3HVIA

Rat catechol o-methyltransferase in complex with a catechol-type, n6-ethyladenine-containing bisubstrate inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Molecular recognition at the active site of catechol-o-methyltransferase: energetically favorable replacement of a water molecule imported by a bisubstrate inhibitor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 82
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hviA00
2YQZA 2OB1A 3FYDA 2HMYB 3G5LA 3GJYA 4P7JA 5FUBA 4C06A 4X63A 5LSAA 3NJRA 1WXXA 1SQFA 2OO3A 3CBGA 1NT2A 2Q41A 4HH4A 1JQEA 5CVEA 5DPMA 2YX1A 3CJTA 4KRGA 1RI4A 5DXJA 3UA4A 1UFKA 1XTPA 3DTNA 1SUIA 3G88A 3OFKA 3FTCA 5DSTA 4F84A 4BP1A 4CTKA 7MHTA 4E31A 4JXJA 4PWYA 1PRYA 3BXOA 1Z3CA 3THRA 3NTVA 3I9FA 3IYLW 1FP2A 3DLCA 3KHKA 3GRYA 4KDRA 2PX4A 3MQ2A 2AN5A 2GB4A 2B78A 2ZIFA 3BWYA 4WXHA 5LQKA 2JHPA 3G2QA 3AXTA 5F2OA 3NW9A 3DH0A 2C7RA 5D1HA 1V39A 4QDJA 5E8RA 5LQAA 1AQJA 3EGEA 1O9GA 3FUXA 5T67A 1X1AA 3GIWA 2BR5A 3P71T 4ISCA 2AN3A 3BWBA 1Q0SA 5EZQA 5EMJA 3GRVA 3DMFA 2Y1WA 1DUSA 1XDSA 5HIIA 1WS6A 3CJRA 2PWPA 2OPBA 5K05A 4YUZA 2ZIEA 3BKXA 3FYCA 1NE2A 3EGVA 3TRKA 3UJAA 3HCDA 4ER7A 5DM0A 3A27A 1G55A 4OX9Y 3LBYA 3DXXA 3PT9A 2B3TA 4QTTB 1KXZA 4RV9A 3LL7A 3RW9A 3EVDA 2QM3A 2AN4A 5EQJB 4ZTBA 3D2LA 3PS9A 5HZMA 2PBFA 4Y2HA 5ICFA 4EKIA 3HA3A 3BWMA 1KR5A 3LGAA 4YV2A 2AOTB 1EIZA 4U7TB 2ZFUA 3PB3A 3KQQA 1NW8A 4E2ZA 2WA1A 3NDIA 3OU7A 2EJUA 3CJQA 3LCVB 3LHDA 5DM2A 3A4TA 1JG4A 1HMYA 1KPHA 3OE4A 4QPPA 3TKYA 2B2CA 2HR1A 1ZGAA 4RTSA 4MHTA 3AXSA 2ZZNA 3DOUA 3E7PA 1RJDA 3KQOA 2OYRA 1PJZA 4DQ0A 5JR3A 1ZG3A 2N47A 2CMGA 2H11A 4DA4A 4YMGA 3BZBA 3FUUA 5EMLA 5HIKA 3DULA 5HIMA 2CKDA 3B7PA 3SSNA 2PGXA 1L3BA 4E30A 2ONZA 3M4XA 2QRVB 2PX2A 4GOOD 2QRVA 3TR6A 3V97A 3P2IA 5CVVA 5EVJA 2HTEA 5E9QA 2JG3A 2R6ZA 3NVMB 4P58A 9MHTA 5GM1A 2NYUA 4OQDA 1P39A 5E9WA 5GOZA 5DRTA 5DX1A 1XDUA 4DM3A 1X1BA 2B25A 3DMGA 2CWWA 4PGHA 2BM8A 3SX0A 2A14A 5HEKA 4FT4A 4FT2A 2IFTA 4B17A 4FSDA 5E8JA 3UJ7A 4YMHA 4RTPA 3DLIA 3KQSA 4E70A 1JG1A 5HIJA 2E5WA 4PGGA 4CKEA 2P7IA 3AWIA 3A26A 3T7SA 2I62A 3TKAA 5K0EA 1I9GA 1VLMA 3EVFA 4CKBA 5EG5A 5B1SA 2ZWVA 2YUIA 3FRHA 3G7UA 3RODA 2XBMA 3GDHA 1ZGJA 1BOOA 2AOVA 3KQYA 1T43A 4PONA 3HCFA 2ESRA 4R8SA 3I64A 2KW5A 5LQUA 2PV0A 4GOLD 2AOUB 3GRZA 5EIWA 5E9JA 2ADMA 2O57A 2O0LA 1I1NA 2UYQA 4KIGA 5ICEA 8MHTA 3ELYA 5DM1A 3UJCA 1MHTA 2PLWA 2BH2A 3OPNA 2GH1A 4M7RA 1G38A 3A7DA 4C03A 2EG5A 4X61A 1AV6A 5IKMA 1L3IA 3UJ8A 1L1EA 3M6XA 2VDWA 1D2HA 5LQJA 2JHAA 3EVAA 1G60A 1KYWA 4QQNA 4RYLA 1P1CA 5EIFA 2YXDA 1YUBA 5IH3A 1WY7A 4FSXA 4R6WA 4H0NA 5LQRA 2OB2A 2G71A 4EK9A 5E1BA 5G02A 3HP7A 4RTNA 2UYHA 2O06A 2YXEA 3UFBA 1KP9A 3PLAE 1ORIA 3KQTA 3HVKA 4P7FA 4E2YA 1EJ0A 1YB2A 1SQGA 4R05A 3PFHA 2YTZA 2XYRA 1RJGA 3G8AA 2EJTA 3P2EA 3DUWA 1ZQ9A 2B9EA 2GAFA 2QYOA 3THSA 1R8YA 3LCCA 3P9NA 2CMHA 1G8SA 1P91A 3R0QA 1SG9A 3UZUA 1NKVA 3KR9A 5GP1A 5K0BA 2QY6A 4LWPA 4KWCA 4GBED 1B42A 3FPHA 3GWZA 5DXAA 5T64A 1BKYA 5DTRA 4ER5A 3TMAA 3IV6A 5DTQA 2FK8A 4RTLA 4XUDA 5FADA 4RTKA 3MCZA 4PINA 1KHHA 4R8RA 3X0DA 2ZVJA 5GIPE 3AY0A 4PYLA 3FPGA 1JTFA 4O29A 4BP3A 2G8NA 3SSOA 1RJEA 3MAGA 3ME5A 3OZTA 4X60A 5HILA 2GLUA 1M6YA 2PX5A 1N7IA 2YXLA 1VL5A 5CD1A 2CL5A 4PIPA 3ELDA 4PYOA 1OR8A 2NXNA 2OXTA 3VYWA 4FR0A 3R9XB 5FWDA 1JG2A 5BXYA 2PVCA 3BUSA 3O7WA 5E2BA 5EMKA 5KQSA 1Q0TA 1KPGA 4RWZA 2FK7A 5U4XA 3HCAA 5E1MA 5EPEA 5E1DA 3PVCA 4A6DA 4RVDA 4DMGA 1VP9A 4PYJA 4GEKA 1P1BA 2H00A 3C6MA 3KR0A 4GF5A 4DCGA 5DT2A 5BW4A 5CIYA 2IH5A 4LECA 2K4MA 4M36A 1WZNA 4GOND 4NECA 4OQEA 3ELWA 4X41A 3UA3A 2PT6A 4LWOA 5DWQA 3BGDA 5FA8A 4OBWA 4AZVA 2NP6A 3KQVA 2OY0A 2FPOA 1FBNA 3R24A 3R6TA 3EVEA 4CTJA 3UBTA 2P41A 2WK1A 5EKUA 3GRRA 3VC2A 3H2BA 4AZTA 5CCXA 1EJ6A 4HTFA 4PYMA 4POOA 4Z2YA 1XXLA 4ER0A 2P3LA 3ORHA 3TOSA 3C3PA 2AZTA 2XYVA 2ZIGA 4XUCA 3TFWA 3GU3A 2ZLBA 5GM2A 3TLJA 3FZGA 4PCLA 3HVIA 2VDVE 3HCBA 4F85A 4UOEA 3NMUF 3KPUA 4RSRA 1R6AA 1QAMA 3KR1A 3UJDA 2PT9A 1YFJA 5KQRA 1QAOA 1R18A 2I6GA 3A7EA 1XDZA 5FTWA 2WA2A 3G2MA 2BM9A 4U7PB 3PX2A 5CVUA 3LPMA 3HNRA 3K0BA 1JQ3A 3JWJA 3PFGA 5FWAA 5ICGA 3GXOA 3GO4A 2LD4A 1O54A 1F3LA 1X1CA 1HNNA 3GRUA 3IEIA 5EC8A 2AVDA 5CCBA 1FJXA 3L8DA 5DX8A 2GPYA 2ERCA 1IY9A 3BGVA 1SKMA 2ZZKA 3F4KA 2IDKA 1JTEA 2PY6A 1L3CA 4QQKA 2IPXA 3T0IA 3BWCA 1NV9A 4QDKA 3V8VA 3QOXA 1NV8A 3JWGA 2NXCA 3P9CA 5CUQA 3I5UA 5E2AA 4IV8A 2XVAA 2ZSUA 3S68A 4C07A 5ICCA 2IH4A 3E23A 5HFJA 3A25A 2HV9A 4MQ4A 2ZZMA 3JWHA 1SVUA 3LKDA 1M6EX 3G5TA 3LBFA 1NW6A 1FPQA 5CVDA 4FS8A 5GWXA 2P3OA 1XCLA 5DM4A 5DRYA 2Z6AA 2P35A 4PYKA 4EKGA 3HA5A 5EZSA 3DXZA 4RTMA 5DLYA 5HOQA 1BC5A 4BY9E 1VPTA 2FHPA 2H1RA 4KIFA 4C08A 2GA9A 1ORHA 2PWYA 3TPZA 4AZWA 3OCJA 3VSEA 3EVCA 4ER3A 3M70A 1YZHA 1EG2A 2VDUE 3KPVA 3MTIA 3REOA 4GC5A 4C05A 4ER6A 3SM3A 5K0CA 2GS9A 4YUWA 3FRIA 4ATNA 2V74B 1QYRA 4DF3A 1UWVA 2EX4A 3ELUA 2C7PA 3FTFA 3C0KA 4YUXA 1D2GA 4GUAA 1NW7A 2ZW9A 3BKWA 3P9KA 4KW7A 4OA5A 3TM5A 4KDCA 1IM8A 2DULA 5ERGB 3P97A 4IKPA 2FRXA 4YUYA 3OU6A 2YVLA 3TM4A 2UYOA 4E2XA 1DCTA 4IV0A 3ANXA 3MTEA 3EEOA 1KIAA 3HVHA 4GC9A 1M0EA 5P8WA 3CGGA 2OKCA 3KQMA 1VBFA 4GOMD 3EVBA 3FPEA 2PXAA 3LSTA 4KVZA 5FHRA 1VP3A 1XCJA 3EVZA 3KR2A 4R6XA 2VZ9A 5T6BA 3GGDA 3M6VA 2G70A 1JQDA 4HGZA 3NWBA 2IIPA 4L7VA 2F8LA 4MTLA 5EHIA 3I58A 5K0NA 1R74A 1INLA 2ZBPA 2ZULA 4FP9A 2P3QA 1RI3A 2AS0A 4PYIA 4LG1A 4BLWA 3OFJA 1UIRA 3C3YA 3E05A 1ZHFA 3DXYA 3JWIA 4YV1A 2NP7A 3M33A 4A6EA 1VE3A 2IDJA 3MGGA 2NXJA 5FHQA 2O05A 3VC1A 4YUVA 4HG2A 4EMSA 3SVZA 2C7QA 5K0FA 2JH8A 3UJBA 2JJQA 4RTJA 4C04A 3MHTA 3SMQA 3DMHA 4QPNA 3C6KA 2OBFA 3EEYA 4V0RA 3P2KA 2HWKA 1O9HA 3KPJA 1TPYA 2XYQA 5DSXA 3B89A 1X19A 2OZVA 4PIMA 4PYNA 1D2CA 4RVGA 2AVNA 5CVJA 4DKJA 1QANA 4K6MA 4HGYA 4C4AA 3EGIA 1DL5A 1EAMA 5MHTA 3PX3A 2P1DA 3FUTA 1JSZA 1JSXA 3B5IA 3FTDA 3UJ9A 3SR4A 2IBSA 4X1OA 3EVGA 2I7CA 3K6RA 4P7GA 5GINE 3KPYA 4HSGA 5E1OA 2Y1XA 3FPJA 3SXJA 1JG3A 4F86A 5F2KA 1FP1D 3RIEA 2V7EA 3M6WA 5K8VA 3FTEA 1EQAA 3EMBA 1F38A 3P9IA 4RVFA 1QAQA 1G8AA 1NW3A 4XUEA 1YF3A 1KYZA 1N2XA 3HCCA 3FPFA 3G8BA 1L9KA 4HTFB 5K0JA 2ONYA 4E33A 4PNEA 2AR0A 4AX8A 3ER9A 3CKKA 5K03A 2IP2A 3MB5A 4PCAA 1XVAA 1JR4A 5FQNA 3B3JA 4Y30A 1WXWA 3LECA 1TW2A 4V0QA 3AJDA 5EKXA 5KVAA 5BW5A 1RJFA 2C7OA 2AOTA 5FA5A 3U81A 3LKZA 5K09A 2I9KA 4QVGA 4E2WA 5GIOE 4RX1A 4QTUB 1RI2A 1NBHA 2PKWA 1SUSA 3T7RA 3KU1A 3P8ZA 4HC4A 1VIDA 2PJDA 3M6UA 4EQZA 3IHTA 2AOXA 5EMMA 1ZKDA 2EFJA 1AF7A 2IGTA 4OA8A 4CKCA 5LQCA 3BGIA 3FUWA 2O07A 4YV0A 3BT7A 4M37A 3Q7EA 1MJFA 2FCAA 3GNLA 3OU2A 2QE6A 4RTOA 3LCUA 2UZ4A 2G72A 3R3HA 3LDFA 4FZVA 5BP7A 3FUVA 2ORED 2ZBQA 1N7JA 5DTMA 3QOWA 4AUKA 2IBTA 1QZZA 2P7HA 2ZBRA 3E8SA 3NDJA 4IWNA 1H1DA 1BHJA 4OBXA 4GQBA 3UWPA 3B3FA 2BR3A 3Q87B 5KYGA 3ER8A 3MERA 5M5BA 4G56A 5K01A 2NNWB 2ZWAA 5F2NA 4CXMA 3T7TA 5CM2Z 3HTXA 2G1PA 4FGZA 2P8JA 5C0OE 4RTRA 2DPMA 5K0GA 2UYCA 2YR0A 3EMDA 1IXKA 3MCTA 5EEGA 4AZSA 2JHCA 3QV2A 1KPIA 2P40A 3LDUA 4WVLA 4M38A 3PTAA 1AQIA 1R8XA 3KKZA 4DCMA 3LDGA 2AOWA 3CC8A 3OZRA 4RTQA 1YZ3A 4MIKA 5LQNA 2Z6UA 1Y8CA 3NWEA 4DZRA 3DR5A 3O31A 3KQPA 5EEHA 3CCFA 3LX6A 3HA7A 2VP3A 2BZGA 3UJ6A 2JH9A 10MHA 3NVKI 2PSSA 3GCZA 4XCXA 3HVJA 1TW3A 3HEMA 5EGSA 4CWAA 5LR6A 4PYQA 5DX0A 1X1DA 5K0LA 2PXXA 1U2ZA 2AOUA 2XVMA 3HM2A 2PXCA 3KQWA 4HRAA 4QVKA 5JUWA 2IH2A 1I4WA 5KS2A 5EOVA 2VS1A 3CVOA 1YFLA 3O4FA 1XJ5A 2ZCJA 3ERCA 1WG8A 3I53A 2R3SA 3G2PA 3G89A 3TQSA 2Z6QA 3WSTA 1R00A 2BR4A 2HNKA 2NXEA 3ID6C 3OE5A 4E32A 5D1NA 3OZSA 3SSMA 5FCDA 5C1IA 1NW5A 4EVIA 1VQ1A 3DP7A 3HCEA 3KPWA 4P7KA 4BLVA 2ZTHA 4RVHA 3SGLA 1G6Q1 1RI1A 5FQOA 5C9ZA 5FULA 4MWZA 5EHGA 4BLUA 2PX8A 1RI5A 3B3GA 1NBIA 5H02A 3G2OA 3EPPA 2FYTA
chains in the Genus database with same CATH superfamily
2QQFA 3A1NA 1FK8A 4JLAA 4LMAA 3T3NA 5KAMA 1NYQA 2MU1A 3GAMA 1OKKD 4KYUA 4TKUB 3WYAA 1YA6A 3EGXB 4D46A 5AVTA 5IJ9B 4EW1A 4B75A 3UMYA 3CJTA 3CEJA 5BNZA 4GQIA 1SPBS 3B8EA 5LLTA 4GDFA 4LF5B 2PMEA 4RQTA 1HQYE 2BUAA 1GIAA 3F6EX 1QB7A 3IB3A 5EIBD 2IUEA 5CITA 4D3DA 2OR3A 2DPHA 6YASA 1D3AA 2ZR7A 4BC1A 4RENA 1RKVA 2HJGA 4QATA 4IFBA 4JVOA 2UUPA 2B4KA 1PW5A 2G83A 5LQKA 1JHOA 1T5SA 4ZVVA 3RH0A 1J9GA 3RKUA 5F7JA 1UMBB 4AJOA 3DH0A 1V26A 3HBFA 3PEEA 4F1KA 3JASB 5B4UA 5DIFA 2Y9MB 4TXJA 3LXXA 1XLWA 1ID1A 1KY2A 4DMCA 1KEEA 2J9FA 2YVQA 5CT6A 2C2MA 2EJWA 3LPCA 1N5LA 1E9SA 3GPCA 1VDMA 4OHZA 2J9XB 3TZQA 4KR7A 2WSSD 1XXHE 5JSKA 4M1TA 3KJNA 1AQNA 1XKQA 3HCDA 4R1TA 4N7JA 4X3CA 3N2EA 4N12A 3RQIA 1EVYA 3FOWA 4XFKA 1KXZA 3IV7A 5CA0A 5LN1A 4DW8A 5A6SA 3GRPA 4ACAA 4RFSB 3ETDA 5G40A 2OBXA 3LRXA 5JY1A 1U6IA 2JIPA 3LGAA 3QX8A 2FUG1 1PSWA 2QK4A 4AZ3B 1QTIA 3PQDA 3D54D 4NJOA 4RSGA 5KTYA 3OU7A 2VWGA 1A77A 1I2DA 3K70D 1ODJA 1T13A 3Q6NA 3HKCA 5KYYB 2NSDA 3LLUA 3F47A 3OE4A 2HSGA 2ST1A 1MKYA 5EJ5A 4LTMA 3AXSA 2ZZNA 3L8FA 4C0SA 4BFLA 4AT1A 4EY3A 1AQUA 4GLJA 4BIMA 3DDUA 4MDFA 4JEHA 1NR1A 2H11A 1KS9A 3A05A 3BIJA 2WVJA 2JBAA 3CH5A 1P2FA 3RLIA 4IQFA 2PUTA 5JEDA 3CX7A 1KZ9A 1L3BA 3JQGA 3VSCA 1Q0ZA 2HOQA 5L7WA 4PN7A 4U2GA 2C7GA 3TSOA 3VPDA 1PHRA 4WLOA 3P2IA 3L7IA 4EB8A 4WK4B 3C14C 4F5DA 2DFDA 2R25B 1KSGA 4U39A 2Z2IA 2R8BA 1Y48E 1E4EA 1J2YA 2VUTA 3PICA 4FEGA 4QO8A 5BT9A 5E6RB 1T9DA 1DP4A 5LUAA 2XCTB 1IQPA 1EDOA 2FE1A 3E9RA 3PQEA 1X87A 3N8KA 2GFIA 2QU7A 3HB9A 4U2EA 1XMQB 1UK9A 2BM8A 2QN7A 3MGBA 4JBXA 3CNQS 3M34A 2HMUA 5LZ8A 2HUNA 1HNZB 1ICEA 3UMBA 4QODA 1JHRA 2HEGA 2VUIB 1MD9A 4HVTA 4KC0A 4ZVPA 1FMFA 1JG1A 3IT2A 1E6WA 3CX3A 3H8WA 4TYWA 4KO4S 1DAKA 1Z2DA 3HUUA 1FE8A 1VJGA 4DA0A 2BSXA 5EJ6A 4PU0A 5JAPA 4YPVA 1EUQA 1P2TA 2XTNA 2IELA 3PXCX 1FA9A 4BGIA 1A9ZA 3G49A 1I7QB 2QYHA 2QXTA 2V0NA 1KK2A 2XEXA 2MCFA 3I23A 4KUGA 2AZXA 4L6CA 4JR2A 4YRMA 1QGOA 1BCRA 4DNXA 3OM9A 1VCOA 3V1UA 5DN9A 4IZIA 3RS0A 5CDHA 2B94A 2B9VA 3I8SA 4KOEC 2PL1A 4LC0A 3TF5A 2ZS7A 4EKYA 2DHRA 3CS3A 1EEXB 4HADA 5T67A 4HJXA 3V6LA 3ULKA 3ZLBA 4F6RA 3GCGA 3RGGA 4R5MA 3LX8A 2O2YA 4MAMA 4ONEA 1AN0A 1G60A 1JIUA 2FW8A 1P1CA 1T8YA 1WHSA 2IQ5A 2J59A 3B1JA 3CISA 3CLSD 1QPGA 4XD7D 1H5QA 1W75A 1C7IA 4C0AC 4F2HA 5DP1A 3RVJA 4OJYA 3SF0A 2NVOA 3W04A 2WJAA 4EI7A 4X97A 5KVQA 3LPLA 5E1BA 2I91A 3I4LA 1CS0B 4XX0A 5FDFA 3JRNA 4CUKA 2JK0A 5AVJA 2JFZA 1U2DA 1FOEB 3A1WA 1ZRHA 3JZFA 4BTVA 5IHXA 2VPPA 4V02A 3CKMA 2BGUA 2XCSB 2CLKB 2XTJA 1ZLXA 3WAKA 2VBCA 3DE0X 2CXQA 2YWBA 3DDCA 3WMFA 2FN3A 3BCUA 3ZNPA 5A04A 4ICIA 4QUKA 3W9BA 5B64A 3D2BA 3ONWA 1H6BA 3SFZA 4ZVMA 1AUQA 1II8A 1IHUA 1PVVA 2FHSA 4TMZA 2RKBA 4XVQA 3TOZA 3BQMB 4FDMA 5A4IS 3VKGA 1GPWB 3IAAA 2HK6A 2PN1A 3O8QB 4QDXA 3E27A 3SM9A 4JC4A 1WMAA 1BJTA 3CUTA 1MVLA 1GLNA 3EXG1 3GDOA 3OP4A 4OQPA 5CU7A 5AKXA 4W8OA 4W4TA 2LKCA 3LP6A 2GLXA 5FUVA 4BU0A 1GR1A 4OUDB 1QS0A 3ICPA 4UBIA 1TZCA 2ZTUA 3C6ZA 5ALVA 2EATA 1XWWA 4UPEA 4NOMA 3CYFA 5C5EA 3HHEA 4B3IA 5IJZA 2GEDA 3QVKA 4LPSA 2PKQP 4NARA 1A0OA 4HNHA 5BOSB 2J48A 2V6GA 1S8FA 1NVTA 4GAEA 4BL5A 4H6WA 2C4UA 2FK7A 4P9NA 5E1MA 2HBZA 1ZNQO 1DEHA 5HBRA 3V1KA 5IJ0B 4GM0A 3ZXIA 3K1ZA 4V2IA 3U7GA 4DMGA 1TE2A 2YN0A 4B6OA 1NC1A 1JMKC 3B1FA 2KM1A 4IEEA 3FNRA 5BSKA 3B6MA 5C8ZA 4GF5A 4D9FA 2GVZC 1TD9A 5DT2A 4M2LA 3E0XA 2LDXA 2K4MA 4NECA 4FNAA 5KYVA 3OWXA 5A4MS 3ZGVA 4Q9HA 5DWQA 4HMOA 2BAGA 5CVCA 5JATA 3QXGA 4RANA 5DF1A 2OAP1 4X8HA 3H86A 2OCBA 4A0HA 4ZYWA 2IEIA 2F1RA 2P41A 3QOYA 2BEUB 3WMXA 1QIFA 1PWXA 4BKQA 2DQYA 1ZH0A 2E85A 1FNDA 1OW3B 1TMGE 4YRGA 1QHGA 3C1OA 1E1RD 2DUUA 2YRWA 4OXQA 5JASA 4N8DA 1NJ5A 1PGPA 1HG0A 1N7HA 2XYVA 3HKDA 3DBHA 4MULA 4WLUA 1U90A 1UDXA 1EGAA 1JIQA 4QJBA 4Z7JA 6ADHA 3DVRX 2Y6UA 4F85A 2C1XA 2J9YB 4ZU6X 1NMSA 4RZ2A 4G5QA 2J6IA 3RFVA 2REQB 1GUDA 4TTQA 4DAOA 5JCPA 1E2DA 3QWHA 1WXEA 1BVUA 1E1CB 1XLTA 2J31A 3HHPA 4O4HF 1Z0IA 1ZRMA 2RHGB 5HR5A 3TYXA 4KN6A 3HNRA 1SULA 5EINA 3EAGA 2PZAA 3EDOA 4LTDA 4B09A 3D5QA 1RPZA 3SU8A 2W0SA 4R84A 5EC8A 1GL9B 5FWXA 3G5AA 1KORA 1U94A 2WFAA 4JROA 1PL8A 8OHMA 3PLNA 4JDPA 2RBEA 4LRSB 4PLWA 4UKDA 5C51B 1N9ZA 5NULA 3T3GA 4RTPA 2R65A 4I55F 1D4ZA 2GZ1A 3LZ6A 3QOXA 3D6VA 3WK4A 1LQTA 2Z3ZA 2W2TA 3FLAA 3JWGA 2PGJA 2E2WA 3L8GA 2VAVA 3P9CA 4JP2A 5E2AA 5F12A 3ROZA 5ICCA 1Q12A 3INGA 4N82A 5A06A 1XGKA 2IA5A 3OEWA 4J16C 3R74A 3GZ4A 3RSCA 1BRMA 2MYPA 4ZGBA 2F55A 3RVMA 4C14A 2QMYA 2QTCA 2AFHE 1TK2A 2JI7A 3CF4A 3KYBA 1KJJA 3MRVA 3FFTA 4C7MA 1AQ6A 2JGKA 4BY9E 1QIEA 3FMVA 2SHKA 4MKHA 2B69A 3QWBA 2V6BA 3BSWA 3ZWAA 3IT0A 3KSMA 1P1FA 1Z0ZA 2MMCA 4CFZA 1T0UA 1W59A 1XZJA 2ZAIA 3HFRA 4D02A 3E84A 2BZ0A 3E82A 3D3WB 4F2PA 1U5BA 5B3JC 3DOIA 4QUEA 1Y37A 1GAJA 2ZYHA 4I19A 4OK3A 2WB2A 1L6IA 2IU6A 4B6GA 2OQ2A 1ELOA 2WWWA 3CPSA 2CDNA 4MA4A 5SY9A 3R8XA 2P78A 1XCGB 1UP4A 3R23A 3P97A 5D3KA 5BSFA 4IV0A 2X2OA 1VSVA 2X58A 1XNHA 2WIAA 2GETA 1QRDA 3DAHA 4ZDKA 4FYHA 3ITEA 1VMIA 3RVPA 2CNKA 2OO7A 3O75A 3R7SA 1H65A 1WQ4A 3NX4A 5ADVA 2VLIA 1U0RA 4PQYA 4C1BA 3CF4G 3EW7A 4N6GA 1AT1A 3F2VA 3V2IA 5ICSA 4NV1A 1IZZA 3ZXYA 3K0AA 5JJKA 1J09A 1KFBB 2ZULA 1UEIA 5EIOA 2IYVA 1K7SN 1M2GA 2OYCA 3SFTA 4U7FA 3U13A 3UNXA 3LC0A 3UV7A 4QXPA 5F52A 1B26A 5AKIA 3DKRA 2GZMA 3GFOA 4ZD6A 4BDTA 2Z9BA 1RHRA 2GERA 4JOSA 5GVRA 3VV2A 4U8GA 1U02A 3QEJA 3SVTA 3D0RA 4FMDF 2GPWA 2FJPA 3H2YA 4I8IA 2AUMA 3R76A 3K6SA 1Q0LA 3C4VA 4BFUA 5LOVA 1L4LA 1K89A 1WEKA 2HF2A 2R00A 5E3HA 3EEYA 2FZCA 1HEUA 1MC1A 1JG7A 3GHYA 4TYPA 1JILA 3HVRA 2QZSA 3L5OA 5G1OA 1U2RA 2DTEA 3GBVA 3VZRA 4BV2A 3B89A 1EWVA 1NUSA 4KODA 3LT0A 1YJXA 3MT8A 3TQCA 1Y98A 3Q5DA 1II0A 1KVUA 1USGA 4OU4A 1TM5E 3I12A 4QDOA 4YK7A 4AQDA 4XSVA 4B3HA 4EHBA 3R6WA 5HVNA 1VMDA 3PX3A 1VYVA 4FM9A 4WFIA 1G7SA 1RW4A 2PM8A 2R8PA 3C1AA 3EEBA 3LGXA 3QPBA 4D4IA 3C6YA 1MJ5A 1I7DA 4OGWA 1YB1A 3MW8A 4N3GA 3LY5A 4WCFC 3M4JA 4JBGA 2FP4A 4X54A 3K2IA 4XGNA 4DR2B 4KE9A 4EGAA 1RNLA 1TM2A 4IQGA 4AFNA 4M22A 4IHAA 1JPVA 4L51A 5F5NA 1G6KA 2DQZA 1XDWA 3UATA 1JXAA 2CNBA 5K8VA 1EQAA 2NV0A 3ETCA 4EMTA 4RVFA 4S1VA 4GYYA 1S4MA 1G8AA 2ZOSA 3FCOA 1AKNA 4DLTA 1V3VA 1VGRA 4Y2GA 3WWZA 3PIDA 4GD3Q 3IR6A 2PZ8A 3FOCA 3OIDA 5JYDA 4IJ5A 2Q5JA 1M67A 2GXUA 3H05A 3JW8A 3LECA 3AY3A 3C3BA 2ACWA 2CLSA 4YO8A 5ALXA 1EVEA 4AYTA 1HDCA 2KLBA 2WNSA 4IM7A 4TS4A 4TUYF 3A31A 5IXSA 5KCZA 1HO3A 5J23A 3AF1A 5KWVA 2QJFA 1TYZA 2V8BA 3BFXA 2JZCA 3E7DA 3HE3A 4U2FA 5EIHA 5FBRB 1UKCA 2PXHA 2AJDA 2H8GA 3KU1A 2FFQA 3CU5A 3SY8A 4CEHA 4DIDA 1JEJA 1UXKA 1IDN1 4XSGA 2TMDA 1LCIA 1B0PA 5KUTA 1F3OA 4XFDA 3ZI4A 2X40A 2EWVA 4C43A 1FYWA 1PVDA 3GT0A 1QQAA 2VPTA 5EXTA 1ZM4A 2ORED 1OH5A 3QHAA 3QF4B 1RZ3A 4TWAA 1YBHA 5A3QA 4RCVA 4RMHA 4JIMA 1MV5A 2C42A 2YVKA 3ZHUA 1Q57A 4DIKA 2RGWA 2RJ3A 1IEQA 3LCMA 1I1OA 4KUEA 3R5JA 3U2QA 2O5CA 3AIIA 2R4TA 4L72A 3LO5A 4E88A 3C7TA 3PXGA 1O9BA 2K87A 3F9CA 5C37A 5HK9A 1TECE 1A2OA 1O77A 4JLUA 4ND1A 1HRDA 3X2EA 3ZUPA 4URXR 3I61A 3UK7A 1A72A 3OZ7A 5JD4A 5COAA 2PAAA 2BY4A 3I2JA 1PI3A 4J90A 4KIUA 2NO1A 3GJ8A 3HBAA 3AM4A 4X95A 3ZBPA 1JBEA 3WYCA 4D8UA 4EQ6A 2PPVA 2ODTX 3WGNA 1QH1B 5F76A 2AC2A 1M1XB 3GPBA 3MLBA 3NTUA 1DMSA 1Y6QA 4Z51A 4OLAA 2MT9A 1W4ZA 2ZDGA 1BJRE 4EEKA 2WF9A 2X8JA 3RTCA 2V7QA 4YLGA 4DRXA 4PAOA 1T0BA 3RS4A 3LFTA 3HK2A 3D2AA 2QUHA 2FSPA 4GVLA 3UWSA 1O6ZA 3SC6A 4XCXA 2HW8A 3OQ6A 4URHA 2XWSA 3WQHA 1P1JA 5DNUA 3HZRA 2PT7A 4NIMA 2ERYA 2CV0A 4XUGB 1YFLA 4PFQA 4YAEA 3OA2A 2CYCA 2QGFA 1PLKA 2R1VB 5FTKA 1E66A 1K97A 1GKYA 2ZATA 2VTVA 3C85A 1Q92A 3PP8A 3B53X 1A9OA 2NXEA 1UPTA 3ID6C 3OCVA 4X7RA 2HXSA 4OI1A 4NH0A 2NUTA 2NTVA 1DOHA 1JNXX 3KIPA 3WK8A 1R3UA 5IVKA 2AG1A 3IV9A 4GX5A 2JBWA 3KPWA 3O8NA 1QTNA 1SQSA 2AFRA 1KJYA 1O94D 3DDOA 3P9XA 4O2RA 2HF8A 4E21A 2IE0A 3VC7A 5JXGA 4IG4A 4F11A 1ENZA 1KJ9A 2Y1OA 1U3FA 3N8GA 4PY2A 3X3HA 2IOQA 3G2OA 1Z62A 2QBYB 3F5QA 5CXQA 5IF9A 4MQFA 2AUTA 1TF2A 1V8BA 1POWA 2JLSA 1JDZA 4MUXA 4MYHA 4UHDA 1Y9DA 3LYLA 3N5CA 5FUBA 2AUNA 4TKUA 1ZMXA 1CLUA 1NNSA 2OLKA 5IJ9A 4A15A 4EHIA 1PNTA 2I6FA 2NSJA 4ND3A 1UFKA 2QRGA 5IFLA 2ECPA 1XTZA 2XV1A 4Z7OB 1XRMA 2ZSEA 1I6WA 1EGQA 3PR3A 4OI2A 1JSRA 2NQ2C 2X9VA 1Z16A 4WZAB 1MZPA 2H08A 1Z3CA 4IJ6A 3ZQ4A 1XD2B 2NSYA 1WCIB 4I81A 1IN1A 3FVTA 2B78A 3MCWA 4I66A 1DEKA 2YW9A 3JD2A 5B7PA 2Q8QA 4OK5A 1OXUA 2P2GA 3L0YA 3OM8A 4FCVA 3HL0A 4Y2SA 1JHZA 1U8FO 1H9CA 3JASA 3QX7A 5I4BA 2OFPA 4WKPA 4X44A 13PKA 3DZJA 1G2OA 3SE7A 2XDAA 3STHA 2R5FA 2Y1EA 3A8TA 1W5SA 4NJEB 3C48A 5HIIA 1M74A 2BFDB 1U28A 3QBEA 4US2R 2PWPA 1LD3A 4PG5A 1Z2CA 3L2OB 5ANRB 2QOEA 3MJFA 5BUZA 3FYHA 4UVHA 4IW3B 3GT7A 1ULSA 2DKNA 1B8NA 4QJ3A 3UMSA 3ZWYA 4QM7A 4YP5A 4MUJA 3IHKA 4XKJA 5FPPA 4BLQA 4EPRA 2PUAA 4WESB 3FYTA 3PS9A 4UXJA 4IFTA 2W11A 4IHQA 2JRCA 4Q4AB 2ZFUA 1PFWA 3C3AA 4GL4A 4AZ3A 1H2BA 5FP0A 1LW6E 3VR4H 2BFOA 1MOZA 2VPWA 3PEFA 5JXHA 3TRHA 3WMRA 5DGIA 1K2VN 3AQIA 1YA4A 3BGSA 3ONVA 3FOAA 4FDVA 3GMDA 2FUNB 2BGGA 2IYWA 4UREA 5KYYA 1JDPA 4Q12A 4H1UA 2HREA 4XDHA 2ZT8A 3HRKA 1Q2XA 4YJ3A 4MHTA 3WWYA 3QEAZ 2WF5A 5ERYA 5T4HA 3A37A 1X15A 5FTMA 3K9QO 1RKXA 3G0GA 3SYTA 4GVPA 4JJAA 3N8NA 3QA9A 3JWPA 1YB5A 5JVDF 4MMZB 1CDZA 1N2CE 3IXQA 3M7IA 5AUPB 3Q3EA 3QXXA 5C7OO 4X90A 1M76A 3QG1A 3ILHA 1DIOB 1S3IA 4JC0A 4JI1B 1L7PA 3O9ZA 3LUHA 5KSPA 1YB4A 5GM1A 3LD9A 2A9VA 2OWEA 4Z0PA 2B0CA 4BO2A 2R66A 4DEXA 5E9WA 2QT9A 5BPHA 2ZYIA 1E5XA 1VECA 3KD3A 5E6RA 3GUYA 1KVRA 2H4JA 3D3KA 4FHEA 2CBZA 1SZPA 5T3UA 4GI5A 5U1PA 3UCEA 4IDAA 4B45A 1GZ4A 1O57A 4J9VA 2EHJA 2TECE 3VJRA 1C7RA 4PO9A 5HEKA 1YQQA 4JBHA 4F72A 3IQEA 3DEHA 4QUBA 3MWYW 1J8DA 4HQLA 4DZZA 4RA6A 3TW4A 1TVMA 3W5JA 1VLMA 4IY1A 1OC2A 3N2IA 4TS9A 1VKOA 4C7KA 3ER6A 1RMTA 2POQX 3CZ4A 3VR5A 4PPNA 4B3BA 1C7ZA 4ZAWA 1EG7A 1Q3TA 2XUJA 2PWBA 3JQ7B 5HKLA 3T52A 3VX3A 1E7QA 3ZWQA 5FLEX 1F5SA 2ZIZA 4A4DA 2VXOA 4NFLA 3I2IA 1MU0A 2DG2A 2R6AA 3I30X 4NWIA 2R2GA 1CSEE 3V7UA 2OFWA 2VBIA 1RXWA 1OYVA 4YCJA 3F7OA 5JALA 1Y82A 1J06A 3M9LA 2BFFB 2WF6A 4AJPA 2OZKA 2VDWB 3MTGA 3OX1A 3RSSA 4F3YA 3I2KA 3IRVA 3DMTC 3B9RA 2R1ZA 2RJNA 3I0ZA 4Y0AA 1DAEA 2OG1A 2X1VA 1C41A 3CZ9A 4NDNE 5DGCA 2XF2A 1YUBA 4OHFA 1N0HA 4NCXA 1RABA 4GZ5A 3SQOA 4EY5A 4BZXA 1KOGA 1VFPA 1U7UA 4GOKA 4WUTA 4BJ1A 1WUYA 2HSEA 2QX8A 2XX3A 4II2A 5BVHA 5K0ZA 2P67A 4IFIA 2ZB2A 3OFNA 1CRPA 1YUMA 3IUYA 1CS0A 1SBNE 4NY1A 4EMBA 3C4QA 3D7MA 3S1AA 2R6CA 2OV2A 2XB9A 3NHWA 4DYDA 4FR5A 4WZBB 2PS9A 2ZUEA 4HYTA 4Y6GB 1BX3A 3PXUA 4FS3A 1R6BX 3RV4A 1XMPA 2BBSA 2VF7A 3LS2A 1R8YA 4NEHB 2XB6A 2ODWA 4B44A 3TTTA 4JBIA 3R3YA 1L4NA 1XZMA 3DZDA 1FDUA 5I9IA 1L5KA 5AK4A 4LKRA 2EQAA 3QLUC 2P6RA 4KX5A 1H05A 1O95C 3HDTA 1EE1A 4JKOA 2FPPB 1Z8DA 3I92A 3KXDA 4K9LA 3JYPA 4LPKA 5TQJA 3LVBA 3O8QA 3EOAI 3HZZA 2RH4A 4Z9AA 3AY0A 3GGCA 2G8NA 4Y3UA 2FP3A 2TMGA 4AMUA 2Q4RA 5KIAA 1CF2O 2MMGA 2AG8A 3QTBA 4U6QA 1VL6A 3E15A 3WRVA 4CQMB 5LUBA 1PQ4A 4P35A 1A98A 1OFUA 2EP5A 4DPLA 3DHEA 1XCMA 3VYWA 4BMOB 5C5CA 1KI9A 1TUEA 2GSDA 2OV4A 2AQKA 1UKBA 1E5LA 1GTL1 5ALGA 4D4LA 1C1DA 4BFWA 3VR3D 4BLPA 4YRKA 3GLFB 4P84A 2Z08A 3Q7SA 1NXVA 4PZEA 1MO6A 1SGWA 5IJ0A 2BEVB 5BNFA 2C8VA 4PZCA 5AM3A 2W4QA 3VU3A 1ZK3A 1D5WA 4J8PA 4BB6A 1WY5A 4GEKA 1YS4A 4XLTA 1P9WA 5CIYA 1XK7A 1KSHA 1VJ5A 1PV2A 2JVIA 4GOND 4Q82A 4X41A 4ZYZA 1IXRC 4R81A 2WJ4A 1SPXA 1YMUA 1Y1PA 4ZO9A 4EJSB 3U0BA 5HFNA 5A5DA 2D2EA 4YXWA 4FE3A 3R7NA 2JI9A 4L7QA 3KWMA 4A92A 5LP6F 3RUEA 1Z17A 2BEUA 3AI7A 1KEVA 1P80A 1W4AA 4PSUA 4D0GA 5FX2A 5CCXA 2QTAA 3MT9A 1T25A 1GA1A 1YB7A 2HA0A 3BF7A 1XXLA 4Z2YA 5AR1A 4N7MA 5M04A 5ARCA 2B99A 2JZOA 3U4HA 2OFFA 1KFKB 3DPIA 4V0LA 4DR1B 2QJTA 4WKBA 4M60A 4DV3B 3AUFA 5LMCA 3N07A 1RE1A 2GRUA 3A7EA 2E4WA 1XDZA 3OZGA 4G8JA 1X7DA 3L8MA 3BXHA 3DTVA 4OMDA 1E1CA 1Q11A 1HOTA 1TQHA 1Z4PX 2SKDA 2QXUA 3L7BA 4NYMQ 1XMXA 4JX8A 4DHEA 2FPGA 2AWOA 4ML3A 4MI3A 3E7FA 1PZHA 3S29A 2ZJBA 5L6LB 1XCBA 3IEMA 2ZPUA 2H1OA 3AVTA 4G6ZA 4Z5XA 1PV4A 3K9BA 2FV8A 4WJZA 5TQ0A 1U3DA 3K70B 3FNIA 2OZLB 4ENQA 3ICOA 2FMKA 4TVBA 3RYHB 2HNAA 4KOAA 3COJA 5CLJA 3LZCA 1LTHR 4RQAA 4U6NA 1NG1A 3RSZA 3BJEA 3VVBA 3NHKA 3I5UA 2W2VA 1SBZA 1S3SA 3AHIA 3QFFA 4R54A 1O4VA 4PBTA 2HV9A 3UH0A 4HVCA 1FU4A 1K5HA 2WMYA 4TM7A 5G3YA 3RBVA 5HDQA 4QQRA 1HR0B 1CR0A 2ROQA 5D85A 4URYR 1ZMBA 3DEKA 1HE1C 1XCLA 2EW8A 4H60A 1FW8A 4UU8A 4TQGA 4PG7A 4QELA 3HXOA 3F1LA 3NR2A 3GGJA 3VU8A 1VXRA 3RUIA 4QQFA 3WA6A 3FPCA 3RWOA 3PDCA 5JD6A 3OJCA 1P9NA 4LI0A 5B4VA 3OY7A 5C7LO 2OCKA 3RSHA 1GWNA 1NR7A 3ZWNA 1ESCA 1DQNA 4G4JA 1VPDA 2DKFA 2GS9A 3ND9A 3FRIA 3D3WA 3HJNA 2YNMD 4XYGA 5AXBA 4INJA 3VISA 1WUHS 5CFOA 1ZCFA 1ZCZA 2X6RA 3MEQA 2I0FA 2WHYA 1GZSA 4GUAA 1MP0A 1YONA 4RGVA 4HEA6 4W7SA 5I9NA 1LQUA 3CUKA 4DB4A 1JEQA 1RWKA 5TX7A 3WGVA 1K6XA 1NMEA 3RTBA 3RLFA 5B4TA 4EB3A 4KMOA 1CB7A 1OVMA 1BGXT 2K2WA 2ZBVA 1XKLA 4O2AB 3WRYC 3QELB 4TMYA 5BMOA 2FW1A 3AHCA 3I04A 3WYDA 4XYLA 4WNCA 2YMQA 3L0IB 4FR2A 4JJFA 5FWYB 2DRIA 1OU0A 2WY2D 4D57A 5LD2C 5EHIA 3WC4A 3UPDA 2WTXA 1CKEA 1QZUA 5DOVA 4K9QA 3LFUA 1B43A 3RVSA 3TIGA 1N2SA 3L82B 4MB2A 3SAJA 1DAGA 4ILEA 3H5WA 4TQ9A 5HP4A 1M3SA 1XFDA 4PWZA 5BQ3A 5K9ZA 3ENVA 2I71A 5KKNB 1JHYA 1ZI8A 2QX9A 4Q9IA 5B57C 3CSSA 4ZC1A 1N92A 1VE3A 5CGQB 2VYNA 1L5NA 1VLJA 3VC1A 1GQRA 1E9RA 3ZDQA 1P75A 2YV3A 3QYFA 4XQ0A 4CMAA 5E0KB 5FPSA 3TPCA 2YHAA 5AFSA 2E4ZA 3DUFB 4FQ5A 3SMQA 2QPTA 4RW0A 3LW7A 4X94A 1LEHA 1Z6GA 3EMKA 1UP7A 4MB6A 3AW9A 5DSXA 4ZK2A 3TG2A 3D6NB 5JECA 4V0ME 4QFMA 3HV0A 2X8AA 4KVFA 2PH1A 2AMJA 2RH8A 5ULLA 2O2XA 5HK8A 1EFUA 1ZIYA 4ZVUA 4FILA 2F4NA 1JEYB 2J5BA 2RGCA 1JWBB 2B1GA 3W6UA 2DWOA 4CM7A 3FUTA 4N1AA 2XZDA 1UBKS 2C9YA 4BKRA 2VZ0A 5C80A 1QF9A 2CXRA 4BEWA 1DX6A 2L19A 1NF9A 2H07A 2ZRMA 4HSGA 5KX5F 3SHVA 3OUUA 3USES 1AMNA 2FDCA 1TKBA 2CE2X 2HDOA 2IY8A 5DWVA 3BL5A 5AHXA 1P7CA 2FPUA 2QUKA 1U2PA 2QRZA 4JVSB 2A5FA 2HJVA 1ITZA 4QEZA 3FPFA 4EW3A 4E33A 5EAIA 1CUDA 2LUOA 2WKRA 3IQHX 4C6TB 4PS0A 1LWNA 1KO4A 1ULTA 4TTTS 2I1LA 1XVAA 3TJZA 2AQ8A 2H7YA 3OEEA 1WXWA 4AY5A 2F8MA 1SVSA 1GL7A 1DSSG 2YJZA 3F97A 3GJ4A 2M1XA 4KFUA 1PDWA 4LYAA 2EEPA 4Q3DA 5GIOE 4HAVA 1OI7A 3CUVA 3OZXA 4WNYA 1SH7A 4BNJA 4Q15A 4U2CA 1NQXA 1SUSA 2IZ7A 2WWGA 3IIEA 5FFFA 4N5DA 1N78A 4TMXA 2JGDB 4UBNA 4RPIA 1E89A 1HLPA 2OGUA 4GGPA 5BN4B 2EW2A 1SNYA 3E5RA 4IEIA 1GCUA 2JA1A 2HSZA 1VE9A 3CHYA 2Q7DA 1PYOA 3QF4A 5DTMA 4DJDC 2ZB8A 5FH9A 3ICWA 5CDGA 3HR8A 1E6MA 3NDJA 4ZVNA 3W7VA 4KZKA 1G9SA 1E4YA 4IWNA 3VV3A 4DC0A 4D5EA 4QYXA 4YQZA 4O3FA 3MLEA 3PRJA 2ODNA 3I9NA 4MP3A 3GJRA 4WV3A 3AUJB 4Q02A 3MSCA 1A2QA 1Q77A 2FX5A 4LDRA 3D6AA 4W99A 2FXVA 1IHOA 2IOHA 3QVMA 4S1NA 1WM1A 5IM4F 2RHJA 2FXIA 4FJ0A 4ZU1X 4ZOQI 4NCBA 1EEHA 5JAUA 3KQHA 1UM9B 2NAPA 3F4LA 4EELA 1T9GR 4OBBA 4UCWA 1XRJA 1KH2A 1S2LA 3BTVA 1KPIA 1QH1A 2A94A 2HF7A 2P40A 2B4RO 3DE6X 2OOSA 3QV2A 4M0PA 2WM2A 3V48A 4A0FA 3GJ7A 5DHRA 2FMTA 1YQGA 3AJRA 3OZRA 2NZYA 4IX9A 1OTHA 4B3TB 2J5XA 3AV0B 2GZRA 2J3HA 1E94E 2KS6A 4EOGA 2Q9UA 2FNAA 1N6RA 2DUNA 4AYXA 2W8BA 2I33A 2KE5A 4CM5A 1ZN7A 2GWRA 1SOVA 1QWOA 1LSJA 4IPTA 3NV9A 1OI2A 3GROA 4FW9A 3EWAA 3ZLUA 4BB9A 1VHLA 2I9PA 1T5TA 1BXZA 3SS9X 1ULHA 3P9PA 5K4GA 1XJ5A 3MC1A 2J09A 3Q2OA 1EINA 3HUFA 2R1VA 2XDQA 4J1TC 5DP2A 4B35A 5IVPA 3K2EA 1DKQA 1I6MA 1M2OB 1R5BA 4DQVA 2ZWIA 3B6ZA 3QWFA 1ADCA 1ZMOA 5JARA 3GLGA 1AGXA 3CEAA 1IPEA 1EUYA 4QGGA 2JRLA 2D62A 4UDXX 2XTMA 3D9QX 1FLDA 4HQFA 2EOAA 5DYNA 4G0NA 1T2UA 4RVHA 3BXEA 5DK6A 3HFSA 3DOEA 1HQCA 2FH5B 3AR6A 4BLUA 5HW0A 1R0KA 2QRKA 4KUHA 1QZTA 4KV9A 4EEXA 1R9GA 3OJXA 3TUZC 1E64A 5JAOA 3K2QA 1ST2A 3I01M 2Q1TA 4E51A 2HX1A 4RJIA 2C31A 1PKXA 1WXXA 1DS6A 4AS3A 3E3LA 3W5AA 2Q3BA 4HX9A 2FUCA 1A88A 4INZA 3GFPA 3U3KA 1X1TA 4OHVA 5DDIP 1GV1A 3OFKA 3NTLA 4J0JA 2G5CA 2OGWA 4JAVC 4DIEA 4RLFA 4RJTA 1S2GA 4E31A 2V54A 1W46A 2WTNA 2RGBA 3W6NA 1D2RA 3ECSA 2M2IA 4WZAA 2D3TA 5ALZA 5EP4A 4Y2JA 1XD2A 4BN4A 4AVYA 2PEYA 3LBIA 5INTA 2Y4OA 3VDMA 3L9WA 4KPUB 1WSAA 3FM9A 4Z1MA 1KNXA 1E7MA 3OURA 3QWIA 1NX6A 1V39A 2GTPA 2P2NA 4CF3A 2X8WA 3T7CA 2CHVA 4HZIA 2PFSA 4XGIA 1J42A 1ESMA 2HQOA 2QN1A 3PGVA 4V3BA 4Y2UA 4A7PA 3PCXA 4E94A 1XDSA 4LRUA 1GVHA 2BFDA 4NJMB 3OQVA 4YMWA 3KFLA 2ZTVA 4DJAA 5KTPA 3IMGA 3EQ6A 3ST7A 4JCCA 1CY7A 3A6JA 1XFAA 3UQZA 1OV4A 2WYWA 3UJAA 2PIDA 1F7UA 5C3UA 1XL0A 2C2GA 1RQGA 3CUEF 4KK4A 4D9GA 1VCMA 3N3AC 3ZHBA 4OIMA 1HT0A 4AMVA 1XALA 3RQSA 4PC3A 4CGYA 3I42A 4GSLA 3ZGOA 1RQPA 4BO1A 5CB4F 4WESA 3V1LA 2PBFA 5A4KA 3M6MD 5AM2A 1EIZA 2XA2A 4EPWA 1JWLA 2DHDA 1G5PA 2Q6IA 1R6UA 3CJQA 4DLAA 2BE9A 2WP0A 4R9NA 4K2HA 2V6MA 4UUAA 4DBZA 4QPCA 1Z82A 5TC4A 5I51A 1HMYA 4KHZA 5F1KA 5HCUA 4AF6A 1JKJB 1F0PA 2O1WA 5K8CA 1A69A 2V3CC 1XD8A 1R6VA 4GU5A 1THGA 1ZG3A 2N47A 1PS9A 3KB8A 3ONFA 3WGHA 1OH6A 4K6OA 3IP7A 3D6MA 3S2FA 4DNFA 3FMPB 1JLHA 3M3HA 4DA4A 5DV9A 1SB8A 4LISA 2EU8A 3H7AA 3DT9A 2BFAA 1RWVA 4AIIA 1CEQA 1XJ0A 1JHPA 1GTZA 2WAAA 2ZPTX 3AKYA 1N2HA 3OOEA 2X6QA 4G8CA 2FVYA 5CDFA 4D56A 3FCYA 5TPZA 4EF5A 4O25A 1TIPA 3O8OA 3B20A 1P1HA 3PC7A 1GJRA 1WHTB 5T7BA 2IYXA 1SBYA 5EUBA 3ZDZB 4C29A 5EJ9A 5LCXA 3WBJA 2WKPA 4M89A 3VNSA 1PZGA 3EAQA 4S05A 2RJOA 4EG6A 4HVAA 4RVSA 1SU7A 4G07A 2WWHA 2XNSA 5EUMA 4AC9A 3NORA 1J99A 1GV0A 2A4MA 3DTYA 4B17A 4EF6A 3YASA 3H1PA 3MOGA 4RORA 2W6PA 1VHQA 4JMPA 1PEYA 4BNLA 5J58A 2WTBA 1J5PA 3GVHA 3WLLA 1BVRA 2PJRA 3WAGA 5EG5A 2JD2A 4RF3A 3VU0A 3KTAB 1WDTA 1HG1A 2PA3A 3CRZA 3NU1A 5KDLA 4EY6A 3UPUA 3M9XA 3WP1B 1HXHA 3JQ7A 2WFLB 1ZA1A 2JCYA 1PFKA 3GEDA 3ICEA 3VR0A 521PA 1IJBA 3HNPA 2I1VB 3A36A 5ALHA 4L02A 4N3CA 3KOMA 4MYSA 1UK7A 1ZJ5A 2BI4A 2FEWB 3BD8A 4JYCA 1NKTA 1WF3A 1KSJA 3EE6A 2WSMA 4ZCSA 4OL9A 1Y3AA 3AR5A 2BFFA 1BHSA 3HXTA 4TXLA 5F33A 2VDWA 3S6JA 2QEQA 1C29B 2IY7A 1ZEJA 2QTVB 3LC7O 1A97A 1BS1A 1OFVA 1T8RA 1WCWA 1RZVA 4Z86A 1TDJA 1EFVB 4FKBA 2G5TA 3OETA 4CMEA 5I7VA 5LIPA 3FHTA 3Q40A 4RKEA 4FONA 3L7OA 3S81A 2X1HA 3DL7A 3THYB 4Q1DA 1Z2NX 4G3XA 4GYKA 5CM8B 3BWVA 3AOEC 5IANA 1KP9A 3L1KA 4HNAB 1QE5A 5JXJA 1RVDA 3BA1A 1L5WA 3EGDB 2Z2KA 1VJCA 1E1DA 1X77A 3BXPA 4WZBA 1GPNA 1H1LA 2OHHA 4EO9A 3O0TA 3MELA 4TMFA 3OKCA 5FO1A 1BS9A 2QG4A 4OHPA 4NENB 1COZA 5H9WA 1XTBA 4GZMA 3KR9A 4FPXA 2FQ1A 1REQA 3ZJTA 2AXQA 1Q7TA 3TLZA 4E4TA 2HC9A 2AC4A 1BKYA 4OVKA 3RUFA 2GPAA 1AO3A 3WZLA 4RTKA 4EUNA 4TXMA 5IMSA 2FPPA 2J7PA 1SUCA 3X0DA 1K92A 4JJ4A 3LLSA 1BE6A 1DO8A 2EWMA 2GAIA 4DR6B 1TO2E 1D6NA 1SO8A 3L43A 3P5SA 3ZZUA 4W5OA 5D87A 1N7IA 3FJOA 1VB3A 4GXNA 4DE5A 3TK1A 1GZ6A 2C77A 3K7EA 4HLQB 1W96A 1KE2A 4ZO7A 1PEAA 3M2PA 5MN5A 2ZANA 4TLAA 1OY1A 4EH1A 4TLLB 3KLBA 2FZGA 1T6NA 3QFSA 4KDFA 1BEUB 4BQSA 1XYVA 2PVCA 1EHYA 1D2AA 1N8TA 1OXXK 4TKMA 1M8JA 3UT5A 3X43A 1PD0A 2PZEA 3FMOB 4CQLB 3GLFA 4NI5A 5E1DA 3ETHA 4BZWA 4Y2XA 2NO4A 1AXGA 2NO6A 4MQMA 4DMUB 3ZJUA 1VHDA 2HLDA 3OQHA 3QBDA 4UD6A 2B1JA 3LW8A 3NP7A 3JPYA 3WJAA 4AO7A 3DEYX 3ESYA 1NR5A 3D8TA 4M36A 5JFOA 2BPOA 1ZICA 2IITA 3A6ZA 3FI9A 1QG2A 5FA8A 1WKBA 1DIAA 1M1YE 1YZNA 1B16A 1B15A 1RYEA 4QNNA 4V24A 3FKQA 3VPSA 4ZJYA 4DDVA 3EVEA 2XBLA 4WCDA 4BX9A 4EJSA 3LUFA 1GPUA 4HQ0A 3UK0A 4IUYA 1EA7A 3VSAA 5HKBA 2P9TA 1K63A 3C8HA 4GZLA 5JBQA 1E59A 1MT0A 4MW0A 4ILKA 2FFAA 3H2BA 2AG6A 4ENWA 4Q48A 3L0BA 2BE7A 2ZBDA 1U9JA 4GR5A 1CCWA 3ORHA 3HU5A 3HWRA 3M4ZA 4JY7A 3PKZA 3U1TA 5I4IA 4K9KA 3KHSA 4AN0A 4BQEA 3FCAA 4O4IF 3VPXA 4QT4A 2AEFA 1K7FB 2BGJA 3PNOA 4IKOA 5ES4B 1SUEA 2BFEA 2JFFA 3WICA 3OHSX 4NEGA 4HEQA 3VO8A 1YFJA 1P73A 1A9PA 4J0FA 3NO4A 5IS2A 2NIPA 2QNBA 1QIDA 3H6GA 4UZFA 4MWSA 4CU5A 1G3QA 5CIWA 4X66B 4YCBA 1ULUA 1ADBA 2NQ8A 1FX0B 3K0BA 1UBSB 1GCGA 1EXVA 2BP7B 3PC8C 1HNNA 4DJ5X 5KQMA 4DR3B 1T8WA 1KQFA 3M5CA 4FHFA 3SZ3A 2HRZA 3L8DA 1E6EA 5JO9A 1LV7A 5AI4A 3QU4A 3TLGB 4XQGA 3JYNA 1KVSA 1UPBA 1YR8A 3BGVA 3HGQA 2OZLA 3K09A 5JOQA 1H8HD 3RYHA 3V8VA 2RKWA 1K6MA 4EJMA 4ERNA 1C0EA 5FJJA 2C4VA 3TAUA 2CMFA 2FDXA 4GMFA 3TX2A 4DAEA 4R1SA 5AJYA 2ZSUA 5DNYB 1JT2A 2EZUA 5DI9A 1JAIA 5LM3A 1JLLB 1FYVA 3T12A 5BV8A 5EP3A 1PR1A 4IP0A 4R0VA 3AB8A 1P5HA 2G1KA 1J90A 3TX6A 3NOXA 2P4QA 4HAXA 1HDOA 3FIJA 1YZKA 2XHZA 4MKRA 1AB5A 3AINA 2VHXA 3QHPA 4NAVA 1PG0A 2WWRA 4J2OA 3ZHCA 1BH2A 1JHVA 4U0JA 4ER3A 2E18A 4RJJA 2PS1A 3WGOA 4C78A 1YQWA 1JIJA 4IJMA 5I8ZA 4CV1A 1TEVA 2ZJYA 4GDMA 3FPKA 1A9XB 2QL9A 1IFXA 2CHFA 2ZR9A 4AIRA 1EX6A 1QGAA 1SHLA 2QTMA 4DMHA 3KWJA 2PG3A 3UGTA 4ROSA 2NU6A 4KDCA 5BQOA 2A58A 1ECFA 3BIWA 1EP9A 1K7YA 3FXAA 3LOQA 3OU6A 4Q4HB 2AEEA 1BW9B 2IZ1A 2OD2A 2Z8YM 2QU8A 1YNSA 1T0HB 5ELMA 4CF6A 2AA3A 3QJYA 1PS0A 2WM3A 5AUNB 3A9WA 1QJCA 3OCXA 5LMUB 4RS4A 3EVZA 1JUDA 1DHRA 2W6JA 2O1EA 2QTWB 2VZ9A 4B73A 3QELA 3JCZA 2JC3A 4LGVA 1GL3A 2ACVA 3HBNA 4QBIA 4HWGA 5BR1A 4MVWA 2YC4C 1O2DA 1W35A 3KWFA 4RA9B 4RETA 4AY4A 1R74A 1ORTA 2QLBA 1H85A 1BQEA 4J0EA 4B81A 4LOKA 1UIRA 2F8TA 5FL7D 4HQKA 5BUCA 3UQYS 1N6HA 1M2NA 4BQPA 1WVIA 5LLDA 2HA6A 4OGFA 5TPWB 1VPVA 2DAPA 1LC3A 2CMDA 4GXRA 1R64A 5ESRA 4ZCLA 2B3DA 4R8LA 1KDYA 1YVEI 3AVQA 4JXZA 4NG4A 4PPFA 1ZSYA 4W6QA 1Y6FA 3RTDA 4EGSA 1YS7A 3R5FA 3DMHA 3DUFA 1YR2A 1NNEA 2OBFA 2C9ZA 3IH5A 3VOBA 4R0MA 1QLHA 2R7AA 4M9RA 2VL7A 5SV2A 1IJFA 2IXDA 5JHGB 1J8YF 4A8TA 5K0SA 1DFGA 2ATIA 4PIMA 1A9TA 1SBQA 4GMGA 3VZDA 2JH3A 3DV0B 1NNI1 1PNRA 3WNCA 4L3OA 2IYZA 3TAXA 2OP0A 1JR3A 5MHTA 2ZYAA 1JSLA 2MSEB 3LNTA 1W85B 3K15A 2ILVA 3RHTA 4FNMA 1APBA 4CMCA 2R8XA 3GJZA 5EMNA 3TXAA 2OD7A 5KO2A 3K0CA 4CMIB 3SXJA 1LVUA 3EWSA 2ATEA 4QOIA 4WZ6A 4CBVA 3QPVA 4CNBA 1RWXA 1WZCA 4JKIA 5FNVB 1EWKA 3TMKA 5AVWA 3HDGA 5AVYA 4YI5A 3FD8A 1Q0TA 3FFBA 2JLBA 4I9UA 3RK1A 4KVGA 1OIVA 3PDUA 1KHTA 2VP4A 4X7BA 4NPAA 5K0JA 3F5DA 4WHMA 2AR0A 4MPPA 1L9XA 2EFDB 4PCAA 5FQNA 4C6TA 5C3MA 4UPDA 1AGNA 1TW2A 1BDIA 3P94A 5EKXA 4ZAFA 2H85A 3WDLA 1VI5A 2NUBA 2QN8A 4QXAA 3TH5A 4RX1A 3MSXA 1TEZA 1NBHA 1ECCA 1QQBA 3KAJA 4MR7B 2X3FA 1WPRA 4BE9A 4ZYUA 1RWMA 1P61B 1XI2A 1ZM2A 3ECAA 4KYIB 4TSKA 2AOXA 3REQB 2Z83A 1F0YA 1N1MA 3PQ8A 4NOJA 4W8GA 4KO1S 3ISJA 1FJGB 1UOQA 3FDFA 3QVLA 2QN2A 2WTMA 4KO2S 1L4BA 5CT5A 1CY2A 1KAHA 1O6FA 2XCOA 1EAYA 1W0KD 5BN4A 1PFUA 1ZGBA 2G77B 5BP7A 3WSVA 4F2DA 2PKYX 1GD1O 4MCHA 1DWOA 1DGQA 4RHUA 1IIBA 4YB8A 4JLPA 4CIYA 2XVYA 2YN2A 3DE2X 3GVXA 2AI3A 3COWA 3N86A 1GEEA 2OCPA 1XLUA 3NI2A 2J0UA 4TTIA 5H4GA 4P0PB 1TEXA 3GDWA 4RKFA 4G5OA 3RV3A 1QG4A 2WV7A 3WYBA 2OCXA 1E0SA 1K6JA 5HMMA 4DBLC 4JS0A 3O4RA 4GNKA 3OCUA 1V7QA 3SQXA 5GGYA 3ZOZA 5JDIA 5JC8A 1PWYE 4X0EA 2JAUA 5KNBD 2O8EB 2X0KA 3KUDA 2P8JA 2CW5A 2JF0A 1JYFA 4ZOBA 1FYEA 5AKZA 3RYIB 3DT6A 1IVYA 2IK8A 2OENG 2JHCA 5JYBA 4PZ0A 5DULA 1G63A 4NJEA 1CHDA 3UUEA 3GL9A 1L8AA 3V2GA 4I3GA 3AERA 2A5DA 3OKAA 1WQ3A 4N48A 2QDXA 4RTQA 1QYXA 2RC6A 1OWLA 1U0FA 4ISBA 2P9HA 3O31A 2CEKA 2CC2A 3IVRA 4HRVA 2JH9A 3F73A 4PHFA 2LIPA 3N58A 1NJ2A 2XMGA 4M4SA 4CM9A 3HEMA 1FS5A 1T24A 1XQVA 1YQUA 2D1RA 3GR6A 3QKIA 4PYQA 3ROTA 4BP9A 2PXXA 1QHSA 4EG3A 1W581 5AI0A 3KXLA 1HKUA 2RB4A 1R0CA 4ZV9A 3BRWD 5CX1B 4K3UA 3I1FA 3L93A 4UFNA 2D6FA 5EJAA 1JFFA 5EJFA 5AJZA 3TQSA 4TV9F 1VKZA 2F3UA 1M2OA 4NATA 2DE0X 4LC1A 1OXKB 4AXXA 2IUSA 1WVMA 2JGFA 3SSMA 4NG5A 5HS4A 3TR5A 3TSYA 2VXBA 3ZLVA 4ZEOA 3MRSA 3M6AA 4M88A 5DIZA 4WY2A 5T41A 1T5DX 5FULA 4JITA 5KYUB 2NAFA 4N76A 3GEIA 1FP7A 2RAFA 4U3JA 1W73A 4XCQA 4YRLA 1KK1A 2Y1DA 4E4RA 2Q9CA 2FYTA 3A06A 3C3KA 4BMPB 4J6EA 3P2OA 3R3WA 2UDPA 4ZI5A 2VQ6A 4X63A 1QOZA 1VLQA 1W2HA 3A58B 5BSGA 5CVEA 3CA8A 1ZOIA 1W4RA 3RFUA 3ZWBA 5SYAA 3CRQA 2W4MA 3SZRA 3UJ3X 3PWKA 4QT0A 5EJEA 1KMNA 2I7VA 5KMGA 4N5MA 1THMA 2HGZA 2NW6A 2H59A 2PD3A 1DUVG 2C1ZA 2PX4A 5KYNA 3B1ZA 1ML4A 1OWMA 4IO0A 3NRJA 3TZKA 5DM60 1TMYA 1LNQA 1RADA 3JX9A 5AICA 1AXEA 2CUKA 4KPUA 1JJ7A 3E4DA 1VLVA 3IDSA 3LWZA 4Q1CA 4YJFA 4JJ8A 2JFNA 2OAGA 3RRBA 1JU4A 1TIKA 2B6NA 5CFMA 1BU8A 4MVJD 2FW0A 4YAKA 4IIJA 3R75A 3P71T 2ZWOA 2AZ4A 2LW7A 4HUQB 1UF9A 1CUJA 2V3WA 3KT0A 3QTLA 4NJMA 4JNKA 5E95A 4UNPA 3BKXA 3IOBA 1CIVA 3L7LA 5TV2A 1RXCA 1BWSA 4H1VA 1IM5A 5AUOB 3DXXA 1SRQA 3CRNA 3PYLA 1ZW6A 1W36C 3EG5A 5AYVA 1M8KA 1Z39A 2R7NA 4YRCA 4H4CA 2VKTA 3U44A 2G9ZA 1T9CA 1X7GA 4EKIA 3AHDA 3HJTA 4YV2A 4W5TA 2I7XA 3O95A 2F1IA 4EY8A 4E2ZA 2YWCA 1Z0DA 5EJGA 3DD1A 1YD7A 3IJ5A 1RQ2A 3D8HA 5HWSA 1X7WB 4MV9A 4QRDA 5BOVA 4X00A 2PGNA 2QRMA 3LQYA 4QOHA 3TKYA 5L51A 2YKGA 3QQPA 3N2KB 1MFZA 3GLQA 3RROA 2FQWA 4UPVA 5IX8A 2WIBA 1KOFA 3NVAA 5L4NA 2VDOB 5JO0A 5KDDA 4IDOA 4BJ3A 2WFZA 1SN7A 2CCJA 3I37X 4UTOA 5EMLA 4Q4DA 3U56A 3R9KA 1ISRA 1BD3A 4JUFA 3ZIUA 2NSLA 1B4DA 2QRVB 3H6HA 1YT5A 2DBYA 4JI5B 3OEHD 1IN7A 1EWYA 3L8HA 4EB6B 5J1SB 1CWUA 1ILWA 2QYSA 2WJHA 3QPCA 221PA 2EP7A 3RM3A 1HM5A 1WHTA 2VYQA 3A28A 3KSZO 3A1DA 3O3NB 1EDBA 3F7NA 3KJFA 1JECA 1ORVA 4GP7A 4P22A 4PX5A 5AKLA 1E2LA 2QI9F 2I3AA 4MGHA 4QULA 4JNCA 5DBOA 3DMRA 3L05A 3KSAC 3LOUA 1LLCA 4ASUA 4DY6A 3DLIA 5CEFA 2WEKA 3RRYA 3IJEB 1NMXA 3HACA 3OEYA 3UICA 4E7PA 5E6SB 4QU0A 3EVFA 4X85A 4DR5B 3RG8A 1X86B 3H04A 4NNJA 3KTAA 4PQEA 4JV5B 1R0XA 1P72A 1BOOA 1ORDA 4IRXA 4PONA 3IESA 4ZQCB 4AKTA 2HH9A 2Q3HA 5JRDS 3AB3A 2WFLA 3NNDA 4HTAA 4UBLA 2QL7A 4Y0NA 2DF8A 3LBNA 3GN1A 4HT3B 2HHAA 2MSCB 4OGKA 2LWIA 2HZ7A 2PLWA 1IOLA 2QP4A 3AWDA 4OH7A 2J3IA 3JVUA 4ZWNA 5H83A 3T5DA 3W6OA 3KM0A 1QIHA 1XRLA 3BD7A 2VT2A 1XHEA 4BMXA 2DM6A 3TE6A 2Z1NA 2QMEA 5GTDA 1T2VA 1IN6A 1XZNA 5ALLA 4KFRA 1DHTA 4XIIA 1P3Y1 1WY7A 2M6KA 1M1ZA 4S3MA 1CUYA 4FSXA 4R6WA 1ZMRA 3UAZA 3PHGA 4OQZA 5KJ1A 3W5DA 1U8ZA 2Z95A 3THYA 5G02A 3CRMA 2OPHA 3HJFA 3ZU6A 3I9LA 3HLKA 3ZDCA 4O8CA 3HFGA 3HO6A 1LFAA 1ADYA 5EXEA 4UD2A 1EWRA 3S2IA 3TD9A 4E5NA 1L8OA 1MZVA 2ZUTA 5JJ5A 2BLNA 2DC1A 3JZIA 4IDQA 1Z0FA 3PDIA 1YQXA 1UKEA 1UDWA 1W49A 1WZEA 3LCCA 2E4UA 4RPHA 2G40A 2GN4A 3PQCA 4FCCA 2P75A 3K5PA 1Z07A 4OYRA 1C7FA 1FXWA 5IPFA 1TVCA 3E18A 1Z7GA 3FCSB 1E2JA 3KBOA 2BDEA 2JKYA 4KR3A 2SNIE 1RHKA 2AJCA 2NU9A 5DO9A 4PINA 3WWCA 3KEOA 5KYXB 3QKWA 2ZBGA 2D7CA 3DHWC 3N7AA 2VH5R 4BMSA 4Z99A 4E5VA 1I36A 1E6LA 4GE0A 5JT1A 4O8ZA 2QZZA 3FGOA 4QUJA 4DHWA 3TG8A 4FYXA 3U1VA 5AVUA 4QWWA 1Q7RA 1XELA 5HUHA 3WO1A 5JBNA 1OR8A 5CA0F 3AEUA 3PE4A 2FI1A 3O47A 5CW2A 4WKNA 4JU8A 2GK3A 3TRDA 2WF7A 5E2BA 1RM3A 1TD1A 1E8DA 1WXQA 2FLKA 3N0RA 2ZCUA 2E37A 5HKKD 1MEEA 1BRTA 3G2IA 5JAIA 5LJIA 1QVVA 3AVPA 4LEIA 1MG0A 3LA6A 3ZW8A 4B4DA 2PHZA 1C30B 3GUHA 4LDJA 1JR6A 3C98A 1PSDA 3AEQB 1W29A 1EH5A 2AK2A 2HNBA 1Z4NA 2H4FA 1HBJA 3A10A 1PG2A 4OQEA 1WZNA 3O74A 1T3ZA 4F4HA 4GPD1 9LDTA 2XNCA 2HWUA 1XA3A 4KLCA 2OY0A 5FFMA 1FBNA 1I2BA 1NATA 4M76B 5EKUA 4D8WA 1F8YA 4DY4A 3KNZA 3VC2A 4EAAA 4CV3A 3IQZA 4ZT3A 2O7VA 2QRNA 4DLYA 3GRCA 3EIXA 1NW4A 4WCFB 5B55A 4H7EA 3Q8WA 3MJEA 3I9V1 2DSNA 1RZUA 5C35A 5I9BA 1JPNA 3SCZA 2GXAA 2I6XA 3HCBA 1Y6RA 3U4QB 2XMSA 3PXBA 2JFPA 1QIIA 1HSOA 3SJBA 3SZGA 1QYDA 3LVQE 4NABA 3BCSA 1A4XA 3B48A 2NTJA 1RE0A 3EG9A 3KVVA 3LFHA 4ZRMA 3U4IA 5KJCA 4PSAA 5T4EA 4DWWA 1QG6A 4XX1A 1A7KA 4N01A 2KJQA 2OYSA 1XN4A 3IVGA 4XYMA 1UBRS 3IKLA 2W00A 1I4EB 1FX0A 1W5EA 4PO3X 3AL3A 4KBFA 5EPOA 4QBGB 2BP7A 4MRAA 4US1R 1TOAA 2HHCA 5ALYA 4NBKA 2VUHB 4L9RA 3ZNOA 3B51X 1BROA 5IKXA 4W5NA 4C4XA 1TA9A 1KF0A 1W52X 3PD1A 3TLGA 1OTXA 3W2GA 1VIMA 2ERCA 3FNBA 1I2AA 4UNSA 1I5EA 3NFRA 3HB4X 3R4VA 1X9IA 2D0IA 2JIMA 4FHCA 1I24A 1J0CA 1X74A 1G7TA 4FB5A 4E6PA 1TIBA 5FI1B 1ECBA 1D7OA 3LP5A 3DO8A 3PNKA 4E1BA 2XVAA 3URMA 5JI3E 3S0JA 2UXCB 1DCMA 2PKQO 1JLLA 4GXQA 5IHPA 3R0JA 3AJAA 4CNQA 1UBMS 2XD4A 3LBFA 1FPQA 1N3IA 3RHFA 4C87A 1UFRA 2I4NA 2VOJA 3ZVKA 2BJVA 1OZ0A 1Z25A 1M8PA 1Z5VA 2F43B 2FPIB 3DXZA 3HA5A 1XYYA 3LL4A 4YIHA 3D59A 1Y8ZA 4YO7A 3CO5A 2FHPA 3IAUA 2QGNA 3DT8A 1P6QA 4ZVOA 3BXXA 1E98A 3VSEA 1SQ6A 2YHBA 3O4GA 1OWOA 2Z9DA 5KB3A 1X9GA 1KERA 5K0CA 3RIYA 4OQMA 4UVIA 1GU1A 4ATNA 2XUGA 1A9XA 1I3OA 1Y34E 3EIUA 4OOFA 4H35A 3A70A 5TY0A 3W3AD 2A84A 3GQBA 1PW7A 3AHHA 3ROPA 2WC1A 3I0NA 5WRFA 5BNTA 1OHHD 2FRXA 3FTPA 4IKPA 4IAOA 1JBKA 3ZHTA 3J7AC 1V6AA 5F3RA 1IHDA 1BW9A 1CJVC 2VYVD 5COQA 1AS0A 3ZZTA 5P8WA 2OKCA 1ZA2A 4O4JB 1AUVA 5JMOA 1RJWA 4QGSA 4DCNA 3I9V6 4PSVA 4GE3A 3LC2O 3H1BA 3LX5A 4HDQB 2OQIA 1SB9A 4D8YA 5AKJA 2VK8A 1C3LA 1T1IA 1GG8A 4YECA 3WLEA 4YRIA 4YS6A 3NHPA 4BNGA 1V6CA 3DZFA 2A0FA 5THQA 1KZ1A 3GLGE 1RJ9B 3PNPA 2XKKA 3EPRA 3HDHA 3UM9A 2LP4Y 2NG1A 2L82A 2D5CA 4HN2A 1LSSA 1ZJWA 4XOIA 3DMDA 3C6QA 1SHJA 4B4OA 2CDRA 3VR2D 4UCXA 5TPWA 1M0TA 1G21E 2VR1A 1P5ZB 5DU2A 3TLBA 5CFRA 1Q1NA 4M86A 3OHPA 4HG2A 2FLVA 1F9AA 2NU7A 3KAKA 3PQ3A 3WXMA 1G3UA 4M83A 1VZ3A 2HL6A 3B6JA 4OQLA 4UTRA 1V9SA 1RLUA 4KGDA 4R2KA 4JT4A 1Z37A 3A9RA 1E2QA 3E8MA 4NDZA 4P93A 5AKHA 4QKQA 5C32A 4C7XA 5DI3B 4XIJA 5HJ7A 2ZPAA 3BMXA 3T5MA 2NXWA 2W6NA 4G1VA 4ENPA 1DELA 1MB4A 2J0VA 2AR9A 3LOPA 3EW9A 5C18A 4RVGA 2JJYA 4KV7A 3H19A 1T8PA 1UC5B 2XYGA 3OTWA 2P65A 3DV0A 3OKPA 4MHOA 4O63O 5EERA 1WE2A 2XB8A 1F9EA 4CDRA 4P5DA 3HBMA 2P6MA 4XDGA 5LL6P 3MINA 4MQEA 1EX7A 3FHCB 3KDPA 2QTGA 4ID9A 3B5IA 4GRAA 1X39A 4RJKA 1T29A 1XF9A 2CJFA 4CU2A 4PZDA 4YCLA 4G81A 2IXFA 4BPBA 1ZNXA 3EVGA 3N6VA 1DBPA 2N46A 3AONB 4M9UA 3RTGA 2J3EA 4ZCRA 4OXIA 2A7XA 3WGUA 4CM4A 1TB4A 3P9SA 3NDBB 2COEA 4KR0A 2AYXA 4XQEA 1RKBA 5FNVA 3ZNNA 3EMBA 3AV3A 2LKDA 2BKEA 4UC0A 1ONBA 2V59A 3IA7A 1BWQA 3FETA 4HF7A 4OI4A 4WADA 2ZB7A 4M7PA 2ONYA 4L5JA 3L7AA 1R88A 3DKPA 3CKKA 3OBBA 1PJLA 1E1QD 5B2FA 4FYWA 1C9DB 2Q49A 1WXFA 3GELA 3A1EA 4KSBA 4XSHA 4QVGA 621PA 1R6TA 1OX5A 4PCVA 1XVUA 4GWGA 2ZRCA 4B8WA 5KEIA 5KOYA 2VATA 2WKSA 2XR1A 3AHEA 5JS8A 4MR7A 3QFRA 4IMRA 1FFBA 3P8ZA 1H93A 3WKCA 4BWFB 1GGFA 2O48X 4BVLA 1N2OA 2B0JA 2YUTA 3N59A 4UVGA 4W5QA 3FB1A 2C5BA 1N0VC 3HADA 1T9GS 5L3SB 2UZ4A 9LDBA 2CMKA 1LBHA 2B4YA 1RQ7A 2IYRA 2PD6A 3WTBA 2RD2A 4LJ5A 1YZVA 4N40A 4W6ZA 2OXFA 1C50A 3V1NA 1QZZA 3FF1A 4ZC8A 3W8FA 4B85A 4EB0A 4J49A 4OP1A 3FSRA 4JUDX 1PGNA 2PWAA 4X3PA 2A3NA 1C3OB 2YCLA 1VHWA 3BIXA 3ZC3A 4KJZA 5AKYA 3T9CA 4D8XA 4G56A 4MQLA 5AP9A 1L7AA 3GAAA 2H5JA 3STVA 3N70A 4DV4B 2I76A 2Y93A 3PR2B 4WGFA 2ZWPA 3I83A 5CD9A 1V4NA 4O4HA 3NS7A 1H6CA 3MXOA 4RK4A 1HYBA 3KE8A 2WVHA 3T1OA 2C4TA 2O8EA 2VOEA 4AY2A 3EMDA 5B1IA 4MLDA 3RYIA 3TQFA 3IEUA 1QHYA 4P3NA 5KTOA 2FZWA 4DG8A 5FUMA 4BGUA 4ZHQB 3L8ZA 1UKZA 3I6MA 3U26A 1PQWA 3VOAA 2X0IA 3KKZA 2GXSA 2IU0A 1KDVA 4XJTA 5BO5A 2PZKA 3K8YA 1FUIA 4CTOA 4KN9S 2NVUA 1EP2B 1XTRA 2PEZA 1S1CA 3CCFA 3H1AA 3KQPA 3N2LA 3TD2A 4EFLA 1EVIA 3N5KA 4KQ9A 1LI5A 2VNAA 3DVSX 3GFVA 3QGMA 4Q3EA 4N47A 4HNTA 1Y3IA 4CWAA 2IHKA 1R27A 1E1MA 5DX0A 1QGUB 4WLEA 1U2ZA 1JQAA 1Z35A 3GWGA 4ZT2A 1VXOA 1K4MA 4URVR 4QA9A 5JAZA 3PA8A 4RF2A 5CX1A 3ZVNA 5DXFA 1X70A 1G20B 3VR3A 1ZUWA 2VRNA 1R0SA 1JRLA 3G2PA 2WABA 3BSYA 1CNMA 2WG2A 1YB6A 3PIRA 4N9QA 3SZOA 1WKVA 2C84A 4BEBA 3OE5A 1ZR2A 1LI7A 1QU3A 1GU7A 1R0YA 2OV3A 3JALB 1NN5A 1C1YA 3JZMA 2QQ5A 4OUKX 1JQBA 5IBRA 4BRWA 3DCJA 4Y1GA 1JDSA 3VXKA 1GAEO 2DWPA 2XNKA 3GMTA 4J91A 4MAAA 3THOA 5AJWA 4N8SA 1CDDA 1ZH8A 5I7HA 3LPDA 2R62A 2RARA 3IE2A 5KYUA 1X1SA 2CLCX 3IP5A 3EPPA 3MA0A 2ZJ3A 1QF6A 2O8NA 4G5YA 3SI7A 1GCIA 2OB1A 3G02A 3GJYA 3T1QA 4FWTA 5LOVF 3B12A 1XTQA 1M8GA 2I54A 3WYEA 1SQFA 1Q16A 3AZOA 3C6XA 3IURA 3BB4A 4G5HA 1SEPA 4LY9A 4NU6A 2A1IA 4X45A 4LJ9A 2HDHA 1J39A 1SUIA 4YFYA 1RM0A 2Z98A 3EC2A 1WUJS 4NK4A 4EHJA 4EVSA 4U9UA 2JLUA 1PCXA 3THRA 5JQWA 1FP2A 1KP3A 2HU8A 3L1VA 1OX4B 1N5JA 2HIAA 3MQ2A 3Q5GA 5IVDA 4ZMRA 1ZUNB 3HWSA 3MK31 4MS3B 3G2QA 1DOZA 3BD9A 5KI6A 3CVVA 3LM8A 1BU5A 1DV2A 2N1MA 4GX0A 4XVUA 3K8ZA 5K8LA 2Y77A 1Z36A 2WYUA 1P5FA 5BSHA 3JATA 1ZM7A 3OJWA 2W2LA 4M0KA 3U48A 4UM5A 1CQZA 1XAGA 1Y1LA 2RH5A 2PQMA 2Y8EA 4HPWA 4RHTA 1B6RA 2QT0A 1J5XA 3BWBA 4LNUB 5IN4A 5DW0A 2I2DA 3ZVLA 4CCWA 2JEOA 4FOLA 4MVYA 1B1CA 4NYJR 1M5TA 1OSNA 3ZYCA 4ZDJA 4JJIA 2FGKA 3Q3JB 4KPFC 3S40A 4QTTB 1NSFA 4CW7A 4OXNA 2VYFA 1DMRA 4ZCIA 3MWEB 2IL1A 4W5RA 1J5EB 3PDHA 3ZQUA 3AH8A 3A6DA 3KL4A 4DM4A 2ZUFA 1NUPA 2VTKA 4O4LB 4ZTBA 2X7XA 3TLEA 1NZFA 3C8UA 1KBOA 1OTYA 2OBMA 1N3LA 2X5OA 3ETEA 3VBCA 2D2VA 3NDIA 1DDGA 5C53B 3UJHA 1V5FA 1WPGA 2ACEA 5BQ5A 1X7WA 2CN1A 2WT4A 1E2EA 3UJNA 1QRSA 4R1OA 1XEXB 3EZ2A 3UAGA 2F67A 3HM9A 3EZFA 2P27A 4FIZA 4C20A 3N2KA 2LDBA 3A9TA 1RJDA 3IERA 1DBSA 3KQOA 5K4AA 1YIAA 3ZDXB 4DA6A 5JR3A 4HNUA 2R9VA 1WCYA 1PFQA 1YZFA 2YZ2A 2PFGA 4KQJA 3WP0A 3H0CA 4JLWA 2BONA 2RG7A 2VJLA 1OVGA 3BZBA 2W6IA 2E4VA 3NTQA 3NBFA 3OSUA 4HQNA 5HIMA 3UMMA 1B0UA 3IT1A 5FPYA 1Z7WA 2PGXA 3CTMA 4G41A 4XB1A 2HU7A 5AJHA 4EG7A 2QRVA 1BGWA 4HHEA 2LNDA 2WSLA 3ORQA 1GITA 4GSKA 1YL5A 1Z6YA 4O5OA 1NVUQ 2O6LA 5LZ7A 3K53A 4Q3NA 3SQMA 1FMLA 1RCTE 1YC5A 3U39A 3MAJA 4M8NE 4MINA 4R8MA 3PNYA 1IHXA 1MORA 4RM2A 1MLDA 1GHTA 3R3SA 3KV1A 2R1UA 4XJVA 3KEFA 3PHCA 3NUGA 1T3SA 4FBMA 1Z68A 4D0RA 1TRKA 2GKGA 2Y2UA 2O3QA 3FNQA 1BXKA 3UJ7A 3KWLA 4X1YA 4H18A 4LJ4A 3AWIA 2H3EA 2HK7A 4L3VA 1ZYUA 2XODA 4MW7A 2R1TB 3GBPA 3WKAA 3JVDA 4NCNA 5K0EA 1OZGA 3PQ7A 3UCXA 4ZANA 3D5TA 4UFOA 4MV5A 1MGOA 3GUVA 1Z4IA 4URZR 3ONDA 1L5RA 2UVPB 1MRZA 3DEJA 1S6YA 3OI7A 3RAPR 3GEMA 3OLQA 5LQUA 3ZOKA 4AL4A 4MW4A 4GOLD 4ZQEA 2OAQ1 4XCVA 4GSYA 5E9JA 2VK4A 2ADMA 3DCNA 1CF9A 3OFSA 4NE2A 3FSGD 5G1PA 8MHTA 3CBQA 3VZBA 5IASA 4M7RA 5C1DA 4C03A 1AV6A 4P81A 2TRSB 3WLMA 2EZ4A 5AD1A 2FY8A 5EIFA 3TUJC 3NWPA 3MG9A 4FOOA 4J16A 4K6GA 1ISIA 1EUCB 1MJNA 5D5HA 1IWOA 3FJ1A 3OPQA 2J3DA 5TJ9A 4BAUA 2R8ZA 1RWOA 4LBWA 5AW9A 2VNHA 4TVKA 2VXCA 2EL9A 5LQRA 4EWLA 1K68A 2VN8A 2G71A 1QX3A 4RTNA 4I50B 1IOZA 1ZU5A 1GQQA 2XTZA 3F78A 7ADHA 3SFVA 3QITA 3QJ5A 3NHAA 1HE3A 1ORIA 3TLCA 4LXXA 3IA2A 3SYNA 1U9ZA 1VGQA 4HWPA 2V5UA 5B3JA 4CGZA 2FPMA 2V0GA 3M1YA 4FOSA 3KOWA 1W6UA 2VSXA 3TJRA 3EJWA 1GRVA 1ZIPA 4HWRA 3L1HA 1AE1A 2ZUDA 1TMKA 3HU3A 3NNNA 3OFVA 2NO9A 5HE9A 3K8OE 1C1XA 1HYHA 3DF9A 2WAOA 3RI3A 2GBLC 2YWFA 3BL6A 3I8XA 4B0OA 4XWGA 1T9BA 4R2JA 3KZOA 2FEPA 3IV6A 3QBVA