 1LBTA 2PX4A 4AZTA 4B3DA 5L95A 3RC8A 2H54A 2W2NA 4QLBA 5FWXA 2J6BA 3M7IA 3JQBC 1QOZA 1NG9A 1B1CA 3A1UA 1KEVA 3RRNA 2C4VA 1VL8A 2XW6A 5AW3A 4JXJA 5LYJA 3TOVA 2QK4A 1UJNA 1LLQA 2OXEA 5HFAA 5JPIA 1Q16A 2XMDA 2DB3A 4BKOA 4YV7A 1DELA 4ZOBA 4BQPA 4EPWA 5E1OA 1X42A 1IIBA 4NQRA 1C3OA 1XTJA 2V7EA 2C42A 3L0DA 4JP2A 4YAFA 4DRZA 1B1AA 1PG5A 4JQOA 2J08A 1YF3A 3IA7A 3K70B 3IULA 3EZ7A 5LQMA 3GOHA 2FJUA 3FKJA 4AZSA 1P7VA 1MA3A 2BFDA 4DCVA 4LXXA 5KVSA 1SXJD 1L4MA 1XJWA 1T2AA 2XBUA 3DWGA 4M9UA 4OVKA 1R9NA 2WFLA 4HMPA 2XE8A 1XRLA 2ZSAA 2G08A 4F6RA 5D5QA 2FWRA 4RK1A 4JWKA 5D1HA 1NJGA 4H9GA 1TQ4A 4W4TA 4Z0NA 5BSMA 5JXJA 5GJWC 3WRYA 4YRSA 4G0OA 4QM7A 3VR6D 4AJJA 3PFFA 1CHDA 1WULS 4BKPA 3EIEA 1II0A 4KIJA 1E62A 3X1YA 1WHTB 2E55A 2JFPA 2NTVA 2OK8A 1NXWA 2VLBA 4JROA 5H0IA 2PD6A 4LYJA 2O59A 4R9NA 2FSVC 1TEXA 2LDBA 4C6SA 1NXXA 3G0GA 2R2GA 3PT9A 3C85A 1H6BA 4CCAA 2KE5A 2ZCUA 5I7VA 4Q9NA 4AQ7A 1A5BB 2UZ4A 3SD7A 3KEOA 3BMOA 4QICA 3ZNQA 1RKQA 4AG6A 3A25A 4JI3B 3TX6A 4HDMA 1JLHA 1KAGA 2C4TA 2FLKA 3KAQA 2DLDA 3COZA 1T24A 3IX7A 4IDEA 4B87A 1AJEA 4PTZA 4O4IB 1JECA 5FBVB 1G3IA 4KYUA 3RFXA 2HMAA 2QTAA 3EDOA 1WZNA 3K0CA 1PK9A 4BFLA 5M34A 4Y18A 2RG1A 3V9AA 2VTBA 3PDUA 2PMCA 2OTCA 2XUAA 3P5BA 4I55F 2UUPA 4J3JA 4C43A 2DC1A 2O20A 4KXMA 4X66B 1DINA 2WTBA 3HM9A 3A3KA 1P2DA 4YUVA 1YZQA 1US8B 1S0UA 3JWGA 4GX5A 4X60A 5CG2A 5EHGA 1YWGO 3MEQA 2REBA 1TYZA 3HJBA 1JIVA 4BZQA 4S1PA 5IABA 1QFXA 4JS0A 4L4ZA 5J2UF 3E8SA 3LX5A 3O94A 1MN6A 1XZPA 4JLVA 3IUYA 4V0KA 1FQKA 4O2BF 3UB4A 2Y9MB 5H3LA 3ETNA 2BKAA 3LKDA 5B58C 3TR6A 3AIOA 3PIRA 4U6NA 5IRCD 4LJYA 5C9ZA 2YZMA 2NLOA 1QH8A 2C1ZA 4WL0A 1NP3A 1JPUA 1EK5A 2ZSKA 5DIZA 3OX3A 3F9RA 3IL2A 2LKDA 5FLYA 3BMOB 1PZNA 2PSDA 2YJ3A 4G23A 2IYXA 1QCYA 3RNLA 3UMCA 1HL7A 1JAZA 1JU4A 2VIIA 2EBWA 3GEMA 1SXQA 1QKKA 3M1IA 4NCIA 4X7RA 1CU1A 1BD4A 1SVSA 4YP1A 4NZZA 3AEXA 2R8ZA 2BIFA 1II8A 5I5GA 5F9FA 2EOAA 3WKAA 1ONSA 3A58B 2G40A 1TAHA 1OF1A 4TLLB 4YAUA 2EV9A 2NQ8A 2OC4A 5B53A 1MX9A 1P74A 2NXWA 3EGVA 3CISA 4IQFA 2WU3A 2NU6A 1LLCA 3OFJA 3DL7A 4RY2A 5CA1A 2A9PA 4HPXB 5TXGA 3T34A 1RKXA 3PC3A 3RGGA 1FCJA 2XE4A 4JIMA 3DBLB 5IKXA 3BKXA 4WVFA 4QBIA 4Z6KA 3G1WA 2IYYA 3ZWMA 2IEYA 3OBIA 3THSA 2J09A 1MC5A 3F9CA 5BSFA 4FYKA 4ENRA 3ZDYB 2A0KA 2IJGX 1Y3CE 1VLMA 1LF5A 1R37A 2ZWOA 3QW2A 4ZODA 5LYYA 5CDFE 2H2FA 3RV4A 1WW3A 3DPIA 3ZXIA 1XD2B 1YJBA 2AYXA 4R6XA 3EE6A 2YJZA 2ADMA 2CLMB 2ZBFA 3LPCA 3GLFA 3P9CA 4MS4A 2IUTA 2QRNA 2GWHA 4ITRC 4R2JA 4KBFA 4XH9B 3VPDA 1XE3A 3P0EA 1C4KA 2XKJE 3NJ8A 3W2FA 4YCSA 4Z2AA 2WI8A 2DWOA 3X1ZA 4CF3A 2GSDA 1A69A 4IUCS 4H1UA 2JBAA 4BVBA 2WLTA 1GJRA 1E1QA 2C0QA 1Y7TA 5DBFA 4JV5B 4MKFA 1QP8A 1II8B 3G49A 3DF7A 3OEYA 4IQ8A 1RBYA 2A3RA 1N2EA 4J16C 3G0IA 4LXQA 4UXIA 1UMBB 4QPNA 1IOVA 1NI3A 1VPWA 4FEYA 4B8ZA 4F71A 4FXOA 4R6WA 1LX7A 1B6RA 2WVAA 4RD1A 5FI5A 1EEHA 4ZZIA 3QA3E 4HGNA 5CA1B 3ZQ6A 1ECPA 3NVDA 2HRRA 1O77A 2GKSA 4N8SA 3MWEA 4RJIA 4MJ3A 4WQMA 5CFZA 2FPLA 2QN8A 4P92A 3RHZA 2HDOA 2QTRA 2HIMA 2ROQA 4WHMA 1PR2A 1Z39A 4MO9A 4QPDA 2ZP1A 1PL7A 2ZCVA 3CX4A 3LCMA 3WK7A 3TOZA 3RRFA 2WWHA 1P0CA 4NDAA 5DHTA 2R6JA 4FONA 3GHHA 2IU0A 3T41A 1CY2A 4DAEA 2F1RA 3MOGA 3RU7A 4CIWA 1WB4A 1JFSA 3FMIA 4QQFA 3QPBA 4Z7OB 3AF6A 4LDJA 4TKMA 2PU7A 5IH3A 3CY6A 2H1SA 3KLMX 3GA5A 1WXQA 5KYVA 1VRVA 3BH6A 4ND4A 2GO1A 4U6SA 1M72A 4NHEA 3OT5A 4E46A 1AKEA 3K71B 3TZLA 3DZJA 4Q7KA 3G89A 4DV4B 1SWVA 3B7GA 1RRFA 4M0FA 3DHYA 3EGEA 3ADDA 2I7VA 4G5XA 2LVBA 1R4MB 4MRAA 4CM4B 2A1IA 4ZVMA 5B6PA 1IZYA 5HIAA 4AFNA 2WYVA 2FW1A 4LRQA 2GAOA 2QUZA 3ED5A 3ORYA 3PD1A 1ZJ6A 3O1JC 5A3QA 4FJ0A 2RD2A 3QKIA 4HAVA 4MCAA 3FM9A 4Q6BA 4FVTA 3TLAA 4RJLA 3DOHA 4LBVA 1MAVA 3UT6A 4RGYA 5DGXA 4E1BA 2QUBA 3C98A 3V7FA 1RZVA 1OV4A 3L7MA 4KO2S 1BDHA 1OBOA 2QLTA 4PYMA 1D1SA 4W5HA 4B6GA 1X1RA 3QTLA 3W6UA 8LDHA 1PDWA 1U8AA 3SEZA 2ZK7A 1RQNA 4LWZA 3C5HA 4R8LA 1FNNA 1FTGA 1UBUS 2ZAIA 4ZCPA 3U7IA 1VLLA 4W9NA 2GVNA 2AWOA 2MTBA 1D0SA 3COJA 4RE5A 5IW8A 2AWNA 1AO3A 1U1DA 2EBHX 5AD1A 1Z28A 3EMVA 3O3NB 3QBDA 1NMEA 2V4ZA 5CTJA 3U49A 2XRZA 4N48A 4TOIA 5KWSA 1W0CA 3ZHOA 2IW3A 1YGYA 5CA0B 4K9SA 2XDQA 4V02A 5LA6A 2X5XA 1Z6QA 5B3AA 3N07A 1E92A 1QE0A 4Z9YA 3TD9A 2ZUCA 3U13A 3PR1A 3QVJA 1QGDA 4FC7A 3E22A 3RFTA 2WWYA 4TMVA 2ES4A 4HWGA 3B7WA 1HDOA 3OT1A 3VDRA 4MYDA 1RXUA 4U7TB 3CWCA 2IY8A 3KOXA 1IXRC 3IMKA 4UZEA 1E9EA 3IOMA 2V45A 3F3SA 3ROFA 4EMSA 1J90A 1EH5A 1Q7RA 2D3WA 2GR9A 1GNTA 2HAEA 3H9CA 4CEJA 3HUUA 1BH2A 4GIBA 5E4YA 1DL5A 4XM0A 1QZTA 2WA2A 3LT1A 2BPOA 2GXSA 521PA 2B35A 2DKOA 3ER9A 3OPNA 4PGAA 1CQIA 1R8QA 1YJ5A 2EKQA 3EZ2A 3RRMA 4DA0A 3PTLA 3WYGA 4EYSA 4K40A 4RO0A 1EUQA 1N6RA 3B1VA 4UBIA 1CRZA 3W2EA 3ZLBA 5HMMA 3FTDA 4LZPA 2PH1A 3OIUA 4LYYA 4PHTA 3SN6A 4KK3A 1D0IA 4DQKA 1TAUA 1E6WA 3GPLA 4M1ZA 1T43A 1TEHA 2LBPA 5FB3A 4INZA 2P27A 3W2HA 1LPMA 2VDJA 1X77A 4LXTA 1Y4DE 1P0IA 4R9SA 2A5GA 3TM4A 5U4QA 5AVRA 1RYNA 1KMCA 4P82A 4YDHB 2NTEA 2XDAA 1R8SA 3ZK7A 1X94A 1YV9A 1L3CA 3IOBA 4ZU6X 1F38A 1JXAA 4JLOA 4PPQA 3I23A 4AN0A 3V1KA 2P2YA 3BE5A 1K7YA 4IDBA 1ZA1A 4WNAA 3VJKA 1E3WA 2VI5A 1FVFA 5KVVA 2P6OA 1IDN1 2HLNA 2WSYB 3GMTA 5BR4A 3MTIA 4JQYA 3CLSC 4DAOA 2IHJA 2BEKA 4OHWA 3T3PB 1EWRA 3U3XA 4R0MA 4YRFA 1Z36A 5K0NA 1QP0A 3H4VA 2WIAA 3VPHA 5MN5A 3GL9A 3VYVA 4ZOAA 4D4IA 1DEHA 1LDMA 3HCRA 3ZQKA 3HO8A 3LLSA 1H2WA 2ZRHA 2P78A 4Z86A 2Q62A 3GZNB 1WUHS 5BR7A 5HJ2A 4JEMA 1O96B 3FHCB 3KEMA 4P4SB 4EG8A 5JBIA 2ZKLA 1VB5A 5LZ4A 2W6JD 3V1YA 1S8AA 1ZH2A 3VU0A 3NAZA 5CNIA 4BFCA 1KFEB 4LHYA 1ZH0A 3NIBA 4HFMA 4Y9DA 2PX0A 1XZFA 2ECKA 1U0BB 3JQ7B 3TBFA 5CFLA 1FU8A 3ZEIA 4XPZA 1Z74A 4S1NA 2CVZA 2R6ZA 3HB9A 4OSEA 1L3BA 3MM4A 2DG2A 2V4UA 4ZAYA 1Z6TA 3ZDZB 2IXTA 3ZKWA 4E70A 4OHCA 5HKBA 4K05A 4R41A 4RL6A 3WYFA 4QXPA 1F8UA 4JASB 3TQQA 3AEKA 3P45A 5EPUA 3KE8A 4MYTA 1E9RA 3V4OA 4CEHA 3CLVA 2C8KA 4HZUA 1U3GA 3O75A 3FYHA 1ORTA 4WBSA 4ZRNA 5G0WA 5T6MA 4FYXA 4OQYA 4HAUA 3NRBA 2P6NA 2DJIA 3CVWA 1DKRA 2HF2A 1DC3A 1E1MA 1TJNA 2YRWA 1HOTA 3AUYA 1JILA 2W6ZA 4O4JB 4EW1A 4HDNB 3RANA 2QD5A 1Y37A 1GL7A 5BSGA 5DTMA 1EFTA 4TXJA 3ORFA 2DUJA 2WSIA 5BN3B 1D2MA 3NC4A 4XUCA 3GGJA 4NBUA 3CINA 2MHCA 3FPJA 1VCHA 2F59A 4A2WA 4JVOA 1GRQA 3R3ZA 4Y98A 1XCOA 1GQRA 3QWFA 5BR1A 3E84A 1YULA 3QV2A 3K0EA 2XF8A 2Z58A 3A7DA 5CT5A 3UFXA 4KR3A 2AKEA 3T9CA 1F0YA 4P80A 3EVEA 5KC8A 1M2FA 4J9VA 3JQBA 4CN9A 5B2EA 4LHSA 4KJXA 1V48A 3AIKA 3B6JA 3RR2A 4AYWA 2NOAA 2DUUA 2BI4A 3LTNC 1VLZA 3SHOA 1PJ3A 2DPYA 4B3MB 1B2RA 2BUBA 1V6SA 3LVFO 3V4PB 2Z3VA 1AA9A 2PLFA 2X3UA 1N2HA 4X7PA 1GRCA 5BN5B 3GUUA 1H4TA 3AY7A 2H92A 4BEJA 1I4LD 3MCWA 3MHTA 2PMWB 2XMZA 2YZNA 4BEVA 3OLXA 4ARIA 3MUEA 4MV3A 5LU8A 3BL5A 3S44A 3AFIA 2GS9A 3FIJA 1QQ5A 4A03A 1BVUA 3ZE7A 1U1FA 4PLFA 3J7TA 5ECWA 1U6IA 1MAAA 1V3UA 4MEBA 4ZA2A 1IJBA 4KREA 3R6WA 5BSKA 1PK7A 3UWDA 3OSZA 4KFSA 4P5DA 1QG0A 1GCGA 2BMDA 2JL1A 3DO6A 3D0KA 1UC9A 5HFNA 2POQX 4RL4A 3ZCTA 4LC0A 1SH7A 4WCFB 3B8HA 2QWXA 2C5SA 3L8DA 2G4VA 3UC5A 2O2EA 4BQNA 1RMTA 5KJ1A 5KINB 1E2BA 3MXTA 1XEXA 4RTQA 1QF9A 2QTNA 4A2CA 4H4CA 2F64A 1VG0B 1JT2A 4NL4H 2D1YA 5IH7A 5JSFA 1UOOA 2FSVA 2HA7A 2KX7A 4AB1A 4L73A 3BMCA 3KBOA 1FYDA 4A5SA 4RBNA 1KBOA 4W7SA 3MUOA 4EPRA 3ABSB 1MQSA 2BHNA 2GCIA 3WZ2A 3VNUA 3TIGA 2QDXA 4QNMA 3EGWA 3I83A 3V1MA 3WBJA 4EBBA 5J4YA 2JG3A 2OLEA 2B4TO 4HD8A 4U8HA 4D98A 3N5KA 2GN4A 4TTSA 2WIFA 3CVJA 4UTVA 4L57A 4KQHA 4ZI5A 3WK5A 3QTBA 5U4XA 2CUZA 2IH4A 4M0UA 4WD3A 4DQ0A 3SJCA 2NSJA 4I1YA 5DLQC 4ENSA 4CL3A 1CX9B 2HWYA 3EXHB 3TVDA 3LP5A 3SF8B 3WHKA 3OQOA 1NLMA 3I58A 2QZZA 2Z9CA 2YJNA 4B6EA 1EVJA 1MIHA 3FJ1A 2PK3A 4NBSA 4NOMA 5EJMA 4M0MA 1YS6A 1RM0A 4QBGB 4PNEA 5KVAA 4DIBA 1MQAA 3I6ZA 1XQWA 3KZKA 1B8UA 1GDTA 4KRFA 4REMA 2FFHA 4BMPB 1I10A 1U9JA 4ZU3A 4FX5A 4ER6A 4UREA 3I1FA 2IIQA 1PUIA 2QG9A 2C7BA 2X1LA 3RASA 2AYYA 3WG9A 5A3RA 2GM3A 4A23A 3B20A 2JIDA 5K09A 4OKSA 1NXPA 3A1DA 1KJ9A 4P7BA 3WLRA 1EX1A 1G2QA 3HKCB 5JCZA 1GPAA 2IHTA 3IILA 4HNVA 1OTHA 2TSYB 2V7TA 4IKOA 2EZ4A 4M36A 4HFNA 4IDAA 2L42A 5AOVA 3C3XA 4D02A 5G1OA 1B14A 2ANBA 2HSJA 4MR9B 4BATA 3QBVA 1IB0A 1XWFA 2OCAA 1S5PA 3JQCA 3NIWA 1UM9B 1CRPA 2BKUA 3AV3A 3K4QA 3KB2A 2QYSA 2FZWA 5AICA 4CIDA 3IHTA 3IKLA 3VO8A 2QX9A 4F1JA 4US2R 1OLOA 4IIYA 1RHKA 3R44A 1FRFS 4BMSA 3MJSA 3ZZ0A 5HUQA 4TN1A 2VC2B 4TKLA 3EWIA 1P4SA 4C4SA 2PPLA 3V55A 4D6PA 3RADC 2R6AA 4E88A 3O8QB 3LLCA 3ZK8A 4INPA 4XJXA 1JHVA 1SC9A 2BP7A 2FSFA 2GKGA 3FA2A 4F9GA 1XB2A 1ECCA 1VZ3A 4MVCA 1ZMBA 2O48X 3K9LA 3W9BA 3RSCA 4OATA 5B7NA 5A9RA 3KL4A 3EPLA 1EBUA 3LHKA 2EQ5A 4MUGA 3ICOA 4TWIA 1GARA 2EP8A 1K3TA 4FPXA 5D3KA 5KNCD 5CT6A 2PV7A 3FR7A 4D57A 2R66A 3RWMB 2XNKA 1KVRA 1PL8A 3HP7A 4FYMA 5KJEA 3R7FA 3VV3A 1Z15A 5AT1A 3BXZA 1GKYA 4FP9A 2H48A 4FYWA 5FBRB 3ETGA 4ZAVA 2QVYX 2BKLA 1G1MA 4QWMA 1SN7A 3DVRX 1XCPA 4N7BA 3KEQA 4G09A 4P4NA 2FWIA 5FX2A 2QD1A 3QX9A 1CZLA 4H17A 3R4CA 4Q18A 4YP9A 3OHMA 2P30A 2HH9A 4OU5A 4EARA 4LC9A 4ZJYA 1GZVA 2CGEA 5JPDA 3MJ4A 4AW9A 3GG9A 5LD2C 1JIJA 1OPRA 1V9SA 3W6ZA 1Q19A 1A9QA 3F2VA 3V7NA 2OXCA 1JA0A 4WKNA 2NZ8A 4MCJA 3Q3VA 4QFMA 4QDUA 4NULA 4I8DA 4NONA 4NFSA 3L5KA 2QTBA 1GDHA 1NJ5A 3EGDB 3IALA 3A3PA 4NV0A 4US1R 3WWDA 2RGXA 2V3CC 2EZUA 3WTCA 2ADOA 4LJ6A 5K01A 3GN1A 5K3SA 1TKRA 4BCDA 3JRXA 4ZN6A 2NZYA 4J16A 3DDOA 4C03A 2C5LA 1WOMA 1I2DA 2HRDA 3BBLA 4F86A 5HPYB 4DDUA 1T2DA 4PSKA 5KYYA 1YS7A 2JVJA 1NIPA 2KPOA 1INLA 3G3EA 4H4DA 1R64A 3GLKA 1YVRA 1IEXA 5GQSA 1MVNA 1ZOPA 3BSWA 3DDCA 4OAQA 1PK8A 2RB4A 3GFOA 4HADA 4IOLA 4OGWA 5AVQA 5KYKA 1DAPA 1QK3A 5KOYA 3PU6A 3OZTA 2HHLA 4D3SA 2ZWAA 4QRHA 4ZCTA 3FGZA 4ZAWA 5ES4B 4X6XA 1PFGA 1ZBDA 1ZGBA 2L19A 1D3AA 3FSGD 1JTFA 5F9MA 3UW3A 2BWJA 5FIUA 4U2DA 1CE8B 1JGTA 1ZRNA 1U0LA 2H9IA 3Q98A 4BB6A 4DSTA 1KVQA 1NBMA 1SFRA 2H11A 1N4DA 3BCRA 4EFNA 5GMOA 4EPYA 2V97A 3O8OB 3WDMA 1N33B 2R7AA 3WNVA 2G0TA 4IP0A 4YUWA 1PYGA 2IS1A 1G5FA 4EZEA 2J31A 2SECE 3QUTA 3UEOA 1JWLA 1JPJA 5AW7A 4IGEA 4H0NA 3WB0A 1OJ7A 5F21A 2XCLA 2C03A 3P5SA 2AFIE 2EDAA 3SBOA 4ISBA 2F1OA 3BA6A 3NBFA 1VIMA 1ZI8A 2N9UA 3MTDA 3A1CA 4JJGA 2P4UA 2IODA 4KNWA 5G53C 4KOEC 1VBFA 2ACEA 1RPJA 4NFYA 3VHXA 3HJNA 4LZAA 2IEGA 2XH8A 4HQLA 3OLWA 5DNWA 4RPCA 3UAGA 2Z09A 4HUTA 4IGKA 3RAPR 5KSWB 4E5SA 2XOKA 4K2HA 1CF4A 2ZGVA 1E2HA 4AJ1A 4HT3B 4UXJA 4GI1A 4MVJM 4G36A 4HAZA 4YX9A 3AFMA 3TL2A 3KKOA 2GERA 1SXIA 5ICMA 3DDUA 4KBGA 1CB7A 3GU3A 1HE1C 2VOJA 4G8CA 2O3UA 3OVMA 2FKNA 1KAMA 1K4YA 3O4JA 2DLNA 4BFTA 1FRZA 2GAFA 2XMRA 1N2BA 2PGAA 3T1NA 3GD5A