3RVLA

Structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89r
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvlA00
5F64A 2QXYA 2MYPA 1EAYA 3QEMA 4ZYLA 1LJLA 3E61A 4N0QA 6CHYA 4G0YA 4KVFA 3RVOA 4H60A 3Q15C 5JNVA 1URPA 3NHZA 5B3JA 1DJMA 3GV0A 4YO7A 4N76A 3H6GA 4EYKA 3C3MA 3H5TA 4RY9A 4ETIA 2LIVA 1MVOA 2HSGA 4KQ9A 4JAVC 3URMA 2RDMA 2Q5CA 5IUNC 1L5ZA 3TB6A 5TQ0A 5B3JC 3T6KA 1RXEA 1EWKA 3H5OA 3QEKA 1DCFA 5KC8A 2VUIB 3JY6A 3M9WA 3N8IA 4P98A 1VRVA 1QO0A 3H5LA 2L19A 3RQIA 4MGEA 4F8JA 2F8SA 2WJWA 3A0RB 3OO1A 3OQMA 4PE5B 3FDFA 1EHCA 1LBIA 4RXMA 1FQWA 3DBIA 1TLFA 1S8NA 3H75A 4LDAA 2PUEA 3IP7A 5GQSA 3HK2A 1E6KA 3LUGA 2PL1A 1JWLA 4RK0A 4WXMA 4LX8A 1U2QA 2FVYA 3KG2A 3LUJA 2ID9A 3O2SB 4W5RA 1USKA 2FMFA 1ABFA 3KLOA 4LE2A 2M1ZA 3A0UA 5FBHA 1SXIA 3JTEA 3L6UA 4YGXB 5EWLB 4F11A 1DP4A 1ZDMA 4IF4A 2FQXA 4XASA 3O2QB 4RK1A 4Z4FA 2F8TA 3KHTA 3TMYA 1RXIA 2JBAA 4S04A 1JBEA 3HV2A 3SG0A 4IILA 5IULC 3LKVA 3IP5A 5KQPA 4N47A 2KYRA 3QX8A 1Z13A 4M88A 2PUBA 3NNNA 4G0MA 1Z26A 5KWSA 4RK5A 2R47A 5DTEA 3FFWA 3QEMB 1W25A 3ILHA 1MIHA 4JP1A 5CNKA 1F4VA 3RVJA 3EDCA 3L49A 1YIOA 1PUXA 2QSJA 2WMYA 2IPAB 3OLVA 4PICA 5KI6A 1F51E 2CD7A 5ED4A 3QLVA 5PNTA 4YP9A 3O21A 2V0NA 3Q7RA 2FMIA 1VPWA 4H3KB 2QVGA 1L5YA 3FMVA 3KYIB 5CNJA 1JYEA 3BRSA 1BDJA 2R4QA 1VLZA 3F7NA 3KS9A 1UDRA 5IX8A 3MIZA 1GCGA 4MYRA 4RZSA 5IBQA 3KLNA 1NATA 4MQEA 1SXHA 3CKMA 4IGAA 4N0PA 4Z99A 3H6HA 4JOQA 3H5WA 4RU1A 3EQZA 3EULA 2LPMA 3A10A 1ZESA 2FN9A 4MQFA 4MRMA 3SM9A 1Z15A 5TQJA 3FFXA 3CS3A 1NXPA 1CHNA 1GUDA 4YV7A 3MM4A 3LKBA 1A0OA 1KRXA 4DQDA 1PHRA 3RVPA 1R8JA 1K68A 2AYZA 2E4ZA 1C4WA 3KTOA 4RK7A 2YHAA 3HJFA 4Z0NA 2CHFA 3I5AA 3OQNA 3OO0A 4F12A 3RH0A 1JDNA 3KKEA 1SD5A 4P1ZA 1ZH2A 2MYTA 3JPWA 3QLVC 3C97A 1YS6A 3T8YA 2PKXA 1FFSA 2PUGA 5DKFA 2VUHB 1ZVVA 1JHZA 3C3WA 1BVHA 3I09A 1PNTA 2WY2D 4RKRA 3UKJA 2A9OA 5CNMA 2JVJA 3JPYA 3IDOA 2GKGA 3QELA 2PAFA 4WT7A 1MAVA 4WXEA 3T95A 1QP4A 3O1IC 1P8AA 4E7OA 3HEBA 4QYWA 5DCLA 5FBKA 5KC9A 3LUDA 2RJNA 2ID7A 4W5NA 4OG2A 4Z4HA 3GBPA 1ZY2A 2I6FA 2VYCA 3NNSA 3I45A 4Z4EA 1DCKA 3KJXA 4O5AA 5EWJA 4EGSA 1BDIA 3CTPA 4IRXA 2OENG 5I4CA 1E6MA 1NY5A 4EYQA 5EWMB 7ABPA 4MR8A 3SY8A 4LE1A 4UHJA 3Q41A 5T3YA 3OM1A 3RVMA 1ZGGA 5E3JA 1YVUA 3C3KA 4XFKA 2OQRA 5C5CA 3GRCA 2P4UA 3N0XA 9ABPA 4RWEA 4MQEB 2JK1A 4Z9AA 1USGA 2IPMA 4MS3B 3CHYA 3C6QA 3S99A 4TN5A 4L85A 4D6YA 3N0RA 5JNSA 4NQRA 1QQBA 3H1GA 3K4HA 5TPWA 2PUFA 3OM0A 3LOPA 3OLXA 1USIA 4MQFB 1LJUA 4MRMB 3OQOA 4MS4A 3CFYA 3RVQA 1KRWA 4JB0A 5JNTA 4RKQA 4KPYA 4G0OA 2X7XA 3SQNA 2FLKA 2E4WA 2IPLA 2QV0A 2WB4A 3IP9A 4HNQA 2LUOA 4XLTA 5FWXA 5TE9A 3GBVA 5JNUA 2PUAA 3VNBA 3HO1A 3NNDA 4YS6A 4NICA 4RV5A 4EYOA 4MPTA 3SNKA 4YRZA 4G0PA 1KMIY 1BAPA 5FWYA 2ZAYA 1YTUA 2CHEA 4CBVA 1QPZA 2L18A 2BGGA 2LP4Y 4OTZA 4KQCA 4LRQA 2NUBA 1PEAA 1RZRD 3LUCA 4RSMA 3DGEC 3FGZA 3R0JA 3HS3A 3O74A 3HVRA 4FE4A 3A3KA 4WUTA 1P6QA 1Z12A 3QELB 3F73A 3E3MA 4KMRA 5C5EA 4PYRA 4RXUA 3EGCA 3K9CA 2AYXA 4Q6WA 1JFTA 1JH9A 1DG9A 2FN8A 4N41A 3EODA 3RVNA 1LBHA 4Z4GA 2QU7A 4ETNA 2FTKE 1I3CA 1QP7A 3BILA 1M2FA 3DLBA 5TQ0B 1U2PA 2IOYA 1RNLA 1P2FA 4MR9A 4MR8B 2HQRA 3CZ5A 1NXOA 5GOTA 4MLDA 2R48A 1TMYA 4O1HA 1Z25A 4D6XA 2ZWMA 4QICA 5CHYA 1BDHA 1M2EA 3QK7A 4Z4IA 3IPCA 4TLMB 4GPAA 1QO0D 4QPJC 2B4AA 2H3HA 2FEWB 3HDVA 4ZJPA 2W42A 3N0WA 1OXBB 1DBWA 5TPWB 4S05A 1GUBA 4EVQA 2NZVG 3GYBA 4Z4CA 5D2CA 3TO5A 1BA2A 2FEPA 3CRNA 4MS1A 3UK0A 1ZN2A 2FSPA 3MA0A 1DBQA 1K66A 3DLHA 5FWXB 2WRZA 1FFWA 1OXKB 3HZHA 5HKOA 4G0ZA 1GLGA 2VK2A 3HUTA 1M5TA 2GBPA 3Q9SA 1SRRA 2QR3A 3N53A 2MYNA 4KK3A 4RK6A 1YK1A 2JVKA 5FWYB 5BQ3A 2FW0A 1D5WA 4KFCA 4OLAA 2JBAB 1ABEA 1P6UA 1Z2EA 3CG4A 2JVIA 3HCWA 1QP0A 2N9UA 4RXTA 1XWWA 4KREA 2NT4A 3HSYA 3OLZA 1PEYA 4F3TA 3DGFC 1JX6A 3NBMA 3EQ2A 2M98A 3O1JC 3UUGA 2CWDA 2PUCA 2NT3A 4JA2A 4KV7A 2HJ9A 3P9YA 4EUKA 3W9SA 6ABPA 2DRIA 2P9HA 2MYUA 1CYEA 2FEKA 3OMXA 3BRQA 1APBA 2PE5A 3H5IA 3DZDA 2IDMA 3O2JA 1D1QA 5BRAA 2PL9A 4W5OA 4KK4A 3IPAA 2MSLA 4MLCA 3TX6A 4ETMA 5T7BA 3O1HB 3G1WA 1W9HA 1YMUA 3MYYA 3O75A 4MR7A 3JVIA 4OLBA 1ISSA 2R25B 1JL3A 1NTRA 4XAQA 4MR9B 2JCGA 4RS3A 5BR1A 1M5UA 1E2BA 2NZUG 1DC7A 3QLTA 3LUHA 3NHMA 1MB3A 2L2QA 4IMJB 1Z18A 3QLUA 4OBBA 5TPZD 4TMYA 1DCMA 1J56A 1JDPA 2E4XA 1NXWA 2YHBA 3CNBA 4F06A 2QVCA 3GL9A 3GA5A 4LDZA 5ABPA 4NCBA 4NV3A 3D8UA 1E6LA 1NXVA 1TJYA 3VNAA 2GWRA 3H1FA 4MS1B 3OLWA 3SAJA 2PUDA 1EWVA 3B2NA 3LUFA 2MSWA 3MMNA 4ZPJA 1JYFA 1Z16A 3OLYA 4DN6A 4N03A 4YR7A 3H5VA 2PJUA 1ZITA 2FMHA 3Q7SA 1JLKA 2PLNA 4L4UA 3Q7TA 1U8TA 4HYEA 4DADA 1EWTA 3H1EA 1JF8A 4LZLA 4Z9BA 2B1JA 2IPNA 5JNWA 4G97A 1DZ3A 2E4YA 2FKAA 1U0SY 1Z2DA 4JB2A 3ROFA 3IP6A 4JASB 4HNRA 1DRJA 3G85A 1DBPA 3KCNA 4B09A 4ZMSA 3LUKA 2LBPA 1D4ZA 2FXIA 3QX9A 2HPHA 5TQ2A 5KQLA 1KGSA 3KYJB 5JS1A 2JB9A 1D1PA 2QZJA 4O1IA 1XHFA 3GWGA 1T34A 3BBLA 1LK0A 1U04A 3F6PA 4RY0A 3HDGA 3LFTA 5BRJA 3QLUC 1WETA 1ZAYA 4YLEA 4FE7A 5CNIA 5DGCA 4WWHA 3GT7A 3LUAA 4RY8A 1YS7A 3D02A 4E7PA 5EWJB 1QNLA 3I42A 2E4VA 4IMIB 2XDYA 1DRKA 5HQJA 2WWVD 1Y1LA 1RPJA 1A04A 3N75A 4MR7B 3KSMA 3F6CA 5IEJA 5DLEA 3EAFA 2WJAA 2E4UA 1AB5A 4EYGA 2FLWA 2QW1A 3M9XA 4KNYA 3LMKA 4PZ0A 1FSPA 1TVMA 1NXXA 2PMCA 4RK4A 4FB4A 4ZMRA 1DC8A 3MQ4A 1QQAA 4Q6BA 3CZCA 3CG0A 4UHKA 4GNRA 1IIBA 2A9RA 3N6VA 1JFVA 4HNSA 1AB6A 2L17A 1ZGZA 4EY3A 8ABPA 1ZHHA 3CLKA 4MS4B 5EWMA 3JS5A 3RVLA 2FQYA 4G0XA 3HXMA 1H9CA 5TPZA 3RVKA 4LE0A 3M6MD 3TD9A 2O20A 2TMYA 1JFSA 2FQWA 1EFAA 3FFTA 1NXSA 3JVDA 5IEBA 3RVSA 4ML3A 3MF4A 5HSGA 5IUJC 4MS3A 4H3HB 1D2AA 1ISRA 1C0EA 3ILYA 4Q7EA 1YK0A 4WZZA 4G0QA 2RJOA 3RVRA 5KQMA 4PEVA 1Z17A 1QKKA 3EJWA 2RGYA 4NCAA 4EVRA 1VKRA 2MSKA 3HM9A 4KZKA 5IUKC 5HM6A 1ZH4A 5JS2A 1NXTA 3LTEA 1CEYA 2JRLA 4XARA 4MAAA 1SXGA 4EVSA 2J48A 1HEYA 1MB0A 2FMKA 4QYMA 4YWHA 4Y9TA 5TQ2B 3CU5A 5EWLA 4W5TA 2A9PA 4OATA 2IKSA 2IYNA 2HQOA 4RDCA 1FFGA 1GCAA 3BREA 1B00A 1XHEA 2H0AA 1RZRA 2GI4A 1PNRA 3OMWA 3ROTA 4TLLB 4W5QA 1QMPA 1YMVA 5KQGA 4D74A 5IC5A 4G86A 1A2OA 1TM2A 4KRFA 3T38A 4YCSA 5JNRA 2GX6A 4XXHA 3HUUA 2HQBA 2A9QA
chains in the Genus database with same CATH superfamily
2W6JD 2EU8A 2XRFA 4FMCB 1CJCA 2QY6A 4G0YA 2B8TA 3F6YA 3F0TA 5DP1A 3GW8A 2V7QA 3KFXA 5BSTA 3M2PA 4JLMA 3JAWB 3EG9B 1XNQB 1GDDA 3ZV5A 4NYMQ 4QGBA 2Q6OA 1K2WA 1WV0A 2AOXA 2JI4A 1E1NA 3GJTA 3R3XA 3SC6A 3MUOA 4COKA 2R65A 4RZXA 3AHDA 5I7SA 1MXFA 5BVGA 2A3NA 3BICA 2EWVA 2VT2A 3B3GA 4B71A 3B38A 4CEHA 1Q0SA 1A8HA 4L2IB 2Q5IA 5JEDA 3SMVA 4M1OA 2I9PA 2ATVA 3JY6A 5ES4B 4FFWA 1RMQA 2L19A 1VECA 3D6MA 3WGZA 2GXQA 1VE3A 2P35A 3RQIA 3T94A 4EECA 1QIIA 4IZHA 4CUZA 2F8SA 1NBMA 2PS1A 3A0RB 4GZ3A 2ENWA 3AM4A 2R3SA 1N8NA 3W3AA 2J8ZA 3OQMA 1QF9A 5KQSA 3EXG1 3NWJA 2CLDX 4QUDA 5JC8A 4OP3A 3DL2A 2X8JA 3RDPA 1LS1A 1U2ZA 5HTKA 2HAEA 1WUJS 4P3OA 5I7VA 3U7JA 1E6KA 5DEIA 2PL1A 3LYHA 3ETJA 4JITA 4UUPA 5EERA 1HE2A 4AUMA 4RK0A 1CY2A 2Z6AA 2XAAA 4RDIA 3IRUA 1QC5B 2X19A 4H3SA 4MW2A 3KYCB 4CT0A 5C52B 4KBGA 5B58T 1H4VB 2JKYA 4CR8A 5C8YF 4DILA 3PXEA 4H6WA 4UEWA 1ABFA 1QHXA 4EARA 4DTCA 3L6UA 3RGGA 2FMXA 2QIPA 8ADHA 1G3QA 5B1HA 1C1HA 3TG8A 2FQXA 3D3EA 5AFSA 3VO2A 3DBHA 4B0PA 3VOSA 1UPTA 1Z82A 4S04A 3TWOA 2WAXA 4FZRA 4NK5A 1M34B 3N6XA 3H11A 3RIHA 2AFIB 4B6OA 2VCHA 3ZGXA 1U02A 4P86A 3F9CA 4UQOA 5DK4A 2M6LA 1X1DA 2LCQA 3LXUX 1A71A 1MX1A 2YWDA 1CY8A 1X7XA 2IGBA 3AOGA 3LHKA 5LB2A 3VR6H 3QY9A 3CZRA 5SZKB 5I48A 5HOEA 1JZQA 4LOIA 4Q4HB 4BDSA 1V7PC 4U63A 4E3WA 2G1UA 3KQSA 3LOUA 3IQXA 3OD5A 3BCHA 3OWXA 3OZWA 2GTIA 3GZNA 1JHQA 3HU5A 3I6YA 5EQTA 5JPIA 1UXJA 3LW8A 4C0JA 1GNSA 3A3YA 2BCEA 3F71A 5LLTA 1P9NA 1F51E 2HPZA 4WK6A 3GA0A 3QLVA 1GZ3A 4I7EA 4YP0A 1KERA 1RDFA 2PBFA 3RSCA 3WK9A 1TZCA 4QDUA 5FL3A 3V2HA 3KIPA 1KFCB 3V1TC 2HU2A 5DHFA 4WIAA 2G82A 1W75A 2Q07A 2QRVA 2FG6C 1BDJA 3D0QA 3HJCA 1O94A 2NIPA 2BFEA 1ESZA 1WD5A 1WIWA 2EX4A 2HPVA 3GROA 1WF3A 4ITRC 4PC1A 4PSCA 3BSFA 4Q1CA 2X23A 1C30A 3CEHA 5TARA 4WBNA 4ZIRA 1EYZA 3GFSA 1LDMA 3DNPA 2VP6A 3PXXA 4P4UA 5HK9A 3NCHA 1UPAA 3QBJA 4PGHA 3A1SA 3VPAA 1GNPA 4RF2A 2H0RA 2C7PA 2FN9A 3C5CA 1KYQA 2PX5A 1Z15A 3T7RA 4QECA 5A6VA 2JGAA 1NXPA 3RT1A 2QT9A 3CYFA 4DQDA 4MVJF 2XMQA 3RVPA 2NTEA 3TNDA 1F7VA 1SUAA 1U99A 4ONEA 5HGXA 4FEAA 2VJOA 4ZHQA 5HF8A 3U4CA 5C4GB 4W1RA 1C7RA 1QRAA 3PWTA 1YUBA 4BCCA 3HJFA 3TQQA 2ZRDA 2WV7A 1VHWA 3EE6A 3THSA 3JPWA 2ZYWX 4PRYA 4XEHA 1TM4E 1DCTA 3FVVA 4P5DA 3S7TA 1SC4A 2JGRA 4Y6PA 1TU4A 3TDKA 1CUXA 4RETA 1PNTA 4NARA 3WDSA 4RSHA 1M74A 2JIPA 3PSAA 4DABA 1MP0A 5BXQC 3KETA 3FTEA 2W9XA 3NPMA 2BGLA 2FGKA 3GUZA 2QOEA 4JROA 2V74B 3QPWA 3PDJA 4RACA 3VHLB 3OFSA 1QHFA 1XSEA 2P3QA 2IZ6A 3EIUA 1LVGA 3GA7A 3HGQA 3M9LA 3MWEA 3QBDA 4XW2A 4HNAB 5LJLA 2HYIC 3Q0TA 2A5JA 2CLIB 3ANLA 3FZQA 4HXEB 2FUEA 4ZAXA 1C3VA 4B3MB 3C16C 3KQPA 1ID1A 5A5FA 4F38A 4KDCA 4ARUA 1IM5A 4WN3A 3FCUB 2QBYA 4E5PA 3KVVA 3DQQA 3M1IA 5C2JB 1NVMB 1C1XB 3MTIA 3AW9A 3C6MA 1JJBA 1TZMA 3L8YA 3PX2A 4LWPA 3RHTA 3PQFA 3ZU5A 4A03A 2HTEA 1GTMA 3IGFA 1CB0A 4JKYA 4B35A 9LDTA 3ZVMA 4ROTA 1N2EA 2P6RA 2PSHA 1Q0RA 1HFJA 4PR3A 1UEIA 4EB3A 2B7CA 2HHJA 3QUBA 4V0ME 1TUIA 2OT3B 4ASUD 2HM7A 2GPTA 5TPWA 3PEYA 2BE9A 2ZR9A 5EIHA 2DQ4A 1WP9A 3G02A 3OLXA 2VJLA 4MRMB 4RNCA 3WNBA 4E03A 1EQ2A 4N4AA 1JE1A 1L4BA 4GXQA 1U31A 5EN4A 3K72B 1QIGA 4CLDA 5KJ1A 1KFEB 1ILWA 2IPLA 3BRCA 1A8PA 2BGJA 4Y6LA 4LHEA 4GLJA 1ZUIA 3AF2A 4EYOA 2DERA 4P34A 2FSSA 5JRZA 4DSOA 5AVVA 4G0PA 3Q72A 1JIQA 1LLCA 3GLHE 3I76A 2QGFA 1N0HA 3K1TA 3KEQA 1H0RA 2F3TA 1UFKA 4AX8A 3CVWA 4GBMA 1PR6A 2VJCA 2A0WA 1QLWA 2XIJA 5L7YA 1JLHA 3GGJA 2EEPA 2H1VA 5L40A 4E21A 2M1XA 4WZAA 3RM3A 4AJJA 1NUQA 4ZQHA 1BE0A 2H65A 2W6ID 4UEQA 3E9EA 4C9BA 1HOXA 4M1WA 2O0KA 1Z5WA 3A3KA 4OJNA 4QOGA 1XALA 1X9GA 3BJMA 3JASA 1T9ZA 3A28A 3G68A 4YAJA 1P2GA 2AMJA 4IHQA 3GD5A 4M7RA 4WHMA 4BMDA 6LDHA 3LWNA 3CF4A 2C7GA 5JHHB 3AETA 4KN8A 4JYMA 2P41A 1YZYA 3CR3C 3DBRA 5IDQA 3C8ZA 1QO7A 5KMGA 3OA0A 3CEPB 3FZNA 4Q3NA 5HQTA 4LJ5A 4UAUA 4UMVA 3OD1A 3PRKE 3EEIA 2R0QC 1XZAA 4GG1A 4XYBA 5A4IS 3FAZA 1YJAA 1P2FA 2YH2A 1VFPA 1WCIB 1Z0SA 1JT2A 2Z5GA 2ZBEA 5DEOA 2ORED 2G0AA 2I33A 2W8BA 3LZCA 3NWPA 2ZRLA 4OGKA 3WK7A 1GPBA 1L8QA 3DC7A 3X1XA 3WG9A 4BNJA 4CM4A 1OYWA 3IJ5A 4D6XA 3PQ8A 3G9QA 3SNHA 3WIBA 3IXQA 3PNYA 1M2EA 3QK7A 2ON6A 3PI7A 3Q5GA 4JJ8A 1F8YA 2XMBA 3HDHA 4HBGA 4HH1A 5CB4F 4MCAA 1RE1A 4MI3A 5CX1A 3IVMA 1H1LB 4K7JA 1VZ3A 1T2AA 2O6LA 4YUYA 4Z4CA 4GMKA 1P9WA 5B3KA 4G5OA 4MVCA 5DHAA 4YR9A 1B0AA 1K7XB 1MJGM 2GD0A 3FFBA 3ZHVA 3MA0A 2DXIA 2Z57A 4HLUA 2WSLA 1YZLA 4A73A 3H1TA 4Y1RA 3AIIA 2WRZA 5AI9A 3SXUA 3ER9A 2J0UA 4AL4A 3QWIA 2CFCA 1KI6A 2BZ0A 2XE6A 1OTXA 2GZ3A 2HIMA 3PNSA 5BQ3A 4KQMA 3D64A 2MR6A 4U6QA 2IE8A 2H3EA 3AP1A 4ERXA 3D4NA 3TLXA 3ZDAA 5IC4A 1ABEA 2EKLA 5KNBD 3CG4A 1IOZA 1PS0A 5GIPE 1ZRHA 5CPBA 1N3LA 4JQSA 1XWWA 3FMIA 4G1MB 5BW5A 2QTMA 1AS2A 1EJ6A 1SULA 1UXKA 1VRWA 2IZ0A 1YO6A 3O1JC 5LOVF 3Q7EA 2GAJA 2PO5A 1C9KA 4WLFA 1XTZA 4DJEC 2V97A 3H4TA 2AR0A 4CV0A 2HJ9A 3P9YA 1TJNA 3LLMA 2IEIA 3U3XA 3DH0A 4BUCA 1KYZA 3WVNA 1UDAA 3C1UA 3TNJA 3VPFA 4V0RA 2ODWA 3VSEA 5CLHA 1V7ZA 4KXQA 4O8ZA 4MUKA 2O57A 3W0LB 4P08A 2PV0A 2ZS7A 3RF7A 3G1WA 2A5LA 4P83A 4QUKA 4TYQA 2ZVQX 3PNBA 4MV0A 5KIAA 5J2UF 2IHVA 1BOFA 1RQRA 4XAQA 4LRWA 4E2YA 3PEEA 5BR1A 4XYLA 5ER6A 4BQSA 4W5JA 4A8HA 1F2VA 1DC7A 4MWDA 3ZYZA 4ZTBA 3UJNA 4RMNA 1AKEA 2FRDA 1ECCA 4PTYA 3VH1A 4B4WA 1NKTA 5JRDS 3LY7A 3I23A 2BZGA 3FBTA 3G0OA 4HHEA 4ALJA 3A6JA 5SY9A 1T9GS 1V8ZA 3CPHA 4KC0A 1ITZA 4U7FA 2VJAA 3SC2B 2O3RA 4QTUB 4RELA 3UW1A 4CM1A 1GL7A 4E1AA 3GL9A 1U7XA 4DAEA 3WL5A 1DAMA 3IT3A 3C8DA 3NT5A 3AFIA 1J1IA 1P6XA 3NTOA 4NCJA 5EIOA 3G8DA 2Q2QA 3RJMA 5AVKA 1SB8A 1U9CA 1ZN7A 4XRRA 4NX2A 1RP1A 4DCGA 3ZKWA 5IM4F 2SNIE 4M8IA 2VWQA 1ZJYA 4J1QA 1JBKA 1NU6A 3FVQA 4NU8X 4WCFA 1ZITA 3PJFA 1UMDA 3DLPX 2GMWA 3PE6A 1AKUA 3H7AA 3S4YA 4CFSA 1C8KA 1SGWA 1E8MA 3DJFA 1XV5A 3ADOA 2XD9A 3I2KA 4JXJA 3AL3A 5ULLA 5JJCA 1XN4A 5JNWA 1RXVA 2GVNA 3OT1A 2E4YA 4GECA 4INPA 5A62A 1LB1B 2W2LD 2J0SA 2HI0A 2QUIA 4KOEC 4G1VA 5HPYB 2QYOA 2LBPA 1CJBA 1G8PA 2AOVA 3NBKA 5IWAB 1VYTA 1G5TA 3K5PA 4IFBA 2W98A 3OHMA 4ZI2A 2QYSA 2JDIA 3LC0A 1AHNA 1CS4C 2Q46A 2JB9A 2Z8YM 4O1IA 5ECDA 1XHFA 4RY0A 3VQTA 3VPCA 3WRYA 2FA9A 2R8ZA 3NKLA 1QB8A 3PTLA 2QVLA 1ICIA 4KRFA 2OC4A 1G6OA 1L4GA 1QANA 4Q7JB 4WVFA 1YJBA 4Y1GA 4BEVA 5JD5A 4RHFA 1JQ3A 1Y1SA 1NGSA 1F9EA 3OY2A 1T9KA 4B48A 2C4NA 4V02A 4IMIB 3CUKA 5BWMA 1DBIA 2AG8A 1X39A 1XZKA 2OCBA 2VNJA 2Y2UA 2D7JA 3K53A 1M0EA 1J25A 3BGVA 2OWEA 3FWZA 1PDOA 2C58A 1NRWA 1BQEA 2EP7A 2X1VA 1JR4A 1YH3A 3DOOA 3G5LA 3UXEA 3EEBA 2H59A 2ZT8A 1AB5A 2EIXA 2VL7A 4EYGA 5JTUA 3OM9A 2O7NA 1VPTA 1OJLA 1DARA 2C99A 2YN2A 3DG9A 5FBZA 1QHSA 2Q2VA 3L82B 5D3MB 3IVRA 4A1OA 3QUSA 2HJWA 1NVUQ 2ZP1A 4MEJA 1T25A 5LZ4A 4HQRA 2LV8A 4JY7A 3VU9B 4EY3A 1U8ZA 5AK3A 2GSWA 4IJQA 4LY6A 5DIZA 4D0LB 1SZDA 8ABPA 4BNIA 2RGXA 4IUBS 3BB4A 2EZ9A 4EMUA 1JLSA 5A2QA 4KXNA 5ITWA 4OUDA 1E0AA 1M1UA 2BE7A 1CP3A 4XM1A 3RSZA 3VTZA 3MF4A 4OJMX 2RHHA 2GN8A 5HSGA 1O77A 2HA5A 4HVCA 2MWMA 3FVWA 2YY7A 1RAEA 3AVXA 3CB2A 3M4YA 4B4VA 2IZZA 1OI7A 3FB1A 1HBJA 2ZZKA 4NOMA 2H2HA 4UQPA 1V4BA 2JCVA 1IAVA 3VR2A 1WA5A 2ZBPA 4E30A 5TIIA 2OV3A 3EWNA 4U0JA 3MPUA 1QPGA 4NYIR 2FSHA 3ZR4B 5IBCA 1YDHA 3RROA 4LXQA 3M5CA 1ZJWA 2Y1KA 4XARA 1CEYA 4HPWA 5JCXA 3I5XA 4YWHA 1WRBA 4CI0B 4TT3A 4Y9TA 4KWIA 4CEJB 2XVMA 4V03A 3SQMA 2YASA 2HQOA 3PDWA 4I8IA 1IVYA 5D5PA 4K8OA 4B3GA 2B8WA 1T5SA 2Z8ZA 2DGDA 1AQUA 3MPOA 3I2FA 1SQFA 3LCRA 3ZU6A 5AXDA 1CNFA 5JZOA 1JBQA 3NWOA 1NXQA 2YV4A 3LQ2A 4GQAA 4PSDA 4K26A 4A26A 4RHCA 4AAYA 4B31A 2FR0A 1D0VA 3BXEA 4UXIA 4A36A 3KZOA 4CIBA 2Q7OE 1CRPA 3TEMA 2WJJA 3MQFA 2JCBA 2R1VB 3CF6R 3D6AA 3IIJA 5AXBA 4GIBA 1MC8A 1HE4A 3UJDA 4MKRA 1QAOA 3BEOA 4QBGB 4DA7A 3O8RA 1V47A 2YWEA 3PE3A 4B6FA 3I5YA 3E3NA 1E8DA 1NVVQ 5EJFA 1E2IA 2A1UB 3AHEA 2V5UA 3G9UA 5FPTA 4D99A 1XDGA 3A4MA 4EW6A 3RO7A 5AW7A 2BF7A 3U0VA 1PJBA 1TLTA 1EVIA 3I72A 1OKKD 1QRRA 1O9HA 2FQ1A 2CLLB 4PIMA 1G4AE 3STXA 5JMOA 3ED5A 1SCIA 1XNRB 2YHUA 2CXRA 4JGGA 3D0KA 3X1YA 3U3DA 4WK4B 4R31A 5EHGA 4D02A 3VH3A 3ILXA 1CE8A 2PR7A 4DQLA 3KQKA 2AB0A 5J3JA 1QNFA 4U7PB 3DMGA 4MJ3A 2HSJA 4B4UA 1UBHS 1MAHA 2IEBA 2BM1A 1U0LA 4BVJA 1Y1KE 2K2WA 4HC4A 4CN9A 2A57A 5L53A 2V55B 2DCMA 5T4BA 2NOAA 1FJ2A 4P31A 1E60A 5ICSA 3BQNB 1FQWA 4LGCA 5ENZA 4YH1A 3RT9A 3F3MA 3HA5A 1LI5A 3HCAA 3L6OO 3N59A 3PUJA 1P45A 4KFTA 1BJRE 1L6RA 1SKYE 2IKQA 3QW4B 2AQ8A 3PICA 1Y98A 4KXXA 1HGXA 1MJHA 3B60A 1L8LA 4CF6A 2G77B 4MVJH 1C1YA 3DMHA 1E9BA 4LXGA 4KZPA 5I8ZA 3OCVA 2X0FA 3WK8A 4PHFA 2RKOA 4RPCA 2XUOA 5A5VA 5L3SB 4CCYA 3WMEA 2GEDA 3JTEA 2BEVB 4UBIA 2P30A 4ISBA 3MLBA 3B9BA 1EZZA 4RTQA 3LPNA 1KPGA 3ZUPA 1G60A 4R01A 1GTVA 3HJUA 3D7NA 3CX4A 4CGYA 1DXHA 1WCWA 1NBME 1V6AA 2B1RA 3PGA1 4N0DA 4R1QA 4BFUA 5LPNA 5JOQA 4GE0A 3RC3A 2CCGA 3EYWA 2DJ5A 4GI5A 4I36A 3BIWA 1T9DA 2VTBB 4KITB 1YB7A 4FFNA 5AI6A 2A5FA 2XQFA 3FX2A 4BE4A 1UDCA 2I8CA 4DV4B 1XQVA 5BSWA 4QUHA 1DVRA 1U0EA 1ZW6A 3GJXC 4DDHA 5CA1A 5GWXA 5IF3A 5K01A 1ZCBA 4JUAA 4PAQA 4BZWA 1SCUA 1BHQ1 4R9RA 4YP7A 5EJ7A 3JYOA 5ED0A 4QASA 4EPYA 1K86A 3D4BA 4AMGA 1JSZA 1TZKA 3PZBA 1N32B 2NPOA 5KWIA 3LDGA 2C3UA 5AIAA 3UB3A 3ELWA 4BFCA 3WB2A 2QD2A 1KWGA 1KYXA 3EZ9A 4BAUA 1YF3A 3VSAA 4W4TA 1PGJA 2R4QA 5EMJA 4D97A 1QHNA 1WAMA 1CVRA 1SIOA 2SCUA 1DO8A 4G89A 4ZO4A 3QW2A 1BRTA 1GT6A 3A1DA 4NJEB 3EXFA 4MUJA 6PFKA 2NVUA 1WY7A 3UATA 3ZE8A 2GZAA 5I7FA 4MQEA 4FGJA 1Q3TA 4H17A 1TZ2A 3NIGB 4TS4A 1CZKA 3NBZC 4JOQA 3Q8MA 5CT6A 4IDEA 2PK3A 1M2OA 2FW9A 4RZ2A 3I6QA 1U7OA 4TTRA 4U2CA 4XCQA 1A2QA 1ZOSA 5TQJA 4EHNA 1KF0A 2GEJA 3RJ5A 3LLVA 1A4RA 2IXBA 3FWKA 1LZLA 5EE1A 4RMHA 4I14A 3AR3A 5IJ0B 2IIBA 2DTEA 3CN9A 2JASA 3ESYA 1L1QA 1G7RA 1PJ3A 2O0LA 3I1IA 2X40A 5GY7A 1FMJA 3PXBA 4DBLE 3THXA 4CPDA 2VJQA 3GLQA 4M99A 2IUTA 3R0IA 5DTRA 2WF5A 2ERXA 1MO4A 2VBGA 1GPAA 3L3BA 2MYTA 3D8BA 5CM8B 4R1UA 4OAPA 1AKTA 3W1WA 1QCDA 1QTNA 1TVCA 1VKHA 2KB0A 4LA4A 1KK3A 3CEMA 3KOMA 2G1KA 1E3IA 3OZUA 4S2UA 3SX0A 4NR0A 1M1NB 2R8XA 1GV1A 1S2MA 4RFLA 3ZHCA 3K9BA 2RK6A 2VRWA 3VYSB 3WGGA 1N7HA 4O4IF 4N6OA 4IXTA 1NW4A 2H4HA 4RFSB 4WXYB 1KOLA 5IKEA 2NO6A 3SZLA 2WVGA 1CY7A 4CG3A 2PAFA 2D2EA 4UHBA 3T95A 4XQ9A 2VA8A 2FN7A 5KC9A 4ENTA 1CUBA 4GKBA 4Q3AA 3LUDA 5AW4A 2VEDA 2PWZA 1MZVA 3L6EA 2FR1A 4P35A 3TL2A 2FZEA 4DZRA 3P9KA 5IXYA 1II8A 3GLGB 4J0EA 3TQRA 2ASEA 3AUSA 4HNUA 4UEJA 4Q93A 4OQ4A 3RTGA 3FR7A 4L4SA 1J8DA 1PE0A 1Y9EA 2MOKA 1FSFA 2QTZA 2JLRA 3BTUA 4I4TA 4Y2TA 4DNXA 2QUKA 1OV6A 1MO3A 3E7XA 1E79D 3FPHA 2D0PB 1MHTA 3QX3A 2NSHA 2QMYA 4BATA 1DKUA 3RRBA 1RI1A 2FJ0A 1I0LA 1V16A 4HSGA 2IYXA 3WYEA 5KYTA 1ZGGA 3R6GA 4HFRA 1VDMA 3O8BA 1VMKA 3L7LA 3Q7PA 4I08A 4K6HA 4XFKA 2JIZD 1LC3A 1I13A 1N0WA 2R1ZA 1H6DA 1O6ZA 3L9XA 4I99A 4K40A 4D9KA 3K73O 1LPPA 3C6QA 2QRPA 3D4LA 2EQBA 4RM3A 5SY4A 3TLCA 4DR7B 1FUEA 3DUFA 5H9WA 5J43A 2E18A 2BR3A 5FA5A 2TRSB 5C34B 3RU9A 1KRWA 1USIA 3L7MA 4GF5A 4U2DA 5AK4A 4GI2A 1DUSA 2C9YA 5DN6A 4AFNA 4C0AC 1I14A 4HGQA 4JB0A 3A25A 3KTDA 2VDNB 1Y6RA 3HL4A 3Q8XB 3ZWNA 4KPYA 4IUCS 3LYUA 5K0JA 3HMKA 1W581 3RVJA 3SE0A 3A2NA 1X14A 1PLKA 3EC1A 1MT0A 5AUOB 3GNTA 4L08A 4G65A 4CKZA 1SJ9A 3EMDA 2Q0QA 3QHPA 1KVTA 5KVVA 1Y9DA 2E49A 1FYVA 2H1SA 1JJAA 4IDDA 2X15A 4YRZA 2I2AA 3DZJA 3D7LA 3DDHA 2AZMA 3MT9A 5CXSA 5JDCC 4BMCA 3TINA 2F1HA 2Q4BA 3BWEA 2NU9B 2DPLA 3HCPA 2JHAA 4HFJA 1T6XA 2L18A 2ZYIA 4OLJA 5D1HA 3GPBA 5AIBA 2JJMA 2O8NA 1PZNA 1Y5RA 3KYDB 4GRAA 2G06A 2FWMX 1OFUA 1RQXA 1TU3A 1BJKA 4DLYA 1HDYA 2WHYA 5T67A 3J80A 1EFPB 4KMOA 1WM1A 1XDUA 1J9GA 3WGHA 1YVRA 3FPJA 4RGBA 4WUTA 1Z4KA 3PWSA 3W5JA 1AQJA 2P9ZA 4WQMA 2Z6UA 2YXPX 3EASA 3KOYA 3R7LA 3E70C 5B2ZA 1VKJA 8MHTA 1PS9A 2ZITA 4R98A 2HFJA 2VVTA 3N2GB 3QQPA 4V0QA 3ZKAA 1JFTA 2WU1A 5DH9A 3M5DA 3VKWA 4FCVA 1KPIA 4TZ0A 2DVMA 5LD2B 3P0EA 2CF5A 4G67A 3VTKA 2B6HA 3GI1A 3STHA 4G3XA 1D8AA 2PTGA 4WY5A 2VH1A 5C7IO 3FOFC 3JQ8A 4B8ZA 1RNLA 2PQ2A 3M4XA 3BHJA 3ZDQA 2BGMA 2JF0A 1J2RA 4J3FA 1UJCA 2I6XA 2GJ4A 1PL6A 3CUTA 4KQWA 3CZ5A 1NXOA 4NG4A 3AUAA 2XXAB 5CAEB 3RIGA 4LY9A 5CCEA 2Q5FA 2V6BA 1VMDA 1JAYA 2Q3LA 3GLRA 4RORA 1Q0PA 5ERXA 5BNTA 4CM3A 2CF6A 1UBOS 2QP4A 1ZOPA 5ARCA 4D98A 4KO1S 4TLMB 2IK8A 1WR8A 4QPJC 4ENSA 2FEWB 1G7SA 2VJBA 3RPEA 3DTVA 1ETUA 3KR2A 1EXDA 1XVTA 3VM6A 1NBMD 5M04A 2P62A 2ZJ6A 2N0SA 3W3AD 2BI4A 2PLRA 3F5DA 4DEYA 2UXCB 2FEPA 1A9PA 4KO8A 1VHQA 1FSGA 1X3SA 1N7IA 3EH2A 1QRTA 4M1EA 4N5NA 1EP3B 3KJIA 1M2KA 3C5VA 1FVHA 4HDMA 4CG2A 4NZYA 2CT8A 1RYEA 1XZDA 4R7GA 1AA6A 4R8LA 1L5VA 4ZRNA 2GA8A 5FWAA 3WSVA 3A04A 4CYMA 2MYNA 3EHEA 3JQEA 1KEEA 1SUIA 4FU0A 5H0IA 3A4IA 3Q85A 2OXEA 3QEAZ 1O97D 4RGYA 1SKMA 4M2LA 1BG6A 3ZWVA 5AHWA 1J97A 3B6MA 5EINA 1ZOIA 5L8VA 4RXTA 4XYMA 2VAXA 1HL3A 3ZHTA 3WYCA 8LDHA 2E2WA 4KREA 3MCUA 4EMSA 5JCZA 3HHEA 1TIPA 4R5MA 4LWQA 1OQAA 2CXOA 2Z9CA 3U09A 1PFUA 5JT1A 2ZQYA 4RVHA 1CB7A 4TOIA 5E7IA 5GMOA 4MWZA 1E2KA 1WHTB 3CV3A 1OLUA 4O33A 5AM1A 2QKYA 4D4JA 1Z2OX 3KJHA 2JLZA 2FW6A 4EY4A 3HVHA 2XQKA 1FRZA 3IO5A 4RHXA 3PNVA 3IDFA 3I28A 2RH8A 5FPPA 2AMVA 4LC1A 4TWAA 1RZVA 1K75A 4L27A 4AWAA 1G5PA 3KTAA 4FILA 1HQCA 4ESOA 3OP4A 2V8BA 1VL6A 3IPAA 4MLCA 1B8NA 1EXNA 1DSSG 2C9OA 2H1FA 2I7CA 3L93A 3QVSA 1W9HA 2W0MA 5IJZA 1EU1A 1U3VA 2H63A 2JFUA 3GFBA 4MINA 4Q39A 2H1LA 3NTXA 1AJEA 1PQ4A 4DW8A 1J7KA 2VJKA 4QOSA 3QUTA 1XQYA 1LSSA 1RXCA 3CF2A 1S5PA 4J94A 1BS1A 1Z29A 2ZKLA 4UUBA 4ZVRA 1L5HA 1E3MA 3K0AA 1D9ZA 4TROA 4XIJA 3P0JA 2XUGA 5J4KA 5FULA 4UHCA 3C3JA 1O94D 5AXAA 2QX4A 4ND4A 3LW7A 1C4XA 2IY8A 2HNAA 1P1FA 4MB0A 4CU5A 1H85A 2EFHB 5ABPA 1Q3HA 3ICPA 1SBHA 2Q8QA 3L9WA 3TXAA 3E6AA 2XCUA 3IPRA 4JLUA 3B51X 4HEA1 2WILA 2FFRA 1YB1A 1HSZA 1T10A 1WMBA 2CFOA 1DDOA 3GQVA 3MMNA 2OV6A 4G2TA 3T5CA 4P92A 2IOHA 1L7QA 1LBEA 2QD1A 4B85A 2OA0A 1YQXA 3KXPA 4NSNA 5ALOA 1XZMA 1T15A 3NVMB 1QU2A 5K0ZA 2XMGA 2CNWA 2JK0A 3AIMA 4O5OA 1HY3A 1DG3A 3AIOA 3FSEA 4G8DA 5CP8A 3QKUA 2C0QA 1VOTA 3ZIDA 1T4MA 4D8XA 3ENQA 1GU7A 3L2OB 3AI7A 5JJIA 3HUFA 3PPIA 1ARZA 1PQYA 2IL1A 4CR6A 2IA5A 1ECJA 5AM0A 5JXWA 3EMKA 3JAKA 1ELOA 1LK0A 5LZ2A 1U7UA 4JV5B 3O0TA 1UPBA 4PU0A 1IQUA 4UASA 1XIVA 2OYSA 1XMQB 2QDXA 3ZHUA 1BFUA 3VZDA 4ZI7A 5TLSA 1Z06A 2DR0A 2AUNA 3ANSA 1FQJA 3CZMA 3V1LA 4XCXA 3AVUA 3C1TA 5CA0A 4L15A 3IQHX 2DWUA 4TUYB 1AGYA 1K8XB 2AEJA 3ZE6A 1D1SA 3DAHA 3MINB 3NOOA 1J9EA 4MR7B 2ZAGA 1DEHA 4UPEA 5DLEA 3RSFA 3FRJA 2OFWA 2ZJ3A 1EFRA 3UKDA 1VJGA 2C4UA 3HYCA 1PYOA 1IB6A 4EYEA 1UZNA 2WNHA 3T0IA 4GDFA 2BISA 3OECA 2QV7A 1ODTC 3L0OA 1YKSA 3CKLA 3EG5A 3VOBA 5JH7A 4NHOA 1BN7A 2C2MA 2XI4A 1TVMA 1T9HA 2YJNA 4ATNA 3THWA 4QFBA 5K99A 1PV4A 1RBYA 2A9FA 5IK2A 1PI3A 4O0MA 2R66A 3E5RA 3DUWA 3HJHA 4JR0A 4M8NE 3MJTA 3OZFA 3TMKA 1LSJA 2XYPA 1P0MA 1FF9A 1KZ9A 1PWYE 4JLKA 3RI3A 3AB7A 4R2LA 5HUJA 2FXVA 1R9MA 1UKCA 3HO8A 1WVIA 3B5IA 1KJJA 3IILA 4GC9A 3K9WA 3BIFA 3G2NA 1LDNA 1P3DA 5F5NA 1XA0A 3MOSA 1P91A 4HH4A 3S3TA 3TM4A 1R37A 4G81A 1SAYA 3ZNPA 1SD2A 2RGYA 4YDSA 1KDZA 1A8SA 1JWAB 2P3SA 1JTVA 1X7YB 5HM6A 2JFFA 3LDUA 2A6PA 2YRXA 4MAAA 1QUFA 1Z8HA 4F6CA 2IY7A 1LNZA 4RMGA 4MMZB 4P36A 5KNCA 5DI3B 4OX9B 4KHPB 1WPXA 1YDFA 3UO8B 2YCBA 3OOEA 5B4UA 2REQB 1E2LA 1K8QA 1FFGA 2PT6A 2VAVA 4RGQA 4IDOA 3RYIA 2M6RA 1CZNA 2Q3MA 4CKXA 2JJ8A 2CLKB 5A4JA 3OMWA 1IPFA 5CT9A 4YUXA 4W5QA 2CDCA 1A9XB 3BQ9A 3P5SA 3PQ6A 2AEMA 2QTHA 1SB9A 4DB2A 3RCBA 3D1JA 3T38A 5I7RA 3U1BA 3IUJA 1GJRA 3O82A 3NEJA 3WYGA 2DBYA 3U4GA 1Y1TA 3OSUA 3QSGA 4JT4A 1KIFA 2BJHA 3K2BA 4N0QA 3WLLA 2POCA 1IN4A 3ZXUB 1G38A 2AA3A 1V96A 3MAJA 3OM8A 4LF6B 2GRAA 4BZZA 4JI1B 4DV3B 4EBFA 3E27A 1E98A 4DNPA 3JZDA 5FLKA 2D3TA 1IVNA 2HB6A 3H6GA 3UGTA 4KPEC 3K8YA 4UUAA 3KTFA 2HJVA 4QUEA 1OZHA 3MJFA 4PLWA 4UBKA 2DBQA 3EWSA 2NUTA 2O54A 2IF2A 5JLJA 2HOQA 4GOXA 4HUQB 4KAFA 1L5ZA 5JASA 3PTAA 1UK8A 4CETA 2DFLA 1S4MA 5CH8A 1RKQA 4FFDA 5UKDA 4C04A 1JIVA 2EZ4A 1E3WB 1IZZA 2WDZA 4H7DA 5TEWA 3DDUA 5IH7A 5KKCA 2WD7B 1EK6A 1ZKDA 3FDJA 4I9NA 5CIWA 5H3HA 3HCRA 4HWKA 2WWIA 2ZIGA 4IJWA 3FNHA 4KQ2A 3A6LA 3BHNA 1KFKB 3VJMA 4CKBA 3FYUC 2WBLC 3MUNA 3WLAA 3FDZB 2B61A 3IVXA 3LCCA 4OBXA 3SR3A 5B64A 1Z4JA 3BG5A 2TYSB 1V41E 3L1VA 1G3RA 3O47A 2XYRA 3F6SA 2PZBA 3DZCA 4I1IA 3MT0A 1I2CA 2QLLA 1MQ8B 4P4TA 2ZAIA 4G9BA 2F1IA 1UBFA 3BJRA 3DHEA 1B2LA 4KXMA 4ARZA 5CYGA 5FTMA 4NWIA 1KJ8A 1QPBA 4JLOA 3T9CA 1N9GB 4R1PA 4KAXA 5LU9A 4KU4A 1DLIA 4D2IA 4NZNA 2IVFA 3OQPA 4IOKA 2Y6VA 4BNWA 4JLAA 2DE0X 1WUHS 4BV2A 1J0EA 1XMVA 3CNQS 1SXPA 1V43A 1LPBB 4XZ3A 2VQDA 3FCEA 4XASA 1W48A 4GXRA 1B8UA 3RRJA 3VKGA 4JBHA 2OCXA 3ZVKA 1UWKA 5C3MA 1KO1A 2FZLA 1M8JA 2G9ZA 3QXSA 3ZGVA 4QVGA 5IXSA 1DFIA 1Z7EA 1RWKA 1YHNA 1P2TA 2B4TO 2V6IA 3JRXA 3DV2A 3ND5A 1Q0UA 2UKDA 4GICA 3WQQA 2GLTA 5EE0A 1SUSA 2FWJA 4RZUA 2PUBA 1ATZA 4DFDA 1KFJB 4M9CA 1Z26A 4LZPA 1DXQA 5DTEA 1Y8AA 4LOLA 1ZD8A 4L8VA 5J9FA 4PQGA 5GZ3A 1RYFA 4DANA 4RW0A 3PC7A 2N1MA 1VKNA 1Q0ZA 3M1AA 1TIBA 1PQWA 2HGSA 2JIMA 2QSJA 1NSFA 2YX1A 3DPSA 4IH9A 4WFJA 4DLKA 5IS2A 3R8XA 1FFHA 3KZMA 4CLRA 3E8XA 1MB4A 2X9VA 3C43A 5FR1A 2HA6A 4YP9A 2PQ0A 2RGNC 5KYYB 5EXSA 1EWYA 3VPDA 4E11A 4F3NA 2O4CA 1FBTA 2GWHA 3NUZA 4NOKA 5THKA 1V8OA 3EZFA 1ENOA 3NV7A 2GQ0A 2Z9DA 3EZGA 5CNJA 2W70A 4FZVA 2V1UA 2VCYA 3EWIA 1P2BA 3GPDG 5LB4A 3V6LA 3SYTA 1Z6ZA 3DEZA 3OQIA 2B83A 5FRDA 2B21A 3WRVA 1UJ2A 2I3BA 2QLBA 1NMQA 5EQJB 2IWRA 2R97A 1KRHA 4DMUB 5JO0A 4N0PA 3PEUA 4N6NA 1T4GA 3PL5A 1H1DA 5AJZA 3PGMA 3DO8A 1BE1A 3W4KA 2IYZA 4C4PA 4DZZA 2AIRA 4LHYA 3TI9A 5CTJA 3L0SA 1LGYA 1NX9A 2Y6UA 4YI3A 4OBWA 2CBGA 3QFHA 2PKEA 2D5LA 1OT3A 3BPSA 4IYJA 3G0GA 4R9SA 2XITA 1KA9H 4XWGA 2QMUA 5TMEA 3WMXA 1XI2A 2WZBA 4YCNA 3DOEA 1E64A 1G59A 2XLBA 1P77A 1PZGA 1MPXA 2AYZA 2QRGA 2H1HA 4X6YA 4GMGA 3Q0EA 1JG2A 3ZNNA 1NC1A 1BXZA 1K7EB 2CXSA 4GLBA 2GPJA 4UPDA 4Q4JA 4NI5A 4QGHA 3R7DA 5ELMA 4G85A 3S28A 4NBTA 3DZHA 4ZT5A 1UC5B 4H0NA 4KQ1A 3R7NA 4BQOA 2O8BB 1U9JA 2J87A 4BIMA 2HO4A 1CC1S 1CEQA 1MEJA 1SVKA 2R6ZA 3GGDA 1KQ3A 2IEZA 4M38A 4QLBA 2AQKA 3AR5A 5KWEA 4BDTA 3C3WA 4AIRA 1U0JA 2IODA 2JDID 3M3HA 1AX9A 2IW1A 1P1RA 4LF5B 2O2SA 3V4RA 3RS3A 2C5GA 2JVJA 4EZBA 4KRXA 1UCFA 2GKGA 4UHEA 1RWXA 4YMVA 3HB0A 1JN0A 1G8JA 1POWA 2R2AA 2ZSUA 5CLIA 4X1KB 3CWZA 3KQWA 3IPLA 2G80A 3ORFA 1J2EA 3U17A 3ZZTA 3O9VA 5JDCA 1F60A 1HC7A 1R12A 2BVNA 1YI0A 3RGWS 1XZFA 3DL4A 3L05A 4K87A 3TM5A 1VJDA 4O5AA 4BQIA 3F4LA 2CV2A 1TD1A 1W0CA 3L0IB 2WHRA 2QW8A 4Q15A 4LRUA 4YRAA 4X7BA 2Z08A 1E6MA 3CY6A 2LE0A 4ENPA 1DQPA 4YP1A 4MRPA 8ATCA 4HAIA 4S24A 4BCBA 2JAHA 1TTHA 3FCSB 1HM5A 3W90A 3QMMA 3EGEA 4ZAYA 4E2FA 2X2PA 2JK1A 1L7DA 3CHYA 5CLFA 1ODFA 2ZBDA 1QV7A 1OR8A 2B6NA 3V46A 1DTEA 1JE0A 2EZ8A 5G4LA 4C3VA 4EQZA 5KKNB 1A8IA 3OM0A 1YA6A 4CDMA 3BFPA 4KE9A 2XMSA 4EO4A 1M75A 3V8EA 2Z09A 1R0ZA 4GKKB 2IS2A 1XFDA 1DJNA 3FPKA 3UWSA 1QRUA 1IWOA 2QM3A 4NY1A 3ZTTA 5A03A 4RLFA 5EXEA 4F86A 4XTRA 2O07A 2R4UA 1VI5A 2Z3ZA 3HA7A 3Q1KA 1GSOA 3UJAA 4FWTA 1EUQA 4LQLA 3VR2D 5E6RB 3NKVA 3R0ZA 4CODB 3J7AC 4C0HA 3A9WA 4KQGA 1K9VF 3D7KA 4WASA 4KP7A 3CRRA 2P0YA 4YMLA 3ZBUA 1RAAA 4TT3D 3V34A 1Q0HA 2VPZA 1T0IA 4R8MA 3IUSA 3AVQA 5JATA 4M0EA 4AWXA 2NUBA 2W48A 3QXJA 3T4XA 4ZCMA 1DIOB 1KSJA 1XMIA 2CXTA 2GJAA 3FMPB 1MJNA 2KI5A 4D56A 3TRFA 1YJQA 1TGYA 2QI9F 1L7PA 5T5QA 4BN4A 3O74A 4GX1A 4PINA 2FWRA 4GEKA 3X2FA 1GPUA 4PNHA 4BKMA 3F73A 4RVNA 3FJOA 2PO7A 2PWAA 3LQ1A 4F4UA 4Q47A 1P33A 2JARA 1NJ2A 3ABOB 3GJZA 1U2RA 1PQUA 2QN9A 1SKYB 3LHIA 3W2IA 3EAGA 4N40A 5EKSA 3JZIA 3ZCQA 1BD4A 2M6KA 1O4VA 4TXNA 5HMLA 1A2BA 4ARIA 1R10A 1FRNA 4B7AA 3ETEA 5BVGB 4ND6A 1A77A 5DJ5A 3GH3A 3W5CA 3HA2A 2PKYX 1RU3A 4POOA 4FEGA 2I9KA 4B73A 1CS0A 1U5BA 1M10A 3O95A 1ZGAA 4F9FA 3GGPA 1XTJA 4AKGA 4QT4A 1DOHA 3GFQA 3N70A 1PGOA 3OFJA 4AX4A 3F74A 4XVHA 4TV8F 1U80A 4B0OA 4K81B 4P9NA 2R48A 3MRSA 1NA5A 3B53X 1QS0A 4R9UC 1VL2A 4TTQA 3VJKA 1C9EA 2XNJA 3T06B 1Q0QA 1TQ8A 1RLOA 3DNFA 3PC3A 4KB5A 1FSSA 2QRUA 3BULA 3EZ7A 3HEAA 3QFSA 2WVJA 3RV3A 4ZC8A 4EQ6B 3IT1A 3GYBA 1Q6YA 3KE8A 1PDVA 3UJHA 1BA2A 4X97A 5AD1A 2Q2OA 1ES9A 4IXMA 1DAGA 3NEAA 1DBQA 3QWHA 4D80A 2V4ZA 3LWZA 3OFND 4X20A 3GB9A 2ZIEA 3AKDA 3DKVA 1GQYA 1GY8A 4MKFA 1R4ZA 1Z4LA 2L42A 2UUPA 4JEUA 2YRFA 4JLVA 4BKRA 4DR6B 1QSGA 3AU9A 1AQYA 5AJTA 2DTDA 5GVSA 1SXJC 1PSZA 5IHXA 2NZ8A 4ARAA 5J58A 1Z08A 5LP6F 1LFDB 1E2GA 3IS3A 3NHUA 3N05A 3LNCA 3DVQX 1W8DA 3NDJA 5ALTA 3MFQA 1LCIA 3CCFA 1USUA 2BT4A 5L3RA 1E9DA 2NU7A 1ODKA 1X7XB 5J1TB 4I3GA 1IZ9A 4EG0A 1U8FO 3WQRA 1H9AA 4WSOA 2HCTA 1M6VA 2H08A 2ZBVA 1ISIA 4RQUA 1NDUA 3UB4A 3KPWA 4OOFA 3SSAA 3VYRB 5K6TA 4J7XA 4PAMA 9MHTA 3C8HA 1BXRA 2PGXA 2RK4A 3A70A 1JAHA 4IOMA 3P9ZA 5HMMA 1ONOA 5KNBH 5I51A 3R5XA 2XH8A 1BWSA 1ZUD1 2VDQB 4QLAA 4HX2A 4GQIA 1YZVA 3DAPA 4BQRA 4W9MC 3DVAB 3HCFA 3RAFC 3MD0A 4ZT3A 4B4KA 1TA9A 4DV6B 5DF1A 4TXMA 4OLBA 2RHLA 1XNGA 4BVHA 1ZA2A 3HSSA 4N7JA 4PO1A 4R1SA 4YUVA 3U9LA 1G4UR 1F2TA 2BFEB 3EGXA 3WFZA 1ZNXA 3TQTA 5LP1A 4WOBA 2O2YA 4N7MA 1KDRA 3L0CA 2B1IA 1G1AA 4FD2A 2GZMA 2A78A 3KZ1E 3UXMA 1V5GA 1ATIA 2NM0A 3R3VA 4ITUA 5CDSA 1QYCA 3RT7A 5AW1A 2Z2IA 3DDCA 3AW8A 1YA4A 1MABB 2PZMA 5K8LA 1H94A 1XTRA 1BWPA 1FNSA 2NG1A 3CNBA 4FFMA 2BDTA 4K3UA 4MYDA 1AOXA 2YZGA 4D4LA 2IHKA 3MEQA 4BLSA 5JECA 3SQOA 3OWOA 3VNAA 4DMFA 4MS1B 2RHGB 3FNQA 3OLCX 3RREA 4IGFA 4ZHQB 1S1CA 3PG5A 1A7JA 1CZUA 5B3AA 2GBFA 3AERA 4W82A 4ZPJA 5EMHA 1I2MA 2IF0A 3BD8A 4W99A 5FUBA 4ZOBA 3VHXB 4CW7A 4WNIA 2OGSA 1B0PA 4LDJA 5JYDA 4AKHA 2E37A 1JZSA 2D2XA 1M1YA 4NIMA 5BSRA 1GZ7A 4QAQA 4LOKA 1DWQA 1IJEA 5JD6A 3C1AA 2C57A 1UBJS 1M1ZA 2IPNA 3BXXA 1ZMXA 4G5GA 4G97A 4JX9A 3UCFA 1CT9A 1MG5A 2RH4A 1WPRA 2IEGA 2RG1A 3IP6A 1KJNA 4JB2A 3CEAA 4MWTA 4YCBA 4CR7A 4ND8B 2IIQA 2J45A 1D4ZA 2QN6A 4C4TA 4TWJA 3QX9A 2OB1A 1HQKA 1RCTE 3MJDA 4IFTA 2P3OA 5B7GA 1HYBA 2J67A 4JLDA 4OYHA 3SZUA 5DMHA 1SOUA 3F9RA 3VZRA 2X9QA 1W1WA 4PV7A 4EKDA 3LWBA 3QVGB 4RBNA 1NM5C 1RQGA 3KU1A 5DGCA 5DGXA 4DCPA 4B7ZA 4A6XA 3MMPA 1GU0A 4KRYA 1UANA 3DHWC 4LBWA 2GD1O 2ET6A 1AUXA 4QM6A 1QGOA 2R5WA 1XEAA 1EXVA 3N5KA 3PCTA 1K0FA 2J5KA 2ODNA 1BYUA 3RIMA 2COUA 3B48A 4X1YB 3L1KA 3ONNA 4BB5A 2FAXA 1HG0A 3G2LA 1IBMB 5F78A 1B15A 2V0CA 2FW1A 1J42A 4KIUA 1T2UA 3WI7A 1C14A 4FBMA 4PQRA 3M9XA 1TE2A 1JR2A 2X4GA 3NAZA 2H85A 1UC8A 4N9QA 4NG5A 3B2QA 3QF4A 4TSFA 4ZQGA 1P60A 4UEOA 1ZI9A 2PTHA 5AHRA 3HKEA 1PN3A 2OQIA 2PT5A 4HNSA 2L17A 2Y1FA 2AH5A 4DG8A 1EGHA 2Y05A 4WBSA 3ZW7A 3P2MA 5EWMA 3KDPA 3HXMA 2OFXA 2E82A 5A7HA 1J1UA 2Q1UA 1FPMA 1VP9A 3JYNA 3LGSA 1T1IA 1GRNA 1QZUA 2FQWA 2Z1DA 3ZDEA 1OXTA 4CKCA 3RVSA 4ML3A 3WV5A 1V7CA 5EXXA 1NMZA 2AWNA 5DN6D 5BT9A 1E1KA 3K0KA 4J0CA 5EQDA 1PUJA 2WAAA 4HVAA 3TXYA 4C5BA 1V5IA 3L0PA 1ODSA 5WRFA 5E6UA 1Z17A 2XB8A 1PRYA 1DKOA 1QOZA 2HGZA 3CLRC 4LX0A 3KLBA 4TTJA 3HR7A 3IFSA 2F2TA 4HWOA 3WA6A 4NC9A 1ZSNA 1RRCA 1Z83A 4CMJA 1FLNA 1XVAA 2GM3A 1KI1A 4IBOA 4NMWA 4BB0A 4MUIA 4CHTA 4FYPA 1NR5A 2J48A 3A6PC 3CH6A 1ZISA 2FUKA 4UZFA 2QLMA 4IX9A 4MA0A 3HM2A 4AKTA 2PH1A 5EKDA 2D1FA 1GCAA 3CPEA 1B43A 2G83A 3L4EA 5C8ZA 3FYUA 2GI4A 2P1RA 1OE0A 4JSYA 1QFXA 3FOEC 5KNLA 4FIZA 1D2EA 3V7YA 3W8EA 3RVDA 2OVBA 1Z6QA 5IKOA 4Y98A 2OHHA 4NAUA 1KVRA 2C5FA 2PYIA 1GAEO 1OYYA 1DADA 1XKTA 2F6RA 2GX6A 1OXVA 3QWFA 2ZATA 2IP2A 4O4LA 4MGHA 2E89A 4MVJG 2O7RA 4MX8A 1X77A 5BPHA 1GGEA 1EVQA 3T1HB 2Y0DA 4IGEA 1Q16A 3E61A 2OYRA 3G2HA 3LQYA 5KVQA 2H9AA 3S55A 4QQKA 5HKAA 1ZJJA 1NHWA 1JG7A 3B5EA 3CRMA 3I83A 2YC4C 4E4YA 4DHWA 3ZDBA 1GP2A 3IODA 3H16A 4UE6A 5GGXA 1CR6A 3H0KA 1U6KA 4BVKA 3HDJA 1RKVA 5FBWB 3HDQA 3V4PB 4AJOA 3NOQA 1R5OA 4FOPA 4GBED 2IUUA 3WWPA 4KN6A 3UV6A 3VXKA 1QIEA 2C96A 3KBOA 1Y33E 2AG5A 4JMPA 4EG6A 2GN0A 1Z0JA 4HATA 1RXSA 5TJ9A 1UC4B 1ZONA 1KSHA 4EI2A 1L7VC 2CDAA 2IHJA 5HWSA 1IK4A 1Z9BA 2XA1A 5LYJA 3V9PA 2F59A 4F60A 3OPMA 4IKEA 4YRIA 3K9FC 3DTVD 1P73A 4BJ5A 5IF9A 2JLAA 2J0UB 3Q87B 4RZ3A 1ZVMA 1NG1A 3QMWA 4K6CA 3BXPA 4Q7MB 4EKNB 5L6LB 3PKZA 4B2PA 1U7DA 3CUEF 3NONA 4TVOA 5F3RA 5GV8A 5K3CA 4ARBA 3TIFA 3M4NA 3UAVA 3SYNA 2I54A 3ZHOA 2RGNA 2H8KA 2PMBA 3E0XA 2IV2X 3T61A 1P19A 3PUKA 3QJ5A 3X2SA 3E22A 3GDWA 4O0LA 3WJ2A 3K1JA 1OXMA 1X1QA 2DLCX 2Q1TA 3TLMA 3S2IA 1H2XA 1OOEA 3IE1A 1KZYC 2ZG6A 4B3XA 2PFSA 5AI4A 1TF7A 1MH9A 5EWLB 1MJFA 5K09A 4LWZA 3GUUA 3C7AA 2YMLA 2W6OA 4RIFA 4X61A 4RK1A 4NZZA 2NQTA 5TF0A 1Z6TA 1AO0A 4B1FA 1KI8A 5JMTA 4MP6A 3D6FA 3IT0A 5GOZA 1G21A 1JBEA 4QPZA 4QBIA 4L0DA 1EE9A 3NANA 3DE2X 2WOJA 1KVUA 1IN6A 3QX8A 4MGIR 1YCDA 3T3DA 4GOOD 5JS6A 5GIOE 1L3CA 1R74A 1OXUA 2HLDA 4PRZA 3BXGA 2R47A 2XHEA 1W25A 1EK0A 4ZDJA 5KTOA 4MWGA 2I8LA 3FJYA 4Y2PA 3SS8A 2YMQA 2CVQA 1YIOA 1V9LA 5A4FS 3S8YA 2WMYA 2NLOA 4EGAA 5HVNA 2AC7A 3DMTC 3DXFA 2PSEA 3H2BA 3FYCA 4NOJA 4UDYX 4GSYA 3SLRA 4D3XA 2NZXA 1MEEA 3JQCA 2E87A 1QQ5A 1RP7A 1IDN1 2FPXA 3H18A 4G5QA 4L0CA 4PQEA 3ELDA 4R3WA 2OO7A 1P1IA 2CLOB 1YT5A 2QVGA 3PFFA 4A1FA 3U49A 2UVDA 4IEEA 3Q3GE 2P0AA 3I9V6 4PZAA 2NW6A 4LMRA 4TKMA 4AICA 4MOWA 5HCIA 4G23A 2A84A 2HLNA 4B34A 3QFFA 2P9TA 1CHDA 3FOZA 1XKXA 3PFGA 4YRJA 2JA1A 3E05A 4TWBA 3UENA 3H5WA 4WLUA 4YV1A 1KJZA 2I65A 3OC6A 3ASYA 3DYIA 3KWFA 4BAGA 1YR1A 5I5GA 1IEWA 5CFZA 5FXMA 2MJLA 2HF9A 1ZHFA 1KNXA 4A2QA 1W4ZA 5J1SB 2EXXA 2BGRA 2WWGA 1Y8RB 4H6XA 1KS2A 2PT7A 3HABA 3MJRA 4R8SA 1RHJA 3BD6A 4D8UA 1B0ZA 3L7NA 4KAAA 3E9CA 1PZHA 3KZXA 1NLMA 2D1QA 4RK7A 2O5EA 4WNYA 2CNWD 2GN6A 4QREA 4U5QA 2QLNA 3TJRA 2YV3A 3CX8A 1JPVA 4HWRA 3SF0A 2BY4A 1FB5A 3NP9A 4FP9A 5CVTA 3KAPA 3VR6A 5L9AA 3U3MA 1NMEA 2G0NA 2JGFA 5IMSA 2VUHB 4I5EA 3NBUA 1ZH6A 2YZMA 3BFXA 4RKRA 2UZ0A 5KSPA 3UH1A 4D9MA 4UCXA 5TSDA 2YC2C 5LMZA 1ZX1A 2DJIA 4D9HA 3RK1A 2FPSA 4LXHA 4MV9A 3THOA 1ORIA 3JPYA 1H2RS 2WWWA 2H1RA 4FZ5A 2JIDA 1Q2UA 1CQWA 2I78A 1R0CA 3EQ8A 3KOWA 4E12A 3AJDA 3WJ7A 4H77A 4R9VA 1FU8A 2HMAA 2Y1XA 1Z56C 4K6MA 1FEZA 2WIJA 1DCKA 1CW2B 4JL8A 3FPBA 3RLIA 1P7CA 2HSEA 3UTCA 1CIVA 3KT6A 4XRGA 2O8FA 4I5GA 1EGVB 4PIPA 1EFRD 3OX1A 3WWCA 5DASA 4D8YA 1LVUA 2WAMA 3RB8A 5I4CA 1NY5A 3H5NA 3O4VA 4J07A 3JYLA 5KTKA 2HA2A 3TCXB 4WI1A 5TT1A 1OH5A 3Q41A 4FXPA 2A4MA 3GP5A 3K6RA 4G4SO 4I81A 5AM3A 2OQRA 4C4SA 3GRCA 1H22A 2AI1A 3L8FA 3FNGA 3G9TA 1JSCA 4QPNA 3DBLA 1Z0AA 2HXGA 2TSYB 4Z9AA 1X7ZB 3RSSA 1W49A 2YJTD 3G1UA 3UC5A 5KVSA 3JD1A 5LXTB 1JHDA 5INTA 1BCSB 1RBZA 3MNFA 1OLSA 1G9SA 1J0XO 2YXBA 5CVUA 3M6FA 5EC8A 1EBUA 1LJUA 3O91A 5EMKA 4M36A 4JI6B 2Y0EA 2R7MA 1TK3A 1Q6ZA 4M7WA 4P81A 2AEEA 1QE3A 2OBBA 3DF9A 1H2WA 2OP0A 3M89A 1B74A 2CUTA 2HRZA 1FNNA 4FGZA 4TVKA 3LK6A 4ZI3A 2ZUBA 3QEOA 4R8RA 3VNBA 1QH1A 3GJYA 3T5PA 3HO1A 2OMEA 2I29A 2YYSA 3U7QB 2W6MA 4MPTA 4ER5A 2WB2A 2PJZA 1U2TA 2KLBA 4KJZA 1T2CA 1M8KA 1T3SA 2ZAYA 4TQUS 1YRYE 1X8XA 3HR8A 4PANA 2W90A 4BVFA 1NQTA 3ZZ1A 1P1CA 2QTRA 3QKSA 2D3WA 1L4KA 5KNCD 3WGIA 3QEBZ 1IHYA 4B3HA 2ZIVB 4F3CA 2BR4A 4YIHA 4G25A 1P9OA 5CUQA 5LU8A 4ENUA 4GOJA 3PHGA 1IEVA 4WNAA 1S8AA 4K03A 1B6RA 4YT8A 3JX9A 1FXWA 4EJMA 3RFXA 2QL6A 2ZR7A 1MORA 3GELA 1P6QA 5FOVA 3BGSA 4DRZA 3QE3A 5AM4A 2A5YB 1CERA 1OAOC 3WMRA 4CNQA 3ZDDA 1QR2A 1EESA 2QD4A 4P53A 2VZEA 4FC6A 4JH0A 1MOZA 1XAGA 4L95C 3ZZ0A 4AMZA 3P26A 3OFKA 4TKLA 5JU6A 1DG9A 1OH7A 2QUHA 1MDBA 1GCUA 1KO5A 2B7LA 3B6ZA 3LQKA 3EODA 5DHPA 1SXJA 4OJQA 2P6UA 2GUWA 1YR7A 4PPYA 5E1DA 5G4KA 4EMBA 4P22A 1PJQA 2J4DA 2MTBA 2ZS9A 3CVVA 1MCZA 2CHQA 3RRMA 3KSAC 4C2AA 3E9ZA 4OI4A 4MR9A 4N3NA 2WU8A 2WT9A 3FOAA 1BZYA 5DXFA 3SI7A 1SKQA 1MZPA 3BAZA 4IDAA 2ODEA 2ZRNA 4M86A 4X90A 4LFCB 2WWXA 4O1HA 1M67A 1RADA 3TZ6A 3WNQA 3WAJA 4O59O 1LBQA 4I1UA 3SFZA 4A0FA 4JI0B 1A9TA 4IJUA 5EXPA 3CRW1 4GM1A 1N6LA 3D5TA 1F3OA 3HDVA 5D84A 4X3PA 4KQEA 2GPSA 1XFAA 2GTHA 3C70A 2H16A 5K05A 2I4OA 2KSQA 2FMTA 4C3ZA 4F2GA 5FV7A 1SOVA 1ZN2A 3THRA 2H2WA 3CNHA 3K32A 2A7XA 4WLOA 3RAPR 2Q6IA 5KHLB 2WE8A 2EAUA 2J3JA 2VYQA 3JR3A 5ECWA 1E2QA 3DS8A 5JAQA 1E61A 4KGVA 3KQUA 4EHFA 3ZBPA 5IKXA 1LA2A 1DZIA 1QUEA 5HS4A 3KFVA 3JRWA 4P0QB 3JD4A 2YV1A 4H7EA 1N33B 4JUDX 1OBCA 2XDAA 3IAM1 2F8LA 2XYQA 2B5OA 3IA2A 1JH8A 1ZO8A 2WKQA 3FLMA 3NI2A 3ME5A 2JA2A 3NT2A 4XQEA 3ZLVA 5BOSA 1JJVA 5LQRA 5DGIA 1JLLA 3FOBA 4AZ3B 4YY3B 1IHDA 4RH0A 3GRFA 3H8VA 4DDVA 4Y6SA 3O4FA 2CWDA 4BUJA 1KY4A 3GVHA 4HS4A 5CBPB 5E1BA 4CTMA 1KTVA 4KLRA 5CA1B 2FUNB 1Z8FA 1ACMA 1UBLS 3BSSA 4WESA 4E4RA 4ED9A 3RASA 3R3UA 5J4HA 3QSYA 4QAJA 4TLCA 3N58A 4ZARA 1PK8A 2ONZA 1YQ9A 3AU8A 3FYDA 3KSUA 3PR1A 4M98A 3S2EA 1XQXA 5E8RA 2I71A 2J5RA 3DO5A 4KI0A 4QARA 4XWAA 3RUHA 4AO8A 1D1QA 5J4LA 2JZNA 3VR5A 3QV1A 3CIOA 4FDAA 4J0QA 1VIVA 3MTEA 2KX7A 1G8KA 4CM5A 821PA 1U9YA 4CLEA 1RLUA 4OAQA 3T5GA 1PW7A 1YMUA 1NZDA 3MYYA 1VI6A 3EVEA 3H2KA 1N8SA 2PLAA 2FPIA 2QM0A 4WJZA 3R7BA 4ER7A 1N77A 4J7AA 2R25B 4M8KA 1TF5A 5K2MA 5BYKA 3CNEA 3K1ZA 1RPNA 4LMBA 3EXFB 4RIGA 2NVUB 3BRWA 4DSAA 1W5EA 4F5DA 1TAUA 2HF2A 2JI9A 3FW1A 3Q3HA 1P39A 4XVQA 4GWGA 3DZFA 1AXEA 5FUWA 1VA4A 4YUAA 1TI7A 4RDXA 3LCJA 1NM5A 1NIJA 1SBIA 5BN4B 1C80A 1AU9A 1M2OB 4PPQA 4RPJA 4EPXA 2FW7A 2NXCA 1OLXB 1W4CA 3HBLA 1KIMA 3AHGA 1J6UA 3TRHA 1KEUA 1UBUS 4JJKA 2R8OA 5B55A 1BO6A 1P5HA 3ACDA 4LAFA 1NBOA 2CVFA 3FGOA 5ALGA 1FK8A 2WINI 3KAKA 3PDHA 4DTIA 5TMBA 4UJ3A 5F2NA 2R8EA 3I58A 3REGA 3M33A 4LTMA 1ESNA 1JYFA 4V0NA 4AZ0B 2PL5A 2FPUA 2PX0A 2PRKA 4DBVO 1R3UA 2IV3A 5L7TA 3KQLA 2D13A 4GWKA 4DADA 4LCJA 1A69A 1LK5A 1EWTA 5EYPA 2H52A 2NZYA 5LKAA 2VPXA 1K4YA 4QM7A 4KTVE 3GFRA 3HKCA 1QZ3A 5DLQC 4YAUA 5HILA 2NO7A 3QITA 1HT2E 2OHIA 5DNVA 2V7VA 1DAPA 2O0HA 5TY0A 3MCTA 4QBKA 1BQ3A 1S3IA 1AGPA 3NC4A 2FPMA 1UZAA 2GZ2A 2Q4OA 3A9CA 4Y2RA 3RE1A 1QONA 5B1SA 5K4GA 1GTJ1 3W6UA 3DE4X 1N5JA 2QZJA 4RSGA 3AVVA 1T34A 3BBLA 7ADHA 1NNEA 4B32A 3C3BA 4BMVA 4TL8A 3JATA 4YPOA 1W2GA 3L0DA 3ICCA 4NTZA 5DM0A 1GZVA 4DYDA 1KI3A 1SVMA 1QNLA 1UOOA 4A8JB 2R7NA 1GFSA 4Z1MD 2WWVD 4Z2AA 2XF2A 3PWZA 1HURA 3MGGA 2A9VA 2IITA 1ADYA 2B4QA 4EK9A 2J59A 3TQOA 5EJ9A 5E1OA 5DZSA 1N5RA 2NU8B 2EP8A 2P2NA 3RSHA 4EF4A 3NW9A 3CW8X 2QUAA 3UTDA 1JEQB 2WJAA 5JMPA 4G0VA 1E0JA 2JL1A 1Q1EA 4R3NA 3ZU4A 2V9PA 3ENNA 2HX1A 4ALIA 3QYPA 1R1DA 1XLTC 3SX2A 1JR6A 2CLHB 4JQYA 4QOJA 3R7AA 3CB4A 1JS1X 2COKA 2AJDA 1FS5A 1UQRA 2ZSFA 3EIEA 3HP7A 4M1SA 2HA3A 1ORRA 5ETJA 5M2QA 3QFRA 2Q4DA 3ZH2A 3B3QA 4PW0A 1H5NA 2I7DA 1WWKA 1XLVA 4MPJA 2V3WA 2R5FA 1D04A 1MC5A 1X74A 1I0ZA 2AVDA 2O7VA 3DWEX 1TC1A 5DN9A 2DWPA 4P3PA 5FUVA 3RSLA 3MTGA 3H9CA 1NI4B 1WHSB 2QJWA 4WJKB 4X71A 3K9HA 4OV6B 3ZZNA 2QSZA 2AXPA 4PZPA 2C4TA 1Z7GA 1JU3A 3KKQA 5K45A 3I61A 1NVXQ 3HJTA 4Y7CA 4Z3OA 5A0TA 5K8IA 4PYQA 1KSGA 4WJLA 5EKTA 2J3EA 3H2SA 1RJ9A 1KDOA 4KZKA 5TS2A 3RBAA 1LX7A 1NXTA 1RHRA 1C9DB 4WZBA 5JFGA 3IQEA 4KPUA 2LKDA 3WDKA 4BN0A 3TR0A 5A3RA 4B84A 1A1VA 2F1OA 5CU7A 1D09A 2PH5A 1AC5A 5K8TA 4DNFA 4ZV7A 3CGGA 4WN9A 5ENDA 3VR1A 3ICEA 2WHQA 3EOAI 1Y5MA 4FQ7A 4HEHA 1ZC3A 1Q0LA 2B4KA 1T9BA 1XHEA 2H0AA 2QD3A 5F1YA 1D0SA 5AUPB 3OCZA 1PG0A 4RV4A 1OH8A 1QMPA 2ZJAA 3HBMA 3N74A 3VDMA 4AYXA 4D74A 1ECPA 1SUEA 1DU4A 1JHMA 2YQZA 1CJKC 1HLDA 4QOIA 3UMGA 1Q17A 2BL4A 1VDZA 3AWIA 4TYPA 1JQLB 4HNHA 5HZMA 5DT2A 2XOXA 4P84A 4H1WA 3W4JA 3SSNA 4JLPA 3L43A 1EDZA 3DE5X 5LBIA 3RKUA 4DR2B 2O3QA 1UL1X 4MI9A 3FTDA 4JI5B 2H7VA 4URHA 2QTCA 3A1EA 2ZI6A 3O84A 1MVOA 3HZOA 1SG9A 2ZSAA 1CUEA 4F04A 1CUCA 4GL2A 3GVCA 3TB6A 2ODAA 3F9IA 2XGJA 2F64A 1DDGA 3P96A 2JEOA 1IN5A 2AC4A 3G49A 5TEVA 3DEKA 5H82A 3R3YA 2A0YA 3M9WA 4L4RA 1RIFA 1VRVA 3KKKA 5FJIA 4B6SA 4LYEA 4JEIA 3WP0A 4C2UA 1QVAA 1UWLA 2CFRA 2KHZA 2WJWA 1JXMA 3NYWA 1LRKA 3HZZA 4FIDA 2NNWB 2QMEA 1L5OA 2EBWA 2H18A 1TOAA 2OCYC 2G9NA 4B8WA 4DRYA 3D4IA 2IYWA 3CGWA 3DMTA 3H75A 2QVYX 2D6FA 3MMSA 4V1CA 5KDDA 1BU5A 2PUEA 3P97A 1IJFA 1R7RA 2WHPA 2ZBGA 2XWPA 5C8YA 3MJVA 4L73A 5ALZA 3D8NA 1OT5A 1EP2B 2V7GA 4DQUA 4IJ6A 3NOXA 2W4QA 3HFGA 1JWLA 1GYRA 2ALJA 2CC2A 1Z8DA 1WW8A 3EUWA 1NVTA 4HO1X 3IDSA 1PWHA 2QX8A 3O2SB 4RM2A 2O4UX 4X7RA 3T4UA 5MN6A 2IS6A 3GCXA 4JEHA 1UOEA 4KR6A 1DP4A 1G2QA 1ZDMA 3EAQA 4ESHA 2Y1WA 3C7TA 4DLPA 1D4FA 4OQXA 4P4GA 4V2UA 4YPFA 4AY3A 2VQEB 2F8TA 2DBRA 2VK4A 4CL0A 4NBSA 1IYZA 4YC7A 2WV9A 1V8BA 1F20A 1PGNA 3ZBTA 3REQB 1MOSA 3PVZA 3QOFA 3BH7A 2PH3A 5DNYB 1VI2A 5ESXA 3VDXA 1HYGA 1N7GA 2XDWA 3OOSA 3KTAB 3BEDA 4FNMA 4MQ5A 4CL3A 5JQGA 3HPQA 1XF9A 1VJ1A 1XRJA 3DLCA 4PYNA 2GPBA 2V6MA 1G3MA 3H3JA 5IRCD 3H97A 4ZOAA 1DBRA 4EHDA 2NVBA 2BIFA 1RSZA 1M7BA 3QPDA 4JP1A 3GRUA 3QHAA 1F4VA 3KB6A 4JMLA 2B9EA 2PSDA 4LPSA 4V0KA 2PJDA 2X14A 4J2OA 3V1UA 1T8PA 3REOA 2EX0A 3K0AB 4M9SA 2NTNA 3NU1A 1XTQA 1JHUA 2VF2A 2VYFA 5DSXA 2QTAA 4P93A 1YR3A 3PWKA 4NH4A 2FMIA 3S5UA 3W2GA 1M76A 2JIRA 2ZI4A 1UEXC 1PVDA 2XCLA 2GZRA 3JQBC 3PNMA 4HDNB 1PK7A 2Q4TA 2PWYA 1VL5A 4G4GA 4O2AA 3F7NA 2J30A 4OSPA 4YLYA 3FMFA 4DF3A 3WHLA 2BUCA 1U3TA 1ZMBA 4WBNB 3TAUA 2ZIUB 3KLNA 4R84A 4UVDA 1FJGB 1SQ5A 1T1JA 2IT1A 2V7UA 2ZJOA 3D7SA 3K0HA 2ZE6A 3DFIA 4KEAA 4DCNA 1E4VA 3NTRA 2B8EA 3MWDB 3DEAA 4KXUA 2SKDA 2OHOA 3OIDA 1IOVA 5ARDA 4KE7A 3W5HA 3OCWA 4B3FX 4DVGA 5THXA 4C4ZA 4PHHA 5L4SA 4YJFA 4ZREA 1AQNA 1I9CA 2EKZA 4RIIA 4LMAA 3NT4A 1CY4A 4ZV9A 2ZSEA 4DCTA 4OYRA 1YKFA 4DCUA 1UDBA 3IAFA 2WF6A 4A2CA 1X87A 3AP3A 3OQNA 2PZ8A 5SZIA 3NH9A 4MWCA 5H70A 4EY5A 1GG8A 1K08A 1XL0A 2YYAA 3CH4B 3CONA 4LJ4A 2XUFA 1QV6A 3U40A 4HQLA 2H9YA 3KWJA 4C1NA 1A50B 1NUHA 1R15A 3PUXA 4E1BA 3JQAA 2X76A 4LGYA 1SBTA 1W85A 3ER6A 5LQUA 2D8MA 3F2VA 4FW9A 5EXTA 1LI7A 4YHHB 3HBFA 4N5IX 3VYUB 2A9OA 3FPFA 4NF2A 2W6PA 2UZIR 4ILEA 5LWHA 4KI7A 2ZPAA 4KLZA 1QP4A 5IARA 3D6JA 1Z5GA 3PC2A 1H3FA 1WKBA 3K96A 4A10A 2BEJA 4HUJA 5AVXA 2ID7A 3R20A 3SVZA 3EIQA 2WFLA 3PJDA 2NQ2C 4IKPA 2GAAA 4BWYA 5KVCA 3NNSA 3I45A 3ZGOA 5BMOA 2XUIA 3PXUA 2K6GA 4FFRA 3ULKA 4KGXA 1Y3CE 2GF0A 3CTPA 3TPFA 2Y66A 1JIJA 1WU7A 3D1LA 2NUAA 3WLKX 3COWA 1B8VA 2GFQA 2HWUA 2ZPTX 4HGOA 4NABA 3TZCA 3X1ZA 1R00A 2A2ZA 1E89A 2HFKA 1R4AA 2QMQA 4C6SA 5F4BA 3INRA 5HQ3A 5DCUA 1USWA 2GZ1A 3L8CA 3PUZA 2IYSA 4TSFD 2Q9BA 5DLDA 1JECA 4C5CA 4DLWA 5AP9A 1JQEA 2QVBA 3DAOA 2B8JA 1XTVA 1OA0A 1SHTX 2J5QA 2O3SA 2WJPA 2IPMA 2NNLD 3HFRA 3WRWA 3R8FA 1YZQA 2QR5A 2RHOA 4WUVA 3AY7A 3CJTA 4DLTA 1XG5A 2CKMA 2WUFA 5CXUA 3PT9A 4WH0A 2G25A 1OFGA 2Z5VA 5GONB 4HVLA 1O1YA 2J3DA 2QPAA 4JS0A 3RVQA 4W5HA 1W19A 2DOKA 3BJEA 4RKQA 1BDBA 1LDEA 3PA6A 1PX2A 2PN1A 4P4SA 1QHHB 1XTPA 2IELA 4JBXA 5CYPA 4EJSB 2EKPA 4RPLA 4DA8A 1YUMA 3TIXB 4DJDC 1OF1A 1KJWA 5K5EA 5KVAA 4NICA 1QDEA 4NPAA 4E5MA 10MHA 3B7WA 4JI2B 3RS9A 3FHLA 2ACEA 4UTNA 4PC2A 5FWYA 4DKXA 3IOBA 5ALKA 4RIEA 1O9GA 4Z2YA 1DRUA 4YX9A 4NQZA 2DKFA 2GNPA 5HYVA 2EERA 3X2EA 1UWCA 4MKIA 1QE0A 1UQUA 1O95C 5GZ1A 1FFEA 4JU9A 4GS5A 2ZUFA 1PD1A 2ZUWA 2CNLA 2FZWA 1J8QA 2GBCA 4GW3A 3CO5A 4KL8S 1TZJA 1GYPA 4MV4A 4H6VA 1T6YA 2WJGA 1B26A 2NQ8A 2PGLA 4JQZA 4YT5A 2VKQA 4GZLA 5DPMA 3E03A 5HFNA 4DM7A 1PJ4A 1DQYA 4EAAA 3N76A 5FO1A 2PA0A 3ZD8A 3ZCSA 2GCOA 5C5EA 5IYZA 3SZGA 3KQYA 2XXBA 4PYRA 1I2DA 3TN7A 3HCCA 3Q10A 1U8CB 3NV9A 4KNWA 4OIFA 2JHCA 521PA 2XVXA 5K7SA 1IHXA 3E9DA 1UINA 4X00A 2GEFA 1XD8A 3GPCA 1RQNA 2D5IA 2DKNA 1CJMA 4E07A 3KPVA 2X1LA 3RANA 1CZOA 3OLQA 4PC6A 1UXIA 3OTWA 3RYHB 4KBFA 2VLBA 3HR4A 3N2KB 3OOHA 3CPSA 2X41A 4ZI7F 3BWMA 3ZX5A 4KIFA 3V48A 4BEBA 1E3EA