3QVGA

Xrcc1 bound to dna ligase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
LCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 3
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/ligase
total genus 18
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16759 LIG3_BRCT DNA ligase 3 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3qvgA00
3SQDA 2EP8A 3EF0A 1T29A 3QVGB 4BU1A 2HTFA 3SZMA 3SHTA 2R1ZA 1OQAA 1N5OX 2XNHA 2D8MA 2INGX 4BU0A 2M2IA 3HUFA 2NTEA 2K6GA 3PXAA 1L7BA 2EBUA 1KZYC 2COKA 3PC7A 3T7KA 3T1NA 3UENA 2ETXA 4BMDA 1IMOA 2COEA 2XNKA 2K7FA 3COJA 3T7IA 3PD7A 3PC8A 3PXEA 3PC8C 3JVEA 5ECGC 3PA6A 3U3ZA 2VXCA 3HUEA 4N40A 1Y98A 3I0NA 2E2WA 3K15A 4Y18A 2DUNA 1GZHB 4OFBA 2LE0A 3K0KA 3T7JA 2EBWA 3EF1A 4XQ0A 4JLUA 4ID3A 3PXBA 1T15A 3L46A 3L41A 4Y2GA 2VXBA 2WT8A 3PXCX 4U4AA 4BMCA 4IGKA 3K0HA 3PC6A 1L0BA 2ADOA 3KTFA 3L40A 3QVGA 3AL2A 1IN1A 1CDZA 1Z56C 1WF6A 3AL3A 3SHVA 4XPZA 3K16A 3UEOA 1JNXX 3I0MA 3FA2A 2AZMA 3PXDA 4IFIA 1T2VA 3II6X 3K05A 3OLCX 2L42A 2COUA 1T2UA 2JW5A
chains in the Genus database with same CATH superfamily
1J33A 2D4AA 1GPH1 1ZD2P 3PC2A 4MAFA 1TJNA 4I1RA 4UE6A 1RW4A 4PICA 5TX7A 4FMDF 1YQDA 2P75A 3RABA 4ED9A 2JFXA 5IG2A 4GP9A 3LK7A 3PX7A 4FYKA 2AR9A 1NUPA 2BYTA 1JFVA 3L7NA 4P86A 2PG3A 2GQ0A 4LE1A 4RV9A 1UJ4A 4EEKA 3BD7A 2ORYA 3BAFA 1JHUA 1XIVA 1CUSA 3ROMA 2HYIC 4Q9NA 3U7JA 2DPLA 3KJQA 3TB6A 4AG3A 4L5JA 4HWSA 1GDTA 3RVKA 5CVVA 1JPVA 1ZHHA 1ZSVA 2VRCA 1SBCA 3KQUA 1XPRA 1RKUA 1G4AE 1AHIA 2CD7A 4RK1A 3Q6IA 2OKCA 3QU2A 3PXAA 3R3YA 5JWRA 3KSAC 1DIAA 2B1RA 2Q49A 2ADMA 2B78A 1PKXA 2RHLA 3O03A 4QFMA 5AI6A 4F3KA 2HJHA 4KG7A 2PZLA 3AEKA 4E4TA 5IJWA 1Z4NA 4OYHA 1Y6ZA 4U5XA 1QCYA 1F2UB 4U0JA 3LVRE 5CDHA 1SCIA 5TY0A 1YBMA 2JK1A 1KWGA 2SBTA 5TQ0B 1P4JA 4O8ZA 4RHFA 3ZDFA 2QR5A 4C3OB 5LZ7A 1JN0A 1QKKA 5K8TA 1WUIS 4HL6A 1TFUA 3M5PA 1G8SA 1OJ7A 3QZUA 4LKOA 5KNDA 3CF6R 3JYLA 5LNK1 2VTEA 3VR5H 2H5EA 5FTNA 3HLYA 3TNFA 4DWJA 3VXKA 1TO6A 1TPYA 3DUFA 1J20A 2GZ3A 2ZSBA 2FPPA 3HLKA 1XDZA 3QE3A 5DZSA 3WL5A 5LP6F 5K3EA 5GJBA 3UMVA 1E1NA 4MV5A 1UPFA 1U28C 1XKXA 1W8DA 1UT8A 3S2UA 1C1XB 1ZKDA 4UU8A 2IVFA 3CSUA 3EZGA 2OLEA 2GZ2A 3NIDB 1D4OA 2RH8A 4ZAWA 2ETVA 2H2DA 1ESCA 4J8PA 3RVBA 1XTRA 4PTLA 1Q1QA 2ADFA 4QQNA 2V8BA 3UMBA 3PNLA 3X1XA 1KMQA 4KE6A 4EUNA 2NW6A 4AO7A 4ZZ0A 1CRZA 2G7MC 2ZBQA 5PNTA 5LKAA 4V3CA 2P27A 2AW5A 2AOUB 2GA8A 3P9KA 5FKJA 1QHSA 5HE9A 5DYYA 2QMHA 5CG1A 4O08A 5JDIA 3DO5A 2MWMA 3P9ZA 3HDJA 2C0CA 1FP7A 4KXNA 1NVUQ 2DFVA 4Q1VA 4WEOA 2QIPA 4CT0A 1N8KA 4TLDA 2QW0X 4TT8A 2IX9A 1YF3A 3K70D 4LQLA 5A6SA 2GBLC 5JIBA 1E3WA 2DTXA 4RPLA 3KJFA 5J4YA 4BJ3A 2XCSB 1A69A 3IOEA 5DNAA 4TT3D 1PZMA 1HDGO 3N8KA 3OG9A 3URKA 1WF6A 2E85A 2P4UA 1NVXQ 4OAOA 5KUTA 2ZIAA 3PUXA 3GAZA 3AI3A 1CFZA 4W1SA 1K4MA 4ZAGA 1O0BA 5ICFA 4AFNA 1T8TA 4ENWA 4LRXA 1ZA1A 3H86A 4U39A 4Y30A 2NU8B 2YWCA 2Q4DA 3CRNA 3QG1A 3Q7SA 2A9JA 5JC1A 5JXWA 2R79A 3KUDA 4R3UC 1RBMA 1FYDA 2JBAB 5CM2Z 4H7KA 4RJJA 3E9CA 4NC9A 4HAIA 4XOUA 1LDEA 3VH1A 2WAXA 3A2LA 4I08A 2V6IA 4PF1A 3RS9A 4ZFNA 3C6YA 1GZSA 1IAVA 1VFPA 1M76A 1T6BY 1W19A 4XX1A 2FJPA 3FBWA 3PS9A 4R8RA 4I50A 3WGMA 3EX7C 2WF9A 4CIVA 3A8TA 1PBTA 3NATA 3V1MA 2GSWA 1UBGA 4J91A 3BQNB 1Z83A 2WTUA 2OQ2A 3P9YA 3ASVA 5D5PA 5EAIA 1DFHA 1N6OA 1OQAA 3E03A 3Q8WA 4OHVA 4OMUA 2NO4A 2ZLBA 1JR6A 5THKA 3L02A 3ND8A 3HSKA 3OQHA 3W4KA 3IILA 3QJGA 1XHEA 3SBDA 2Z57A 1T1IA 4MPRA 5AOVA 4EVQA 2DWQA 4QPZA 1PVVA 2C8KA 2WSLA 5KMGA 4O5OA 5IYZB 3IPXA 1J9EA 3ZHCA 1KE2A 3GFPA 2COKA 3CN7A 3FOWA 1GZ6A 1QYVA 4UEQA 4JGBA 4YBRA 1OHHA 2VWQA 1Z4QA 1T1GA 2Q4TA 2GD6A 5AJVB 2YCBA 3CUWA 2ZYSA 3UMRA 2D62A 3L7CA 5CHEA 4CCWA 1PTJA 5KYGA 1T4GA 3HJAA 2PKCA 5KTRA 2GJAA 2B30A 1G6KA 4IKEA 4XIYA 1M83A 1U0TA 3SCZA 4FYXA 2PT7A 3AQ4A 4AQDA 1EJ0A 1KZ1A 2HSJA 4U3JB 5EZSA 2JK0A 1VCOA 3RD5A 3QE4A 3ZWOA 2VDRB 1VKOA 4N9WA 3P2JA 4WXHA 4KE8A 3EZNA 4TQ9A 2Z3ZA 1G60A 4URXR 4QGSA 4BNIA 5HM8A 2J3HA 4MYCA 5DXFA 2YWHA 4Q37A 3B6IA 3ESBA 2Q6TA 4NXMB 3B3FA 2WSSD 1TM1E 2IDKA 1HY3A 2LTAA 4JEMA 1K6JA 2EFHB 2I1WA 2PRIA 2YJ5A 2IPXA 3IEIA 3KWFA 1U2SA 3ELBA 4XX0B 4P35A 3FNFA 3SIXA 2PS0A 1JTVA 1G21A 5I48A 1V7PC 3DVAA 4FFDA 4TMVA 2NAFA 2V5VA 5FI5A 1GZHB 3VISA 5AM3A 1N8SA 2B4QA 2GZAA 3I3OA 5E7IA 1I0ZA 1J42A 1P1FA 3PNBA 1DU4A 4L74A 3SC6A 2HNKA 4U02A 3T3GA 4AMGA 2BFEB 2G71A 3BDAA 2EFYA 1JPUA 3CMMA 2XF2A 3RYFB 2HT1A 2K2WA 4HNAA 2JDID 1YULA 4BB0A 4EF6A 1AMNA 1UIMA 2HZ7A 2J3IA 4MDFA 1B73A 1Z4PX 3DS8A 4ITRC 3DWEX 5CEJA 1YUMA 2BGJA 3QIAA 2APJA 1HYGA 3X1DA 2VYNA 5EXXA 3QQ5A 4DQVA 1VTKA 4FC6A 3GEGA 2B37A 2FSIA 4EYOA 1J0DA 1KYQA 3AHHA 4HH1A 3EVAA 3KLOA 3UATA 5E2AA 2Z5LA 2ZIGA 4XW2A 1LDGA 1IBLB 2E1RA 1KXJA 3R24A 5FBWB 2G09A 5FI0B 3D2BA 2GERA 4HVTA 1N5KA 5FUWA 1NU8A 1R5JA 3WBFA 1TYZA 1XZJA 1ZWLA 3Q9LA 2B1GA 3ECAA 3UY4A 5KVCA 2BFWA 3GRPA 2X22A 3TRJA 1TZ2A 1SPBS 3UC5A 4X41A 1TUBA 4NCHA 2X9LA 1N2HA 3WLFA 1FQWA 2R1UA 3WWEA 5ICGA 2I2DA 3JW8A 1BMFD 3EG9A 1G8PA 1ESEA 3CNLA 5K99A 5IFKA 4HRYA 4HPWA 2NUTB 2EDAA 3N2LA 4IS2A 1NNI1 3C6QA 4CMJA 5IT0A 2DLNA 3PVCA 4E7OA 2YS6A 3I2KA 4C0SA 1I2BA 1KAOA 1DEAA 2WHXA 2E87A 3KTDA 3MQ2A 3MYRA 3A2NA 2H5JA 4AO8A 1IRIA 2D1SA 1DT3A 4W1QA 3QEJA 3HBAA 3PL5A 2ATVA 4C4YA 3M2PA 3ZHOA 4E5SA 1SD2A 3HZHA 4MDYA 3H6GA 4LCJA 3RVPA 5I4IA 1FZTA 3ES9A 2ZSHA 5EUBA 4FCVA 4MLZA 1CY1A 4MKHA 1FYVA 2PMCA 2W2KA 1LD3A 1H1LB 1URPA 4QL3A 1JG2A 5KSPA 4ND1A 2PYIA 3AG5A 5HE8A 3GLGB 1L1RA 1Q3HA 2H4WA 3BM5A 4L27A 4ZVMA 3O9MA 3WLTA 4BKUA 2QG4A 5K8VA 4PFKA 3R75A 3JYNA 4RLFA 2WDZA 1J2JA 4J0IA 3PUYA 3KQHA 4R16A 2QRNA 3EOBI 1QGUA 3FCSB 3N0WA 3ZV4A 4H4CA 1GPUA 1XQYA 2O3QA 2XI4A 4GP7A 4RIFA 5CD1A 4HB3A 3OLXA 4QC2A 2Q3CA 5B7PA 5AOBA 2R97A 2FZ5A 1TL7C 4F12A 5AHOA 4F7WA 4BY9E 4CGYA 2B2XA 5FV7A 5AESA 4PZ0A 2QRVA 5AK4A 4EW6A 5DB4A 4WKNA 1MX1A 1V5FA 3AF4A 2BWJA 4LJ5A 2V7XA 2E4VA 4DLSA 3UYLA 1G1MA 2AC7A 1R8YA 4OLAA 3OIGA 1Y98A 1T35A 3W9YA 5MN5A 1P1BA 1W73A 2WUEA 2Q2OA 2OUKA 2D5LA 5DP1A 4ER3A 4CETA 4LUCA 4Y98A 2JVIA 4E03A 4MUKA 1NOKA 3RVQA 1MENA 2MIIA 3NHYA 4MRVA 3F6RA 2ENWA 1SH7A 1UOQA 1BW9A 1V5GA 3TZKA 1U02A 2FP4B 4YAJA 1SC1A 3LP8A 1T34A 3DE7X 1Y82A 4OLJA 1W4RA 3P0EA 1KZ6A 1XU9A 2GRJA 3NM4A 4FJ1A 1XZFA 3WOHA 1K9VF 3TTYA 4ZA2A 2BBTA 3F9RA 1V0JA 2IE0A 2HDWA 1X8KA 1ZNYA 2TYSB 1J70A 2XDYA 1RXUA 3SIRA 4JENA 3K73O 4EPVA 3LY5A 1RKQA 1OT3A 3EVEA 3COPA 1CQWA 1SXGA 2GBFA 2QN8A 5DP2A 5KCZA 4GQBA 4UXHA 3CR8A 4KRYA 1JT2A 3P9QA 3WYDA 1L5HA 1G3QA 2CMHA 1IY1A 4Q12A 3ZDDA 2ECFA 3O2NA 3W7AA 3FCXA 4EMUA 4Q4CA 1L9XA 3HVIA 1PJTA 3PQ8A 3ZQ6A 4HX5A 3JCZA 1RPJA 3D6HA 3V8BA 5HBGA 1J7KA 1XNGA 3CO5A 4JVSB 2Y4OA 2TMDA 5IAAA 4RXUA 3FPCA 5HUQA 1V16B 3C41J 4FHGA 3U5TA 1B41A 2H17A 3RYHB 4D9HA 3BDIA 5LQNA 4ZRMA 1NMSA 3ZBUA 1MB3A 3CVOA 3BMXA 3EGDA 3TOVA 3BMQA 3NYWA 3Q0IA 1BGWA 5BSRA 1XMXA 3K8YA 4R9NA 4BDTA 3JQ8B 1JYSA 1J2UA 5FYDA 4JLJA 3VMMA 1HC7A 3ED5A 3KNZA 3RUIA 1KWKA 2EC5A 4NPAA 1EESA 4LSWA 4RQUA 4EI2A 1RHMA 1ID8A 3EEOA 5ALSA 3WGGA 2NSLA 1H6CA 3W6OA 4MKZA 3B6EA 4BRWA 2C5AA 3EW9A 3HE3A 1ZCAA 1RM4A 2EQAA 1P7VA 4HQFA 1EK1A 4QOEA 4QRHA 4UARA 4BMZA 4DRXA 1IQUA 3OZSA 5FBRB 1GRVA 1OIWA 2RGNA 3KXLA 3SJZA 5H8WA 5TPZD 4HMQA 2K6GA 4NBNA 3D2LA 4PNZA 4X63A 3Q8MA 1V1RB 2VJNA 2CKMA 5AVSA 4IIJF 5EMNA 2FK7A 2IYPA 1POXA 3QLVA 4EEZA 1DGQA 3IHLA 2FW1A 3TKLA 1JQEA 3T0FA 3C2QA 5JJKA 3S2EA 1E3SA 4I1SA 3FROA 3N5CA 4EP1A 3ADDA 3PXXA 5M3BA 4RGYA 3HCPA 4Z2AA 1K86A 4CLRB 1N3BA 1M6VB 5G2OA 4IRXA 2VJCA 4BJ6A 2XQFA 3WQRA 1A0OA 3WG9A 3DL4A 4CG3A 2N47A 5FX2A 4CQJA 3HR7A 1X3SA 4O4IF 2EKDA 4DANA 5IM4A 1X94A 2K7ZA 2RHTA 3GJ3A 4OHRA 5EQJB 4Q5IA 1YJ5A 2DHEA 4RKRA 1KDZA 4YT8A 2QK4A 2C9OA 4LVOA 4QG7A 2ZUDA 4X90A 1C3OB 2HPZA 2G5PA 1YJXA 2WHYA 3GNQA 4M1MA 1D2HA 2VIIA 3N2IA 2OYRA 2ALJA 2WUWE 1BU5A 4D42A 4GAEA 1DXHA 1YDMA 3D3NA 4HEQA 1K0UA 3VX3A 4N01A 5AJYA 1SBYA 3IOMA 5DSTA 4V1CB 1UMCA 1GVNB 3VO8A 2YY5A 1T2CA 3I9NA 1HRKA 2PX5A 1GPAA 4FDAA 2DKOA 5C51B 3TZ6A 5DNWA 1NLMA 4ZT7A 2BM8A 5BN3A 1HMYA 3O8LA 5KYNA 1G3UA 1OXXK 2ZI4A 1I9GA 5DEOA 1L5SA 1EZ4A 1NC3A 3KD2A 4WCFC 3ZBPA 4FSXA 4MX8A 4YVFA 2OB1A 2PU7A 2JFGA 1VBMA 3TX2A 1GKYA 5I7EA 4MVXA 1N9KA 1WO8A 5ALEA 2VPQA 4X95A 2O0KA 1Q57A 4LJLA 4URFA 4D0LB 4OXKA 4B3GA 4EHAA 4UNRA 3V7FA 1A9TA 4PS1A 4WX2B 4I4CA 5IT9A 5SY9A 3KT6A 3MHPA 3OPNA 4BLRA 3P7MA 4UVHA 1RD4A 3WLRA 4F0JA 2JAWA 1OOEA 4UD6A 1QE3A 1LK5A 2OB2A 3N28A 2ASEA 5F4ZA 2K87A 2Q1TA 1IHXA 1X80A 3QYFA 4KXWA 1JX6A 5FUYA 4M83A 3UA3A 4OUDB 3H04A 2C4UA 3CGGA 1TA4A 1CE8A 1LBEA 3IESA 3QFTA 4BV2A 3SS8A 3K4PA 4C4SA 3U3DA 3AYZB 2X8LA 4FGKA 4D96A 2P6OA 1AX9A 2Q8QA 2I7DA 1YONA 2VF7A 4L15A 2Y1KA 4PNPA 4R5MA 2PL3A 1VM6A 3HYRA 1OXKB 2AB0A 3SDBA 3LG2A 4LNUA 4P7BA 4AXXA 2H07A 1FDWA 1J0CA 1QVWA 1R6UA 3OZIA 2GI4A 2NU6B 4URYR 3VSCA 1EGVB 4B6OA 3RIGA 4DQLA 5IC6A 3WL3A 3BMCB 1RRFA 5CDUA 2FZEA 2B8JA 2O2SA 1FVOA 1PJSA 2BUBA 1SN7A 2RJNA 2YIVX 3C0KA 3CLRD 2RCYA 3FSEA 3LK6A 4GL4A 1PT5A 4PRLA 6NULA 4BUJA 4DMMA 3DNFA 1ZEJA 3B3JA 1OC4A 1NFFA 4G5SA 2ZTMA 1WPRA 1EXVA 4IM7A 5DSXA 1SD1A 1WW3A 2JGIA 2AS0A 1JAXA 4J3JA 1QRSA 3RS7A 1KAMA 3B9RA 4PPYA 1R8QA 5KQRA 1IJEA 3WGOA 1Z2EA 4R81A 3SBOA 3ZE8A 3SQNA 2RHBA 2RMKA 3F7OA 4Q4JA 4E07A 4UMVA 1UKCA 3ODPA 4CDRA 4HRXA 5E8RA 4DN6A 5AICA 2ZRLA 3OKFA 3A9UA 4EHBA 4S0XA 4TMYA 2KJQA 2CFIA 2C5GA 1I1OA 1K75A 4GZMA 1F20A 3H1TA 3QBDA 4EG7A 1YI0A 4RQBA 2HN9A 2QVBA 4BV9A 4YGYA 2YJZA 4WAUA 1X9IA 4FWIB 2AR7A 2PN1A 2GH1A 2PGIA 3VGPA 4E31A 3OZWA 4IJ5A 3L4JA 5A4KA 4TTQA 5CM9C 2X6RA 4HNHA 4Y2RA 2Q3EA 3A6ZA 5B4TA 1XTTA 4UCFA 4XSGA 1N34B 1KBZA 3HCEA 3DLAA 3NS7A 1KAEA 3FDZA 2NTJA 4HWTA 3SQLA 5A05A 3DPUA 1PZGA 1ZD5A 3B6MA 4J76A 1DQRA 4JH0A 1VFNA 2J08A 4RFVA 1BMQA 1UBMS 5DM2A 5E9JA 5I8ZA 2ODQA 3QXSA 3H1FA 3TCKA 4FNMA 1IOZA 4GI1A 3PIDA 4KITB 3FGPA 1JEQB 1JQLB 5LMCA 3ENZA 4EA8A 2EKQA 4OQFA 3KZNA 5NULA 2IUFA 3AVXA 1SBZA 3D6VA 3GJZA 1WCYA 4J1TC 3NHLA 4XGNA 8LDHA 1JA1A 4EBBA 3A6KA 2BGWA 2PX3A 2C77A 2EJWA 4ALIA 4DDUA 2QR3A 4FZ3A 1ECGA 3NXKA 1T4BA 3QQPA 4MQ5A 5H9WA 3UPTA 2OZPA 3A0UA 3W7BA 3NRBA 5HILA 4MQUA 1ODKA 2C5FA 2OE2A 1X7YB 2DY1A 2QX7A 4FNGA 4F4IA 1THTA 1QGED 4Y6RA 3T35A 1H5QA 2E0IA 2XYVA 2A58A 3MB5A 3ZY2A 5ICCA 1CXZA 3LOPA 5BV2P 3D6MA 1MX3A 3NBMA 1CUGA 1IVYA 2ZRNA 4L75A 5F64A 1CEEA 1LQUA 1M0EA 2JC3A 4RSMA 4Y9DA 4KN9S 4IRMA 3NBQA 1TU0A 3LUBA 4NMHA 2V7QA 4C21A 3DKKA 4KR2A 1ACLA 2DULA 1FSGA 1RI1A 4RF2A 1NU6A 2DUJA 3S7ZA 1SVMA 5BYAA 2VH5R 3F6SA 3KZOA 2W6IA 4WY8A 3VDNB 3RU3A 4EW2A 2WTMA 1S2GA 4R1OA 3EZXA 3VR4A 1E3IA 4IYRA 4DPLA 1PI3A 4ZI3A 4L0CA 4MW6A 2OD9A 1O97D 2C5LA 1G42A 3KHTA 3M5WA 5FNZA 2V74B 3E5RA 3T7DA 1RI5A 1XD2B 5EPOA 2IZZA 4S1OA 2UUBB 4B5KA 1KVUA 3KLNA 4YUVA 1X1SA 4M9RA 1YVPA 4CV0A 3SHTA 5IBPA 4FJ2A 4QUGA 1RAAA 5ENVA 2FPMA 1X6VA 1GNSA 2G67A 1TTQB 3ANMA 3IP3A 3PQ7A 4IV5A 5DCLA 3QWAA 1U9JA 3O21A 2QVCA 4JFRA 4RKYA 1VLZA 3OZ7A 3QVUA 4O2AB 2G1JA 1ZJ5A 1F5SA 4HB0A 5LJIA 5AOAA 5FI1B 4D44A 4MW1A 3DOOA 3ONDA 3OVMA 1SGWA 4MEAA 3CNQS 4IPTA 4RHCA 3LLCA 3JQEA 2AIRA 3TR6A 2I3DA 3C43A 5WRFA 2XGOA 4RBNA 3NVDA 3RRJA 1AHPA 5KC9A 1HLPA 3R8CA 1CB0A 3WQBA 1JHPA 3GCZA 1KJJA 4XFJA 1ZW6A 4INZA 1R9JA 4ZALA 1USIA 1P8JA 2CLEB 4UUQA 1CJUC 2DHCA 4JR0A 1YNSA 2Q6OA 4ZTBA 1E2DA 3OPYB 2VDVE 3ROQA 4U2CA 5LYYA 2G5TA 4L22A 2I66A 3HCAA 2BT4A 1IZYA 1EQAA 4YCSA 4D4MA 3SR0A 1OV6A 1XTVA 3H16A 4OPMA 3T61A 3R40A 1W5EA 1QANA 1UWVA 3V4PB 3ZE6A 3RDPA 3P5BA 3NBFA 2PFSA 3RRZA 2I2BA 1NVMB 2V97A 3G49A 4PGMA 3GDHA 3T06B 4BMPB 4DGSA 2JGMA 1EP2B 5CFNA 1A5AB 5COQA 4C4TA 3G2IA 1KYWA 3C3KA 2B99A 2PYZA 4N0EA 1E9RA 5F2OA 4EGCB 2Q3BA 2RK4A 4AKEA 3IPAA 5EMLA 4PX5A 1CJVC 1W4BA 1MBZA 2ZANA 4QZVA 5JNSA 4IDGA 3ZXXA 4TLEA 5B1YA 1U2DA 4MR7A 2VAPA 4WA7A 1KIFA 1S1MA 3S3TA 4AS1A 2QL9A 4US2R 2XUIA 1FQKA 3AU9A 5E7MA 1WV0A 3D6NB 1G20B 1DBQA 5FR2A 4D8XA 3BB1A 1OCEA 1E89A 4UQLA 1PR4A 2YFYA 2FW6A 3L41A 4ZOLA 4Y2GA 3S70A 1OX4B 3JQAA 4E1AA 2BLLA 3GEBA 3AUYA 1N2CE 2CDNA 3TLMA 4BMCA 1QIHA 2C5SA 4I46A 5EIFA 4JCCA 3HU5A 5LU9A 3RIHA 4IHAA 1K0FA 4I9GA 1USVA 2EZ4A 3DKPA 4MS3A 5ALGA 4AN4A 4CQLA 4Z53A 1ZUNB 2ZRQA 4PYIA 2HK6A 1JFSA 5DHTA 3ABZA 1WA5A 1RAHA 3RYIB 5JZMA 1BD3A 3W5BA 4HUQB 3PT5A 3BJMA 3GARA 4LE2A 5EVCA 4M98A 1DV1A 2ZJ2A 2O3UA 2V6FA 3DMFA 2CFOA 2G07A 3OCYA 5HDBB 1ADBA 1YIAA 4MRRA 1ZK4A 4LOAA 1R5NA 2JARA 4RHXA 3IUSA 1QPBA 2OFOA 5CAEB 2BFOA 2EG5A 5B3JC 1HT0A 2WNIA 3D8SA 3TE6A 2RE8A 2VBGA 4MKXA 1E0JA 4X1KA 1QFYA 3EA4A 4PC7A 1X7GA 4K6OA 4YEDA 1RXWA 3IBSA 3USCS 5B5SA 3WSWA 1J8FA 2WT4A 3B6KA 4QELA 1N9GB 3SE0A 3F98A 3EMKA 3HKEA 4FFSA 1GO2A 2BKLA 5H3CA 3VHXA 3AY6A 3VSAA 4D3XA 1JQDA 1CYEA 1R74A 3MJFA 1E94E 1DAOA 1YR9A 1ADYA 4JFAA 3E15A 2FGJA 1K4KA 2CDBA 3AIIA 4KHZA 3OCJA 2YH2A 5E2IA 5EKSA 3SXUA 2OBYA 3OQPA 1H3EA 1JLRA 1SC9A 2A0YA 2ZYGA 3C97A 2QE7D 4INAA 1NJ5A 2W2LA 4Z9XA 4YP1A 3VR2D 1FYEA 1LBHA 1OSNA 1Y8RA 1ULZA 3NU1A 1XDBA 2G4VA 1WDWB 4G65A 3CURA 4NATA 1WQ4A 2WJAA 5HIMA 4BVGA 1ZRSA 4IV8A 1FSSA 4XJTA 1RBYA 1XR3A 1RRCA 1C0LA 4Q0MA 3UBTA 1XFAA 4I3GA 5E0OA 1D8AA 1CHDA 4KQ2A 4B7CA 5JXJA 4Q4DA 3EK2A 4Y6QA 4KKVA 5GVRA 1NVBA 3O7MA 3NEPX 3G02A 4ZVUA 2LCQA 1NJ8A 4CKEA 2ZCVA 2IHYA 4X66B 3PHCA 2WWYA 5CT6A 2ZZKA 1IMOA 1WWKA 4KQ6A 2BE9A 1DX6A 1UK8A 3LBAA 5IXJA 3MTBA 1DAHA 1DEKA 2G6TA 3RUCA 5DM4A 3A1VA 1Z3IX 3ZCUA 4ENSA 4I1VA 2OXEA 3FTQA 1QRUA 4CODB 2R8OA 4ZYWA 3IT2A 3NH9A 4ZT3A 4AB1A 2D06A 3OMXA 4JI7B 3JASB 1FQOA 5KQLA 4UZFA 1CB7A 1E18A 1GT6A 3KKPA 3ND7A 5L4NA 3M3PA 4IL5A 1PL8A 1A27A 2H29A 3IUPA 2P4EA 4D6YA 4LZZA 1KP9A 1ZXBA 3DULA 4BN4A 2FPGA 3S40A 4Z7NB 5BQXA 4NVRA 3BZUA 3TGPA 2HBRA 4OQEA 5EIOA 4IDEA 4RY0A 2IFTA 4FFRA 3VNRA 1R18A 2VAVA 3C5HA 4PG5A 2PUTA 5LP6A 2CVFA 2D3TA 3PDWA 1Q0RA 3PNPA 3V00A 1E5QA 3A3YA 1W48A 3PITA 3EIWA 4E1VA 3K70B 4WUTA 3AY3A 1R0KA 4YALA 3C3BA 3P2MA 1H1DA 3HKBB 3H9UA 1W0KA 2N0SA 2VSFA 2BJHA 3EY9A 4YJKA 2WNSA 4URHA 3GFQA 1IBCA 2HF9A 2Y0CA 3FZGA 2AL7A 3FNQA 2IYXA 4NR0A 4DLXA 2O5CA 2AWOA 2VQDA 3DZBA 4RF4A 3ZNOA 1R7RA 3A1NA 3MMXA 1DWPA 3NAZA 4PAQA 2EZ8A 1XVTA 2X2OA 2H57A 2W9XA 4GP6A 1L7OA 4WK6A 2WV9A 3A9CA 2DQYA 4RORA 1XMQB 3QVKA 1D2AA 2CL5A 4L72A 3TFOA 4NJOA 2RGUA 5EJAA 2CZQA 3SSOA 3ZCSA 4R2HA 3RV3A 4PX3A 5AVRA 4KWHA 3EC1A 4XPZA 3NG1A 1Z7EA 3GFSA 2OAEA 5EMHA 3PXUA 4BB6A 2A0KA 1D6NA 1Q0SA 3FRJA 3GLFE 2F4NA 2NTNA 5G1PA 1WOMA 1Q0UA 4RVOA 3RVLA 4FN4A 1J5PA 3JVUA 4C0AC 4YRRA 2WKSA 4F3YA 1OH8A 1P0MA 3CLRC 1MEOA 3EQ7A 5K3BA 1U8UA 1ZZEA 2IYQA 2O05A 3TAHA 5AVVA 1K2WA 4ZJYA 2FG6C 2HJ9A 3NOVA 3H7IA 3D2AA 3LPLA 1FFXA 1PWEA 2RJ3A 4LOKA 3TQQA 5BY2A 1CZOA 2E5LB 1DUIA 5TQ2A 2F1JA 5HKOA 3NWBA 4X65B 2ZRPA 1B2LA 1B1AA 1BRMA 4UJ3A 4INOA 3STUA 5BN4A 5KYXA 2YVLA 2J6HA 2DH5A 1FFGA 2JGKA 4PTZA 2O5EA 3H11B 3NBYC 1TQ2A 2O7QA 3N7AA 5E0KB 4M1QA 4REQB 1O2DA 3ZGXA 4QQ8A 4HNRA 2XQIA 3N74A 3G1UA 4TSFA 1H65A 5THXA 1UPCA 2PFKA 2P2DA 4LMPA 4NV1A 4Y0AA 3IP9A 4BX8A 4F56A 5BO5A 2WWTA 3U4GA 2X9NA 1BQEA 3IUJA 1NZJA 3B3GA 1SOUA 2FLKA 4PHTA 3OFKA 2HIMA 1JDZA 2YV3A 3E7DA 1QX4A 5IZCC 5DLQC 3FPAA 2HK8A 3O4IA 2EFEB 4GPTA 3BTSA 1M2VB 5FJIA 4EUFA 1CERA 4ETWA 6CHYA 4JC8A 3ANNA 4OI4A 2DTEA 1GTL1 1W0JA 1DKPA 2XKAA 3FBGA 4OYRA 4ROTA 4C2AA 4DLNA 1NJ2A 1OXBB 1D07A 2Q1WA 4BEJA 3DHWC 1U5AA 4H4EA 4MA4A 2ZJ8A 5EKDA 4M1EA 2F43B 2C88A 1U8YA 5CH5A 5ADWA 2ZJYA 1PWXA 1RAGA 2R00A 4H9GA 4UHEA 4DR4B 5B1IA 1SZCA 4OHFA 5DU2A 3B1VA 1KPGA 2J09A 3T1OA 2Q0SA 4GGOA 4F06A 1GG5A 1Z73A 2O8BA 2UAGA 3DZDA 5H4GA 4X1YA 2I4IA 1BGXT 1MC5A 1Z0UA 3MJDA 1PS9A 4O2RA 1E7RA 2JLYA 1SUDA 2GN6A 2XTNA 2EFCB 1IULA 1TI7A 2Z5FA 4QSHA 1JFFA 4LXXA 1CPYA 2C2BA 3NBXX 4FQ5A 1SZDA 4GMFA 2JVJA 4OF4A 4OEHA 4OFBA 3IBTA 3CYFA 3MCWA 1VJDA 4PO1A 2NWQA 5I7AA 1J97A 3IPYA 1UFRA 1GV1A 5A9SA 3OO1A 4HDMA 1N7IA 2JGLA 1MD9A 4WJZA 2XT0A 3D59A 3ORYA 3FNHA 4QRDA 4EHNA 3PLRA 3R2JA 1JLHA 4OUKX 4TS1A 1PNOA 1DI0A 3PA8A 3PIIA 1ECFA 2H11A 2Y99A 3DC7A 4RX1A 5CNKA 4LY6A 3U6KA 4HVAA 2PMBA 3SF0A 2PWPA 2NU7A 4NYMR 2VSQA 5GM1A 3MC1A 3GJYA 5LQJA 3A1EA 3OIFA 2UUAB 4O0LA 2A67A 1M1UA 4C03A 2FWBA 5DBOA 5K9ZA 1UK7A 1S7CA 3K72B 4OXYA 1TIPA 4RIGA 4XEUA 4Y2SA 1AA9A 2VAWA 1COWD 2X42A 5A1JA 5IYZF 1AG9A 3EBPA 1SULA 3ZIAD 3C1AA 3A6GA 4FXPA 1W4ZA 2QEQA 3E35A 3L43A 4KSYA 4MCIA 4BGEA 2PSJA 2EKLA 3QXJA 1FIUA 3UN1A 1H2YA 1P74A 3DV9A 5CB8A 3NP7A 2Z2ZA 3X1MA 2QLNA 3TLZA 4XWKA 1HE2A 2I4LA 2UZAA 3HABA 1ZRHA 3MRXA 3CINA 3BXFA 4MVJD 4NNOA 5CVCA 4KVFA 1IZ7A 3N0XA 3PUZA 4UUPA 1Z68A 3BJZA 1ORDA 1Q7RA 2DKFA 3JQ7B 3KZXA 1CP3A 4G2NA 2J5KA 3VPHA 5IAKA 4GICA 5B64A 1N9ZA 2ZOSA 3EUEA 1VXOA 2FPWA 2C57A 2AI1A 2J9FA 3VYTB 2VZEA 3H3FA 3CJRA 3EEQA 4P1ZA 1C7RA 1U4OA 3SZMA 4CEHA 1WG8A 4UEKA 4PRYA 1UBNA 2Z98A 2FQQA 3M49A 3U2QA 5C5EA 2V59A 1BCRA 1Y8AA 1S3GA 3BXPA 1EHIA 2CNWD 4JLVA 3UT6A 2B1IA 3BK2A 4L8LA 1T2EA 1UXHA 1RTKA 2HWUA 1ZK2A 2A94A 2P3QA 3KYBA 4XQEA 2YV4A 4MV3A 2ZTSA 4DTIA 2P91A 4KLAA 5FTMA 5BV1A 2RB5A 5EMMA 2LP4Y 4LDNA 1JHAA 1FXUA 2H4ZA 2BKEA 2VYQA 5G1NA 4UM9D 1Q3KA 1DC3A 2PXHA 2XTJA 3T9BA 1CNFA 1SO8A 3ZZMA 2JG3A 3AKDA 4WJKB 4WOKA 1EUDA 1A9XA 1KZ9A 5CYPA 4HBGA 3KSRA 4RAQA 4BWVA 1YBHA 4EY7A 2Q7DA 4NEGA 1LDNA 1UXJA 4NBSA 2R7KA 5G0TA 1F9EA 1OU0A 1T0UA 3VKUA 4BFVA 3HKCA 5JU6A 2VRCD 2IY7A 2UXCB 2W0MA 1GARA 1ZH6A 5DGTA 2PZFA 1ZMRA 4ZC8A 4YK7A 2BVNA 2ZE8A 1YSCA 4IRUB 5A4AA 1GPDG 2I6GA 2E4ZA 4CDNA 2GHTA 4YC7A 1T6YA 5G4LA 4FM9A 3H9CA 2IU6A 1Y3BE 3NDJA 2A6PA 2ERYA 2AMFA 4M4SA 4R01A 5A1TA 1KK0A 4ND7A 1PNQA 1GCUA 1HT3A 2XWJI 3DCNA 4K9MA 4ZT6A 1XNJA 3UXMA 4G36A 3VR6H 2J7PA 4D9JA 1E8DA 3K8OE 2PXCA 3Q11A 1ZOSA 1C1DA 2JRLA 4R69A 1D9ZA 1KSHA 5FUBA 5KNDD 1GAXA 2BHRA 4H3VA 5AHXA 2Y0EA 4ZCLA 3UGKA 4EJ6A 4PN3A 4CXMA 4UBJA 4E09A 4W9MC 2R2AA 4PBRA 4LW8A 3SVZA 2J0UA 3WGYA 2QYOA 3GBVA 1DZIA 2QTTA 1O94A 1XAGA 5JXHA 3K8QA 3DLBA 2CLIB 1QUFA 2O48X 3WICA 2XGSA 3DW1X 3M2TA 2EBWA 1SJ9A 3ZBTA 2I62A 3L8EA 4JLOA 4JNCA 5B2EA 4FFPA 4BPBA 1LLCA 4OJNA 2QTVB 1INLA 3AETA 4MCJA 1N4DA 3EYWA 3H4IA 3R6WA 2RG1A 2QU7A 4RGBA 4B3SB 1ABFA 2OBNA 1GXSA 1Q11A 3L9WA 4F3TA 4TKVB 3GEDA 3QKRA 4LN1A 4MTLA 4QYXA 2V9ZA 5HGXA 4Y3UA 4LF7B 1RC1A 1UIRA 5SZIA 2GCOB 1XTBA 2CW5A 3ED1A 3F6YA 3O26A 2W2VA 3L6BA 4EIWA 4ZHQB 3SJAA 1RMTA 3LX8A 3DG9A 1NIPA 1V3VA 3ILSA 1IN6A 3A3NA 1GR1A 1IDN1 3OM0A 3PUVA 4O2BA 2AXPA 4QGHA 4RF5A 1UZUA 5D3QA 1LPSA 2VN8A 2XQVA 3CF0A 4EG0A 4FIZA 1V47A 3X43A 3UTDA 5K0TA 1RWMA 1AQLA 3UF0A 2XBLA 4IOLA 1M67A 2UZIR 5THQA 3FLBA 1X8LA 4TUYB 3ZJ5A 3T3IA 5CDYA 1HFJA 1PQWA 4CI9A 1RZVA 4GYYA 2IXFA 1W5TA 2JS7A 1KEZA 3THWA 3FR8A 1Z4JA 3BIWA 3T1HB 3TXYA 4X62B 3VAYA 5A5GA 3GCWA 1RABA 2IZ1A 1AQJA 4YH1A 1KI4A 2NNLD 5FOTA 4L51A 1UJ6A 1A4IA 1UKYA 3HCRA 3GLKA 3F71A 4FEYA 4FT2A 2YWEA 4HLUA 5M29A 1SU8A 1WMFA 4E1BA 1DXYA 1KDRA 1FDUA 2REQA 1DBRA 1M75A 2E5WA 2GEDA 2YQ4A 3O38A 2X0EA 1DHRA 3K9BA 5ALXA 1LQ2A 2A5JA 2W8BB 3L6UA 3U9SA 3KUUA 5EJ5A 2PRKA 3LRPA 1ODLA 1J6UA 3QUTA 5SV2A 3C3XA 3VV3A 5LYJB 3S1SA 1BX1A 4YMHA 1J09A 2FSVC 3M6WA 3PQDA 4LPSA 1RVV1 2W6CX 3UJ3X 3WLJA 3FRIA 3KB6A 3GUVA 3HZRA 4UUMA 2H2HA 4S0ZA 4YRJA 3WVNA 3OX3A 4E3WA 2XCTB 1TFRA 4IDOA 3MT9A 2FX2A 3FW1A 4GZLA 5BPHA 3KDSE 1TM2A 2Q99A 4BMOB 5HJ7A 4JELA 5H70A 1E7WA 1K6IA 4ZXPA 1QHGA 4GH5A 5CUQA 4IIJA 3LBHA 4KLCA 2AXQA 5IF9A 4C5CA 3WRYA 5JD4A 1EM8A 1Q15A 4LHVA 2XB6A 4RPCA 4C7OA 2ZPTX 4MQEA 3MBIA 4WKCA 3GLIE 1MW9X 1GNRA 2HDNB 4JLAA 4RA6B 3U26A 5A62A 2A9PA 1J0EA 2IIPA 4I4IA 3WXBA 5JAPA 4P9NA 2V3CC 1PLJA 2YIDA 3EZYA 4G0PA 4N40A 3IJ5A 5F12A 3Q7PA 4P4GA 4BDSA 4OSPA 4ERXA 1ZM7A 4QGAA 4O4IA 4QUBA 4RULA 2G82A 4FYJA 2ZB2A 5BRJA 2VLBA 5JVDB 3RVJA 5ERXA 3HB9A 3L8YA 1GZUA 2NVBA 5T4FA 3B7WA 2RK3A 5H5JA 4BEVA 4E6EA 1S2DA 4MWGA 4TN1A 1RKBA 1UXIA 2FMIA 4QDOA 1I5EA 2X8WA 2GXQA 5HMMA 1OWPA 1Q1NA 3HXMA 3D8UA 1NI4A 2AG6A 3NDPA 4O4LA 4RESA 4GKJB 5M5BA 4GXNA 1W5SA 2J6IA 2XHZA 4IXWA 1YGYA 5HF5A 1WUTA 1JG6A 3W79A 3ZR4B 5B37A 5BNZA 2GUWA 2PY6A 1FTQA 3GNSA 1YB5A 5ABPA 2ATCA 4EFLA 3FJOA 4JXKA 2QQGA 4HV4A 1U5CA 4QJBA 2ZG6A 3M33A 2H65A 5AM0A 2ABWA 3RO7A 1NZDA 2F1HA 4X20A 3ZCPA 3OM9A 5A0VA 2B4RO 2QUZA 4EI9A 1I3CA 3FMGA 3IJPA 1KNQA 5JALA 1MOQA 4KGDA 4PZPA 4BVAA 1XELA 4P0TA 2HRDA 4F1WA 1TAHA 1SHKA 3OJOA 1U2TA 4P82A 2XUAA 3TW4A 1PK7A 1I5RA 1TX4B 4LMAA 1Y6QA 3OESA 3ZYCA 2J9YB 1HE8B 4ECAA 2VBCA 3A26A 4B17A 3C1UA 1NVTA 3TZHA 2O2EA 2FN4A 1NATA 3P4XA 2M32A 4LDPA 4H77A 1EEXB 4OKNA 2FJ0A 3P52A 5AK3A 3U4HA 1UODA 1ZMOA 2DG2A 5IDYA 3RM3A 4BO1A 4F8JA 1WHSA 2O14A 3F2IA 1NSFA 4QDKA 4U6SA 2ZBFA 1KDOA 1WB4A 3AM3A 1DO2A 3ESRA 3Q7QA 5GOTA 4E33A 5FADA 2CBZA 3VU1A 3IS3A 4ZI7F 2VYVA 4OAPA 4DHWA 4I8XA 2EZUA 1QOQB 3VH3A 4HQRA 4QAJA 2WA1A 4K5QA 3R9IA 4F2WA 3GPCA 1A2OA 3ZN2A 1PE0A 4A03A 1ZVMA 3GBPA 1E98A 5JXGA 1VSBA 2PKRA 3L6EA 4KACA 1DJOA 4BZQA 2D0OB 1Z0FA 4GM4A 2I3BA 3L7KA 1OI4A 3IIEA 2LDXA 3UAYA 4DNFA 1WVIA 3PQ4A 1VL0A 2AEEA 2B8WA 3OJWA 5IXYA 2IPAB 4XCQA 1R0BA 3PC3A 2C4MA 3KJEA 1NW7A 3ELWA 2FW8A 2W37A 3EIHA 3KAPA 3KAQA 1I4LD 1XEAA 4IWYA 1L7BA 1MV5A 3HBFA 4L4ZA 3DOJA 2OZLB 4DNPA 4GI3A 2HLPA 1RPZA 1Z39A 1WB6A 2OMEA 5A4JA 2F4VB 3AZPA 2NYRA 1IN8A 8ADHA 3NHKA 3JTEA 1FDSA 2HJWA 2BI8A 5EHNA 4B2YA 1F8UA 1Q74A 1MA3A 2ZQZA 3V4RA 4L02A 4ZVKA 1FDTA 3EXIB 5EN4A 5SICE 1OASA 3WWCA 3IQXA 1V7QA 5K3CA 4E5UA 3HVKA 3DCYA 4EVIA 2R6R1 4GVPA 3UGQA 4UTNA 4D9IA 4FD2A 3DC2A 4L4SA 4DM7A 5KYYB 2B4AA 2FWNA 3QSYA 4P0PB 1TQDA 5BYJA 2QYTA 5GZ6A 4IH4A 5LQKA 3HBNA 4ES6A 1WZNA 2OXFA 2BSAA 4WK4B 1DOAA 1CUZA 1Y1QA 2C31A 2RHRA 3A31A 3DF9A 4LGCA 3SBEA 4PYJA 1CR4A 8MHTA 1O08A 3LT0A 3IV6A 2OLJA 5JSFA 4G07A 4JEHA 3HVUA 3N1UA 5C8YB 5CEFA 2ACKA 5JAUA 1SKMA 1NXQA 1PUIA 4A16A 5KC8A 2XF8A 3O8OA 1VJ1A 4LX8A 4XGRA 1ZQ1A 1MOSA 5TR9A 3QF4A 3I72A 1NMYA 1P17A 5I6DA 2D1YA 2GCEA 3HP4A 3CZPA 3A4VA 1SC3A 1Z4LA 1P44A 2EFGA 3W5JA 3DVSX 2ZAOA 2NO0A 4JB2A 2Y76A 2VJDA 4H18A 3WMGA 4BQQA 4U63A 3URMA 2HA5A 2CDCA 1KS2A 3OEHA 3KJZA 4BZWA 4LZWA 4C1BA 2EGUA 3IQHX 2MU1A 4I2NA 4OA8A 5AKKA 4F4JA 1XWWA 3VDQA 2XMDA 5J1TB 1H6BA 5CT5A 5AVJA 3LNCA 2RGBA 1X1QA 4RDHA 3B1KA 4MV8A 1EXNA 1L0BA 1BX0A 1KTVA 2PSDA 4Y9TA 3M3HA 4UOZA 2OT3B 2GN4A 3QPUA 1AGYA 2JGJA 3FB1A 1CY4A 3QXXA 3SZRA 1XRSB 1MB9A 1CT9A 2FSHA 1M0SA 3UJDA 1GTVA 1T5SA 1W85A 2RARA 3OCCA 5DBEX 2FY8A 4B3JA 4BO4A 2GDZA 3D3EA 1MHPA 2QN6A 1S2IA 3OURA 1Z4MA 2JIZA 5DHUA 3SZOA 5EIEA 2XUDA 4AG5A 2I3GA 1ISJA 3S8MA 4RM3A 4R54A 4BX9A 4E5NA 1DC4A 1PX0A 3RK4A 5KOIA 1Y42X 2QMYA 2O7RA 1OVGA 2ISQA 2RHJA 3TNYA 1PW7A 3TRDA 1R4NA 1J7JA 2VA9A 4XFDA 1HDEA 2V6MA 1R1DA 3O83A 2X9VA 3KSUA 2WW8A 1DPGA 3IVRA 4JYPA 2XUJA 1W36B 4FKZA 4BWGA 1EJ6A 4NX2A 2IOFA 4JHLA 2D74A 1X2BA 3LQ1A 5AOCA 1UMDA 2QBYA 1DDIA 4I9HA 1JB9A 1XZNA 3ZQ4A 1ML3A 5DN6A 4RSGA 3GVXA 4RD2A 1UM8A 1FBTA 1CJCA 3VYWA 3TECE 1NW8A 3MWGA 4LC0A 2XDQB 4DRZA 2BM9A 3W3AD 1YIDA 2QTWB 1G4UR 3ELUA 4P4LA 4ABYA 4IHQA 3RNLA 3VR0A 4CBVA 5FBLB 3I8SA 3WI7A 2WJGA 3R77A 1XXHE 2X5JO 2DCUA 3SYNA 3TD6A 3QEBZ 2NUAA 3TI7A 4UREA 2LIPA 3G6KA 4TN5A 4EB6A 5KQSA 1SOVA 4JI3B 4A6PA 1PAUA 4R8SA 1VJ0A 4XYLA 5BOSB 2BV3A 4R8KA 4TWJA 4YJ3A 4RDCA 4TXMA 1PSDA 1W0CA 1MC4A 1MOPA 3HKDB 4X3PA 5EUMA 1KO1A 1ZX1A 3VHLB 3WKEA 4RE6A 3ELDA 4CFSA 1ZQ9A 3QVVA 3EGOA 3HCCA 1QS0A 1RMQA 3K96A 1EWTA 4WECA 3LXRA 1NOJA 4MTCA 3OO0A 1C9KA 1KBQA 1MABB 3OLVA 4WZAA 2IZ6A 4EO7A 4J2TA 1WF3A 1PR0A 1ZXLA 2C07A 1RYDA 4C4XA 3EJWA 3KQYA 1XTJA 3ZWNA 4LWOA 1N0WA 2HIGA 1H69A 3GQVA 3E27A 1QYIA 2ZRAA 4LQCA 5JFGA 1IG3A 3LE8A 2AD5A 1F2DA 1FYWA 1KVQA 1L8AA 1MXHA 4FNAA 4YY3B 1Z33A 5EGSA 3CTPA 1ACJA 1Q0PA 4FCWA 1KEWA 4U2GA 2CXTA 2YC4C 4OBWA 4B3XA 3N0RA 3IUYA 1FSPA 3L9XA 4L3VA 3AUKA 2MMGA 2O8EA 2P3OA 4A0GA 5CTAA 2AOVA 4HT3B 1F06A 4LQDA 2LWIA 3E5NA 1VIDA 3K09A 2CXXA 1YOBA 5IVKA 3JARB 4ZYUA 2JHPA 4PINA 3ZZTA 3Q7IA 3CNNA 4BP9A 2X3YA 5G40A 2AFIE 3THSA 4JBNA 2G1PA 5EPUA 2VWPA 2UUPA 5BNTA 5CA0F 4OSOA 1IDOA 1H22A 1SUIA 2B8EA 5FLKA 1JHDA 1VHDA 1YR7A 2B5OA 2YBEA 2O2XA 3GR6A 4X6LA 1IAQA 4XLLA 3UJAA 4BVHA 1I30A 2QXTA 4PQRA 4TKUB 5JYCA 2IW3A 3VNAA 3CVUA 3VZQA 3D8HA 4KQ1A 4HEA1 5CBKA 5KVSA 1QWOA 3QSGA 1C9EA 4D3FA 3BQ9A 4DC0A 5HRUA 3J80A 3ZCVA 1Q2UA 5F7XA 3OTOB 5AUNB 2DUWA 1WS6A 1H94A 3KDPA 1LV7A 4K03A 4JUCA 3DMTC 5JSQA 3R5FA 3MTGA 5G4KA 4BNFA 2O9JA 1KAQA 4RMGA 4RS4A 2AQHA 1G9TA 1Q3TA 5FBZA 1F1JA 3V8QA 1QZ3A 2DT8A 2ILVA 2BJWA 4XCXA 4N5NA 4WD3A 2COUA 4MS4B 1ZGAA 2ZRBA 3EG5A 4ZGBA 3L8ZA 4OHBA 3EMVA 3R7FA 1ULUA 2YJ6A 4FBLA 5F2KA 2PV0A 3IC5A 3PYMA 4X61A 1DTWB 2WVGA 4YCCA 1N6KA 2GAIA 4YJFA 2QRUA 5EUQB 4KFTA 2EU8A 1YMVA 2DBZA 5IK2A 3CZ5A 5HR5A 4KR6A 3MGAA 1NR7A 3O4RA 3TAUA 1HXHA 2VDJA 4P31A 1DADA 3OOYA 3TVYA 1UMBA 3EVCA 3O0DA 4OQMA 1Y81A 3BERA 4M7OA 4OBXA 3BB3A 1VJCA 4BV3A 4ITVA 1AK2A 2OFWA 3BWVA 2PVPA 3QKTA 4M37A 1NWCA 4A8JB 5L7TA 2SCUA 2Z4TA 2EQBA 2OCPA 3Q3VA 1OH7A 3UK2A 5CG2A 4XUGB 2JCVA 2YHUA 1NBME 3ZV3A 1KK2A 4M0FA 4N3GA 5LU8A 1RYBA 4GU5A 4PSDA 4U7TB 1AD2A 1E1CB 4IZIA 5F4BA 1DMRA 1Q5PA 1R8XA 2R751 3C14C 2PEZA 3TN7A 3F6PA 4B0PA 1GFIA 1EIWA 2GZMA 3O1JC 3UV7A 1I4WA 1NXTA 3JYQA 3TLGB 2NT3A 1GWNA 2ZVJA 3I58A 1J9GA 4ZVTA 4XDGA 5IJ0B 1PEDA 1Q2XA 4IDHA 2Y0PA 1JDPA 3FIJA 1YHNA 1I14A 1XCOA 3K1ZA 1J1ZA 1WKCA 3C8UA 1B8NA 1NVVR 3LDGA 1LPOA 4J6EA 2VQSA 1B1CA 1NVWQ 1OPRA 2OOKA 1A2BA 4GE0A 4JX9A 3G2OA 2GFHA 4N5MA 4Q3BA 4P3NA 4Q3CA 4TYMA 4N18A 5AM1A 5F78A 4B3TB 3CRMA 1JQBA 4JK3A 2F3PA 4WI1A 5TPWA 5J23A 1A9QA 4U8GA 4YX9A 2IBTA 3U3ZA 5DTIA 4Z51A 3CVVA 3T7RA 2HA2A 3GT7A 4CM6A 1CUVA 2JJ8A 2DH6A 4RFSB 2X4LA 4B2IA 4KO1S 1M34A 5C0OE 1AB5A 2XWPA 1WE2A 1RU3A 2YYAA 3KETA 1TOAA 2XYRA 1D7OA 4CIAA 5F52A 4L2IB 2CHGA 4PPQA 4Z0HO 2VOEA 4IQ8A 4AF7A 1YWGO 3WNZA 3KELA 5KTYA 3TPFA 3DEHA 5HXAA 4EENA 2JGEA 1FDRA 2CVOA 2JHAA 4JMPA 3R44A 3QEMA 1UBSB 3PPXA 5LIPA 4KGZA 1PFUA 2WJ3A 1JQKA 4GSYA 4NQRA 1GGMA 2F59A 3AM4A 4RKWA 1W25A 2VPZA 5K3FB 4LF9B 2RGGA 2QTAA 3GPIA 1UP7A 3EBLA 3SYLA 2IXEA 3FUCA 2BEWB 4CHGA 4NXNB 4CCYB 2H4FA 1L3IA 3L4BA 1EBUA 1NW6A 4LRWA 4DWOA 4DR1B 5DW3A 1FRQA 4MLCA 1U5BB 4P8RA 1TCVA 2ZBPA 4LVCA 4EHIA 1OBVA 2ZRGA 1MJGM 4ZAVA 2J07A 1WBBA 1OREA 1VL1A 2D13A 3ZXUB 3QVLA 3I30X 3E9ZA 4NCAA 3LFTA 1N2XA 2EWVA 1FK8A 1KI9A 3MEQA 1TVEA 5G02A 3HA7A 2WZQA 1RJWA 3CQ9A 3FOAA 4U9UA 1ZGBA 2UV8A 3RUHA 5MFZA 3L7MA 1ANKA 1XJCA 3G8BA 1SNYA 3HO6A 4LOLA 3RS3A 3L8MA 1T2DA 4MJ3A 5TJ9A 3SJ7A 5F1OA 4CU5A 3Q5DA 3L79A 2OK7A 1XVVA 4QJ5A 4U0KA 3BXEA 3MIIA 3Q7EA 3WLAA 3EFBA 4FGSA 1BCSA 2HU2A 1IHDA 3TBHA 3ZW9A 1O6BA 3TZQA 1BX3A 4RY9A 4S1PA 4H1VA 4CYMA 3NWJA 2VA8A 2ZWAA 4QXOA 4X92A 2V7QD 2WUFA 5FEMA 1NIJA 5JRDS 2VQ3A 3GB9A 3MAAC 2IPOA 3FVRA 4G4SO 2BGLA 1HYEA 2C3YA 4PX2A 1F2UA 5DX0A 1WUHS 1YZGA 2P7HA 2WAYA 2VO1A 5TQ0A 3C7CB 2OFPA 2X23A 3CISA 1BDMA 1U2GA 4HN4B 5EC8A 4WDRA 4NL4H 4B4DA 2QGZA 2W6ID 3MQ4A 2AN4A 2H3HA 2HD4A 1US8B 3MK31 4PZ9A 2GXSA 2HREA 4XQGA 4DMFA 1DAFA 1LPPA 1SIOA 3G8CA 2RIRA 3GZJA 3VR4D 3OPYI 1YCGA 1HT2E 1TRKA 4G09A 1IHUA 4EPXA 1ONNA 1HQYE 1LK7A 1OZGA 1V2GA 3B1ZA 2LKDA 3DBHB 1GQQA 3EFEA 4AY5A 4CKCB 4PR3A 3K6KA 3WYCA 1PFKA 3WTBA 2OEPA 1U0GA 2SECE 5BORA 1C8VB 3NRJA 3ZDCA 4HAWA 1BWRA 1KJZA 2W90A 1C1XA 3QOYA 3KCNA 2PIDA 3GGJA 4ZYVA 4BE9A 4FE7A 2IOQA 2WYHA 5AW2A 2VQ6A 1XAHA 2PQ0A 3PDHA 4JHXA 4L73A 4DDMA 1U0OC 1GGHA 5KYXB 3EE6A 3AR6A 4RPIA 3L0ZA 1N2CB 1YRQA 1I01A 5H4HA 3WDMA 4OB6A 1HGXA 2AOUA 2L69A 2Z2JA 2BRUC 2VDMB 4ALMA 5IKPA 2R85A 1L5KA 1RYYA 1GQRA 2IYLD 2FW9A 2XJ4A 4ZAZA 1WUYA 2O8NA 2AV6A 3H2IA 3PZBA 2WHEA 3B1WA 1CEYA 2CCKA 2G70A 4G0YA 2MHCA 4PFSA 4TL9A 1SZPA 1ODCA 5T3UA 3KS9A 4FZVA 4Z1OA 2IYUA 3HM9A 3S2ZA 4MIYA 3ZY3A 1VG1A 2WPDA 2IS2A 4UOEA 4UMEA 4M0LA 3BKWA 5ESXA 5JWOA 3Q5GA 2C7QA 3NWOA 4LOIA 5K3DA 1SA0A 2QRPA 1ZDMA 1NQOA 3DZFA 3EOAI 4F1KA 3HWWA 2HB6A 3KRTA 4N48A 3O8DA 3AR8A 3L7AA 3ZU4A 1LU9A 5DV9A 4Q1CA 1RIIA 1SKUA 1V4NA 3B7PA 4Y9SA 4OX9Y 2CXOA 2NU8A 4PE5B 5A03A 4BQEA 1Q22A 5KTSA 5CITA 2Z8ZA 1SFRA 1IM8A 4H7DA 1HNWB 1N0UA 1B0ZA 2JBAA 1OFVA 1HLDA 2FR8C 1XA3A 3JX9A 1SCJA 2H1RA 4RTLA 4HF7A 5JZ9A 4LNAA 4ZMSA 5K8LA 5FQOA 4ROSA 1IE3A 4IDFA 4P83A 5CB6A 2GN0A 2JH3A 3HY4A 1GQSA 4WUVA 3ER9A 3IBCA 3R20A 4NJMA 1AT1A 3EEIA 4B6RA 1U1DA 3LRXA 1E3JA 1XZDA 2ZIVB 2XSZA 4NH4A 2FZGA 4ONEA 1QJ4A 1KYVA 2CVQA 1MO2A 2VPIA 4QLOA 2G1UA 4ND8A 5FUVA 1C9MA 2OY0A 3B70A 3AEXA 3JQAD 1IPHA 1OAAA 4NCIA 2I9PA 4DAEA 2X13A 3KSBC 3K0AA 4TMZA 1RAIA 2GB4A 3UH1A 4YP6A 2DYKA 1FB5A 1LFDB 5T3YA 2BI7A 4JKIA 3B20A 3GAFA 4LDRA 1B0UA 2XXJA 3QNWA 5ALMA 3RVSA 4L3WA 3TRHA 5B6IA 2FMKA 3KLBA 4Q4HB 1V95A 1WPQA 4ZYLA 5IYZA 1N3IA 4QREA 2P7IA 1T8YA 4PG7A 1DL5A 5JS7A 4DLBA 3O8NA 4S24A 4KQJA 2VYCA 1YB6A 4MJ7A 2PX6A 1EINA 4QATA 1TJ3A 2ZXUA 1G59A 2ZZMA 4KV7A 5ER9A 3NQ41 3NUGA 1HT1E 2WIGA 4MIKA 1YR1A 1LW7A 5C46F 1AXGA 4KEAA 1YS7A 2JKZA 1G0OA 1EB8A 2QXUA 1FJHA 1KZHA 1RJEA 4U3JA 2EW8A 4PCAA 3TK1A 4A1FA 3EHEA 4W9NA 3ZGOA 2FPRA 2DE0X 3UW1A 1BHO1 3D0KA 4ZQEA 3REQB 4YMIA 4NE2A 3IAAA 2RGNC 3HCOA 3MCVA 3PUKA 4QXAA 1R16A 1NRIA 2HH9A 5KVVA 1F0PA 1EJBA 2XRFA 3T7EA 2P4SA 4XB1A 4YI5A 2P8JA 1A7UA 4MO2A 1H0SA 2BH9A 3D8NA 4P58A 2Q9UA 2ZVPX 3TBFA 2OZKA 1HI9A 3F5QA 1YTLA 3EXAA 3FMOB 3KR0A 2RAVA 3HU3A 4JA0A 4IMJB 4ZO8A 4YPOA 2GN1A 6REQB 1EM6A 3KXDA 2XXAA 2QGFA 2Y92A 5ANRB 1WQ1R 1DTEA 3RSHA 4EPYA 3U3KA 3WYBA 4BO8A 3ICEA 5JXIA 2BFEA 1KFJB 1H9CA 3PC8A 1RDFA 1UQUA 2NMVA 1XZAA 2VSYA 3E05A 3FVWA 3KB1A 3EXEA 3GJXC 4HGQA 3L1IA 3RYFA 1PT8A 3R3WA 2QZPA 3CRRA 1JSRA 3ZE9A 1X9GA 3G89A 2AK2A 1N5MA 4KC0A 4PC3A 3RCBA 4Q82A 2OG2A 1XKLA 2FNAA 1XVAA 3D4BA 3F5MA 3IAUA 4K6CA 2ZSJA 1TW3A 1U8XX 3GLFB 2J32A 4IVRA 5FWXB 1W5FA 2DBRA 4PTYA 4BLPA 1SHUX 1ZMXA 5DTEA 4BO0A 1EFPB 2QA5A 3GD5A 1JIJA 1ENOA 4RZSA 3B51X 3CXRA 3IQGX 4FYVA 4KPYA 1I1HA 1FSFA 1B0PA 1W94A 1XNHA 4CWAA 1QTRA 2XT9A 1BN6A 3PHLA 5FULA 3AERB 3H17A 3WNVA 4F46A 1QAMA 3O91A 1ZGCA 4HNGA 1PFQA 3ODGA 1Y6GA 2H63A 1CEQA 3TLAA 1HQDA 4N9QA 4FU0A 5B57C 1K3FA 1WSBA 3NGLA 3NBUA 2VXBA 4ON9A 2XKKA 3QBJA 5CB4B 3OTHA 5FA6A 3ZY6A 1OILA 3C5EA 3D1VA 4QU9A 3G7SA 3ID6C 3UKDA 1MJHA 5J2UF 4GGPA 3EIXA 3RRFA 3DZ8A 4PR0A 4C5BA 2NUTA 4D9EA 1W0KD 2BGNA 5CYGA 2G08A 2I1VB 4BNDB 5D8DA 4YCMA 1M1YE 1YFLA 2HO5A 3UJ6A 1FDOA 5KAPA 2D1RA 3DMPA 5AW9A 1DBSA 4D43A 2Z2XA 1P5HA 4RSRA 3QGMA 2EQ5A 5CD9A 4GPD1 1TTTA 1VHLA 4F60A 3FA2A 2XCRB 1ISSA 1OYWA 2BUCA 1PJBA 1XZ8A 4H16A 1Z34A 1NKVA 2AJBA 3A4LA 1A9OA 4JYCA 4FTWA 5F35A 4DE5A 2DP4E 3AK4A 4OI0A 2JLZA 2YXLA 4GLFA 5EYPB 2LVBA 1U98A 2YMLA 4V2UA 2F8TA 4OP3A 2AG0A 1H1LA 1ODFA 3DVRX 3KPYA 4BGUA 4TXNA 1AXRA 3GLGA 3D8RA 4V0RA 5IU6A 3ENNA 4TTRA 1N25A 3RUEA 1KTIA 4IUDS 1HO3A 5IUJC 1WHTB 2HMAA 1U0LA 3GL9A 3ZOKA 4X85A 3PSHA 1A77A 4BS9A 1JDSA 3SKXA 1M2OB 1SKBA 2D2EA 3BGSA 2BFCA 3GT3A 4F2HA 2NZWA 1G5QA 3HN2A 2MSCB 1JAZA 4KU4A 2DQKA 3ROEA 2UU9B 1D8TA 2XEXA 4R2MA 1ORWA 1W1UA 3GPBA 4K9OA 3BT7A 1V39A 3CUEF 3IE0A 2R48A 1MVLA 4R7TA 3H2GA 4F4FA 1Q92A 2XMGA 4ZEMA 2ZE6A 4DY6A 3AP2A 5TC4A 4PBTA 5BRAA 5EHIA 1ODIA 1F4VA 2R44A 2YRXA 4WN3A 1G7RA 5DO9A 4D57A 3V8MA 1Z37A 3IAXA 3HY6A 1DMSA 1JDBC 3OX1A 5CPBA 2FLVA 5BMVB 2Y0DA 2XYGA 4U2EA 1S8AA 3TSYA 4J4TA 3BBLA 1CU1A 1FTNA 1WMDA 1VHQA 1QIEA 3CNBA 4Z9AA 2X40A 1NBOA 2FP4A 4L6IA 4R4JA 3DLIA 3O7WA 4NBVA 2FWJA 1F6BA 4XSVA 4TSFD 3VQTA 1WR8A 3N07A 1C3JA 4JYBA 4DQUA 4ZVNA 1MQAA 1PZFA 2OCIA 1C1YA 1ZESA 4IOMA 4MGIR 2BTOA 4X24A 3CW8X 4NFHA 3L8DA 5D2CA 1P73A 1M8JA 1PJQA 3ICVA 4H59A 1C0PA 4JGGA 1ZD4A 3P9CA 3V8PA 2IRWA 1ZY2A 5EE3A 4F4DA 3TQSA 2BUAA 3N2KB 3DPIA 4AJ4A 1B00A 4C78A 4DLTA 2FMFA 3C7TA 2WUVA 3DQZA 1TCUA 2QD2A 2WF6A 3EMDA 4R51A 2EW1A 2J9XB 2Z6QA 3HDGA 2VJPA 4EYKA 4FHEA 1NYRA 1H2AS 3CUTA 2CL7X 1D0SA 4DWVA 2ATEA 2VNSA 1TIBA 5P21A 3RHTA 1E6CA 4V0LA 2XZDA 4FGLA 1Q6YA 4NZPA 3B5IA 1V16A 4MWZA 4CQMA 5FYQA 1PV1A 1I2MA 1ZGZA 2HM7A 1P5ZB 3X1JA 2JFWA 1ULHA 1UBRS 2EJVA 3EWSA 1Q17A 4AJPA 4ZIRB 3DE3X 3OHPA 1OBCA 4IIEA 1DAIA 1O95A 2AN9A 1Q0ZA 1RIFA 2PYDA 3WGKA 5D00A 2WT8A 3JQ8A 4IDAA 5FOQA 3U3RA 1R8JA 4AJ2A 3ZD7A 2AF4C 2GWRA 1DHTA 4GMXA 5BRNA 4CLDA 3OQJA 4JT8A 4CR7A 1DCFA 3BKXA 4HO1X 4NBKA 3UJBA 3G9XA 5TIIA 3NM6B 3FHTA 3AL2A 1CDZA 4DDHA 5C7YA 1SU4A 3N5KA 1O5TA 1AH2A 1YR2A 5DM0A 1IY0A 1RI4A 2NZXA 1X92A 3NUZA 4X8LA 3OPQA 5EWLB 2IWRA 2ZJ3A 5AIBA 3K6SB 1ZD8A 1OA1A 4NLLA 3RHZA 1GCAA 4PY2A 1L9KA 4LTDA 3MWEB 3E22A 5LQUA 4ZZIA 4WQMA 1XPJA 1AZWA 2QWXA 4ZYYA 1XRPA 2QTFA 1WP9A 4KV9A 1K7XB 3G8DA 1WU7A 2JLXA 1NFQA 3KZMA 1XJWA 4GOND 1RVDA 1ACMA 2H51A 2W98A 1V1RA 3DF7A 4W8HA 5K0NA 3W8DA 3WHPA 1VP3A 4LNHA 3WV4A 4HYYA 1B15A 1WM1A 3DE6X 5KKCA 1KIAA 2QUKA 2WINI 1AQNA 4PXSA 4YHHB 4EW1A 1LWNA 1XLWA 4LI3X 1J0BA 4PLHA 3TM5A 2IXDA 1NBHA 4L07A 3IAM1 1SKQA 4CLRA 2EFJA 1GCOA 2O8FA 3G5UA 1M6VA 3P96A 3W1EA 1SQSA 5A02A 2DPXA 3FVVA 1JR3E 4YRDA 3DDHA 3OIYA 3U7EB 1E1YA 4Q7QA 1S89A 1MLDA 2FJUA 1GTSA 1J5EB 2QKYA 1FTGA 3NETA 2RAUA 3IPLA 1L4EA 4Z7QB 3NFRA 1ZU5A 2WUGA 2OTCA 1KQGA 5LXTB 2PBRA 3JWGA 5DOZA 2PMEA 4P36A 4FDLA 4L76A 4PZZA 2KSQA 4AK9A 1TVKB 5DGXA 2FSFA 4Z49A 1ZIOA 2E37A 5DJ5A 1UPBA 4JJFA 4UVEA 4WJLA 4UCQA 4PSCA 1Y1TA 3VKGA 2YJ3A 2C03A 3L7LA 5HBRA 4V1CA 3DXYA 3DWIA 2BM1A 3MSXA 4HN2A 2MCFA 3RRXA 4BGVA 2IUEA 4AJEA 4U6NA 1I7SB 1TQ4A 2BDUA 2KS6A 2Z2IA 2GVNA 3DLCA 3L8HA 1T9BA 4G0NA 4PAWA 4QTUB 2BFDA 1E9SA 3ERCA 4ZT4A 3TLEA 4NFLA 5AJWA 3KAKA 3FZNA 4LQ4A 4ZQCB 4RTPA 4AMUA 721PA 1KFKB 2B5VA 5BN5A 3CH4B 2PS9A 4JSRA 2TMGA 1I5OA 2YIJA 3TUZC 3QOXA 4Z7OB 1S96A 1JFRA 1ZSYA 3AKYA 3BMOB 4TV8B 4BFCA 3KEGA 2GBLA 3TQHA 1XLTC 1CUUA 2FRDC 4PYKA 2C4HA 5H80A 1GN8A 2C9CA 3EISA 1LTHR 3D0QA 5KCMA 3NO4A 2XNCA 3H83A 4B80A 3GRYA 1UFVA 3R3UA 2FSSA 3K5IA 3BSYA 1Z6XA 1CUHA 2WU1A 5L7YA 1VGVA 4MV6A 2GD0A 3M9WA 4L57A 4J0DA 1QOZA 2IH2A 2J7PD 3HBJA 4OUDA 4AQYB 1E2FA 1VPVA 2D2VA 2Z8YA 4BBZA 2EKZA 2ZJFA 1A8PA 1RLMA 4MB0A 2HHJA 4G89A 4QARA 5IVDA 3KWJA 1Z2NX 2IJGX 2V7VA 2XODA 5DI9A 3B9PA 1V8ZA 4FNOA 4RY8A 4PGAA 4TTTS 1USWA 3MJEA 2J5XA 1O94D 2DQZA 2HIAA 4HK4A 4MS1B 4FLEA 5JE8A 1VYHA 3UBMA 2OPHA 2NU6A 4HD8A 4IIFA 4HYEA 1N32B 2F62A 1N6NA 2J9GA 3BMCA 4PIVA 3WGQA 5BN1A 1L5WA 4GLBA 5K0GA 4H3KB 1GL7A 3MCAA 3RG2A 3E8MA 3RTBA 5K8UA 2YYZA 2IUUA 1B42A 4PEVA 4DTCA 5K1ZA 4JOBA 2QVYX 4XWYA 1Z18A 3MLAA 4OO3A 1NVEA 4JUDX 3JQPA 4B34A 3CG4A 2DWPA 1G9SA 1MAAA 1KERA 5DASA 5CXUA 1HTBA 2DGDA 3PPYA 1E59A 5TLSA 1MAHA 1OLOA 1OWMA 3LFUA 4D8VA 5ED4A 3AJDA 4D0NA 3FFXA 4X84A 1MU0A 4O59O 3FOZA 4UHHA 3F49S 1K5PA 2HDHA 2FUG6 4HZUB 9GPBA 4HYQA 2IEBA 1VA4A 3BSWA 1Y7TA 3ITDA 3GLIB 4TXHA 3UKOA 1OLSB 1BAPA 2Q3MA 4RK6A 4LX0A 4B4VA 4XVHA 5J4KA 1H3FA 1SHZA 1YVRA 2ZR8A 3L1JA 5B1SA 2RGYA 4E2FA 2ORVA 2YYYA 4K2HA 1JF8A 1E9DA 3FB4A 4ALNA 5C8DA 2BSXA 1QCZA 5C8YF 3FXAA 2JI8A 1NASA 3FHCB 3KKMA 5FL7A 1I2ZA 3K9NA 2PDAA 5AKLA 1YQEA 4PXAA 1GSHA 1L5ZA 2ORWA 5J5VA 4P4UA 2W11A 5COBA 4IOJA 1FU4A 4LMBA 2GK4A 1A7JA 2H1VA 2MR5A 3CB4A 4MINA 4P08A 4W5HA 5C9ZA 5KB3A 4GXQA 1GGKA 1RPTA 1SCDA 4OCZA 4D9MA 3NHSA 5ITWA 5JDCC 3WK7A 2BKVA 4E2WA 2QQFA 3IP5A 1JEQA 4R0NA 3DXZA 4HDRA 4TWZA 5M7EA 2A3RA 2VZ9A 3CU5A 3G0GA 4I5EA 3BFKA 2ZREA 3CKLA 4FI3C 2QT0A 4GT1A 1AC5A 1CX9B 4HZGA 4WESB 5CLQA 5BUCA 5LOVF 4GL2A 1Q95A 1JU3A 3ICWA 3UUWA 4DY4A 1DINA 4HS4A 4RV5A 2ZI3A 4XOIA 3RTEA 2F8SA 4ITUA 2A9KA 4M0DA 1SG9A 4B48A 3FPKA 5JRJA 4Q19A 1TAUA 3IP6A 4IKPA 2JGNA 1NKSA 2NXCA 2HFKA 3RC7A 5MGNA 4Z4EA 2AKYA 3I83A 4Q3EA 3P5SA 4UNQA 4KE7A 1YQXA 1MR3F 1AGNA 2R8YA 4G4GA 4NI5A 4CM1A 1MB2A 3ZVMA 1QFMA 3TQTA 3DBVO 3ICOA 5BSWA 4KQXA 1LB1B 2HCBA 2JD2A 2JIDA 1OFHA 4EJMA 4ENPA 5IC4A 1GNLA 3FSGA 4MV1A 2GASA 4QDXA 1NAHA 1RBQA 1RP7A 3MSCA 3F4KA 1RHKA 4K9SA 4P81A 5HRCA 5KNBA 3VC3A 1P2GA 4Y8VA 2V03A 4ASUA 3GP8A 2GN2A 3V4FA 3QE9Y 5F9MA 1TU3A 4WOCA 3ZE7A 1U3TA 3DE0X 1Y80A 2H7VA 4YNBA 3ESYA 1C9JA 3WE7A 1XPOA 2FR1A 3K30A 1FNSA 4C30A 1M2HA 3ZIUA 1E2KA 2XPCA 3MPUA 1A5SB 2BFMA 4KDCA 2I6UA 4TS3A 1CRWG 3ER6A 3I9OA 4PC6A 2DTDA 2A35A 3PGVA 4UHBA 5AI5A 5IN4A 5IVPA 1A88A 4RTMA 1KFEB 4D0RA 1ECCA 3IMFA 5F7JA 4B3HA 2QMZA 1IN1A 4KE9A 3OECA 4MYSA 4OYYA 4DM4A 4GI7A 3EPJA 5JCOC 2V7WA 2H4YA 2VLIA 2EIHA 5KINB 2BFPA 1TM7E 2WM9B 4GNRA 1L3CA 1WDKA 5LZ5A 5CA0A 3UJ7A 1M5RA 1RC0A 4DCGA 4O02B 3U5ZB 5JEEA 3BE6A 4YO8A 4M53A 5LZ9A 1RQ2A 1BVRA 4DNOA 3HJNA 1JLMA 4J16A 4PVDA 3LZCA 5DYNA 3ZCTA 5CK4A 1QZXA 4X6XA 1I10A 4O2AA 4K0RA 1THMA 2XVAA 4WDQA 5L9AA 3UK0A 2P6UA 4OQYA 1AS3A 2WD7A 3EYAA 3OICA 1L5RA 4QOSA 4Y2HA 5L4SA 2O2DA 2CHVA 3WRXA 1F2VA 2V4MA 3IDZA 2JI4A 3EFHA 3RTDA 4WE3A 1D2NA 1C41A 1L6RA 2QTCA 1DBPA 4I14A 3ZV7A 3OY7A 4F7DA 3OQOA 4GR4A 4FDMA 5BNIA 2VHXA 2OV8A 3ZXSA 4U8HA 3KOUA 5H16A 1MAVA 3VU3A 3GJSA 5IEJA 2ZJ1A 3JALB 3KQWA 3KTOA 1EP1B 3OPYA 1PT7A 3RG8A 5HJEA 2IXAA 4WFJA 2GK6A 1P8AA 3KZVA 3EA5A 1FP1D 1G5TA 2CXSA 1YQGA 4GKKB 1JQAA 1KMHB 4YLEA 1KOLA 4A23A 1JHOA 2FWAA 2ZI5A 1R10A 1R0RE 1FBNA 3UAOA 2OCGA 1XCJA 4YRSA 3GJ4A 5HCUA 1QB7A 1EP9A 4Q18A 4KMOA 1U3VA 4LISA 2FETA 3JYHA 4WKPA 4MULA 2IOYA 1JDBB 2VATA 2VJAA 3UV6A 1KZYC 3OTGA 4OHXA 3VR1A 4RCYA 2WB2A 3M4YA 5ALLA 3R0ZA 2P69A 1RWKA 5EZQA 3PWSA 3DFZA 4JUBA 1O9GA 2YWRA 4UEJA 4EBFA 3WFZA 4CZ2A 2HV9A 3VR5A 5EHQA 3TNJA 4EY8A 5MF6A 4NEQA 1IYZA 2I7XA 5D6OA 5EEHA 5H7XA 3U0VA 3WQSB 4POAA 2BM0A 3J81A 2H0QA 4TVBA 2FR0A 1NQ5A 4U00A 4JYZA 1QV7A 2WTBA 2YRFA 3DL7A 4LBWA 4W1PA 5LP1A 3RBVA 1X19A 1M6HA 3MUNA 4M49A 1G20A 4A82A 3R7WB 4E22A 2A5FA 3FNRA 1A04A 4LZPA 3PUHA 1XCLA 5AJUA 4OA5A 4ZZ2A 5GZ1A 5JECA 5K0CA 5SY6A 1PYGA 5E3JA 2WILA 5DCYA 2AOWA 1I4EB 2HL6A 1KMCA 1G8JA 4JXJA 4PQYA 1CKEA 1MF7A 5E7JA 1DLIA 1HE4A 3G5TA 4M76B 4U7PB 5BQ3A 1Q0TA 2NACA 2NQTA 5TMPA 1TZBA 3RC8A 4V0NA 1ZUNA 4AUMA 4EAAA 1LKZA 1DQYA 2G80A 3OLWA 3QHPA 1NQWA 2Y0BA 2D5CA 4BTEA 4HUQA 2UYYA 3RFVA 1KKMA 4OL0A 4B31A 1S8OA 2LE0A 2WKPA 3T3HA 4YI3A 1WCIB 5DYIA 4XWTA 1I24A 1DCTA 4G1CA 3AHJA 3TRIA 4MWEA 4BCDA 5IDQA 5CAEA 4Q9AA 4OQLA 4ID3A 5LD2C 5JPIA 1P5FA 3UGTA 1OI3A 4PIPA 2W22A 2DLCX 4K26A 4FR2A 4KYIB 3R1IA 2AKEA 2ZJ4A 1X7ZB 3HDYA 3LI2A 4BYGA 1VE1A 4XD7A 1LGYA 5IPFA 1XPUA 1ETUA 3PC6A 3WLPA 2WG0A 3ENVA 4E46A 1N9GA 3NHRA 2YNMC 2BISA 3P2KA 1IN5A 1HLFA 3DDOA 3M4ZA 1EFTA 1V1JA 2VBFA 3BTUA 1XXHB 1N3LA 4IDDA 3RYCB 5CT9A 3ZW8A 3BWEA 1GYRA 2Q2QA 1E3LA 1CUWA 3WRWA 1Y6FA 4GSKA 2ECQA 4Y2UA 4YCLA 3C6XA 4EH1A 2J8ZA 2WHRA 3AHGA 5U9CA 4CF6A 3W2TA 3TTWA 4XARA 1D6SA 3FBTA 3STWA 4PSVA 2XAUA 1LTQA 4DAOA 1WD5A 2XGJA 1FC0A 3FHOA 1IUPA 3S28A 1RLTA 2YQZA 3OSZA 3GEPA 3LY7A 1T5TA 2IYNA 4KIUA 5CIQA 5LBIA 3V3TA 1CS4C 1WOYA 5ALPA 4PO8A 4NAVA 4U7DA 3ER8A 2JJ2A 5K2OA 1IC6A 4PYOA 1YMQA 1B6RA 2JIZD 5I9IA 10MHA 4TGLA 5BSGA 2AEJA 2P9GA 3BHIA 2XE8A 4AP6A 4EHFA 1MC1A 2C94A 2FPIB 4AZTA 2BF7A 5L53A 3LC1O 3AFOA 4HYTA 2AQIA 4OVKA 5TF0A 3HL0A 3Q85A 1QV9A 2O3JA 3E0XA 4AU1A 4ZTZB 1GZ3A 1W4AA 3AX6A 3MT8A 3SJCA 2VK8A 4QO8A 3NHBA 5CX4A 2ZYWX 2P1DA 4LZLA 5ILOA 1XTSA 2GTPA 5AXBA 4EG4A 3AFIA 4X3CA 4HDNB 3QTBA 5DN6D 4YMTA 3KKQA 5CMLA 4YR7A 1Y3IA 5C4GB 5I9NA 4JEIA 4NBLA 1QVAA 1X7HA 1P9NA 2HYDA 4G41A 3USES 5L40A 1KRXA 4HZIA 2DC1A 2AFIB 2F1RA 3DFUA 4OQQA 2BH2A 3JVIA 4PLTA 5JS8A 2J59A 4C2UA 2WOJA 3F6BX 5E4TA 4XWAA 4EY4A 1BRTA 1U9YA 1ULTA 4WCFA 3CA8A 4YDSA 4RTRA 4IMIB 1DZ3A 1XJ0A 1KAHA 3WA7A 3HKBA 4YAEA 3DAGA 4LXHA 4ZT5A 1ZGGA 4TT3A 3DZJA 4EO9A 1U8EA 1HLGA 1KEUA 1JLLB 1WMAA 3JVEA 2ZQ5A 1T36A 2GLTA 3KBBA 5ETJA 1CZNA 2NSHA 1EI9A 2VFAA 4WCVA 5T4HA 3TOSA 4ZV4A 3W2EA 4HEJA 4PQFA 1WB5A 2CE7A 2GJ8A 3IUEA 4RD0A 1I32A 1DKQA 3INGA 4HNQA 5DOVA 5E9QA 1QKIA 1A8HA 2O2ZA 3LHFA 4HX9A 4I1OA 4FYPA 3TCNA 4R9VA 3T4UA 5AW7A 2VDPB 1BXKA 1R3DA 2ODPA 5T67A 2WJWA 2WIDA 3OLQA 1KE1A 2VQFB 2ZJ7A 3I05A 4G9GA 5BV7A 1TZCA 1QOPB 1FA9A 3UQYS 2HHLA 3WZ2A 4BC0A 5CYOA 4YP9A 2P9FA 4DSAA 1B6TA 2OQIA 2R6CA 3W6PA 1C3VA 4AY6A 1LXCA 2H1WA 3IMKA 5E4FA 1O94C 1MEEA 2H2WA 1C81A 5D6NA 4MWDA 3OF3A 3EQ2A 2FZVA 4W1RA 1SQ6A 2OP0A 1GAEO 2QM0A 1PVDA 1QP7A 1KI7A 2YZ7A 1G291 4ZCMA 2J30A 1KHHA 1U81A 3OSUA 3OQBA 4RTNA 1Z74A 3TIFA 4GI2A 5BQ5A 2FMUA 2Y05A 3KZKA 3WDLA 3OP4A 2JIQA 3V1UA 2ZVDA 1RPAA 1BE8A 5DBFA 4BNZA 1K7CA 3GJ6A 4KZPA 4Y1GA 1JB1A 2D54A 4US0R 1EBBA 5C34B 3V34A 5H81A 2GEBA 2ZYTX 1IWBB 2BFFB 4W7SA 1NN1A 2OK8A 3F47A 3RIXA 4DT1B 3WYNA 3H11A 2I34A 13PKA 5T4EA 1QK3A 3PTLA 4REQA 4EHLA 1ZUWA 4OM7A 3K05A 2G63A 4KJXA 4BZZA 4H3SA 5AVTA 5H59A 3AR9A 2LDBA 1CS0B 4LGVA 3E7FA 4WCDA 1QHXA 1ULBA 2FP3A 1BOOA 2I6TA 5J4HA 5JFTA 1Z2OX 1N0HA 1VGRA 3QK7A 2PVSA 1MB0A 2FAXA 1U0NA 1IBSA 1TU4A 2QRGA 1K97A 3QLTA 4DV5B 2DPMA 3PYLA 5J59A 4DVJA 3OJCA 2WMDA 3CNEA 3G2LA 3HFGA 3TIIA 1M2VA 2VDWB 2SKDA 4IIXA 4X3OA 4X6YA 1NYTA 5COAA 4Z3DA 4CM7A 3SP1A 5DXJA 4KRFA 1QR6A 1ONSA 2VDNB 2XUZA 3B82A 4ZO7A 3FUWA 5F5NA 4KQFA 4BC1A 1GGEA 3EIEA 7AT1A 2Z09A 3M82A 5DHSA 5K01A 1OXSC 4TPKA 1SC6A 1W2GA 3OIVA 3BFVA 3K8ZA 4Z86A 5IK2D 2F43A 3U39A 3MUOA 2RGRA 1LCIA 2OCBA 4B5LA 2JA1A 2O2HA 3H5NA 5HTOA 4BBAA 3BWDD 3D6FA 5L6MB 3LIIA 4G0QA 4CM9D 3VC1A 1R00A 5HIKA 1DWQA 1H1TA 5EKTA 2H5IA 4GECA 4HJRA 3IVMA 2CJFA 2R5NA 2PK3A 3IDAA 4J1TA 4OU5A 2QN9A 3CFYA 3D8BA 2JDIA 1E1RA 5DYTA 1UFKA 4PCUA 3UIEA 1TB4A 4ZKDA 4A2PA 3DA8A 1UK9A 1IY8A 3FMVA 3I09A 2H7CA 3OCVA 3SSMA 2NP7A 3AF3A 1L7QA 1T5OA 1Q16A 2E5FA 4YUAA 3HG7A 3WRYC 4Z4GA 3V80A 1JP7A 2OZVA 4BO2A 1DIRA 3VI4B 1DS6A 4E5KA 3NVMB 2ODAA 5K4HA 1WTCA 1JZTA 4CNBA 4MW5A 4NMMA 2XMPA 3IUQA 2WUDA 3AVYA 4P3KA 4RZHA 1E9BA 3Q2KA 3R5KA 4KUEA 1XTZA 1AQYA 2CXRA 1JW9B 1TK3A 4IJKA 4LJ9A 1V25A 2ZSDA 2CYAA 1SVKA 3LCUA 4BGDA 5L8VA 2Y66A 3V55A 4IXNA 4E12A 1WLSA 3FH0A 3LQ2A 5I9SA 4N47A 1GPNA 2GFIA 4BTLA 1EVYA 4AWBA 1WETA 1I2DA 1LSUA 3L1KA 1YJBA 3VZBA 3X2FA 3FPJA 4OMCA 4YUXA 4TTVA 2YL2A 1A50B 1HKUA 3DOIA 3KE8A 2EEZA