3RRMA

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
375
Chain Sequence
GLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELVNVDAIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 119
structure length 375
sequence length 385
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrmA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rrmA02
1PUIA 1GL6A 1J90A 2BJVA 3BXZA 1AKEA 2FPLA 1UJ2A 4RFSB 1N5LA 2ZJYA 3A1WA 3RRYA 5JZVA 5HCIA 1NVVQ 2P5SA 2R2AA 2XOKD 1GAJA 3LQRA 2H5EA 2OCYC 2YWEA 3QI2A 4O2RA 1QHYA 3BS4A 3G82C 2V1XA 4RVCA 4DCVA 2PX3A 1Z6AA 3DKVA 3EIEA 3RS2A 3N5CA 2O8FB 3W6OA 5CIQA 1A4RA 2C99A 5E3HA 3OIWA 1ANKA 3TMKA 1IONA 2WVJA 1G17A 3HU3A 2ZE8A 3BJIC 4NMMA 1SXJE 4LUCA 1KMQA 1Z08A 2LKCA 2IXFA 4KU4A 1YRAA 1Q44A 2F9LA 2C95A 1XMJA 3HR7A 5FI0B 3KUDA 3NDPA 1R7RA 4QGGA 5K8TA 4WVFA 2GWHA 1F2UB 1Z47A 3NC1C 2QMUA 3ND9A 3ZIAA 4CRWB 1XD8A 2ODBA 4CEHA 3T34A 2GESA 3U44A 1KI2A 1KMHB 3K09A 5LDDC 3P27A 1FNMA 1DELA 3KKNA 2IYRA 2VLIA 2IL1A 1GITA 3QNUA 3VAAA 4JLOA 1T3HA 4Z1MD 5L3RA 1W7AA 1KYIA 3EX7C 1Q20A 4Q21A 4C7OB 3FFBA 1P2VA 2ZS9A 3ZZTA 3MG9A 1ZCAA 1VCIA 1XF9A 4HLCA 4DCTA 1XB2A 5D3MA 4URUR 5J47A 3T15A 1GNPA 1B23P 1G8PA 3EAQA 1QBKC 5HE8A 4BLTA 5KTYA 4OQMA 1WB9A 3BAFA 3P4XA 3CH4B 1E2NA 3W8RA 2B21A 3K0FB 5JFGA 2WIBA 4HI0E 4IVPA 5EQTA 3KQHA 1NMYA 3PJRA 1IXSB 2RGNA 2B6HA 1NI3A 1XEXB 1N0VC 3CWZA 2J41A 4YDHB 5HE9A 1IY1A 2H16A 4LX0A 1XXHB 4US0R 4OQXA 3LX8A 1VG9B 3U7EB 5E4FA 4A82A 3EARA 2XEXA 4Q1BA 1SVIA 1ZM3A 1XD2B 2CVHA 2G0NA 3X1XA 3NG1A 1Q12A 1X8KA 4Q66C 2C98A 4OI4A 2GCOB 2GKSA 5FUXA 1KY2A 1KNQA 3A8TA 5G40A 2ZSBA 4M1KA 5E95A 2O8DA 2QQ0A 1KZ7B 2O8CB 2CE2X 2WWFA 4HAXA 5FBLB 1TF7A 3VR2A 5A0FA 1UFQA 2ATXA 5AJXA 2XZPA 3P4YA 4CW7A 2QM7A 2RGGA 2ZJBA 5FOWA 4LC1A 2ZR9A 2AHOA 2YJTD 1XXHE 1J70A 3QVUA 3AH8A 4ACAA 4NZYA 4GL2A 3ONWA 1Z0AA 4XTCS 3OIUA 3NBZC 3ADBA 3SE0A 4A2PA 4ZKEA 1HT1E 3DM9B 4WZBE 3AKYA 3S1AA 1ZINA 1TQ2A 1GTVA 2WJHA 4D82A 1G6HA 1UDXA 3UK6A 3VFDA 2OSBA 3ZIAD 4XD7A 2CLCX 4RD0A 3SBDA 3AEZA 4LBZA 5A4JA 3GLIE 3O8RA 2GBLA 3QPWA 2QI9C 5JWHA 1XPOA 4B2LA 1NRJB 2ZYWX 2VF7A 5L3QB 5DNYB 1N6PA 1L2TA 3IKJA 2ZI6A 4I1UA 4ASUA 2KSQA 4Q5IA 3SFVA 1HQYE 3CW2A 4ZPXA 2Z5FA 3UWOA 1ELOA 2JJ1D 3G0HA 1AKYA 3UPUA 4WXRA 1G3UA 4MRRA 2YV5A 4IHQA 4FMDF 3REGA 1KSFX 4OI2A 3PUZA 1XTRA 3UMRA 2RGAA 1OFIA 5KSPA 4AYWA 2H57A 2R6GA 5KU1A 4ZIRB 5EZ6B 3A1TA 2G6BA 2IXGA 4AK9A 3QKRB 4PHGA 1WQ1R 1BOFA 1E2EA 2JLRA 1JJVA 3U7FB 3IGFA 2YKGA 2W0MA 3CIOA 4OKSA 2RB4A 2QSZA 1TUEA 3K0SA 5J4YA 4MUAA 1JQLB 2MSCB 3TK1A 2C03A 3F8TA 2V3CC 3NXSA 4TLEA 4EFMA 3QKSA 4LJ8A 1U9IA 2YC2C 2G1JA 4BFUA 4C30A 2FSHA 1KGDA 4JBYA 3SJBA 2ZXUA 4FMDB 4IDQA 2ZRNA 2WHXA 1OPXA 4B44A 1OF1A 4V02A 4FWIB 2XOKA 2AFIE 3SHFA 1JR3E 3B1XA 3K09C 3OHMA 3TIFA 3FMIA 2VHTA 2ZRDA 3IDQA 4JLJA 1K6MA 1NMZA 4KVAA 4IXMA 1XCMA 2NG1A 4DCSA 3U6KA 1V5WA 3HU1A 2Q9AA 2VBCA 4FI3C 1E0AA 1ODFA 1NVXQ 4DLWA 3DPUA 2ZANA 4LJ7A 4BRWA 3CR7A 1YR7A 5BYKA 1L8QA 2RAPA 1KI9A 1NKTA 3B7GA 2AD1A 2CJWB 3AKEA 1UBGA 2IHYA 5CM9C 1C9KA 2MMCA 5CYOA 4C3ZA 1JEEA 4Z54A 3CUEF 2H92A 1KAOA 2QENA 4QRHA 5JECA 3GLGA 1S8FA 1GILA 1KO7A 3KTAA 4KAXA 4LJ9A 1Z63A 4Q9LA 4ZV4A 4M22A 4DCUA 1G8HA 4POAA 2NZJA 3SN6A 1GRQA 2W2TA 5TB5A 1E99A 5H8WA 4JKIA 3AF3A 4PO1A 1T6NA 4GI7A 2BVNA 3TSWA 4TMKA 1EXMA 3AP2A 4HYYA 5EUQB 4P3YA 3EZ7A 1IAQA 4LY6A 1F3OA 3BOSA 4HLUC 1P9RA 1P6XA 2NO9A 3TQFA 2CDNA 2GJ8A 3AVQA 1UF9A 4H1VA 1P61B 2C2HA 1NG1A 3D3QA 1G7TA 2JLWA 2ZSFA 3V00A 4ESVA 2GEUA 1N2CE 3EC2A 2GXQA 4TQ9A 3OAAD 1FUUA 3QF7A 1Z8FA 3TLXA 1N0WA 3QQ5A 1G5RA 3ZS8A 1E9FA 4AI6A 2DHRA 4JVMA 1XWIA 221PA 2CLSA 1CR4A 3H1TA 4Q48A 3GPLA 2R6DA 1OKKA 1L4YA 2EQBA 2W6JD 5BQ5A 2KE5A 1W46A 2AXPA 5AJVB 1W4AA 2ZS7A 4GZLA 2FSGA 4JVNA 3CKLA 3GFOA 3SQWA 1R5OA 1DS6A 1JR6A 3BK7A 1RC8A 4OI0A 2CBZA 2GBLC 3KUCA 4ZDIA 2WSSD 1R4AA 2OO7A 5K8LA 3KQKA 3ZGXA 1QG4A 3A1VA 4LWZA 4KVGA 1E2HA 1D8TA 4UJ3A 5IRCD 4PO8A 2QSYA 3PVSA 3LDAA 1XFAA 2CNWD 1ZYUA 4FCTA 4I81A 2QBYB 1G5TA 1S96A 4JLMA 5FPYA 3TVTA 1G3IA 3OZXA 1NSTA 4IXNA 2A3RA 3I3SR 2CEAA 2FX3A 2PLFA 2RGDA 3W6PA 2C04A 3I5XA 2G0TA 1AZTA 1OXSC 5E7JA 2ZRPA 4GP6A 1XP8A 1BMFA 3CF2A 1E4VA 5JHHB 2ERYA 3BIFA 3LV8A 1KO1A 1BIFA 4A2WA 5JI2E 4EQ6A 2JLQA 2HCJB 1VYVA 2QAGA 4CYMA 4ZO4A 3T1OA 3ASZA 4DDTA 5E7IA 2JLUA 1WP9A 1MR3F 1E0KA 2WMOB 3A36A 821PA 5KYKA 3T1TA 1ZU5A 4K46A 1JB1A 1G41A 1UDWA 4GP7A 1OKKD 2QROA 2C78A 1H65A 1KK2A 4PO9A 1NLYA 2J9RA 4Q4AA 1ZBDA 4TL9A 4BZXA 4FMBB 4RD2A 1CJMA 4HAWA 4TQUS 2HV8A 1QHHB 1U81A 5DGXA 1GG2A 1YZKA 2QE7A 1HH4A 3P20A 3U61B 4TTQA 4ON9A 1T0HB 5AUPB 2QORA 4IEIA 1NBMA 2ZSAA 4ARZA 1ZRHA 4YMSA 1EWRA 1SKYE 3OE7D 4P0TA 4EPVA 4Q4HA 5KSYA 5GJWC 2XNSA 3A58B 2ZAOA 5FBQB 2CHGA 3SOPA 4PC3A 5FUVA 5JWRA 1P2UA 1EGAA 4HAYA 2V9PA 4EJSC 5HZKA 4UJ5A 1E9BA 2IC5A 4LYFA 4QBFA 4A0FA 4RZ2A 2F7SA 3HJNA 1W0JD 4TYPA 1D2EA 2XTZA 1KSGA 4FCVA 4EPRA 4HDOB 1G1MA 8OHMA 4HZUB 3ZS9A 3DL0A 4TN1A 1Q1QA 3X1WA 3LQQA 5CJPA 3VR6A 4TZ0A 2V54A 3FKSD 3FHCB 5EE1A 1OH5A 2GEVA 2FGJA 1G7CA 1GSIA 1G9XA 2DPXA 3CM0A 1VHLA 4DJTA 2EFGA 3KJGA 3C5HA 4AYXA 1Z22A 4EKDA 3EPLA 5ELXA 1SGWA 2WWGA 1N6LA 1TF5A 3ICQB 3RS0A 4TYNA 3GEHA 5DH9A 2ZJAA 1Q0UA 4DKXA 2B7BA 3MRSA 2FPKA 2ZRJA 4JL5A 1W36B 3VKWA 4TYYA 4LZZA 3U4QB 3X1ZA 2QMOA 3Q72A 1LS6A 4PZYA 1ZM4A 1P7CA 4DLRA 2OG2A 3IIJA 1KI6B 1GFIA 1VHTA 2YINC 3W3ZB 1AQYA 5CIWA 5FUYA 2JIZD 2XX3A 1XMIA 1KI1A 3GJXC 3CLVA 3VU9A 1KDOA 4KV9A 4P4SB 3TAHA 5EXPA 3RAPR 3MWJA 1F2TB 3LFUA 1DARA 2NPFA 1GVNB 3B1YA 2KB0A 2WPDD 1VYTA 1GL7A 5DN6A 1GZSA 4URVR 3LBNA 3WYAA 2Q3HA 4TSFD 1H8HD 2F1JA 3IILA 5DISB 1FTNA 1M7HA 5AUNB 1RVDA 3L43A 2RMKA 1G5PA 3LVQE 4FMCF 4RFSA 3GCGA 4NCHA 1RJ9A 3DMDA 4NCJA 1DTSA 1R10A 5J5CA 4DUGD 1US8B 1GNRA 1W2HA 4C0LA 2F1HA 3DZDA 1BKDR 2ATVA 3RNLA 2Z4SA 4L16A 3Q5EA 4PPNA 4WIAA 1P73A 3F0TA 4C0AC 2V7QD 4I1SA 4DLSA 5KPDA 2Q6TA 5EXXA 4DZZA 4GDFA 2C5LA 2PEYA 2ZJZA 1FUKA 4V0KA 1BYIA 3B1VA 1OLOA 5G3ZA 4QNRA 1XEWX 4A2QA 3DO6A 5J4HA 3ZLJA 1NMXA 2CK3A 2FZLA 2P0EA 4W5WA 3E5HA 2HF8A 4ACBA 2ZE7A 3SDZA 2XSZD 4DEYA 4F38A 2O8BB 4C4PA 3FVQA 2ZSEA 5JSZB 2BIFA 4G5RA 2F6RA 1AGRA 2QPOA 3GLHB 2IWRA 2BMDA 2BJWA 2G77B 1OB5A 2FSFA 4V0NA 1F2UA 4NYJQ 2X1VA 4G5QA 4TT3D 1B0UA 1Z3IX 2Q3MA 4CEHB 2NO6A 3CX7A 2OM2A 3U44B 4JL8A 1N6RA 5KDLA 1OXTA 3IO3A 4F93B 4MKIA 1ZUIA 3OEHA 1E1RA 4OYHA 4PQRA 3MFYA 4B43A 3AVVA 4M1MA 4W5HA 2QRZA 4TLBA 4IVQA 4MQBA 3FTQA 4KO8A 3O47A 4RKFA 3U3JA 4B71A 3JZMA 4M53A 1ZM7A 2WOJA 3LO5A 2EFCB 2XB4A 4JYCA 3NIBA 4MGYR 2NQ2C 1NKSA 1TF2A 2J0SA 2HT1A 1KSHA 1W2GA 5DO9A 1V43A 2HXYA 3KQLA 2Z4RA 3M4YA 1BH2A 3G5UA 4B47A 3RANA 3ADKA 4ZDKA 1I2DA 2QMEA 1OE0A 1SHZA 3THOA 4BUJA 1YE8A 2OESA 4P31A 2XB2A 4RD4A 4TTPA 4PPGA 4QJ4A 2ZR7A 4NU0A 4YMUA 1ZCBA 3SQXA 4NYIQ 4A1FA 1EFUA 1MABB 3SFZA 4Q7MB 4S2EA 4M9QA 2JEOA 2ZJ8A 1K8RA 2G88A 4QG7A 3KXKA 1TEXA 1SVOA 1U8YA 3PITA 1XD2A 1I4LD 1UADA 1BYUA 2J0UB 4YMVA 4DCNA 1Z6TA 4NPHA 5FBWB 1SXJA 5FOXA 2RGXA 3Q7PA 3UG6A 2GCOA 5BN5A 3U6BA 2OT3B 1TL7C 2NO7A 2VHQA 4LC0A 4CEJA 2QGZA 2QU8A 5EP1A 2ODNA 3MLEA 1IXZA 4Q00A 4E5UA 1DVRA 3CRRA 3VR3A 3A1UA 2ZRLA 4M9SA 2QRNA 3PR1A 4TQAA 5CB6A 5FPHA 4B6FA 1P62B 4UXHA 2IX3A 3ZH9B 1NY5A 1XPUA 5EP2A 3EZ9A 4KYIB 2E1RA 2N42A 4FMCB 4UNSA 1ZAKA 1W5TA 2O0HA 3VX4A 4IFBA 4W5JA 2ZE6A 3U3OA 3NVAA 4E03A 2WWWA 2BWJA 5C18A 1Q1EA 2CXXA 2NGRA 1A2KC 1PV4A 3CNLA 2FF7A 4BFWA 5BW8A 1K5DA 2DWQA 2J7PA 2WJYA 5DSZA 4JLNA 2F1RA 4QKQA 3RC8A 1Q3HA 2NIPA 1UM8A 2XJ4A 3NDBB 3QE0A 3C7KA 4DLTA 2OBLA 3RVBA 3C4JA 1IQPA 2OCBA 2QP4A 2RGEA 2D62A 3AKCA 1CXZA 1XRJA 3OIYA 4TMXA 3GJ7A 4V03A 3LAWA 4ERNA 1J2JA 4M2LA 2IEYA 3HWSA 2DY1A 3FB4A 3CZPA 2FFHA 2JJ1A 1KNXA 2ZRFA 4YLGA 3VQTA 4XVRA 3UG7A 1YVDA 4PC1A 3HPQA 2OEPA 4TMZA 5FBRB 3K1JA 3CWQA 5B2ZA 2RGCA 3RWMB 2IEZA 1JJ7A 3M6AA 4D0LB 4DLXA 2FGKA 3MJHA 4U7DA 2GJSA 4RY2A 3IPYA 4I99A 1CR2A 3FYHA 721PA 5JJKA 3WXMA 1VG0B 1CU1A 2ZREA 3UMSA 3WHLA 1UKEA 4JLPA 3GD7A 1NJGA 3J81k 1JI0A 1NY6A 1D2MA 2ZI4A 2IS1A 4LYHA 1H8HA 2BEJA 2IYVA 3ZD7A 3B82A 3K0CA 4Q1FA 1MO5A 4D81A 3MGCA 2FOLA 1T0JB 1YU9A 1U0JA 3LRPA 1FQKA 2KI5A 3CRW1 4WOPA 4Q9KA 4Q9HA 1II8A 2C9CA 1ZC4A 2RGNC 2AWOA 1E2GA 1TNDA 2OZEA 3T1VA 3QKUA 4N3NA 1M1YE 1HE8B 1W4BA 3OEEA 4QBGB 2LKDA 4LI0A 2WM9B 4HUQB 4UXIA 1IXRC 3R20A 2BKEA 1XCPA 5SZJA 1JR3D 2REOA 4R2HA 1MO4A 3TR0A 3IPXA 3AVXA 4BLPA 1VIYA 4ZCIA 2G83A 1NL3A 2F55A 2IYQA 1TPZA 4BFYA 3KQUA 5AUOB 1IN8A 1IN5A 1IHUA 2PCLA 5B64A 2WTUA 4PC7A 3WYFA 3I61A 1G3QA 1AZSC 4ZKDA 1HQCA 2X8AA 2IWHA 4IOMA 3WBKA 2BDTA 1KJZA 1S2MA 4IOKA 5JRJA 1KI7A 3D7MA 2ZRHA 4W7SA 2XXAA 1IM2A 2ZRAA 1AN0A 1DOAA 3K8YA 1DAEA 2P6NA 2ZRGA 1EFHA 3CZQA 3THXA 4Q1EA 3DKPA 3BH0A 4C7OA 4KBGA 4TLAA 1II0A 5KUTA 5JRZA 2JLYA 3LW7A 1EX7A 1F48A 3AKDA 1AS3A 4WXPA 3W3AA 2V55B 1CJVC 2IUUA 2PCJA 4N0DA 2AR7A 2BBTA 3EA5A 1SXJC 4US2R 1NBME 2V6IA 1G3RA 2R6FA 4HDCA 4JVSB 1TMKA 3PEVA 4LRWA 1EG7A 4O2LA 4V0ME 2JDIA 3CB4A 4HSEA 3DOFA 1C1YA 1E9CA 4BWYA 5FL7A 2WICA 3FE2A 2FMXA 5J4LA 1XZQA 2IF0A 1OH7A 2ZAMA 2G1KA 3AVUA 2PZFA 2W6ID 2B8WA 3L82B 4B33A 5K8IA 4WAUA 1Z6GA 2JIZA 2Q9BA 4ASUD 2R8RA 3E2IA 4V0MA 3TW4A 4JSTA 1BMFD 4DLYA 3GLFE 4JBWA 2WPDA 1MV5A 4GPTA 3SJCA 3EIQA 4II7A 2F3RA 3CRMA 2WKPA 2OFWA 3QG5A 3ZZUA 2O8CA 2F9MA 4B34A 4EPYA 4CEIB 4B35A 1W47A 3IHWA 4Q1DA 3B8HA 4A0RA 4KJZA 1RE0A 3FHOA 1JR3A 2O0JA 3IUYA 4IDPA 4DSNA 3R9IA 4JLDA 3U2QA 3N2EA 1Z28A 3LY5A 2QT0A 5AUQA 1QZXA 5K8UA 4LYJA 2JCSA 2P5TB 4Q03A 2LCFA 3Q8XB 2FV8A 4OHVA 4A9AA 5GJBA 5D3QA 4RZUA 2BM0A 4I1VA 2CVFA 2ZVPX 2EFDB 1G7SA 4KODA 4KSBA 5EE0A 3SI7A 2Z43A 5DI9A 4AKHA 3WNDA 1L7VC 2VRWA 3RS7A 1TQ6A 3M1IA 1Z6XA 4G5SA 5IK2A 5BN4A 3RRZA 1M6NA 4DLVA 1W0JA 3KXLA 2ZUCA 4HB2A 3ADDA 2IYTA 1HV8A 1O3YA 1XCGB 3AP1A 3MSXA 3VR1A 4DWJA 3FKQA 4B3XA 3VMFA 1XMSA 4YMTA 4EDHA 1YR9A 2D74A 3H86A 4F4IA 3ASYA 3T12A 4CF7A 1KTVA 4TZ6A 1G8FA 4Q47A 1YZGA 3D6TB 2ORIA 3NHBA 2R65A 4JSYA 5FL7D 4FW9A 4BFTA 1KK0A 1W4CA 2ZJ2A 1OYYA 1LY1A 4N0EA 4EAQA 2JJ2A 1E1QA 2BOVA 4AY2A 4UKDA 2WJJA 3FFAA 4JVLA 5A5GA 3QKSB 3WYGA 3W8NA 5KHOC 1KI8A 1XTQA 5BYJA 2ZTSA 1E2LA 2QTVB 4L15A 1CR1A 4BE7B 2CHQA 2GJ9A 1YZUA 5EXTA 2W2XA 3M0EA 2IYSA 1XXHA 1XU4A 3I32A 1GP2A 2C8VA 2ZJ5A 4PAOA 1KKMA 2RKOA 4DSOA 4JJZA 4M1WA 1SKQA 2CCJA 1OFTA 2CCGA 2D3WA 3EIHA 2AWNA 4MGZR 3ZZ0A 1E96A 3NHAA 5FR1A 3AVPA 4OHXA 3ZDQA 4X8MA 1FMJA 4QM6A 2BKUA 1CJKC 4JJKA 3WY9A 2UKDA 5EP3A 2IYWA 2W6JA 4YQFA 4MDEA 3TUZC 1E4YA 4C0SA 5KOYA 3MUFA 2AN9A 1S3SA 3Q3JB 2HUPA 2H1LA 3V4FA 1X3SA 3QJYA 3U4QA 3LW8A 3WMFA 1FZQA 3C8UA 3EC1A 3EPJA 4M1TA 1E94E 1OSNA 3NEJA 5CYPA 5C2JB 1DPFA 5CB8A 4X8HA 2PH1A 1XTKA 4K8OA 5FR2A 3RS3A 4A15A 1P5ZB 5KO2A 1FMLA 3L0IB 2ODWA 2ZUBA 2ZR0A 1GM5A 4YC7A 3K0AA 5IDVA 3NH6A 2GAOA 3F5FA 2J46A 1PUJA 1VPLA 2VF8A 2I1VB 5BN3A 1UKVY 2VP4A 3EZ6A 4Q1CA 4Q7LA 1DO0A 2QN6A 4DSTA 3U5ZB 3X2SA 1DE0A 3CO5A 2ONKA 4LBYA 1T3LA 3GLIA 1T4GA 2EWVA 3IHLA 4KI0A 4UNQA 5JJLA 1SZPA 3BWDD 1A82A 2NTYC 4U5XA 1U0HC 1Z2AA 3KFVA 1D9ZA 3WBJA 1E2QA 2IUTA 4QHYA 1ZM9A 3ZVMA 5TY0A 4NYMQ 5JCZA 4UNPA 1A7JA 4NCKA 2IK8A 2DR3A 4BEBA 1M8PA 4KITB 3EW9A 1FX0B 1KK3A 3EXAA 4IJMA 3UANA 5EJEA 3SU8A 5B30A 1P72A 4LHZA 3T06B 4Q4LA 4TT3A 1TU3A 4C0QC 1E2DA 1ZNYA 2FEMA 4XH9B 1SVKA 3K70B 1QHSA 5TMPA 5FOVA 4HLUA 1L4UA 2XAUA 2F3TA 3FWYA 3SYLA 4Q9JA 3UIEA 1VMAA 1FFHA 2YYZA 3FPAA 3OF5A 2VHCA 3PEWA 4KXFB 3I4LA 1FP7A 3I73A 2VP5A 4LCBA 4RCZA 4HZIA 2CK3D 1J99A 2ZU0C 3NBXX 3ZVRA 1ZD1A 2YWHA 1R8QA 2ZIAA 2HJVA 3TH5A 5GVSA 1H8ED 4JIMA 2O8EA 2D4HA 2DFLA 3P26A 2GTPA 4S35A 3LVRE 4RD6A 2HXSA 2O8FA 2WWYA 2XTNA 3HYTA 2RHMA 1GWNA 4FXPA 5KDDA 3GJ6A 5FI1B 3WHKA 4DT1B 4BLSA 3MCAA 3SS8A 4JT4A 2WJVA 2C9OA 4IVRA 5DI3B 2ZUDA 4L8GA 1Y3AA 4XWKA 5GJVC 2XZLA 1AS2A 3BERA 3C41J 2DFKB 4BZQA 4GOXA 1PLKA 1UBEA 3IEUA 1Z0IA 2ZYTX 4HLQB 2CNWA 4PXAA 3ZVLA 1R5NA 3W6NA 1Q22A 2P6UA 4QBIA 3FMFA 4MH0R 1G64A 2IBMA 3PFIA 5IF9A 5IK2D 2GF9A 1ZU4A 2WMNB 3TBKA 1KMHA 4NH0A 1WXQA 1UEJA 3TNFA 2KJQA 3AF1A 4Q4JA 1WDTA 2FZ4A 2ZM5A 1T5IA 4G5OA 4UQOA 1AGPA 1HT2E 3OFNA 5DE3A 3FOZA 4V0OA 1CS4C 3THYB 3RRNA 2C96A 1T9HA 2W83A 4M1YA 3O8DA 1RRCA 2MSDB 1IN4A 5CK4A 5CK5A 2QEQA 4LHVA 1G20E 2J0UA 4Q18A 3JZAA 2GVDC 2J45A 1ZD9A 4Z8XA 3MD0A 4PHTA 5TXGA 4LPSA 2FFQA 4BFXA 2ZEJA 2QT1A 3SJAA 1E1QD 2PLRA 4BFSA 4QGAA 2GCNA 2Z6VA 4Q7KA 3UKDA 4ITRC 3UWKA 1Z0JA 1E2PA 4IRUB 2MSEB 4D6PA 5JS7A 3K0EA 2ZRBA 3BB3A 4KCGA 3R8FA 3NBYC 3PV0A 1GKIA 3K9NA 1ESNA 1DAHA 3CBQA 2FNAA 1OXVA 1UPTA 2IYZA 4HZUA 4A8JB 5CJ2A 4ESHA 2FU5C 2JLVA 1CIPA 3IQXA 1YRBA 4PPFA 4AIIA 4RFVA 4ZCLA 1ZVQA 2OXRA 1J8MF 2DYKA 2J0QA 4QJ5A 2HYDA 3D8BA 1H8EA 1Z29A 4LPKA 1COWA 1X86B 5E7MA 4WZ6A 3TR5A 2O8DB 4PQYA 1YR8A 4JLKA 1CRPA 1AA9A 1JPNA 1P60A 1ZP6A 3EZFA 3R7WA 1U8AA 3BORA 2EFHB 4LSGA 3RYTC 2IS2A 4MITA 4EPWA 4O0MA 5HKKD 4GBMA 4C0HA 1KKLA 3QIAA 4C0JA 3QVVA 1G4UR 1U99A 1JEDA 1CLUA 1GNQA 2GXUA 1N25A 3QF4A 2CCKA 1JNYA 4LBWA 4LOAA 2FPMA 1I4DD 3VU9B 3REFA 3EASA 3BH7A 1G8YA 3QBTA 3BB4A 4KHZA 1I4TD 3CRQA 2ZJOA 3K9LA 5DYIA 1IOZA 2WKQA 4URXR 4AC9A 2GVZC 2RH5A 3QY0A 1IBRA 1RKBA 1U98A 1QHNA 3GFPA 4Q1AA 2GETA 4XOIA 1LTQA 3QG1A 2QAGB 1LF5A 2V4ZA 5JMTA 1E79A 4OJKA 4PHHA 2QUZA 3OEHD 3B1ZA 1MRSA 1E32A 1T8TA 2AXNA 2IT1A 3I8XA 4EUNA 2P65A 2CL0X 3A4MA 3K0FA 4WZAE 4B2IA 3X1DA 2PZGA 1JPJA 1E3MA 3LX5A 4Q4AB 3K53A 1OV4A 1XEXA 2GK6A 2VP6A 121PA 1UKZA 1VCNA 1BO6A 2N46A 3U60B 4OK6A 5AJYA 3NWJA 2GNOA 1ZNZA 3A37A 1P2TA 1MO6A 4MRSA 2NZ8A 2BMJA 3QKRA 2YC4C 3BC1A 1KIMA 5B57C 2PZEA 1Q1ZA 4D0GA 4GT1A 2V8OA 4M0LA 3VR4A 2E9SA 3NTUA 2XZOA 1ZUHA 2IYLD 3OEED 3QUSA 3TKLA 4M9XA 3RHFA 2GF0A 1MT0A 2J3EA 2PL3A 3GJ3A 3QEOA 3WRXC 5BXQC 2AK3A 3I8SA 4BZPA 3LD9A 3CRVA 1XJQA 3PQCA 2J87A 2R62A 5CDFE 4EJSA 2QP9X 2HEIA 1OT3A 3B13B 1VIAA 5L3SA 2W6IA 1C4OA 4LHYA 4TTRA 3IIMA 2BV3A 1U9IC 3THWA 1WF3A 3PUWA 4H9GA 4A92A 1F5NA 2VP9A 1OH8A 4P4UA 3V4RA 5DLQC 5UKDA 4TSFA 4YDSA 2WKRA 5LBIA 1OW3B 2AFHE 3WP0A 3IO5A 3S1AB 2ZVQX 5H70A 2XITA 4TL6A 4Q01A 4QHTA 4WW0A 2D7CA 4MDFA 4L4UA 3I5YA 1S9HA 4XSGA 2HDNB 3VKGA 2FEOA 5EE5B 3LXRA 2GRJA 1F6BA 1E2JA 2JASA 1R5BA 3AUYA 1OIWA 4IOJA 2R9VA 1IN6A 2VSFA 3NEYA 2J1LA 4DBLC 4NYJR 1TQDA 4YONB 4QJ3A 3X1YA 2XNDA 1G7RA 1E2IA 2GZHA 1E1RD 5BWMA 2J59A 1CKEA 4FIDA 4O3MA 3L2OB 1N6IA 1E9AA 1LB1B 5FUWA 1E69A 2QAJA 4PSAA 1FL9A 1VCOA 2A5FA 2YWFA 3OFND 1E9DA 4TLDA 3KXIA 2FH5B 2UZ3A 4A6PA 2ZETA 1IJFA 3I1FA 1UBCA 1CRQA 1D9XA 3WNBA 4EPTA 2QTFA 2VP0A 2F43B 5AR1A 4DB4A 3ZYCA 1ZNWA 4G0NA 2PJRA 5KNDA 2QPAA 1FP6A 4TLCA 1X8JA 4AURA 2J7KA 2PMDA 3KX2A 4CVNA 3KKOA 4PPQA 4XWOA 2ZYUX 3R9WA 2DB3A 2YNMA 1AQUA 3QEJA 2P2LA 2AX4A 4LK2A 3OIVA 4LJ6A 4TMVA 4Y0VA 4NCNA 1QG2A 2VSOA 2ZI7A 3WRYC 1XTJA 5L8VA 1UEIA 3R8CA 2AKAB 3SYKA 1AJEA 2GHIA 1R0XA 3QENA 2KBFA 2FN4A 3AF2A 2W2VA 1WMSA 4JYBA 4RJLA 1N6KA 3LLUA 4F4JA 3E70C 3U7GA 4MKHA 1SULA 2J5XA 3DMNA 1YHNA 4XIGS 1XMVA 4DDVA 2QA5A 1P4SA 3RSLA 4BRUA 1HURA 3C16C 2H18A 4JL6A 3VKHA 4E09A 3DOEA 1LNZA 1KJWA 5KSZA 1OH6A 1XJ0A 1RFLA 1S3GA 3N70A 5HCNA 3HPRA 4JMPA 1RYHA 2REBA 4BEJA 1TUIA 2GZAA 3GLHA 2QZ4A 4LV8B 4LV5B 2W00A 3ZD6A 4AD8A 1ESMA 2J0VA 1N6NA 4GMDA 3GLGB 2O5VA 1RPZA 3VR5A 2FJUA 3PG5A 3DEFA 2FA9A 1LS1A 1PZNA 2WSMA 3RLFA 1QDEA 3PUVA 5IT5A 1XEWY 1CP2A 2ZRMA 4NDZA 3TAUA 5D3MB 2PT7A 4I1OA 5JI3E 4LJ4A 4CT4B 1RZ3A 4TMTA 1ZM2A 2WV9A 2ZE5A 4NYIR 3DVLA 4KLNA 1NLFA 3GLFA 4B3CA 1KSJA 1G291 4D4LA 2RCNA 4Q9IA 2QL6A 4G5GA 1KO8A 3KKMA 1W36C 1G6OA 2OV2A 4RZ3A 1ZUNB 1HA3A 1YJ5A 3LNCA 2A7QA 3AGPA 2VL7A 2ORWA 3IBGA 2RGBA 5ANRB 1SHKA 1MO3A 1W1WA 1X1SA 2BHRA 2AL7A 2BEKA 3U7HB 3CPJB 3TW8B 4HDQB 5TV2A 2EW1A 2JDID 3DZ8A 2ZI9A 1T3SA 4XD7D 3RWOA 2QP3A 1X8LA 3CPHA 4BFVA 3EPHA 3ADCA 1W5SA 2V1UA 1HYQA 4KBFA 4IFEA 4DRZA 3SBEA 1GL9B 3RRMA 2IS4A 1OXXK 4TMWA 1MRNA 4XJXA 3K9GA 3ETLA 1ONBA 3PENA 4MKGA 3GQBA 2ZRIA 3GMTA 1LV7A 4C2UA 1G16A 4NP6A 3SJZA 1WCV1 3R9XA 1P2SA 4EPXA 3MJRA 3EPKA 2VPPA 4BECA 2QPTA 4EIWA 4HATA 4OHWA 1FPMA 4QC2A 2Q21A 1M7BA 1JQJC 2WWXA 2ZSDA 4X8LA 2IYXA 4KYUA 5FTKA 3LWNA 3WMGA 3IQWA 5CLLA 4X8OA 1LFDB 4UNRA 2EFEB 4MYTA 1YZNA 1COWD 5L3QA 1IJEA 4B3GA 1OJLA 1M7GA 2YWGA 3HR8A 5JHGB 4J0QA 4BLOA 2QG6A 5C1BA 1EESA 4Z51A 4NONA 2O52A 3BFXA 5F2EA 4TL8A 1ZIPA 2WZQA 3FHTA 1SVWA 2B8TA 1Y63A 5G41A 2QE7D 2QMHA 4PSVA 2A2ZA 2IUSA 3BGWA 4H1UA 5GVRA 1XZPA 2QNRA 4CZ2A 4OQLA 2HCBA 2X77A 1AIPA 1K5GA 2IA5A 2DFTA 4HB0A 1XTSA 2OBNA 3OE7A 3ZVNA 2ZITA 4D80A 2FFAA 2N1BA 1OIXA 4B75A 3LH5A 4HAZA 5B58C 4DLUA 4P4TA 4AKIA 5AJZA 3AVTA 2GEDA 5G3YA 4DEXA 2GZDA 4L5BA 3GJ8A 2V6JA 1GRNA 4DB2A 1NF3A 2NMVA 1W0KA 3AVYA 3DM5A 5AJWA 5H1YA 5CITA 4GZMA 2J7PD 5FL3A 3QKTA 3ND8A 1IN7A 5DN6D 3W90A 4NHOA 1HEIA 4QL3A 4CEIA 2P67A 4ZI2A 5F98A 4DXAA 4RCYA 4DIEA 2CL6X 2OHFA 1MKYA 2PT5A 5TDHA 4TYQA 1HTWA 2YOGA 1AK2A 1KK1A 2W0SA 3CX6A 3LA6A 2ANBA 5KNCA 1KI4A 5DIFA 1R6BX 3KKPA 1FNNA 1QVAA 4MGIR 4PQFA 4RD3A 2GCPA 1PVOA 2VQSA 4B6EA 4EFNA 4F91B 5DYGA 3U3RA 1VG1A 3PEYA 1VDZA 1EFCA 3B9PA 2ORVA 4HUQA 4QGFA 1VKJA 2OXCA 1T8UA 5DI3A 1DEKA 2D2FA 3U3MA 4D25A 4M21A 2QM8A 3RS5A 2PX0A 3RABA 2BM1A 3W5JA 2GJKA 1SKYB 5FTMA 1EX6A 1ZD8A 3W5IA 4RKEA 2CJWA 3LBHA 2HLDD 4WA7A 1EK0A 3NKVA 5JSZA 2P6RA 1JALA 1DG3A 1Z6YA 1UAAA 2XSZA 4DDWA 3FMPB 2BCGY 3KTAB 1P9NA 3D31A 4B3BA 3A1SA 4PFSA 4B3FX 4F4CA 5JLJA 1OB2A 1Z06A 5C4GB 4OBEA 5C46F 4Q4JB 1WBDA 3L0PA 4CT5A 3THXB 1HUQA 1E6CA 4Q19A 1S1CA 1LW7A 4AKEA 1SXJD 3KFXA 3IIKA 2YOHA 2JATA 2ODEA 1P75A 2OFXA 2FWRA 3FKSA 1G18A 4TYWA 2YHSA 4KFSA 1OXUA 4B73A 1FTSA 1G21E 1VTKA 4JKYA 4IDOA 4MRNA 2QY9A 3C14C 3CH5A 4F92B 4E22A 5KNBA 1KJYA 4GOKA 2VH5R 2SHKA 1U0LA 1TX4B 4MKFA 1A2BA 2CE7A 4AG5A 4D4MA 1S9DA 4IW3B 1MABA 1US8A 1DBSA 1YQTA 2QGNA 1E98A 3BE4A 1S0UA 1WA5A 4XSHA 4A8JA 1TQ4A 4BLRA 4C0BA 1E9EA 2OE2A 2JGNA 3VHXA 5FPSA 2PMKA 1RIFA 3W9YA 4LV6A 1KO5A 1R0YA 2MMGA 5EXSA 1NP6A 1EFRD 2KBEA 1KY3A 2BCJQ 3OESA 2D7DA 1DADA 1N5IA 4XVQA 4KLZA 1XDBA 2OAQ1 4Z8YA 1DG1G 1P3JA 2AK2A 1AS0A 3AGQA 4NCIA 1OYWA 4U02A 4MYHA 4PX9A 1YKSA 5J40A 3KQNA 2P3SA 3CF0A 5CM8B 4B3DA 1OFUX 3MWKA 5HKKA 2RHDA 5GADl 1UBFA 5FOSA 1M34E 2A78A 2YVUA 1DAMA 5FTNA 1FQJA 1DAGA 3I92A 2F1IA 4FINA 4K81B 3U3KA 3PUXA 5FTLA 1IY2A 2B7CA 3H84A 3KJEA 1NN3A 4FD2A 4OK3A 2PJZA 2G9NA 3AVOA 1NSFA 1Q21A 3B2EA 2WJIA 2V7QA 1G4AE 4PAMA 4KSCA 1KOFA 5EZ5A 3TJZA 2FFBA 2JJ8A 2BMFA 2NOAA 4QHSA 1WBBA 3AV0B 3ICEA 2JLSA 1GUAA 5SZKB 3CR8A 1QRAA 1JAIA 2VEDA 3B1WA 1CTQA 2DWOA 1XBTA 1LVGA 2OBMA 3VHLB 2Q3FA 4V0LA 2Q0HA 4C9BA 1PLLA 3A4NA 1OHHA 1VCMA 2C77A 1QHHA 4GOJA 3ECCA 5JWOA 1Q57A 1FX0A 1XJCA 5AWFC 2H17A 3OAAA 1QHGA 2BMEA 4OK5A 3SEAA 2ZRKA 4Q02A 1GKYA 4A0GA 4KFUA 5FTJA 3ZQJA 4DLZA 3AQ4A 4LDJA 5TARA 2GDJA 4PZLA 2GAAA 4ARZB 3KZ1E 2JLZA 2DBYA 2DCUA 2L0XA 4ZDJA 1U2RA 4Q4HB 2YZ2A 3FGNA 1CJUC 3K70D 3SNHA 3I62A 4DDUA 1U8ZA 1E0SA 3JVVA 3UMFA 2HF9A 4RZXA 1FW6A 2XNDD 1EWQA 4WBSA 1XNJA 5LB4A 4YXWD 3F3YA 1NVWQ 4BQSA 5GJCA 2O8EB 4L9WA 4CIDA 4KFTA 5L3SB 4D4KA 3LBIA 3GJ5A 5LB2A 5EE9A 4BLQA 4M1SA 2GJAA 3CONA 4D4JA 2JJ2D 1NNEA 1KDPA 2B92A 2ZU6A 4PTLA 1E2MA 3UATA 4DT1A 1Z0KA 1QHIA 4AYTA 1D2NA 3BH6A 3KKQA 4ZDWA 1Z07A 3KB1A 2HJGA 4MYUA 1G8GA 3EZ2A 5EP4A 2VHJA 1ZW6A 2H7VA 2A30A 1M74A 3CF6R 4HAVA 2YOFA 1W48A 3MMPA 4IOLA 1HY3A 4G01B 3BRWD 3HDTA 1N6HA 4GSYA 1KI6A 1TEVA 4MYCA 2C9YA 3KB2A 2E87A 3NC0C 4L9SA 1CEEA 4RD1A 3QPVA 4MA4A 2ECKA 2QQEA 2FE4A 3E1SA 3UXMA 3FMOB 2EYUA 1D5CA 3PCRB 3P1JA 4DVGA 3AM1A 4OJQA 3T1QA 1SQ5A 4DUGA 4YXWA 1XD9A 1NLZA 2ZI3A 2HYIC 1NVUQ 1S1MA 4KFRA 3C5CA 1I2MA 4JT2A 4M4SA 1WRBA 5LD2B 3BFKA 3BBPA 3KDSE 3T5GA 4HEJA 1NBMD 4TL7A 5SZHB 3T5DA 2A5DA 2IXEA 5FH9A 3VNVA 1T91A 4LJYA 5JS8A 4LBVA 1RJ9B 2UVQA 3B6EA 4NTZA 5FPKA 5EUMA 2CHVA 3DDCA 3H0KA 2LWIA 4LHWA 3BD9A 4IKEA 2GXSA 4ZIRA 4LYAA 2VTKA 1NN0A 3GJ4A 2WSSA 4QXAA 3V9PA 4RSGA 1N0UA 2NO0A 1LF0A 1E2FA 3AF0A 3P32A 5JEDA 2VHUA 5F9FA 3PXGA 3O8CA 621PA 3AF4A 3AP3A 1CR0A 2AD5A 3MWLA 4PC6A 5LPNA 2XTMA 4UNNA 3B78A 4OQNA 3R7WB 4NL4H 4HLDA 4B32A 4GFDA 4JLAA 2REXB 1NN5A 3EWAA 3B5JA 4R71A 3CNOA 1EFTA 3QBVA 1XEFA 4LHXA 1QF9A 5FOTA 3A4LA 3K0CC 4B2PA 3WMEA 3TSOA 5KDOA 4OHYA 1KDTA 2OCPA 3CPEA 5FPTA 1J8YF 5JBQA 3GLGE 5HPYB 2BBSA 4M1OA 3GJ0A 2XXAB 4DSUA 1CBUA 2K5UA 3Q5DA 1O87A 2FDCA 2VIIA 3H4MA 4IEEA 5HR5A 4QGHA 5F9HA 3NBFA 1KDRA 2Z83A 1JXOA 3TRFA 2R6CA 4Q7JB 1F60A 3BB1A 2XGJA 1DAKA 1TAGA 3Q85A 2O0KA 4JS0A 2ZROA 3PIRA 4W9MC 1R0ZA 1JAHA 4OHZA 3H2YA 5J4KA 1GKUB 5M04A 1QHXA 4C2TA 4FCWA 4NE2A 1MOZA 1DO2A 3CNNA 2X19A 3GLFB 1FOEB 1NIPA 1CULC 2NPIA 2D06A 4QM7A 3TUJC 4U00A 4R98A 4OI1A 1HE1C 3IEVA 1U90A 4N1AA 1NN1A 1VG8A 2R44A 1SVLA 3FDIA 1SVMA 2OFOA 2WWIA 3TE6A 4PC2A 1E0JA 4B74A 1E9SA 3RDPA 4A36A 4D26A 4HAUA 2IHBA 2G3YA 1E79D 3QXHA 3EA0A 5DHAA 5KPJA 2WIAA 4JLVA 1G3MA 3QSYA 1CF4A 2OAP1 4R9UC 2Q9CA 3ZQ6A 1BS1A 1Z5ZA 2A5GA 2BC9A 4Y0AA 2CLDX 2DWPA 1X1RA 1WE2A 4O25A 3TUIC 1MH1A 1W49A 1RRGA 2GILA 1JXMA 4FWTA 1XTIA 2ERXA 1R8SA 3EG5A 2QAGC 4QOSA 4BFZA 2OCAA 2BBWA 2JA1A 4OL0A 5FFMA 1TU4A 3VTKA 4CDGA 2ZRCA 1NG9A 3A6PC 1N6OA 5JEEA 4URYR 3L8ZA 4JLBA 1E9RA 2Z0MA 3L8YA 2VSXA 3GLHE 3L0SA 2FG5A 1Q1BA 4A0HA 1R2QA 2IYYA 4NBSA 3SYNA 2H8KA 4B48A 3AVWA 3B85A 3QXCA 4JZKA 1S4QA 1Z83A 5AK0A 2A5JA 4AWXA 3HU2A 2A9KA 1TADA 5CLQA 5F3WB 1T5LA 1KI3A 1YZTA 1GOTA 3GFTA 5G53C 3QPUA 3TQCA 2OLKA 4CGZA 5JJIA 2ZI5A 1GDDA 2W58A 1GIAA 1KAGA 3T35A 1RW4A 5SZIA 4P33A 2TMKA 2FSIA 4M9ZA 4BGDA 4AG6A 1RYFA 2OLJA 1W0KD 4JBXA 5J4VA 4I4LA 1VYUA 2QBYA 2O8BA 1PJRA 1YZLA 3QF4B 3QXXA 2WOOA 3HP1A 2HT6A 4PSKA 4DHEA 1RRFA 3QOFA 2GA8A 2OUKA 3K0AB 2EVWX 1N5JA 4TWZA 5H68A 3W34A 3TGPA 421PA 5JCPA 1CJTC 1R0WA 3EWSA 1J7KA 3DHWC 4NKRA 2Y8EA 2IF2A 2PBRA 4US1R 5L3VA 3JVUA 1PLJA 1KO4A 1N5KA 4EQ6B 4PR0A 4AKGA 5HZHA 3GLIB 4MGKR 3WP1B 1X6VA 1XX6A 3SR0A 1NIJA 3I72A 4ZI3A 2CMKA 2VO1A 1ETUA 4DIDA 5C4MA 4YMWA 2UZIR 5TVKA 2IYUA 3NH9A 1TTTA 2WBLC 2ASEA 1ZMXA 5IHPA 5HTKA 4C0KA 1UKYA 4GNKA 1AM4D 2JLXA 3RC3A 1U94A 4MRVA 3HYRA 2KWIA 2I4IA 1II8B 3IBYA 2HLDA 1OHHD 3VNUA 1Q3TA 4IDNA 2PEZA 4LJAA 2ZPTX 4PANA 2WWHA 3KJHA 2I1QA 3TSZA 4R2IA 4A6XA 521PA 4ABYA 3TVDA 2ANCA 1IY0A 4M8NE 1P9WA 3RS4A 2I3BA 1Z0DA 2OILA 4GMXA 2GK7A 2CL7X 3BFVA 4URZR 3GEIA 4HB4A 3SZRA 4D2IA 2ZYVX 1N3BA 1SXJB 4PZZA 1A5TA 1GRRA 3Q9LA 4MUBA 3B9QA 1YR6A 4CEJB 1NJFA 6Q21A 4LJ5A 5LD2C 4EFLA 5DHFA 4ZCMA 3KL4A 4NYMR 4EJSB 2VA8A 3CX8A 4BASA 5EE3A 4XVUA 4XWAA 2NO1A 2XJ9A 3RSOA 3SHWA 3THWB 4FN5A 2WJGA 3B60A 3C15C 5KSOA 3QXSA 2ZS8A 2VP2A 4A8JC 4UXJA 3PUYA 1G19A 1OIVA 4PHFA 2EU8A 3PEUA 3MAAC 4XTRA 4P32A 1XPRA 3LLMA 4URWR 3K9HA 5CDFA 1JECA 2EWWA 3K70C 2IS6A 1EFRA 2WAXA 1NVVR 1SVSA 1W44A 3AUXA 2ZQ5A 3LXXA 3MWYW 2ONJA 2X2FA 4ILEA 3ZJYA 1ZNXA 4A4DA 4GRAA 1RRPA 2R6AA 1KZGB 1JBKA 2D2EA 4R7ZA 4D0NA 2X2EA 1ZC3A 2VYFA 4BPBA 3T61A 1ZJ6A 4QFMA 4DC9A 1YZQA 2IW3A 1DAFA 4G1UC 4QBHA 1DAIA 3Q7QA 1KHTA 1E2KA 5FOUA 3L0OA 1OFHA 2AKYA 1Z2CA 4IDHA 1QVRA 1Z0FA 4HB3A 3SC3A 3VX3A 3GP8A 4LGMA 4B76A 4HUTA 3GEEA 2JAQA 2GXAA 1W4RA 3KJIA 1W36D 1A1VA 1ZIOA 2DFNA 5FBVB 3THYA 4PAQA 4P4SA 2WAYA 4E07A 2A5YB 1D6JA 2EYQA 3N2IA 1F2TA 4MRPA 3WNCA 3AB3A 3QXJA 4F7WA 2BBOA 2QTHA 4QNMA 3O8BA 5P21A 1II9A 4G3XA 4Z1MA 1M2OB 4OQFA 1VECA 2F43A
chains in the Genus database with same CATH superfamily
1GL6A 2N3ZA 1GZHB 4AW9A 2AEFA 4BNDA 2A1TS 3BXZA 3D4IA 1JYSA 3WYBA 3E53A 1W85B 4RFSB 3UH1A 5DN9A 1QV6A 5EERA 4B4KA 3IXLA 4LKOA 5HCIA 1YNSA 2QMYA 2R2AA 3I1IA 4I3FA 3O31A 5J3JA 2YWEA 4GBJA 2XYRA 2X0NA 1QHYA 2B35A 3G82C 4DCVA 5ED4A 3H2HA 3DKVA 4MEBA 3EIEA 3LK6A 4X1IA 5EZSA 3N5CA 5JISA 4U4AA 2XCIA 5CIQA 1A4RA 3R9KA 3LLVA 2UV8A 2I8CA 4UREA 1JG4A 1HKUA 4TGLA 2VSQA 2ZP1A 3RVOA 1KS2A 1Z5OA 4Q3LA 4ISCA 3BJIC 5B1YA 4RTMA 3L4JA 2FUEA 4IYRA 3O95A 2VTBA 1PK9A 2C59A 2ORED 3TZQA 5AW1A 4DR3B 3RU2A 2Q2VA 4A8TA 5A4MS 1C9MA 3HR7A 1B8NA 3JD3A 3KUDA 4RZSA 1I6LA 4UVGA 1ZRMA 5CDHA 2E4XA 1DP4A 2QUJA 1KBQA 1KRWA 1KEEB 2ZIUB 4ZVKA 1U02A 4IICA 1KAMA 2QMUA 3H7IA 3ND9A 1Q0ZA 5KYUB 3ER9A 3TM4A 5KOHB 1RFGE 4CEHA 3M34A 1KI2A 1J2TA 1RCTE 3FDFA 1PQ4A 2POCA 3K09A 1IEVA 5LDDC 1CZRA 3KKNA 3ML1A 4R2XA 1CVIA 2IL1A 1VXRA 5ILGA 3VAAA 3UGTA 1WPXA 2RGRA 3KT8A 5L3RA 2OHVA 1W7AA 1KYIA 4AO8A 2ODTX 3LGAA 2OO5C 3SXUB 2A86A 4LFCB 3A9VA 4DCTA 4IJKA 1ETHA 3E2PA 5LKRA 3T15A 3WGHA 1GNPA 2ESRA 2PGDA 4PX3A 3N1UA 1WXIA 2HU5A 2DPLA 2F8SA 5IAOA 4BLTA 4UAJA 1ECJA 3H19A 5JD5A 5A4KA 5BUCA 1MVNA 1VA4A 2Z4TA 2QI9F 4IIFA 3OPMA 1E2NA 3CTMA 5I47A 4XFJA 3W8RA 3K0FB 1C14A 5JFGA 4KN6A 2WIBA 3N76A 1AHHA 4HI0E 4IVPA 5EQTA 4B83A 1ZUNA 1IXSB 3HV2A 3O4GA 3NPAA 1D7OA 3IP1A 3CUKA 1E3IA 5BSVA 1AB5A 2SCUB 3HVHA 3MZ0A 5HE9A 2H16A 5H80A 4OQXA 4R8KA 3LCCA 3LX8A 3TLEA 1JX6A 1RRKA 3E4CA 4TPKA 5E4FA 5TF4A 2KYRA 2FPWA 2C57A 4Q1BA 1IM8A 1P8JA 1A9PA 1XD2B 2P8JA 5D86A 4Y67A 5EVJA 5D51S 1YQUA 2C98A 3LOQA 1PWXA 2GCOB 1SY7A 2GKSA 4PVCA 2A92A 3HEAA 1VB5A 3MRTA 5G40A 5K3BA 5AQ1A 1N33B 4M1KA 4UCFA 4I1YA 3E3AA 3RFUA 1N34B 5DU2A 5AW9A 3RV4A 3GEDA 4EYGA 3BQMB 1DSSG 2EOAA 1TF7A 3HH8A 4HEA1 5AVRA 2PKCA 1YVPA 4DIOA 1EXWA 1UFQA 3ECSA 2QX8A 1NFRA 3ABSB 2XZPA 3RSFA 5FOWA 3T9EA 2ZJBA 4PZDA 3WK8A 4CM8A 4EO4A 4BNVA 2P9YA 1J70A 4RPKA 3ONWA 1Z0AA 3VAZA 4XPIA 4RDCA 1XELA 3SE0A 3ADBA 4F11A 5BURA 4ZKEA 2GM9A 1V4VA 1YGPA 3BRQA 1R4ZA 5KI6A 1HT1E 1GVHA 4WZBE 2BKXA 3AKYA 3IVXA 1JVBA 3UWPA 1GTVA 5KQLA 4FS8A 1UDXA 4GUDA 4A1OA 2P3QA 1H2EA 3WQHA 3I28A 4D8UA 1ISMA 3EK2A 1W73A 5IDWA 1SQ0A 2CLCX 2DULA 4QOJA 3AEZA 1FMCA 1U1IA 4ZD6A 4JC0A 3O8RA 4OFXA 4C01A 5JWHA 3P71T 3PRYA 3RYIB 2O06A 5D5PA 3NHYA 5DNYB 3EGDA 4P0PB 1RKVA 1ZBQA 3DOUA 3LPDA 2IQIA 1S01A 4R1LA 2Y0CA 4C04A 3PFNA 2G04A 3OBBA 2KSQA 4M38A 5LYJA 4Q5IA 2PYIA 1D0VA 2WT9A 3R76A 3SFVA 4BTEA 2HR1A 1NQOA 1ZQ1A 2FP4B 3UMBA 2JJ1D 2AFHB 2VJYA 2GPTA 3G0HA 3UPUA 3GHYA 3PYXA 4WXRA 3X1KA 4NATA 5BSKA 1YL5A 2XYQA 1J0AA 1NJ5A 1RACA 4POOA 4L8FA 1X0XA 3R40A 4DHWA 2OKGA 1UL1X 2C4VA 2QG9A 3JATA 3K15A 2RGAA 5KSPA 1CUHA 2CKMA 1I80A 3QLTA 1W88B 2D2IA 4G0OA 4WCVA 5KU1A 3I12A 3H5RA 3JYHA 3Q8WA 1JQDA 3A1TA 5ALZA 1X74A 2EKDA 2IXGA 3PUKA 5T4BA 3IEKA 2FEKA 1BOFA 1VMDA 2O5EA 3WK4A 5EKTA 2OB2A 2W0MA 3FSGD 3PIDA 5LLTA 3OTIA 3PFHA 3CR3C 2RB4A 2QSZA 3K0SA 2WV7A 5J4YA 2FCRA 4MUAA 3TEJA 4IJ5A 4OUDA 4YYZA 2MSCB 3IA7A 2Q8PA 4L6CA 1CUGA 3OPQA 3F8TA 2ZAIA 4U7WA 4B5LA 4ZGWA 3KHUA 3C6QA 1XZKA 1FEZA 2HU2A 3KR2A 3QKSA 4L95C 4EFMA 4YJ3F 4FE7A 4BKMA 1XAJA 1VL8A 1KYQA 1N9GB 3CUTA 1N78A 4JBYA 3M6VA 5E4TA 1SRQA 2JIQA 3SJBA 5FUQA 2ZXUA 3STVA 1NW4A 4C4XA 4FNMA 2WHXA 2AT1A 3QVSA 1OF1A 1AQLA 1GL3A 1ZLYA 2EIXA 1PFWA 4L78A 4BU0A 2XOKA 4R9SA 1D09A 3SHFA 3OHMA 2J6IA 1SIBE 4WBNB 3G0GA 1GG5A 2NNLD 4FGZA 3KSZO 2AX3A 3AUFA 1K6MA 1NMZA 3FNIA 3IDQA 4EHJA 3ZKWA 4K9QA 2JH8A 2ZBVA 4WWHA 2NG1A 5I8PA 1U3GA 4EG0A 1E0AA 3FBWA 2OBBA 2V03A 1IBLB 3TQHA 1XZDA 2JHCA 2WB4A 3CKMA 3G6WA 4I50A 3VC3A 4KRFA 3D6AA 1L8QA 3B7GA 2DRIA 1QONA 5AVOA 5LL6P 1WCWA 3JR3A 3RT7A 1BE8A 1T6YA 3S2ZA 3JYOA 1X8XA 4J0KA 1X7ZA 2OWEA 1G98A 1UBGA 2IHYA 2VDUE 2Z3VA 3LO8A 4JP8A 3M5DA 4QLOA 5CM9C 1YJQA 2JPDA 3DC7A 3WBFA 3CUEF 5ALOA 1FRFS 4Z54A 1HORA 4LWOA 3CZMA 3GVPA 3KTAA 4KAXA 4OFBA 3C1UA 4WLVA 1Z63A 4Q9LA 1EUYA 2OHHA 3LP6A 3LKBA 1G8HA 4Q82A 2W2TA 5FFFA 5A5FA 3T7RA 1JHVA 5H8WA 4PNPA 1K1EA 4PO1A 4GI7A 3OEWA 4UU7A 5PGMA 3S8EA 5TS2A 4BVBA 5THXA 1PFGA 1E6LA 2IZ7A 2EBFX 4LY6A 1T9GR 2X5XA 1F3OA 4MS1B 4HLUC 4UMVA 1QPGA 2NUAB 3H5WA 3SPXA 1XL1A 4LYDA 2A1IA 2NO9A 5ERYA 3UUGA 2CDNA 3KSRA 3UCEA 1UF9A 2C4UA 4HDNA 5JS2A 3RHSA 2JGFA 1NVDA 3H9UA 1DDGA 5F7ZA 1G7TA 5CFPA 3FXAA 4H4DA 5AK5A 2GEUA 1IOWA 1A7KA 4JJIA 4OQQA 4OYYA 5FWDA 5EIBD 1U0BB 4IP0A 3PGJA 5KJEA 1X2EA 1FUUA 3DOIA 1FLNA 1Z4KA 1ZIDA 1D6NA 1G5RA 3OQ1A 1GKKA 3ZHRA 2HU8A 1PYGA 2AYYA 2I71A 3TI7A 1XWIA 2Q45A 2XQKA 3DYIA 3K16A 4UU0A 5TC4A 3TOXA 2PZ8A 3G7SA 2CLSA 1UXOA 3DEHA 2VUIB 2R6DA 3OCJA 4WEOA 3GPLA 1DEAA 1Z2NX 3SQNA 1U7WA 3VVLA 4TKVA 1CWUA 5I7HA 3I83A 2AXPA 1QCDA 2WE8A 3VHXB 1LJLA 3DP9A 4F2PA 3DE5X 3S6JA 1OVMA 3SQWA 2NSDA 1EQAA 1R5OA 1T8SA 1WPRA 3F9IA 4MVJD 3WK9A 5EWLB 4P7GA 2HIMA 4YRJA 2IELA 4OI0A 3X43A 2BGUA 1X7HA 3LLCA 2CBZA 3KUCA 5JARA 2R87A 4O5OA 4EARA 1ADBA 3J7TA 4YI3A 2WSSD 1TJPB 5TPWB 3GX1A 1JNXX 2V58A 3ZV7A 3RVNA 4DARA 3KQKA 1UZNA 3OX3A 1QG4A 1NBIA 1H4QA 1MW9X 3HY6A 1E2HA 1I01A 3AHFA 1MQSA 5IRCD 4PO8A 4WY5A 3G8YA 2CNWD 3KLMX 1ZYUA 4FCTA 2PJUA 4HGRA 4I81A 4P5DA 4Q39A 4TTVA 5EFZA 5FPYA 5AXAA 3SQDA 4NCAA 1NSTA 3CKKA 3IUJA 4IXNA 1EZ1A 2CEAA 4WKCA 5JPCA 1NRXA 2AEJA 3EMBA 4QYSA 1I0ZA 1M2VB 2C04A 3DONA 3I5XA 4Y1EA 3BXGA 2G0TA 2P9HA 4E1BA 1MGOA 1AZTA 3LSTA 4KLAA 1RWPA 1R50A 4WNAB 2I3DA 1E4VA 1L4LA 4A2WA 4B6JA 5JI2E 2V74B 1T1JA 1J21A 1GPMA 2HQ1A 2C2WA 2W6ZA 2XCLA 3PFBA 4ZO4A 4DDKA 1HF3A 5AFSA 3RT1A 3RYFA 1AMUA 4NEGA 4RJJA 5E7IA 4EYSA 2ZVDA 5P8WA 5BN3A 1WX1A 4LQDA 4IDAA 5KYKA 3T1TA 1UT8A 1G41A 1UDWA 4DA8A 2WYWA 2QE6A 1WKBA 2X13A 1ONPA 3X2FA 4HAWA 4PTZA 4GGOA 2QX9A 2HV8A 2IY9A 4TQUS 3PNVA 1QHHB 4S1TA 5DGXA 1KU6A 1TECE 1YZKA 4CMGA 2QE7A 3P20A 2PFKA 4ER7A 4N7MA 4FJ0A 1ZHHA 1Y8RB 4V3BA 4X62B 4GM4A 3U61B 1V9CA 3P2JA 3EVEA 1QH1A 1XVVA 2G70A 4IEIA 3SX4A 4FHDA 1IHXA 5CA1F 5IPFA 1J2RA 3K2IA 3STWA 4ARZA 4DR1B 4BVLA 1P77A 1TAQA 1ENZA 3DZCA 2D8MA 1EWRA 5JATA 1YK1A 3OE7D 4WQMA 1WULS 5CHEA 4F04A 3QHAA 3G13A 4H3HB 4JUCA 5LP1A 4G0ZA 1DEOA 3HWX1 1I30A 1YSCA 3RF7A 5FBQB 4FEAA 5B37A 3WL8A 4UHKA 1Z75A 2EJBA 3OPNA 5JWRA 1B0PA 1EGAA 1T9KA 4N40A 2ZRQA 2RD2A 2V9PA 4G41A 1QE3A 5KTMA 5HZKA 3IDAA 1E9BA 2HBZA 2NZ2A 2B99A 4H7EA 1WD5A 3OZEA 4R9RA 5EZYF 3ZHXA 5LZ2A 1Q19A 1QAQA 1V11B 1J1UA 4CFZA 1JDUA 5KTSA 3N6VA 2OOSA 2V4MA 1U0NA 2FLVA 3BSWA 3DAFA 4TYPA 4WXEA 4TRMA 1KSGA 2PUDA 4FCVA 3PQEA 1ZI8A 1YJBA 3WLQA 1QRTA 3M6FA 1MHPA 1UBTS 1PDWA 2K7ZA 5TQJA 2GPSA 3DL0A 4AWAA 1Q1QA 4R83A 4ZHQF 3L92A 1FFBA 2MCFA 1T43A 3FHCB 1DWQA 2DQZA 1M72A 2GEVA 1PV1A 2RBGA 1GSIA 5H83A 4M6WB 3CM0A 3UHFA 2EFGA 4TTJA 3KJGA 3C5HA 4B85A 5G0SA 3WQSB 1D2CA 4G89A 4LOLA 5GIOE 2XD9A 1PK7A 4PICA 3RS0A 2DTEA 4OQ4A 2DKNA 3OFVA 4DKXA 2B7BA 2OHXA 1Q2UA 5C5EA 5IXJA 3ME5A 1Z62A 4JOBA 4OOFA 1Y3BE 3S0JA 1NBHA 5F73A 2Q27A 4ZT4A 4KPGA 2QMOA 2AOWA 3SIRA 4PG5A 3NT2A 1MAAA 4PZYA 3O4JA 1P7CA 5CNKA 1CEYA 4RIFA 3KNZA 2QTRA 3OZBA 3ZWOA 2WJ3A 4UUPA 2X0JA 3OOSA 3W3ZB 3DVAB 1UPXA 3N0WA 3WGGA 2UVPB 5C32A 3ZDXB 1XMIA 1CQZA 2X15A 1XMQB 2UXCB 1KZHA 3VU9A 2QOEA 2C92A 1P29A 3MJDA 1YBHA 2IVFA 3D4LA 4M9RA 5E3IA 3V1YA 2B5VA 4YV1A 1ZGBA 2F48A 5CVDA 3ZTTA 3MWJA 3KLBA 2VQ6A 3WTCA 2NPFA 3B1YA 3E7WA 1PG2A 2WJ6A 2OZKA 1VYTA 1GL7A 2CXSA 4H18A 5BUSA 2E18A 2R0QC 4URVR 3LBNA 3I6IA 2JIMA 4INZA 1L6RA 5KYVA 4TSFD 4DADA 3RVSA 2FPPA 2WU1A 1OWPA 5C1DA 2Q7XA 4YQZA 1C7FA 2E7ZA 1YAHA 3G8BA 1XI2A 3PQFA 4J2OA 5AKJA 1IYZA 4C6SA 4DDHA 3EVZA 4RFSA 1ZGGA 3GCGA 3QUQA 2XQVA 5HJ7A 5KTNA 4JEIA 4DV3B 2WDPA 5J5CA 4L5YA 1US8B 1GNRA 2PKRA 4D02A 3R77A 1W2HA 2GPWA 3QLVC 4BBZA 3N2YA 4BNFA 3MM4A 1E60A 1SPXA 1KORA 1BKDR 2O7QA 4N3GA 4MKXA 3BGIA 1KOLA 3RS8A 5D3ZA 3MT0A 1P73A 4I1SA 1MTOA 4DLSA 2Q6TA 4MV7A 2TS1A 4DZZA 2C5LA 3L05A 1J09A 4O2AB 1SCIA 2KX7A 4RORA 1BYIA 4PYIA 2PLAA 3FRHA 2Z2XA 2O2HA 4Y2TA 2Z2IA 3WYCA 5G3ZA 1M2WA 3NWOA 2XMDA 4QNRA 3SC4A 2VR1A 1P5HA 3TQRA 1C81A 4XM0A 5BV0A 3H87A 1PDVA 2PD3A 4K3VA 2QTWB 4RK1A 4RFLA 2P0EA 1RI2A 3ZDEA 4EO9A 4EG6A 5FWNA 1T2FA 2JFXA 4R9VA 1YQWA 4ACBA 2FAXA 2AUMA 3W6ZA 2XSZD 4RJIA 1XTVA 1S2DA 3MF4A 1M2NA 3FHLA 1RCUA 3D43A 3WMFA 4BO5A 4AAYA 4EYOA 3W9BA 1D6MA 2BH9A 2ZSEA 4NXMB 4YX9A 3U4AA 1KZYC 4TQGA 2P9CA 2QPOA 2YS7A 1WXXA 1K8QA 2BMDA 5JE8A 3PJGA 2W2KA 2R84A 2A1TR 4G5QA 5AKGA 5K0SA 3MHPA 5HM6A 1F1JA 2Q3MA 4B0OA 4N0MA 1IRXA 1Z4QA 1BC5A 4XX0B 5TQVA 2AVNA 1N6RA 2GZMA 3TLYA 1HQKA 3KV1A 3EXHC 3GBSA 1IVSA 4ER5A 2O8NA 3KPJA 4EB3A 4F93B 1ZUIA 3K35A 3OEHA 4OYHA 2Z6QA 2HLPA 1QAOA 2IIBA 4RKFA 4KBYA 1O94D 1T36A 1K6IA 1M1XB 4M53A 1PZXA 3AR5A 4AS1A 4EYEA 3EOAI 2PZJA 1GGKA 2HSJA 2AEEA 4MGYR 2NSHA 2W6MA 2RAUA 1NKSA 1XYYA 2Z1MA 5EI5A 1IWOA 5FA5A 2G25A 3ZQ4A 4H3VA 2JFWA 5DO9A 2HF2A 3ZWPA 2HXYA 3KQLA 1BH2A 3G5UA 9LDBA 3RANA 1VE3A 1CS0A 3ADKA 3R5HA 3W3AH 3VH3A 1FFCA 2C9DA 1JWLA 4KQ6A 4QA9A 2CSXA 3DQZA 1I2DA 4MB2A 4YIHA 1OE0A 3D2BA 1EK6A 1ISGA 4HRAA 2JKZA 4TTPA 4JR2A 3CF4G 3OP4A 4P1ZA 5C5DA 5MFZA 2WTXA 2ZR7A 1P0PA 3V55A 1TDJA 4WOJA 4YMUA 1B43A 3JU3A 1BRTA 3DJYA 2JEOA 2ZJ8A 5LOVB 3LYHA 2W48A 2BR5A 2FZ5A 5BORA 5IZ4A 3PITA 1QR2A 3C85A 1I4LD 5J2UB 1BYUA 4YMVA 3BL5A 4PM4A 5CM2Z 2E5FA 5FBWB 4YRSA 1GZ4A 5BN5A 2GCOA 3FNBA 3PXDA 3U6BA 2NSYA 1DFIA 2NO7A 3CU5A 3QPCA 4NH4A 4QUJA 2QGZA 4MJXA 4UBKA 1QZTA 2SECE 2Z30A 1DVRA 4Q00A 3MWDA 2COUA 3V5NA 4ARVA 5IABA 4M9SA 4DMGA 1VHQA 4BXOA 4E0BA 2R1ZA 4L8YA 4B6FA 1K2VN 3BIXA 3WZ2A 3ZHQA 3R9XB 1U7UA 3HY3A 1P62B 5I45A 1L4NA 4M37A 4HYQA 4HRVA 2IX3A 2R96A 3GH1A 2WMDA 4YH1A 1XPUA 2AYZA 3EZ9A 4KYIB 5JS6A 1A7UA 1AF4A 2B98A 2DBVO 1ZAKA 3PYLA 4NDAA 4WN9B 1COZA 3N3BC 1XDWA 3VX4A 1QPBA 1O6FA 4JI0B 4Z4GA 4J7UA 4LIPD 2FRVA 3NVAA 1IG3A 1WEHA 2QYOA 2W9XA 4RHUA 5EKUA 3HCFA 3U3OA 1QCCA 3CXRA 1P8AA 4PYNA 3CNLA 2UXDB 4H1HA 4HH4A 1EXDA 2I2XB 2FZEA 2F1RA 4FKBA 1Q3HA 3FR8A 4AJEA 2X58A 2NO4A 4IIVA 4UHFA 3FUWA 1GZ6A 1Z17A 1ZVKA 2VT6A 5ALUA 4X54A 1PBNA 2PYDA 3H7AA 2D62A 1C4WA 4GI1A 3AKCA 1CXZA 4TMXA 5BQXA 3GJ7A 1D6SA 3QFHA 3DNPA 3TZBA 2M1ZA 3BRSA 4ERNA 3E9MA 3NO4A 4Q9DA 3DFKA 4JBLA 4YALA 1MZVA 4OGKA 3CZPA 3NEAA 3GZNA 2Q1TA 3IOMA 5TMEA 2JL1A 3PEEA 3HPQA 4Z0TA 2PU5A 2Z3ZA 4BO1A 2DHCA 3DAPA 4L57A 1G6KA 3MJHA 1O4WA 5EQFA 1FU7A 1A77A 2GJSA 2Z2YA 4I99A 4B6GA 1HM5A 1ZPDA 3O84A 2E4YA 2ZREA 1GPUA 2OQRA 3NWPA 1YIAA 3M9XA 2C61A 3GD7A 1KP3A 3IVRA 5BQOA 3ZH2A 1EA7A 3ESZA 1D2MA 1QG0A 4H3KB 4NIMA 2IS1A 4YDQA 4IUYA 2RGYA 3K0CA 4IH4A 4OXQA 4O5AA 3PJDA 2I29A 1T0JB 1Q91A 1ZH2A 1NF9A 1FQKA 4NU6A 4Q9KA 4Q9HA 3D64A 4GYKA 3HKCB 2RGNC 5DGIA 4HFRA 1SK9A 1G6Q1 4KWEA 1E2GA 1LBEA 4QOFA 3V4PB 3DTVD 1HE8B 2A4KA 2Y6VA 4HQKA 3V8MA 5C5IA 4LI0A 1VGRA 3N05A 2H0QA 2CGEA 4BX8A 2R25B 2HO4A 4O6VA 2FN3A 2REOA 3EF0A 4R2HA 1MO4A 1M8JA 5SZJA 3AJ9A 2W37A 5BRAA 5IVHA 4BLPA 2FPIB 1VIYA 3O94A 3QOWA 3RKSA 3DEZA 1KMCA 1GAXA 4OB8A 5IKPA 2BFPA 2GNPA 3DDWA 5ELLA 4WDRA 1HT3A 4I2VA 4GG1A 5KBYA 2PCLA 3EVGA 4B9AA 3HRIA 2O14A 5K5EA 1EAYA 4H7FA 3A6HA 4YP5A 3BZUA 2GYWA 2X8AA 3REQA 3LTNC 5EIWA 5A2QA 1KJZA 1U11A 5C8YB 5JRJA 1JDTA 1KI7A 9MHTA 2Q5FA 4JY7A 1R6VA 1IM2A 4XIIA 4XR4A 1EM8A 4XE5A 4EGFA 1VBNA 1XZAA 2DVMA 1U7PA 1CDDA 4Q1EA 2II6A 3DKPA 4GU5A 1PW7A 2MT9A 3TLCA 2D8AA 1NYQA 2FMIA 5IM4A 3E5NA 2PMBA 2H9YA 2JLYA 2XBMA 1W93A 3CVVA 1UJNA 3EISA 4I4TA 2CNNA 3W3AA 2V55B 4E2XA 2PCJA 4N0DA 3ZNQA 1O77A 3SSOA 4HDRA 1HEYA 4JB8A 4OCZA 1NBME 1M2FA 3A9RA 3RYCB 1L5OA 1MQAA 5A5EA 5CH8A 2BFOA 2BZ0A 1CT9A 4YP6A 3C3EA 4KUGA 5TPZA 5K09A 4O2LA 4V0ME 3OKFA 6LDHA 4HSEA 5IMSA 3UICA 2OGSA 4YCDA 4BWYA 4Z49A 5FL7A 4P08A 5J4LA 2C9MA 1D4OA 1XZQA 1OH7A 2I2AA 4RABA 3CRNA 1JBEA 4DUPA 3NRJA 3H2IA 3NQ41 4QFBA 3DV9A 3ELYA 3L82B 1KU0A 4RGBA 2X1LA 4CG3A 1RM4A 5JZSA 4KL8S 3L06A 2JFVA 4I6JA 1BKYA 1P6QA 2OCIA 1Z6GA 2XYPA 3OWOA 4WAUA 5EOVA 1NM5A 4CKYA 4EM6A 3MXOA 1R4MA 4V0MA 2DH6A 2NUBA 3PK0A 3W05A 1FNDA 1BMFD 2HQBA 1E2BA 1XA0A 4CETA 4JGIA 2NVBA 3U1VA 1K88A 3SJCA 1A96A 2F3RA 3ZWKA 4Z9BA 1Y3FE 4O8CA 2XWSA 1WSDA 2R7LA 2O8CA 2F9MA 2J9YB 2X3FA 3H11B 4B34A 1OA0A 4XRRA 4PCLA 5AM1A 1ZSNA 2I4MA 3DDSA 4YMHA 4EDFA 1ZD4A 3KYJB 4HD8A 2XUDA 3IOBA 2LV8A 5IJAA 4BP1A 4XDHA 3D6VA 1GLNA 4QTUB 4YEDA 3U19A 3IUYA 5MF6A 5L4LA 4ZQFA 3U2QA 3LYAA 3IIEA 2QT0A 4HNAB 1IUNA 4P80A 3WVNA 4ND2A 2GH1A 3OLZA 4M99A 4Z3DA 4BTVA 4KNYA 3EGXB 3LUPA 3GQVA 4FB4A 2DJIA 3Q8XB 4O1IA 1XNQB 3TFWA 2B82A 3U4DA 2MOKA 2NYUA 3H5AA 3O5AA 2GHQA 3HMKA 4LYEA 4JI2B 4LY9A 2R5NA 1L0BA 2AQIA 2VI5A 1B8UA 5JC8A 4PG4A 4FP9A 3DGFC 1L7VC 3Q1KA 5E9QA 5EYPB 2XVZA 1FJXA 2OCKA 5DNAA 2RH4A 3CW9A 1H2ZA 3RRZA 2XVYA 4DLVA 1W0JA 5GTDA 2P91A 3SM9A 4DV0B 1I1NA 4ZRDA 3ZWAA 1W5AA 4GLBA 4W4TA 5K0GA 1E6MA 4K9MA 2WI8A 1O3YA 3AP1A 4ZREA 1FYVA 4BZWA 2BGWA 1YIDA 3FKQA 1ISRA 3S4YA 1Y9JA 2JFPA 4G0YA 2V0GA 4Z4HA 1JHUA 1YR9A 1LCIA 3T12A 2BDEA 3ORQA 3CW8X 4N6OA 4CF7A 1WLSA 2O8CB 4Q47A 3W4KA 1EHCA 3CSDA 5HMMA 3ZI4A 3D6TB 1DC8A 2ORIA 4N9QA 1GUDA 2IKQA 3NHBA 4WE3A 5B7GA 1O94A 5CBPA 4MMXB 4JSYA 3A2KA 1BQ3A 1H66A 3HABA 1IBCA 4R0MA 3G0IA 3EZGA 1W4CA 3NHZA 3EZLA 1NJSA 3KUXA 2ZJ2A 1OYYA 5AM2A 2JJ2A 5L3ZA 1E1QA 1GZ3A 4DJJA 4AY2A 2QRVB 4G23A 3OU7A 4U39A 2FY8A 1VJ1A 4G8CA 2QUBA 4YO7A 4UUQA 3PBKA 2Z9DA 5TGDA 1AU9A 1RQGA 4D9EA 1JSCA 3A3YA 3O8OB 1JIIA 7ABPA 1SU6A 5E6SB 5A71A 4HJRA 3TG8A 1U3CA 3R7BA 3UOAB 4JUDX 1Z18A 4X00A 4DWOA 4M0PA 2GJ9A 3TX2A 4ZOLA 1HSOA 2HCFA 3V8VA 1LUAA 5ISMA 2IYSA 1HL3A 1GGFA 3A6ZA 3R0JA 4C03A 3JAWB 3TO5A 5JW6A 1B26A 2BRUC 2QLLA 2DR2A 3SXJA 2Z2ZA 4GQBA 5CNJA 4O2BF 1T8WA 2BDUA 4DCOA 5JNUA 3ZE0B 2BFWA 2H4FA 3WBBA 4IUCS 4RVUA 5A03A 1SC4A 1JA0A 5IH7A 4LG1A 4II2A 2D3WA 5JAPA 2RK3A 2Z9CA 3AYXB 4IDGA 3WWZA 1E96A 1QGDA 1XQVA 5FR1A 1R8XA 4PRLA 1LNQA 3ZDQA 1CSEE 1CJKC 4F5ZA 3C8MA 3LF1A 4IHJF 2EEPA 3DZGA 5IBPA 2AUNA 2QS9A 4MDEA 3FYUB 4S1VA 4C0SA 1T2DA 3MUFA 2AN9A 1AX9A 2IVZA 3Q3JB 3RRFA 3V4FA 1JEYA 1NYLA 1Q3KA 1QMPA 2CUKA 3C3DA 3LW8A 3QJYA 4N49A 5DOZA 1L9XA 1KVQA 2E82A 3R2JA 3C8UA 1UMBA 2X9NA 1NQAO 3EC1A 3GAZA 3HUEA 4MW9A 2MYUA 3FDJA 2F00A 1REQB 1TFRA 3IOCA 2P2CA 2DOKA 2GFHA 3DZHA 4P5EA 1FNCA 4EYQA 1QWOA 4K8OA 5FR2A 3RS3A 4A15A 4IJ6A 1P5ZB 2K7FA 1FMLA 2CDCA 2ZUBA 2NXCA 4FX2A 3AWIA 4HEQA 3K0AA 4HN9A 1RQNA 4IDBA 3FCOA 1KJIA 4MQFB 1XYGA 2GAOA 3F5FA 5F33A 1VPLA 3E18A 2GDZA 2YW9A 5C9ZA 1CF2O 4TTTS 2Q6OA 2W2LD 1UKVY 1X80B 1SEVA 2VDVE 2HHCA 1WDKA 2PLNA 3JPWA 1DO0A 4CMIA 2JGAA 3ORHA 3G85A 4IHJB 1DE0A 1NZFA 4OX9Y 2YVAA 4WK0B 3FBGA 3CIFA 2ZT7A 2EWVA 3IHLA 3GNSA 3TSAA 3ZCPA 4BY9E 2ZYGA 3BWDD 3O1JC 3PX2A 3PA8A 3H8VA 2WAMA 1L4HA 2Z95A 4ZA2A 1Z2AA 3KFVA 4MWEA 4OJNA 3L0DA 3WBJA 3ABOB 4RA6B 1E2QA 5CA0F 5K8JB 3FAZA 2Y27A 4C7KA 5JCZA 1G0NA 3I53A 3ZLUA 4Y1RB 2DR3A 3S7ZA 4MUJA 1JWBB 1NWCA 4OHMA 4Z7QB 4OJMX 1DPGA 1UWKA 3EW9A 1FX0B 1QC5B 3BD8A 1BTOA 3EXAA 4FYHA 3WJ1A 2BAGA 1YGYA 1QO0D 3SU8A 5KX5F 2ZSJA 3D3WA 2X5JO 2QB5A 2CHFA 2CFTA 2OLEA 5ARCA 3RVQA 3ON5A 2FEMA 1E2DA 1CEQA 1SUEA 1ZNYA 3NNNA 2PXHA 3O26A 4QU5A 3ZTWA 1GHTA 5BNIA 1HEUA 2GAJA 4ZV7A 1L4UA 5FOVA 2BP7B 4BO8A 3ESXA 2HW8A 3CGWA 1U1EA 16PKA 1M76A 4ECAA 3VDXA 2P1RA 4QPZA 3C70A 3I9V6 3QA3E 2CK3D 4INAA 2CZQA 2OUIA 2ZU0C 1BHJA 3GFFA 1BX3A 2PT6A 3BIOA 3KEOA 3TH5A 3TL6A 2C31A 4UVDA 5LZ8A 1YA4A 1JXAA 1L7DA 5ICMA 3KD3A 2W2KB 2GYVA 3UXYA 1TO6A 3V9AA 3EE6A 1P7VA 1USKA 4Y2RA 5SY9A 4PSDA 3ENKA 2WWYA 2O8FA 3HYTA 3OO1A 1GWNA 2QSUA 3BF7A 4R54A 5KVSA 5FI1B 3AFHA 4JT4A 5J2UF 1U8FO 4IVRA 4F4DA 1IEWA 2ZUDA 3RI3A 1UKBA 1BD3A 3FW1A 4MUMA 4XWKA 3G1WA 5AW4A 1AS2A 2PKQP 3C41J 5BYAA 2DFKB 3ZW8A 1XZFA 1Y1RA 4G0XA 3W2TA 4GL2A 2IEAA 1MA3A 5EN4A 1UBEA 3IR5A 1YD7A 3KZOA 2F90A 1T3ZA 4PXAA 2VA9A 2V5VA 2PLWA 3ZVLA 5CHYA 4RWZA 2OCGA 4NDNE 2P6UA 2ZIGA 1RKXA 4ZQHA 3K31A 3JAMA 2QGFA 5LKAA 1I14A 1JHRA 1DNPA 2JJQA 3DUWA 2XZTA 4UEQA 3AM3A 4B5KA 5IUJC 3S2EA 4F12A 1WXQA 1UEJA 3F4KA 3AF1A 3JQDA 4RVDA 5JNWA 4N9WA 1Q95A 4K86A 1GPBA 4Q4JA 4YCCA 5CDTA 1FC0A 2O2GA 4G5OA 4EFKA 2YRWA 3T3IA 3ORYA 3PDHA 2ZZNA 3KJZA 2QN2A 1CS4C 2NZUG 5JYEA 4ZT7A 1WU7A 2H1HA 3ETEA 3KALA 3OMXA 3JALA 4MXDA 4CL8A 1TT5B 1GPWB 1IN4A 3G2JA 2J32A 4B4UA 3JD4A 4MWZA 1JIUA 3PLRA 2J0UA 4E94A 4Q18A 1YDFA 4GMFA 2H3HA 3JZAA 4RYDA 3LY9A 3OJOA 4WTOA 3S2UA 4PHTA 1NFQA 4BFXA 1E66A 1V1RA 3UN1A 4FXOA 3Q7SA 4BFSA 1XZCA 4QGAA 3SQOA 2AR0A 2Z6VA 1SN7A 2XBLA 4RJTA 4KIUA 1Z0JA 4GXRA 2MSEB 4CJXA 4PZEA 2IOQA 5DM60 4IYJA 5CT4A 1F0NA 1GKIA 1BE1A 1ESNA 3K9NA 1DAHA 1TM3E 4FDMA 5DHTA 5B3AA 2C3OA 4DNOA 3L7MA 4CTKA 4ESHA 3SP1A 3E9QA 3IQXA 3ZGYA 2AA3A 1FFXB 2EL7A 3PP8A 4ZCLA 4F3RA 1J8MF 1AKNA 1L1RA 3FJ1A 3R3VA 4K9KA 4KGDA 2JGIA 5EL0A 2DYKA 4PYRA 4PIVA 3G1UA 2PPLA 2J0QA 1R0LA 1ULHA 1N32B 1COWA 3E6AA 1DMSA 1BH6A 3TR5A 4ND5A 1QIEA 4PQYA 4BGIA 4CG2A 1YR8A 2AI3A 2E2WA 4JLKA 4RXMA 1CRPA 4GPAA 1ZP6A 1YKGA 4KB5A 3R7WA 3RVKA 3WJ7A 4L5IA 1U8AA 1WCIB 4AUKA 4CV0A 2IS2A 2PQMA 1T2UA 4KQEA 4PYQA 4EPWA 4O0MA 5ALQA 3SSMA 4F46A 3DUFA 4NOJA 1YS9A 4ZV9A 3WNVA 4TWBA 1MX5A 4AUNA 3UMYA 3ENWA 1QGOA 4QXOA 4QYXA 1EFVA 4IFIA 4C0JA 4MV3A 7MDHA 5LP6B 3OTQA 3DWGA 4J4HA 1I3MA 1V37A 2GXUA 1A2OA 1IUPA 1N25A 3DKIA 1GT91 4LBWA 4RQAA 4X24A 1RAFA 1FP1D 4MUEA 2ZYIA 1I1HA 4ARBA 1LKZA 3FLAA 3VU9B 1ZGHA 2EP5A 3EASA 4LRSB 3RK4A 4A7PA 3BH7A 2CY0A 1BGWA 3TEFA 1UK7A 3K0KA 2F67A 3CZ5A 3QBTA 3C3CA 4K26A 3K9WA 3P5BA 3DCNA 1T0IA 2WIGA 5DYIA 2NUTB 3SZMA 4EI8A 1IOZA 3CHYA 4OGLA 4BJ1A 4PN7A 3JQBA 2GVZC 2Q4OA 1UOQA 2ZBEA 2Z08A 4Z86A 3CVYA 3HACA 1RABA 1CQPA 4RK0A 1UC4B 4Y8VA 1MRZA 3N8HA 2WD7B 5DV9A 3K72B 3O90A 2CNBA 3L0YA 1GUBA 3UA4A 3OEHD 4EKGA 2VDWB 3AWDA 1MRSA 4FD3A 5LZ5A 3I8XA 4IDFA 3A4MA 2CL0X 3K0FA 3IHKA 4CMAA 1QQAA 2XB9A 3TZ6A 2PZGA 1JPJA 1W6RA 3R0VA 5I9MA 5HA5A 3JY6A 4QOGA 4Z0NA 3AV3A 2WKWA 4EZBA 1V3TA 3N6XA 3HVJA 4RESA 4CN9A 2UUBB 1U4OA 3ACCA 2YZNA 1HFKA 2NZ8A 2VP3A 3QKRA 5B57C 5JJLA 5HMLA 4D0GA 5KTPA 4M0LA 3VR4A 3I04M 3TWOA 2XZOA 2Q62A 1IK4A 4TV8A 1G20A 3HNPA 2CVQA 2PL3A 3F6BX 4PGHA 5AVUA 3QEOA 4EG4A 3WRXC 2IZZA 1NW5A 2AK3A 2WPNA 4QUBA 4BZPA 1SXPA 5D7NA 3LD9A 1UFRA 3CRVA 1ZR4A 5ILOA 2IH2A 3V4VB 2O9JA 1XO1A 3PQCA 2J87A 2R62A 1E8MA 1IH8A 1Y1KE 3OQJA 4EJSA 3WO1A 3PQ6A 3MOSA 1C4OA 4LHYA 2LBPA 4I8DA 2VXYA 1N57A 1V11A 1DBRA 1SFRA