5LC1A

L-threonine dehydrogenase from trypanosoma brucei with nad and the inhibitor pyruvate bound.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
320
Chain Sequence
MPRVLVTGALGQIGTDLSLALRDKFGADSVLVSDVVEPGAKHPLAGLKGVEKLDCLDSNGFEKLVKEFKPTWMYHLPAIMSVRGEAEPDLAMDINVNTTRYALELARKYNIRIFIPSTIAAFGDKCGKTMTKDDTIMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAATLPGGGATDYAIHMYHSALLQKKCVCPVLPYESLPMMYMPDTLNSLVKIMEAPLEKLTRTVYNITGFSFSPSELRFSIERCTDRTIEVEYVEGPAQKIANSWPDSLDDSNARNDWGHQVKYDIDMMSEDMLRQIPILHGLPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-threonine 3-dehydrogenase
publication title Structure and function of L-threonine-3-dehydrogenase from the parasitic protozoan Trypanosoma brucei revealed by X-ray crystallography and geometric simulations.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 121
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2016-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5lc1A00
3VAZA 4YRAA 1SPXA 4CM7A 3QVOA 3NRCA 3MOIA 1PS9A 4GBJA 1I2ZA 3DTTA 3FCOA 2HMWA 1PGPA 2FPGA 3BHMA 3GHYA 4DMLA 4DWVA 3FR8A 1B2LA 3C8MA 1DJNA 3IJRA 2OMEA 4E21A 4YT4A 4HXYA 4IXWA 5IN4A 3OQ6A 4LSMA 3I4FA 1HKUA 2CF5A 2P9GA 2NVWA 3RKRA 4BNGA 1B8UA 4BMNA 5F1PA 1PWZA 4CMBA 1OBFO 2IODA 1DIBA 3B6ZA 3JQ8A 1BXGB 1A72A 4HFMA 2X58A 1C14A 2OUIA 3ZU4A 1R0SA 1T1RA 5AOVA 3PJGA 3SJUA 5KJEA 3I52A 4MKXA 4UVHA 1K6JA 4J0EA 2WM3A 3WFIA 1ZJYA 2CF6A 3JQGB 1NHWA 2IYPA 1YBAA 2WDZA 3EMKA 5BSHA 4TRMA 2TMGA 5JAQA 1YBMA 2GSDA 1DLJA 3EGOA 1H93A 3JQAB 3QIVA 3S2IA 4DIOA 1MV8A 4RZHA 3CINA 4CLRB 1O94A 4PLPA 3ADOA 4QECA 2OHXA 4WJZA 4XEHA 4E5MA 4E4YA 2XPCA 1JU9A 2DTDA 1C0KA 1CF2O 2X5KO 4IS2A 4R9RA 1RWBA 4B7XA 4Q3NA 3H9UA 1JKJA 5JCXA 1IPFA 3DC2A 1ISMA 1JVSA 2ZTVA 4FBGA 3WNVA 3FWNA 2IEBA 4B3IA 3S1LA 4L9RA 3NDIA 1ENZA 2VHYA 2BGLA 4BNLA 4R1SA 4M86A 2G0TA 2QYTA 3QRWA 2A9FA 4QQRA 4CMCA 2Y68A 4CV3A 4CUJA 1E77A 4E12A 2OL4A 1ARZA 4MVJA 1GZ3A 5KKCA 1GEGA 2I67A 3WGTA 4JIGA 3H6KA 3ZN2A 2E37A 1J5PA 3DBHA 5A1TA 5L4LA 3U4CA 1LJ8A 1YBVA 4RV9A 1E7WA 5BT9A 1U8XX 3ITDA 3R1IA 2PZLA 1O89A 1YDWA 2AEMA 4AJ4A 4I5DA 1B3RA 2O2SA 2ZQZA 4BKUA 1KVSA 1U4OA 1T2EA 1W6UA 3CKYA 2IE0A 4FGSA 3U0BA 5CDYA 2AMFA 3GOHA 3JD2A 5JAMA 4IGFA 3Q11A 1EZ4A 5JAIA 2E4AA 1J4AA 4GI2A 5CPBA 2YDXA 5TJ9A 3RASA 2C2YA 2CY0A 3NX4A 1D8AA 2O7QA 1PX0A 5KCZA 1GY8A 2FSVA 3NJ4A 5A4DA 2PFGA 4E30A 4OHUA 4CL8A 1Y8QA 5L53A 2YJZA 5I9NA 4PLZA 4JBIA 1UZNA 3JQ7B 2PZMA 3FR7A 4QFCA 4YQZA 4CMEA 3IC5A 5TS3A 1EUCA 5DP1A 1LLUA 4NBVA 4YXFA 5EN4A 4IINA 2JFGA 1VLLA 4LGVA 3ZWBA 2AE2A 5KJ6A 2O3TA 3LYLA 1P1KA 2B69A 4P4GA 4OL9A 4YRBA 1XCBA 3L77A 4NIMA 4NG5A 2GLXA 3H65A 4A27A 2O3UA 1PEDA 3W4KA 3G49A 4ALKA 4BNZA 3U62A 3IP3A 5EJ2A 2EKQA 4ZD6A 1R12A 1DRWA 5ICMA 4K9DA 2RHRA 1PL7A 1SO8A 2VRCD 3KYDA 4GQAA 4NMHA 2HJRA 3B20A 4L0QA 4XB2A 5A9RA 4J2OA 5L95A 3GDFA 4PZDA 2BFOA 1KVUA 1PQPA 2VNAA 3MJSA 1PU2A 2O3SA 4BNYA 1YO6A 2QYSA 2P9CA 4B4UA 1Q7BA 5FWNA 1CRWG 3UGKA 1YDEA 4TRRA 3PWZA 4GX1A 3V1UA 4J9UE 4XGIA 4UVGA 2OFPA 2VYNA 3VH1A 3KYCA 4LMPA 4D44A 1QYDA 3AUSA 5DOVA 3FSRA 3GH3A 2IXBA 1XWFA 3G17A 3MTJA 2DPHA 1NQTA 3QHAA 2A35A 3JD3A 3OICA 3WJ7A 4XDYA 3PXXA 4YRDA 2Q45A 1F06A 4EEZA 3KHUA 4J4BA 1LQUA 1ZK1A 5FEUA 4TRJA 4ONEA 3E48A 5L4NA 3I9MA 4RDHA 4RVGA 1JW9B 4NDNE 1XU9A 2D59A 2CDBA 2GNAA 3JQBC 4FFOA 1WDLA 1E6UA 2NVUA 5T6BA 4LISA 3Q2KA 4YWJA 4IDAA 4GX5A 2ZB8A 3CH6A 1EVJA 1NFQA 3AU8A 4A7PA 4BO6A 5LDGA 3INRA 3RBVA 3L07A 4RF5A 5JPIA 4BNTA 5G2OA 1L1FA 4IMPA 2YV1A 2YV2A 1PWXA 3RJ5A 1ZK3A 3F1LA 1QLJA 2P4QA 4J6FA 1ZH8A 2Z95A 1JVBA 1E1LA 5ENDA 2WYUA 2UV8A 4K6FA 2B35A 3DEYX 2DFVA 1FDVA 3IAHA 1LSUA 2AG5A 4U0JA 1YXMA 5B4VA 4NU5A 2UDPA 2WSBA 3E03A 4DREA 1KY5A 4MVJP 3PHJA 1LX6A 3QVWA 4S1VA 4BNJA 2EP7A 1E3IA 4GWGA 3G79A 5B12A 2VYVA 3QWFA 3DZKA 4ALJA 2B37A 3QP9A 5L7YA 1RYDA 4J4TA 3GA0A 4XQ9A 4J7UA 1DFGA 3LT2A 3AK4A 2AA3A 4GLLA 4H16A 4IDBA 3U09A 1VM6A 4DGSA 1L7DA 1E6EA 1NXQA 1PJSA 1ULSA 2NWQA 2Q1WA 3INGA 4QTZA 4D0RA 4HP8A 1FMCA 3MWEB 3BZUA 3DONA 1W4ZA 1XIVA 3FI9A 4MVJM 3KSDO 3NT5A 4QXMA 3BMNA 1VSUA 4E2XA 1R4MB 4B7UA 4WCFB 1FXSA 2V65A 3IDSA 3F3SA 3H5AA 1YL5A 2NU8A 5JC1A 1HDOA 3BMOB 5KJFA 1SCUA 2GR9A 4DIBA 3I6IA 4RVHA 2H63A 3JQFA 4UEJA 4IM7A 4YJFA 2J3JA 4WLUA 1NR7A 1BHSA 3OH8A 3GLQA 5IZCC 3JYQA 4QEDA 4CM8B 1HT0A 1R0LA 3X2FA 3M2PA 3VHRA 3ZDFA 1P1RA 4BHTA 5L7TA 2V6GA 4FFMA 1E3SA 2OP0A 5IJZA 4H7PA 2PR2A 5CG1A 5EMHA 3VKUA 5F5NA 5IN5A 4IS3A 4AVYA 3D4OA 3L6DA 4J7XA 4EUHA 4YYZA 1A7AA 5G0TA 4G2NA 5CHEA 4RF3A 2NU7A 2OGUA 1DHTA 2VOEA 1SB9A 3KBOA 1GV0A 4L4XA 3P5SA 3FBTA 1K2WA 3DL2A 1YKFA 3ONEA 4B8ZA 2GN6A 4CM5A 2VUUA 2RCYA 4II3A 4UUNA 4CM4A 4NQZA 4QX6A 2X23A 5T57A 3AM5A 1RM0A 4DLAA 6ADHA 1I01A 2AQIA 4W82A 4KQWA 4EZBA 2X86A 3PZRA 1ISFA 1EBFA 2DQ4A 3AOEC 4PRLA 1EDZA 1KERA 2Q1TA 3ROQA 4II2A 1JTVA 4NPCA 2AG8A 5HWSA 1P1HA 5CPFA 3H2SA 3JD4A 2EW2A 3D3WA 4DL9A 1P0FA 3RUAA 4UUMA 2RBEA 3QVSA 3RVDA 1F12A 1LQTA 4CQLB 3OEYA 4KUEA 3MOGA 3PI7A 3L6EA 2QG4A 5JMWA 2ZTMA 1N7HA 3WSVA 4CUKA 1E0DA 1XEAA 3KRTA 1CDOA 4XQGA 4PFJA 2W98A 4RLHA 1C1XA 3WWZA 4YQYA 1ADGA 3PRJA 1S7CA 5F5LA 3H4VA 4UVIA 2J3HA 4PG5A 1NPYA 1PZFA 3N58A 2DUWA 4KQXA 4DXHA 5BNTA 1M67A 1VL0A 5ENVA 3CEAA 4FJ1A 4Q39A 4MDHA 1FDWA 1I33A 3OSUA 4IBOA 4U5QA 4BMVA 4RPLA 3H8VA 3W6UA 1IZ0A 3ZWXA 2VWQA 4JJGA 3OJLA 4J3FA 5KJ1A 1BTOA 1IHYA 4JGBA 4HX5A 4EGFA 1R4NB 4FGWA 3WB9A 4DPKA 5IFLA 1V9LA 2UUOA 3ENNA 3PEFA 4A26A 4CM3A 1U7HA 1Y6JA 3ZHZA 4CV2A 2O23A 3SEFA 3P2OA 4E33A 2AHRA 3DHNA 4R01A 1AXGA 3GGOA 4LSWA 3PJEA 4ND3A 2VN8A 1QR6A 1JKFA 1T26A 3KB6A 3SX2A 1N1EA 1GADO 4QO7A 2YUTA 3NV9A 1ONPA 3WSWA 3NTQA 2YW9A 1C0LA 3RBXA 4CL3A 5EL0A 4PG8A 5IF3A 3W4IA 1OC4A 1HETA 5DOZA 1VL8A 2QIOA 3OMLA 4FD3A 3GEGA 1Y8RB 4BNNA 2CVOA 2PTGA 4KUHA 2HLPA 3QY9A 1J6UA 1X7HA 1YJQA 3K2BA 3TRIA 3B1JA 3JQEA 1BDMA 3IIEA 1G1AA 2CVQA 4GMGA 4EDFA 1H0KA 1UXJA 4JP3A 3H5NA 1YQDA 1A5ZA 4YAEA 1K6IA 1X1TA 1QKIA 2OORA 3Q1LA 4OXNA 1DRVA 1ID1A 3MJEA 4U8GA 5G0UA 1RM5A 2XOXA 1E7SA 2VT2A 4FR5A 5G0VA 2VRCA 4XR9A 1E92A 4CJXA 2CDCA 4RVUA 1M6WA 1VL6A 3JD1A 2J5QA 3F5SA 4B8WA 1QYCA 2BI8A 2R6JA 3DXFA 3F4BA 1V8BA 4OO3A 5JSFA 1PJBA 5JO9A 5KJCA 3ANLA 1KEVA 1GD1O 1VJ0A 2C0CA 2YFQA 4OSPA 5EQDA 1BW9B 2WYVA 1LSJA 3ABIA 5A02A 3GFBA 4E32A 5CEJA 4RORA 4D43A 4U6QA 1UDCA 2HMTA 4G5HA 3EZLA 4WLOA 4M55A 4IXTA 4O1MA 4RPHA 3WR5A 3DFUA 5K6AA 5BNIA 5DULA 3GF4A 4AJOA 4E5YA 4YAKA 4AJHA 4PLHA 4WUVA 1PSDA 3H9QA 2DVMA 2ZB4A 4R5MA 4AJJA 4AJEA 3S55A 4NU6A 4DIFA 1MXHA 4MP3A 5I9LA 1TEHA 3ZH2A 1DOHA 3CXRA 2GYYA 1BXZA 1WAMA 2XF8A 4YT8A 1B15A 3OFSA 3GGPA 2B4TO 5C7IO 3GUCA 1U28A 3ZWMA 1EE9A 3DO5A 3ZNNA 3IQDB 1DAOA 3GT0A 3WICA 3E9MA 2EKLA 3OEWA 5HTOA 1XU7A 2AEFA 5JLAA 4JJIA 1PJLA 2WMDA 4MPDA 3RUEA 4GMFA 2GN4A 3GMSA 1RPNA 3VOSA 3ETEA 1Z74A 3W8EA 4D41A 4IQ8A 1DXYA 5AXDA 2EG9A 5I7VA 2A4KA 4CMJA 2GN8A 5CDGA 1M66A 3OQ1A 4BV9A 2VCYA 1HE2A 2QHXA 1U2GA 3WOHA 4E2ZA 3VPSA 2JD2A 1FK8A 2YQ5A 4NFSA 2EV9A 4Z9FA 5A9SA 4W9NC 3WLEA 3VH3A 1CEQA 5IG2A 2VYND 2JCVA 4KDFA 1Q0LA 1SEPA 3ZV6A 3VVCA 4M89A 4BOYA 3BMQB 4DPLA 3OETA 4E5PA 2Q49A 4RPKA 3QQPA 3V2GA 5IDWA 5T8KC 2LDBA 3E18A 1PL6A 4FFPA 3WGHA 5JDIA 1TT5A 3U49A 1ZJZA 2Z1MA 1ZZEA 3UW3A 5L40A 2W2KB 5KWEA 3RUDA 2H5LA 5CDUA 2VZ9A 2EP5A 4XZ3A 1NQAO 4IGEA 1EVZA 1HZZA 2GASA 5F3RA 5G4KA 1DO8A 1DC5A 3HUDA 4P4LA 2Q4EA 3DHEA 1D1SA 3TL3A 4KWIA 3OJEA 3HHPA 1ZSYA 2FP4A 5B1YA 3UXYA 4R69A 3OA0A 5L4SA 2GZ2A 2VWPA 2AW5A 4IDGA 3ENKA 5A05A 4CUZA 4Z9XA 3GR6A 5BSEA 2HAEA 3JQFC 1KOLA 1XQ1A 5U1PA 1YONA 1ZNQO 2JCYA 4CLDA 5A5EA 4R16A 1LXCA 2W8ZA 3T7EA 3PDJA 3DAGA 2DBVO 2GZ1A 3GK3A 4CMGA 1NQOA 3LT1A 3GZ4A 3UICA 1UP7A 1C1DA 4Y67A 3UOGA 5CDTA 1Q1NA 1ZK2A 3ZHXA 3PGJA 1A9ZA 5TLSA 2VYVD 3WX0A 1GPJA 1I36A 4YDRA 1P1FA 2Y1CA 1DJQA 3PYXA 4CR8A 3JCZA 2AEJA 4IJKA 3L4BC 2NLOA 2Q2VA 1K0UA 1UUFA 5C7OO 4LCJA 3V1YA 1WMBA 3DMTA 4UVDA 3KVOA 2X0JA 1YB5A 4OMUA 4O6VA 4WK6A 4BQRA 4FPXA 5G0SA 3DB2A 3NTRA 4PG4A 3L9XA 4D79A 3IMFA 3V1TC 3I83A 2JHFA 1IL0A 3DBRA 3IJPA 1XDWA 3QLJA 5BSFA 2YHIA 2EJVA 1YQGA 4MO2A 4KTVE 3MJTA 1UP6A 4L8VA 4BNKA 4YT5A 2Q1SA 3NJ8A 3VPFA 4HKTA 1EQ2A 4WGGA 1E3EA 3RJ9A 4RF4A 4Z6KA 1KC1A 4GKBA 5COBA 4F45A 4E0BA 2HO5A 4I9HA 2CDAA 4BIIA 4J90A 1GEEA 1VKNA 4Y8VA 4TMFA 4J0FA 2VQ3A 3TN7A 2IZ1A 2NNLD 2FWMX 1UXHA 2DLDA 4QFDA 2WD7B 2OO5A 3NEPX 4BMSA 4BGUA 1L7EA 1DIGA 1R16A 1V0JA 3AFNA 1ISGA 5COAA 1GDHA 2BFAA 1E1MA 2HUNA 4J1NA 1ZMTA 1ISHA 3EHEA 2SCUA 3KEOA 5DBFA 3ZWWA 1NM5A 4I5FA 1DRUA 4YAJA 4OQYA 3WIEA 1GYPA 1DB3A 1SB8A 1P9LA 1SNYA 5DCWA 5TSDA 3ZNPA 3JYNA 4TKLA 2BF7A 3VTFA 2ZCVA 1AXEA 3O9ZA 2B5VA 4GWKA 1A7KA 4CLHA 5IDQA 4WKGA 4I9NA 4BKPA 4YJHA 3WGIA 2HJSA 4KTTE 1UH5A 3KUXA 4PCVA 4YVFA 1HSOA 3GQVA 5TT1A 3PHHA 2NTVA 3EK2A 3O8QA 1VE9A 5DCYA 1LU9A 3P19A 4NFYA 1F8GA 2C5AA 3GC6A 5CDSA 2O7SA 1KVQA 4CM1A 3BYZA 1D1TA 1ZK0A 3R3JA 2Q1UA 2G1UA 4J43A 1GUFA 2P2SA 3LK7A 4YPOA 4Z3DA 1WLYA 3HZZA 3WDSA 5H81A 1PIWA 4GAEA 4K26A 3PIIA 3GG9A 1IYZA 3I1JA 1E5QA 4LVUA 1ZMOA 2H1SA 1HDXA 2B0JA 1HDGO 2AQ8A 2EHDA 4EITA 1PQUA 2HCTA 3OJOA 4FFNA 4OXYA 5EERA 2NV6A 4WEOA 1GZ4A 3JQ6A 5FI5A 3LF1A 5DT9A 4ND4A 4RVSA 3W8FA 4BNXA 2I3GA 4EJ0A 3F47A 1YOVA 2QW8A 4EBFA 3PQFA 3GY0A 4JBGA 1GQ2A 2VTEA 3E82A 1KYQA 1KBZA 3UUWA 5ITVA 1PZGA 2C07A 2BHLA 4N18A 2O48X 2EKPA 3Q3CA 5ILOA 1MX3A 3DBVO 3SXPA 4ZICA 3R6DA 4JK3A 2EWMA 5KVCA 1MGOA 4B3JA 3F4LA 2JFFA 4BKQA 1EK6A 4Z0PA 2QRJA 4D3FA 1J49A 3ROMA 4DQXA 1F14A 2I3AA 3T7CA 5B4UA 1NQ5A 1K89A 4OXKA 4XCVA 1ZBQA 1ZXBA 3L4SO 2F00A 3PLNA 1UJMA 4KZPA 4DLBA 2P68A 4ZQFA 1MLDA 2EERA 1NFFA 3TNLA 4ALIA 4MVJG 4ID9A 3AW9A 4PLYA 1JN0A 1LRJA 2OBYA 1V3UA 3GDOA 4XA8A 3I23A 3VDQA 3UCXA 1XELA 1DC6A 2HK8A 3L9WA 3PWSA 2I99A 1T2CA 4HWKA 3FD8A 1HF3A 3TPCA 2E82A 2VTDA 4LCEA 1HLPA 5LCXA 5K6AC 3QWHA 4OQZA 2ZKLA 2P5YA 2CSUA 3C1AA 4PGFA 3DTYA 1A4UA 1UDBA 2BFPA 2YY7A 3TDKA 1OOEA 1UP4A 3GVPA 5CG2A 4BGVA 1ZEJA 2ZIZA 5AXAA 4ZHSA 1EFLA 3LDHA 2YFHA 2UYYA 4WLFA 3H9JA 2NVBA 2PD4A 1DFHA 4G81A 3GHHA 3U4HA 2ZYAA 5T67A 3HFSA 4O5OA 4JCOA 3CPSA 5L51A 5FFFA 2PGLA 5DP2A 2PKQP 4CLOB 2OP1A 4RVFA 5JNLA 3V2HA 3JD0A 4CQMB 3CMMA 1BXGA 3PYMA 4UEKA 3EY4A 4AFNA 2X5JO 3FBGA 4AJKA 4Q3AA 5HBRA 3GZNB 2DTEA 4DQUA 2V6FA 3LC7O 2C7VA 3PJDA 1DDOA 4KWHA 3JQGA 3DHYA 2AQKA 2DM6A 1WW8A 3TFOA 3ITKA 4K1LA 5JDIC 1LNQA 1ONNA 3QVTA 1I10A 3JQAA 1VI2A 1W73A 1UXGA 3Q0EA 1MUUA 4ZGWA 4GH5A 2WWRA 1ORRA 4CLRA 1PTJA 3E5RA 3SC4A 2C20A 1H5QA 3K8ZA 3TZKA 3U4IA 4Y6SA 2PGDA 1U1IA 1V6AA 3DBLB 3MCVA 4JNKA 3ZWPA 4D7AA 5F1OA 5T5QA 2JAPA 1I24A 5JO0A 1XSEA 1QG6A 1R66A 2FSSA 1E7MA 2BI7A 5CP8A 3E6AA 1E7RA 4P4NA 3OIDA 2C82A 3GRKA 2Q99A 2OZPA 4IJVA 3GVIA 1U5CA 3ZW8A 2XXJA 5DNAA 4GVLA 1HZJA 2B4RO 5KIAA 3VPGA 3A06A 3AM4A 1PJ3A 1TI7A 1NWCA 2X8LA 1HYGA 3CUKA 3IOYA 4FOSA 1P1JA 1YGYA 3UCFA 3HB4X 4CLXA 2C59A 3NAQA 1KS9A 1X7GA 1E3WB 3RQSA 3ZI0A 4NJMB 5EINA 4WNCA 4JJFA 3JQ9A 4ZRMA 1IE3A 1X15A 2R00A 4ALNA 4MIOA 3U5TA 4B4OA 4HV4A 4FJ0A 4OYRA 1PJ4A 2E6UX 1UXKA 5BNFA 2FZWA 4XR4A 4WLEA 2HK7A 5GZ6A 3X2EA 3R3SA 1WVGA 4UUPA 2DFDA 3ZWAA 3M1LA 3PQDA 4FFRA 4A73A 1T2DA 3DFZA 4GSLA 3BTSA 3GVXA 3WGYA 1GCOA 3UH1A 4OSOA 5I7SA 3LC2O 4XYEA 1CETA 1MB4A 1HDRA 3LLSA 4N7RA 4NR0A 1ZIDA 5TJHA 1G0NA 5A04A 1P31A 3WJAA 1K5HA 1TXGA 4A2CA 2WEKA 2PD6A 3FNFA 3HADA 1H9BA 4DQVA 1WZEA 3F5QA 3JQ7A 4IZIA 4S3MA 1D3AA 3S2FA 2ET6A 4BL5A 4BO3A 4WOKA 2HDHA 4PLGA 5U9CA 3G3EA 1NVGA 3PYLA 3WXBA 4KP7A 4R54A 1O95A 3BMCB 2X0NA 2GD1O 4YA6A 3JYLA 1T2FA 4J9VA 4P38A 1D7OA 2DT5A 3K31A 3NYWA 1LDBA 3AOGA 1JAYA 3I4CA 1CIVA 3GG2A 4TKMA 4JX8A 3TL2A 5TF4A 1KEWA 3ZV5A 3F6YA 3WTBA 3CSDA 4BB6A 1WDKA 3RC1A 3DZGA 3UN1A 5AVOA 2GN9A 1B3BA 4CMIB 5B37A 4NBUA 1V3VA 3RAJA 4YJGB 1Y1PA 3A9WA 4XX0A 1IB6A 4EYEA 3BXXA 5I8ZA 3OF2A 4TZKA 2UAGA 1ZEMA 3ONDA 1EK5A 3HWRA 1S6YA 5JS6A 3WBBA 3WYCA 4AJPA 1GTMA 4E3ZA 4GX0A 1JWBB 4X54A 1PS8A 5GZ3A 1PZHA 3GFGA 1YL7A 1DFIA 2O50A 3C85A 3K5PA 1I3MA 3NGLA 4E2WA 2NU9A 3OJFA 1WZIA 5DBGA 5KOIA 3AI3A 3DZFA 4L75A 1BWSA 1Z6ZA 3AI1A 2HMUA 1JKIA 4J7CA 4XQCA 4DUPA 2J8ZA 4WEQA 3WGZA 5JFOA 1F8FA 1NP3A 2JJYA 1DIHA 2B5WA 2P9EA 3INTA 3H3JA 1VJTA 2HRZA 1PGQA 2IEDA 3KSZO 1EDOA 3PQEA 2PD3A 5KVVA 1XHLA 2X0RA 2BD0A 4EI2A 5GY7A 2NM0A 1PR3A 2Z5LA 3MTGA 1I3NA 4YTEA 5JDCA 4I08A 1NAIA 2X9VA 4XJTA 2Y93A 5HRUA 2RIRA 4BNIA 1LC3A 4FCCA 1EFKA 4IDCA 4RO0A 4TVOA 5L3ZA 4CMKA 1NYTA 3ROPA 4AL4A 4XYMA 3S2EA 3O38A 2JD0A 4Y6RA 3RUFA 1SZJG 1RYEA 5GMOA 4PG7A 1N9GB 4CR6A 3TJRA 2PZJA 4OOFA 1AE1A 3KM0A 2E49A 2W90A 3OJ0A 2CVZA 4QUKA 1I3KA 3I9LA 4H3VA 1JLLA 1YJ8A 3HQ4O 1SOWA 2ILTA 5EQFA 4UEOA 5ICSA 3IUPA 3RU9A 1A4IA 1UXIA 1NVMB 2I76A 2LDXA 4GGOA 4RCVA 3MJVA 3W4JA 1MG5A 2O3RA 4ZQEA 5C37A 3C7AA 3LVFO 3T4XA 4R3WA 4N5MA 1G6KA 1H6DA 2PY6A 2JKVA 2B36A 3RIHA 2V6MA 4BNMA 4CMEC 1EQUA 1LDGA 1V3TA 5THQA 4BNUA 5A03A 3FNHA 1PQWA 3VDRA 3IKVA 1BGVA 1YB1A 3D4NA 2HU2A 3RKUA 2QQ5A 7MDHA 4IQGA 2J6IA 3PIDA 4Y6PA 4R5HA 1ULUA 4IUYA 4LN1A 3G1TA 3AUTA 7ADHA 3PGXA 4AJLA 1U2DA 4BV8A 1R4MA 4WCFA 1T4DA 1IHXA 1LBEA 1I0ZA 2EIHA 1M6HA 2DUUA 3BMOA 3U9LA 3W6ZA 2QRKA 4U6SA 4YR9A 3RD5A 2ZJ0A 3NT4A 3PHGA 5C5IA 4NFHA 1Q7GA 1WWKA 1XKQA 1V35A 1YB4A 1O9BA 2CMDA 3WGGA 4AJ1A 1LLDA 3RC7A 3ULKA 4CM8A 5EIOA 1MFPA 2W4QA 4K6CA 3FF4A 4CLEA 3HN2A 2HMVA 3QJ5A 1XR3A 1G0OA 1CQIA 3FPLA 4LMRA 2FPIA 3KZVA 3R0IA 5JY6A 2WD8A 4BO7A 4JBHA 4RL6A 1M76A 1EUDA 3WS7A 1FJHA 1MP0A 2ZK7A 1EMDA 2JL1A 9LDBA 1GQQA 3I6QA 3K6JA 3AI2A 2BGMA 3DZHA 4BGIA 1TVEA 3ZW9A 4HUJA 3AU9A 3PLRA 3JQ8B 1SMKA 2GRAA 4RQUA 2IZ0A 5T64A 2D8AA 1WPQA 1UZMA 5JXWA 2Y1GA 1LDMA 4ZA2A 4KMSA 4Q3DA 3RFVA 2ZQYA 3SLGA 4W7IA 1H2HA 3C24A 3C1OA 1KETA 3K96A 2X0IA 2ZTLA 2FRDA 4NHEA 4YCAA 1NHGA 1PGOA 2Y0CA 2BFMA 4IDDA 1VRWA 4LW8A 4CQLA 5BQFA 5L7WA 1BVRA 1MXFA 2PV7A 4D3DA 3SBOA 2O4UX 3N74A 4DA9A 1OI7A 1JWAB 2BLLA 3DQPA 4NBRA 4XGNA 3LLVA 3VKVA 3ADPA 4YB8A 4G65A 3KV3O 3GNSA 3G0OA 2FZEA 1E7QA 1K6XA 4TSKA 1Y5RA 4PLFA 3GEMA 4NNJA 3ETDA 4NBWA 5J23A 2I5PO 1NBOA 3EAGA 1DIAA 3O26A 1NPTO 2I65A 4IIVA 5CEEA 5JCJD 3BA1A 4NJOA 4QT0A 4RLSA 4RF2A 1FDSA 1HYHA 3C3XA 2POQX 1EVYA 4I9UA 3EW7A 1NFRA 2FMUA 1U8FO 3PFFA 5DDIP 2AE1A 1LRLA 1I8TA 1PR9A 2PKRA 2TMDA 3MJ4A 4DYDA 4GGPA 2J5RA 1HLDA 3FNEA 1ZO8A 1O8CA 1SC6A 1LDEA 3JQ9C 3JQAD 2P4HX 1VPDA 2YDYA 5JMPA 2Y1OA 4IDEA 1R4NA 1PJQA 3DBHB 3JTMA 2J3KA 3ETGA 4NH4A 2Y0DA 5EESA 2WJPA 2BMAA 1LC0A 3V5NA 4F3YA 2OOSA 1XGKA 1LEHA 2QZ9A 1H2BA 3JQBA 3JV7A 4W7HA 1WNTA 4HFRA 5I7FA 4B4VA 3QA9A 4BS9A 1HDCA 4Q3EA 5AYVA 4L76A 2A94A 3I9OA 2VHVA 4RGBA 1R0KA 2Y67A 6LDHA 5FYDA 1KY4A 2VOJA 5FI3A 5HA5A 2JAHA 4EUEA 3IKTA 4E6PA 3RFXA 1Y8RA 1ZW1A 3AY6A 1I5RA 1OZAA 4PVCA 3I5MA 3RUHA 1GFSA 1JAXA 2FY8A 2VUSA 3DDNA 4HNGA 1MA0A 4B7CA 3CMCO 4JROA 1Y8QB 3H5RA 1XQ6A 1PS0A 2NUAA 4Z0TA 3ZWCA 3GVCA 2EGGA 3Q2IA 4ZVVA 4A0SA 4DPMA 2P5UA 3ZU3A 2G76A 3WLFA 2VHZA 3FN4A 1EE2A 4INAA 4A5OA 1XG5A 4XRGA 3DZIA 3OECA 4URFA 5CEFA 2Z1NA 1BMDA 4CM9D 3OBBA 4I5EA 3WGQA 1BVUA 3LF2A 1JQBA 1ML3A 4FW8A 1KC3A 5BSGA 1N5DA 1PL8A 3STHA 4E31A 4M8SA 1P33A 3IP1A 4R1TA 1Z73A 3QSGA 1GQYA 4KUGA 1F0YA 3VPHA 3KTDA 3DAFA 3F1KA 3NTOA 2Q2QA 3OIFA 3PP8A 1BXKA 4E5KA 4WPGA 4K28A 1Z7BA 4TWRA 4ALLA 1TLTA 3E8XA 1DHRA 5JBIA 3PPIA 3ZV4A 1BW9A 1M2WA 1R15A 1H6BA 4WOJA 4Z3KA 1LDNA 1PGJA 2I6TA 3KYDB 4BO9A 1ZFNA 5IZCA 5JE8A 5HS4A 1U5AA 1NAHA 3WMXA 1H94A 4E13A 2B83A 1PJ2A 5KVQA 3ZZNA 2BELA 2NTJA 1H6CA 2GGSA 4IMRA 1HDYA 1DLIA 2C2XA 5DF1A 4P22A 3RI3A 4BO4A 1N92A 4MINA 3Q9NA 1X7DA 3D3EA 4AG3A 1OFGA 2ZATA 3KYCB 1C3VA 2VUTA 3I9KA 3S8MA 4DC0A 1HEUA 2JCXA 1JA9A 3P2YA 3TOZA 5G0WA 3VH2A 4CODB 2PA3A 3TFQA 4KOAA 2VZ0A 1P74A 2G17A 2QRLA 1ENPA 3PJFA 4LK3A 4XRRA 4U7WA 3HDQA 2VRBA 5IDYA 3C7CB 4N5LA 5C3MA 4FC6A 3AOEA 5G4LA 5JDCC 1HE5A 3DZJA 3P7MA 3L6OO 4F6CA 1U3WA 3GPIA 2I66A 3RFTA 1SEVA 4XYLA 1Y5MA 5H83A 1F17A 1LRKA 2XXBA 2UUPA 1U4SA 4J4HA 3W8DA 1HRDA 1PZEA 1ZSVA 2NVUB 2YV3A 1SBYA 1GU7A 2UVDA 3E9NA 3PFWO 2H6EA 4I8XA 3D5QA 3K9QO 2CFCA 4XDZA 5MDHA 1LSSA 1YL6A 3ZV3A 1EUZA 1JDJA 1U9JA 3K2EA 2V6BA 1CERA 1T4BA 2CZCA 1GUYA 3GAFA 3ZCXA 2GO1A 1FF9A 3ST7A 3BMQA 3HSKA 3GEDA 2PK3A 4CQMD 2RHCA 1A27A 5KKAA 1GR0A 2FR8A 1ONOA 2FHSA 1O0SA 2F1KA 3EDMA 4FN4A 2EF1A 5AXCA 5U4QA 3NT2A 4OIMA 4CV0A 2W2KA 1P45A 1LLQA 3D0OA 4B79A 4YAGA 2VNSA 5TC4A 3E1KA 1IZ9A 4OM8A 2WTBA 2OBNA 1B0AA 2PLAA 1XYGA 1DC3A 3UHAA 4GLOA 4XYBA 3ZU5A 4PN3A 3QWBA 1YH3A 4ND5A 1DAPA 3GDGA 1Q0HA 2DBZA 2W2LA 3KLPX 3JYPA 1I30A 2X22A 1KVRA 4D46A 1QLHA 3U3XA 2I9PA 1X14A 2GPTA 4WCFC 2A92A 3MZ0A 1TA4A 1E6WA 4CMAA 2QX7A 5MGBA 1QV7A 1Y9AA 3BMNB 5F1KA 1BRMA 1Z82A 3WQRA 1QSGA 4DMMA 5I7EA 4IQ0A 3CZRA 5DN9A 1W0CA 4OH1A 5DZSA 1I32A 3N7UA 3M1AA 1MFZA 4BNVA 1RM3A 5TRTA 1CYDA 3D64A 1OMOA 1YVEI 3ASUA 4YJFB 3D1LA 3VC7A 1Q0QA 3OA2A 4HADA 1P3DA 1N7GA 3EVTA 3UCEA 3TZHA 5ITWA 1Q7CA 4FJ2A 5DCUA 3PZBA 3D5TA 2EW8A 3RUIA 3WG9A 5HM8A 3GRPA 1O6ZA 1ZVMA 4DBZA 1HWYA 3CE6A 2GUGA 3KOUA 3ICCA 2YHUA 5A5FA 4IZHA 4WECA 2VHXA 2C5EA 2PZKA 3CZMA 2ZCUA 3ICPA 1AHHA 2JFHA 4RVDA 4GX2A 2RAFA 1UAGA 4BO2A 2X9NA 3AJRA 3Q9UA 1WMAA 4CM4B 1RJWA 1NTOA 4I1IA 2RH8A 3HE3A 4XIJA 2D5CA 4BVAA 4NK4A 2BKAA 3H2ZA 4GSKA 5ES3A 3F46A 1PJCA 3HN7A 4OGWA 3WTCA 4MVJE 1LTHR 4PZEA 2D1YA 3VZSA 5IZ4A 4OOEA 4A03A 2HRBA 3COSA 1ADFA 4R41A 3D3WB 4RPGA 2WD7A 3B70A 2Y1DA 5JCJA 4C7JA 1HSZA 3VPXA 5JYDA 5LC1A 2EXXA 1OAAA 4MKZA 1I3LA 5ER6A 4BNWA 1QRRA 3EZYA 3HDJA 1VJ1A 1LSOA 3VZQA 4N54A 1Y9EA 3TSCA 1C1XB 4BNFA 1N8KA 4EEXA 3FRJA 4UVEA 1BSVA 4OAQA 3T4EA 3KLMX 1HXHA 3HNPA 1QMGA 3TQHA 3G1UA 4A10A 3QVXA 3ZGYA 3TZCA 1Y7TA 3D7LA 3WNQA 3ZHYA 3DOOA 4J49A 4JLWA 4W4TA 2Q4BA 4MP6A 3HB5X 3ASVA 4DC1A 1SOVA 1A9YA 4J2HA 1ZK4A 4E5NA 4XKJA 4TROA 1IULA 4FDAA 1B8VA 3KSUA 4RQTA 2PH3A 2ZYDA 4LRTB 5ER9A 3PTZA 3GN2A 3Q6IA 2C29D 3AUUA 1ISJA 3ZWOA 4BUCA 4J1SA 4J1QA 1WP4A 3FPCA 3NUGA 4ZRNA 4DVJA 1GPDG 5A06A 3NDJA 1QYXA 1AN9A 4Q3CA 3I3OA 1Z7EA 3K92A 3ZWVA 4BGEA 2YZ7A 3MEQA 2PWZA 1QP8A 4W9NA 4NI5A 4NK5A 1X0VA 2ZB7A 1LUAA 4M87A 2AQHA 2J5KA 2IRWA 4MIEA 3U4DA 3S2GA 4O0LA 4XIYA 1MC4A 2P91A 2Y1EA 2CUKA 1VC2A 1E5LA 3O03A 9LDTA 1DEHA 5T8KA 2RH4A 2PGJA 2PKQO 4CM9A 3AM3A 2BGKA 3ORFA 4BQPA 4C4OA 2BRUA 4HBGA 3DMTC 3FNGA 1HL3A 2DBQA 5KNLA 3PK0A 4OKNA 4BB5A 1LDYA 3NDRA 3ROKA 4BKOA 1RKXA 5A3JA 3O4RA 2H9IA 2DBRA 4PRKA 1IY8A 1UDAA 3RCBA 3WQQA 4D3SA 1LLCA 1T1SA 2D3TA 4RJTA 3PDUA 3OHSX 5JY1A 1AUPA 1E1NA 4BO5A 1HE4A 1T25A 2ZTUA 4UREA 3ZNQA 3D4PA 4JP2A 3BHIA 2D2IA 3BTUA 3QWAA 2WYWA 4R1UA 3FWZA 4IIUA 3A14A 3GGGA 3E5MA 2VWGA 4UAGA 4CM6A 2DAPA 4R1NA 1DBVO 1YE3A 3TOXA 5TIIA 1Y81A 2X6TA 1U3VA 4UULA 4DBVO 4O59O 4MVJH 2ZB3A 2GERA 3EYWA 4MJLA 4YBZA 3UVEA 4PLTA 4AJNA 4WNIA 1GZ6A 1ZSNA 1TB4A 2NQ8A 4YACA 5AQ1A 3NKLA 5I8WA 1MG0A 1GV1A 3L4BA 3RBZA 2NU6A 1O5IA 4FQ8A 3EVNA 4IPTA 3OP4A 4QO8A 2R2GA 4M49A 3K73O 2FOIA 2VHWA 1P0CA 1B26A 4EW6A 4TQGA 1WDMA 3ANMA 4M54A 1NR1A 3F9IA 3ANNA 4F46A 3MJCA 4TVBA 4XWYA 4YT2A 3WIDA 1KIFA 2CNBA 4ZQBA 3PVZA 2B4QA 1MC5A 1ADBA 1HYEA 4JQCA 3AFMA 2FPPA 2X7HA 3GNQA 3BTOA 4MVJF 2WE8A 3WBFA 3V2UA 4E2YA 2O3QA 2X5OA 4GKVA 1QXSA 1H6AA 2IDZA 2VWHA 1GYQA 4CLOA 3WQSB 4ITUA 3ONFA 3QWIA 1GCUA 1HTBA 3BIOA 4WASA 4CQMA 2GF2A 2DTXA 4FSHA 4OKIA 1QYWA 1YQXA 3M2TA 2Q46A 1EVIA 4FC7A 1M75A 3GZNA 3B1FA 4L4SA 3LC1O 2NADA 3TZ6A 4PIVA 1X0XA 2O3JA 2Y05A 1B14A 4YEDA 5A9SB 3SC6A 1K3TA 1E3JA 2NACA 1C0PA 4RPJA 2FN7A 2Y1FA 3C7DB 3RUCA 3HG7A 4LRSB 1HDZA 4AJIA 4Y98A 4H15A 1AGNA 3TWOA 1AHIA 2VZ8A 4Z0HO 3A28A 4LVCA 4Z9YA 4ZU3A 1TT5B 4PLCA 4TZTA 3QE3A 3ZWYA 4CR7A 4CV1A 1XA0A 1YRLA 3LQFA 4EJMA 5AXBA 3WMWA 4YAIA 2V7PA 4PLWA 2ZJ1A 2HSDA 4CPDA 1J0XO 3DBLA 3H9GA 3SLKA 5JW6A 4GPD1 2HMSA 4MKRA 5H82A 3WYEA 2EEZA 4ND1A 4FIZA 3DWFA 1GYRA 3IS3A 8ADHA 3GAZA 4L74A 5HS6A 5G4KB 2G82A 1R37A 4D0SA 3HFGA 3JQDA 1CWUA 4XQEA 1C0IA 1QYVA 3UFXA 5I9MA 3H9EO 1E7YA 4BKRA 1B16A 2GDZA 4BO0A 4AJ2A 1R6DA 4ND2A 1D4FA 5COQA 2OXIA 2NQTA 3ZWNA 4P8RA 2Q2WA 4B3HA 3TZQA 2D4AA 3RROA 1NNUA 3VH4A 4HY3A 4R51A 4HFJA 2YQ4A 5DBIA 1E3WA 4UUOA 3ZHBA 4R3NA 4W99A 1ENYA 4NJMA 3VTZA 1P44A 2PNFA 4QSMA 2D0IA 2Y0EA 4D42A 1N2SA 3LT4A 4DLLA 3M6IA 5BR7A 1B8PA 1W8DA 3OIGA 1C1DB 5KVSA 3CIFA 5L9AA 4YJDA 3B1KA 5JAZA 4Q3BA 1A71A 1NX6A 4MVJD 3KETA 1P1IA 4FB5A 2BH9A 4GVXA 3SJ7A 2W2LD 3DR3A 4PZCA 1WXDA 3GN1A 4FOOA 4BNHA 2FR0A 1ZKMA 3GMDA 3AY7A 2O2YA 5CAEA 1I2CA 4DRYA 5THKA 4EUFA 1LA2A 2X1HA 2VT3A 1LI4A 1RM4A 1UR5A 1IUKA 1U3UA 4JN6B 4XB1A 1ZCJA 4R68A 2IZZA 4FS3A 1EBUA 4ZN6A 1CJCA 3LT0A 5JYEA 2O4CA 1GL3A 5TX7A 3DBRB 4J91A 4MVJI 3W1VA 2YHIB 3VZPA 3EC7A 3VVBA 4IJUA 1YS4A 4R9SA 3V8BA 3WFJA 3FTNA 1X13A 1T2AA 3UKOA 4D45A 1E3LA 4ALMA 3WGOA 1Z75A 1PGNA 4Q9NA 5B4TA 3ZNOA 3BMCA 2C54A 4Y9DA 1B7GO 4HFNA 3PHIA 3HDHA 3AWDA 3DOJA 1GUZA 1N1GA 4PVDA 3PWKA 1DC4A 1XLTA 1DSSG 2G5CA 4ZJUA 5IAAA 4U0KA 5TT0A 5IXYA 4AICA 5KTKA 1QORA 3A4VA 3GVHA 3UAGA 3DAPA 1FDUA 5F21A 1KVTA 4MP8A 4J16A 1IPEA 3RWBA 1CQJA 1DPGA 4DTIA 3LZ6A 4BO1A 4CMIA 3CTMA 1EEHA 2C7GA 3A1NA 1NPDA 2EJWA 4KDEA 4YJGA 2J3IA 4IJWA 4N5NA 8LDHA 2E48A 4NZ9A 4WE3A 2DU8A 1VSVA 3DOCA 4ESOA 1T24A 4ZQGA 1QV6A 3DMYA 4YJHB 4FFLA 5L45A 1E1KA 4L73A 2Q50A 2X4GA 1FDTA 5ADHA 3O8QB 3HDYA 2HKIA 3KO8A 4WCDA 5IXSA 2Q3EA 2HK9A 2WE7A 5C7LO 3GNTA 2D5AA 2EGHA 2X9GA 3AY3A 3RU7A 3KEQA 5EPOA 3L0DA 4DYVA 5A9TA 5JC8A 3BHJA 1VKOA 1NASA 1BG6A 1KEUA 3JSAA 2PH5A 1Q2XA 3BAZA 3OQBA 4JXKA 3WWYA 5CFZA 4I5GA 4EJ6A 3H7AA 5FF9A 1U7TA 3IL2A 5A3VA 3HJAA 2R00C 1BDBA 4XJSA 2Y99A 4IY1A 4ROSA 3FTPA 2DC1A 3LU1A 3QV1A 3RC2A 4F6LA 2ZYGA 4XYGA 4IDFA 5IDXA 3RSHA 1X1EA 3KXDA 2GZ3A 3AUAA 5K0ZA 2XAAA 3UF0A 1YOVB 2JHGA 2HQ1A 3TF5A 5TQVA 4WLNA 4B4WA 4CMHA 1OC2A 4OJNA 1N9GA 3DZBA 1UAYA 3GPDG 3IUSA 4J1TA 1ADCA 1HE3A 4TRNA 4RZIA 5TGDA 4XGKA 1TT7A 5ILGA 1ZXLA 1ISIA 4BO8A 3KYBA 5TNXA 3NGXA 4L4RA 1P77A 3FHLA 4O63O 3GUYA 2NSDA 3BTVA 2QZZA 3QW2A 1ENOA 1SAYA 4WLVA 5GZ1A 2CD9A 4HNHA 3RC9A 1NVTA 2FR1A 3I9JA 4ZQHA 1GAEO 1DIRA 1ZUD1 2GCGA 4PG6A 4PLVA 3EUWA 4XD2A 4R4JA 1KEPA 4C7KA 2DPGA 1I2BA 3VZRA 2IYOA 3JYOA 2IXAA 5LDHA 3WYBA 4GL4A 2NTNA 3JQCA 3I9NA 3LSYA 4ILKA 2Y66A 3PHLA 4RDIA 2JD1A 2AXQA 3C1TA 4M1QA 1NWHA 3H3FA 3OM9A 3MWDB 1IOLA 2DKNA 3E9QA 3K30A 1H9AA 1U3TA 1UZLA 4NBTA 4W6ZA 4MOWA 1YWGO 3ZU2A 2YYYA 3SVTA 5K9ZA 3ON5A 1PJTA 4MIYA 1Z45A
chains in the Genus database with same CATH superfamily
2GN0A 3LUGA 1COWA 4CM7A 3LD9A 5F78A 1EEXB 3MLBA 3ABSB 1EGMB 2BEUB 3BT7A 2B1JA 1C0EA 3M5WA 5KYNA 3TLBA 5AHOA 4NCAA 2Z2YA 3BHMA 1OR8A 3HHEA 1QANA 5G02A 3FR8A 1B2LA 2NP7A 1DJNA 1QE3A 2KQUA 3IJRA 2GJ4A 3IQZA 3DS8A 4MVYA 3V4ZA 4O02B 2VXYA 2KS6A 4IXWA 4ARAA 5B64A 3PX2A 3OQ6A 5L6LB 4EL0A 2W6PA 3BCUA 5E1BA 1RWWA 2D1FA 4JLPA 1JYEA 3AR6A 3P97A 3CVXA 4JJ7A 3CVYA 1Z63A 1CR0A 2PVCA 2FFRA 1Y4ZA 2WZDA 4DNPA 2M1XA 2YWXA 3K3PA 1GUBA 2PO7A 2NVWA 3ZCTA 3OURA 4D80A 5F1PA 4AWBA 1YQQA 1PWZA 4CMBA 1FJGB 3EVAA 1EX7A 3F0TA 3RVNA 4TYWA 1DIBA 3RSCA 1A5TA 3CEMA 4GXQA 5KQMA 4FINA 4ZOQI 1W93A 1ZOOA 2XI4A 1QGYA 2F90A 3FGZA 4Q24A 4MPPA 3KJQA 1C3XA 3IGFA 3VISA 1T1RA 5AOVA 3W5JA 1FNCA 2FEKA 3O90A 1KARA 1OILA 3I52A 4MKXA 5HDBB 5KJEA 1K6JA 1SCQA 2GHRA 2ZRQA 1BN6A 1TO6A 2W00A 4RK5A 1KWKA 1NHWA 2DH6A 1Q0ZA 4R7TA 4B9EA 1SVIA 2II6A 3EMKA 5BSHA 4TRMA 2GEJA 2VDQB 1DLJA 1N7JA 1H93A 1BFDA 1SG6A 2QXTA 5DXAA 5CJJA 5TQ0A 1NULA 1R6UA 3I5UA 4F5WA 4KN5A 1FP4A 4ZVPA 3UA4A 4CLRB 4I4CA 3I2YX 2W6MA 1DAEA 4XEHA 3S1AA 1E64A 1EYZA 3JAWA 1O9GA 4F85A 2Y8EA 1GIAA 3FPGA 4YJ3A 2HNKA 1C0KA 1CF2O 4F2PA 5FAKA 4OLAA 1RHRA 2IDMA 5AKHA 3H5VA 3WHPA 5EKUA 1EK0A 4H2DA 3I6ZA 2EFCB 2O05A 3K0EA 4FYIA 1P7YA 3ADKA 4O2RA 4Q3KA 3SHWA 5K4HA 5L6MB 3DC2A 3JARB 3O2SB 4R8SA 4ZYXA 4UPVA 4Y2YA 4B82A 1FSGA 3BWBA 5KHAA 2XE4A 4RKQA 4RPCA 2QOEA 3S1LA 3EEOA 2HFJA 3T9EA 3O1JC 3G2MA 4QU0A 5CVDA 4EAAA 1WPRA 1ZJ5A 4WESA 1BCSB 1OGJA 2QYTA 3OC6A 2A9FA 3K6KA 4P83A 2WWFA 4R7ZA 5L3SA 2I7VA 3QGMA 4M8LA 1BS9A 3VUEA 1DDIA 3EPRA 4BDSA 3E53A 3H8WA 4MVJA 2H4XA 1TA0A 2YIDA 3N2YA 5E9AA 1JYFA 1GEGA 3IUMA 4GWLA 2A2ZA 2FFAA 3FUTA 3WGTA 4B4KA 1J5PA 2UVPB 4F3RA 4B0PA 4G86A 3GCGA 4XIIA 3LCVB 3ER6A 3NP9A 5H59A 1I1HA 4NCHA 1KI3A 1CK4A 5KINB 1FP2A 5BT9A 4TKZA 3X43A 2PM8A 4WVFA 3O83A 5ALXA 1E0AA 3KJNA 3CG0A 3AHIA 5EG5A 1WLSA 4AJ4A 4F3NA 5HJ5A 1ECJA 2ZQZA 1PZNA 4MQLA 1T2EA 5PGMA 4FGSA 3U0BA 1CJKC 5CDYA 3KWJA 2UYHA 3PE3A 2HIAA 1IZZA 3K9HA 2JJMA 5DM1A 2XCQA 3HO1A 4D9CA 2XUFA 3K0FA 2Y1WA 3HEBA 5EYPA 4I4TB 5A3RA 2E4AA 5JXIA 2I54A 5ELXA 3JYHA 2CDRA 2YDXA 3RASA 4GQBA 4RM2A 1D1PA 4YCCA 2CY0A 3NX4A 1ISPA 3QK7A 4AZSA 5EP1A 1HPLA 3L7DA 1II8A 4OI2A 2JLVA 1YFLA 1XF1A 3OQVA 1N3LA 1Y1QA 3DMGA 2BP7B 1UK8A 1XD9A 4IIEA 3K94A 3JAMA 2AT1A 2B8EA 2GJSA 4EF4A 1E3MA 4JBIA 1UZNA 3JQ7B 2PZMA 4QFCA 1O6BA 3KQPA 5AW9A 4MLPA 1FIUA 3F97A 3BQ9A 2JBHA 2YZ2A 3ZZMA 3P0HA 2ZBEA 3CX7A 5CBPA 1VLLA 2QM3A 2IBTA 2YIVX 2AE2A 2G80A 3B2QA 3ITEA 3DEJA 5KJ6A 3ZJ4A 4ZI7B 1RP1A 4WZZA 2V97A 2O3TA 4URUR 1P4AA 2C3PA 4PPQA 2BZ0A 1B8OA 3C98A 1RQPA 4Z4CA 5JCZA 3OQHA 4NG5A 5DHFA 3AG5A 1MC8A 5LQKA 2GLXA 5CB0A 1XCLA 3W4KA 5C8XA 3K6SB 3QLEA 4FMBB 4JQSA 3NNNA 4X90A 3HBMA 3ZDAA 3ZJVA 3RRXA 3IP9A 3VI3B 1P4RA 2A14A 3F7MA 1GFIA 3IP3A 5EJ2A 3DXZA 1HKHA 2GH1A 3A4LA 1JALA 4PO1A 4GOXA 4ZD6A 3R5TA 1DRWA 4WI1A 2XQFA 1YS2X 1Z36A 3BGDA 3HJRA 3Q87B 4FMCF 3E2MA 3QE2A 4HQRA 2HPZA 1QOQB 1CD5A 3IMCA 1DS6A 1W88A 2RHRA 5LOVF 3W5IA 1RW4A 1PYDA 2C4TA 1Z8NA 4P6VF 1BWRA 1UPFA 1BROA 4GQAA 5IKOA 5JRDS 4BXOB 4XB2A 1BRTA 5A9RA 4XX0B 2QTTA 4OHVA 1JV2B 1G5TA 2BFOA 3B52X 2CW5A 4OHKA 5A7HA 1RXCA 3GCWA 5AOAA 1PU2A 5ESXA 3GI1A 3F5FA 3AINA 2GYWA 2P9CA 4JKIA 4B4UA 1P7ZA 1SD1A 2BHRA 4UXIA 1IATA 4MQEB 4GPTA 3T41A 4AQ7A 2J45A 1N6OA 3AEYA 1NQVA 3V1UA 5NULA 3HB0A 2VYNA 3TG8A 4NICA 5EIFA 2QAIA 2W9XA 2DWOA 1NIJA 3AUSA 5DOVA 1X7XA 1PYOA 1VPEA 2IXBA 1CZKA 4MV8A 1ZA2A 2VTBA 1NQTA 1LVHA 3OICA 2FG7C 2J9RA 2XOKD 3PXXA 4TM7A 4XDYA 4Y6GB 3MJDA 7REQB 3J80A 1XVLA 4ZCMA 3NVKI 4PBSA 5DI9A 2XCTB 3EOBI 3V42A 2D8MA 4J4BA 3R8CA 1ZK1A 2QI9F 2XRFA 3NOVA 5FEUA 3OZDA 4I8IA 4TRJA 3CBQA 4KBGA 3TCNA 3BIXA 1MGPA 5L4NA 1OY1A 1U94A 1JW9B 3BB3A 3ENVA 4EYKA 3U56A 3W7BA 4LYDA 2GNAA 4FFOA 1EKXA 2NZ2A 1YZTA 4ZCLA 3QXGA 2FN4A 4ZV4A 1YR8A 2NVUA 5FLKA 2ADMA 4LISA 3Q2KA 5H3HA 1YA4A 3CH6A 1E1RD 1EVJA 1NFQA 3VMMA 3PA6A 3WLPA 3AEUA 2R751 2ZUBA 3NM4A 1POWA 5ALEA 1RACA 1MU0A 4PAOA 1OH8A 5TPZD 1ZUHA 1TEXA 2YV2A 3DL4A 4HLUA 4D9EA 1L5QA 3F1LA 4MPRA 5FPPA 5LZ4A 4L1KA 3VV3A 3UK6A 3Q85A 1P0MA 3JR3A 1NYQA 1RZUA 3C1UA 3K0HA 4URYR 2WYUA 3DEYX 3HY4A 3OT1B 3L41A 3RTDA 1FDVA 3SSAA 2WG1A 4REQB 4QYIA 1NMZA 1YXMA 3I9FA 2NW6A 1SGWA 2WSBA 3RR2A 2E4UA 2QX9A 3E03A 5B7GA 1ZHOA 4HNSA 3PHJA 1JZTA 4F1JA 2XD9A 3GRRA 3DT6A 4JFAA 5A0FA 3E15A 3EH1A 5SICE 3QWFA 3INYA 1B6SA 4HMQA 5ALQA 2B37A 3QP9A 4ALJA 1RYDA 2AUTA 5JZMA 1PSZA 3UWMA 3LT2A 1SVSA 3ROFA 5K2MA 1PFUA 1ZH6A 1EHIA 2CYAA 2H4YA 1ULSA 3NGMA 2Q1WA 4QTZA 3FSGD 3BZUA 4BP1A 2WAOA 1XVVA 2H11A 3DOFA 1W4ZA 3R20A 4J0DA 2P7IA 3AF3A 3TAXA 3ZD8A 3HZRA 4POOA 5KTYA 2HZBA 3NT5A 1H4TA 2IIQA 1VSUA 4JJ6A 1NBHA 4B7UA 1FXSA 3IDSA 4PC3A 2ZJYA 3SAJA 5JC1A 4R6WA 3ZGLA 4JJEA 3ZY6A 1T3LA 4CCYB 1SCUA 2WKWA 2GR9A 5F9MA 5LL6P 2HB6A 1BMTA 4UEJA 4C3UA 1IDOA 1U7OA 4YJFA 4WLUA 3T7DA 1NR7A 4ZVMA 5IBRA 4B7ZA 3DDWA 1X3LA 3BDAA 3IAFA 3OCJA 3JYQA 5IZCC 4YCNA 1G60A 2VDVE 4G5QA 4ER6A 4HDKB 4D3YA 4F9EA 1FPQA 1G291 1R0LA 4V39A 3VHRA 5L7TA 2P9QA 3P2KA 1SOAA 4N7BA 3ANSA 4S1OA 1E3SA 2BR5A 2ENUA 3HB1A 4Q7KA 5CX1B 5IX8A 2W5UA 2PFKA 4MMYB 2V7EA 3AF1A 3GLUA 4NMMA 1LTQA 3SZOA 5K8UA 1QYRA 4NC9A 2RHWA 1PUXA 4H6WA 3D4OA 4J7XA 1EUDB 2WTMA 1A7AA 3LW8A 2EOAA 4G2NA 4IV5A 3K0KA 5CHEA 2NSLA 4RF3A 2Z4SA 4BLPA 1BFKA 1RWNA 3ONEA 4WERA 1G9XA 4FK8A 2GN6A 2WTAA 1KFBB 4WXRA 2RCYA 4KU4A 4UUNA 1K4KA 2ZBFA 3GA7A 1ZGJA 2X23A 3FJOA 2CWWA 3DV9A 3WMFA 3DFKA 4DLAA 4EGSA 4DWJA 5I4CA 3UMRA 2O59A 4FI3C 4H08A 5AJTA 3COPA 4KQWA 4UBNA 1SVNA 4KN9S 5ESWA 3I09A 3AOEC 1DAMA 3F9CA 4L95C 3S2SA 2VDKB 2Q1TA 2VCHA 3ETNA 1AQIA 1QZUA 1XZFA 2Y4OA 2ZETA 1RPZA 4D8WA 4II2A 1P17A 4HLCA 3H1GA 4NPCA 5DEIA 2AG8A 3R41A 5AVSA 2YYSA 1HTWA 1KZ4A 3ACDA 4NONA 8ABPA 4LNHA 5CPFA 3HWX1 4DL9A 1O94C 3GRZA 2O1XA 4R83A 4UAUA 4UUMA 4CQLB 3HVRA 1JDPA 3IVGA 2IX9A 2GBIA 4QOJA 4Q9AA 5EIAA 1IN4A 1PVDA 3G6WA 4Q82A 2RHDA 3L6EA 3MS2A 2QG4A 1YE5A 4KYTA 1TCBA 1DVRA 1N7HA 5BRAA 1BQ4A 1E0DA 5ABPA 3C6KA 5ALYA 4C4SA 1N8SA 3E5NA 3KRTA 2BMVA 4N82A 4S24A 1JSZA 2FR8C 2P3SA 2W98A 4PFJA 2VQSA 4RLHA 5HTKA 3WWZA 3CGGA 4REMA 3BCHA 3PENA 3G89A 2CVHA 4NDAA 4QOFA 2IEYA 5T4FA 3PRJA 1S7CA 1JEDA 3H4VA 1E2PA 3QBEA 1VJGA 1FRVA 4PG5A 1NPYA 4RYLA 1PZFA 4KQXA 2X3UA 1IXZA 2TMKA 4GMXA 5EWJA 4DXHA 5LKAA 1M67A 2F3SA 2GCEA 2W83A 3P32A 4V1CB 5CM8B 4K6GA 3OM1A 2C4MA 5EEGA 4LBWA 1I33A 2FZKA 1JIIA 4LY9A 4K88A 5F2NA 5KTPA 3FMVA 2XIQA 4C4TA 4NULA 2FZLA 2PMCA 4Q7MB 3W6UA 1VHLA 3U9SA 2NUPA 4NY1A 4JJGA 1IB0A 4EFLA 5JRZA 3OTHA 4C0WA 5IFLA 1V9LA 4AO6A 1L4YA 2DFLA 2UUOA 4FWBA 4JFRA 3RWMB 3ZHZA 4CV2A 1YRQA 1UBHS 2O23A 1G2PA 4MUHA 2HCBA 3P2OA 4M7WA 2QNIA 3DDHA 3TRHA 3DHNA 3GGOA 4ND3A 1JKFA 1T26A 2JJ8A 1NDHA 2WJWA 3N8GA 5BN4B 3SX2A 2P9TA 2JK1A 2JJQA 2XLCA 1XQXA 1ONPA 3WSWA 3NTQA 5BR1A 1Z34A 2BF4A 2HIMA 2YW9A 1C0LA 3OI7A 5DHUA 5AP9A 5EL0A 4PG8A 5IF3A 5JMTA 1TL7C 3W4IA 4PF1A 1DDGA 4BBJA 4NTZA 1BHQ1 2RB4A 3MT7A 2A0KA 4QWWA 2ZSEA 3W9BA 5JVDB 3BJIC 1ES9A 2PTGA 2DUJA 4ML3A 3KSRA 3QY9A 2OPBA 1J6UA 2VJMA 1X7HA 3RS5A 3TJMA 3K2BA 2FDRA 5G40A 4DJTA 3E1SA 1DCTA 3B1JA 4IUDS 4F4FA 1U0OC 5CNMA 1FQJA 1VP9A 3IIEA 1Z0IA 3L18A 3OZWA 2PUTA 3FCAA 1ZITA 5CFQA 4EDFA 1H0KA 2OQVA 5ES4B 1UKZA 1KK0A 2JAUA 1CFZA 3EZ7A 3NDPA 2BEWA 1A5ZA 2Z4TA 3P9YA 3Q7TA 1VJ5A 2J7PA 2MYNA 1K6IA 2OORA 1QKIA 2XXAB 3LIIA 1DRVA 2GPYA 5G0UA 4UZFA 1E7SA 2H8GA 2QZ4A 4I6EA 2AUMA 2C7RA 2O6HA 2IX3A 5G0VA 3RYCA 2WF7A 3F2VA 2LXNA 1BQ3A 4N6GA 1E92A 1J0AA 3PVCA 4GR4A 4YAFA 1VL6A 4I9FA 3ZVRA 2J5QA 3K8OE 5HILA 2GPBA 1R8YA 1BA2A 2BI8A 1ZHHA 2OFWA 4WK2B 5JSFA 2DR2A 3ZD7A 2I3DA 2VRWA 5AH0A 4CZ2A 3IAEA 3ANLA 1KEVA 3LX8A 1II0A 3NIDB 1SBNE 1XO1A 3HP7A 3GZJA 3QYAA 3E3MA 5EQDA 1J9ZA 2OSVA 1LSJA 3QMMA 2O2CA 2BH2A 3A9RA 1ACMA 4YHHB 5IKPA 3CF6R 2JA2A 1JH9A 1ZZGA 1AUOA 2LVBA 4ZYUA 1FFXA 3EZLA 2DETA 4C29A 3IQFA 3M6WA 4WA7A 4O1MA 4XJXA 3TTVA 4OCZA 4C2BA 3TH5A 3KPUA 1DC7A 3GPCA 5BNIA 3P2IA 1JQ3A 1EP2B 3GF4A 1EFTA 4WUVA 2C3OA 3S55A 3LNCA 1TRKA 1PT6A 1QAQA 2IF2A 3DYBA 4MP3A 5I9LA 3VFDA 3ZXIA 3ZH2A 1V7ZA 3DBIA 5C1IA 1MX5A 3ND7A 4LK2A 3EWNA 5AESA 1JAIA 3U7EB 1PUJA 4KIWA 4YAUA 4RKEA 3TW8A 1HUQA 1OE0A 2JEOA 1AMUA 2XITA 4WV3A 4ARVA 2NT3A 4NENB 2Y0BA 5KNDH 4L57A 3IQDB 1DAOA 3GT0A 5THXA 3WICA 1ISSA 3CCFA 3FMPB 2APJA 1QC5B 5DWDA 5HTOA 3L49A 2AXNA 1RZVA 2IIVA 2YIJA 4XWGA 3VX4A 3FPHA 1O4WA 3PXCX 5C80A 4FHZA 1JLMA 2E0IA 3BMXA 4GMFA 1W5FA 4L4UA 3EOAI 5EXXA 1UMKA 1JJVA 2HH9A 4IGIA 3ZYCA 5JRJA 4FCWA 1WVMA 1G5IA 2VUIB 3W8EA 2QV0A 5LMCA 1E1CA 1ZUWA 5F2OA 3ORQA 2A88A 4U7DA 1PR4A 2GN8A 3OQ1A 4LF7B 2AOVA 2VCYA 2QHXA 4MS1B 2KW5A 3AMVA 1N5JA 3WOHA 1EWTA 2ZJZA 1NJ1A 5B6JA 1P73A 3G8AA 2ZZNA 3W2TA 2VAXA 3TZLA 4Z9FA 4I3FA 3KKMA 3WLEA 4FKMA 2I2BA 4G0MA 4AUKA 5IS2A 1ZICA 3EXAA 1Q0LA 5I7OA 3QX7A 3KP1A 4FILA 1SEPA 1OLXB 3IXMA 3QZUA 2ZBVA 4OQXA 4AXXA 1LVUA 1A9QA 2PRJA 2J9ZB 4PNPA 1C8BA 3QQPA 2WKRA 5BXQC 4FFPA 5CCXA 4FONA 5LOVA 2R8BA 3QJYA 4P53A 4HWRA 1XMQB 3O1LA 4XD7A 2W2KB 1QRTA 3EG9A 5AM0A 4A0FA 3X1DA 1ZM7A 1F6BA 4N3CA 2H5LA 1XK6A 3EF1A 4QRHA 3IESA 2VZ9A 5E7JA 4QPCA 5CU7A 1JU4A 4MUMA 2PZAA 4N12A 5J59A 3ZZ0A 1GPUA 3J7AC 1QBKC 1NQAO 2DR3A 4MWEA 1SXHA 4IGEA 2V6IA 3WISA 4UCWA 1HZZA 2HF2A 2J9FA 1SUWA 1R8SA 1M6YA 2XQGA 5F3RA 5G4KA 4D82A 1DO8A 1ZX1A 1W44A 3UMJA 4DMKA 2DKFA 2Q4EA 3GGDA 1PNOA 4HH4A 4AMYA 3DHEA 3K16A 2XUGA 1AB5A 1SQFA 1W0JD 3KPYA 3MCAA 4KWIA 3ICQB 3HKBA 3LZDA 1ZVQA 1LVGA 2QM8A 2I62A 4GYYA 5B1YA 4R69A 2X15A 4QDTA 5BN3B 2WRZA 1R5OA 4FNOA 2GZ2A 4PYRA 5CD1A 4IDGA 4HX2A 4CUZA 1QP7A 5A4FS 1N34B 4Z9XA 2DX7A 3OEEA 5HG0A 2V3VA 3BJEA 5K51A 1H2RS 5BSEA 4F2WA 3HBAA 3JQFC 4TTPA 5U1PA 2D1QA 2WHEA 3BC1A 3FLMA 2BCGY 4C43A 2ZRNA 1K4YA 4CLDA 4UTVA 4R16A 2W8ZA 4LWOA 2X3YA 2P90A 5A5EA 2C9OA 5BOSA 5FX2A 3DAGA 5KVAA 2P3QA 1CJVC 2B0CA 3KTAB 5FD8A 2QX4A 2QTVA 1UP7A 4ZAVA 3ORHA 3SM9A 3WXMA 1KSJA 3L1KA 4L27A 3ONVA 3ZHXA 3PGJA 3WX0A 2W6JD 1XYYA 3RREA 1GPJA 1I36A 4IOLA 4YDRA 4IW3B 3UG6A 4CR8A 1KRWA 3GP3A 4Q93A 2AEJA 3X0DA 1TAGA 2Q2VA 3LPCA 3V7YA 1DMRA 1K0UA 4I0WB 2JGJA 3UJCA 1MZVA 4NAHA 4OLHA 5LQUA 1GUDA 1QS0B 3DMTA 4D9MA 4C3VA 1AKNA 1VL5A 3MMXA 1REQA 3BOSA 4OMUA 1YA8A 4O6VA 4NE2A 2FSUA 4PQGA 1U98A 3DB2A 1H66A 1I0LA 3KDSE 2CBGA 4B17A 4ENSA 5EJ4A 3HEAA 2Q4RA 3TSYA 1NW5A 3Q5EA 1EFAA 3REOA 2O19A 3I6MA 3QLJA 4JKYA 3KKLA 2EJVA 2XRYA 3E9DA 1NVXQ 2NPFA 4XOIA 5F73A 3IOBA 3USES 1OFUA 3NVAA 4KACA 3GD5A 3SN6A 4ER5A 2V7QD 1YZQA 4DSZA 2VSFA 1Z4OA 1I9CA 3NONA 1AQUA 5EXEA 1OPRA 4GKBA 1FL9A 3TTYA 4KFTA 1NMYA 2HO5A 2QXYA 3X1MA 4WK4B 2CDAA 3KQVA 1CUSA 1ECBA 4EAQA 2YWDA 1SZDA 2ADFA 4LYGA 1A7JA 1JSCA 4O3FA 4KV7A 3OMXA 3CB2A 2FWMX 3QBVA 3ZJUA 1CVRA 3K1AB 1V2GA 1W49A 2JRCA 3IKLA 2Y2UA 3LDAA 3LQ1A 4FYVA 5CLIA 1ORIA 4A6PA 1U2SA 3NAMA 1QZXA 4LDAA 4LF5B 1NI5A 4INOA 1J8VA 5D5PA 3AFNA 4YXWD 4M36A 4LNAA 1W5AA 1ATZA 1E1MA 5SYMA 2HUNA 4J1NA 1V39A 1HBJA 1ZMTA 2IUFA 1SQGA 2XQVA 4G5XA 4RE5A 1X1SA 1DCMA 3MJFA 3KBBA 3KPJA 2WNSA 2X19A 2HA0A 3EIXA 3H8JA 4UBMA 5IT5A 1C4XA 3B2EA 2C4KA 1ACLA 1WEKA 4OQYA 3WIEA 4KR0A 2WZCA 3ZNPA 5BRJA 1RAEA 3KPWA 1XVAA 2VZLA 4OFBA 3UEOA 2BGRA 2ZCVA 3U48A 3C3MA 3N2KA 3M1IA 2B5VA 3B9RA 1FFWA 1K06A 3HL4A 1X9HA 1N25A 4HEA6 4ZAXA 3V8EA 4CLHA 4QTTB 4WKGA 3SYTA 2IOFK 2X7JA 3DH0A 2IYFA 1DEKA 1WM1A 3DTVB 4GM4A 4HNRA 4OBBA 3SX0A 1BKDR 4RZ3A 4P84A 3K5HA 4M1MA 2DPYA 1KQPA 3GQVA 1I2DA 1M72A 5A71A 5TT1A 1YZGA 2HADA 3IUYA 4OAOA 2CJXA 3O8QA 2Q6LA 3G5AA 4Z2AA 4V0RA 1GQSA 3GC6A 1ORDA 1CBUA 4R8MA 2O7SA 2OXEA 3WB1A 3MHPA 2Y3IA 1V8OA 3GW8A 2JLZA 3BYZA 2D2VA 2EARA 5KWJA 1PFVA 2G1UA 3WLAA 4BLQA 2B3DA 4Z4FA 1H0SA 1KDVA 5AVUA 1IUNA 1WXWA 3Q6MA 3HZZA 5ALWA 3W0LB 1WXGA 2WJIA 2D1TA 2X5NA 4D9IA 1ADYA 3ANYB 4MULA 3BF8A 4Z54A 2EFGA 5FJIA 4KR6A 1XMVA 3GEIA 1CRPA 2HL6A 4HYYA 3VU0A 2QDXA 1CY8A 4G6ZA 4MS3A 4JU9A 2HCTA 4HQ6A 4N5DA 2I8CA 3OJOA 4NZPA 4PC6A 1DQPA 4FGZA 4RD1A 4MYCA 1W9MA 2BJHA 4BX3A 3W5CA 4TL8A 3KLNA 4DLYA 5FI5A 1TCVA 1ODLA 5K3OA 3U6BA 4OBEA 5DT9A 3PC8A 5HRAA 2ZT5A 1JHRA 4RVSA 1J2YA 4LV8B 4B35A 2ZROA 1XZIA 1O5OA 4BZXA 3HY6A 1VDMA 2QW8A 3VKGA 1A9OA 5KSWB 1DBIA 2VA9A 3DWEX 3HYSA 4CW7A 2PKYX 5AO9A 5LQMA 1QHHB 1P3JA 4JY7A 3WB0A 2C5HA 5ED4A 2OC4A 4AC9A 2EKPA 2ZAOA 4FE4A 3DBVO 2NTEA 3MG9A 2Q8QA 5FXMA 3SXPA 4ZICA 3IA7A 2EWMA 1ESNA 1KKMA 3TSAA 1Z56C 3BX1A 1CZHA 1BVHA 1BNCA 1G2OA 1MGOA 3LHIA 1GR1A 1I6LA 3G5LA 4FT4A 3WLKX 1OXBB 4FOLA 2I1QA 1VLVA 2QRJA 1Q84A 3NFRA 3PE6A 1KI1A 3VNAA 4A2PA 4D3FA 4YUZA 1F14A 3GRVA 1U3DA 2XA9A 5AW5A 3NHZA 4N3AA 5LLTA 3E35A 4AB1A 3ECAA 3THRA 3IDFA 3JWIA 4DA8A 3PJRA 1CF4A 3L4SO 1W19A 1Y4UA 5DM70 4GRAA 2HLNA 3DEAA 3ILSA 3PLNA 4RWZA 1IJBA 5C8YF 2GPWA 2F1HA 2Z2ZA 4HD8A 3KR0A 4HX9A 1MW8X 4P08A 3GCZA 4DLBA 4TSRA 2YY5A 3SZLA 2XZOA 1COZA 1L6RA 2EERA 4CBVA 4J0HA 4JT9A 2B1RA 3TQIA 4XA8A 3VYTB 2OBYA 2VDPB 5GPBA 3DEKA 3PXAA 1XELA 4KMOA 1FRNA 4XVQA 2I99A 5I7RA 4MAFA 4ND6A 1SCDA 2EU8A 2GT1A 4LCEA 3A1WA 4I19A 1DBQA 2DMRA 1Z4KA 4WWHA 3TSOA 4BRZA 1O97C 4OEHA 2VDMB 1FX0B 2ZKLA 4DAOA 5CNKA 4NV1A 1EUQA 1ZU5A 1XTVA 2CYCA 2Z8YM 3KR1A 3LDFA 4IVQA 4Y2SA 4KK4A 5DGHA 2RIPA 2XT9A 4Y7CA 4PGFA 5FWDA 5HK8A 3GFOA 3EEQA 2H0AA 1A4UA 2OHVA 3DE3X 3DTYA 2ZR9A 7AT1A 1KXJA 1PG5A 2BFPA 2HWWA 4ZVKA 2YY7A 3TCXB 3NEJA 4GDFA 1TFUA 1RCFA 1OV4A 4P3XA 3OCWA 2HWYA 3UMMA 4C22A 1QIHA 4MRAA 1QZZA 4BGVA 3TR0A 5AKJA 2HRDA 3UY4A 1C9DB 4ZHSA 1ZY2A 2SBTA 3AEXA 4WLFA 4F2DA 4IVRA 2XZTA 3LRPA 2PWYA 3K8YA 1YIOA 2H1LA 4LZOA 2P2ZA 2AN9A 3VSBA 4DRXB 4RD4A 3LBFA 1MKYA 5KTSA 2WJJA 2LCIA 3O94A 1V48A 5T67A 1OVMA 3HFSA 2BEVA 4YP1A 4GKJB 4B73A 1YBFA 3BXHA 1OLUB 2W6OA 2WD9A 4JNCA 1IEQA 3CPSA 1E2NA 3DZCA 5FFFA 4BFLA 4HDNB 1J56A 3OUZA 2XSZD 4WZBB 2PKQP 3RFCA 1U6IA 4QQFA 5C1PA 2DP4E 3EWIA 3FZQA 4J94A 1R64A 3EFOA 1YSCA 4UEKA 2NV2B 1W48A 4AFNA 5LJLA 2Q3JA 3KQTA 4AJKA 4Q3AA 5FTKA 2I87A 4TX1A 5HBRA 3ZR4B 1OGIA 3CZPA 4KE8A 1Y6QA 3AVYA 2VJPA 3G5MA 3CX8A 3P8ZA 3PDIA 3V00A 2HA4A 4H17A 5FEMA 1G4UR 1DDOA 3PJDA 3JQGA 3CRW1 1A76A 3O8OA 2C7QA 3V46A 1JF8A 2ALJA 3MFQA 1JIVA 3CJQA 3AL3A 2EX1A 4M0LA 1KJJA 3WOVA 3QVTA 4F96A 3JQAA 3TGLA 3RADC 2XTZA 4FYYA 4M0KA 1OT3A 1M8FA 1UXGA 3UBMA 4BZPA 3HBFA 2G1KA 4G89A 3ZCRA 2WWRA 4TM8A 2WWYA 1ORRA 1P2SA 2OK7A 5ED0A 3S2UA 5C52B 3E5RA 3SC4A 5K8TA 3PIRA 4CF5A 4ZFNA 3ITNA 3KZCA 4MDFA 2CD7A 3TZKA 1XPUA 5TQ2B 3D7KA 1U1IA 3F96A 4EENA 4EKGA 2FA9A 1RYHA 5T5QA 5HKOA 1I24A 3L1VA 3H5WA 3TQOA 2JLWA 1I94B 2OHJA 4XQ0A 1BO6A 1R66A 3DG9A 2FSSA 1DQNA 1DT5A 1E7MA 2BI7A 2OHOA 2X7XA 4JAVC 4HYEA 4FFDA 5JQWA 3HXOA 1Z83A 2CLSA 1E7RA 1ZONA 1PCXA 1ZD8A 3GLFB 4BFUA 2Q99A 3C5VA 4B6PA 2OZPA 4IJVA 1U04A 3GVIA 4R1OA 2VI5A 2XXJA 4RDCA 5DNAA 1XZBA 3K09A 4NOKA 3WSTA 3OZRA 1EG2A 2BFWA 4PBTA 2X0EA 5DPMA 1NWCA 3CUKA 3WRWA 3IOYA 4FOSA 4IXNA 1KMQA 3HB4X 4AP5A 2QX8A 4JOSA 4RJIA 4DCJA 3DLBA 1NW8A 4KSCA 5A62A 1TM1E 2R7AA 1RI3A 3I32A 1X7GA 3TRFA 1Z8HA 2VKTA 3RQSA 1H2WA 1X6VA 4NJMB 3CF0A 4EHKA 3K2IA 4B4DA 2HTFA 3A10A 4RY8A 3T15A 1M5TA 5AK3A 3VU9A 1L7RA 4CCSA 4HV4A 1WCYA 4OYRA 4M9XA 1XZEA 2HXGA 3DLTA 4Q4JB 2FZWA 3WIUA 1G8YA 2HK7A 5GZ6A 3OOYA 1OV6A 3VO1A 3GLRA 3M6MD 1XDDA 3PQDA 1GZSA 1T2DA 5KUTA 2JEZA 3DFZA 1NL3A 4MQBA 5CH5A 3GVXA 1ECFA 1IMJA 1B0UA 4K6HA 1GCOA 4YMWA 3U9TA 3WGYA 5KAPA 5J43A 2ZE7A 3V2IA 3U19A 4V03A 2C58A 2DHCA 1TVKA 3LC2O 1MB4A 2W48A 5D3MA 3WLRA 3SKVA 1QR2A 4V1CI 4NR0A 3OZAA 1YF3A 2QW0X 3UJBA 5A04A 3WJAA 1MOSA 1K5HA 1CTQA 4EJMA 1MRNA 2H57A 1E2LA 2H29A 3RJTA 4D8VA 3L4KA 3FNFA 3D4BA 4MV1A 3UUGA 3F5QA 2PUEA 2ZI5A 3H2YA 1EINA 1JHOA 2CJYA 2FMHA 3FOZA 3FOBA 2WJ6A 1UWCA 5U9CA 5D6NA 1ND5A 3PTLA 2G70A 5ISMA 2ZU0C 3E7WA 4DDVA 4R0NA 4RGQA 1NF2A 2H18A 4INZA 3PYLA 4Y2QA 3WXBA 2VH1A 1UXOA 1VLMA 2FYTA 3MXOA 2X0NA 4GDMA 1WKBA 3JYLA 5DWVA 2F9FA 2XR1A 5LZ5A 1SG9A 1JBQA 3NYWA 4GW3A 4BUJA 3AOGA 4D97A 3P2EA 3HRKA 1MOQA 3KKZA 1Y98A 2VNHA 3TL2A 1KYZA 4FZ5A 1Z8FA 3A1VA 3KOXA 2ZJ3A 1NRJB 5BYJA 3F6YA 3WRYC 4TVSA 3SWWA 4OQPA 2JVJA 3DZGA 4V0SA 5IJ9A 4A0QA 3GT3A 4OHCA 1RZRA 1U1EA 3Q15C 4DMCA 2GN9A 2HREA 2QRHA 4DDWA 4G4SO 1T5OA 3SZMA 4DLTA 4C89A 1Y8CA 4EYEA 1Y1PA 3C3JA 1IB6A 5GWXA 1TFRA 5I9SA 5I8ZA 5TPWA 5JECA 1XJWA 4MV7A 4IGKA 4WIAA 1L8XA 3VAAA 1XMIA 3FF1A 1NJGA 4IHJB 4QIHA 5ALPA 3WYCA 3CRMA 3R23A 5HUJA 1GTMA 3IURA 2BKUA 3B78A 5DGTA 3WYAA 1PS8A 5GZ3A 3QSYA 3SVZA 1QO0A 2AK2A 3KXKA 2O50A 3ER9A 1QPBA 1I3MA 3NGLA 1NMQA 3OKFA 5CB4B 1ECGA 1FRZA 2DHDA 2NU9A 3HS3A 4JLNA 3RTBA 4BLTA 3LX5A 3ZDRA 5KOIA 3HN6A 1R0RE 2GJKA 4IO0A 2BDUA 3STTA 6AT1A 3DZFA 4L75A 4OHOA 2PU7A 5DLEA 3Q8MA 1P3Y1 4DUPA 4DTCA 2PZGA 3WGZA 3CUSA 1ZCFA 2G08A 2IY7A 2O06A 3LFHA 4RKYA 4MJ3A 3ZE6A 3T5PA 3IHKA 3ER8A 3BSWA 2J7KA 2HRZA 4KE6A 1Z47A 2X8BA 3GLSA 5FOXA 1F6WA 1Z6TA 1FZTA 2PD3A 1XHLA 3B6MA 5ERYA 2AFRA 4QG7A 3R6WA 2Z5LA 3MTGA 3CURA 1I3NA 2W0MA 4EB6A 4I08A 1L4HA 2XUJA 4IEIA 2Y93A 5HRUA 4MUFA 1GNVA 1LC3A 4X85A 4YJ2F 1V8PA 2ID7A 4ZVTA 1QV9A 4TVOA 4F1KA 4MWOA 3M89A 2WWHA 5IM4F 4RTJA 3HACA 1YS1X 3KJZA 3EDCA 5ALFA 5TB5A 3P94A 1E3DA 1FS4A 3S2EA 3O38A 4Y6RA 3BUSA 1CS0B 5GMOA 3QLTA 2ZT6A 1T34A 2I3BA 3FPKA 4DZRA 4QBGB 4MQFA 4CR6A 3TJRA 2D7JA 1VBFA 5CH3A 3ZG6A 3BBPA 4HXEB 2SECE 1CUXA 3F7OA 4QUKA 1JEEA 5IC5A 1OLSB 2G72A 1JLLA 2FSVC 1J0EA 3HQ4O 3NVMB 4OJQA 1RJ9B 2WUDA 5T41A 2NPIA 4MQ6A 3ZS9A 4PAWA 4HBZA 4EA9A 4EOGA 3C0KA 3MJVA 3VNSA 1MG5A 5T4HA 5C37A 2IUYA 3LVFO 3R5FA 1Z2PX 1H6DA 3P9PA 2B36A 4WDQA 1YK1A 1LD3A 3MBIA 4WKNA 1LDGA 2QMHA 4RTLA 5ESRA 1E2EA 2K2WA 5KMGA 2VJNA 2QUJA 4LXHA 4LFBB 4CIBA 3IKVA 1CLUA 1YB1A 3K1TA 4RMNA 3U2QA 3RKUA 4EG3A 7MDHA 1EGVB 4LNUB 1K88A 2FSFA 5BSKA 4Y6PA 5KQSA 1TM4E 5KTTA 1ULUA 4D4MA 1NYRA 2CHQA 3CO5A 3G1TA 3LQQA 4HEA1 1RXYA 3FJYA 1TVMA 4WZBE 5WRFA 3O4GA 4CN9A 7ADHA 5IRCD 3LY7A 4MS4A 2HPVA 4D25A 1DAIA 1QJCA 5I47A 2DCMA 3LBHA 4JI8B 3KL4A 4KRGA 4WCFA 5DH9A 5E1DA 1KJYA 5EHXA 4PSDA 4DR6B 1I0ZA 1PE0A 2NYVA 4COOA 1VIMA 2DUUA 3BWEA 3V6MA 3KE9A 1IC6A 1UFQA 4Y2JA 3W6ZA 2QRKA 3DR5A 3GGSA 1J24A 4QVKA 4TUYF 4U6SA 4EHAA 3RD5A 5K7SA 4G1FA 3NT4A 5C5IA 1N2BA 1L4KA 1WZCA 4NFHA 4DUGD 4M1YA 1Z7WA 4R81A 1O9BA 2CMDA 2GI4A 3O8BA 3ULKA 4MA4A 4EI7A 3WC4A 2W70A 1T0JB 5HMLA 1U8YA 4QXRA 4CN8A 1G0OA 2IH2A 4DXAA 3OKCA 1KJ8A 2XB2A 3E0QA 3T35A 3ZE1B 1E2GA 3MT0A 4RSGA 2IY8A 5KNCH 2NXWA 1P80A 3FMOB 3U31A 1HV8A 4QU9A 3CF4A 3B8HA 4FP9A 5GQSA 3D3NA 3ZQ6A 1DP4A 4DARA 1PL0A 3BFKA 1MP0A 9MHTA 4V24A 1GPBA 1EMDA 2H1FA 2JL1A 1SUCA 2FMIA 3GV0A 4R2LA 4OY3A 4ENPA 5IYZF 5L3QB 4CKBA 3DZHA 1TVEA 4J0CA 4QJBA 1FUYB 4AYTA 3ZW9A 3C8HA 1DQZA 3AU9A 3LCRA 4HUJA 5DBOA 3T1HB 1CS4C 3GLFE 2GRAA 3LDUA 2IZ0A 5AM1A 3E8MA 5FA6A 1W46A 1QHXA 2IS2A 2XEXA 4WW0A 4KGZA 3OU2A 4YMSA 5EJFA 2RI1A 5IABA 1DBWA 3ND5A 4RH3A 2Y1GA 3L8EA 4EY3A 1KP3A 5C8YA 3ZE2B 3IPRA 4X6XA 3SLGA 3GCDA 4G2TA 1OX4A 3C24A 1MVNA 1QFZA 3ZBUA 3AFIA 1XTSA 3DW1X 5DLQC 5HEKA 1TYBE 1DKNA 3U16A 1PGOA 4IDDA 2BFMA 4LZAA 5L7WA 4NBKA 5M29A 5TQ0B 3ZVMA 4YH1A 2ATVA 1FP4B 3N74A 2KI5A 1YR3A 3NPMA 1H3FA 1VA4A 1JWAB 4O1HA 1JDNA 2JFWA 4NBRA 1QG2A 3LLVA 3JAWB 4RKWA 5GJWC 3S1AB 4DEXA 1OB2A 3ADPA 4J7AA 1UPCA 4YJ3B 5LMNB 5FUVA 2RB5A 1L5GB 5EKSA 4G65A 2PE5A 2PUFA 3KV3O 1DRJA 3G0OA 1E7QA 3R24A 2P9ZA 1DTSA 2AG1A 4RULA 2XF2A 3ETDA 4NBWA 5LP6C 4EF5A 5J23A 1E62A 3BB4A 3KT0A 5C18A 4WKBA 3O26A 4RQBA 4CU2A 1P4GA 5DLDA 4RVOA 4DS3A 1JILA 1Y5NA 2POQX 4EBBA 2ZVDA 2CHEA 1EVYA 5IG2A 1PR2A 1I3CA 1T3HA 2XNDA 2VYFA 6LDHA 1I7PA 1O7JA 4ENRA 1PR9A 2TMDA 4KR7A 4Z53A 2XBMA 2VJLA 4WESB 1EZ1A 3FNEA 5GJCA 5L3SB 1CR6A 1CY1A 1ZO8A 1SC6A 2H1RA 3NYIA 3PQ4A 4KXNA 2RAVA 3JQ9C 5A5GA 2P4HX 1U1CA 3FFWA 1K9SA 1U7XA 2P1ZA 3AJ9A 5FKJA 1K3UB 2FX2A 1VYUA 1USVA 4UMEA 5AR1A 3NASA 3IIIA