3QVGA

Xrcc1 bound to dna ligase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
LCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 3
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/ligase
total genus 18
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16759 LIG3_BRCT DNA ligase 3 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3qvgA00
4ID3A 3T7KA 3HUFA 1N5OX 3JVEA 3UENA 2E2WA 2XNKA 3PC6A 3COJA 1T2VA 2D8MA 1CDZA 1T2UA 4IGKA 3OLCX 3EF1A 2HTFA 4Y18A 2COEA 2COUA 4OFBA 3FA2A 3K16A 3AL2A 1T29A 2AZMA 3SHVA 3T7IA 4BMDA 3PC8A 4N40A 2K7FA 3L40A 3L41A 3KTFA 3QVGB 3PD7A 5ECGC 1T15A 2INGX 4IFIA 3T7JA 3EF0A 3T1NA 1L7BA 3U3ZA 2DUNA 1GZHB 3AL3A 4U4AA 4XPZA 3SQDA 3PXAA 4XQ0A 3PA6A 3QVGA 1L0BA 3L46A 2WT8A 2R1ZA 3PC7A 4Y2GA 2VXCA 3SZMA 2COKA 3K15A 1JNXX 1OQAA 2M2IA 2JW5A 3PXEA 1Z56C 1IN1A 3SHTA 3K05A 3HUEA 2EP8A 3II6X 3I0NA 1IMOA 3PXDA 3PXBA 3UEOA 1KZYC 4JLUA 2NTEA 3I0MA 2ADOA 2XNHA 4BMCA 3K0KA 2K6GA 2ETXA 2L42A 4BU0A 2EBWA 1WF6A 3PC8C 2LE0A 3K0HA 1Y98A 4BU1A 2VXBA 2EBUA 3PXCX
chains in the Genus database with same CATH superfamily
2C96A 4GKJB 5JCJD 5KWEA 1UBTS 3BN3A 3RC7A 1EDBA 1BDMA 2WU1A 1QFZA 3IAM6 1GHTA 1MQ8B 2QD5A 4IV8A 3VDXA 1IBMB 1CF2O 3BXOA 3TVDA 4BQQA 4H15A 1ZS9A 4JR0A 2WJHA 1XRLA 3B13B 1CUBA 1E60A 2YQZA 1WTAA 3GBPA 3N9IA 4LHSA 2D1RA 1G9SA 1C9KA 1TAHA 4EHNA 3OZTA 5F51A 3OBIA 1ZOOA 1S0UA 1PCXA 4ZT6A 1EBUA 3FSEA 2QLLA 5LZ7A 4BMNA 1NVVQ 3I32A 2CFIA 2BFOA 4C2TA 5GAJA 2QRQA 2J6CA 3BGSA 1NQWA 3P0FA 3LX4A 4MHOA 1CJKC 4AUKA 3G5TA 3L6DA 2X8JB 1CB0A 3OQJA 1LJLA 3GFRA 2I3DA 2CHQA 2VUTA 4LZZA 3SLGA 5BQFA 1JKMA 3GRKA 3OIDA 1SQ6A 2Z1MA 4EJSB 3AHDA 2P9JA 5CLIA 4YN3A 4EMBA 3LOQA 3PUZA 1M1XB 1C7FA 3D3KA 3H5RA 3L49A 3PJGA 4OAOA 3UKDA 2WB2A 4GZ6A 2PGNA 5BO5A 1QRDA 4FR2A 4CKCA 2PKQP 1C3VA 2I54A 2OKCA 5LLDA 3FOZA 1LBEA 1TPZA 3GGGA 3D8HA 1NBMD 1OYWA 3F6PA 3KJQA 4N3NA 1J7KA 5LBUA 4PZPA 5EKDA 5TNXA 3U80A 3ISVA 4A0HA 3NMUF 2XWQA 1CHDA 1QZZA 2Q5OA 3FROA 2WKWA 2YTZA 3HXPA 3IUBA 1X7ZA 3N2ZB 1EWKA 4Q0MA 4ZVNA 3T9EA 2WUWE 4W1QA 3ZNNA 5IJ0A 3M89A 2Q62A 3PJRA 2O1SA 5BUCA 1QIMA 3OA0A 2F8LA 2G1JA 4NCJA 4YUZA 4BNWA 1DIOB 2FF7A 3KIPA 1DFHA 1UDRA 1X8JA 4C6HA 2X4GA 1IEXA 1TUBA 2AUNA 3CX6A 3L8FA 2EHDA 4MRMA 1YASA 4OBXA 5CDUA 1OZHA 2OVBA 1VBNA 2P40A 2AXNA 4GNRA 4ZAVA 2WILA 1PJ2A 1YJXA 5CGZA 3ZTTA 5CX1A 1SC1A 3FRIA 4PO3X 4EO4A 1ODTC 3G6KA 4EKEA 2CJWB 1SUBA 4Y2GA 1DTWA 1EK2A 1V8OA 1KU0A 3MCTA 3HCCA 1EMDA 5JISA 1MOPA 3N86A 3VHXB 5HRCA 1KMCA 3AC0A 5LSAA 5EWMB 2QG6A 2FZCA 1EUCB 4PPGA 2BGNA 3P26A 1C2YA 2DPHA 2VTVA 1SA0B 5FO0A 2GJ9A 3HVIA 1DQZA 3D3WA 1G5HA 4BLQA 2C54A 5CFQA 1Z7BA 5HF8A 1KXJA 2PX4A 3UH0A 4JL5A 3VVCA 1T91A 3I0MA 2HK9A 2R7MA 1EEHA 2ILVA 4G36A 5DN9A 1ID8A 3G88A 5BSHA 4XPIB 2W4QA 3JQ9A 4QBFA 5TQJA 4NZYA 4DLTA 4OXRA 1A9ZA 1CJVC 5A3VA 3UK1A 4ZMSA 5AW8A 2P9TA 4IHJB 5IS2A 3WWEA 2QE7A 1HR0B 2JLQA 1PZNA 1TDJA 3M6IA 1KY4A 2SCUA 4EY6A 3R5KA 1E2QA 3IVMA 3NBFA 5ULLA 2AD5A 2FPLA 3QFTA 1CYDA 5EN4A 2B5OA 2ZBUA 1I2MA 5KDDA 1KOLA 1Q19A 2JANA 2VWQA 4I8IA 1Q0QA 3D2LA 2DU8A 3T5CA 2VHJA 4MH0R 1YMUA 3D4NA 3ESZA 2PSHA 3IVRA 3GGDA 4PGMA 3AESA 5H16A 4OLFA 4DLXA 2GYVA 4KPEC 4Z3OA 3A9RA 5SICE 3HU1A 4ZI2A 3MS2A 5BSRA 1P5FA 3T95A 5JNTA 1P2SA 2X2PA 4ESHA 1NJ8A 2NYUA 3L6RA 1OLOA 1TM7E 1ZLXA 1KL7A 3CTPA 9LDTA 1FX0B 1GNSA 2XZLA 3PEWA 1GLVA 4AP5A 2Z5LA 4B82A 3K9NA 4Y30A 3VYWA 1VRWA 2QVYX 3W5CA 5IXJA 2FVYA 1R4AA 2WAOA 3JATA 3G2NA 1UBFA 1VYVA 1HEYA 4M2LA 3H5VA 3MYRA 4JP5A 4P4LA 3R8XA 5JLAA 4UJ3A 1F0KA 2G63A 4B47A 4C07A 1U6IA 1N6OA 1BXGA 4DSOA 4ZYTA 4CL2A 5JD4A 4ZTZB 4LGCA 4NG4A 2ONCA 3NJRA 4PBSA 3FD8A 3TZBA 3VVLA 4RESA 1W5EA 2QDKA 2XOKD 3SF8B 4QRIA 4A9AA 2TMDA 5B30A 1VLVA 4DV1B 2R86A 1WP4A 2PK3A 3JAKA 1KQPA 3UZUA 1ZD9A 5FAXA 5E2IA 3OPNA 1KMHA 4MULA 4W5NA 1Z8NA 4QU0A 4H6VA 4LI0A 4I46A 4RIEA 1Z2PX 1DEHA 1CP3A 1FFBA 3JYLA 3AVYA 3OX4A 3A6EA 1YK1A 1HT1E 2QWXA 3E22B 1DCMA 1YRBA 3HYLA 3JQ9C 1Q16A 1I36A 5EJGA 1XZIA 4D0GA 4DGQA 2HU7A 4DCGA 1IONA 2ZBQA 2ZBPA 3KSZO 4B76A 3S3TA 3DDSA 1GZ6A 1VPEA 3LYAA 2Y68A 4LK3A 2IYOA 1VYTA 1P60A 1GY8A 2VF2A 3P9ZA 4MYRA 4RWZA 5BPFA 3CUSA 5JAZA 1VMKA 1RD4A 3DDCA 3F6SA 3LPAA 4AB1A 4ZQHA 5TGTA 3D1JA 3I6ZA 4WK0B 4U2GA 3UPDA 5F98A 4LRXA 2CD9A 3SIWA 4H1WA 3JQ7B 4OOEA 2DFPA 3A27A 3H9GA 5CVJA 1UFKA 3AI3A 2X1MA 4NBRA 4NDAA 1FEZA 4BNGA 4TVKA 1ULBA 1Z56C 1JBKA 4P5EA 2D7JA 3ONNA 3QPCA 4QDJA 1ESNA 1GUBA 4H16A 5DTRA 3QBVA 5DOZA 2W7TA 5DSTA 4NENB 5EPEA 1Z25A 1LX7A 2BZGA 5JG7A 1VJDA 3Q15C 5ILGA 4JSYA 3G7UA 3PEUA 3MAGA 4YCDA 5THQA 1NN0A 3L1IA 4PICA 3RS5A 4IXNA 3QF7A 4MQ4A 4Z9XA 2ZYAA 2PYZA 4IEFB 3P2MA 4IWYA 3RIXA 5BW8A 4PR0A 4I4TF 2ZJ6A 3R7BA 1G8GA 1KE1A 2PKRA 1GTMA 1DC4A 4DJDC 4Z1MA 1FW8A 1GUDA 2J45A 2PH7A 3QENA 4MTLA 5BSVA 2CXUA 2H5JA 2FX2A 1NLUA 4AICA 4PFJA 3GT3A 3V1YA 3K8QA 1NVBA 1UT6A 3TL3A 3H5NA 3NWOA 3KQNA 3QEKA 4N5MA 5JZMA 3SE7A 5JO0A 2HGSA 3U3OA 1MB3A 4A6XA 2QI9F 5LXTB 1OGJA 1Z0SA 3G23A 4KYTA 3B5IA 3B8HA 2BIFA 1PQWA 1GPAA 1T9BA 1NN1A 4P38A 2H2IA 3GDGA 1G2OA 1U2SA 3GLSA 3OPQA 3ZTYA 4B3DA 4EI2A 5CB4A 4DB2A 1QQTA 4IKPA 4RWEA 5FDFA 3EOZA 4I6JA 5C35A 3OLYA 3QELA 4EBFA 1N8SA 4TTTS 3Q85A 1C81A 1L5QA 2ZYVX 3PX3A 1Z82A 2BFBB 4UD2A 4YRRA 4MYDA 3ROGA 5B36A 1HG1A 1IU9A 3C6QA 2B98A 4LJ9A 4PC2A 3QNUA 5LQSA 2VSQA 4WN9B 4B40A 2QLFA 4W7SA 2XMPA 5A2QA 4UXJA 3ESYA 4Y2XA 2ZBDA 1N3LA 3DZHA 4MLZA 5IYZA 2UYHA 4CE6A 4JI6B 3NBMA 4G0MA 2IBTA 1EB8A 3SFZA 1V16B 2GH1A 2Y3IA 3FAKA 3ELWA 4HLQB 5AKLA 2CXQA 2ZRNA 1L6IA 1L3IA 4GWLA 2QUJA 3JD1A 2WFLA 4P80A 3TMKA 3W5DA 1QP0A 1N1MA 1MJFA 2E4YA 2QRGA 2V96A 1Y1LA 3LH5A 5BQPA 3FVWA 4HI0E 4A8PA 1QLWA 4CIVA 1NU6A 3LBHA 3MD9A 3DOOA 2YL2A 2B1JA 3WV5A 5CMLA 4FD2A 2CLEB 1KAGA 2XQVA 1W85B 4YRDA 5SV2A 4MUIA 3TCKA 5ER6A 1JYEA 1YC5A 3U4MA 2WBLC 1HRDA 1KJQA 3SLRA 3FHOA 1EK5A 3GELA 3GVCA 4DLNA 2VTDA 2IF2A 1SVKA 4ZOQI 5A5EA 1HZZA 1BO6A 1L0BA 2G70A 4RY9A 5EE0A 3ZCPA 3ZHUA 3LXUX 2W8BA 3F7TA 4IO1A 1RKVA 1DJPA 1L4NA 2ZSAA 1XALA 4D9CA 4D9KA 2BMEA 1RJGA 1YQQA 2RHJA 3MYYA 3WL4A 3UJNA 1H6BA 2QP9X 4EF4A 1GCIA 3U9TA 1FCJA 5LIRA 4ARAA 1SBCA 4WXYB 1W4AA 4XQ9A 4RENA 4J6FA 4RIFA 4MLDA 3G3EA 5JAIA 2Q5HA 2ZUFA 3K53A 1GPLA 2WTBA 4F72A 1KDVA 4BVHA 5IHXA 1V1MB 3TQIA 4I0WB 4Z4IA 4KQCA 4IIDA 4WY5A 5DHTA 1MR3F 1ZEMA 5FNVF 2IYYA 4HXGA 4HVAA 4KRFA 1M72A 4U00A 4NBNA 2IPMA 1ZJ5A 2J6IA 2R62A 3CNOA 3CRW1 4DA6A 5DNDA 4DCCA 1ZJWA 4OXNA 3GN2A 3MBKA 1Q7CA 1GCAA 3LKDA 2Q6OA 2XDWA 3PF9A 3K0KA 4INJA 2NU9A 5H3HA 3NHUA 1X7YB 5K3FB 1P2FA 4RGBA 1LK0A 3UCXA 2J0QA 1EP2B 2WP0A 3IA7A 1KZ1A 1JKIA 2WHYA 2Y2VA 3IAAA 4QPZA 5JSHA 4B8WA 1QU3A 3G8CA 5A7HA 3JRXA 4LWOA 2LTAA 4GECA 2B8EA 1A98A 5CW2A 5CFRA 4OB8A 4YCLA 3HKEA 3TN7A 5DM2A 4DIUA 1TM4E 2EBUA 2ZPTX 1E99A 1KNQA 2H52A 3U1TA 4IUBS 4DJ5X 4MK4A 4GU5A 3L4KA 2HWKA 2NUTB 4L75A 3KYBA 4YQFA 2MDTA 3TLEA 4DCNA 2QNBA 1I4OA 2HZ7A 1LPMA 2IVFA 4EJ6A 4DARA 5BN5A 1NSYA 4R16A 1WD7A 1IL0A 4F5DA 1MH1A 1CU1A 1XJ5A 5JZSA 1Q0PA 2I6TA 1PYDA 1MABA 3MWDA 4HRVA 1IBRA 3LECA 5LA6B 2F1JA 1ZI9A 4LBZA 4RK6A 4B7XA 4EA9A 4YBRA 4Y6QA 5JEEA 4RF5A 3PTAA 2IBSA 3EG9A 2MINA 3K4PA 4M21A 1T1GA 2B20A 2FWNA 1U98A 1L4UA 4NAHA 4XUDA 2RHGB 3FDIA 3UV3A 1NU8A 4RZSA 3VR1A 3VYTB 1LDNA 4OO3A 1RBZA 3F2VA 3IQGX 5IAKA 2DWOA 2LVBA 1N25A 5D5QA 3NM6B 4BVJA 4YNBA 2GCOA 4C7OB 3WMWA 5C7YA 4L08A 4MVJF 3QFSA 2FPIA 4Z8YA 4E7OA 4IMPA 2XJ9A 1TGYA 2A92A 2C0PA 2WVGA 1XTKA 4MGIR 3ETHA 3NHZA 4OJTA 1DPGA 1I1NA 3DWIA 4XWKA 5AW3A 5KIAA 5ECGC 4DSUA 3GUUA 4ZRDA 3EB9A 1QG2A 5LMZA 3CF4G 3Q8LA 1RQNA 5BR8B 2J5BA 3PFBA 4E3WA 1CY2A 1FE8A 4II2A 3FPEA 3SZUA 2BTEA 4HQKA 4U9HS 3RYIB 4B3BA 4HY3A 1QAMA 4R7ZA 4EAQA 3CX4A 4TTJA 1WVIA 2MSKA 3V1KA 3GRPA 4X20B 3GQBA 3GZNA 4IRMA 2CMFA 2JRCA 4DT1A 4FGKA 3S5JA 1IQUA 1A9OA 3NYIA 1OAOC 1QMPA 3LLMA 3RASA 3DDNA 3WLRA 4GIBA 1BMTA 1KEUA 2ZFUA 3T34A 4NCKA 2BDTA 3JRNA 5FWYA 3CNEA 4JK3A 2E4AA 3PPYA 1DBWA 3CCBA 5AJHA 3IEKA 3EIFA 2OFFA 2IYTA 2H17A 1FQJA 2D2IA 3B1XA 3D4OA 4MRAA 4QIHA 1QRSA 1NBHA 4E4TA 3DMTA 1N5MA 1VECA 3CLUC 2AG6A 1H2AS 1QV6A 4X7BA 3JWPA 1J2RA 4DDWA 4RKQA 3Q88A 1C8LA 2W4IA 2X9VA 3NHRA 1DKMA 1OQAA 2JATA 3KE9A 2O5RA 5B3KA 2ZXFA 3UO8B 4WZZA 3ZWOA 4Q7MB 5JXIA 5LOVB 1Q0HA 2DBQA 2WYUA 1V5WA 3VNUA 4WZAB 5B58C 2YV3A 2H57A 4OUDA 5CA0B 1E5QA 4FONA 3NHAA 2WDZA 5BV8A 1NJ5A 1G8KA 2BT4A 1N2OA 3BMQA 4L4ZA 4M1EA 5IJ9B 1VQ1A 4U02A 3TTXA 1ARZA 1KOJA 5NLLA 5C4MA 2ODQA 2Q6VA 5K6RA 2AJBA 3E5RA 4LJ5A 5CCXA 1A4RA 2OOKA 1QTRA 3MTGA 4XFJA 1B43A 3QP9A 1RQPA 4TN5A 4WAUA 4X95A 4YO7A 2H5LA 3G0CA 3RVQA 5A4KA 3BGDA 2C4KA 3NASA 4RE5A 1J23A 1SUEA 2ID8A 1ZXXA 4YXWA 2C82A 5CLJA 1LK7A 2IU0A 5HKOA 1SQSA 3ABRB 3ECSA 2FW0A 3ETNA 1Y1TA 2BGGA 3S8YA 3DLTA 5BN1A 1F5SA 2ORYA 2D5AA 1ZJJA 3ENZA 1H69A 1QYXA 2H31A 2BW0A 3EVFA 3MOSA 3O1IC 4BNMA 3BEDA 4RZIA 1R8YA 5AUPB 3OP1A 1IBKB 4JUDX 3TECE 3VNQA 3L7BA 1N2CB 4XUCA 4AYXA 4E31A 3C97A 5JLJA 2FWRA 4WECA 4YRCA 1HYGA 2BRUC 5DW0A 1P1BA 1R6BX 2P9BA 2LXNA 3KVYA 4J4TA 4WJZA 3DGEC 1DBVO 2ODPA 2V54A 3DHNA 3QKIA 2AGVA 3GJ0A 2JIZD 3GZTB 3QE0A 4P35A 2BEVA 9MHTA 1USKA 5I7AA 2VRBA 3BJEA 3LFTA 4Q3KA 4DNFA 5IDWA 2H2WA 2G9VA 4PAMA 2MSCB 4NV0A 4UEQA 2QRNA 1MGOA 4EVRA 2JJ2A 1J1UA 5LBTA 5J4LA 2PL5A 3DM9B 2K7FA 2VBCA 3ER8A 3K0BA 2WKRA 4P92A 3TLXA 4FBGA 3ETJA 2XYVA 4PQFA 5I9MA 1N5DA 3G8YA 3HVJA 2X15A 1WB5A 2FYTA 5EE5B 3ANLA 1TO6A 1JRLA 1R4MB 2X8BA 5CFPA 9LDBA 4YY3B 4OLAA 5K3SA 5LU9A 1P7YA 4E1AA 2CC2A 3TPCA 3C6BA 3GCZA 2OO5A 5TLSA 4JAVC 1L7XA 2G8LA 3FMVA 4HYQA 4YJGB 1AN9A 2I1LA 3G5AA 3M1AA 5AVJA 2Y8EA 2IUTA 2B7LA 3RUDA 4QZVA 1E2NA 4UHBA 3WHPA 5F2KA 3LSTA 3G7SA 2Q07A 4IGFA 2YZMA 5KB3A 3I5UA 5GJWC 5KNDD 3DT9A 3G68A 1S2LA 3OJWA 4OCZA 2OENG 1CLEA 2F4NA 2YHUA 1ZU4A 3Q98A 4RMHA 3ZY3A 1EWQA 1YU6A 4CTKA 1VHQA 2A4MA 1M10A 5H83A 4WKNA 1JVNA 3PEFA 1XVVA 2XOXA 3NOXA 4R51A 4UZFA 2WPDD 1OIXA 4L0MA 3RJTA 4G6ZA 4REMA 5LZ2A 3C5VA 2R7NA 2WEKA 4I9FA 4BCBA 1DBRA 2HT6A 4MDYA 4GI3A 1E9DA 2VRNA 1X80A 1FBNA 2NZXA 1NF8A 2LP4Y 3EMBA 3OZAA 2CLSA 5ARDA 1MN6A 5JJCA 4BFYA 2A0UA 2HK6A 1YZGA 4PAGA 2O05A 1M2NA 2NUAA 4DBZA 1EJ2A 4OL0A 4UVGA 3FOFC 1N9GA 2FUG6 1V6AA 2Q6TA 2XZDA 1CQIB 4LYFA 4TS3A 4F3RA 3TGPA 2PAFA 3ZE8A 4LECA 2QZ9A 1XJCA 4R54A 5IBRA 4YCMA 3H5OA 3SEZA 3I23A 1N5KA 1VYUA 3PDJA 3UAWA 2P91A 5CDSA 1CUDA 1W2GA 1C7RA 3R24A 4MVJE 4Y9TA 2V7UA 2EBWA 1ABEA 4MGYR 4TSFA 1FC0A 3TIXB 2IUFA 1AXGA 2XB4A 2J07A 4O6VA 1K7FB 2YCLA 1DG9A 2VJMB 5BSUA 2O2YA 4UCFA 3HKCA 4PO1A 4K9SA 3PXUA 5JBIA 2XY4A 4PGFA 2XOEA 2C9ZA 1JE1A 4FBLA 4HFMA 1YHZA 4P7GA 1K27A 1R0RE 4JBLA 2CUZA 5ISMA 1GG9A 2UYOA 4MGZR 2XUGA 1LI7A 3WWDA 4X66B 1VE7A 3K8ZA 1AGXA 2YMLA 1Q1EA 3Q3JB 4L5JA 2ADFA 3W4KA 5ICFA 2VJAA 2OO5C 4E32A 3T0IA 3UQYS 2HR1A 1QHFA 3MLAA 4UVHA 2H0RA 1L6RA 1XE3A 2HJHA 2ZTSA 2JRLA 2A1UA 3DCJA 4YMTA 2CXTA 1GM5A 1B6SA 1B4DA 3A3KA 2Y1CA 4O1MA 4AMYA 1NX6A 4TOIA 4AF7A 2QLTA 3HKBB 2Z9CA 4RHXA 3M6VA 5KX5B 3E1SA 3FA2A 3G2PA 3VJKA 3W6OA 3FOEC 1YWGO 5KTRA 4D0RA 5JSKA 2HRBA 4FGWA 2JASA 4X1IB 5BYJA 1NUAA 1XTUA 3KOXA 3KZNA 1H22A 4MW2A 3ET5A 4BLRA 4CETA 4H7FA 3P71T 1XG5A 2H16A 3NJ4A 3ETCA 3OO1A 3ZW8A 1GA1A 1DT3A 1KVTA 2OM2A 3ZQJA 5JTUA 7REQA 3C24A 3DHWC 1UODA 3M1LA 4KUHA 4KHZA 1NFRA 4UBKA 5IK2A 4HGPA 5AKGA 2VPXA 1UBNA 3BH6A 3QLUC 3ZHCA 5C1BA 4I8XA 1HDGO 4ZV9A 3A9SA 1OOEA 4FMBB 4MW7A 2I29A 2RGCA 5HQJA 4DUZB 4FYYA 2D13A 2B8TA 2IYRA 1RJEA 5EMJA 3WA7A 1ZK4A 1Q1GA 1JILA 4EMUA 3IX7A 5ELXA 2ZRAA 2J0UA 1UXJA 1UIMA 4Z9BA 1XFAA 1QMGA 3BJMA 2V6IA 4XPZA 5ADUS 1E0SA 4BFSA 2Q9BA 1MXHA 3X1YA 3KLBA 4RQTA 2XIQA 3V7NA 1GCOA 3MTQA 2VTBB 3I9NA 3QVVA 1W25A 3CT6A 2ZWMA 3NTVA 5CU7A 2XVAA 3N0VA 2ZB3A 4BVKA 5HZKA 5KPJA 5FBRB 1YOVB 1UM9B 2B0JA 5K6AA 1CUZA 4QXAA 4EEZA 3BOSA 2ZVDA 1OI4A 4FYJA 3C3JA 4OVKA 1VRCA 4Q82A 3DKKA 5KINB 2ORVA 5LKAA 1RVV1 4RQBA 4KAAA 3DL7A 1NN3A 4YPFA 3VKUA 2JFWA 3LM8A 3K0FA 5BV7A 1GVHA 2P9FA 2QE7D 3O4RA 1W6RA 3HBNA 4RU1A 3SDBA 3D6AA 1S7GA 3NWBA 3R2JA 1K4MA 1QDUA 1T3GA 2PSSA 2A9PA 4AZ0B 4MPRA 5LBIA 4OI2A 3TTYA 3ZU4A 4ARIA 3CRNA 5F64A 3GT7A 3NBUA 1YUNA 3BCSA 1GNVA 1STOA 4OKSA 1FUUA 2VF5X 4S12A 5ERGB 1PTKA 5PNTA 3S55A 2J4CA 1JR4A 2OQIA 2X0JA 4UTXA 4D8TA 4PHHA 1TUIA 4C03A 1L3BA 2Q0QA 1F2UA 4IJVA 4RXTA 4YRQA 1XJWA 1P80A 1UAYA 3TD9A 3ZNPA 2J5QA 5FRDA 1QZTA 2C1ZA 4N01A 2K6GA 4RBNA 1ZC4A 3FDJA 4GZ3A 3L79A 1KH1A 3C3WA 4J0EA 4R1OA 3O8OB 5FQNA 4DG8A 5IEBA 3VDRA 1JXMA 1Z88A 1GFZA 2ACWA 4M9RA 3VISA 4JEIA 1U8ZA 2GBIA 1N4AA 1HMPA 1ONOA 1BA3A 1T3HA 1U63A 3PEYA 5KOJB 4PW0A 5B1EA 3ZCXA 4Y1RB 4CF5A 3DAOA 1BJRE 1LH0A 1U3UA 4TMWA 4ZA2A 4ZGBA 1NQOA 1UEXC 3ZD6A 3KD2A 3HTXA 4H18A 1HXHA 2P0EA 4WKCA 1G8MA 4HZUB 4I5IA 3IP3A 4TTAA 2VIIA 5F1OA 2G7ZA 5ES4B 2D8MA 4J7CA 7MHTA 1VPDA 2E21A 1DRVA 4EEKA 4TKVA 1U2RA 2RH5A 5ANRB 3O5AA 4HATA 2VJDA 3IQEA 1XLTC 4QXMA 3LSYA 3MWYW 3LHIA 5D84A 4C0WA 5ALVA 5DLDA 1P1CA 5C3UA 1YQEA 3G5MA 2P3OA 3F9CA 4JUIA 5K6AC 2AD1A 1RMTA 1GO2A 2B78A 2E55A 2QX6A 3T41A 4D82A 2H4HA 2W37A 3USZA 3PFWO 4MJ3A 4CI0B 4KE8A 1NBAA 4W1PA 1Q11A 3H9UA 3EGEA 2GEVA 4UULA 1KIAA 2AOXA 1HLFA 3ZWQA 1JKXA 3R9WA 3P96A 2NMVA 1PZXA 4R8LA 1LC3A 3ZD9A 4E15A 5JBNA 4H27A 3QEAZ 4QD3A 1T6XA 4NYMR 4TV8B 4ER6A 3QVGB 3N8GA 4H6PA 1QF6A 1OBCA 1YDWA 2O6LA 4HPJB 1ZCAA 1GU7A 4IDHA 1TQ8A 2WJZB 4YP5A 3U3ZA 3ZE1B 3D8BA 1WCIA 1U5BB 3GLFB 4Q4JA 3EZGA 3HL0A 3G85A 1O7JA 3M5DA 4R1QA 2OILA 5IU6A 4B3FX 2DUMA 2VP0A 2ZS8A 1Z22A 1VL6A 2NQTA 1H9AA 4ONEA 3GVHA 2AVNA 3FNFA 3GWZA 3BAFA 3MFQA 5DZSA 1N2JA 2J09A 5EJ2A 4BMXA 1SKAA 3EXG2 3QMVA 4YP9A 1S2GA 5A05A 3RYHB 2EV9A 4I9GA 2QLJA 3PE6A 2BE7A 4LHZA 2XMSA 1Y9DA 3THXB 2VDKB 5K0NA 1EPUA 4U39A 1DKRA 2BD0A 4DLRA 4NMMA 4BN0A 1X70A 2ET6A 2IYLD 2ZIZA 4B4KA 3GB9A 1OWMA 1SVIA 4L1KA 5TJ9A 2VSOA 4ZAGA 3QY9A 1D5WA 2OXTA 1KOGA 2IP1A 3A1WA 5LR6A 5C53B 5J4YA 3W7AA 1II8B 2H4FA 4TLDA 4R2WA 4OIMA 1YJBA 4U3JB 1D6SA 1LQUA 2JLRA 3DAYA 1U7DA 1CRZA 2WVAA 2O1XA 3LK7A 5GOZA 5ALMA 1RSZA 4KWHA 3PUVA 1OZGA 1QC5A 5F12A 2GO7A 3O2SB 4A6PA 1VJGA 2Q3MA 1KRXA 1FK8A 5DCLA 1D2AA 2YHAA 5JS7A 1ZIPA 4G07A 3V7UA 5HVNA 3SQWA 1PJLA 4QQ8A 4YYZA 1UPCA 1P44A 1XZFA 2Q7XA 3TPFA 1XRNA 3SDSA 2AG5A 3U49A 2VSXA 3HYNA 3QVLA 3I4LA 1SJ9A 2IXGA 3IMGA 3K6RA 5CT4A 2BKAA 5ENZA 4B2PA 3VC3A 5HYVA 5C7OO 4NS1A 1DOHA 2RHMA 3L4EA 3R6DA 5J2TF 3ZHYA 5AVSA 1I5EA 2HRDA 3U40A 2WZCA 4RY0A 1AY0A 2XXJA 1KI8A 1QVWA 1L1RA 1M2FA 1UKYA 2VHVA 3RREA 5TIIA 5JNUA 1Q91A 5C52B 3S1LA 4DRZA 5A0FA 3CLKA 1NXWA 1HSOA 3TJZA 4G81A 3OEEA 5FPHA 1UBMS 2I76A 2WJGA 1DEAA 3COJA 4EYKA 1OH7A 4HLCA 5CK4A 1JIXA 5CD9A 1J2TA 1M34E 1TZCA 4IH1A 4M9SA 3IDQA 1NGSA 4D3YA 1CUSA 2MWMA 4E5DA 4JXXA 1KDPA 3BB3A 3KWLA 4YB8A 2EF0A 2GPAA 3FIUA 4UDNA 3QYAA 4CM4A 1O6CA 4R5MA 4HT3B 5BWOA 3VYSB 1A97A 1PK9A 3PFGA 2DTXA 3AV3A 3TSWA 2DVMA 4OHPA 3R5SA 1TVKB 3P9KA 1TU0A 2VSFA 3BGIA 1E98A 4FDTA 5J59A 4L8VA 1D2GA 4JLOA 4KAFA 5DM60 1U81A 4B3CA 3OTHA 1MJNA 1VJTA 1UXGA 3A6PC 1ZN8A 2P90A 2YUTA 3BWVA 3OCZA 1T3TA 2QIOA 3OVMA 4QSHA 1E69A 2YMQA 2CGEA 2Y1DA 3LHSA 5IBPA 4R3NA 3GGSA 1QR6A 4CIWA 2DHDA 1PZHA 4Y9UA 4IDBA 5JECA 4QJ5A 4KHPB 2HJVA 4TL9A 1C0KA 1NJSA 2QD4A 2PH5A 4S2EA 3M4NA 1W4LA 1F0YA 3HGQA 4IUDS 1HYQA 1A95A 2TRSB 1SUSA 1NWHA 1GZ5A 2Q5CA 3Q1LA 3IBTA 1RCUA 1CUJA 2BGIA 1NVAA 3C1AA 3QGMA 4FLMA 4U7HA 2BH9A 4AYTA 2V3CC 4IX9A 2FQXA 2R4QA 2WWFA 3T38A 5ALOA 4C87A 2AOWA 4MQ5A 4OIFA 3PXAA 3BD7A 2XA1A 2I2CA 3DMGA 4O4HF 3GRCA 4GS5A 2XRZA 4AM8A 4D56A 2HQOA 2HJWA 3U0VA 5IDQA 1GA6A 3CNBA 4TWRA 1NNI1 5ADVA 3VKHA 1AQYA 1JECA 1MCZA 2FVXA 2GRAA 4YBZA 4DXHA 1DJMA 2F7SA 3R8FA 3NHFA 3DNMA 1F60A 4GPZA 2LCQA 1DL5A 4LV8B 1TU3A 1IB0A 1U5AA 1XU9A 2F9FA 2P5YA 3B6ZA 3BQMB 3I01M 1CY7A 4TYPA 4WXPA 4BQPA 4JI0B 3V3KA 2CUKA 4O02B 2MR5A 4W5QA 1XWWA 4LRSB 1TM2A 1A7UA 2QNIA 1JDPA 1N8KA 3CMCO 2NZVG 3EVCA 4GVLA 4INOA 1KPGA 4XLTA 2M2IA 3J7TA 3PWSA 4CKWA 3L7OA 3CLUD 2H1CA 3FWPA 4NI5A 3MJRA 2J9XB 4KI0A 5AJVB 3K0AB 2XVXA 2ZDQA 4EHHA 5LJIA 2O2SA 3K05A 3HABA 3ZCRA 3IVCA 4J91A 4PG7A 1C7QA 4ZQEA 2NIPA 4W8HA 4KPGA 3OX1A 1VG9B 5JWHA 1UMDA 5G41A 2F67A 2BWJA 1EX1A 1GPMA 2HNAA 1PVDA 2IYWA 2RHOA 4S1WA 2RCYA 2VN8A 4UUQA 5G0UA 5GM2A 2YBEA 2QR3A 2DFDA 1V96A 3B5EA 4KQ6A 4LOHA 2HL6A 4YV2A 3RD5A 1D4AA 5HCIA 2WWVD 5BR7A 4Q1VA 3TBKA 2A9RA 1FLDA 2WMYA 5DHPA 4YRPA 4ZOCA 4KXYA 1CJTC 3RJ5A 3PGXA 2OXRA 3BE5A 5U9CA 2FPMA 4OI1A 1UBOS 5DI3B 3DTVB 1U8TA 2QL7A 4EK9A 3NIGB 4JQZA 2RGAA 5BV2P 2XEDA 3K1AA 1NKVA 4KUEA 4YJ2A 1G20A 3PD0A 3T7KA 5D00A 1JR3A 4JROA 5AJZA 2H1RA 4CDRA 1N6HA 1JE0A 3BMNB 3KJEA 1ZD5A 3TOVA 3U4AA 5CEJA 5IKEA 1OREA 2I7CA 2WUFA 3H11A 1GNTA 4JT2A 1OX4B 1SVMA 2QLMA 5AW5A 1QDLB 2H1SA 3UYLA 4C7JA 2XW6A 3DQQA 5DXJA 1N36B 5I9BA 1OFIA 1XN1A 1NBIA 4OXQA 1GARA 4GO1A 3NORA 5TJHA 3OFJA 3B2EA 4OFBA 3KHKA 4RKWA 4RVSA 5C1IA 2QMZA 4CW7A 4ZCPA 4P58A 1XP5A 1CZLA 4RVGA 3T7RA 1P8AA 2D62A 1L3CA 5K0TA 4DC9A 1N33B 3BIXA 2EZ9A 3E6AA 1LLUA 3JXEA 1EINA 3GEEA 3OH8A 4FSHA 4L9WA 1TADA 4BP9A 1JGTA 1M2VA 3X1DA 2QTVA 2XI4A 4KACA 4JJ8A 3RSGA 1OUMA 1HL7A 1QF7A 3I9FA 4EYEA 1OX5A 5K0BA 1FQKA 3VUFA 5AM3A 2QY9A 3KYJB 3FNEA 3ME5A 1TVCA 4PPYA 5JMWA 2C95A 1WSWA 1A1SA 1SVLA 1U0RA 2NVOA 4RSGA 4HFRA 4XB6B 2X9LA 1FPQA 4BWGA 1SXPA 4JNKA 1V6CA 1NM5A 2FEMA 2DWCA 1HSZA 2VH1A 2C57A 1O94C 4PG4A 2OYCA 1RBMA 2CEKA 4TKZA 5E2BA 3OD5A 2NPIA 3A4LA 2QVCA 1B2RA 4QASA 1K08A 4BJ3A 1JQKA 1ETHA 5KYUB 2PZLA 1R6TA 1DIHA 2WNIA 3GNTA 4R0MA 5AW6A 4ETMA 3UGQA 1Z8FA 2H9IA 2IHYA 4B5KA 3RK1A 2VHZA 2HQBA 3WNDA 2KB0A 2IZZA 4IXDA 4UU8A 4BO0A 1SN7A 5JANA 1CIJA 5FFFA 1IM5A 3WLIA 2ZUUA 2BFEB 4KR3A 1YS2X 1IUKA 1L5YA 3T7DA 2H3HA 1N0UA 1A4XA 2P8JA 3ND6A 2IHVA 4BUJA 3BQNB 1YD7A 4P22A 4MS1B 4R4JA 1SKYE 1KC1A 3CR7A 4XFKA 1JHQA 2BJHA 3AR2A 2POQX 3IRVA 4UXIA 4XI9A 3UIEA 4NK4A 1UP6A 3DE3X 4RD6A 2IYPA 4LZAA 3UKOA 3D1VA 4ADSG 4AYWA 1AS3A 4B3MB 3BXFA 3WOHA 1N75A 2JLZA 2IIVA 2P8SA 5HGXA 5J4KA 2X0RA 4OQFA 3GLTA 4QQRA 3WGUA 1W88A 3ZHSA 6ABPA 1IN6A 3HCDA 1J22A 3EZ7A 4JB2A 5AYVA 5J2UF 3THYA 1EP1B 2C7PA 1Y3HA 4ZDJA 3RUCA 4K3UA 4DZRA 1AKWA 3LDUA 4NZZA 2QTLA 1J00A 3TLAA 5L4NA 1YJAA 1A2BA 3DCYA 2DQ4A 3M1IA 1ULTA 1DSSG 3OZXA 4GXNA 2FR8A 3AOEA 2PMFA 3ZR4B 3WNVA 5G1OA 4ABTA 4DGSA 4MIOA 3PWKA 3VR4D 4NMWA 5EMLA 1U9IA 3IAEA 4C29A 1DFGA 2JJ2D 1DP4A 2WR8A 3CN7A 4Q19A 1ZIYA 5E1OA 2CL5A 1ZQ1A 3H1TA 3PXCX 4NPCA 4U0JA 2A9JA 3ZYZA 4D4GA 5IBQA 1F7VA 3JQQA 1X42A 2A6PA 2PQ6A 4PNZA 1GU1A 2J59A 4NCBA 3RWOA 2IE0A 1NM5C 3LCRA 1Q0ZA 5FWAA 3KZOA 4FGLA 2KHZA 1E9BA 2H2HA 1R4NA 2EF1A 4JVLA 3CUYA 4X9XA 4XCVA 1F8YA 3R0XA 2XYPA 1QV7A 4ZKEA 2YW2A 4HDNA 3K70B 1OI7A 1XD9A 1XL1A 2WSIA 1GTJ1 3GW8A 1FS4A 3SE0A 3UXMA 2FPWA 2EWVA 3N2IA 2VG8A 4R1NA 4KWIA 3NB0A 3OJEA 5JE8A 4FEGA 5F5LA 2VJNA 1GL6A 4MW4A 1PF7E 1T4GA 2QTGA 2UYYA 3RGWS 1J0DA 4TV9B 4EENA 4IYRA 3U7GA 1UR5A 3M9LA 1TYZA 4QUJA 5E6RB 2BHTA 1JG1A 2PS1A 3DULA 1TCCA 3VPBA 4DB4A 1G55A 1UJNA 3Q2OA 4LYYA 4C3ZA 4YUVA 3B5JA 4QREA 4DQVA 5FPKA 4BY9E 1A71A 1SD2A 3JQDA 4GOOD 3A32A 1S9HA 2PDAA 4M0CA 1YBFA 1DT5A 4E5KA 4PX5A 2IUEA 1NW9B 2N46A 4L73A 1YZ3A 3IELA 4NYMQ 1T2NA 3V8PA 1ZMRA 4FHEA 2H08A 4HNAB 5I7SA 2WG0A 2VDOB 3NVMB 4G97A 4G4SO 3B3QA 2LR0A 4P31A 4Z0PA 3VDMA 3VOBA 1Q1QA 1OT3A 1Q95A 3U7IA 1BX0A 2B0CA 3ZDDA 3OSZA 4PGAA 2H4YA 2XMDA 3M34A 1VKRA 2AFIE 3AL3A 3B1YA 3GDWA 3KB8A 1F0NA 5IUNC 2CL0X 3GNQA 2AOTB 3ZHQA 2RKBA 1J39A 3BL6A 4HXEB 1FDSA 1C4WA 1E62A 1GKIA 3CZRA 3GL9A 3P9XA 2ECPA 4YI5A 2XECA 3CJRA 3JD4A 4KO3S 2FR8C 1N9ZA 1I6KA 4GZLA 5TX7A 4N82A 2Z3WA 4NZPA 4WKPA 4C2BA 3MINB 3L7NA 4LYAA 2WWWA 2CXSA 2RGNC 3C98A 2R8XA 2YXDA 4KV9A 4BMYA 1FZQA 3NTOA 1Q20A 3PNBA 4TSFD 2Y0CA 1GN8A 1EBFA 3EPRA 4NQZA 1QBGA 5A9SA 1ZI8A 1P2BA 3BS4A 5L7TA 1XF9A 1JEAA 3MTJA 4LJLA 1IZ8A 3VYRB 4CM1A 4JYPA 4BLVA 1MB4A 4LXQA 4YFYA 3W9UA 3NOVA 1QGAA 3O83A 1Z4PX 2ROQA 3LT5A 3PQ4A 4L51A 3K2BA 4X1KB 4BATA 4KYVA 1D6NA 5G1NA 1ISSA 1YHNA 1PYOA 1AE1A 1F48A 2PUTA 4W1RA 5GJVC 2FW7A 4RVDA 3KUXA 4D9IA 1WUIS 5G0TA 2HMAA 4J0FA 3ZX5A 4F45A 4J1QA 1Y48E 1E0AA 2Y6UA 1ESDA 4AP6A 3HSKA 8ATCA 1EGHA 4G3XA 2EFDB 2Z9BA 3PNPA 2HADA 1U99A 4NONA 4ND5A 3ZK9A 5AVZA 1AQUA 5DNAA 2Z95A 2DKNA 1W94A 2WTAA 4M1OA 3L18A 4YRGA 4EDFA 2BPOA 4QPCA 4RJTA 4FWTA 4NDZA 3EZYA 5J58A 2R751 4ZYYA 1J24A 3ESBA 4YJ3F 1Y9ZA 4UC0A 4EMTA 4JD5A 3DVRX 4O59O 1L4FA 2R6ZA 3A2NA 3Q9LA 4L0DA 1E9RA 1L4BA 5AXDA 1RHJA 3DZDA 5LP6B 2C98A 1T0IA 3M82A 1T2DA 4G9GA 5IK2D 2BJVA 3LA6A 3R4VA 5LB2A 1IWPB 1A72A 3UB3A 3W5BA 4FEAA 1UZLA 4P2GA 3WFJA 1K98A 1NXQA 2F43B 3OOEA 4R8MA 5BRAA 2J85A 4DCJA 2V6MA 3RVDA 2XHZA 3EWNA 1ISHA 5FI3A 1VL5A 3O92A 1AX9A 3N5KA 3I9KA 3UJCA 4WVLA 3NU1A 2PL1A 3BGVA 4RXMA 4EUKA 3TRFA 1JQEA 5A9TA 1PJRA 3UOAB 4IS3A 3V6MA 1Z9BA 2C9CA 2PHZA 4B4OA 4EW3A 2O3TA 3WLKX 2DSNA 3T7AA 1ZH0A 1FFGA 4HWKA 2X5NA 2YJGA 4FOSA 2B5VA 3ZBPA 4BEVA 1PJBA 3WWYA 4EYQA 3H9EO 5IJAA 3IILA 4PSKA 2BGJA 3PRKE 2RAUA 4Q1FA 3U81A 1Y3IA 1E1KA 3CPEA 4DUGD 4ENQA 5KVVA 4O8ZA 1Z63A 1JEOA 2WF9A 4DNQA 4MRMB 5F35A 3GBSA 2QROA 3QQPA 1Z47A 4R98A 3ICQB 1OIVA 4ZT2A 3ANMA 2BP7B 2FFRA 1WW3A 1WRBA 4HRYA 4DLPA 4ON9A 3MHPA 1JZQA 4DVGA 1K9SA 1BJKA 2E5FA 2RK4A 3CX7A 3HCNA 4PZCA 3Q10A 3WK4A 1CNEA 2WJ6A 3H04A 4Q7EA 3UAVA 4CHTA 3LYHA 1E2IA 2AYXA 2WG2A 4G9EA 3ABOB 3G0GA 4OQXA 5LLTA 2CMDA 4TWJA 3HR4A 4YAWA 1ORRA 5EJ6A 4N41A 4TUYB 4BIIA 2R68A 5A2GA 5B7GA 3GLGE 1XEFA 3T12A 3E27A 4KQ1A 1E20A 4WBNF 1H2HA 4ZK2A 3RVJA 1JNYA 1RTTA 1SB9A 5AI6A 3VFDA 1CJSA 4DY4A 2OBBA 3HXOA 3TNLA 1UJCA 2OT3B 2WAXA 2XGMA 1JAIA 4AJJA 1A69A 3LK6A 4D98A 3UCFA 3TCNA 3C1OA 2FWBA 4IHQA 1C1DB 3ZY2A 4DWVA 4DZTA 4YCAA 2R1UA 1ZINA 3LUKA 4C0AC 3D8NA 3UANA 3ZGYA 3EY4A 1P17A 2SCUB 2FEWB 4LBWA 3RR2A 1KAEA 4UAJA 3O31A 2VHUA 5CNJA 2WOOA 3MQ4A 4C1NA 4EY7A 1NQUA 2QG9A 2D2FA 3A6ZA 1E1NA 1XPOA 2D5BA 5TF0A 1L5GB 2YW9A 3WQBA 5EOVA 1O95A 3R4CA 3BE8A 4FE7A 1A82A 3CA8A 4DWOA 2WM3A 2X1LA 4FYVA 4CIAA 4X7MA 1DHRA 1XTSA 3FJ1A 3K0SA 4L02A 1N78A 1BD3A 2O0LA 4BU0A 3N7AA 1SC9A 2VAMA 1SXJE 1PJCA 2OHXA 3OPVA 5DTMA 4UOQA 5DBGA 5A9RA 2R7LA 4PTLA 3O90A 3VAZA 2F59A 1SR8A 3HSSA 1L7RA 2ZSFA 3AUJB 1SBTA 4CU2A 4LYDA 5HZMA 4BMPB 1A9TA 2XKAA 2C61A 2Q4DA 2XSZA 5KS2A 2AYYA 3QPWA 5L3ZA 4RL4A 4CQLA 4MEJA 2PLRA 4DIOA 4UEOA 4HUQB 2PD3A 4OHRA 5CXXA 4KXQA 3TNYA 5DM70 1JLHA 2X5JO 3IMKA 2HSJA 2J30A 3N74A 4PS1A 4RTNA 1OH6A 3KD3A 1NNEA 2XMGA 3OT1A 5ALLA 2A86A 5BNTA 3E9RA 4BB0A 4CLRB 3AVXA 2B1IA 3AVWA 4HLDA 4FFPA 5KNBA 1Y6JA 1U1FA 5CB4B 3ZHTA 3C5EA 1BFUA 4CIDA 3WYDA 4JODA 3LUAA 2ZZKA 3JSXA 1R5JA 1QCYA 2B8JA 3UAZA 3PS9A 5TMPA 4F2PA 4DV7B 1XKTA 1RADA 3OIYA 4OHYA 2R48A 4DREA 2YDYA 3BL5A 3DM5A 4LJAA 5BSMA 5TE9A 1EE1A 2XVZA 1Z4KA 4GX2A 4MR7B 3P2OA 3IP5A 4BEJA 1OGIA 5CLGA 4RCVA 2XQFA 1DAIA 1U4OA 2YIVX 3FSJX 1OASA 1LKZA 5E38A 4ARSA 1YI0A 4XGRA 4INPA 2YVUA 1KHTA 3PA8A 3JAMA 4CMCA 1UBGA 2VEDA 5I5EA 1WPRA 1GQ2A 3JAWA 3SEFA 2PRJA 1X13A 4RNDB 1DXQA 1Z2OX 2FWJA 3PD7A 3RDPA 3FB4A 1IDN1 3FOCA 2JB9A 1PFQA 4M0EA 1L9XA 1SCDA 2R6FA 2K5UA 4AO8A 2QQEA 4JA0A 3RTAA 4CUKA 1OXBB 5CDHA 1L4YA 1JPVA 3P97A 3IQXA 1Y34E 5JQGF 4RY8A 3AHJA 5JR3A 2QJOA 1RM5A 2JNWA 3A3OA 1O95C 3ZWBA 1K4YA 2W11A 4HNUA 1YZVA 3OTGA 3SP1A 4O25A 4KN5A 4QYXA 3DYVA 2QYHA 5EKUA 4AJLA 3PPXA 1W46A 2J48A 4TZTA 4XJVA 2GILA 5D1NA 3GRRA 5EVJA 4X6YA 2DHQA 2HU2A 5IEJA 4N0DA 2QR5A 5LQNA 4DRXA 1WCV1 2OGZA 4IQ0A 4U6NA 4GEGA 4JR2A 1Q57A 4RTSA 1KAOA 1R8JA 1X1AA 1AMUA 4PYJA 2QAGA 5LQMA 3PC7A 3FTEA 4Q37A 5HF5A 4NQRA 2JGDA 4C5AA 1QP4A 2AG8A 4F8YA 4HC4A 5DI9A 2A94A 1SKMA 2P75A 4MVYA 4HMPA 1LSJA 3HBFA 3OJ0A 4IIJA 2J33A 4UU7A 3C3XA 3GPBA 3UK0A 1FFYA 4KR0A 1E0DA 2A9VA 1IG3A 1RPJA 3CB4A 4JVOA 1AN0A 4OYLA 3FOWA 4EVSA 2CW5A 1HOTA 5EHIA 2V5UA 2EGUA 4NPHA 5EJ4A 2SBTA 1EA7A 2E48A 2YN4A 3S6JA 3OEED 1ODSA 2C3YA 1RKXA 3FVVA 3F90A 3ABZA 5CIWA 5A6SB 4HDCA 2ZYTX 3RSZA 1T25A 3PXDA 3SC6A 3OKCA 5ITVA 2AWOA 1AZWA 1FMFA 1MO3A 1U7HA 1YE5A 2G0TA 4QTUB 1ZFNA 3LOUA 2AJCA 4J1TA 5D5PA 4BRSA 1KAHA 5CYGA 4ND8B 1P5ZB 2RB5A 5DRYA 3ZV5A 4BV9A 3W9SA 3X1MA 6GPBA 3ORRA 5JYCA 2ZIGA 2VSNA 1AM4D 3I45A 3VSAA 1AO0A 1N32B 5DW3A 5C1DA 1ZM7A 1JTFA 5KQGA 1ENPA 5FX2A 3QELB 1JDSA 3H6GA 5GJCA 2ZVQX 3VZSA 4UE3S 4Y9RA 4DMKA 3OKPA 4GOLD 4V0OA 3RIGA 2Z1NA 1SXQA 1FFCA 2WMDA 1WDWB 4FDLA 3PPWA 3F6EX 4ZARA 1RRMA 2MHCA 3UHAA 2PM8A 4AJEA 4BC1A 2O2EA 2IPLA 1J21A 4HQFA 5DCWA 1M3SA 4PE5B 3W2IA 5DWDA 1EKXA 3HV0A 4NEGA 1T5OA 4PZ0A 3L05A 5K8CA 1M0SA 2WFLB 2BM9A 3IQIX 1ZM3A 4XIGS 3MPOA 3FNGA 5ICGA 1T9CA 1G21A 2C92A 4AF6A 4DFDA 1JKFA 1JXQA 4H3KB 4ND3A 4XSVA 4MI9A 1U3GA 1T24A 4Y2UA 4GQIA 2IELA 1LDEA 4DG9A 5DSXA 1EM8B 4K1XA 1F14A 1P5JA 2QVGA 1TA0A 2JDIA 1ODKA 3KTAB 3QEMB 3SQNA 1DRWA 1MV5A 4LZPA 4DM7A 2WM8A 3AHCA 2V9PA 1IY1A 4XGKA 1HLDA 1JBQA 3V4RA 1WBBA 2ZANA 5CTAA 2V55B 3H9JA 1BWQA 5HOQA 3QTLA 4OQMA 1TNDA 2Y4OA 3E9CA 4TRJA 2YVLA 4F4IA 1OC4A 3GLIB 2CVQA 3N0TA 3QVTA 1C1XA 3NFYA 4QUKA 2IXAA 2C4WA 4OYYA 2QBYA 1XLVA 3FPHA 5IC4A 4CN9A 4DMRA 3FYCA 3KYDB 1U7OA 1QH9A 2GZMA 4KK3A 3CISA 4CTNA 3S0JA 2EKQA 2GLTA 2ODBA 4D97A 4TZKA 5FBVB 4F4DA 1QG0A 1VHTA 3KSAC 3OJLA 3SKYA 3T54A 3G9XA 1G17A 2LW7A 3JRWA 4EGQA 4KREA 1NBME 3DTNA 2C8KA 3HP1A 3SIRA 2Q1XA 4JKYA 4AJPA 1BX1A 1HY3A 1OCEA 1QPGA 2ZIVB 3TTWA 1OBOA 3DDZX 2IKQA 4LE0A 5G0WA 1IZYA 3M3PA 2JI8A 4OHUA 1TL7C 1BU5A 1BJTA 4IDFA 3U39A 4YEDA 2YY5A 2EKBA 1ZOLA 4PLVA 1QFXA 1XNJA 1FS5A 3AIOA 5G1PA 3FPSA 3KLOA 2NU9B 2HDWA 3U44A 2FNAA 3O0TA 4KMOA 3T7EA 2ZIXA 4N54A 3GHYA 2VH5R 1M0EA 5TS2A 4ZOLF 1UPAA 4EHFA 1UF9A 1OXSC 3RYFA 2NPFA 1AMOA 4UE6A 1GR0A 5JNSA 1ZX1A 2JFFA 3MNFA 3I53A 1JR3D 1ZUNB 4WLOA 1Z17A 1YU9A 3G5LA 3EFBA 3L0IB 3FHTA 2J3LA 4LTDA 3AFHA 4CM8B 1XEWX 1T6BY 5EZ6B 5LC1A 2O8NA 3F47A 3VOAA 1BN6A 2ZAMA 2PUGA 3PVSA 1DEOA 5BN5B 3OZSA 4AKEA 4D7AA 3VI3B 1V0JA 1EAMA 4F4CA 1WDTA 1LI5A 1D1PA 4MEBA 1JHAA 1WPXA 4RHUA 3RAGA 3Q40A 4RHTA 4Q1BA 2AL7A 4N03A 4LV5B 3H7IA 3SS9X 4DMGA 3IERA 4CV1A 1P4RA 3QI7A 3WWPA 4B9AA 1U0EA 3OMXA 1XBTA 2AZXA 2WHRA 3SXUB 2JFXA 4KG7A 2M1ZA 1QCCA 1QLJA 2QMHA 3L1KA 2HPVA 3H99A 3I37X 2G3YA 2JIDA 4G89A 4MP6A 3THSA 3E7DA 4UMDA 3UT0A 4YPVA 3OCUA 4WDQA 3TR6A 4BO8A 4AX8A 1HDIA 5A1JA 1EP9A 5AM1A 4WLEA 4NDNE 4HO1X 2P7IA 1RI3A 1P74A 1WO8A 2B4AA 2C84A 4L85A 5EA2A 2O8CB 2Q3EA 3C5CA 1HETA 1SBIA 3NXSA 4MIKA 2XCSB 1CDZA 1EHYA 4PZZA 3ZIUA 3FCYA 2R11A 4OKNA 4D79A 1NLFA 1BS2A 3WGHA 4CR6A 4CLHA 2ZLBA 1GPH1 1THZA 2AZTA 2P4HX 3DT8A 4NXNB 2EJUA 2EATA 1F9AA 1JEQB 1MNQA 3NWPA 1VI2A 4ZOAA 2EU8A 2QMYA 2VUHB 2KBEA 4LQ4A 1O0SA 3T3IA 4Q4HB 1T9GS 1C80A 4IINA 4ILKA 5IANA 4RLSA 2G1KA 4AJOA 1PEYA 1AKNA 1D1QA 3GZNB 3H2SA 5GMOA 5B1IA 2CV1A 2K4MA 3B6MA 4AKIA 4DAEA 3STXA 4BAUA 2Y67A 1XJQA 3NTQA 1TYCA 3NBZC 2BFDB 3SM9A 4AY6A 1IY0A 1VE1A 3BFVA 3Q9NA 5I47A 2WTMA 2HQRA 3F7OA 1XA3A 2F55A 3QLVA 2I8AA 2PQ0A 1KJNA 1N2BA 2II6A 2OCIA 4GXQA 4I4TA 4PG8A 2OC9A 2R5WA 3ROKA 5HMLA 5DGXA 3OCVA 1OIWA 4EGAA 4BFTA 2A0YA 3PL1A 3RSSA 2C9OA 2FSFA 5HTKA 2VYVD 4G8JA 1QRAA 3INNA 4OHFA 1JFFB 3OM9A 3ZQUA 3FTFA 3IIMA 3KOOA 4H1TA 4RPIA 3NP9A 4L8FA 4UVIA 2GTPA 2IHNA 3OPYA 4G0WA 1P9RA 4KTVE 4ILEA 3CONA 4EPRA 1LK5A 1YMQA 3L04A 3NDPA 1I3LA 4G4SP 4L9AA 4RACA 3JWEA 3O26A 4FJ0A 4MWGA 2QSZA 4NPAA 1A27A 1GEEA 1ODCA 4IVRA 4NAUA 2C5EA 2XUFA 2XWBF 4IL5A 1TGVA 3SR4A 4ZJPA 1X8LA 4DM3A 4GMKA 1EHCA 3DZGA 3OA2A 2R60A 3L0SA 4V0ME 1PV1A 5FEMA 3RS8A 4D4KA 5B5SA 5CBKA 1ZK0A 1QVRA 2QUHA 3ZIAD 1HFJA 3EIWA 3WGOA 4JB0A 4UM7A 2DQYA 4URXR 4KRYA 1SFRA 3C5WP 1S2NA 2WTEA 4JA2A 3TLBA 1B41A 1VC2A 3TJMA 1TJ5A 2JAOA 3ZE0B 2GD1O 4WPGA 1BTOA 1DMRA 1L5RA 2O5EA 3PBKA 5JQGB 2A5LA 4CEIA 4UM9D 3H0KA 2PPVA 1RI5A 1ZBDA 1Q21A 1B26A 2V0NA 3E9DA 5KNLA 2DG2A 1IOVA 1Y42X 2E3JA 3FRHA 2FUCA 4JLAA 2G80A 3DEFA 1IHOA 3S4YA 1WMDA 4RMJA 3QOXA 3VNBA 1LBQA 3PJDA 2O7VA 1Q12A 1RFGE 3ASZA 3EJ6A 4MOWA 5LDGA 3TFOA 3D3QA 1CRQA 3M6LA 3OLQA 5FOWA 4ZC1A 1LWOA 5DKFA 3IAHA 5HZHA 4AY2A 4NMLA 2OZKA 3K32A 3HWWA 2WUVA 2X1HA 1JHMA 4BX3A 1BH6A 3VAYA 3OZVA 3QQ5A 4QTYA 1NIPA 3T9AA 1VI6A 1ZCFA 2E9SA 4LNUB 1XNRB 3ANSA 3VKVA 4DTIA 1XQWA 3R7SA 5IMSA 3QLVC 4YAJA 3WKDA 4UFNA 1XRJA 4G0OA 1AGYA 2VZ0A 3E48A 1K8RA 3H87A 2HTEA 4BLOA 5LL6P 4H9GA 3SGLA 3O94A 2PCJA 1G1MA 1MQAA 1VDMA 3M49A 3D7SA 3ANTA 5DK4A 4C2AA 5H7XA 5H80A 2I3AA 2WU4A 5HTOA 3BSYA 4YLGA 2QTAA 1NNSA 2GASA 3QBTA 4TTSA 5G4KB 3ZVNA 3OZIA 4NMHA 1RMYA 3KQSA 4M0MA 4ZVTA 4CPDA 5HQ3B 3O8CA 3R5FA 3NNDA 4I6EA 3GD7A 1H3EA 3UMVA 3IYLW 2A67A 2WLTA 3KB2A 1PVVA 1N6PA 1WZNA 3DAGA 4S3MA 1YCFA 5FNVA 3PRJA 5DHQA 2Y9PB 1T35A 4FJ1A 5C46F 4PZYA 3MRVA 1OV6A 3TXYA 4NV1A 4PLTA 2J31A 2NM0A 4RPCA 3S99A 3W4IA 4C7VA 2J9RA 2W00A 2OTCA 1PL7A 2VHXA 4HUJA 4C89A 2ZTUA 3FGZA 1VPLA 3MJEA 4JL8A 5ELMA 5FTLA 5JT1A 3MXOA 1E6EA 2C5LA 3RIHA 3W6UA 3IUPA 1Q17A 2C8LA 4WLNA 2V7TA 4GLLA 4LDRA 5KDLA 3SM3A 4CTJA 4F6RA 5L9AA 3K5WA 1CBUA 2P77A 2Z83A 4OUKX 1LDBA 4BLSA 3IAFA 2YJ5A 5BNZA 3D6FA 2LDBA 4LJ7A 4C0SA 4RV5A 2ZJZA 1XTIA 2Q4OA 3PDIB 1EQ2A 1LS1A 1XL0A 2H1WA 3LBFA 4XXHA 3WL6A 4PQGA 5EG5A 3MUFA 2BHSA 1IM8A 1J99A 3I34X 3IQFA 3LPCA 4KAXA 1C9YA 3IAM1 4I5DA 4WKBA 5F3WB 4QNRA 1W36D 1F8FA 1TM1E 2VA8A 4G23A 2NUAB 5C2JB 5LWHA 3I4CA 4ECAA 3C8MA 1NUTA 4I2NA 1S2DA 5EYPB 3PUWA 2ONYA 4E4YA 3BWMA 3PKJA 1H2XA 4D4HA 4KQXA 4KCGA 4WZBA 3PPVA 5B7QA 2EIHA 1TM3E 3DLCA 1X86B 2AN1A 13PKA 5D3QA 4PWYA 5CT6A 1EWYA 2AFHA 2PQ2A 4UQPA 4LOIA 2OFWA 3AP3A 1A9XB 1FP4A 2FPPA 1RDFA 1VLMA 2AHRA 3AETB 1TVEA 1XU7A 2R8OA 1YI8A 4JITA 4ERXA 4H2DA 4DKJA 2F3TA 2FP4A 4BFCA 4NOJA 3EGCA 5H9WA 3KK0A 5FBHA 4OBEA 4MGHA 1VFPA 2XXBA 1EDZA 1M2OB 3QXHA 4II7A 4I1PA 1E5DA 3BMOB 2RBGA 3A1TA 3JQAA 5AVUA 2CDAA 1SD1A 3DZBA 1J97A 5SY6A 3CTMA 1CQJA 4RKFA 3VVMA 1PJ8A 4AFNA 1TEVA 3TO5A 3R3HA 4IILA 1ZVVA 5DK6A 4FFBB 2C0CA 2CNKA 1JBEA 1FUEA 1GUAA 2QJWA 2IF0A 3IPLA 1PFYA 1PSDA 2DTEA 4H3HB 4LEIA 5DO9A 3KR1A 3MLBA 1NYQA 2Q1YA 1ABFA 3TNDA 4BWVA 1GQYA 4JUCA 1EUQA 1E32A 2WV9A 1KS2A 4MUFA 4PTZA 3W06A 3G13A 5D6OA 3R7WA 2WNSA 3OOYA 3BXEA 2WV7A 2H1FA 2CDRA 4FNMA 5BMVB 4HN4B 4UKDA 1DUSA 3KXKA 1W7AA 4B2YA 1EP3B 1VCMA 4LJSA 5LZ4A 3ICCA 1FYDA 4M87A 1NYTA 1PG5A 3HN6A 4RJKA 2DCMA 1U0BB 1AHPA 2Z2JA 1SHLA 4WBNA 1E94E 2AK2A 4BPRA 4GRAA 2ATEA 2YV5A 3QF4B 1T8TA 6AT1A 2ISSD 3ILVA 4AZWA 4XIFA 2GF2A 4WCDA 3SXJA 2MTBA 3WLSA 5BN3A 4X1OA 5BQXA 1APBA 2M6KA 5BWNA 1GLGA 3RIMA 5F52A 2DYKA 4A0GA 4ES6A 2YHIA 2JLCA 2VF7A 2HU5A 4JX8A 3F49S 2GBFA 2HNBA 3P2KA 3UKJA 1DIRA 3GJTA 3H1EA 3GP5A 1EXWA 2HIMA 2OMKA 1GNQA 4EJ0A 2FN8A 2JA1A 4OQEA 3IV7A 1E4EA 5TVKA 4GVPA 1YK0A 2DOKA 3SX0A 5BWBA 821PA 5IVKA 2A84A 1JQ3A 1X94A 3PJFA 4FYHA 4XOUA 3RVPA 2VXYA 3L0PA 2NV0A 2NNLD 4GC5A 3W3AH 3WMXA 3HCRA 1D3AA 2VPTA 4LV6A 5KVQA 1UFVA 1WOMA 2KBFA 1M54A 3PTLA 1T1IA 3WGTA 1PL0A 2PZBA 3WYGA 3HXQA 1O1YA 3N6VA 3QU7A 3U4QB 4J4HA 1LDYA 4TLAA 4FQ5A 3KWFA 3PQCA 4E33A 4M6WA 3UAYA 1PZFA 1YACA 3IAS6 3TSZA 2O2JA 1LV8A 1S9DA 3F3KA 1KRHA 1QZUA 3NGLA 3VI4B 2Q1SA 1DKQA 2Q46A 2JBHA 3WLMA 3QX3A 1NV9A 1O95D 1QWSA 3AJDA 3BZUA 4JNCA 4ZDKA 3FUXA 3LYUA 3R0ZA 4KDCA 1DE0A 3CUTA 3VZBA 4QJ4A 5CLHA 1G6Q1 4GMDA 2C20A 2VHTA 3OZDA 3R1IA 1RI4A 4JZKA 3RKUA 4KP7A 1X9IA 2OCPA 3NH9A 3K8YA 1NXPA 4GGPA 1J8QA 2XRMA 4CMKA 1RZUA 1IJFA 1E1YA 1KFJB 2GK6A 1OHHA 3H5IA 4TS1A 3AFOA 5EHGA 3KAKA 1I2AA 4L9RA 3LXXA 2NU8B 3HUUA 1D9ZA 4J2OA 4OV6B 4DSZA 4IS2A 4FFDA 2NSLA 3WQSB 5KQMA 5ILQA 1NY5A 1P77A 2WAYA 1EFLA 3QYPA 5KWSA 5IT0A 3LX8A 3L7YA 1C9DB 3PQDA 4HGQA 5EMKA 2HC9A 4E5UA 2PE5A 3PLNA 1O97D 3H65A 1ZIOA 2Q4TA 4YRJA 3F8WA 4AK9A 1JLKA 3MC1A 1SXIA 4CM3A 2WF6A 4Q4DA 5EXEA 2X3YA 2YV2A 1VPTA 2QQFA 3V97A 2OHJA 2Y9MB 3IC5A 2P9EA 1L5KA 3U9LA 2DUJA 5CM9C 4A0QA 1XDDA 5KNBD 5M29A 1KPIA 1DBSA 1LBSA 4KBGA 4TLMB 4YAGA 2XUPA 2NO9A 3EBLA 1XQ9A 4UVEA 4Y9DA 1T43A 3EDOA 2ZBEA 3PQEA 2ACEA 3CB2A 3KPVA 4HDRA 4J3FA 4MS3B 4B79A 2AMVA 4BFLA 4I1IA 5CCDA 1GUZA 3AP1A 4DNOA 1XTZA 3D81A 2HOQA 5CM2Z 1NMEA 4F11A 5KJ6A 2Q3CA 3MW8A 4TQ9A 1M2GA 3CIFA 1K97A 4ZO8A 2C9YA 3GH1A 3QPUA 4I1SA 1CUWA 4RJIA 3L1HA 2GBGA 4ZYXA 4RH3A 1NMZA 1PUJA 3BWCA 1A2KC 1CQWA 3HG7A 3X1JA 2DHCA 1TMOA 5K99A 1ES9A 3KCNA 2G5PA 3CE9A 3R44A 2W22A 3EF1A 5COAA 2OFPA 1QS0A 3T99A 1BE8A 4JJKA 3RG8A 5C8DA 1H4SA 3GT0A 3Q7SA 3V5NA 2QAJA 1JIUA 1R9NA 4YAKA 3AIIA 3GVIA 5AVWA 3F5FA 1EQAA 2DPMA 2EARA 2GD0A 4JYAB 1QTIA 1JKJA 2FFHA 3FCUB 1UMCA 2DR0A 4N6NA 4NEQA 5E95A 5EAIA 5EWLA 1SCQA 2YZ2A 1ZRHA 4F4JA 1MHPA 3DZ8A 3WK9A 4B6RA 2PAAA 2JKVA 4Q12A 4Q34A 3OY7A 5D86A 2FB9A 3AUAA 1W73A 3BIWA 2HMWA 3TR0A 1ZYUA 2VPPA 3R7FA 3KV1A 5GV7A 5I3ZA 4J3NA 1II0A 3VKFA 4MV6A 2LD4A 4NBLA 1QYCA 2ZR0A 4F1KA 4PZLA 4MIEA 4XSGA 4CQMA 5B4UA 3T7JA 4YMVA 4RIGA 3WS7A 1J2YA 3BB1A 2JFZA 4ECEA 4DC1A 1Q0LA 2Z98A 3QBJA 1Z07A 2ZDHA 4RDHA 1R66A 4QQKA 5CVDA 3ADCA 4EKNB 1V71A 4Q3DA 5C5IA 3LUDA 1H2WA 1AKMA 1L7DA 1N92A 2H1VA 3IVXA 3JYQA 4I3FA 2YDXA 4NYJR 4W4TA 5HILA 4Z4HA 4PHCA 4DHWA 4N5HX 1KSJA 4DSNA 1O6FA 2EEZA 2WDPA 4IIVA 4XYGA 1MO5A 2G6TA 4YO8A 5ENVA 1WOYA 2Q0HA 1KYQA 1XPJA 3ROQA 3ABSB 1TI7A 1TZBA 3FBGA 2EDAA 4NVRA 1P4SA 1CC1S 3FCOA 1QDEA 3MG9A 1PR1A 1KO5A 1QC5B 1S8NA 1XN4A 2R1ZA 1EXNA 1VSBA 5A3JA 1JWAB 1KMMA 1HNWB 3QXGA 2Z2KA 1EFAA 4JI3B 4O08A 4D74A 4P81A 1U0FA 5AK0A 1IZ0A 4NHEA 2HSZA 2FEKA 4J0CA 1X9GA 1N5IA 2BI4A 3K9FC 4XYMA 3SJZA 3F8SA 3EDYA 3B53X 2DT8A 3FN4A 5IH3A 3TOSA 5LKRA 1WULS 4IAOA 5JI3E 1YXMA 3QI2A 4O0MA 2A9OA 3WYFA 3W6NA 4PQYA 3IO3A 4RK7A 3LQ4A 5CAEA 1LQ2A 4W5HA 2O54A 2NO4A 2H4ZA 1QGOA 2H2FA 3CUKA 5ESRA 4WGFA 2C03A 3QW4B 3RAJA 4B2LA 1M73E 3NBAA 4PGHA 5EIFA 2ATVA 2HH9A 4UFPA 4YV7A 4YGYA 3H8WA 3K6KA 4PC1A 1KVQA 4Z0TA 1K8YB 4IHJF 1G2QA 5KDOA 5EZQA 3D5TA 3UAOA 3E15A 2YY6A 1JN0A 3ONWA 4ZI5A 3WC4A 1TECE 2YR0A 3DXZA 3EJWA 1UAGA 3SKXA 3HDQA 5K4GA 3S81A 4M1WA 3DUFA 2JDID 3A1NA 3VC1A 3CIOA 4PBTA 5EKSA 5K9ZA 1BDJA 1LLDA 2J46A 1SXHA 5ALPA 1NRXA 1TUEA 4ITRC 3RFUA 4AX4A 1EJBA 3DLBA 2AF3C 4ZVKA 2C2GA 1CE8B 2CXRA 3O8LA 2FW6A 4UE2A 5MN5A 1WS6A 1M1UA 3PC6A 4RK1A 2FMTA 1ZKDA 2Z2YA 4R2JA 2CWDA 1PDWA 3HI4A 4BNJA 3JQGB 3RU7A 3TZ6A 1ZN7A 2FSSA 2GJAA 5AOCA 1TFRA 1IY8A 3AKYA 3KZMA 2PZGA 3P2EA 3QMMA 5CLQA 3GJYA 3CW9A 5K0SA 1L4HA 1NXSA 1WSBA 4UHKA 2OOSA 4K6CA 2P2CA 4S2UA 4JXJA 3FUVA 1UH5A 2RHRA 3GARA 3HBLA 2A3RA 2NYRA 3ZDFA 4F56A 3STHA 4LXYA 2VHWA 4DIBA 1GTVA 1I5OA 4MV8A 4BJ6A 3F4LA 4NZNA 5T8KA 1MVLA 3HADA 1PBTA 1R0LA 2Y1LA 5H02A 4XJTA 2JLAA 5GWXA 1IBSA 1IVSA 4WBXC 4Z3DA 1ZJ6A 1IHYA 5HUJA 4XTCS 4XGQA 3ND5A 2DHEA 2DPXA 3I76A 4C6TA 1YQWA 2VDQB 3CW2A 5FHRA 1L4EA 4FB5A 1ISMA 3VU1A 4F06A 4MIYA 3M9XA 1U7XA 3RB8A 1PTJC 4OK3A 5BNIA 2QRZA 1T36A 1LX6A 3S1AB 4JGBA 3NAMA 2UVDA 4NLLA 1UC5B 4H7JA 2OZLA 3EEBA 3PA6A 2H7YA 1BSVA 4LXIA 4ZP1A 5EJMA 4CV3A 1DKPA 1X77A 3PQ8A 2JLXA 1RQRA 4RH0A 4EZEA 4C4TA 1KSHA 4H6XA 4H7DA 4U2CA 3WB2A 3LRTA 2EP5A 1YFJA 4QG3A 3LQQA 3FTDA 1UJBA 5JCXA 1II9A 1N8NA 2GPNA 2O50A 2BUBA 4G1UC 1NNUA 2VHQA 4WOBA 1R0BA 4JMPA 4GOKA 4H7IA 2GZDA 1DOZA 2H7XA 4CR8A 4DIDA 1CTQA 3RFTA 1Z7WA 2RHTA 4LYJA 3VZCA 1SIOA 2FU5C 3NHYA 1IE3A 3DL2A 4PZEA 3UPTA 1E61A 5JAUA 5CFZA 2ZJBA 3U7HB 4YALA 3OLVA 1R8XA 1WU7A 4GM4A 3E9EA 3WXMA 2LPMA 1JQAA 1YNSA 1I4TD 1E3WA 1YVEI 3ZGVA 1WXHA 1VL1A 1X6VA 2GT1A 1HL3A 1BQ3A 3EQZA 4G5OA 4MKZA 3H19A 3LLCA 4A82A 1E2PA 3R0IA 1IC6A 5INTA 1G20B 4YDRA 4J0QA 5LB4A 3LBNA 1AUPA 4XLLA 2RFLA 2NTEA 4LRTB 5CNMA 2O20A 1GZDA 3RLFA 3BA1A 3O7MA 1KYYA 1IOZA 1EVZA 2N75A 3DOEA 4S0XA 4E30A 4EI9A 1N6NA 1PDOA 3TGLA 2PRKA 3M4ZA 3K9LA 4RZXA 1O3YA 5JWRA 2L17A 1L2TA 4Y2PA 4WESA 2KMLA 2JK1A 1T5BA 4EQZA 2EFJA 2BFMA 2ST1A 1KU6A 2VCHA 1QONA 4YH1A 4EW1A 3TSOA 4N48A 1NOJA 3O84A 3HA2A 1XZGA 4G1BA 1SBHA 4AU1A 1RP7A 4KV7A 5EP3A 2GEJA 4GL4A 3LKBA 5DM0A 2IYQA 4HSEA 3O2QB 5LXTF 2FQQA 2R44A 2UV8A 2AI2A 3I05A 4G25A 4OQYA 4XSHA 1JLLB 1ND6A 3EWAA 3VU9A 3ZGOA 4EB6B 4DV4B 2HMVA 2F48A 4NTZA 1M2VB 4FMCB 2QTVB 1K88A 3W8NA 3V6LA 4CF7A 2VDWA 4EY5A 1GZ4A 4ZEMA 2HDHA 3BE4A 1XMVA 4P83A 2DPGA 4AG6A 4RDXA 4CTOA 4RNCA 2ZCVA 1YL6A 4MMYB 2M6LA 1GSAA 4OSEA 2WOJA 4DJAA 3QE2A 1W0CA 4QVIA 1J9EA 1E2JA 2WQ6A 2AOUB 3SC4A 5JU6A 1WXEA 2VWGA 2ZRHA 3EEFA 3WLPA 1ZUD1 1DEKA 4G0XA 5HEKA 2R8BA 3L0OA 2CHFA 4DHEA 4KR7A 4IXTA 5K7SA 3B9QA 3VVBA 4E46A 2WJPA 5B57C 4ZV4A 3X43A 1QGDA 1SVNA 4L3VA 4RAOA 3ZE9A 3AF0A 2GKOA 4W5OA 3X2SA 3MGKA 1Y6RA 2P2DA 3BUSA 1TT5A 4D9FA 5JFOA 5JVDA 1A88A 3S2EA 3QKSB 4W5WA 3V80A 1RMQA 2ZJ8A 2X7XA 5J2TA 2WLSA 2XH8A 3Q5EA 5FI1B 1CUGA 3T3NA 4OSPA 3IOBA 1GNPA 4KFTA 4GAEA 3R7DA 2PJDA 5A3RA 1DQPA 2CDNA 2XV1A 4GMXA 3DWFA 3DZFA 3ZJYA 1OD6A 2CV0A 1QO7A 4CXMA 1SHKA 2DR2A 1ORWA 2FZKA 4LYHA 5AUNB 2VT6A 3T3GA 3OCJA 4GFDA 2GFIA 4Q4AA 1YR3A 5AOAA 1W88B 4O4JB 5LUAA 3THYB 4H59A 2HREA 5IVDA 3DJFA 2X77A 4EZIA 4ZZIA 3RBAA 4LFBB 2SNIE 1UPUA 4RELA 3HL4A 2WINI 4CF4A 4O5OA 4BJ1A 3TLGB 3W7VA 2GCGA 1EEXB 1RYDA 1KJIA 3LHDA 3HJHA 1IG0A 1I0ZA 1CP2A 3ICVA 3OWOA 2Z58A 3TLJA 3TYXA 1UC8A 1OYOA 1DDIA 2GUGA 4OQLA 2P4UA 5I9NA 2ORWA 4ESOA 3D8SA 1ZHOA 4AJNA 3A4MA 2IZ7A 3OQIA 2FQWA 1K6IA 2HF9A 4REQA 4ZQBA 4Y2JA 3QKWA 3G0BA 2VZ9A 1KEEA 2QN9A 5F7OA 3HU2A 3V4ZA 2LIVA 2Q4BA 1LCIA 4JP1A 3OZUA 1ECCA 4BV3A 1CXZA 4LJ4A 2YOGA 3ICWA 3ZDAA 1UXOA 1V3QE 2GJSA 4GP6A 1N77A 2B9EA 3RQSA 3X2EA 2FA9A 5ALNA 1Y33E 1YKGA 1YQ9A 3K92A 5HCNA 3KPYA 1R4NB 3IPXA 2PUJA 2ZT7A 2QRVB 4LMAA 3D8UA 4FN5A 4HDNB 3AL0C 4KK4A 1UBCA 1AC5A 4FCVA 4CMGA 3LX5A 3OE7A 5HRAA 4RXUA 2L69A 1RRFA 5BXYA 2PLNA 4G4IA 2H85A 3GYBA 2X5KO 2XUOA 3RTEA 5JMOA 3I8XA 2Y2UA 4RLFA 3FTCA 2X2OA 5IKXA 3FB1A 3BCHA 3NTUA 3IIIA 4IMIB 4O4HA 4OD0A 4U8HA 5AR1A 2LNDA 3HUFA 2VF4X 1ECBA 3T4PA 1RWMA 3P5SA 3LYLA 1KE2A 1BKDR 2REOA 2O8FA 1XSEA 2R5NA 3O73A 4KXXA 4OH1A 4XQEA 2X8WA 3DKIA 1W49A 5HZGA 4N49A 4IKOA 2JIBA 1ICEA 2CNNA 2WYHA 5IN4A 1XRRA 2PMKA 4BRWA 1DUIA 2BR4A 4LZLA 1KBOA 1JHOA 3C7DB 1EUDB 1F0PA 3AEUA 2G0AA 1KWKA 3SJ7A 1Z5OA 2V7VA 3CRZA 1Z75A 1CFZA 3DVSX 3KO8A 5JFTA 4FNOA 1SZCA 2ERYA 2FUG1 3EOBI 4LCEA 1W48A 3STUA 3QKRB 2BFCA 3K09A 3U09A 1O5OA 3WVNA 4YLEA 1R37A 4NYIR 3X1XA 2XE6A 3HRIA 4DPKA 5BW5A 3LUCA 3PENA 4OGKA 2CLFB 2D0DA 1DAGA 4GQAA 1V37A 1FNNA 3H16A 2C8VA 3N8NA 3MT0A 2IPNA 1UAAA 1Q92A 3D0RA 1RYMA 2FP3A 3IBFA 3QVKA 2IU4A 2HFJA 4MAMA 3FPGA 4DYVA 3HFRA 2FUKA 4MLCA 1TAUA 1RM0A 2FLWA 1GRQA 1E9FA 1CY0A 2BL4A 3ED5A 1A7AA 4NYJQ 4HQ0A 4OXYA 4U9IS 3JARA 2FW9A 3D6MA 4Q9HA 4NBWA 3ZZMA 2Y0BA 3T6KA 1H42A 1XEXB 3PUIA 2NZYA 2WUGA 3LGSA 4YJHB 1IXRC 3DCIA 1D1SA 3WGJA 3VZDA 4CQNA 3A10A 4GD3Q 3RUEA 4OM8A 1OXVA 3KPWA 3KX2A 1VP3A 4NOMA 3DBVO 3O8QA 4BNVA 1YNOA 2RJOA 1U2PA 1DEXA 3EXHA 3PNKA 3WRYA 5A1TA 2O7NA 3ZDBA 1XIVA 2JVIA 3G1UA 1ZAYA 5E9QA 2V03A 2AXQA 3F5DA 2QP4A 3OE5A 1T4CB 4J16A 4UW9A 4XR4A 5TF4A 1JNXX 1RABA 5HFAA 1C14A 4F9GA 2YVAA 1UIRA 3O7WA 4BNTA 5CA1B 4MB6A 2AA3A 3CF6R 5JXWA 2OWDA 2YY7A 4U2FA 4ZEVA 4F3TA 2J67A 4AWXA 3KV3O 1WMSA 3UTCA 1EFDN 3E0XA 5AOBA 5JAOA 4XWWA 3OPMA 1LLQA 2ZSEA 2REQA 2NZWA 2VT3A 5EXDA 3RE1A 3U7QB 3EXEA 2DE0X 1Y7PA 2OLEA 1FYWA 1KQOA 2PIDA 5K4HA 4RFVA 1C4KA 2GCEA 2AC4A 2WM2A 2AMFA 1YCHA 5BN4B 5L6MB 2ZXUA 3V33A 2Q3FA 1M6WA 1FFWA 4QPNA 1JS1X 1NR5A 2YJTD 2C2WA 3FPLA 4HOYA 1SGWA 5HUQA 4DLZA 3MEQA 2B6NA 3GEGA 4EAAA 1UP4A 4TTPA 4FFSA 4KRXA 4KQJA 2R5FA 3OQVA 3GMTA 2IP4A 4RTJA 4F5ZA 2G1UA 3UMCA 1PS0A 3UMJA 4BZXA 4FZVA 1DTSA 2QENA 3NEJA 2R1VA 1OILA 3NAGA 5IPFA 5LNK6 3JVEA 1U28C 2CJFA 3HSYA 3N8IA 1X7GA 3OICA 2VLIA 5A4AA 3E3LA 3PNLA 4TGLA 4Y6PA 3OBBA 2EYUA 2WFAA 4O29A 1B76A 4BQIA 1IHDA 2I4NA 3GFVA 3WMFA 4W7HA 1SU8A 4DDHA 4NZOA 1XD2A 3IIKA 1YDHA 2GHIA 2XTMA 4IWNA 3C43A 3OU6A 2FRDA 4O3FA 1P39A 2GTIA 3AGQA 3DH0A 4EJ2A 3DFMA 5THXA 1I7QB 4GT1A 3SOPA 3TB6A 2YIDA 1ESZA 1R50A 2DWUA 2QW0X 1GYPA 3AJAA 3KPUA 4MUAA 4CKEA 3RSLA 3A7DA 1XUOA 1GU0A 4J75A 3DE2X 4IVNA 5E7QA 3MTDA 3HDHA 3SCZA 5L3QB 1D8TA 3CNNA 2O1EA 1F38A 4JOBA 5GONF 2DEUA 1T1JA 4JOSA 1E92A 1PWZA 2ABWA 1RQ2A 4JT8A 3CZMA 5CUQA 5JS1A 3C8DA 4LS3A 4Y0AA 3ELYA 3IPRA 4HH0A 4WOKA 3E9ZA 2UU9B 4J16C 1A5AB 3RJ9A 2NSJA 2HHAA 5K05A 1Q50A 2J9GA 2VJBA 3DVAA 3O9VA 1AQLA 4DMHA 3K2EA 1FNCA 3EARA 3THRA 4L5AA 4RLQA 1J1IA 2B82A 3W8FA 1P9NA 1W2WB 2VAXA 3PLRA 5BSKA 2C4TA 1OHHD 1UK7A 2FMHA 2ZRCA 1PS9A 5A04A 5LYJB 2AH5A 2PLAA 3B1KA 3IEUA 4M37A 3AJEA 4Z2YA 5J4HA 2ZR8A 1NIJA 2PWYA 1G41A 5CR9A 5CJJA 1U0SY 3E84A 1UBHS 2OV6A 3NNNA 3GJ5A 4IDGA 5UKDA 4QARA 4FFLA 3T4XA 1Q0UA 4P7FA 2HQSA 1A8PA 2V5VA 3CZPA 3LC1O 4D8UA 1NSFA 3GC6A 2Z6VA 1VIVA 2C4VA 3A26A 1E3DA 2D3WA 4LHXA 3IPAA 1VJ0A 4LI3X 5AH0A 1L8AA 2WIJA 3R75A 2AG1A 3E58A 4ENUA 2ZRBA 1L7QA 3EFEA 4B85A 5JROA 2W6IA 4AN1A 1XDSA 2JGLA 1WZ2A 5HPYB 4IMRA 1JW9B 1VIAA 2C59A 2Y1GA 1BW9A 3L8YA 5CP8A 3ASYA 3FSGD 5WRFA 3AI2A 4IRXA 5AOVA 4BDSA 5I45A 1E96A 3ZOZA 3Q4GA 2EJTA 4KMSA 4M22A 2NVUB 5JQWA 3K72B 3GPIA 2ES4A 2JAHA 2IX3A 3ZD8A 4C0XA 1W1WA 3H2GA 1ZVQA 4KQMA 2IXBA 3ZIDA 2FRDC 3OC6A 3QJYA 2JAWA 3BXXA 1U8FO 1WZUA 3SFVA 2V9CA 3FZNA 4DA7A 3TPZA 4GRIA 2B2XA 3KU4A 1XAIA 1X38A 2GARA 1WHTB 3I2HA 1SIWA 4G9BA 1B6RA 1MEJA 5EE1A 1NVDA 3U1BA 2CLCX 2ENWA 2PMCA 3NWEA 4PLHA 5AVOA 1ZOPA 1N0HA 3QPDA 3OHMA 3GNLA 3KOZA 1V3VA 1UBRS 2FFAA 5E0KB 4DBLC 5KHAA 3GUHA 4HAYA 1H0KA 1RACA 3L0ZA 2W6NA 4M4SA 1ZICA 4N39A 2VBGA 5B2EA 5JRZA 2XMQA 4BKMA 3B1FA 4H3VA 1M8KA 3I2GA 1NQXA 2W2LA 3IEMA 1OC2A 1TIPA 2QM8A 2NTJA 2O52A 4INAA 3ZI7A 4ACAA 3DNFA 1B8NA 4PYNA 2ZULA 1GDHA 5BSEA 3MTIA 4MVJG 3NC0C 2D1QA 3REGA 3B3FA 5IT5A 1E2GA 3BRQA 3H5AA 1Y0BA 1L5WA 1VG8A 4H7KA 2O2DA 2WWYA 2IIPA 4EI8A 2M98A 1E2LA 1K8QA 2CYBA 1V8ZA 3VH4A 4BO3A 4MQLA 5C9ZA 1T0BA 3AR3A 5AVQA 5KSZA 3PHCA 4HAXA 4G1EB 4MW6A 4B73A 1P9LA 1EFCA 2EG9A 3K5HA 3PHBE 5KX5F 1QRRA 1ZGZA 1Q3TA