3QVGA

Xrcc1 bound to dna ligase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
82
structure length
82
Chain Sequence
b'LCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 3
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/ligase
total genus 18
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16759 LIG3_BRCT DNA ligase 3 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3qvgA00
4IGKA 4XQ0A 2R1ZA 2LE0A 1OQAA 3K16A 3SZMA 2COUA 3EF1A 1CDZA 3HUFA 2XNHA 1WF6A 3UEOA 3UENA 2NTEA 1JNXX 2K7FA 1GZHB 3PC8A 2VXCA 3K0KA 3QVGB 2M2IA 4XPZA 3SQDA 3PC7A 3PC6A 3PC8C 1KZYC 2D8MA 1IMOA 2E2WA 4U4AA 2XNKA 2K6GA 4N40A 3FA2A 3I0MA 4OFBA 4ID3A 3II6X 3HUEA 3AL3A 3T1NA 1N5OX 3U3ZA 3EF0A 2HTFA 3KTFA 2INGX 3PXBA 2VXBA 1L0BA 4BU1A 5ECGC 3OLCX 3PD7A 3L46A 1Y98A 3T7JA 2ETXA 1T2VA 4BU0A 1L7BA 4BMDA 4BMCA 3COJA 2COEA 3PXDA 3SHVA 3T7IA 4IFIA 1T15A 3L40A 3PXEA 1T2UA 4Y2GA 2EP8A 3PXAA 2L42A 2JW5A 3QVGA 3PXCX 2AZMA 3AL2A 4Y18A 3PA6A 3I0NA 3K05A 4JLUA 3K0HA 3K15A 3SHTA 1T29A 2EBWA 2ADOA 2WT8A 3L41A 1IN1A 2EBUA 2DUNA 3JVEA 2COKA 3T7KA 1Z56C
chains in the Genus database with same CATH superfamily
5FD8A 4TTPA 2JL1A 3L1IA 1Y1RA 3L7IA 3ASYA 1THMA 4X90A 1RKVA 4PEVA 1RLMA 2X0NA 1T0JB 3LYUA 2C7GA 5TB5A 1J2JA 4ARZB 2VBFA 2P9ZA 3OZTA 2OO3A 1MXHA 3DD1A 4X41A 4D80A 2QVXX 4BFXA 3D3QA 1EIZA 3TTUA 1YRWA 3DV0B 1AKYA 3EZNA 3QLTA 1VDZA 1NW9B 1ZW6A 4C0XA 3KKKA 2QR3A 2IJGX 2BKAA 5JXGA 1A9QA 1VLHA 5HPYB 4UNPA 5F98A 5IF9A 4DABA 2IZOA 1J9GA 1CE8A 1NQAO 1VRCA 2NGRA 1P3Y1 2XADA 3AP3A 1EKXA 4KAFA 5FIUA 4UU7A 4YRCA 5FOWA 2FZGA 3EQ9A 2Z1DA 2ZUDA 3F6EX 1JJAA 3K30A 3O2JA 4EG7A 1M2WA 2RGEA 2Y8EA 1YOBA 1N3BA 2PZKA 2XUDA 1EK2A 1O9HA 1Y34E 2HTEA 2ZG6A 3OX4A 1MOQA 1TO2E 2BKUA 4PTYA 4YUWA 2C54A 3KUDA 4GPAA 5B7GA 5IT0A 1G20E 4EFDA 4QGFA 1DEOA 1XU7A 3HMKA 4NG4A 3OECA 4V3BA 1NSYA 1JMKC 3BTOA 3HY3A 5K03A 2QA5A 1PJ2A 2A9QA 3GLVA 3GMIA 1L7OA 5FO1A 3TQCA 5B1SA 4MR7A 4KYIB 4BV8A 4EW3A 4E6PA 3AUSA 2YX1A 4RO0A 4MP8A 1HT1E 2QVCA 3JQGB 4TGLA 2C2OA 4TUYF 4YHHB 4MROA 4GLOA 4G5XA 2A33A 5EJGA 1U31A 3OJ0A 2HL6A 2PUJA 3KHTA 4HNHA 3AHEA 2LDBA 2X6TA 1P77A 1PR2A 3BD7A 4GGOA 1U2QA 5T5QA 5JH7B 1U0SY 5CEJA 1PJQA 2IVZA 4UQOA 1M2NA 2QMOA 4W7SA 4XIJA 1E3QA 4YLYA 4BY9E 3OCVA 2Q0HA 5KDOA 2C7OA 1EUCA 3HU2A 4ENPA 1JU9A 3TSZA 1GNQA 5U4XA 5ARBA 2H0RA 2B5WA 4L78A 4X6XA 1D5WA 2VDMB 1O94A 4EB6A 5HKOA 4A6XA 2EFDB 6Q21A 2HLNA 3IB3A 3R3UA 3Q9SA 3ZVLA 2QNRA 1NQ5A 3SVLA 5C5DA 1QYDA 2HGSA 1VJGA 3EUEA 1E1RD 3NIDB 1IE3A 3M1IA 2DLDA 2HYIC 1VG0B 2QMZA 4K81B 4J1QA 1N32B 5AHRA 3T9BA 2FW9A 1AGPA 3IODA 3A58B 3DR3A 3QWFA 2IPNA 1U2ZA 3OIGA 4KXYA 4PYJA 3QEAZ 4R2MA 3GDFA 5P21A 4HFRA 4E51A 3DZCA 1CF9A 1GUBA 5AHWA 4A5OA 3EEFA 1B2RA 1EX7A 2IOHA 4KX5A 5AKEA 4KREA 3Q87B 2XMRA 1K6XA 1QTNA 4F6RB 2ZCJA 5H4HA 2W2XA 4X54A 3OG9A 2P1ZA 3DXFA 2C31A 2W9XA 1JF8A 2C1XA 3WQSB 1ONSA 4QLOA 1Z5UA 1V1MB 1Y4UA 4CKXA 3PJFA 4BMNA 5JS8A 1UFKA 4CM4B 5IS2A 2I78A 1VMDA 1ZK4A 1ZVMA 4QDTA 2YC2C 3UW3A 2OBFA 1KQ3A 5F52A 2VQFB 1V5EA 4UDYX 5KHOC 1ZUIA 5IN4A 4U2DA 1V1RA 1XWWA 1JGTA 1PFKA 4JLWA 5KOYA 4YP7A 1A9PA 1LLQA 1M7BA 1OTHA 2CZCA 3VSBA 3ZWOA 3R3SA 4TZ6A 3LUFA 2H9AA 2FEAA 4WZBE 3RODA 1Y8ZA 2K7FA 1FRNA 2XCQA 2PWAA 5T4FA 1GZHB 1V5WA 4NENA 3X3HA 3R6LA 3GA5A 2HF2A 2FPWA 1ZW1A 4XGQA 1RAEA 2AOUB 2F67A 4MVCA 1PWYE 1Q74A 1OFIA 3M8KA 3D64A 4DSZA 3IR5A 1O03A 2C4KA 3L7NA 5ADVA 3WGYA 3HC7A 4FFOA 3VPGA 1S8NA 4E5NA 1KZYC 1W44A 3CG0A 3EGDB 3WLTA 3ROKA 1YZYA 3QPAA 1Y63A 3HVJA 2Y1DA 1KU6A 1NBIA 4CQLA 3STXA 1WX1A 3G0IA 4Y2UA 1C4WA 1FTGA 1QIFA 2IEGA 4D5GA 1L5OA 3BDAA 4JYCA 1GG5A 1VMKA 2GJKA 4XPIB 5EESA 4YXWA 5LU9A 2XE6A 2Y77A 4JLNA 2QJRA 4F3RA 3I73A 1QJ4A 2WE8A 2JGIA 2F3SA 3VUEA 1M34E 2B30A 5AT1A 4BVFA 2H57A 5M3BA 3ETEA 3NHKA 4KO8A 4LC9A 4MUYA 1RABA 3V8BA 5JV5A 4JA2A 1QNLA 3QXXA 4KEAA 4CDNA 3U4QB 1ZOOA 2XHEA 1YQEA 1ZP6A 1AS0A 3FTCA 4C0QC 3ZTWA 5ALLA 1CG6A 4IH4A 3JS5A 1KPIA 3PNYA 4CLXA 3FTFA 3BERA 4OOFA 1MIHA 1QE3A 4NVRA 2REQA 1E3WA 2GCEA 3HJCA 3LH5A 3MJHA 4TTIA 5BQOA 3VZPA 4WFIA 2R7AA 1QLJA 3OPYA 1KYWA 4X8HA 4DIDA 1JDZA 3MC1A 1Y1KE 4RVFA 2I99A 2HY7A 5FWYA 1ZNWA 3DKKA 3GPDG 3FHJA 4XM0A 4IIGA 4UTZA 1GQOA 2Q1UA 3QZUA 2EU8A 1CZHA 4PZ9A 4DCVA 4RU1A 3LS2A 2FPLA 1C2YA 3H3FA 3IQDB 4CMKA 4X60A 5J23A 2Z4RA 3GMTA 2VT6A 3NWEA 4PC7A 1IY0A 1N7GA 1NONA 1QGOA 2QD3A 1SQFA 1X1BA 5FHRA 4B7XA 2GJSA 4NOKA 3LU1A 1I4OA 1RMTA 2Y1CA 2V6IA 4HWGA 3I04A 1NP7A 1NN3A 3P9NA 4YRFA 1D2MA 2MJLA 5AW7A 5K0CA 2XZDA 4A23A 4BBZA 4RJKA 2DHRA 3C1AA 4NBVA 3VUFA 4E07A 4BVHA 3ICWA 4FGKA 4H3KB 3L8ZA 2EFHB 1YTLA 2GF0A 3EC7A 1OXBB 1HKHA 1MOZA 1V8BA 1OLSA 1Y6JA 3KRTA 3NXKA 4G1FA 4J3FA 4Q6BA 5ALGA 4BQQA 4YYZA 4HNUA 1LBEA 5CA0F 4WOBA 1HL7A 5DK6A 1Z25A 4Q21A 2HEGA 2OUKA 5E1DA 4K28A 2F1JA 2FLKA 2EJUA 1T26A 1UT8A 4KQ2A 1HUQA 4GO1A 4D82A 4LZNA 2DY1A 2OUIA 3EMBA 1H0HA 4EYGA 5LVAA 4BMYA 4MVJE 3CLRC 4C2BA 2LIPA 4GM0A 4UATA 1SD1A 4W7HA 4AY6A 3KTAA 3C6BA 2WUFA 2QWXA 4ZI7A 2I4NA 2W2KA 4R2WA 1GTJ1 5J58A 5K3SA 3HUFA 3BSSA 4IDNA 3C45A 2ASVA 4PHGA 5TQ2B 1HQCA 3VO9A 2DR0A 2RHCA 4CMIB 4UTXA 1ZC4A 1MO5A 2J32A 2EKDA 3AV3A 1QH9A 4GZ5A 1D0VA 3E4DA 1XJ5A 4KXWA 3V6LA 3HEAA 4GX0A 5HYVA 3PCXA 1UBCA 1UBGA 3PE6A 4F46A 1U7OA 3IUQA 5TQ0A 2PYDA 5K51A 5EWMB 3QVGB 5C5CA 5KQPA 3SQDA 2DUUA 4DJ5X 3OIUA 1NVXQ 3NV7A 1DBQA 1G21B 1HRDA 4GOLD 2Q6IA 2WSMA 2XUIA 4QGSA 2L69A 1C30B 1WSDA 3GRFA 5DYGA 4X1OA 1YJCA 4CTMA 2OG1A 3GEPA 3EA0A 3IMGA 4X6UA 2HXGA 3DQQA 3H42B 2OP1A 3K2IA 5K0BA 2Z43A 3G8YA 4RHUA 3AUJB 1ZD3A 4B71A 3CX6A 3TLGA 2YJ3A 2CCKA 4RAQA 4UUAA 3B3FA 4NMMA 4MDFA 4I1UA 2F43B 1HO3A 4WVLA 3NRCA 1P1RA 4IH9A 4L7VA 3RT9A 1RPZA 6ABPA 1ARZA 1XD9A 1OIVA 1P18A 2OKCA 3Q5DA 4D9KA 3DKRA 4AF7A 2RHHA 4RNDB 2ZIVB 1RLTA 1QCZA 2QTVB 3MNFA 4AYXA 1U1CA 3KG2A 1KSHA 4DUZB 1PUXA 2AW5A 2ANBA 3VYSB 3ONFA 2DTDA 1NJ6A 1Z82A 1UOQA 4DWOA 1YTUA 3LUGA 3M9XA 2Q7OE 5DH9A 1B8NA 1M1YE 3SJUA 4YRLA 1DS6A 2PGJA 3LQ2A 3IR6A 1QXSA 4QRHA 4UMVA 5D3ZA 1S4MA 3OJCA 2XDQA 2ZJ0A 1EAYA 3FD8A 4MB2A 4ZOLB 4HG2A 2FH5B 4IOMA 3WFIA 4B8ZA 1JTVA 1GUAA 2HXYA 5JAQA 2DCUA 4HLDA 4Z3DA 1W85A 1F6DA 2C3MA 4MYDA 2X1VA 1G6KA 3F4LA 1XSEA 4DCNA 1RYNA 1G5FA 5LP1A 2IBMA 2OFFA 3I28A 3RDPA 3T15A 3E3OA 4JXZA 4CDMA 2O2ZA 2A9JA 3QF7A 3PIRA 4IO1A 3UUFA 4EW1A 1OASA 2QBYA 4F56A 5CX4A 3R5SA 3A26A 1BOFA 1GVHA 1WKVA 5C0OE 1AXGA 4OXQA 1AZWA 1RHMA 1ZJ5A 2WVHA 2YXEA 4R05A 5FTKA 2JFOA 3IV7A 1IPHA 1WCWA 3T7KA 1TZ2A 3HR4A 1KMCA 3LYAA 1UFOA 4MGYR 1HYHA 1MB3A 3C8DA 4J94A 4I9NA 1OREA 1YIOA 4CR6A 5AESA 1AD2A 3L0BA 3DCYA 2AFRA 3JQCA 1WXDA 4IHKA 4F4HA 3UYLA 3QPDA 3B5IA 5IN5A 2BI8A 3FNFA 2PXHA 3GOHA 3M3HA 1W7AA 1N5KA 4TS4A 1TU4A 3IP7A 4RDIA 4ZCMA 1N7HA 3QVXA 3FBTA 3DS8A 4UZEA 3N0TA 4B4KA 3TW8B 1PZGA 4UD2A 3FNRA 2GVNA 1C9EA 1LRKA 3U7JA 2F8SA 3HB1A 1JDTA 3FX2A 3HA2A 3ITKA 3RSLA 4YR7A 4AKEA 3MTBA 1J22A 3L93A 1TAGA 4F11A 2O2YA 3MYRA 1P29A 2UZIR 3R24A 3TGLA 3SYRA 4IIYA 1ZMOA 2V7BA 4AUEA 2JZCA 2JGLA 2O3QA 3QP9A 5G2OA 4N7BA 2HU2A 4WXHA 1NMYA 3LP5A 1NF8A 1V8DA 1X7ZA 2FPIA 3LT4A 4QUEA 4B75A 1PWZA 3NALA 2PZAA 1X80B 3RUDA 2D2XA 3U4IA 1Z73A 1O6CA 2QX4A 2O50A 5JMPA 5JTUA 3CM0A 2ZITA 3C0KA 2AS0A 3QELA 3T12A 2H2FA 1EP1B 3T5GA 5B5SA 1B43A 3CN9A 5LFAA 1NU8A 3SJBA 1SN7A 2A5YB 4C7VA 2JBWA 5H1YA 3LQRA 5KNDD 2CGEA 3LKVA 2YMLA 4B32A 4OHPA 1PTJA 4IHQA 4M38A 4ZJZA 1HDRA 2I8AA 4L9SA 1Z7BA 2E1PA 1D9ZA 3HUEA 4OHFA 1IZ8A 1GITA 3G5AA 1TQ8A 3MAGA 4JIMA 5L3RA 2LCQA 3UH0A 4JHXA 4CMEA 4FEAA 4FGLA 3W6ZA 1OBCA 1U7ZA 3DVLA 3L1VA 1U5CA 3FMVA 2A67A 2RAFA 3NEYA 3OLXA 3ICVA 3H1BA 4C1BA 5KYYA 1M6EX 1TQ2A 4EI8A 2QE7A 3TD2A 2O1XA 2ZWMA 4ERNA 3AMVA 1ONBA 4LYAA 2R0QC 4FGJA 5HSGA 1ZUHA 1I4TD 1TM4E 3I9V6 4O1IA 4PGGA 5J5VA 3LDAA 5FBKA 3KXDA 2EKLA 4RIGA 1Z29A 4OLFA 4X65B 4KBYA 2C9ZA 3MWEA 5K8LA 3TLJA 5BWOA 1G1AA 3AC0A 2O1EA 3EVBA 3I3SR 1N75A 1H5NA 1OX5A 3OQ1A 1ZBQA 2RGWA 2IHTA 2W2PA 2O0KA 3FUUA 5CNJA 3DL4A 3ICOA 3JQ7B 3WB9A 1V6CA 1Y1TA 3BE4A 3QEBZ 4GYJA 1FVHA 1TW3A 2UU9B 1DO8A 4W5NA 2NYRA 2Q9CA 4S35A 4DWVA 4UPEA 2ZM5A 1NFFA 4YMIA 2P2DA 4Q24A 4QXAA 1V48A 4ZCRA 1M2OA 4HYTA 4B6OA 3QKUA 4DFDA 4IEIA 4OEHA 4EYEA 4H1WA 4RQAA 3H87A 2XPCA 1BQ4A 1M2VB 2F90A 4Y3UA 5K3FB 3TRJA 4XWOA 2IOFK 2Z4SA 3BXOA 1A2KC 3OTHA 5EWJA 3MHTA 1G0NA 3OE4A 4JSRA 4LOHA 1GCIA 4P0TA 4BCDA 1XHEA 2KLHA 2HI0A 1SU7A 4YJ2F 3T3EA 1OA0A 1E6KA 3QXSA 4RJIA 5ALUA 2JZOA 3R77A 1E99A 3AKDA 1NF3A 4PPQA 1NZJA 2P5TB 4W6QA 3VM6A 2YJGA 3CXUA 5FB3A 5TV2A 1R0KA 2WMDA 5C8VA 5AM2A 5DXAA 1NG1A 3CF4A 5A6SA 3PX7A 4YACA 3B3JA 2H5LA 4YPOA 2FN4A 1UFVA 4OH7A 3RWOA 4G0QA 2H7VA 1KOLA 5LL6P 1O94C 2IQIA 2W2OA 1GRQA 4FZJA 4J76A 3P2KA 3M4YA 3ENNA 4QLAA 4XD2A 2JLUA 3B8HA 3DTVA 2BBWA 4QGAA 2B7LA 5L3QA 1IXKA 1P2FA 1P4SA 3S44A 2HNAA 3NTXA 5INTA 1IOWA 1M1ZA 3AFIA 4DG5A 1XR3A 4AC9A 3NAMA 2WHXA 4INOA 4MIYA 2P7IA 4HDOB 2HGZA 3M3PA 3VPHA 5C34B 4RY8A 3RWMB 3T1TA 4ZMRA 3AJ8A 4WPGA 5JCJD 1BFUA 4TRRA 2HO5A 3ANMA 1A88A 3O2QB 5F9FA 2XOXA 5K4HA 3QVUA 4GECA 4Y2PA 1Z2PX 1E2NA 1RHKA 2HFJA 2V7VA 4MRMA 3R5HA 2RJ3A 4KMSA 2DETA 3W2TA 1H5QA 2UUCB 3QU5A 5F7OA 4LQLA 1PQWA 5JROA 5LB4A 4Z53A 3GGPA 2D8MA 3O0DA 5L7YA 4ETNA 1AA6A 3DEYX 4F45A 2R6CA 3DFFA 3FCOA 3P9YA 4M9QA 1GZSA 4BATA 1T10A 4G41A 5BWBA 5KOHA 1Z0ZA 4D9NA 4D0LB 3JPWA 1EFRD 3IILA 1BXRA 4LOKA 2O8CA 4ARBA 3H9JA 4C0LA 5HDBB 3ZGNA 3L9WA 4H31A 4Q02A 2P68A 1FXSA 2DGDA 4J75A 3AW8A 3H5AA 3OM1A 4KJXA 2EV9A 2O3TA 3QJ5A 4I36A 1YZQA 3P52A 1CUWA 2YY7A 3O8NA 4NNPA 4OXKA 3HHPA 4UHFA 5F1YA 4CM5A 2H1FA 1UBKS 2HA6A 2I6GA 3FWPA 1G3QA 4N6GA 4Y2TA 2XTZA 1OXVA 1X3SA 2F8MA 4ZVPA 3RC2A 5HZKA 1OTXA 1P5HA 5L7WA 3UMCA 4B3CA 4B31A 2FUG6 5F12A 4BRUA 1EJBA 2J5BA 3OEYA 1FUKA 4BOYA 5IK2D 4MVXA 1I4LD 1JTEA 5SZJA 2QPAA 2OLJA 2GD0A 5JYCA 1SEVA 1J2RA 1EPUA 2A6PA 4PC3A 4M1KA 2HN9A 2ODQA 3HBMA 4M54A 2NUBA 4Q9DA 2Z04A 3N1UA 4WKOA 3PHBE 2SCUA 5HIJA 3SHVA 4BMZA 5CP8A 1E6EA 2ZSBA 3HLYA 3GUUA 1BIFA 5ITWA 3BYZA 5JBNA 1WTAA 2XDYA 1VSVA 3SE7A 3LTEA 5CB4B 4ER7A 4O59O 1ZONA 3A1EA 1OAOA 1FJGB 3ZWMA 1Z2EA 1TVMA 5CDTA 5ECDA 2WJAA 5LP6B 4V02A 4EGSA 1P1CA 2DERA 2ZIXB 1U9JA 1UR5A 1X74A 1YQDA 3I0NA 3WHKA 4B17A 4EYSA 2PCJA 2C4WA 4A2QA 2VAPA 4JLUA 4XW2A 1VCNA 2XYQA 1MR3F 4IGFA 1KZ4A 2W93A 1D7OA 1HLFA 3ROZA 1IN1A 1M83A 3IIKA 1Z4IA 2WWYA 1VYVA 5K45A 1WMEA 2AYXA 1NI5A 3NIWA 3GHHA 1X13A 5IULC 5JAIA 1O0SA 3D8HA 4C7XA 2IIPA 4BDTA 3V7YA 1JKXA 2K87A 4FOPA 1M0SA 3NV9A 3IDOA 5CVVA 1GPJA 2BGUA 3DOOA 4M9ZA 5HIIA 3K16A 1ZLYA 3GNLA 4FVTA 2FP4B 4A2CA 1V7ZA 1GDHA 3MJSA 1T9DA 2B94A 5EZYF 3X1ZA 8ADHA 4X66B 4OLAA 4H7JA 2ZGVA 4W1PA 1KMNA 1R9GA 5KINB 1ULBA 2VTBB 5ED4A 5AWFC 4KB5A 2BZ0A 3K6JA 4C4YA 5FUYA 4QGHA 1E4EA 3BF8A 4FZRA 4IMRA 2BMAA 4PONA 4R6XA 3W2FA 1GQRA 4RTRA 5KOJB 3TM5A 2HSEA 2XNHA 4MS1B 1AUPA 1NLZA 2H7CA 5J2UF 3R5JA 2KQUA 2Y71A 1H1LA 3TDNA 2VWHA 1U7TA 4RF5A 3N2GA 1OXMA 4P33A 3QKSA 4H17A 4R41A 2C7QA 5JS6A 1QUEA 2I5PO 5CLGA 3W9YA 4ZVOA 2QVZX 5BOSB 1CUCA 4OQDA 4RFVA 3FHTA 2GFHA 2D1RA 5HE8A 5KVSA 2DFVA 2GLTA 1U8UA 1UFRA 5H81A 4N76A 1M6NA 2HSWA 2GA8A 4FB5A 1E9AA 2B4RO 1P5FA 3GMDA 1NXTA 3CNHA 4KWCA 2OXTA 5BV1A 3GLHB 1T2EA 3CRMA 2I9PA 3DE2X 4OTZA 2HMSA 2I0FA 2FJPA 4OREX 2ZXEA 2WYOA 3BHIA 3WNZA 3CZMA 1U04A 4HNGA 3VPAA 4BVEA 4EJ6A 3JYOA 1JKJA 1GHTA 4BEVA 1S02A 1KI4A 2O8EB 1N5OX 5BOVA 2ZRIA 3HYCA 3S5UA 1AH2A 1W46A 3SJZA 2CE7A 3EXIB 3JALA 5BQPA 4D02A 5A62A 2IWRA 2J5RA 4QGGA 3FGZA 5DBIA 1DTEA 3AY7A 2OHOA 3KB1A 1T1RA 2JLBA 1ST2A 2QUJA 3H5VA 4F12A 3K0AB 1DX6A 2ETXA 1GRCA 2A84A 1KY5A 1PV2A 1RKBA 1QVZA 1V7QA 4NU0A 3VV3A 3GVIA 1JRLA 1NI4B 5IH3A 4BWFB 1SIUA 2VRNA 1YJQA 2PVCA 1KZ6A 1PDVA 4MUBA 1RWPA 3HVUA 2FEPA 4WN9B 5NULA 3W2EA 1EA5A 1CPYA 3LQFA 4TV9A 5C46F 5KQSA 3UPUA 4URWR 4W1RA 3EIFA 1GPLA 1A8SA 1RZUA 4ALMA 5BSVA 3X1MA 2VWQA 2HJVA 2VKTA 1QLHA 1QG0A 4H6XA 3X1XA 3CE6A 4YA6A 2B1IA 5CPBA 3ZI0A 2BMEA 2P1DA 3ND7A 2MYUA 1CP2A 1KEPA 4L57A 2XAUA 5B1EA 2HCTA 2JLSA 1P2DA 4LYEA 1DKUA 5AVXA 4I4LA 1K5PA 3TDMA 3O4FA 2XY4A 4R4JA 3IAM6 1QDEA 2XEDA 1WM1A 1FIUA 4Q1VA 5L7TA 3DT6A 2IV7A 1TM2A 2UXBB 2BHSA 1C9JA 3E22A 1ADFA 2AJ8A 3A36A 4DC1A 4GDMA 3HKDA 4CCSA 3LUDA 1NUAA 1L6IA 1RYHA 4C0KA 1O1YA 3D4NA 4TQGA 3TQFA 3TW4A 4AM8A 5CB8A 3NB0A 1XA4A 3JXEA 5A1JA 2HEIA 1VIVA 3HS3A 1YQGA 3T7TA 1D6SA 1UWVA 3RT1A 4XRGA 2ZIZA 4LMPA 4RD4A 2OQRA 1EZZA 2XE7A 1NV8A 1N6RA 4RPIA 3OBBA 1E2PA 1H2AS 2A9FA 4JJKA 4Q3BA 4QUBA 1XX6A 4GBMA 4S1NA 1V3QE 3D2CA 4NK4A 1J7KA 5EKDA 1M6YA 4UBKA 5CFQA 3GWGA 1HY3A 1MO2A 4YRQA 3U37A 3C7AA 721PA 3WYAA 4L6AA 3GLIA 3ZWCA 4I0WB 3H4TA 3VHQA 2I55A 1VE1A 5K2OA 4IF6A 1NPDA 3DGEC 2VXCA 2Y66A 2IOFA 4K3VA 3W05A 9ABPA 2CJXA 2CHQA 1NQWA 1YDFA 2OILA 4X44A 1UAYA 3EXHB 3H05A 4GX2A 1UBNA 1WZEA 3NONA 3TLZA 3VDRA 2VK8A 5CAEA 4AF6A 4L72A 4F2DA 4J90A 4JQOA 1XT6A 4U2EA 2CMDA 1P7YA 1JN0A 1Y89A 4P53A 3V1LA 4E7OA 4U7WA 5J47A 1ZXXA 2AQ8A 4WK4B 3RAGA 3ETHA 1XKQA 1SBNE 5HFNA 3TBKA 2JGDA 5BN4A 2D7JA 5FR1A 4QHYA 2FZLA 4WLNA 3E3MA 4D3DA 4DPLA 1SVUA 2PQ6A 3H2JA 1X6VA 3HYRA 3IDSA 2PT9A 5AJWA 5JC1A 3EWIA 1GR0A 1O54A 3EDQA 4B76A 5MFPA 2ZRLA 3D6UA 2ZTLA 3AJDA 1XAJA 1A9YA 4LZAA 1GPAA 2YWGA 4IXDA 2PGIA 5HS6A 5IUJC 1YACA 3OEHA 3MJTA 4IP0A 4B3HA 3B3GA 3KTFA 1CU1A 3LT1A 1ACLA 4O33A 4YJKA 1Z0UA 3A31A 4BU1A 1WDLA 2WUEA 3QMPA 3U17A 4CV1A 4M60A 4EUEA 2H0AA 5KTTA 2QSJA 3FH0A 4IV8A 3GFQA 4ZT3A 2VEDA 1X1QA 4PNEA 2GEVA 4ZOAA 1OF1A 3EFOB 4A1FA 3CRVA 2LCIA 4JEIA 1KI7A 1JLKA 4GLBA 4QQFA 4F9FA 1GNVA 2VOEA 3F5MA 2QF7A 2NO7A 4L5IA 3RSCA 4P3NA 1MC4A 3HXKA 1RRKA 1ZAKA 3HUUA 1HFWA 2X4DA 3TTTA 4ZK2A 3FVWA 1WHTB 2IYOA 2QMYA 2XA2A 1BMFA 3I6YA 3ICQB 5CXQA 1COWD 3WGTA 3I4LA 1JG3A 4X62B 1Y3AA 1CY7A 2MYNA 2E5FA 3G02A 4GMDA 2P9EA 3IIEA 2VHZA 3H2BA 4A0QA 1PHRA 2VDPB 3FSGD 3DLCA 3RS3A 1TQ4A 1PBNA 1U0GA 1KMMA 1PTJC 4PYKA 1VIDA 3KB6A 3VR4D 1QTRA 4LCEA 4PW0A 5JC8A 1T8SA 1EFVB 2X9NA 3MRTA 3CVUA 4R71A 3DMTA 4C6TB 4XQCA 4CMEC 1SRQA 1XAIA 2Y2UA 1WMFA 3G2JA 1H6BA 3SX0A 2HJWA 1QH0A 2WPDA 1OCEA 4WRRA 5LU8A 3GRUA 1BDIA 1U6KA 3O0TA 3P2JA 4FLEA 4E2FA 4OHYA 3KVNA 1OU4A 1YSCA 1LA2A 3TWOA 5IEJA 4ZV9A 1KEEA 3EGIA 5DCYA 2HKIA 1MV5A 5JZOA 2WZBA 4XB2A 4A2PA 2DC1A 2VH5R 3HR8A 4C1NA 4MI6A 1GSOA 4ZKEA 3DFZA 1P8AA 2ZVQX 2XCOA 1IC6A 1RIFA 3KYJB 3UMRA 3TUZC 3R9XB 4MYTA 4QOEA 3TOVA 3MCTA 4EK9A 2I54A 2Y0EA 3KOXA 3RK4A 1BGXT 1CY0A 2EOAA 2H1RA 5E6UB 2GESA 2C8KA 3M70A 3TPZA 2EQAA 2O7VA 1JQJC 2DHCA 1U2TA 2IRWA 5I7EA 2FOLA 4HMPA 2BR3A 4BV9A 2F48A 2GR9A 2VJKA 1DARA 1UP7A 5AW5A 3ENQA 3H04A 4F60A 3FGPA 3ZDYB 4DQXA 1GT6A 2QU7A 2LUOA 4M6WB 1BKSB 1JXAA 2J6HA 4FJ0A 1FU7A 4V0MA 1ES9A 3CEMA 3AF0A 2AV6A 3DBIA 3PDIA 1VG9B 2WWTA 3O1IC 4UDNA 1FVOA 4UVDA 2V03A 4TYPA 2X13A 1R3DA 3EC2A 2OD2A 1CULC 4K6MA 4QYTA 5FORA 3CV3A 3K0BA 1BVYF 3NWOA 5PGMA 2VI5A 1WABA 4A26A 1M6VA 3NUQA 3ZVMA 1GO2A 2FJUA 2ZRBA 4AL4A 3ED5A 1T4BA 2DBYA 5CCDA 1X9GA 1YHYA 5EQTA 3VR5H 4FKBA 3OFJA 2ETVA 2Q3MA 2VCEA 4Q39A 3W79A 4B3TB 3D1VA 4TS3A 4J1SA 1E5XA 1BXZA 3ODPA 4K9OA 5U1PA 3OAAD 3ZDEA 2CLKB 3CLSD 4ZO8A 1YS6A 1XQWA 2AIRA 2CHUA 2PS9A 2ZQZA 3CCFA 4DBZA 4RGQA 4DJTA 4LRUA 1Z5ZA 3PGJA 3RUAA 1M2FA 4OXYA 2OR3A 4TS9A 4EWLA 2Q3EA 4UHDA 1TLFA 3TMYA 3MHPA 2OORA 2QRGA 3IIJA 4RADA 3FPFA 4D3FA 4K86A 1UBLS 1VQ1A 1X2BA 3AI2A 4QBKA 4X20A 2C94A 2LRHA 2CJWA 1E3MA 3B9RA 1TJ5A 2G9VA 2X42A 1EVIA 3UNXA 1SA0A 2GSDA 2R1VA 2RONA 3PGA1 3T9DA 1VHQA 2PLWA 3WLMA 2QT9A 2RCYA 3MINA 4ME6A 3HMQA 5K99A 2PZBA 1BZYA 1T4CB 3KTDA 4WOPA 3GCWA 1SFRA 4KN9S 1UWLA 3AOEC 4RHEA 5LIRA 4RK7A 1M8JA 2G25A 2E3JA 5JS7A 1HV8A 1OC2A 1W4BA 3IELA 3GRZA 4U8GA 4ER6A 4A82A 1HMPA 2BFCB 2XZPA 2I7VA 1CB0A 2I2AA 1J49A 3L0IB 4BLSA 1IK4A 4J49A 3ZHUA 2I2XB 4ZYVA 5JJ5A 5KJ6A 1YI1A 2P2CA 2A4KA 3IVAA 4FW9A 3B13B 4XIIA 4H0NA 1ZR4A 1FNSA 5AQ1A 4CGYA 4YQZA 3OQOA 4GLJA 2WHYA 2P27A 1DDIA 2QGZA 5COBA 1W75A 4Z1MA 3TQOA 1J06A 3PUKA 3PEEA 1GP2A 1MGOA 1N9KA 4A73A 4COOA 3KWJA 2DBVO 4N3BA 3H1GA 2EKBA 4IDCA 4Y9TA 3RBZA 2ENUA 3DDHA 3G82C 2C9DA 2MSEB 3JVUA 1FPMA 2JH8A 2FN8A 4QPNA 2BGTA 5REQB 1K66A 3U3MA 3V2HA 1TQDA 3VVMA 5JYEA 4JJGA 4P4SA 5KC9A 1EK6A 1X77A 2ZJFA 2NUTA 4DCTA 3KR9A 3H6HA 3CEJA 4RY0A 4BIIA 4JB2A 1U5BB 4J2OA 2QAJA 4QM7A 1T2FA 4RIEA 3PQ7A 1NPTO 3L8DA 3RAPR 2I71A 3OTIA 4NV1A 1T5LA 3TIXB 3I2GA 1O2DA 3EQZA 4A6EA 3TB6A 4BPBA 5KHLB 3HCNA 3BORA 3F47A 4INAA 2HSDA 5GZ3A 3SDZA 1FFDA 4RK6A 3TSCA 1N1MA 3DLHA 3IJEB 3G68A 5F4BA 4JJ8A 3NC4A 3LUPA 4IJVA 1UMBA 1E4VA 3PFFA 1OAOC 4MRVA 1V71A 3N3AC 4F2GA 2HLDD 4NBSA 3M6IA 4GRIA 2R11A 3FPHA 3DHVA 2CDRA 1ZYUA 4L2IB 4MGEA 2YWEA 3ZQ4A 3DBLA 1HNZB 1JR2A 4QT0A 1X2EA 1EB9A 1L4UA 2PZJA 1R5NA 2FEWB 2EGUA 1KKLA 1JHYA 4C20A 1VFNA 4FLFA 3CVJA 3TGPA 4XDGA 3G5UA 1JPVA 1W36C 2I22A 1Z0AA 3CXRA 1YVEI 2J3KA 2VP9A 1JDPA 4NFLA 1N0HA 1U4OA 3CWQA 4MZDA 3V32A 3SBDA 1TEHA 2UZ1A 4C3OB 3N05A 2QD2A 3K20A 4AMBA 5H4GA 3GFPA 1V9SA 4OUDB 1TJYA 2NSJA 5JSZB 4TTAA 3B82A 3UCFA 1H94A 4KQXA 4O2RA 4EI2A 1U3FA 1K7CA 4RIFA 4OHXA 4Z3OA 2C9YA 3U4DA 1VP3A 1SHUX 3D7LA 1EM8B 1LI4A 1NV9A 2P62A 4XVRA 1JIXA 1R6DA 4O2BF 1FYWA 4YROA 4LYHA 3G8DA 5DOVA 4RESA 4XX1A 2Q4OA 4JBWA 2UYQA 1EG7A 4QFMA 2Q2VA 2XQKA 1QG2A 3C6ZA 3DNFA 3KOWA 1NVDA 4NYMQ 3TSWA 4ENRA 1RWBA 2PX6A 5B2ZA 7ABPA 3DBHA 4L3OA 1DO0A 3CUTA 3HDTA 3TAXA 2C2GA 3KLMX 4FOTA 3GJ5A 4KGDA 2MCFA 5JSFA 1DJMA 4FT4A 3FYHA 4AFNA 3NGLA 4YMSA 1TYAE 1H8ED 1VIAA 4ZC8A 1L4EA 1Z07A 2GOYA 3CMMA 1IY2A 4RELA 3QEMA 4G0UA 2G82A 2ZJYA 4IMIB 4YT5A 2MIIA 3NVDA 3Q4GA 3BQNB 4IQ8A 1XCMA 4JP3A 4C4AA 4B3DA 2JBAA 1FTQA 1XRLA 2HFKA 5AK3A 5AO9A 2VTEA 5F2EA 4D4MA 1PZHA 4XIYA 4YRKA 3U60B 4B3SB 3CLHA 2PXCA 2G3YA 3C7DB 4DDUA 3M4JA 4F71A 1CZNA 3KL2A 2BHTA 1EEHA 2QT0A 3AONB 4HN4B 4QTTB 1NYLA 1M2JA 2QLLA 2YJ5A 3PTZA 4C05A 3FOZA 1D1TA 1QVAA 2WMYA 5DNUA 3IC5A 2CB0A 1MHPA 3SVZA 4HKTA 2EW2A 3OFVA 4GYYA 2FLVA 4Z86A 1R6BX 3U61B 3F6SA 1JE0A 3WLHA 1IULA 1FMCA 1PSWA 3H7IA 1SBQA 1TCBA 4RLSA 4A6DA 3B6MA 4HH3C 4Y0AA 4ZYXA 2JAHA 4QREA 4PZDA 1RKQA 2FW7A 1N8TA 2GKGA 1IAVA 1FRQA 1WHSB 3KSDO 2XKKA 3K3PA 5DSZA 3EPKA 2A86A 1RXYA 3B1YA 2CLOB 3E3NA 4LGCA 4BZWA 1DRWA 1P73A 2QN9A 3KZVA 3W5VA 4ARZA 2OENG 3SQXA 2PT5A 2VJNA 1HETA 3LVFO 4MR8B 2GK6A 2ZRKA 3DF7A 5A2GA 3DV0A 3LGSA 2WMNB 3CLUD 3KUUA 1YJAA 4YDHB 4PLYA 2X7XA 1IXRC 2P1RA 3D7RA 2QY6A 5GVRA 5CD9A 3K2EA 3NASA 4NG5A 4R7ZA 1YRHA 2OV2A 4RACA 2VDKB 1TC1A 3KQTA 1OQAA 1O5OA 3A6EA 3GEGA 3PE3A 4M46A 3IO3A 2VWPA 1QG6A 3BFKA 1Z4KA 4RA9A 4BNIA 4WBNF 2CF6A 1RHUA 2DH6A 1N92A 1U7PA 3OM8A 1V0JA 1JU3A 3G9ZA 3PPVA 1BRMA 4E5YA 3O38A 5JZBA 3IT1A 5BWLA 3JWPA 3THRA 1P44A 4DEVA 4XD7D 5FQOA 5KYNA 1BG6A 4UMDA 1IZYA 2X0KA 5G0TA 1HQKA 5BNTA 1YL6A 2QX7A 1K2VN 4JFAA 4JLAA 1RAAA 3UENA 3P0FA 1C4XA 3CF4G 3QI7A 3WXBA 3OZWA 3KAPA 5H02A 1ETUA 4ZC1A 4TYWA 3L8MA 1VG8A 2B8JA 5J43A 5JARA 2Q8PA 1V8PA 4Q82A 4YUXA 3JQGA 2D54A 3RFUA 3GLIE 4XTRA 4NCIA 3VSDA 1EFHA 1OGJA 2GARA 3NOVA 4NOLA 5IBCA 3UCXA 1Q0HA 3F6YA 4WFJA 1Y3FE 4LGMA 4X84A 5DTEA 5CA1F 3MXTA 4B45A 3EZ9A 1YA8A 2IX9A 2VJYA 4CF3A 5JH7A 1ZJ6A 4WGFA 5IX8A 4C7BA 1H9CA 2ZBFA 3DDCA 3WYFA 4LG1A 2GQ0A 3D8UA 1Q7RA 5G0UA 5EOVA 1FUYB 1EHCA 4ZDJA 4YALA 2I6UA 4I3GA 3ESZA 4HB2A 4WNYA 4DW8A 3EEOA 4GKBA 1G64A 1M5UA 2FSGA 2FF5A 3KQKA 1M3SA 4D45A 3BWVA 4A0FA 2Q3CA 2HA7A 3OFKA 2AX4A 4WDQA 3TEMA 2WSSD 2OBMA 3H2SA 2QQEA 4HQRA 4Q66C 1C1XB 2VJOA 1Q1QA 3GZTB 2YYYA 4P80A 1N1EA 1G8HA 3GELA 2J5QA 4ZEWA 4E7PA 1VGVA 3E1SA 4ALLA 1VHLA 2EKQA 1RYDA 4NJOA 4YUYA 1FJXA 5EI5A 1Y1PA 4KQJA 1IXZA 2EW8A 2N3ZA 3QF4B 4TXHA 4WKPA 2IYXA 2M6KA 2NXNA 3W6NA 1U2PA 3HV2A 2PS3A 3LKZA 3WG9A 3CX4A 3IAAA 5DNWA 5HTOA 4MDEA 1JQKA 1SKYB 5J2TF 2W2NA 2Q99A 2ZXFA 4BX3A 2TYSB 4BN4A 4GEKA 1T9ZA 2NZJA 4IF4A 1RQ7A 4J3JA 4MDYA 5I3CA 5DZSA 1Z35A 3HXOA 2RBGA 4U5QA 1S3GA 4F6RA 2ZAIA 5F7JA 4ZYLA 2TMYA 1SXJE 1DIHA 1A4XA 4CF5A 1PJ8A 1GAQA 5B4TA 4XQGA 2DT5A 4ETIA 2I6SA 2WUGA 5EE9A 3PFNA 1CQXA 4U39A 2BMVA 1K5DA 1R88A 4Q4JB 5HMMA 3UT5B 3EA4A 1V1MA 3QJGA 4PX2A 1K5HA 1QBGA 4UEKA 5IM5A 3W5UA 2B78A 1ISFA 4WCDA 2DMRA 4CM4A 1P75A 3DBOB 2DQYA 3C98A 3NKVA 5CGZA 4ZV7A 2AEEA 4AYTA 2H5EA 2JKYA 1V3UA 1H4QA 1J70A 1I33A 1L5FA 4AP5A 4JBYA 3UV6A 1S3SA 5CYFA 4HNAB 5LC1A 1E64A 2LKDA 5DHFA 5IEBA 4EY5A 1VHJA 4P7BA 4L5AA 4J3NA 1LX7A 4LNAA 2IH4A 3DEJA 5HRAA 1SXJC 3WZLA 5FPYA 2C84A 3DYVA 1F6WA 2C9OA 1J1ZA 1NY6A 4KO4S 4Q18A 5F2KA 5FTNA 2AOUA 2HQOA 2HDOA 2JK1A 2PFGA 3GK3A 1XZNA 1HYQA 3DD5A 3NG1A 3PFIA 3WYCA 3ZVRA 1U2DC 1EH5A 4D9BA 2AZ4A 3WWPA 1FMFA 3VDMA 5LM3A 5KPJA 3SAJA 2XOEA 1DXHA 3BMOB 1XQ6A 1IQRA 3EGDA 3HFGA 3KQPA 4HP8A 3ZY4A 5DI9A 2IZZA 4U9UA 1OY1A 3DMTC 3G5MA 3BD6A 3UAVA 4O4LB 8AT1A 4RF4A 3FVQA 4XPIA 5EJ4A 4WCVA 3TLKA 2JI4A 2QX8A 3ESDA 4V0ME 3UHPA 3IV9A 4J4HA 1LJUA 4RD1A 5EE0A 2LR0A 1ZMRA 2GNAA 2R751 3ELWA 3EFEA 3U4QA 2QL6A 3QBDA 1C7QA 4UOEA 5KYXB 4YMGA 3STYA 3GFBA 1P6XA 3MWFA 3DL7A 3FOFC 3SD7A 1Z6AA 2ZBGA 1P2TA 2OBBA 4W5HA 1A7JA 2OSBA 1J0AA 2OLEA 2W11A 2I76A 3NH6A 4ZAWA 5F5NA 5JRDS 5KHAA 1Y9EA 1XZKA 2QRVA 4O4HF 5BUZA 4NLLA 3T3HA 2WEKA 4AKIA 4HSEA 3R3ZA 1ORDA 1KF0A 1M2HA 3BCHA 3O9VA 1KSFX 1Q91A 1T5TA 3LZ6A 5KYWA 4XEHA 1L9KA 5CW2A 2B8NA 3PQ5A 4KR3A 5HXAA 1C1DB 1LPSA 2JZNA 1Q0UA 1VIMA 2QTMA 4WL0A 3H1EA 1ZMXA 1UADA 2IP2A 3I39X 2VYVA 3QG5A 3P9IA 4CIDA 4DEXA 5LD2B 5GIPE 2FUNB 2QPTA 4CN8A 2XT6A 4JJEA 2PSSA 3PIDA 1KQOA 4HAOA 4QQ8A 2W6JD 3AKCA 2WTXA 3I9V1 4QGBA 1T5SA 1W2GA 1J0DA 4KOAA 3IIMA 2Z6AA 3NYRA 1NQUA 5TGZA 3BH6A 5K0JA 4G25A 5A71A 1OWPA 3N87A 4CNQA 3VOSA 4F7DA 1PEDA 4BNNA 4MR9B 1ZXBA 3GCXA 2VHWA 2JLYA 3H13A 4PZEA 4TSFA 3PF9A 1HFKA 1TEXA 1XD2A 3VHXA 1T15A 3O8DA 4UM8B 2VVTA 3UJPA 1FYVA 4P4TA 1DU4A 5BSMA 1MVNA 3B7GA 1PFQA 4KTVE 1EGAA 3KQVA 2R4UA 4DDWA 1T1GA 1AT1A 1Z6PA 1VL6A 5KNBD 3F5DA 4IR7A 1GTRA 2ACVA 1I10A 3SSOA 4H6WA 1G5IA 3WKBA 2HDWA 5DBOA 1FP6A 3TNDA 3QVLA 2OORC 3UMFA 4ML3A 3RVMA 4O4IB 3D4IA 4BN0A 4F97A 3B89A 1N2ZA 2G06A 2GUWA 2V7EA 2C2ZA 3LAWA 4PAGA 4ZVNA 2CUNA 1XA0A 4PSVA 4EDFA 1ND6A 2Y92A 4CLOB 2RJOA 4AP9A 4DQUA 4CMIA 5TQ2A 2N46A 2LDXA 4YTEA 2O8BB 2WJ6A 1F6BA 1MIOB 3C3CA 3FYUB 2LXNA 1P31A 1WA5A 2IZ6A 1B2LA 5GJCA 2YNMD 5JZVA 4B43A 2FCAA 2HNBA 1YL7A 3SX4A 2X1LA 3WAKA 4GW3A 3S28A 5EWMA 3ZDFA 1DTWB 2J0VA 1JVSA 4B34A 1CLUA 4N48A 3VR2A 3FWNA 5F7ZA 4CMAA 4YMVA 3QSGA 2C57A 2NVOA 1QQAA 1ESMA 1AHIA 1JZTA 3AR2A 3LCUA 1G21A 1GQYA 3SY8A 2AKEA 4L4UA 3AUAA 5CTJA 2ATIA 5ULLA 4IOKA 4YPVA 3PI6A 3MEQA 1C30A 4BNUA 1KPHA 2GMWA 4RQUA 1P1JA 4IY1A 4TVBA 2MSWA 3CGGA 1F2VA 4XM1A 2OT3B 2XI4A 1YB1A 3I76A 2Q5QA 2I6QA 4ZDIA 2BMDA 2BMWA 1UJBA 2FAXA 1YS7A 4ETWA 4WBSA 2P6PA 1XWFA 3JQ8B 3RG2A 2F43A 5FBQB 4NEGA 2JJYA 4ZO6A 4B3XA 2FV8A 3UZUA 4DRZA 2AJDA 3EHDA 1HL3A 1GEEA 4ZQIA 5F1OA 2XGJA 3VDXA 1E92A 1ADCA 3OIVA 4B40A 1NBMD 2D5LA 2VP5A 1Q16A 1PW5A 2Z08A 3L7KA 5FI5A 1B1AA 4RUKA 3DPIA 1Q7TA 1PN3A 3Q2KA 3RLIA 2UVDA 3T9AA 4FGWA 4EW6A 2OYSA 4PRLA 2POCA 4DL9A 1QAQA 2WUWE 2FMIA 4MVJH 5DMXA 3TSOA 1B74A 4UEQA 1OB2A 3FZYA 3RKRA 4ZOLA 5TJHA 1XNRB 4PAOA 1QB7A 2QROA 3ME5A 5LZ5A 5CVEA 2WKRA 2XVZA 4NR0A 1AG9A 1KJ8A 1XCJA 3GIDA 1M7GA 2ES4A 4TMYA 5DLDA 5E7MA 1ZD9A 5JPCA 3IMCA 4I4TB 5T3UA 3R0XA 1W96A 5AW8A 1G2PA 1HX7A 1KYZA 3QFCA 4OI0A 3F2IA 2Z3VA 2HAEA 2IEZA 1QWOA 1PYGA 2IEYA 2QI9C 2VS1A 1ZWLA 4PYLA 3U4GA 5DN6D 2J3QA 3DMFA 1A7KA 2ZSHA 4L02A 3A6GA 1EHIA 2Q29A 3SYKA 3YASA 1MX9A 4A36A 1EYZA 1U0OC 4DLVA 4EKDA 1Y9AA 5DNYB 3EPLA 3GI1A 5AJZA 5A7GA 2ZI7A 4L22A 5HOEA 1XZFA 1HXHA 4ECEA 4Y2SA 5HKLA 2PBLA 1C8LA 1Q12A 2C92A 4FEGA 1ZAYA 1GA4A 3FZGA 2YFHA 1KFBB 3H18A 1V8ZA 1N5RA 2X5KO 5EE1A 1W49A 3ZDBA 2GCNA 2P9YA 3GJSA 4R2LA 1IU9A 2ZWIA 1NSTA 3AYXB 3CUUA 1UBEA 3IDFA 3WZMA 1IEXA 3R75A 1X8XA 2BJVA 4FNGA 4OHBA 4EUHA 2JCBA 5H8WA 2YMMA 1GILA 2IV3A 3EUFA 1A2QA 3AFGA 3H84A 3KEOA 4FPXA 1XVLA 3E2MA 3MCVA 4NMLA 3L5OA 5DFAA 5CBKA 3NVMB 3KM0A 1IPEA 3A4TA 4IJMA 2HPAA 5K8IA 4U7FA 1XTRA 3OPMA 3R3YA 4GI5A 2RK3A 3KZCA 4IQ0A 4AG6A 4OQZA 4DCUA 1E2LA 1Z4PX 4ZWNA 3U40A 1IUKA 4AKHA 1UP6A 4UFOA 1JDSA 2V7GA 2M9MA 3N28A 2C00A 3ND5A 2E18A 4GBGA 4GLLA 3GVPA 1AUVA 3R0QA 4K6GA 1TF2A 4II2A 5FUVA 3MTJA 5IVIA 5COQA 1DG1G 4B48A 3FDIA 1L8AA 3WWYA 1TYBE 4H4EA 3VU0A 3IAFA 3NBUA 5AOCA 4BNTA 3URMA 3A10A 1U0RA 4D96A 1U28C 1X80A 4BGUA 2NMVA 2W0MA 2K2WA 4IJKA 1A82A 4D98A 4UPDA 2HU5A 2FEOA 1G8GA 3L49A 5SY6A 2Z98A 4NRDA 3N0WA 1NLYA 3JQ9A 3DEAA 4W99A 3GWZA 4HX2A 4RZ3A 1I2ZA 4D9EA 4GICA 3ZK8A 1DJLA 4BRZA 3UK1A 1PK9A 1GGFA 2QUHA 2YH2A 1MLDA 3UB2A 1JR3E 2N47A 5H9WA 4YIHA 4WMLA 1F5NA 1I7NA 4FMDB 4GSYA 4NFYA 5ETJA 4EYQA 4CIYA 1Q0TA 1PJ4A 3HJTA 3F3SA 1O8CA 2E21A 3H5RA 4I4TA 4MQ5A 4WADA 4B3RB 4NI5A 2C03A 3QHQA 4TKLA 4NU5A 1U5AA 5K01A 2CLEB 4J0FA 1M5RA 3C8MA 1EZ4A 2FWBA 3S7ZA 2JAOA 5I9IA 4MOWA 4MP3A 3SHWA 2K6GA 4B80A 2X2PA 3FF4A 2IPXA 3FA2A 3GLGB 5I8ZA 1QJCA 1VECA 2ZR0A 3M2TA 4HADA 1QO0D 2QRPA 3INRA 3EH1A 3O6VA 1XDBA 3B6ZA 4QQKA 3FKSD 3OUUA 5K9ZA 3F90A 2QORA 4D9HA 3ORSA 4EUKA 2OCIA 3MK31 4F2HA 4NCKA 3MFQA 2Z9BA 4MUIA 4C78A 4BVBA 2K4MA 1THZA 1HZJA 3JQ7A 3W7AA 3HADA 3FLBA 2H2WA 3IT2A 1RQPA 1ZK3A 3PXBA 1YK0A 4F3NA 1E79D 1O95C 2BGKA 5FFFA 1P61B 2B3TA 3BKXA 3JQFA 4LAFA 5JNSA 7MDHA 1FLAA 1E62A 1T8PA 2BFPA 2C5SA 5FFMA 3FNQA 3ETDA 1WMAA 2BGIA 1R64A 1HT2E 5MFZA 1SQSA 2DJIA 5C5EA 1MEEA 1CERA 3NZEA 4KQ6A 2AEFA 1UBTS 2C07A 5JPDA 4TZKA 3HL0A 5ARDA 4TX1A 1M2VA 1GL6A 2CWDA 3BWBA 5K3FA 4HEJA 3FPKA 2CNWA 4Z2YA 2ZYHA 5E6RB 2GM5A 4ROSA 1OXUA 3REFA 1OXTA 2Z1MA 1DGQA 4XQEA 3C5WP 3F97A 4YEDA 5EKSA 1FUIA 2EYUA 1O89A 3BRWA 1Z6ZA 3PRHA 3UOAB 1Q1NA 2BBSA 3BGWA 1H2RS 1O6ZA 1XL0A 2V0NA 3RARA 2W6ID 3NHUA 2Z83A 2ZIGA 3QVVA 4JBHA 4TKMA 4TKVB 5DBGA 5LBUA 1EXDA 1LDMA 2QN2A 1KDTA 2R2GA 3DHWC 2AN4A 1QHEA 1BMTA 2JGJA 3DVSX 2OOSA 1YF3A 3ELUA 1NLUA 4BLTA 5DGTA 2NG1A 1DUVG 4ZODA 1MRNA 4F2PA 4RMHA 1IHXA 2XMCA 2JLCA 1ZH4A 3WLIA 3IAM1 4Z51A 2BI4A 1VE6A 1K7EB 1KY2A 4G2TA 4BZZA 4ZU6X 5AW0A 2IHBA 1RI1A 1SHKA 2OCBA 5KSPA 4AZ0B 1XRQA 2Y1EA 3IDQA 4LGVA 1AB6A 3CO0S 1GL7A 4N0DA 5ERGB 3SS9X 1MPTA 2F17A 1UJMA 1R5BA 5PNTA 4RK0A 5H16A 3TZCA 1T0HB 1ZZEA 2Q8NA 3L05A 2YQ5A 5L40A 2NO5A 1DQZA 2J9RA 2XWSA 3AEKB 4D0GA 3GVCA 3QBVA 5JY1A 4O02B 3ADBA 1R7RA 5JRJA 1E6CA 4D1YA 4DCOA 3PDWA 1KZHA 4Z9AA 4Z4FA 3ZLVA 3I2JA 4UOQA 3W6UA 1KI9A 1L1RA 3B6EA 2ZB8A 3IV6A 3M4XA 1CDEA 1XTPA 4I1SA 2R8PA 4LN1A 4MH0R 3K5WA 5A3VA 4LV6A 2P2NA 3TTXA 5FRDA 2PGNA 4E0BA 2YZKA 4HVAA 4LF6B 2Z8YA 1PJSA 2Q1SA 3M4NA 2Q6VA 4TRNA 4LHXA 1JQBA 1TYZA 4O2AA 4TPKA 3MD0A 4LC0A 5ECYA 5H3CA 3FUVA 3SR4A 5AVYA 3PL5A 5B55A 1LKZA 3A3YA 3B6IA 4PAMA 1PDOA 2CB9A 4C6HA 1JH9A 3TNYA 2H17A 4YV7A 5DHPA 2O7SA 4JVMA 4RDHA 5ER9A 1ZIYA 1ODKA 2J0UB 2LKCA 1P9OA 3RHTA 5CW1A 4AT1A 3M3DA 1ADYA 1IEVA 2XBMA 1JKMA 4YRDA 4FFWA 5CVTA 4HNVA 3P4XA 3ESRA 2R6JA 5HCIA 3S6JA 3TQQA 3U9LA 1F0KA 1XTVA 3QPUA 3F5FA 1QGYA 4FE4A 4QU0A 1DJOA 4KQEA 4BWGA 4TN1A 2OM2A 3T5MA 5KB3A 4LBYA 1Q2UA 4LZJA 1OKKD 4CQMD 1HT3A 5F3RA 1HTWA 3CZCA 1J8YF 3NEPX 1A4RA 2CXPA 2EJCA 1EBUA 4RYLA 1C1HA 2QZ4A 4JU9A 4EPXA 2ZI5A 3IAEA 1NXSA 3S0JA 4R8MA 4BVJA 4DUYB 2QN3A 3O1HB 2QSYA 4GKJB 1Y5MA 4EQ6B 2JH3A 5BQ3A 1EA7A 2I1VB 2OV4A 3D5EA 3SYMA 4BNDB 5CB4A 4LBZA 4AVYA 2II6A 1KI8A 3SU8A 3HJFA 1NT2A 1QSGA 4C2UA 2GJ8A 4HNRA 3Q8XB 4TUYB 5LP6A 2DBQA 3OJEA 2ZT7A 5HRUA 2ZIXA 2QJTA 1H3EA 1E8NA 1GUDA 1WV1A 3KFVA 2D0DA 4OSEA 3IKMB 3EVNA 4E33A 3JATB 4U9HS 4AK9A 5GADl 3WIOA 1SBTA 2Y9PB 1JLHA 1N2JA 1MJFA 3R0JA 3ISVA 1X9IA 2WABA 2Z58A 1XVUA 5C7YA 1AK2A 1DSSG 3GGCA 2ZIEA 3BRCA 1ZR2A 1YVDA 3LVQE 2P9FA 2HCFA 2LPMA 1N0IA 1A9XB 1ZZGA 5AM4A 4KVZA 3T9CA 3FLMA 2PDAA 1NVMB 2PMEA 4K3UA 5TGDA 1T4DA 3UN1A 2FP4A 3PBKA 3PQ6A 3GN1A 3RASA 1PHPA 2C83A 3K0HA 3OPQA 3VO1A 3WTCA 5CEEA 3ZD8A 2PN1A 1MGPA 3JARB 3CNQS 3FNHA 4R2JA 2XCTB 2VTBA 4EF6A 2YCBA 4PZUA 1J9ZA 1MORA 1OFUA 1H2HA 2AR9A 1K5GA 1H23A 4QG3A 2QQGA 4TLLB 1QYRA 2PL1A 3IKJA 2OD7A 1N3LA 2H63A 3TR0A 3T7CA 4UHKA 4CIAA 1Z37A 3KDPA 4IXNA 4JGBA 4AECA 1OJ7A 2C3OA 4HSGA 3G49A 4FSDA 1TU3A 4KV7A 4Z8YA 4RXMA 1UPAA 4JLBA 3WHIA 2ZIAA 1S2IA 2GD1O 3LBHA 3LPMA 4FUTA 4RY9A 3V8RA 2BE7A 1UJ5A 4IEEA 3VYUB 2NZWA 2IYYA 2Y05A 2AZDA 3GUZA 4FHDA 3GIWA 3GLHA 4XFJA 1CUZA 4PG6A 4ZU3A 5ELLA 5I9MA 1XEAA 2D62A 3OZIA 2PLFA 2WVAA 1Q19A 4M8LA 1EAMA 2UYHA 1KDOA 3OMXA 3ER9A 2C3UA 1WUTA 2GWHA 3E70C 3K1YA 4E1AA 4B6FA 2VQEB 4W9NC 1WOYA 3I92A 2XWPA 3K9WA 4JT9A 1RXVA 1WXGA 1P4RA 3L0YA 1VE3A 4H15A 4OQ4A 3GC6A 2O8EA 2HB6A 1SVLA 1XE3A 3K0FA 3JQPA 5K8VA 2AZTA 1O77A 3RTGA 3B2NA 3EXIA 4QQNA 1JDUA 2CFOA 5AUOB 4PNHA 5LUBA 5FADA 1CF4A 2R6AA 4ZCSA 1VL5A 2Y27A 2YN4A 4ZAYA 5A4MS 1H42A 1S9HA 5IP5A 2C9CA 1I1OA 2B2XA 2MWMA 3K0AA 3KWFA 4UAGA 3Q7EA 2WU3A 1OH5A 1EJ0A 2C5GA 4OGFA 1Z4JA 4E70A 5LOVF 1DQRA 3MELA 1NI4A 3WA6A 4YCMA 4YP9A 3A4VA 1IBSA 3WICA 5KX5F 4I9FA 2TMDA 4BGEA 4E14A 2INGX 4P1ZA 5ALIA 3I12A 4Q1AA 2OXCA 2Z3ZA 3EA5A 3FYSA 3I9OA 2BTEA 1KJIA 4TLEA 2W58A 3GRVA 4LFAB 1E6WA 3IQEA 3E7XA 4X7MA 3THYB 4W5WA 5CH8A 3O74A 4GI1A 3S2EA 4IKEA 2VQDA 3W5IA 4URVR 2D6FA 4EL5A 2R8RA 4WUVA 1Q17A 3RKSA 3C6MA 4RKEA 1LH0A 5EHGA 3ZGYA 4CQJA 1QHNA 2O8VA 2Q3BA 2BEKA 4FS3A 4KL8S 4LGYA 1YE5A 4DCSA 5B6IA 5JEEA 2VDOB 1FW6A 5E1OA 3ZZMA 2Z56A 3B51X 1SPBS 1PNVA 5E9JA 4OJNA 4C43A 3HSSA 2B20A 1KDYA 3CLTD 3VC2A 4YAKA 3Q7RA 3NO4A 5DSXA 1LJ8A 2UDPA 4JELA 5SYMA 4PF1A 4D4GA 4D8UA 1GGHA 1RTTA 2VJAA 3TECE 5KSZA 1U7UA 4PGFA 5AR1A 5AVVA 4RWEA 4KK4A 2P6UA 4FB4A 1MOSA 4GPBA 4REOA 4DLBA 3U1BA 5K0NA 5AVTA 1MTZA 3H1AA 4A8TA 1E2DA 5JVDF 2XE4A 3RAFC 4PHHA 1U2RA 3VU9B 5TMPA 2ZJAA 4D97A 5BMVB 5FLEX 1DLJA 2LTAA 1I36A 2ZFUA 5AK0A 1K75A 4UAJA 3AB7A 3PQ4A 1UMCA 5KTMA 1FNBA 1JQAA 1OE0A 4HZGA 3DOIA 2H5JA 1KYQA 4EFMA 4XB6B 4D26A 2ZR9A 4A10A 1IIRA 1XTKA 4D8YA 4LY9A 3IOCA 4FYHA 3JD2A 3NATA 5HM8A 1E2QA 2GUGA 2H31A 1NJ8A 1FUEA 2H18A 1IAQA 2Q9AA 3QU2A 4PCLA 4J6FA 4RSMA 3TO5A 1WETA 2E7ZA 2Q5LA 1XTTA 1EGMB 3GPLA 3M6AA 2QN6A 2VYFA 3SG0A 1SGWA 4AY4A 1R9NA 1Q57A 1EVKA 1Z18A 2IW3A 2R60A 2HMTA 2VSFA 2WIAA 4TL9A 2VRWA 3N07A 1N7JA 1UT6A 2ZRDA 3EF1A 4I1IA 3EXHA 2Q0QA 1SCQA 1MTOA 4XI9A 2JHCA 5CA0B 1CR4A 1PZXA 3CH4B 4HX5A 1NDUA 4QUGA 4KYTA 3OQBA 4UU0A 2ILTA 1DCTA 2F2TA 4CEJA 1GPDG 3VNSA 3W6OA 1XZLA 2G83A 2WM2A 1I2BA 2YV2A 2Y6VA 3F49S 1YR8A 5BNWA 1ZNZA 1A97A 3GEHA 5DGHA 5ALSA 1R8YA 1B1CA 1TK9A 2P78A 3LK6A 3QW4B 2KBFA 5GMOA 3G13A 5ALPA 4F1JA 1LPNA 5KREA 4LS3A 1KO4A 5KWJA 4HWKA 3ADCA 3SFZA 4B7CA 2FOXA 2M2IA 2PV7A 2DBZA 3AIKA 3GFOA 1FXWA 4MKXA 2F55A 1TKCA 3E9ZA 2P75A 2CY0A 4TMTA 1EUZA 1I1QB 2A0FA 1XZQA 2ISQA 2V58A 2JANA 1DP4A 1G19A 2OTCA 3OZFA 1SU4A 4HV4A 3PKJA 3UUEA 4TMZA 2O54A 4U02A 4ZEXA 5DHSA 2Q4RA 3ROQA 3PFWO 5FPHA 3IJ5A 4L0CA 2X58A 4RMJA 3EFOA 3JR7A 3SEAA 1V5GA 4JYBA 3D8NA 2GAFA 3UJCA 1D4ZA 3SSMA 4LXHA 4DVGA 1NVKA 1V4BA 3I6IA 3O93A 5I6DA 1L7EA 3E61A 3A9WA 3KWMA 5DW0A 3UTDA 4MQLA 4LBWA 3IP8A 3NJ4A 3SKVA 1G8YA 4TT8A 1OPRA 3UC5A 4EHLA 1WHTA 3FI9A 3UK2A 3KKQA 2BDEA 3SLKA 4ZHSA 2P0AA 2FFAA 4UXHA 3FUWA 3I2IA 4JSTA 4FZ3A 4EG8A 3HJHA 3JQ9C 3WMGA 3G0CA 3P96A 2PNJA 1N2BA 4HLNA 4O5AA 3N2ZB 3B60A 2P4UA 3K1AB 3EVZA 4MV9A 3ZH2A 4ZT5A 3RSOA 1P91A 4X5OA 2IUSA 4H7IA 2PO5A 1ODJA 1EFVA 1UMKA 3SM9A 4BQNA 4NAVA 1WULS 3NDJA 4C6TA 1TVEA 1XQYA 2ATCA 4RKQA 2CD7A 4EG0A 2D7CA 3FHOA 5I3ZA 2LGJA 3KU1A 4G4JA 1JJBA 4KV9A 4F3CA 1FFAA 3ZCUA 1U0JA 1EM6A 3CPEA 4O0LA 3AVPA 5DX1A 3WGHA 1BDBA 1N6KA 2X5OA 2VUIB 4M53A 3PP8A 4JUIA 4YQFA 1OOEA 2VC2B 2JLWA 3V4VB 4Q1BA 4ITVA 3JRXA 2OXRA 4WOCA 1NM5C 3R9XA 1PS9A 4MYHA 4MNTA 1UWKA 3WNVA 1AVTA 2IGTA 3LOPA 4JQCA 4U5XA 3SE0A 1KBZA 4PYIA 4RMGA 3K05A 5E6UA 1BE0A 1JSLA 2PA0A 3WOHA 3WDMA 3T1OA 2ZKLA 3IUPA 1QCYA 3HDQA 4NJEB 4XUCA 3RVJA 2QN8A 5FPSA 2FZ5A 3GAAA 3JQFC 1YI8A 2F9LA 4XDZA 1PR6A 2ZUTA 4C3VA 1TO1E 1FU8A 4GYKA 1ZUD1 1F7UA 2AFIA 1MO6A 3AHDA 4M6WA 4QTXA 2Z30A 2WIFA 3D4BA 1I32A 1XXLA 1Z56C 4B84A 4LCJA 4KXFB 2VZ9A 1AGYA 3VFDA 2D2IA 5CDUA 4QDXA 3ONVA 5J4LA 4OAQA 4Q01A 2HR1A 5FYDA 2ECQA 3KKMA 3E5RA 1TPYA 4MI3A 4WFQA 4YAGA 3R5FA 5AW1A 2I2CA 4XVQA 2ZUUA 4WNCA 3IRUA 2WVJA 2JGNA 5JSKA 1A76A 1DIOB 1JIUA 2TMKA 4K88A 4WKBA 1AKNA 4G36A 1YBMA 2Q0SA 4WXPA 1L1FA 2R8YA 3U48A 3V55A 5I7VA 5K0TA 3L6BA 3UAYA 2QTTA 4R7TA 1SK9A 3HKCB 2BEJA 3IMFA 2WE7A 3WDLA 2P3QA 2CLMB 1SM4A 3KCNA 3RIXA 3QXHA 2GRUA 3SIWA 3VZSA 4CHTA 1IBMB 5K4GA 3EJ6A 2A5DA 3H4MA 4CCWA 1JL3A 1Z5VA 2C1EA 2GZAA 4YJ3F 1U1EA 2V1UA 3H6GA 3JWGA 4BFSA 3GJ6A 1KR5A 1E58A 2UVQA 3PXXA 2IYVA 1M5TA 4GH5A 1EVEA 4JROA 4PLGA 1LZLA 5JCXA 1UJ6A 2H1SA 2C2BA 1CS4C 4BZXA 3RIYA 4BNWA 4X3OA 2EC5A 1Z45A 5CHYA 2ZAMA 5JNLA 5KO2A 2OFWA 2ZPAA 4BS9A 5IKXA 1P2GA 3SS8A 3WHLA 4TM8A 1YKFA 3I9FA 1X39A 5E9AA 5IAGA 3W7VA 1ESZA 2FSVA 3AR6A 3MXOA 4JI4B 1WCIB 3EE6A 5KNDA 1C0KA 2YBEA 1D09A 1G8JA 1T4CA 3K6RA 4U7HA 3V7UA 4B2PA 4DR5B 4Q19A 3VC3A 4QKQA 4FI3F 2BSAA 2WSBA 3CKMA 3MZ0A 1FRVA 1MRZA 4HFJA 3OCXA 4GL4A 3CUYA 3NQ41 4KXVA 3VAAA 5BVHB 5L8VA 3BUSA 3D8RA 3HBAA 4LYGA 2Y0CA 1TK3A 3FHCB 4IGAA 2BFCA 2IYAA 3A11A 2QRJA 4TYQA 3BH7A 4YLEA 3V34A 4XGRA 5IDQA 2LVBA 4II3A 1N4AA 1G3IA 3L46A 1OV6A 4LZZA 4CKBA 3LXUX 3H4IA 4FK8A 1TEZA 4ZRNA 3IH5A 3BJZA 4Q3NA 2XIQA 3L92A 4OKIA 5BRJA 2Q2OA 3GQBA 3HV0A 4J0IA 4QD3A 3AVYA 1ZSYA 1A5ZA 3UQYS 4B2IA 3QE2A 1TADA 4XWWA 1UDXA 2J30A 3EIEA 1XDWA 3LWDA 4WKGA 3JYPA 1FSPA 3D3NA 1S7GA 4YRIA 5REQA 1W0CA 3OOSA 4RSRA 4BYMA 4OHRA 1Y1SA 3UHFA 1OHHD 2DF8A 3KOYA 4LQ4A 1Z16A 1BD4A 1K6EA 1PO7A 4WFKA 4CMJA 1U5BA 4TXNA 5HCNA 4OI1A 4NHEA 5IJWA 2SBTA 2CD9A 3UF0A 2OCLA 4KFRA 2HU8A 3ST7A 3QE4A 3U26A 2I03A 3ZWYA 4E2ZA 1EZ1A 1FJHA 3RHSA 1IVSA 1C1YA 4QXPA 2AJCA 3FCXA 5G02A 3TL6A 2AQIA 3KEQA 4GOJA 4JQYA 3HSYA 4B82A 3E48A 4YX9A 1ZKDA 4DCPA 3JYHA 2DEUA 3KTOA 5L51A 3DXXA 5B6JA 2RIPA 4EAQA 1PSDA 1KC1A 3A1UA 4G81A 4RPLA 3O83A 1NJ5A 5KJCA 1T1EA 1CFJA 3GGGA 2ZJ6A 3MLAA 2MMCA 4F4CA 1U4SA 5AW2A 4MWEA 2CVHA 4MRRA 5FOSA 5G40A 2GM4A 3K9NA 2Q27A 1IFXA 3AM5A 2RE8A 4YRZA 2PAAA 4L28A 3ZXXA 1GRNA 3BIFA 4B87A 4PLTA 2PEYA 5EMJA 4L2IA 1HFJA 2IYTA 1BAPA 4OQQA 1YKGA 2GYYA 3L6EA 4NP6A 4TWAA 5B4VA 1A95A 4YJ2B 4CUJA 2PUHA 4A4DA 4PXAA 5CCBA 2XODA 4JJ4A 4AO8A 4ZALA 1L5LA 2BJWA 4COKA 5DBEX 1VA5A 3HGMA 4H1TA 1AS3A 2YICA 1CDZA 1NE2A 2JJ1D 2Z5LA 4MX8A 4JUFA 4OJKA 4B3MB 2SICE 3EGVA 3KLOA 2WP8J 3OQIB 2Q3LA 1X8KA 3ETGA 3A9CA 3LRTA 4KW7A 4OUDA 5JSZA 3K7EA 4MRNA 2DVMA 4NZNA 2IYWA 3S40A 3Q7SA 3OQMA 4CM9D 3AEUB 2OECA 3I23A 1NBEA 2A92A 2V97A 3TCXB 4P5EA 1TJ4A 4BO9A 1EM8A 1JNXX 4Q48A 4BMOB 4RV9A 3A8TA 3GLHE 4MKRA 1T13A 5JASA 1FFCA 2BISA 4KR9A 2R2AA 4XCXA 1R5JA 1UOOA 3FTNA 4EO9A 4R8KA 2E5LB 3RTAA 1RE1A 3WLRA 2X0JA 1LGYA 4DBVO 4WZ6A 4Z0TA 4NYIQ 1T0UA 3F67A 3R9IA 1W5EA 3FCEA 3I6QA 2MSCB 1K7XB 1PT6A 2B98A 4MJXA 3PQ2A 1MABB 1EVLA 3CZRA 4GC9A 2A58A 2W6MA 4ITRC 4RD0A 2OXFA 2XYGA 3OEED 2H00A 3ZHXA 1Y1QA 4DLPA 4AS3A 1QGZA 1SC3A 4URFA 3LK7A 2FR1A 3PG5A 3DE1X 3NBZC 4O4JB 4M1MA 4DSNA 2HMVA 2W6PA 4HN9A 1XMIA 2OBLA 1G8AA 3ANNA 1VBNA 3DE6X 2YS6A 3CZ4A 1QNFA 1GA6A 2WKPA 3LE8A 4E15A 1YQUA 5D1HA 1ELOA 3A6DA 4UUPA 1E94E 1EJ2A 1ZVVA 3V4RA 1U8AA 4R3WA 4F93B 5F23A 3ZOZA 5CLJA 1E59A 1F8XA 2OEPA 4IINA 3B3QA 1JFFB 2VF5X 3PUYA 4KC0A 4CLDA 2HZBA 3TZQA 1WE2A 3UG6A 5CD1A 3OPXA 4CIBA 3VVCA 2JI6A 5HQJA 3SEZA 1WP4A 1ZNYA 4MR8A 2WIJA 4URUR 3ULKA 2QS9A 5KNCD 1E7YA 3DR5A 3GU3A 2QUBA 4E5PA 2H7YA 4LSGA 1XEWY 2H4YA 4RTPA 5FNVF 1ZM4A 5ERXA 4PSKA 5DWDA 2J3MA 4JB3A 2WYIA 3KSZO 5EUCA 4ZJYA 1VYHA 5DTRA 2G5CA 4TTRA 3JQAD 4MS3A 1XELA 4QVGA 2ZTVA 3ILXA 1QX4A 1EGHA 3GGOA 4DIOA 3TBHA 1WBJB 2EBWA 3GT4A 1BX3A 1WG8A 3W2HA 4B44A 4CT4B 5EIBD 1QZZA 1YS4A 3EZLA 1R4ZA 3SZUA 4X9XA 2WTBA 2H4WA 2WNIA 3L5KA 3OE7A 2H1IA 4LFBB 2H4HA 4AWAA 5GINE 6GPBA 1EFKA 4N03A 3NYWA 4RZQA 1UPTA 4G0OA 4R81A 5GONF 5SV2A 2P2GA 1SHTX 2BFBB 4GUDA 5AVRA 5IXSA 1EP9A 3R09A 1AE1A 1V39A 2WINI 3WFZA 5IDVA 3WL5A 1BMDA 3UAXA 2IYRA 1RPNA 2BD0A 4OXRA 3F8SA 5IT4A 3M4ZA 2B3DA 2ZVPX 3AZQA 3G5LA 2ZUWA 4DANA 2CJPA 3PCRB 3C3KA 3WGGA 2VBCA 4AF8A 1PR4A 2E49A 1KMQA 2F8LA 2GRAA 4L4ZA 1XTJA 4L0QA 1A5AB 4XM2A 3KXKA 4KH1A 2IYQA 2JHPA 5EZYB 5FAKA 1REQB 1P9NA 4WZAB 4KIGA 4RENA 1BHSA 2YHUA 2IDZA 4GXQA 3IDAA 4H3HB 5J5CA 4RJ2A 3F8WA 4G85A 4NMWA 3UG7A 1W0KD 4L3WA 3LD9A 4MW2A 1ECPA 2R68A 4BHTA 4C4XA 5L6MB 2PXAA 4YT2A 5J2UB 2GHRA 1MUUA 2QD4A 2VYQA 4PYRA 3C5HA 1V8OA 4HGNA 4EKNB 2G1KA 5JSHA 3G2NA 1PLJA 1C1XA 2ZKIA 1KFJB 2GXUA 5CHEA 1M73E 4QBGB 2IQ5A 5CB4F 4D6PA 4AN1A 3GJ4A 1HG0A 2PAFA 4R1LA 5D3MB 2VPXA 1WWKA 1M0TA 1LNSA 1VHWA 3ETJA 1YR1A 3PKZA 3RUHA 5LP6F 3NWPA 1FTWA 5CURA 1FMTA 2AMJA 3LC7O 2I2WA 3QF4A 4EY7A 2CEKA 4Z7QB 2EKPA 4EGQA 1XRSB 1OUMA 2A7QA 3LXRA 1XAGA 3PGXA 4ND7A 4C7JA 2PX2A 3UMVA 3DHEA 3ZHZA 4OYLA 5CDFE 2VAWA 3KYDB 3BIXA 1P1IA 5HR5A 2O8NA 1L0BA 2P5SA 4H7DA 4XARA 2PUAA 1GPKA 2IU4A 3CONA 2PUDA 2HW8A 3Q3CA 3R4CA 1OFVA 2CBZA 5CDHA 5GGXA 1WTCA 4K2HA 1VKJA 4U0KA 5CBPB 3PL1A 5EJ7A 1IB6A 2JFGA 1GY8A 2O1WA 3G6WA 1NFRA 1TYDE 5FYQA 2PSHA 4C22A 4O8CA 1A8QA 3IUSA 2FQXA 3ML1A 3IBFA 3BCUA 1UDAA 3DM5A 3UT5A 1XL1A 4Q4JA 3WO1A 3ZY3A 1JFSA 4KFCA 1AMOA 3ZWBA 4N9QA 2VNSA 2HOQA 1J5XA 3ZVKA 2AVDA 1PGNA 3U56A 3AR3A 4EHNA 1TE2A 5E95A 1ZL2A 2WLTA 4JQSA 4Z5XA 3SS7X 3STUA 2GBCA 4J4TA 1P1KA 2WM3A 1BN7A 2PD6A 3GCZA 4HAXA 1Q6YA 3EAQA 1ML3A 1UM9B 1FDRA 2HWUA 2PKEA 3FETA 1CJMA 4NX2A 1GAWA 1UKZA 3M5PA 4HNAA 1GL3A 2ZUCA 3KB2A 3I2KA 3R7NA 3C43A 3I01A 3DH0A 1EDDA 2XLBA 3S2ZA 5LQUA 2R00C 2AYYA 1ZVJA 3HCBA 3SDBA 1D7AA 5LCXA 4WZZA 5U9CA 4XQ9A 3UV3A 3CVWA 4CM6A 2LCFA 3E53A 4DR6B 3KPJA 1V9LA 2E1RA 4R1TA 3UJBA 2FEKA 3QYJA 4ITUA 3A1DA 2OP0A 5CCXA 1L5SA 4DTIA 1MT3A 3BMOA 2CJYA 2GZDA 4CI0B 4MIKA 1PRYA 2D2VA 1SVOA 2DKNA 1KQFA 4BX2A 1RADA 3S2YA 1KXJA 1PP4A 2IY7A 4HGPA 5FT9A 3DEHA 4F5DA 4O4LA 5A5EA 4F85A 5FA8A 1M74A 1Z75A 1XVAA 2AFIE 1B8OA 2J9FB 2ZROA 2VJQA 1OI7A 3EODA 3EGWA 3LDFA 1J0BA 4LE1A 5EE5B 3MOSA 4CETA 4JD5A 1NHGA 3Q5EA 4G07A 4DV5B 1IY1A 2V5VA 2P9TA 2ZI4A 3NTLA 4I6GA 4R69A 8ABPA 4YRMA 5KYXA 2D3TA 2VYCA 4ZCQA 1R16A 1VBKA 4MVJM 1G9XA 2OCGA 3NWJA 4UULA 3D4PA 4NHOA 2QRLA 2PANA 2GM3A 5EP1A 3USZA 2RHRA 1ZG3A 3W90A 3WK6A 1GLGA 1D4OA 2OQ2A 1DEXA 4MW5A 4LYYA 4G5QA 4FHZA 4OQFA 1NBWB 2YMPA 1CF2O 5IBRA 4ZOQI 2AWNA 3V2UA 1SMKA 1C1DA 2VBGA 3G2MA 4MIEA 5LA6A 3T4UA 5KYTA 1FTSA 2CLHB 2ZRHA 5KTNA 1E1MA 4K6HA 5FBRB 3ZNOA 3AF6A 2WF8A 3V4ZA 4NWIA 1JWLA 4BL5A 4PZPA 1F8UA 3ZBQA 4L4SA 3FTDA 3HDJA 3V5NA 2C2MA 4DMMA 4CV0A 2YWDA 5BUCA 2AUMA 3QQPA 3X1WA 5C8YF 1DLIA 3IUJA 4P2BA 4M0UA 1AGXA 4RVSA 1KR2A 4Z6KA 1V37A 4V0NA 5E8RA 4G4SO 1JIVA 3HZZA 4RL4A 2NP7A 4MR9A 2H59A 4QNMA 3WB0A 4DQLA 3MPUA 1I9GA 2WU8A 4A15A 2I4RA 4Z0PA 5LR6A 4CKCB 1RXSA 2AHOA 4TL6A 4CWAA 1PR0A 4CLEA 3HXMA 3VNVA 4XJSA 3NC0C 3T4PA 2NV0A 3CLKA 3TSYA 4RORA 1F48A 2I3ZA 4BE7B 3FCYA 1DG9A 4QODA 3GD7A 5JSQA 2BONA 2ZVDA 1OXSC 1UMDB 1Y8RB 1S2DA 1KKMA 2W2LA 3MWGA 2O5CA 4YV0A 1JQ5A 1K3FA 2QLMA 1OILA 2BRUA 2ATVA 4MQFB 4PCVA 5FTMA 2C58A 4EGJA 1ZY2A 1XHLA 2D1FA 3IOYA 3KX2A 1JB1A 2H3EA 2FQWA 3BMNB 4O4IA 3K35A 3ZV7A 4WE3A 2JKVA 4NE2A 4GOXA 1QH1B 3ZD7A 3OZSA 1A3CA 1K97A 1MG0A 4F06A 2FSVC 3L0CA 4ZU1X 2DRIA 3BWMA 4GIBA 4Q4AB 3IEXA 3C3XA 5IHPA 3HFRA 1VXOA 3VR3D 2YHBA 3I4FA 5EMKA 1WCXA 2O5VA 5J4YA 5JAUA 3P20A 2BGWA 1VG1A 1GRVA 4BIMA 4AQ7A 1BXKA 2W5UA 1MIOA 4MSUA 1WF3A 5KYKA 3FYUA 1JLMA 1V3VA 3BK7A 1HDZA 3THXB 1CTQA 3EGCA 1YMVA 3W34A 3ZHCA 3PTLA 4D8WA 3R0IA 4Y2HA 521PA 3RFCA 4DILA 2NTJA 4LDJA 2PHZA 1DTWA 3LX8A 5DLPA 4AZSA 3IJRA 3OJOA 3NPAA 4OFXA 4REMA 3QW2A 2IXBA 4EIWA 1ZSNA 1Y6QA 2Z5VA 1QRRA 3PPYA 3CA8A 3TCKA 2IIVA 2OV8A 5TPWB 3C4VA 1J8FA 1SCUB 3VVLA 1UK9A 3ECAA 1BCRB 4WDRA 3OIDA 5C1BA 1MJ5A 3IPXA 2C61A 1KAGA 3R44A 1FQWA 2V6BA 4AMYA 3AUFA 4D3XA 4KIWA 3I9LA 5A05A 5CG1A 1HK7A 1FDUA 1SVNA 2R1ZA 1ST3A 1WP9A 3KT0A 3NJRA 2A7XA 5EKUA 3W7BA 4E3WA 1I3NA 5D01A 4M8NE 2WICA 3OOEA 2VJLA 4ZAVA 4IDQA 2HMUA 5LQRA 3IBGA 4DLWA 1AQ6A 1GD1O 3IXQA 1L5GB 4MV1A 4JJ6A 3LYHA 4Q4DA 2AFHB 3IULA 1EDOA 1II8B 2QM0A 3VKGA 1P6UA 3LV8A 1KTVA 1CVLA 1ZMBA 4L15A 4EPWA 4KXXA 4PSUA 2KMLA 3MB5A 3F46A 1WIWA 2DWOA 2FMFA 1PFYA 3FMGA 2UKDA 3PHJA 4RQBA 3D6HA 4FBGA 4D92A 1X7WA 4DA9A 2DOKA 4NH4A 1U8TA 2B83A 4JL6A 5DYIA 3R5KA 1Y8AA 2WYUA 3ZI4A 3SWWA 1QX3A 1R8QA 2XUZA 2CXSA 2XQIA 4IWXA 5JU6A 3D6JA 4C7MA 1QMPA 3USES 2QJWA 4XR4A 3L7LA 3U3XA 3DT8A 3ENKA 2J31A 1UJ2A 5MHTA 3GW8A 2H8KA 1PTKA 3MS4A 4FDVA 2F1RA 4EECA 5BV7A 2XNJA 2BGLA 1OZFA 3O3OB 4BKQA 1VKZA 1IY9A 4EMTA 3QPCA 3EK2A 3U4CA 3RR2A 4C5BA 3E9QA 2YW9A 4DJDC 3AQ4A 4Z0NA 4HJXA 1L8QA 1RJWA 2CHGA 2FWJA 3DC2A 4PGAA 4QU8A 4WJZA 3WIBA 5J4VA 1KYYA 3BJEA 1QGAA 4KNVA 4L8WB 4Y7DA 1V9CA 3ETLA 3LW8A 4G1BA 4RK5A 2Y1OA 3WLNA 4QQRA 1E5LA 1VE5A 4KO2S 3QFSA 3UFBA 1EE2A 4FINA 4WECA 2WWXA 2G9NA 3SJ7A 3L8HA 5G1PA 4LA4A 1QFSA 1J0EA 1ABFA 1UBRS 4FYWA 5TEVA 3AFHA 4HL6A 3MCWA 2I7TA 4DA0A 4FSHA 1EG2A 1LPAB 1QBKC 3PHIA 2VF2A 3EGEA 4DVJA 5EMHA 3IKVA 2FPRA 4HDKB 5CT5A 5BXYA 1ULZA 1VE7A 1KH1A 4RF2A 1G3UA 3F98A 2Y68A 1Y80A 2D5AA 4LRYA 1WW2A 1KEZA 3BM5A 3GYGA 4M9XA 5GWXA 1H4VB 4FFNA 1Y3IA 3JZIA 4J0KA 2GZSA 2WKQA 5GV7A 3WL4A 4GXNA 1QPZA 1A77A 1MNAA 2QP9X 2JFXA 3ZCTA 4EYKA 2ZJZA 1RLUA 3U13A 3EW9A 5JQWA 1J2YA 3GFVA 4AJ1A 1NLFA 3I6BA 1WDWB 1CUFA 2PMCA 1NUPA 5F7XA 1U2GA 3UJ8A 1ZU5A 3HRIA 2PRIA 5IZCA 4DNQA 2FLWA 5T8KA 3T3GA 1CZUA 1FS5A 1E18A 4OKNA 4PLFA 5E4JA 3L6CA 5HF6A 4YMLA 4TZTA 4BP3A 2VA9A 4AS2A 3NBAA 2VNHA 4FN5A 4MVYA 2O3UA 2YV1A 4RNCA 2E4YA 4Z9FA 3OVMA 4DREA 6YASA 2JEYA 4FS8A 3FDFA 3W5BA 2W2VA 1MB2A 1ZRMA 1JR6A 1K8YB 4JUAA 3A9SA 3FNBA 1HLDA 3L43A 3MGBA 4UBIA 2WFLA 2XW6A 3WL7A 1JJFA 3MTDA 3DDUA 2QN1A 2VSNA 1W5FA 3QLEA 1WUKS 4K9NA 1H66A 1E9DA 3KJHA 4ONEA 1U02A 3RCBA