4QO7A

Lactate dehydrogenase a in complex with substituted 3-hydroxy-2-mercaptocyclohex-2-enone compound 7
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qo7A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qo7A02
4EBFA 3P7MA 2NU9A 2A35A 4NBRA 4CLXA 1YL7A 2C54A 1CETA 3AUSA 4TSKA 5A9TA 1DIRA 5ES3A 2AHRA 4GGPA 3NV9A 3ZWAA 3CMCO 2X22A 1KVRA 1GUZA 3HB4X 1P1KA 3WBBA 1S6YA 3KYBA 4CLOA 5DULA 5L7WA 4JQCA 4W4TA 1EDZA 3NAQA 5T57A 4NIMA 1LSUA 5BSGA 2H9IA 4PLVA 1X7HA 4CMAA 2Y1OA 1PL7A 5JY6A 3G1TA 2CSUA 3HSKA 3QQPA 1K6IA 2G82A 1D8AA 1YBMA 1R4MB 2VZ0A 4RLHA 3QHAA 2IYOA 3O4RA 2SCUA 3SC6A 1YWGO 4ND4A 5FWNA 1EUCA 4YPOA 1LDGA 1WZIA 2UV8A 5FF9A 3DHNA 3NX4A 5IDYA 2VHZA 3RVDA 1T26A 1VLLA 5G2OA 4M87A 2D59A 2Z1MA 2IRWA 4ZU3A 4R1SA 2YHUA 9LDTA 2VN8A 3MWEB 3BHMA 4LW8A 3AM5A 4J1TA 3H5RA 3V5NA 3F5QA 1ENYA 3ROKA 4J6FA 3E9MA 1AXGA 3QSGA 4WCFB 5L4NA 2Q1TA 2YQ4A 3R3JA 3WLFA 3C1TA 3WGZA 3RBZA 2POQX 4RDHA 1IB6A 2B35A 3RUAA 2GDZA 1J0XO 4DIFA 3WIEA 5ENDA 1DIBA 3PGJA 4PG8A 1V3UA 1JTVA 1LDEA 2O2SA 2PGLA 1ISJA 2OMEA 2UAGA 2Q49A 1H6BA 4ITUA 1LLUA 3PHHA 3FR7A 4CM3A 2AW5A 3DQPA 1GZ3A 4Q3BA 3BHJA 4EUFA 3VH1A 1QR6A 4OO3A 3RQSA 1MB4A 3DFZA 3H5NA 1Y8QA 1M6WA 1PGOA 3EDMA 4WUVA 3DZFA 1UZLA 2YFQA 4IJUA 2V6GA 1PR3A 5CG1A 2RAFA 4LSWA 1DSSG 3M2TA 1U5CA 5A3VA 4RVSA 1Q7CA 4XWYA 3WFJA 3TOZA 3WGOA 3V2GA 5JXWA 3ZV4A 3P2OA 1XA0A 1SCUA 2DFVA 3O8QA 1H2BA 2IODA 3WDSA 3DBRA 5G4KB 4OL9A 1EMDA 2P9CA 3EC7A 3BYZA 1NPYA 4DYDA 1DIGA 1IHYA 3ZV5A 4B79A 1N2SA 1W0CA 1IPEA 2UUOA 2WMDA 3NGLA 3R6DA 2Q4EA 4PRKA 4TRMA 4YRBA 3ZW8A 2H5LA 1GAEO 1ZMOA 3AUTA 4FD3A 1VRWA 4RO0A 4Q3AA 4DGSA 5JDIC 1NFFA 1D4FA 4NHEA 3JQAB 2DQ4A 3FD8A 3JQFA 1RJWA 3KYDB 1U8XX 3IOYA 5JW6A 4EITA 2RHRA 2J8ZA 2VNSA 3OM9A 3KLPX 2FRDA 1XCBA 2P9EA 3GNTA 3PXXA 4XDYA 2QQ5A 2PTGA 4RGBA 3UF0A 3ETGA 2W2KA 3PVZA 4OMUA 1SMKA 1NHGA 4AJLA 3GG9A 3HWRA 4OM8A 5EN4A 3RU7A 2HQ1A 5AVOA 4K6FA 1SOVA 1YB1A 1TT7A 4R4JA 3FNEA 3OP4A 1V3TA 3WSVA 4BNMA 2BMAA 2JCVA 3ZWPA 1U1IA 4G2NA 5ILGA 2VYND 4IXTA 4P4NA 4E6PA 3TZHA 2J3JA 2EGGA 5K9ZA 2OOSA 3A14A 4XDZA 2YV2A 5I8WA 1PJLA 3FI9A 3ZZNA 3S2EA 1LLDA 1Y9AA 1GR0A 7MDHA 3L0DA 3K92A 3C3XA 1LTHR 3FN4A 1ZCJA 5C5IA 4XJTA 3F4LA 3WIDA 2FOIA 2R6JA 4YJHB 4E12A 1NTOA 3DTTA 4E2WA 4Z9YA 1W8DA 2WEKA 3EYWA 1ZK0A 2HSDA 3SBOA 3KSUA 3MJEA 1O89A 1LNQA 4Q9NA 2ZJ1A 3JQ9A 4Y6PA 3AWDA 1J6UA 2YDXA 4IQ0A 1PJ3A 1FDTA 1DJQA 4CM4B 5JCJD 1TVEA 3DC2A 1LQTA 3DB2A 1LSJA 1N9GB 1QSGA 3RFVA 2X1HA 3GVPA 3U0BA 1GPJA 2VTEA 1U5AA 4XB2A 2BGLA 5JO9A 3TFOA 2Q1SA 3E1KA 3OA2A 3VH2A 2LDBA 5TNXA 3UHAA 3OF2A 5H82A 1YB4A 1P3DA 3WTBA 1C0PA 1B8VA 1HE4A 1N5DA 2XXBA 4LN1A 1E3EA 4ZHSA 4NZ9A 4NPCA 2E6UX 2Q4BA 4Z0PA 4BO5A 1GD1O 3X2EA 4CM9A 1W4ZA 4BNXA 3EY4A 1MXFA 1R0KA 3ASUA 3GLQA 3T4EA 1H2HA 3W4JA 4J2OA 2DPHA 3IKTA 1D7OA 1IHXA 3ON5A 1ISMA 2RIRA 2VTDA 4DC1A 1M66A 2FR0A 2CDAA 3MZ0A 4QFCA 3ZU3A 3MJTA 4FDAA 5C7IO 1YBAA 1LI4A 2VRCD 5KVCA 1KEUA 3NT5A 4GX5A 4DC0A 2BI7A 2IZ0A 4IDGA 3TOXA 2GPTA 3UFXA 3EVNA 3A28A 5KCZA 4CM7A 4N18A 3E8XA 1OC4A 3NUGA 3CH6A 4BGIA 3LT0A 2O3JA 1I3MA 3RASA 1VSVA 1BVRA 3IKVA 3K2EA 4BVAA 3CZMA 3WG9A 3JQBA 2Q50A 4I5GA 4ZQGA 1UDBA 1I33A 2HAEA 2Y66A 1DC3A 3DAGA 3GEDA 5A3JA 1TLTA 2ZTMA 3D4NA 3QE3A 2P91A 4DPLA 3WNVA 2GSDA 1FMCA 4IJVA 2WD7A 3VPXA 1LLCA 4F6LA 5I9NA 2DTXA 4MVJH 4DREA 1C0KA 1C1XB 3E03A 4BNLA 1G0NA 4NBTA 5BSHA 1WVGA 5EESA 2LDXA 4HX5A 1R4NB 1KBZA 2YDYA 1L7EA 2YV1A 4WECA 3K5PA 4FFPA 2EXXA 1P33A 2C82A 2JFHA 3PIDA 5AXDA 3LT1A 1E77A 1BTOA 2HLPA 3PQDA 4TVBA 1ZJYA 1WMAA 2BFMA 4KMSA 2ZYDA 1E7MA 3GGGA 3RC2A 5A4DA 1O9BA 3ANMA 1OI7A 1I8TA 1R16A 1GQQA 3KUXA 3DL2A 3I9KA 1HEUA 3DMTC 4B8ZA 4CPDA 4OKIA 1PS9A 5DZSA 4CQMD 5A9RA 1GADO 2CNBA 4AJHA 4RPGA 4ZJUA 4P4LA 4BKOA 3TZCA 1X13A 5FFFA 3DZBA 3HFSA 4DQVA 4NH4A 2AEFA 2AEMA 3M6IA 3WOHA 4IBOA 4J1QA 3DBHB 1K5HA 4LRSB 1ZIDA 2AQIA 2C29D 3Q11A 3I4CA 5H83A 5T6BA 4CUJA 4OQYA 3LSYA 4E5MA 3QP9A 4AJIA 2OGUA 5L40A 1O95A 1LDBA 5JDCA 3D64A 2ZB8A 4LVCA 1QRRA 1P1RA 4MIOA 5CEFA 4TMFA 1LSSA 4LK3A 3K73O 4W99A 3WS7A 1XYGA 1DEHA 3FF4A 2B37A 1FDVA 2PH5A 2HJRA 2WE7A 3UUWA 2NTNA 2RBEA 3INTA 2PD3A 3PLNA 4WOJA 1HDXA 1KS9A 3AY6A 4BKRA 2ZQZA 2O3SA 3GF4A 1LBEA 1H6CA 3ANLA 4AICA 1SEVA 4CMIB 3OFSA 3Q3CA 2EW8A 4R9SA 4XX0A 3OIFA 4AJ4A 4J16A 3IP3A 4E2ZA 2NM0A 3B1KA 2O7SA 3F1LA 3OEWA 1HZJA 3ZHYA 4BKPA 3ZNPA 5ICSA 1HDZA 3DOJA 1UP7A 4QTZA 1PJBA 3MOGA 1C1DA 1J4AA 1NR7A 1V0JA 4GWKA 1MA0A 3D1LA 3QWHA 3WYCA 3L6DA 2VUTA 4QUKA 1BDMA 4E0BA 1QKIA 4JIGA 3H8VA 3L4BA 5I8ZA 1TA4A 3PRJA 3UCFA 1F8GA 4XYBA 4YT8A 4MP8A 2IZZA 3CXRA 4HWKA 4ZQBA 3ADPA 2FP4A 3C7AA 4UVIA 5IJZA 4NBWA 3T7EA 5JFOA 3JYQA 2BLLA 3UKOA 4WKGA 2EW2A 1KVQA 5GZ6A 1P44A 4HBGA 4FS3A 1O8CA 5G0TA 1XHLA 3GNQA 1A9YA 2EV9A 3OETA 1R6DA 1U2GA 1UUFA 3QRWA 3NJ4A 4CMCA 3TF5A 4KQXA 4NQZA 1Z7EA 2NACA 5U4QA 1ADGA 3DZIA 1BXGB 1MXHA 2B69A 4P38A 2PWZA 3KTDA 4A7PA 4ALLA 4B4OA 1FF9A 4EEXA 4RF5A 2EHDA 2Y0EA 4MO2A 3WGQA 3O9ZA 5AXBA 5F5NA 4WOKA 3OJ0A 3RAJA 3VKVA 4NFYA 3WMXA 2BFPA 3KXDA 4IDEA 4H16A 4JXKA 3ST7A 3TPCA 2BH9A 1CERA 1YB5A 2J5KA 3HHPA 1Q0LA 3OBBA 2O4UX 5HBRA 5IF3A 1JW9B 1T2DA 4EGFA 4PG4A 2JD0A 5TF4A 1KEWA 2WTBA 1NVGA 4DXHA 4Y67A 2EG9A 3PHLA 4YQZA 1A27A 4BL5A 4G81A 4MVJG 3RBXA 3DBVO 3ZWMA 4NG5A 1DBVO 4PLZA 5U9CA 3BMNA 3BMOA 4UUMA 4ZD6A 4Q3EA 2A94A 2NTJA 2W90A 1B8PA 4K6CA 1BW9B 4D3DA 4CM6A 2P5YA 4E5NA 5AQ1A 1NQTA 5T5QA 2W8ZA 1DC6A 1D1SA 2BF7A 3GVXA 3L07A 2PV7A 1A4IA 1SEPA 5A03A 2ILTA 4GAEA 5C7OO 3QWAA 2E37A 2BFAA 4R54A 4A03A 3ZWNA 5JCJA 2VWPA 5GZ3A 3WJAA 2X0RA 2JHFA 4RV9A 3WBFA 2WE8A 2VRBA 3NT2A 1DIHA 1PJ2A 3QV1A 3U4HA 4ZRMA 1ONNA 2ZTLA 3WICA 1M6HA 1QLHA 1WPQA 3U4CA 5JAZA 3KSZO 3GRKA 3NYWA 5JSFA 1TI7A 1UP6A 4R41A 4ZQFA 1WLYA 3RFTA 3EUWA 3KEOA 3R3SA 3V1TC 4AJJA 1L1FA 4MVJD 2X23A 2QZZA 3OSUA 2PZMA 1GU7A 1JVSA 1Y8RA 3FWNA 3W1VA 2C07A 1QMGA 1DO8A 3ANNA 3JQ8B 4OXKA 3QLJA 4L74A 3Q0EA 4FCCA 4I9NA 3VC7A 2QZ9A 2W2LD 4K1LA 4JCOA 4DIOA 3PDUA 2X5KO 1X0VA 4PIVA 4YJGB 4BNGA 2EWMA 1E3WA 1TB4A 2VRCA 4DYVA 4CLOB 1BG6A 4F3YA 4XIYA 5G0WA 1E3JA 5TQVA 4DPKA 2YYYA 2Y99A 3JQEA 1LC3A 2V6MA 1ZFNA 4NJOA 1NM5A 3A9WA 4UEJA 1I3NA 2Q99A 1KEPA 4E2YA 1NFRA 3EMKA 3DHYA 4BMSA 2ZTVA 2CY0A 4ZQEA 3HJAA 2B36A 1XWFA 1VJ0A 4ALJA 1I0ZA 2EKPA 3A4VA 1RM5A 1XU9A 2F1KA 2OP1A 2PD6A 3H3JA 1GYRA 3VDQA 4BMVA 1LDYA 1VKOA 1Z75A 2I3AA 5JLAA 4BMNA 4I9UA 4BNIA 3BA1A 3PWKA 2CDBA 1E92A 2QHXA 1HZZA 1MFPA 4FB5A 1BSVA 4XR9A 1YKFA 5TT0A 3JD0A 5KJCA 4CUKA 4BO0A 3DBLA 2AQHA 1NHWA 3I1JA 3Q1LA 4B7CA 4BO7A 4CMEA 3UICA 2NQ8A 3E18A 2PK3A 4XGIA 1PZFA 4GVLA 1E1MA 1E6WA 1FK8A 1P45A 1Y5MA 3NKLA 3LK7A 1WMBA 3K9QO 4ESOA 3TL3A 3E5MA 5F1OA 4BQRA 3GN2A 3U4IA 1PWZA 3IQDB 3QWFA 2GYYA 1NVTA 3WWZA 4CQLA 5BQFA 1YQGA 5AXCA 1CF2O 2DBZA 4ZN6A 1BDBA 1PJ4A 3WLEA 1SOWA 3H7AA 3ETDA 4E4YA 5JS6A 1SZJG 3PEFA 2PD4A 2QX7A 4R3NA 2YHIA 5CDSA 4BNUA 5JYEA 3U09A 1Y81A 4N54A 4CQMA 2J3HA 3VPFA 4URFA 1Y8QB 4O59O 1NWCA 4FBGA 2FPPA 1R12A 1XKQA 3JYNA 1AHIA 1NBOA 2C7VA 4PZDA 2VUSA 4IMPA 3GR6A 3HE3A 4JJIA 1P31A 3WGIA 2YFHA 4DMLA 4FJ0A 1U4OA 4WLOA 4J90A 3H2ZA 3HADA 4R1UA 3NEPX 3TWOA 1NAHA 1E5QA 3DTYA 3O8QB 3DBRB 5IZCC 4UVHA 4UAGA 1LUAA 1BXKA 3PYXA 1LA2A 1PIWA 1XLTA 1WZEA 2OBNA 2AG8A 2P9GA 3JD2A 1JA9A 2ZKLA 1MUUA 4OXYA 1P0CA 1EFKA 1JKFA 2VWQA 4RQUA 1ZO8A 1YDWA 4QEDA 3DOCA 4KP7A 3COSA 1H6DA 4U6QA 4TQGA 2PGJA 5L53A 2BGKA 3OECA 3E9QA 1H9AA 3DFUA 3CEAA 4W9NC 4CMJA 1HE3A 4KTTE 1MX3A 1E3LA 3JQAD 1K89A 2BI8A 4Y6SA 4YQYA 1Z45A 1ONPA 4RQTA 4UUNA 1I3KA 5DCUA 3OIGA 2AE1A 2J6IA 1ZK3A 1NAIA 2EKQA 3S8MA 2EGHA 1P77A 3E82A 4AJ2A 5A04A 5DOZA 2I76A 4B8WA 2Y1GA 2W2KB 1LC0A 1A5ZA 3LT2A 2R00C 3AU8A 3GOHA 4B7XA 2DM6A 4PLYA 3L4SO 4WASA 2CD9A 4YYZA 2PFGA 3Q6IA 1R0LA 4WLUA 5COAA 1ISHA 1EUDA 4A27A 3AOEC 3PLRA 4QXMA 4RVHA 2AA3A 1UDCA 1VE9A 2Q2WA 5DBIA 1ULUA 4GLOA 4BNHA 4C7JA 4BGEA 2UUPA 3WQSB 4YBZA 1BGVA 3DAPA 3CKYA 1HDOA 3ONEA 4J7UA 3CMMA 3WMWA 5ENVA 1K0UA 4D0SA 4RDIA 4FJ2A 5TRTA 3VHRA 2IEDA 3N74A 1ZK2A 2BGMA 1ZUD1 4HADA 4PVDA 3SX2A 4ALNA 3B70A 3EHEA 3PK0A 4KDEA 3W8FA 1YL5A 1BXZA 3PPIA 4MJLA 4OOFA 2CZCA 4U0JA 4XZ3A 5FI5A 2HDHA 4QQRA 1XEAA 4OOEA 2FR8A 4BNNA 2VT3A 3UGKA 2X58A 1OZAA 4IQGA 2FN7A 1J49A 4QSMA 5IAAA 1LXCA 3HZZA 3ZWWA 1HDGO 3T4XA 4HFMA 4IZHA 1EQ2A 4WK6A 1XGKA 2I9PA 2V65A 4YAIA 3W8DA 2WDZA 1N92A 2CVOA 2NU8A 1UZNA 1G1AA 1A71A 1AHHA 1VJTA 1WDLA 1UXJA 3PJGA 4MIEA 4P22A 3PWSA 4EDFA 4KWHA 1GL3A 3WXBA 3AY7A 3D3WA 1DC5A 2RCYA 2FPIA 3GC6A 5TT1A 5BSEA 5ADHA 5JDIA 1DRUA 2OFPA 4BNTA 2NVUB 2ZYAA 1IY8A 3F47A 4NFHA 5CAEA 3I9JA 1TT5B 4CV1A 5I7FA 2D0IA 4XIJA 3VOSA 1LJ8A 4CR7A 2HU2A 3JQ7A 3PGXA 3O03A 1LSOA 2JKVA 1NYTA 2HKIA 1OMOA 1EVYA 1B8UA 4LCJA 2FZEA 3K6JA 4U5QA 4BB5A 3KHUA 4PZEA 4CODB 1HRDA 4AVYA 1E6EA 3Q9UA 4YAGA 3JTMA 4MVJE 1MC5A 1I24A 1O0SA 1WNTA 4R69A 1ZW1A 4YJFA 4PLWA 4GBJA 4Z9XA 3L6OO 1QYVA 2HCTA 3AUAA 3HDQA 2DAPA 4CMHA 1DOHA 1EBUA 2O3QA 4BO1A 3QJ5A 4MVJA 4JBIA 2X5OA 3G1UA 3GT0A 3L77A 5EQDA 4YRAA 3JQGA 3EK2A 2ET6A 1K6XA 5KOIA 2WD7B 1ZBQA 3ABIA 4DQUA 3OJOA 2WSBA 2NSDA 4EI2A 2HMTA 1H9BA 1NQ5A 4D3SA 1QLJA 2X0NA 5A02A 3D5QA 2Y1FA 4A26A 1ENZA 4JROA 1Z74A 2YV3A 2GN4A 3JD4A 5CDUA 2VCYA 1HT0A 3VTZA 5BT9A 4XR4A 2C0CA 3GNSA 5TIIA 4TRJA 2BD0A 4XCVA 1DFHA 2VHVA 4WNIA 4WPGA 3ZV3A 4RPLA 4Q39A 3ITKA 4BNJA 2C59A 1ZSVA 5A05A 1R4MA 1P9LA 5IN5A 4EEZA 4YT2A 4AJOA 2D8AA 1CIVA 1UR5A 1U7HA 2O23A 2PKQP 3JYPA 1ZEMA 4IGEA 5COQA 5COBA 1GCOA 4WLEA 3VH4A 1MV8A 1PTJA 1F12A 4O5OA 4NI5A 3DZJA 4QO8A 1LX6A 1Y5RA 4WLVA 1IYZA 1N8KA 1B16A 1BVUA 3LLSA 3X2FA 3RUFA 1QXSA 4Q3CA 1CWUA 3WR5A 4NK4A 4CLRA 5HS4A 4DVJA 1BHSA 2QYTA 1B26A 2ZJ0A 1OBFO 1MG5A 1I01A 3FSRA 2WYUA 3JQFC 4XJSA 1Y7TA 1MP0A 4WCFA 1EUZA 2PR2A 1DHRA 1XQ6A 4IM7A 1WWKA 2GN8A 3PWZA 3KEQA 1K2WA 1E5LA 4KTVE 3SJUA 3BMQB 5AXAA 3MWDB 4XYEA 1DFGA 1QV6A 1GUFA 4J43A 3NRCA 8LDHA 1U2DA 1SBYA 2GR9A 4G65A 3VH3A 3PZRA 1JAXA 5FI3A 3V2UA 4A5OA 3RSHA 3SEFA 3AW9A 1JLLA 4U7WA 2VOJA 5TX7A 4X54A 4GX2A 1PWXA 5TGDA 5KJ1A 2O4CA 1NX6A 3KSDO 4I5EA 2CUKA 3P2YA 4DRYA 5JAIA 1EBFA 2W98A 4CUZA 2A9FA 2WYVA 1EVJA 5I9MA 4YAJA 1EK5A 1IUKA 4MKRA 5MDHA 3OICA 2JJYA 3BTUA 1HDRA 4BV9A 4L4SA 1A72A 1YGYA 3BMCB 4DIBA 4PLHA 3HUDA 4RF2A 4RVUA 3VVCA 4D46A 4FJ1A 3RIHA 3GFBA 4PLPA 3FTPA 3DXFA 3H2SA 3JQ9C 5G4KA 4D3FA 2ZB4A 4RVFA 1ISIA 1QV7A 4BO6A 2AMFA 5JNLA 1I36A 5HS6A 4CMGA 3ROMA 3DDNA 2GZ1A 1EQUA 1E6UA 1LDMA 1LRLA 2YY7A 3BZUA 1PZGA 3IJPA 3WGGA 3C7CB 3FRJA 5F1PA 1VI2A 4ND2A 3WYEA 4CMEC 1DC4A 1YQXA 1ULSA 1U28A 2CVQA 3AFNA 1T25A 4GMFA 3RJ9A 3JQAA 1XDWA 3RKUA 2AQKA 3E9NA 4L75A 3V8BA 1YS4A 3KYDA 2Q2QA 2PKQO 1T4DA 1EFLA 2H1SA 1HSZA 3W8EA 2CVZA 4IGFA 4J2HA 4IDDA 5CG2A 3C1AA 1CYDA 2IXAA 3NDRA 2E82A 1JKIA 3ZWOA 1TEHA 3GQVA 3NGXA 1X0XA 3ZWBA 1U9JA 3ASVA 5DBFA 4BNKA 3ZW9A 3UN1A 1XQ1A 4DUPA 1IL0A 4FGSA 3WGYA 4W82A 3BTOA 4J4HA 1FXSA 1HYHA 3BMOB 4UULA 2WYWA 4FC7A 3OJFA 3OH8A 2IE0A 3AI3A 3DR3A 4R5HA 4GSLA 3STHA 4AJ1A 5EL0A 1ZMTA 3SC4A 4CJXA 3DONA 1ADFA 1Z82A 2TMGA 9LDBA 5A06A 2C7GA 3WGTA 1YVEI 3L9WA 3JQBC 4ALKA 1ID1A 3GA0A 4I5DA 5EMHA 2G5CA 3VAZA 2C5EA 5L4SA 5DP1A 2NVWA 1E7SA 5DDIP 5IDWA 1M2WA 3TZ6A 4HFRA 2GN6A 4Z0TA 4PN3A 4J4BA 2X9VA 1YH3A 4CV3A 1ONOA 5JAQA 1UXHA 1XELA 2X7HA 3AFMA 4W7IA 2VWGA 4FR5A 5KJEA 2C2XA 4OQZA 4WLFA 1PZHA 1T24A 4AG3A 3Q2KA 5KWEA 3RUHA 1HSOA 2HMUA 4GWGA 1IOLA 2GZ2A 5CEJA 4HV4A 3KVOA 4QX6A 3L9XA 4PRLA 4R1TA 4E2XA 3F5SA 4GMGA 4Y6RA 3RWBA 3W6ZA 4LSMA 1ZK4A 1DJNA 3ZNNA 1T4BA 4YRDA 3ZWCA 1Y8RB 5CHEA 5KVQA 3UH1A 4Z6KA 1I30A 2Z1NA 1GZ4A 3H9JA 3H3FA 3AM3A 1DB3A 3JSAA 1JU9A 1PS8A 3GZNA 4IIUA 2X8LA 3F1KA 3BTSA 5CDGA 3MOIA 4O63O 2PY6A 2B83A 4PG5A 1ISFA 2JL1A 2DFDA 4WCDA 3LF1A 3H5AA 4GL4A 1JDJA 2NU6A 4HY3A 3LZ6A 3WJ7A 1Q7GA 2PA3A 2GGSA 3RI3A 4RF3A 1QG6A 5C37A 2DUUA 1NR1A 2GNAA 1GEGA 1A9ZA 3BTVA 3GFGA 3B6ZA 4OYRA 5F5LA 2BKAA 2J5RA 4IZIA 2YJZA 3GEGA 4BNVA 5B4VA 2E4AA 2I5PO 4MDHA 4YAKA 1NWHA 5KVVA 4E5KA 3R0IA 4DWVA 4AFNA 4ALMA 2UYYA 3S2IA 4IS3A 5HM8A 2X5JO 3GVHA 2Q1WA 2DBQA 3GAFA 4RPKA 3DBLB 3SXPA 3OMLA 4EW6A 4IJWA 3RUDA 1GTMA 4K26A 1E1LA 4IMRA 3RJ5A 4A0SA 1H5QA 3GDGA 2C2YA 2PNFA 1Z73A 4NNJA 5ILOA 2IDZA 2GD1O 2F00A 3JQDA 3WYBA 1PGPA 2DUWA 2VYNA 4YJDA 2ZB7A 3MJSA 1F17A 1SB9A 1B3RA 2B0JA 3KO8A 2DVMA 3L4BC 3I9LA 4A73A 5THKA 3ADOA 4NJMB 1XSEA 4CQLB 2AEJA 3I9NA 4E21A 1MFZA 4PZCA 5B12A 4DBVO 3QVSA 5DT9A 5ER6A 2D4AA 3GUYA 4GGOA 4D44A 1O94A 3OJLA 5GMOA 5DNAA 3DMYA 2YHIB 2Y0DA 1OOEA 4N5MA 3O26A 3A06A 2AXQA 4N7RA 4FOOA 4YAEA 2I66A 1UAYA 4U8GA 8ADHA 2HRBA 1MC4A 5JC8A 1V3VA 1UJMA 2X9GA 1VJ1A 1P1FA 1KETA 1UXIA 5KVSA 6ADHA 2YW9A 1C14A 2O7QA 3AI1A 3DBHA 1DDOA 5LC1A 4CL8A 1GPDG 1GQ2A 2QRLA 1HE5A 1DIAA 1UXGA 1YOVA 5DOVA 3G49A 3HDYA 3PYLA 4CLDA 1M76A 4OJNA 1UAGA 2NQTA 4MVJM 2DTEA 4IUYA 1ZKMA 4OH1A 2OHXA 3NT4A 2E48A 5JBIA 1T1SA 1PSDA 1IE3A 1ZNQO 4XQCA 2YUTA 3I5MA 3IS3A 1KY5A 2X86A 2VHWA 5T8KA 3ZNOA 4QO7A 4BO8A 3ICCA 4KUGA 1E1KA 2X0IA 3S2FA 2P4QA 4D41A 4PLCA 4ND3A 5THQA 1HKUA 1AN9A 1GCUA 1X7GA 4YT5A 3D5TA 2X0JA 2PLAA 2NTVA 1JWBB 4INAA 4R5MA 2ZK7A 4I08A 4J0EA 4IS2A 3KYCA 2A4KA 2WM3A 5JMPA 1Y9EA 3KZVA 5HA5A 3VKUA 3VPGA 1P1IA 3RKRA 1F06A 4PLFA 1U3UA 3V1UA 1DFIA 3UXYA 4NDNE 1A7KA 4TWRA 4Y9DA 3PHJA 2NADA 3ENKA 1VM6A 4CR8A 5EJ2A 1NVMB 2FMUA 3ETEA 1ARZA 4IDFA 4AL4A 3GGPA 2NLOA 3OA0A 3RBVA 1B2LA 2FPGA 3LLVA 3EW7A 2BFOA 1EE9A 5LCXA 1JKJA 4Y98A 4N5NA 3LT4A 3FBGA 3HDHA 4E32A 4FQ8A 5JO0A 1YJQA 1ML3A 3P5SA 4EZBA 5BR7A 4OKNA 3QWBA 1BXGA 4ZQHA 4BB6A 5L7TA 2QRJA 1C0LA 2NU7A 3HN7A 3PI7A 3JYLA 3H9GA 3D7LA 5ER9A 3U62A 4HFNA 4GQAA 4I9HA 3D0OA 3RU9A 1AGNA 1I3LA 2HMVA 3EVTA 2Q3EA 3DHEA 5G0UA 2ZYGA 4BO2A 3GGOA 1RWBA 3ICPA 3C24A 3FNGA 4D42A 5KNLA 4OSPA 2ZIZA 5IN4A 4YT4A 4I5FA 3A1NA 3JCZA 5K6AC 4TRRA 2QG4A 3PZBA 1A4UA 2B4RO 5TLSA 2Z95A 2J3KA 4KZPA 3LC7O 5L9AA 1DLIA 1LLQA 1NXQA 4FFRA 4M54A 3PIIA 4R01A 4D79A 1KYQA 2JAPA 3D3WB 3E6AA 3RC9A 3I23A 4RORA 3DZKA 2GLXA 3JV7A 4IDBA 5L51A 1UZMA 3P19A 1N7HA 3LU1A 1IZ0A 3TNLA 2Y1DA 1X14A 4JBHA 1IPFA 5EQFA 3RC1A 1WXDA 2BELA 3TDKA 1ZK1A 3PFWO 2CF6A 3VTFA 4YEDA 4CM8A 5DP2A 2NUAA 1E7WA 4I1IA 3AU9A 3D4PA 1HXHA 4HNHA 4RPHA 2P4HX 4M55A 5DF1A 3TSCA 3HN2A 4YTEA 3AJRA 3PJDA 1KC1A 1FDUA 4NR0A 1AE1A 4RVGA 3IUSA 2H6EA 1CRWG 4ID9A 4E5YA 4OGWA 1KOLA 4B3HA 1V9LA 2V6BA 2I3GA 2OORA 3MCVA 5B1YA 4HXYA 1ZZEA 5EINA 2NWQA 4XQGA 3IC5A 4D7AA 5I9LA 4TVOA 1EE2A 3F46A 3GZ4A 4CLHA 3KV3O 2OBYA 1LRKA 2FWMX 2AG5A 1KVSA 4W7HA 2AQ8A 1DHTA 3E5RA 3HG7A 1X15A 5C3MA 4PLTA 4JK3A 1YDEA 1B3BA 4JP3A 4II2A 1A7AA 5TC4A 2PGDA 4JLWA 4J1SA 3LYLA 4G5HA 1HLPA 5LDHA 4Z0HO 3GN1A 1QYDA 4MPDA 2HRZA 5CP8A 1HYGA 2OXIA 3FPCA 3FR8A 2HMSA 4YJGA 1JQBA 2QIOA 3FBTA 4II3A 4R1NA 2O3TA 4PGFA 3IMFA 3N58A 3ZHXA 3DOOA 4RVDA 4U6SA 1Q1NA 2G17A 1SNYA 4FFMA 2E49A 4TZKA 4LMRA 1PS0A 1R37A 3GAZA 3HQ4O 4ZICA 1EK6A 2H63A 2XXJA 3CPSA 1PQPA 1VPDA 2GRAA 4BOYA 3G3EA 1OC2A 4E5PA 1E7QA 4DLLA 5TJHA 1V8BA 1YRLA 3HFGA 1PL8A 1U3WA 3AY3A 1NPTO 2Q1UA 1D1TA 5KKCA 1ENPA 2JFFA 4XYLA 1PJCA 1NASA 2EP5A 3RUCA 1T2CA 4DTIA 4CLRB 3CSDA 3QIVA 3IIEA 4CMKA 2VNAA 5ITVA 4XA8A 3BIOA 5A5EA 5JMWA 1U7TA 1Q0HA 4P4GA 3OQBA 1I2CA 1HYEA 1UP4A 1HE2A 4GVXA 4YA6A 3CE6A 3ZWVA 1HDYA 2DC1A 3JD1A 1E7RA 1YBVA 2VHXA 1IULA 4M89A 2Y1EA 1H94A 3WB9A 4BIIA 3GPDG 2FSVA 4WJZA 3ZH2A 5B4UA 1XIVA 4GH5A 2NNLD 1T2AA 5C7LO 5GZ1A 3GHHA 1X7DA 5TS3A 3PHGA 1CQIA 3OEYA 2D5AA 2GO1A 4TRNA 4AJPA 4OHUA 4C4OA 1KY4A 4DLBA 3RUEA 3TQHA 4BHTA 3UAGA 5A9SA 5JC1A 2B5WA 4W6ZA 1DLJA 3B1JA 3MEQA 4FW8A 4KWIA 2D1YA 1ZJZA 3W4KA 4B4UA 1JN0A 5JE8A 4FSHA 3PJEA 4XGNA 4YACA 2GCGA 3FCOA 3OIDA 4PG7A 2HUNA 3FHLA 4E13A 2NVBA 1J5PA 5HRUA 4M1QA 4WEOA 2NV6A 4BV8A 2RH4A 3D4OA 3QWIA 4L9RA 4FFLA 4H3VA 1YO6A 1DXYA 5BSFA 3GMDA 5FYDA 1PX0A 2IZ1A 1DPGA 2PZLA 2X9NA 2W2LA 1YQDA 2R2GA 3H65A 1XU7A 1QORA 2I65A 4Q3DA 1CDOA 4YWJA 2XOXA 1ZXLA 4BNFA 4D0RA 4JN6B 1KC3A 3ENNA 3GDFA 4D43A 5L4LA 1GV1A 4IDAA 4TZTA 2X4GA 5ICMA 4XB1A 3WTCA 3M1LA 4TKLA 1YL6A 4NFSA 3G17A 4DA9A 2Y1CA 3L6EA 1UDAA 2VHYA 4O6VA 4RJTA 4UVDA 4XQEA 1G6KA 2Y0CA 3GH3A 3LDHA 4EJ6A 3H4VA 5I7EA 2P5UA 3WQQA 5HWSA 3TFQA 3GRPA 5A1TA 1ADCA 5L45A 3ULKA 2JCXA 1PEDA 2JCYA 3Q9NA 4IQ8A 1AUPA 3EGOA 1ZXBA 2IYPA 4UUPA 3VZPA 5I7VA 1EZ4A 1U3TA 5KKAA 4B3IA 2W4QA 1RPNA 1Y6JA 2UVDA 2VZ9A 4TKMA 3PDJA 3PHIA 4MKZA 4WEQA 3U9LA 3ZV6A 1SPXA 4BGUA 2A92A 1ZSYA 1LQUA 3GVIA 2ZCUA 3M1AA 4JX8A 2VYVD 2EJWA 2DBRA 3WNQA 4E33A 2Y67A 4HKTA 3WFIA 2CF5A 2GERA 4LRTB 4PLGA 1HLDA 3OQ1A 4ROSA 3IUPA 4BKUA 1IZ9A 4ND1A 3QVTA 2UDPA 4MVJI 4GLLA 5G0VA 3SJ7A 1DRVA 4LISA 2XAAA 1GEEA 1LDNA 1PJTA 4NU5A 4AJEA 4R9RA 3H9UA 2JD1A 3QVXA 4Z3KA 2OO5A 3ZWXA 2IXBA 3ONFA 4CV0A 5CEEA 3WGHA 5AYVA 1PR9A 3RROA 1C0IA 1GFSA 2O48X 1CJCA 3RCBA 4XQ9A 5BNTA 1C1DB 1SO8A 1E3SA 1NP3A 2NVUA 1VL8A 4Z9FA 3S2GA 3PP8A 1TT5A 4P8RA 1N1EA 3D3EA 4KUHA 1ENOA 4BNZA 3F9IA 2EERA 3FNFA 3GZNB 4QFDA 1ZSNA 3I9OA 4EJMA 3KLMX 3RFXA 1E0DA 1GYPA 4BKQA 4BO4A 3U5TA 2B5VA 4OIMA 4GPD1 2EKLA 5MGBA 3RC7A 2OL4A 3PQFA 3ORFA 1ORRA 5DCWA 3DMTA 2V6FA 3LF2A 3I6IA 1R0SA 5A5FA 5IXSA 4MVJP 2C5AA 3JQ6A 2P68A 4R51A 5U1PA 4JBGA 4WCFC 4LMPA 4MINA 1Y1PA 1PGQA 3UCEA 3VPSA 3LC1O 3PYMA 3GEMA 4GX1A 3VZRA 3W6UA 3MJCA 3DO5A 4LCEA 1QYWA 5T67A 4UVGA 1VL6A 5F21A 1B14A 5JPIA 2CFCA 3RD5A 4HUJA 2HK7A 1HTBA 4MVJF 1OAAA 2B4TO 1VC2A 2ZB3A 1SB8A 4DL9A 2RHCA 3VZQA 4K9DA 1MG0A 4IIVA 4RCVA 4YVFA 5JCXA 5F3RA 4ONEA 2C20A 4IPTA 4UREA 3MJ4A 2GF2A 3AM4A 1MLDA 1KVUA 4S1VA 3AOGA 4L73A 4U0KA 3M2PA 1YONA 2DTDA 2PZJA 3F3SA 1PGNA 4KQWA 2B4QA 3GHYA 3PFFA 3BMNB 1B7GO 1T1RA 2DU8A 1O6ZA 1H0KA 4B3JA 4RZIA 3JQCA 4J4TA 4YDRA 2PKRA 1HF3A 4J0FA 5KJ6A 4F45A 1ISGA 2IEBA 1V35A 3W4IA 1D3AA 1PJSA 3GPIA 4GKBA 1E7YA 1PQWA 4I8XA 1K3TA 1AXEA 4CMBA 3IL2A 2O3UA 3N7UA 4J9UE 4YJHA 3ZNQA 3LVFO 1I5RA 2TMDA 3ZU2A 5CDYA 4EYEA 1LEHA 1W73A 2JAHA 3BXXA 2FZWA 4F6CA 4Y8VA 4CM4A 2O2YA 2EF1A 1JVBA 4DQXA 1N9GA 5DCYA 4J49A 3IJRA 4S3MA 1F0YA 2VOEA 2XPCA 2JHGA 4XEHA 3UOGA 3ZI0A 1YOVB 4AJKA 4E31A 1RYEA 3R1IA 3K30A 3UVEA 4E3ZA 3F6YA 2VZ8A 4HFJA 2BRUA 2VWHA 4GX0A 3INRA 2OZPA 1S7CA 5DBGA 1DRWA 4JJFA 5IDQA 3NJ8A 2G76A 5KTKA 3ZHZA 2Q45A 4YB8A 3IDSA 3BMQA 3OHSX 2FHSA 3G0OA 3K2BA 2XF8A 5L95A 2DPGA 1VL0A 3ZU4A 3ZU5A 1X1TA 1GQYA 2FSSA 1BWSA 1DAPA 3MTGA 4FIZA 4H7PA 5G4LA 4BO9A 3UCXA 2J3IA 1B0AA 4B4WA 1UH5A 3QVOA 1QP8A 3CZRA 1E3WB 4XKJA 1T2FA 3QY9A 1I10A 4DPMA 1FDWA 3KYCB 2BHLA 3BHIA 3H9QA 3HDJA 3ONDA 3I83A 3IAHA 2WJPA 3SLKA 2ZTUA 3EZYA 3BMCA 3TL2A 4CL3A 3O38A 4IXWA 1RKXA 5JDCC 3WX0A 2QW8A 3WWYA 3DWFA 2OUIA 1P74A 1P1JA 3BAZA 1MGOA 2HJSA 1PQUA 1Q7BA 5H81A 1Z7BA 4FFNA 4DBZA 5EPOA 3KRTA 3LC2O 5JY1A 1V6AA 3DAFA 1FDSA 1WDKA 1RM3A 4CLEA 4J1NA 4J91A 1WDMA 5TSDA 1KEVA 1LRJA 3U49A 1NNUA 2DKNA 1XG5A 3FWZA 4R68A 5CFZA 5IZ4A 3GG2A 3ZWYA 1VSUA 4GKVA 1PL6A 4L4RA 4PVCA 5B37A 3G79A 4DMMA 4R16A 2D2IA 4RPJA 5LDGA 1W6UA 1H6AA 4TROA 1C1XA 2I6TA 3IP1A 4KOAA 2O3RA 5G0SA 4J9VA 3TZKA 4L8VA 1RYDA 4XYGA 3NTQA 4RF4A 1R4NA 1JWAB 5IFLA 4E30A 3QW2A 4R3WA 3QVWA 1YE3A 4MP6A 3I3OA 2I67A 3PQEA 1N1GA 3V2HA 4HNGA 1Q2XA 2GASA 4MKXA 3I52A 2Y68A 3LQFA 5BNFA 4GSKA 4CM1A 5B4TA 4ZRNA 1SC6A 1U4SA 1C3VA 2EP7A 5KJFA 3ITDA 4KDFA 3KM0A 5I7SA 3AK4A 1EDOA 3OQ6A 4CQMB 1BRMA 4NU6A 3H6KA 1F8FA 3U3XA 1QYCA 3HNPA 1DAOA 1I2BA 2ZCVA 3GUCA 4M86A 5CPBA 4CR6A 3C7DB 1F14A 4HP8A 6LDHA 1GZ6A 1PZEA 4XRGA 4O0LA 5ITWA 3INGA 3PJFA 4XRRA 3ROQA 1E1NA 2VYVA 3I6QA 4JJGA 3T7CA 3KBOA 3VZSA 4BUCA 4RZHA 2PZKA 1M75A 4D45A 4DLAA 2HK8A 4N5LA 4CM8B 4F46A 2QRKA 1PGJA 5IXYA 1KVTA 5T64A 4XD2A 3K31A 1NQOA 4L0QA 4WGGA 5DN9A 2EJVA 3DZHA 2I99A 2D5CA 3DEYX 1NFQA 3GY0A 5GY7A 1GV0A 2FR1A 5CPFA 1Z6ZA 4IINA 2DLDA 5L7YA 1KIFA 2VUUA 2JD2A 3OJEA 4EJ0A 3AUUA 3DZGA 4BO3A 1NPDA 1ZEJA 4WNCA 1XR3A 2G0TA 4CMIA 2GUGA 3FTNA 1JAYA 2Q2VA 3TJRA 1HDCA 5FEUA 2CMDA 2RH8A 3FNHA 4ND5A 2ZQYA 1N7GA 1VKNA 4FGWA 1UXKA 4WLNA 3C85A 5EIOA 5CDTA 4BS9A 1G0OA 3NDIA 2Q46A 4H15A 3Q2IA 1O5IA 4A2CA 2ZATA 4Q3NA 3F4BA 3WQRA 1EEHA 1GUYA 1KERA 4J7CA 1GYQA 1ZH8A 5JAMA 5K6AA 4NK5A 5IDXA 3SVTA 4ZVVA 4MIYA 1TXGA 4MOWA 4IJKA 4EUHA 4UEKA 3ZCXA 1P1HA 2GZ3A 4J7XA 3S1LA 4MP3A 4YCAA 3CTMA 3MJVA 4FN4A 5IG2A 2WWRA 1B15A 4QECA 3ZGYA 4ZA2A 2OP0A 4B7UA 4ZGWA 3V1YA 4YXFA 2EIHA 2Y93A 5JYDA 1E3IA 3B1FA 3CINA 1M67A 3KETA 4RLSA 5EERA 4JGBA 3JYOA 4XGKA 1EVIA 4J3FA 3KOUA 4FPXA 4YR9A 5BNIA 1WP4A 2HO5A 3C8MA 1HETA 1FJHA 4LGVA 4M49A 3EZLA 4PG6A 3RUIA 4NBVA 2AE2A 4NBUA 3CUKA 4PCVA 4WE3A 3ZN2A 2QYSA 2YZ7A 5IZCA 1ADBA 3GDOA 5T8KC 4EUEA 3UW3A 7ADHA 4ALIA 1WW8A 4KUEA 3ROPA 3GVCA 4BNYA 1GDHA 1SAYA 4FFOA 1PU2A 2DT5A 4GI2A 1YJ8A 1RM4A 1WAMA 2YQ5A 4ILKA 3CIFA 1YXMA 5AOVA 5KIAA 2JFGA 3E48A 1HWYA 1RM0A 5HTOA 3I9MA 4A10A 2CDCA 1R15A 4BGVA 1PJQA 2GN9A 1I2ZA 3TZQA 4NJMA 1T2EA 4W9NA 1ZVMA 1X1EA 2WD8A 4C7KA 3ZDFA 1BW9A 1GY8A 4OXNA 3TRIA 4L4XA 4M8SA 4IY1A 3VVBA 3H9EO 4CM9D 3GK3A 4BNWA 3JQ7B 3NDJA 2O50A 4JP2A 5A9SB 1CEQA 2P2SA 2R00A 3KB6A 3U4DA 1LU9A 2DBVO 2Z5LA 3NTRA 3SLGA 2HMWA 1R66A 4OSOA 4NMHA 3S55A 2D3TA 1I32A 2X6TA 1BMDA 3AOEA 3K96A 1QYXA 3C1OA 4IDCA 3EAGA 3VPHA 3PTZA 3WSWA 5K0ZA 3NTOA 4FC6A 5TJ9A 5J23A 1NQAO 1Q0QA 3VDRA 4Z3DA 1U3VA 1OFGA 4RL6A 4UUOA 4YJFB 4AJNA 3GMSA 3ZHBA 4FOSA 4LVUA 4O1MA 2FY8A 5F1KA 5L3ZA 1K6JA 4BQPA 4CV2A 1H93A 2PH3A 1HL3A 4B4VA 3HB5X 3AI2A 1P0FA 3TN7A 2G1UA 2VQ3A 3B20A 4QT0A 3FPLA 4UEOA 1EVZA 2V7PA 2Y05A 4PFJA 1CQJA 4L76A 4CM5A 2EEZA 4OAQA 3I4FA 2J5QA 3JQGB 3MTJA 3QA9A 2VT2A 4UVEA 3JD3A 1L7DA 3K8ZA 2HK9A 4XYMA 4K28A 4JNKA 1U8FO 3JQ8A
chains in the Genus database with same CATH superfamily
4L8LA 4L0DA 5B2ZA 1YS6A 9MHTA 1ZIOA 1RC1A 2P3OA 4GWLA 4RSRA 5ES3A 2EARA 3NV9A 1K7XB 2OOKA 2X22A 1A69A 5BV2P 3HB4X 4DM7A 1P1KA 4UDXX 1S6YA 3KYBA 5JJ5A 1EX1A 4CLOA 4M9CA 4RTNA 2R8ZA 3G7NA 1PEYA 3NM6B 3OM8A 1QHFA 1QHYA 1EYZA 2CLLB 2R4TA 1TFUA 4HAZA 2YOHA 5I4IA 3BJMA 1VKHA 3MWLA 4QQKA 2D54A 2H9IA 5JSZA 4U7DA 4PLVA 5DWQA 2OB2A 3B9PA 4CMAA 4QWWA 2MSEB 1PL7A 5JY6A 1J21A 1RMQA 2FPWA 3HSKA 5AJXA 2G82A 2C4KA 1D8AA 3EGDB 3HYLA 3MUNA 4OLBA 1F20A 4OFZA 1P9WA 3GT3A 4RLHA 5DI3B 3X1ZA 2W9XA 1PBTA 1YQ9A 1V71A 1YWGO 2XX3A 3HCCA 5FWNA 4HMOA 4P32A 3VISA 4F5DA 3KQSA 2ZT6A 1TD1A 5FF9A 4IF6A 3F78A 1I2AA 1VE5A 3RVDA 1AQYA 3C6BA 4JB3A 2YHUA 1CZNA 2O2XA 2EX0A 4B82A 1Q1GA 4ZTZB 2YMQA 2I2CA 3OPYA 4P4SB 2Z9DA 1QDUA 2JCBA 4LJAA 5E6RA 4A0GA 1EB9A 1KKLA 2I7VA 1ODKA 1OI3A 4DJEC 221PA 4JC8A 1U90A 4QXOA 5JATA 5KOJA 5L4NA 2QSYA 3LBIA 3W5AA 2IXGA 3G2IA 3DDOA 4TQAA 1DCMA 2POQX 3JPWA 3MW8A 5C8ZA 1PDWA 3SNKA 2B35A 1O95D 3RUAA 3ANSA 2BBTA 4KIWA 4ZAFA 4DY4A 3RK1A 2V5AA 4MWGA 2FFAA 2WU3A 1DIBA 3IQWA 3ZE9A 1JHZA 4PG8A 5IVHA 1XF1A 1S2OA 3S3TA 4AD8A 5JT1A 1H6BA 1NE7A 3E05A 5K20A 1C7ZA 4ITUA 4RCYA 2BBWA 1JMYA 2J6BA 3OCJA 2HPVA 2FSUA 3FR7A 4FX5A 3P4XA 1D6JA 1Z0ZA 2C7BA 4F9GA 1JT2A 4LHSA 2FA9A 5YASA 5BWBA 1E3TA 3NATA 4EMBA 1OH5A 1FDIA 1QR6A 2V4MA 4L9WA 3DFZA 1T36B 2ZUUA 3H5NA 4V0NA 2Q6VA 2A9RA 3SAJA 4DJFC 3T9BA 3AZOA 2BUAA 3RRJA 2ZJYA 3SZOA 2RG1A 3JR7A 3LX5A 4IJUA 4EPRA 3DMRA 5JIBA 1ZR4A 3N05A 3O4HA 3C3PA 4OHRA 3DTVB 5EWJB 3DJFA 3PUKA 4C4SA 2GJSA 3E61A 5CG1A 2RAFA 2YC4C 2QE6A 3ZCUA 4LSWA 4X6YA 3F4KA 4WCVA 4G2TA 3M2TA 1U5CA 1Z4QA 1Q7CA 3SC2A 1TX4B 2LV8A 2D1QA 3BXFA 4J7AA 5K8TA 3AVXA 4PN7A 2EZ9A 5M5BA 3BCUA 2C42A 1SA0A 3WGKA 2UXBB 1FDRA 2DFVA 3HCDA 2IZ6A 4DMFA 1WY7A 3K09A 3W5CA 1KFEB 3ILXA 5IMSA 4MJ3A 3TGPA 2GPSA 4PAMA 4QU8A 2FX2A 2I54A 2P9CA 4LFCB 3WK5A 4B3GA 3EC7A 4C43A 1NPYA 3WWDA 3GP5A 1ZAKA 2IYAA 3M5WA 1Q1ZA 4BU0A 3BRWD 5BSKA 1VSBA 3S5JA 3V7FA 4TRMA 3R6DA 2H1CA 1KJ9A 2Q4EA 2QZSA 2YHAA 5DYTA 4O3MA 4DRXB 2H5LA 3DLIA 1GAEO 2RC5A 4INPA 4FD3A 1H65A 2PX5A 2AJBA 2WOOA 4MA5A 4RO0A 3T7KA 2PG3A 3EG5A 4ZQCB 3P1JA 2X6RA 1PDOA 3T1VA 5KNDA 4IDPA 1YFLA 1D4FA 3NRBA 3DO8A 2NMVA 2PSEA 4DDVA 3OZRA 1BNCA 3JQFA 4N03A 3F0TA 5E8JA 5IMBA 3VOBA 1JFFB 2AIRA 3GGCA 4QGGA 4ZT3A 5K2MA 4I50F 3BXOA 3ASZA 3BEDA 3VO9A 4EITA 4TLBA 2HXSA 2J8ZA 2YV5A 3AFHA 5JCOA 2WMOB 1HURA 1E2KA 2KSQA 3KLPX 4AJ9A 1XRRA 2FRDA 5LLTA 3C6MA 9GPBA 3GRCA 3PXXA 1HI9A 5FHRA 3EZFA 3IAAA 4JB2A 1YJ5A 3UF0A 3CNHA 2H7XA 4BZQA 2NUPA 2I1LA 4I55B 4AJLA 4D8YA 2AUTA 4MTLA 4X97A 2K6GA 7REQA 3GG9A 3RU7A 4OM8A 3S7TA 2JIMA 1EM8A 2QTRA 3FPHA 4WW0A 4IMIB 4K6FA 4KQFA 3V6MA 2QTGA 2F1IA 1TT7A 4R4JA 3RAPR 4ENTA 2PAAA 3ELDA 3HL0A 2EC5A 1WEKA 4GOXA 5C81A 1ZAYA 1NJ8A 1U1IA 4TL9A 2VYND 4XEUA 4MYRA 3RSSA 3TZHA 1KMHB 2O6HA 4HYEA 2J3JA 1E5DA 5K9ZA 1K27A 5H9WA 1PG2A 3DYVA 1KJZA 4PWZA 1PJLA 1E99A 4FHFA 3ZZNA 3RF7A 1GR0A 3L1UA 3TK1A 1AC5A 2ST1A 1Y89A 2ETXA 4FYJA 3DSRA 2ZE5A 2AN4A 2ZRAA 3F4LA 3WIDA 1AKQA 3I4LA 1IN6A 5WRFA 2MSKA 4ENPA 1HG1A 3HS3A 2RFLA 3DTTA 1J0AA 2Y71A 4AO7A 4E2WA 5A5DA 4Q4LA 4Z9YA 3UAYA 1W8DA 2WEKA 5K0TA 2ZETA 1OJLA 4ZGBA 1M2OA 5KYKA 1KAQA 1UKZA 4IJMA 2Z8ZA 5CT4A 2ZJ1A 3LCUA 4U8HA 4O8ZA 1R9JA 1JQ5A 1J6UA 4IQ0A 1NI4A 4RNCA 2HA0A 4RPIA 3DC2A 1LQTA 3HB0A 4KX3A 3GLFA 3W2HA 3I39X 3AHFA 1H2WA 4Z2YA 1NW9B 3WL8A 2BDTA 3D7SA 4BCDA 1Y6GA 4RHYA 3CRW1 3GVPA 3TE6A 1RWNA 1RAIA 3U0BA 4UHJA 3U39A 3DF7A 3DAYA 4X3CA 4XB2A 5HRAA 4U02A 4MWTA 1HQKA 4KQEA 1RRVA 3GEIA 4L6IA 5D5PA 3MT9A 2G08A 2GX6A 3OA2A 1JILA 3TBHA 4UTPA 2KYRA 1D2HA 1I6WA 2DY0A 1CIPA 3KT3A 3O93A 3OF2A 4MQBA 1B8VA 1W0JD 3UHAA 3WTBA 5IXJA 1ZWKA 2G4CA 3JVUA 4NZ9A 3EEFA 2BGTA 1VG9B 3G2JA 2CN1A 3QKSB 4IVPA 5K0GA 4Z0PA 4BO5A 1GU1A 1P2TA 3CRQA 1DE0A 1RI1A 5HKLA 4C1BA 3EY4A 4XW2A 3W4JA 4QLOA 3GLQA 2ZBVA 3MA0A 1SKBA 1U63A 5BPHA 2FEAA 1IHXA 4NS4A 3ON5A 4FBLA 2N3ZA 2QJFA 4GW3A 4TXNA 2VTDA 5CD1A 3HGQA 1DQYA 2R66A 2FR0A 3LFTA 3W1EA 2OGSA 3N75A 4OJTA 4PZUA 2C5BA 4MGYR 3MJTA 2YMLA 1ZYUA 2JA2A 4LJ8A 3R7DA 3DD5A 4LGCA 3OI7A 5ELMA 1NOKA 2D2FA 4B84A 1D2NA 3AIKA 5CD9A 1XVTA 5D1NA 3CPEA 3UFXA 1UKVY 2HQRA 1L4NA 5HGXA 4N18A 4BB0A 1T6BY 2ORYA 4X60A 1MB9A 1RSZA 1AHPA 4BGIA 1L1QA 1I3MA 5KTOA 1VSVA 3LHFA 5I6DA 1BVRA 5FO0A 3U80A 5J59A 1T3LA 4P33A 1M34E 3AVWA 3LUKA 2Q50A 2VBCA 2WI8A 2XQKA 3K8OE 4XDGA 3DAGA 1NMQA 3K20A 1U2DC 4PANA 1JJ7A 3GEDA 5AW5A 2OO5C 2YH2A 3EXEA 4GS5A 4EKYA 3TO5A 3QE3A 1QG2A 3PPWA 2QL5A 3A2LA 4IJVA 2WD7A 1MO6A 4F6LA 3L6RA 1P2FA 4ZOBA 4BNLA 4NBTA 1FOEB 2HLDA 4GC9A 4HX5A 1VMIA 2H85A 2YDYA 1L3CA 2CNOA 3CZ5A 3DULA 5IHXA 4AKGA 3EGCA 1Y80A 3N3AC 1JNXX 2HLPA 4TVBA 1T8PA 3VU9B 4LEIA 1ICEA 2BFMA 5DN6A 2ZYDA 3ZCPA 3I09A 1XF9A 3RC2A 3NTUA 2VNHA 1PJRA 5A4DA 1VCMA 4UM5A 4QGAA 1KZ7B 4ER5A 1NONA 5DX1A 1O6GA 4DQLA 2C3UA 1CRLA 3DA8A 1H2ZA 2EOAA 1GQQA 2KQUA 3QA3E 2P6RA 1RPZA 2XSZD 1WUTA 3JWJA 3W5DA 2XJ9A 1U0GA 1IRXA 5JH7F 4PS0A 1AQ6A 4B8ZA 3QH4A 1H1LB 1H1TA 3BH6A 4TL6A 5CDFE 2Z5GA 5DZSA 3RF6A 3TBFA 1I2MA 5EUCA 3WL7A 2CNBA 3N8HA 4N49A 2I03A 2HW8A 4FVTA 4EA9A 4M22A 4NMXB 4P4TA 3ZU6A 2OFXA 2G1KA 1RNLA 4QUAA 5CH8A 5FFFA 4IICA 4FFBB 4DQVA 4UC0A 4NH4A 4EG8A 1U28C 3CLHA 2AEFA 4K87A 4LRSB 4FT2A 5H83A 5JMTA 2EZUA 5CDFA 1D6NA 4E5MA 5KX5F 1RYNA 4AJIA 2PUTA 2J31A 5L40A 3T3EA 4KG7A 1EFPA 5FBHA 4QZVA 3KTAB 2ZWOA 2Z8YM 3SS7X 3TW8B 2PZGA 3W2FA 2AS0A 4G63A 3SDBA 2B37A 3VU0A 5KZMB 2G25A 2HJRA 1NJGA 4H9GA 5JWRA 5EGNA 3CPHA 3NHMA 5K4GA 1U3CA 2QVZX 1YQQA 3G7UA 1NDHA 4PPGA 3LM8A 5B5SA 1HDXA 1KS9A 1P1BA 2RKOA 5DHQA 4BKRA 1MMFB 3GF4A 2R68A 1ZUIA 3NHFA 3ANLA 4AICA 3MJHA 3OFSA 1KS2A 5I3ZA 4AKSA 4QQNA 1QUEA 3C3DA 1CF4A 2NM0A 3B1KA 1JE1A 3OEWA 4M53A 1HZJA 1M5UA 4BCCA 1U3GA 3ZNPA 1UMBB 1UP7A 5D85A 1HQCA 3W5JA 1SVOA 4JLUA 1SJ9A 2B8EA 5CNIA 1MA0A 3D1LA 3QWHA 3WYCA 4ZVOA 4E0BA 3OWXA 5IANA 3H8VA 5EJEA 2BHNA 2Y0PA 3H0EA 3UCFA 5BR4A 1SUPA 3PRJA 1D6SA 5C32A 3TLCA 4G9EA 4CGYA 5FTJA 4OUDA 1ZNWA 2D6FA 1NL3A 2WP8J 1RXVA 2PRYA 4PO1A 1U6IA 4HB2A 2QRVA 2D0DA 3FSJX 1V96A 4J6EA 4QEKA 5JFOA 4MHTA 1DWPA 3O4JA 1UOEA 3TXYA 3EAFA 5FA8A 2O1XA 2XMGA 1GFWA 1POWA 1QQ6A 3HUFA 4V0RA 1RJ9A 2HIAA 1JKJB 4D4KA 2JG3A 4YIKA 3WADA 4R7ZA 3GNQA 1MF7A 4C4RA 1A9YA 3OETA 4G01B 5AI4A 1U2GA 2Y2VA 3NJ4A 5BURA 3AEUB 1OA1A 3FVWA 1AK2A 1AUOA 1SUFA 1Z25A 3JWPA 4KQXA 1MB3A 4RV5A 3URMA 4LNUA 2PHZA 1F0PA 2AK2A 1ADGA 3DZIA 3IAXA 1C7RA 1MXHA 4ALLA 2IT1A 2PWZA 1OIWA 1Y6ZA 2XECA 2QE7A 1DG1G 3BD8A 1MQ8B 3KKLA 1JHUA 3FX2A 4RF5A 2GILA 2Y0EA 4X6LA 5G02A 4CXMA 2QEQA 1XRSB 2IP2A 5AXBA 1YF3A 2MMGA 2ZYVX 4AF7A 3NVKI 1MGPA 2JGRA 1UDXA 3MD0A 5F5NA 4WKNA 1OWNA 1YT5A 1Q16A 4ASUA 3DEIA 4M1YA 4NFYA 4EY8A 1XRNA 2BFPA 1Y4ZA 4C0AC 4JXKA 2HXYA 3TPCA 1CS0B 5J1SB 3HHPA 1CERA 4PO8A 4RK6A 3TIGA 3TXAA 1GKUB 2P2DA 2REQB 2CJYA 1B1AA 2ZSKA 4PG4A 2JD0A 3JTEA 3Q0TA 3MHTA 5LZ9A 3C3MA 2OGWA 1V3QE 2WTBA 3AR9A 1ZU4A 2RBKA 4DXHA 3PE3A 2EG9A 2I7DA 4BL5A 4G81A 4ZO9A 3WLJA 3ADBA 3ZWMA 2WSIA 2QAJA 4QBIA 4K5QA 4NE2A 3AGQA 1Z5WA 5FV4A 4L78A 4EYGA 1N8NA 4ZD6A 1NXSA 1IWOA 2B0CA 2H08A 4WN3A 4TKVB 2W90A 2ZRFA 1B8PA 1L4MA 3FCUB 4K6CA 1BW9B 4YNBA 1P2DA 3BWBA 3ERCA 2BHRA 1UPXA 4WV3A 4CM6A 4QUGA 3Q8MA 3EODA 1I6LA 5EIWA 1PYGA 3HBJA 5AQ1A 4KQMA 2OLEA 4Q7QA 1DNPA 1U31A 2PL5A 4E7PA 4D96A 2NUAB 1CHDA 1OXBB 1USKA 3PR3A 1JFSA 3U7EB 3ZHSA 3LZDA 1NJ5A 1BHQ1 1SCAA 3SR4A 3C8HA 1YB6A 1V25A 3MSXA 3OT1A 1JIXA 1SEPA 2BFWA 5ICEA 2R8OA 1U94A 2GFIA 4HEA6 1WJGA 4XIIA 3ZWNA 2BFAA 1WUJS 2EEPA 2VWPA 4FYIA 3P2IA 4HVAA 1XZAA 3FMVA 4GL2A 1XXHB 4GFDA 2W43A 2F1JA 2E7ZA 1P5HA 2PSFA 4RH3A 3OFVA 5IAGA 3JWEA 1JRLA 1PJ2A 5ERYA 4AIIA 4RKEA 4ECAA 3LTNC 1E18A 3OZGA 5H1YA 2R6HA 1L7XA 2YIDA 2FXIA 1QLHA 1WEHA 3U4CA 1WO8A 1YGPA 1TI7A 1TVCA 1ZI6A 3VJKA 1NZDA 2EF0A 3DE0X 3OCXA 4LUCA 3RFTA 4DLSA 2OKCA 3EUWA 3KEOA 4OSEA 4ZTUB 3NEAA 3K1ZA 4WNYA 1XPJA 1ZS9A 3ZXSA 3BDAA 2FFBA 3EQZA 3CU5A 4ZIRA 1GU7A 3FWNA 1AB5A 5BXQC 4OMFG 3HEBA 3UMMA 2C9CA 1IBKB 3R76A 4NCBA 1MTOA 3OX4A 5D6NA 4L74A 3Q0EA 4XVUA 1NNSA 1T35A 1JHVA 2JNWA 3G6KA 3PDUA 2BFDA 1ISRA 1TEVA 3O95A 1XK6A 2EWMA 1XKTA 1E3WA 1TB4A 1IJKA 3F8TA 4GPEA 2WVJA 5IC4A 4QPPA 4LF7B 4G1CA 1LK0A 4F3YA 4XIYA 4M1SA 3K9BA 3I1YA 3QJYA 4RWZA 5TQVA 3OF3A 2RSLA 4DPKA 5BYKA 5LOVB 4CFYA 1T0PA 3N2YA 3PR2B 1GPYA 1I3NA 1LB1B 2B4AA 2GWRA 4E2YA 2EFYA 1H23A 3EMKA 3BD6A 1QGUA 2ZTVA 1ZXXA 5FPYA 1T29A 1BD4A 2QNBA 2XI4A 1VJ0A 4BFTA 1SZDA 1E59A 3GP3A 4XGRA 1RM5A 1XU9A 5A7FA 3VV3A 4H6XA 3EHDA 1VKOA 1Z75A 5JLAA 4BNIA 4C7XA 4I9UA 4PX5A 1QHXA 4TWIA 3Q7SA 2BC9A 3UWPA 1WXEA 1DKUA 3ER8A 2ZUEA 1HZZA 3OOWA 2YNMC 2OA0A 3RYCA 3RNOA 1UBFA 2HIMA 2OBFA 3RBAA 2MMCA 3PFNA 1RXSA 2PSSA 2ZRDA 2XWPA 3O90A 3R7FA 5JCZA 4AP5A 3FDFA 4C14A 4CUKA 3GLIB 4C01A 1EH5A 1FQOA 3U4QB 3GX1A 1T8SA 4ZMRA 3X2SA 3FYCA 2NQ8A 2OSBA 2RGGA 2RJ3A 2VHUA 2PK3A 3E18A 3L79A 4Y1RB 3S44A 2BR4A 2FQWA 3U56A 4FMCF 4UDYX 2ZXEA 1ZKDA 1WMBA 3AF2A 3FPSA 4ESOA 3HXPA 3FMFA 4WSOA 3OZEA 2I8LA 1A9TA 2HO4A 3PDIB 5HJEA 1PWZA 3IQDB 4KNWA 3B7PA 1G6OA 1CZLA 2GYYA 4U00A 2FZ5A 1N3IA 1CF2O 4JHXA 3L1JA 4NE9A 1P5FA 1PJ4A 1QHGA 2CJFA 2VSNA 5JS6A 4RE5A 4IYRA 1K8YB 1ZRHA 3SG0A 4BNUA 4NEHB 3SF8A 5HOEA 2OK7A 4AMUA 4MRRA 5HTKA 4BRZA 1FQJA 4ME6A 1RMTA 1Y81A 2GVNA 4N54A 3TRJA 4CQMA 5KNCD 4NU8X 1KEZA 1US8A 721PA 4PYRA 4EJ2A 3M4ZA 1SKMA 2WR8A 2QP4A 4FBGA 1UZUA 5IUKC 4F5YA 3EFEA 1UJNA 1NBOA 4UHBA 1MPXA 4Y1EA 4X45A 2XYHA 5BWLA 4GRIA 1RJEA 1EP2B 3IP9A 4IMPA 3GR6A 3HE3A 3FRHA 4JJIA 1GPWB 4CYMA 3DTVD 1UF9A 4DMLA 4ZV7A 2AC2A 3GJRA 1GHTA 4PCAA 2RK6A 3ZHVA 2Y9MB 1DKPA 1OBOA 1L4BA 3I32A 4KQKA 5EZQA 1G18A 2IU6A 3ZUPA 5P8WA 1IPHA 5K8UA 1NXPA 3DBRB 1SBNE 2HTFA 4Z7JA 2OZKA 5ECYA 2MSLA 5C0OE 2YJ6A 2GXSA 3L93A 4UHEA 4RZXA 4F7DA 4KR7A 3F6RA 5HPYB 2PGNA 3PYXA 4I14A 4RJIA 2PH7A 3DGEC 1BCRA 1XROA 4R8SA 5JSHA 1JA1A 5KYGA 1W5AA 3E5HA 3VNRA 3GJ7A 3JD2A 3ZTWA 4GBED 1K3FA 1P0CA 4YLGA 4RQUA 4ZI7F 4QEDA 1FZTA 5HKKD 5EWMA 1KK1A 3DOCA 3KSBC 1ADYA 4KP7A 1GFIA 2XDQA 5C5CA 4QTXA 1ZJ5A 2BGKA 2WFLB 3E9QA 4P0PB 4Y2RA 4CEHB 3OPVA 3F6BX 2VAXA 2GBLA 5CJJA 1XTVA 5H8WA 4Y6SA 3QXCA 3HKBB 3UJBA 1FMTA 2RHTA 4A1OA 3K0AB 1ONPA 4AU1A 4EELA 3WQBA 3WKAA 3WLSA 4OHOA 4DNFA 1ZK3A 3S8MA 3E9ZA 1NW3A 3K4HA 4MVYA 2X15A 2Y1GA 2W2KB 2DHCA 1R4ZA 2FAXA 5TVGA 2A7XA 3WMRA 2R8XA 4JOQA 2DWCA 4B3BA 1PWHA 4PLYA 1IY2A 3L4SO 1RFLA 4D02A 2FU5C 1M0SA 1PR0A 1XTZA 1UEJA 5J40A 3N7AA 4KU4A 4MHOA 4ZCTA 5BN5A 4HATA 5COAA 1AGYA 3FW1A 1CY7A 3FE2A 1XNJA 4AUEA 3OVMA 2N1BA 1XD9A 1TECE 2PYIA 4GLOA 3VDMA 4EKIA 2AOVA 2IBSA 4MA4A 3WJ2A 4KVFA 1D04A 4DCCA 4ZI3A 4OU4A 3VNVA 2NZXA 5AJYA 4EFLA 1NVVR 1HORA 3DR5A 1DIOB 1K0UA 2MR5A 3ZVRA 5L95A 4ALNA 3IAS1 3OCCA 3RLIA 4KR2A 1DGQA 1L9KA 4KDEA 2A0UA 3UT5A 3G0GA 4FR0A 2Y1KA 3KQWA 4EYQA 1NKVA 3I9V6 3PPIA 4X94A 2H07A 1YZ3A 3R0JA 5GVSA 5FI5A 4DCMA 2C5FA 1S02A 2HDHA 3QKIA 1ZOLA 2PL9A 3EVDA 4MUYA 4BNNA 3S27A 4Q4CA 2G5PA 3S28A 3UT0A 3G8DA 4GR5A 3EQ7A 3WLNA 5IAAA 1KKUA 4UTXA 1QGAA 1LXCA 1W1WA 3VQTA 4RUKA 1HDGO 3T4XA 2ZVJA 3GD5A 5CFQA 1HRKA 3QFCA 4GLFA 4I1OA 3KQTA 3QNWA 4EB8A 4FYXA 2M2IA 2WDZA 2I2WA 2CVOA 4FDTA 3F9RA 3IVMA 3SJAA 3QMMA 3Q5DA 3BGVA 4UXIA 1AHHA 2PRJA 4EAAA 5B64A 3PWSA 1PK7A 4BP3A 2VATA 1XJ5A 4J2TA 4M88A 2ROQA 3SWWA 4Q1EA 3AEYA 2R48A 3ZE8A 3ZJ4A 4COOA 4PHGA 4YDSA 1G21B 2OYRA 3EPJA 3HXOA 4LJRA 2R7MA 2PJDA 1O03A 1II8B 4NFHA 4ERXA 2VK2A 4OBBA 2JGFA 1SCBA 4Q7EA 2C84A 4NDAA 4V2UA 4LJLA 3BA6A 3VYTB 4OGFA 3WLMA 3VOSA 4JYCA 3DC7A 1LJ8A 4RK5A 4L8GA 3U17A 3U48A 4QVGA 1ZCBA 2R1VB 2YJ3A 2IY9A 3E2MA 3K0KA 4B85A 3UATA 3LCRA 2HF8A 1B8UA 2CHEA 4U2KA 2BZGA 3K6JA 4MDYA 2JAQA 2B20A 3ENQA 1WZ2A 4PZEA 3KCQA 2BFBA 2JARA 3B1XA 2B7BA 3DPSA 4GZ6A 4AZSA 4B2YA 3TTXA 4F3NA 2Q9BA 4XH9B 2ZI6A 4L4YA 1A4XA 3LCMA 1E6EA 4DQ0A 4YAGA 2HEGA 2IA5A 2ZB2A 3V46A 2IEAA 2ZM5A 2R1TB 3JWHA 1O0SA 2ZSUA 2A9PA 3CSUA 1SG9A 3LUCA 3QXHA 1N0VC 4RQBA 1TF5A 3W9YA 2BMFA 4NCXA 3CVYA 1QIIA 1Y5NA 2AG1A 4N9WA 5C18A 3AP2A 5LYJA 3AJ9A 4G3XA 2CJXA 5HUQA 1LV7A 1XZHA 3REFA 5CLIA 5JV5A 3HDQA 2DAPA 4ZXFA 2LPMA 4CU2A 4CMHA 3R4VA 3NNNA 2LVBA 4DCGA 3QJ5A 4ISCA 1SD5A 3HJRA 3PXCX 2X5OA 3FTCA 4MS1B 5JHGB 3JQGA 3LX6A 3UJAA 2B3DA 4D99A 2JI6A 2WA2A 3E3LA 3ZK8A 1EHYA 2GZRA 3ZVLA 3OU2A 4OK6A 4CKBA 3UK1A 1TZCA 1JJFA 4ZZ2A 3V7YA 4B9AA 3ABIA 5A4KA 1MKYA 5ECWA 1IFXA 1UPFA 5TQ2B 2WU4A 2FSFA 1B8OA 1AKYA 2YFKA 5CTJA 3IUBA 4G4JA 1E66A 3C5CA 4HZGA 3DXYA 5H02A 3X1WA 2F8SA 5GIPE 2IS4A 1ENZA 4UEWA 2IHTA 1TQHA 10MHA 1Z74A 2YV3A 3AY0A 4IV5A 2XBLA 4WK0B 2XCQA 2PUBA 1WXWA 4BJ3A 2IX9A 2VCYA 3FDJA 3GB9A 1QO0D 1X2BA 2DY1A 3VTZA 4XR4A 3SZ3A 3GNSA 4CTOA 5TIIA 3EXFA 3NOVA 4TRJA 1D2AA 4RKRA 1XQYA 3ELWA 5ALPA 3QUCA 1EI9A 4WNIA 4MS4A 4HZUA 5HK8A 4OJMX 5CFPA 3ZV3A 1HT2E 1R00A 1DAMA 1KDPA 3FROA 4XTCS 4CIAA 5GV8A 5L3QA 4W7SA 4RPLA 2F6RA 2ODWA 3DVAB 3I0NA 4BE9A 5AW4A 1YOBA 1DV2A 1H0HA 1R4MA 1P9LA 2WC1A 5CVJA 3WSTA 3MBIA 4PZYA 5JASA 3KCNA 2D8AA 1CIVA 1DEOA 2ARKA 2PKQP 3JYPA 3SXUB 1ZEMA 4IGEA 4ILEA 2P75A 4BXOB 3P9KA 3MILA 2G7MC 4UAVA 1KQ3A 4ML3A 3CSSA 4HQLA 1ZJWA 1F7UA 4NI5A 3WGLA 3M7IA 4WLVA 3IQHX 4QPJC 1EB8A 5B3JA 4KYIB 5BYBA 3FAZA 5IJXA 4OQDA 3LLSA 1TO2E 2Q4DA 4ZCIA 1CEYA 5SZIA 4OF4A 2IHUA 3LPLA 4JOSA 1I4LD 1X74A 3BH0A 3R3VA 4WZ6A 2BTQA 1JS1X 1M2KA 1MG5A 1OBFO 2ZJ0A 3FSRA 4BMCA 3JRNA 1MP0A 4FFDA 3ZJVA 5JVDF 3GEEA 1EUZA 4GR4A 1DHRA 3U7GA 1A7UA 2AJCA 1FU8A 3I2GA 3A4YA 4FE3A 5EIHA 5G40A 3K4QA 5IF9A 2WQZA 1UWVA 3GEPA 5EZSA 2O8CB 1Y1TA 2GN8A 1JPUA 1KMNA 4RVNA 1G5HA 5E3HA 1CVLA 4L1KA 3K71B 1K2WA 1E5LA 1L5NA 5BY2A 3RODA 1RVV1 4Q02A 3WDLA 2WG0A 2D2EA 1F60A 2EJCA 2ZIXB 5FYQA 4F60A 1NNEA 2PUEA 3MWDB 4GRDA 4MW0A 3FTQA 4RD4A 5EHIA 3KDPA 4D5EA 2CJWA 1RPAA 1SELA 1TJPB 4LOJA 2YNMD 3SFTA 3EPRA 3HXQA 4G0QA 4AG6A 2PVSA 4A5OA 2RCNA 1KRWA 4RVOA 1SR8A 3RQIA 3NM5A 3ZI7A 4ZHQF 1ULZA 2X41A 4DRZA 4GX2A 5AM5A 4XWOA 4KPUB 4M0PA 3WMEA 2O4CA 3AC0A 4WXHA 4I5EA 4CUZA 1I9GA 2WYVA 4Q37A 5I9MA 1DELA 4YAJA 1EK5A 3WRYA 4F3TA 5MDHA 3PC8C 4NV1A 1M0TA 4TTJA 3CVJA 1ODLA 4LI0A 4BV9A 3PVCA 4L4SA 2IGTA 4K81B 1A72A 3BMCB 3USES 4E1BA 3PC7A 1C8LA 2ONKA 1GXSB 3HR4A 1E64A 1Z4JA 2NZJA 2Y4OA 1VECA 2FNAA 3CKLA 3EG9A 3IO5A 4MUFA 1IXKA 2H0RA 2BGIA 4F6RA 2ACKA 4IVRA 2MIIA 5AW0A 3I6YA 4E03A 4G5FA 3DXFA 4G0MA 5G4KA 5IBRA 2IVFA 4J07A 1E94E 1Q1QA 2J59A 2G3YA 3FNRA 2WTUA 2II6A 4AY5A 3CF4A 4Q16A 2AMFA 2WAMA 1JG3A 1XTTA 2CLFB 3HSYA 3WWCA 3DDNA 1CX9B 1JR3A 3SIRA 3UPUA 4B3SB 2RMKA 2DULA 4C7VA 1FFSA 4HBZA 2YY7A 4JJ8A 3CLKA 2V97A 4MV9A 4XLTA 4IHQA 1RXWA 4QULA 5AKGA 2ADOA 1VGVA 2QM8A 2WHPA 2QP3A 3C7CB 3HWX1 3ZGZA 4BJ1A 3CUUA 2VJQA 4IIBA 3AFNA 4F86A 1T25A 2RGDA 3G9XA 1J8MF 2YYAA 4P31A 3JQAA 1GAXA 4N76A 1VG1A 5FORA 2GF9A 3UAOA 3V8NA 3V8BA 2ZRMA 3KYDA 3EY9A 4HNAA 4RTPA 1E2MA 3PXEA 4XJVA 1E9DA 4D0NA 3A4IA 4XFDA 1Z7GA 1M6VA 1W1UA 5I8PA 1GPH1 4E5DA 2YFYA 3NDRA 5CT6A 1GP2A 2ZTSA 1TEHA 3GQVA 3ZWBA 4WQMA 2WYOA 5THXA 3UWMA 3SGLA 4BNKA 1QOZA 1SBTA 1SKQA 2GARA 1XQ1A 2O8VA 3F3MA 1CJBA 3UQZA 4FGSA 3LGXA 3NLLA 2PTHA 4Q4HB 5E3JA 3WGYA 5JBIA 1NI5A 2H48A 3MGGA 1HYHA 4ZFNA 3C7KA 3I5AA 2WYWA 1P8AA 1HTWA 3V2IA 1FNNA 2H0AA 3TNDA 2JLVA 1L4YA 2BTOA 2DFPA 2C9ZA 4LBYA 3CR7A 3ZLVA 3NHAA 1A9RA 3WRXC 3H8SA 4ZOEA 1Z82A 5FAKA 3IUMA 2WWXA 5HCUA 1QH1B 3I58A 5A06A 5JSYA 3WGTA 1FTQA 5AO9A 3J7AC 5L3SA 3L9WA 1QBKC 2VS1A 4ZWNA 2FK8A 3GA0A 2FW7A 3LW7A 3RSLA 4EPVA 2AV6A 2AOXA 1FVOA 3F98A 2R751 4WESB 5DP1A 1FL9A 1G3UA 1E7SA 2BFEB 3MT0A 5KNBH 5DDIP 4EFNA 1YHZA 3R0XA 1F3OA 3TZ6A 1YDGA 2KS6A 5EJMA 3UMVA 1XNGA 4JY7A 4DCUA 4HL6A 5KQSA 4XWGA 4CV3A 4ARIA 1NBEA 1UXHA 2X7HA 4W7IA 4CKYA 4D3XA 4DR2B 4WLFA 5I9SA 3PQ4A 3LXXA 3Q7IA 3TUZC 1C9NA 3Q2KA 4LHXA 4CT4B 2A8YA 4DJAA 3CNQS 1AF4A 3RUHA 4NU0A 2HMUA 4DMCA 4V1CB 1IOLA 2GZ2A 2VDJA 1E1RA 1RZRD 1JIVA 2PZFA 4C0WA 5C8VA 1XEXA 1D0IA 5KTYA 3F5SA 4KWTA 2W2MA 2COEA 2FI1A 5D5QA 2XOKA 1KDRA 1ZK4A 3W6ZA 4RBNA 1BEEA 5BR1A 4JT2A 2Q7DA 3MMSA 2Q07A 2IU3A 1JNYA 2C83A 3ZWCA 4ZVRA 3H1GA 1HBJA 4Z6KA 2VJYA 3W5IA 3MTDA 4RTQA 3D59A 3FFWA 3AM3A 3G2MA 4HGOA 1NATA 2JF0A 4HNSA 2I2FA 3TPFA 5ADVA 2HCBA 1JU9A 4HHEA 1TM4E 2EYUA 5CB4F 2AI3A 1BD3A 5CDGA 5EMNA 4HYQA 4ZVUA 2B83A 1YZKA 1ISFA 2DFDA 2H1IA 3AV3A 1HPLA 3W3ZB 5K0CA 1F2UB 1I4WA 1R6UA 3N59A 2RI6A 4LHVA 4X92A 4HPWA 3A8TA 2HRRA 2XUAA 2ZRIA 3D6TB 2ADMA 2NU6A 5D8DA 1UC8A 1VMKA 1K8ZB 3PU6A 4TMZA 4RCZA 4QSHA 4C0XA 3FHTA 4UUQA 2XUFA 3FTEA 1MJGA 4JSRA 5C37A 2DUUA 2E87A 2FZCA 5BQXA 3IT0A 1U1FA 3GFGA 5DBEX 3RSCA 2WHRA 4HVCA 2BKAA 3AHIA 3K9NA 3IILA 2CXQA 2J5RA 2Z6QA 2XGGA 4FFSA 4XFKA 3T9EA 5ESRA 3WWOA 2XGSA 5DISB 1PR2A 2E4AA 2I5PO 1RPTA 5F4ZA 1YMVA 4MUEA 5IM4A 1QHSA 2XLCA 4AFNA 4TYYA 5J2UB 1WXGA 4M1KA 2X9QA 1UQUA 2X5JO 2Q1WA 3KLOA 4Q6BA 4UU0A 4GSYA 5K45A 1ZR2A 2WB4A 2FFRA 4IJWA 4JDUA 3MSCA 4K26A 3PX7A 1U0JA 5IFKA 3C41J 2RGXA 3GDGA 1JECA 2ASEA 2C2YA 1T34A 4AZ3A 2F00A 4RA6B 4EMTA 1XNHA 4FM9A 1PGPA 2DUWA 2Z56A 4IWNA 4MV7A 3L01A 4BECA 1I7LA 5EAIA 2Y6VA 3MJSA 4UNNA 1SB9A 4PYQA 2B0JA 2YIVX 3KO8A 2XUQA 3L4BC 2QL9A 3IE0A 4JVNA 2JK1A 5THKA 2I78A 1I9CA 1XSEA 3I9NA 4B34A 2WFAA 4E21A 2O2IA 4BP1A 3L8MA 4DBVO 5DT9A 3EGEA 5ER6A 1FBNA 1QZ3A 3X1XA 2B1IA 1T0JB 2XUGA 4GGOA 4QT4A 4C6TA 1N5JA 2H92A 3LC0A 4CHTA 4CFSA 5DNAA 4MEBA 2YHIB 2NO4A 2O8FB 4I55F 4N5MA 2VEOA 4RTKA 1MQ9A 4MWZA 2AXQA 2EFEB 4YRTA 1WG8A 2XD9A 3PHCA 2R5FA 4N7RA 4HI0E 4PGMA 1JI0A 2NG1A 1WTCA 4FZ5A 5CVVA 1LFAA 2I66A 4IDQA 1N9KA 4EW3A 1DEKA 2AVDA 2OK8A 4H60A 2FPPB 4Q9KA 4E08A 1NW8A 2HRBA 2QL6A 4CW7A 1W5BA 3B2QA 2QTTA 3BXHA 3HFRA 5B30A 5I01A 4PEVA 1VJ1A 3D6AA 1ZJ6A 3QPCA 4KSCA 1C4WA 3IHWA 1G60A 4G0OA 3PFKA 2CYBA 3AI1A 2IC5A 2WSYB 1NUHA 1Z08A 1DDOA 3DBHA 3E15A 2P2ZA 4N40A 1N4AA 3SQLA 4AS3A 1KPIA 2GJ9A 4WERA 1DIAA 4Z4QA 3NYIA 3RYFB 3P9ZA 1KSGA 2O2ZA 3HDYA 3PYLA 2ID9A 2HDNB 4ZPJA 3IB6A 3PKZA 2I6QA 3R4CA 4EG7A 5ES4B 4F85A 1Y3BE 3F8SA 3NT4A 3LE8A 5D84A 2E48A 2QGFA 4KCGA 1KOGA 4BN5A 1B42A 2CFOA 1GT6A 1OTHA 3CVVA 4EF4A 3NBKA 3L84A 5C8XA 4RSMA 1YZFA 2VFAA 2ZI4A 4QNNA 1E1KA 1OGJA 3S2FA 3GDWA 4YRFA 4L6AA 1K9VF 1HKUA 2Y2UA 1N5IA 1X7GA 4YT5A 3D5TA 5IC6A 3EARA 4Q1VA 3N8NA 2ZK7A 4FYKA 2CGEA 3HRIA 4J0EA 3A7EA 2CW5A 2CHUA 3AIOA 3U37A 1ODJA 4ZEVA 3RKRA 2PE5A 3BE8A 3F7NA 5JSZB 4JZYA 3L7NA 1IZZA 2CXTA 4QYMA 5D7NA 1XMSA 3OCYA 3WGUA 4MR7B 2I71A 3KDAA 3SPXA 4LGMA 4AQYB 2YZGA 2FEMA 2NADA 4KGDA 3S1AA 1BDIA 1VM6A 3TEFA 1V9CA 3FFXA 5EJ2A 1BX1A 2ZDGA 2VDQB 1TGVA 1UOPA 2ZWIA 3OZSA 3HA3A 3ANXA 3GGPA 3PCXA 1WULS 3RBVA 2J46A 4QFMA 4RHFA 2C3MA 4FXPA 3UV6A 3VYSB 2BFOA 1WABA 2Q8NA 1B76A 2XUZA 3L0SA 5LCXA 5LQUA 3D8SA 1T5OA 1SXJA 2K7FA 4N5NA 1F8YA 4E32A 4XASA 1KTVA 2ZYIA 4FQ8A 2FQQA 1VP9A 5H59A 1YJQA 1WIWA 1UJ5A 5E6RB 4C88A 1NXWA 4Y6GB 3D0RA 1GZDA 1UJ6A 3QWBA 4JX9A 4IOLA 5KOJB 1J20A 3ODGA 2A0FA 5H68A 2NU7A 3MUEA 4XIGS 3D3JA 4JKYA 2C2MA 5FI0B 5HMLA 5ER9A 1QVWA 4HFNA 2PFSA 5J9FA 1C5KA 3QU2A 1ZH2A 2DCUA 2HMVA 1ZGHA 1ST3A 3FXAA 3H84A 4GM1A 4MRMA 3BL8A 1X8JA 3SQWA 1OLOA 2ZYGA 4HTFA 4FKZA 3ICPA 3URKA 4CIYA 2HRQA 3UMGA 2AH5A 1CTQA 1DC7A 1ZN8A 4YT4A 1WPRA 4H0FA 4GXRA 4I5FA 3ONWA 3PZBA 4K9LA 3BPSA 1A4UA 2IS2A 2NTEA 2Z95A 3QSYA 1XP8A 2XBMA 3DCYA 4R2LA 4FFRA 4BZPA 4C3OB 4D79A 1NZFA 2JAPA 1G63A 1SIWA 2JB9A 3RC9A 2JANA 4WFKA 3V8QA 5KPDA 5B7PA 4RORA 2DLCX 1GVNB 3PNPA 1ETHA 4BWFB 1SFRA 3QV2A 2H2WA 2XVMA 4JJEA 4K6MA 1KJQA 2CNNA 4FMDB 3P19A 1N7HA 2O1EA 3NHWA 4INOA 5AP9A 4B76A 1TAUA 5LXTB 3HBAA 4JBHA 4BJHB 2ZRGA 5EQFA 2PWYA 1NC3A 5LA6A 1WXDA 2BELA 1K8RA 2ETVA 1UWCA 3BWVA 3MRXA 4KO4S 5KYXA 4AX4A 1SA0B 3PDHA 4HUTA 3CWZA 5ENZA 4ZREA 3N2NA 3KE8A 1HXHA 4X8OA 5LQJA 1QP4A