3QVGA

Xrcc1 bound to dna ligase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
LCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/ligase
molecule keywords DNA ligase 3
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16759 LIG3_BRCT DNA ligase 3 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3qvgA00
2EBUA 5ECGC 2M2IA 3HUFA 1Y98A 4JLUA 3PXBA 2K6GA 2E2WA 1KZYC 3K16A 3T7IA 1N5OX 1IMOA 2EBWA 4BU1A 3L41A 1CDZA 2R1ZA 2COKA 4N40A 3PXDA 3L40A 3PC8C 3SHTA 1Z56C 3T7JA 4ID3A 3SHVA 3JVEA 1L7BA 3AL3A 4IGKA 2COUA 2HTFA 2WT8A 3PXAA 3UEOA 4BMCA 2L42A 1T29A 3EF0A 1L0BA 3QVGB 4Y2GA 3K0HA 3OLCX 4OFBA 4Y18A 3I0MA 1WF6A 1GZHB 3II6X 3FA2A 3L46A 1OQAA 2VXBA 1T15A 3U3ZA 3AL2A 2D8MA 2XNKA 3PXCX 4U4AA 2ETXA 3PD7A 2JW5A 4XPZA 1T2VA 1IN1A 3PC7A 3K15A 3KTFA 2XNHA 3PA6A 3T1NA 3SQDA 3I0NA 2ADOA 2LE0A 2VXCA 1T2UA 2NTEA 3UENA 2INGX 3K05A 4XQ0A 3PC8A 2DUNA 3EF1A 3PC6A 3PXEA 2AZMA 2K7FA 3SZMA 3QVGA 4IFIA 4BMDA 3COJA 1JNXX 3T7KA 2EP8A 4BU0A 3HUEA 2COEA 3K0KA
chains in the Genus database with same CATH superfamily
4U2GA 3QKTA 2ILTA 4IKPA 3BXEA 5KTKA 3RJMA 5E1MA 3GEIA 4IX1A 3EDOA 2Q3MA 3ZCTA 1DRWA 1EM8B 3NCTA 4R05A 3RGWS 3IOBA 5IRCD 2GAFA 1J8MF 2ZUBA 4OXXA 4QECA 4BC1A 1CIJA 2FMUA 4DMKA 1QJCA 4ZVPA 4PNPA 1UT6A 3MCUA 1YZNA 4JUCA 2BEWA 5AUPB 2EZ9A 2FZCA 1O6GA 3W2FA 4B8WA 4PWYA 2Q2QA 2AHRA 1I4WA 1D9XA 3KOOA 4NQZA 4AJ4A 1UMCB 3STTA 4WKBA 1QVAA 4L15A 5F2KA 5CAEA 3QIAA 4L6IA 3FPAA 4AMBA 4X66B 4H3VA 3VR2A 2PKYX 5AUQA 1XQXA 2DLDA 4J2OA 4NL4H 1P9NA 1JJ7A 1N5JA 2V7PA 3IBGA 1VBNA 2A9PA 3FBGA 3HKBA 1Y4SA 3EX7C 1DBSA 1IRIA 1PJQA 1VIMA 1GTL1 2I0FA 3S2GA 2JFOA 1M1NA 2VHZA 4B2YA 2YIMA 5TMEA 1NY5A 3DP7A 3ZK9A 4BLUA 5BYKA 3LWBA 3B9RA 1XRJA 2HFKA 1FPMA 1Z4LA 2ZYSA 3HVHA 3IVXA 1BKYA 2JLAA 1W4CA 4M0EA 4Z2YA 4DG9A 3MJFA 1UPCA 1OHHA 1X14A 5BSEA 2WVJA 2BMFA 1FMTA 4WDRA 1T0BA 3IT1A 3QWFA 3RS9A 1ORRA 1B0PA 3NUGA 5KPJA 1W6RA 3ZXIA 3FWZA 3VUFA 5L45A 3K70C 3VHQA 4JI3B 3ESXA 1ZW6A 3UK0A 2FZGA 4DSTA 2E3JA 3KUKA 5FPYA 4IJ5A 4DA4A 4M1QA 2CW5A 1RXYA 1NXVA 1T6ZA 4RMHA 3ZU3A 5DW3A 3PGKA 3T1VA 1Y3IA 3IBYA 3KQQA 4Q82A 2G40A 4LGVA 5CIWA 3ABZA 4R5HA 1A72A 4V0QA 5FI3A 3SE0A 5CFOA 1Q3TA 1D3AA 3AZQA 5HUQA 3LQ4A 3GGCA 3AHCA 3QENA 4J1QA 1CLUA 1UBRS 4NENA 3G1UA 3USZA 3ZD9A 1ZYUA 2GMWA 2PV7A 2GHTA 1C8LA 4DUGD 2Z30A 1UWCA 1RWXA 2IPMA 1I1NA 3KT8A 3SC2A 2WYHA 4DY4A 1Z0KA 3AEYA 4IXNA 5A04A 3H2IA 5ECWA 4E1BA 3OLZA 2X2OA 4WT7A 1U81A 2ZQ5A 3ZIAA 3RK0A 2P0EA 4ND3A 1Z5NA 4AF6A 3V8PA 4GPZA 1V47A 4OG2A 4OO3A 4RO0A 5BPFA 3ROTA 2FFJA 3JWGA 4QYIA 3VPXA 2YXBA 3GN1A 3U19A 4YPOA 2GKGA 1KEEB 5L3QB 3CW8X 4U7DA 5EIHA 3UUGA 2VYCA 2V45A 3FY4A 3GJYA 1PWXA 3I9LA 4TMTA 1QIGA 3VU9A 1OGYA 4DCNA 4DQKA 4PLYA 2J48A 4XD7D 3HU1A 4ZODA 1DL5A 1ZMOA 2YYSA 2VNSA 4DM4A 2O14A 2IPLA 3PZBA 4D02A 3MFQA 4BJ6A 4TZ6A 4AZ0B 3C1AA 2K7ZA 3UJPA 2EC5A 3X43A 3ZW8A 4YUWA 5CG2A 3QW2A 2F1JA 4G0ZA 1Y6ZA 3G2HA 4QT4A 1Q1NA 5TF4A 2D2IA 5ICSA 1SXHA 1AB5A 4WXMA 1WL8A 3V48A 1F2TB 3D5EA 2IUTA 3I0ZA 4MLZA 4OMFG 4HRAA 4ER0A 3KS9A 3IE1A 1T8WA 2E4UA 2FCRA 3D64A 1E4VA 2PWAA 2FZVA 1EE1A 1BXGA 1XHLA 1LBSA 1WQ1R 1ZK1A 2GRAA 3EQ6A 1DS6A 2BGLA 3HNOA 4U7JA 1PGQA 4X20A 1FSPA 4C7OB 1JG4A 5ERXA 4DQUA 4WK4B 1KYQA 4F2DA 1TTHA 1CUAA 2V7VA 4L51A 4XDHA 5T6MA 5TIIA 4QRDA 2WLSA 2WJYA 4F1WA 3M8KA 4LMPA 5AOAA 3I5YA 1F51E 1CY6A 1E0SA 4M0KA 2XA1A 3TCXB 3TNLA 1TQ8A 2C9YA 2O5VA 2XCIA 1UXGA 3GUUA 3QFTA 1XTUA 4ZVKA 3N7UA 4GXQA 5HS6A 1ZA1A 5BRAA 3EODA 4B79A 3AHGA 4W8HA 4Z4GA 2FR8A 2P2CA 4NCXA 4TMZA 1WWKA 2RBKA 2C00A 2ZRPA 3BTVA 1SZDA 2QN9A 4NTZA 1E94E 5THQA 4W7SA 2WKPA 2ZVJA 1NBME 4R3NA 4YS6A 3ZS9A 5K0TA 4JJAA 2ZRKA 1MUUA 2KHZA 3IUPA 2D1SA 2EZUA 3OQOA 3NUQA 1YVEI 5ARCA 5KIAA 2H54A 1NXQA 2ODAA 3VKFA 2R6JA 1P2SA 4RW0A 3EFEA 5AVSA 1YQGA 1SUDA 4HAIA 2PQMA 5DN6D 5FPSA 4DS3A 5HTOA 3DM5A 3I9V1 4ZCMA 2X0IA 3LLCA 1HXHA 3AEUA 4CMAA 4CIWA 4DBLE 1GKUB 2DH5A 4RIGA 1POXA 1AQIA 2ATXA 1LPOA 3RTEA 4ZMRA 4F4CA 1NQAO 3AL2A 1C0KA 1I7NA 5AESA 2VTBB 3OJFA 5DM60 4ZOQI 2YICA 3CRVA 1FDTA 3ORSA 4DOMA 4F9TA 2ZETA 4JN6B 4WVFA 3V8QA 2OYRA 4CNQA 1II0A 4LC1A 4CG0A 3R0VA 5A7GA 2NNWB 3GGPA 3RSQA 4UZEA 4EECA 4DYHA 1RXEA 3V7YA 1R27A 4CG2A 2QTCA 1Y3FE 1N7HA 2CDBA 3OZIA 1OXBB 3GJ0A 4MCJA 2ARKA 4ESVA 4D3FA 1E9SA 4HHEA 2NTYC 4FHZA 2Q5LA 5E4JA 3T41A 2ZJ3A 2AC4A 3HDGA 4OIMA 5DBHX 1GTG1 1Q17A 4FHGA 2XW6A 3I0NA 3S44A 4CVNA 2NPIA 1GKYA 3LECA 3TW0A 4D74A 1W88B 4RZUA 1Z0UA 3V4LA 4AJJA 4BE9A 1BVHA 1AA6A 3EPLA 2WDZA 2OWDA 2R7NA 1ZG3A 421PA 1DV2A 3SGLA 2A78A 4LHEA 5JD6A 2HJRA 3QF4B 4RF4A 1DKMA 2JK0A 4QATA 3NQ41 4W5TA 1NVXQ 4Y0AA 3K9LA 3ER6A 4L3VA 3U31A 3DDHA 3CJQA 3M4ZA 4IFIA 4UASA 1T36A 3BJRA 5JJ5A 2VOEA 5BRNA 1WBDA 2XQGA 4J0CA 4QOEA 2I6UA 2YR0A 1RQ2A 1WTAA 4HYEA 1X80B 4M7WA 4NE9A 3I3SR 3K0KA 5AOBA 3JQGA 2QJFA 3KJIA 4Z9BA 4PG4A 1RMYA 2R1TB 3DE7X 5HFNA 1OU0A 2KE5A 1RWWA 1X7YB 1JQJC 4XVQA 3S8EA 5EMMA 2V6GA 2J41A 2W22A 1J00A 4P4LA 4D43A 4ECAA 2JAUA 5F23A 1DXHA 1MIOA 5I7OA 1HT0A 1EI9A 1OV6A 3CNQS 3G13A 2Y2UA 4DIKA 1XRLA 5KSWB 1I2CA 4NMLA 4D0SA 1SBQA 4YRDA 4F3TA 1E8DA 5G3YA 1O03A 3ZDZB 5KI6A 1KAGA 2DGDA 4RZQA 1V5EA 3IR6A 3D7LA 3DE6X 4OHPA 1GNLA 4HVAA 1YMUA 5K3AA 1JE0A 3VR5D 3WNDA 1KI7A 1BDJA 1KMQA 3WQSB 5C1DA 4GXRA 2XQJA 2ADFA 1JLLA 3QOFA 4TRMA 4M9CA 4PPNA 1QLJA 3B53X 1TI7A 4LDNA 1KHTA 2I4RA 4I9GA 2AYYA 3K0HA 3OF2A 1Z0ZA 2IYEA 2ZYDA 3KLNA 3MXTA 3S6JA 5L7TA 3CBQA 1SC9A 4LQDA 1BMFD 521PA 2OORA 4YXWD 2IYXA 2FUKA 2O50A 4N03A 4HFNA 4RSMA 4OB8A 3ROQA 4BQEA 3EVGA 4FIDA 3M89A 4F9EA 4EGCB 1LEHA 1Q3HA 4ASUD 2PJUA 2BAGA 5A0VA 2CFTA 1KA9H 3EVNA 3TCNA 1EG2A 1T91A 1G3UA 1Y7LA 3N7AA 2P7HA 2HPZA 4ZJPA 1Q15A 1D4OA 3FHLA 5FBKA 4YAOA 5AI4A 4KPFC 3CCBA 2WYVA 3OUZA 3PE3A 4YDQA 1NUSA 2CEKA 3A1NA 3DFZA 4FE3A 2RHTA 2YWJA 4OL0A 4TPKA 3STYA 1OB5A 5B3LA 4WGGA 1XVVA 1N8TA 5LDDC 3WGHA 4WOKA 2POQX 2HMYB 4QHTA 2PZLA 2O8EB 3AM4A 2OGSA 3JTEA 4M21A 1EX6A 4Q9HA 5EEGA 1B8NA 3UW3A 4BMVA 1T2FA 3T1QA 2OCKA 3ANNA 3CH4B 4NJEA 5H3CA 3GEBA 3WGJA 3ICOA 1DELA 4MUJA 2RGAA 1R0LA 3ZY5A 4QREA 4MVYA 4RLSA 4URZR 3I2KA 4FXOA 4PBRA 4L2IA 3WI7A 5C5DA 1G8SA 4OA8A 4FCWA 2YS6A 1J24A 1X0XA 1KETA 3NHRA 1ZI8A 2QPLA 1N34B 4GBED 1YVDA 4QEZA 3FFTA 1WX1A 4K9DA 4HLDA 1WUYA 3CLSD 4KMMA 1Z5GA 2JGEA 3PXXA 2IGTA 4HH0A 4MV4A 5IZCA 4URHA 4B80A 4D9MA 4HPWA 3SQXA 1XTJA 4WY8A 1L4HA 2JAQA 1U31A 1YZKA 2WT4A 4WADA 4NZYA 5TARA 1N6LA 5B2FA 3AR9A 1ZLYA 1T6BY 3HJRA 1L1FA 4AF7A 5CCBA 4YA6A 3JQFC 4EPXA 5KWJA 2ISCA 1J8DA 1Q12A 5HCNA 2OWEA 3O8OA 1A76A 1Y1QA 4BXOB 1IM8A 3OX3A 3ND9A 1ZRSA 1CX9B 1E6KA 3QJGA 1M2WA 4UTXA 3NDPA 3F46A 3QU2A 4QBIA 2X42A 4EKGA 2QTVA 1SVIA 5D1HA 1WM1A 5DHSA 1CXZA 1FFYA 1J4AA 2DY0A 1GT6A 2OBXA 5ILQA 1QAQA 3NEAA 3D2CA 3P9SA 1ZI9A 1QZZA 1O97C 4FNAA 4G09A 3ZCXA 1RPJA 1AO0A 2J0VA 5DULA 4U7TB 3ZE1B 1HDZA 3GQBA 1HTWA 1LVHA 1TU3A 2B92A 3TRJA 4DC9A 2XBMA 1U1DA 3A6GA 2B94A 2EX0A 4QYWA 1Q20A 4D6YA 2DQYA 3L4SO 3OQHA 5I9NA 5K5EA 2GA8A 5DNUA 1QZTA 2VT7A 4D82A 4JEUA 3UWOA 3TMKA 2D7JA 3RM3A 1CF9A 3QRWA 1UP7A 2V6JA 3IKJA 3M6FA 2QRKA 5FT9A 3W8NA 2P3OA 4J0DA 3W4JA 1GRNA 5MN4A 3C3DA 2B3TA 1BMQA 3K8ZA 3LO8A 3TXAA 1W5FA 4CQLA 1LF0A 1ODTC 2I6TA 2JAXA 1Y4DE 2LIVA 2ODPA 3EIFA 1SAYA 1Z22A 1GGFA 2B6NA 4OP3A 2IYRA 1CQIB 2R96A 4IZ6A 5CXSA 2CCJA 3B5IA 3MF4A 3QVOA 4II7A 2MWMA 3G6WA 3FTFA 1FLNA 4FEGA 4MS1B 5BO5A 1Y80A 3I1YA 1E9CA 5BYJA 3HL0A 1JDPA 1U8TA 4QGHA 3X1JA 4NOLA 4OKIA 3E1GA 5JYBA 5GIOE 1K9VF 5DXFA 1WW8A 2C54A 5TDHA 1X74A 2FDRA 3HH8A 2V7UA 3OUTA 3UPDA 4A3SA 4KODA 5L51A 3WHKA 3QPAA 1XKTA 4DLTA 1SG9A 2C9MA 2JGJA 3O03A 3ZUGA 4JIMA 1V5WA 4I2NA 3DPSA 1KE1A 1GNPA 3QI7A 4J4HA 4PINA 1WQ4A 3WG9A 4BHTA 1EGQA 2NXWA 3EGOA 3UG7A 3RFFA 1MX1A 2V7TA 3DP9A 1RHQA 4WK6A 3G8BA 5EMHA 5LU8A 1AF7A 1OIVA 1QCDA 2CFOA 2QE7D 4EB8A 1A8IA 3DAYA 1W9HA 5MDHA 4NDNE 3P0FA 4HDQB 4RIEA 2WG2A 1JEYA 3NPAA 4BASA 2OXIA 5LQCA 4CN9A 4N3GA 3ZD7A 2GN6A 3SYMA 1QM5A 1ID1A 5PGMA 2XUPA 3PPWA 3ZK7A 1J21A 2IOFK 4MKRA 3A6EA 2ZRJA 4HOYA 3EYAA 4QTXA 2H6EA 3HVJA 4I0WB 5FOUA 5AKKA 4BNMA 5KQLA 1YBHA 1YL6A 2KYRA 2OOKA 1HH4A 2QRQA 1UBSB 3A36A 4IKOA 3PXGA 3DUFB 2FYTA 3PEVA 3IH5A 4QYMA 3TZHA 1L4FA 3J7AC 5M2QA 2F8LA 3KKMA 2AK3A 4FGLA 5CEEA 1VM6A 4ZU6X 1QHGA 4E1VA 2XOKA 3JATA 4IG4A 3DZ8A 2CUNA 1TJ3A 1XR3A 2RHGB 3KYDB 4NDZA 5FIUA 4YHHB 4DA6A 1E5XA 1XRNA 1XAIA 5GOZA 4Q4AA 5KQGA 3U3RA 2JEOA 4KGXA 3BMQB 3SSOA 3PEYA 3VM6A 5ETJA 5EJ5A 4J0FA 3DOUA 5L3SB 2VSOA 1I9GA 2F59A 4O4LB 1P19A 1L5WA 3VTKA 4DSAA 2EWWA 3DLTA 3RT7A 3AF5A 4M0MA 2V3CC 3RU9A 1SOWA 2AN5A 3H9JA 1IUKA 5D6NA 4N7JA 2BM1A 1LXCA 1G41A 1DAMA 2C4WA 5JH7F 4KN9S 3K9GA 5H3LA 4UZFA 4C4AA 4H7EA 5AHWA 4JLUA 1SD5A 3LCJA 3RVPA 5JR3A 2XB2A 5C3UA 3OQJA 1S5PA 4F06A 2OKGA 5BN3A 4ZK6A 5CTAA 1JA0A 4UU8A 4DQDA 1IY8A 1I3OA 3NGXA 4AF8A 5CHYA 1M73E 2MR5A 3G5MA 4FWTA 1Z5OA 1Q7TA 5AVKA 3W7BA 4BYGA 3A37A 3BG5A 2J3LA 1FTGA 4NESA 3V4PB 1JAHA 2BH9A 4BFSA 1SVSA 1IN6A 2I1VB 2YUIA 2IW3A 2ZS8A 1NP7A 2CSUA 3B1XA 4X3CA 1L9KA 2G7MC 3GRYA 4S0ZA 5T3UA 3ZQUA 5ITSA 3STXA 3ZV7A 3VKHA 3OQMA 1E1CB 1JEYB 4EJSC 1J97A 1IULA 4PLTA 2W0MA 4PTLA 3FNIA 3SKYA 1U4SA 3VVBA 4D5EA 1F6DA 1UJMA 1KH2A 2XYHA 1VKRA 2WABA 2ZATA 2YWGA 1QRRA 3Q15C 1WULS 4HXGA 3A06A 4IICA 4MS4A 5REQB 4A2PA 1QXSA 2GVDC 3K2IA 4TV8B 4KLNA 3ABOB 1JR4A 4Y2UA 1KJZA 2DAPA 4U9UA 1A2QA 1QX4A 3HY6A 1TGYA 4TXNA 4ZOAA 3TRKA 4E07A 2OZVA 4EI9A 5AW2A 3QEOA 2DCUA 3FF1A 4E5KA 5JADA 4BRSA 4IUCS 2P2YA 4M9SA 1QS0A 5EJ2A 3VRHA 1MQSA 4C6RA 2PUEA 2HRZA 3WP0A 4DIDA 1C1DA 2VUIB 4PXYA 2D2EA 2X4LA 4O4HB 3TOVA 3GG2A 5C0OE 2MSLA 3KPJA 3A6LA 4FTWA 2WIDA 4JP2A 3KJZA 3OQ1A 1LH0A 1CRLA 3RC3A 4CIXA 1V6SA 1HBJA 3O3MB 4U0JA 3PFFA 3TEJA 1I51A 2IX9A 3HE3A 3GL9A 1NBMD 1RS0A 1NVGA 2CB9A 2J4CA 1DKPA 4M9ZA 4NPHA 4RK0A 1A9TA 3K3PA 3ND8A 3K2BA 5T4FA 1E6WA 2TRSB 3UJHA 4MYRA 2BGGA 1TEVA 3AUAA 3NYIA 1IQPA 3O2SB 4MP6A 5TGTA 4Q39A 4BO4A 2ODTX 1S1MA 1EX1A 5CAEB 1JL3A 2HY7A 1ZHOA 1GPWB 2V5AA 4NCHA 1GG5A 3CPSA 2CD7A 5CVCA 1G16A 2R11A 3FZNA 4PV7A 3RDPA 3V1MA 3AMVA 1JVBA 2PWBA 3TKYA 2WU4A 4A2WA 3IQIX 5COAA 4BMZA 1KEWA 5LP6F 3LUHA 4LK2A 1GSHA 1HLGA 5JSKA 2QVZX 3PR1A 3IP1A 2G82A 3G9QA 3HKBB 4YCNA 5I7RA 3O92A 5IJXA 3VO9A 3HB4X 1JGTA 5FUXA 1M1NB 1O95A 2B2CA 3C6MA 1DHTA 3OZCA 4DV5B 1SU7A 3FCYA 3PWZA 3TRIA 3R0ZA 4JYMA 1JMYA 2GXQA 1URPA 3HXOA 4WLEA 4QJIA 2N46A 1PG2A 1CP3A 3M7IA 1A8QA 2VRNA 4HNAA 5B37A 2CHFA 1MRNA 4IFBA 1GQRA 3R23A 3COSA 4OAPA 2YJGA 2ID8A 3RV3A 4DANA 4MDEA 4DYDA 3QBDA 1C1XA 3U40A 2PRZA 4V0MA 1QIEA 3T3IA 2WKRA 1C3JA 4X62B 5KNCA 2I2WA 1RLMA 2YJ6A 3O2NA 5K0NA 5C1PA 3E0XA 3K4QA 1D0SA 3KP1A 2JFZA 3OPYA 3QYJA 4D5GA 3JRNA 3TZQA 2ZWPA 5FO1A 5C1BA 1VKZA 4QUBA 5HRAA 2O8NA 4UC0A 1ICIA 3TLGA 1CY1A 1XZCA 1Y81A 5C7OO 3NHWA 4XWAA 4HS9A 1L7PA 3PNOA 1VSBA 1UZMA 3DO6A 4F8EA 1IMOA 4KVAA 1FMJA 4R3WA 1E9AA 2C2ZA 5EUCA 2D1RA 2MYTA 1TQHA 3SC2B 3ZI0A 3JAWB 3WAGA 2C7QA 5E4TA 2Z83A 4RLHA 4EVSA 1NW6A 4ZEWA 5HUJA 2JD0A 2VDPB 3ZCRA 4URWR 2OMEA 4MYTA 4QJ5A 4UMFA 5LNK1 4F8JA 1RFGE 4Y2SA 3JVEA 3CF4A 4DZTA 5SYNA 4G86A 2R6AA 1IUOA 2W0SA 3NKVA 2IW1A 3VDRA 4KITB 2VBCA 4P54A 3JQQA 4XIJA 1FU4A 2W4IA 2YCBA 3R7DA 3FXAA 2GEKA 1HUQA 2OGTA 1J0DA 3B6ZA 4F4DA 3KOMA 3D59A 4Q12A 5K0SA 1QK3A 3TF5A 3IVAA 2ZREA 2B0CA 2B20A 4Y1RA 3NG1A 1CDEA 4DMMA 1E1MA 4TLMB 3V8BA 1W35A 1AXEA 1NBWB 2VWPA 2IUUA 3M2TA 5H16A 2QZJA 4NWIA 1MRZA 4J0GA 4U7GA 1QTIA 4I3HA 2ERYA 2D7DA 1XZGA 2EOAA 4KO4S 4C2AA 5LNK6 4KRGA 3DOFA 2VPZA 3UHFA 1OLXA 4TV9F 2DF8A 4RDCA 5BW5A 4CV1A 3B1ZA 1EYZA 4XGQA 3NCHA 2NZ2A 3WYGA 4Y9DA 4G0NA 3PYLA 1GSIA 3LPAA 3DE4X 1KPIA 4R6WA 1RFLA 2F43B 2GK6A 3OM0A 4EA7A 4WEOA 4UXHA 4GMHA 3E23A 3H19A 2VSNA 2XGSA 3CIFA 2Z8YM 1UKAA 1E79D 3K1AA 2IP2A 3KOUA 1UZUA 2ZE6A 5JAZA 1KZ4A 3A4NA 5DDIP 4D57A 4PQGA 3HTXA 4OIFA 3AP3A 3JQBC 2CL7X 2I4NA 4LG1A 4HTFA 5JLJA 3EPJA 1DAPA 5JFGA 1YIAA 3FUTA 4BMPB 1YWGO 3BB3A 3K9BA 4RE6A 4GP6A 4I5EA 4YFYA 4PG5A 3CB2A 1RAIA 1IB6A 1ZNZA 2JZNA 3IT0A 5AKEA 3IQWA 1Z38A 1GFWA 1QCZA 4EHJA 4CIVA 2GEFA 5KQPA 3U44A 1GTSA 2C4NA 4IY1A 4TVKA 3FCXA 1KYYA 4ISCA 3KSZO 4GYJA 1DBRA 1XEXA 4YVFA 1GZUA 4KIJA 2FR1A 3D3WA 1MX9A 4XWGA 2PZJA 4BNWA 3Q12A 3VR1A 1EFPB 2G9NA 5K0CA 1R50A 2TECE 1GV1A 4OM7A 1MRSA 1NG1A 1H69A 2YQZA 2WZCA 3RSZA 1WHSB 1XK7A 1Y9JA 2VO1A 3ETCA 4FNGA 1S8OA 2I1QA 1PT5A 2FPPA 4XOUA 2PCLA 4R1QA 4EF6A 3VR2D 5LMCA 2IXBA 4BVBA 3ESYA 1FSFA 4RTQA 5G0WA 2WNIA 4FYKA 4UUAA 4BATA 2E18A 3CR7A 3RROA 3MTAA 3NW9A 4C4XA 1XKXA 3HJFA 4LDRA 1T3LA 1G64A 1I6KA 1RWBA 4YQYA 4NBUA 3AJ8A 3T7KA 2XRYA 2YHSA 1Z7WA 3JQ6A 1KL7A 1GTMA 1M6VA 1Y5MA 4GX2A 2A7XA 3A4YA 3C70A 4D96A 4FPXA 5JFTA 2ZROA 1JB9A 3E9QA 1OH8A 2OHFA 3TX2A 1HF3A 2GPAA 2BFFB 1OHHD 3JAKA 1KYTA 3OT5A 4I4IA 2H9IA 1EESA 1EGMB 1T8UA 1KXZA 3WMFA 4RPJA 2UYCA 1E64A 1MJGM 3CGGA 4X95A 2F90A 4ZJUA 1ESDA 1UC5B 2ZJ0A 1CUDA 5K0EA 4Q9NA 3OMWA 4DF3A 2BUCA 1YZQA 3SHTA 5DOZA 1VI5A 2NYAA 2O8VA 3B9BA 1X8XA 1W5BA 4G67A 5FORA 3G7SA 1WB9A 2X15A 3Q2IA 2BI4A 1M0WA 3HG7A 4L5BA 3S29A 2Q9CA 5CX1B 2F1IA 1VBKA 1M2HA 4ANFA 4KXWA 4PM4A 4Z3OA 5E38A 1B15A 2ST1A 3WFJA 3Q1KA 1PR6A 1BA3A 1JDBC 3F3MA 3HKDB 5E9QA 3FCCA 3AERA 1PI3A 2ZRIA 1FY2A 1ZDMA 4X8LA 4PWZA 2QIOA 2AMJA 4W5NA 1XJ0A 3DWIA 4K8OA 2EKQA 3TMAA 3U1BA 4CMEC 4FJ0A 4IDBA 4BO0A 1ZGZA 5E4YA 3HDQA 4N3AA 2P9TA 5LOVA 1T3HA 2RD2A 2V7XA 2YYYA 3ZIAD 4E4YA 3BZUA 3EWSA 4MUIA 3FCSB 2SICE 2O7RA 1HZZA 1LI4A 3N70A 4ZFNA 1SUPA 2AQ8A 2FSFA 2IDJA 5AUNB 3GNQA 5K3BA 4DSOA 1ZD8A 5IULC 1RM4A 2BKXA 3EGXA 3NBQA 1JJVA 1MJFA 4MICA 3WO0A 5TSDA 1E2KA 3I3OA 1X1DA 3C39A 4N01A 1DCKA 2CHEA 1XBTA 1OYVA 3DQPA 3FNEA 3OLVA 2VSQA 2PQ0A 1UBOS 2GLUA 3OCWA 4OMDA 3AJDA 4UQPA 4E5DA 1QKIA 3BQ9A 5JNTA 3PHIA 2NZUG 4DRXB 1AQLA 2NUPA 2QSJA 4C0KA 4N5IX 4XSGA 2LD4A 1K63A 5E2BA 3T9DA 1N8KA 1W96A 3BL6A 4JUBA 3B36A 1L7QA 2IITA 1PT9A 1A9XB 4NOKA 4ALKA 4CEJA 1E69A 4TYYA 3U09A 3QNWA 2A6PA 1R00A 2C2HA 3RSSA 4MVJF 2HQSA 1QAOA 2Y1GA 1PEDA 1NVVR 3PV0A 1XN4A 3FMIA 1W0KA 1U5BB 1O57A 1K4MA 2P68A 2QRZA 4K6KA 3I6BA 2PHZA 2QBYA 4G23A 1ND6A 2DT8A 3DZHA 1T9CA 1VLVA 1GQFA 1XRMA 5KNBA 1CUCA 2YWCA 4RDHA 2VP2A 1Q1BA 3S2ZA 3G5TA 1F2UA 2LDXA 2XJ9A 2QSZA 1IQUA 1Y4AE 1C9EA 1Z6QA 1QGED 1E0JA 3F5FA 4MA0A 1YS4A 4YIKA 1FTNA 2GJ9A 3HBFA 2IS6A 1TZMA 1U2TA 3KR1A 4AXXA 5BWMA 1VP3A 1J33A 3QLUA 5CG1A 4MGHA 1TJYA 4Z9XA 3OVMA 3NFRA 3OA2A 4LOIA 5JVDB 4AURA 3Q5DA 3IXMA 1YMQA 2Z8YA 4XJXA 4ZA2A 5FI5A 4HD8A 2VHVA 1Y6JA 3C1OA 1AKMA 1EB8A 3GMIA 3ZWMA 5AI0A 1Z6XA 4ZVVA 5KOHA 3ADCA 1RLIA 4J9UE 4YQFA 4CGZA 4I4TF 1VSQA 1F2DA 1RM3A 1XZHA 3RUDA 2PH3A 4EUFA 2PGIA 2PWPA 4NJEB 3ROFA 3T95A 1NYQA 1AC5A 1ODSA 4IRUB 3G8DA 2F7SA 3I72A 5ALQA 1DQPA 1J2EA 1RAFA 2VP0A 3LCUA 4N12A 2DR0A 4NX2A 1Z73A 4QRIA 3EAFA 4DQVA 4G97A 1TZ2A 5EP3A 1ODCA 2GQ0A 4RHXA 1GPAA 5BVHB 3L05A 3T3PB 2DLCX 5B2ZA 3PI6A 2ZP1A 4CUKA 5FA5A 5JECA 2IHBA 5JXGA 3WADA 2ZB4A 4FEAA 3CKKA 3U3XA 3CF4G 1KIFA 3R9KA 4PICA 3U4QA 4XVHA 1X19A 4CR6A 1WD5A 2B36A 3SYTA 4LY0A 1PZFA 2Z57A 3TXYA 1DEOA 1Y34E 1YJ8A 3O8OB 4REQA 1L7RA 2YWEA 4F84A 4B6OA 3ZV3A 4UM9B 4LF4B 5A4AA 2UXBB 1M6WA 1QVZA 2XWBF 2WU8A 1I1QB 2ZRMA 4HUQB 4W82A 4V0ME 4Y18A 2PX6A 3GJ3A 4EATA 4F4UA 1K3UB 3JD4A 3QLTA 1OXXK 4K88A 2O8BB 2PKEA 4YP6A 2KLBA 1CC1S 3DBOB 4ZD6A 5TC4A 4KBFA 3LYHA 3ZIDA 5LIPA 2YWXA 3LVRE 1ZM2A 4Q7JB 2HSDA 4ACBA 2C4UA 1MJGA 3NT2A 3SR0A 1DNPA 1UQRA 2ZPUA 2ZVQX 4JT2A 2CF5A 4XGKA 2J0EA 2RHWA 4O2LA 5A06A 1XUOA 1ZM4A 2JZOA 2DKNA 1Z88A 2JGMA 1NUHA 4EVIA 1FP4A 2R7LA 3SVZA 5ADVA 3Q6NA 2ZQZA 4GICA 2IYLD 4IOKA 4CCYB 1RC1A 2YYAA 1DBPA 3NBYC 3DLPX 4PRLA 3LWNA 1W25A 3SP1A 3ONVA 2H2IA 5KNLA 1JIVA 2FEMA 3AF1A 4H0CA 4V38A 4WXRA 3V00A 5J2TA 1PK8A 4W1PA 1EWKA 3JYOA 4J3JA 1YCFA 4ZHQF 3QKRA 3A6HA 4RQTA 3X0DA 3U4IA 1MF7A 2DFVA 4MAFA 2ZB8A 3KTFA 5ES3A 3PKZA 1OY1A 5HSGA 3JQ9C 3E7XA 2XGMA 3H2KA 3FZQA 3NHMA 4HWRA 4TL9A 4EUHA 2P9YA 1OX5A 4B5KA 3E5HA 4DCSA 1UDXA 1WIWA 4AO8A 1JX6A 1BA2A 1U3DA 4ZQHA 4DLLA 4EY8A 3QE9Y 5LQKA 3NOOA 3FUCA 1ZCFA 1RP1A 1EBFA 3MQ2A 3D8HA 3OFKA 4Q4JA 2IS4A 1HFJA 8AT1A 2HLPA 2WYIA 3C6BA 3GG9A 3OT1B 4RM3A 2XT6A 3DDZX 1ZX1A 1DDOA 2HK7A 1QZUA 4PYLA 2ZZKA 4OP1A 1LDGA 5LCXA 3FDXA 1NN0A 1NV8A 1V11A 4O4JF 1RPNA 1C9MA 2R7KA 4Y1FA 1HEUA 1AZTA 1OI2A 3WWDA 1KO7A 1UMKA 3Q3VA 2CVOA 2QS9A 4OK5A 1P0IA 1WA5A 3REQB 4GRAA 3UAVA 4EZEA 2ZJOA 1QWOA 1BW9A 1VZ3A 2C3UA 2RC5A 4TTJA 3KAQA 5BURA 1NQVA 1VBFA 3OQNA 1K75A 3VR0A 3SS7X 2AXPA 1JG7A 1GSOA 4R2MA 3U9TA 1M2OB 4L8WB 1WXWA 3TQTA 2C0QA 1IIBA 2PM8A 2I7XA 1PW5A 1Z82A 1ELOA 2NU9A 3WS7A 2Z98A 4GM0A 4W5HA 1Z17A 5DWDA 3H2BA 3WK7A 3T99A 4WI1A 2J0UA 1E9DA 3MTDA 2CXXA 1Y37A 2FN4A 3SBDA 1BFKA 1UFQA 1P5FA 1T1IA 4GBGA 5FJJA 2G4CA 1U5CA 1LQ2A 1UMBA 1A5AB 1Y8AA 4C6SA 3VJLA 4URXR 5I8PA 5ITZA 3JATB 1E4EB 3DF9A 4RH0A 4RFVA 1EFCA 3WMRA 2O3SA 1YDMA 4IDNA 1KVRA 2JI8A 1U1CA 2ZJ4A 4CMBA 4EYKA 4Q4CA 3G7NA 3M9XA 3JVDA 1SCUA 4WINA 5IDWA 1V25A 3JARB 3ONEA 3DLBA 3A3NA 3DCYA 3DJFA 5HDQA 2CJPA 3WISA 1LC0A 2R7AA 1N1GA 1THZA 2Q4RA 3DPUA 4M99A 5B53A 1H4QA 1QU3A 3HXMA 1A8PA 2QE6A 3VAAA 5HX7A 4IIJA 1KKLA 4X71A 4R1MA 3L92A 1LQUA 3FAZA 1VPTA 4EQ6A 4KK4A 2G6BA 1J0CA 4GI5A 4JQYA 2JFHA 5BRJA 4KVFA 3U6BA 2YBDA 5AJTA 1F7UA 4KXUA 3UHOA 3C3AA 2L19A 5GIPE 1S7CA 1E61A 2B7CA 2FP4B 5BN3B 2AFIA 1MB2A 1NUTA 1P4JA 3BJIC 2WVHA 4OXIA 4QNMA 4DSNA 5HM6A 1D4ZA 1C4KA 4HYYA 1CNFA 1LNSA 1RQPA 1CVIA 1EVIA 1E3IA 3U7QB 2ASEA 5CA0F 5JS8A 1XT6A 3O38A 1FFGA 5HFAA 1MR3F 4MRNA 3KR2A 1QYRA 4FBLA 4PF1A 3GCGA 3VPAA 1GCGA 2L17A 1S8NA 3BOSA 1EH5A 1QRUA 1BDHA 2XCTB 1Q21A 1L8LA 1SG6A 4E4TA 5JI2E 5FBQB 3EVBA 4KMSA 4KR6A 5GGXA 1VHLA 4UNRA 1WPXA 1B8UA 2JIOA 4YJFB 1MT0A 2BF7A 5HIIA 2LR0A 5LA6A 1A2KC 1H2FA 5HIAA 2Q5HA 4J4BA 2CWWA 3T34A 5K20A 2RHLA 1DWUA 1K0FA 4UM5A 5EJ7A 4UNNA 1BEEA 1F12A 1NURA 2NNLD 2WIKA 2HSWA 1BU8A 1XLTC 2G3YA 2OO5A 4B4KA 4KWEA 1K06A 1MOZA 4E15A 4ZYTA 3OKAA 1DG9A 2ZDQA 2A0KA 4BFLA 1EK2A 4DDHA 3Q9NA 2ZPTX 1XQ9A 4BKMA 4DVJA 1SOAA 2NT4A 3H65A 1D7OA 4E5SA 2IZ0A 4D26A 3CZ5A 1F8XA 2AZMA 2B1GA 3IUEA 3A14A 3SQWA 4C21A 2SCUA 3CUSA 2Y0EA 1ENPA 1GR1A 5HBRA 5K99A 4TYNA 1NMQA 1U3FA 4JOQA 3KV1A 4BVGA 4ZCIA 3GLFA 5TJHA 4ZYXA 2YY5A 4IJQA 3H86A 3X3HA 2PJRA 3LXMA 3D4PA 2XBLA 4YJ2B 1VHJA 3O2JA 3N5KA 4IDAA 4RX1A 4LY6A 4C0XA 1KZYC 4F6CA 4EUKA 5LBTA 2BLLA 4O2BB 3K53A 4NNOA 1PEAA 3U0VA 5AHKA 3T9FA 3MLAA 1RQXA 4RPCA 4AJKA 1DB3A 2P2DA 2CYCA 4CF4A 3ZE2B 4BUCA 4AZWA 4D8XA 2XCQA 4HGOA 4W9NC 4QOHA 5JZSA 1Z83A 3AO0B 2CNKA 4KXFB 3U9LA 2VZEA 5IZ4A 1ZIDA 3QHPA 1AXRA 5EKXA 4OREX 5KYYA 2W2KA 1ADGA 4O0MA 2WQ6A 1II8A 1HEYA 1O94C 3TZEA 4CM9A 4E6EA 4ETIA 1L7BA 5A7HA 4XVRA 2IH2A 4AKHA 1BGVA 4JYCA 3NIDB 2OBBA 1DZIA 3AG6A 3LQ1A 2HHHB 2DHCA 1AKWA 4E5PA 1PQWA 4KP7A 2R48A 4XJSA 4F45A 2G63A 3A9TA 3LI2A 3VMFA 3BRWA 4UCQA 1G4UR 3SG0A 4CM4B 4ND7A 5TMDA 4JI0B 3PQ4A 5AJYA 3K96A 2BMWA 1CE8A 3LS2A 4EW6A 3OE7A 2J5XA 1U3GA 1EXWA 3TZCA 1MU0A 3C8ZA 4PAQA 2PD3A 3E53A 4BUJA 1FMCA 2AYZA 2R2AA 1TCAA 3GN2A 5AHXA 3WIUA 2HCJB 2XOKD 4LBYA 5J9FA 5LMUB 1EP2B 1SMKA 2HA6A 3E3MA 4H4DA 2PA3A 3LWDA 1N5MA 5JARA 2VEDA 3ND6A 1SBZA 2PUVA 2Q3CA 3AIKA 4HS4A 2UZ3A 2F9MA 4ZIRA 1G38A 2GYWA 4Y2RA 1L5OA 1U9JA 2W11A 3PQ3A 4ZYWA 3AUYA 1LX7A 3MWEB 3PDHA 1FB5A 2CC2A 1Y7TA 2IELA 4CIAA 3IT2A 4EUNA 4HFJA 2WAOA 3H1TA 4F6RA 3UCXA 1DC7A 4DPMA 2OCLA 3FBTA 1QDEA 1R64A 4YV0A 5C4IA 4CEIB 1FQWA 1SIUA 3V8EA 1A95A 2G9RA 4TMFA 4IXMA 2JGAA 2YMMA 1JWAB 3UNXA 5H80A 4HWGA 1R0CA 3GRVA 1V4VA 4BBPA 3L8GA 1QPGA 1M74A 1QCCA 1M34B 1VFPA 4Y1RB 4OUKX 1ZUNB 3HJCA 1RWPA 3OTGA 3DLAA 2JNWA 2NN3C 4QDUA 4C0LA 4BECA 4H59A 2I87A 2XYQA 3IESA 3PX2A 1D07A 1U0SY 4LWOA 5CW1A 2LIPA 3NETA 2H85A 4KQGA 4NAHA 2RARA 4HX9A 1D6SA 4ENWA 3HGQA 5A4IS 5EG5A 5SZKB 3H8JA 2AWOA 2PSJA 3Q1LA 1KI3A 3UG6A 1CEYA 3Q2OA 4ZREA 5JNLA 2AVNA 1PR3A 3ADKA 2AOWA 4O4IA 3ZHRA 1GLGA 4BO1A 4YDHB 4EB6A 4O1IA 1V96A 1XTPA 3FKQA 3R0QA 4NVRA 3GCXA 4XXHA 3C7KA 1SUFA 3IVRA 3W5VA 5KTOA 2HHLA 2PMEA 4MR7A 4M1ZA 3TLBA 5IM4F 4B3MB 3QF7A 3AUXA 3H8WA 1GZ5A 2R0QC 3FI0A 1DCFA 3COJA 1Y4UA 3BGSA 4PYRA 1YC5A 1RU3A 3OHMA 3CC8A 3RANA 4JLSA 3DCJA 4BIMA 3HCAA 4LSMA 3RVQA 3UGJA 2I22A 4HGPA 4EG6A 1PS9A 1MHTA 4G0WA 4L9SA 3L8FA 3MGKA 3TIGA 2ON6A 4MKXA 1P4RA 2Q29A 1ST3A 2FW1A 3KHSA 3LG2A 1ZGHA 2DFKB 3JALA 4Q48A 4B44A 1HLPA 1NNEA 2IYYA 2V0GA 1YA6A 2C1EA 2PAAA 4Z0HO 3GD5A 1PL8A 4WNCA 4ID9A 3VVLA 5EIWA 5IF9A 2ZW9A 1EP1B 3GPBA 3VO1A 2GM3A 4IRMA 2QTTA 4YB8A 3ISTA 3OCUA 3ZHXA 4Q02A 4RVUA 5FO0A 5CBPA 4A26A 4IG9A 4TUYB 3W8DA 2XOXA 3NBZC 4ZDWA 4DPKA 3O0TA 1GQ2A 1ONNA 1P91A 1W44A 3FHOA 3NWPA 3T0IA 1QGOA 1XWFA 3PE6A 2OZLA 1XMIA 3BREA 1VP9A 2XHZA 4U00A 1AF4A 3MMZA 2NV6A 4BB6A 1QOPB 2QSYA 3CLHA 1Z2PX 2XMDA 3AR6A 2ZSDA 2CBXA 4M1WA 5DHQA 3V2UA 4YXFA 3ZDDA 2GEJA 1U9ZA 3HZZA 1OAOC 1GEGA 2X76A 2ZRBA 1GZ7A 3GJSA 3O5AA 3OOYA 4G0YA 1TD1A 1XZIA 3RVLA 4Q1BA 4BJ3A 3ELUA 1U0EA 1Z74A 2GAOA 3OQVA 5BNIA 1M6VB 1RIFA 5E4FA 3DZIA 4RK1A 3I8OA 3KQPA 4B3IA 1DFIA 4MR8A 1YOVA 4CT5A 5ESWA 2MSWA 3AC0A 4R54A 3VFDA 1V2GA 1DUSA 2GSDA 1TKRA 3II6X 1GQQA 4EHIA 1SKYB 1Y8QB 4DGQA 4BTEA 2GGSA 4A8TA 1V26A 3VZCA 4LBVA 3V4SA 3FKJA 1TTTA 1TEZA 1O8CA 4K3VA 2BP7B 3DDNA 5L8VA 1BQ3A 1FLVA 1N5IA 5ALEA 3U61B 5CD1A 2NWQA 3OSZA 4GGMX 9LDTA 4R1OA 3FSRA 5CNMA 4C87A 2G0NA 2VQSA 2D62A 1UKBA 4W1QA 3D3JA 4RD4A 3FOAA 4RMJA 4F85A 5KNCD 2ACWA 2OAP1 1U63A 2FSSA 2JLRA 2A0YA 3M6VA 1Z35A 1DPGA 2YZMA 1KI6A 3PC4A 2VTVA 2FZLA 5TGDA 3N05A 3NIBA 1T26A 1V1MB 1MQAA 4LJ4A 3O8LA 4EG3A 4HCJA 1N9ZA 4G01B 1TF5A 2EHDA 2WYOA 4YAJA 4MV7A 2P6RA 3L77A 4DWJA 1E1LA 4WIAA 3FOZA 3W3ZB 4IEEA 3CZ4A 1RQNA 2NGRA 4HEHA 4ZO7A 3UVEA 3VNAA 3ZVKA 2AUMA 4ZVTA 1EP3B 4ZVOA 1JB1A 3OO1A 5T4EA 1FRFS 2VDLB 3ZJ5A 2P1ZA 1KI8A 2ZANA 1Z0DA 2GD6A 4PHFA 5L3RA 4AX4A 2Z56A 5L53A 1USWA 1C0IA 3U3MA 4K6MA 4QUHA 4DR7B 3TQFA 1XU9A 1XIVA 3ICWA 5MFZA 3LSTA 2G72A 1O6BA 3PC6A 3P9PA 1E5DA 3B8HA 4K2AA 5GJWC 4AJPA 2DR2A 3EGXB 4C6TA 1UODA 2JVIA 2HMAA 2O9JA 3CLTC 4XPIA 2OBMA 3NFYA 2QQFA 221PA 4CEHA 2AFIE 2AMYA 3B3GA 3G17A 1EJ6A 2ZAMA 1C80A 2DWQA 4L4SA 2W5UA 5EQDA 3FUUA 1U11A 1R4MA 1TIBA 1ZUIA 2Q9BA 4I50F 5FUQA 1ISJA 1YASA 4MHTA 4NJMB 3DTYA 2H0AA 4GF5A 4WSOA 2FSPA 3SEFA 4AN4A 2G71A 1E3MA 2IEBA 1KDZA 3BK1A 4F11A 1RPTA 3ISVA 2R8RA 3EZ9A 1A9SA 1DQZA 2JZCA 4FYYA 5ALTA 2C7RA 4GMDA 4MKHA 4QIHA 4TROA 4RZXA 5ALHA 4EGFA 3R9XB 3MT7A 3U39A 2IYSA 3GVIA 3C3PA 3B5EA 5ARDA 4QBKA 4BCBA 5BR4A 2CHQA 2FPUA 3B60A 3OOJA 3CEHA 5B36A 4QM7A 3L7JA 4MWZA 2A58A 1H22A 2VK2A 2XZTA 3BSSA 1JJFA 2Q41A 3IKMB 3OA0A 3PHCA 4ZO8A 4C4OA 1GHTA 5TV2A 3R3VA 1UZLA 1RBZA 3FPGA 2A33A 1IRXA 2P9GA 4K6FA 4OB7A 1Z8NA 4X7RA 2WM2A 3CPJB 1QR6A 3Q7EA 1DC8A 1RADA 4XQGA 2A5YB 1ZAYA 5AXAA 3E6AA 5DNEA 1H2XA 3VJKA 3HUTA 1W8DA 1UC8A 2XXJA 4LHXA 3I23A 4ILKA 4LKRA 4S2UA 3HACA 5AI9A 3ZXYA 1IVSA 2IYZA 5F77A 1WLYA 2WUFA 3IEIA 1MABA 1TVCA 4X90A 3WLLA 1ZNYA 4F2WA 2C4TA 2WM8A 1I30A 2IYFA 3ASVA 1HKHA 5D8DA 3DHEA 4HFMA 4YRQA 3TD9A 1XZLA 3O7WA 4I8XA 1KEZA 3CNHA 4M4SA 1FFXB 3VAYA 4OXKA 3ZDCA 1P29A 5K7SA 1P17A 2GDZA 3GLFE 1QYCA 4YGYA 5KOHB 3DWGA 4JELA 5AFSA 1XCLA 4P58A 3PUXA 1U2DA 2C3MA 4MVJP 3EEOA 2P6PA 1W4RA 5FOTA 3FA2A 1FW8A 2ZVPX 5ALMA 3L46A 4G89A 1SBHA 1L8QA 1NMZA 3PLNA 4WERA 5H4HA 1PKEA 1QTRA 4OAQA 2NSHA 5JZBA 3V2IA 4NRDA 2WFMA 1OFUX 2QTFA 4KXMA 4RH3A 2P9HA 2D74A 3LDAA 1PG5A 4ARBA 2EEPA 3UAZA 4NYIR 4XTCS 3D8UA 1SPXA 2PDAA 4KXYA 3QNMA 1WUKS 4BX9A 1UF9A 5IDQA 3NHAA 3CZMA 4RA9A 4B3JA 2AZXA 1P62B 2BFOA 3DTTA 2H1SA 3AEZA 1B3RA 2A57A 4AG3A 2ANBA 4E1AA 1GG8A 3VR6H 4FZJA 7YASA 3RWBA 1RZRA 3HSKA 5CVVA 1PS8A 3F5QA 3QELA 3G5AA 3JD2A 2QAIA 1NF9A 2Y68A 2ZB2A 1YI0A 3STVA 1GL9B 1NE2A 1P6QA 3SC3A 5K6TA 5KWVA 2A9QA 2ZI7A 2H0RA 4REQB 1SXIA 1ZGAA 1IXZA 1BHJA 1YB2A 2A4MA 3QUQA 4RZSA 1WS6A 5DB4A 5FUYA 2R5FA 5DGIA 4CM8A 1N0HA 1KJJA 1FEZA 3IOYA 3KFXA 4Q3CA 3F5SA 1HDYA 3IO5A 2CWDA 3MIZA 1R8YA 1LPSA 3PE4A 5FUWA 4JLNA 3RYFA 3GHYA 3SLGA 1RYFA 5L6LB 5EJAA 2RGUA 3T9AA 4FHCA 2H2HA 2WTNA 4F8YA 1VLLA 5FR2A 1CRPA 3FPFA 1S8AA 1U65A 1DFGA 4R69A 1R9GA 3FCOA 4BKRA 3L6CA 3QFFA 5BUZA 4HRVA 1RWOA 5HRCA 2CFRA 3T3DA 3THOA 3EXEA 4CIDA 3L6RA 4G8JA 1VJ1A 2JGIA 1QZ3A 3KE8A 3LFTA 3O1JC 3Q4GA 4TMVA 3CVOA 5JC1A 2DWOA 1SXQA 3IEVA 3H75A 1O77A 1CJKC 3QQPA 2JBWA 4INOA 2BRUC 4EMSA 3BJMA 1FNSA 4H7FA 3V8NA 3G6KA 3L1VA 4UEQA 1QQAA 3MCTA 3U4DA 2GTPA 2FSIA 2JANA 4WZZA 5FI1B 3RVMA 2DHQA 3AOGA 3DO5A 3HMQA 4YO7A 1WBJB 5ALRA 1W9MA 4QPDA 4IDGA 2QYTA 2Y1KA 1IHXA 3CWQA 4NLLA 1RWKA 4K9SA 4JUAA 4OHKA 3ZDXB 5TY0A 2H7YA 3ZQJA 5A9RA 4IS3A 3F9RA 3DDOA 3V8MA 4Z7NB 4Q15A 2GFQA 2BM9A 1MAWA 3WLKX 4PG6A 1BOFA 1MOQA 1CUGA 2EERA 2OK7A 4FYMA 5IYZF 4CM3A 1VG8A 4QLBA 5DP2A 1QGUB 3L06A 4EFLA 4AICA 4CJXA 3CUYA 1VG1A 1L5ZA 5B6JA 4ZT5A 3LHIA 1EAMA 1ZSVA 4FC7A 4KO3S 1X2BA 5G02A 1WXHA 1XA3A 5B3JA 4US2R 2JFYA 5DLDA 2FPSA 2GAIA 2JHPA 3U3JA 1NNSA 3WLPA 4AKSA 3FVQA 4LY3A 4TXHA 3AUSA 1W0KD 3H9BA 4G0MA 4JC8A 3ZDQA 3IHTA 2BSQA 1ZC4A 4OBWA 1FNCA 1DADA 2EF1A 2F17A 3AFHA 2E89A 4M22A 3WLJA 1TYDE 2Q62A 3UQYS 2P9BA 1NF8A 1N9GB 5KNBD 3W2EA 1Z34A 2I9PA 1GPYA 2JJ1A 2JFWA 4JKIA 3O4GA 3LCMA 4B6GA 2Z43A 1PGOA 1UDAA 3N0WA 3TAXA 1PT6A 4NMMA 2Q5QA 2DH6A 1CZKA 3MTEA 4QLAA 5BQXA 2NU9B 4A0RA 1X1AA 4HB0A 4DA8A 3HXQA 4HFRA 3CZCA 4IRXA 2A1UA 3BGVA 1VPWA 1BD4A 2CT8A 1KK2A 2G8NA 1GN9A 2GTHA 2Q9AA 4TRRA 4UHDA 5AR1A 1X6VA 3TI9A 2NZVG 1QKJA 1QHEA 2VHQA 2CK3A 1L5NA 3PZRA 2JI7A 4GECA 1DQNA 1UMBB 5A6VA 1FA9A 2F9FA 3S8YA 4QUAA 2C20A 2IY9A 5H59A 4MRSA 1XZJA 4HEJA 4O0LA 1OWOA 3AW9A 5FBRB 4Z1MA 1VKHA 5DHUA 5JH7A 1I10A 5L4SA 4DG5A 4BNTA 5IH7A 2XZPA 1RI5A 2Z9CA 3W6NA 1SVLA 1A8SA 2SHKA 4ZV7A 5EYPA 4R2HA 5HOQA 3ZZMA 4UREA 5AKXA 1V37A 2DFLA 3PQFA 1NPYA 2W6IA 1XN1A 1QP7A 4MJ3A 1U0BB 1MH1A 1C5KA 1J56A 2YHIB 2H48A 4RPHA 3UMCA 1NR1A 1JJAA 1TYBE 3F96A 4IIJB 4JB2A 5K6AC 1G0NA 3GLVA 4EQ6B 5IUKC 4Z5XA 1DEHA 4HADA 3BM5A 1YE5A 2NYVA 3BUSA 1DSSG 1UPUA 4TL8A 5FLYA 1K5PA 4UVHA 1VTKA 3G49A 3OCCA 1ZR4A 4ZMBA 2JJQA 1I3KA 2VP5A 2I7CA 2AFIB 2XDYA 1T9KA 2ZI6A 4CM5A 1C2TA 1SHKA 3L0DA 3OZDA 4ZQGA 3G9TA 3AH8A 5C1OA 4D0RA 1QIKA 3Q7RA 3ZEIA 1RLTA 1CB0A 1REQA 1AS3A 5D7NA 3GA0A 1U3CA 5AHRA 4X6XA 2FAXA 4XX1A 3W5IA 5DRTA 1GDDA 1AK2A 5DP1A 5H68A 1NONA 5EWJA 4MQEA 2F1HA 5CNIA 4DCOA 1H2YA 2XVMA 2Q3DA 4JBWA 4WESA 3HJUA 3BSWA 5LA6B 4A36A 1U7WA 2OE2A 2BMEA 2CKMA 4G6ZA 3EZLA 4C5CA 1SQ5A 4WN9B 3AHEA 3C3EA 5H82A 1G17A 2G8LA 3PI7A 1PO7A 2R25B 3LPLA 1IEVA 4NS1A 5JSFA 3HPQA 2BC9A 1LLCA 1ZU5A 2QMEA 5SZJA 4F4HA 4AUNA 2WJHA 4YONB 5B4UA 1WXIA 4WOPA 1HFKA 3PUHA 3ESZA 3HVKA 3GBPA 3FUVA 3OE5A 1NW9B 4CHTA 3OH8A 1GAXA 1DT5A 3F1KA 2GDJA 2WHQA 2Y0PA 3P9YA 1OPXA 4LKOA 4IQ8A 1T29A 5K3EA 3KU1A 1YQDA 2IPNA 1KI2A 2BKEA 2M6KA 4AQ7A 1EGHA 1Z0JA 4X85A 2QMHA 2OFOA 4X1IA 4DXDA 1H0RA 3IDSA 3UMBA 2G5PA 4MPPA 4HDNA 1T4MA 1F8FA 2BCGY 2MSDB 4LCBA 4C30A 4HAUA 3I0MA 3C6KA 4OXNA 3C87A 2QP9X 1GAEO 2VEOA 2ZIXB 2WC1A 5LR6A 3O0DA 4LOHA 2XQIA 4MWOA 3TW8B 3F7MA 2IU4A 3FR8A 1ESNA 1PVVA 4RGBA 3UPUA 2UZ1A 5ICCA 1B74A 3OD5A 4Y0VA 3EDQA 2C03A 2ZRGA 3CMMA 4QTZA 1EKXA 1M5UA 4IL5A 2DOKA 1LNQA 4RQBA 1ZNWA 3JQ8B 4AJOA 3B6KA 3EFOA 2VQFB 2ATVA 3T3MB 1BFDA 4HRYA 5KYYB 2N3ZA 2W2KB 1UAAA 2O19A 4PPFA 3N75A 5G0UA 4OUDA 3ZJVA 3CX3A 3FSEA 3LKBA 1O9GA 4IUDS 2FPKA 4QQNA 1KEKA 5FCDA 4EG1A 4JP5A 1MX3A 2CLLB 2Q6OA 3FE2A 1OTYA 2O4UX 4G9GA 4BV9A 2ZWOA 1JYEA 4II2A 1Z0SA 3EUWA 3CKLA 3ZN2A 3OE1A 1AGPA 3I34X 2HCTA 1JFVA 1V39A 3QJ5A 3VZPA 2QRUA 4IJVA 2GK3A 4NV3A 5CMLA 1CE8B 3KDAA 2AUTA 4QQKA 1PWEA 2EJTA 2VSXA 5CDFA 5KSYA 4KC0A 4NZOA 2WUWE 3ORFA 4KAXA 3VDXA 4ARZA 4RTLA 1SKUA 1OJ7A 3FOCA 1G291 3OU7A 5ALYA 3TNDA 2V3WA 6GPBA 3DMFA 3CIOA 1H1DA 1VHWA 4XYLA 1JBEA 3KYBA 4QFDA 2ID7A 4JJ7A 1T9ZA 2HOQA 3D7SA 1X13A 3N07A 1JECA 4KJZA 4NU8X 4UU0A 3U2QA 5LXTB 3H9CA 5EY5B 2I29A 4CXMA 3GA7A 1ZH4A 4PFSA 3FLMA 3AF0A 1LDBA 4KQ1A 4NJOA 1GTZA 4Q9LA 2FSHA 3N3AC 4IR7A 1M8GA 1R4NB 4MVJM 4ZIRB 3J7TA 2BBSA 1B0UA 4AZ3B 4ZXFA 2NW6A 3K6JA 5FRDA 5LVAA 3DEKA 3LX5A 1XF1A 5K3DA 3SF0A 3Q72A 4Q3OA 4F7WA 4KWTA 4MR9B 1N2SA 2C3YA 1A0OA 4I4CA 2FQQA 5CH3A 2MMCA 3PUJA 4YJ3B 3C3WA 1XQ6A 3NBFA 2ATCA 2YMLA 1YC2A 2P4SA 2HKIA 4RTSA 4TV9A 2WTBA 5DGDA 3E4CA 2TMYA 3UGTA 2PD4A 4PTYA 2QLLA 3P9NA 1Q0PA 2D0PB 2XA9A 4GWGA 4JY7A 3LQFA 4U8GA 5K3FA 2DPYA 1CU1A 2XUGA 4PEVA 1IBRA 3CPEA 3EOZA 4Y9RA 3GLIE 4BB0A 1UM9B 4EO4A 1Z8DA 4FZ5A 4Y2HA 4RPGA 1YR3A 3JX9A 3BD8A 1YZHA 3BMNA 1MA0A 3E7DA 1IAQA 1VCMA 4EO7A 1BDIA 2H7XA 3SR3A 2VK1A 4XWOA 4KSBA 4ARUA 3INGA 4O4IB 3VYWA 4AKIA 3MUNA 2VG8A 3FPHA 3DFUA 3NRBA 4RADA 4UUMA 4JODA 2Q3HA 5GV8A 1ZS9A 2E55A 2R86A 4MR7B 2OZEA 1F17A 3HR7A 5DTQA 2GZHA 2BEJA 3QUCA 4NMXB 3RJZA 1QDLB 2ZS7A 3L4BC 1IPEA 5A9SB 1VPVA 2BM0A 1O4VA 3EIUA 2JFVA 3O1LA 4QGFA 4LJKA 4ZOBA 1BRMA 3EWAA 3OEEA 1T0HB 4PS1A 1GFIA 2X5OA 1TLTA 3LP5A 4ATNA 5FADA 3OU2A 1AMNA 2O23A 2XDWA 3WL3A 2J5QA 2IXGA 2XNDA 2JIZA 1Q6ZA 1R6DA 1RXIA 2LXNA 3GLKA 4Z6KA 1JKFA 3DBRA 2WMOB 4NF2A 4Q1AA 4EJ0A 4S04A 1ID8A 2GO1A 4GR9A 4K87A 4NCAA 1GGJA 3ZNNA 4QU5A 5ALOA 3WP1B 3L4JA 3ENKA 3BSFA 1ZJ6A 4B6RA 3TEMA 3OPXA 3OZSA 1P3Y1 4HEA1 1G60A 4TTVA 3E1KA 2OV3A 4QXRA 3UTCA 2CYBA 1H0SA 1MJNA 2QAGA 3FF4A 4WXEA 5CT5A 1BWSA 4B4DA 4YCCA 5CTJA 3KKQA 4PX5A 2XIJA 4AIIA 2BEKA 1T3GA 3DMNA 5G4LA 3KZOA 2A86A 1MO2A 3KU4A 3IHWA 2F2TA 3VHLB 2BMAA 2AC7A 4WFKA 3X44A 2ID9A 2QRHA 3FPBA 2WWFA 2BFDB 1KO5A 4M0PA 2OQVA 3A9WA 4FWIB 1U8UA 1N6PA 4YRSA 2X0RA 5HJ2A 2OQRA 4UFOA 2PLNA 1QHNA 2B78A 2EKZA 2REXB 4ZP1A 2Q4OA 1FDSA 4KFTA 2NTVA 4JLDA 4MPRA 4ALLA 1F4PA 4OYHA 4HEA6 2ZZMA 4B3XA 4EY6A 1E32A 4CM9D 3FGZA 5FBWB 2C2BA 2QX9A 5JFOA 4ZTZB 2AFHA 1E59A 4BFWA 1JP7A 5EMKA 4DW8A 2QDXA 5ERYA 2O5EA 4E46A 1GTJ1 3DB2A 4WZAB 4N5MA 2HJHA 4BBJA 4XFJA 4KE6A 3K9NA 5BW6B 4JX9A 1XA0A 2ZULA 4XZ3A 5JW6A 2VYQA 3ZWNA 3VKVA 2H11A 3Q3IA 4FMCB 1JNXX 4KB5A 4PZEA 3T3EA 4LFBB 3AM5A 1VI2A 2IIBA 5HW0A 4XM1A 1NDQA 4BU0A 4Q00A 1UZNA 5JS2A 2LCFA 2DPHA 1ADFA 2G25A 3IAFA 4ZQIA 5HKKA 5JWRA 3LUDA 3OE7D 1WZCA 2H2AA 3PLRA 4U2DA 3CO0S 2EARA 1FX0A 5DASA 4X1YA 4TTRA 1KYXA 1T6XA 1G8PA 3GRFA 4HSGA 4R8VA 1U80A 1CR0A 1IXSB 2IQIA 2J4FA 1J2YA 2ZWIA 2EWVA 4HLQB 5FQNA 3U3KA 1JAXA 1HV8A 1Y7IA 4JOSA 2EAUA 2HU8A 3GUCA 4OEHA 2R1ZA 4KN5A 5G41A 3MTGA 2HA3A 5LWHA 3ED5A 3NV7A 4PO9A 5J5VA 3ZUPA 3UAWA 4RCVA 2RAVA 1RTTA 3LMKA 1NP3A 2TMDA 3O3CA 2Z3VA 3HCOA 1D8TA 1DJPA 1OFHA 2XECA 5L3VA 1QLWA 4TYMA 1FW6A 1KVTA 2P1DA 2ZR0A 4F9GA 1W36D 3L0ZA 4QQRA 4JVNA 4J94A 4KH1A 2JRLA 4L73A 4RD0A 4TM8A 1EUZA 3PIDA 4QBGB 2GKSA 1W4ZA 3O8QA 3ZDRA 2G28A 1Y9DA 2H5JA 4C6TB 1E2HA 1ZZGA 1KOGA 1A5TA 1TM7E 4LXQA 5HM8A 1ZK4A 3B52X 2X19A 5TQ0B 4MVJA 4ECEA 3AL0C 1MEEA 1PYDA 4OXYA 3AHJA 4AJNA 4Z3KA 1WE2A 3ER9A 4CKBA 3H11A 5SY6A 1P39A 1H1LA 2IUEA 1KWGA 5LBIA 1SQ6A 2CJXA 4IZIA 3SC4A 4CKXA 3M6XA 1R37A 4RORA 5KVSA 3ODGA 2ZZNA 3PNYA 5BR8B 2QUIA 3L2OB 2G83A 3IJEB 3LQYA 3OPNA 3S99A 1I0ZA 4RKQA 3PUWA 4L5AA 1RMTA 1RWNA 1SNYA 3L5KA 1GDHA 4U7FA 3MWJA 4IAOA 5BUCA 1WHTA 3RH0A 6Q21A 4QC2A 1KMNA 3WK8A 4P38A 5LB4A 3VHXA 1NKTA 4MUHA 4JL6A 3ORRA 1E3LA 4CKCA 1AH2A 2XE4A 4FDAA 1DJNA 4U4AA 4FOSA 1E9RA 1PQ4A 3UT5A 4TKUA 3LIPA 2E85A 5BWOA 3SEAA 3W9BA 4KQWA 4XIFA 3OZUA 3WB9A 2R1VB 3G9XA 5MGNA 5FWYB 1H9BA 1ZOOA 4I4TA 3D0RA 1M6HA 3P2YA 3DZCA 4Y6SA 4JC5A 1K3TA 4E2XA 1FMFA 2Z4RA 2HD4A 1LFAA 4RZIA 3TQSA 3W5UA 4I7EA 5J3JA 3THXB 3GRCA 4N5NA 4AY5A 5BWBA 3KAPA 2NU7A 3CVUA 1I1HA 2EP7A 5JXHA 1ETUA 3PDJA 5IKPA 2H1CA 4CETA 3F1LA 4IIEA 2BUAA 1K6JA 1W29A 1QO9A 2Q5EA 2V65A 3L8ZA 4R31A 4V0LA 4BFCA 5BT8A 3B13B 4B7CA 3LUAA 2WU3A 2WEKA 2FE1A 5ADUS 2HADA 3THYA 4HVCA 1VB3A 1RM5A 2HEGA 5E6UB 2WFAA 2WKSA 2WQZA 1CFJA 1BE0A 2XMGA 1EGAA 1L1QA 1WB6A 2VDMB 3ECCA 2JCXA 3WLEA 2FUNB 1NIJA 3I9MA 1ZH0A 3MS7A 2QNIA 1PV1A 3P5BA 1JXAA 2VK8A 5JJBA 4FMDB 1WAMA 2XXBA 3R9WA 3TBHA 1M54A 5KQMA 1BZYA 1UPBA 1W1UA 5JNSA 4K46A 1YFZA 1TTPB 2EBUA 2QNBA 3DAPA 3LZCA 1YZVA 2MSNA 3MLEA 3N28A 4M0UA 4MIYA 4ZQFA 4DV4B 1R12A 3KNZA 1GCIA 2KBEA 5EQJB 3FVVA 1ZITA 2JI9A 4J03A 3R20A 3S8MA 3FNBA 3A1CA 1CRQA 1I13A 1JZSA 2BEUA 3CO5A 1E3QA 3DV0B 3H2GA 3O8NA 2XKBA 3DF7A 1M6NA 4HGQA 1GAQA 1XTVA 2Z09A 4KTVE 4MW4A 2B1JA 3AJRA 4B46A 4F1KA 3ZHUA 3QWIA 2CKDA 4CM8B 5A5VA 2PKQP 4PSDA 3OQ6A 4WOBA 3A2KA 3SYLA 2J7PA 1U8ZA 2WWTA 3BCRA 2HTFA 3WBKA 3LU1A 1OI4A 5CK5A 3CSSA 3S2UA 1UXOA 5CDFE 2ESRA 2HUPA 4DNFA 3UB2A 2VF8A 2B30A 3EG5A 2PGXA 1Q91A 4KQ6A 3RBAA 1ESEA 1NVEA 3NM6B 1W46A 3V5NA 1Z7EA 3UJBA 3F4LA 3WYNA 1GJRA 1U8XX 3R7AA 5JBQA 1D7AA 1PR4A 1UBGA 3IEPA 1Z6ZA 5CLFA 3GJQA 1KRWA 4JLKA 3HB7A 2IODA 1PSWA 4QDKA 3PTAA 1A88A 2R751 1QC5B 2IBSA 1BS9A 2RI6A 1J2JA 2X6RA 3HSSA 4F0JA 7REQB 3IQFA 2ZBGA 1A9YA 2IF0A 3PUZA 3DYBA 3TAUA 1WUJS 1G63A 1X1BA 3ENQA 3M4YA 3MJVA 1H2ZA 3B89A 3PRKE 1ODJA 3B6EA 2XT0A 2VPQA 1QWSA 2NZYA 1SN7A 2Y3IA 3KSBC 1CR6A 1ZN8A 3KOZA 2JAHA 2QY6A 3O1HB 1AHHA 3S7TA 1RJ9B 2FW7A 1Q1ZA 3OTOB 2AN1A 1KK3A 4YR9A 5ITVA 1A1SA 1BQ4A 3A05A 1DI0A 4MVCA 4WNIA 4YH1A 3LBYA 3JQFA 4QODA 3VV2A 1EIWA 3K0AA 3PXCX 1CS0A 3U3OA 2Q6VA 3EEQA 3V1LA 4JL8A 3O90A 3BMXA 4O4JA 3PVSA 2WKWA 3B3JA 4BEWA 2YWHA 2A9KA 3O8BA 1BDMA 2Q2OA 1X7GA 2BHRA 3KUUA 1QP0A 3DT6A 4BS9A 1P75A 5CGQB 3ZBTA 1DPFA 1O2DA 5EWMA 1Z39A 4ZAXA 4LE1A 1G5PA 2WSMA 4IIFA 1KQNA 3EXFB 2HMUA 3JD3A 2Q3EA 2ZUDA 3G5LA 3Q7SA 3C4VA 3GNSA 4YUVA 3TNYA 1GZVA 2IX3A 1U7PA 1VCHA 3L7IA 3W8EA 5LJIA 4Q7MB 1KQGA 5EP1A 4HBZA 1KAEA 3AVPA 4KE7A 2HX1A 3NOQA 5FKJA 4GQBA 4LY9A 1J5PA 2ODWA 1KVUA 3K05A 2OA0A 1ATZA 1AMOA 4IH4A 3DMYA 4K81B 4K1LA 4AUKA 5AM5A 4BWFB 1QP8A 1D2EA 3WWPA 4A03A 1KDRA 3D6VA 5BWLA 1BIFA 2OXFA 1LJUA 3E9DA 4DBVO 4CL3A 3RGGA 3EH1A 3UWMA 2X3UA 1DINA 3B6MA 4B6FA 3VR3A 3EA0A 3K73O 4RF3A 4AMYA 1CUBA 5TNXA 1T3TA 3BT7A 3QHQA 4GPEA 1A04A 2NMVA 4P8RA 3LJKA 4UPVA 4NCNA 5HOEA 1XD8A 4XWTA 2OUKA 4P3KA 2H1OA 1JHDA 3K0FB 2RGRA 1SXJB 5DNDA 5EJIA 2BI7A 1Q19A 4FCCA 2VF4X 4KDRA 3OJEA 2M32A 3TM4A 2RG1A 5DIZA 1TUEA 3RG8A 2W6QA 3AI1A 3GMDA 3ZHQA 3M49A 2G9VA 1UBMS 5D01A 3RVBA 1G2IA 3ZU6A 4CLOA 4I2VA 4CMGA 4EHFA 3C6QA 3VNUA 2G70A 2VN8A 1IEQA 2C5EA 3HKCA 1NQXA 1U02A 3PHHA 2CYAA 2PMKA 2PGOA 3MHPA 4IDFA 4NBSA 4ZI5A 3UFBA 1P60A 3JQ7A 4KL8S 2NSLA 2ZIEA 1O4WA 3M5WA 2OVBA 1ZMBA 1Q7CA 4YRMA 1GL6A 1YQQA 4INAA 2R4QA 1Z12A 5CA0A 2XGGA 4R7ZA 5JNWA 7MHTA 1U6IA 4HYTA 3RC7A 3NT4A 3HJHA 4RSHA 1MOPA 5DSZA 3D7RA 1D9ZA 2AKYA 3Q9UA 2HDHA 5T4HA 1AE1A 1YU6A 2AFHE 2MHCA 2WUEA 4OKNA 4PG7A 2OZKA 3EF0A 4YACA 5EJ8A 1RZRD 4N41A 2O8DA 2B34A 5FHRA 1N1DA 1IUNA 3I73A 3Q2KA 3ZG6A 3HXLA 4HNTA 2ZJ6A 3NBKA 2YYZA 4MVJG 4MQFB 4YRRA 5CD9A 3N0XA 1H05A 3LXRA 4OFZA 1XL0A 2YV1A 1COZA 1AKRA 1K92A 2QAJA 2ZDHA 2G77B 3C7DB 3HCWA 3MB5A 3MMXA 1DC4A 3OOEA 2YV5A 2Q5FA 5LB2A 4HMOA 5EKDA 4C0WA 3BWDD 3WZLA 3ETNA 1QH9A 2MYUA 1G9SA 3WGUA 1W48A 2PEZA 2DTDA 3I5AA 4PBTA 1JWLA 2YMQA 3L1KA 3W77A 3AXTA 4MINA 4MO9A 3M1AA 2RHRA 4Y6QA 5BSGA 2ZYWX 1OVMA 2R60A 3AZPA 3HFJA 4FNOA 4CLHA 4M1KA 5C80A 1G8MA 1TB4A 5IKMA 1ZIOA 2QZ4A 3JPWA 5EIFA 5TRTA 5HZKA 1T34A 1VE7A 3GV0A 3ETGA 3CZPA 4IMRA 4QGGA 5F3DA 3RS0A 4DDUA 3IQZA 4XPZA 1PFYA 5E8JA 3X1XA 1SKBA 4YRKA 5D84A 3OWXA 5ELXA 2YC2C 1CBUA 1NVFA 2EBHX 1NW7A 4IMPA 5U4XA 2C5LA 2JFQA 2X7JA 4YGXB 1KMIY 3PICA 4QVGA 2H1WA 4QPPA 1P2DA 2OXTA 3FDZA 5A4JA 4Y1EA 1J99A 1MC1A 4EYOA 2VXOA 4RCZA 3WMGA 3KYCB 4X1IB 1G5QA 3AGQA 4R41A 3W3AH 4HDNB 4ALNA 2P2SA 3KV3O 2PZEA 3ADOA 3OIYA 5HTKA 1N3BA 4MVJE 1RMQA 2GFIA 4JKOA 1W52X 2INGX 2C83A 3KX2A 3OJLA 5CYOA 5B1DA 3D0OA 1HL3A 2FN9A 3GRAA 3MTJA 4TL6A 5CDUA 5GZ1A 1G3RA 3EFHA 3CR8A 5IC4A 3ZI4A 2UZ1B 1QHYA 1C0EA 3GU3A 3KZVA 4JDUA 2Y0CA 3ZOZA 2VPTA 3DZKA 2LBPA 3SMVA 4JQSA 1I14A 4UJ3A 4EJSA 3PVZA 4NBKA 3T0GA 5JJCA 2LP4Y 3CZAA 3IDFA 4L3OA 4U63A 1YK0A 1RKXA 5KCMA 2AR9A 1EFTA 1D2NA 4GRIA 4L4UA 3X2SA 4HXYA 2WWWA 3FYSA 3RRMA 1ZXBA 5DM70 3K1YA 1K8QA 1SELA 2BGTA 2F9LA 3MWDA 3HUFA 1OFUA 2YXDA 3LVFO 3RARA 2PMBA 1V43A 4HXFB 1NUPA 3IMKA 1E5LA 1ML4A 1I32A 2GN4A 3HEBA 3QA3E 3UXHA 4BBAA 5JCOC 3LBHA 4LK3A 4MQ4A 4BAUA 3QOWA 2JJ1D 3R5XA 4C4PA 4LF9B 1C14A 1A9PA 3H9UA 4E12A 1QH1A 3LK6A 1RIIA 3DBVO 1Z06A 1GZ6A 3JYPA 4MQMA 3ICQB 2OBNA 2ACVA 2OZPA 3MGAA 4AJ1A 2Q1WA 4TRNA 1A69A 3O73A 3UV3A 3CA8A 3CUEF 1AQNA 1G18A 3ZTTA 1NP6A 3C5VA 2V59A 1XJ5A 1A4RA 1K6IA 4B8ZA 3V9PA 4NC9A 4BB9A 4F46A 5BP7A 4XW2A 5KC9A 4QOSA 1NMSA 3P9IA 3ESDA 4Z0TA 4ARZB 2CK3D 2HCBA 2WT8A 4NCIA 1W7AA 1RRPA 1XNJA 3BK2A 4JVSB 3OCJA 5D3MB 2W98A 3QJYA 1MHPA 4NE7A 4C7MA 1H2BA 2VQ6A 1DAHA 3LBNA 2KWIA 2P1RA 1W581 2BGJA 1G8HA 1YKGA 4K05A 3GXBA 3KZCA 3V4OA 4WJLA 2A92A 5DGTA 1C9YA 2ZYVX 5WRFA 4TX1A 2YN0A 5DO9A 5A5GA 3QUSA 5JBNA 1KU6A 2Z58A 4F12A 4TKLA 2PK3A 2HW8A 3P5SA 2W6ID 4TS3A 2PX3A 4RL6A 1A9ZA 1Z4QA 4EW1A 5KVCA 3TRFA 1JUDA 1O0SA 1AUOA 1TZJA 3CX8A 3NO4A 3I1JA 2IHJA 3DFKA 3TECE 1JFTA 1DBIA 1NSYA 2IF2A 3MWYW 1ADBA 3I1IA 1X3SA 3TLCA 4FLEA 1CVRA 1KO4A 5ALSA 4ZRNA 5E6SA 2W48A 3UXMA 2XKKA 2LPMA 1TM5E 2DP4E 1XHFA 1FXWF 1LUAA 4XDGA 2I3AA 5HR5A 5K3FB 5TB5A 2KQUA 4TQGA 3IX7A 4RY2A 2GEDA 4V0SA 1W5AA 3TE6A 3RS4A 2W6MA 2PX5A 2QN8A 5IM4A 3MSXA 2ZBFA 3M5PA 2DWCA 2YFYA 3VR6A 5JEEA 3PB3A 4YRIA 5JS1A 5G1NA 3BE6A 4RZHA 5J40A 1HDRA 2IIQA 3BYZA 1VKJA 4MLCA 4GX0A 5I4BA 4BNNA 3DAHA 3CRW1 2X0FA 4K6CA 1QAMA 1ZVQA 4DT1A 3TGPA 1RXCA 3TL2A 2YY6A 3JSAA 3R7FA 1XDBA 1OA0A 3PPXA 5HQTA 5BV2P 1FLDA 1FUIA 2JBHA 5HQ3A 4FDMA 4C7JA 1PFGA 4QPJC 3SQDA 5A3JA 1K8RA 1XZEA 5E7QA 3SIWA 1UDRA 4YMGA 3KM0A 4HH3C 4EH1A 1UXKA 3F6SA 2R5NA 4E33A 1OYYA 2WU0A 5K0ZA 3OPQA 1CEQA 5FXMA 4R9NA 4TS9A 3QHAA 4RABA 1HYQA 4LJLA 2N42A 1U7TA 3EHDA 4JMLA 4MWGA 3L8MA 3BAZA 4WGFA 3QX9A 2FKNA 2XWQA 1PHRA 4QU9A 3WL6A 2D1TA 4F2PA 1DRJA 1P73A 1ZM3A 1PNVA 1E2GA 2GJKA 2Y76A 3C0KA 1FQOA 3C1UA 3RBVA 2OG2A 2NOAA 2V97A 3GNLA 4G26A 3UXEA 3WNZA 1GFZA 2VJYA 1S02A 3WIEA 4EGJA 1Z7BA 3C3JA 3MWGA 2RONA 2I1LA 4YQZA 1T2NA 4AN1A 3AVVA 4KPUB 2XDQA 3TQQA 4IGEA 1FLAA 2QL7A 2VHJA 1JALA 1QHIA 3K9QO 1CR4A 1FVHA 1GAWA 1VL8A 1NJFA 3F5DA 4OQDA 1KAHA 4NNJA 2HU7A 2QAGB 4DE5A 1LC3A 5CLLA 3RC9A 3H1GA 1Y1TA 1YBMA 5J58A 2VLBA 4YCJA 1Q0TA 1N0IA 3QITA 1COWA 2VUTA 1BHSA 1P1IA 2JHAA 3RUIA 4YT8A 1T0PA 5A5DA 1SCAA 5FUVA 2H9AA 2NVWA 3OG9A 4UD2A 1E2LA 4AYXA 2BFWA 1C2YA 2PS9A 3BWYA 1ANKA 1MAHA 3DL0A 4O3MA 1P1FA 1THTA 4H17A 2DBRA 4H3KB 4UHBA 3D6FA 4QU0A 2HYDA 4U8HA 3AUFA 4HWTA 3ZW9A 2R1UA 5K3CA 3K0BA 3EXHB 1NVKA 2H8GA 1Y8RA 1C9JA 1U90A 2XRFA 3BCUA 1IHUA 1VYHA 2OECA 3JU3A 1YNSA 2Q4TA 2JG3A 2AMLA 2HQBA 2PS0A 3MOGA 1XDSA 3JASA 4KG7A 3KJFA 4TMKA 5U4QA 1AUVA 4ND2A 3TVDA 8ADHA 2IYNA 4WKGA 5C8YA 3JQBA 2HIMA 4FFBA 4MUKA 1DC6A 1JHXA 1L5HB 1R8XA 1MZPA 1OBHA 4H1WA 1SBTA 3QY9A 4EBBA 1EFHA 1P31A 2R65A 1JDVA 3CH7A 3D1VA 3FIJA 1QGDA 3UAOA 3VZDA 3FNFA 3HM2A 4ALMA 5DTIA 5JAMA 5FNZA 3WGGA 4DR4B 3LCVB 2X22A 4OATA 4EI8A 3AU8A 1T6NA 1NN1A 3R44A 3UUFA 2VFAA 3FTEA 4DJJA 4AI6A 5IVIA 5I9LA 3DEYX 1IDOA 4DV3B 2ZBDA 3N2GA 2F3QA 4XQ9A 1A82A 3CFYA 4FN5A 4KLRA 3OM9A 2OTCA 3WRYA 3AVYA 3WL8A 3D7KA 2UVPB 4CMHA 2UV8A 4CIYA 4EFKA 2I7DA 5CYGA 2ZSUA 2CVHA 4WD3A 5LBUA 2PKCA 1IJEA 5KQSA 4YY3B 4NI5A 5EPUA 4NNPA 4PN3A 2Q5JA 2PANA 5LQUA 4ABTA 2V1XA 3CLRC 1D6NA 3BBLA 3RTBA 1YGYA 4QOFA 4ZT2A 1F06A 4L08A 1IEXA 3NASA 4UUPA 4I50A 4RYLA 4LC9A 2QP4A 1QDUA 2XWSA 1X42A 1CJMA 2C77A 4UMEA 3WJ7A 3O8QB 4GLOA 1C1HA 3B2NA 3OKCA 1SCBA 2VTEA 5KYNA 3BGOS 2H16A 1P2FA 4U6QA 3ZE6A 1L3IA 3K5IA 4XSHA 2IDZA 5KWSA 1E5TA 2MR6A 3X1MA 4WHMA 1DAEA 4IBOA 3R9IA 3E9MA 3W78A 3ZS8A 2YZ7A 4ZEOA 2G88A 4B09A 3ADDA 3LBAA 2OBYA 4NAVA 5KOYA 4C08A 5D5QA 1Y7HA 2LW7A 3ZV5A 4CKBB 4DJTA 1TU4A 1WSAA 2PRSA 5AK0A 4D45A 1R15A 3TRHA 4UOEA 1PJCA 4TLDA 4Y6LA 2OILA 4RPKA 4ZVLA 3LUPA 3DTVA 4N65A 3CEJA 4O2AF 2LNDA 3JYNA 3ZGOA 1GPH1 4RANA 5E7MA 3TL3A 4EHAA 5I3CA 1SUWA 3Q3JB 3F90A 3VTFA 1NWCA 1NI4A 2HWYA 3QXGA 1C9NA 1OYOA 1S3GA 5EKTA 2X0EA 2PT5A 5HYVA 4IYJA 2RJNA 1UADA 1F0YA 4TT8A 2HCFA 4RIFA 3DV2A 4EY5A 4CHGA 1Z2DA 4KGVA 2QIPA 3U0BA 4YJKA 1XCBA 4GT1A 3R3UA 3UY4A 2OB1A 4TKUB 3OEED 4CMEA 1JT9A 5LPNA 2B25A 3KEMA 1AM4D 1WR8A 5EPEA 1IG0A 5JD3A 3ZCSA 3WK4A 1O8BA 2XNDD 2JIZD 1XF9A 5F1PA 1YQXA 5EZ6B 4RAQA 1P4GA 3RVDA 1CDZA 1P72A 1WEKA 2C5FA 2QW1A 5EGNA 3M9WA 3L40A 5ABPA 1JE1A 2Z9DA 4EHKA 4G36A 4EARA 5T7BA 1FDWA 1DG1G 2Z4SA 5HCUA 4YP9A 5B55A 4IHJB 3RIYA 1BH6A 1Z2EA 4URVR 2F64A 2GERA 3CJTA 3U16A 2WQ7A 4XSVA 2X9GA 4OSOA 1RXSA 1G42A 3OZTA 4HZUA 1P2UA 3DHWC 3ZCUA 4RACA 2FKAA 2JIPA 2V0CA 1E3SA 4BLVA 5A5EA 1O3YA 4AY4A 4HEQA 4I8DA 2G9ZA 2DSNA 2X5JO 1NMXA 2A9VA 4KIUA 4CTMA 1ZJWA 4R1NA 1XJCA 3AFMA 2VP9A 3CU5A 4EG8A 3RT9A 4I55A 3BZBA 1TC2A 4E4RA 3GEGA 4DUPA 4QTYA 3THYB 3O4HA 3RVKA 2A7QA 4P83A 2FF5A 1KNXA 3ANYB 3MYYA 4CLRA 4FHFA 5A71A 3ZVRA 4PLCA 1YHZA 5T57A 3UANA 1T1JA 1RPZA 1I4TD 1UP4A 2OCAA 2ZAYA 3BEDA 4PZLA 4HI0E 1TL7C 1WSBA 2J3HA 1L7NA 2RHMA 5EHZA 1XTKA 2P9ZA 2Z08A 1VMKA 2ZJ2A 4QASA 3RHTA 1CQJB 4KK3A 3WWYA 1YULA 1EA7A 1LTKA 4Q9KA 1AS0A 3LUKA 3S81A 4R8SA 3GDOA 3KJXA 1XCGB 3KOYA 1JLKA 1NXXA 2ZR7A 1IVYA 1T0UA 3N5CA 3PNQA 4S35A 1IY1A 1W5SA 4FFLA 1MB3A 3U1TA 1QFXA 3AOEC 4HSEA 4MP8A 4R83A 1BQEA 3I5MA 1UQUA 2GK7A 2ES4A 3H6HA 3G2JA 4M9UA 2GM5A 2WF9A 3LPMA 3OFVA 1Q50A 1ZRHA 4F4FA 5JMOA 1XLWA 4MQBA 1XEWX 4R9SA 5ELMA 4X61A 5HKKD 5NLLA 1VIVA 1J09A 2ENWA 3A3YA 3HWRA 1X8LA 1IVNA 4IXTA 3IC5A 4AJ2A 4QE3A 5A4MS 3C5EA 2JCVA 2REQB 1JIUA 3AETA 3PA8A 3SLRA 4DDVA 1B1AA 4DV2B 1QGAA 4UVEA 2VWHA 1QJ4A 2ACKA 4X93A 2R2GA 4EGAA 5A6SA 3PA6A 4RK7A 2XVAA 2BCJQ 5SY9A 5B1YA 4MV1A 1WXEA 1GVHA 1H9AA 2CVZA 4DHEA<