4QO7A

Lactate dehydrogenase a in complex with substituted 3-hydroxy-2-mercaptocyclohex-2-enone compound 7
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qo7A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qo7A02
2VHYA 2JCXA 3F1KA 2EKQA 1VPDA 5DBFA 1B8UA 1UZNA 1NFFA 3CMCO 3W8DA 1SO8A 1JKFA 2UVDA 3GZ4A 3AK4A 4C7KA 2HO5A 4DIBA 1U7TA 3WS7A 1M6WA 4RVSA 1NQAO 3RROA 1LQUA 1LC3A 4EDFA 5EQDA 1VM6A 4BO9A 3L6DA 5ICMA 4B7XA 1YL5A 1J5PA 4BKUA 4MINA 1K6IA 4BNKA 3DZFA 2AE2A 3RSHA 2VWPA 4JIGA 4PRLA 3C7CB 3F5QA 2QZ9A 2HJSA 4NBWA 2J3HA 1ZIDA 2W2KA 1R15A 3ASVA 4RF3A 1DO8A 1LA2A 2HMTA 2HDHA 4XX0A 3VVBA 3OETA 3EGOA 1PS0A 3NGXA 1I24A 2VUSA 5C3MA 4RVUA 2YFHA 1Q1NA 1YDWA 3DO5A 5KVQA 1KVRA 1BG6A 3K2BA 2PKQP 3A14A 1ZEMA 1D1SA 1UH5A 2GDZA 1HLDA 1PL8A 1U5AA 3O4RA 4J7XA 4RLSA 3FBTA 3L0DA 3U3XA 1XU9A 4RPGA 4R1TA 2DFDA 3VZPA 3CPSA 4CMEA 5LC1A 2ZTVA 4K26A 2O48X 1GDHA 2V7PA 3CE6A 1XQ6A 2EG9A 2O3JA 3I5MA 3MJCA 3I52A 2CMDA 3GG2A 2V6BA 1B8VA 4R5MA 4ROSA 4OMUA 2I3GA 1E3IA 1I3NA 1H0KA 1E6EA 4J1QA 2Y0DA 3NTOA 3D3WB 3UW3A 2VHWA 1A72A 5A3JA 4A0SA 3OQ1A 3ZU5A 3ABIA 3WJ7A 3BIOA 3JQBC 1CIVA 1PL7A 4XQ9A 4YJFA 3ROKA 3B70A 3VPXA 3CZMA 1DLIA 2HMSA 4QO8A 4L73A 2O7QA 4GX5A 1Y8RB 1PGQA 2IYPA 3HDYA 1NQTA 4RDIA 4WEQA 1VJ0A 1MC5A 4ONEA 3EVTA 2ZYGA 5DZSA 5IXSA 1HDRA 2WMDA 4FFPA 3RCBA 1QG6A 2Y1FA 1DXYA 2BELA 2JJYA 3DEYX 1PJTA 3GOHA 1U4OA 3HNPA 4E4YA 1OBFO 4UUPA 3DZBA 2XOXA 4B7CA 1DC5A 1IUKA 2Q4EA 1H9AA 1ML3A 4UVDA 1OFGA 6LDHA 4B4WA 2EIHA 3LSYA 4OOFA 1K2WA 1MG5A 1A5ZA 1XHLA 3GF4A 2BI7A 2ZB8A 3STHA 4DRYA 3UGKA 5L40A 3VVCA 4IQ8A 4TRRA 2BGKA 3IJPA 3MTGA 4NJMA 2CD9A 2NQ8A 4BKRA 4YCAA 4ZQHA 1CWUA 3PQDA 3PWKA 5AXAA 1R4MB 4XGKA 1I36A 4LCJA 3SC6A 3K9QO 3QVTA 1G6KA 3I3OA 1K3TA 4CLXA 1EEHA 1GADO 4FGSA 4BNUA 3PYLA 3ZH2A 3W6ZA 2W8ZA 1ZK3A 1OC2A 4M8SA 4MDHA 3ZV4A 1MB4A 3A28A 3RKRA 3PWSA 4L0QA 4TSKA 3NT2A 5F1OA 5C37A 4YR9A 1ID1A 4NFHA 4MKZA 3ZW9A 5HS4A 1BRMA 1QYCA 3PK0A 3LC7O 3OFSA 4BKPA 4FN4A 5I7EA 4IJUA 3TPCA 3ZI0A 1XCBA 1SB8A 1NPTO 1LLQA 2G82A 3DFZA 3D5QA 3VH1A 1ONOA 4CM9D 4E21A 2HU2A 4NJOA 1PR3A 3DOJA 4JJIA 3HE3A 3PFFA 4PLCA 2EEZA 1JKJA 2V6MA 3KYDA 3LF2A 2X86A 3WOHA 4RDHA 2X22A 1J49A 3ITKA 4IXWA 1EUDA 1U8XX 1W4ZA 3FRJA 4BVAA 1PEDA 1T26A 1SC6A 3K6JA 4PZCA 5DBIA 3JD4A 3ZZNA 2WYWA 3FN4A 4TVOA 4YAGA 1U9JA 2HMUA 3JQFA 4G2NA 4DIFA 1O9BA 1HWYA 1H2BA 2V6GA 3ICCA 1U3WA 4I5DA 1Q0LA 5U4QA 1ZK4A 1GZ4A 1P1IA 3IDSA 4XEHA 1UXKA 1A4IA 1DBVO 4BQRA 4FFRA 3RU7A 4CMAA 3RUDA 1E7YA 5JW6A 3JQCA 2WE7A 4KTTE 1SBYA 2GSDA 3HDHA 4PFJA 4M89A 2P2SA 1U1IA 4R4JA 2J3JA 1F8FA 4ID9A 4MVJA 4MP6A 3DBLA 4PIVA 1XSEA 3EHEA 2GD1O 1DRVA 2OMEA 2UAGA 3KRTA 4F46A 2PGDA 4TZKA 4ZN6A 1WW8A 3QW2A 3PLRA 1E77A 4TKLA 2NM0A 4CM3A 2NLOA 4U8GA 4CMKA 3N58A 3UKOA 1PWZA 4J0EA 4II3A 4NR0A 4OHUA 4P4LA 4D41A 1NR1A 1NR7A 1X15A 4CLOA 3PRJA 3IP1A 2I6TA 3TZQA 1LDEA 1V6AA 2NU6A 4OAQA 3S2GA 2DVMA 5U9CA 1XDWA 3I9KA 5KJEA 1Y1PA 3JQAB 4NBTA 1S6YA 1O0SA 1P1KA 2IRWA 1U8FO 1TA4A 5MGBA 3TNLA 4L4SA 4FFNA 4HWKA 3MWDB 4UUMA 3G49A 2D5AA 1MP0A 5AXCA 4E31A 4D79A 5AQ1A 1YB4A 3K30A 5EL0A 2JCYA 4EBFA 5L4LA 4WUVA 1IZ0A 1DDOA 4HUJA 5ILGA 4KWHA 4J4BA 3JQ9A 5A03A 3Q11A 4NBUA 4DXHA 4E5MA 3VDQA 1FDWA 3FNHA 2SCUA 1GQQA 3KXDA 4AJIA 3K2EA 2PK3A 3KB6A 3UH1A 1MG0A 5C7OO 5JC8A 1ISGA 3EW7A 4M87A 3S8MA 4Y67A 4R3NA 3CMMA 1YXMA 3ZDFA 3GA0A 3V1TC 4GGPA 4XYMA 4CM8A 1WDKA 4YAJA 2NVUA 2Q50A 1D7OA 4R1UA 3DZHA 4UVEA 1BDBA 3GNSA 3UVEA 3WDSA 5TNXA 3INRA 4Y6SA 2YYYA 4YQZA 5JSFA 4CUKA 4ZHSA 1SMKA 4PN3A 3C7DB 2FSSA 1BGVA 3D4NA 4IIVA 4BHTA 2Y67A 3DBRB 1DIHA 2J5RA 1Z7BA 3DBHA 3MEQA 1QYDA 1UXJA 2J8ZA 3OECA 2I76A 3CSDA 4QQRA 4PLPA 5A5EA 3BMOA 4NDNE 1X7GA 2ILTA 2NTJA 4MP8A 1ZJZA 2IYOA 3FPCA 4CLDA 3DQPA 3PHIA 4ITUA 2X0JA 4MPDA 4Q3BA 1T2AA 4DPMA 3M1AA 4RPJA 3MZ0A 3WGOA 1DAPA 2Q3EA 4BNXA 2AG8A 1GY8A 1C0LA 3RC1A 2UV8A 3MOGA 3P5SA 3U0BA 2YHIB 3ANLA 3ROQA 1E7SA 3KSDO 4ND3A 2ZCUA 2C07A 1Y5RA 4O1MA 5I7VA 2RIRA 3H9EO 4B3HA 3CEAA 1I3MA 4KUGA 5HRUA 4DMMA 2JD0A 3DZGA 4ZRNA 4AJ1A 4WNIA 3PP8A 4BGEA 4JBGA 5K6AA 1HYHA 2EKPA 3JD3A 1N9GA 2C54A 2HQ1A 2WWRA 4BB6A 2FPIA 4OOEA 4WK6A 4DQUA 3BMCB 4RF2A 5JC1A 3DTTA 2ZTUA 4LVCA 1Z82A 2CVOA 3W1VA 1ORRA 1HDXA 5F1KA 3KYCA 4WCFB 4EUFA 4BGIA 4KMSA 3KLPX 2A9FA 4YJGB 2YW9A 3L4BC 3NYWA 3LC1O 1L7EA 3I9MA 1DEHA 2P9GA 2QRKA 2TMDA 4EJMA 4D43A 3VPFA 2YZ7A 5A4DA 1ISMA 3K92A 3WFIA 1YKFA 1GV0A 1TEHA 1A71A 3V1UA 2OO5A 2X5KO 3LF1A 1VJ1A 3WMXA 2I5PO 3U5TA 3QWBA 4R54A 1N7HA 4PLZA 4PLWA 2JCVA 5L7TA 1S7CA 3B1FA 3I1JA 4LK3A 4CMJA 4NK4A 3HN7A 4BQPA 1P9LA 3WGTA 5CDSA 1D1TA 1NWCA 4HNHA 4P38A 4BNTA 2VZ0A 2GN8A 3GVXA 4Q3EA 1DIRA 3D5TA 3QJ5A 4K1LA 3S55A 3E5RA 2CDBA 3HJAA 1IE3A 4GMGA 4WLVA 1DB3A 4BUCA 4GX0A 5GZ3A 4X54A 1GFSA 2WD7A 4CQLA 1V35A 2WYVA 3TF5A 2X5OA 2W4QA 5F3RA 4NBVA 1E3LA 4IJKA 3D0OA 2OP1A 4E2XA 1T2EA 5KOIA 1ENPA 4R51A 4IDDA 4IY1A 2YDXA 1U4SA 4KP7A 1KY5A 4NZ9A 4DA9A 4W6ZA 1DC3A 2X7HA 1XEAA 4E2YA 5IXYA 1H6AA 1GAEO 4MIEA 5GZ1A 5JAZA 1KBZA 3B20A 4IGFA 4FJ0A 3K96A 4Q39A 3PWZA 4PVDA 3ZWXA 4ZJUA 3WGIA 2B4RO 3AI2A 3R3SA 2Q1TA 4DLLA 1RM5A 1HEUA 2GR9A 4H15A 1SAYA 4ZICA 3ZWCA 1I8TA 1LSJA 3SLKA 5K9ZA 3ZWOA 3GHHA 3ITDA 2NSDA 3I6QA 3GEGA 3ETDA 1P1HA 2C59A 3BTOA 5CPFA 4DIOA 3H9JA 1C0KA 4PLHA 4AJ4A 4PG8A 3DOCA 1UZMA 3G79A 2DFVA 5A9SB 2FR8A 4HBGA 4RGBA 4D42A 2GZ2A 3SLGA 1UXHA 3NJ4A 2C0CA 3RJ5A 2TMGA 3AM4A 5DULA 3RUFA 3E9QA 4XB1A 2RHRA 3T7CA 2OFPA 3RUHA 4C7JA 5I9MA 4XYGA 1V9LA 2HMWA 4LVUA 3WBFA 1P77A 3S2IA 5T8KC 1LLDA 2D59A 3E03A 1YJQA 1KEUA 3WGHA 4P8RA 4XZ3A 1C1XA 4OXNA 4R5HA 1P74A 2GERA 2VYVD 2VRCD 1W8DA 2IEBA 3I9OA 5IZCC 1HXHA 2JFHA 1BVRA 4J7UA 1BW9A 3MTJA 4CV3A 3E48A 1I2CA 2AE1A 5FEUA 5DCUA 3KVOA 4MVJE 1ZZEA 1LSUA 1VC2A 3JYLA 5TSDA 4RJTA 1YO6A 2OBNA 2ZYDA 4CMIA 4A5OA 4CJXA 1VL0A 1P45A 1Y8QA 2P91A 4L76A 3GGPA 2WD8A 3TZCA 5AXDA 3FR7A 4CLEA 1PGNA 4OQYA 3PJFA 3JCZA 5ES3A 3T4EA 1NNUA 3E9NA 1YDEA 2HJRA 1VSUA 3WG9A 3ZHZA 4BNFA 1WP4A 5JXWA 3JQGB 3ONEA 4MIYA 3S2FA 1R12A 5ADHA 4B7UA 4UUOA 3WX0A 1WMBA 1CETA 4QECA 4ALIA 1QRRA 5G0WA 2OZPA 3BMQA 3ZGYA 1HDZA 2YQ4A 3PIIA 3GNQA 4MVJM 5HM8A 4H3VA 2R00C 1LDGA 1RM3A 2E4AA 2GZ1A 3DMYA 1Y6JA 3HFSA 1YQGA 3GMDA 4RV9A 4BMSA 4RPHA 3NDRA 5TJHA 5L7YA 2RAFA 3DONA 3OA0A 2H6EA 2BFMA 4RVHA 5CFZA 1P1FA 1KVSA 1U2DA 3GPIA 4GH5A 5G0SA 3JQ6A 1DFIA 1VL6A 4MVJP 4E2WA 5CEJA 1TT5B 5I8ZA 3DBLB 4IDFA 3ZNQA 4FJ1A 4G65A 1MA0A 3E1KA 3OIDA 3CIFA 4CR8A 4FC6A 4E12A 1LI4A 3SEFA 1PJLA 1YOVA 2OGUA 4AJJA 4BO0A 1JU9A 1IB6A 1PZHA 4Y8VA 3S1LA 4DBVO 3HSKA 4IM7A 2AQ8A 1TI7A 5JCXA 4A2CA 4F3YA 4FOOA 2VCYA 2W2LA 1Y7TA 2Q1SA 1GUFA 3E6AA 3ZHYA 2DM6A 3UF0A 4BO5A 2AEMA 4PZEA 2DLDA 1DJQA 2VUTA 3OICA 3QVXA 3LK7A 3ZV6A 4I8XA 5CDYA 3KHUA 4IS2A 3FSRA 2HK7A 2RBEA 5JDIA 2EW2A 2X8LA 4Z9YA 1E1MA 2P68A 2D1YA 1UR5A 4UEKA 1Z75A 3Q2IA 4L74A 3FHLA 4OH1A 1NHGA 4K6FA 4TMFA 4YT2A 1KVUA 5JMPA 3HDJA 5KKAA 3QV1A 1N1EA 3QVOA 5G4KB 4DL9A 4FQ8A 3RVDA 4BL5A 4YEDA 4OIMA 2Y68A 3KSZO 2VZ9A 4BNLA 3DHNA 1AXGA 3UHAA 1PJQA 1T1SA 2DC1A 3KBOA 4ND4A 2JL1A 1SEPA 4PG7A 2DAPA 1DRUA 3JQAD 1IULA 4WCFC 2P9EA 3TFOA 4OO3A 3L6EA 2BFAA 9LDBA 1N2SA 5F5LA 3JD2A 4K6CA 1T24A 2HLPA 4OKNA 3C85A 1DC4A 3DXFA 5ENVA 4CMEC 5JFOA 1WAMA 3OJLA 5JNLA 2DQ4A 3RFXA 1LUAA 5L3ZA 1YL7A 1NVTA 3GQVA 2NVUB 1FJHA 3Q0EA 4LMPA 4IPTA 5BNFA 2FZEA 2EF1A 4PZDA 4L4XA 4QO7A 2Y1OA 3Q3CA 4IXTA 4R16A 5ER6A 3WIDA 1A9ZA 5JY6A 1NQ5A 1G0OA 4MO2A 2VHZA 4NU5A 3VPGA 3WSVA 3I83A 4AG3A 2EKLA 2QG4A 4XDYA 4Q3NA 3IC5A 2A35A 1E92A 2VT3A 3H5RA 4YJHB 5MDHA 2O2SA 3OJFA 1KC3A 4LSWA 3UICA 1PS8A 1IPEA 1I33A 2X23A 2W90A 3RWBA 3W4IA 2RH4A 2ZTMA 1DFHA 1PS9A 5LDGA 3RC9A 2D2IA 5EERA 3IS3A 1ULSA 1LQTA 3KETA 1X13A 2P5UA 3OF2A 3B1JA 1GYPA 1EQ2A 3OJEA 1C14A 1U28A 2B69A 4Z0HO 3AUTA 1PL6A 1CYDA 3FF4A 2C20A 2IXAA 2Z1NA 3FTPA 4QX6A 4EUHA 5JCJD 1N9GB 3A06A 3PQEA 3GEDA 1HE3A 2PA3A 3ZNPA 5JYDA 3UCFA 5IDQA 5GZ6A 1X1TA 3ETEA 3PHGA 1IOLA 5ENDA 1P0FA 1BSVA 3KLMX 1K6XA 5A1TA 4B4OA 2O4CA 2ZB3A 4IUYA 1PJBA 4P22A 4F6LA 1HE4A 3IKTA 3JYPA 3GAZA 5BSFA 2QX7A 2O3RA 5EINA 1SOVA 1TXGA 1AUPA 3VZRA 5DF1A 1EFKA 1VE9A 3RBZA 2XXBA 3PTZA 1KEWA 3ZWMA 3UCEA 2X5JO 1R0SA 1GPJA 4R01A 4FD3A 2Z95A 1N92A 4WKGA 4M86A 1QV6A 2YQ5A 1U3TA 3JTMA 1AGNA 1NFRA 3H5NA 4GWGA 3ROMA 3BMNA 5L7WA 2WJPA 3F6YA 4ALNA 2FR0A 4HNGA 4J3FA 1WPQA 2IEDA 4HP8A 5B4TA 2DBZA 4FB5A 2F1KA 2DT5A 3LC2O 3GUYA 3UAGA 2C2XA 5JMWA 4IIUA 1DSSG 2PH5A 1Z6ZA 4CQLB 1HL3A 3C8MA 1YBMA 5DOZA 3AFNA 1KVTA 2PZMA 3LQFA 4CMCA 3B6ZA 3DZKA 3H2SA 5I9NA 3GUCA 1HZJA 1QSGA 2AW5A 2GYYA 3N7UA 4MP3A 3ADOA 5CDUA 2C82A 4I9UA 3EUWA 4S3MA 1DPGA 1NBOA 4A10A 1RPNA 1E7WA 2YV3A 3SXPA 5FYDA 3GZNA 3RD5A 1AE1A 4ALJA 2I3AA 5KTKA 1UXGA 1PGOA 1Y9EA 4BNNA 3KEOA 1HYGA 2G76A 1EBFA 1O6ZA 3NGLA 4MVJF 2GF2A 4NU6A 1E3WB 2ZB7A 4WCDA 4F45A 5JAIA 5FI5A 1V3TA 1UDAA 1NM5A 1XGKA 2I65A 3F3SA 3JQFC 4IINA 1Z45A 1GTMA 3PIDA 4CM9A 2EP5A 4U5QA 1ISJA 2D5CA 4S1VA 4YJDA 2HK9A 3COSA 5JDCA 1CQIA 6ADHA 3BHMA 4E33A 5JAMA 2QW8A 5A05A 2GN9A 4YYZA 3ZNNA 1EE9A 1YJ8A 1ZK2A 2X1HA 3JQBA 4IDAA 4XYEA 1C1DA 5L4NA 1HSZA 3P2YA 3VZQA 4BIIA 2H9IA 2NUAA 3DTYA 4J90A 2Y99A 2IXBA 3GVIA 3VH4A 4PG4A 5G0VA 4BO7A 2O23A 3DAPA 4FR5A 2GN6A 4YPOA 3JYNA 1N8KA 1WZIA 2EHDA 3IAHA 2G0TA 3QWFA 4D3FA 1AHIA 4YRBA 4K9DA 3D64A 3JYQA 3O38A 3GAFA 2GO1A 1NWHA 1Y9AA 4DLBA 2FRDA 4JCOA 4CM4B 4BNZA 5TT1A 1BW9B 2E6UX 5CDGA 2JHFA 3KOUA 3ORFA 4LN1A 2E48A 4URFA 3O8QA 3L07A 1BXGB 4ZQBA 4G81A 5L4SA 1Y8QB 4W7HA 4CLRA 3W6UA 4B4VA 4B79A 3KUXA 2AG5A 2HCTA 4QT0A 4N5MA 2QRLA 2O3SA 3LT1A 1ONNA 5T5QA 4E3ZA 1OOEA 2Q1WA 1F12A 1U2GA 4FC7A 4O6VA 1WNTA 3CUKA 3ADPA 5JS6A 2JFGA 3BTUA 4CL8A 3AY7A 4FFLA 2B83A 2DTXA 3AWDA 3F5SA 2NQTA 3TZHA 5DP2A 1J0XO 1T4DA 5G0UA 4D46A 4OYRA 4KOAA 2Y93A 3ONFA 3ZWAA 3UXYA 4YB8A 4BO6A 4GMFA 5BSEA 2BF7A 3G3EA 4WLEA 1NPYA 2FHSA 2O7SA 1YH3A 4M49A 4B3IA 3GRPA 2C29D 1BVUA 1XQ1A 3C3XA 1N1GA 1RM0A 3U4CA 5B1YA 1QYWA 3OSUA 5KIAA 4ZQGA 3P19A 1GCUA 4NHEA 3NTRA 4K28A 3R3JA 4HY3A 1YGYA 1MFZA 3NKLA 4BNMA 3F9IA 5K0ZA 4FS3A 3NTQA 4EITA 4J6FA 5TF4A 4XR9A 3PDUA 4PLVA 5KNLA 3RIHA 4LCEA 4KUEA 1FDUA 4WEOA 3W4KA 1E1NA 4FGWA 2FOIA 4BV8A 3JQ8A 3LT2A 3DL2A 3ENNA 3ZHBA 1MX3A 3PI7A 4D45A 5EQFA 4Q3DA 3VAZA 4ZQEA 1HTBA 1HZZA 4OQZA 4YT4A 2EERA 5BNIA 5KJ6A 3OQBA 1OC4A 3D3EA 3JQ7A 2DKNA 4BKOA 4DWVA 1ZEJA 1ZSVA 2VHVA 1WDLA 5COQA 4CQMA 2VTEA 3I23A 4WLNA 4OM8A 2PD6A 2NVWA 2OL4A 4RVDA 4NFYA 1MLDA 2CDCA 2NTNA 3NV9A 2VWQA 4HXYA 3ZNOA 4KQWA 4CPDA 4IMRA 1H93A 2X58A 1Q7GA 4MKXA 1NHWA 3H4VA 3LLSA 4NIMA 5EMHA 1PQUA 1EVYA 4QSMA 1Y81A 4CM6A 1PTJA 1ZXLA 1YQXA 4J43A 4PLTA 3AJRA 1E7RA 5CEEA 5TGDA 1PZEA 2PNFA 4CR7A 2D4AA 4E5PA 4A26A 5EJ2A 4LRSB 3IQDB 1JAXA 3ZWNA 3DBVO 3TWOA 3WICA 2CSUA 4BS9A 4ILKA 1KOLA 4LRTB 4YWJA 3UCXA 1LRJA 2O4UX 1NASA 1MXHA 3LU1A 3RUEA 4Z3KA 1B8PA 1QYVA 4XD2A 2Z1MA 1B0AA 1X0XA 2DBRA 1PJ4A 5IF3A 2NACA 3CINA 3VZSA 2E37A 3QA9A 5IJZA 4AJ2A 5IDYA 2POQX 4LW8A 4XIJA 2GN4A 2W98A 4U7WA 1PGJA 3GG9A 4KQXA 4HV4A 3ZWPA 4ZU3A 4GQAA 4CL3A 1IZ9A 2W2KB 3PQFA 2AQIA 5I9LA 1ADGA 3HZZA 4I5FA 1B7GO 1Z74A 3PHHA 1HYEA 2G1UA 3AW9A 4O0LA 4TRMA 4OL9A 3OBBA 3EDMA 4RF5A 3MJSA 3PLNA 4YAIA 5TJ9A 2EJWA 2VNAA 3Q9NA 1LX6A 3RQSA 4JLWA 3ULKA 5CDTA 2Y66A 3DHYA 3DB2A 4TQGA 5L53A 1JLLA 4JQCA 5EESA 3KV3O 4AJNA 4E13A 4BB5A 1SB9A 4RPLA 4PLYA 1O94A 5G2OA 1ZK1A 4DYDA 1RYEA 2IE0A 4BNJA 2FZWA 4GI2A 1IYZA 2YHUA 2VT2A 4UVIA 2G5CA 4XQGA 1MV8A 2BGLA 2CF6A 3M1LA 3GVHA 5JO9A 1DAOA 2QHXA 4C4OA 2QQ5A 1LDNA 3PZBA 1OZAA 3RC7A 4D44A 4XCVA 1V3UA 3KSUA 4GAEA 2CDAA 4UEJA 3LZ6A 3HG7A 4DVJA 1XIVA 4W9NC 1TVEA 3EK2A 1TB4A 3GC6A 1ZVMA 3EY4A 4KWIA 4IJVA 3Q2KA 4KZPA 3O9ZA 1Q2XA 1UP7A 4II2A 1BDMA 1E5QA 4AICA 3D7LA 4YJFB 4BKQA 4ZVVA 1O89A 5BNTA 3FTNA 2RHCA 1MC4A 1UJMA 3NRCA 3QLJA 4R9SA 2O3UA 2CVQA 4Z9XA 2X0IA 5TS3A 1Y8RA 1Y5MA 3OH8A 4LGVA 2OUIA 3PZRA 3RAJA 1EE2A 3VPHA 4DUPA 3GVPA 4YRDA 3BHJA 5ICSA 4J4HA 4NPCA 3EZYA 3H9UA 3PGJA 3IKVA 1I01A 4UREA 4QFDA 5HA5A 4WOJA 2H63A 4WE3A 2JFFA 2PKRA 3RKUA 3ICPA 2Q49A 3MJEA 3CKYA 1A9YA 3PJDA 2D8AA 2ZQYA 3IUPA 1WDMA 1EZ4A 3U4DA 4BNVA 1NQOA 1VLLA 1E7QA 3DAFA 1GYQA 1JAYA 2HAEA 1QP8A 2BKAA 5A5FA 3JQEA 5KVSA 1L1FA 2NU8A 5BSGA 2JHGA 2EGGA 1P1RA 5JBIA 4NFSA 4NJMB 3CH6A 3TL3A 1Q7CA 4PRKA 4FFOA 1O8CA 1R4MA 2ZKLA 4XRRA 3VTFA 2DTDA 3GZNB 2VYVA 1WXDA 2GZ3A 5CEFA 4BO8A 2HRBA 4NQZA 4UULA 5TQVA 1P1JA 3DDNA 3VOSA 1B3BA 1CERA 1LU9A 4PG6A 4Z3DA 3GMSA 1GV1A 4G5HA 4EZBA 3DMTA 3WGZA 4AJKA 1B26A 4R1SA 4IGEA 3W4JA 4L75A 4R3WA 1PU2A 3F4BA 1H6BA 2OBYA 3E8XA 3E5MA 3QVWA 1U3UA 4A03A 1NP3A 1Z7EA 4N54A 4OSOA 3WJAA 1ZCJA 1XU7A 2EXXA 3FPLA 1M6HA 1JVSA 3TFQA 4CUJA 3BXXA 3KTDA 3M6IA 3RC2A 2B0JA 2IZ0A 3ZU4A 1HDGO 5F5NA 3AY6A 2HSDA 5TLSA 4H7PA 3RBXA 2Y1CA 4YAEA 4W99A 3F46A 4D3DA 2PTGA 4TZTA 3CXRA 2ZTLA 2NU7A 4YAKA 3I4FA 4J49A 2Q2QA 4BO3A 1MXFA 4TVBA 5CG2A 4I5EA 1H9BA 2IODA 4UVHA 3KYDB 3QSGA 5JE8A 4OJNA 1Q7BA 4RF4A 4Q3CA 1VL8A 2ZB4A 3NT4A 5G4LA 2I67A 3WWYA 2VN8A 2FWMX 1PGPA 3O26A 1I3KA 3G17A 3NJ8A 1U5CA 4MJLA 5JDIC 1NTOA 3OA2A 2X9GA 1GPDG 1LDYA 2AXQA 3SVTA 3O8QB 3D4OA 2OP0A 1HKUA 1UDCA 1EK5A 3G1TA 1HSOA 4CLRB 4FSHA 5C7LO 1N5DA 1PJ2A 1PJCA 4ZD6A 1GL3A 1X14A 3R6DA 2Y1GA 3RASA 4WECA 5ITWA 2VYND 3WYCA 4HFMA 4FFMA 3GH3A 3GY0A 4I5GA 1DIBA 3AUAA 4J9VA 4BNGA 3M2PA 4DQXA 3F47A 2DBQA 4AFNA 1KEPA 1NXQA 4L9RA 1W0CA 4QFCA 4TRJA 5IN4A 5A06A 3MOIA 1EDOA 5TT0A 2BGMA 2Q2WA 4GLOA 5BQFA 2O2YA 4FIZA 1DC6A 2EV9A 2VNSA 5KJCA 5H81A 5BR7A 1I0ZA 5EPOA 4YQYA 1DHRA 4KDFA 3WNVA 4L4RA 3U4HA 2O50A 5T8KA 1WWKA 1PQPA 1PIWA 1CF2O 4NBRA 1SOWA 1BTOA 3LDHA 1G1AA 1KEVA 4CLOB 3B1KA 1L7DA 5THKA 1ONPA 3F1LA 3PHJA 5IZCA 1LEHA 4DBZA 3JQAA 4NH4A 1UXIA 2J3KA 5DCWA 4AJLA 5L9AA 1LXCA 1E5LA 1ZJYA 2CF5A 1ZW1A 2I99A 4RQUA 3H3FA 3ZWBA 1HETA 4ZQFA 4E30A 1P0CA 1V3VA 3GGGA 1GQ2A 3MCVA 4J2HA 1ZH8A 3DWFA 2CNBA 4BNYA 3UN1A 1A7AA 3JQ8B 7MDHA 1IHXA 2OHXA 5A9RA 2ZYAA 1KS9A 5CHEA 4AJOA 2G17A 3KYBA 2BMAA 2GRAA 1FDTA 1VSVA 2V65A 3GN2A 3ZWYA 2ZK7A 3NUGA 4JX8A 2VQ3A 3ZHXA 1FMCA 4J16A 3WQQA 3AOGA 4RZIA 3TZ6A 8ADHA 1EK6A 1NAIA 2LDXA 5ILOA 1H6CA 1XLTA 4Z9FA 4CMHA 2PLAA 4YT8A 1H6DA 1LRLA 5TX7A 4MVJH 5KVVA 1E0DA 4YBZA 4Y98A 3BTSA 4CM8B 4JN6B 4EW6A 1XYGA 4GBJA 1E3EA 3EAGA 4BO2A 2O3QA 1XKQA 3DOOA 3C7AA 4EYEA 1PR9A 3AUSA 4XA8A 4I9NA 1BMDA 3WFJA 3HWRA 4XJSA 3AOEA 4RL6A 2VWGA 2AEJA 3JD1A 1NFQA 3T4XA 3DBRA 3DBHB 4BV9A 4IZHA 3TRIA 3QHAA 2QYSA 3BMOB 3FR8A 4DPLA 1WZEA 2PFGA 4IBOA 3WB9A 2GASA 3SX2A 1NYTA 2ZJ0A 5JCJA 5KKCA 1YBVA 3BTVA 3L4SO 4CODB 2CZCA 4FW8A 3VKVA 1EBUA 2B37A 3FNEA 4YXFA 3NX4A 1LNQA 3GDFA 3VC7A 3H2ZA 4Y9DA 4M54A 2CFCA 4YDRA 4CV2A 2YY7A 3AU8A 1D4FA 2YHIA 1K6JA 2A94A 5H83A 4W7IA 3PFWO 4ND2A 3WYEA 4LSMA 1JA9A 2C2YA 2YV2A 1DLJA 1VRWA 4HFJA 2FPPA 2J5QA 1KYQA 4Q9NA 4AJEA 2GUGA 2CY0A 3PJEA 1DRWA 1Q0HA 4CR6A 3FBGA 3L9WA 1LC0A 3MJVA 4RORA 3OIGA 1M76A 1IHYA 4FPXA 1WMAA 1GEGA 4WOKA 4IJWA 3ZWVA 1BXZA 3U49A 4DREA 4ESOA 5JYEA 3BMCA 5TC4A 4GGOA 4R69A 4GVLA 1DHTA 4UUNA 1W6UA 3FWNA 4D3SA 1YL6A 1YB5A 3KM0A 4WLOA 1J4AA 1LTHR 3FD8A 3WBBA 4DGSA 4AJHA 4CV0A 4WCFA 3KYCB 3GFGA 4JJGA 3RUAA 2B5VA 1MUUA 4YJGA 1B3RA 3WTCA 2HKIA 1SEVA 3AUUA 1AN9A 3A9WA 4ALLA 5TRTA 4B8ZA 1T25A 3BHIA 4CMGA 2WEKA 1JDJA 2GNAA 4NI5A 3F4LA 3QY9A 4BGUA 1YONA 1ZKMA 2B35A 3I9JA 4INAA 3PJGA 3TN7A 5EN4A 5JDCC 2DPHA 5C5IA 3TQHA 4UAGA 4EEZA 3A4VA 5I7FA 4YT5A 5EIOA 3K8ZA 4NK5A 4QUKA 3WR5A 4DC1A 5IZ4A 2EGHA 5IAAA 5LDHA 3H7AA 2DUUA 4DPKA 3G1UA 3EC7A 4GX2A 3DHEA 1C3VA 3H5AA 5T67A 4BMNA 3GEMA 4U0KA 5IG2A 3W8FA 4UVGA 4E2ZA 1VJTA 3WQSB 1MGOA 2WD7B 3JD0A 3SJUA 1J6UA 4J1SA 4RO0A 3OM9A 1PJ3A 4P4GA 4BNIA 3GDGA 4TROA 3IMFA 1ISFA 5C7IO 1YBAA 4Z0TA 3IUSA 1UZLA 2Q46A 1FF9A 2NU9A 2IDZA 4Z6KA 2UYYA 5T64A 3WGQA 4BOYA 1NPDA 4BGVA 3C1AA 1EVZA 3NDJA 1ADFA 1KERA 1VKNA 4FJ2A 3ST7A 4IMPA 3HQ4O 3VKUA 2PY6A 4HFRA 3UOGA 2VHXA 4WASA 3EVNA 3DZJA 1TLTA 1FK8A 3TDKA 3V8BA 2GLXA 4EJ0A 3PYMA 2FP4A 5KCZA 4ND5A 1X7DA 2Q4BA 3GT0A 1ISHA 1OI7A 1GEEA 1C0IA 4YVFA 5IFLA 2YJZA 1FDVA 4Y6PA 5CP8A 5AXBA 1UAYA 2ZQZA 3H65A 3VTZA 2JAPA 1ZBQA 1U3VA 4XYBA 3DC2A 2XXJA 3AM5A 4NNJA 5JO0A 3TJRA 3IP3A 5A9SA 4XDZA 3X2FA 1KIFA 3TOXA 2CUKA 1K0UA 4IDCA 3V1YA 4WLUA 2PZJA 1GD1O 4MIOA 2B36A 4PG5A 1GYRA 5DCYA 5JY1A 1LJ8A 4JBIA 2VZ8A 4N5NA 3RJ9A 4EJ6A 2H5LA 1BWSA 1ZMOA 2BH9A 2P4HX 3HDQA 3IOYA 4IS3A 4GKVA 1ARZA 1YWGO 1EUCA 2P4QA 2OORA 2DBVO 3BZUA 1LDBA 1GZ6A 4J0FA 5J23A 1PSDA 1C1XB 2HMVA 3VPSA 4A73A 1EFLA 4D0RA 3OEWA 5AVOA 3EMKA 3ASUA 2NTVA 3WQRA 1KC1A 5JPIA 2DTEA 4W82A 4U0JA 2CVZA 4IZIA 1B14A 3ZN2A 5HTOA 3ZWWA 4OXKA 3ONDA 5A3VA 2X9NA 1LDMA 4EUEA 1V0JA 4CMIB 3O03A 3S2EA 1N7GA 4CM1A 1BXKA 3GN1A 2R6JA 4J1TA 3VHRA 4O59O 2X0NA 1E1KA 1JWAB 5AOVA 3ZW8A 1HF3A 3JQ9C 5DBGA 3RFVA 2VWHA 4WLFA 3AI3A 4GSLA 3JQGA 1HE2A 5B12A 1LLUA 4R41A 1ENOA 2Y0CA 3WGYA 1JVBA 4JBHA 1PWXA 3RUIA 2GGSA 4CM7A 1H2HA 2B4TO 4I08A 4PCVA 2AA3A 3HB5X 3WXBA 2Q1UA 3W8EA 3BMQB 2FSVA 3CTMA 2AQHA 1QORA 1YQDA 5DP1A 1RM4A 1P31A 3E82A 4M1QA 1EVJA 3JSAA 1B15A 2HK8A 1SPXA 1LLCA 3INGA 4L8VA 2Q99A 4J9UE 1LBEA 1OMOA 4GLLA 3V2HA 4OGWA 4E5KA 4CV1A 1RKXA 5U1PA 3RI3A 4IDBA 5FF9A 4BO1A 3PVZA 4W4TA 2J6IA 3I6IA 1TT5A 4GKBA 1T2CA 3RBVA 3PYXA 1B2LA 4DTIA 1CJCA 3KZVA 2R2GA 3GR6A 4KTVE 4GVXA 1YOVB 4XWYA 3GRKA 3LT0A 1ZUD1 3GGOA 3OQ6A 1YVEI 1NVMB 2GPTA 2GCGA 4E5NA 2AMFA 1JQBA 4HFNA 3HUDA 3SJ7A 3JQDA 3MJTA 4ALMA 4E32A 3TL2A 1JWBB 2JAHA 1E7MA 3C24A 3M2TA 3ANNA 1PZGA 4E6PA 1R6DA 1SNYA 5A04A 5DT9A 4EEXA 5DDIP 1I32A 4ND1A 1QXSA 4MVJD 2B5WA 3VH2A 3OMLA 1MFPA 2EP7A 2V6FA 3C1TA 4RPKA 3AY3A 4CM5A 5K6AC 1D8AA 1YE3A 2FPGA 1V8BA 1ULUA 1E3JA 2BLLA 1ZFNA 4JJFA 5L95A 2WTBA 2Y0EA 5F21A 5G4KA 1M2WA 1F06A 3Q1LA 4M55A 4PLGA 4RLHA 3OIFA 5LCXA 4XGNA 3H3JA 4FOSA 3QE3A 1R4NA 4IQ0A 4HX5A 4AVYA 2A4KA 4BO4A 3MJ4A 2JD1A 5GY7A 3H9GA 3UUWA 5DOVA 5DN9A 4ZGWA 2UUOA 1SCUA 4JNKA 3MWEB 4JP3A 5ITVA 1NVGA 4PLFA 1O95A 1I5RA 1JTVA 4WNCA 3E18A 4XIYA 1HE5A 2P9CA 1G0NA 3HFGA 4PGFA 2BFOA 3WWZA 2RH8A 4LMRA 1H94A 2AEFA 4OSPA 3ZV5A 5CG1A 4JP2A 3OJ0A 1I2ZA 3AM3A 5COBA 5G0TA 3DR3A 3X2EA 2NV6A 2B4QA 5THQA 4D0SA 2PV7A 1ZSYA 2EWMA 3GPDG 3C1OA 2VRBA 2VOJA 2D3TA 5JAQA 2BD0A 1RYDA 4CQMD 5DNAA 4XR4A 1CEQA 1OAAA 1PZFA 1F17A 4I1IA 1K89A 1QMGA 4YJHA 3AFMA 4O5OA 4R1NA 1DFGA 1EDZA 3NEPX 1M75A 4BMVA 3QP9A 1A4UA 1E3SA 5CPBA 2FMUA 3TZKA 4Y6RA 2FR1A 3ROPA 1XWFA 4MVJI 1K5HA 4RQTA 2NNLD 2Q45A 2WDZA 3OEYA 2PD4A 3H6KA 5GMOA 1X7HA 2ZJ1A 3A1NA 4DQVA 1X1EA 4XRGA 2XAAA 4YRAA 3KO8A 4CLHA 1NX6A 3IIEA 3WLEA 2HRZA 3WLFA 2Z5LA 4P4NA 3OJOA 2PZLA 3U9LA 1GR0A 1O5IA 1KVQA 1XA0A 5I7SA 3PDJA 4A27A 1A7KA 1EQUA 1Z73A 3EZLA 1NAHA 5F1PA 4N7RA 2ZATA 4KUHA 5HBRA 2I66A 4E5YA 4XB2A 2P5YA 1HT0A 8LDHA 4DMLA 3SBOA 5FI3A 3GLQA 3HADA 3LLVA 4OXYA 3RU9A 1M67A 1QYXA 1LSOA 2YDYA 3U62A 3I4CA 1E1LA 1W73A 1P33A 5T6BA 1M66A 4JROA 9LDTA 1B16A 3D3WA 3L9XA 1VI2A 2QYTA 4J7CA 4YACA 1KY4A 2X4GA 1AXEA 3ON5A 2NADA 1QR6A 1UAGA 4B4UA 2Y1EA 1ENYA 1ZNQO 3V2GA 5FWNA 1XR3A 1F8GA 1ZXBA 3DMTC 3HB4X 3ZCXA 3L77A 3OHSX 3WGGA 3FI9A 3NT5A 1R0LA 2O3TA 3EYWA 1SZJG 3BYZA 3D4PA 5HWSA 1RJWA 4GPD1 3BMNB 4J4TA 1ISIA 1YB1A 2WYUA 4GX1A 2DPGA 4CUZA 3R0IA 1P3DA 3N74A 2C5EA 2EJVA 4ALKA 4D7AA 2J5KA 2JD2A 1GZ3A 4J2OA 3D1LA 2FN7A 3RFTA 1ADCA 2D0IA 1A27A 1C0PA 1JKIA 1VKOA 2F00A 4CMBA 2YFQA 4JGBA 4XJTA 1R37A 1T1RA 1LRKA 4R68A 4ZRMA 3K5PA 2E49A 2J3IA 1I30A 2PD3A 1F0YA 3DZIA 4JXKA 1ZO8A 3TSCA 3WTBA 4AL4A 4IDGA 1UP4A 2BRUA 2Q2VA 1GQYA 4XGIA 4PVCA 3PPIA 3GHYA 3Q6IA 4QEDA 4EI2A 1ZMTA 2PGLA 5CAEA 2DU8A 1HRDA 1UDBA 2C7VA 3L4BA 2IZ1A 5COAA 5HS6A 2BFPA 3DAGA 3E9MA 2ZIZA 3NAQA 4DYVA 1T2FA 5KWEA 2QIOA 2VRCA 2LDBA 2EW8A 4NMHA 3FNFA 3PHLA 4NG5A 3SC4A 2PR2A 4GSKA 3U4IA 4EGFA 1F14A 1E3WA 3GFBA 1ENZA 3K31A 3WIEA 4YTEA 2QZZA 4FBGA 2ZCVA 1DIAA 2C5AA 1RWBA 1QKIA 2AQKA 4W9NA 3OP4A 4DC0A 1YRLA 4GL4A 1H5QA 2YV1A 2X6TA 1ADBA 3ZV3A 4RCVA 5L45A 4J1NA 3HHPA 5A02A 1C1DB 1R66A 4LISA 5L51A 2X0RA 4U6SA 1PX0A 4WGGA 2BI8A 1Q0QA 1P44A 2NWQA 2PKQO 3AI1A 4XKJA 4BNHA 2XPCA 1U7HA 3WMWA 3IJRA 1DIGA 3P7MA 1EVIA 2BHLA 3ZU2A 2Y1DA 1AHHA 3BA1A 1ZSNA 5IN5A 4GWKA 3WSWA 3GK3A 4QXMA 4TKMA 3I9LA 1HDOA 1R16A 1FDSA 4B8WA 1GU7A 3JYOA 1YS4A 3FWZA 3I9NA 2VYNA 2PH3A 3INTA 3ZU3A 4DLAA 4A7PA 5TIIA 4CM4A 1PQWA 3V2UA 1EMDA 2WE8A 5KJFA 3GVCA 4R9RA 4WJZA 4U6QA 3H8VA 1XELA 3VDRA 5FFFA 3G0OA 4HKTA 4XQCA 3VH3A 1BXGA 1UUFA 3JV7A 2IZZA 3LVFO 3QRWA 4WPGA 2PZKA 3ANMA 4AJPA 3HN2A 4I9HA 3DFUA 3GDOA 5AYVA 5KVCA 1GUYA 3QVSA 1HDYA 1UP6A 5JLAA 4E0BA 3ENKA 1GCOA 2H1SA 1BHSA 1R0KA 1LSSA 2ET6A 2UDPA 2WM3A 2QRJA 3FCOA 4N18A 4ZA2A 1CDOA 2PWZA 2UUPA 4JK3A 3FNGA 1T2DA 4MKRA 4J91A 5B4UA 5KJ1A 1HLPA 1WLYA 3PXXA 2DUWA 1QV7A 4FDAA 4RVFA 4UEOA 1JW9B 3WNQA 2OOSA 3UFXA 3LT4A 1I3LA 1IY8A 1JN0A 3BAZA 1IL0A 4H16A 3LYLA 1WVGA 2VOEA 3Q9UA 3RUCA 7ADHA 4YA6A 2VUUA 3AOEC 1QLJA 3K73O 1CRWG 4KDEA 3V5NA 2JKVA 3H9QA 3WYBA 1T4BA 3PGXA 1GUZA 3NDIA 2XF8A 5IDWA 4MVJG 4OKIA 1D3AA 2AHRA 4N5LA 4MOWA 3QIVA 4RVGA 2OXIA 2NVBA 4Q3AA 3GNTA 2A92A 1XG5A 4IDEA 4O63O 2X9VA 3AU9A 3L6OO 3QQPA 2FY8A 5A9TA 1KETA 2C7GA 4QTZA 5B37A 1HDCA 5BT9A 1X0VA 2E82A 1ZK0A 2PGJA 1I10A 2RCYA 4BNWA 3ETGA 4IQGA 1FXSA 5B4VA 5ER9A 3U09A 1QLHA 1I2BA 3JQ7B 4Z0PA 1E6UA 4B3JA 1E6WA 4HADA 4CQMB 2I9PA 3PEFA 3QWIA 1IPFA 1TT7A 3TOZA 3CZRA 3QWHA 3R1IA 3P2OA 5IDXA 1PJSA 2HUNA 4FCCA 1DOHA 1DJNA 2R00A 2W2LD 5H82A 3T7EA 1CQJA 5I8WA 4RZHA 4F6CA 4TRNA 5T57A 1R4NB 2Y05A 3KEQA 4XQEA 5BSHA 4XYLA 3IL2A 2YUTA 2VTDA 3QWAA 2WSBA 1EUZA 4TWRA
chains in the Genus database with same CATH superfamily
3UJDA 5EIBC 5GM2A 4MK4A 3MHTA 2OTCA 4D9IA 3GOQA 2EKQA 2ATVA 5GWXA 4L5IA 2JRCA 2XUQA 1NFFA 1WTAA 4OGFA 3LGXA 4U9IS 3CLRC 3RAEC 3PHCA 3ZXYA 3PKJA 2JKZA 3ZZMA 2XDAA 4N39A 2B82A 1VHJA 3KJGA 1N6IA 1FS4A 4OV6B 2UVDA 1MCZA 5KNBD 4AO6A 3AK4A 4CG2A 3N39C 4DIBA 1SCKA 2DCUA 2HQRA 3ANXA 4TUYF 4AX4A 4HQRA 3QEOA 4NJEA 4CHGA 1XCPA 2YMQA 2RHGB 1B2RA 5FPKA 2A78A 3W77A 2QM0A 4ON9A 2KLHA 3MC1A 3N2NA 3T1QA 2C3UA 2YBDA 5K0NA 4KRGA 1YL5A 4JVOA 1J5PA 1YB6A 3KVYA 4FYWA 2G9QA 2QZPA 3C39A 4KNVA 4GLBA 3HCEA 1G8FA 4M9UA 2R1UA 3DZFA 1QIDA 4RY8A 4KYTA 3VR2D 1XD2B 2VWPA 1IVYA 3K05A 4BQOA 4HZUA 2ZIXA 2NZWA 1FFSA 4CVNA 1UIMA 2VCHA 2AC7A 3FNBA 2HHCA 3VZCA 3KJQA 4JGIA 3VR6A 3COJA 1MOSA 3VTAA 4F6RA 3L1UA 3LHIA 5JJIA 4QM7A 5A3RA 1DNPA 3LRXA 3WLQA 4QYXA 1PR0A 3ANYB 4L50A 5E4FA 3OETA 2QYHA 3NGXA 3DVAA 1NJ8A 5EZYA 5D3QA 1JVNA 1G2PA 5BURA 1QTNA 3CRVA 4YH1A 4LY3A 3R44A 3K2BA 1Y9DA 1ZEMA 3L8CA 5JS7A 1Z5GA 1JS1X 1GPKA 3R24A 1GTVA 1U5AA 3N3AC 4DRZA 4DA6A 4RLSA 5JISA 3BE8A 1SXJC 2DUJA 4RZUA 3U3XA 4W9RA 1XU9A 4RPGA 4NP6A 2C03A 1YDGA 3BCHA 5FB3A 1GDHA 2XMBA 3DE5X 2V7PA 3SFVA 3G5AA 3I5MA 4QGSA 1Z4QA 2CMDA 2HSEA 4A8TA 1NM5C 2P30A 3GG2A 2V6BA 4R5MA 3QI2A 4LY0A 2I3GA 2H4YA 5HK8A 2ZYTX 4L5BA 1I2AA 1I3NA 1V5IA 4GNRA 2DZDA 5ARDA 3SXUA 3QMPA 1E2PA 1H0KA 1E6EA 3KQNA 4ZVKA 4LV5B 3LXXA 4J1QA 1L8AA 2YUIA 1VMEA 3IIMA 2NQ2C 2IITA 3C97A 3DFMA 3MQ4A 4KK3A 5CX1B 5FBQB 1RWOA 1Z6TA 2J0QA 3CVOA 4WH0A 4PGHA 3AM1A 3ZU5A 3ABIA 1ZD4A 4G2TA 4WKCA 3AO0B 1CIVA 1PW7A 3IRUA 1PL7A 4YJFA 3ROKA 1T1EA 3OQPA 1KY3A 1WP9A 3PNBA 4J6EA 1N2ZA 3VPXA 3KR1A 1Y4UA 5KQLA 3N70A 4ZI7B 2HMSA 4NE9A 3DBOB 1NQWA 2JGMA 1J8VA 1JYEA 1Y8RB 2WWXA 2ZSBA 4RY0A 3BIXA 3WP1B 2EDCA 4WEQA 2XYGA 1VJ0A 1OTHA 3PVSA 4KE6A 3F49S 1DG9A 5DX1A 3U7JA 2C98A 4EW1A 5C5EA 1KQFA 3P2KA 1JSLA 3ZD6A 2ACWA 2BLNA 3L46A 4C5CA 3D1VA 1Z36A 3TCNA 4DCSA 1SVOA 2WHQA 3NIFB 1X42A 1R6BX 2NYVA 3T0GA 3CRMA 1DX9A 3GT3A 3HNPA 3LY8A 2I7XA 5E6RA 3EXG1 2WTXA 2AV6A 2OAQ1 2SHKA 1JR3A 1OBFO 1HM5A 4UUPA 1LQ2A 4FYVA 1WB9A 1B41A 4QXAA 1VE7A 3HGQA 4ETNA 1SBQA 1X7WB 1DEKA 1Y63A 2FUNB 2PGNA 4XCQA 3ND6A 4XTRA 3ZLBA 2QW0X 5LA6B 1PNOA 2OEPA 4GR5A 4G0UA 2D1TA 2WF6A 2Z3ZA 5IKMA 1K7FB 3UAZA 3WGJA 4XM2A 4Q1DA 1MG5A 2OZVA 3JU3A 4MH0R 3STHA 4DLZA 4PPGA 1RXVA 4MRRA 2XQIA 1ZN8A 3FIJA 1O97D 2YC4C 1P5JA 1CG6A 4TRRA 2NU8B 3EEOA 2UZ1A 2C5GA 2WV7A 5KTSA 4B43A 4BKRA 2W2VA 3M6XA 4HNAB 3ZKWA 5FUMA 5IXJA 1N6LA 2ZKIA 4HGOA 1I1QB 2XECA 4WKNA 1R4MB 4XGKA 2JFOA 4FYYA 3EQ6A 4G4JA 3DDUA 1OJLA 4OMDA 3QVTA 5C80A 3VDNB 1GZUA 3GRUA 4MRNA 5ALGA 4CLXA 2A5GA 3V9AA 1MT0A 3EW9A 3U7RA 3U56A 1AHPA 3MT9A 3G0GA 2DUMA 2I6FA 3LVQE 4N49A 3GELA 3MAGA 5EVJA 4EHKA 3BFPA 3EZNA 3DE1X 1N9ZA 4G0QA 4IRUB 2GM5A 1G2IA 3KJIA 2QNBA 1JI0A 2VQSA 2OWDA 1JMKC 1UEJA 1L7QA 2IYUA 3ANSA 3PWSA 4KI0A 3NT2A 3WMGA 5F1OA 1ID1A 2O5CA 2BHRA 2V59A 3LWDA 4MHSA 4TN5A 4TLAA 3ZW9A 5HS4A 4RA9A 3W5CA 2A5YB 4BKPA 3BN3A 3CCCA 3RVMA 3P4YA 1MU0A 4IEFB 4OHOA 1V8OA 1XCBA 4MV6A 1NDUA 1AN0A 1V8FA 2R9VA 4MROA 3ZI0A 1W75A 1XZEA 3DFZA 4ZV9A 1JU4A 4EATA 4QKQA 3X1KA 3UWOA 2QMQA 3O21A 1PRYA 4HDQB 1CY4A 3KT8A 2R47A 5HQTA 4JJIA 1UANA 1Z29A 2EEZA 2V6MA 2EIXA 3MD9A 3KYDA 2V8BA 3GFOA 3OHPA 1OBCA 2R8BA 3QPCA 4DJ5X 3FKQA 4EB8A 4MUIA 2X86A 5KDLA 3MUEA 4B6SA 4PNZA 2W6QA 5CBKA 4IXWA 1EUDA 1W4ZA 4Q9JA 1D7AA 2NO0A 5CCBA 1UT8A 4BVAA 4EUSA 1NL3A 5LLSA 2Q3JA 1PFWA 1T26A 1SC6A 1QK5A 1UPCA 2C97A 4EG8A 2E3JA 1GL9B 2C94A 4TVOA 1QU3A 2J0EA 4YAGA 2GDJA 5B3KA 2QZJA 4PFSA 1O9BA 1H2BA 3ICCA 2C4VA 4I5DA 4LY9A 1A95A 2HN9A 4O4LA 1SKYB 3CEPB 3EGCA 1P1IA 3S68A 3AUYA 3BICA 1YRQA 4DLWA 3U60B 1SCQA 1A4IA 1TCVA 1V71A 4AN0A 2H3HA 1DBVO 4K86A 3RU7A 1R1DA 4CMAA 2XD9A 3G2QA 4LBYA 1JFFA 4ZVSA 2Y92A 2W58A 3ICWA 4G07A 5IBQA 2WU4A 5JW6A 2ID9A 4KTTE 1N0IA 3RV4A 4DBLE 4ANFA 3G5UA 4W63A 4RJ2A 1FPMA 1N8SA 2GHQA 4PFJA 4R4JA 2Q4OA 4H7IA 1D2HA 1OWLA 3DBLA 1XSEA 3RVBA 2OMEA 2UAGA 1E64A 1HT3A 1L0BA 2WJZB 2JBAA 4IHKA 4TZKA 4LE2A 1GSAA 3QEBZ 1B93A 2FQXA 2VJMA 2X0EA 4R71A 5BR1A 3KTAA 4P5EA 2Z1DA 2GKSA 1G8PA 2WR8A 3GP8A 4I3HA 4CMKA 1VBMA 1LJLA 2R48A 2NUPA 1V7ZA 3IPLA 2OT3B 3RWOA 1X15A 4CLOA 1VJCA 3L7DA 2QLFA 3IP1A 1CY2A 1LDEA 3S2GA 3ZJYA 3TFWA 5I4CA 2IXTA 5KNCA 1H1LB 2RGYA 2ZSHA 5CT4A 1IVNA 3HYRA 5KJEA 2DFPA 2XCTB 3EFEA 1IQUA 2NAPA 2RI6A 1P1KA 4HLNA 1U63A 5TQ0B 1EESA 4RS4A 1TA4A 2DFNA 2HA2A 1W85A 3LHDA 3TEMA 1YS2X 1KPIA 3DR5A 5K01A 4V02A 4HWKA 4TS9A 621PA 1UJ5A 4OBXA 2QRHA 4UUMA 1P1BA 4TTVA 1I7LA 2OO3A 3CG4A 4D79A 1MW8X 1SKAA 3HGTA 4JI6B 3WKBA 5IABA 5L4LA 4WUVA 1IZ0A 5ILGA 4O2BB 4LDJA 3GW8A 4J4BA 3K70B 2GKGA 3EJ6A 2FAXA 3JQ9A 3LNTA 2V74B 3NBUA 5A03A 3Q11A 1O3YA 4QDUA 3FNHA 3SBXA 3NHRA 5ADVA 2P7IA 2RB5A 2XVYA 1M54A 1QS0A 4FHFA 2ZWVA 3K2EA 4JI8B 1ODLA 1M8JA 1PSZA 1TJ5A 1XAHA 5K03A 4UUQA 4KQ1A 4QJ3A 2CXQA 3EW7A 4M87A 3TIIA 5BVGB 4DGQA 1O94C 3EYAA 4Y67A 4LF4B 1G4UR 4EDHA 1ZOLA 3CMMA 1QFSA 3THXB 1GA6A 5PGMA 3UMRA 5JCOA 4CM8A 3IEIA 5LMCA 2BFFB 1NT4A 1GGMA 2HCBA 3R8XA 1ZNZA 4MRMB 5CNMA 3TIXB 3VOTA 4X1KA 4F96A 3DCIA 5D5PA 3OZBA 5D85A 3ADCA 3GNSA 3PTLA 1FNDA 4LZZA 4NCHA 2G67A 4Y6SA 3A2MA 4YQZA 4K9LA 1FU7A 4CUKA 1QH8B 1SMKA 1J70A 4QOFA 3ZGVA 1W9HA 3B89A 4YCDA 3AR8A 2F8MA 4QXOA 1EFAA 1QYDA 2G71A 1UXJA 2J8ZA 1YKSA 3F71A 3ABRB 1NZDA 2CLDX 3PICA 3BMOA 3S40A 1G4AE 2ILTA 4MP8A 2P2DA 4MYRA 2H17A 3T7IA 3FPCA 2IYOA 3FHTA 3PHIA 3KE9A 1RJDA 2B6HA 2H2GA 3SZMA 1OU0A 3OZTA 3RT7A 2QMYA 4EYOA 3M1AA 4HQKA 1N9KA 4Q47A 3GZTB 2JLBA 2PX4A 2WIKA 2W2XA 3GCZA 3V4ZA 1C9NA 1E9DA 1C0LA 1GY8A 2FJUA 4M37A 1IHDA 3AHJA 2MR6A 3P5SA 3ROFA 3RVRA 1JH8A 3U0BA 3ANLA 1RC8A 1YRBA 4R40A 2O2HA 2ZCUA 4YO7A 4E07A 3H9EO 4B3HA 1KKMA 3CEAA 1LX7A 5EYPB 3H1AA 2ZRIA 4U7TB 2QD2A 4C2UA 2IBTA 2EU8A 1VPLA 3LO5A 4CF3A 3N0RA 5DWVA 1ADJA 3S5JA 5KYUB 2NP7A 4LBVA 2WY2D 1UBGA 4WK4B 3KOXA 2VTBB 2J0SA 1QIHA 4OQPA 2XNJA 3KKPA 4R2LA 2C0PA 1NJ5A 2JJ2D 5DT2A 3UPTA 2H07A 3I73A 3Q5GA 2FPIA 5GTDA 5CNJA 4DQUA 2WK1A 4JQSA 3BMCB 4QARA 3LCVB 1YK1A 5L6MB 5M29A 1KJWA 1XO1A 4HQLA 2CVOA 3RAGA 3OQMA 1QK3A 3O8RA 1L3IA 4JI0B 4WCFB 4BGIA 1NF9A 4Y7CA 4N0QA 1ULAA 4G8CA 4GXQA 4DQKA 2A9OA 3LC1O 1R6TA 2H9YA 3HRHA 3OQHA 4GF5A 1JR3E 3AESB 2XB2A 2FG7C 3RDPA 4C2AA 4QDJA 1FFXA 4QBGB 5GOTA 1VMDA 3GRRA 2WVGA 2YZ7A 1YNSA 1WU7A 1ZC4A 1ZIYA 1ZPDA 2EL9A 2HZBA 3AVPA 1Z35A 2DX7A 2R8RA 1L5SA 3GLIB 4QOEA 3CZQA 1W46A 1W88B 2H1LA 2HSWA 2ZT8A 4QU8A 2WLTA 1KDYA 1GV0A 5FBVB 3HLYA 1SY7A 2X42A 3L41A 3U7IA 4PINA 3RRXA 3WMXA 2W0SA 2O2XA 4PLWA 4RD2A 4O2AA 5L7TA 4LGMA 3VZBA 1XB2A 5JD5A 1RFLA 1K27A 3K9HA 2V4MA 3P9SA 4D81A 4ENPA 1D1TA 1HL7A 1KK2A 5EGSA 1UKBA 4FCTA 3EFBA 4BNTA 2VZ0A 16PKA 1K5PA 3LSTA 3R9WA 4UNRA 3CJRA 4Q3EA 4E2FA 2V9PA 3WMFA 4K1LA 1VB5A 4D9KA 3QYPA 2VPXA 1SUWA 2KYRA 1IE3A 3CLUC 4GMGA 2CJPA 4PFKA 3JARB 4GX0A 4WLVA 1GFSA 3AL0C 2DWPA 5DJ5A 3OZVA 2IGBA 5K09A 2ZJYA 3D0OA 1X8XA 1P60A 1OZ0A 2DR0A 2O2CA 4K3VA 4KPUA 2Y9MB 1M2OB 2G9VA 3OMWA 3DV0B 2YJ6A 3DLBA 1Y34E 5KOIA 1N4DA 1NJ6A 3NIGB 4IY1A 3S28A 2YIMA 2EWWA 3II6X 1L6RA 2Z5GA 3ZUGA 2F1JA 1N5KA 2DY1A 4M9SA 4ZEOA 5JJ5A 1DKNA 4C21A 3SHFA 1L5KA 3GLGA 1GAEO 3O47A 3PC8C 4X6UA 3F6CA 5C4IA 1PD1A 4FDMA 4G41A 1KBZA 3PG5A 2FEOA 3UKJA 4QODA 4Q39A 3PWZA 2GRJA 3GRCA 4PVDA 3HO8A 5BW6B 1Y82A 1M1YA 1GGHA 2Q1TA 4DLLA 3IT3A 4H15A 2EAUA 1U8CB 2OGTA 5FOWA 3WIBA 3ZVRA 4XFKA 5EXPA 1LSJA 3DDCA 3RRBA 5IT0A 1US8B 2J30A 1M74A 4LFBB 3ITDA 1H3NA 3I6QA 2QVLA 5DYNA 1P1HA 1FSFA 2WMYA 4HN9A 3U48A 4YP0A 4GICA 4AJ4A 3W7AA 5AD1A 5H8WA 5A9SB 2ZUCA 2Y1XA 2YJ5A 2AFRA 4JT8A 3LX8A 2AI1A 1VIVA 1GRCA 3RTCA 1Z2DA 4TGLA 3NJ4A 5E4JA 1RXSA 2Y1KA 3AM4A 4V24A 4C5BA 2CXHA 4R0MA 1QQ6A 2OFPA 3RUHA 1IY0A 4C7JA 3CZCA 4EM6A 5BV0A 1V9LA 3FA2A 4QLAA 2E0IA 2HMWA 1M8FA 3EH1A 3WBFA 4ZYXA 5T8KC 1H2XA 1LLDA 3PFIA 3E03A 1YACA 1E0KA 4FGLA 4R5HA 2LZ0A 4MHOA 3K09C 4BVEA 1NI4A 1KMMA 4ZDKA 1WLSA 1CUYA 2CUTA 2VRCD 3WYFA 2IEBA 2DHRA 2FH5B 2ZUWA 4B48A 1AQUA 2JFHA 1BVRA 4MCAA 5FPHA 4EL5A 5C8XA 2CXUA 4DB4A 3JW8A 4NCBA 2BBTA 5FEUA 4Y1EA 5DCUA 3V3KA 4LRYA 5DI3B 3V4FA 1VC2A 4U63A 2OCDA 5EUCA 5BP7A 2O59A 3GP5A 2WILA 4N0EA 2BDEA 2JVIA 4CMIA 2VHCA 1ZD3A 4L76A 3PQ4A 2ZJ3A 5K3EA 1TZBA 5AXDA 2CCKA 4I5IA 3FR7A 3RHSA 4EJFA 3T3NA 4H6PA 1AT1A 4ZIRB 2JFBA 1SA0B 3PJFA 4MGEA 4OQYA 4ZVTA 1MTZA 4ZYTA 3CUWA 3O90A 3K70C 2VHQA 4N12A 4U7DA 1PEYA 1PN3A 1YDEA 4ASUA 1VSUA 3DO8A 1Y3BE 3BJRA 3ZHZA 2HDOA 5LQNA 4G0VA 1YZ3A 3SHQA 4P1ZA 1VZ3A 2WUDA 1N4AA 1R12A 4ZT5A 3UPUA 4B7UA 4F7WA 2D00A 1FZTA 3UNXA 3CRQA 3M70A 5IJXA 1CETA 4QECA 3ZI4A 2XVZA 2BDUA 4I9GA 5DEOA 1N2OA 1XLTC 1FDOA 2RAUA 4IX9A 1BD4A 3K5IA 5F2NA 1HDZA 1KJZA 2XMCA 4FNOA 4EGAA 1EHYA 5CFPA 2ZRQA 4RA6A 1PYOA 1RM3A 2GZ1A 2JGIA 3DMYA 3GB9A 3HFSA 3HSSA 3HACA 1THZA 5DW0A 4BP3A 1YQGA 2R1TB 4GBED 2AF3C 4RPHA 1OT5A 2R66A 2C9MA 1MAUA 3DONA 5L7YA 2M6LA 3MB5A 3OA0A 3LHSA 1BKSB 5A5DA 5CFZA 1E1YA 1HE8B 1Y6GA 2Q5JA 1LNZA 1DFIA 3QF4A 1VCOA 3KHKA 5IANA 1YAHA 4DCTA 1UKZA 4IDFA 5I8ZA 4WIAA 4BFTA 1QC5A 2JBWA 4G65A 1XYVA 1R6AA 2H2IA 3OIDA 3RYIA 4E12A 4ZHQF 1E4OA 3LBNA 3MOSA 3CEMA 4AJJA 2FXIA 1FRZA 4O4IF 2AG6A 2C2KA 1SZDA 1TI7A 3H0EA 4BGDA 5F4ZA 3ZHCA 2E4UA 4F3YA 1Q0UA 1RRGA 2W2LA 3K1AA 4AKHA 2Q1SA 1GUFA 1FYXA 3H3XA 3TOCA 1IEXA 1O77A 4BATA 1KQPA 5JIBA 4FLFA 3UHJA 1NLUA 1IWBB 3QLVC 4IG9A 1EJ2A 2VQEB 2C31A 2JJ1D 1UMDB 2CV1A 2W22A 3OICA 3QVXA 4RK5A 3NI2A 5ICFA 1ZU5A 3NBQA 2F9FA 1A0OA 4YLEA 3CONA 4F2PA 2RBEA 5JDIA 1UBNA 3I5UA 1USUA 2OPHA 3ZK9A 3OPNA 4YIKA 3FYUB 4KN6A 4INZA 3UK1A 2C5HA 2IJGX 1BU5A 3OPYB 4CN8A 4OH1A 1L7PA 4K6FA 1QBGA 5TPWB 4ENRA 4AY3A 5JMPA 1S5PA 5KKAA 1UFOA 3QV1A 1N1EA 4LJ7A 3VR4H 3NFYA 3RVDA 4DZTA 4OIMA 2G83A 2PMBA 4OK5A 5EPUA 5ALSA 1UOPA 2F8TA 2FW8A 4CFSA 1BS9A 1SCNE 3CGWA 4NKRA 1I6KA 3F7MA 3LBHA 4KPGA 3ZK8A 1SEPA 4QGAA 3DQQA 1DRUA 1KBQA 4DQLA 1PYGA 2CHVA 2H4HA 2AJBA 2RHOA 2TRSB 3ENZA 3MQFA 3NOVA 4QJBA 4WCFC 3QLUA 5AW3A 4G0PA 1Q91A 2EKBA 2GFIA 3OZRA 1U8ZA 4US2R 2RONA 3EAQA 2GAIA 4PO3X 2CYAA 5JNLA 5AVYA 1TQ4A 2OUKA 5IKPA 1NVTA 2NSLA 3A1VA 1KGSA 2VHTA 4Y9RA 5BNFA 4KO2S 5K6TA 1A8HA 3JASA 4D9JA 2Y1OA 3X1DA 3D3KA 5ER6A 1RDFA 1JEEA 2A59A 3FETA 5FTWA 3HO6A 1KFCB 2F1HA 3F2VA 2VHZA 3IALA 4NU5A 4R0NA 2NGRA 3TLYA 1CY6A 3U61B 2YTZA 3OG9A 1ND6A 2X5NA 3HC7A 5ICCA 5B6IA 3QJYA 1K4KA 1Y7IA 3VO8A 1EUQA 1ZVVA 4MI3A 1T1JA 2QG4A 1AKEA 1RYHA 3HV0A 1M1NA 4XLTA 5KYVA 3CNHA 2XMZA 4KO3S 5D2CA 1RBQA 4BVGA 4H1HA 4LDZA 2JI6A 2WVHA 2PL9A 5T4FA 2XWSA 2M6RA 1PS8A 3DOHA 5J1SB 3DULA 3M81A 4K6OA 2NZ8A 3ZPXA 5J43A 1BVYF 3AL2A 1RKVA 1M2JA 3CNBA 1R7RA 3W4IA 4C6TB 3FRHA 2OILA 1DFHA 2D2IA 2HMYB 4RHYA 4BC1A 3PR1A 2HWKA 9ABPA 4HAVA 2FUG1 4KFSA 1G3UA 1X13A 1UEIA 2HA4A 2BEJA 5DX0A 3B1JA 2V1XA 3TTTA 1EQ2A 5B2FA 4E46A 1TZCA 1GKIA 1U28A 2VHUA 2PWPA 3DDWA 4N5HX 2ONJA 1IXSB 4FMCF 1CYDA 4E4RA 4LXXA 4MS3B 4MMYB 1PDVA 2C20A 1MB3A 2YWRA 4JJKA 2P41A 3G5LA 1P4RA 1EM8B 3A06A 4RV5A 3GEDA 1HE3A 1C7EA 1W5FA 2YOGA 3MB8A 3MUFA 4MYCA 1AURA 5CB4B 4ZK6A 1PK7A 1Z37A 1R5NA 4EVIA 2Q62A 5IDQA 2W7TA 3ZCRA 3ZYZA 3ZS9A 2HV8A 5IBCA 4PE5B 4M88A 2DG2A 2VA8A 2VKTA 3CPJB 5HRCA 4EB6A 4L0DA 2D2EA 1EDBA 2BM8A 1E3MA 3KLMX 4RY2A 3FPSA 5L8VA 2ZI5A 1JJ7A 4O4HF 2O4CA 2ZB3A 3NNNA 4DDMA 1ZD9A 1N5MA 5HFJA 2JFXA 4AZ0B 1OLOA 4QUDA 3K4HA 4O2LA 1H2AS 3BX1A 3KLNA 3OKAA 4LBZA 1GRRA 2WRZA 3RRZA 3RRJA 1WVIA 1DAKA 1KTVA 4AMGA 1DWOA 1T15A 1BWPA 2D7CA 3WIOA 3EIWA 1VGQA 2FRXA 1O57A 5T4EA 1HR0B 1SIOA 3GCWA 3OFNA 2C96A 2WPDA 3PTZA 5LQDA 1Z2CA 3GLGE 4B2PA 1OIXA 2ECFA 4TMTA 2X5JO 5BQOA 1ZG3A 2QS9A 4FD3A 3ANTA 4PC7A 4WKGA 3HDGA 5GONA 2B0CA 1QV6A 2YVUA 1U3TA 3JTMA 3H18A 4HSEA 4M86A 1E8MA 3BSFA 1M1YE 2P5SA 3L0CA 4RLQA 5HGJA 4L28A 4YAFA 3G2OA 1N2GA 2R85A 2W93A 3CW8X 3BMNA 3PFBA 1KGDA 2MYPA 2OORC 4GWGA 3F6YA 5D00A 5P8WA 4F3RA 2FR0A 2O2IA 3CEHA 4HNGA 2WV9A 3LWNA 3S1AB 3WWOA 5CJPA 1FY2A 1EDDA 2DBZA 1NNLA 2JANA 3FBWA 4UTZA 3UWMA 4KW7A 2GTIA 3LI2A 1L1EA 1FSZA 3COYA 5TB5A 4TQUS 4Y0NA 4K81B 4B45A 2C2XA 3OX4A 2A84A 5BMOA 4JXXA 2IXGA 2IW1A 4X61A 3SSOA 1Z6ZA 1HL3A 2WZCA 1YBMA 5K2MA 4H1TA 3TJMA 3WWEA 2HLDD 4DTCA 3FWPA 3W3AD 1T43A 3WNZA 3B6ZA 1JHMA 3T1OA 4F2DA 4ISBA 3GUCA 2CMGA 1HZJA 2PRYA 5I9NA 5CLLA 2BGGA 2W2QA 4MP3A 1A5AB 2ZREA 3M3HA 4FT2A 2I4RA 2C82A 3EUWA 3UMFA 3EGIA 1W0KD 1NBOA 4KO8A 5ARBA 1O96B 5CAEB 3L84A 1SXJA 2XT9A 2YV3A 1EWKA 4EHFA 2O8CB 4MCJA 1XDGA 4EO7A 2QL5A 1UXGA 4RNDB 4TX1A 4NU6A 4K6GA 2AZ4A 3ZDBA 2HF7A 2JLXA 4WCDA 3UJAA 4PX5A 5JAIA 1UDAA 1NM5A 2I65A 3L18A 1JJVA 2AXNA 2BN4A 3M6AA 3QFFA 4YMLA 2OHJA 1ZINA 4QE3A 4U5QA 4ARIA 1F0NA 1ZQ1A 4YJDA 2P90A 1QHEA 2HK9A 4RKWA 3KT0A 3WLPA 1TLFA 4M6WA 3LW8A 1GKUB 1WCYA 2PYZA 4DARA 5HZMA 5JAMA 2QW8A 4MI1A 2M1XA 1QF7A 3DZ8A 4UAJA 3E5HA 1D09A 3OT1A 4YYZA 1NURA 1OE0A 1BFUA 1RLOA 5EHQA 4CGYA 5L4NA 5HIJA 4U2CA 1BN6A 2WFLB 5JVDF 4YP7A 3PX2A 4OQXA 5IULC 4BIIA 4FZ5A 5T3UA 2IGTA 2PMWB 3GJ7A 3JAMA 2Y99A 4QT4A 3GVIA 2ODBA 1EJBA 4PG4A 5E0OA 1EBBA 3VH4A 1ZMRA 4FR5A 3O3CA 1DKUA 3RIXA 4YPOA 1R0RE 1JLMA 1LS6A 3A9SA 3JVEA 3M6FA 1MQAA 2ZBGA 4OA5A 4NVRA 2YYSA 2XCLA 2EHDA 1FJ2A 3THYA 3QWFA 4D3FA 4M38A 4WQMA 3M34A 2C99A 1T1IA 2WIDA 1HORA 4JI4B 1JRLA 3WA6A 5BNZA 1U5BA 3UG6A 3AFGA 3KPUA 3P9ZA 2DH6A 2I2XB 3QFCA 3TEFA 3QA3E 3KU1A 2NTEA 2C7QA 2GD2A 3IPAA 3FWKA 4YBRA 5TT1A 4RABA 1W9MA 4JLVA 1DI0A 1H4QA 1V2GA 3T3IA 4MV0A 1B42A 4D9HA 1N6OA 3O8QA 4FVTA 4DV4B 4GQIA 3A2LA 2OLEA 4CTNA 3QNUA 1Z0FA 4M0FA 3W6UA 3AEKB 1NBEA 3BGWA 4QELA 4Q3LA 5ALUA 4J3JA 3U7QB 4I36A 2ZRBA 3LT1A 4L27A 1H3FA 3MJFA 3FKSD 2Q5CA 4QYIB 3JAKA 1T4CA 3UAVA 4O6VA 3K9CA 4B3MB 2OQRA 3FVQA 4O02B 1IOVA 2JFGA 3BTUA 1M2EA 1J2TA 4CL8A 3T5GA 4FFLA 3FYDA 2QN1A 3N2GB 3F6SA 1JEJA 2XMSA 4NARA 4RYLA 3SZUA 4EHBA 4PXYA 3QPUA 4N4AA 3IYLW 2AVDA 3C3KA 3WLNA 4YUWA 1AC5A 3UXYA 3PXCX 3D7SA 2W6IA 4BN4A 2H4ZA 4BO6A 1OT3A 2ERXA 2BF7A 3D6MA 3E53A 3G3EA 2AOXA 1NPYA 1SG9A 4RZQA 4Z4EA 1YH3A 5LBIA 4MR7A 1T3ZA 3EIQA 1JQ3A 4B3IA 4YALA 1BVUA 2QTHA 5FULA 1N1GA 1HYQA 2P6MA 3DXZA 5EE0A 1ONSA 1QOZA 3STXA 3ZHSA 3HXMA 3OSUA 3B3FA 3G2JA 3HKDB 3KZMA 1ZW6A 2JF0A 1NBHA 4ID3A 2IEYA 1J8MF 3NTRA 4K28A 4MVYA 4UATA 3ETNA 3N3BC 3ECCA 3HKEB 2DERA 4ZZ2A 2JRLA 4HWOA 3DKRA 2A0YA 3X43A 4N03A 5K0ZA 4DJAA 2FFJA 2FSGA 1IUNA 4EITA 1E98A 1GQSA 5TF4A 4RTKA 1FU8A 5JANA 3DM5A 1JQEA 1NXOA 2RIPA 3AHEA 3W05A 3ZQKA 4EJ2A 5JASA 1NQUA 2PT7A 3BOSA 4AKSA 1Y8AA 1WMEA 3W6NA 2XMPA 3ORYA 2IUEA 1E1NA 1AMNA 1JEQA 2FOIA 3D8SA 3ZHBA 4DC9A 2D5LA 1MX3A 5BMVF 1AQJA 3BSYA 1Z9BA 3FTCA 2NN3C 2WVAA 4A8PA 3DVQX 3IVRA 1KO4A 3H19A 1SM4A 3HU3A 3U3KA 1HTBA 5FTNA 1B73A 1G3RA 2R6CA 2CLFB 3FLBA 4OQZA 4YT4A 1Y3HA 2EERA 3ZZUA 5BNIA 2BDTA 2ROQA 3OQBA 4AQ7A 4QEZA 2ZSKA 3SYKA 2QU8A 5HJ5A 2D7DA 2DKNA 4BKOA 3E2IA 5JSZB 1WDLA 2GK4A 3A32A 5COQA 5SICE 3KUUA 4WLNA 4TZ0A 1RABA 2PD6A 4GP6A 4RVDA 4Y6OA 2CL5A 2CDCA 4H08A 1P2TA 1B1CA 3IDOA 5HE9A 3ZNOA 2MIIA 1LVGA 3F3MA 4UFPA 1K7YA 3Q4GA 4IMRA 5H3HA 2ZW9A 4ZV7A 2Y0PA 2C3YA 3GA7A 3K8OE 2F3RA 4J03A 2WQ6A 1NBMA 4NIMA 1KQNA 1JU3A 1RI2A 2LNDA 2UZ0A 1Y81A 1Q21A 1J33A 3PQ5A 1TTTA 5IX8A 4BASA 1ZXLA 5T4HA 2J32A 1YQXA 3TQOA 2AR7A 5E4YA 3FOFC 3MGKA 4K2AA 3TYXA 1PZEA 3BD8A 1NJ2A 2NPOA 3IVXA 2QGFA 1ECPA 3DJFA 3ITNA 3ZJVA 5EP1A 4N3AA 3H5TA 1Q6ZA 1SIBE 1JDSA 1QF9A 2OFOA 2H7YA 1X1QA 1JAXA 1Q50A 3E0XA 3EXFB 4H3KB 4XWGA 3ZWNA 3QPVA 3TWOA 3EA5A 4BP9A 1TC1A 1XEFA 2WKSA 4ARZB 2PSEA 4BS9A 3LS2A 5LR6A 4Q37A 4UTXA 3KUCA 3RSZA 4LRTB 4YWJA 4H1VA 3Q7RA 4JD5A 2BJVA 1VMAA 1YI1A 3CU5A 4B5LA 1JILA 1LRJA 4GM1A 1K92A 1JTEA 1J0AA 2QRVB 1MXHA 3LU1A 1RAHA 4DJJA 1YDMA 1B8PA 2A0XA 2W6JA 4XD2A 3NP7A 3UMJA 3J81k 1M8KA 3MMPA 4IGKA 4L3OA 3NKVA 5TR9A 5IF3A 4JU8A 4MQFB 4PQYA 2WTNA 5GP1A 5G41A 5C0OE 1KI2A 5F1YA 3DW1X 1E94E 3ND7A 1T8UA 2PPVA 1G3IA 1JJBA 1I5OA 1EE1A 1XD2A 2POQX 2WBLC 3O4IA 4LW8A 4M1EA 3V97A 2J9ZB 1CJTC 5I9BA 2IEGA 2KSQA 1T9ZA 4MQ5A 3ZWPA 1O9GA 4DKJA 4IF6A 4B31A 1VGVA 3N6VA 4O4IB 5I9LA 4BVHA 2O0MA 4I5FA 2EBFX 3PHHA 4JC0A 5KOJB 1GXSB 2G1UA 3O2JA 4ODIA 4WBXC 1Z25A 4RF5A 3IFSA 4WVFA 4YAIA 2HXGA 2NNWB 3MXOA 2HWXA 3FUXA 1UBUS 2JW5A 3PPYA 3QHPA 4LOAA 4LQDA 1VHTA 2FK7A 2RC6A 2Y66A 3ULKA 5L53A 3THWB 1JLLA 1HT2E 2RARA 2ZJBA 4E13A 4BB5A 2IYAA 4URXR 5K8CA 5ELXA 4HGPA 1J8YF 3FSEA 2CNOA 4JLSA 4JCCA 1O94A 3L6BA 2M6KA 5G2OA 5CA1B 3QG5A 2FSIA 1A8SA 2PLNA 3HR8A 1AD2A 2BKUA 1IYZA 1VTKA 2ZDHA 1E0JA 3NU1A 3NXKA 4GI2A 3EZFA 1OZFA 2BGLA 4I4NA 2HJ9A 3PGKA 3C3JA 5JO9A 2QHXA 3ADKA 3LBIA 4OMCA 4C4OA 2QQ5A 1I6WA 1LDNA 3SQNA 2HWUA 2I2AA 4NEGA 4AB1A 5WRFA 3STWA 3LV8A 2BMDA 1UPAA 2CDAA 4FFWA 4LY6A 1BQEA 2JFNA 4RLFA 4UEJA 2R8YA 4KX3A 4Y2GA 5DEIA 4DVJA 1TVEA 1L5QA 1QB8A 5A0FA 3AKZA 1O6CA 2XCQA 5F7JA 3KVNA 5CFNA 1NVEA 3LKZA 1GN8A 1GG8A 3EY4A 1IM2A 2DY0A 4KWIA 5CX1A 4DLKA 2Y4NA 2I2FA 3Q2KA 1GGKA 5M3BA 4AQDA 3SC2A 1SXJE 2JKYA 3O9ZA 5D3MB 1UP7A 2GLTA 1NSFA 3OKPA 2QP4A 3L1IA 3OO0A 4JDPA 1EGQA 3D7LA 4G67A 3T0FA 5E2BA 2RE8A 1MN6A 4ZVVA 3ZTWA 5BNTA 3K9LA 4ZI7A 4R9SA 4GQBA 2HQOA 2H1IA 2XOKA 5TS3A 1Y8RA 1NW6A 1TJNA 1Y5MA 2OUIA 3OH8A 4LGVA 3PZRA 5AKIA 5AP9A 3EVZA 2MSKA 1YGPA 3FHOA 4WY8A 3SDSA 2WTEA 4HH0A 1NXTA 3GVPA 4FDVA 1V8DA 3MYYA 5JADA 4QTTB 3EZYA 3H9UA 4L8LA 1I01A 4DSTA 5ALJA 4QFDA 4L78A 5KREA 2AOTB 2FW7A 2HWWA 4PAQA 4NS4A 2X8AA 2GYUA 1CPYA 3A9RA 2O7NA 1PR6A 2H63A 1ZI9A 4LUCA 1P0IA 2R1ZA 4WE3A 5B53A 2HA5A 3UJ8A 4M76B 2ZBQA 3CKYA 1X7WA 1DKQA 3ORHA 5LA6A 3C43A 1FP4B 2ZQYA 5FPYA 4A4DA 1CJSA 1EZ4A 2R6DA 1XQVA 2AZDA 1XZCA 4MW4A 4Z8XA 3RTEA 3UA3A 1VLLA 5KNDD 1Z06A 4DIEA 1GYQA 2HAEA 2XRZA 1QP8A 1N0UA 1QE5A 4JJAA 3RYFB 3JQEA 3LNCA 1L7AA 3DEZA 4CR6A 3AZQA 4LC0A 4DMGA 4V1CB 2FMTA 4F1JA 2BBOA 2NU8A 1J0DA 1O8BA 2AR9A 5JBIA 1T0HB 1JF8A 3FGNA 4NFSA 1SRQA 4HNAA 4NJMB 3CH6A 4ER7A 2W2OA 4FMCB 5MN6A 1KNXA 2Z9BA 2JDID 2C1XA 4FFOA 4X95A 1GGEA 1R4MA 4G0MA 4XRRA 3V7UA 1EP9A 1ORVA 3MFQA 2GBGA 2VYVA 4MWEA 1PT7A 3MMSA 1I1NA 1Z4MA 2EFCB 2VL7A 2HRBA 4WERA 2QGZA 2PA0A 3I8SA 3K2QA 2FWIA 4HX2A 2RG1A 4MV9A 2XUPA 1CERA 4PG6A 4JJ8A 5AKHA 2ZIUB 3GMSA 3WLOA 1GV1A 2ZAOA 4O8ZA 1TJYA 4NENA 1B26A 2A7XA 3BH6A 3OCUA 2VT7A 3EG9B 5HHTA 1A8PA 1BMFD 1Q20A 2Q5IA 3W4JA 3ZIUA 2P77A 3AETB 4QUHA 3SHOA 4L75A 4R3WA 3FOEC 4KPEC 5KU7A 3F4BA 2E6KA 3SF0A 4AX8A 5FBKA 5CBPB 4CEHB 4ZKDA 4DMCA 3MS2A 3DC7A 1Z7EA 4X1IB 2P2GA 4B35A 2EXXA 5GJWC 4V0LA 3MK31 1BAPA 1USIA 2OGZA 1T13A 3BXXA 1LCIA 1KR2A 3EZ6A 1IJBA 2HZ7A 3U4QB 1HYBA 2IZ0A 2PU7A 3ZU4A 1YJBA 3AY6A 4B6OA 1AKTA 1JQ5A 2Y1CA 3SK0A 3VO1A 5IEBA 3MLAA 1NBIA 2ZP1A 3HVIA 1X1SA 2PTGA 4D3DA 3GUHA 4LTNA 3C2QA 3U7EB 4C08A 4BY9E 4KJXA 4YAKA 1Z62A 5IWAB 5JROA 2B25A 4MDYA 1BJRE 3JALB 5AI5A 1H2RS 3O2QB 5TMPA 2WWWA 3RSCA 4I5EA 1H9BA 2YJGA 2X4DA 5BN4B 1DE0A 4D80A 1ZNXA 1QHGA 1IFXA 2V03A 4KXUA 3VU3A 4AS1A 4LDPA 2V7QD 3NT4A 3GRVA 3JWJA 3G17A 1XZBA 1U5CA 3E35A 3D7RA 4X8MA 3WIVA 3BT7A 2HY7A 1Z4KA 2ZANA 1XMJA 2IU0A 5KSWB 3OA2A 1E2GA 2X9GA 1JX6A 1K68A 4U7HA 4DY4A 1FLVA 4JR1A 3SYTA 3WK7A 1PVVA 3A1TA 3PC8A 4DCCA 1HI9A 1DOZA 5KYWB 3HJHA 2YHBA 3KEMA 4LZAA 4U7FA 1EK5A 3GAMA 2YRFA 2UYHA 1A82A 1HSOA 4KQMA 5FOQA 1MD9A 4CKWB 5EZ5A 3RSFA 3DPSA 1N5DA 3R41A 4MEJA 4ZD6A 2PYDA 4X84A 1WSWA 3IXQA 2PX0A 3L92A 4JI5B 2XR1A 3NOOA 1JG3A 3PQ3A 4Q4JB 4R7ZA 3L1KA 3RASA 1WBBA 4R2WA 3BHNA 5LP1A 4LC9A 2BR3A 4UE6A 2JLUA 3WYCA 5DNWA 1AV6A 3ZJ4A 3WB1A 4I5GA 3HWWA 4OK3A 4Q1FA 4J9VA 4YWHA 2PCJA 4OHXA 2XQFA 1XROA 1DEAA 2I7DA 1IN7A 1KEPA 1Q95A 1XVVA 1YRWA 3OT5A 4QFCA 4QXQA 3MOIA 4B44A 1EDOA 1NVBA 1ZVKA 3UXMA 4UQLA 3E9RA 5A5VA 1P6XA 5HBGA 1QG0A 1H42A 2EV9A 3AFHA 2QRMA 1W35A 3D0QA 4Q02A 3MTEA 1IHOA 4AG6A 1DHRA 4AROA 4I55F 4D4JA 4Z4FA 5T8KA 2JAQA 4B6JA