4QO7A

Lactate dehydrogenase a in complex with substituted 3-hydroxy-2-mercaptocyclohex-2-enone compound 7
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qo7A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qo7A02
1WMBA 3A1NA 2I3AA 4DUPA 2CVZA 2P9CA 1GTMA 4BNHA 3WFIA 3ICCA 5L51A 1HWYA 3G17A 1K0UA 1R66A 3WBBA 3NJ4A 4D3FA 4D3SA 2BMAA 1IPEA 2FPGA 3AU9A 5FWNA 1P0FA 1DC4A 1DPGA 2F1KA 3DZGA 4CPDA 2DC1A 2IDZA 4NBVA 3QWFA 4YJHA 1A5ZA 2D3TA 2V6MA 4D0SA 1HE4A 1LXCA 3ITDA 4D3DA 2UAGA 3ETEA 4W4TA 4J9VA 2AG8A 3QJ5A 1ADCA 2HK7A 4YA6A 1J0XO 3P7MA 4JJGA 4J4HA 5I9MA 1R0KA 2FMUA 4KQXA 5ER6A 3WGQA 1WP4A 3OQ6A 1JVBA 4IZIA 2PV7A 1W6UA 3HDQA 3IDSA 4UEKA 4YACA 1SO8A 1CF2O 3SLKA 3ZN2A 1B8PA 1PJLA 2ZB7A 1ADFA 1Q1NA 5F5LA 4Z0TA 3VTFA 2VYVD 4ZGWA 4UEJA 1NVTA 3STHA 1PJCA 3I9NA 5JDCA 1RM0A 1Y5MA 4OH1A 1M75A 3RI3A 1Y6JA 2O4UX 2EF1A 5ITWA 3GF4A 3JD1A 3GG2A 3N74A 3Q9UA 1VPDA 1VJ1A 3QRWA 2CF6A 1MFPA 1WNTA 3LQFA 1HETA 1GQ2A 4XX0A 3E9MA 3ABIA 4YBZA 4TROA 5HWSA 4CQMA 3SBOA 4D0RA 1N1EA 2OMEA 1YQDA 4ZU3A 2V6GA 4HFJA 1R6DA 2DUWA 4BO5A 2WYVA 3VH1A 2CFCA 2IXBA 1NQ5A 3QVXA 1C0KA 3V1TC 2Q3EA 3BAZA 4ONEA 1E5LA 3O38A 4NU6A 4LSMA 3ENNA 2PH5A 1DJQA 2VRBA 4UVHA 9LDBA 4EUHA 1LLCA 3AUAA 3A4VA 2O4CA 1YJ8A 4YJHB 3FPCA 3DOCA 3LT1A 3ZWPA 1KY4A 1GADO 1Y9AA 4FFPA 1HXHA 2F00A 2C20A 4MP8A 4QXMA 4R54A 3DFZA 4BV9A 1ISMA 5TQVA 1HRDA 3BZUA 1LC0A 2ZCUA 2E37A 4YAGA 4TVBA 5CDYA 2I76A 5TJHA 1EMDA 1H6DA 4TVOA 1MX3A 4MIEA 4PIVA 4UVEA 3VTZA 2Y68A 3JQBC 3IJPA 3NGXA 5JO9A 2JCXA 2NU6A 3TPCA 2Q46A 5G0UA 3MZ0A 2GO1A 4YTEA 2JFGA 3OM9A 1XWFA 3QWAA 4EEXA 3FNGA 4PCVA 4FW8A 3DOOA 5CHEA 1K89A 4CL8A 2PKRA 4AJ4A 1PJQA 1OZAA 1T4BA 1FDWA 1ZK2A 3OHSX 5TF4A 4CR6A 4M1QA 1JN0A 3QV1A 1U1IA 3GEMA 3QVTA 2O3SA 1EFKA 4CQMB 1ZW1A 3VPHA 4Q3NA 2NSDA 4M8SA 5F1KA 1JVSA 1U7TA 3DZJA 1NX6A 4LMRA 3Q11A 4CV3A 4E5KA 3C1TA 5C7IO 3GEGA 4XIYA 5T67A 2ZB4A 3PJGA 5EMHA 1IB6A 3KLMX 3X2FA 2UV8A 2E48A 3PTZA 1F14A 1MB4A 3JYOA 3PQEA 3S2IA 1JKJA 1LRLA 4HWKA 1WXDA 4K1LA 2EERA 1EZ4A 4J90A 5L4LA 2Q4EA 3DZKA 4CODB 4HFNA 1QSGA 3AJRA 3LZ6A 4YEDA 5JAQA 2Y1EA 2EW2A 2ZTMA 2UUPA 4WNIA 5CDGA 4NJMA 3ETGA 2Q1UA 5JW6A 1YKFA 3ROPA 1NWCA 4EI2A 1ZMTA 2J5RA 5CAEA 3PHHA 2B4RO 1BTOA 2AQKA 4Z0PA 4CMHA 4IS3A 3G79A 2LDBA 5JCXA 2D0IA 3JQGA 4XR9A 3CEAA 1QYVA 3BMCA 3TZCA 3P2YA 1S6YA 5F3RA 1UXHA 2AEJA 4E30A 3D7LA 1RYDA 3ENKA 3H5RA 3WYCA 1YO6A 2EKPA 2X0JA 4N5LA 4DRYA 4TRNA 2NVWA 2HKIA 3AI2A 1XGKA 1LDYA 3DMTC 3MWEB 3BMOA 5F21A 4TKLA 4TQGA 3IAHA 3WX0A 4J2OA 4UEOA 2FPPA 1NPYA 3I1JA 1ID1A 1LUAA 1L7EA 2JFFA 3Q0EA 1UZMA 1HSOA 2IZ0A 3IC5A 1XA0A 2ET6A 1H94A 5I9NA 3GGOA 1DEHA 1XQ1A 4OSOA 3QE3A 2OO5A 3DL2A 2E4AA 5A06A 4AJJA 3EYWA 2PKQP 1TXGA 1N9GA 3CZMA 4OAQA 3QWBA 1GQQA 2AW5A 2NV6A 4G2NA 4NMHA 3OBBA 5IAAA 4BNJA 1ZK1A 3LC2O 3PJFA 4IDBA 4YJDA 4FC7A 2OOSA 2ZYAA 1HYHA 1R37A 3FRJA 1OMOA 2DKNA 3H9GA 1B14A 3MJ4A 2O2SA 3DZBA 3RQSA 1MA0A 4I8XA 2AQIA 4E2ZA 1F12A 3C7CB 4NJMB 5I9LA 1YB1A 3VPSA 4H7PA 3U5TA 3DBHA 3SVTA 1U3UA 2VHXA 4DIFA 4Q3CA 3G3EA 4N7RA 3GDFA 5DOVA 1JDJA 3O03A 3M2PA 5AVOA 2G1UA 3ZV5A 5FI5A 5JAMA 1LLUA 1P45A 2BF7A 4O1MA 3BMCB 3C1AA 1RWBA 4P38A 1LRKA 4R1NA 4E0BA 1XR3A 2I9PA 5BSFA 1VRWA 1PR3A 2I99A 3F5QA 1EK5A 3D1LA 1PQUA 5TT0A 3TN7A 4CUZA 5COAA 4XGIA 4RPGA 3LT4A 3BMOB 3K6JA 5EQDA 3RUEA 5B4TA 3WXBA 2WE8A 3G49A 1Z7EA 4YXFA 2BGKA 1Z7BA 4CMCA 4BNVA 1KIFA 3S1LA 3F6YA 1VL6A 3WDSA 4MVJP 2CY0A 1TEHA 3NRCA 4BNWA 2J5QA 4RJTA 3E03A 1X15A 4GKVA 3WLFA 3ZU5A 1D3AA 1PR9A 5A9SA 3VPXA 4AFNA 5THKA 1IHYA 4YAIA 1N9GB 5A1TA 2FZEA 3RUDA 1PWXA 4P8RA 1YGYA 2C29D 4II3A 3K8ZA 4UVIA 3VKVA 1U3TA 2QIOA 3LLSA 1DRUA 3S2EA 3MTGA 7ADHA 2DBZA 4RDIA 4TRMA 5FYDA 3Q9NA 4ILKA 3UXYA 4CQLA 1DB3A 4F3YA 3ZU2A 4A03A 1G0OA 1EUZA 2HMTA 4EZBA 4BKQA 3DTTA 1FDVA 2W90A 4AJ2A 1B15A 4BNMA 5CEJA 3AI1A 3PQDA 4XDZA 3CKYA 2JKVA 2HQ1A 1PZEA 5JMPA 3C85A 4JJIA 2OP0A 2VHVA 3TRIA 3ZHXA 2X5JO 1I2CA 4EYEA 3H5AA 1DLIA 1B7GO 3ON5A 1Y81A 1CEQA 3GN2A 3E48A 5LC1A 1ISGA 3CZRA 2GN4A 3GZ4A 1N92A 5JSFA 2B35A 4PGFA 3ZU3A 4J91A 2OBNA 1LLDA 3LSYA 3ZWCA 1OOEA 2EWMA 4A5OA 3UFXA 4ZQHA 1GQYA 3U9LA 2WD7A 2WTBA 3HDJA 2NNLD 4CM7A 1I2BA 1N1GA 3D64A 5DNAA 1T1RA 4N18A 1NAHA 2EKLA 1ADBA 5IXYA 2Q2QA 4J2HA 2FR1A 4W7IA 1YRLA 4TRRA 3NJ8A 4DVJA 3L4BC 1I10A 3H5NA 2YZ7A 4IDAA 2I3GA 4RORA 5HS6A 5A9SB 2X9GA 1KEWA 5KJFA 3UH1A 3OECA 2TMGA 1BXZA 4XA8A 5K0ZA 4UUNA 3CXRA 3AOEC 4NU5A 4DLAA 2WDZA 3OA2A 3S2FA 1D4FA 1R16A 2UUOA 4ESOA 4EUEA 1C0LA 4Z3KA 5IG2A 3KSUA 3AWDA 1DLJA 1Q7GA 5LDGA 3ZNNA 4CQLB 1P1IA 4NZ9A 1OI7A 1OBFO 2XXJA 4WCDA 1H6CA 3TWOA 3PLNA 1QR6A 4OXYA 3FNFA 4J7XA 1NYTA 1Q7BA 3GZNA 3ORFA 5KIAA 3EVTA 3ZW8A 3PVZA 4E2YA 3OQ1A 1K6IA 4IDEA 1AGNA 4NBRA 4F46A 1U4OA 1A9ZA 1UZNA 5G4KA 4I9UA 2VWHA 2Q1TA 4DLLA 1ZEMA 1EFLA 1NQTA 4Z9FA 3OIGA 3MWDB 4GMFA 2O3QA 1JKIA 5IDYA 2D2IA 4MJLA 1C3VA 1BG6A 2RHCA 3I9OA 2P5UA 2WD7B 3MOIA 1H9BA 1YVEI 5AXAA 1B2LA 1EBFA 1DIAA 4Z0HO 1UXGA 3GPIA 4O59O 2O3UA 3GA0A 4DC0A 5KOIA 3EK2A 2HJSA 3IL2A 4K26A 5KNLA 1T26A 1PS8A 2Z1MA 1T25A 4QX6A 1NVGA 4JN6B 2V65A 3HE3A 4PLYA 2BHLA 4MKXA 1BDBA 1MXFA 3QWIA 5JMWA 2C5EA 4CUJA 2BH9A 4RF4A 2BFPA 3RKUA 4FPXA 3V8BA 4BMNA 5L7YA 1PGNA 2Y1FA 1O9BA 1UXJA 4JROA 4NPCA 1VJTA 4J7UA 5AOVA 1TA4A 3ZI0A 1ZXBA 1AXEA 2VWGA 1VL8A 1F0YA 3O8QA 2ZTVA 1P0CA 2NTJA 4GI2A 3AK4A 5BR7A 1EK6A 3VZPA 4CM4A 4PLTA 4YJFA 1J4AA 4Y6PA 2CSUA 4BKRA 2FR0A 3GZNB 3R3JA 3ST7A 5B4UA 4ITUA 2NADA 4B4WA 1VLLA 2JAPA 1EQ2A 2EGGA 2FR8A 1JQBA 5G0TA 3KYBA 5G4KB 4DA9A 2JHGA 3WSWA 3V2UA 1VSUA 4HNHA 2OP1A 1WZIA 3D3WA 1PJ3A 4J1TA 1P33A 4CMKA 1HLPA 2VQ3A 3ZDFA 4KTTE 4RF3A 1QLHA 4MVJA 4K6CA 5JY6A 1LQTA 2HDHA 5A5FA 2CVQA 1XIVA 1P1RA 1DC6A 3W4KA 4IZHA 1WW8A 4FFLA 1FDTA 4JP2A 1N7GA 4PVDA 3ZWVA 4G65A 4QECA 4E4YA 3X2EA 3H7AA 2PGLA 2Q99A 4IS2A 2YJZA 1SBYA 4ND2A 2BFAA 2O3JA 2DUUA 4ZRNA 4NBWA 2DBQA 1BW9A 3K96A 5HTOA 2ZB8A 2C59A 3NDRA 4W6ZA 3U4HA 2VUSA 4MVJH 3AM5A 4I9HA 1WDLA 1ZCJA 2PZJA 2DQ4A 2VZ8A 4B3IA 1C1DA 3MJTA 1A7KA 1X13A 3JD2A 4E13A 1PJTA 2X8LA 4TSKA 4R4JA 1XDWA 1H2HA 5JAIA 1EUDA 4P22A 4O63O 5F1PA 5JC8A 2FY8A 4FJ1A 1KOLA 3O8QB 3K9QO 5LDHA 1SB9A 3NT5A 4XQCA 2AEFA 2OXIA 2VWPA 2ZJ1A 4S3MA 2HU2A 4YJFB 2W4QA 3TF5A 4URFA 4XYEA 3MOGA 1LLQA 5HBRA 4XZ3A 2Q50A 5B12A 4YPOA 3JQFA 1C1XA 4U5QA 3OSUA 4XB1A 2OHXA 2X9VA 4GVXA 1D1TA 2J3HA 3E9NA 2HRBA 5DBIA 5AXBA 3PP8A 4KOAA 4CMEC 1YL6A 1PIWA 2RHRA 1NQOA 4PLCA 4WKGA 3BHIA 3S2GA 4CM5A 1M76A 5BSEA 4EDFA 2Y1GA 1JLLA 4HY3A 3ZHYA 1PZGA 2ZYGA 4Y6SA 5DDIP 3DDNA 1HZJA 2PZKA 2P68A 3PYMA 1OC4A 4NFYA 3K30A 3LU1A 3TQHA 5CDTA 4DBVO 3ANNA 4JXKA 3V2GA 2CNBA 3HNPA 2HMUA 4CMJA 3C24A 4YT5A 2Y99A 1BW9B 2OBYA 4XJSA 3L6OO 3FBGA 1AN9A 2YDYA 3WB9A 2Z95A 1Y1PA 4NK5A 1C1DB 1WDMA 1GZ6A 3TFQA 2G17A 2PD3A 1HDZA 5GZ1A 5CEEA 1IZ9A 2HJRA 3JQDA 4ZHSA 3OIDA 3VPGA 3C1OA 4BS9A 2NUAA 2X9NA 3GY0A 3OP4A 1UDAA 1YJQA 1O94A 4L4XA 5HM8A 3VDRA 2Q1SA 3P5SA 3TL2A 4J1NA 4GPD1 3LVFO 2FZWA 4BHTA 3BXXA 4LRTB 1IE3A 4R69A 1GFSA 1AHHA 3UHAA 5IZCA 4BO8A 4WCFC 1U8FO 4F6LA 3WLEA 2VNSA 5A02A 3FI9A 4PLHA 4Z9YA 2V7PA 2WSBA 3HZZA 1P3DA 2W8ZA 4FR5A 3DHEA 2JD1A 2BRUA 4PLFA 4BO1A 4X54A 5KTKA 3ANMA 3PZBA 5T8KC 4FCCA 3RUAA 4D45A 4ALLA 3ZHZA 5FF9A 1V35A 4ALJA 3RCBA 3QQPA 4EGFA 2ZJ0A 1Q0HA 3MEQA 1B0AA 2HK8A 3HSKA 1KEPA 1NFRA 4FJ0A 5T57A 3TZHA 2VNAA 1NBOA 1JKFA 1YDEA 3GGPA 3I52A 1H93A 3OJLA 1NASA 3RJ5A 5ES3A 3EDMA 3ZWYA 4AJ1A 1VJ0A 3KZVA 4Y8VA 2EKQA 4U0KA 3JSAA 4JP3A 2FSVA 3PZRA 4LRSB 4RVSA 4DL9A 2WYUA 7MDHA 1EVIA 3KLPX 4OM8A 2PWZA 2Q45A 4OOEA 3RBVA 4E2XA 1I30A 4O6VA 5AXDA 3WTCA 4MVJI 3HJAA 4RF2A 4GKBA 4HNGA 4YQYA 2C2YA 3ZWXA 1KVTA 3RFXA 3KO8A 4MIOA 2VZ9A 1GZ3A 4ZQFA 4I5FA 3WGIA 3W6ZA 1U2DA 2G76A 1WLYA 2NWQA 2HLPA 2NVUA 4MINA 1UP7A 2ZTLA 1DIRA 3ZH2A 1SOVA 4YYZA 5JXWA 3D5QA 5ILGA 1NXQA 1IUKA 2EJVA 4FN4A 1LU9A 1E3SA 5I7VA 4KUEA 4FOSA 3TOZA 5JO0A 1I3KA 4XEHA 4WLUA 1M2WA 4JGBA 3ASVA 3QHAA 4BV8A 2VRCA 3JD0A 3F5SA 3WWZA 4BNUA 1UAGA 2UYYA 4FQ8A 5GZ6A 4R1TA 4QFDA 4FB5A 1I3NA 4OGWA 2SCUA 4GSKA 2IZ1A 5A05A 3COSA 5JDIC 1PZHA 2C0CA 3K31A 1EUCA 3WWYA 2JAHA 3DAGA 4W9NA 3H3FA 4OIMA 3RBXA 2IEBA 3W8FA 4HADA 5HA5A 5JCJA 5CFZA 5G4LA 2NLOA 3VZSA 1HZZA 3WGZA 1LSOA 3AUUA 1GPJA 2X58A 5IJZA 1GU7A 1GY8A 1U28A 1GUFA 5L4SA 3CMCO 4DXHA 4LVUA 1H6AA 2Y05A 1CQJA 1DIGA 1DHTA 3OJFA 1Y8RA 2E82A 3CIFA 3JD4A 1I2ZA 1ENOA 1HE3A 1GCUA 4E6PA 2P4QA 4ALKA 4RVHA 1G1AA 4B79A 2VYND 4FJ2A 3PWSA 2B36A 3EUWA 4A0SA 4D41A 1GR0A 4PRLA 2GN8A 4FGWA 2NVUB 1OAAA 1WAMA 2W2KA 2Y0DA 3ADPA 3GNTA 4QEDA 4BNTA 1H9AA 4CM6A 1YONA 1IYZA 1YWGO 4ZD6A 5CG1A 2B5VA 3GH3A 1Y9EA 3F3SA 1FJHA 1PGQA 2HCTA 2VT2A 3E6AA 4QT0A 2V6BA 2VWQA 4KMSA 4W7HA 4ZJUA 4CUKA 1DFHA 4XCVA 2PD4A 2JHFA 1IHXA 4WOKA 4ZVVA 1PGOA 3O26A 3RUIA 4YVFA 1ML3A 1X1EA 4AJNA 3G1UA 3GC6A 5CDSA 4XYBA 3UAGA 2A35A 2NTVA 4WLOA 3PI7A 4RPJA 4B7UA 1DO8A 1V3VA 4M55A 5L45A 3FR8A 3WMXA 4HP8A 4NR0A 4R01A 2EXXA 2NTNA 4GGOA 5DZSA 5JAZA 1E3JA 1ONPA 4NBUA 4OMUA 1GDHA 3NEPX 1VL0A 3AOGA 4IQGA 2XF8A 3FCOA 4AJPA 2AE2A 1DAPA 3K2EA 1IULA 1LSSA 3UVEA 3KXDA 3MTJA 3PPIA 4EJMA 1BXKA 3GVXA 4RVFA 1PU2A 4GLOA 3CPSA 1Y8RB 1YE3A 1EVZA 3GMDA 3SXPA 4OJNA 5A03A 1SZJG 3JV7A 1WDKA 3W6UA 1NAIA 4U7WA 3F47A 3QIVA 1E92A 3FR7A 5L40A 4DPMA 4WLFA 4UVGA 2CD9A 3GHYA 2W2KB 2Y93A 1LX6A 1ZO8A 3TZQA 1PL8A 1JAYA 2D59A 1QYDA 3RAJA 3UF0A 3FPLA 5G2OA 2O7SA 1CJCA 4UUPA 1O0SA 3HN7A 1LBEA 5KCZA 4KDEA 4CLRA 1CWUA 1R12A 1ZJYA 4QFCA 4K6FA 4NDNE 4YAJA 1CETA 1P77A 1PQPA 4BGIA 1GYRA 2YV2A 3NTRA 1QORA 3PIDA 2RH4A 5K9ZA 4PZEA 3JCZA 5B4VA 2CZCA 3LDHA 4KQWA 4GX5A 5K6AC 1PSDA 3P19A 4GLLA 4BNXA 2B69A 1V6AA 1LDBA 2FHSA 4XQGA 1P1HA 5ENDA 3M1AA 1HLDA 3DZFA 3ZGYA 1E7YA 1KBZA 3PRJA 4KZPA 1NWHA 4BMVA 3PQFA 4EJ0A 3SC6A 4GL4A 1X0VA 4J0EA 4E32A 3ZV3A 5L7TA 4J1QA 4LCJA 4IM7A 3R3SA 1YDWA 3WGHA 1EQUA 4R3NA 4H15A 3K2BA 3OJOA 1H0KA 2Q4BA 4M54A 4WJZA 2XOXA 1F8GA 3JQAA 3E82A 2A94A 3INGA 4YRDA 1DC3A 1NFFA 2R00A 3DTYA 2J6IA 1IY8A 1Q7CA 2IYOA 4OL9A 3JQ9A 5DBGA 4BIIA 5JY1A 2B37A 3GEDA 3PDUA 3GNQA 4R1UA 1Q2XA 3INTA 4DIOA 6ADHA 3W4IA 2H6EA 1VKNA 4IPTA 4AJLA 3AW9A 3I9MA 4JLWA 2DPHA 4CR7A 4I08A 3QP9A 1DRWA 4XR4A 3MJEA 4YAKA 1P44A 1MC4A 3NT2A 4J4TA 1IZ0A 5TSDA 4U8GA 4CLRB 3KVOA 4M87A 3TOXA 5CG2A 2I6TA 4Q3EA 3AFNA 1SNYA 2GUGA 1ISJA 2FSSA 4BUCA 4ZQGA 1UH5A 3ZWOA 1NP3A 1ZXLA 1UP6A 4GWGA 1BMDA 1ZSVA 5KWEA 2O3RA 4NJOA 2YFHA 4I5EA 4EUFA 4FFRA 4ALIA 3D3EA 5FI3A 4BNIA 3FTNA 4MOWA 2VTEA 1E7RA 4RVGA 4JBGA 3PEFA 3OIFA 4BMSA 3VPFA 1QYWA 1E6UA 1QMGA 4WE3A 2X4GA 5DF1A 5T64A 3QW2A 1E1KA 1LSJA 4MVJG 3DQPA 3E18A 4DTIA 3C8MA 1UR5A 4XRRA 4IGFA 3AUSA 4JNKA 4DBZA 1L1FA 1BHSA 4I5GA 5T6BA 3LT0A 4NQZA 4R9SA 5THQA 4BVAA 3RU9A 3JQAB 2WD8A 3DMYA 1HKUA 2DPGA 1T2CA 4GX0A 2X0NA 5EESA 5CPFA 2DFVA 3I9LA 2DU8A 2E49A 4J4BA 4KUGA 3W4JA 1YL7A 1MGOA 2DBRA 3I4CA 5ER9A 4IDCA 2VRCD 3S8MA 5EINA 3V1YA 2JL1A 4N5NA 3Q1LA 3ROKA 1WMAA 3WIDA 2X5KO 3FD8A 4IJWA 4KDFA 4UAGA 3VZRA 2A92A 4CQMD 2WE7A 4XYGA 4E5PA 2DTDA 4IUYA 2GLXA 1C0IA 2QHXA 3PHJA 4ND3A 3CE6A 1PX0A 4I9NA 2EHDA 3D0OA 5DCUA 3DC2A 2EG9A 4G81A 4YAEA 3L77A 1ZK0A 1EE9A 4AJIA 4BNFA 1FMCA 4GVLA 3B1KA 4EBFA 1VSVA 1G6KA 3JD3A 2OZPA 1HEUA 1SCUA 1H5QA 5IDXA 2YQ4A 3KSDO 2X0RA 1J6UA 1KEUA 4YWJA 3VH3A 2CVOA 2BD0A 3B1FA 1BVRA 3JQ6A 1TB4A 1E3IA 3LK7A 1ARZA 2QYSA 3UW3A 5A3VA 4DMLA 4CM9A 1E7WA 2VOJA 1ZZEA 3G0OA 2HUNA 3E9QA 2JFHA 3GUYA 5IXSA 1N7HA 1PJBA 2OGUA 3U3XA 5B1YA 3BMQA 3T4XA 2QRLA 4KP7A 3FTPA 1E3LA 1PJSA 3VZQA 4BNGA 3KV3O 2C54A 2OL4A 4R3WA 4EITA 5HS4A 4W99A 2BKAA 3PWZA 5H81A 5CEFA 2QQ5A 3WOHA 2DVMA 3L4SO 3JQ7A 1PEDA 4J9UE 4XB2A 2QZ9A 3WGOA 5FFFA 4W82A 3ROMA 1PS9A 4GH5A 3FSRA 4PFJA 1N5DA 4UVDA 5JBIA 1ENZA 2IYPA 2D8AA 5JDCC 5JNLA 4FDAA 4A73A 1P1KA 3GQVA 3RASA 4FFNA 3OFSA 3KSZO 4U6QA 4NHEA 2WYWA 4IY1A 1EEHA 1RKXA 3GDOA 1GL3A 5L9AA 4MO2A 2IRWA 3NTOA 2RH8A 2DLDA 3IUPA 1DSSG 3BA1A 1LA2A 2B4TO 5A4DA 3RBZA 4NNJA 5DOZA 4WLNA 1TLTA 3VOSA 5EL0A 3ONEA 4DIBA 2CMDA 3A28A 4CL3A 5JYDA 3H9EO 3AUTA 3KEOA 3W1VA 2C82A 4H3VA 1E1NA 2PLAA 3B6ZA 1CQIA 1ENPA 3QWHA 1NR7A 1U4SA 4CMAA 1V9LA 4G5HA 4H16A 4MKZA 1LEHA 1SPXA 3M6IA 4OQYA 2GN9A 1Q0QA 3PYXA 1D7OA 2YFQA 5KJ6A 3RD5A 1RM4A 3I5MA 1GUZA 4PLVA 4AICA 1XHLA 1WZEA 4AVYA 4XGNA 3VC7A 4CV0A 3H8VA 1IPFA 4HFMA 1DBVO 4PG4A 4BNZA 3BMQB 3WNQA 5L4NA 3H2ZA 1GD1O 3NUGA 3AY3A 5CP8A 1KC3A 1DOHA 1KYQA 2Y66A 1UUFA 3JQBA 1A71A 4PG7A 1AXGA 3JQ7B 2PKQO 4A10A 4OYRA 1BXGA 2DM6A 1N8KA 2ZKLA 1MG5A 2ZYDA 4BNNA 2PY6A 5TX7A 2J3IA 3T7EA 3BTUA 4EW6A 1JAXA 2VYVA 4C7KA 3HQ4O 4E21A 3HB5X 2VHYA 1FDUA 1DXYA 5TS3A 3OA0A 3EZYA 3RROA 3ZWWA 4HBGA 4E12A 3OEWA 2X22A 1A7AA 1GV0A 2JCYA 2Z5LA 3Q2KA 4Q3AA 4CM8A 3DOJA 5BSHA 1Z82A 3F4BA 4FFMA 1SB8A 2Y67A 3H4VA 1ZEJA 4QQRA 1VM6A 1P1JA 3E5RA 2C5AA 3GT0A 2HMWA 3HHPA 4IJUA 4ND1A 3RC9A 4E3ZA 4K28A 2C07A 4KUHA 1E7SA 3ZWBA 4YRBA 2NU9A 3WQQA 2QRKA 4DYVA 1K2WA 3H9QA 1QXSA 1YOVA 2QYTA 1XEAA 1HDXA 3DFUA 2PTGA 1M66A 1KVQA 2DTXA 3F4LA 4CJXA 5TRTA 1M6WA 3GFGA 5L3ZA 5BSGA 1TT7A 4Y6RA 4BO7A 4PLWA 1DIHA 4OKNA 3BHJA 3KOUA 1ADGA 1XQ6A 1YQGA 3H9JA 1LDGA 2DAPA 4DPKA 3GK3A 3HG7A 3WTBA 3GLQA 5T5QA 3WICA 3KB6A 1B8UA 1B8VA 1QYCA 1R15A 4RPHA 4WOJA 1D8AA 4EEZA 1FDSA 1BXGB 1CERA 1UXIA 4NIMA 4A27A 4NBTA 4B3JA 3GVCA 1HDGO 2NACA 3ZWNA 3UOGA 4C7JA 2QZZA 2YY7A 3DMTA 3TSCA 4PG8A 4J1SA 1NVMB 3DO5A 3PLRA 4J7CA 1ONOA 1GAEO 4BB5A 1DHRA 1KY5A 1V0JA 4Z3DA 1X1TA 1X7DA 4LVCA 4U6SA 4CM8B 1H2BA 4XYMA 4BOYA 1R0SA 1U9JA 2G5CA 5B37A 3WFJA 3D4PA 1NM5A 1MG0A 4PZDA 5EJ2A 4BB6A 3H9UA 4CLDA 3DEYX 1JWBB 4PVCA 2AE1A 1SEVA 3TL3A 2TMDA 2NVBA 3ROQA 1YOVB 1B16A 2AEMA 1E0DA 4AJKA 3JQ8A 4RGBA 2ZCVA 4GBJA 1E77A 4HUJA 4NK4A 4ZQEA 5CDUA 2EEZA 1CRWG 1Y8QA 1ZK4A 4O0LA 2GD1O 4OXNA 3Q2IA 5MDHA 2PGDA 2VTDA 4PLPA 2H1SA 5DULA 2Y0EA 3V1UA 3DHYA 3KHUA 4IQ0A 3FWZA 2Q2VA 3OMLA 4INAA 3VH4A 3P2OA 2Q1WA 5BT9A 3TZKA 4D43A 1YB5A 5U9CA 3U4IA 5ICSA 4YR9A 5IF3A 5I8ZA 2NU7A 1D1SA 4GSLA 1CYDA 5FEUA 1S7CA 4TMFA 4Y9DA 4CMBA 2H9IA 2GZ1A 3A14A 3IKVA 5EERA 1NFQA 4BGUA 3ONDA 2GPTA 4A7PA 4P4NA 4CLOA 3Q6IA 2HMVA 4Q9NA 1EVYA 4BNYA 4AG3A 2YV3A 1LQUA 5BNTA 3BYZA 5U4QA 1LDEA 2PK3A 1KERA 3SLGA 2H63A 4RF5A 5G0WA 5KVCA 3QLJA 2ZQZA 3AI3A 3T7CA 3JQEA 1F06A 3D4OA 3RC1A 4HKTA 2O23A 1KETA 4O5OA 4QUKA 1KC1A 4CM9D 2QRJA 4M89A 4B8ZA 3WJAA 3ZWAA 4R16A 4DQVA 3LYLA 1GPDG 1ONNA 4YJGA 3PFFA 5KKAA 4CMGA 3UUWA 3F9IA 2J3JA 5I7SA 1IOLA 3CH6A 4RZHA 2WEKA 1XLTA 1C14A 3JQ8B 1V3TA 2Q49A 2CF5A 1JA9A 3R0IA 2EV9A 1M67A 8ADHA 1Y8QB 5I7FA 2HO5A 4BNKA 4II2A 3GHHA 4YT8A 2IODA 4HFRA 4BO0A 3NAQA 4L8VA 2I67A 1JW9B 1VI2A 2FPIA 1B3RA 3FN4A 2PGJA 3HADA 3F1LA 3H65A 1E7QA 4NFSA 1ISHA 4UREA 3AM3A 1U3WA 5IFLA 2P91A 4JIGA 2IE0A 2NM0A 3EAGA 4BKPA 5G0VA 4D7AA 4NH4A 2G82A 3UN1A 2R2GA 3PDJA 5AYVA 2EP5A 1I36A 3OF2A 5ADHA 1T4DA 4CLOB 1ENYA 2YYYA 1K3TA 3TFOA 3WJ7A 3PGXA 2GF2A 4YT2A 5TC4A 2W2LA 1HL3A 3V2HA 1ZIDA 3GFBA 1HYGA 2JCVA 3B20A 2FWMX 1P1FA 1YS4A 3TJRA 3RUCA 5ITVA 2ZTUA 3KM0A 2GRAA 3C7DB 1HE5A 1VC2A 1QKIA 4XWYA 4FOOA 2GGSA 4RQUA 1ISFA 4DGSA 3PGJA 3L4BA 3WSVA 1P74A 1AUPA 1HTBA 1XKQA 2P2SA 4J0FA 4M49A 5COBA 4DWVA 4WEOA 4E5NA 2P9GA 2QG4A 2A4KA 3B1JA 4WEQA 1B3BA 3AOEA 3LC1O 4YJGB 1W8DA 1U8XX 4B8WA 1C0PA 4E33A 3EVNA 5IDWA 4ZA2A 3W8DA 1ZKMA 3PHLA 1KVRA 1UP4A 3WGYA 1OFGA 3DB2A 3DBLA 3F1KA 3T4EA 1VE9A 1BDMA 5KJ1A 1A72A 4MP3A 2X7HA 4IXTA 1X7HA 2YUTA 1GUYA 4MIYA 4OHUA 1WWKA 3VDQA 2WJPA 2Y1OA 2YHUA 4J6FA 3BMNA 4PRKA 3WS7A 1G0NA 3LF1A 3Q3CA 3V5NA 2E6UX 5JLAA 2P4HX 2XAAA 4TZKA 4WLVA 4GGPA 1I0ZA 4B3HA 3GOHA 1XYGA 3I83A 1T2FA 1Q0LA 3BTVA 4FFOA 4MVJD 3L9XA 5JS6A 2P5YA 1O95A 3DXFA 3ZZNA 4L9RA 4RVDA 1F8FA 1EDOA 2VOEA 4UUOA 4WPGA 3PFWO 3UGKA 2XPCA 2GZ2A 1I01A 4TKMA 4Y67A 1YL5A 4JX8A 5GMOA 2BELA 2H5LA 3ZW9A 1AHIA 2C2XA 1LJ8A 4LCEA 3IOYA 1LDNA 1W73A 2BGLA 4R68A 3BIOA 4TRJA 4MVJE 4DC1A 3QVSA 3RFVA 1MV8A 5C7OO 1RPNA 3GN1A 1E5QA 1YQXA 5EPOA 4WK6A 1O6ZA 3DBLB 4XYLA 3PJEA 4CMIA 4I5DA 3OQBA 4L4RA 1YBMA 1QP8A 3M2TA 3INRA 1A27A 5C5IA 1X14A 1J49A 3LT2A 3BMNB 3PHGA 4RLSA 3ULKA 2NU8A 1UJMA 1DDOA 5TIIA 3EGOA 1TT5A 2BFMA 5DP1A 3SJUA 4IXWA 3GG9A 2YHIA 3OH8A 5EN4A 4RPKA 9LDTA 4J49A 3I6QA 1V8BA 1U3VA 2YV1A 4GMGA 1I3LA 1X7GA 4NFHA 3JYNA 4IDGA 3ASUA 2RAFA 5GY7A 4CR8A 4RQTA 4LK3A 4MDHA 1A9YA 5C37A 1T1SA 1LDMA 2HRZA 1OC2A 3WIEA 3EC7A 3H6KA 1EVJA 5I8WA 4A2CA 1WVGA 4RCVA 3O9ZA 4BKOA 5L7WA 2VUTA 3TZ6A 3NX4A 2Q2WA 4OQZA 1ZNQO 1DAOA 1MLDA 2JJYA 5TT1A 1FK8A 3S55A 1P31A 2FP4A 3GR6A 3EHEA 3R1IA 3CINA 4BGEA 3I4FA 1ZVMA 2X6TA 2VN8A 3VH2A 4CMIB 2RBEA 2WWRA 4N5MA 3DAFA 3WGGA 4KTVE 3PXXA 4OKIA 4KWHA 2YW9A 3FF4A 4R51A 3ZV4A 1GCOA 2LDXA 1KEVA 5L53A 3JQFC 3JYQA 4GWKA 2ZIZA 5BNIA 1I32A 3OICA 1KVUA 4Y98A 1I24A 2VZ0A 1DJNA 1TT5B 4LMPA 3RWBA 4D44A 5KVVA 2YHIB 4D46A 2PNFA 1LRJA 2BFOA 3OETA 2PZMA 4CMEA 2CUKA 3ZNQA 1ZSNA 5ENVA 3JTMA 3GAFA 4IGEA 2B5WA 3L9WA 5IN4A 2GR9A 4FS3A 2GZ3A 5TNXA 1IL0A 2PD6A 3RVDA 1LTHR 3ONFA 3E8XA 4LSWA 1PWZA 1H6BA 3FNEA 4B7XA 1N2SA 1UDBA 3RC7A 2VHZA 3OJ0A 5JC1A 5TLSA 1SMKA 3PHIA 4FBGA 1PS0A 2BI8A 2VCYA 4PG5A 5BQFA 3KBOA 4CLHA 3TDKA 3ZNPA 1QG6A 4DLBA 1P9LA 2C7VA 3U62A 1I33A 2B83A 2OUIA 2GYYA 4MPDA 8LDHA 4IDFA 4S1VA 2VUUA 4IBOA 3MJCA 4PZCA 2G0TA 4OO3A 3LF2A 4QO8A 2DT5A 2RCYA 1ZK3A 3HFGA 3JYLA 1O89A 3SEFA 1T24A 3JQGB 3DONA 1ZJZA 1W0CA 1GEEA 2XXBA 1U5CA 3K92A 4CLEA 3GVPA 4B7CA 3G1TA 4MKRA 3U4CA 4A26A 2W2LD 4BQRA 5A5EA 3MCVA 4TWRA 3CSDA 1PL6A 4FSHA 3IP1A 2Y0CA 5IZCC 4WCFA 3U49A 3NYWA 1NHGA 5KKCA 3QVWA 1Z75A 2EP7A 2PR2A 4I1IA 3KYCA 3RUHA 1HDOA 2Z1NA 3DAPA 2GERA 4L0QA 1BSVA 1YBVA 4JQCA 3UCXA 3RIHA 2Y1CA 4Z6KA 3D5TA 3FBTA 1GV1A 3H2SA 4XQ9A 1ULUA 3HDYA 4YB8A 1DC5A 4D42A 4DYDA 5T8KA 3PYLA 4ND5A 5KJCA 1EDZA 1SAYA 4D79A 3PK0A 5KVQA 4PN3A 1U5AA 1QYXA 1DFGA 4DMMA 4BGVA 5A3JA 1HDCA 1U7HA 2A9FA 2PA3A 1R0LA 2J8ZA 3UKOA 4HV4A 3JYPA 3GGGA 2YDXA 1AE1A 1E6WA 1L7DA 2D4AA 3I3OA 1NQAO 4J43A 1RJWA 4U0JA 1I8TA 2R6JA 3ZCXA 4ZICA 2AA3A 1Z6ZA 3I23A 1O5IA 3IQDB 3GMSA 4WLEA 5JCJD 1JTVA 3RUFA 5H83A 4KWIA 3DBHB 3SX2A 3MJSA 1PGJA 2PH3A 5JPIA 2X0IA 2ZK7A 3UCFA 2GDZA 3RFTA 2O2YA 2X5OA 3E5MA 4J16A 2O48X 3R6DA 4RPLA 1RM3A 4IJVA 5A04A 2X23A 2AG5A 3RSHA 1UAYA 3EMKA 4P4LA 1E3WA 3FHLA 4IIUA 4BO4A 5DCWA 3EY4A 1PGPA 3IUSA 1DFIA 3AM4A 1YH3A 3O4RA 5A9TA 4L4SA 1ULSA 3EW7A 2BGMA 4WCFB 5I7EA 4BKUA 1Y7TA 4N54A 3KYDA 3KYCB 4DQUA 3L6EA 3KRTA 4HXYA 3NGLA 5JYEA 3CUKA 4MVJF 3HN2A 1EBUA 1MXHA 2C7GA 3UICA 3HWRA 1NPTO 4DREA 2V6FA 2B0JA 1Y5RA 4ALNA 1XU9A 2VT3A 2P9EA 3A9WA 4NI5A 4CV1A 4ROSA 3OJEA 1NR1A 1HE2A 1U2GA 2UVDA 4CV2A 3BHMA 2FRDA 5JDIA 4BQPA 4GQAA 3PWKA 4MP6A 1QV6A 3IIEA 4RV9A 2EIHA 1ZFNA 4QO7A 4Q3DA 1Z45A 3A06A 4R5MA 4J3FA 4OSPA 5IDQA 2NQ8A 4W9NC 2B4QA 4JK3A 4IJKA 1E3EA 1PL7A 4GX2A 1A4IA 4WNCA 3ZNOA 1LC3A 5DT9A 3KUXA 4HX5A 1WPQA 4E5MA 3GRPA 4BO9A 1O8CA 1PTJA 1ZH8A 3WNVA 3QSGA 3KEQA 1UDCA 3MJVA 2AMFA 3K73O 4Q39A 3RU7A 5KVSA 1CDOA 4ZN6A 1E3WB 3NKLA 3LC7O 5G0SA 5DN9A 3U4DA 3LLVA 2HMSA 4RL6A 5JFOA 3F46A 3KETA 4QSMA 4R9RA 3NDIA 2CDCA 2YQ5A 1NNUA 4ALMA 1KS9A 3KYDB 2UDPA 4P4GA 4PLZA 3DWFA 4YDRA 3VAZA 6LDHA 3SC4A 3ICPA 1BRMA 2D1YA 3FNHA 3E1KA 3AY6A 4E31A 2O50A 1XU7A 1HT0A 1KVSA 2GCGA 5EIOA 3B70A 1W4ZA 5L95A 1Z74A 3WG9A 3GPDG 1LSUA 4BO6A 3WYEA 3DBVO 1TVEA 4CM3A 1LNQA 3TNLA 2HK9A 1EE2A 2VHWA 4FC6A 1SC6A 3C3XA 1UXKA 2ZQYA 3ANLA 3W8EA 2JD2A 4XQEA 1J5PA 4WUVA 2J3KA 3WR5A 3AY7A 2FN7A 1XELA 3PIIA 4AJHA 3K5PA 3I9KA 2AXQA 2GASA 4IDDA 3SJ7A 3VKUA 3GUCA 3BTOA 4L75A 1HF3A 4LN1A 1MUUA 5DCYA 4CLXA 2IXAA 4IQ8A 4YQZA 3JQAD 2PFGA 4JCOA 1ZBQA 3U09A 3HDHA 3RKRA 3QA9A 3GVIA 4XIJA 4YT4A 2RIRA 1RM5A 3GNSA 4WGGA 4PG6A 4IIVA 1BWSA 1E6EA 2D5CA 1T2EA 3DR3A 1QRRA 1ORRA 4Z9XA 4CM1A 4DPLA 3HB4X 1HDYA 2EW8A 3I6IA 1I3MA 3DBRA 2AQHA 2O3TA 1SEPA 3GVHA 5H82A 2OFPA 3IJRA 4GAEA 4C4OA 2VYNA 3DHNA 2PZLA 5CPBA 4BL5A 1JU9A 4BNLA 2IEDA 3D4NA 3NDJA 1R4NA 3PJDA 3EZLA 4RZIA 5HRUA 4EJ6A 4B4UA 2WMDA 4F45A 1NTOA 4B4OA 3ITKA 3L6DA 4L73A 2ZB3A 4JBHA 1NHWA 4JJFA 3U0BA 2OORA 1K6JA 1HSZA 3C7AA 4XDYA 3NT4A 3GRKA 5ICMA 1MP0A 2DBVO 3GDGA 3WYBA 3RC2A 2X86A 5DP2A 3ETDA 5F5NA 4B4VA 5K6AA 4RVUA 3CMMA 4JBIA 1MC5A 2AHRA 1Z73A 4FD3A 4L74A 2EGHA 4E2WA 2D5AA 2GSDA 3NTQA 1HDRA 2QX7A 2BI7A 3KTDA 3L0DA 3AFMA 3ZHBA 3NV9A 4CM4B 1XCBA 4DQXA 4XRGA 5GZ3A 3H3JA 2ZATA 1X0XA 2QW8A 3CTMA 4BO2A 3I9JA 4YRAA 1YXMA 1ISIA 2GN6A 1PQWA 1M6HA 4K9DA 1GYQA 1UZLA 1K6XA 1GEGA 2EJWA 1BVUA 3DZHA 3L07A 3M1LA 3AU8A 3D3WB 1FXSA 4LW8A 5IZ4A 4WECA 2R00C 3ZWMA 1XSEA 1T2DA 3JQ9C 1NPDA 2ILTA 3DBRB 5EQFA 4F6CA 2W98A 3IKTA 1QV7A 4AJOA 5JE8A 5J23A 5KJEA 4RDHA 3ADOA 5A9RA 3JQCA 5COQA 4UUMA 2I5PO 3IP3A 3WMWA 1GZ4A 4WASA 4AJEA 1R4NB 5BNFA 4ND4A 3HUDA 3BTSA 4ZQBA 1R4MA 4FIZA 4YCAA 5AQ1A 4LISA 1E7MA 1QLJA 3RJ9A 4XKJA 5LCXA 4QTZA 3IMFA 1V3UA 5C3MA 4XD2A 1VKOA 5TGDA 3VVCA 4E5YA 3FWNA 2CDBA 2NQTA 1TI7A 4IINA 3DZIA 1GYPA 1CIVA 1YB4A 3WBFA 5AXCA 1A4UA 1JWAB 4M86A 4OXKA 5U1PA 2J5KA 2FOIA 3OEYA 1PJ4A 3VHRA 1DRVA 4FGSA 1SOWA 5MGBA 2IZZA 4IMPA 4R1SA 3UCEA 4BO3A 4TZTA 1T2AA 5C7LO 1PZFA 1ZSYA 4LGVA 2O7QA 5ILOA 4RO0A 1ZUD1 4OOFA 1C1XB 1F17A 2DTEA 2BLLA 4XJTA 5IN5A 2HAEA 4ID9A 3QY9A 3ZV6A 1LI4A 1BGVA 2POQX 1E1MA 2AQ8A 2X1HA 1YBAA 3N58A 3WQRA 2CDAA 2Y1DA 4IMRA 4AL4A 2GNAA 3GAZA 2HSDA 1K5HA 3QVOA 4R5HA 1HYEA 4RLHA 2DFDA 3IS3A 2JD0A 2WM3A 1DIBA 4PLGA 4GX1A 3HFSA 5TJ9A 5DBFA 4NG5A 1B26A 1MFZA 1XG5A 3VVBA 1ZMOA 4MVJM 1PJ2A 3WQSB 5F1OA 4Q3BA 4XGKA 1I5RA 3N7UA 4ZRMA 3ZU4A 1RYEA 4L76A 2I65A 1FF9A 4UULA 3WGTA 2I66A 1R4MB 4R41A 1E1LA
chains in the Genus database with same CATH superfamily
2C3OA 1P4JA 2I3AA 2MINA 5K0NA 3O4FA 3VJMA 4RMGA 2GB4A 4BNHA 4DUPA 3DEIA 4MV4A 3G13A 1A5BB 4Z1MA 2HUPA 1YR8A 1T0HB 3P4YA 3QG1A 3VM6A 4D3SA 1JH9A 3AU9A 4P2BA 5FWNA 1P0FA 1RR6A 2FE1A 2H2HA 3ZKAA 4GHWA 5ELLA 3ZQJA 2CLKB 1SCAA 3BWXA 3GQBB 4M36A 3O6VA 2VCHA 3BFJA 1Q2UA 2IDZA 4A6EA 2HT1A 4NBVA 3QWFA 1XCMA 2QNBA 2D3TA 4D0SA 2YTZA 1LXCA 1KJNA 1XEFA 3WHPA 3ITDA 2ZSIA 1M2JA 5C8VA 4K05A 5GJWC 4W4TA 5HKAA 4AU1A 4ENVA 2AG8A 1ADCA 1N25A 2BWJA 4YA6A 1J0XO 1IJFA 1A9OA 3DWGA 1K1EA 3O8DA 1DVRA 1OLUB 4PHGA 3OTQA 3ESRA 3KEMA 4IOJA 1NA5A 2WABA 3OLVA 5I9MA 1R0KA 4KQXA 2ZWIA 4E1AA 1OJ7A 4QQFA 3DXZA 3U3KA 5I4CA 2IEYA 4KQ6A 2CL0X 3MM4A 3PSAA 3RRFA 2AOVA 2PV7A 3CLKA 4KZKA 3D31A 1CNMA 1JG7A 3AQIA 2R1ZA 3IDSA 4LY6A 1GTJ1 3NQ41 4UEKA 4XE5A 4DDKA 1CF2O 4P92A 4RFVA 3K6SB 2XBLA 3HXTA 4G84A 1XPUA 2P0EA 4XDHA 5JFGA 1XTRA 1ADFA 3IRUA 3C41J 5DI9A 4Z0TA 2VSQA 2VYVD 3RAPR 3G9ZA 1P6XA 1NVTA 1T0IA 1YKSA 1PJCA 5JDCA 4FS8A 4FHDA 2QVBA 3GEHA 2R47A 2OZLB 4EA8A 2BH2A 1M75A 1G8HA 1NI5A 2F4NA 3EIQA 3Q98A 5IAKA 3RI3A 1E3QA 3H19A 4FLEA 3SJCA 5A2QA 5ITWA 1B0UA 1QX4A 2XVMA 2EZTA 1VPDA 3IP9A 3QRWA 1NQVA 3ZDZB 4XX0A 3AP2A 1GSHA 1HETA 4YMIA 1U1GA 3I6MA 5CXUA 1GVHA 2CFRA 3DTNA 1Z3IX 4D0RA 3KVNA 2MINB 1KYTA 1LNSA 3CZQA 3SYLA 2G1JA 3AR5A 4HFJA 1TMKA 4PQFA 4TM7A 1Y8ZA 1JG6A 2QUHA 5JZSA 4OGGA 2NSJA 3ZU6A 3UFBA 1OYWA 4ZCMA 4ZK6A 1QBKC 3QKRA 1OH6A 2WSLA 3V1TC 2IE8A 5F2EA 4BN0A 2A5DA 2HCFA 1M3SA 4M9CA 4MA5A 5WRFA 1E5LA 1FYWA 1P39A 1UWVA 1Y6RA 3EXFA 4LSMA 1JZSA 2JB9A 2PWBA 4UVHA 3R7NA 3TLMA 1ZONA 2A67A 1LLCA 3A4VA 1YJ8A 5DH9A 4AYXA 3DOCA 4LYGA 3NHZA 2CLLB 2PGXA 2D62A 3ZDBA 1YKGA 5HOEA 5I7OA 4GPBA 4RM2A 2F00A 2Q3LA 2Z30A 2R7MA 1BWPA 2ZUVA 4MP8A 4P4SA 4NMLA 3RODA 4BVHA 5DNWA 5GINE 1ISMA 2WPDD 3L0BA 5TQVA 3CV3A 4BMYA 4HO1X 1Y4AE 1RWMA 2E1RA 1GSOA 4MYRA 5CDYA 1EMDA 2HF8A 2YXNA 3CJTA 4QT4A 1INLA 5SYAA 4PIVA 4N39A 1RKBA 3JQBC 3W0LB 4DLKA 1QGAA 3IJPA 3GLGA 3TPCA 5EJ8A 4O4HA 3UJAA 4DB4A 4MAAA 4LTNA 4REOA 1GXSA 1GCAA 1M8GA 3P0HA 4EEXA 2BKXA 3D8HA 3DE5X 4TV8A 4YFYA 1CB0A 2ATXA 3AW8A 1JPJA 1FZQA 1E2KA 3BIFA 3OKFA 5JZVA 1OZAA 1U3CA 2QE7D 3NH6A 1VIVA 3R6WA 4B6SA 3W5UA 1HR0B 3WDMA 4CR6A 5BV2P 4TTSA 4KGDA 4XX0B 1MAWA 4Y18A 5E8RA 1Q1AA 5EY5B 4MGHA 3PKZA 1CEEA 3ND5A 1GGKA 4NMXB 3MTBA 3X1WA 3OOSA 4M8SA 4W8GA 1AKMA 1B73A 3V3KA 3VR6D 1U7TA 4QATA 3ZXSA 3EX7C 4LMRA 5C7IO 4E5KA 1W52X 5AJWA 4WKPA 3GEGA 5IAEA 3WRYC 1S7GA 4MLCA 5EMHA 4POAA 4G1BA 5IAJA 3TTTA 3QKRB 3PDIB 4YAWA 3UK6A 4Z3OA 1U80A 2PCJA 5EJEA 2W71A 5EP4A 1SKMA 3MT0A 2TSYB 4FMDB 4J8PA 3EXFB 1G21A 1WXDA 2QT1A 2JGAA 4OF4A 5K3AA 3TAXA 4CETA 1EZ4A 3FG9A 3L1IA 1X19A 1Z0JA 4J90A 1MO6A 2C2MA 5JNSA 1LH0A 1Z39A 2WF9A 3VYTB 1SCJA 5L4LA 3DZKA 5JPCA 3I5UA 3AJRA 5HFAA 5BQXA 1U1FA 1WU8A 3HXKA 3JWGA 2YVUA 2ZTMA 1IZ7A 2CMFA 2UUPA 4GPIB 1RHRA 4OJYA 5CDGA 1XQXA 3GYGA 4QLOA 5HOQA 5I48A 4ACBA 5JW6A 4KR3A 1NWCA 3G5TA 3SCZA 5A1JA 5ABPA 3C87A 2DR2A 3FKSD 1BTOA 3TX2A 3E3LA 2IIBA 4Z0PA 1EJ2A 2PDAA 4CMHA 4TYYA 2BUCA 2FHPA 2QTMA 3G79A 2C2ZA 3GLGB 1G5TA 3JQGA 4JQOA 1MVNA 2OG1A 4I3FA 3TZCA 2RGXA 4PZ9A 5ALDA 3G8CA 4LYEA 1EFRA 1UWCA 2DQSA 4O4HB 4IX9A 4R1PA 3GBPA 1WXGA 4DLZA 1GXSB 4JSYA 5DISB 4LNHA 4RE6A 1RYDA 2OLKA 2VAVA 4TV8B 5U4XA 4QGSA 4JNCA 3DDZX 1G16A 2EKPA 2X0JA 4N5LA 5K3DA 1Q0UA 4M0FA 4NAHA 2BE7A 2V9PA 1GU1A 3RS0A 3AI2A 3OMXA 4X45A 2Q3HA 3T34A 9ABPA 1FFXA 3BIJA 3I42A 2ID9A 2QMQA 1M6YA 4TKLA 1GPUA 4TQGA 2A2ZA 2FEXA 2FPPA 3FSGA 3B1YA 3CO5A 4OJKA 1LUAA 2NAPA 4TT8A 3X1MA 4RELA 2V7QA 5EIFA 3Q0EA 2ETXA 1J8DA 1QAMA 3N8DA 4GP7A 1PJZA 2ZQ5A 3OQIA 3IC5A 1FQOA 3B6KA 2QTRA 3H5OA 2JFXA 4A6DA 4JH0A 4PANA 4BP3A 3UT6A 5I9NA 3DMHA 4IXDA 2WTUA 1TMGE 3QU9A 1NM5C 1UJBA 2DBYA 2IITA 1NSYA 5FBZA 1KJQA 4NMMA 5E2IA 3EEYA 3AVYA 5E4TA 3M4YA 3KUKA 1WQ3A 1N9GA 3PD1A 1D6MA 2MT9A 3HCCA 1G21B 4G5XA 4HH3C 4OLJA 4HXGA 2V0NA 5H80A 1XTQA 3DF9A 2WV7A 4ZOQI 3GRCA 4IDBA 2B1QA 3EVBA 3OU7A 3DE2X 4KITB 3EA4A 1G38A 3MLEA 2HBRA 3FRJA 1DBIA 3PC8A 1B14A 2NZJA 2O2SA 3FDXA 3CW9A 3LHIA 1MA0A 2P9ZA 2MSEB 3C7CB 4ZEWA 4JVOA 5I9LA 8MHTA 3NWBA 3VPSA 1Z12A 3VJLA 3X1JA 2XRFA 3BRWD 3DBHA 4JR1A 5CD1A 2VHXA 3RYCA 4DIFA 1FDRA 1UJ5A 1FFCA 3G3EA 1A1SA 3D6VA 3O03A 5BR4A 3M2PA 2D6FA 1K4KA 1SOUA 1FXUA 5JAMA 5GIPE 1FYDA 4HXFB 2ENWA 2HJWA 4R6WA 3MMXA 4ERXA 2JJ1A 5J4VA 1OBHA 3LFUA 5DIFA 2I9PA 5JPDA 3IPYA 4URXR 1VRWA 3OIVA 4PZPA 3EZGA 4LJ7A 1EK5A 3D1LA 1PQUA 1T5BA 1M54A 5ALMA 3N87A 4L6IA 3RUEA 1J90A 5B4TA 1FFXB 3ZVLA 3FFTA 3LGSA 3WXBA 1I13A 1T4CA 4DLUA 2XKKA 1USUA 2HADA 2YJ4A 5BSRA 2DMRA 2BCGY 1VCNA 1X39A 2FPPB 1RYHA 3FOAA 1R0WA 1V16A 3PS9A 4FZ5A 4MCJA 1EP1B 1OAOC 4WFQA 3IXQA 3LUAA 4JAVC 3ISVA 3OQIB 5DW0A 3GW8A 3E03A 1JJVA 1XALA 2FJPA 3WLFA 3SXJA 2PRKA 5F7OA 3QU7A 2IY7A 3LTNC 3R5FA 3VPXA 3F6RA 4XIGS 1OI4A 5C1OA 4JKYA 2Z2YA 3SJBA 1JUDA 3OI7A 3SNHA 2VA9A 4YAIA 4G0VA 1N9GB 2V7WA 3EPHA 2FZEA 1V4NA 2LZ0A 1LPAB 1PWXA 2FU5C 4NH0A 5IMSA 5IH3A 3K0FA 2BGRA 4UVIA 2ZJZA 2CMHA 1U3TA 3V7WA 2QU7A 2W2TA 3WIBA 2Q5LA 3C16C 3MTGA 3HL0A 4TRMA 5FYDA 4BBZA 4TTAA 1U6IA 5JVDA 1DB3A 3W1EA 2JLZA 5EEHA 1U9YA 4CKZA 2PJZA 4ETWA 4KIGA 1H42A 1THMA 3PX2A 5IK2D 3RYCB 4BKQA 1FDVA 3OO0A 4WVLA 2W90A 4DLRA 2KYRA 3QA3E 3AI1A 4XDZA 4C5BA 1XA3A 3AINA 4MQMA 5HMMA 3K8YA 1XMXA 5JMPA 3KIPA 4DA0A 2X5JO 4C43A 5CB0A 1T6YA 1JSRA 1DLIA 4HAUA 4I5IA 2ZAGA 4TYPA 5D51S 2VC2B 3N6RA 1CEQA 4Z99A 1SQSA 2ONZA 2OMKA 4TXNA 1QCDA 1WF6A 3CZRA 1N92A 3GZ4A 3L18A 1DNPA 2Z5FA 3VC2A 4WBNA 3B6EA 1CRZA 4J91A 2OBNA 5AD1A 3ZWCA 2FSHA 1VLZA 5E0KB 4UCWA 1GQYA 1GGVA 4FNGA 3VOTA 2ZXEA 3ECSA 3HDJA 1KH1A 1CUCA 3MTQA 4DR1B 2A0KA 5FAKA 4I14A 1T4CB 1W0KD 3CUEF 4N18A 5C7YA 4PS0A 5IXYA 2QZPA 4LJAA 1DJMA 4ENRA 2VQDA 1S4MA 3KQHA 3ZCVA 1VKRA 2X2EA 5C5DA 1V5GA 4DVJA 5H9WA 4RORA 5ADUS 2G4LA 2XZDA 4B9EA 2IOYA 4JI2B 2X9GA 3SQNA 2PKEA 4QBIA 1X9GA 3BJIC 4JYAB 1BXZA 1LB1B 3MD9A 3ADBA 2J48A 3CXRA 4DNFA 3LA6A 4CZ2A 4NU5A 4EEKA 2WDZA 3K0FB 3OA2A 3SYKA 4X62B 1R16A 4MHTA 4D96A 3IB3A 4GKKB 3IULA 2RK3A 4IL5A 2COEA 4PIMA 3GJYA 4FZVA 2BOVA 4QULA 5LDGA 2ZZNA 2IYQA 2QAJA 3AF5A 3DCJA 3P9PA 4JJZA 5FOWA 5JVDB 3T3OA 2PVCA 2BBWA 4NZ9A 1F8YA 1OI7A 5T4EA 1OBFO 2CNOA 2BMJA 2A4MA 1VCIA 3MWYW 4QA9A 2RI1A 4BE9A 2ONYA 1J9ZA 3FNFA 1Q7BA 4TL9A 4HUTA 3GZNA 2WNHA 2GDJA 1A9TA 1E98A 2VPIA 4LDZA 4LF7B 4IHQA 3CRRA 3KPVA 3WKBA 3ZW8A 4E2YA 1PJRA 3EIXA 1K6IA 1T34A 4I4IA 5LYYA 2O8FA 5IT0A 4NBRA 1MABA 1RLTA 1IN5A 1UZNA 5G4KA 4E5DA 2BBTA 1KMIY 4JQZA 3KOXA 3VNSA 4B31A 2QUIA 1NQTA 1MORA 1HQYE 1ZLYA 1VL1A 3DF7A 3NETA 3V34A 5MGNA 1JKIA 2CXXA 2D2IA 4FQ7A 2OC4A 4P36A 3ILYA 5CCDA 4YRMA 1BX3A 2BUBA 1JIQA 4MJLA 1Z6XA 2HCBA 2FK8A 1L7VC 1Y3IA 2RHCA 5CT6A 3I9OA 2P5UA 2HLHA 4QDUA 1P4GA 1H9BA 2ZPAA 3S2YA 5AXAA 2XOKD 4PV7A 3CRQA 4MTLA 1TTHA 2OBLA 1MTOA 5SY4A 2XUIA 3WLLA 1CK4A 3JRNA 4Z0HO 3FLEA 4YV7A 3L5OA 4FKMA 3OWHA 3A4MA 3V8RA 1D6JA 1W96A 3EK2A 4ND8B 1KE1A 1QIIA 3AILA 3PNVA 4K26A 4TKVA 2A1IA 2Z1MA 3ZK9A 4DWOA 1ST3A 2J5BA 2LCFA 4QX6A 1E59A 1SHTX 4JN6B 5DGDA 3NV7A 1VE5A 1ZL2A 1NBMD 3MUFA 2ZW9A 1NZJA 4MKXA 3QWIA 1OGYA 1AQJA 2C5EA 4TUYA 4CUJA 2BH9A 4IIDA 3OZCA 4RF4A 4FPXA 1QTQA 1PGNA 2C4HA 4DIMA 1NKVA 3ER6A 3GLUA 2P1DA 5AOVA 3WBJA 1IM2A 4LPSA 3W2TA 5BW5A 5E6UB 1ZXBA 4O29A 3WQBA 1AXEA 1FMJA 1C1HA 3O8QA 2WTMA 5LLDA 3EIUA 4RPIA 1Z2PX 3ZE0B 2ZTVA 4GI2A 2J85A 2FWPA 2X4LA 4FDLA 1EK6A 3L1JA 3VZPA 4PLTA 1ZI9A 2D8MA 3UJ9A 2WF6A 2DETA 3B53X 3MJHA 3BH6A 3GZNB 4JXZA 3E22A 1DWQA 2AOXA 1TKAA 3KVVA 2NADA 3L7JA 2LIVA 2MSNA 4OB6A 1JPNA 4QFMA 5EKUA 4YR7A 2FR8A 2IHNA 2O8FB 1G8AA 2W2VA 3LA8A 1MABB 4G6ZA 5G0TA 3RT1A 4BEJA 5G4KB 2JHGA 4GW3A 1OLXA 2RB4A 5CR9A 1VSUA 2H8KA 1C80A 1CP3A 2GFIA 2LD4A 2Z56A 4NCJA 4QU8A 1WZIA 2F59A 2BGWA 1D5CA 2MTBA 3FXAA 4C0AC 5LLSA 3Q3GE 2Z8YM 1Y1SA 2R79A 5L3RA 2C97A 2IUTA 1G3UA 2VNHA 1Y80A 3GFFA 4TXJA 4PSAA 3HVIA 5A4MS 2ZJ3A 1QLHA 1B0ZA 2WAXA 3K1ZA 4TKUB 5JY6A 3PC3A 1LQTA 5A5FA 4Q24A 5EE0A 1QQ7A 5F2OA 4NECA 1P1RA 2GBGA 1DC6A 3AHCA 3S4YA 3N5KA 1FDTA 3FDFA 4JP2A 4PVDA 4A91A 1DTEA 3FIUA 3D6JA 4G65A 3FTQA 2V4MA 4G8BA 2PGLA 2ZPUA 1G18A 2OBFA 2BJVA 2O1XA 3N2YA 4IS2A 4BB0A 1UPFA 1RHKA 2J7PA 4ZRNA 4NBWA 4ZYYA 1I14A 2ZB8A 4CGZA 1K7YA 2ZI9A 4RAOA 1W581 2IU6A 3OCZA 4M22A 1JG4A 3U4GA 4LPKA 1O03A 4D3ZA 1C1DA 1IWBB 1G4UR 1V2GA 3MJTA 3QVMA 2NSHA 4TUYB 4YRQA 3BL8A 4V0NA 3WISA 5JNTA 4GM1A 1NV9A 1OAKA 5FBKA 4RMNA 2C0PA 1U3DA 2H00A 2PX5A 5KUTA 5JAIA 1X70A 1EUDA 3FJYA 4HRXA 4YBZA 5F1PA 3JAMA 2FY8A 1QH1A 4MW0A 4FJ1A 1KOLA 3O8QB 5FBHA 3NVDA 2QROA 2X41A 4RGVA 2MYUA 4DUGA 4XB6B 5HIIA 3QXXA 3MOGA 5JH7F 4G1UC 2Q50A 4AKTA 5B12A 3JQFA 3E22B 2E6KA 3B82A 1B74A 3FIJA 3CZ9A 2GPNA 4BX9A 5LYJB 1OBOA 2HEGA 4UUBA 4CFZA 1CZHA 2OHXA 4XB1A 3ROEA 2V9CA 3IDOA 4TM8A 1HDEA 4GVXA 1D1TA 1OLXB 4NYJQ 4D9JA 2NZ2A 4HC4A 3PKJA 2A1TS 5DBIA 4MVWA 4MPPA 3UK2A 3PR3A 4K03A 1PIWA 1U8ZA 2EFGA 5AW0A 2AL7A 5F2NA 1YASA 2DLNA 2HU7A 4CM5A 1VHLA 1MRSA 4QTYA 1Z0UA 5BSEA 1IWOA 2ZS9A 5AMXA 5EJ9A 5LQMA 4M3NA 1XEXA 3SR4A 1EFTA 4WFJA 2N42A 2VDRB 1PZGA 1RYZA 4WXHA 5EXDA 4C0KA 5HQ3A 2BLNA 2FCRA 3Q7QA 5IYZA 1JDBC 4GPTA 1TK9A 5EVCA 1HZJA 1PG5A 3ZE6A 3K30A 1ODKA 3R3XA 4MW5A 4TTPA 1QFJA 1V5WA 4IJQA 3NIGB 1TYAE 4LGMA 3DDSA 5KU1A 2ZVPX 2G9ZA 3HBAA 1JF8A 4NNOA 4R2KA 4C5AA 3JZAA 2Q8PA 1NY5A 2PS9A 3M49A 4YT5A 1N0VC 4FOTA 4H6XA 3VR6H 4CI9A 1CU1A 1JLKA 4XJSA 1JFSA 3AF4A 1DL5A 2BMWA 3MC1A 3WB9A 1NW5A 2JGNA 3WLOA 3H8SA 1C1DB 3ED5A 1WDMA 1GZ6A 3TFQA 2Q3JA 3AQ4A 1WQ4A 2UZ3A 1JTFA 3AVXA 5CEEA 1IZ9A 1W19A 1JDZA 3BEDA 3EEQA 2HJRA 1UDWA 4ZCIA 3JQDA 1H22A 3C1OA 3TIFA 3WRVA 2NUAA 1PSWA 4BJHB 1QH1B 1Q16A 1HLGA 2MR5A 2X9NA 3GY0A 4WIAA 4AD8A 1ABBA 1G7TA 4OHFA 4RLFA 1V5FA 3Q2OA 2D5BA 4Y7DA 1OYOA 3R5KA 3P5SA 3MYRA 3TL2A 4HX9A 4J1NA 2O6LA 2ZGVA 4F3NA 3ZJTA 4UBMA 5E4JA 1IE3A 4R69A 3S28A 1FNNA 1C9KA 2QR2A 4TMKA 3RYTC 4CG0A 3CRMA 2OVBA 3LUCA 3IDAA 3K8OE 2R11A 3QITA 3ORSA 3SXUA 4V0RA 2DPMA 3FI9A 3QVGA 3HDVA 2C61A 4AF8A 2Y0BA 1R0XA 4LBYA 4X6LA 4BQOA 5IBCA 1P3DA 2W8ZA 4BQEA 4WXRA 1XVIA 2YWBA 3GDWA 2N75A 1ODTC 1QDLB 4FR5A 4Y9SA 5KTKA 1XEXB 3WWPA 4MQEB 1WS6A 2H3EA 3HZRA 4FCCA 1LF0A 4YHBA 4ALLA 1USKA 1JDUA 1DUSA 1SH7A 2R751 3JU3A 4G1VA 1KH3A 1DZ3A 3ZHZA 5B64A 4H6PA 4C6TA 1HG1A 1SUCA 3K4HA 1ECJA 4IJMA 1FLDA 4IIJA 4NCNA 3MEQA 2C4MA 2WTNA 3E35A 3HSKA 4WZBA 5AHXA 5AKLA 4GYWA 2JAOA 1CJMA 1Z0SA 1SIBE 3LWBA 4Q1VA 4EA6A 5KNDD 1IJBA 2VNAA 2ZRMA 2QL9A 3K70D 5E7JA 1P60A 2C96A 1II8A 1YDEA 2XHZA 2ZI3A 4I4NA 1NVAA 1RZUA 5DIZA 2XRZA 1R64A 1SRQA 1DBQA 1F6WA 2ZBGA 4UD2A 4LEIA 1T3SA 1E2HA 1EYZA 2FW1A 1FS6A 5C8DA 3W5JA 3EC1A 4N3BA 4OLBA 2GWRA 3IP8A 4MV5A 2JJ2A 4C1NA 2P5SA 3L01A 4Q1EA 2R6HA 4TMWA 3SS8A 4Y8VA 4LF6B 4C2BA 4JP3A 4PO8A 2NUAB 4DRXB 5ALLA 1SXGA 2B20A 2C2HA 2JLVA 1RPJA 4URUR 5C18A 3KP1A 1NATA 5B1HA 4KR9A 3T5AA 5H1YA 1U0EA 5E1OA 1UANA 4KYIB 1GG5A 2WKRA 1GKYA 2C2YA 4G89A 2IZ6A 2VHTA 2QN6A 4P3YA 5EMKA 3VYWA 3ZWXA 4HATA 2HHJA 5ADVA 4L0DA 2IS2A 3WGIA 5BN1A 2C4UA 1WLYA 1AKYA 1Z18A 3TPFA 3C3CA 3SXUB 4PX9A 4FCWA 2NVUA 5L3VA 2ZTLA 2IDJA 3QVGB 1SOVA 4N65A 3PSHA 4GI7A 2IV3A 3THRA 4B6GA 821PA 1GPWB 1YQUA 1XZAA 1IUKA 2EAUA 3M5DA 3LX4A 4HEA6 3JSXA 3SZLA 3BWEA 3T35A 4ON9A 3T7AA 1QAQA 4KUEA 4MRAA 5MFPA 1IXYA 1FP2A 3DGEC 4FOSA 2FEWB 3U6KA 1N5OX 3Q87B 5JO0A 4RD2A 1L8XA 2PAFA 1I3KA 1X9IA 2GPAA 4CIBA 1CUEA 3DQZA 2J0UA 2QJTA 3QHAA 4JGBA 4BV8A 3L7OA 2G6TA 2VRCA 3JD0A 1RC8A 1J42A 2B6HA 1YDGA 3H17A 1U2GC 4QFDA 3IVGA 2GX6A 3W5SA 2HRQA 3IPAA 5K7SA 4IIJB 3MIZA 1XRLA 4U63A 5K20A 5A05A 2EQ5A 2FRDC 4WZBB 5FNZA 1QJ4A 2GI4A 1MA3A 1PZHA 2JFQA 2C0CA 4QQKA 3SC3A 1EUCA 4B3SB 1OFIA 1II8B 2PANA 1JDVA 3M3HA 2WIKA 4ZP1A 5EHZA 3RIEA 3EQZA 5JAUA 3K70C 3RYIA 4OIMA 4QQNA 1Z37A 1RACA 4KB5A 3W8FA 2XSZA 3S2ZA 3BGWA 2ILVA 2C0QA 4JL5A 1TM5E 3ES9A 4QUDA 3T4PA 3IQIX 4P7KA 4LY3A 3KTOA 3PEUA 5BYJA 1SN7A 1SIWA 3WGZA 1PTJC 3P2JA 5IJZA 2TMKA 2CSXA 2BP7A 5EGSA 5IWCA 1Y98A 5K0LA 4BLOA 2PR7A 3V7UA 2I2BA 1N0IA 5AKKA 5A71A 4DXHA 2JIZD 1H6AA 2PL3A 2UKDA 1DIGA 3OJFA 1Y8RA 2E82A 3GPLA 2BY4A 2LKDA 2R4TA 3QLEA 2P4QA 4UBLA 4ALKA 3TLYA 3QTTA 1MDFA 1CUIA 2GOYA 3PWSA 1XYYA 4WT7A 1JEEA 3FMIA 4IEIA 4D41A 1X1CA 4V0ME 4XM2A 1GR0A 1P80A 4OD0A 2J3QA 5I51A 1R3DA 2GN8A 3KQTA 4FGWA 1WAMA 2NVUB 2Y0DA 1FBNA 3GNTA 4M9QA 3BQMB 521PA 3PA8A 4BNTA 1YONA 2PXCA 2O2IA 3UMMA 5GPBA 4AKSA 3R7FA 2R6GA 4WQMA 2VT2A 5LBUA 5IJ0A 2MU1A 5CUQA 2IZ5A 2QNRA 3H4TA 3Q3VA 2QM0A 1UQTA 4D98A 2UXDB 3WIUA 1X2BA 5FFNA 1BS1A 2C57A 2O2GA 4QWWA 2VWQA 1T4MA 5EP2A 3CFYA 2HTEA 4ZJUA 2EWVA 2J0UB 3AH8A 1DFHA 4Y9UA 5AT1A 2PD4A 5M3BA 5KC9A 2HX1A 1WKVA 4I4CA 1IHXA 3CT4A 1JL3A 3MWEA 3F9RA 1PGOA 3AONB 3DYBA 2EU8A 2WK1A 5B58C 3O2QB 4X9XA 2D2XA 3QMPA 4ARIA 1HQCA 4OAOA 4AJNA 1LTQA 3GC6A 5CDSA 2JFUA 2OGSA 2V96A 1S0UA 3F2IA 2Q1YA 2XTNA 1JHAA 1SHJA 1E9SA 3EEFA 1JFFA 3V55A 2GD6A 4AX8A 4OQNA 1P2VA 3II6X 4IVPA 4M55A 4E7PA 3OQPA 1O77A 3AJ8A 1GRQA 1Z08A 3FR8A 2NIPA 3QFCA 2HJ9A 4GECA 4HP8A 4OHBA 2FWRA 3E23A 4ZEOA 4YDHB 1O5TA 1IBRA 3RYIB 2XCRB 3IXMA 2OZVA 1ONPA 4AS3A 4KXWA 3TNFA 5ISMA 4NBUA 5IANA 1ZCZA 5C2JB 2JIMA 1VL0A 4FMCB 3HUEA 4LHXA 5FA8A 3PQ4A 4RH3A 3AOGA 4IUBS 2HF9A 5A7HA 4IQGA 1KS2A 1L4HA 2XKAA 3OPMA 4S05A 4LNUA 2FYTA 1DAPA 1LZLA 3DNPA 1IULA 2BP7B 2CXTA 4XUEA 1L5QA 3FCYA 3PTLA 1E4OA 1V7QA 1G64A 3PPYA 4EJMA 2GBLA 3JPYA 3GVXA 4RIGA 4RVFA 4I1RA 2W9XA 2A9JA 2X42A 1H9CA 2AZMA 1Y8RB 1YE3A 3B3GA 3CX7A 4C0SA 1EFVA 1XZJA 2X1LA 2XMPA 3W5CA 3ILSA 3I2JA 4TSRA 1CJVC 5AJYA 7GPBA 2FPMA 4LS3A 4A0HA 4U7WA 4BECA 3ZWQA 1IBSA 4P58A 4P31A 2NOAA 3AIIA 5AHOA 3GHYA 4ZYWA 3TZQA 1X3LA 1PT5A 1ZO8A 2D59A 3GCWA 3O1LA 3UNXA 4NICA 4D9HA 5G2OA 1E2FA 1CHNA 5H02A 4B17A 3WLQA 3HN7A 4E4RA 1W34A 4Z4GA 3VRHA 1RHMA 1AXRA 2FW8A 3I8SA 1JBEA 1UJNA 4K6FA 3PDHA 3VVLA 1XPRA 1CSEE 2L0XA 1AURA 5EP1A 2AHOA 1GA6A 2QD5A 2G1KA 4RFSA 3CURA 3E5NA 2D2FA 4GX5A 5K6AC 4PS1A 4B3RB 4RJKA 4JOCA 5LD2B 4Q4AA 2F17A 1LDBA 4XQGA 1JFFB 1P1HA 3C45A 2CLSA 1IZ8A 3FFAA 2YBDA 2XQIA 4K0KB 2E89A 3ISJA 4Q19A 2H0QA 4TT3A 4EJ0A 3EIFA 5JZ9A 1KSHA 4P83A 5JWRA 1X0VA 1WKBA 4U02A 4E32A 3FNRA 2J46A 4HQNA 4RD4A 3R0JA 4LCJA 3H2JA 1NMEA 1QIGA 1QONA 3ELWA 3F7NA 1B6GA 1C3LA 4KRFA 2R7LA 4LNUB 1JIUA 2Q4BA 4KWCA 4L5YA 2OYCA 4B3CA 1F8GA 3N76A 3BX1A 1NUSA 2C7BA 4PYNA 4U9HS 1XXLA 4DV5B 4YRDA 1KBOA 1PLJA 2J67A 1VI5A 4CTMA 3HCRA 1FNDA 3BWVA 1T3ZA 4V03A 5J1SB 3GEIA 2IYOA 1Q7CA 1W4LA 1IAQA 3JQ9A 4ZALA 1PFQA 5JY1A 2G71A 3PDUA 3GNQA 4ZVOA 5IJXA 2VR1A 4DIOA 1AGPA 1YTUA 3CTPA 2HGZA 2ZIEA 1FYVA 4IPTA 4QYMA 5D3QA 1ZIXA 2H0RA 1QV9A 4IWYA 3RTDA 2EFEB 3IT2A 4MEBA 4I08A 4KFSA 4CR7A 1GUAA 1DRWA 1U0SY 1XK6A 4ES6A 4KX5A 3ER9A 3NLLA 3AEYA 3WK4A 2JGKA 5KDDA 1IBLB 3NT2A 4J4TA 3GUZA 3G82C 3OPYA 5TSDA 5DCLA 1HH4A 3KVOA 2R0QC 3ABZA 4JSTA 5CG2A 3C3KA 1SVMA 1ZJ6A 3EQ6A 3TEFA 4DHEA 3MHTA 1G8JA 1SNYA 1GPKA 2GUGA 1SIUA 4BQNA 2BR4A 4X92A 3ZUPA 4NXNB 4DSAA 3UENA 3ZWOA 3GFQA 4ZAXA 2V7UA 5A6SA 1L8OA 1R8XA 2ZVQX 3AF2A 3AHDA 3T9DA 1ZSVA 1EU1A 1RYMA 2O3RA 2YFHA 3G2LA 2G08A 4I5EA 1IBKB 2AMVA 2CCGA 2H9YA 2XNKA 4Q4AB 1FQKA 4QPJC 4QIHA 2EGUA 1E5TA 3QKIA 4K6OA 1Q0TA 2GVNA 2WVJA 4OFBA 4Q7MB 5CLQA 5GQSA 2QZSA 3UJ7A 4IFEA 1JEDA 3LG2A 3IBFA 1NTRA 4IMIB 3CNHA 4OFWA 1QMGA 4WE3A 1LLFA 5E9JA 4CG1A 5IC5A 5DF1A 2CLIB 5T64A 4NFLA 2WMOB 2KBFA 1FRNA 3DQPA 4AY4A 1E0SA 4CF6A 3C8MA 3CWCA 3SS7X 2H1HA 1OZ0A 2KLHA 3N05A 3AUSA 4IGFA 4XRRA 3GRYA 3VKFA 3VNUA 1SZDA 1TM1E 5ALFA 1HEYA 1DC7A 3AETA 5T6BA 3E27A 5LP1A 4KIFA 4NY1A 1RRMA 4R9SA 5THQA 3RU9A 1JR2A 2W5UA 4EKDA 2ZR7A 2W6QA 3HBJA 1BFKA 1HKUA 2DPGA 2JHPA 3PVCA 3DLTA 1PR4A 3CUVA 4YUVA 3LQYA 1K98A 5C32A 4MCIA 2DFVA 2DR3A 1WRBA 3JWJA 4KUGA 3E0QA 4C1BA 2DEUA 3MA0A 4IDCA 4Q21A 1NF9A 5EINA 4DDVA 2SKEA 4BFUA 1C8LA 3Q1LA 2PX4A 4BLVA 3FD8A 4UAGA 1QB8A 2ZYRA 3G9TA 1N0WA 1V1JA 2XNDA 3EHDA 4DV4B 4D8VA 1BMQA 1Q0RA 3B9RA 4FCTA 5DKFA 3ND8A 3OPYB 2O2JA 4WDQA 1C0IA 1MNQA 4ND3A 4KK3A 3CE6A 4MDFA 3QUAA 2EHDA 4HSEA 4RZQA 1FNCA 3TQOA 5K8VA 2JI7A 2FKAA 3R9WA 2FGKA 4YAEA 1MAUA 2D3WA 3V4LA 1KZYC 4D9KA 3N3BC 1LK5A 4LXIA 1V43A 1VJGA 4KGXA 4WKCA 5CNJA 3UV6A 4HLCA 2LPMA 3UAWA 1SQGA 2E4ZA 5A6SB 1FFDA 2RHOA 1JV2B 4M0CA 2BM8A 4OHVA 4IHAA 1ESCA 2VJDA 4TSFA 1KDOA 4MB6A 1YZUA 3BICA 2PL9A 3OIUA 4C9BA 2ZIAA 1H5QA 5AJTA 3L8ZA 2XBMA 5IDXA 2H1OA 2P69A 1KEUA 2FWJA 2IEGA 3A3KA 1R4AA 1WCV1 3V4PB 2PLWA 4C0WA 3U6BA 4CEJB 3EIOA 4KDRA 2B99A 2G1AA 3HYTA 1A4XA 1E3IA 1ARZA 1NUUA 1RJDA 3M34A 2D2EA 2O07A 2PCLA 4II7A 4IOKA 4XWAA 3UW3A 5BUQA 4CM9A 8ATCA 3SJZA 1ZZEA 4GYKA 2YYAA 2EG5A 2HUNA 5IXSA 1HE1C 1E1QA 1L5OA 2OGUA 3C15C 3DKVA 4D5EA 3T38A 1W25A 2ZU0C 4TVSA 3AETB 3EEIA 3FSJX 3IVMA 1E3LA 4LOLA 3OO1A 4BNGA 1TW2A 5ARBA 3KV3O 2C54A 4EITA 1LBQA 2QI9C 4DAOA 1OYYA 2DVMA 2O2XA 2WSSD 3N8IA 4LHSA 4KXVA 3HI4A 3WGOA 4AP9A 4DG5A 1X80A 3A58B 5BSTA 2JCBA 4KQCA 2R3SA 4W82A 1KP9A 1PS9A 3IAUA 4DRXA 4XCXA 2BDEA 2ODEA 4TLCA 3HEAA 2IYWA 4MS1A 3KL2A 2FPRA 1JAIA 1PYOA 4QXQA 5KTYA 4YMUA 1TUEA 2YYSA 1TQ6A 4IV5A 4Y2HA 4G26A 5BUSA 4NHEA 4KR7A 3C3PA 1I6MA 1C4OA 3R5HA 5I45A 4K9NA 3TJMA 1AS2A 1U7DA 1GL3A 1TCVA 3C3JA 4UM9D 3ONVA 4L7QA 3NTOA 2DPYA 2HA6A 2RH8A 3EXHC 3H5WA 3OUTA 1QP4A 5ECWA 3O0TA 4ZXFA 2RIPA 3GLGE 2CJFA 3FNBA 4WLNA 1TM2A 1TZBA 3PF8A 3VOSA 3TLGA 3EIEA 3ONEA 2HI0A 4DIBA 3O1IC 3DC7A 3P5BA 4Q9KA 1EP9A 2ZYWX 1PW5A 3AUTA 1NSFA 3KEOA 4LQDA 2VK8A 3W1VA 2C82A 2EWWA 2YICA 5AESA 1ETUA 4H17A 4BIMA 2JGLA 1H2YA 2PLAA 1NYLA 1CQIA 3DP7A 1ENPA 1I4LD 4PR3A 1NOIA 2R48A 2Q6TA 3ZJYA 4CMAA 4OQYA 4B83A 1GQSA 3KAKA 1G8MA 1QDEA 1SPXA 2HY7A 3M6IA 5GONF 1WABA 1TX4B 1U04A 3PYXA 4C3ZA 2E5FA 1VPEA 2W4IA 3NHPA 3AHGA 4UTVA 2NV2B 4ZVQA 1GUZA 1W30A 3UTCA 4DXAA 3QX3A 5THXA 1ZICA 3O47A 4UHFA 4XGNA 5AJZA 5TR9A 4DV6B 5HZHA 3B3JA 3C14C 3R6GA 3LRTA 1GRCA 1QO0D 4PG4A 4BNZA 3COWA 3H99A 3WNQA 3M6AA 3H2ZA 2FXVA 2XH8A 2LXNA 1KC3A 1EFCA 1F60A 2Y66A 4N3NA 3JQBA 2XLBA 1CNEA 3PNSA 1G21E 1QHYA 4PG7A 3QX7A 3UJNA 5AW7A 3KXKA 4CCSA 2O8NA 4O4IF 1X80B 4OYRA 2I2WA 4ZJZA 1MG5A 2MWMA 3CT6A 3L82B 3N86A 2PY6A 3TEMA 4G97A 3K4QA 1LK0A 4MS1B 1WMDA 2VDLB 3L8CA 4EW6A 1E58A 2C3YA 2VYVA 4F4CA 5JHHB 3IKJA 3OF5A 4KO1S 2F3PA 5AO9A 1Z63A 4IJ6A 1D0IA 4XVRA 1RKVA 1JT9A 3IDZA 1ODSA 5TS3A 3COVA 3IIKA 4OHPA 3RVNA 5JS8A 2JPDA 3H13A 4DCNA 4NU8X 1T36A 1EK0A 1TKRA 1VZ2A 4E12A 2E5WA 1NT2A 3U3RA 1DV2A 2ZE8A 3PUHA 4UJ3A 1GPLA 4ZGBA 3RJTA 3V3TA 4F92B 1BDHA 2Y67A 4Y2UA 3INYA 4QQRA 3WRYA 4C7BA 1JWLA 4C7OA 1Z5PA 1P1JA 1TTPB 4L3VA 2ZSKA 2HMWA 3GT0A 4IJUA 4M21A 1JDPA 1R5OA 4ND1A 2IH5A 1NULA 1USGA 1WHSA 1FOEB 1XROA 4KBGA 3NHSA 3WP1B 3S0JA 3ZWBA 3WQQA 4M1SA 2VQFB 1CQIB 1K2WA 4GFDA 1M8FA 3RV3A 2QYTA 4EG5A 4URWR 5ALJA 5B2FA 2M9MA 3A3NA 9ATCA 5C35A 1NIPA 3CM0A 5TRTA 1JFTA 5BYAA 1Z2DA 2F43A 4XX1A 3W34A 5CFRA 1U8YA 3B5IA 4MV0A 3TR5A 1L5VA 4L9WA 1XQ9A 3DV0A 4BN4A 3KOUA 3AKCA 3JVVA 4LZOA 3K6RA 2VJKA 4MV9A 2DAPA 1PYGA 1UWLA 1YS9A 2PRZA 3G89A 4RJLA 1AKRA 3WTBA 1SBNE 4ZAFA 4XWOA 3HTXA 1KHTA 3GLQA 3TMKA 3RTBA 4BQIA 1Y82A 4ITRC 1QYCA 1ZISA 3PFGA 5I6DA 1AA9A 4RPHA 3SX4A 1RHJA 3OZDA 3DWIA 1NVDA 1QHFA 2YY6A 3GLVA 4NIMA 4B3JA 4EEZA 4AQ7A 2Z04A 4C30A 4BBPA 1O97D 3WC4A 4BCCA 4NV1A 4LZWA 3OCUA 1GSAA 2NACA 4G9EA 3V8QA 4CDRA 4KIUA 3KVRA 3S5JA 3KTFA 3ITNA 3K9GA 1ZLXA 2QZZA 3BZWA 3TSCA 3LY9A 5JISA 3OZSA 3A1CA 4IUCS 1UOPA 1YZKA 2P3LA 3PLRA 4J7CA 3I72A 2QE7A 1ONOA 3KOMA 4RHTA 4FM9A 3RKSA 5HUJA 2QQGA 5P8WA 4L78A 3AXSA 1KY5A 2PRYA 4N82A 5EUBA 4Z3DA 1KMHA 1X7DA 1Q14A 3AL3A 5G02A 2R65A 5FD8A 4CCWA 1OXTA 1H2BA 1XN1A 5GP1A 1SUPA 3SLRA 2NVOA 1LI7A 3FM9A 2W6ID 4NYMR 4QOGA 4OHCA 1R0SA 1U9JA 5E4FA 3VR6A 1WX1A 2G5CA