3RRMA

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
375
Chain Sequence
GLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELVNVDAIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 119
structure length 375
sequence length 385
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrmA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrmA02
2O0JA 1G8PA 1JEDA 5E7IA 4DB4A 2YYZA 1E2QA 1G7TA 1ZM4A 1KSJA 3U7GA 3RVBA 4LBYA 2OG2A 3WP0A 4N0DA 1WBBA 1E1QA 1G5RA 2GJKA 3GLHB 3I4LA 1DAFA 1KAGA 3CF0A 2ZE5A 3I1FA 3SZRA 3PITA 4B3CA 1QHHB 1N6RA 4OI1A 1P62B 3SQWA 2JEOA 1MH1A 4D82A 1D2EA 1R5NA 3DKPA 4Y0AA 2YC4C 1W46A 3ZGXA 3EZFA 1TQ4A 2CE2X 3ECCA 4M1SA 2NZ8A 1Z29A 2IYYA 3SU8A 1SVKA 2VF8A 5KNDA 3W3AA 4JLPA 2WHXA 4QL3A 3SYNA 4PC2A 4DIDA 2EU8A 1XJQA 3NHBA 3ZH9B 3PJRA 1NY5A 3SNHA 3TH5A 3J81k 2ODBA 3PUVA 4TMZA 3K0AB 5F2EA 1YRBA 2RMKA 1QHYA 2GEVA 1IXSB 2CJWA 3L0IB 1G64A 5TXGA 3Q5EA 1M74A 2CDNA 3OESA 3PQCA 3ZQJA 2P5SA 2IS1A 3RWOA 2PT5A 1Q20A 1MRSA 1OH6A 2YOHA 2XZPA 2FSIA 3HPQA 3EA5A 4JBWA 4B3FX 3BE4A 4B74A 3I5YA 3KKOA 2R65A 2AXPA 3H2YA 5FBLB 1T0HB 4JT2A 4TYWA 1H65A 3U4QB 4EAQA 2ATXA 4X8LA 3BERA 2WKPA 4YMTA 1P7CA 4NL4H 3RS2A 3ZIAA 4X8OA 4MGYR 4Q9JA 3GLIB 2UKDA 4C0JA 1R0XA 2JCSA 2V1XA 3B85A 1ETUA 4KCGA 4JYCA 2RGDA 1FX0B 3WYFA 1OW3B 2EFDB 4DCUA 3KJIA 1HE8B 1CIPA 3GFPA 1UDWA 3TQCA 2VBCA 3HDTA 4TMKA 3K9GA 3G82C 1EX6A 4PSVA 1GKUB 2LKCA 2QPTA 4QJ4A 4I1OA 3SS8A 3U2QA 4CEIB 2VP6A 3NWJA 5DI3A 1LW7A 4ZI3A 3I62A 3GPLA 1D9XA 5KTYA 2ZRCA 4LC0A 4A2WA 4HI0E 2Z4RA 3VX4A 1D5CA 2ZUCA 3NBZC 5EP1A 3RABA 2GCOB 1DEKA 2Q9AA 1OHHA 3K70C 3R7WA 1TQDA 4PZLA 4PTLA 3NBXX 1IN8A 1DVRA 2RGGA 2VP5A 2RGCA 3SI7A 1XDBA 4JVSB 2IXEA 2E1RA 1VECA 2YWEA 5CYOA 3JZAA 1HYQA 3KJGA 4DC9A 4DLSA 4UNSA 5JJIA 2YKGA 2VTKA 3DM5A 3MWYW 3GLFE 3W8NA 4V02A 3MRSA 2V6JA 1EFRD 5KDOA 5FPTA 1HA3A 1OXTA 1KMHB 1BMFA 5CJPA 3VKGA 4NP6A 5DLQC 2CCKA 2C2HA 4DLWA 3GJ8A 3A4LA 5EXTA 2BWJA 3KQHA 2ZJ5A 2QBYA 1E6CA 2JASA 4D4MA 1EWQA 5KNBA 4UKDA 2IYSA 1ZNYA 2REOA 3A36A 4QHTA 3OFNA 4AIIA 2NQ2C 2VHTA 2QAGB 4KFUA 3AVVA 2BBOA 3AF1A 3OIYA 2Z43A 1GG2A 4CZ2A 2PMKA 4TL6A 1ZNXA 4YMVA 2I1QA 3AUYA 3V00A 3FOZA 1G18A 1LF5A 2CLCX 4UJ5A 2P6RA 4Z1MD 4M22A 2C77A 3NC0C 5JSZB 4BLRA 3T1VA 2WWWA 2QGZA 2YC2C 4PZZA 3U3JA 1NSFA 3K8YA 3LQRA 2PMDA 1QVRA 5K8IA 4POAA 1XD9A 1N0VC 1V5WA 2QP3A 1R5BA 4L9WA 4I1UA 5HZHA 1AS3A 3LW8A 4YQFA 1GOTA 3W3ZB 3O8DA 2D7CA 1Q57A 4IVPA 4I99A 5EJEA 1H8HD 5KSOA 4MRPA 2J5XA 4EFLA 1NG9A 1M34E 1QRAA 2PH1A 4M1WA 1E96A 1G8FA 3CX7A 3GLGA 1YQTA 1MOZA 3PENA 4QJ3A 4ZCLA 4D0LB 3R9IA 4KSCA 1T6NA 4CF7A 3MUFA 5BWMA 2CHGA 2ZPTX 4H1UA 4A8JC 2EYUA 5EXXA 4GNKA 1HY3A 4NPHA 4E09A 4O3MA 1QHGA 1W0KD 5JS8A 2QZ4A 3BAFA 2DR3A 2DFNA 4KJZA 1E2DA 1IXRC 1FUUA 1E69A 1NI3A 1K8RA 3ICQB 2YHSA 2XJ9A 4XWAA 2OLJA 2VPPA 4JLAA 4S2EA 4G01B 4LV5B 3LBHA 4R98A 2JGNA 1NL3A 1FP6A 1G17A 1TUEA 1N5KA 3MFYA 4WZ6A 2NO1A 4EPYA 5L3SB 1VCNA 2GXUA 3CONA 1TQ6A 3GJ4A 4IJMA 2ZRIA 3ZLJA 3FKSA 3MGCA 3FWYA 4LWZA 1JB1A 3ICEA 4HZUA 4N0EA 3RS0A 3I5XA 3U3MA 1II0A 1A5TA 4UNPA 2IUSA 1FZQA 3MCAA 2FN4A 1G19A 5JHHB 1LV7A 3RWMB 4QNMA 1W2HA 3JVVA 4QBFA 4ASUA 1RJ9B 3P4YA 1OXSC 1QDEA 3EIQA 1MO3A 3NIBA 2OFOA 4KFRA 2RB4A 2W6ID 3TKLA 4D4JA 5IRCD 1CXZA 1KI6A 2J0VA 4M4SA 4BFZA 2AR7A 3RS4A 3CX8A 4ILEA 4P4SA 3K0CA 3Q3JB 3V4RA 2VYFA 5JJKA 5H8WA 2WJJA 3ZVMA 1CRPA 3OE7D 4MH0R 2OXCA 3QF7A 3Q85A 4K81B 5G3YA 1F48A 2D7DA 4RFSB 3JZMA 2AFHE 3FGNA 4M1OA 4IDHA 4A92A 2QL6A 1ZUHA 3K1JA 5FL3A 4B33A 3TVDA 2AK2A 2OO7A 3CO5A 1Q1ZA 1I2DA 4TMTA 1XPOA 4X8MA 1XX6A 3G0HA 3ZDQA 1E0SA 4OHVA 3UWOA 1UEIA 1OJLA 2J0UB 4HLUA 4OK6A 3OIVA 3KKQA 4M2LA 2FFHA 3D7MA 4EIWA 4RCZA 1JQJC 5BN4A 1G8HA 3KQUA 2GF0A 2XITA 1U98A 3ONWA 3WRYC 3PUYA 2FE4A 2IBMA 4TLCA 1ZD9A 3VR5A 3CF6R 4CGZA 4Z8YA 3CWQA 5KOYA 3LV8A 3FDIA 1M7HA 4V0LA 3IEVA 4QBHA 1G16A 1U94A 3SOPA 4HLQB 4DRZA 4F7WA 3KXKA 4HAXA 3GLFB 2F1JA 2ZRKA 3FYHA 4V0NA 1D2NA 2QU8A 5DIFA 3K70B 3T35A 1XPRA 1G3QA 2VHQA 1Q3TA 1X6VA 2RCNA 4UJ3A 4PHTA 2RH5A 3BH0A 4BE7B 2CK3D 2V54A 5DE3A 4B2LA 1WE2A 3FHOA 3LAWA 4Q03A 1JNYA 4LJ7A 2PEZA 3X2SA 3NKVA 3QG5A 2R62A 4DUGD 4IOMA 4FD2A 5KDLA 1YR7A 3QKUA 4KYUA 4CEJB 3QJYA 4PANA 5FTNA 2O8EB 1HTWA 5TV2A 3CZPA 4UNRA 1XFAA 1E0JA 4XVQA 3IIJA 1E2EA 2GVZC 4AURA 4RD3A 1II8A 2H8KA 3QSYA 5F9HA 4B35A 1DAMA 2Q21A 5J4VA 2AK3A 2JLQA 4E03A 1Z5ZA 1HQYE 2O8FB 1SXJC 3W90A 1W4RA 1TEVA 2G0NA 1U9IA 3T61A 1SVOA 1AQUA 4HB0A 4L8GA 3U44B 2XXAA 1IY0A 1P75A 1Z2AA 2IEZA 2Q3HA 2ZJBA 2ZREA 1II9A 4HAWA 4RZUA 3AVQA 4TMXA 1GAJA 1U0LA 5AWFC 3T06B 1R6BX 1E2HA 4JLOA 2VIIA 3M1IA 1RRGA 5SZKB 1SVMA 4NYIQ 4O2LA 1OXUA 1SXJE 2W2XA 4W9MC 3SFVA 2AWNA 1D2MA 3PUZA 5M04A 1FMJA 3VX3A 1J7KA 2ZE8A 3RSLA 3OIWA 1B0UA 4LY6A 3BFVA 4ZDKA 3ADBA 1VG9B 1F6BA 4XD7A 1ODFA 2ZETA 4DDWA 3EW9A 1AGRA 2GBLA 2R6DA 1T3LA 3HYRA 4Q7MB 3DEFA 1CULC 1X1SA 2H18A 2V55B 2BDTA 1KTVA 1IOZA 3QEJA 1XTRA 1DPFA 1RYFA 1UPTA 2GEDA 4DB2A 4C0SA 1N6NA 2HF9A 3AVUA 4A8JB 1P9RA 4GMDA 4WIAA 2ZS8A 3THYA 2I4IA 4AD8A 3SHWA 1JI0A 2F1RA 3DZDA 3U3OA 1AQYA 5HR5A 1KHTA 4KVGA 4Z1MA 2ZI9A 1CR0A 2WWYA 1G3RA 3Q72A 1P9NA 4IOLA 1F2TB 2ZTSA 4C0AC 1U8AA 1Q1EA 3MWKA 4US1R 2WICA 3LDAA 1KYIA 5EQTA 4DT1B 4F4JA 2C98A 3P1JA 4TQUS 1OPXA 2GK6A 4A0FA 3E2IA 3PEWA 5GJVC 4IEIA 4UXHA 2C95A 3P26A 3EAQA 2ZVPX 3QNUA 4G5RA 5KSZA 3VHXA 1S2MA 4OI2A 4Q1FA 4MRSA 1W36C 1H8HA 4G5SA 1VKJA 4LK2A 2ZRHA 3TGPA 2HJVA 1Z6GA 3EA0A 2X77A 1N5JA 1MO6A 2P2LA 4OI0A 2G88A 4XSHA 2AKYA 2BHRA 2A3RA 1MABB 1QHSA 1QG4A 4J0QA 4TL9A 3T5GA 4WA7A 4C7OB 3IBGA 2E87A 1NN3A 3CPEA 2JLUA 1A4RA 3WHKA 4DEYA 2VA8A 2CBZA 2BCGY 1YZGA 3GLHA 5FTJA 1KSGA 5KDDA 1NJGA 2GETA 2DBYA 4F91B 4TTQA 2I3BA 4JL8A 4MKHA 2LKDA 1NVXQ 4LCBA 2FGJA 3AQ4A 2FEMA 2OBLA 1R8SA 5EP2A 3WYGA 4LYHA 4ESVA 3TW4A 3KUDA 1DTSA 2FF7A 2QP4A 3QKRA 1OFIA 2O0HA 4TT3D 1SVSA 3X1XA 1NBMA 4EJSC 2IEYA 2FPLA 2IA5A 3BFKA 4XWOA 3E5HA 3WMEA 5ELXA 2BM1A 1E9FA 4TL8A 3K0AA 3AKEA 3KUCA 3W5IA 5L3QB 1GITA 8OHMA 1D9ZA 1YU9A 4MYCA 4P32A 1BYIA 3EASA 4GBMA 2FFAA 1XXHE 3QY0A 1OE0A 1PLKA 4HEJA 2XB4A 1J90A 3H84A 4FWIB 4MGZR 5A0FA 1E79A 3RDPA 2F7SA 1ZUNB 2AFIE 2Q3MA 1UF9A 1U2RA 2DWQA 2A5YB 1LNZA 3E1SA 4LBVA 1K5DA 2W6IA 5KU1A 2GJ9A 4P0TA 3TUIC 1E2PA 2ZYVX 1D6JA 4ZI2A 1P73A 4BLSA 5KUTA 2OFXA 3AVYA 2DY1A 1NMXA 3B7GA 5FFMA 4YMWA 2FG5A 3U4QA 4QBGB 3K70D 3EG5A 3VKHA 1IY1A 1IHUA 4CT5A 2B7BA 3LD9A 4TYYA 1VDZA 3IIMA 3OE7A 1IY2A 2HCJB 1NF3A 3PCRB 4NYJQ 5JI2E 3AV0B 5FBQB 1S3GA 4PAMA 3QKTA 4HUTA 1Z22A 4ZIRB 4MYTA 1FX0A 4O0MA 3NBYC 5FI1B 2ORIA 4G5GA 1PZNA 2IWHA 1P5ZB 1UBCA 2JAQA 3GD7A 5JBQA 1FNMA 1P3JA 3MLEA 2ZRDA 2ZANA 3B82A 4WVFA 4JLNA 2FZ4A 1GDDA 4CEIA 1GKIA 3AGPA 4K46A 1XZQA 4JKYA 2V7QD 1GL7A 1W5TA 4JLBA 5ANRB 1MV5A 1BMFD 4Q01A 1EFHA 4BZQA 4TZ0A 3K0EA 1N6IA 5HTKA 4YMUA 1N3BA 4RSGA 1Q21A 1E2IA 4IFEA 2HJGA 3W6OA 2Q9BA 3TSOA 1C1YA 1U90A 2GCOA 1SXJB 4U7DA 1Y3AA 4BUJA 2QMUA 5JZVA 3BB4A 3BWDD 1GP2A 3EX7C 2A2ZA 3UATA 4JVNA 3L8YA 4MITA 2CK3A 4B2PA 5L8VA 1CBUA 3BJIC 3CR7A 4C0BA 1YZKA 1M8PA 2P67A 821PA 3AM1A 1XEXB 1OYWA 1I4DD 3TJZA 4LDJA 3QQ5A 4Q4HB 1KMHA 2F3TA 4IVQA 4Q5IA 1HEIA 2ATVA 3B9PA 3OEHD 3BORA 3B6EA 3TQFA 1RE0A 1W7AA 1N5IA 5CM9C 4H1VA 1YHNA 5FOUA 1KI3A 4MA4A 3SE0A 1G1MA 1M2OB 2OEPA 1NLFA 4IXMA 4X8HA 5J4HA 1VYUA 1G8YA 1OIVA 2VEDA 1IN4A 2OT3B 2QAGA 2GCNA 3RRNA 4OHYA 3IQXA 3C5CA 2GKSA 2VLIA 2OUKA 4KSBA 4D81A 4PSAA 4M8NE 1T91A 2GHIA 2B8TA 3SJAA 3IKJA 4FMDF 1RRFA 3U61B 1J8YF 2NO7A 3DOFA 4GFDA 1P72A 1YZNA 2F43B 1JJVA 3P27A 4S35A 5JSZA 5FOXA 1E2GA 1G9XA 1NG1A 2CXXA 3CRRA 2XTMA 4A2QA 1KI9A 2J59A 1Z0IA 2GEUA 3AUXA 4ZDIA 2GXSA 5CYPA 1G8GA 3ZZ0A 5HCIA 2P0EA 5G40A 1IN7A 1K6MA 2IUTA 1RKBA 3PIRA 1G5TA 1W2GA 3ADDA 4DLYA 3UMFA 2HLDA 3NHAA 2RGEA 3PEVA 4BQSA 2HUPA 2ZI4A 1W36B 1UADA 3UWKA 5FUWA 1YR9A 5J5CA 3CLVA 3U3RA 4A36A 3C7KA 1Z6YA 1FQKA 2ANCA 4MUBA 4V0ME 1CJKC 4TYNA 2B92A 2QMHA 2EYQA 1ZCAA 1T0JB 1MO4A 3FE2A 3GFOA 1DELA 2WIBA 1KSHA 1OLOA 3HR8A 1KNXA 2OCBA 2QGNA 2G3YA 4EPVA 3RANA 4ASUD 4QGFA 2CLSA 2D3WA 1X3SA 2ZR9A 1S9DA 4ZCMA 5GVSA 3NG1A 4NMMA 2C9YA 1S1MA 5CJ2A 2BIFA 2K5UA 5DHFA 2NO9A 1KI4A 2OAQ1 2WJVA 3IIKA 5H70A 4B6FA 5L3SA 1YZQA 2G83A 3KXLA 1XXHB 4CRWB 4B76A 1OB2A 4WXPA 4EJSB 1AN0A 1Z6XA 3FPAA 4GMXA 4YLGA 4YONB 3LX5A 3C41J 4DXAA 3AVTA 4M9SA 2PLFA 3HU3A 4O25A 3NDBB 3A4NA 1CJUC 2ZSEA 1EFTA 1RJ9A 4KV9A 1TADA 1G7CA 3RNLA 4DVGA 5FPYA 2OZEA 2ZAMA 3QUSA 2PZEA 1U99A 2ECKA 3KDSE 4IOKA 4C30A 1A7JA 1VTKA 1KNQA 5J47A 1KIMA 2JJ1A 1BO6A 2BKUA 1CU1A 2PX3A 2QSZA 4RFSA 3GQBA 5BYKA 1TF7A 1G291 2RGNC 3FMFA 4G1UC 4CW7A 2ZU0C 2NTYC 1ZIOA 3SYKA 3U7HB 5CIQA 4GSYA 4ZO4A 3KL4A 3QI2A 4URWR 3RRMA 1T3HA 2BJWA 4Z51A 4JLMA 1FUKA 1VYVA 4Q02A 1XTSA 1YZLA 4Q1EA 4TT3A 1JAIA 5HZKA 1EGAA 5AK0A 2J0QA 2J0UA 2ZSFA 1WQ1R 1OXXK 4B3BA 4QBIA 3SJZA 2NG1A 1Z0JA 2Y8EA 3GJ0A 1XD2A 2WOOA 4PZYA 2OCAA 1N6HA 2H1LA 5G41A 2ZE6A 5J4LA 5HCNA 5CLLA 2QTVB 4FINA 2GRJA 1KKMA 2JA1A 2XEXA 3L2OB 1SXJD 1E0KA 2BEKA 2KJQA 1R8QA 4Q4AB 3A1VA 1DADA 2CHQA 3QPUA 3DL0A 3GLFA 3NH6A 2WMNB 1CJMA 4C0LA 5GADl 3QENA 4R9UC 5EP3A 5FOVA 4DBLC 1GL9B 2B7CA 2QTFA 4AI6A 3VU9A 1BIFA 1A2KC 1ZM7A 2FPMA 4FN5A 4HLDA 2J7PA 4E22A 4B3GA 1G4AE 1YRAA 1E9SA 1KI1A 3N2EA 5AJZA 3ZQ6A 5EP4A 3AVXA 4LRWA 4WBSA 3F3YA 5FTLA 5EZ5A 3QE0A 3P20A 1Z0DA 4Q66C 3KKNA 3ZS8A 2VP9A 4LJ5A 3FB4A 2QAJA 4CEJA 3DPUA 2O8EA 3ND9A 3PR1A 4PR0A 3KQNA 4RFVA 2W2VA 2ZR7A 3CH5A 2GA8A 4EQ6B 2V7QA 1S3SA 3K0FB 2WTUA 3G5UA 2IHBA 4RZ3A 4XD7D 4A9AA 2FH5B 4LZZA 1Z07A 5J4YA 2JLZA 5P21A 2O8FA 3RC3A 1LS1A 4PFSA 3CB4A 2ZRAA 2NPFA 3U44A 1UBGA 4OI4A 5JWRA 1G7SA 1D8TA 3SJCA 2VRWA 3KX2A 3I92A 4GRAA 2B6HA 3A37A 3B8HA 2XTZA 3IHLA 221PA 5FBVB 2A9KA 4CVNA 2RHDA 1U8ZA 2ORVA 2CE7A 5DSZA 3TR5A 2A78A 5JFGA 3HU2A 2W58A 5D3MA 2ZJAA 5FBWB 3TW8B 3CZQA 3Q5DA 4A6XA 3EWSA 1JXOA 2D2EA 4RD4A 1U8YA 1KJZA 4MKIA 1S9HA 3JVUA 3V4FA 1M6NA 2CL0X 3OEHA 1XU4A 4DEXA 1XEWX 5LD2B 1FQJA 4F38A 1W36D 4E07A 1JALA 2QPOA 4JJKA 4ARZB 1G5PA 1YZUA 4OK5A 3R8FA 1NIPA 1CJTC 1MKYA 4PO8A 4OYHA 4GOKA 3L0PA 3CR8A 4GPTA 2QORA 5FOSA 1UJ2A 2X8AA 4KLNA 2ZR0A 4A8JA 1OFHA 1ZVQA 1GSIA 2O8BB 3X1YA 5F3WB 1GTVA 4AKIA 3M4YA 3TAUA 1CEEA 1G6HA 1OH8A 2ZS7A 1E98A 1Z28A 1F2TA 5CDFE 2NZJA 2NIPA 3FMOB 3CNOA 4DT1A 2ZJYA 4OQLA 3TSWA 1P9WA 3MMPA 3BH6A 3CRQA 2ZUBA 1EG7A 3IPXA 3LVQE 4LBZA 2PJRA 4B75A 2WSMA 4PAQA 1YZTA 2MMCA 5JI3E 1MO5A 2XX3A 4C2UA 121PA 3B1YA 2OBMA 5FBRB 4B2IA 3AKCA 1NBMD 1Z0AA 5C4GB 2IS6A 4M0LA 2EFGA 3CIOA 2QENA 4DCSA 3CM0A 1MABA 1F2UB 3H1TA 3ASZA 3CRW1 5JEDA 4C7OA 4GP6A 4KBGA 1KAOA 4ZV4A 4XTRA 2HXSA 3RYTC 3ZD6A 1VIYA 1ZU4A 4KU4A 4HUQA 2VL7A 1IN6A 2QI9C 2QSYA 1E79D 3MWJA 2FNAA 2ZJ2A 4Q9HA 3T12A 5K8UA 4XJXA 3C5HA 4AYWA 2WPDD 2GXQA 3UMRA 4D80A 1DAHA 2F3RA 4OQFA 1ESNA 2PX0A 1IONA 4G3XA 1Q1QA 2NMVA 4ZDJA 3BK7A 4RCYA 1SVIA 1ZD8A 1MRNA 4BFWA 2Z83A 4PPQA 4F4IA 4C3ZA 5L3QA 2VP2A 3IDQA 1ZD1A 2D4HA 4M9XA 2G0TA 4R7ZA 4US0R 5E3HA 5B58C 2C5LA 5DH9A 1G41A 1KK2A 1MR3F 3PVSA 4H9GA 4TWZA 1Q44A 1VCMA 3TAHA 2BBSA 1GUAA 4XIGS 1VMAA 4UNQA 3WNDA 2ZJ8A 5FI0B 4FCTA 4PXAA 1T9HA 1E9EA 3AP3A 2Q3FA 1N6OA 4QGGA 1XB2A 4NCHA 1JR3E 3QKSB 3KQKA 3NEYA 4D4LA 1OIXA 3PFIA 4JL6A 4IEEA 3ZZUA 2GAAA 3HR7A 4HAZA 4D25A 2AWOA 4PC1A 4JJZA 5TVKA 3VR2A 2QP9X 4LPSA 2REBA 3NH9A 3SBEA 4QGAA 1YVDA 1UEJA 3AH8A 4ZIRA 4TLAA 3GJ5A 1TNDA 1OFTA 1XCGB 2CCJA 3QF4B 4B32A 3O47A 2HYDA 2W6JA 5JRJA 4HB3A 1RPZA 2JLXA 4AYTA 4HLUC 4URVR 4PSKA 3QXXA 1W0JD 1ZMXA 1ZUIA 2VHJA 4NCNA 1R4AA 2P6UA 1KY3A 4PC7A 5DYIA 1XTJA 3Q7QA 2FEOA 2JATA 4R2HA 3L43A 4OQXA 3A4MA 1GL6A 2IWRA 2PZFA 1COWD 3LXXA 4P4TA 2DCUA 1E4YA 3AVOA 3WHLA 4BLOA 4P4UA 3DDCA 3AF4A 3HU1A 1KDOA 4Z8XA 4D0GA 3AP2A 1XMJA 1SXJA 2QG6A 1XMIA 1EFUA 3PUWA 4QHSA 3GMTA 3WMFA 4CYMA 1FOEB 1F3OA 1X1RA 1H8ED 2DFTA 2YWFA 4LUCA 4OJKA 4GT1A 4XOIA 2WSSD 2ERYA 2ZYWX 1XPUA 1NMZA 2PT7A 1U81A 3RLFA 1L4UA 4B44A 4JBYA 4B3XA 2MSDB 1JPJA 1EFCA 2KSQA 4HDCA 2V3CC 3I73A 3SQXA 3IPYA 5AUOB 4Q1AA 1VG1A 2VSOA 2ZRMA 3OEED 2JDID 1XEXA 5JEEA 4Q4HA 1X86B 1U0HC 2KI5A 5JECA 3GJ6A 1N0UA 5CK5A 2XNSA 1R7RA 2BBTA 3RAPR 3QBVA 2IX3A 4FIDA 2YOFA 2Q0HA 4URXR 4NU0A 3THXB 3KJEA 1JR6A 5CK4A 5CM8B 1AK2A 1DE0A 3LW7A 3X1DA 2IT1A 5KNCA 4GL2A 1UBEA 2W0MA 1P61B 3D3QA 3SEAA 4DLZA 2QBYB 2EWWA 2Z0MA 4TMWA 4KO8A 3VKWA 2HLDD 1XD8A 5GJCA 1DAKA 2QMEA 3QVVA 3GEEA 4KFSA 4L9SA 1NVWQ 4AKHA 4LJ6A 3QIAA 3HYTA 4M21A 3Q9LA 4A4DA 4ERNA 3D6TB 4NYMR 3RRYA 1US8B 4FW9A 4NZYA 1L8QA 1P2SA 2ODWA 4MKFA 4DCVA 2IYUA 3U6KA 4ZCIA 1ZBDA 4UXIA 2ONKA 1QHIA 2C03A 3F5FA 4LSGA 1ZP6A 5A4JA 2IYQA 5IK2A 2ZM5A 1V43A 1BYUA 2YZ2A 1L2TA 4C4PA 3NXSA 3F0TA 3BIFA 5SZIA 3VFDA 3K53A 1ZCBA 5A5GA 1P2VA 5FPSA 3RRZA 5FOTA 3LLUA 4G5OA 1R0ZA 3THWB 1WXQA 1X8KA 2QRZA 3WBJA 4DKXA 2QMOA 4Q21A 1J2JA 4UXJA 1PVOA 4LGMA 3IHWA 3MAAC 2FWRA 3ZVNA 3MD0A 2OFWA 4HYYA 4P31A 2AXNA 4A0GA 5BN3A 2WIAA 5B30A 1N5LA 3OAAD 4C0KA 2MMGA 1IJEA 2ERXA 2ZSAA 2GAOA 2WM9B 3EARA 1JPNA 3BBPA 3EWAA 4B48A 1T5IA 2QT1A 2RGXA 4Z54A 4F92B 3S1AB 3THOA 1DOAA 2KBEA 4Q00A 1WMSA 1KI7A 1SGWA 1TF5A 2A7QA 2QT0A 2VQSA 3KXIA 2TMKA 4AK9A 2HYIC 4KLZA 3GP8A 1YE8A 4M53A 3UG6A 1XCPA 4DWJA 2GTPA 3EIEA 4N1AA 4QNRA 4YDHB 4BLQA 2ZYUX 2CHVA 1B23P 2F1IA 2A30A 3GFTA 1GVNB 3L0OA 2JJ1D 3CRVA 1KO1A 2XZLA 3CPHA 1KMQA 4BLTA 4Q9LA 1QHHA 1Z0KA 2BJVA 2FSGA 2YINC 4FMCB 4LHYA 5DI9A 1IQPA 2QM7A 5E7JA 4RZXA 4FMDB 4EJSA 5G53C 4TTPA 4PC6A 3X1ZA 4JZKA 2F9LA 1IBRA 4WZBE 2HF8A 3PUXA 5EXPA 3PG5A 1KI8A 2GZDA 5KO2A 1AJEA 4PQRA 2R6CA 2GJAA 2OILA 3W9YA 5B2ZA 1KO4A 2CEAA 3K9LA 1IXZA 4PPNA 1UKYA 4CDGA 2FSFA 2RGBA 3KB2A 4KI0A 1SZPA 1U0JA 2CVHA 3R8CA 2FDCA 5F9FA 4PAOA 5GVRA 3UIEA 2R6FA 3KFXA 4GOJA 2CCGA 1CF4A 2VHCA 3LLMA 4B3DA 1IAQA 5J40A 4CT4B 4LHVA 4I1VA 1AGPA 3LNCA 1AZSC 3B2EA 2WPDA 2H16A 4A6PA 4HDQB 5LB4A 1ZYUA 3BB1A 5EE5B 5CITA 3I72A 4L16A 1VCOA 3A1WA 3GLIA 1OH7A 4UQOA 4GZMA 2J7PD 3T1QA 2WWIA 3REFA 4LJ4A 1LVGA 3TSZA 2F6RA 2ZXUA 2G1KA 3P4XA 4EKDA 1S8FA 3SBDA 1FP7A 4EPWA 1L4YA 2OV2A 1TU4A 3WRXC 2O5VA 3N2IA 5GJWC 2GVDC 2EQBA 2IXFA 5IHPA 5JJLA 1N0WA 4MQBA 4A15A 1KO8A 4ITRC 4IDQA 2XJ4A 4KXFB 2PCJA 2WWHA 4QHYA 2ZRJA 3IUYA 1X8JA 1KI2A 4G5QA 1GNRA 4Q4AA 2BMEA 5HE8A 2WMOB 1E9AA 4OJQA 4LHZA 5FR1A 2O8DB 4URYR 4IDPA 4C2TA 4NH0A 2V1UA 5DN6A 4GZLA 4BFUA 3UPUA 4AKGA 3N70A 1YR6A 5C46F 4LV6A 1XF9A 4DLRA 3I3SR 3FTQA 2B21A 3LQQA 3VR4A 3K09C 2FOLA 5BW8A 1N6KA 1ZC3A 3B1XA 1ONBA 1GRNA 3NDPA 2YWHA 1P6XA 1RVDA 1W0JA 3R9XA 4EQ6A 2ZVQX 3TR0A 4JL5A 4KVAA 3F8TA 1NNEA 3K0FA 4MYHA 2W83A 3K9HA 3T1OA 1COWA 2WWFA 3A1TA 3AKDA 4IFBA 1Q3HA 3E70C 1W4AA 4NCIA 2GJSA 4JVLA 3WXMA 1LFDB 1OF1A 3RS3A 3TNFA 3B1ZA 5UKDA 3CPJB 5AR1A 4OQNA 4IW3B 5EE1A 3W34A 1ELOA 1LTQA 3DM9B 3LFUA 3SDZA 1H8EA 1QG2A 4JIMA 2WSSA 4CIDA 2F9MA 1Z6AA 4HAVA 3EZ2A 1RFLA 3QXJA 2FFQA 2IL1A 4D6PA 4FMCF 1NN5A 4RKEA 4BLPA 1E4VA 2IYVA 5AUNB 2IF0A 2L0XA 5KSYA 3OEEA 4BWYA 3LX8A 2JDIA 2V6IA 1N2CE 1R0YA 1QVAA 3W6NA 2IYTA 4G0NA 2XNDD 4DZZA 1W4BA 2BMFA 2VF7A 2RGAA 1SVLA 3RS5A 4Q9IA 2QEQA 5C1BA 1DARA 2OESA 4ARZA 1Q0UA 4V0KA 5LD2C 3WMGA 2P6NA 1ZW6A 2ANBA 4V0OA 2ZQ5A 2ZRNA 2EW1A 1KJYA 1XBTA 4HDOB 1PLLA 2O8BA 5JWHA 3HPRA 1T8UA 2ZS9A 5DHAA 4JLKA 3EXAA 2PEYA 4WW0A 2HEIA 4HAUA 4C0HA 4BFVA 5AUPB 2ZU6A 3CNNA 3TLXA 3R20A 1TEXA 1W48A 3K9NA 4HB4A 4OK3A 4BASA 3OIUA 1NKTA 3FHCB 1P60A 4FWTA 1AZTA 2IYXA 1ZM3A 2AL7A 2ZSDA 3GEHA 3KZ1E 4NTZA 1XMSA 4BFSA 1W44A 2YVUA 1E2MA 3A1SA 1S1CA 2QPAA 5LDDC 1KZGB 1O3YA 2YJTD 5SZJA 1KGDA 2EFCB 3CBQA 4ABYA 1ZINA 4U5XA 5K8TA 3OAAA 4OL0A 3QPVA 4GI7A 1DG1G 2DYKA 4TMVA 4WXRA 3B9QA 1RIFA 1F2UA 4LJ8A 2IS4A 3C14C 5IF9A 4Q19A 1RYHA 2ZJOA 4HB2A 1Z6TA 2ZYTX 3C15C 2QQEA 4E5UA 4MDEA 2CMKA 1KK3A 4LC1A 2X2EA 2O52A 2C04A 5DISB 4YC7A 5HKKA 1MT0A 3PEYA 3RSOA 2OCPA 3HP1A 2R6GA 1GNQA 4P3YA 4GOXA 3CNLA 4DDUA 2IUUA 1JJ7A 2NPIA 3KTAB 2RGNA 1NKSA 1AKEA 4NBSA 4QG7A 5E95A 3QKRB 2EFEB 4II7A 2ZI3A 3LBNA 3MSXA 1TAGA 3A58B 4NDZA 1Y63A 2BM0A 5KPJA 2J45A 2Z6VA 4MRNA 3EPHA 3B5JA 2PLRA 1TUIA 4LHWA 4RD2A 1JBKA 1FNNA 2W6JD 4PO1A 3LXRA 2VO1A 2ZRBA 1PUJA 5FL7D 1CLUA 3BD9A 5EUMA 2GWHA 2A5DA 4EPTA 2C99A 2F1HA 2OXRA 2ZSBA 3GEIA 4DJTA 2FV8A 3NBFA 421PA 1NVVQ 4QRHA 1NVVR 3H4MA 4U02A 3QKSA 4GDFA 3AVPA 1GKYA 2QN6A 5IT5A 1FMLA 3BH7A 4GP7A 2WOJA 2I1VB 2FSHA 2YV5A 3UXMA 4D2IA 1KO7A 4LYJA 5TDHA 2OHFA 1GNPA 2X19A 6Q21A 1EWRA 2G77B 3QF4A 4L4UA 2CNWA 5H1YA 2H7VA 1RC8A 5TY0A 4TSFD 5C18A 2IF2A 1ZU5A 2FPKA 1DO2A 3ADCA 4FMBB 3N5CA 2JLYA 4DCNA 1UKVY 1P2TA 2ZROA 3A8TA 1Z06A 4LJYA 5EUQB 5C2JB 3GJ7A 4XTCS 3SHFA 4PHGA 1S96A 2OLKA 4BFTA 2BMDA 3FKQA 1HURA 2AN9A 3H0KA 2AX4A 1Q12A 4Q47A 4BRWA 4BFXA 4FCVA 1G20E 1E32A 3AP1A 4BRUA 4TLBA 2XGJA 4YXWD 3RC8A 4EUNA 1XTQA 3RS7A 2P65A 521PA 3AB3A 4M1YA 2WJYA 4KYIB 3VR6A 2D06A 4DSTA 4KITB 1E9BA 1G3UA 4LYAA 5AJWA 2IXGA 4BGDA 2NO6A 4CEHB 2ZI6A 2BMJA 4DSNA 4NONA 1ZJ6A 2HT6A 4V03A 2DWOA 1FTNA 1FPMA 1Q22A 1XNJA 2FX3A 3BGWA 5IK2D 3EPLA 2Z5FA 2JLWA 2WWXA 2D74A 4AC9A 1VG0B 4ON9A 1E1RA 1XEWY 5IDVA 4M9ZA 2ZITA 2R8RA 3U7EB 2QQ0A 3TE6A 5JS7A 2R2AA 3THXA 3BRWD 2GXAA 3AVWA 2J9RA 4Q4LA 2QA5A 3WNBA 2IK8A 3LH5A 1Z2CA 1XJCA 3FFBA 2O8CB 2XTNA 5L3VA 2YOGA 3ND8A 5DGXA 1A82A 4B71A 1GRQA 1R2QA 4AG5A 1W5SA 1EX7A 2IYWA 4QOSA 5CDFA 4IVRA 4TL7A 1US8A 2KB0A 3CUEF 4IDNA 1ZC4A 4TN1A 1EK0A 3VR3A 4DSUA 1AS2A 4ZKEA 5FPKA 4D26A 2JJ2D 3GJXC 1I4TD 3IILA 3WYAA 3FVQA 2FZLA 1ZIPA 1HV8A 1WA5A 2QRNA 3BFXA 4AYXA 5C4MA 5EZ6B 4M1MA 4L15A 4LJ9A 2DB3A 3CW2A 3THWA 1UKZA 2HV8A 1RZ3A 3QVUA 3BS4A 3DHWC 3W8RA 1VYTA 3Q8XB 2IW3A 2OE2A 2A5JA 4AG6A 4QXAA 2DWPA 4FCWA 3QG1A 3TVTA 1XEFA 2XNDA 5D3QA 5J4KA 4QM6A 2CVFA 1ANKA 4LBWA 3V9PA 4MDFA 2GILA 4WOPA 1FW6A 1E0AA 2X2FA 1HUQA 4M9QA 3EC2A 1KK0A 5JWOA 4DDVA 4ZDWA 3M6AA 1NVUQ 3S1AA 1NMYA 2P3SA 4IHQA 1QF9A 4NCKA 3MWLA 4Q4JB 3SC3A 4PX9A 3TRFA 4BZXA 2JLRA 1ZAKA 4YMSA 2AD5A 1SHKA 1XCMA 4NHOA 2GF9A 4A82A 1ZRHA 5TMPA 4BZPA 4LI0A 4Y0VA 2WJIA 1IJFA 4I4LA 3TK1A 2ZI5A 4B47A 4BPBA 2Z4SA 3TBKA 3AEZA 2BEJA 2GK7A 3T15A 3GLGE 1YR8A 2DHRA 3OHMA 3WY9A 1HT2E 3HJNA 3ZYCA 1OYYA 2CL7X 3PEUA 2QE7D 2QNRA 2REXB 1VHLA 2WKRA 4HLCA 4IDOA 3KJHA 3TUZC 2UZIR 2ZE7A 4QJ5A 1ZNZA 5HE9A 1NN1A 1JEEA 1XTKA 1ZNWA 1KJWA 1AKYA 2AKAB 3IBYA 1E94E 2GJ8A 1J70A 2WAXA 1OKKD 1CS4C 4Q48A 3B78A 4B6EA 2JLVA 1PLJA 1JR3A 5LB2A 2QTHA 1Z83A 2PJZA 4QGHA 1R0WA 4EDHA 2SHKA 1EESA 3AKYA 3AF3A 3BOSA 2OM2A 3VTKA 1HT1E 4MGIR 1WBDA 5AUQA 1I2MA 3T34A 2CJWB 3QBTA 3FHTA 5FUXA 2ZI7A 1QBKC 2NGRA 5E4FA 2G9NA 4DLVA 1E3MA 2O0KA 3AF0A 3EZ7A 1G3IA 4IKEA 1GZSA 1S0UA 1SKYE 1WRBA 3IGFA 4L5BA 4LV8B 5L3RA 1E2KA 3LO5A 1YJ5A 1M1YE 4BECA 1KZ7B 1W4CA 2FGKA 4PHFA 4TYPA 5CLQA 4KBFA 5E7MA 3T5DA 1LF0A 1KK1A 3K0CC 1OT3A 1KOFA 1HE1C 2G6BA 1DAEA 1CR2A 2PCLA 3AGQA 3LBIA 2ODEA 2P5TB 4BEJA 4RVCA 3MJRA 4JLDA 2QUZA 1FL9A 4R71A 3QXSA 2NO0A 5DO9A 4HSEA 2GDJA 5DN6D 2J46A 4UNNA 3LRPA 2ZUDA 1A2BA 3U7FB 1T3SA 2EVWX 3DZ8A 2WWGA 3O8RA 4DIEA 2HCBA 1GM5A 1UKEA 2FJUA 5FL7A 4U00A 5AJYA 3KB1A 5HPYB 4MUAA 4OHWA 3U6BA 3B1WA 2XSZD 1TX4B 1XD2B 4FXPA 5AJVB 4RKFA 4D4KA 4Q7JB 4URZR 1UM8A 4O2RA 4Q7LA 2WAYA 5BN5A 4PQYA 2H57A 4XWKA 2KBFA 1L7VC 4RJLA 4PPGA 5KYKA 3OZXA 5KSPA 2QROA 4PPFA 5DI3B 3K0SA 4XVUA 2JIZD 2KWIA 1WB9A 5G3ZA 2V9PA 3FFAA 2IYLD 3MJHA 3EC1A 1W49A 4MRRA 4MYUA 2O8DA 2WBLC 5TARA 5EXSA 3VNVA 4US2R 2DFLA 1P2UA 1XTIA 2BBWA 2HDNB 3VU9B 3PXGA 2G1JA 4IXNA 4W7SA 1T8TA 3R7WB 4JYBA 4M1TA 4MGKR 2IS2A 1XMVA 2IHYA 3BB3A 2XOKD 3DVLA 2GESA 4TSFA 621PA 4XVRA 1OSNA 1G4UR 2CL6X 5JMTA 4OBEA 1O87A 2W0SA 3EPJA 721PA 3O8BA 4M1KA 1LS6A 2RHMA 2J7KA 3SJBA 2MSCB 4JS0A 4EFMA 3Q7PA 1Z0FA 3EPKA 1VG8A 3VR1A 3DO6A 3LA6A 4JKIA 5JCPA 4Q1CA 1DAIA 3X1WA 4BEBA 1DBSA 3FMPB 4DLTA 5FUVA 1NLZA 3D31A 1KDPA 2E9SA 5EE9A 1VCIA 4YXWA 4TTRA 1E9DA 2LWIA 3WBKA 4DSOA 3RHFA 1OV4A 3QXCA 3DMNA 1J99A 1TPZA 4KODA 2GZHA 1BKDR 3VQTA 2PL3A 3UANA 4NYMQ 1U9IC 3KQLA 2LCFA 4I81A 3SR0A 1UFQA 1W1WA 4TQ9A 2IYRA 5JHGB 2R6AA 3ZJYA 4N3NA 3UMSA 2DFKB 4NYIR 3R9WA 4ACBA 4D0NA 3L0SA 2F43A 2AD1A 5D3MB 2OCYC 4LX0A 1ZM9A 3L82B 1XZPA 1EFRA 4IOJA 3WP1B 2C78A 5BXQC 2FMXA 3KKMA 1FFHA 1E9CA 1GILA 2OAP1 3CKLA 4DLUA 5H68A 1SHZA 4IRUB 5LPNA 3VMFA 2N1BA 4DHEA 1C4OA 5JCZA 1XWIA 1Z47A 4OKSA 5KHOC 1AIPA 4LHXA 1A1VA 3VHLB 1C9KA 5CIWA 3A1UA 1KDTA 3U3KA 2YNMA 4DCTA 3W6PA 2OSBA 2IC5A 3EZ6A 2GBLC 1I4LD 2C8VA 4JMPA 2EWVA 1KDRA 3T1TA 2ZRPA 1CJVC 3GLGB 1RW4A 1XJ0A 2BKEA 4RY2A 4F4CA 1DO0A 2FFBA 4PC3A 1DS6A 4ZKDA 2ZJZA 1NRJB 2JJ2A 1NN0A 4NCJA 4HAYA 1TU3A 2CLDX 4TZ6A 1J8MF 1E1QD 1OXVA 3SN6A 4W5HA 3TIFA 1AA9A 2PZGA 3I8SA 4C9BA 2WJHA 5HKKD 4QM7A 1UAAA 4AKEA 1XRJA 1E99A 2W00A 2C96A 2WV9A 3ZS9A 4DLXA 1RRPA 3CH4B 3ZVRA 4AY2A 3ETLA 3W5JA 2C9OA 1S4QA 4B43A 2WVJA 3B1VA 2OBNA 5DNYB 1XXHA 5B57C 1K5GA 2N42A 1Z63A 1RRCA 3DOEA 3BC1A 3KFVA 4JLVA 2J3EA 3NC1C 2A5GA 1CP2A 2HT1A 1SKYB 5BQ5A 2Q9CA 3QPWA 2XB2A 4XH9B 3NEJA 2MSEB 3CWZA 2ONJA 1Q1BA 4LOAA 3C16C 4HZUB 3NTUA 3L8ZA 5CB8A 1DG3A 1W0KA 4RD0A 2R9VA 5EE0A 2GZAA 4HUQB 5FH9A 3QOFA 3VAAA 5K8LA 3UG7A 1M7GA 4WAUA 2QM8A 3O8CA 1Z8FA 1E2FA 4R2IA 2EFHB 2H5EA 1HQCA 1KI6B 3KTAA 5BYJA 4P4SB 3TMKA 2QE7A 1HH4A 3ZIAD 1F5NA 1TL7C 4JVMA 1N25A 1SQ5A 3ZVLA 4DDTA 1T4GA 1JAHA 2CNWD 2V4ZA 3GLHE 1KKLA 4MRVA 5GJBA 2ZEJA 4HATA 4JSTA 1OKKA 5FTKA 2H92A 4QC2A 2HXYA 4LYFA 2BCJQ 2ZAOA 2R44A 2UZ3A 4OHXA 3SFZA 1W47A 2WKQA 1N6PA 3H86A 3IQWA 2ZRFA 4YDSA 4I1SA 5DYGA 1DAGA 4A2PA 2XAUA 2VH5R 2FA9A 3GCGA 3IO3A 3LWNA 2WJGA 4W5JA 5AJXA 1F60A 1BS1A 3EIHA 2ZIAA 2F55A 1NBME 1QHNA 1LB1B 4OHZA 1CRQA 3TUJC 1NY6A 2W2TA 3LY5A 3PV0A 2BOVA 5FUYA 3HWSA 3ZD7A 1PJRA 2JLSA 1WP9A 4NYJR 2VSFA 4ESHA 1OHHD 4QKQA 1NIJA 3AF2A 3CRMA 2DPXA 3DKVA 4W5WA 1OFUX 3QXHA 4Q18A 4EPRA 2WZQA 1SVWA 1TQ2A 3I32A 3K09A 1OIWA 3CF2A 1XP8A 3FMIA 2J0SA 1G3MA 1JQLB 2V8OA 4MKGA 4FI3C 4NE2A 1CR4A 1CTQA 1NLYA 1TF2A 3ZZTA 1E1RD 1ESMA 5FTMA 1P4SA 2B8WA 3A6PC 4EPXA 2IYZA 4B34A 2PBRA 4AWXA 4WZAE 2D2FA 3GLIE 3I61A 5F98A 2XSZA 4JBXA 1IM2A 2VP0A 4B73A 1UBFA 2C9CA 3WNCA 1G7RA 1E2LA 1GRRA 2KE5A 1CKEA 5SZHB 2QY9A 3M0EA 3B13B 3KKPA 2ZRGA 4ZPXA 1TTTA 3ASYA 2AHOA 2UVQA 4A0HA 3OFND 3OF5A 5FR2A 1II8B 2JIZA 1SULA 1TMKA 1VPLA 5CB6A 1PUIA 4CEHA 3IEUA 4F93B 5EE3A 4Q1BA 2BVNA 5KPDA 2FU5C 4A0RA 2ZRLA 1E2NA 3VNUA 4XSGA 2J87A 5TB5A 2VHUA 5JRZA 2XXAB 4TLDA 1NJFA 2YWGA 3CX6A 2BV3A 4K8OA 1JXMA 2J1LA 2XOKA 1E9RA 2ASEA 2BC9A 2GNOA 1GWNA 4EFNA 4BFYA 3P32A 4KFTA 4Q9KA 3D8BA 4TQAA 4DUGA 2ORWA 1GIAA 4LPKA 3U5ZB 2ODNA 1WF3A 4C0QC 4JSYA 1R10A 4JLJA 1YKSA 1WCV1 2O8CA 1PV4A 1G6OA 1ZM2A 1FTSA 1LY1A 4V0MA 1QHXA 1M7BA 3C4JA 1N6LA 4Q1DA 2Q6TA 2VSXA 4ACAA 3EZ9A 1G21E 4RD6A 1VIAA 1KY2A 2JJ8A 4PQFA 5FPHA 3REGA 3C8UA 2A5FA 3I8XA 3GJ3A 4QFMA 2QAGC 1AM4D 3DMDA 1AS0A 1BH2A 5B64A 5JLJA 4PHHA 1KSFX 3IO5A 3NVAA 1NSTA 2VP4A 1EXMA 2N46A 1OH5A 4HZIA 3U60B 2XZOA 3LVRE 3QEOA 3SYLA 1GFIA 4TYQA 3THYB 4TLEA 1T5LA 4JT4A 2H17A 1OB5A 2NOAA 3BXZA 1E2JA 4Q7KA 1NP6A 3MG9A 1Z08A 4KHZA 3ADKA 2RAPA 4P33A 1IN5A 4NKRA 4PO9A 1UDXA 3UKDA 1WDTA 1CR1A 4RD1A 1R5OA 2D62A 1SKQA 1X8LA 2J41A 5FOWA 1Z3IX 4KAXA 1BOFA 3FKSD 4LJAA 4URUR 4RZ2A 5LBIA 1KO5A 1QZXA 1JR3D 3UK6A 4OQMA 1JECA 2RKOA 2X1VA 3B60A 4Q4JA 4A1FA 2GCPA 1VHTA
chains in the Genus database with same CATH superfamily
5JO9A 2DE0X 3GRZA 3PD7A 4MAAA 5E7IA 3SQNA 4PNHA 2YYZA 3GVXA 4MVXA 4E5YA 4B83A 5ITZA 3U7GA 4P92A 1V1RB 1RM5A 4M6WB 4CNBA 1KDVA 3LC1O 1RJGA 2GJKA 1ILEA 3I4LA 1DAFA 1KAGA 1GPWB 3GJZA 3MJ4A 2VP3A 4IJQA 2VQ6A 1VKZA 3LUGA 3P5BA 3V42A 3VO2A 2BE7A 1BW9A 4Y7DA 5ES4B 1K3UB 1SUCA 3B48A 1CDOA 3LC7O 2HPHA 2GDZA 2Y71A 1N6RA 2YVKA 2PDAA 3PITA 4QTZA 5DT2A 1QYCA 4UPVA 2JEOA 4OI1A 1M2NA 4AXXA 2Q5EA 2VUSA 1D2EA 1R5NA 2FWBA 1PT9A 2RK4A 4BVHA 4DTCA 1FIUA 1CEQA 2YC4C 4DADA 1FUIA 1Q7GA 3COSA 3ZGXA 4XKJA 3CEPB 3FOAA 4M1SA 3SU8A 2V6FA 2NZ8A 1Z29A 2HTFA 3EF1A 3WWCA 5HUJA 4GS5A 4QL3A 4DIDA 1Y6JA 2VJCA 2XF2A 4LIPD 4C87A 2LR0A 2NU7B 4HAIA 4XWWA 2ODBA 3GFGA 1FU4A 4HWRA 2XUJA 4DV2B 1A8UA 4AX4A 1CUBA 2GEVA 2CJWA 1G64A 5TXGA 3WL7A 4XW2A 1IK6A 2IS1A 3RWOA 1QQTA 1SC3A 2PT5A 1AUXA 1Q20A 1ISJA 1L5LA 2Q2OA 1QS0B 4PRYA 3L7YA 4C05A 3RYHA 4YT2A 3TF5A 3GGJA 1HG1A 5DEOA 3GH3A 2AXPA 3NBKA 2IPXA 5LMUB 1GTZA 1T0HB 1RXUA 4TYWA 3L7AA 1BWPA 1NKVA 1EU1A 4H31A 4Z9AA 4RH1A 3U4QB 3L8DA 2ATXA 4X8LA 1CRLA 1ZMTA 3BERA 1P7CA 1G4HA 3IDOA 5M7EA 4L6CA 4Q9JA 2Y0EA 4C0JA 1MEEA 4XQGA 1RQ2A 2QN9A 2V1XA 4PG7A 4JYCA 1ISSA 1YK1A 1FDRA 2RGDA 4Y6OA 3EFOA 1BEZA 5EJAA 5BUQA 2EFDB 2P9HA 3AJ8A 1HE8B 3HEBA 4XX1A 1UDWA 5TMBA 3HDTA 4EI2A 4TMKA 3FYDA 1IRIA 1QZZA 3G82C 1EX6A 1JKIA 1GKUB 4KIUA 4BMSA 1IRXA 2QPTA 4QJ4A 1NZDA 4QQFA 3U7QB 3U2QA 2VP6A 2GA9A 5JJ5A 3TZHA 2JFHA 4N0MA 4PEVA 2LW7A 4RK7A 3REOA 4KWCA 3T0FA 1QQ7A 4A0SA 1U0BB 1TC2A 5EERA 2D00A 4CM3A 3I62A 3D8UA 4LC0A 2W22A 3G7NA 4BNHA 1IQRA 4H77A 4KQMA 2PMCA 2ZUCA 3RABA 5LQDA 3OTHA 1NQ5A 1VBFA 3EQ7A 1KOGA 1H85A 2Q9AA 1OHHA 1V4BA 1OQAA 1VXRA 4K5QA 2QTTA 3SIPA 4MW0A 1GZ3A 2RGGA 2ZWIA 2J4CA 3ESYA 3GLTA 3IOCA 1XDBA 4JVSB 1T0UA 3MTQA 1ZVMA 2CN1A 3LIIA 3NHPA 4R0VA 2W9XA 4YJ2F 3ZY4A 3FXAA 2R8EA 3WNZA 2V0GA 1VIVA 1DJOA 1JW9B 3R9XB 3MAJA 3GLFE 3UBMA 5CIYA 3NP9A 2V6JA 4XYLA 1H9CA 3N6VA 1Y3DE 3MRXA 4PY2A 1KJ9A 5BVHA 1UBHS 5JNUA 3FDJA 4ROTA 5CJPA 4NP6A 3OT1B 2C2HA 3GJ8A 4CF3A 1X1QA 3R7BA 5BV8A 3ZGVA 2XE7A 1I0LA 2QBYA 1EWQA 3NAGA 5KNBA 2MSKA 4E5MA 2REOA 3CUUA 3JYNA 1L4MA 1K4KA 5FDFA 3OFNA 1UBOS 4Z86A 4AIIA 4C43A 5DYTA 1ZN9A 4KQFA 2CNOA 3MMNA 3TSYA 3OIYA 1QC5A 2Z43A 4GLBA 4NMWA 3ZWQA 2XWJI 2V5VA 5ILOA 4FT4A 4TL6A 1ZNXA 4H7IA 3TPFA 5IS2A 3AUYA 2QNBA 2WIJA 4ESEA 1NPTO 2WFZA 4R2JA 4HBZA 3ZHVA 3OPYB 4DA9A 4Z1MD 3DOOA 1UZLA 4DG9A 2HQRA 2OWDA 5HKBA 2NTJA 3T1VA 1AMNA 5L4LA 2JHCA 2PL1A 3F6YA 1VZ3A 4YO8A 3K8YA 4QAQA 2D5BA 2FW9A 5K8IA 3C5EA 2RGRA 4CG0A 1R5BA 3KD3A 4L9WA 5HZHA 4YQYA 1TLFA 1ULTA 2JZCA 3LW8A 5TJHA 1VL8A 1WZNA 2BGTA 2JK1A 4R4JA 1Q57A 2JAOA 1U6JA 4YP5A 4ZYYA 1MENA 1WTAA 3FAKA 3B6JA 3F8SA 3R23A 2C31A 2J5XA 1NG9A 4JOQA 3O8LA 1NQUA 2HK9A 1M34E 1QRAA 4LC9A 1QFXA 4W1RA 4JLWA 1TM2A 2WD7A 1G8FA 1SZJG 4Z3DA 3GLGA 4MULA 2BGWA 1UXIA 2QRVB 3S2IA 3FI0A 4KDEA 2HZBA 4AXBA 5C5CA 5HK9A 5BWMA 1EDBA 2CHGA 3U5TA 2EYUA 4MVJM 4LDZA 1KRWA 1HY3A 1RHRA 1W0KD 1M8GA 3KLNA 4F8EA 5K4AA 2QXUA 5ITVA 1E2DA 1GPMA 2R8OA 2EZ8A 2OHJA 2XJ9A 2YYSA 3Q5GA 4XWAA 2Q6IA 3ACDA 5K3OA 4DQKA 1NYTA 1N57A 1NMEA 4MW9A 3VXKA 1ZGCA 2OMEA 1U0EA 3CBGA 4JLAA 1LVUA 2RHWA 1F38A 1AZLA 4M38A 3T94A 3LBHA 4ZT2A 3KETA 4R98A 1T9GR 4EZBA 1C8KA 1X94A 2X3YA 1TUEA 4O4JB 4YRPA 4BMNA 1DUVG 1K1EA 2R7LA 1K5HA 3DEHA 1T6YA 1UBJS 1XCOA 4YP1A 4YUWA 5D85A 3GJ4A 4IL5A 3LO8A 2I4LA 4JJFA 1QO7A 3T3HA 5LJLA 5B12A 2CVQA 4PLTA 3ICEA 2NN3C 3S55A 3JD1A 1I6LA 3SZMA 4E3ZA 2NQTA 2ZTUA 3ED5A 3UMYA 1II0A 1J33A 1A5TA 4UNPA 2IUSA 3MCAA 2FN4A 1Y1LA 2LDBA 4P7FA 3Q11A 1LV7A 3HWX1 4RMNA 4HR7A 2O4CA 3N9IA 3L84A 2YTZA 4FDMA 2VF4X 4KGZA 7REQB 4BNYA 1FYDA 3NIBA 3NT4A 1X7GA 1ISGA 1C7IA 4K7JA 4KFRA 1NHGA 3GGGA 3QWHA 2F59A 4OATA 5HRCA 4M4SA 3MFQA 1ZISA 3ZDEA 1JHDA 4YP7A 3RS4A 4BFZA 3LPNA 5D6NA 4DY4A 3HFSA 3Q3JB 3K6SB 3V6MA 2HW8A 2VYFA 4UEOA 2YASA 4ZQIA 3INRA 2WJJA 4KRYA 4D6YA 3M34A 1U2ZA 4MO9A 3QF7A 3ABOB 3Q85A 1RRVA 1WL8A 2ZQYA 4IJ6A 3TNDA 3ZWYA 2D7DA 3S8EA 1J00A 1WABA 2GZRA 4KNWA 1XTPA 2QL6A 1P1BA 1ZUHA 3DHNA 4JC0A 4O4IF 5FL3A 1ND5A 3TVDA 4B33A 4WNAA 4ZHQA 3CO5A 1Z6QA 5AQ1A 3EVBA 2NU9B 4EKIA 2HA3A 3RADC 1XX6A 3FCOA 1XPOA 3ZDQA 1E0SA 3FOEC 1ADCA 1UEIA 3NVKI 1EKXA 1OJLA 2CXUA 3OF3A 4UHBA 3ROFA 1EK5A 5EJ4A 1LK5A 3HJUA 4CM1A 2PGJA 3MM4A 5EHXA 2HSGA 5TPWB 3RC2A 4C78A 4M2LA 3ZEIA 3D7MA 1XVVA 1VHDA 3R9KA 1SCDA 1I1QB 4GQIA 3QJ5A 4ZOBA 1E2BA 2XITA 3D8TA 3PUYA 2VATA 1Z5VA 1UJNA 5AO9A 2WFLB 1YKGA 4JU8A 3RVOA 1LLDA 4CGZA 1DC7A 3H6GA 3I0NA 3UC9A 4Z49A 3GYBA 5CFQA 1QGOA 4TRNA 1EFLA 2G0AA 1B26A 3PIDA 3IE1A 3RVDA 1M7HA 3MPUA 2GERA 4V0LA 4EI9A 4MPPA 3I5MA 3SOPA 4HLQB 4DRZA 1F1BA 1RBMA 3KXKA 3OM1A 4HAXA 1PHRA 4U2FA 3GLFB 4U0KA 1OBVA 3FYHA 1D2NA 2QU8A 4MQ5A 5DNAA 3W5BA 4IF4A 1UJ4A 2VHQA 4K2AA 4FFLA 4PHTA 3RFVA 1EE2A 1P5RA 2CK3D 3G0OA 3FHOA 3LAWA 1SBHA 2VDNB 4DLLA 2CFIA 2L17A 4FN4A 2JIRA 1CNMA 3TLCA 4HYQA 4LY9A 3NKVA 2RIPA 1WPGA 1N2XA 2AOXA 2DFVA 1X42A 3QG5A 4IFTA 5AKYA 2VHEA 1RZUA 1TCUA 1P4GA 3PPIA 4RVGA 4FD2A 4WN3A 5KDLA 4KYUA 4CEJB 3PQ4A 2Q3LA 3O38A 2ZQZA 4PANA 5FTNA 4BO7A 1HTWA 2QLFA 1TI7A 1B1AA 1E0JA 5JH7A 3IIJA 1G55A 2WE7A 3STUA 5BRNA 1B2RA 2ZJ3A 1XZIA 3M5DA 4LNUB 1Y1TA 2UZ0A 5J4VA 4JZYA 1E77A 2C29D 4E03A 3LHFA 4J0HA 5E3IA 1SXJC 4J0DA 1W4RA 1TEVA 4OHPA 1U9IA 3AG6A 3BULA 3IJ5A 1AQUA 2D0PB 2YV4A 3U44B 3RTBA 4H4EA 2ZJBA 4HAWA 3FZNA 1CUVA 1II9A 4IIJF 4RZUA 1E62A 1N2EA 4ZCTA 4GBJA 2GUWA 4C3OB 2A8YA 1GAJA 1U0LA 2ZR8A 3GLVA 3HADA 1BWSA 1E3IA 2B5OA 4FDVA 3T3OA 4JLOA 1CQJA 2HMSA 1JBQA 3LQ2A 5SZKB 4NYIQ 1KMCA 1M34B 1MAUA 1OXUA 2LNDA 2C9DA 4N6OA 3VSDA 5HP4A 4Y2VA 4W9MC 3SFVA 2AWNA 2NVBA 4QFBA 4KQHA 4N18A 5M04A 1XP5A 1D6MA 1O6ZA 2VDKB 1J7KA 2ZE8A 4UM9D 3RSLA 1O9BA 3B5EA 4F21A 1P1IA 2GPYA 3WLHA 2P9BA 5F7XA 1VG9B 1F6BA 3D2BA 4HDRB 2YY6A 3MJVA 1XYGA 4XD7A 2V4UA 4WY5A 2AXEA 2M6KA 2BFBA 2R5NA 2ZETA 3COYA 3LUBA 4CMCA 2VWPA 2DP4E 3BXEA 4DA0A 4DDWA 2RGUA 4S12A 2R6DA 1T3LA 3E9YA 2RI6A 3HYRA 4Q7MB 3C1OA 1NW5A 2V55B 4RZHA 4BE4A 4P6VF 1TAUA 1I3CA 3KT8A 2YHBA 1PDWA 2AYYA 3G3EA 2HA5A 4ZK6A 5T8KC 1C80A 4A8JB 1SJ9A 4CLOB 4UFPA 2ZS8A 3SHOA 2CVPA 3ETEA 3IUEA 4AD8A 1Z2OX 1ZI8A 1RM0A 1Y7PA 3W5DA 4WH0A 1JI0A 3DZDA 2IKQA 1DKQA 1N2GA 1Y5MA 4L6AA 5T4FA 3RVSA 1B3BA 3Q72A 1P9NA 1CNFA 3V46A 4NFSA 1C1DB 1Q1EA 2WSIA 2ZXFA 3RRJA 6ABPA 3P45A 3LDAA 5EQTA 5HQ3B 2PU7A 5CD9A 5C32A 2E89A 1DHRA 1Y6QA 4QE3A 2QN3A 2Z8YA 5ALKA 4A0FA 3U16A 1A27A 4P86A 3HGMA 2VYVA 4ZEOA 1D0SA 1CR6A 1U80A 2ZVPX 1SCAA 4P5DA 3VHXA 3VZSA 3WWOA 4OI2A 5E1OA 4Q1FA 5L95A 5C5DA 3WTCA 3GFSA 4O0LA 5BOVA 5LP1A 2ZRHA 4KR6A 3VPXA 1N32B 3EA0A 2X77A 4DCMA 2X41A 5DCYA 1MO6A 4JDPA 1OXBB 1QGED 4PV7A 4A5SA 5BR7A 1S02A 2J07A 1EFPB 3BTUA 3KBBA 4YRTA 4L0MA 4TL9A 2PH5A 1PJZA 2W8ZA 4IX1A 3A3KA 5B3JC 1Z4KA 1NN3A 4WLOA 3HVRA 1A4RA 4EI7A 1YOVA 3WWDA 1GN8A 4EARA 1DIAA 3O83A 1FYWA 4QEKA 3AETA 2AZDA 4I66A 3L0DA 3OICA 3N2LA 3EHEA 2HI0A 4TTQA 2JF0A 5FWXA 3PJDA 4MKHA 3SGLA 1BD3A 1NVXQ 4P3KA 3VKUA 4LCBA 2FGJA 4YI5A 3WYGA 1M2HA 1WB6A 1FXWA 1QQBA 1O8BA 1QCZA 1YR2A 2BFDA 5FCDA 2HHCA 5IAKA 3FJOA 5K1ZA 3OZDA 4KN8A 4W82A 3U0BA 1ZVVA 4PPYA 3WQHA 3A9TA 4PLFA 1D2CA 1WF6A 4EJSC 1FNBA 2IEYA 3I6BA 1N2BA 1Z0UA 2NUPA 4GVPA 1S5PA 1JHUA 1P44A 2WIKA 3WMEA 1W0CA 2MHCA 3DAPA 4HBGA 3KUCA 3QE9Y 1XDGA 5GTDA 3NTQA 1GITA 3AR4A 5DM70 1RLOA 4UBOA 4X6YA 1B43A 2C4VA 3AR8A 4MYCA 1BYIA 1EUQA 1FVFA 3TPCA 1I0IA 5DP1A 3R3XA 3TGWA 4R51A 1ZH2A 1OE0A 1PLKA 1VE7A 3R0JA 3ROMA 5JYEA 5A0FA 4FWIB 5C51B 3G68A 3RFTA 3RDPA 2FW0A 4WLNA 2AFIE 2NXCA 3IBSA 3C24A 4EY4A 5E0KB 1UF9A 1U2RA 4LY0A 3E1SA 2W6IA 2J3LA 1X19A 4HLNA 5D86A 2GJ9A 3TUIC 1E2PA 1H42A 2VVTA 3BJEA 1P73A 3FCSB 1K7CA 3KR0A 3Q7SA 1HYGA 1NMXA 2DY1A 2PRYA 4LKRA 1LBQA 4CLEA 4EUEA 3EG5A 2C5HA 1IHUA 4KWIA 4CT5A 1KU6A 3B51X 1VJ1A 3LD9A 1IB6A 1AZWA 1ONNA 4YRMA 2H1IA 1R66A 2VT3A 3L1VA 3RF6A 3EZNA 4RY8A 1U3VA 1JG1A 1ICIA 1Z22A 3JD2A 4NJMB 4HUTA 1FP1D 5JJCA 4YMIA 3VA7A 1N9GB 1XF1A 2ZB3A 4G5GA 1R9JA 4PZ9A 2XMGA 4U0JA 1Y80A 4Y2UA 1UBCA 4E7PA 3GD7A 3Q2KA 5A1TA 4M1QA 1FNMA 2RAUA 3IV6A 2PUJA 3UN1A 4HNRA 5AI5A 2F8SA 1D7OA 2FWAA 1D3AA 1NMSA 2F9FA 3B82A 4FGSA 2FZ4A 4REOA 3R77A 3O8QB 1V3VA 4JKYA 4JXKA 5GM2A 4C6SA 3LX4A 1AK1A 1G1AA 1GL7A 2WUVA 1SUBA 3BTSA 5EINA 5SYMA 4BNMA 1ZESA 1WD5A 3I04A 3UUGA 4M7OA 5KYWB 3F4LA 2IXDA 2WUDA 2VEOA 2P9GA 4E6EA 4GPEA 4IFEA 2JIMA 3QVSA 3W6OA 1VSUA 3M6LA 2X42A 3BHNA 4G1FA 4LX8A 5KNBD 2BM8A 3G9QA 1GDHA 1NI4A 3H9UA 4E70A 2Z6QA 1SXPA 1O6BA 2OHOA 2QMUA 3GUHA 3PT9A 4OYYA 3ZWCA 1QH9A 1Z7GA 3WO0A 4IZHA 4U3JA 2UYCA 3OCUA 3BWDD 5IZCC 3OLQA 3ON5A 4FHDA 4D8YA 5CX1B 3UATA 4NEQA 2A94A 3BSWA 2GD1O 4B2PA 3KOWA 5L8VA 1ODCA 1KYQA 2ZIFA 1ZXXA 2VTDA 3IL2A 3C43A 1T2CA 4AJIA 1H1LA 1YZKA 2P67A 3VC1A 821PA 1XEXB 1OYWA 2A86A 3HG7A 1ENOA 1OT5A 1SCBA 3TJZA 3QQ5A 1UQTA 2F3TA 4IVQA 3EXEA 1HEIA 4YRLA 3B9PA 3UV7A 1W7AA 2Q07A 4GECA 4Y6RA 3H1GA 3E4CA 3UJ9A 2CEKA 1JFTA 1QDUA 1N5IA 1XZGA 3W1EA 4MA4A 4Y1RB 2G7MC 1FS5A 1M2OB 1Y4UA 2P68A 3PJFA 4IXMA 4PFQA 3DTVB 2AOTA 2N47A 4ZMRA 1VYUA 3K1AA 4L8YA 4QECA 3B52X 2VEDA 1G8MA 2WWRA 1IN4A 2OT3B 3NDJA 5JR3A 4MR7B 2QAGA 3SBOA 4O3FA 4BVBA 4YXFA 4EO7A 1JEJA 1NJ2A 4R1OA 4LSZA 1DLIA 2O3RA 3C5CA 2IV7A 1E18A 2GKSA 2VLIA 3GBVA 3JWHA 1E66A 3SMQA 1EM6A 4YAFA 4PSAA 3I2YX 4YV0A 1YQDA 4BS9A 3T9AA 5H4GA 1NUAA 5AKJA 3LP8A 4HADA 1XGKA 3U61B 2IIVA 1X7WB 3DOFA 5FWNA 5JSZA 4MWGA 3JV7A 4WLFA 2BR5A 5FOXA 1U4SA 4RK4A 3UHAA 3CUWA 1TU0A 1R74A 3FZGA 2XTMA 4GMKA 1KI9A 1V8DA 2ICAA 2J59A 1ZQ1A 5I47A 4R3WA 4S1OA 3K0HA 4HDSA 3DMFA 3FOCA 3R6DA 4G1EB 5SICE 2ZBPA 4AO6A 1G8GA 4X91A 3UH1A 4QLBA 4W4TA 1CUFA 2ST1A 3K20A 4ZZIA 4OQYA 5IABA 2JH3A 4BO9A 1RKBA 1G5TA 3PL5A 3BDAA 3NBQA 3ADDA 1U4OA 1J24A 2AN1A 2UYOA 1SG6A 1SHLA 2GWRA 2HUPA 2F1OA 4CV0A 1W36B 1MJNA 2YXLA 3HLYA 3UWKA 1NXQA 2GF2A 3DGEC 3FPJA 5FUWA 3CNHA 1H4TA 1B41A 2A14A 4IDGA 4P8RA 4A36A 3C7KA 1Z6YA 4MUBA 5CYFA 4TYNA 3IFSA 3I2IA 2KYRA 1SAYA 2EYQA 3AFNA 4HCJA 3FE2A 3CKMA 4BU1A 1DELA 1Y1RA 3FNHA 1EINA 5A9SB 4AZVA 3EVDA 3IUSA 4EFKA 5E4YA 4YBZA 4KP7A 2D3WA 2FWJA 1T1RA 2O48X 16PKA 1MG5A 3LXMA 1TZCA 3B7PA 1EPUA 3H1PA 3E9CA 4ZCMA 3HCOA 3NG1A 3UICA 4NMMA 4G65A 2DWUA 1S1MA 2LVBA 2PJDA 3E8XA 2M6LA 2BIFA 3AR5A 1C0KA 1B73A 2K5UA 3L49A 5DHFA 1A5ZA 3W7AA 1KI4A 3F6PA 3L0YA 4E12A 4EGQA 2OAQ1 4LSWA 3IIKA 1Y5LA 2PRZA 5L3SA 2G83A 1FRQA 3ETCA 2I4OA 2Q3BA 1YQQA 2WJWA 3GLQA 4P5PA 1DEXA 4BV8A 4Z3KA 1LRKA 2QYTA 2LZ0A 3HSSA 2AFIB 4NAUA 4ZV7A 3FPAA 1I10A 2OO5C 2JFXA 4L22A 4YONB 2HY7A 3PX3A 1E8MA 3LX5A 2OD2A 5EIHA 2V03A 4X1KA 5GONA 4DT1A 4M9SA 1O94C 1L9XA 4XM0A 3NDBB 9MHTA 1CJUC 2ZSEA 3G6WA 4KV9A 4ZV9A 2X9GA 3A6LA 4BO6A 5KREA 3AEUB 4CQLA 5G0WA 3W8DA 1BWRA 1RWOA 4AZ0A 3COPA 4NENB 3F78A 2PZEA 4F45A 1HE5A 1R64A 1A0OA 4C30A 3LG2A 4CQMB 2BKUA 3M4NA 4XGRA 1CU1A 2QRKA 2QSZA 5EESA 5TQ2A 5IYZA 3UV6A 3ABQB 1IYZA 2RGNC 2ZTLA 1PW5A 1GA6A 4J7UA 1CZUA 5HUQA 3JQAB 1ZIOA 4JYZA 4GSYA 3UOWA 3E4DA 3CKYA 3L41A 3WFJA 1FUKA 2E49A 3E9EA 2ZIXB 4IWXA 1XTSA 4RFSA 2APJA 4N7RA 1Q0LA 3NV9A 2J0UA 4OJTA 4PAWA 5F51A 1JDZA 2B30A 1N2ZA 5CT5A 1WKVA 1WQ1R 2XH8A 1OXXK 1UOQA 4D3XA 2NG1A 5C1OA 1Z0JA 1AD2A 3AUAA 1AHHA 1EQAA 3R0XA 1MQ9A 5AOCA 3D4IA 5BR8B 1EIWA 3H2KA 4K9PA 1JQ3A 1BA3A 3DDOA 4A8HA 1E9VA 3LJKA 2JFWA 4ZU1X 3I8OA 3FNFA 4MWOA 6NULA 3A3PA 4RE5A 4JVOA 1KHHA 4ZALA 3THXA 3M6MD 2V7EA 1QYXA 1R5JA 2GRJA 3DBHA 3L2OB 2WHPA 1PG2A 2YWCA 1SXJD 1E0KA 2BEKA 2KJQA 1MDBA 2G80A 2JGAA 4UBIA 3PGJA 2P1DA 3QKIA 5F1YA 4A10A 3RKRA 2WF8A 3EBOA 3QUCA 4A6EA 4IMJB 4K88A 1J0EA 1CJMA 1SA0B 2HRZA 3QMMA 4TVKA 1CUGA 3HB9A 4UHFA 2NSDA 1C7JA 3ORSA 5FOVA 5JS6A 2C59A 2B7CA 2QTFA 4RK5A 1ZM7A 4HLDA 5HQJA 1YZ3A 1JMYA 1IHOA 1KI1A 2AG6A 3CW9A 5AJZA 1YONA 2XUOA 4LFAB 5FTLA 3QE0A 2BUAA 4TWAA 2YS7A 4AB1A 4GI3A 4HS9A 4IV8A 4BB5A 2H2AA 3B2QA 3FB4A 1PL6A 3FDZA 3KWJA 1G21B 2WA1A 4JEMA 2KMLA 2QM3A 2ENUA 2O8EA 4Q3NA 2QW1A 1W35A 3KQNA 2CUTA 3OZSA 1S8NA 3CH5A 4JEHA 3SE7A 4WJKB 2V7QA 3KUKA 2BR3A 4CKBB 1N8NA 3K0FB 2ZYGA 2WTUA 1RYNA 3KJZA 3OJWA 1B6GA 3D6JA 4CWAA 4XD7D 2FPGA 3IMCA 4LZZA 5K0LA 2BEUA 3CRZA 3SQXA 2O8FA 2QL7A 3O9VA 1CHDA 4S1VA 5DW0A 1GNLA 4R41A 3RSFA 5H3CA 2Y1KA 3U7IA 3UAGA 3BGOS 3CB4A 2NXEA 4GBGA 1VMEA 1G7SA 5TS3A 4UAVA 1D8TA 4UHKA 3SJCA 4G97A 3LGSA 3I92A 4GRAA 5DX0A 3B8HA 2RFLA 3U9SA 2HBRA 2XTZA 1G5FA 2EEPA 2PSEA 2XQGA 1B15A 3BDIA 3CUTA 2A9KA 5DYNA 5LXTF 3ROEA 4CVNA 5KWIA 2ORVA 1HLPA 1T26A 2CE7A 1Z0SA 5ALOA 1V9LA 4EA9A 2QVZX 1NF2A 3HU2A 2W58A 3GUCA 1D2GA 2ZJAA 1CZLA 2DKFA 4G23A 3Q5DA 3Q6IA 1LPMA 1X7DA 1RI4A 2PV7A 3EWSA 4RD4A 4AP5A 4LQLA 5K0NA 1S9HA 1VYHA 2YZMA 1M6NA 3EQ8A 2XVYA 3I6QA 4YJHA 4ZODA 4FM9A 3D4OA 4E07A 1PNRA 2B9VA 1Y34E 2QPOA 3SF0A 3R8FA 3TX6A 2IH4A 4EKGA 1NDHA 1O77A 3TFWA 1NIPA 3EH2A 1MKYA 1V1MA 1XZFA 4GOKA 1N75A 5ALGA 5DZSA 4OQPA 2ZYDA 7MHTA 2W2LD 2QORA 3O1HB 3VR5H 4XUEA 2X8AA 4REQA 1ZNQO 2COEA 4EJ6A 1OFHA 3MMZA 4HO1X 1SC1A 4OUDA 1VFPA 1WPXA 4J1TA 4FYHA 3HYSA 3DMRA 3NKFA 3MCTA 1Q3KA 1G6HA 2YWDA 3QPAA 3CLTC 2IYEA 1FFEA 2ZS7A 3MSCA 3RH0A 1UPAA 1OH8A 1Z28A 1F2TA 5CDFE 3DPIA 2YIVX 1Q0ZA 4XARA 3CNOA 1FFDA 2HL6A 4E30A 1U28A 2VK1A 4OQLA 4WOKA 3RFFA 3TSWA 5BWCA 5KYGA 3R7AA 2E55A 4YRJA 4AJPA 3ZQ4A 1OC2A 3IPXA 1EG7A 3WLEA 3LVQE 3FKJA 4LBZA 1INLA 3WJ1A 2PJRA 4YTEA 3PUIA 4B75A 2WR8A 3A9WA 1YZTA 4MROA 4BP3A 5DTMA 1F12A 3PVZA 1WO8A 2H4JA 4HEQA 1WXDA 2XX3A 3FWHA 4ZOAA 4HMOA 5FBRB 2H1FA 4B2IA 3AKCA 3VDNB 1QSGA 1BVUA 2SKDA 1C4WA 2IS6A 4M0LA 3WK9A 1M2FA 4MQEA 3DP9A 2OO3A 1N5RA 1ZGBA 4DCSA 5K3FB 3VC2A 5THQA 3H1TA 3CRW1 4C7OA 1OAAA 4XYMA 5ED4A 4ETMA 4KBGA 1IXYA 1NR7A 3UWPA 4RLHA 1KAOA 4Y3UA 4ZI5A 2W90A 1UBNA 5C4IA 2XUPA 4XTRA 1VJGA 5JNTA 3KSAC 2WDZA 3UJ3X 5HRAA 1FJXA 2PGAA 2FHSA 1OGIA 3HKDA 2FNAA 2PFGA 5K8UA 5KMGA 2R1VB 3STVA 3ZBQA 4XJXA 2WPDD 1X39A 1EVEA 1UBLS 3MPOA 5GOTA 2RONA 3KEFA 2JEYA 5AK5A 2F3RA 2R68A 5G1OA 2P1ZA 4F85A 1GA4A 4Z4EA 2EW2A 3KKKA 4HTFA 1EUCB 4OGLA 3PHBE 4YUXA 5CB0A 4ER3A 2HCFA 4DOMA 4ZDJA 1PJBA 2BFNA 3C8MA 3IP1A 1OWOA 1ZD8A 4D5EA 1MRNA 3P0FA 2ACEA 2FPOA 4F4IA 1GVHA 4JEUA 1QO9A 4WINA 4IJKA 4G1MB 4C3ZA 5L3QA 2X9LA 3FF4A 4G4GA 1IY8A 1BWQA 2PNFA 3DSRA 1LPPA 2XIQA 2VH2A 3H1FA 4KX5A 3UAZA 2UYGA 4DIFA 3H75A 2C2BA 1G41A 1MR3F 2C4MA 4TWZA 3WHPA 3HR4A 4C14A 5D01A 1Q44A 3I2GA 4ZEVA 2AR0A 2Z5GA 3DTTA 1AQNA 4XIGS 3AHFA 3D6MA 3OPMA 2ZJ8A 1YGYA 2C2ZA 3IJRA 5FI0B 1DIOB 2B99A 4FCTA 3TJMA 4PXAA 3SQMA 3JQFA 3HXMA 3K9BA 1N6OA 1TZMA 1XB2A 3KWLA 3O2NA 4NCHA 1I32A 1C8BA 1SQFA 1TJ3A 4XI9A 3TTSA 3ZNPA 5JMOA 1OIXA 3R7DA 3PFIA 3EGXB 1GDTA 1KL7A 1Q50A 1C9EA 1JRLA 1S8AA 2H1SA 1DRWA 3KALA 2AWOA 3UJDA 3WLIA 5TVKA 4JJZA 4RSHA 2D1TA 1XQ1A 5I9BA 4JI3B 1GT91 4HVCA 5ITWA 3WX0A 4QGAA 5HIIA 4BNTA 5BNWA 3AH8A 4MAFA 4TLAA 2NYRA 4ZIRA 1SOUA 3QF4B 4GX5A 4G84A 3ZNOA 4J07A 4DR7B 3O47A 1PK8A 5J63A 4MRMA 2FOXA 3JPWA 1V7QA 2FZCA 2ZPUA 3QM1A 1U04A 4YB8A 4DIBA 3PQ5A 3UXHA 5CXXA 4AYTA 1A8QA 2O59A 4YCLA 1KP3A 1QKIA 5HM8A 1QR2A 3QXXA 2H2DA 1W0JD 4E4RA 5KTPA 2LP4Y 4NCNA 1HYEA 2JJYA 2YXNA 1NW7A 3KYBA 4NOJA 1U8FO 2HHHB 5LFAA 4P22A 2VXYA 1UC4B 2PZKA 5AW2A 3ES9A 1Q17A 3D9QX 3BJRA 4JNKA 4I9NA 4ZU3A 3AY3A 3VDQA 1QFSA 1E6MA 1P0IA 1SKMA 2IWRA 3LXXA 2PA0A 4YLEA 5JS2A 4F6LA 4QLAA 4XGIA 1E7SA 1JTEA 1KDOA 2XDAA 1OTHA 1TJYA 2Q4OA 2QG6A 4G1VA 3VNAA 5BV0A 5K2OA 1FOEB 2ZBDA 2YWFA 4OGGA 4XOIA 4ZVVA 4QOEA 4D9CA 2ERYA 1P81A 4KQ1A 3LFHA 3R8XA 1NMZA 2PT7A 2VTVA 3FSGD 3OCYA 4FCCA 4MUIA 5E2BA 1L4UA 4MV9A 4DSZA 5JYDA 4B3XA 1GGFA 1QH0A 2KSQA 3OY2A 4MEBA 3RTEA 3NAZA 4W5TA 1ZHHA 2AN3A 3HWWA 2C5EA 1T9BA 3R7NA 3ZE9A 5C5EA 4BL5A 1FRVA 1GQSA 1RCUA 1XZKA 2JDID 4L2IB 3TFQA 3KOXA 3MRTA 4RJJA 1KPHA 2KI5A 5CK5A 2AHRA 2C54A 1KYYA 2J9XB 2ZSHA 3FNBA 4FIDA 4MYSA 4X6UA 1Z88A 2Q0HA 3RT7A 3W2HA 1YD7A 2XI4A 2D6FA 3U3DA 2GPTA 1U0SY 5CK4A 1T9AA 1DE0A 4HQFA 4C7VA 2QLTA 3D1LA 5JBNA 5FNVB 1X7XA 4L95C 4Q37A 3UC5A 4BP9A 1KZ4A 1P61B 2UZ1B 3E23A 3D3QA 3OU2A 2WTXA 3UV3A 4DLZA 1O58A 4KO8A 5SYNA 2ZXEA 5DSTA 4BQPA 4X93A 2Y1WA 3O2JA 2QMEA 4KOEC 4P2GA 3PA6A 4QO7A 1CDEA 2PPLA 3WIBA 1KOJA 3RRBA 5C8XA 4AKHA 3HYTA 3Q9LA 4A4DA 3GZJA 5CFMA 4JJEA 4XSVA 3JAWB 2FXIA 1G2OA 1L8QA 4MKFA 4TWRA 2OWEA 3F5FA 1ZP6A 3CLHA 5IK2A 3N8NA 2R1UA 2FZEA 2NQ8A 4MS1A 1AK9A 4WOJA 1V43A 4DYDA 1QJ4A 3O84A 2QGFA 4YPVA 1ZCBA 1WX1A 2D2VA 2DBRA 4HQRA 3WGKA 3ZY3A 3SVLA 3RRZA 5FOTA 4G5OA 3HB5X 1X13A 5BMVA 4DCGA 5KINB 3LLVA 1VPTA 5LLSA 3A9UA 5T67A 4L9AA 2VK8A 4XAQA 5AI0A 4XZ3A 4BNDB 4OXIA 3TLZA 4Q21A 2P90A 1PZFA 2XZTA 3M6VA 4K05A 5DIZA 4QUBA 1ZH8A 1JILA 2G09A 1XG5A 3G59A 4N7JA 4UXJA 2FWRA 4KR9A 1MNAA 4R8RA 1KH1A 1QIFA 2WTMA 3JVIA 3NOOA 4P31A 3DE0X 3TG2A 4DV6B 5B30A 2NUAB 4F9FA 4ARCA 2VRBA 3J7TA 2ERXA 1XZLA 1DQZA 3M1YA 1SUDA 4RAOA 1O94D 4CMKA 3PDCA 1T5IA 4ONEA 2QQGA 1B76A 5CHEA 2IZZA 4MIKA 4K3UA 3ENQA 4DQVA 5CA1B 5HJ2A 4F92B 3NMUF 4Z4QA 3HWRA 3THOA 2FUEA 4PNPA 1KH3A 1M1ZA 4PM4A 4Q00A 1TECE 1WMSA 1A88A 3I01M 1KI7A 1N4AA 1TF5A 2A7QA 1X7YA 1TM7E 3G23A 1U2PA 3ACCA 2TMKA 3OE4A 3KEOA 5EFZA 1YV9A 5CB4B 4HG2A 1SKUA 1MOQA 4Y2RA 5ITSA 2VJNA 1P9LA 4C1NA 1DUSA 1LPOA 2Y1FA 4FSDA 3EIEA 4MAMA 1IG3A 4Q1VA 3WL3A 5LKRA 5HJ7A 2CHVA 3E9NA 2F1IA 2A30A 1KFKB 2R7NA 3OCXA 3IP6A 2GD0A 4IQ0A 4PLHA 3BD6A 5G0VA 3T8YA 5DNUA 1H2RS 5L6LB 3NKLA 4PYJA 4DMLA 1G2IA 4JBIA 5KJFA 2XIJA 5IM5A 2FUNB 2VKTA 3NQ41 1A7AA 3JQ7B 4FEEA 5ECGC 2CHUA 3NIFB 2ZYSA 3TIVA 3I1JA 3N53A 4EHKA 1YDMA 1T34A 3X1ZA 2VH1A 1H2WA 1U5BB 2HQSA 3CZ4A 1C41A 4FHEA 2L42A 4BJ5A 2B36A 4MOWA 4WZBE 5F7OA 1XCJA 1QDLB 3LDFA 4DANA 3FSJX 2GCEA 5KO2A 1AJEA 4Z53A 2GEBA 3Q8WA 4PX5A 2OILA 3GZNB 3HKEB 1KO4A 4H0CA 1VZ2A 3CXUA 4CDGA 5LU8A 1M67A 3KB2A 4KI0A 1A9TA 1V8BA 2A57A 2SICE 3R8CA 5GVRA 5T6MA 1QKKA 3GFFA 4XGNA 2B35A 2GN0A 2J30A 1XQ6A 2VHCA 3EF3A 3WGOA 4MCAA 4CT4B 2Q4DA 3ZDDA 3TO5A 1JIUA 3ZWBA 2A9PA 3FVWA 2I1LA 2I2WA 3E9ZA 4MJ3A 4MW2A 3HZHA 3NUQA 4K1XA 4B4DA 5LB4A 2YZNA 3KS9A 1ZYUA 2YIDA 3BB1A 3TOSA 2V96A 5FUBA 3MJCA 3S28A 5CITA 4WCDA 1DJNA 2REQA 3H2BA 4PYLA 3LQYA 5LYJB 2J6IA 1NC1A 1Y8AA 3C5VA 4LJ4A 1LVGA 2ZXUA 3F9CA 2LTAA 1USUA 4QJBA 4EKDA 4OMDA 4G86A 1OI7A 3F7MA 3KVOA 2ID7A 3Q0EA 5AW9A 3WRXC