3RVLA

Structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvlA00
2NT4A 1DCMA 2E4UA 3CTPA 1SXIA 1S8NA 3T95A 1TM2A 3BILA 5TQ0B 2X7XA 1VKRA 1QP7A 4N0QA 4JA2A 3QEMB 4KMRA 3LUDA 4XARA 5E3JA 3UK0A 1W9HA 1OXKB 2YHBA 3O2QB 3CLKA 2IPMA 4RXTA 5FWYA 1SXGA 3Q15C 4MR8A 5KQLA 4RK0A 4XFKA 3DGFC 3H1FA 1FSPA 3SAJA 1EWTA 1MAVA 1YIOA 2KYRA 2CD7A 2MYNA 4G0ZA 4F8JA 3I45A 1BVHA 4G0PA 1K66A 5FWXA 4OLBA 4KNYA 1SRRA 5B3JA 4LZLA 4N47A 1EHCA 3H75A 4NICA 3NNNA 3FGZA 1YMVA 1L5YA 3I42A 4MQEA 4QPJC 4RY8A 4TLMB 4F3TA 1E2BA 3N6VA 1Z15A 3A10A 3Q7RA 4YCSA 4YV7A 3H1EA 1I3CA 4RU1A 5TPZA 3HDVA 3DLHA 1XHEA 1ZITA 3ROFA 4Z4GA 4MGEA 2WJAA 3I5AA 4E7OA 1ZH4A 3HK2A 4HNSA 4N41A 4MAAA 3IPCA 3MIZA 4G0XA 1GLGA 4KVFA 2B1JA 3OQOA 3KJXA 5D2CA 3H5VA 3O1HB 5DTEA 1YTUA 2QVCA 3GYBA 2PLNA 5EWLA 4Z4HA 5EWMA 1EAYA 2PUBA 2MYUA 2V0NA 4EVRA 3OQMA 3NHZA 5F64A 4RY9A 4N76A 6CHYA 3RVNA 3JVIA 1APBA 3CRNA 4DQDA 2VYCA 4GNRA 1R8JA 4D6YA 2PMCA 5GOTA 5I4CA 4JP1A 1JFTA 3OM0A 3VNAA 5HSGA 4XXHA 1QPZA 1RZRD 2IPNA 3TX6A 2GBPA 3VNBA 4Y9TA 2P4UA 1FFSA 3G85A 5FBHA 4WUTA 3O1IC 1KMIY 4MLDA 4MPTA 1JX6A 4WXMA 1DBWA 2VUIB 4O1HA 4B09A 4M88A 3BREA 2WMYA 4W5NA 4MRMA 2J48A 2WY2D 3GWGA 4MR9B 1NXSA 3O75A 4JASB 3CS3A 5HQJA 3HSYA 3M9XA 1NY5A 1BDJA 1QNLA 5C5EA 2FN9A 4EGSA 2QSJA 4RKQA 1FQWA 2VK2A 5KC8A 1XHFA 2FSPA 3H6GA 1QQBA 3IPAA 1RPJA 3D02A 1UDRA 4IILA 4HYEA 1Z25A 1DC7A 1KGSA 3QX9A 2XDYA 1Z2EA 3IP6A 3QELB 1ZN2A 3OLXA 2QZJA 1CEYA 4P1ZA 1E6MA 4PYRA 4XASA 4YGXB 3OO0A 2R47A 8ABPA 4IMIB 1M5UA 3KKEA 3KG2A 3EULA 1VLZA 3DBIA 1PUXA 2WJWA 4EVQA 2CWDA 3EAFA 3HXMA 1TJYA 1D1PA 2QU7A 3C3MA 3EQ2A 3N0WA 3S99A 4G0QA 4XLTA 3B2NA 3LKBA 4MQFB 1C0EA 3LUGA 3OMXA 3HZHA 1JFVA 1USGA 2F8TA 3QLVA 4MS4A 2RJNA 3LMKA 3OM1A 1T34A 2DRIA 3EQZA 3NBMA 1AB5A 3Q41A 3ILHA 3M6MD 1JH9A 1K68A 5KQPA 3QK7A 2JVKA 3H6HA 4LRQA 3P9YA 4RV5A 3DZDA 4RZSA 3F73A 4G97A 3FMVA 1DBPA 2IYNA 5FWYB 3CG0A 1XWWA 2P9HA 1ABFA 4RK6A 2A9PA 1EFAA 4MLCA 1W25A 3TMYA 4KPYA 4Q6WA 2LP4Y 4RY0A 3KLNA 5KWSA 1RZRA 4PE5B 1YVUA 3HO1A 3HCWA 4FE7A 3RVSA 3MA0A 3D8UA 3BBLA 1OXBB 1ZGZA 2GX6A 4EY3A 2H3HA 4Z4FA 5CNJA 1LBHA 3TO5A 3CG4A 3FFXA 1JDPA 1NXPA 2JBAA 3GA5A 2RJOA 1DZ3A 5IULC 2H0AA 5TPWA 1DBQA 4KQCA 1USIA 1WETA 3H5IA 4KREA 1YK1A 5ED4A 4YLEA 1P8AA 1D4ZA 5HKOA 1PEYA 2A9QA 3UUGA 1A2OA 1JYEA 1DRJA 3OO1A 4JOQA 2QVGA 4YO7A 5BR1A 1U0SY 2IDMA 4IMJB 1CYEA 1D2AA 1QQAA 1BA2A 2O20A 7ABPA 3LOPA 3KYIB 1NXVA 6ABPA 4F12A 2LIVA 1P2FA 4NV3A 3ROTA 5KQMA 1VRVA 1USKA 4W5TA 2MSLA 5IBQA 1Z16A 3EODA 4MS1B 3UKJA 2HSGA 1H9CA 3QLUA 3HEBA 4S05A 2PL1A 9ABPA 3HJFA 3C3WA 5JS1A 5TQJA 5T7BA 3LUCA 4OBBA 2A9RA 4N0PA 2FXIA 5TQ0A 3KYJB 4D74A 4Z9BA 4OLAA 3QEMA 4KK4A 5TE9A 1IIBA 2FQYA 4WXEA 3RVOA 4EVSA 4ZMSA 1DP4A 3TD9A 4YRZA 4OG2A 1QP0A 5C5CA 3T8YA 3GBVA 3Q7SA 3R0JA 3KHTA 5CHYA 4LDAA 1DC8A 4H3KB 4W5QA 4H3HB 4Z0NA 2W42A 3I09A 1Z17A 2PUAA 3SM9A 1Z13A 4G86A 3HS3A 3KTOA 1Y1LA 2NT3A 2WB4A 1PEAA 4O1IA 1NXWA 4DN6A 4Z4CA 2LUOA 1MIHA 5DCLA 3CNBA 4MR7B 4PICA 4MS3A 2PL9A 4EUKA 2E4ZA 2LPMA 4RXMA 3SNKA 2CHEA 4IF4A 3GBPA 1JL3A 1AB6A 1NATA 4ZPJA 3N53A 4YP9A 3M9WA 1QP4A 2I6FA 4YR7A 3H5WA 4PZ0A 3RVKA 2QW1A 3KSMA 2JK1A 2WRZA 2Q5CA 2GWRA 1QKKA 3JVDA 1TLFA 2HQOA 3JY6A 2PUCA 1DJMA 2FVYA 3N75A 5EWJB 2FEPA 1BDIA 1JFSA 2L18A 4JAVC 4LDZA 2FEWB 4RXUA 2RDMA 4D6XA 5PNTA 3ILYA 2ZWMA 2R48A 1QO0D 1QMPA 2HQBA 2LBPA 4MYRA 1JLKA 3Q9SA 3A0UA 1TMYA 3O1JC 2GI4A 1RXIA 1MB0A 2NUBA 4KV7A 3HUUA 2PUGA 3FFWA 5JNVA 5ABPA 4L85A 1KRWA 1D5WA 1E6KA 5TQ2A 1ZESA 3DGEC 4ZMRA 3GL9A 4RK7A 4QYWA 3HV2A 2FTKE 2JVIA 1A04A 4P98A 2B4AA 4ETMA 1DG9A 2YHAA 3A0RB 3JPWA 4L4UA 2RGYA 3E3MA 5IX8A 2HQRA 2VUHB 4MR9A 4Q6BA 1M2FA 3W9SA 4HNQA 5TPZD 1E6LA 3F7NA 3OLWA 2FLWA 4G0MA 4LE1A 1J56A 5KC9A 4UHKA 3CU5A 3HVRA 3BRSA 5HM6A 2ZAYA 1GUBA 3RVMA 5T3YA 1JWLA 5CNIA 5DGCA 2PUDA 2E4XA 4MR8B 4Q7EA 4TMYA 5TPWB 1DRKA 1GCGA 2JVJA 3JTEA 3OLZA 1YMUA 4YS6A 3T6KA 1L5ZA 4F11A 1MVOA 2NZUG 4YWHA 2FN8A 2IPLA 4RDCA 3O2JA 4Z4IA 4RK4A 2FMKA 4KZKA 2ID7A 5FWXB 5JNRA 4EYQA 4RK1A 4MQEB 2PUFA 4EYGA 2QR3A 5JNUA 2IOYA 2L19A 3K9CA 3LUHA 5JNTA 4S04A 3OQNA 3LUAA 2PE5A 2IKSA 2MSKA 4IRXA 3C3KA 1ABEA 1C4WA 4MQFA 1F51E 3IP9A 4RKRA 3L6UA 3T38A 2FKAA 3F6PA 4NCAA 3LUKA 4Z99A 2FMIA 5BRJA 4XAQA 1ZVVA 2AYXA 4JB2A 2E4YA 2R25B 3NHMA 1NXOA 4ZYLA 5JNSA 5EWLB 5EWMB 1ZGGA 2CHFA 1SD5A 2PAFA 3LKVA 3C6QA 4W5RA 4G0YA 3RVPA 1B00A 3GT7A 1KRXA 2A9OA 4HNRA 3H5OA 1M2EA 1QO0A 4RK5A 5DKFA 1ZHHA 1JF8A 4NQRA 4TN5A 4ETNA 3N0XA 3QLVC 1P6UA 2N9UA 3KLOA 1LJUA 4ML3A 3CHYA 4NCBA 5IUKC 5KI6A 4RSMA 5BQ3A 4TLLB 4Z9AA 1LBIA 3E61A 5DLEA 3CFYA 1MB3A 1U2QA 2M1ZA 5KQGA 5IUJC 4MS3B 4MRMB 4IGAA 5IEJA 4OATA 2PUEA 3L49A 1GCAA 4F06A 2IPAB 1JBEA 3RVJA 3JS5A 3HDGA 3O21A 1U2PA 1BAPA 3KS9A 1D1QA 3NNDA 3RH0A 3LUJA 2L2QA 5JS2A 1TVMA 1YK0A 1U04A 2GKGA 3IP7A 3RVLA 4LE2A 2QXYA 2HJ9A 2M98A 2JCGA 3SQNA 3O2SB 1PNTA 4FB4A 4KRFA 2FW0A 5GQSA 1EWKA 3K4HA 5B3JC 1ZH2A 3LUFA 4RS3A 3LTEA 5CNMA 4W5OA 4MS1A 3CZ5A 1GUDA 3HM9A 4CBVA 2E4VA 3MYYA 5IEBA 2OQRA 1FFWA 5TQ2B 1ISRA 1ZY2A 2NZVG 2MYPA 3A3KA 5IUNC 3FFTA 4ETIA 4PEVA 2MYTA 3OMWA 3H5LA 1EWVA 2WWVD 4E7PA 2TMYA 1NTRA 2FQWA 2FLKA 1Z12A 1RNLA 3N0RA 5FBKA 4KFCA 1JYFA 3QLUC 4MS4B 3QEKA 2JB9A 3URMA 1PNRA 2FQXA 4DADA 2R4QA 3QX8A 3C97A 5IC5A 1URPA 3GRCA 3MMNA 2MSWA 3H1GA 2FMHA 3JPYA 1ZAYA 4UHJA 3GV0A 3F6CA 3SY8A 3CKMA 1JHZA 4QYMA 2HPHA 4WT7A 4ZJPA 4EYOA 4KQ9A 1YS6A 1Z18A 3MM4A 4N03A 4EYKA 1LK0A 2QV0A 4MR7A 3TB6A 1A0OA 2PKXA 4O5AA 3HUTA 3IDOA 4QICA 4WZZA 3RQIA 2E4WA 3G1WA 3BRQA 1HEYA 3OLVA 3RVQA 2L17A 1ZDMA 3KCNA 4LX8A 1FFGA 5JNWA 4LE0A 1F4VA 5CNKA 2JBAB 4RWEA 3DLBA 1BDHA 2PJUA 3EDCA 3NNSA 4G0OA 1M5TA 3QLTA 3EJWA 3FDFA 5BRAA 1DCKA 1YS7A 3QELA 2F8SA 1JDNA 3EGCA 2ID9A 4OTZA 2OENG 5EWJA 2BGGA 4WWHA 3N8IA 1U8TA 3RVRA 1LJLA 4Z4EA 1Z2DA 1NXXA 2JRLA 3MQ4A 3LFTA 3OLYA 1P6QA 3SG0A 2AYZA 3O74A 4FE4A 3IP5A 3H5TA 4KK3A 4GPAA 3Q7TA 1CHNA 1PHRA 4H60A 1DCFA 2FMFA 1VPWA 2FEKA 3CZCA 3MF4A 4JB0A 1ISSA 1Z26A 1SXHA 1RXEA 1NXTA
chains in the Genus database with same CATH superfamily
5FORA 1E8MA 1KI9A 4A23A 1TM2A 5IVIA 3ZNNA 1QK5A 4DLPA 4LC1A 2P30A 4KHPB 4BVGA 4B81A 3OKPA 3ZW7A 2F1KA 2NG1A 1U3UA 3U3ZA 3FGNA 5CCXA 1Q57A 5CBPB 2X0NA 1KSHA 2BFFB 3EWIA 3TBKA 3V2GA 5I9LA 1MNQA 5DASA 2W37A 3DGFC 3GB9A 4G63A 5AW9A 3RUAA 4O3MA 9MHTA 1H8HD 1QHYA 5CH5A 5EXEA 5I4BA 1ZL2A 4X5OA 1YF3A 1P5ZB 2J0UB 4X6XA 4YRFA 1C1DA 1XNGA 2QHXA 4QLBA 3NETA 1QAQA 2IH4A 1F17A 1NASA 1L5NA 1SRRA 4BVFA 4KNYA 2ASEA 5FUVA 4PYIA 3MWKA 4GNKA 4EUSA 5HS4A 2W98A 3DKVA 2PXCA 5AKJA 1SXJC 1NVTA 4TYPA 2JAWA 4EDHA 4H59A 2DUJA 3K2IA 4ALJA 2YY5A 3HSSA 1RDFA 1ZZGA 3IJEB 4PNPA 1XHEA 3ROFA 4C4XA 5JROA 3VNVA 3FKQA 1V96A 2ZBDA 1T1EA 1Y5LA 3D5TA 3DO5A 3GEEA 3L7OA 4L8VA 4KXVA 5LD2B 4PCVA 2AFIA 2HXYA 1PDVA 4MAAA 4PR0A 2VDPB 4YJDA 3RUHA 2BTOA 2FOIA 5LYJF 3G0DA 3KJXA 3SS9X 4J07A 3JWIA 5KU7A 4U3JA 7REQB 4RV9A 1OWLA 4Y6LA 2BI8A 2WTMA 1EAYA 3HL0A 4FGLA 4MRNA 1YQWA 5G40A 4Z4HA 3QKRA 3GI1A 5FHRA 3SYKA 3GRAA 1NV9A 4HLQB 4C5AA 2OECA 2QSYA 2RCYA 3TUIC 4LDNA 1UXIA 1F8GA 2G80A 1K98A 4LXYA 2NTVA 1U3TA 9LDBA 2GCOB 4AKHA 2YWHA 3KPJA 2AD5A 4YJ2B 5TT0A 1OT5A 3BKWA 5A5FA 2V7WA 1JFTA 3ROKA 3L5KA 4GBGA 3PJGA 3UVEA 1R9GA 1QE3A 5JYDA 421PA 1LZLA 1QPZA 1KFBB 2XXAB 5EG5A 3VNBA 2QROA 5ENZA 5EJ4A 1EVJA 2FETA 3QLJA 4G07A 1JLLB 1EUCA 3FPSA 4UARA 2GTHA 1MORA 1V1MA 4XH9B 1SUPA 3D3JA 4J9UE 4DR2B 2XZPA 3AUXA 4U7TB 1P0MA 4MPTA 4FFBB 3STHA 2WJPA 3OEYA 1I5RA 3BREA 1LZKA 4QXAA 4M4SA 1TJ3A 3HCPA 2AJ8A 4UU0A 2IPXA 3Q9LA 4XVCA 3HKEB 1EWYA 4P5PA 4X61A 4EO4A 3GGOA 2Y1OA 1N8TA 3LUBA 2VDWA 1N1DA 4YRMA 5I51A 3H19A 3PC3A 1S3FA 3B38A 4CJXA 5CDGA 4RKQA 3QEOA 2QLJA 3F4BA 2FPLA 3DV0B 3FBTA 3EAQA 3EOZA 2IL1A 1IUKA 1VE9A 3HCBA 4KDEA 4W7HA 5C81A 3A58B 3PPXA 2V6FA 4ARUA 1QQBA 3KB6A 1A4XA 1EB8A 2NNWB 1DZIA 3DVRX 3AUJB 1N2EA 2PJDA 4URVR 4LCEA 1T2VA 1MPTA 1V7QA 1GR0A 2G67A 1T1GA 1IWPB 1ZNYA 1YAHA 4J0DA 1L4NA 1Z33A 2FEXA 3S1LA 5EZ6B 3RU2A 8ABPA 2FEOA 2B35A 3K4PA 3W4IA 5K8CA 1I0IA 3P0RA 4Y2YA 4DLVA 2W11A 3BBPA 1GFIA 1N4AA 4BNDA 5AVSA 3A6PC 4EJ0A 4NYIR 1QHFA 3EAFA 4F2WA 1SUSA 5TV2A 1GG2A 4KH0A 6ADHA 3UAVA 3H86A 1AS0A 2B1GA 2UDPA 3JARA 3KNZA 4YJ3A 3GT0A 1Y8ZA 1WXWA 1Z4PX 3L7NA 5BW6B 2B4QA 4X91A 1U9IC 5EC8A 2GFQA 2P1RA 1XRRA 3UJ3X 2C2ZA 2RGRA 4Q47A 2WG0A 4BNGA 5PGMA 1RI4A 4D57A 3TRKA 2BCEA 3HBMA 3INGA 1ORWA 3COWA 3CUUA 4GM4A 4LV8B 5ITWA 3FMVA 3E2MA 3IPXA 1RPAA 2HLHA 4D9GA 4DWWA 1W25A 4GE3A 4EY7A 4A73A 1IG3A 3F2IA 1P60A 3L0SA 3CSSA 3GLGA 1BRTA 3RKRA 4M0PA 4GS5A 4AWBA 1IOWA 4FX2A 4U7HA 1JLMA 3N8GA 4LTMA 1W1UA 2JGDA 1UBEA 2XH8A 3NAQA 3ESXA 5FYDA 2SKCA 4DDWA 3GFSA 1W59A 3O0DA 1R27A 4C21A 3U44B 3E7XA 5BN4A 3FUWA 1O57A 2JBAA 4HF7A 4K3UA 4CT4B 1MQSA 3W90A 5TARA 2VA8A 3SMQA 3ZG6A 3VR1A 3I5UA 2ISSD 3N5CA 3ZR4B 3L8GA 2I6GA 4ZCLA 4ALMA 4AN0A 3EVTA 3MCTA 2IF2A 4NNOA 2JKYA 2P4QA 2WSIA 4BEVA 1LWOA 1TMKA 4DQ0A 5BR1A 1ST2A 2OCPA 5BMVA 2C83A 3JXEA 3TLYA 3LBFA 5CD1A 3TQOA 3OOHA 2REOA 3DBLA 1Z0UA 3LOPA 3RWMB 2R97A 2YYAA 3KYIB 4LCBA 3E9NA 4OIFA 3RYTC 2H7VA 2X1MA 1P8JA 2AK2A 1NI3A 4H1VA 5J5VA 5CB4B 3HO6A 1CB0A 4L2IA 4ZQFA 2WG2A 4XEUA 3IAM1 1XXLA 1Z28A 3B9RA 4M1MA 4MW6A 4BFCA 1SQ0A 4P7FA 1WZEA 4P3XA 1L5LA 2C58A 4H4EA 1NYLA 1AKYA 3MGGA 1ORRA 5ALTA 1M72A 2PL1A 3GFVA 3P2IA 2HU5A 4FW9A 4CV0A 4DG9A 4H0NA 4R81A 1FYVA 5A4MS 3X1KA 5HQ3B 1GPAA 2G5GX 4Z9BA 2EKLA 4OP1A 2OA0A 2QL7A 3PQEA 2C99A 1KI8A 4P53A 3SJCA 1JQDA 3NGXA 4HNVA 1DP4A 2QTWB 1TEXA 4O2AB 3KTDA 1F14A 2R5NA 3IQXA 3MD9A 3NOQA 5G4KA 3CRW1 3DOJA 4C2BA 4QPDA 3GBVA 1B7GO 1QV7A 3KOZA 1HE8B 4KO8A 4CTNA 3TF5A 2CNWA 3VOBA 1BVUA 1MVLA 1UJNA 3OE5A 3O8OA 3RIGA 3T52A 1A9ZA 3OCCA 3VVBA 3ZKAA 4ARAA 3SHOA 1AZLA 3V7YA 4K9RA 1S8AA 2NXNA 3AL3A 2BKXA 3HQ4O 1W2HA 3BL5A 3TCNA 4Z4CA 1ETUA 4MB6A 2I34A 2B94A 3GT3A 1Q50A 4MR7B 2YDXA 1IB0A 4OHPA 2ZI6A 3QEJA 5DYNA 4GEKA 3CZAA 4YAOA 5AYVA 2ATXA 3IJ5A 4C7KA 2CHQA 2DKFA 5KSOA 3HJRA 2I6TA 1Z5GA 2DM6A 4IRUB 1JR3D 1NRIA 3EHEA 5EXDA 2ZJ7A 4H6PA 4HEHA 4JVMA 3WLNA 2I6FA 4KVZA 3CRVA 5WRFA 4A8TA 4YB8A 1CP2A 3Q9NA 3SFVA 1AG9A 3V9PA 5EJIA 5CIYA 1BVYF 4OJKA 1XMSA 4KRGA 3KSMA 2W70A 1YI0A 2A0KA 3EEOA 2WRZA 2ON6A 4NCHA 1JXOA 1S5PA 2ONZA 5BXYA 2XCLA 3DSRA 4LNUA 3QX3A 2W5UA 1ETHA 1GKUB 4RCZA 4HGQA 1FRNA 4JNCA 1QH0A 1Z3IX 2GPBA 2VHJA 4V0LA 2FEPA 1BOFA 2ONYA 3NS7A 1N6PA 4WL0A 1H4QA 2B82A 1ZS9A 5I48A 4RANA 2I3GA 1G8HA 4CM6A 5JI2E 4RHFA 5EMMA 5KTTA 1DMRA 2PVPA 3OIGA 1W93A 3NASA 4WESA 3PT9A 2C0CA 1A7KA 1NAHA 4I6GA 2GPAA 1TMYA 4FR0A 4ND3A 1XA4A 4DNPA 3AOEA 5ALJA 2WF6A 5HUQA 1T5IA 1KVRA 3CO5A 1WXXA 3G5MA 5EIAA 2BSXA 1E6CA 4NOJA 1N5RA 4JT8A 5E6SA 4YN3A 5TQ2A 3VU0A 3KP1A 2V7QA 5H68A 3WIEA 4TKUB 1YZKA 5F7JA 5C8YB 2I2WA 3FRHA 4JJAA 3IB6A 3QKSA 4G5XA 5AICA 3U40A 1R88A 3UWMA 4GXQA 5BURA 2A5LA 1FZTA 1F7UA 2DULA 1WQ1R 4ZOBA 1I01A 1JDBB 3LA8A 4QHYA 1ECCA 2OTCA 3WIUA 1QYWA 4QXQA 1U7OA 4EA8A 4Y2SA 4Q66C 1ORHA 1XLTA 1L4YA 2WYIA 4L78A 4KXFB 1U3CA 4NU0A 5EIFA 2JFZA 2VAWA 2GLTA 5DGCA 2ZCVA 5FTLA 2I80A 1QRSA 1V16A 1DDIA 1JP7A 1RJ9B 1TCBA 1IJBA 2I29A 5JV5A 3IBSA 4YS6A 5FRDA 4YJKA 2OP0A 4LSMA 4B2IA 1OGYA 2JIPA 3UXHA 1F5SA 2Q4RA 5U4XA 4JN6B 1M34E 4IDNA 4CLDA 2WM9B 2XADA 3BCHA 4PANA 4Z3DA 4FSXA 3VUFA 3VPFA 4ONEA 4DGQA 4EMUA 1XR3A 4IJQA 2R6DA 4Z8YA 4EL0A 1JG7A 5T64A 1GEGA 3M4JA 3SPXA 1AHPA 4UM7A 3CVUA 1HNXB 3R6DA 1XRLA 2WJIA 2ZFUA 2ZYIA 4TXMA 3E4DA 5MN6A 2FPIA 4PHTA 4YXWD 5JPCA 4H9GA 3MFQA 2M6RA 3PJDA 2EJVA 3L6UA 3C4JA 2JNWA 5AXCA 1A82A 3F6PA 4IV8A 3W5DA 3AVYA 3E18A 1W36B 1JB9A 2CNDA 1ODKA 1YFZA 3GLIA 3NHMA 2RE8A 3FGPA 2YJTD 3K9WA 4R98A 1NR5A 5CFMA 5EWMB 2WHQA 2WPNA 2RI1A 1J20A 1NAIA 2GK6A 1Y37A 4W5RA 5D5PA 4YJ3F 2A9OA 2NZJA 4E5PA 2I9PA 3B3AA 1M2EA 2OCYC 4BGEA 4G81A 4AWAA 1AT1A 4E13A 1Y4AE 3NJRA 4JI7B 3M7IA 2PD3A 4DLSA 3AEXA 3QLVC 2JLAA 4S0XA 1EZ4A 4AM8A 3HKBB 3L01A 2Q1UA 4HAXA 5BYKA 3RYCA 2VQEB 3DEKA 1JIXA 4MUEA 4XB6B 5JZ9A 4M37A 3EGIA 2VKTA 2RGNA 4KGVA 1MOZA 4M54A 5BYJA 3ZGLA 5GGXA 3WJ1A 2E0IA 2X9VA 2O8FB 1O94D 1FSFA 4L5JA 3WB2A 1JKJB 3E8SA 3M2PA 5DF1A 3WJ7A 1K1EA 3OZGA 3KAPA 1PR5A 3VNQA 3ZU3A 4B3HA 1EM6A 4LDJA 1QX4A 1UJ2A 4BNKA 2J9ZB 4FYJA 4I4LA 4QGBA 2WIAA 4TZ6A 4MRMB 3QA3E 2J3KA 4ZOQI 3W1WA 3ZJ5A 3Q3HA 1G2IA 2NYVA 4FEEA 1G1AA 4A0FA 2HH9A 2ECKA 3CJTA 5I7WA 1QFSA 5LBIA 3WLAA 4CRWB 2H1OA 1S3IA 4FYMA 1FDOA 3B2QA 3KS9A 3BTVA 3IUNA 2ID8A 3NBQA 1KE2A 4II7A 4EHLA 2D3TA 3AETA 2WQZA 2RHGB 3HU1A 3LH5A 5BV8A 2PLAA 3IOMA 1XVUA 1OXSC 4OKSA 3WYCA 4MUYA 4GL2A 4MW4A 4ZTZB 3N2KA 4NZ9A 4M86A 4XUDA 1AZTA 1ZICA 2XXJA 3C3EA 3A3PA 3FHCB 3GPDG 3QY0A 4YMSA 2MSNA 1DBIA 1SQSA 1NXQA 4IIJA 1UOEA 1BVRA 1JWAB 2R3SA 4NV0A 1JQAA 5CMLA 5CNMA 5BMVF 5JWHA 1UKVY 4RVFA 1LKZA 1ENZA 4QC2A 1JSLA 1MIOB 1F60A 1CR4A 2ZIAA 5DI3B 2GTPA 1FYDA 1FNNA 2WVAA 1N2IA 1OASA 3FTQA 2FX3A 3B13B 2NZVG 4LRTB 4TKVA 1I7SB 1K4KA 3I6ZA 3KJFA 5JT1A 3E15A 5KX5B 4DV5B 3NATA 1P4RA 4BNHA 1NTRA 2AWOA 4CIWA 3F6BX 4N4AA 4MLPA 1V39A 1KMHA 2YNMC 4DUGD 4WDRA 3URMA 1GSAA 2I54A 3BRWA 4Q02A 1RYHA 3PDWA 3M49A 4M9XA 5EN4A 1O87A 1OAOC 2PSSA 1MU0A 3BMOB 3KSRA 3SFZA 1R15A 2NSDA 2R7LA 3DUFB 2R86A 3GO4A 1HTWA 4GOKA 2AEEA 3GWZA 5TMEA 1X7GA 2J41A 4M0FA 4ZJPA 2DR2A 5JXHA 3A9RA 5K4HA 3BB1A 1DI0A 1ZBQA 3A9TA 3WRXC 1JAZA 3DC2A 1B1AA 4KE9A 3S1AB 2N46A 3PK0A 4QUHA 4DQKA 4MRVA 3E1SA 2F4VB 5F4ZA 1FTWA 2XTJA 1A2BA 3CNOA 3VHQA 4E3ZA 1VGRA 2L17A 5G02A 3P9KA 3RVQA 3P9SA 1ACMA 4D5GA 3IOEA 4GPBA 2IYTA 4J3FA 5BOSA 1UK9A 2CL0X 1YFJA 2BV3A 1PKXA 3FNEA 4EKNB 1J99A 4M7RA 4ZCSA 4IEIA 4X97A 3USCS 2HEGA 3BE5A 5K8JB 3H1AA 3I0ZA 1QX3A 4GXRA 4JJIA 4ZCIA 1RZ3A 4V1CA 2DMRA 3KV3O 1YWGO 4QBIA 1YBHA 1ODTC 1YR1A 3AR9A 3NDJA 1VKOA 1ZI6A 2FPMA 1XCGB 1ZNWA 2QY6A 3DDWA 3HKDA 4U6QA 2GH1A 1X74A 1XIVA 3VH2A 4BS9A 1SM4A 4XGNA 1PFUA 4RIFA 3L04A 4JYBA 4L22A 4AJKA 2AYZA 3ZV3A 2O0LA 3K0CA 4JU9A 5DFAA 1SAYA 3S1SA 1JHRA 1CHNA 1N6KA 1OX6A 2H2GA 1Y8QB 2NZWA 2PXHA 3FDJA 3PF9A 4L0CA 1P61B 2ENWA 4FD2A 3SLKA 1Z4OA 4K0RA 2HA5A 3RFFA 1EVZA 1VLLA 5EP4A 1RXEA 3RYFB 4BP1A 1IHOA 1IN7A 1GPKA 1V1RA 3H11B 4GEGA 4DWJA 3AJRA 4ASUA 4B48A 2YVAA 1SFRA 2QJTA 3BXFA 4N0QA 2YWRA 3IMEA 4KMRA 1E20A 1OJ7A 1T13A 5GY7A 3KAJA 1Z6YA 3UY4A 4BX8A 4TMVA 1G4UR 4MUBA 3V34A 1K7SN 3GJ3A 2OL4A 4I5FA 5FBQB 3FJ1A 2DQKA 2WUEA 3DMRA 3CR8A 4JR2A 1SCBA 4JLBA 2Y0CA 1MLDA 4XYBA 5BSMA 1ZJYA 2ANCA 3VR0A 1Y1PA 3THXA 4AZSA 2FE1A 1JHAA 3K05A 1HTTA 3A05A 4EF5A 4IXTA 5EFZA 1WV1A 2A57A 2HWKA 3PHJA 4B44A 4EPRA 1OB2A 1NMEA 1PGOA 2PCJA 3A10A 4M76B 2BCGY 3VPXA 3B7PA 2QVBA 2CHVA 4OHCA 1OBVA 4RU1A 1N5MA 1A5ZA 1U2DA 3T9AA 2GVNA 3CNQS 3HDTA 5ITVA 3G0BA 3I5AA 3PIIA 2XX3A 3Q3IA 1HOTA 1SOUA 3DOIA 5EJ9A 1JZSA 1YU6A 2XV1A 1CFZA 4KVFA 1GRVA 1NOIA 1E63A 1Q91A 3W78A 4CIBA 5KYTA 2K2QB 1YTUA 1Y33E 3GMTA 2DTDA 2DAPA 5G3YA 4BAUA 1TA4A 1VDZA 3H0EA 1V8PA 3ZXXA 3R40A 1ZMXA 3KVNA 2X5NA 4LJYA 4D3ZA 2OCLA 4V0QA 2OCBA 3KUCA 5FADA 4KACA 6PFKA 3EZLA 3PS9A 1EUYA 3HXKA 1WY7A 3HBJA 3KHUA 5AK0A 2GASA 5AVJA 4UFNA 3O3OB 1N6RA 2UVDA 2Y1LA 3QWAA 2V6GA 3ZDZB 4DIOA 2DH6A 3WAGA 5CYOA 3Q5GA 3WGTA 4Z54A 1UT6A 2A5JA 4G26A 4EHJA 4FCTA 3TW6A 1NL3A 1WZIA 2Y1KA 1RXSA 3JAWA 4XB2A 4X20A 1GZ7A 2OB1A 4ZRNA 5AQ1A 1FFSA 3DLAA 4RZIA 3AR2A 3KR9A 3CEMA 3G0OA 3NDPA 4HDQB 2CYCA 4DV7B 1KC1A 5E4TA 2QM8A 3T7SA 1YZLA 4M88A 2NTEA 3K09C 4P35A 3REOA 3RR2A 3VR4A 3VR5D 4AIIA 2EHJA 3V5NA 4PQFA 5KTNA 4RADA 1G3QA 2XNHA 1I6KA 1NNUA 3EZXA 1WPGA 5A1TA 1C3JA 5FUQA 2XAUA 4G56A 4HDRB 1YT5A 3ZVMA 1O0CA 1JDUA 1QKIA 4GZ6A 1T29A 2QSJA 3B6MA 4CL8A 5A9SB 3GYGA 3EVGA 2VK2A 5ESXA 4CIAA 1K7FB 4K7JA 1SUIA 4FOTA 1KJWA 4ZAGA 1K5HA 3WGKA 4DCMA 1LGYA 5IC6A 1FMCA 3U0VA 3U9SA 5A9RA 1R0XA 2X1VA 3S8MA 2P9EA 4HN4B 4PYOA 3WWPA 4CKBA 4AMUA 5JSZA 1NUQA 4MA4A 1U2ZA 3H05A 2GXQA 1AJEA 2WYOA 3ZHCA 2P1DA 1GFWA 3AY3A 3FKJA 5AM0A 4IKPA 3FLEA 3UKOA 2C4MA 3HJUA 3MD0A 2IOQA 1NVWQ 3FXAA 4NCXA 2JCBA 3QFSA 4A82A 1GZSA 3QMWA 4CFZA 4XSGA 1RR6A 3MRXA 5EJFA 3NAGA 4PCUA 1YVEI 1RWXA 4XD7D 5AI9A 6REQA 3Q8KA 1TJYA 1V7ZA 4OQLA 5JSUA 3HDJA 3NT2A 3BZBA 2PS9A 4JGBA 4HTFA 4QLOA 3TG2A 2IY9A 3A7EA 2R8PA 1FP2A 3UYLA 4B3IA 1HZZA 3MPUA 2W00A 2ZWAA 1S1CA 4D46A 3OMXA 2NU7B 4UHDA 4IIJF 2Z04A 1D0IA 2PA0A 2BFNA 4ZT3A 4FLMA 1T34A 3EQZA 3NBMA 2ZI5A 4LTDA 1PEDA 1TTPB 4DGSA 1D09A 3DFKA 1Z36A 3MSXA 4O8CA 1TJNA 1GQFA 3LCCA 3T7KA 3R7AA 3UWDA 4FWTA 1X77A 1YZVA 1E9BA 4DDHA 2IYNA 5FULA 3EWSA 4RK6A 3QTBA 1IBLB 1NP6A 1QIHA 1DJNA 1RHMA 2YQ4A 2ETVA 3EIXA 1ULAA 2E7ZA 3DONA 4UUMA 3D4IA 3VU3A 5ED0A 4HB0A 3EW7A 1YQUA 4FE7A 4OGFA 3TXXA 4JL6A 4B4VA 5KYXB 1VHQA 4F0JA 5KKAA 4TSFD 2GX6A 5IBRA 5EL0A 5CNJA 4MDYA 3TO5A 2WPDA 1GPNA 4IXDA 2WTAA 3W6PA 5JSYA 3CSUA 5CDFE 2J9RA 3H4MA 2JFUA 3GR6A 4XX0B 1Q0LA 5SYNA 5A02A 1F6DA 1E5XA 4DLWA 1VTKA 4U2BA 1O4VA 1F7VA 3C74A 1WP4A 1FDUA 3KEMA 3WG9A 1YDHA 2JG3A 1HFWA 1AMUA 1H2BA 4IWYA 4Y98A 3DVAB 4RQUA 5KDOA 4B3RB 1EIZA 1XTUA 3L2OB 4QUIA 3ETCA 5F9HA 5BSWA 4FS3A 4KFSA 1A7AA 1H0SA 1O6ZA 4IMJB 4CV3A 4TWJA 1TTHA 3D8SA 1NQVA 3ZLUA 3NMUF 1SKAA 3M4XA 2G9ZA 3BQNB 3JYOA 3AUKA 4XPIB 3ZI0A 2X8WA 3MJHA 3QKUA 2J85A 2QYSA 2UUOA 1CTQA 3OKCA 2LIVA 1AKRA 4LCJA 3BD9A 2DX7A 3GRUA 1NRJB 3TIGA 2UUPA 4M1QA 4W5TA 3HYLA 4XOUA 5ECGC 4BY9E 5GJVC 4J1TA 2YFYA 2R84A 4EEZA 2HDWA 4OI4A 4G8CA 1HQYE 1YSCA 4IH1A 4J0EA 4ZVMA 1TKRA 1JT9A 3TQFA 4URWR 1N8SA 4RPCA 3MLBA 1JPJA 1E3MA 1YBMA 5FI3A 3CNNA 2D2FA 4I9UA 1HLFA 5ERGB 3V4VB 2P0YA 1Z38A 4IZOA 1Z2OX 1I9CA 3IDFA 1GQSA 1RM5A 3PP8A 4IDQA 1GT6A 1P73A 1Q7EA 1RQXA 3HVIA 4U2KA 2O3UA 3ZDAA 2QY9A 4X1KB 4YK7A 2J9FA 5J5CA 1GARA 2VDWB 4DREA 4BO8A 3IXLA 4J1NA 5B2ZA 3RVBA 3PEFA 2XB6A 2ZKLA 5BUQA 2CMKA 3JQ9C 2PQ0A 5FYQA 1Z13A 3ETLA 4O5OA 3WNQA 2IYQA 2VSQA 3O4IA 3NTRA 1LDBA 3T54A 1C1XA 3E1GA 3M5CA 3R3JA 5FPPA 4M99A 1EX9A 2NSYA 2W2TA 3D7MA 3EZNA 4HLUC 4XJVA 3T1OA 1Q19A 1H2RS 1YKGA 4MI3A 2O48X 4ZCQA 1JU4A 4H6VA 1I2ZA 3RAGA 5GIPE 2YRWA 3CISA 4C2AA 1Z4KA 2GEKA 1BE1A 3QFHA 2WQ7A 4O1MA 1T8YA 4U7PB 3UGTA 3VHXA 3U09A 3NGMA 3R7DA 1WHTB 3ZH2A 4MI9A 1CJKC 1I1HA 4KXYA 2ZUWA 1TYEB 1MENA 3GJSA 3NORA 1M66A 2YJNA 2PMKA 2VPXA 1QKKA 4CCWA 3G2NA 1II9A 3QYAA 1KMCA 1Z6TA 5DWVA 3A11A 1W4LA 2D0DA 4ERXA 2VDUE 5FWAA 1Y9AA 3G7SA 2RGWA 5H4GA 3D8RA 2X2FA 2RJ3A 2Z8YM 1MMFB 2OVFA 2VRCA 3F96A 4D6XA 5LP1A 4K9PA 1THGA 3VNRA 3QE3A 2HQBA 3DL0A 3M70A 1UC9A 2C98A 2LBPA 2QE7A 4GVPA 1E5VA 1MC5A 1WHSB 1ZGCA 2JPDA 3RFCA 1BFDA 4A9AA 2GI4A 2IGBA 1RVV1 4TVKA 2O0MA 4ZOLB 1BFUA 4MV9A 2FSHA 5CJ2A 3TVTA 4YAJA 5JNVA 3EEYA 4EHHA 4FVTA 5I7UA 2ZR9A 2Q3MA 1RFLA 4S1WA 3LT4A 4CR7A 2A35A 1E9FA 2G77B 4C9BA 2IOFK 4JI0B 5G4LA 3UWKA 3ZUPA 1VKHA 2RGYA 3I4CA 2O2DA 2F3QA 2QU8A 5BT8A 3EX7C 3U7RA 2D6FA 4D9NA 1EIWA 2FLWA 4DCTA 2JGDB 2V4MA 3O4FA 4BO6A 4HUTA 3RYIB 1YI1A 2ZJ6A 5T4FA 3CWQA 2ZYHA 3IJRA 4OUDA 1GN8A 3LPNA 4DCCA 2E21A 1PZXA 2HMUA 1X7HA 3WKCA 3L06A 5AXBA 1RI2A 2IW1A 1JSXA 4TMYA 3F8SA 1QTQA 3LL7A 3D3NA 3OLZA 3LQQA 2ORIA 3NYQA 5LN1A 4FQ8A 5FPSA 3OA0A 2V55B 2FMKA 2PLFA 3BIXA 5AUPB 3WRVA 1HE1C 3G82C 4WBSA 5JWRA 2P0AA 3H9JA 3F6EX 3D4PA 4UMFA 4ITRC 5L3QA 2QUIA 4B33A 2JGNA 5CB6A 4EEKA 2PQMA 1KMQA 4J43A 3WL4A 1H1DA 1N0IA 2DWCA 1BHQ1 1EVKA 4PYNA 4UDYX 3AG5A 2WJYA 2CBGA 4MCJA 4DS3A 1HE3A 1WB5A 3LPLA 3E05A 4XVRA 4AZ3A 4BNMA 5GVSA 3CH7A 1GITA 1QYDA 1SQGA 1MA0A 4LHWA 3S2YA 1RWVA 1KWGA 4Q19A 3EXIB 4C78A 4PG5A 1T5DX 2AYXA 1EPUA 1X92A 4A0SA 2R25B 3O3MB 2AG5A 4ZHSA 2H59A 3D81A 3Q7EA 4XJXA 1L7EA 1XU7A 5JCJA 4AF6A 2ADFA 3RS2A 3OC0A 1BCSB 4CTOA 1J2UA 1N2HA 4NZPA 4F96A 4TVSA 2Q2OA 3PIDA 1MQ8B 2HPAA 2VHQA 1LVHA 3SYLA 4IKOA 4TMZA 4BRZA 1LLCA 5DGDA 4QG3A 2FRDC 3H5OA 1QO0A 3VPSA 3ESQA 4C4YA 4YRGA 2Z8YA 4ETNA 1YDMA 3GLHB 3N0XA 3OESA 5ALLA 3EF3A 4IZIA 5G4KB 3W6ZA 4C3OB 2UXBB 3RTGA 3DR5A 5F51A 3B1XA 4G4SO 2MCFA 2C5FA 4HEA6 5AI5A 5IKMA 5DLYA 2CDRA 1HFJA 3IODA 4M9CA 5DTMA 4UDOA 5JJIA 4WK2B 2RHJA 1Q3HA 2B6HA 4WLUA 4XLZA 5KQSA 2TYSB 4XPZA 3UMVA 1G8SA 1Y3BE 4UM8B 5ARDA 4YAUA 1UZAA 4IGAA 4K8RB 2BP7A 3FSRA 3OPMA 4EKDA 1I24A 3HA5A 3JQFA 4HO1X 2JD2A 5GTDA 4EUHA 3W5CA 2YN0A 1FP4A 1OTHA 2C7GA 1U2PA 2J33A 1ZSYA 2XT0A 1FA9A 1N3BA 3K5HA 5BORA 1ZOPA 2ZJ2A 4LOLA 2YKGA 2ZJ0A 3DYVA 4KRXA 3OX3A 3VUEA 2PWBA 3AP3A 2ET6A 5C1BA 2AJDA 2QZ9A 2W2QA 2WWHA 3BICA 4I1IA 3EBOA 4LE2A 1SUEA 2QQFA 5L9AA 5M7EA 4S1NA 1MJHA 3U3KA 4XM1A 2CLIB 4LN1A 3HYNA 1OCEA 4F5ZA 1JEOA 4IH4A 1V5GA 2ATEA 3WGUA 5GONA 5KSZA 1NSTA 1SC3A 3F3KA 2V7GA 1DKQA 2PX5A 4KN6A 2F55A 2IS6A 4D45A 2DUWA 3NM4A 4BUJA 2HNAA 2ZSKA 2BGKA 2IIQA 1GUDA 1TIKA 3JASB 3A3OA 3FYUC 4KN5A 4P58A 3AWDA 5ALNA 5E6SB 1SG9A 4HVTA 5TQ2B 3IVXA 3LO5A 2NZ8A 4W8OA 3FFTA 3UTCA 4C04A 2RB5A 4PEVA 1YCGA 1ID1A 1EWVA 4YCDA 1WCYA 4QVGA 5DK4A 4P9NA 1TGVA 3AM1A 2VQ6A 2ZSHA 1TYDE 3DOCA 4EW1A 2XCTB 1YQDA 5JPDA 2VDNB 5HDQA 1XQ1A 3L79A 4FONA 3IP1A 4DADA 1M34A 2YINC 3EBLA 4OHUA 2EZTA 1TZKA 1ODJA 1YB4A 4HDSA 3QYFA 1J22A 5HIJA 3BOSA 1NBHA 2QNBA 2B8JA 3K9BA 1Q2XA 5BUCA 3I30X 3W3AA 3ZDBA 3C2QA 1ITZA 5AI0A 2ZREA 3BB3A 1SVKA 1JTFA 3UJ6A 3AFGA 2AF3C 3R5FA 4K86A 4DJJA 3N86A 3R09A 2JFHA 1VPEA 3FF1A 5IHPA 1HYGA 2G1AA 1UXKA 2KMLA 2Y6VA 4MPPA 3K35A 3HLTA 4BBAA 2ZYVX 1ACJA 3HB5X 4PRKA 2MJLA 4JUAA 4KXNA 1NMZA 1GNLA 1UBRS 5CLIA 1XCLA 3U13A 3PKIA 2WYUA 3ADKA 3G49A 3T4EA 5JNWA 1YIDA 3LVBA 2D1TA 2ZVQX 1HE5A 1WOYA 2BGUA 2XMCA 3B7GA 3SVZA 3UV3A 5ADUS 3MCZA 2HMWA 3NNSA 4R8MA 4G2TA 5D85A 4ZJUA 2AV6A 1DCKA 4F7WA 2NPOA 2CLOB 5KTMA 1S7GA 3AUAA 3C3JA 1XPOA 3NDBB 1XCJA 3V1LA 4D44A 4WWHA 2ZUUA 4MPRA 4MHOA 4J3NA 3GLIB 1SD1A 2BHNA 3AVWA 4N3AA 1NC1A 3HWWA 4O8ZA 3USES 3DTVA 5KSPA 4PXYA 3AFOA 1BSVA 2HY7A 4WPGA 4GLJA 3GJQA 5D5HA 4DDUA 3ZE0B 2WMOB 5CDSA 1QG6A 2AJCA 4MP3A 5I8ZA 1TKCA 1MJNA 2X3YA 3NBYC 4XM0A 4TSRA 3ZVRA 1PHRA 1GGEA 1MF7A 1PQWA 3IAUA 2E2WA 4H6XA 4F3NA 5FTMA 2QVXX 1DQSA 3AYXB 3JWEA 4X44A 3W7VA 3AKYA 1F8UA 5BQPA 4X62B 4TS3A 4UKDA 5HF8A 1V9CA 1U7TA 1GQ2A 5KWSA 4BFYA 5KYUB 4ZAXA 1O96B 1JEYA 1L7DA 3LZCA 5EMJA 3PPWA 5EZQA 1CULC 2QTGA 5AW7A 4ODIA 1YL7A 1YR2A 2YJ6A 2Z2JA 4EKIA 4QYIA 3O2QB 1DT5A 4MYSA 2ERCA 3IELA 4CKCB 3KQVA 5LJIA 5DX1A 5JJCA 2V6MA 4ABTA 2J3HA 4YJGA 2HXGA 3ZPXA 1TU3A 3NM6B 4B3DA 1XTQA 4Y30A 4F8JA 1DHTA 1LLDA 1HT3A 3DAGA 2H1VA 3N07A 3SJZA 4QPZA 1R0YA 2V7UA 2RK4A 5EKUA 2R5FA 4KQKA 3GGCA 1ISGA 1IHPA 4YEDA 2XGGA 1PQYA 2QGZA 1FBNA 4QPJC 4RESA 4BASA 3W6NA 2AZXA 4KNWA 4MJXA 4TQAA 4DCVA 1K97A 3I6MA 4ZT7A 5BWNA 2ZU6A 1XRPA 5DRTA 5IFLA 3AL0C 3N2KB 2D1RA 5DNDA 3TSWA 2L82A 1OUMA 1A8QA 3AF1A 4Q15A 5D01A 5A3JA 1F48A 4D97A 5JTUA 3KYCB 3LNCA 4JJ4A 5FV4A 3BMNB 3HZZA 3KU4A 5EUCA 4G0XA 4GGOA 1E1QA 3BX1A 3ZHYA 5HCUA 5LLTA 1VMDA 2C1ZA 3M5PA 4NBKA 2QBYA 1R1DA 5FLYA 3KKNA 3OIWA 1N7GA 3A1NA 3B1ZA 2HYDA 3OJFA 3OX2A 3PNSA 5EWLA 5H70A 4DG5A 4A2QA 5I6DA 1T8UA 1MEOA 4KWCA 4PV7A 3NVKI 2F3SA 5F64A 3LY5A 3TR0A 4HEJA 4GQBA 4CT0A 4N76A 1QFJA 1LPBB 4FYXA 4J91A 4L8LA 1GYQA 1QPBA 3EN0A 4JI6B 3EIFA 3D6TB 3JQ8B 5EQJB 1XQWA 3ZQUA 2O52A 2GDJA 1TLTA 2WFZA 3CLVA 4RMIA 4LFAB 5T3UA 1JFFA 3PFFA 5BUSA 2GR9A 3DLPX 5NULA 4BNXA 2I3BA 3TBHA 1ZXXA 2B4RO 2NXJA 4KR6A 1ULSA 1J0CA 3E1KA 5AKGA 3QH4A 1Y1SA 2ZBUA 2V5AA 5EHGA 4JQOA 3HXQA 1L4FA 1IK4A 1VG0B 3BH7A 3QE0A 1RWKA 1XKQA 4TLBA 2RBKA 2WHRA 3KBBA 4WUTA 4YQEA 3AB7A 3A1UA 4N9QA 4YC7A 5BRNA 4ARSA 2DB3A 4B09A 2BFCA 3DMPA 3OEWA 2X5OA 4K9OA 2IHVA 3B36A 3GWGA 4W6ZA 1K8QA 3O75A 3HSYA 5KWJA 1IE3A 2V45A 3R75A 1YDGA 5FF9A 3UMSA 4DJEC 2JLYA 3SZRA 4R8SA 1Z75A 1Z47A 4RENA 4LX0A 5EUBA 1C3XA 4ZWNA 1USWA 4L5IA 4WCFC 1US8A 3D7RA 4R8VA 4GFDA 2BFEA 1UDRA 1WQ3A 5DNAA 2B7LA 1Z25A 5KJ1A 1D1TA 3TUZC 2KB0A 1JHUA 1CY8A 1HL7A 1ZO8A 1R6VA 4MVJM 1E1RA 3KFLA 1PBTA 4IQGA 2QX6A 2IT1A 2XMSA 3LCRA 1FXUA 3IVMA 3KUXA 4R2KA 4OGWA 2RKOA 3RT7A 2RHBA 1M1XB 1OILA 3EULA 4UVEA 2V6JA 1C0KA 3DEHA 4IJ6A 4DXHA 2IXTA 3N2ZB 3I05A 3SHWA 2DXIA 3HXMA 1AKWA 1JJIA 3BWMA 4ARBA 2A6PA 4YRDA 1J5EB 3KUKA 2PKQO 2PZAA 3D0KA 3OIDA 3VZBA 2ADOA 5GONF 3L6CA 4NS4A 1CQXA 1O3YA 4RIEA 4WADA 2LR0A 3RBZA 3T7DA 4HP8A 2D5AA 4LJAA 4LUCA 4OHOA 2D2IA 1WD5A 4C7XA 2A30A 2WHPB 2ODQA 3UMRA 5HRUA 1WXQA 2GD1O 3IC5A 4URXR 3S2EA 3AY6A 4XIFA 2O19A 2ZIXA 1N8NA 3AL2A 1AE1A 1D0SA 1W29A 2AMVA 4G23A 5HJEA 2V6BA 5F3WB 1Y98A 4ZQIA 3FNIA 4HEQA 2NPFA 3TXAA 4K87A 4ZXFA 4MUMA 2VTDA 4BJ6A 3I9V6 2O8EB 1HORA 3V4FA 4BB0A 2X19A 4ND6A 1GQRA 4PN3A 4P83A 4M22A 1CUFA 3M3DA 1KOGA 4AKIA 5JD3A 1Q7CA 2QP9X 3HMQA 4HVAA 4QBFA 4R41A 2ASVA 3MTEA 2VN8A 4CZ2A 1O9BA 4ES6A 1BXGB 2Z30A 4AXBA 3VR5H 1LBHA 4REMA 1LVGA 1P1CA 1SCNE 3DCIA 5LU8A 2NUTA 2IEDA 1PW7A 2VEDA 1UMBA 2HSEA 3AG6A 3QENA 2MIIA 4EI8A 3A9VA 3GMSA 1TIPA 1FVHA 5F7OA 7GPBA 3BDAA 3EPKA 4QXRA 3UT5A 4BKOA 5DB4A 2JFWA 4EDFA 1E99A 1RWBA 2P5YA 3AONB 1XVVA 4UPDA 3TLEA 3ZDCA 1GGHA 1OFTA 2FSFA 3EFOB 3KVVA 5IH7A 3ZIAA 3NPAA 1DRJA 4V3BA 1PTJC 5P8WA 4C4PA 3W6UA 1XTTA 2EFJA 3CZMA 4RA9A 4YO7A 4KUEA 2ZSFA 3I1IA 3NKFA 4X54A 5E7IA 3GK3A 2EBFX 4EVIA 1VBKA 3LXXA 2Z56A 4DC9A 4BPBA 4MTLA 4ZGGA 2OYRA 4NABA 4CUJA 4PQRA 1F38A 1JVBA 1VP9A 5KWEA 2OV2A 1J1IA 5B1DA 3X1WA 2A4KA 1GUFA 1BXRA 4MVJA 2VNHA 4ZANA 1P2FA 2ODWA 4EPXA 3ETGA 1OFUX 4DRZA 2H65A 1EVQA 2QM3A 2J07A 1PWXA 2GSDA 3JYPA 3MJDA 4IWNA 1RRGA 1USKA 5T5QA 1LRLA 2LW7A 4FFVA 5IBQA 3T9CA 3K1YA 2WZCA 4GWKA 3NJ4A 3QXCA 2QSZA 1A71A 2C7VA 2PCLA 5DW0A 4BU1A 1GDTA 2C31A 2Y93A 3G9TA 3SJ7A 4S05A 4P82A 3JAWB 1PR1A 5TQJA 2OYSA 2HMVA 4ZQEA 1QQ5A 2QVYX 2KW5A 3DP9A 3QF4A 1XN1A 4L8WB 4DHEA 1IY2A 4IXNA 2AN3A 3ENKA 5AK3A 2VC2B 3GAAA 2B2XA 3W1VA 1FQJA 1VKZA 1EG7A 1L5FA 3VVMA 5JANA 2C92A 1C8BA 4WECA 3G23A 1LW7A 3LV8A 4YROA 4CR6A 4EKGA 4FMDF 4KGDA 4P5EA 3TFQA 3KFXA 3C3CA 4KHZA 3KHTA 4E94A 4CMIA 1PR0A 2H2DA 2PN1A 4N8DA 3EF0A 4JBNA 1SKBA 2P35A 2PUAA 5AK5A 4PO9A 4G86A 2AQIA 1M7HA 5HP4A 2ZBEA 4KTVE 4O2BA 3K53A 2DYKA 4GM0A 3KTAB 1G2OA 4JB3A 4DLRA 3D2BA 3VHRA 3ZUGA 2K2WA 2IZ5A 4C0JA 3NT4A 5ESDA 1F20A 2PL9A 3AIIA 5E7QA 1EQ2A 1PEKE 3EXHA 4BO9A 5DYWA 1HDCA 1MUUA 2WSLA 4MMZB 4ZALA 1F0NA 2DBZA 1Y7HA 4M55A 1XKTA 2KJQA 1S2OA 3F3MA 3DQQA 1U7HA 2ZAMA 1ZQ1A 2CHGA 2AF4C 1TVKB 3MILA 3PB3A 4J2OA 2WSSD 1EUQA 1KDOA 1TIBA 4HNAB 2PZBA 2NQ8A 4KDRA 4YRRA 2IZ0A 1F4LA 1XQXA 3FCCA 4G0UA 1UFOA 3JD4A 3TQHA 4GDFA 2JK1A 2Q5CA 1JU9A 2GWRA 3I3SR 4RE5A 2FFRA 3O2NA 4RY2A 4ACAA 5B6JA 3FNHA 4IIEA 3H5RA 1B16A 2VR1A 1ZI8A 1JAIA 3O4HA 4TMXA 2GWHA 2PUCA 1YASA 1UPFA 4M1EA 5EWJB 2I5PO 2O23A 3VTAA 1EUZA 1W0JD 2EJWA 1LK7A 4BN0A 1VBMA 5BPFA 4L3WA 3QIAA 3U4HA 4CEHB 2QR2A 3NALA 4LJ8A 1D6MA 1ZWKA 2HXSA 3ZU6A 3C6MA 5JSKA 1IFXA 3ZDDA 2NQTA 2QRNA 1TM5E 3AHCA 2HBRA 4JGGA 4L85A 2W93A 1RYBA 2H5JA 1T5LA 4G1EB 4UHBA 1XN4A 1RWQA 1NUUA 1X13A 2OAGA 3SMVA 1CYDA 2FR8A 2WKRA 4MAFA 4B3JA 5CDFA 1W8IA 4P98A 4IIXA 2BELA 3IDAA 1GGVA 2GESA 1GL3A 2AI2A 3CZQA 4H4DA 4B2YA 4RSHA 3IKJA 1DMSA 4QXPA 3TGPA 1NFRA 2VUHB 2WYHA 4L5CA 3DFIA 3HBNA 1ZHFA 3ABRB 4UAJA 4BMOB 1FEZA 1KQOA 1WMEA 1BU5A 3A4LA 2W6JD 3CU5A 5H5JA 5HM6A 3RNOA 2C78A 3HVRA 2FSVA 4A03A 1JWLA 1QK4A 4TN1A 1I9GA 1QVAA 3P5BA 4R9RA 4ZQBA 3QGMA 4Z2AA 1K9SA 3RV3A 5JO0A 4KO4S 3BN3A 3UPTA 4FHDA 4QA9A 3V9AA 2I3AA 3D8BA 3GFBA 1EEXB 5LZ7A 4ZVUA 1UCFA 2B21A 2Y1CA 4HB3A 2NVWA 4CF5A 5IK2D 3OA2A 4UU7A 4XB1A 2JFXA 1XZJA 2ZBQA 2QX9A 2M1XA 1KGDA 1O95D 2VEOA 4M87A 1Y3CE 2ZDHA 1U1GA 1O58A 4WVLA 1WDKA 2C4KA 4A7PA 3T15A 1QHIA 4NJOA 1VHJA 2C59A 5GINE 4DMCA 4F85A 2G9VA 1QB8A 3C3KA 4IRXA 2IUTA 1N6NA 4M49A 4S1TA 1NBOA 4MQFA 1GG9A 3D8TA 2R8RA 1JHDA 5HE9A 5C5DA 2ZTMA 4N48A 1J1UA 2D2VA 1Z4MA 1G5QA 1LQTA 4MMYB 1G8JA 3UJHA 1U1DA 4K1XA 3PG5A 1SOVA 2VJDA 4TL9A 4JB2A 1XQ6A 3I04M 5TMPA 1QFMA 3QI2A 2O8NA 5EZYA 1HETA 2IVZA 4DLXA 1ECBA 2OCGA 1EJ6A 1YE8A 5FI1B 2PMFA 2VXCA 3DUWA 3GDGA 3QHPA 4MWDA 4OBXA 3WGMA 5JISA 3QWIA 5JD6A 1JU3A 1RWPA 1KRXA 1GV0A 2WWIA 5KVVA 4YAWA 4OMFG 3Q2IA 2J0SA 1W35A 3IHKA 4LF7B 4M0CA 3LP6A 5AK4A 1R66A 5FL7A 1YQXA 4MV7A 3HU5A 4RV4A 3ZC3A 1NVAA 5F33A 5BW5A 1TC2A 4IFEA 3DW1X 2EKZA 2JW5A 3RAPR 3QVGB 2FCAA 1HQCA 3RM3A 1A1VA 3EGDB 1O03A 2ECPA 1GPBA 1KP3A 4EPWA 2ZYAA 2YHSA 3GRRA 4LHXA 3U39A 1U2QA 4RVSA 4UEKA 1UZNA 1XP5A 1ISJA 3BFJA 3H87A 4XLLA 4Z3KA 4JP3A 4K40A 4MWSA 2AFRA 5D84A 2IPAB 1IY1A 1QYVA 2NYAA 3E3NA 3IUJA 3HM2A 3O21A 4X1YA 4B73A 4OX9B 3RH0A 2OG2A 2I99A 3L7KA 3FCEA 1C7JA 3PTLA 2IU3A 1E4EA 2NADA 1E1DA 4BMZA 5B7NA 2KM1A 3AVVA 2H16A 1JS1X 1YZHA 4FW8A 5HRCA 2K4MA 4YCBA 1IZ8A 3AC0A 4JHLA 4HDMB 4L50A 1TZCA 2I78A 3SQNA 4LNAA 4IXMA 3KYBA 1FNMA 5E9AA 5K0BA 4NZYA 3OJCA 1IEXA 4CVNA 1VSBA 4XTCS 2HHCA 5C4MA 1JDTA 2OHVA 2FPGA 4B35A 2ZWIA 4GBJA 4G5SA 1JHOA 1PI3A 2YJ3A 1M74A 2NYRA 2CVOA 1GPH1 3IILA 3IR6A 2VYFA 5FPTA 1R9MA 3DOFA 1U0JA 4GC5A 4MVJF 3LXUX 9LDTA 2EZ8A 3AKEA 4Q4HA 1XA0A 2QVLA 3HGMA 1XZKA 2Q3JA 1XV5A 3RRMA 5L4LA 4IX9A 4U39A 2JFOA 2V3WA 2EWWA 2NV0A 2FPPA 3NM5A 3WGHA 4B79A 4WTOA 1RNLA 4E0BA 3L6EA 4BL5A 1FSGA 3BORA 1FQOA 3MIIA 3T0FA 1HYQA 3I04A 2BZ0A 4QNMA 4QT4A 3U61B 3RE1A 5GJCA 4GMDA 5DBIA 2ZCJA 4FGJA 4IDEA 4TM8A 3EZYA 1EGAA 2AEFA 3R9IA 4DMFA 1RBMA 5AFSA 3SFTA 3E7DA 3ZQ4A 3PC6A 1YC5A 2PKWA 3K2BA 2DY1A 3U16A 4PNEA 4Y6GB 5JS6A 1QTIA 1DO0A 3ASVA 1NBMD 5FEUA 1YS6A 1Z18A 1BW9A 1SO8A 2IHBA 3PNQA 4LSWA 4KIJA 4YQYA 3RKUA 4YRIA 4E30A 2GEBA 4BNZA 2SCUB 5BNWA 3GJXC 3IDOA 1WB4A 4YDQA 4LXIA 521PA 2BEWA 4WOCA 4HEA1 1KFJB 4CM4B 2DFNA 1ZC3A 1T3ZA 2V7VA 1UIRA 4WZAB 3KCNA 3PDJA 4UBMA 4XWKA 3JQBC 2KE5A 3MW8A 2ACVA 4O2BF 4R9SA 5AKIA 1CD5A 6GPBA 1L4KA 1MV8A 3CLTD 5G1NA 2C9MA 3SEAA 3V3TA 1Q0SA 1Z6ZA 2P6NA 2ZRFA 4BQPA 4HQRA 3E22B 4XFDA 2OENG 4DNOA 2I22A 4PYLA 2QTRA 3KZKA 5LSAA 4LKRA 3TK1A 3EY4A 4WLEA 4GHWA 1XMQB 2FDRA 2BD0A 4Y2GA 3W2TA 3GJ6A 2A33A 2X40A 3BK7A 2GK3A 5JSQA 3WK4A 1EK6A 3IEVA 1CNFA 5AW2A 1Z68A 2PT7A 1ZJWA 4YVFA 1OX4A 4E5NA 4FE4A 1F2TB 3J7TA 2XA1A 3S2UA 2DLCX 3PR2B 4BC1A 4HGZA 1VPWA 2ZW9A 5F12A 3CZCA 4I9HA 4PLFA 3OCXA 2PWPA 4A0HA 3TDMA 1PR2A 1SCUA 2OBBA 5KREA 2WJZB 1XDWA 3H16A 4OHBA 4D4KA 5MN4A 2BJHA 5JRJA 1QP7A 2XNDD 2Y1GA 3UCFA 1HV8A 1N5KA 1J8DA 5CIQA 2FPXA 4D5EA 1OXKB 1ULTA 1Z56C 2CUZA 3CLKA 4OXRA 3SDBA 1VE1A 4XFKA 4B6FA 4BEBA 4UOQA 5DGTA 1MO6A 2IYYA 4DNXA 1J21A 5HXAA 1TD1A 1VL0A 4CCYB 4F4UA 3LXRA 1ZOLA 4G4JA 4KFTA 4NOKA 1MJ5A 3VO9A 2AOTA 3TQSA 3FFBA 2QXUA 4DQLA 1OZ0A 2J0VA 2NP7A 1G6Q1 1M0SA 3FMPB 2C0PA 1FZQA 4QREA 3MYRA 5HIMA 3VZDA 2CXTA 5FP0A 3SYRA 2X0DA 4YV0A 4M38A 3MTJA 1HFKA 5CCBA 4QBGB 3ZHVA 2AMLA 2YXLA 1X15A 4BV3A 5GIOE 1WKCA 3I5XA 2R79A 2QRVA 5JJ5A 1Q0RA 8ATCA 3W5VA 3HK2A 1QYCA 4HNSA 3SYNA 2ZZMA 3COSA 1Q7BA 1C9DB 3L7JA 2PMEA 1K75A 3DTYA 3FVVA 4EHDA 1YQ9A 1OKKA 5K6AC 2IVFA 2XUZA 5AP9A 3C15C 2GAJA 4LOIA 4C0AC 3EG9A 2WU0A 4M8NE 4LF9B 4N3BA 3VU9B 3P9XA 1Y6RA 2G07A 4ZHQB 4QZVA 3OQMA 4RH0A 1QHNA 3PWZA 4UXJA 1DBSA 1E7MA 1YJXA 2GARA 1UANA 1H2AS 2LZ0A 2PRZA 2RC6A 3C6KA 4C05A 2WR8A 2QKYA 3FSGD 3HPRA 3RRFA 1KWKA 2CSXA 2QD4A 1CUBA 4V02A 3VYWA 1NVFA 4DQDA 1E64A 1HF3A 2FRXA 3KJHA 1R8JA 2P79A 3BZUA 4ZVQA 1BJTA 4P0QB 5CW1A 5EZYF 3T3OA 2YL2A 1L4GA 2QE6A 3BSWA 1NJGA 3JD3A 4AMYA 1YO6A 1DXOA 2R751 1QHSA 4C0LA 1OVMA 3WLIA 2IPNA 4N65A 1T43A 2GA8A 2JJ2D 3E9DA 3DMDA 4MKGA 2GBCA 5FKJA 4C6HA 1WIWA 4UTOA 1L8LA 2O2JA 4WXMA 2J46A 1DPFA 2ATCA 3V7FA 4W5NA 5TX7A 4P33A 3OIYA 2J3QA 1E3WB 1KK0A 4KWTA 4MR9B 3VDMA 2Q46A 3IQFA 1MEEA 3WL7A 1SZDA 3BEOA 3ZV4A 4JY7A 4UNRA 4BLVA 4MIYA 3KSAC 2NTJA 1DV2A 2EQ5A 3CEHA 3RHSA 3ZU4A 3LWBA 4L16A 1P72A 3WYGA 2BHTA 2O57A 4HWGA 1FQWA 4BO0A 2H1HA 1XHFA 4JXXA 1MABB 4I8IA 3LX6A 3K70D 3IPAA 4FMCF 1U7UA 1HR0B 2BGIA 2QRMA 3EMBA 1ZSVA 4CG3A 5I7OA 2XDYA 5GADl 5JYCA 3SZOA 1KQFA 3DNMA 1C7RA 1X1RA 3A6KA 2BRUA 1RQNA 3DS8A 4L9SA 1SJ9A 4BAGA 1UFRA 2GZMA 1XBTA 2JIZA 3DTNA 4GXNA 1C3OA 5AVVA 1E3DA 1KAHA 5JALA 2WSBA 1XZPA 1OREA 1KDTA 1U0EA 2E82A 1QAMA 5TNXA 4YAFA 5M29A 4BZQA 4AX4A 1D1PA 1DUIA 1TTTA 4FHGA 5EYPA 4G0QA 2VAPA 4BFLA 1XSEA 1KR2A 2HAEA 3S3TA 4BKRA 5TIIA 1GKLA 2ZB3A 4WKBA 4ZKDA 1FS5A 2ZUEA 2C4NA 4X92A 5DNCA 2BGTA 2Q28A 4F97A 1QWSA 3WSWA 2EBUA 5BSTA 3T5BA 2BEJA 2IHJA 2GRAA 2NSLA 4IQ0A 4KVAA 1USGA 2BGWA 1JEYB 4NMMA 4URZR 1Y9EA 2OEPA 1ZJZA 2HL6A 2Q8QA 4MS4A 1S96A 3Q0IA 4W1PA 2BJWA 1MTOA 3IIKA 2ZJYA 4QQNA 2JGLA 1UDXA 1ICIA 4R1TA 2G0NA 4YH1A 1QG4A 3N0TA 3Q85A 3FN4A 4FFRA 4B8YA 2CL7X 4BNJA 5CEJA 4O25A 2CE7A 1B6TA 1B76A 4ANFA 1DAHA 4BVKA 1MH9A 2A9PA 4OAPA 1ADYA 3HG7A 2ZIZA 3BXGA 3DE4X 4NCJA 3LGXA 4DDTA 3IQIX 4J0FA 4CV2A 1UP7A 1E3QA 4AO8A 5IHXA 4B3TB 3DAYA 4AKEA 1XDZA 4QYSA 2AOVA 2DFKB 3X2FA 1ZIDA 3OQVA 4WBNA 1C8VB 2QN8A 3SR0A 2I6QA 5F9MA 4F3YA 3T7EA 4Z4FA 1H4TA 2DGDA 5FJJA 2IUSA 3CG4A 1CUCA 5F21A 4ND7A 4EJMA 4MK4A 1XAIA 1CLUA 2VSYA 2RJOA 1X19A 2W2LD 4IP0A 1OX5A 1Y89A 2G08A 4HDOB 3WNCA 4RDHA 4DC1A 5DN6D 5DRYA 4PONA 2VPIA 3U4QB 3REQA 2LXNA 2WD7A 2HWUA 4E5DA 1ELOA 1IQUA 2HF9A 2B61A 2VNSA 4TXHA 3T5AA 1IG0A 4CM5A 4MB2A 2F1RA 4K2HA 3WIOA 3X1DA 2M6LA 2EW2A 1P3DA 1RM0A 4OK5A 1BA2A 1W94A 3F6SA 3IBFA 2C29D 7ABPA 4IVQA 4QEKA 1I0LA 4G5RA 3H42B 1NXVA 1MHPA 2BMEA 4JWKA 3GLQA 3KB8A 4ERNA 1E2FA 2QX4A 4EYSA 4DFDA 3KWJA 4D3SA 3W2FA 1CUXA 1NDQA 4LVUA 2CV1A 2BIFA 1GXSB 4LK2A 1R4AA 3MS2A 4NBLA 1EM8A 2G8NA 5B1HA 4RMHA 3WWOA 1I7QB 4KR0A 1ZJ6A 3EODA 3INTA 4GI1A 2VLIA 3ZV6A 4PC7A 1NNEA 2E5WA 4WA7A 2X6QA 2E5FA 3LDFA 4H17A 9ABPA 1CRZA 1Q1BA 2OM2A 1HOXA 2A1TR 1T9GR 1X94A 2FXIA 4RELA 4NFSA 5IANA 1TF2A 1AGYA 3BERA 3TRJA 5CU7A 1OU4A 3DBVO 1BQEA 4JS0A 5C3UA 4ECAA 1N9GB 1WCXA 3HN6A 1X1QA 3E3AA 2PSEA 4W5WA 3VC7A 3HJAA 3WNVA 2IS2A 4HV4A 1UODA 4ILEA 3SZGA 3ZW9A 1P2TA 2H1LA 3DKRA 4FOOA 1SXJD 4NYIQ 1P2GA 5EFOA 2DLNA 3A4TA 3SJUA 1C80A 4XR9A 4UTPA 2ZG6A 2GYYA 1NP3A 3OZVA 1LF0A 4DMMA 4TUYB 2VPTA 1BHJA 1U81A 1Z73A 4MWZA 1KQGA 2XI4A 1AC5A 3I9V1 4O1IA 1Z5PA 2P9GA 5LUBA 4YCMA 2F00A 1BN6A 2LUOA 1XQVA 3C24A 2G72A 1C7FA 2QW8A 1DTSA 2J87A 2LPMA 3L40A 4GRIA 4Z7OB 3KKZA 2CHEA 1QIMA 4BJHB 3OPQA 1K06A 1PBNA 3DNPA 2ZETA 3T5GA 4UE2A 4F93B 1TQ4A 4FYWA 4IBOA 4NPHA 3QHAA 1D3AA 2WU3A 2XKJE 4DV2B 3KIPA 1OY1A 1PFKA 5BPHA 3JQPA 4QQRA 3NEAA 3CPHA 1WULS 3H5WA 3EYWA 1ZLXA 3NOVA 1WV0A 5BT9A 3VTZA 2ZWOA 4E33A 1SXQA 2ODNA 1QO9A 1V9LA 3MT9A 4YP5A 1HLGA 1PTKA 3UENA 4XVUA 1ZONA 4PNZA 5AR1A 3OD1A 1TQHA 1L4EA 1W52X 3WKEA 3RK1A 1PDOA 2BEVB 3DF9A 4RVCA 1SCJA 1R6TA 4KN8A 1FS4A 1JTEA 4OBWA 3D59A 3A1EA 3OCWA 3ZCSA 3U6KA 3N2NA 2FN7A 3F49S 3GVIA 5DBGA 1VSTA 1P0IA 1RXIA 3IGFA 1O5TA 3MJEA 2F1IA 4KV7A 4CQMB 2O1WA 4AECA 1D5WA 2XF8A 3WOHA 4RK7A 2YZ2A 1VCOA 4X94A 1MG0A 2JVIA 3UA3A 3WVNA 5BW8A 5DM60 1YJ8A 3CVXA 2B3DA 4KQFA 4DEXA 1JNYA 5IN4A 3EASA 2X9GA 3WBFA 2KQUA 1BDBA 1S2NA 3BGVA 1Q14A 2CMHA 4WJLA 4DA9A 3P0IA 8OHMA 4KIGA 5C1IA 1RQ7A 2D1SA 2R65A 1D9XA 1Z0KA 1WUIS 2DG2A 1NE2A 4E2FA 2OUIA 3W9YA 1Y9DA 4CUKA 1N2SA 3KX2A 3QNWA 4BLSA 1HG0A 3HABA 4B4KA 3I2YX 5EVCA 4Q7EA 4DZRA 1EVLA 2GAAA 2F43B 5LA6B 2YHIB 5JADA 3E9CA 2DSTA 5EA2A 3H0KA 1GNVA 1ZGJA 1ZVQA 3R77A 1CS0A 1R4NB 2IYEA 5CVVA 1I3LA 3AHEA 1HKHA 4H1UA 5C8VA 5K45A 2GSWA 3ZBQA 1ABBA 1A7JA 5JATA 4CM7A 3H2BA 3L0CA 1H2HA 3OZBA 2DUNA 1PX2A 5FNVA 3S40A 2ZRMA 3G2KA 1KEEA 1E5LA 3VHLB 2I2FA 5HBGA 1K8XB 3BMCB 1XLUA 1B3BA 3R7SA 1J0DA 5B12A 4EMSA 3HXOA 1C9NA 1F51E 1VPVA 2F3PA 4AVYA 4KQ2A 4Z3OA 4P7JA 1CVLA 4KYIB 1F8FA 4NCAA 4KYUA 2XEXA 3R7LA 3IKLA 4X7MA 2G0TA 2HK6A 2QYTA 3AJ9A 3N2LA 3G9QA 4D4HA 2QG9A 1FTGA 1G20E 2PZGA 5F5NA 4F56A 5GP1A 1VHDA 2G83A 4JUDX 4L3VA 4NR0A 2C2BA 3WGOA 5K6TA 1SWVA 2AUNA 2C1XA 3RUFA 5CDYA 2CHFA 2O14A 4MDEA 3MCAA 2E9SA 3IBTA 1ODCA 1IONA 4HNHA 1JXAA 3ZD6A 2QAGA 3HEAA 4AG6A 1X7ZA 2VP6A 3UQZA 2CXHA 3KZNA 1B8UA 1BE0A 2DH5A 1JF8A 1IY9A 4WLVA 1MRNA 2BHLA 4KCGA 4PR3A 4GLLA 1EFPB 3KLOA 4ML3A 2XUIA 1C9EA 4A8JA 2VH2A 1H6CA 3CX4A 3AKZA 3JQGA 1U0NA 2Z9BA 4JI2B 3P9RA 4GPD1 1IPFA 1SEPA 1NT4A 3OVMA 3P9CA 2Y1WA 4GPTA 3ROZA 3KL4A 4FGKA 3SDSA 5L3VA 1MCZA 3HCNA 4AJJA 1Y3FE 4XZ3A 3KAQA 3TJZA 4N3NA 5JECA 2RG1A 1FFYA 4EK9A 4X8HA 4FFDA 2DTXA 2WYWA 4CKYA 3M6IA 4ZQCB 3L49A 1AQUA 1BFKA 4QDZA 5KYVA 3UH1A 3K0EA 3PWKA 4WBNF 5ALGA 4MWBA 4Q93A 5JD5A 5DI9A 1FTNA 2MSDB 2Z2YA 3TLXA 4DM7A 4DTIA 3K6SB 4AY2A 5KNBA 5CVJA 1V8FA 3TW4A 3D3QA 3K73O 4IOMA 2GKSA 1P77A 5LB4A 1EK0A 2GKGA 1IN5A 2J1LA 3KEOA 5E3HA 1ID8A 2GJKA 3OPVA 2SECE 2V97A 3A4MA 4WBXC 1R5BA 3SD7A 3SZ3A 3EJ6A 4R83A 5IDVA 3UMBA 4BO3A 3MRSA 4K0KB 2ZAOA 2RK6A 2GPNA 1V41E 1PNTA 1OQAA 4TQGA 4MJLA 4YT8A 2JLVA 1Q17A 1P1IA 1ZK0A 3FF4A 1IU9A 5AI8A 5JPIA 5B3JC 4MKRA 5GZ1A 5KTKA 1OZFA 2XVXA 3IAEA 2WAYA 2D00A 3SXPA 4B3MB 4HGRA 4DUYB 4IOJA 3VYVA 1ZAKA 4D26A 2VPYA 3AEUB 3ESCA 1E4VA 4C76A 4MHTA 1CUEA 1DKMA 2MYPA 3L9WA 2V59A 3AFNA 5AW5A 1VSQA 2WWVD 5BVHA 1DC4A 4B17A 1O77A 4GX1A 4FT4A 3BXXA 3DEIA 2ZM5A 3AHHA 3ITKA 4K26A 1OI7A 4MDHA 3RBXA 3DH0A 2OXCA 4NCNA 3UK7A 1A7UA 2FUG6 2VRWA 3K9FC 3PUXA 3GRCA 4BQRA 1XU4A 1YQEA 2XQFA 3EZ2A 4V0OA 2YS6A 5BR7A 3GLFE 3A2NA 5ILOA 3X44A 3TEMA 1RAHA 4G67A 4IDOA 1RADA 3I73A 1JI3A 3KQYA 3OFND 2HPVA 2ZDGA 1ZR4A 3E3OA 1PSZA 1RQGA 3R41A 4PX3A 2NU8A 4AJLA 3P9NA 5L3SA 4LJKA 3QJYA 4IHQA 3D3WA 3FX2A 3AEKB 4PTLA 5I9SA 1XJ5A 5JUWA 2BE7A 2ECOA 1IAQA 1EAMA 4KR7A 2OCAA 3NBAA 3MTDA 1KRHA 3ZE6A 1RS0A 5FH9A 1O97C 1U90A 1V6CA 1WM1A 2RGGA 2Y3IA 4HHEA 1KJQA 4G1MB 4HUQB 5CNKA 2QS9A 1BDHA 1QHHA 5F2NA 1L5HB 3OU7A 3H8VA 3OAAA 5B3LA 2ZPUA 2UYQA 2ZPAA 1PJ4A 3GD5A 1BX0A 3PNVA 3F90A 5GZ6A 1HDZA 2AG8A 3EVFA 2PBFA 3EGCA 3H2SA 1CUGA 2EJCA 2EZ9A 3CX8A 4HAYA 2ALJA 2W8BA 3CCBA 4KP7A 2C04A 4UCFA 2GJSA 2E1RA 4Q1VA 2X42A 3S8YA 4ZYWA 1XCOA 2IOHA 3P4YA 1G5TA 4WFQA 4YHHB 4DV1B 1T6ZA 2ZRGA 3TSZA 4PVCA 3X43A 3BCRA 3DO6A 2QRPA 2AKEA 2X76A 2NO7A 1ZG3A 2Q3FA 3OZEA 1DELA 4WD3A 3D6AA 3H4TA 3FPJA 3LO8A 1YJAA 1JEEA 4WY2A 2VP2A 3A4YA 1NUTA 3GUCA 1U4NA 4RFSA 4IHJB 1XPRA 2JDIA 4H7FA 2HHJA 2F8MA 3ZQ6A 5CXQA 4DDVA 1PQ4A 2CWWA 3AOEC 1XMXA 5HG0A 1L5OA 1VL5A 4TRRA 5TXGA 2RBGA 1LB1B 3BUSA 3L46A 4HDNB 3MJTA 4BXOA 4XARA 1MX3A 4OLJA 2IBMA 5IJZA 3A1SA 1E59A 1WU8A 5DEOA 1Z08A 1HURA 1U65A 2YHBA 1VL6A 2EGGA 3OCJA 4R6WA 4TYQA 3DNFA 4XDHA 4MR8A 5AHKA 5J9FA 4BLTA 4CLXA 2WKWA 3EZ9A 4DQVA 1SHKA 2ZROA 3MWJA 4KXLA 4Y9RA 3GGGA 4YUYA 3AFHA 4MIOA 5MHTA 4JX9A 5AIBA 2GZ2A 2Q3CA 4S24A 4X1YB 5EIOA 621PA 3SEZA 2ZRIA 2UYCA 5FWXA 1M6VA 4C6TB 4AX8A 1SKMA 4R2JA 1XTSA 2VJKA 4EUFA 1L5YA 2G82A 3U5ZB 4L5YA 1E2BA 3B6KA 1GPYA 3FCUB 1N6IA 3VKFA 4AFNA 2YCLA 2OK8A 4MV8A 2I2DA 2QT0A 4G25A 4OJMX 3OJOA 2XLBA 4I55B 3P45A 1L7XA 2JATA 4XYEA 4G5YA 3TRIA 4AUNA 1QUFA 3O6VA 1FL9A 2QRUA 4JENA 5J5AA 1T2NA 1DPGA 3CH6A 3PCXA 1FDIA 4LJ7A 2W6QA 1S4QA 1RRFA 4QOHA 2R9VA 2YNMA 5E38A 1LF5A 2VBFA 1DKLA 3CJRA 3HA3A 4UM5A 5FFFA 5FNVF 2P65A 3UBMA 2PUBA 3HN2A 1G3RA 3SQLA 3W5SA 3AHDA 4PBTA 3G59A 3HE3A 2AT1A 1DJOA 4BFZA 2H5LA 3HPQA 2CYBA 1VIDA 3M83A 3OJ0A 4AJ4A 1DAFA 1NBME 3M1IA 3PGMA 1VG8A 1W5EA 2P1ZA 2A5YB 5HJ7A 2J0EA 2QD5A 1Y7LA 3CB2A 1UM9B 1E0SA 5DHSA 2EBWA 4A5OA 4V1CI 3NV9A 2BUBA 4ACBA 4E2XA 3BGWA 2H1RA 3GMIA 1F0YA 2OKCA 3IT0A 2G5PA 1CY1A 2SHKA 2ZJZA 3VTKA 1J6UA 4I1UA 4YP1A 4YX9A 3B3FA 2GBIA 4QBHA 3QXXA 2WK1A 2D4AA 3BGSA 4R2IA 5JZSA 4G0WA 1UPBA 2Q5EA 4EB6A 2Q5QA 1I7LA 3TW0A 3C3YA 2E6KA 3GUZA 3H1BA 3P20A 4WK4B 1MQ9A 2RGNC 4UCXA 4TZTA 4Y6OA 5C5EA 2OCXA 3PRYA 3OUTA 4YI5A 2BISA 3IO5A 2PO5A 1T8SA 3H0CA 3FTNA 3KEQA 1FVOA 1YULA 1RLTA 3I4LA 4FFPA 2P69A 5IABA 2X2PA 3D0RA 2KLHA 4HYEA 2GZ3A 4JEHA 4JT4A 1HX7A 3PX3A 3F4LA 3EGXA 1Z2EA 1ZIPA 3DMNA 4JLNA 4KLZA 2NU6B 5C7OO 3F5DA 2FPWA 5A05A 3UFXB 3TR5A 3TLBA 3A37A 2QYOA 3TOCA 5AW0A 4U0KA 3S0JA 4Q4AB 5FPQA 1E7RA 3K32A 1DARA 3VSAA 2IC5A 1KVSA 5JS8A 2AA3A 4YQFA 2CVFA 3CBQA 2VF4X 1U3WA 5LMZA 4XQ9A 2IGTA 5B1YA 2G6BA 3M6AA 4DL9A 1ZGBA 3DZJA 5CTAA 3KELA 1UQUA 3OEHA 4FDTA 4LPKA 3ADCA 5CFPA 1CBUA 2D4HA 4YJFA 4IOLA 1DJPA 2C2YA 4GLOA 1Y1QA 3E0QA 1CF9A 3HZRA 3U1TA 3WQQA 4MCHA 4L27A 5KOHA 5LJLA 2BSAA 3C48A 1T10A 1Z7EA 1OFUA 2PXAA 2XTAA 4IV5A 2GYWA 4RPGA 3OM1A 2ZAIA 4BMSA 1OI4A 3MHPA 4HYTA 1EB9A 2DZDA 3E8MA 3IT3A 3NDIA 2PYZA 5HFNA 1B15A 1NG1A 3AUSA 2H31A 3K31A 1YZUA 2RHCA 2WZBA 2LDBA 4FKBA 3FDXA 2Y1FA 3P9YA 5E2IA 1DC6A 2WF5A 3UMJA 3R3UA 4G97A 1T2CA 4IFBA 4UCWA 2HCJB 2RGCA 5DM0A 4AS3A 1JDZA 4JLWA 1YB6A 3OF5A 3RS8A 3NTXA 2Q3HA 1E9VA 4YQZA 4DM4A 3FLBA 4U7FA 5B6IA 3FMOB 3T0IA 5KYWB 2JFVA 4LY6A 4Q9NA 4UBJA 4E15A 3LW8A 5IXYA 1KH1A 5JJBA 4QPPA 4JUBA 4COKA 1YKFA 4A91A 4D0LB 1LCIA 1SBYA 3DW3X 4G1UC 4LRXA 2SICE 4XFJA 3R7WA 4TMFA 2PUWA 2AS0A 3OF3A 5A2QA 1RSZA 2XJ4A 2HM7A 3IEMA 4Q1DA 1N5LA 3T1NA 3LQYA 4OPMA 1XFAA 2D74A 4ZI7B 2OLKA 3QVWA 1NVVR 3OIFA 2YC2C 1DQZA 1THMA 4L0MA 3DKKA 3GFQA 5A71A 3MPOA 4BQOA 4D98A 1PEYA 2BONA 3ZWMA 4KAXA 1Y82A 2GMWA 2O8BA 4JOQA 5T8KA 1Q95A 1UBCA 3NYRA 5H7XA 3G13A 3DWGA 2BT4A 1ZGAA 1CRLA 2C4UA 3B48A 5EIXA 2O20A 4G37A 1FE8A 4ITVA 5AO9A 5I7SA 5EESA 2EIHA 2GQ0A 3OETA 4GZ3A 3EIUA 4B7UA 3Q8XB 4O4JA 1KHHA 3B9QA 3D0QA 3MJVA 1BO6A 1GUZA 1LBEA 1C4KA 1M1YA 2X23A 4JCOA 2HJHA 4P2BA 3PEVA 4J49A 1Z16A 3ML1A 4JI8B 2V0CA 2LGJA 1II0A 4BECA 2CLMB 2R6GA 1H9CA 1EYZA 3WLSA 2OHFA 2XCOA 4ZVNA 3HJFA 5JS1A 4HD8A 3SKYA 1ZCBA 1CQPA 1LJ8A 1A2QA 3DZFA 1A9XA 4I4TA 3RT9A 1U99A 2POQX 1KVUA 1TECE 5DNVA 1K8YB 3EVDA 5G0WA 3NHJA 3WMXA 4EVSA 1RC1A 3V8VA 1W4CA 2JIRA 4NMLA 1TVCA 2XCIA 1V26A 3LFHA 2ODEA 2B98A 2WJVA