5LC1A

L-threonine dehydrogenase from trypanosoma brucei with nad and the inhibitor pyruvate bound.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
320
Chain Sequence
MPRVLVTGALGQIGTDLSLALRDKFGADSVLVSDVVEPGAKHPLAGLKGVEKLDCLDSNGFEKLVKEFKPTWMYHLPAIMSVRGEAEPDLAMDINVNTTRYALELARKYNIRIFIPSTIAAFGDKCGKTMTKDDTIMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAATLPGGGATDYAIHMYHSALLQKKCVCPVLPYESLPMMYMPDTLNSLVKIMEAPLEKLTRTVYNITGFSFSPSELRFSIERCTDRTIEVEYVEGPAQKIANSWPDSLDDSNARNDWGHQVKYDIDMMSEDMLRQIPILHGLPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of L-threonine-3-dehydrogenase from the parasitic protozoan Trypanosoma brucei revealed by X-ray crystallography and geometric simulations.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords L-threonine 3-dehydrogenase
total genus 121
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2016-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5lc1A00
2CZCA 1ZSYA 1ZW1A 3NGXA 4L9RA 4NR0A 5ADHA 4E5PA 2VWGA 3D3EA 3BZUA 1EFLA 4I9HA 4PLHA 2GZ1A 3OETA 2CDBA 3G1UA 2D4AA 1DIGA 4PLGA 1U8XX 3K8ZA 1E1LA 1S7CA 3HWRA 4PLFA 2CUKA 3WNVA 1XQ6A 2PD6A 4EYEA 1SMKA 3RUCA 3F5QA 1OMOA 1NR1A 3ON5A 1PL6A 5DCWA 1XIVA 5BSEA 5IXYA 2VZ0A 3M2TA 3AY3A 3GR6A 1GCUA 4ND4A 4URFA 4YJHA 1XSEA 4HV4A 4U8GA 4UREA 1QLHA 4J49A 2YFHA 2X7HA 1DOHA 1UH5A 4KUGA 1QRRA 1T26A 1PGOA 1BMDA 1XEAA 4J7XA 3ZWCA 4CM9A 3FTPA 3RFTA 3GMDA 1Q1NA 4M54A 3RUEA 5CDSA 3FWZA 1P0CA 5HRUA 4XYLA 2I9PA 1NPYA 3ZHBA 4AJEA 1Z73A 2PFGA 2ZATA 4FFRA 1DRWA 1ZZEA 4P22A 3BHIA 3ZWPA 3D64A 4BKOA 3WIEA 4XJSA 2ZJ0A 4TZTA 2D59A 4RVSA 5K6AA 4XZ3A 5DULA 1TEHA 4A7PA 4DRYA 5FF9A 5F1KA 4DC1A 2YY7A 5COAA 1U4SA 3C7DB 4TRMA 1VI2A 2Y1OA 4L4SA 5JFOA 1NPTO 4BNZA 1B14A 4DBZA 4CUJA 1BXKA 4WLNA 3A06A 4BNKA 2YV2A 4CQLA 1DPGA 2GNAA 3L6EA 1M66A 1E3WA 4UAGA 4J16A 4Z0PA 4FGSA 2FPGA 1A27A 3CSDA 2PZJA 4OXYA 4DLLA 2YW9A 3SLGA 2NQ8A 5BNFA 1B0AA 2VWQA 3I6IA 3OIDA 1G0NA 2OUIA 4CLDA 1IZ0A 3PGXA 4LMPA 7ADHA 2ZCVA 2YJZA 5DDIP 4I1IA 4AJIA 2G76A 1JTVA 3WGYA 1GUFA 1IPEA 1PJSA 1W0CA 3JYNA 3M2PA 4RPKA 2HMUA 1GYQA 5L4NA 2X0RA 4F45A 3ZWOA 3FNEA 4HFRA 1UXJA 2ZCUA 4GSKA 4MKXA 2IEDA 2JFGA 2DKNA 3PIIA 1YL6A 1E3SA 4NG5A 2YV3A 5TJ9A 1VJ0A 4NK5A 1E7RA 1CQJA 3OJ0A 4QEDA 3IL2A 4RGBA 3JYPA 3ZV3A 5C5IA 1CEQA 1RM4A 1PJLA 1ONOA 2J3IA 3VHRA 4K6FA 3MJEA 4DPMA 3ZZNA 2IYPA 2PGDA 4BL5A 2P9EA 4RF3A 3D5TA 1GZ6A 4L4RA 3RI3A 3ZWWA 4BUCA 3PJDA 2CD9A 1DDOA 4GMGA 1Y8QB 2ZJ1A 4W82A 3WGGA 1OBFO 4XYMA 4BO2A 3WYEA 3EK2A 4K9DA 3WBFA 4BKPA 4MO2A 1DAOA 1ADGA 3S2EA 4Q3NA 1MFPA 1P74A 2Y05A 1LRJA 5A1TA 3GLQA 4RO0A 4C7KA 4BV8A 3L9XA 1VL0A 1I3LA 1GQQA 2DBRA 1NTOA 5L51A 3IKVA 4B8WA 4PLZA 2BH9A 1HXHA 2WYVA 4D41A 1TLTA 5G4KB 3DZFA 1R0KA 3PRJA 1U3WA 3TZHA 2UYYA 5TX7A 3GG9A 2FR8A 4II2A 1NBOA 1VE9A 3IS3A 4RZIA 4CMKA 3UCEA 1CYDA 3AY6A 3HSKA 3WXBA 5JCJA 3SX2A 2YHIA 3S8MA 1SPXA 2XXJA 3E18A 4DMMA 4M8SA 5L95A 4LRTB 4PRLA 5ER9A 4DLBA 3AJRA 3W6UA 4CR8A 1LDEA 2PV7A 4E30A 4WOJA 4YRBA 4GX1A 3D4PA 4HFMA 4NFSA 4D0RA 1YBMA 4I5EA 2HO5A 4YEDA 4BO0A 2LDXA 4J1NA 4CMBA 5I9LA 1KY5A 2Z95A 4AG3A 3FNHA 1A72A 1GV1A 1HWYA 4AJJA 2Y93A 3ZWNA 1YB1A 3K2BA 1WWKA 4R3NA 4E13A 5T8KA 4RVFA 4Z3DA 5MGBA 3ZGYA 1Q7BA 3BTOA 1O6ZA 3O03A 1WW8A 1C1DA 1ZVMA 4W99A 3V5NA 2CY0A 1QV6A 2ILTA 5KJ1A 5IXSA 3JYQA 4OGWA 4XEHA 5C7LO 1ULSA 1GUYA 4MVJG 2W4QA 4MP3A 1P1HA 2AEFA 2BGMA 1KEUA 2C2YA 5KJCA 2DC1A 3DDNA 2Q4EA 3WOHA 4NJMA 3WLFA 5AXAA 1ORRA 4J1SA 5DP1A 3DB2A 4IZIA 1JW9B 3E9QA 3HB4X 3PDUA 4XYEA 3RC2A 4IQGA 1HETA 1ULUA 3ONEA 1DO8A 2AE2A 3GQVA 4IS2A 4PG6A 4UVIA 4XGNA 1KYQA 3KYCA 2DTEA 2C7VA 2Y1CA 4JXKA 2VHWA 1YOVA 3C8MA 1NVTA 2SCUA 1TT5A 1I32A 1YS4A 2B35A 3I9KA 3ONFA 4Y6PA 5AXCA 2QRKA 1ZEJA 3E9NA 3RU9A 1GAEO 1YO6A 1HDYA 4I9NA 4PGFA 2V7PA 2RIRA 4RL6A 4CV3A 1XQ1A 3UICA 3GOHA 3FPCA 4F46A 3KBOA 5EL0A 4HFNA 1ZMTA 2QZZA 2VZ8A 3OQBA 2FR1A 1U3TA 4FB5A 4BQPA 4PCVA 1JWBB 3K31A 4OAQA 3FTNA 5JYDA 1ENYA 4I5FA 2CDAA 3TZKA 4OSOA 3ASUA 1HYEA 3DBHA 1M6HA 2RHRA 4JBHA 3ZCXA 1WZEA 3IAHA 2BELA 2Y1EA 1X7GA 2R2GA 1T4DA 3DC2A 3ZNQA 5HM8A 5HBRA 2H9IA 3DMTC 4IDEA 3NT2A 4N7RA 1RWBA 2AE1A 2QYSA 3C7CB 3KUXA 2NU6A 4NMHA 4WK6A 1YH3A 4PLPA 4BNWA 5H81A 2YV1A 4D3SA 4XB1A 1JAXA 1VRWA 2WD8A 3C1TA 3DHYA 3S2IA 4MVJI 3RUIA 1P33A 2UDPA 3RFVA 4FC7A 1MG5A 3Q2IA 4OMUA 4ZICA 1ZUD1 4XR9A 4L73A 4J1QA 2GDZA 2NWQA 4BHTA 4NBRA 1LDYA 4FFOA 3W8FA 2HMVA 5G0WA 2OOSA 4IDBA 2QHXA 3PHLA 2A9FA 4LISA 4CPDA 1IHXA 3AK4A 4E3ZA 1NAIA 1GV0A 5TF4A 2WE8A 2OHXA 4F6CA 3FHLA 1ISIA 2DPGA 5TGDA 3F47A 5U9CA 4NZ9A 3K96A 4HFJA 2Q49A 3H65A 3EC7A 3HDHA 3WBBA 1O94A 2PY6A 1V9LA 2NNLD 4EEXA 2IXAA 3D7LA 2BMAA 3UKOA 1RJWA 3OEWA 5THQA 2BGLA 4B3HA 3WYBA 5EJ2A 1UXHA 1A4UA 4ALKA 4Z3KA 2D2IA 1UDAA 5JAMA 1SEVA 3Q1LA 2NVUA 2O4CA 3PYXA 4G5HA 1V3VA 3U62A 4CMIB 5CEJA 3PK0A 5DNAA 4IDDA 2BFMA 3PHJA 1X15A 2A92A 3E5RA 1LXCA 3NRCA 4IGEA 1ZSVA 3PJEA 3GAZA 1HL3A 1T1RA 1LRKA 3ETGA 3HDYA 3PHGA 4YAJA 4CR7A 1K0UA 5CPBA 1AHIA 1QG6A 4TRRA 1KC1A 1NX6A 3PDJA 2YUTA 4BNYA 4L74A 4XDZA 1MXFA 1X1TA 4YTEA 1IUKA 2GR9A 2OMEA 3ETDA 2GD1O 4Q3EA 1UZMA 3C7AA 4PLCA 3WICA 3RIHA 4KUEA 4OIMA 3FWNA 1GFSA 1OOEA 2O4UX 1AN9A 1I0ZA 3JD0A 4QFDA 5CFZA 3QWAA 1ZK0A 3WIDA 4ZQFA 4XYGA 3NDRA 4RPJA 5CG1A 4R9RA 1NM5A 4BO6A 4BO9A 1BVUA 3IJPA 4EGFA 3EHEA 4BNGA 4E5YA 1V6AA 4HADA 2ZTMA 7MDHA 4ID9A 4YT2A 3Q6IA 2QG4A 4GMFA 4KMSA 3UF0A 5KVSA 2HKIA 4LMRA 2BHLA 2CF5A 2O3SA 3PHIA 4GGOA 4QECA 4AJPA 3NYWA 1NFRA 1AXGA 3JQ8A 3JD3A 3OQ1A 4GAEA 4MVJA 3L9WA 3HE3A 3LT2A 4TMFA 3TRIA 3GNSA 1ZXBA 1TT7A 3TJRA 3CTMA 3GNTA 1Y1PA 2G5CA 4IBOA 4ILKA 2DTXA 2FPIA 4GGPA 2EP5A 2G0TA 4R5HA 5C3MA 1DEHA 3EUWA 4W7HA 2XF8A 4ND3A 2JD1A 2IE0A 5ITVA 5L3ZA 2QYTA 3QSGA 3PWSA 4Z9YA 4W7IA 4MPDA 1F0YA 1PWXA 1O9BA 3D3WB 1S6YA 4G2NA 1R4NB 5A3JA 4PZEA 5HWSA 4GVXA 1T2EA 3X2EA 3CUKA 1E92A 1FK8A 1T1SA 1J5PA 2VUTA 4M49A 3GY0A 4M87A 6ADHA 3G17A 1M6WA 1IPFA 1PEDA 4YJFA 3IC5A 3KTDA 1QMGA 4XQ9A 1QXSA 3WQQA 4BNNA 5A9SA 1UP7A 1CIVA 1J6UA 1LDGA 5DCUA 5KVVA 5JPIA 3WSWA 3AI1A 2X4GA 1N7GA 2C20A 3GHYA 1E3JA 1A7KA 3CINA 2VTDA 4RVDA 1FXSA 1K2WA 1GQ2A 4MVJH 2H6EA 2VRCA 2HMSA 2NTJA 4J4HA 3C85A 4WCFB 3VC7A 5CG2A 5K9ZA 3B20A 2VYND 3DTTA 4IINA 3DOOA 2B4TO 5JW6A 2WDZA 1PJQA 3OJFA 3GFGA 3D1LA 3VVBA 3JD4A 3WFJA 3TZQA 4B79A 4DQXA 2OBYA 3DWFA 3RBVA 4G81A 5GZ1A 4IIUA 3B1FA 2B37A 4CLOB 1UDBA 4B7CA 2O3QA 5ILOA 4OYRA 4TRJA 3AM3A 1EQ2A 4YDRA 1JU9A 3LVFO 4RQUA 3AFNA 3IJRA 2IEBA 2X5OA 3HNPA 3PZRA 3DZIA 1HDGO 3F4LA 1OFGA 1H6CA 2DTDA 4IDFA 5IDWA 1VKNA 4WJZA 1R66A 1PL7A 2HCTA 3VTZA 1DAPA 1NR7A 5JDIC 5JE8A 1EDZA 2OBNA 4YRAA 5KVCA 1R12A 3DBLA 4Z9XA 5DCYA 1B15A 4EI2A 3SVTA 2X8LA 5DBFA 1DJQA 1SBYA 2I3AA 1L7EA 1J4AA 2OP0A 4Y9DA 2WYWA 4CM8A 3KXDA 2BF7A 4GKBA 1V3UA 1QP8A 1Q7GA 3JYLA 5BR7A 3GGPA 4RVGA 4FS3A 1VKOA 1JKFA 2EEZA 4FJ1A 1DIHA 5JC1A 3ICPA 3HDQA 3WQRA 3VAZA 4CMAA 3KLMX 4FBGA 1C0LA 4PG8A 2IODA 1JKIA 1JAYA 1HT0A 1LLDA 1HYHA 3GN2A 4MOWA 3PPIA 4CUZA 2DUUA 4WEQA 2WJPA 1KVTA 3L6OO 3EMKA 3NJ8A 4RPGA 3AU9A 4DLAA 4UEOA 2NADA 4WLUA 5B1YA 1UAGA 1I36A 2BGKA 3RJ5A 3QVXA 4CM3A 4E5MA 2O3JA 3QWBA 3ORFA 3EAGA 3AU8A 3INGA 3JQDA 4GI2A 4RF5A 1KVUA 3ZV4A 3TZ6A 5KKCA 2Y0CA 3E8XA 1HDXA 3WGTA 1VLLA 2X5KO 2GERA 4FDAA 4KP7A 2AQ8A 2B69A 3DAGA 3NEPX 5DT9A 3TN7A 1XA0A 3WGIA 3KO8A 2D5CA 4O0LA 5ILGA 1EMDA 4WASA 2EHDA 4ND5A 4YAKA 1Z7EA 4YT8A 1QORA 2X0NA 1O8CA 3IIEA 1C1DB 3UXYA 4NU6A 1B3BA 3AUTA 1NHWA 2JFHA 2V6GA 3ETEA 2RH8A 4D7AA 3LC2O 4E21A 3SEFA 2DBVO 1R15A 4JP2A 4CM6A 1HEUA 1R16A 1FMCA 3VDQA 4ZVVA 1GPJA 2C29D 3LT0A 1QSGA 3LYLA 1WZIA 4NFHA 3P2OA 4IMRA 4RCVA 5JLAA 4E2WA 3GHHA 3CH6A 4KDEA 2Y1DA 1J0XO 4XQGA 3WWYA 1NNUA 1DRUA 4NBTA 2AG5A 4XIJA 4BNFA 4EUEA 2HU2A 4FCCA 3ZNPA 1B7GO 3WS7A 3KYCB 1HZZA 3L07A 4U6QA 4MIEA 4OHUA 5T5QA 1LDNA 4MVJM 4OXKA 1BXZA 4YYZA 1B8VA 1V8BA 3HB5X 3ZWXA 2WYUA 3GUYA 2PNFA 5L45A 3VOSA 2VYNA 1D4FA 1ONNA 5THKA 1CRWG 4AJLA 1ISFA 3UW3A 1SZJG 1PR3A 4Z9FA 3B1KA 4GQAA 1A4IA 2HMWA 1PJ3A 3PYMA 3NV9A 2VT3A 3OIFA 4Y98A 5LC1A 3KRTA 4IXTA 3ZWVA 4BNVA 1ISMA 4O6VA 1Q0QA 3JQCA 2IZ1A 3K30A 3Q2KA 1A71A 2GGSA 3QW2A 4YQZA 3GUCA 4R1SA 4R5MA 2ZYAA 1ZK3A 4QFCA 2HK8A 2C82A 2NSDA 3RUDA 1K6JA 3C1AA 4BO7A 1GPDG 4RDIA 4HNHA 1ID1A 1LJ8A 4R1TA 3EVNA 4WPGA 3LT4A 3MCVA 1GUZA 4ALIA 1EUCA 3PEFA 2P9CA 4UVEA 1X7HA 3G0OA 4DIBA 5A06A 3DHEA 4PG7A 1HYGA 4Q3CA 3GEDA 3RVDA 4WE3A 1Y8QA 4Y8VA 4Q3DA 1GQYA 2RAFA 3WLEA 1NWHA 4NPCA 1U7HA 4AFNA 3ITKA 4MVJF 3UGKA 3GVIA 4BO8A 1MX3A 4ND1A 3AOEA 2D0IA 4I5GA 4ZN6A 1P0FA 2Y99A 5JCXA 5ICMA 2FSSA 4YT4A 3CXRA 1I24A 4JJIA 1N92A 3JQBA 2GZ2A 1NXQA 2YQ4A 3LQFA 4AJHA 2YDYA 5KIAA 3H2SA 2I65A 2Y0EA 3IKTA 2W2LA 3GC6A 1UUFA 2WD7A 1Z45A 3H7AA 2PGLA 3AM4A 3I9JA 4IMPA 2BFAA 1TXGA 1N8KA 3OP4A 2W2LD 1ML3A 3DEYX 5G4KA 3OSUA 4AL4A 2UV8A 2JHGA 5BSHA 1DB3A 2JD0A 2W2KB 1IYZA 3GH3A 3DHNA 1YONA 3PZBA 2H63A 4GKVA 3E48A 3PQDA 2Q3EA 3BXXA 3MWDB 1ZCJA 4MIOA 4JNKA 1UAYA 3JQ7A 4Y67A 5COBA 1BRMA 3HFGA 3I9NA 4XA8A 5CP8A 4IJVA 4OO3A 4CL3A 1I30A 4KWHA 5L40A 3V2GA 1E3IA 2WWRA 3KYDA 3JQFA 1NVGA 1QYXA 1YQDA 3LT1A 4YJGB 2VQ3A 5TJHA 3V2UA 3G49A 4A0SA 3U09A 4XJTA 4BGIA 3OIGA 1E3EA 3T7CA 3ZW9A 2VHXA 5IG2A 1U3VA 1WDKA 1ZXLA 3O26A 4G65A 2JCYA 2RBEA 4LVUA 3LF1A 1P31A 2HRBA 3KOUA 2O2YA 3EZLA 3D0OA 1LA2A 4AJ1A 3JYOA 3GA0A 3MWEB 3GZNB 4RJTA 1P9LA 2AMFA 2O48X 4WLVA 1ZK4A 2E82A 1H0KA 1H6AA 3R3JA 5LCXA 5A03A 4N54A 2GN8A 4ZRNA 4IPTA 4RORA 4ALLA 3VZPA 1D1TA 3KEOA 2ZTUA 5EQDA 3V1TC 4H7PA 1R6DA 1U4OA 2OFPA 3FI9A 3PJFA 1ENZA 5KVQA 4W4TA 1U5AA 1WDMA 3WQSB 5JDIA 3RASA 3VPXA 4Y6SA 2DBZA 1XR3A 4IJKA 1IY8A 3QWFA 5HS6A 4D3DA 5A5EA 1LBEA 2Q1SA 3W4JA 2R6JA 3RC9A 4Y6RA 5G2OA 4CQMB 3GEMA 1BG6A 3JQBC 1K3TA 3KM0A 2IRWA 3HADA 1BW9B 3B70A 4W6ZA 2Z5LA 5JAZA 3H5RA 2JD2A 3W8DA 3KV3O 3AI3A 5F21A 1V0JA 5EIOA 3TNLA 1PJBA 4DL9A 2J5KA 4MKRA 1KVQA 4W9NC 1W73A 1PJTA 3U4IA 4MJLA 3WB9A 4MP8A 3PHHA 5JS6A 1H9AA 2JKVA 1P1IA 4WOKA 5B12A 1WP4A 2X22A 4LW8A 4ND2A 1PZEA 4QXMA 3MTJA 1YB5A 4BQRA 1E1NA 6LDHA 3KSDO 3VPHA 2EIHA 3MEQA 1WLYA 3O38A 2J6IA 1B2LA 2PD4A 4XRRA 3NTQA 4Z0TA 2J5QA 1Y7TA 3FNFA 3NDIA 3P5SA 4QO7A 2YHUA 3ANLA 2Y1GA 3PYLA 4HP8A 1WNTA 2P5UA 1H9BA 4JJFA 3CMCO 4R9SA 5T8KC 4M55A 3RSHA 5B4VA 3L4BA 1QYVA 2P9GA 3DBVO 4S1VA 1IB6A 2O7SA 5LDHA 2Y67A 4BB5A 2HLPA 4HUJA 2NVBA 4J9VA 3F1KA 3KZVA 2EKQA 3WFIA 1SB8A 4MIYA 4FPXA 2O3TA 4Q9NA 1DIAA 4D79A 5JAIA 2G82A 2QZ9A 3PJGA 4NIMA 1R4MB 2VYVD 4RZHA 2JCXA 2XXBA 4UULA 4DUPA 2GRAA 4ZGWA 2EG9A 2VUUA 3GGOA 1KVSA 4U7WA 3U4DA 3ZWMA 1WXDA 2J3HA 1LDMA 2NU7A 2DM6A 4X54A 3GVCA 1MC5A 4CMGA 1N9GA 4RF2A 3UN1A 1DRVA 3VKVA 1YBVA 9LDBA 3GFBA 5CDTA 4CQLB 4LN1A 4XCVA 1XYGA 3TPCA 5HS4A 2ZTVA 3TZCA 4PG5A 2NTNA 3L77A 1BGVA 3CPSA 1N5DA 3ROMA 1MC4A 4E33A 3LU1A 4R41A 3RU7A 3ZV6A 3DZHA 5K0ZA 3DFUA 4YQYA 1F8FA 1Q2XA 3T4XA 4TSKA 3HN2A 1PWZA 1I5RA 4XR4A 4EDFA 5C37A 4B3IA 1KBZA 3BAZA 1KC3A 5FEUA 3H6KA 4L8VA 4E12A 4UUMA 4BGUA 1HTBA 3E5MA 3BYZA 4AICA 4EEZA 3FRJA 5KJFA 1ZKMA 4YAEA 2O3UA 3QVOA 1P1JA 2IXBA 3I4FA 1IZ9A 3D4OA 2FN7A 1F8GA 2HK9A 3TL2A 4CV1A 2C7GA 2Y68A 3C24A 3KLPX 4F3YA 2BI7A 2DQ4A 4BNJA 4ONEA 4MP6A 3U9LA 1KS9A 1E6EA 1VL8A 4CM4B 1C0IA 3NAQA 2E48A 1DLIA 4OQYA 5I9MA 4AJOA 4UUPA 4FFLA 1XHLA 3QVSA 3RD5A 5I7VA 4GSLA 1H6DA 1CF2O 1QKIA 2VWHA 2Y0DA 3MZ0A 5CDGA 3TFQA 3FBGA 4C4OA 2VRCD 4A2CA 5TQVA 4XRGA 4BO4A 1PQWA 2R00C 1JKJA 1DFIA 2O23A 3WSVA 2P91A 4R16A 4R4JA 2H1SA 1ZMOA 4R68A 5DF1A 1OAAA 1RM0A 4CMEC 4J4BA 2Q1UA 2E49A 3B1JA 5DOVA 3WDSA 1ONPA 1UDCA 3PFFA 1FDWA 3BMOB 2B0JA 1L1FA 4NH4A 3N58A 3BTSA 2H5LA 4M1QA 3QJ5A 1D1SA 2OGUA 2Y66A 2QQ5A 4R1NA 3PXXA 3SLKA 1Y8RA 3M1LA 1ZSNA 2X9VA 3F4BA 5ENVA 4E5KA 1E1KA 1DLJA 1LX6A 2GN6A 3ADPA 3R3SA 2EGHA 3OJEA 4HNGA 4CQMD 1U3UA 1F17A 3I9LA 1SO8A 4W9NA 1O95A 1PX0A 2Q2WA 3JQGB 4BKUA 5GZ6A 3H4VA 3HN7A 2AQHA 4DBVO 3PTZA 1LLQA 5A9TA 2DFVA 4YWJA 3QHAA 2X58A 1VJTA 1NAHA 1UXGA 2Q45A 2UUOA 2GN4A 1SC6A 4BVAA 3MOGA 4BMVA 4FFNA 5A05A 3RUAA 5IZ4A 2EW8A 4NFYA 4MVJD 4DYVA 2V6BA 2NV6A 2J3KA 1A9YA 2C5EA 4FOSA 4QX6A 5I7EA 4E2YA 1C0KA 4E32A 3BHJA 4YBZA 1GL3A 2P4HX 4L76A 3W8EA 5FYDA 4CV0A 4K6CA 1PS8A 1K89A 1LQTA 3TL3A 3O9ZA 5B4TA 4JGBA 3QA9A 1LLCA 1Y81A 4AJ4A 1BXGA 3CE6A 3JD2A 1ADBA 5U1PA 3E82A 3RUFA 1CJCA 1RPNA 2VTEA 1C0PA 1EUZA 1PJ2A 5A9RA 2CVOA 1GZ4A 3HZZA 1DC3A 4J6FA 4BO1A 4AJ2A 4CLXA 4RLHA 5A04A 2IDZA 5F1OA 2C2XA 3AUSA 1OZAA 5A3VA 5EN4A 1E7YA 1Y6JA 3ABIA 3QVWA 2HSDA 2X9NA 4WEOA 2JAPA 1H6BA 1EQUA 1FDVA 4BO3A 3ST7A 1EVIA 1IHYA 4JK3A 1H2HA 1NASA 5AVOA 3A28A 4PFJA 4PLVA 4YJDA 3VPGA 4YPOA 1K6XA 4E2ZA 2CF6A 5G0VA 2E37A 3INRA 3VZRA 1I3NA 3B6ZA 3UCFA 5HA5A 3I3OA 1HKUA 2RCYA 1WMAA 4RDHA 4CLRA 1NHGA 1DHRA 2PH3A 4QO8A 3DR3A 2GO1A 1UP4A 2ZB8A 4XQEA 3I23A 3VKUA 3I83A 4BNHA 5L4SA 2WEKA 1HF3A 4E31A 3QIVA 1N2SA 1SEPA 2AG8A 5DP2A 3AM5A 4IJUA 5IN4A 3QV1A 1EBUA 1CWUA 1RYDA 3MTGA 2PA3A 4FGWA 1I10A 1O5IA 1YGYA 5H83A 2DLDA 3NKLA 3DBLB 3OHSX 5TSDA 2JFFA 1MA0A 4DIOA 1SAYA 5FWNA 5ES3A 4UVGA 1G0OA 3H9JA 3FR8A 3S1LA 1EVJA 2BKAA 2B83A 3UH1A 5F3RA 2Q50A 1BDBA 3O8QA 4XGKA 2DPHA 4J43A 2R00A 3JQ7B 4U0JA 4IQ0A 3F5SA 2GASA 2GN9A 2Q2VA 1HSOA 1MXHA 4IUYA 4YJGA 1C3VA 3DL2A 3E6AA 2EKLA 3N74A 2HQ1A 1E5LA 1G1AA 1DIRA 3LZ6A 4HBGA 3O4RA 5DBGA 1HE4A 3I1JA 1N1EA 1YL5A 3IP1A 3QE3A 1U1IA 4KUHA 3V1YA 1C14A 1FDTA 5FFFA 4CMEA 4CLEA 3AFMA 3KEQA 2UUPA 4B4UA 1HE5A 3DONA 4EUHA 4Q39A 3U49A 3QY9A 4CL8A 2BD0A 4DREA 4MKZA 1T2FA 1E5QA 1VM6A 3JQAD 5C7OO 2OP1A 4YCAA 1UZNA 1LI4A 4BB6A 3JQEA 3MJ4A 2JAHA 2P2SA 1GR0A 4UVDA 3WMXA 2EJVA 2EWMA 3DTYA 2EV9A 4XX0A 3L6DA 2DU8A 4U5QA 1XU7A 3FR7A 1VJ1A 3GPDG 5A5FA 1CETA 4RF4A 3Q9NA 1QYDA 2PWZA 1B8UA 4K1LA 4FW8A 2LDBA 4KQWA 2CNBA 3GRPA 4DQUA 3FN4A 4UEKA 5JYEA 3BMCB 2OORA 5DOZA 5BNTA 3DZJA 3ZNNA 4E6PA 5ITWA 1AGNA 1IULA 2QRJA 4XB2A 2AQKA 5ICSA 1GYRA 4WNIA 3RC1A 1C1XB 1E6WA 4FFMA 4J3FA 2AHRA 2OO5A 3S2FA 3ZU3A 2AA3A 3DMYA 4CM7A 4TKMA 1HDOA 3OFSA 3PVZA 4EUFA 3GVHA 2GZ3A 4EJMA 3QP9A 1I33A 1Y5RA 3H3JA 4P4GA 5IZCA 4N5LA 3OA2A 1VPDA 3DOJA 1U8FO 3RCBA 1EBFA 4EJ6A 1PTJA 2PKRA 3I9MA 4DC0A 1JDJA 2O3RA 2VN8A 5TT0A 3BMQB 1X14A 1Y9AA 3LC1O 4N5MA 4FD3A 3KYBA 4JBGA 1KY4A 4IIVA 5CEEA 2FWMX 3RAJA 1QR6A 3D4NA 1R37A 3K9QO 4NBUA 4UUNA 1PZFA 2W98A 3DBRA 3QLJA 4R1UA 4DQVA 3DBHB 3P19A 3M1AA 3G1TA 1HE2A 3RROA 5JAQA 1KIFA 5CEFA 2J8ZA 3RC7A 3ZHYA 3V2HA 3K5PA 4ALMA 3WTBA 3TF5A 2W8ZA 2P68A 2X86A 5AYVA 4J0FA 1YJQA 5F1PA 4IDAA 1V3TA 1HLDA 3GG2A 4LCJA 5G0TA 4BNXA 2VT2A 1EE2A 3FF4A 3H3FA 4DTIA 4O59O 1EEHA 4LRSB 2X5JO 3TFOA 3CEAA 1XWFA 5DBIA 4BNMA 1JWAB 3ZN2A 3F1LA 4OL9A 2NUAA 3U4HA 2XPCA 4PLYA 4D0SA 1A9ZA 5AXBA 1SCUA 3NUGA 5BT9A 3TDKA 1DC5A 4DVJA 2IZZA 3GAFA 1XGKA 3EYWA 5JCJD 2X23A 5I7SA 5U4QA 2OZPA 2Q1WA 5T57A 5KWEA 4QQRA 4EW6A 1LEHA 1OC4A 2C5AA 4IJWA 1YQXA 2EJWA 1UZLA 3H2ZA 1PZHA 1ENPA 3SXPA 3NJ4A 2WMDA 4AVYA 5CDUA 4IGFA 3ZHXA 3VZQA 5JC8A 1ZIDA 1X0XA 1G6KA 4FJ0A 1P1RA 2FHSA 2Q99A 4GL4A 1I2CA 4TROA 3GNQA 3UHAA 5L7WA 3S2GA 2NQTA 1U2GA 3DZKA 2VCYA 3K6JA 4YAGA 1EK5A 2NVWA 3GDFA 5A9SB 1NFFA 5CHEA 4GBJA 4BV9A 5B4UA 2HJRA 3WJ7A 4BNTA 3OJLA 4GLOA 2PZKA 3UAGA 3DZBA 2BFOA 5K6AC 1HE3A 5JMWA 2V65A 5I8ZA 3A9WA 5IFLA 3NTOA 3RQSA 2GCGA 1GZ3A 4NK4A 3ONDA 2TMGA 1T2AA 2J5RA 3R0IA 1JVSA 1GEEA 3R6DA 3DXFA 4OOEA 4ZRMA 3V8BA 1H94A 3KHUA 4RV9A 4BKQA 5BNIA 3D5QA 3NGLA 4CM4A 1DBVO 1KVRA 1R0LA 4HKTA 4FC6A 2OXIA 4J9UE 3PI7A 4R69A 5TS3A 3BTUA 1A5ZA 3ROQA 1YE3A 2DVMA 1FJHA 1JVBA 2VZ9A 3ZWYA 2ZIZA 1EE9A 2J3JA 4LSMA 1O89A 3A4VA 1MLDA 4CLOA 1LRLA 2PGJA 4PLWA 1Y5MA 1GU7A 1PZGA 5IZCC 3FD8A 2BI8A 2CDCA 3K2EA 3VZSA 1Z75A 3FSRA 4NBVA 2O2SA 1B3RA 4ZQBA 3W4IA 2EXXA 2Z1MA 2FY8A 4DA9A 5I9NA 4CMHA 3EVTA 5J23A 3H9QA 2NM0A 3BTVA 3UOGA 2EGGA 1E6UA 4PVCA 3CIFA 4RLSA 4MDHA 4O5OA 4KTVE 1X0VA 4DPKA 1T2DA 4HX5A 1TVEA 2NVUB 4CMIA 4IS3A 4PN3A 5EPOA 3PWZA 2WM3A 3JQ8B 3PP8A 2Q4BA 1MV8A 4GLLA 4KTTE 2ZB3A 2D3TA 1HSZA 3KETA 4J0EA 3DOCA 3RBZA 2B4RO 2CVQA 3I9OA 1MP0A 4P38A 2AEJA 1ZFNA 3JQAB 2D1YA 3GMSA 4J1TA 2NU9A 2V6FA 4L75A 2XOXA 4QTZA 3U3XA 2C59A 5DZSA 5L7YA 2HUNA 1IL0A 2DFDA 4D46A 1I3KA 1TT5B 2X0IA 3LLSA 5AQ1A 1DJNA 2FMUA 2PLAA 5JBIA 2VHYA 4PLTA 4ZQGA 2VNSA 2VUSA 1VC2A 1OI7A 1ARZA 3PLRA 4DWVA 1KERA 3TWOA 4P8RA 4J7UA 3WGOA 2PK3A 2Y1FA 5MDHA 3GN1A 3LSYA 3VPSA 2F1KA 1AXEA 4QUKA 2F00A 2QRLA 3D3WA 2X1HA 4NHEA 2VOEA 4Q3BA 1YWGO 3F6YA 1PGQA 3U0BA 1HDZA 5IJZA 3ITDA 3P2YA 9LDTA 1AHHA 1U2DA 3A14A 4DPLA 4EZBA 4YAIA 4YACA 1U7TA 1F12A 1ISGA 4OXNA 2C0CA 4O1MA 5C7IO 2AQIA 1BXGB 3F9IA 3JQ6A 4CODB 4OH1A 1WAMA 2HK7A 1ZBQA 2AW5A 1DC4A 5TC4A 4A26A 3VH3A 3GVPA 4IDCA 1CQIA 3VH1A 4KOAA 5TNXA 4CM5A 3TOZA 2GF2A 3NDJA 1ENOA 3H5AA 4K26A 4PZCA 4EBFA 3OBBA 2B36A 3JTMA 1PJCA 4YXFA 2W90A 4N5NA 4RPLA 4A10A 3H9EO 1I3MA 2FR0A 5L7TA 3QWHA 2ZYGA 1U28A 1XU9A 3EDMA 3CKYA 3JCZA 1F06A 4JCOA 4IQ8A 3ZNOA 1A7AA 4FN4A 2ZTLA 2CMDA 1ZJYA 4PIVA 5IDQA 3TSCA 4BNIA 2CFCA 1LSUA 1ZK1A 1ISHA 1E3WB 2O50A 3W1VA 1EK6A 3PQFA 4ZHSA 2V6MA 4B7UA 4B4VA 1EVZA 1QYCA 4TRNA 4CLRB 3U5TA 5G0UA 5JO9A 4GWKA 4A03A 4R54A 4JIGA 2IZ0A 4Q3AA 1Y9EA 2EERA 4J7CA 4A5OA 3DFZA 1KOLA 5IDYA 1DHTA 1ZJZA 4FIZA 3VTFA 3WGZA 5EINA 1HZJA 4UEJA 3C1OA 1U5CA 2B5WA 4WUVA 3COSA 1J49A 1E7QA 4XDYA 5JY1A 5FI3A 5B37A 4BKRA 4KQXA 1ZH8A 3M6IA 1JN0A 4UUOA 2ZB4A 3G79A 3AW9A 5T67A 5EMHA 4IDGA 4EJ0A 1SB9A 4GX5A 5L4LA 1LC0A 1E7MA 1SOVA 1P45A 2DAPA 4E4YA 5IN5A 4PVDA 4II3A 3GF4A 1ADCA 3FNGA 1YBAA 2G17A 3GGGA 3CMMA 3GK3A 1PSDA 1RYEA 4H15A 4J90A 2PD3A 3IMFA 4WKGA 3VVCA 1GADO 4WGGA 1X1EA 2E6UX 2PR2A 1R0SA 1NYTA 3U4CA 3L4BC 5CDYA 2JCVA 3VH2A 3LC7O 4ALNA 1PGJA 3AOGA 3MJCA 4P4NA 1YKFA 3RBXA 3RKUA 3OQ6A 5ENDA 3F3SA 3OA0A 3L0DA 1ZO8A 4M86A 4WLEA 4KWIA 1NPDA 4FOOA 1Z7BA 3PLNA 2QW8A 1YB4A 4GX2A 1I2ZA 1QYWA 2WE7A 3WTCA 4ZQHA 3ZV5A 2VHVA 4B4OA 4M89A 1LC3A 1ADFA 1VL6A 1LDBA 4YA6A 5T6BA 3UVEA 5A02A 5JXWA 5LDGA 4NQZA 2FZWA 1W6UA 1DSSG 5JMPA 1RKXA 5GMOA 4J4TA 8ADHA 3JQ9A 1XCBA 3LLVA 1JQBA 1F14A 1WPQA 4IXWA 3AOEC 2W2KA 3ZHZA 2I6TA 1M75A 1JLLA 3WWZA 4NJOA 3G3EA 3FPLA 4BNLA 2Q46A 3SJ7A 4HY3A 5DN9A 3W4KA 3QRWA 5EERA 4MVJP 4NI5A 4OM8A 3BMNA 1IE3A 1LTHR 3ICCA 3RFXA 4DGSA 2HAEA 3X2FA 3BMCA 1M76A 4E5NA 3DMTA 1PGNA 4TQGA 5A4DA 2AXQA 2FPPA 3DAFA 4OSPA 1MB4A 2FSVA 1DFGA 2I3GA 3OECA 1C1XA 1HLPA 3OJOA 4J2OA 4XKJA 1GD1O 1E0DA 4LK3A 1WVGA 3V1UA 2B4QA 5JO0A 4F6LA 1PR9A 3MJVA 3H8VA 4EITA 1YRLA 1GYPA 2AEMA 1K6IA 2ZB7A 1ISJA 1R4NA 1SNYA 3A1NA 2I66A 1LSSA 5JDCA 3JQ9C 4PG4A 4YJHB 3TQHA 3MJSA 3HUDA 4LGVA 4QSMA 2YDXA 4YJFB 4DYDA 3IOYA 1LSJA 1PQPA 3ZH2A 1XDWA 4B4WA 1E3LA 2HMTA 1PL8A 4B8ZA 4U0KA 4ZD6A 1T25A 1XKQA 1NQOA 4XQCA 3ENNA 3DBRB 2GYYA 3GT0A 1IOLA 1E7SA 3VDRA 1N1GA 1DC6A 1MUUA 2A94A 3Q9UA 2O7QA 3QWIA 3WYCA 3T4EA 1D3AA 4JQCA 3LK7A 4XWYA 5JSFA 5HTOA 2YYYA 2ZKLA 2Q2QA 1XG5A 3RUHA 2BRUA 1BW9A 3NX4A 4YR9A 4FQ8A 4KZPA 1X7DA 4NU5A 1D7OA 1FDSA 1XELA 3EW7A 1M67A 4J2HA 4DIFA 4I08A 2JJYA 3BIOA 2C07A 1O0SA 4WLFA 5TRTA 1YOVB 4RQTA 2DT5A 1EUDA 4BGVA 1NP3A 4YB8A 2CSUA 4WCDA 3ROKA 3ANNA 3JD1A 2E4AA 2I5PO 2D8AA 2GUGA 1Q7CA 1SOWA 1NQTA 2WTBA 2C54A 1T2CA 4KDFA 4R01A 2A35A 3BHMA 4ZA2A 3ZI0A 4ESOA 1KETA 4C7JA 3HDJA 1CERA 4HWKA 4FSHA 3STHA 3ZWAA 3GVXA 1UR5A 3OMLA 4I9UA 2WD7B 4BO5A 1TI7A 1YQGA 3E9MA 1ZEMA 4ZJUA 4BIIA 4FFPA 3HJAA 3K73O 5BSGA 1MFZA 1LNQA 3ANMA 3Q11A 1RM5A 2YQ5A 2G1UA 4YRDA 1UP6A 1T4BA 2B5VA 5TT1A 3ZU4A 3UUWA 3JQFC 4AJNA 3SC6A 4H3VA 3O8QB 4GPD1 2HJSA 3MJTA 3QQPA 1LU9A 1B8PA 1GEGA 2CVZA 3LF2A 4OOFA 3ZDFA 5BQFA 3EZYA 1M2WA 1YL7A 4XD2A 2YZ7A 2PTGA 5CAEA 1TA4A 5ER6A 3ENKA 4IZHA 4D3FA 2EF1A 1QV7A 4INAA 1HDRA 2Q1TA 3MOIA 4IY1A 5G0SA 3FBTA 3GZ4A 4A73A 2VHZA 4E2XA 1GCOA 1P3DA 3PFWO 3C3XA 4I8XA 3GPIA 1PGPA 1U9JA 5KKAA 4GX0A 2FZEA 4D42A 4WNCA 1NFQA 3WR5A 2QIOA 4CM9D 5AOVA 1ZK2A 3GZNA 1EVYA 4O63O 4BMSA 4JBIA 1GDHA 4WCFC 3S55A 3GDGA 3PGJA 4TZKA 5JDCC 1BTOA 3P7MA 3WMWA 1AUPA 1YVEI 5TIIA 4ALJA 3H9GA 1PU2A 4CV2A 4D44A 3I5MA 3WJAA 3N7UA 3SJUA 1H2BA 1B16A 2ZQYA 4R3WA 4TVBA 5JNLA 4QT0A 4NDNE 5H82A 3R1IA 2UVDA 2JL1A 4OQZA 3E1KA 3ASVA 1K5HA 3PWKA 4RVUA 2YHIB 4A27A 3IQDB 3K92A 1RM3A 3I6QA 2VOJA 4RVHA 4NNJA 4WECA 1NQAO 2GSDA 3KYDB 4B3JA 2EP7A 4YT5A 3I4CA 3DZGA 4TWRA 3H5NA 4LVCA 3GEGA 3SC4A 3OM9A 2JHFA 1LSOA 1JA9A 1UXKA 4OKIA 3NT5A 4LCEA 1PJ4A 4XYBA 3W6ZA 4OKNA 4BMNA 3OF2A 3HHPA 4DXHA 5G4LA 1Z74A 2TMDA 2VWPA 3LDHA 3ZWBA 4GH5A 4WLOA 3CZRA 3BA1A 1UXIA 3EGOA 5I7FA 1E77A 2ET6A 2X6TA 1WDLA 4D45A 5KTKA 3ULKA 2I99A 1I01A 2GPTA 3IUSA 3BMQA 3Q3CA 3E03A 3HG7A 1B26A 4ROSA 4BS9A 1MGOA 2NTVA 3PIDA 1XLTA 1E7WA 2NACA 2FP4A 2P4QA 1HDCA 2IYOA 3DAPA 4MINA 5IDXA 5EQFA 2Z1NA 3WX0A 1I2BA 2FOIA 4BNUA 1P77A 1WMBA 1NVMB 1VSVA 1YJ8A 2DBQA 4NJMB 4CQMA 5GY7A 1VSUA 3GDOA 1LLUA 1X13A 2UAGA 1Q0LA 2PKQP 1KEWA 4Z0HO 3AWDA 1GY8A 4XIYA 5FI5A 1MG0A 5EESA 1E1MA 1FF9A 3TOXA 3IP3A 1NWCA 1Y8RB 3JSAA 4HXYA 1PIWA 4P4LA 2PZMA 5IAAA 1W8DA 3OICA 4ZU3A 1CDOA 1BHSA 2ZYDA 2PKQO 2X0JA 1N7HA 1R4MA 2RH4A 1BWSA 1ZNQO 1EDOA 1V35A 4FR5A 1D8AA 4R51A 2RHCA 3VPFA 2BLLA 4JJGA 1KEVA 1BVRA 3WGQA 3AI2A 8LDHA 1KEPA 1I8TA 1N9GB 1LQUA 3KVOA 4GWGA 5F5LA 3NTRA 4I5DA 3OH8A 3UCXA 3HQ4O 1H93A 1UJMA 2ZQZA 5KJEA 4L4XA 2FRDA 1NQ5A 5COQA 4JN6B 4UVHA 1L7DA 3KB6A 1PQUA 1HRDA 3KSUA 1T24A 5L53A 3RKRA 3ZU2A 4ZQEA 2P5YA 5TLSA 2HRZA 4IM7A 5L9AA 2DUWA 4TVOA 3VH4A 3DO5A 4NBWA 1AE1A 4E0BA 3IDSA 2D5AA 1LUAA 2PZLA 4CMJA 5IF3A 4L0QA 4J91A 5F5NA 3WNQA 4CMCA 5KNLA 3WG9A 5BSFA 4CM1A 2ZK7A 3RJ9A 1BSVA 3AUUA 3H9UA 3GRKA 4WCFA 1Z6ZA 2HDHA 1DIBA 4D43A 3QVTA 1P44A 2VRBA 2QX7A 2NU8A 1PS9A 4PZDA 2I67A 2POQX 4GVLA 1H5QA 2PH5A 2EKPA 4PRKA 1QLJA 3F46A 3RWBA 3T7EA 4JLWA 3ROPA 5GZ3A 1DXYA 4RPHA 3PQEA 4TKLA 3UFXA 2GLXA 4YVFA 3ADOA 4LSWA 5KJ6A 3AY7A 1Z82A 5CPFA 1P1KA 5KCZA 3CZMA 4MVJE 1EZ4A 4K28A 3INTA 1PS0A 4H16A 5KOIA 4JROA 3DQPA 2XAAA 4BGEA 4DMLA 3ZW8A 3ZU5A 3I52A 1BDMA 1TB4A 2I76A 4S3MA 4AJKA 3WGHA 4U6SA 2YFQA 4CLHA 1DFHA 3L4SO 1W4ZA 2VNAA 2VYVA 3FCOA 3BMOA 4XGIA 1EFKA 3HFSA 2BFPA 3Q0EA 1P1FA 4N18A 2OL4A 3NT4A 1OC2A 3KSZO 5I8WA 3AUAA 4JX8A 3JV7A 1YDEA 1Q0HA 2WSBA 4CUKA 3SBOA 4OJNA 2X9GA 4CM8B 2A4KA 2EW2A 4FJ2A 3OEYA 4CR6A 4BOYA 4Z6KA 5JY6A 1GTMA 3EY4A 4ITUA 4CJXA 3IUPA 2NLOA 3JQAA 1YDWA 3JQGA 1FDUA 4JP3A 3BMNB 5T64A 4B7XA 1YXMA 5AXDA
chains in the Genus database with same CATH superfamily
3ABRB 3FYDA 1ZSYA 4L9RA 4QPPA 4R8KA 5AIAA 2CLKB 4C2AA 5ADHA 1EGQA 4E5PA 4C7BA 1GNTA 4I9HA 1B8OA 2NQ2C 5INTA 1UM9B 3A1CA 2CDBA 3J80A 3G0HA 2C1EA 4I3FA 3EXFB 4ZCTA 2JLCA 1SIWA 2CFSA 1ZESA 4L08A 3DG9A 2HBZA 3UWSA 3B12A 3W3AH 4MWOA 3F5QA 2ZRLA 1BU5A 2D74A 2EYUA 1P9OA 1T1EA 1PL6A 3NC1C 2H2FA 2QU7A 1XIVA 4KXWA 5DCWA 4O33A 4FEYA 5B3JA 5IXYA 4RGVA 3SDBA 3FKSD 4P6VF 1QHGA 3M33A 4ZHQA 3NPAA 4ND4A 4URFA 3RSGA 1XSEA 1OAOC 4GXTA 1QLHA 3L18A 3BJZA 2O8CA 1CJTC 1UBFA 1U8YA 2X7HA 1DOHA 3K94A 4MW9A 3LIPA 4EB6A 2ZBEA 4KUGA 1QRRA 1PGOA 2KSQA 1QB7A 3R7NA 5AM0A 3ZWCA 1M1ZA 2FNAA 3RFTA 4H7HA 3GMDA 1Q1NA 3D6TB 3CH5A 4K8RB 4FN5A 4XLZA 8ATCA 1WIWA 2H59A 1H65A 2PUAA 1U94A 4KEAA 4HYEA 3ZHBA 2OO7A 2WFAA 5JROA 2XMDA 3MINA 2O6LA 2YNMC 3QYJA 2FG6C 1DRWA 3BHIA 1QZXA 1SHUX 5ITZB 3ZWPA 1P7PA 4E5DA 5FYQA 1ESCA 3ZG6A 4BKOA 2XWQA 2JZNA 1L4NA 4TZTA 1M7HA 2IOHA 3L7OA 1JECA 1IBRA 5IBPA 4RVSA 4FYKA 3S5UA 2O5VA 5K6AA 4JYZA 4DC1A 1YVRA 2JW5A 1GG2A 4MJ3A 4LPSA 4H08A 2HHCA 3PNSA 4A16A 1C81A 1IZZA 1T9GR 2PWYA 4L4SA 1VECA 3OFJA 4O8ZA 4RKWA 1NMYA 1ORDA 1EFCA 1ZKDA 2F3UA 3O8OA 2Z6QA 1B14A 1QE3A 1XNGA 3PA8A 4M8NE 2JA2A 1KDOA 1Y8CA 3FPHA 3O9VA 1BXKA 2OGWA 1IZ7A 4LY6A 1XDDA 2ATIA 2PL1A 2YCLA 4ZOLF 2IELA 5DHUA 4COOA 2ZYHA 1T9DA 4BVGA 1QYRA 2YV2A 4IG4A 2QTFA 16PKA 3H5WA 3MXOA 4J16A 3U2QA 1A27A 1L1QA 1O5OA 2AB0A 4PW0A 3S1AA 2WVJA 2YW9A 1WU8A 3V8VA 1AZLA 1B0AA 2QSYA 1ZJ6A 5CD9A 5JNVA 1SXJD 3UJ3X 1JTVA 3HY6A 4O4HF 3RAFC 2O9JA 1PJSA 1RWNA 1I13A 1G8JA 1W0CA 4GR4A 4JA0A 3M2PA 4UHDA 3T0FA 5T3YA 2JS7A 1GYQA 1DXOA 3ZH9B 4BBAA 1HFWA 4LYGA 5IJWA 2HL6A 4CN8A 1N3IA 1UXJA 2BR5A 4QRDA 4JC5A 1FRZA 2ZCUA 2KI5A 5CNJA 1D4ZA 4DA0A 3NHSA 5AW4A 5IKEA 3FXAA 2RSLA 1O7JA 3FDFA 4BVEA 1X8LA 2IEDA 2JFGA 2YOHA 2YXBA 2ZOSA 5EZYA 2PX0A 3HU2A 5THXA 4ZDKA 2QGZA 2ZRBA 2XQKA 5DXAA 3BA6A 4RTJA 4EKNB 1DBWA 4J75A 4MQMA 2CV0A 4KWEA 3FVRA 4GT1A 2FE1A 5BW5A 2D6FA 2XLCA 3JYPA 3M6LA 3PXUA 4LJ7A 1NW7A 2AN5A 4GPEA 1YIDA 4EL5A 2QLMA 2AWOA 4QLAA 3Q7IA 3IUEA 5G3YA 4MGYR 1JDSA 3ZZNA 3HB1A 2RGUA 3NVAA 2W43A 1Y3AA 4L3WA 3OT5A 4DIKA 4RF3A 4X63A 5IT4A 3D5TA 1L5WA 4L4RA 3REQB 3RI3A 2FW9A 3PJDA 1GITA 2VXCA 2CD9A 4P4SA 3MS2A 4DF3A 4GMGA 1EDEA 3EQ2A 2Q5EA 1XU4A 3CZQA 4Q03A 5AI8A 3WGGA 5CFPA 1OBFO 5TPWB 1C1YA 1GRQA 4HH1A 4BO2A 3PC8C 2PAAA 3TQTA 2B0CA 2BDUA 4LRXA 1RAGA 3EOAI 5JZSA 1JMKC 4B3XA 4A4DA 5LFAA 1PR1A 2VJKA 3S2EA 2C9BA 1X7WB 4L22A 4Q3NA 4UBJA 3DXYA 3MAJA 3KXPA 2BFEA 4FMCF 4BV8A 1X39A 5D00A 3L9XA 4EZIA 1VL0A 4G0UA 5IMBA 3BJRA 2UZ4A 1OAOA 3O6VA 4GM4A 3U44A 2JEOA 4DG5A 3HR7A 1HXHA 4D41A 3S3TA 4BZQA 3WL4A 4C21A 5TMBA 3DZFA 1DAKA 1M8KA 1R0KA 3QVMA 3RS2A 2IIBA 4M9UA 5KYUB 3HRKA 4B6PA 2GI4A 4DMHA 2OCBA 4II2A 4LGMA 1YRHA 1J24A 1UMDB 1VE9A 2QDXA 4BLRA 4CMKA 4QYWA 2VPYA 4P53A 3K6KA 1RHKA 2ODTX 3RTBA 1U8AA 4B7AA 3HABA 3RF7A 1Z5NA 2FMHA 2JFNA 1SPXA 4UCWA 3CLKA 2AN9A 2FW0A 2XVYA 2ZBUA 4R2IA 3UYLA 4EJSC 5ER9A 4MQBA 5JXGA 1ZHFA 2HIHA 1LW6E 2AN3A 2OK7A 1XZGA 4JKOA 4LHSA 4P4UA 4Z0NA 5J2UB 3W6UA 4EI8A 2QD1A 3SX4A 4BFVA 1QOPB 1M1YA 1M73E 2V7GA 2ZRKA 5AK6A 3LOQA 4E30A 5LLSA 5AICA 5K7SA 5B7NA 1UBTS 3BGVA 4I4CA 2WJGA 1YBMA 4I5EA 1BWRA 2LDXA 2XBMA 2EL9A 4MRMA 5I9LA 1KY5A 5FLXA 4FNAA 5FUMA 2HIMA 3R41A 1A72A 1HWYA 2Y93A 2PSFA 3IH5A 2QKYA 2BUBA 4PNEA 5CX4A 4NDAA 5A0FA 3FSGD 3VNQA 1DG1G 4RVFA 1OZFA 2BZ1A 4OJMX 3BJMA 2QN2A 3HDVA 4WT7A 1W85A 4L4UA 2ECKA 2FFAA 3EMBA 3QPDA 4MICA 5JJ5A 3U7GA 4W99A 1TOAA 2D2FA 2XQGA 4JKIA 5B1EA 2R7MA 1R4ZA 2JFVA 3K1JA 3IBGA 1QV6A 2ILTA 1QC5A 4IOKA 4EL0A 5KJ1A 5HDBB 3JYQA 5AVVA 3I4LA 2NZWA 3GARA 4Q19A 3EGXB 4BPBA 1S9HA 4QUIA 4MVJG 3UGTA 1DBRA 1B8NA 1S8NA 2YYSA 3L8HA 4NDZA 4PICA 2C2YA 3T7TA 1X80B 2C4MA 3DE3X 4JP8A 3MJDA 2PIDA 5LBIA 3K6SA 1KZ1A 3W9YA 3NDBB 4NJMA 1U7WA 2Q6IA 5IS2A 4FNOA 5DP1A 3FAKA 3I5UA 3Q88A 3DB2A 3LPMA 4BAZA 5FTNA 3PDUA 1T8YA 2PUJA 4WMLA 4XYEA 4O4IB 3RC2A 5JSUA 3ONEA 1ULUA 3T9CA 1EESA 4WHMA 3GJ8A 2C3MA 3L93A 3MG9A 4V0QA 1DO8A 3PPWA 4GUAA 4E6EA 3F9CA 1IBCA 1Q2UA 3KYCA 3GLKA 4PU0A 2QRZA 4JXKA 2HB6A 4EHBA 4HMOA 2H4JA 3C8MA 4IWXA 3KB2A 3WZMA 1I32A 3A3KA 1SCQA 1NRJB 2YZMA 3CWCA 5AXCA 4G07A 5JR3A 1A69A 3PNMA 3E9NA 3KQWA 3KQTA 1M0SA 4AS2A 4PXYA 3T7IA 4KODA 4CV3A 3A3OA 5JFGA 4WKNA 5GV7A 2PMKA 1JJVA 5DNCA 1VCNA 1NZJA 3ISVA 4US1R 4F46A 2VZ8A 3OQBA 3IR7A 4BQPA 5JMOA 2CBZA 4N48A 3PC4A 5BUSA 1SD2A 3BAFA 2ZAMA 3UTDA 4EHIA 1JQ5A 2VH5R 1OWPA 3B5EA 2RGNA 3EEFA 1F3OA 2RBGA 4GQIA 3IBCA 2IFTA 1J33A 3QEMB 4B0OA 5AVXA 3T1HB 3KUKA 2JJMA 4QBKA 1RKVA 1RBZA 3DBHA 2PO7A 3DMNA 4LJAA 4TQUS 1D9ZA 3NM5A 3TINA 5I7HA 2Y1EA 2R2GA 3T5CA 1C80A 2P2LA 3DC2A 4LS3A 5HBRA 5AH0A 1EZ1A 1V11A 4HF7A 4X7PA 1L5RA 2JLUA 2CUNA 5IM4A 4JWKA 5E7MA 4Q18A 2O7RA 4OAOA 1BOOA 4LX0A 1AD2A 2QTZA 1XYVA 2YV1A 4D3SA 3SBXA 1N3YA 4RAOA 2WD8A 2AYZA 2WNHA 3DHYA 4MVJI 5DLPA 3RUIA 5LQAA 2VRWA 2P7HA 3RFVA 4ASUA 4OX9B 3FVTA 2XB2A 2VXBA 3Q2IA 1KI2A 1RQLA 3Q3EA 4JAVC 2B5OA 4WKOA 1NI4A 5J9FA 1P5RA 4AY3A 1TTHA 4XR9A 4TWJA 4DIUA 4L73A 1WXFA 4U3JB 2NWQA 4BHTA 4NBRA 1BH2A 5FNVA 1GG9A 4QBHA 2V45A 5FA5A 3MMZA 4L0CA 4EPXA 2V3WA 1T0BA 2YN4A 4IDBA 2C1XA 5FUBA 1GAWA 2EJUA 3RRYA 4A8JC 3OSZA 4LISA 2EEPA 2HBRA 1FB5A 2JI9A 2W8BB 3AK4A 1NAIA 2PGNA 1LPAB 4UTPA 2VSYA 3LRPA 1DIOB 2OHXA 3HYTA 4CFSA 2XMSA 1JT2A 2XSZA 5K0LA 5BW6B 2DPGA 6AT1A 1M1NA 5ED4A 4DV4B 1D6JA 3GRZA 3R23A 2J3LA 5DGTA 1KE2A 1K1EA 4E11A 2F8MA 2IYNA 2IA5A 2WTAA 1O94A 3RG2A 1JU3A 3LHDA 1OFUX 1V9LA 1VE1A 2Y9MB 2CLMB 3AIOA 1XJ0A 1AQLA 3K1ZA 3CCCA 5JSYA 3SXJA 3JW8A 2P65A 2BMAA 2QRVA 1L8XA 5K0JA 3UKOA 3SE0A 4IXMA 2HDWA 1MRZA 4OFBA 3H3XA 1BQEA 1PK8A 2PZAA 4EQ6A 2C8LA 3AVVA 3WYBA 5LQMA 5F78A 1A4UA 2GAAA 4ALKA 3VAYA 2GCNA 1C30B 1KDZA 1LFAA 1AGXA 5BR4A 2O4CA 5CEJA 5IK2D 2GESA 2JLRA 3LGSA 3RK1A 4EPTA 4UPEA 4ZO8A 4DRZA 2HN9A 3B9PA 3RU3A 1X15A 3E5RA 4G24A 1L5HB 4W1QA 4V39A 1ZSVA 3PJEA 1GG8A 2ZJ7A 4JB3A 1QFJA 1I7NA 3TRJA 1B6SA 1NBHA 2R8YA 3MIZA 3G23A 1LRKA 4ADSG 3LXUX 1NVKA 2ZZKA 4NU8X 4ZREA 5KKNB 4K3UA 3EIOA 2HSGA 2UVQA 4HEA6 4ZCPA 1ESZA 3KT6A 1KC1A 1OZGA 2X8JA 4RM2A 3DMPA 1CNFA 1NP6A 2JIQA 5DHRA 3DT6A 1UMBB 2OC9A 4YTEA 3V46A 4DV3B 2Z04A 1PT5A 2GD1O 5AVUA 4A82A 2CC2A 3TNYA 2JGLA 3LVQE 1U6KA 1R88A 1UZMA 2PU7A 2YV5A 4HPXB 3LFUA 5DT2A 1I7QB 1G4AE 4KUEA 5IABA 3ISTA 4OIMA 5IJAA 1GFSA 2J0EA 2P77A 4NOJA 4J0HA 2AWNA 2R5NA 3LHKA 5KYWB 5CFZA 3QWAA 2PZFA 3AHDA 3CLUD 4ZQFA 3SQXA 3M34A 3NDRA 4QDUA 4DCUA 1SH7A 1G7CA 4ZCMA 4BO6A 1IEWA 1BVUA 4KN6A 3IJPA 3A8TA 3LW7A 3LWBA 2F48A 3EHEA 1NYRA 3JWPA 1XL0A 1CY8A 3LHIA 4HADA 5A7GA 4F91B 1L7RA 4YRTA 1RWQA 1LTKA 3GBPA 2GPYA 3IEIA 4N65A 3UF0A 3LNTA 2G06A 3EH1A 1VOTA 2L17A 3PIRA 2HKIA 3CY6A 4F56A 1ZI9A 2Z3VA 1IG0A 1JLRA 2BHLA 1CHDA 2CF5A 1V8ZA 4YRCA 5EMNA 5HIIA 4HI0E 4QECA 1OVMA 1WUHS 2H65A 2FF5A 3MD9A 4AJPA 1NFRA 2O6HA 5ECGC 3ZCPA 2QM7A 3L9WA 3GLHB 3LT2A 4KPGA 1ZRSA 2QY9A 4Y2VA 521PA 4EJSA 4QXRA 4PYLA 3CBQA 1ZXBA 5IW8A 3T1QA 1TT7A 1T5OA 2G5PA 4QLBA 2RG7A 2G5CA 4ILKA 5AJVB 5F5XA 2FPIA 4KBGA 2G0TA 1ST3A 1DEHA 2CHEA 4W7HA 3WDMA 2XF8A 4OJKA 2IE0A 4K86A 3GIDA 5K0NA 1ZX1A 2WU8A 3QSGA 3GV0A 3QFHA 4Z9YA 3JRWA 3HBAA 1HH4A 3GJXC 5I7RA 1E4OA 2LBPA 3N6XA 3F71A 1Z4MA 2O1WA 1GIAA 5FWXB 1AURA 3K5WA 2P3OA 1O9BA 1PR6A 2LWIA 3UA3A 3WE7A 3HJNA 2HUPA 2P6RA 1H3FA 3B7WA 4GVXA 5B36A 3I92A 3I6YA 3OY7A 3FVVA 3GY0A 3LTNC 5LA6A 5BV8A 4R3UC 1NKTA 3KTDA 1U9ZA 1QMGA 3M4YA 1GTG1 1XTVA 2H1CA 1GXSA 3TRDA 3WQQA 1X9GA 1UP7A 3ONWA 5FV7A 4UBNA 4Y2TA 1LDGA 5DCUA 4DAEA 3P9IA 5JPIA 4BX0A 4BX9A 3CWQA 3WSWA 3GLGA 3BHNA 2X4GA 3E9DA 3GHYA 2WNIA 4UBLA 4Q4AA 2IITA 1A7KA 4C4ZA 5JSZA 3EA4A 1SKAA 2DR2A 2RHWA 3HS3A 4G86A 1K2WA 4BVFA 2GILA 2EC5A 3WGVA 4GFDA 1GPMA 2H6EA 3Q7TA 2F3PA 5BY2A 3NATA 2AN1A 4KE7A 2HMSA 2A59A 4PSKA 3RVNA 1JAHA 3K72B 5L3SA 5K9ZA 3ELBA 3PUWA 5FUYA 3DTTA 3OQPA 1WY7A 5ALPA 4J3JA 2Q0HA 2WDZA 3OJFA 4GOND 3TG2A 3LLCA 5JSQA 3GFGA 1XXHA 2HGSA 3IP8A 4QUEA 1T5BA 4X3PA 2QGFA 3VR5D 3EQ7A 3VVBA 2X7JA 1VGQA 1J06A 4Q1EA 2OBYA 3DWFA 5C4GB 3ZWDA 1Z35A 1GLNA 2OWEA 4CDMA 2B37A 5HUJA 1ZGAA 2ETXA 3MRXA 4OYRA 3ZQKA 4ZMSA 5ILOA 5BVGB 1WB9A 3ZDAA 3CB2A 1L5ZA 1EQ2A 1GGVA 3OAAD 1WHTB 1JU9A 2I3DA 3SS8A 1XMSA 2IUEA 4BDSA 5FEMA 3LVFO 3Q2OA 3AFNA 4RQUA 1AZWA 1IWOA 3IJRA 2IEBA 3L7DA 5KQPA 4QYSA 4WZAB 3ZK8A 3DZIA 1HDGO 2NO6A 3S2YA 3P9ZA 5F9FA 1CJBA 1RQ2A 1OFGA 1H6CA 4YAFA 4WWHA 3HV2A 1VKNA 4K81B 1NNLA 1X7ZB 1PL7A 2A7XA 1J9GA 2HCTA 5H80A 2COUA 3IX7A 2H5EA 3UT6A 3WGNA 1DAPA 3ZY4A 2CL7X 4FCVA 4ZAXA 4YRAA 3R4CA 5KVCA 3ZGZA 2C04A 2WM2A 3AKDA 4QYTA 3HVHA 2CZQA 5D3ZA 4Z9XA 4ZAWA 1BMFD 1CR1A 1SQFA 4HNRA 5DCYA 1TJPB 5BSRA 3QEBZ 3QTTA 5KUTA 2HF7A 1FBTA 3BSYA 3DDHA 3UG6A 3VU9A 5JCZA 2OP0A 3TSWA 2QQ0A 5IAGA 4TYWA 4CM8A 2JJ2A 1CW2B 3GD7A 1UMDA 3KAPA 4FFSA 4R1QA 4AN4A 2V74B 1QP8A 2ZUUA 3HU1A 3CW2A 2FB9A 4M3NA 3T5GA 4KI7A 5EP3A 4PS0A 1VKOA 2IQIA 3P9SA 5C5CA 2WP8J 3COZA 4IIXA 3S4YA 1XCPA 3ICPA 3HDQA 1XEWX 2FETA 2FVXA 2NZVG 3A58B 2M6LA 4PCAA 3VAZA 1G7SA 1RXIA 2VJDA 1ZGHA 3HBMA 2VDKB 4CMAA 4FWBA 4PG8A 1MEJA 1LLDA 1TU4A 3C14C 4YLGA 3AXSA 2QA5A 2G09A 2WJPA 4N6GA 4WY2A 1XF1A 4XPIB 3NJ8A 4C4RA 3AU9A 3VR2A 1G60A 4EPVA 1UAGA 2BGKA 2WT8A 4CM3A 3H1PA 2NUPA 2Q4TA 2QTLA 2WKQA 3EAGA 3WNCA 3AU8A 4ILEA 3WLHA 1AA9A 4D6YA 1XQXA 5KKCA 3NKVA 2GJSA 5FCDA 2X0FA 2OSBA 4DG9A 4B0PA 4QJBA 4GZ6A 1PCXA 1OXBB 1XP8A 1HUQA 3C3CA 2AQ8A 3DAGA 3NEPX 4B4KA 1QHSA 3MLBA 2H31A 3VSCA 1FQJA 1WOMA 5B2FA 4UNSA 5ILGA 3W1EA 4WASA 1EGVB 4TLEA 3OP1A 2OTCA 2ZWVA 3IE0A 3HGTA 4J2TA 4BFWA 1O8CA 5LZ2A 1ABBA 2L2QA 4EKDA 1SC9A 3I28A 3O1HB 4A8TA 2JFHA 4ZAYA 1QH8B 3IALA 1G20E 4GBGA 4JMPA 1SKMA 1ZD9A 4ZJZA 2W6ID 4M8KA 1QO0D 2OKGA 1HX7A 4D4KA 1OLSA 3FVWA 3ET4A 2ZIUB 4BC0A 4EK9A 4JU8A 3OO1A 1Z5ZA 2RC5A 2R96A 1L4UA 1JSZA 2I3BA 3D7RA 3VDQA 1I9GA 1GPJA 3HSSA 4MAMA 3VZBA 3TTYA 4BATA 3KJHA 4NFHA 2WFZA 4E2WA 4YXWA 1QIKA 4EYOA 1AKNA 2A1TS 3UV3A 5A2QA 2HHLA 1VKJA 2BJHA 5B58C 3K70C 1LTQA 4LRWA 5KREA 1NNUA 1DZIA 3BFPA 3TDMA 2KHZA 3MILA 4BNFA 1QCCA 3LSTA 2GQ0A 3VKGA 4NEGA 3I76A 5KQRA 1AKTA 2FOLA 4KAJA 3WS7A 1F1BA 3WWEA 2ODAA 3U4QB 2NGRA 5BSUA 2I2DA 3FVQA 3OOSA 4U6QA 1AQ6A 2YS7A 4DXDA 1CR2A 1U5BA 2SCUB 4RZQA 4YYZA 1D2AA 2R8ZA 2V8OA 1Y37A 3RW9A 4AROA 1A8UA 3OVMA 2WIAA 5CD1A 1A04A 5SYMA 3AEXA 2FPXA 2G9QA 2H4YA 3P5BA 4FEAA 3ROXA 4AZ0A 4L4ZA 1C7ZA 1ONNA 1QGED 4AJLA 3T0IA 1ISFA 2GCPA 4DAOA 2VQFB 3F7MA 2A5LA 3HBLA 1PFYA 3B1KA 1OT5A 3G2KA 4GQAA 1A4IA 1KU6A 3PT9A 2HMWA 2L42A 2G9UA 2Y3IA 1MORA 3NV9A 1JA0A 5CDFA 1P4AA 3KRTA 3C6YA 4XWTA 3C3PA 1ISMA 2WG0A 2WHRA 3MB8A 2ZIWB 1YJBA 5C5EA 2WFLA 2A3NA 3UQZA 3HPRA 1C5KA 3Q2KA 1AUXA 5LQNA 1MRSA 5B53A 4EO7A 1A71A 4JEMA 5H9WA 3DLHA 4YQZA 2FPUA 1DX4A 3JASB 1UBJS 5FBVB 1MENA 5SICE 1E99A 2HK8A 3KQSA 1CUVA 1H4VB 2NSDA 2AKEA 3RUDA 2P3LA 3R9XA 2OOKA 1GPDG 1YE5A 3FOEC 2GBLC 1DAEA 4RHCA 2MHCA 4EGQA 1KWKA 1LJ8A 4LDAA 3IHWA 1N5LA 4WNYA 4YCBA 3Q4GA 2WJ4A 2AFHB 4JITA 3LT4A 1O95C 1JRLA 1VDMA 2HHAA 4F60A 3LFHA 3TLJA 4HNUA 4NE7A 2P9CA 5JD6A 1OJLA 1X7HA 4W5NA 3G0OA 1K9VF 1ZM4A 3ERCA 4LTNA 1R0RE 3OX4A 4AMUA 4DANA 4FZ3A 1HYGA 1V48A 1FS6A 3SQDA 4F04A 3IP9A 1FFEA 1M2OA 2HA3A 3H5TA 1G17A 5FI0B 4LYAA 4YWHA 2VPQA 3WLEA 1NWHA 3BSSA 5EIEA 2YQZA 4AFNA 1OXTA 2EBWA 3UJPA 4MVJF 3VGJA 3GVIA 3IQIX 3JALB 1RJFA 4OHCA 1MX3A 4WNAB 5ESWA 3BWDD 3ZS9A 3TX2A 1E1RA 1CR4A 2QMUA 3LOUA 4I5GA 1SVKA 1OLXA 4OU5A 3IT1A 2FSSA 3AESB 4GLFA 4ZN6A 3HA5A 1B0UA 2I4OA 1V47A 3TZBA 4JJIA 4JI2B 4FIDA 2Z9CA 1T6BY 1CUXA 2ECPA 5KTYA 5JJKA 3OE7D 4L95C 1M2VB 4OAPA 4CMEC 8AT1A 2GBLA 3GC6A 3IVRA 1W0JA 2H9YA 4UZSA 1E18A 2JFUA 3AM4A 4IMPA 2BFAA 3OP4A 1N8KA 4WZBB 4D9KA 4O25A 3ROTA 1ZDMA 2QNBA 2BL4A 2W2KB 3KLNA 2L0XA 3GH3A 3PZBA 3X1YA 4HAYA 2F8SA 2OG1A 3E48A 3N8HA 2Q3EA 3BXXA 4ND6A 1CS0A 4WQMA 2CNWD 2GLUA 2FMXA 1OBVA 1E2FA 2XYRA 2QPAA 3HJUA 3T99A 3V4OA 3VAAA 1K5GA 2H3EA 2J87A 4LMBA 3BK1A 3PEWA 1A2QA 1JL3A 1XLUA 5B58T 3VOTA 3I2FA 4KWHA 3ESRA 2BP7A 3W6OA 1VPVA 2J0VA 2GK4A 3KYDA 1XCGB 1NVGA 2GKGA 4LYDA 3LT1A 4B35A 4D1YA 4AKIA 3WLJA 5EUCA 2JAXA 5IUJC 1TVMA 1JR2A 3CEMA 4W5JA 4GYWA 2YXPX 1GDDA 3JAMA 3G2PA 3UB3A 3RSSA 1DEXA 1NVDA 1OWOA 1VXRA 2X4IA 5FOVA 2NUTB 3G5AA 1IU9A 1MTOA 4MB2A 3ZW9A 2PX6A 2C8KA 1B6GA 4RAQA 1ZXLA 2XB6A 3EASA 2JCYA 2RBEA 3ELYA 4HR7A 4LVUA 3KOUA 3UHFA 4S2UA 3WGUA 1V1JA 4S1TA 3EZLA 4E2FA 4YONB 3OJXA 5LNK6 3CTPA 3GO4A 4MIKA 1KMIY 1QFMA 2TSYB 2H0AA 3BWXA 3GA0A 3MWEB 3S0JA 4DSAA 5BPFA 3GZNB 1QX4A 3TH5A 1P9LA 4DLRA 2TS1A 5AKXA 1N75A 4BRUA 1ZK4A 1AO3A 4PV7A 4UHFA 3R3WA 3UFXB 4C07A 5J4HA 4RXUA 1XTQA 1T9ZA 3AP1A 1BCRA 1J2EA 1KFCB 2OHJA 1GR1A 4YALA 3V48A 4G0QA 4N54A 4QE3A 1QHIA 1X42A 1O97D 4YDQA 4PHFA 5ARDA 1D1TA 3AB7A 3M4ZA 3Q5GA 1R6DA 1U4OA 1N3BA 2CCKA 2QAGC 1Z5WA 2OFPA 3PJFA 4H7PA 4MQ5A 3EIHA 3DNMA 4W4TA 4X90A 3HJGA 1BGWA 1SQ0A 4AYWA 1K68A 2OXCA 4BLQA 4BN0A 1I4EB 1W75A 3JZMA 3BK2A 3QWFA 4MWGA 4UMDA 4IGIA 5HS6A 1BD4A 1VG9B 1LBEA 4CKYA 2CFOA 2Q1SA 3LX8A 4CF6A 1X94A 2R6JA 3I30X 3BXZA 4RIIA 4Y6RA 3W4JA 4JJZA 4CQMB 5BN5A 5DI3B 3JQBC 3T3PB 1M2FA 4P5EA 4ROTA 3DDZX 4IW3B 2IRWA 1SBCA 1CD5A 1NMXA 3HADA 1NM5C 2FGKA 3B89A 2JASA 4CFZA 2NUBA 4RENA 1PJZA 3IBFA 3AI3A 3UJ8A 1Z4PX 2JZOA 5F21A 3DEJA 4D96A 4O4HB 4PPYA 10MHA 2HBQA 4W5RA 8GPBA 3TNLA 3FETA 2UXBB 3VTAA 1UT6A 1KVQA 4W9NC 3R9WA 1FPMA 1FZTA 3V7NA 1WKCA 1EUDB 4HQNA 4MJLA 1J22A 2N46A 4ITRC 4M1EA 4OQDA 4Q7EA 1U7OA 1Z5UA 1RHQA 4DV7B 5JS6A 1WP4A 1YQTA 2X22A 4LW8A 3QKSB 5ALEA 1PZEA 5LP6A 4QXMA 5HP4A 2E18A 5HJ7A 5DTEA 3EAFA 3NTXA 1NW4A 3PNQA 4AO7A 1P0PA 1M74A 2FW1A 2QMHA 3AUFA 4IH4A 2EIHA 4RHTA 3VPHA 2PUGA 3KKLA 1WLYA 3ICEA 3JVDA 1IQRA 1B2LA 2WYIA 3LY9A 4K88A 3UKJA 1KIMA 2VA8A 2W2MA 4OHWA 2ERXA 1SM4A 2GZHA 1EHYA 2VG8A 3A1EA 2V3CC 2GOYA 2BZ0A 3LUKA 3GROA 4NCHA 5FPKA 4B81A 5K0EA 1QQBA 2YHUA 5JTTA 4JVNA 4V1CA 3PICA 2I4RA 3VYSB 4XW2A 2BONA 2O5EA 4EBBA 3KV1A 1KDTA 1W49A 4OJYA 4R9SA 2ZG6A 2A9OA 4H31A 3DE7X 5AJUA 2C9DA 2C92A 3MAAC 3TECE 1QYVA 2B1RA 4K6KA 1IB6A 3L4JA 5HMMA 1F8YA 4M76B 4BB5A 4LQ4A 2AJTA 2PT5A 2O2JA 3B5IA 3QPBA 5CAEB 1G9TA 5E1DA 2FQQA 5AI4A 3KZVA 5DIZA 3TSAA 2EKQA 1SB8A 4Q9NA 1DIAA 4D79A 1AMNA 5DNDA 4PC2A 3S44A 1CY2A 3PJGA 1W6RA 2PKWA 4E5UA 2V7BA 1EIWA 1U3DA 3O74A 4NIMA 1SVOA 3O83A 4I3GA 3QQ5A 4ZCQA 5F7OA 4JJ7A 3EVAA 3THWA 2XXBA 1KRXA 1EM8B 1MA3A 1V4BA 1ZM3A 4JL5A 1PKEA 2G07A 4UULA 2BHRA 4WY5A 4Y30A 3GGOA 3U3MA 1KVSA 4PNPA 4EECA 3NVKI 4Z4IA 3VKFA 1Z4LA 1LDMA 1G8PA 1ZJJA 2DM6A 2NU7A 3B3GA 3D4BA 3ELDA 3O8OB 4G5SA 5AKEA 1CUEA 5EUBA 3ITEA 4CMGA 4P2BA 3NOXA 4PTZA 4RF2A 3N70A 1TECE 4KMMA 9LDBA 2C2MA 5CDTA 1YRAA 2BTQA 3LKDA 3M7IA 3TJZA 4CKWA 1KWGA 1MEEA 2F2TA 2ONZA 2X42A 2F9FA 2ZTVA 4PG5A 1KPIA 4QG7A 4QU0A 1DPFA 1Y3FE 2DP4E 4AP6A 3L77A 3CPSA 3AHIA 2B2CA 2BIFA 5C7YA 1EFRA 1FFWA 1MC4A 2FEPA 4LZAA 4OI2A 4R41A 3QYAA 4FFDA 3UK0A 1KGDA 3DFUA 4YQYA 4MMXB 3E4DA 2JI7A 3T5BA 4BMVA 3T4XA 1ORWA 4P58A 3T3GA 4PX3A 2RGCA 3HN2A 4N01A 5ALKA 3HO1A 3PPVA 3KPUA 4TXJA 2DECA 5F64A 5B55A 3CX7A 3GXBA 3OMXA 3T0GA 4QHSA 4C4TA 1KO5A 3TAHA 1UDWA 4L8VA 4BX8A 4UUMA 3PL5A 4BGUA 4DARA 4AY6A 3I62A 4JT9A 3E5MA 3A2MA 1YA4A 3BYZA 5A6SB 1NJFA 2JJ8A 3CF2A 4R8RA 1N57A 3AQ4A 5IH7A 1LD3A 1T1GA 3I4FA 3OAAA 1E79A 2FOXA 4PZ0A 2FZVA 1QCDA 4DCJA 3D4OA 4M1YA 3NBUA 3TL2A 3A6FA 2C7GA 2ZITA 1VCMA 2BI7A 1G6HA 3PNKA 4FP9A 4QYIA 4I36A 4KPYA 4J6EA 4MP6A 4GP7A 1JS1X 2VDJA 1VL8A 4CM4B 2A88A 3SYTA 4PYKA 1C0IA 4CGZA 2E48A 3IPLA 4TV9A 4RA9B 1N2CA 1J8DA 2C0PA 4AJOA 1VJGA 2G67A 1YFKA 4FFLA 1XHLA 3OZGA 2RGNC 3QVSA 1GKUB 2ZT8A 2A57A 1NBMA 2VWHA 3MZ0A 2YH2A 3WYDA 3FBGA 4C4OA 3I37X 4RJLA 2VRCD 3G9XA 4A2CA 1TJYA 5TQVA 1NW3A 4XRGA 4R31A 1PQWA 4ACAA 4BQQA 4TVSA 1P62B 2R7KA 3TKAA 2NN3C 2P91A 4R4JA 2CV2A 1QWOA 1XNHA 2QX6A 1G3QA 3B6IA 3A70A 3JRXA 4LE1A 1NJ8A 4N82A 5AHRA 5AJHA 3STTA 5HJ5A 3ADKA 1N77A 3CXUA 5DOVA 5A0TA 4UHBA 1G9SA 2MMCA 5AOAA 2QN6A 3KSBC 1TJNA 3KDSE 4I6GA 4MROA 3BMOB 4OX9Y 1L1FA 1CUYA 4NH4A 1L6RA 1SXJB 3EDCA 4E88A 4WGFA 2BGWA 1M8FA 2N47A 3HCPA 3GP3A 1N0VC 1X7YB 4G1FA 4MEBA 1F9EA 1UKVY 2NZUG 1RT9A 4AX8A 3T1VA 4E51A 5F2EA 1N36B 2I6FA 1ISSA 4E5KA 1L7MA 1LX6A 4B44A 3OJEA 3OZFA 3GOQA 2QJOA 1ZH2A 5ESXA 2OCLA 3TW8B 2W2QA 3N2GB 1LI7A 4HQ0A 3SHTA 5GZ6A 4OA8A 2IUFA 3HN7A 1XJCA 3H1GA 2RHDA 1PFGA 5F4ZA 5HQ3A 3UK2A 1N5MA 1VJTA 3FZNA 1YJCA 2BMEA 1KFEB 4Y2RA 3J81k 1USGA 1UXGA 2Q45A 3KP1A 3OEED 2UUOA 2RHOA 3ZGLA 4BQSA 3MOGA 4EJFA 3DMRA 3QU2A 2IY8A 5A05A 2MYPA 3AEQA 1QU3A 1L0BA 5GAJA 1S1CA 1WZUA 1P39A 2V6BA 3OCYA 4HSEA 3T5TA 3R5TA 2NV6A 2J3KA 3TKLA 1A9YA 3VA7A 4AXBA 4PQGA 4JCCA 4E2YA 1C0KA 3DXZA 2M1XA 5E2IA 5BNWA 3A1TA 1TJ4A 4RQAA 1CY6A 1T1IA 5J59A 2I4LA 2ZKIA 4BWGA 3CJTA 4Y2YA 2G7ZA 4BJ5A 4CV0A 1U2ZA 4EB6B 3NNDA 3RRNA 4EX7A 3ADCA 4LWQA 4R9VA 2F8LA 2P6NA 4JGBA 3ZIUA 4URUR 5HX7A 3NNSA 4AJ4A 1Y81A 2O8DB 1MQ9A 1G18A 4IO1A 1ADBA 1VCHA 2ASEA 2FZKA 2NYRA 5EHNA 1XCLA 2FQWA 1RPNA 2MSKA 3TE6A 3ZW7A 2MR6A 2VTEA 1OWNA 5HZGA 1TADA 2H52A 3D0KA 4Y9UA 2HRRA 1GZ4A 2ZR8A 1J09A 4RLHA 4ZQIA 2IDZA 2A1IA 2VK1A 5A04A 2QE7A 3HEMA 3OCJA 1H42A 3CF6R 5EN4A 1E7YA 3KQKA 4BLOA 3ABIA 3QVWA 5FDFA 3K6SB 4WEOA 1QGOA 1JIUA 1A9XA 2B6NA 2BR4A 1WCYA 4JK3A 4Q4JA 1NASA 1RR6A 3A28A 4PFJA 5EUQB 2ZI6A 4DMGA 1K6XA 3PD1A 4JT8A 3TZLA 3DUFB 4RABA 3SFTA 1UMKA 2CF6A 2X2OA 2XUJA 3EOBI 2E37A 3PQ2A 4I2VA 5G0VA 4BU0A 3VZRA 1ZUHA 1WDTA 1RIIA 3CURA 1U0BB 3FPGA 3E7WA 1V3QE 1Z2PX 2E1PA 3I3OA 3TRFA 1HKUA 3E22A 4RFLA 4DL9A 5IJ0A 4DBZA 1YR9A 5TPWA 1MGPA 3VYRB 2PH3A 3DR3A 4FYVA 4JJEA 1QFZA 2FPOA 4HLCA 2MYNA 5EQJB 2XKKA 5ALGA 4KLNA 3QNWA 2XCSB 1BEZA 3T12A 1X7WA 1FOEB 1OB2A 1E4EA 3PLAE 1W35A 5DMXA 3RYTC 5J47A 1BHQ1 1BDJA 4MO9A 4F1KA 1QVWA 1M0EA 3VYUB 1SEPA 2W6NA 1FLNA 5IN4A 5E2AA 3VOAA 2JB9A 1EBUA 5HOQA 1RKUA 1WUJS 3MTGA 4FGWA 2J31A 1WPRA 3L1HA 3IA7A 4PQYA 3C8HA 2DLDA 2J46A 2QVZX 4R2HA 5E4FA 3VNBA 5TSDA 2H1HA 3L84A 4IKEA 4MW6A 4YCLA 3TXYA 1IRIA 1YQWA 4NV0A 3YASA 1XALA 5AI0A 4MV0A 4F7WA 3DFFA 4KXNA 5E6SB 2I2XB 3I2IA 1A3CA 2DQYA 1EVJA 2YWCA 2OCPA 2ZSHA 2ZVPX 2FPWA 1XVLA 3K0FA 5F3RA 1LBSA 2Q50A 2MSLA 3KHKA 4V0ME 4G0WA 4Z4HA 3M5WA 1PX2A 2NV0A 2R00A 3JQ7B 1P61B 2Q21A 3GT4A 4FXPA 2ZXFA 4RSMA 3MOSA 4D8VA 3G0BA 1HSOA 5BWCA 2DSTA 1AKUA 1CLEA 1MXHA 4MCHA 5KWSA 3PD7A 2E89A 2O05A 5HRCA 1YT5A 3DEIA 5DHFA 1BX1A 1DXQA 3DL2A 1JB9A 2EKLA 3N8DA 3N74A 3EUFA 2NO5A 2HQ1A 1R0XA 3O1IC 5CDFE 2YZNA 1M6VA 2AG0A 2HPZA 2ZRMA 3GB9A 4QXQA 4YGYA 3J81A 1A2KC 3O4RA 4HLUA 3STWA 1J1UA 4HNTA 3K0SA 1QFXA 1YL5A 3IP1A 4KUHA 3CZ4A 2IHZA 3I1YA 4CT0A 2VJQA 1ZVKA 3ZGOA 3WRVA 1T9AA 4UKDA 4PN7A 3LCMA 4IJMA 5HE9A 1IXRC 4AZ3A 3I9V6 1CQXA 3MWEA 3QY9A 4OUDB 1P9RA 2PQMA 1FLAA 3RYIB 4CL8A 1GTRA 4OYLA 4D9EA 1H4TA 1T2FA 1UPTA 4AF8A 1KY2A 1E5QA 4IEEA 1VM6A 2EJBA 1KDYA 3VKHA 4YCAA 2QF7A 1VA5A 1OGJA 1UZNA 1W96A 1LI4A 1XXHE 1ZD8A 1QHEA 4B33A 2B61A 3E7FA 3LYHA 4BB6A 3KHSA 4KOEC 1EP2B 1ULHA 1KQPA 4ZT5A 2JAHA 4CI9A 2BBOA 4XLTA 1GR0A 1HNXB 4UVDA 2W6OA 4DV2B 1H4QA 4G37A 3WMXA 4YUYA 1SUIA 1NN5A 1TM2A 3DTYA 4JLDA 3GJ4A 2OD9A 4L7VA 3Q5DA 4XX0A 3L6DA 4DDHA 2DU8A 3USCS 2ZP1A 4BQOA 1GPYA 4R8VA 1EVLA 3FR7A 3O4VA 3EGCA 2Q9UA 4QPNA 3BGWA 3Q9NA 5LYJA 5A5FA 1THGA 1TE2A 2W6PA 4B73A 2LDBA 2CNBA 1E1YA 4DQUA 1G41A 1EX9A 3CKKA 1WUYA 2QRHA 1TZMA 3BWYA 4TWIA 4Q21A 2WJIA 2PYZA 4K6MA 3PX3A 1J7JA 2OORA 2NYUA 4GOOD 1Q44A 1KY3A 5DXJA 3ZNNA 3CJQA 4YCJA 2FPPB 1GYRA 4F5EA 1B2RA 1J0DA 3VPAA 4F3KA 1C1XB 4FFMA 3NDPA 2AA3A 3DMYA 1HDOA 1R5NA 2HA5A 1S3GA 2PLNA 4BLSA 1QZTA 5EJ8A 2CV1A 4MRMB 4QWWA 3NH9A 3GVHA 2GZ3A 4TYPA 1VFPA 3RS9A 1I33A 2YR0A 3H3JA 1IZ8A 4FGZA 4JLNA 4FHDA 4LWPA 5FR1A 5IZCA 3EPJA 5FI1B 3IIKA 4N5LA 2W42A 1NNEA 1PP4A