3HVIA

Rat catechol o-methyltransferase in complex with a catechol-type, n6-ethyladenine-containing bisubstrate inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
213
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Molecular recognition at the active site of catechol-o-methyltransferase: energetically favorable replacement of a water molecule imported by a bisubstrate inhibitor.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 82
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hviA00
5CVUA 2B3TA 1KPHA 3NTVA 5EIWA 1R18A 5FULA 1G6Q1 2I62A 3I53A 2EG5A 5KS2A 5EMLA 4BLWA 3GRYA 1DL5A 3P97A 3FUTA 4Y30A 4A6EA 5E1OA 5ICGA 3TPZA 1F38A 3DMHA 1D2GA 4GQBA 3FRHA 1BC5A 2FCAA 4AX8A 3OU6A 4HGYA 1NW6A 1F3LA 4GOND 3BWCA 3GRVA 5HIKA 3PX3A 3UJAA 2ZULA 2BM8A 2VS1A 2IPXA 5EKXA 4IWNA 1JQDA 3GDHA 1VPTA 2PT6A 5EZSA 3TLJA 3MCZA 4AZSA 5E9WA 1NBIA 2AOTB 4EQZA 4HG2A 4KW7A 3AWIA 3FTCA 2IP2A 3DULA 1PJZA 2OY0A 7MHTA 3JWHA 2P8JA 5DSXA 3KQPA 3C6MA 3OE5A 4P7JA 3SSNA 3LBYA 4GOMD 5C1IA 3SGLA 4ER7A 5JUWA 1G55A 3FYCA 4OBWA 4GUAA 4JXJA 2ZVJA 3ANXA 3AY0A 5DWQA 4BLVA 4PYQA 1Z3CA 3ORHA 4GOLD 2EJTA 3OCJA 3QV2A 2PX8A 5EEGA 5K0NA 1QAOA 5E1DA 3HCBA 3A26A 3FUVA 3GRRA 2P3QA 2BR3A 1L1EA 1XTPA 4QPNA 3CKKA 1ZG3A 3CGGA 3KR2A 3A4TA 3P2KA 5K03A 4DQ0A 3HA3A 3R9XB 1RI4A 2IIPA 2YXLA 4RV9A 3VYWA 4MHTA 4FSDA 4PIMA 3NWEA 3EEOA 2G71A 2IFTA 2PXAA 4RX1A 4PYLA 4RTRA 2B25A 3G2MA 3P2IA 5EGSA 4YMHA 5HOQA 2XVAA 1QAMA 1AQJA 3UJ6A 3M6VA 4ER5A 3P9CA 1XXLA 1RJFA 1UIRA 4KDCA 4RTQA 3PB3A 3UFBA 2PJDA 1KHHA 1RI1A 5DPMA 1KPIA 3L8DA 1MHTA 4RTPA 3MERA 3DXYA 4YV0A 3E8SA 5LQCA 4GBED 3KU1A 1VL5A 5BW4A 5FWAA 1AQIA 1VIDA 2A14A 3G88A 1ZGAA 4F85A 2C7PA 5C0OE 4YUXA 1RI2A 1NW7A 3I64A 1QAQA 2O07A 3FPJA 5FTWA 5P8WA 3EVDA 1X1BA 4OA8A 2OXTA 4R6WA 4FP9A 3GGDA 2XVMA 3RW9A 4HC4A 4BLUA 1M0EA 3FTFA 2GPYA 3G5TA 5K0FA 2IH2A 1O9HA 3BGVA 4RTOA 3DMGA 2NXNA 3PVCA 2BR4A 2AOXA 1RJGA 3HCCA 3LDUA 4QQKA 5EC8A 3TM5A 5EHIA 1NW3A 3R24A 1PRYA 2P41A 4YUVA 2CL5A 2OO3A 3KHKA 1VE3A 3G2QA 3RIEA 5LQUA 3KKZA 3ELUA 4M38A 1TW2A 1MJFA 3M6UA 4XUEA 3OFKA 4GOOD 4CWAA 1ZGJA 5MHTA 3NW9A 3CC8A 5HEKA 1BHJA 3Q87B 3MTEA 5EPEA 2VZ9A 3BUSA 5GM1A 5EZQA 2JH8A 3E05A 5E8JA 3PLAE 2AOTA 2UZ4A 3UJ9A 3IYLW 2YXDA 3EVFA 4Y2HA 2XYVA 4EK9A 5LQAA 3FYDA 3KPJA 4E32A 3MQ2A 4ISCA 4EKGA 3HVJA 2ZIEA 5KVAA 2F8LA 4PIPA 3SSOA 4YUWA 2CMGA 1JSXA 4WXHA 3T7RA 1XJ5A 4E2XA 1WS6A 1BOOA 1KR5A 4LG1A 5DX8A 4FT4A 1JQ3A 3DR5A 3MAGA 3GCZA 5DM2A 5DSTA 5F2KA 3JWGA 4UOEA 4CTKA 3SSMA 5K09A 4H0NA 4P7KA 5HFJA 5DRTA 2ZZNA 1YUBA 1ORIA 2PWYA 4X63A 3JWIA 3NMUF 1D2HA 2Z6AA 1L3BA 5FCDA 5KYGA 3UA3A 3SMQA 3DMFA 3LCCA 2NNWB 2YX1A 3LECA 3P71T 4POOA 4NECA 2BM9A 2V7EA 5C9ZA 5DXAA 4R05A 5GINE 2HWKA 3NJRA 1RJEA 2GLUA 4V0QA 5K8VA 2OB2A 3GJYA 5LQJA 1AV6A 4AZTA 3KQOA 1HMYA 4GC9A 3OZRA 3FPFA 3V8VA 4X60A 4FT2A 3LGAA 3KPWA 1I9GA 2O57A 1R8YA 4F84A 2ZW9A 2JJQA 2ZIGA 3EGEA 4CKBA 4GEKA 2DPMA 2PXXA 3DXZA 3LSTA 4RVDA 3O4FA 5U4XA 4DZRA 5K01A 2HR1A 4KRGA 2ZSUA 2JG3A 3CJQA 2ZZMA 3B3GA 4PGGA 3CJRA 4OA5A 3BKXA 3FPEA 3HEMA 10MHA 3B7PA 2UYOA 1KXZA 3MCTA 2B9EA 2Q41A 4KVZA 3A25A 1SQGA 4P7FA 2P7HA 5FHRA 3TR6A 1M6YA 4ER0A 3KR0A 5GWXA 1VQ1A 1D2CA 5ERGB 1INLA 1XDUA 8MHTA 1I4WA 4QTTB 1SKMA 5ICFA 4RSRA 4OQDA 2VP3A 1QZZA 3UBTA 2ZWVA 2YUIA 2FRXA 3I58A 4X61A 3REOA 1EG2A 3KR9A 3P9IA 2PX5A 4P58A 2O0LA 3DOUA 3M6XA 1KPGA 1G8SA 4MIKA 5DTRA 5E9QA 1JTEA 3HTXA 1P1CA 5DLYA 3UZUA 3DLCA 3DP7A 2YTZA 5K0EA 1WG8A 3G7UA 2G72A 3KQSA 1KYWA 3GNLA 2NXCA 1VLMA 5CVVA 2H00A 1IM8A 4MWZA 2JHAA 3CBGA 4CKEA 5FQNA 4XCXA 2C7OA 1NT2A 3C0KA 1QANA 2E5WA 2IH5A 3OFJA 3E23A 2GS9A 1FPQA 3LPMA 2AR0A 3NDIA 3BGDA 5B1SA 3B89A 5LQRA 3IEIA 2IH4A 2ZFUA 3PT9A 1JSZA 3KPUA 2XYQA 4R6XA 4X1OA 3HNRA 3OU7A 3UJBA 4K6MA 5K0CA 3FTEA 3I9FA 1XCLA 2PX2A 2QRVA 3GU3A 1L3IA 4QDKA 4DM3A 3H2BA 3KQTA 3P9NA 1X1DA 3SX0A 3T7SA 4RYLA 4RTNA 5EMJA 3EVGA 2O05A 5HIJA 4HSGA 3NVKI 2ZZKA 4IV0A 3AXSA 2ZLBA 3M33A 1V39A 2I7CA 5DT2A 4PYIA 2FK7A 3AJDA 5EIFA 2ZIFA 3KQVA 3FUWA 1ORHA 3IHTA 2GH1A 3V97A 3EGVA 2ZBQA 5DX1A 2YVLA 2BH2A 1O9GA 2YR0A 4QQNA 3JWJA 2G1PA 4PYNA 4BP1A 3TFWA 3ERCA 2N47A 1AF7A 1NV9A 2AZTA 2CWWA 4HRAA 3LKZA 4MTLA 2DULA 4F86A 1HNNA 1JG1A 2QY6A 3HM2A 3RODA 1R00A 1G8AA 3UJCA 2EFJA 3K6RA 4FZVA 5F2OA 5DM0A 3LBFA 3VC2A 2Y1WA 3A27A 4C4AA 3P9KA 3CCFA 1YB2A 1BKYA 3BWMA 4CXMA 2WA1A 1WXWA 3G5LA 5E1MA 2OPBA 1JG2A 4HTFB 4CTJA 3R6TA 4RTSA 2AS0A 4RTKA 3HA7A 5JR3A 4YV2A 4E30A 1G38A 3R0QA 2LD4A 4P7GA 2WA2A 3TM4A 2AOWA 1WZNA 3LX6A 1N2XA 3BXOA 3HCFA 2HV9A 4R8RA 5DM4A 3PX2A 3OPNA 4M7RA 1KYZA 4RVHA 5BW5A 3FZGA 2UYHA 4YUYA 1FP1D 3C6KA 4FGZA 3HA5A 3MTIA 4PWYA 2H1RA 4DMGA 4AZVA 1EQAA 2AN3A 3E7PA 3ELDA 4DKJA 1FJXA 3K0BA 1L3CA 5DTMA 4DA4A 5BXYA 2G8NA 2P35A 2QRVB 5K0LA 2VDWA 3VC1A 2AN4A 4E2ZA 5LR6A 2PGXA 2Z6UA 4LECA 3TRKA 2KW5A 3HVKA 3GIWA 5IH3A 2ADMA 5F2NA 4AUKA 2ONYA 1R8XA 1X19A 4PCLA 2PY6A 3OU2A 5CUQA 2JHPA 2IDKA 1I1NA 1YZHA 1Q0TA 3ELWA 2NP7A 3NDJA 4DCMA 1NBHA 2ZWAA 3GWZA 3I5UA 1L9KA 2CKDA 2FK8A 3EGIA 1T43A 4QVKA 2BR5A 4FR0A 4C07A 2NXEA 1RI3A 3C3YA 3TOSA 4DCGA 1JG3A 5KQSA 3OE4A 1VP9A 3QOXA 5GP1A 2GB4A 2QYOA 4QVGA 3GXOA 3TKAA 4ATNA 1YFLA 4V0RA 3VSEA 3O31A 3LKDA 1UWVA 5E1BA 1G60A 4RWZA 3DUWA 4LWPA 3KQQA 5K05A 2YQZA 2CMHA 3B3JA 3BWYA 2ESRA 5E2BA 1EAMA 1IXKA 2IDJA 4M36A 3GRZA 5E8RA 4EVIA 5LQNA 2PSSA 2K4MA 3HCEA 3M4XA 3SXJA 2UYCA 4E33A 3BKWA 1NW8A 5FQOA 4CKCA 2AOUB 1P91A 4PNEA 1SUSA 3KQWA 4WVLA 3OZTA 4ER3A 3D2LA 3EEYA 3P8ZA 2NXJA 5CIYA 3GRUA 2PLWA 1EIZA 3DTNA 1YFJA 3G8AA 1VP3A 1X1CA 4L7VA 3FUXA 3SR4A 4PYMA 4C05A 3ME5A 3DLIA 2Y1XA 4FS8A 4YUZA 4O29A 2P3LA 4M37A 4BY9E 1N7IA 1FBNA 4MQ4A 2FYTA 4HTFA 1R6AA 3X0DA 3B5IA 5FA5A 4C08A 2I6GA 3M6WA 3G2PA 4QTUB 1O54A 2OBFA 4KDRA 3G89A 1XVAA 3BZBA 2IGTA 2PV0A 4IV8A 1SUIA 2ERCA 3EVZA 1P39A 2VDVE 4YV1A 5M5BA 4ZTBA 5K0JA 2R3SA 1QYRA 5EKUA 1XCJA 2PBFA 3LDFA 5G02A 2ONZA 2ZCJA 3LCUA 1EJ0A 3CVOA 4HH4A 3U81A 3THSA 1ZQ9A 3EVBA 3QOWA 2JHCA 3FPHA 4RVFA 3TMAA 5GIOE 1KIAA 4U7TB 4RTJA 2I9KA 2XBMA 5CCXA 2JH9A 4PYJA 5HZMA 4RVGA 5DM1A 3UJDA 4EKIA 3ELYA 3KPYA 1Q0SA 5EHGA 2IBTA 5IKMA 5HIMA 2AVNA 3UJ7A 3FPGA 2P3OA 4PYOA 5FUBA 2EX4A 3EMDA 2WK1A 1XDZA 3A7DA 5HILA 4A6DA 2PKWA 2PX4A 3LL7A 3EVEA 4AZWA 5CD1A 2FPOA 1YZ3A 2PXCA 2P40A 2R6ZA 3IV6A 3BWBA 3Q7EA 3G8BA 5HIIA 4KWCA 1Y8CA 2C7QA 4E31A 5CM2Z 4U7PB 1ZKDA 1UFKA 3EMBA 2G70A 2V74B 3PFHA 3TQSA 3ER9A 1JG4A 4KIGA 3KR1A 2QE6A 4DF3A 5CCBA 2C7RA 1JR4A 2O06A 5EQJB 3UJ8A 2ZTHA 5CVEA 3MB5A 4C06A 2GA9A 5GIPE 4RTLA 4RTMA 1SG9A 4PCAA 4E70A 2B78A 2H11A 2OKCA 2P7IA 5K0GA 3BT7A 5GM2A 2VDUE 4PYKA 5EMMA 2AOUA 2GAFA 4IKPA 4E2WA 4B17A 4QPPA 5D1NA 1SVUA 1RJDA 1DCTA 5CVDA 3DH0A 5D1HA 3PFGA 1JQEA 1X1AA 3GO4A 2PWPA 4R8SA 3KQMA 3UWPA 5EMKA 2Z6QA 3FUUA 3EPPA 4GC5A 3LDGA 3LCVB 3C3PA 5DTQA 1NV8A 5EVJA 3OZSA 4E2YA 1TW3A 5T67A 5DRYA 4HGZA 4BP3A 1YF3A 4KIFA 4Z2YA 2IBSA 4EMSA 3T0IA 5FHQA 1M6EX 1H1DA 3LHDA 3FRIA 3P2EA 5ICEA 5EG5A 3HCDA 2NP6A 2ZBPA 3UA4A 3O7WA 5LQKA 3KPVA 4PGHA 5BP7A 1RI5A 5EEHA 3WSTA 3SVZA 2NYUA 3KQYA 4PONA 2BZGA 4YMGA 4C03A 5KQRA 3THRA 1B42A 1ZHFA 5T64A 3BGIA 2AN5A 2ORED 5LSAA 1R74A 5ICCA 1FP2A 2AOVA 2B2CA 2UYQA 3FTDA 3G2OA 5DXJA 5E9JA 2OZVA 3DXXA 2PT9A 3M70A 2OYRA 3CJTA 1DUSA 2OB1A 1NE2A 1TPYA 4G56A 4OQEA 4C04A 3AXTA 3TKYA 5EOVA 1XDSA 2ZBRA 3HP7A 3SM3A 2FHPA 1EJ6A 4OBXA 1WXXA 1JTFA 1OR8A 3MHTA 3EVCA 2HTEA 1VBFA 2PVCA 3ID6C 1NKVA 4LWOA 9MHTA 4OX9Y 1NW5A 3F4KA 3HVIA 4XUDA 5E2AA 2HNKA 2QM3A 4GF5A 3PTAA 4PINA 5FA8A 3A7EA 5FWDA 5CVJA 4QDJA 5T6BA 1SQFA 3MGGA 5FADA 2AVDA 4ER6A 5GOZA 5H02A 3B3FA 2HMYB 3EVAA 1IY9A 1KP9A 1U2ZA 3PS9A 3R3HA 1P1BA 3T7TA 4X41A 3NVMB 1WY7A 5K0BA 5DX0A 3S68A 1N7JA 3ER8A 2YXEA 3HCAA 3HVHA 4FSXA 3NWBA 2P1DA 2EJUA 2XYRA 4XUCA
chains in the Genus database with same CATH superfamily
2ZB8A 3W6UA 1LDGA 3RYCA 5EIWA 2HF8A 4DCJA 2ID8A 4BO1A 5AOBA 1ZUD1 2G9ZA 3LC2O 3RV3A 4BE4A 1XA4A 3FUTA 3IDAA 2I4TA 3ITKA 1JALA 3MWKA 3TE6A 1B76A 1F38A 1RIFA 4KR0A 5E4JA 4US1R 2EDCA 1WEKA 3R74A 4LVCA 4X1KB 1WP9A 3RSGA 1IHOA 4NH4A 3DNPA 4KVFA 5CNKA 4GOND 3SOZA 5AJXA 1OFIA 3W0LB 3OCXA 1ZIYA 1L4BA 1SCBA 2ZULA 5I5EA 3GLHB 3DZJA 4C43A 4ABTA 1II9A 1VPTA 3K96A 1GL7A 5DYNA 2VWHA 4W8OA 1K8YB 3BMNB 2Q5LA 1PJZA 3EQ6A 1J25A 3E9YA 2VRBA 3K8YA 3JWHA 3HXPA 3KTDA 1PFGA 3IERA 4N0PA 4O4JF 4Q19A 3VHLB 4P7JA 2C9CA 4GOMD 1PNVA 3LBIA 3U40A 4IVRA 3VJKA 1A9SA 5TMPA 3FYCA 3GFSA 3HACA 5FO1A 4J16C 1QSGA 1KFKB 1ZNYA 4WNAB 4MUKA 2IUYA 4PLFA 5CXXA 2PX8A 4EKNB 5K0NA 3HZRA 3G85A 1ZJ5A 1RZ3A 2ZJ4A 1U1DA 1YUMA 3AC0A 1D5CA 1BWRA 3L0IB 4QPNA 5B37A 2ERYA 4H1UA 3R8FA 1X38A 1XF1A 2C7GA 3PCTA 5KMGA 3EGOA 3NWEA 2X8AA 2FOIA 2G71A 3JQ7B 4RZIA 1R4NB 3IAAA 3WJ1A 2KJQA 5KTYA 4RDXA 4P0TA 1DOHA 3C3XA 3L0SA 3OP1A 4H3VA 1Y7TA 3DW1X 4H15A 3PL5A 3V4OA 1CPYA 5HBGA 4KX5A 5ALFA 3STHA 1PDVA 5AVQA 3L7AA 1GXSA 1F12A 1ZW1A 3FLBA 1U3CA 3BC1A 2C77A 3K05A 4P3XA 1KFEB 5L6MB 2P6OA 2QW1A 3UWKA 1ZXBA 1T9BA 1Q5PA 3AM4A 3HL4A 4BKRA 2DLNA 3ZDRA 2GYVA 1NQVA 3GF4A 3JPYA 3W77A 2C2YA 4DUZB 4ACAA 1LPPA 1Q12A 4R1QA 5HNKA 4I19A 3SICE 1VPLA 3WL5A 2XF2A 1Z2DA 4E5NA 3K70B 4QXPA 1GGFA 1MG0A 3MLEA 2AN9A 3G5TA 4QRDA 5JYEA 3UMVA 3SWWA 3KXKA 2C5BA 2YWDA 5FR2A 3JQ8B 1JQJC 4B4KA 3IL2A 1OJLA 1PQWA 2YIMA 1TC2A 3R3WA 1FDTA 2AMYA 1J0BA 2K2QB 3BORA 4N41A 1ZLYA 2FX3A 1VE3A 1EHCA 2ZQZA 2NUPA 2XMZA 2XITA 4L78A 3VTAA 4LDAA 4E13A 3NW9A 1O9BA 1OIXA 5EPEA 3R6GA 5A3JA 3N86A 3IDOA 4U0JA 3EF0A 1P9LA 2P30A 3DPIA 1PLLA 3C1UA 3CKMA 3CRVA 3E05A 5ILQA 5A0TA 1GPMA 3PEEA 1TFRA 4QU8A 5TF0A 5JZSA 5BMOA 4Q15A 3ZNNA 1XG5A 4EPWA 1AB6A 1R0WA 2PFGA 1FSZA 2ZUWA 5LQAA 2PRZA 5JMWA 1TU0A 2XA1A 4LJAA 1JYFA 2QXYA 2VSXA 4MI1A 3M6AA 3C3EA 1IN4A 2CHFA 4DMCA 3NU1A 1CEEA 5M2QA 3MAGA 1NSFA 1REQB 3KELA 4ZQFA 1CZLA 5KCMA 4C1NA 3UMSA 3GNSA 1W48A 2BE7A 3CPHA 3CVJA 3D3WA 2LTAA 3FDZA 5F4ZA 3TW4A 3ER6A 4AURA 1AHPA 3JQGB 2AJ8A 4LF4B 1NLFA 3F1KA 4Q24A 1NP6A 4J3JA 4JSTA 1U81A 1CLUA 4RK0A 4KK4A 1L5VA 1PZGA 4WA8A 4YH1A 1QRUA 4R05A 3THWB 1IVNA 3FI0A 3QSGA 4RENA 5B6IA 3KOMA 1SVNA 4PWZA 3QG1A 3TLGA 5CA0F 3QE9Y 2TYSB 2OAP1 2ECQA 1AV6A 5JD6A 4PPFA 3QPDA 4X3PA 3CEPB 1D8TA 5DN6A 1O2DA 4AJIA 4F7DA 1ZH8A 5CB4F 3PA6A 1TPZA 4M89A 4J90A 1QZXA 3KPWA 3O93A 1RDFA 4N9QA 2Z1DA 3BHJA 4GEKA 3GJ8A 4CLRB 3CHYA 4UKDA 1G8PA 4PGGA 4HNHA 3NS7A 3T7DA 2YVQA 4KXYA 4IICA 4EJSA 4EKYA 2DP4E 2EBHX 3K1TA 1SC3A 1Y5IA 2UYOA 4WOJA 5F73A 4B73A 4OU4A 2RBKA 3CNNA 3N1UA 2QMQA 3WC4A 1W85B 4U2FA 5IS2A 4G5FA 4HQLA 4LMBA 2R87A 3LRTA 2QVZX 3N8NA 5CA1B 2I6QA 5ICFA 1J2JA 4CDRA 1Z7WA 2LVBA 1K1EA 1XZCA 4PHTA 1TF2A 1AGYA 1ISSA 3BMOA 1NUSA 4KVGA 1NU8A 1NKTA 3H3FA 3WYCA 2FRXA 4WJZA 3EIHA 4BMNA 1XRMA 1G8KA 3NBFA 3W2GA 5JFTA 4YDHB 1A9TA 3LSYA 3EF1A 3QTLA 3C6ZA 4XSHA 1OOEA 1A7KA 1PZHA 5E7MA 4L6CA 3ACBA 1GR0A 3DXFA 4J91A 3ROQA 4E15A 3WRVA 2Y2VA 4JVLA 3AEUA 2J3DA 1P74A 2M6RA 3GA7A 4CKEA 5IX8A 1LB1B 2JFYA 2P79A 1QCYA 4JI6B 2WB2A 5F9HA 3HKDB 4DYVA 1LLUA 2BMFA 2P0YA 1NXTA 1IHUA 2OAQ1 3LVRE 5E6RB 2FN8A 2COKA 1BS9A 2CXQA 3HL0A 1JHUA 1BJKA 1ILWA 3WBFA 1QG2A 3RLIA 1BSVA 3E6AA 4B85A 4EATA 4XJVA 1WJGA 4MCAA 1ARZA 5B1SA 3TFOA 1KI6A 2QVLA 3E22A 1OIWA 5K0CA 4UZSA 3KQNA 3QEBZ 2GEVA 2ZJ6A 3I9NA 4WBXC 2A8YA 2DF8A 4QDKA 3T9AA 1RXVA 4NH0A 4PC1A 1ZIDA 2C5FA 4HLCA 3FNGA 4FGLA 4UPDA 3TQQA 4DJEC 5HUHA 2M32A 1SCIA 3KJXA 3DOOA 1UDXA 4RTNA 5J1TB 4Y0AA 2QTGA 5JSFA 3NDRA 3AXSA 4B4OA 1PKEA 3ORYA 2Z5LA 2M1ZA 1V8BA 1UF9A 1F9EA 4RGQA 1SUPA 2GOYA 4TZTA 5FV7A 1VI2A 1K7YA 4DLVA 5ERXA 3EGVA 1Z33A 4D79A 1B16A 1N5OX 1THGA 3AGPA 2ID7A 3JVEA 2E89A 1RYMA 1G3IA 2W43A 3C48A 4URUR 3HS3A 2WIAA 4MTLA 1MV8A 3DF7A 5LA6B 4L02A 1GSHA 2ZPTX 5L7YA 4GGPA 3AR7A 3A4IA 5FV4A 1VRVA 1VHWA 5UKDA 3UJCA 2C99A 1CZKA 1D3AA 1IOWA 1YZQA 3QE4A 3KM0A 4IHJA 2CEAA 3A27A 3PHHA 2ZRQA 2OECA 4RWEA 5DISB 2E4UA 3PGMA 2PS1A 1C5KA 1BAPA 2HMUA 4LSWA 2YVKA 2AFHE 1YONA 2FMUA 1L5NA 1LSJA 3WB2A 1I1OA 4RTSA 2FPGA 1Z7GA 3SFVA 3WMWA 3ADDA 4AF6A 3TIVA 4E7PA 2LR0A 4B6FA 3ESCA 4GKJB 2O6HA 1XCPA 1N2XA 3PPYA 1IQRA 1YSCA 1Y5MA 1NY5A 1MGPA 1G8FA 2CK3A 4CF4A 1OX5A 4B3RB 3N6VA 4B8ZA 4E08A 4PLZA 3NP7A 2QN3A 4DMKA 4EGAA 5LUAA 1IIBA 2RAFA 1LBTA 2J07A 3O4RA 1D4FA 4J0HA 4KI0A 1WKBA 4XD7A 4Q12A 5AQ1A 2GCEA 2RC5A 1WQ1R 4PZ0A 5ITVA 1VIMA 3NHUA 4NCJA 3M89A 3OCYA 3IP1A 4RAOA 4W5NA 1JR3D 1G20A 3IR7A 3I0ZA 4AJHA 2NTYC 1DCFA 4OB7A 2ZATA 2GBLC 2OQVA 2HF9A 4IQ4A 1ZMTA 3GWZA 3GDGA 5EHQA 4H77A 3DMDA 2B4YA 2CVOA 2ATXA 2YJNA 1LRLA 3QE2A 2WAOA 1BCSB 1BO6A 5EUMA 1V5FA 1W6UA 1QZTA 1DG9A 1GNRA 1XB2A 1RQNA 2V7BA 3ENQA 4JYCA 4DE5A 1W36D 2MIIA 3T9FA 3SFTA 5AW0A 3GARA 4LOHA 2ETVA 3O90A 4B4UA 3LKDA 3BQMB 1N1EA 5TQVA 1EUDB 3ZD6A 3K5PA 5GTDA 2ID9A 2WIDA 1QORA 3ICOA 4HDQB 3KIPA 3R23A 2D62A 1YOVA 2IDJA 3OZDA 2PD3A 3GRZA 2ZT5A 3IUJA 4QOFA 3VH4A 4Q7LA 1EP3B 4LV5B 5EIBD 3D43A 3K4QA 4PZEA 1A7JA 4LWZA 4RELA 3P9QA 4EMBA 3OJXA 4R1PA 3TRHA 3VV2A 5EJGA 1GTRA 4YYEA 2ICAA 3SZGA 1C30A 3NOOA 3W7VA 4W1QA 1ZSVA 2NXJA 3HN2A 1VMIA 3HGTA 2XDQA 3OZVA 3PUZA 1O1YA 5E4FA 4C20A 4CQJA 1XCBA 1E1CB 3ZLTA 1N5MA 2O8CA 3MWGA 1QFMA 3ZY4A 4B43A 3H9JA 2BTOA 1P4AA 4FEGA 3UVEA 2DH6A 3O91A 4F04A 1R7RA 3BTVA 5T6MA 2IJGX 1NXWA 4HTFA 2VP5A 3TW6A 1FNMA 5JJ5A 1OT5A 2P2CA 3VMMA 3ET5A 5A05A 3L79A 3QRWA 1H22A 3K9GA 2J46A 3K0CC 3T3HA 1DC5A 1R66A 1XVAA 5J43A 2CXOA 2Q6LA 3K9HA 5KDOA 3UHJA 5DI3B 1M66A 4OFZA 3BH0A 4DR3B 1N8TA 2D0PB 3W8EA 2BZSA 1CQZA 2R79A 3C3CA 1DXOA 3IB3A 3CVOA 1W4ZA 1S5PA 3PGKA 4QHSA 2OC9A 2RGGA 3QLVC 1XJQA 3THSA 1I7QB 1GZDA 3AM1A 3DVAA 5DBFA 3LIIA 3EXHB 2Z5FA 4FMCF 3B20A 4DMFA 1KIAA 3AKDA 3HP4A 1DX6A 1JB1A 4JQYA 1K7FB 5JPCA 1A1VA 3LI2A 2DUUA 1YGYA 1J4AA 1SWWA 3DFUA 3FCYA 4I55A 4N39A 3SXUA 4CI0B 4D8WA 1DXYA 2DBYA 1WV1A 4F93B 3VGJA 3HC7A 1E5DA 4KQKA 1W2GA 1NDUA 1C0LA 2WNHA 4LS3A 4QPZA 5IM5A 2DJ5A 4HQOA 4WOKA 1J0DA 3DEZA 4PO9A 5HILA 2D2XA 4E3WA 5AW4A 4HGNA 4UAVA 1XPJA 1WHSB 5TDHA 3WTCA 3Q7EA 3LRPA 2JCXA 5FF9A 2G5CA 4HDAA 5I4CA 4PSAA 4Y0NA 1T9GR 1JJ7A 3MZ0A 3ISVA 4R1NA 3TLCA 1Z16A 3L1HA 3MWEA 1SC4A 2W4QA 2Y1GA 3DAYA 3VHRA 2O5CA 2FXVA 2O8EA 2ARKA 5FBWB 3AG6A 3RYIB 3CLRC 4C06A 2R1TA 3QW2A 2WWRA 4NBNA 2ATVA 4MWTA 4QGHA 1KRWA 4J0QA 4YFVA 2B78A 5LDGA 3AUYA 3B9QA 4EGJA 1A9QA 4EVRA 1OYOA 1R50A 3NNSA 5DHUA 2VHQA 3L4EA 4I50B 2Q1XA 2OL4A 2UZAA 3ZQUA 3HPRA 2ZCVA 5CVDA 4BS9A 4MKGA 5KWEA 4DV3B 5D1HA 1C9YA 5F7ZA 1X1AA 2YQ4A 3UWPA 4JLMA 2UDPA 3ET4A 1RNLA 4S0ZA 4DA0A 4ZCIA 1G7CA 3SIPA 4JR0A 3CYFA 3MAJA 4NZZA 3VKUA 1GUFA 3QVWA 5KHAA 3TLYA 1Z08A 3WL7A 3A6LA 1D1SA 2P9CA 4PSDA 3KHTA 2PKQO 3WSWA 3GEGA 4KIFA 4O4LF 2I1WA 5F1OA 3HO1A 1OLUB 5FTMA 1M8PA 5KTKA 2JFVA 4PGHA 4TV8B 4V3BA 2OEPA 3U3DA 2OHGA 5CVTA 1NDQA 2FPXA 4RGBA 2NYUA 3UPTA 2H4FA 4ZO4A 4DLWA 2BBWA 4YJHB 1CJKC 4X95A 1CSEE 1EE1A 1KI4A 1OLSA 2AC2A 4FFBA 1JFFA 3T35A 4RTPA 1JDUA 5DXJA 3WDMA 1PFKA 3ZDXB 3LYUA 4C4TA 2I4RA 1F2UB 3TK1A 2OB1A 2PNFA 3G68A 2ERXA 2C4HA 4M9CA 2MTBA 5ESWA 1TZKA 4L85A 1GPLA 1C7JA 5D7NA 5EOVA 4ILKA 1JA1A 1EJ6A 4KXMA 5T57A 4AMYA 3N0VA 1JIXA 3OZIA 4I6JA 3LNCA 4H6WA 4LWOA 1HRKA 4GMXA 1XLTC 1GPDG 5B3JC 5JYCA 4OYHA 1JMYA 1R5JA 2FLWA 2UVPB 5E2AA 3KYBA 3IP8A 3PPIA 2BBSA 4NMWA 4P4TA 3GC6A 3GEMA 3KJZA 2AVDA 2ZRFA 3LUFA 3RI3A 1PG0A 1PYGA 2OV3A 3RUIA 4OHYA 3K9BA 4DBZA 4R9VA 1JKMA 2GBPA 5BT9A 3M82A 2C2ZA 2QT9A 2XIQA 5B53A 3GN1A 2VDPB 1SKUA 4PBRA 3AVXA 4R16A 4KQCA 4EA8A 1C8LA 3RO7A 3O03A 4CVNA 2QSUA 1PVVA 4A0QA 5DNCA 3I6BA 2II6A 3EQ9A 4UREA 1UBNA 4JR2A 4JEMA 5BR8B 1XTSA 1PQPA 5K3FB 1CQIA 1ESDA 1I4EB 1QRRA 3FBGA 4M1ZA 1WLYA 2I3AA 4P4SA 1NI4B 1SURA 1US8B 3PX3A 2V4MA 4WZZA 5FNVF 2BHSA 2WFAA 3MUOA 3TVYA 4B7CA 3WLKX 1JLMA 3DKKA 1EXMA 2W37A 4MOWA 1YRHA 4G0NA 4RA9A 4ID9A 3DHEA 2XBLA 4YJGB 3JAWB 4AZSA 3VVBA 1LC0A 1H94A 4IRMA 5KJEA 1XAJA 2X9NA 5H4HA 5KSYA 5J2UA 2KM1A 5BSTA 1SU6A 2CXXA 4TV9A 2FOXA 4WZ6A 3JTEA 1P5RA 1C1DB 4UNQA 2D7JA 1ISHA 1OF1A 3OJCA 1UPFA 2X5XA 3I52A 4MW7A 3WLLA 5B12A 4WEOA 1DP4A 1C9EA 2VVTA 1PUIA 2EKBA 5E1DA 3QXJA 2DFKB 3DZBA 4L2IA 1H5UA 1UPAA 3CZCA 2A3NA 3LOUA 1JHRA 2H4ZA 3QNUA 3UB2A 3C5HA 4DQ0A 1E0KA 4HN4B 4ZPJA 1TYEB 2UXDB 1KAGA 2AYXA 2ZBUA 2MYNA 4EJ2A 3LA6A 1Y3CE 3HCWA 4FYYA 4G24A 4WE3A 4OXYA 1U9CA 5FTNA 1H6AA 3ABRB 1ZNXA 2NWQA 1XXLA 2FZWA 2OHXA 3MCAA 1CT9A 1JEEA 1YVEI 3OD5A 4HMPA 4LJ9A 2CKMA 3EX7C 2PEYA 3KP1A 2VQ3A 5BQ5A 3A1EA 5CEJA 3ZQKA 2MSDB 1CUZA 2QE7A 2QK4A 3OFVA 2NU8B 5C1PA 3UJPA 2IOFA 3OP4A 3DAGA 1VYUA 3F47A 3IVGA 4X6UA 4DQVA 2WVJA 3AI7A 3EPRA 2Z2KA 2Q4OA 1X2BA 1I0IA 2QN2A 1AQIA 2X0IA 4MWOA 3I62A 4YRCA 4BXOA 2IZOA 3LY8A 4W6QA 4UDOA 1PHRA 1CZNA 4IVNA 2G6TA 4FUTA 3TBHA 4G4GA 4BLQA 1WMAA 3F6PA 4ISBA 4H60A 4QTYA 5IK2D 3NEAA 2GD2A 4DBVO 2QJRA 3RJZA 2HYIC 4HWPA 1YRWA 4REQB 4YCSA 1HZZC 3Q7QA 1OFTA 5EC8A 4C4ZA 3UMCA 4DG5A 3BD8A 4G0UA 2OO3A 3MYRA 3QTTA 4MQBA 4Y9TA 3MINB 4MUMA 3CONA 4L51A 2HY7A 3FMIA 3HN6A 4DYHA 2PQ0A 3QPWA 2EL9A 2H65A 1CUDA 1OZFA 3CG4A 2JAOA 5A71A 1YVUA 1TOAA 4G26A 4F06A 4M46A 1ENZA 1U9IA 1MFPA 3PQ8A 1I5OA 1CJUC 3QFSA 1W4LA 4Z53A 2JW5A 1U7WA 3VXKA 5AJHA 3EY4A 3WHKA 1U6IA 6REQB 4MJLA 2RHDA 3ZXIA 2G76A 4B7ZA 1H8HA 2OBLA 2QL7A 4OJQA 2XCUA 3EW7A 2VF8A 4YCJA 3JD3A 3TR5A 5J3JA 3UTDA 3PNOA 1EWQA 4NBTA 4N8DA 5C8YF 4KO3S 4LFBB 3IELA 2PK3A 1M1YB 2DQKA 3H4TA 3MFQA 4PGAA 4QAQA 1U11A 3KYCA 4G4IA 4PZUA 4Q9NA 4ZZIA 4FC7A 4P32A 1PR9A 4Q1VA 5ALSA 2VZEA 4D96A 3MXOA 1ORIA 1XEXB 5CFNA 3JWIA 3UNXA 4QM7A 4JP5A 5KNBD 5MF6A 2GF9A 5KYGA 3Q0IA 4QU9A 4QNRA 4QDTA 1P2SA 4MCJA 1OXVA 3U17A 5LPNA 1DFHA 2HJ9A 4EO4A 5DGTA 2PH1A 4IDCA 3UWOA 1ICEA 4L9WA 4YRTA 3T99A 2JI4A 2BFWA 4AJKA 4C5BA 3GJYA 1E4YA 3THOA 4AZTA 5KYWA 2GKGA 2V9PA 1ECFA 4MLCA 4GGMX 5C1DA 2JVIA 3RSFA 3NGMA 3SDBA 4FGKA 2A0XA 4LHVA 2ZIGA 1E7MA 2YHSA 1WVGA 5JBQA 5K01A 1Z4JA 1NVTA 1C2TA 2H4JA 1CUGA 3LZDA 3R6WA 4URHA 1RLUA 2G1UA 4AMBA 2E21A 3CJRA 4DUGA 5U1PA 3FCXA 3HO8A 3RVMA 3ZHVA 5IC4A 4MVXA 1KXZA 1V5WA 4PFJA 1ZH4A 3EUEA 3DBVO 1SXHA 2P7HA 3IOEA 5JVDA 4PZYA 4HB4A 3S4YA 3TB4A 2C58A 1IEVA 3HZHA 5FFFA 5JSHA 1XFDA 4GBGA 5AKKA 3ROKA 4M3NA 1LVGA 1NZDA 3OWOA 2G9VA 4GICA 4I08A 3M9WA 4MJ3A 2BT4A 2ZJ1A 4UNPA 5IZCC 1HDRA 1AG9A 2NV6A 4MGIR 1QG4A 1YZVA 4EG5A 4Q1AA 3EFOB 5CDHA 5JADA 2RD2A 2VH5R 1DWUA 3BBPA 3E84A 4FJ0A 5E3HA 1SY7A 2B4KA 1NUPA 3QEOA 3QPUA 1KS2A 4EB3A 3BL6A 1NBMA 4JWTA 5T4BA 2D7CA 1ULBA 2K87A 2R6DA 2PEZA 3QE3A 4W9NC 3VVCA 3WWDA 4DMHA 4EI9A 2ZYVX 4MI9A 1IBLB 3E7DA 2G82A 2EP8A 4NOKA 1TUBB 5JY1A 4KEAA 4FCWA 1UBLS 1NQOA 3EGXA 1JVNA 3SXPA 1Z6TA 3CX3A 3ROTA 1UOOA 4QFBA 4L6IA 4IFBA 3UJBA 3QLUC 2GESA 4K9QA 3DHWC 1DDGA 3I9FA 4KSYA 5TX7A 3BXFA 3ZNPA 3OO0A 4UPEA 3COWA 5E6SA 2ISQA 2ZJ0A 2D13A 4C9BA 4F4IA 2HA4A 1X1DA 3CTPA 1Z7BA 3DAPA 2GXSA 5KAPA 1E6EA 2ASVA 3VPCA 1X9HA 2ZWOA 3I0MA 3O75A 2OBXA 4RC9A 4WY2A 5FUWA 4E1VA 3HEBA 1HMPA 4YFYA 4DV7B 2AWNA 4R1TA 4K81B 2WNSA 2B8NA 1P1RA 1YDGA 1MW9X 1GDDA 2FK7A 3KEGA 2I87A 4M1EA 3VR2D 4M22A 3QBTA 3KQVA 1HNWB 1IWPB 1LQTA 2P68A 1HLPA 3PC6A 4JJFA 3R1IA 3RKSA 4PPGA 3MRTA 2ZBQA 3CEHA 4MVJI 4EPRA 3ED5A 1ZU5A 5AVKA 5CNIA 2OHHA 1F2DA 5J2TA 3BXZA 4S2UA 5TY0A 2WHEA 3FFTA 3N0WA 1F4VA 1KGSA 3UG7A 1JX6A 4F86A 4AKGA 1ZM2A 2AZTA 4UXHA 4WNYA 3RSOA 3K0AB 3QKWA 1IRXA 1Q57A 3QX7A 5LD2C 1IM5A 1E60A 4MRMB 1F0KA 2A33A 4FZVA 5DNVA 1KFBB 1UP7A 3O1JC 2BI4A 2VLBA 1OA0A 1T5BA 3DE1X 3Q7RA 4LZWA 4P82A 3WICA 3VSCA 4ON9A 4PSKA 4QWWA 4LAFA 4B3XA 4LF6B 3O3MB 1RKVA 4ZARA 1JG2A 2PD6A 1E3TA 3NZEA 2B4QA 3ZLUA 5HF8A 2HXYA 4FS3A 1OXTA 1P5FA 2GXUA 2OQRA 3MCWA 3NONA 4G5QA 4NYJQ 5ALLA 3WADA 4EG0A 1U9ZA 3M5PA 4ABYA 2IY9A 2YN4A 4M7RA 1ZJJA 4UFPA 4EY7A 3S7TA 1AH2A 4TTSA 1NG1A 4G8BA 4CT0A 1LI7A 1V1JA 5H9WA 2Z56A 5SZHB 2PX6A 2H4HA 3K0BA 1RKUA 4BEWA 2XV1A 1B43A 1QFSA 3DEFA 1SIBE 1NF8A 4Z2AA 2Z6UA 3AYXB 1B93A 1XTTA 1GYQA 2AFIA 2HMWA 1C8VB 3NH9A 3U3ZA 1B15A 4F12A 1XNHA 4KKXB 3W6OA 4M8NE 3W9YA 1HNZB 5C46F 2UXBB 1M6NA 1E79A 1KJYA 2GCPA 2Y0PA 4TL9A 2LIVA 2VJKA 3I5UA 3OM1A 4K9LA 2WWHA 3IEKA 1PEYA 2EU8A 2NSYA 3H1FA 3BXPA 3ESZA 3KX2A 5LZ9A 2OV1A 1CZRA 3JZAA 4FFWA 2YJ4A 3DNMA 3TCKA 4EABA 2JLZA 4DT1A 3IAS6 1OWPA 1M7BA 1WU8A 4DCGA 1OWOA 4YCNA 3G0CA 3GLIA 1H0RA 1NYRA 1CUYA 4LTNA 2QYOA 3DVQX 3ZS9A 4HRYA 1J07A 4R9SA 3RS7A 2PX3A 3TI7A 4B81A 5HS4A 1LBEA 3T5CA 3B9RA 3R7SA 1XHLA 4CHGA 5BYBA 1DEHA 5AJUA 4GRDA 5C7OO 1LVUA 1M1UA 4F9FA 5HKBA 2DGDA 3I2GA 2Y1KA 3AHHA 1JU3A 3WLTA 2L0XA 4ZEOA 4BEBA 4YRBA 2O7QA 2XQJA 3OWHA 5DBHX 1CF4A 2VP2A 1P91A 3W6ZA 1Q15A 1PL8A 2EL7A 2B0CA 4O4IA 1E8DA 5CXSA 1KYVA 1YDWA 5FUYA 4BFXA 4DY4A 3IT3A 1ZYUA 3BGWA 3HSSA 3UGTA 3FY4A 1OKKA 1GILA 4IIVA 1D6JA 2W2XA 4FFLA 4L28A 2FZVA 4UTPA 3AEKB 4DG9A 5JW6A 2QTVA 1G0NA 1LPBB 1O4VA 3MMPA 4DV5B 3H5TA 3OE7A 1N7IA 4NZPA 4O2AB 3ZVNA 1TAUA 3FYTA 4K6GA 4BJ6A 2ENUA 3DEAA 2ZREA 4F0JA 3VH1A 4EHFA 1UUFA 5CLLA 2I6XA 2VLIA 4BX9A 4ENTA 3LY7A 2JFXA 4HGPA 2BELA 4IDFA 4Y6PA 4KFRA 1Q1BA 2D2EA 1R0XA 1A3CA 3LDHA 3G89A 2H9YA 3GFVA 5BQ3A 5LOVB 3PQ3A 4HXFB 1I2CA 1LK7A 1ZXLA 4R40A 4PU0A 1P39A 2ALJA 3CLUC 2DFVA 3H84A 4RS3A 5JLAA 3BB3A 1T0HB 4ZJZA 2IYFA 4JUIA 5K0JA 1EFPB 3VC7A 1D7OA 1DUIA 3BXXA 4DLLA 3LDAA 3ZIUA 3MOIA 1J8YF 1V16B 1C8KA 2QN7A 3QUAA 1VCHA 3P45A 3R3YA 4RD4A 5IFKA 4GPAA 2QUKA 2VTBB 2BBOA 2JHCA 2Q1WA 4PX2A 4LJYA 4QQ8A 4X90A 3TMAA 3DS8A 1SBCA 1YRQA 2EGHA 2OVFA 1ULSA 1U0EA 2YFQA 1FJ2A 2QTLA 1USVA 1VE9A 1VRCA 1UEXC 2XOXA 3LQ4A 4PG6A 5B2FA 3EAFA 1ULTA 4BCDA 4ZCTA 3A2KA 3DAOA 5KPDA 5FUBA 1N33B 4CPDA 3F6CA 4MQ6A 2P6PA 4NOMA 1U0LA 3DBHB 1EJBA 1V45E 1DAHA 2PKWA 1NLUA 5KZMB 1AN9A 3IJPA 3JASB 1SIUA 1NFFA 1FP4A 1ZSNA 2OCYC 1NVGA 1QYDA 2WFMA 2X19A 5KOJB 5KYXA 1JVBA 1SUBA 3ER9A 4P81A 2EWWA 1GCAA 1IE3A 3BH6A 3WLMA 3LLCA 4QG7A 5EQJB 2ONJA 2WR8A 1A4IA 2J9GA 3NUGA 1Z7EA 1ZBQA 5EJ5A 2PSEA 2QU8A 3P27A 1HE5A 1NRJB 5B4TA 4HRVA 1MQ8B 2QG4A 3O38A 4FR5A 2FUEA 2ZUSA 2VH2A 3G3EA 4F8YA 5CCEA 1ZOIA 3I34X 4B17A 5KQGA 3O8CA 5LZ2A 1ILEA 1P2DA 3U4QB 3DH0A 4B09A 2V6IA 1N9GA 1PYOA 4OGFA 4X45A 3WLJA 4D4LA 4ZICA 1C7IA 5BOVA 1SVKA 4WI1A 1KSFX 1IY2A 5TSDA 2YNMC 3EPPA 3S2FA 3W04A 5BWMA 2AEMA 3AETB 1CQJB 2FHSA 2V7VA 4C78A 1H6CA 1N4DA 2EQBA 2WYUA 2YNMA 1X7HA 3LDGA 3T3MB 3FF1A 5HE8A 1YS4A 1I4DD 5EVJA 4DMUB 1RP1A 3RVNA 1N2EA 3LGSA 2V45A 1ZA2A 2JAQA 2YWCA 2P6NA 2O9JA 4LNUB 3FGPA 4XWYA 4K9KA 5CPBA 3TW0A 2WT9A 2Q5FA 2JGDB 1YBVA 2YWRA 2OC4A 2PUCA 4GXQA 2I2AA 3AVPA 2FPMA 2PRYA 4MAAA 3U39A 4BRSA 4AO6A 4IZ6A 2W8BA 3J7TA 4CYMA 3H0KA 3PDUA 3R8CA 1Q14A 2CBGA 3LYHA 5A62A 4YMGA 1U9YA 2FP3A 3LCRA 4WKNA 2NT3A 3O4IA 2QLNA 1ZH2A 1ORTA 3B1JA 1R74A 2HTFA 1CHNA 1PGQA 2WAMA 2ZSEA 3INYA 1HQKA 3WKEA 5A5GA 4NCKA 3NHFA 4H1HA 5JQWA 1DGQA 1GT91 1FLNA 1YB5A 1IN5A 3EPJA 3IHLA 4HF7A 4GWGA 1P3Y1 3AEYA 3HP7A 2YS6A 3GFFA 4KQMA 1UXKA 5TGDA 3SLGA 4CF3A 1N32B 1ZD8A 3WZMA 4II3A 1ND5A 3TXXA 1W0CA 4ZP1A 3ID6C 3KFVA 2FN3A 4UE2A 1NW5A 3SYLA 3P96A 3CLSD 4O6VA 4H59A 2XTNA 1CY7A 1L4UA 3A7EA 3HU5A 5AW6A 1SXJB 1M6WA 4B46A 4BZQA 3H1AA 5AKZA 3O8NA 1QHIA 4E6PA 4MV0A 3EVAA 4NENB 2CUZA 3VO1A 4KTTE 3UN1A 5EESA 1BX0A 1MJGM 4KRFA 3TN7A 2GK3A 1LPSA 2PANA 3NWPA 3PC8C 4K46A 4QOIA 4E14A 4AN4A 2PRJA 2L19A 1W34A 2FW1A 3PC8A 3RRXA 1NMEA 3AVQA 3B36A 1M2VB 2CLEB 5AOVA 2I62A 1XYYA 5LA6F 2IEDA 3WB0A 4DJAA 3I92A 2ACEA 5JRDS 1RC1A 3Q98A 3BEOA 2PSDA 4Y30A 5ESDA 1CQXA 2JAPA 5KQMA 3NR2A 4GT1A 2DU8A 2QP4A 2C9MA 1JQ5A 3VJMA 1WPQA 2G67A 4TKLA 3ZWVA 5TQ0A 3EUFA 1D0IA 3SY8A 4MKHA 5CXUA 3BWCA 2XZTA 3CO0S 3OJLA 1UXHA 2RKOA 1Q83A 3BXEA 3LFTA 2XNSA 1QCCA 1JQDA 4Z4CA 4PO3X 2PLFA 1AK1A 1U0RA 4QQFA 3FTCA 1PCXA 3NCTA 4HMQA 3K7EA 4YQEA 3E5NA 3AU9A 4JI0B 2OFPA 5KQLA 1QFJA 2CT8A 1AS2A 4UM5A 4YUAA 4N0QA 3DC2A 4V0MA 1RYHA 4GUAA 2ZVJA 4JXJA 4NV1A 4IFIA 2W2LA 1AY0A 2FN7A 4LQCA 4ZHQA 3OCJA 3ZHQA 3IVXA 2F9FA 2JZNA 3INGA 4R5HA 1USIA 4EG7A 1QAOA 1NI5A 1DS6A 2IVZA 3A26A 2YWBA 4MVJD 2PZEA 2UUOA 3TZBA 2P6RA 4YAEA 1XKXA 4XJSA 4DIMA 1RWWA 4HLUA 3SJBA 4E2FA 4CMBA 2XUHA 3EULA 2JGIA 4LHYA 2YXLA 1RAIA 4MZDA 3TIGA 2H17A 3L4BA 2QX8A 4FSDA 3OCZA 2J45A 3USCS 4A1FA 3IIIA 1XEWX 1DQPA 4JYMA 1CY6A 2W2VA 4ZO6A 4A03A 3HM9A 4MRAA 1D2RA 4QG3A 1F48A 3GLFA 1D2AA 2ZSKA 2IGBA 3IP5A 5AM1A 1WF3A 2PHZA 3G0HA 1FYWA 1RJFA 2H7CA 3D2AA 1SU7A 3HYCA 2XWJI 4P3PA 4G1CA 5ECGC 4O1MA 3VJRA 2PJDA 1T2DA 4J1TA 3JQBA 1NYLA 2JLYA 2FUG6 1JFRA 4LQLA 3O73A 3DDOA 4A0RA 1FQWA 2IYNA 3DE0X 2DBRA 3BMQA 4YRLA 4F96A 5CDTA 4RIGA 1XZQA 1FFWA 2PLRA 1OQAA 5CEEA 1CVRA 4YMLA 4P80A 1ZCBA 4FGSA 4H1TA 4IIGA 2H7VA 4QXOA 4BQFA 5EY5B 3RJ9A 3MS7A 2CVFA 2OR3A 3E35A 2WWIA 1RXCA 1OU4A 3JSAA 4RHFA 3RS5A 3SC3A 4HY3A 3G2IA 3CU5A 4Q3AA 4UC0A 1IEQA 4LMAA 5FPSA 5HM8A 4JVOA 3LDUA 4RIHA 4RXMA 1G2QA 1G64A 4UBOA 3HXLA 4NU8X 2WWFA 2QTBA 5K4AA 4EJ0A 2Y71A 3T15A 3IA2A 3HBFA 1TMGE 3UHOA 5BN3B 1HF3A 5ADHA 3M4NA 3ENZA 5L51A 4HLQB 1FX1A 1XTJA 2VNIA 3AQIA 3C97A 4CWAA 4DS3A 3F71A 5FUQA 2P9QA 1J70A 4HXYA 3ROXA 3WRXA 4YJ2B 5IJWA 1QGYA 5K8IA 3NI2A 1K9SA 5AQEA 3BL5A 3QELB 4ZOCA 4B3CA 5K6RA 2H2WA 1CRWG 2FLVA 1NL3A 2CNNA 2P2GA 2JRCA 2W2OA 4HX9A 1ECCA 1EFVB 2G06A 2PKCA 3KVVA 3KYDB 2XQVA 1B1CA 4BVEA 1YJQA 5CT9A 3X1YA 5FOXA 2QX9A 1J8FA 3R41A 3RFVA 3WLQA 3EOAI 1VLLA 4AF7A 5AVUA 4X1YB 1DTWB 1C14A 1PR0A 5DX8A 3N3BC 1XYVA 4DIOA 4YV7A 1LC3A 2B34A 1RJWA 3D5QA 3ND6A 5CG1A 3F98A 3F7TA 5CT8A 1YUBA 1CLEA 1A69A 2IEYA 3O94A 1LDEA 1W9HA 2V0NA 3AG5A 1AKYA 1GGVA 3AIKA 2VNJA 3LPDA 4NBKA 5KAMA 2W6PA 4OYLA 4OQQA 4TN1A 1L5LA 3EVNA 3Q2IA 2J5XA 5DXAA 3S28A 1NXSA 1L5FA 3DDSA 4LOIA 3VI3B 4DLSA 2O2EA 1U80A 3EISA 4ZQEA 1OBVA 3IPYA 2OB2A 1G42A 3HB9A 4ZAVA 4B8WA 2VTEA 1P33A 4RKWA 3V4FA 2K7ZA 4K1LA 3FPFA 2D4AA 3VDXA 1XZFA 1W2WB 1WSAA 4IR7A 4XAQA 3WIEA 5B1EA 3KZVA 5HRCA 2C03A 4CEIB 1DO2A 5D00A 1JEDA 1NXPA 3DM5A 3KE8A 3O4FA 2IYWA 3OCVA 4NEHB 1DBWA 4MWGA 5T4HA 1SBIA 1EM8B 3L2OB 1ZCJA 3NHAA 2JG3A 1U2GA 2HC9A 10MHA 4JI4B 2B92A 2E85A 3HEMA 3TYXA 2B9EA 2R65A 3A1DA 1E9VA 4EJMA 1QG6A 4HAIA 4ER0A 1X14A 2JIZD 4DJJA 5ERGB 4OXIA 1HE4A 3ZCVA 3SZMA 2CLLB 4MP6A 4GECA 2RIPA 3AIMA 3BH7A 4ZRMA 3I58A 2JAXA 1WCIA 4C2AA 1PGNA 3FI9A 2LWIA 1TVMA 4E88A 4KE6A 3WZLA 1V6CA 4X7RA 1ZRHA 2H2IA 4NBRA 1G8SA 3ISJA 2JEZA 3H2ZA 5K3BA 4D0SA 1Z4MA 4FCTA 4GSLA 2X7JA 2VL7A 1U28C 3VR3D 5CVVA 1N34B 3L82B 1IM8A 4DWJA 2VO1A 3QEJA 5A6SB 8GPBA 4RVSA 4TV8F 3QPBA 4B6JA 4RV5A 1NE7A 2HGZA 4LJRA 1Y4SA 3E23A 3A9SA 4E5UA 3ZY2A 3AEQB 3SFZA 1NVVQ 5LQRA 3WHIA 3VTFA 2LPMA 1JSZA 1KEZA 1EYZA 1GPYA 4D80A 3EQZA 3GP5A 5LB4A 1DCMA 3G8YA 1QS0B 4DDMA 2XXAB 5TNXA 4N12A 3FDJA 2IYLD 5DNWA 3RARA 4HWGA 2VPPA 1JZSA 3R7BA 3VHXA 1EGVB 4B3FX 3SZRA 1EUZA 4CJXA 2V7PA 5HIJA 3KDAA 1AMNA 5F98A 3DT9A 5JDIA 3WLOA 1F9AA 3EDYA 1WMBA 2HCBA 4ZOLF 4MMYB 3J81A 3WBKA 2HWWA 2H31A 3BB1A 4KBYA 3W1EA 5LYJB 4ZGWA 4RH1A 3B85A 3WR5A 4KO2S 3QKSB 4TRMA 2J3LA 2BVNA 5BSKA 4KR7A 3M1YA 2YVLA 1Y3DE 5CDYA 2XUAA 2OILA 4GYYA 3JWJA 1YRAA 2H4WA 3EDQA 3NH6A 3G5UA 1FX0B 3ERCA 4HRAA 4GM1A 2DULA 2P4EA 4KXWA 4M1SA 3O8DA 5DGHA 4P3NA 4WXMA 1GLGA 1C7EA 1GPUA 2GCGA 2EP5A 1OU0A 4LBZA 1QDEA 4JV5B 1BKSB 1FTSA 2YWJA 3A4MA 3H18A 1Y6FA 3HFSA 2OMEA 4BX3A 2Q3JA 1AJEA 3KJIA 3OQJA 3PIDA 3UKDA 2XOKA 5EJ4A 4TWBA 1HOTA 5B4VA 1M2OA 1IPHA 4HWKA 4XGKA 5DBGA 3STYA 3TSYA 5IF3A 3OIUA 1JBEA 5A02A 5JAOA 5D51S 4RTKA 1GZ5A 4P7GA 5DB4A 1Y8QB 2IDMA 3AB8A 3HCFA 3UQYS 4AWBA 1DCKA 5F5LA 3DO5A 2NV2B 2G25A 2CDRA 3WVNA 4IDAA 5F7OA 2HHAA 2NZJA 2PBZA 3PCXA 1CJSA 2R00A 1I7NA 3FZGA 4ZC8A 5TJ9A 3RJMA 4W8GA 1AHIA 3EWSA 1T6YA 2J3HA 2WD9A 3JQ9C 4RJTA 5MGBA 4EPVA 3ZTYA 1GRNA 1OLXA 3JR3A 4LYFA 4CMEC 3RT1A 3GGGA 2CN1A 3WMFA 1VZ3A 2P35A 5IDVA 2BBTA 2FPPA 3KXLA 4IO1A 4BNGA 3SG0A 4M0PA 1CB0A 2ZETA 2OKGA 4JEIA 4DHEA 2KSQA 1ZESA 4CLOA 2N1MA 5LUBA 3FYUB 2PTGA 5EHXA 1MNQA 5CH3A 3PGA1 1DEKA 2AD1A 1IOZA 3KWJA 3L7LA 3TRJA 3VFDA 1XQXA 3VZSA 4LXHA 4XRGA 2NP7A 4I14A 2Q07A 2RJNA 3JYNA 5AVSA 4BO8A 2CKDA 2FK8A 2YY5A 4KL8S 1JKJB 2EQAA 2E4WA 1A9PA 5A06A 4MVYA 4G0ZA 3OX1A 4QVKA 3ABIA 1UJNA 3AESA 3NBMA 2BPOA 1RW4A 2R8EA 2I2WA 2VI5A 4K8OA 3D4BA 4JJAA 2PMKA 1K2WA 3FBWA 2GB4A 1OXSC 4KMSA 3O1LA 5GP1A 4GLBA 2DXIA 3ZQ6A 4BTLA 3EHEA 5IKOA 4HQ0A 4J0GA 5HRUA 5KX5B 1J0AA 1F6DA 1YVRA 3IXLA 1XO1A 3QKTA 4PAGA 4QNMA 4CL8A 1LEHA 2HSJA 4LNAA 5E1BA 3IJ5A 1UMCA 2C2XA 3H99A 4MDFA 3TLBA 4G65A 4OQLA 1PQ4A 3KL4A 4DL9A 4YX9A 3FJOA 1E5QA 3IHKA 3PU6A 4D1YA 4ZCRA 4MB6A 2W83A 4E33A 4TTVA 2O8VA 3G2LA 1UBFA 1RYNA 1WB5A 1DIRA 2PZBA 4QWMA 4F4HA 1E63A 2CFSA 3RUFA 4DDKA 2VJDA 2RC6A 4JFAA 3E53A 4LHSA 1Q91A 2MMCA 4OI4A 3TBFA 2DR2A 3V3KA 1J09A 1R88A 5BVGA 3HJUA 1X1CA 1S2OA 4HFMA 3KL2A 5JBIA 3AMVA 4I9FA 4MUYA 5DI9A 2VRNA 3PT5A 3OAAA 2Y27A 4ZCSA 5KKNB 1X7XB 3V7NA 3AYZB 3TDMA 3M7IA 2VAMA 3BULA 1YJ5A 2BRUC 2UAGA 2IPOA 2QPLA 4K6FA 5LP6A 1YO6A 4EI8A 4R7TA 5D87A 1JL3A 4HXEB 3KB1A 4IL5A 2G4VA 1N6KA 4ENQA 1KDPA 4MVJF 3PIIA 3PDIA 3I30X 2I2FA 3RC7A 1CE8B 4YXFA 3C4VA 3ZJVA 5FUXA 5KINB 2B8JA 1V43A 3I2FA 1Y3BE 5M5BA 4ZTBA 2QNIA 1J56A 1MTOA 4YPFA 4E07A 2CYAA 4TS1A 2IVFA 4UEOA 2D4HA 5G02A 1QP0A 1MJ5A 4GMDA 2O0HA 1TM2A 4JROA 4MR8A 3C8HA 3NASA 3UH1A 5L4NA 3PUWA 3GH3A 1P4JA 1XK7A 4JK3A 1L7PA 3CZMA 2EG9A 1ZMRA 4OQXA 4KFCA 3VZBA 4U7TB 1RYZA 4CT5A 1D03A 1S3FA 5CX4A 5LU9A 1KDVA 3UJDA 3ORSA 3L92A 3L4SO 1L1FA 3UO8B 2IBTA 1FRFS 1GARA 1T6NA 4L0CA 5ISMA 1N6IA 4MP3A 2J9ZB 3ZGVA 1WD7A 4N8EA 5JCJD 1JXMA 2VA8A 4RLSA 2WU4A 4A6DA 4CW7A 4XQ0A 3D3JA 1FRQA 3IV6A 2R2AA 3FNHA 3I28A 5BR1A 3HA2A 1PWHA 3V4SA 1FYVA 4FDUA 2NG1A 4K9RA 1EJ2A 1PDWA 1JA9A 1NXVA 5ALGA 1JPJA 2O3TA 5KHLB 1NC3A 4D8TA 1GSOA 1RE1A 3PNBA 1ATZA 3AFNA 5BYKA 5F3WB 2TMGA 4XYMA 5CK5A 4JT2A 2NVUB 3L77A 1Z5OA 1UINA 3BT7A 3KD2A 3D3QA 5GM2A 3AHEA 3QIAA 5EERA 1ES9A 4LFAB 3O3NB 1TEHA 2YWHA 1K7SN 1XKTA 3HCNA 2GVDC 3AF3A 1JYSA 1JDBB 2WJ3A 3VR6H 4R8SA 1Y4UA 1U0HC 4I81A 4EZEA 1KNXA 1E3LA 1NJ1A 2X41A 3A3NA 3A6EA 4ILEA 4WOBA 3ROPA 1YR7A 4DUPA 2IU6A 1GVNB 1NV8A 4MTCA 2NT4A 3ZDAA 4HGZA 1GKUB 2HO5A 5IVHA 3TVTA 3ZDBA 1QH1A 4H3SA 2VP6A 2IYTA 4TRJA 4UFNA 2VJMB 2HSEA 2C3PA 4G5SA 1HH4A 4KPUB 3U7QA 4LY3A 4IQFA 4HQRA 1YR8A 1KF0A 1JNXX 3R75A 2AKYA 2ZBPA 3O7WA 5EUCA 2ZI9A 4IZHA 2LCQA 4MA0A 1YV9A 2AMLA 5KC8A 5FBKA 3A11A 4Q1EA 1X39A 4LCJA 2Z95A 1UZLA 4NXNB 2WIFA 3MPOA 3KSAC 2H3EA 2G5TA 1FSGA 1VSTA 4Z4FA 1EX9A 5C8XA 2QJWA 3DDCA 2ZXUA 4U3JB 4RXTA 4YCBA 3TNYA 3R7LA 3ZV5A 4TMZA 4F8JA 4QEDA 3VQTA 4BE7B 1ABEA 2JJ2A 4R8VA 3H1PA 4WXPA 1TJ3A 4JI1B 3CZRA 3ELBA 5DF1A 3V4ZA 1DDIA 1J1ZA 1NOJA 2WAXA 3KVRA 4IGAA 1E64A 3KRTA 1CUHA 1B7GO 4Q9DA 3KQLA 1N6LA 1AF4A 3DDUA 5K6TA 5K4GA 4FMDF 3TUIC 4TYYA 2HTEA 1C0EA 4LW8A 1WY5A 1Q7CA 2H1HA 2O5VA 5HMMA 2X0DA 2PWZA 4GRAA 3RTBA 3W6PA 1S02A 1Y4ZA 5IVKA 4L5AA 2QM3A 5DE3A 4DILA 1VGQA 3RHSA 5T7BA 3N05A 1O6CA 3NLLA 4MV1A 5FWDA 4F2PA 2F8TA 4YI5A 3WQRA 1YR2A 2QTCA 4IIXA 4HEA1 3RS9A 5C1OA 2IUSA 1S8AA 2X3UA 5KVCA 1H3EA 3GP8A 1KO7A 2B7LA 1TA9A 3UMFA 2KQUA 3HVRA 3QEKA 1T34A 2NU9B 2QVGA 1U3WA 2ZKIA 1YWGO 1TECE 3PYLA 2YXEA 5JZVA 5G3ZA 4KPEC 1KYXA 3NWBA 4L8FA 5AUQA 1WUJS 1UZMA 2PDAA 1N3BA 2P9YA 2VYVA 3RVSA 3H5LA 1R18A 1YVDA 1FUEA 1NXQA 5ENDA 3U7HB 2EG5A 1YBMA 4RHTA 2IV2X 5EMLA 4OQ4A 4LSMA 4ZHSA 2WU3A 1YE5A 4QARA 3EY9A 3TTYA 3BJMA 2HCJB 3VNVA 4F3KA 3LWZA 2VQDA 3GRKA 3RRYA 1E3WB 2EEPA 1R5OA 5AI9A 3NXKA 1PWYE 1DG1G 3AR8A 4Y2VA 1COWA 1F3LA 1TEXA 1TO1E 2HDNB 3D4LA 3GRFA 4PLYA 2ZI4A 5FPHA 4CGYA 3ETGA 4RH0A 1Z2OX 3VPAA 1PR5A 4ARUA 3CF4A 1UM9A 4KMMA 3WMRA 2JATA 4MQFB 3JQFA 3MCZA 3UFXB 1R0LA 1T4CA 1XJ0A 2AOTB 2FWRA 2HXGA 3R5KA 4M99A 3V2IA 5BMVA 4UEQA 3PI6A 3QMMA 4ADSG 3FSGA 4YR9A 1CUBA 4LQ4A 2R6HA 1NSYA 2WZCA 5TPZD 3ZHOA 4ER7A 4J2TA 3SNHA 4NMXB 4QQRA 5TMEA 2J1LA 1DDOA 1X1EA 1ZD2P 2I9PA 4IKOA 2WTNA 2OZKA 3GNQA 2OD9A 2OYSA 2XMSA 4JJ6A 3LWBA 4OUDB 4QGFA 2B99A 3Q3GE 4A92A 4EVQA 3F8WA 5FI5A 2ZR9A 4HPJB 4YJ3B 3LA8A 4EYOA 5L4SA 5CHYA 2YJ3A 4Q16A 3CKKA 2H85A 1XVVA 2G28A 3EIUA 3RHFA 4C0SA 5JZOA 3JRWA 1NVUQ 1F6WA 2PJZA 1LS1A 3DP9A 3L07A 4KU4A 2BP7A 4FTWA 3JRXA 4QL3A 3FCAA 1I3OA 3K92A 3NHKA 2WICA 3IXQA 2PD4A 4RK6A 2BFBA 1M74A 2HRBA 2HOQA 1RLIA 3D1VA 1TMKA 3H2JA 3PDJA 4MS4B 5H8WA 3U44B 2GFIA 2K2WA 5IRCD 4U0KA 1WDLA 2B21A 5JS8A 1RI1A 1LK0A 3D8UA 4HXGA 1NHWA 3KJQA 1ZOLA 4OQPA 1JU9A 5EIOA 5IHXA 4F6LA 1S2DA 1VL5A 4WCVA 6Q21A 3MGKA 4FB4A 5FP0A 2QUIA 3SJAA 3JQRA 2XUIA 3FCUB 5C3UA 1SHKA 2WWTA 4YUXA 1A2BA 1NW7A 1RI2A 1B0PA 1QAQA 1A95A 2E82A 3FPJA 3L40A 4B84A 8ATCA 1O0CA 1ISPA 1F2VA 2FW6A 2FTKE 3GWGA 1JDVA 2IXEA 3RW9A 4I4IA 4A4DA 4BMDA 3FTFA 1MOQA 1TCAA 1F7VA 3EFEA 2DUMA 2GZ3A 1QHHA 2JVKA 2V1UA 4ZZ2A 1XRJA 1AUOA 1Z4NA 4RHUA 1TCCA 2IKQA 2J0UB 4KAAA 4IIHA 1GPWB 2DETA 1TKCA 3AY6A 1NM5A 4V02A 1WUHS 1GGNA 3RSQA 1ONBA 3V7FA 3SMVA 2NMVA 1MJFA 3S5UA 3ILXA 1N78A 3IURA 3KJFA 1YQGA 2WT4A 3CE6A 2H1LA 4BNDB 1A8SA 3DBLB 2FP4B 1EE9A 3CC8A 4O2AF 4RSHA 2A0WA 3NV9A 1MZPA 1YZTA 3IP3A 3VR4A 5JISA 3BUSA 3ZWKA 2AFHB 4XIIA 2HLPA 4J29A 4MLZA 4RPGA 2XECA 4HX5A 1P7WA 1H2WA 5DYTA 1F8XA 2R9VA 2XIJA 4M87A 2ORWA 5IC6A 5LOVF 5BN4B 3MQ2A 1BE8A 1F0PA 3E70C 4WZBA 2D00A 2CNDA 1K98A 1VA4A 2PUJA 1DKLA 4RO0A 3ODGA 1XJ5A 1NBAA 3ZDCA 1E7YA 3PHLA 4GLOA 4R3NA 4PXYA 4BNHA 1NQXA 2RGUA 3B9BA 5DM2A 2QW0X 1J42A 3V32A 1WB9A 3OEED 2XGSA 4UNNA 3H5OA 5DRTA 2YL2A 2I8AA 3O74A 4I7EA 4JUCA 3CLTD 1ISFA 3I01A 2Z6AA 2WVAA 1IXYA 1B6GA 1LVHA 3UA3A 3SZOA 4MARA 4POOA 2PGNA 1K27A 4NECA 1TM5E 1X7YB 3GQBA 2A5YB 3BEDA 4X8HA 5E7QA 4DEVA 3BHMA 3L1KA 1G2OA 3RFUA 4UTVA 5EXTA 3H16A 4Z9FA 4OO3A 5HYVA 4C2UA 5TS2A 2OQ2A 2QT0A 2C7BA 2EFYA 1QF7A 4WGFA 3V8VA 3AF5A 3DBOB 4LCEA 4DR5B 3FWNA 4M54A 4X60A 5JJKA 5KYYA 3LGAA 3D0RA 3V2HA 2RMKA 1OBCA 3EGEA 4AMGA 4F6CA 1ZC3A 2LV8A 4CNBA 2HMTA 5IHPA 4J2HA 1KJ9A 3NIGB 3N2GB 2WSBA 3UAXA 1LSUA 4CEJB 4MYUA 4IHAA 2R8XA 2A9KA 1JFSA 1W59A 3BFJA 3C14C 1HL3A 1UQRA 3BVPA 3EEQA 4FYJA 4GW3A 3SF8B 4AMZA 4TYNA 4QOJA 5AK5A 1VL2A 4E4TA 4RSMA 2ZCUA 3VZRA 1FVOA 4TMVA 2V55B 3OPYA 2FI1A 5EJFA 1GFWA 2W6ID 4C7KA 2RH8A 4C0JA 5JJLA 2GEFA 5I7VA 1MORA 1RMTA 3V4RA 4UDXX 1QZZA 1EG7A 5WRFA 3MWFA 3DZHA 4X61A 1UPBA 1EG2A 2HJHA 3HBAA 5CLHA 3VZPA 4HNTA 1YR9A 2DCUA 3P9IA 1R6XA 4IDNA 3IPRA 2N46A 3EDOA 3PKJA 2GPWA 4P58A 4RK1A 1DAEA 1K3FA 3K5HA 2R7NA 2XNDA 4XR9A 4QO7A 3B6IA 5E9QA 2NUAB 1NPYA 5GJBA 3ASVA 2BOVA 3B2NA 3O0TA 2RHMA 5K0EA 3B12A 4LJ5A 2A7QA 4TLAA 4AECA 1SOMA 1EDOA 1IY8A 3LPAA 3S1SA 4Z99A 2IZ7A 1ZJYA 4EGFA 2VQEB 2V7QD 2Y2UA 2JGAA 1RWXA 2R0QC 4TSFD 2A86A 1ND6A 4LDQA 3LPMA 2AR0A 4ZVTA 4B3SB 2IUEA 1RMQA 3CS3A 1JG6A 3I5MA 5HDBB 4B5LA 1UC4B 4B71A 5K99A 5L40A 3F5QA 3PYXA 4QIHA 5BNTA 4NFYA 1O0BA 1T25A 1X87A 2P27A 3W2HA 3Q6IA 4UBMA 4GPIB 4XGRA 4F2WA 2GZ1A 4LISA 2HCFA 1B3RA 2VN8A 4BVBA 3I83A 3B8EA 4US0R 1E7SA 2O1SA 3W8DA 1NUHA 2A30A 1PO7A 1KY3A 1YJXA 4G0YA 4JJ4A 4RDIA 3X44A 2Q3BA 5DT2A 1LW7A 2B2XA 2AW5A 3COYA 1XX6A 3AJDA 4MVJP 3L6BA 3LCMA 3FUWA 4CM8A 1Z12A 4II2A 1NX9A 1VG1A 1X13A 1FZTA 4OHXA 2ZDGA 4FSHA 1USWA 2IHNA 1B8VA 1TA0A 1Q16A 2YR0A 5AR1A 4F3NA 5AI0A 2NO1A 1A5AB 5AM2A 1ADYA 2ZJBA 3PE3A 2CW5A 2EJWA 3LC1O 3L46A 4IY1A 4PYNA 4Q4HB 4L3WA 3RS4A 1NV9A 4UTRA 2RH9B 3UXEA 1V9LA 5TMDA 1ZD4A 3QPAA 4Y1GA 5I01A 5AFSA 2KWIA 4K7JA 2EFJA 2ROQA 4MNTA 5HE9A 1YKGA 2C1EA 4TYPA 4RFVA 5TV2A 3PEWA 3R5JA 4C4AA 2I3BA 5A4FS 2GARA 4PZZA 1SBTA 3WK8A 4TLDA 2FUNB 4WXRA 1NBEA 2WPDA 1BEUB 2JI9A 1B0ZA 1AVTA 2BKXA 5JS6A 2DB3A 1ODTC 2GBGA 3F9RA 1Z0KA 3P0IA 2YJZA 4LXTA 4J0DA 4TQ9A 4LY0A 5AVYA 4BPBA 1SUFA 3H4VA 1YAJA 3CNQS 4E30A 1KNQA 3RFFA 2AFVA 3VC3A 1Y81A 1EP1B 1NR7A 2M6LA 3OTGA 4RY8A 2XCRB 4NBUA 3MJSA 4GPZA 4I4TB 4D43A 1MJHA 4MK4A 1GT6A 1UMKA 1JHAA 2XQKA 3EARA 3FIJA 4FGZA 1Y9DA 1ZM4A 2H1RA 4QAJA 5IDQA 1SA0B 4B7UA 1B1AA 4IDEA 3TJZA 1U5CA 4ID3A 5TEWA 2FGJA 2VT2A 3K6JA 2W2NA 1QIEA 1JE0A 1S1CA 3R76A 3EIOA 4LC9A 3NANA 2JIRA 5C18A 2ADMA 1BCRB 3KJEA 2QWXA 3Q9NA 2P0EA 1PSDA 2SHKA 3EA0A 3QUQA 2JHPA 3AWDA 5G3YA 1I1NA 1N3IA 4E46A 4Z3KA 3Q8WA 1UT6A 3NDJA 5TMBA 3GJRA 4YRAA 5GVRA 1PD1A 2FRDC 2WTAA 1JIKA 2BKEA 3ZZTA 2ZAMA 4EPYA 3ZD7A 5DBIA 1NUAA 1YS1X 2NTVA 1Q0QA 3WWYA 1PHPA 1LA2A 1QRDA 1WXIA 4M8SA 4XA8A 1JG3A 3TCNA 1VSVA 2QG6A 4A3SA 1SUEA 3L0BA 4RFSA 4EW3A 1EP2B 2JDIA 2QPOA 4LOKA 5DCYA 4ZAYA 1XN1A 1M72A 2FG6C 4RPLA 5JCOC 1X7ZA 1TVEA 3NHBA 5I9BA 3P0EA 1Z62A 1YRLA 4OBEA 1JDNA 5JCOA 2ZIXA 1QMPA 2C96A 4N7BA 2XTZA 3AFGA 2CMHA 5E2BA 1N8SA 5C8VA 2HU2A 1UDRA 3BF7A 4NABA 4EDFA 2HMAA 1M0SA 3HCEA 3KWLA 1FLVA 2BJWA 4BC0A 1ZH0A 1V8PA 2KX7A 2X8BA 3DQPA 4N6NA 4ND2A 1NUTA 3ETDA 3SIWA 1DE0A 1TKAA 4NK4A 2FH5B 4WCFA 3WGGA 4D46A 1SUDA 3GLVA 1KE1A 3D2LA 1B73A 3P8ZA 3T3EA 3ZJUA 3NTRA 4DB2A 2DHDA 5KEIA 3G8AA 1ISMA 2FXIA 2QF7A 5BSRA 3OIWA 4D9IA 4DSAA 3SR4A 3O2JA 4PE5B 3SQOA 1APBA 4Q18A 1T5IA 1KDZA 3TLXA 4BFYA 4BVGA 1AUPA 1M76A 2IHZA 3VYSB 2VEOA 3KCNA 4A23A 2P3LA 4I5IA 1GCOA 1WSWA 1R6DA 1Q77A 4NBSA 3N5CA 1CUXA 5LXTF 3T7JA 5AUNB 2WU1A 1QU3A 1YOBA 2VH1A 3FN4A 3PEVA 3G2PA 1QTIA 1KEUA 2OBFA 5AI5A 6NULA 3PQEA 1EK5A 4FFMA 4F4CA 2J85A 3MSCA 3HYTA 3QFCA 1UH5A 3HYSA 4KPGA 4HLNA 5CT4A 5LBIA 1V7QA 4DHWA 1QPGA 3ZWPA 2VDVE 3FWZA 4U39A 4URZR 3QQ5A 4ZU1X 3RRBA 3WYAA 3SKYA 1TLLA 4CETA 3G82C 1J24A 1RR6A 2IRWA 2PU5A 4HRXA 4NBVA 5JI2E 1GLVA 4M76B 1L4HA 3RUPA 4XB2A 4DJFC 1ECJA 3MQFA 3H87A 1G1MA 1HQCA 3F2IA 3CGWA 1R8SA 4YY3B 1ZK2A 4G0QA 4QXAA 3FG9A 2PIDA 4R7GA 3L5OA 5FOWA 5HX7A 3K09C 4I5DA 4RIIA 3NV7A 4S1OA 2H57A 2GTPA 2XYGA 4UJ3A 5DM70 1WD5A 2XGOA 3DTYA 2VPYA 5EHGA 1JDPA 4U7DA 5CM8B 2I99A 2DFNA 2Q62A 3HJTA 3LOQA 2PH5A 2C4KA 4XM2A 2WK1A 4MW4A 3U48A 4KQEA 1C0IA 4MX8A 4U6QA 5BV2P 1W0JA 3IV7A 2OGZA 3R0VA 4MQEA 3EZ9A 4B2PA 4NRDA 4TX1A 5ALQA 3ZE9A 4FZ3A 4AKSA 4HK4A 1OLOA 2NOAA 4I5EA 5ECWA 4ES6A 5B3LA 1X7WA 4Q03A 2O7SA 5HFNA 2V74B 5T3YA 2OWDA 4OYYA 1UXJA 3E2MA 2IBMA 2EQ5A 3VBEA 3U5TA 1P73A 3NX4A 4RKYA 3W2IA 3GOQA 2EKZA 3BG5A 2FMKA 2XJ9A 1CULC 1E4OA 2MR6A 2H5JA 2GA9A 4UHKA 5JCPA 4KXXA 4BX0A 1O97C 4MPRA 3ZCQA 1OD6A 4AJNA 1GWNA 1L4GA 4X6YA 4ALMA 1MRZA 2AZMA 3VYVA 4CV3A 2AOUA 1WZIA 2GAFA 1VSBA 3D7LA 4AWXA 4V3CA 5JSKA 3IEVA 1Z2NX 2DMRA 2QX6A 4N4AA 1W5EA 4NU0A 4YJFB 1SHTX 1WA5A 1T6BY 3ZUPA 4XE5A 4RD2A 4LI3X 4Q00A 5KWVA 3BRQA 1KJNA 1UAGA 4GC5A 4DDUA 1Q95A 1JKFA 1I5EA 4R2XA 4ZQHA 1JNYA 3W34A 4G8JA 1IZ7A 1U7UA 2I80A 3ZW9A 4WBNB 1I3KA 3FHLA 3BZWA 4GP7A 2QRLA 4JQCA 4WINA 3FOCA 1P6XA 2FZ5A 1U2DC 2XKKA 4EMSA 4BL5A 1KBOA 5JWOA 2X9QA 2AMFA 1M6EX 1HYQA 2WSSD 2REBA 2CNWD 2YC4C 4BNYA 2Q3MA 3AERB 4QC2A 5KYTA 3WJAA 4YAGA 2BMJA 3OLWA 1FJGB 1AQNA 2HUPA 3LX4A 4JUFA 3JATB 1GPBA 1JHZA 4WHMA 5EMHA 2MJLA 3VU1A 4TKUB 4RFLA 1CZHA 3BJZA 4D8YA 1Y37A 2XQIA 5HCIA 2EYUA 3W5IA 2B1GA 5A9SA 2J3IA 1EZ4A 4FYMA 2DUJA 3YASA 3Q85A 5DO9A 1I0LA 2NUBA 4HDSB 2Q6IA 4C7VA 5BSFA 3KTAB 3RIMA 1Y3FE 3M70A 5EUBA 3CJTA 5J5CA 1JKXA 2BDTA 4XFKA 2HJSA 1NE2A 1Y80A 2L82A 5CIQA 1UPCA 1EUYA 3VX3A 1FYXA 4WACA 2P9JA 5CAEB 3SM3A 2WT8A 5DNEA 4WLUA 1M34A 4M9QA 3II6X 5JH7B 2AX4A 5FJIA 3T1VA 3L8MA 3KOOA 1IG0A 4ZFNA 1W52X 4N01A 3RUAA 3Q5DA 1XAGA 3GXBA 4H7IA 2HNKA 2ZYGA 5G1NA 3OX2A 2W5UA 5L3SA 3L6RA 4KE8A 3VR5H 2X7XA 3TQRA 2CJXA 1K88A 3L8EA 4B2YA 1CUSA 1XMSA 1P1BA 1EGQA 4P2BA 1GZSA 2ECPA 3BJEA 3KEOA 3LKBA 4KI7A 1WY7A 3VU0A 1IL0A 5EE5B 5K0BA 3PFNA 3IODA 1Q0LA 2V9ZA 2VCYA 2ZB7A 3EIEA 4EW1A 4OKNA 1BXKA 1CHDA 2B8WA 2XYRA 3SKXA 1IJKA 5NLLA 1RQRA 2VT6A 3I53A 3R7WA 1YS9A 1ZMOA 1Q3HA 2F3UA 5K3CA 2D54A 2G88A 3RRMA 1DIBA 4C0HA 2QQ0A 3UOGA 2IKSA 1CB7A 3U9LA 4B3BA 1PJ4A 3IO3A 3DMHA 1ZRSA 4MGEA 2BFFB 1MRSA 2PFKA 2RGYA 2CJWB 3DDZX 3RFTA 5ADWA 3OF5A 1XVUA 3JZMA 3VU3A 4ZAFA 2ZR7A 3QX9A 1UMDA 1L4YA 3JQAA 4D45A 1OH8A 3A1CA 3UJAA 1E9BA 2VS1A 3VU8A 5MGNA 3PEYA 1IYZA 3D6UA 4KE7A 5FORA 5G0SA 3UENA 1TK2A 2LXNA 5EWJB 3ZLBA 4EQZA 4RCZA 3A6DA 2AZ4A 2ZJAA 1SG6A 1BFDA 2OY0A 3AZPA 4X6LA 3GJTA 2BMWA 3IRVA 2FFQA 3NJ4A 4WKGA 3FUCA 4JOSA 1R5BA 3BL8A 3GRAA 4OHZA 1G55A 5A0VA 1QGUA 1DKRA 3ZI7A 5DH9A 3MYYA 1NRIA 3ORHA 3FKQA 4GOLD 2EJTA 3WWPA 4CI9A 5MDHA 3U7IA 1FFEA 3BICA 2BKUA 3QIVA 4DIBA 2AZXA 3R7NA 2ZM6B 1RAFA 4LCBA 4DV6B 1HYHA 2R5NA 4D42A 1DC6A 2ZBEA 2YIVX 1L8XA 2H48A 3AJRA 5HKOA 3LHSA 5ILOA 2XB9A 4QYMA 2I8CA 4BKMA 5JNSA 5DYIA 1AMUA 3U4GA 3UYLA 3FX2A 4HDRA 4EEZA 3H7AA 1OPRA 4F9EA 5FIUA 3EQ7A 4EMTA 4BQRA 1S2IA 1GL3A 1XKLA 2A0KA 3GMIA 1LLCA 3ILYA 3IQIX 3M6LA 3U3MA 1ITZA 1VE1A 4PZPA 1J90A 5CLFA 1NQ5A 3CBQA 2H59A 3GCWA 4G5XA 3UF0A 1S8FA 4EF4A 1OSNA 1XMQB 1TCVA 5LKAA 4D0LB 4FWBA 2QSZA 1O94A 5IWAB 2Y1LA 5EAIA 1O3YA 5H68A 3KT6A 3Q10A 1Q22A 1P31A 3V1NA 3CB2A 4LE1A 4B4DA 3IESA 3RYCB 1YA6A 1SULA 1I51A 2QD2A 2RARA 4A0FA 3OPXA 5BUZA 5KNCH 16PKA 5CYFA 2B0JA 4LOJA 3QVVA 4UUOA 3V7UA 2O2SA 2J3KA 3U4MA 2QTWB 1XL0A 4D4JA 2O2DA 1NMSA 4BV8A 3NHYA 4ESHA 1TKRA 1EFRD 3B6EA 1AT1A 2O07A 3I4CA 5KTMA 4OA8A 2VBFA 2CHEA 2O8FB 3W3AH 3ZU3A 1BYUA 1KERA 4FFVA 4OX9B 4KODA 2OOKA 3E9RA 3PVCA 4XARA 3RTEA 3S1AA 1OH7A 3EEIA 3I9LA 4FGUA 4PTZA 3L0CA 1TO2E 4NTZA 5ENVA 2NXWA 2SNIE 1B2LA 2FSVA 3GYGA 3L49A 2XCSB 3GJ5A 3O2SB 4FE4A 5I51A 3IIKA 2QOEA 3GLGA 3PEFA 4XIYA 1VBMA 3F9IA 4EFMA 1V6AA 4V2UA 1XTVA 4MR9A 3EC2A 4CFSA 4NMLA 3T9CA 4QECA 4K9DA 5LBUA 4GLJA 1RRVA 2IYXA 5E3IA 3SEQA 5G4KA 3EVFA 1CRLA 2GD1O 3T1YB 2P78A 2YCBA 4BU0A 4MJXA 1PF7E 1T8WA 3VYUB 4RANA 1QE0A 3FYDA 4LV8B 5KMGB 1Y63A 4ZV7A 3QHPA 5BV7A 1XZPA 1I1QB 1GFZA 1HKUA 2VYCA 1JI3A 2GJSA 3F6RA 3K31A 4WXHA 3OESA 3RYHB 3U49A 2P5SA 5IABA 2DERA 4NKRA 3DR5A 4G4JA 2EX0A 2NQ2C 4QFDA 1AQYA 4E51A 4IILA 1ORVA 5K09A 1TM1E 1GXSB 4UATA 5CNMA 2BEWA 1P0CA 1IUPA 3H2HA 3A1FA 3T9BA 3S44A 3CUSA 3NXSA 2VYND 4O63O 4MW5A 4P22A 2ENWA 4YMSA 3MM4A 1FNSA 3GFPA 1L4KA 2FAXA 4RCYA 4R2MA 1DELA 5FWNA 3FCCA 4TLLB 4QVIA 4XB1A