4BWYA

P4 protein from bacteriophage phi8 (r32)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
288
Chain Sequence
NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSRGAVFNQFLLSGQSAFLGPNIPESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords P4
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
total genus 88
structure length 288
sequence length 303
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bwyA00
2CLDX 2EVWX 3AKYA 1N6LA 3QPWA 1PJRA 3UG7A 5H1YA 3IIKA 4URUR 1CR1A 1ZM2A 4Q1AA 3TR0A 1YZQA 2QPOA 4EPWA 2CHQA 2G83A 2WSSA 2C9YA 5EJEA 1EFRA 2BM0A 4DLUA 5KNBA 1VG9B 4RZXA 3CWQA 1Z08A 3VKWA 3AVOA 2P65A 3VR2A 4ZCLA 3DVLA 3VU9A 3WNBA 5JSZB 1XTRA 3RS5A 1EWQA 2XAUA 5CIQA 2HLDA 3MUFA 4PC1A 821PA 1IN7A 1KJWA 1KKLA 1ZCBA 3FKSA 2QT0A 3K9GA 1XCPA 2AD1A 3TK1A 3BIFA 2W6IA 3K53A 2CCKA 2IUUA 4EFNA 5GVSA 1L8QA 2WJIA 2FPLA 1U98A 2VP0A 2ZRJA 3LWNA 2IYTA 3PEVA 4PSKA 1G7CA 5HTKA 1QF9A 1IY0A 1OIVA 2WWXA 2XNDD 4JBYA 3U7HB 4GMDA 4V0ME 1XZPA 2X19A 3SYKA 1F2UB 1Z83A 3CBQA 2ZRCA 2ONJA 5KHOC 1FP6A 3C8UA 1M7GA 1RRPA 1Q57A 1LS6A 2ODWA 3D6TB 4XVUA 1P9NA 3VAAA 3DEFA 1WF3A 4FMCF 4WVFA 4JBXA 4OYHA 1N25A 4HZUA 2GK7A 1C9KA 4TTQA 1KI7A 5CK4A 4E07A 2I3BA 1T9HA 3CM0A 3A1VA 2G88A 1VCOA 4IW3B 5JWOA 2GA8A 5JJLA 2QY9A 3L43A 4C7OB 1E0AA 2EFEB 4A2PA 1EFHA 3QEJA 4KLZA 2RHDA 3IO3A 621PA 2Z6VA 4A0RA 3FWYA 3EW9A 1CJKC 2ORVA 1XJQA 1QHYA 3HPQA 3THWA 1TQ2A 5FPHA 3EPLA 2XZLA 2AX4A 1NL3A 2WSSD 4O2LA 1EFRD 1I2DA 4P0TA 3LLUA 4Q02A 4QGHA 2ZJOA 1P7CA 3OAAA 2O0KA 4CT4B 2OEPA 2ZE7A 1MABA 2HLDD 1G4AE 2AFIE 3UPUA 3FKSD 1X8LA 5CYOA 1GKYA 1YR8A 4X8MA 2BKEA 2JLUA 1ZCAA 3EZFA 1HT1E 2PCJA 3VTKA 3U3KA 1FL9A 4Z1MA 1G8FA 5BN4A 3MWJA 4YMWA 1FNNA 1W1WA 5JZVA 5KPJA 3BC1A 4LJAA 2LCFA 2ZETA 3UKDA 1M34E 5DE3A 1GIAA 4I1SA 4IVQA 4B3FX 1R0ZA 2OBLA 4QJ4A 5E7IA 4MDEA 2J0UB 2GVZC 2C95A 4R9UC 3A1WA 2AN9A 1NKSA 3V00A 4QGGA 2WWGA 1XU4A 4UNQA 3TJZA 2GKSA 3R8FA 3VR3A 1GDDA 3CWZA 4B75A 2EFGA 2X2EA 1C4OA 4UJ5A 3O8RA 2KI5A 2HT6A 1EX6A 5BN5A 4PANA 3CW2A 3W3ZB 2NIPA 5FTLA 4A0HA 1U0LA 1N0UA 5HCIA 4FWTA 2ZRHA 2FX3A 1VPLA 4JLDA 4V02A 5JI3E 1P62B 1R8SA 3GPLA 3D3QA 3IGFA 5A4JA 2HCJB 3K1JA 4PSVA 1P2UA 2EWVA 2H8KA 3EWAA 1M1YE 1PUIA 4OHVA 2AXPA 3O8CA 1TQDA 2ZYTX 3KJGA 2R9VA 3ADCA 2VF7A 1RZ3A 1EGAA 1ZM4A 1XDBA 5JLJA 2GHIA 4TL8A 4TMXA 1P3JA 1OHHA 3OAAD 1IAQA 1S9HA 1FTNA 3TLXA 2Z4RA 3DM9B 3MWLA 5DYIA 5JBQA 4LBWA 1TF2A 2CE2X 2OILA 3I61A 2QG6A 1GAJA 2W83A 2O8FA 2LWIA 3NBFA 4FXPA 1NJGA 1Z6GA 1UDWA 2OSBA 3KUCA 5IDVA 1OFUX 3W3AA 4YMUA 4Z1MD 3OEHA 4PPGA 4N0DA 3NHAA 5JS7A 2VSXA 1XJCA 4HDQB 4KLNA 1P2TA 1S1CA 3C5HA 3ND9A 1XMJA 2IW3A 3FVQA 3VNVA 2RGEA 4TYNA 2BWJA 5D3QA 2VLIA 3OEEA 1YZTA 4MGYR 3UXMA 2I1QA 1M74A 4CEJB 1BOFA 1DPFA 2A30A 2I4IA 1E2HA 3CX8A 3LBIA 4A1FA 3THYB 1G8HA 3QE0A 4NYMQ 1WMSA 1G5PA 4LBZA 1V5WA 4FW9A 4LYAA 3IQXA 1XCGB 4LC0A 3RC3A 3W90A 1EFCA 2W00A 4M9XA 3GLFE 4RJLA 2XITA 1ODFA 1O3YA 1IM2A 1CLUA 1NBMA 1NF3A 1U90A 4A15A 5K8IA 3A37A 2IUSA 3BBPA 121PA 2Y8EA 4KFRA 4TQAA 3GJ6A 1UM8A 1P60A 3GFTA 1AS3A 2IF0A 3QF4A 4W9MC 2ZJYA 5BYJA 2CL6X 5FR2A 4C3ZA 3HWSA 5FFMA 3SFZA 4M1SA 4HUQA 2UKDA 4D0NA 4B2IA 4OI1A 4DIDA 3GEIA 2QL6A 3BFKA 2FSGA 3GJ8A 5K8UA 1YR9A 1DAFA 1Q21A 2P6NA 1DOAA 4PXAA 2ATXA 3K0FA 1OHHD 5BQ5A 2ZRPA 4G1UC 1NLFA 1GNPA 1NN5A 2ORWA 3I32A 1R2QA 4N0EA 5FOXA 3RANA 2QENA 1XD2B 1KSGA 2ERYA 2ZU6A 5G53C 2GVDC 3CR7A 3CKLA 4KITB 1G3IA 2B8WA 3BWDD 2WSMA 1HE8B 1GL9B 3VHLB 2AD5A 3MGCA 2QMOA 4URXR 2OFOA 3OEHD 1DAEA 3WBJA 3CX7A 3ETLA 3QENA 3SEAA 4UJ3A 3EC2A 1ESMA 4NKRA 4NYJQ 2O5VA 1RIFA 2J0VA 3JVVA 1Z6XA 1KY3A 2IYLD 3THXA 4WA7A 3F3YA 2ONKA 1VHLA 5AUNB 2C9OA 2IUTA 5AUQA 1KOFA 3PCRB 1JJ7A 5SZJA 2PL3A 4ZI2A 4MH0R 4DSNA 2MMCA 1W36B 2F1HA 1K6MA 4WIAA 4K46A 5KDDA 3C41J 2IYRA 3TE6A 2FGJA 2NO0A 2BJVA 2RGNA 2J59A 1NBMD 2BBWA 3TH5A 3W6PA 2QQ0A 4JLKA 3X1WA 2XTMA 2XGJA 3TGPA 1BMFD 2VBCA 3RABA 1SKYE 2ZRMA 3H4MA 3RS0A 2AKAB 2VQSA 2XTZA 2ZRNA 2ZUCA 3HYTA 2OV2A 4GT1A 1T6NA 3LQRA 1DVRA 3G82C 1P75A 5D3MB 2ZU0C 2D2FA 1G3UA 1P61B 5KYKA 2J9RA 2QZ4A 2XZPA 3KKNA 4Z8YA 3FMIA 3B9QA 5L3SA 1UBFA 2GCPA 3QPVA 1OKKA 3KXLA 4JVMA 4M53A 3KQKA 1QDEA 2HJVA 5E4FA 2E1RA 3B1VA 3Q5DA 1ETUA 2GAOA 5FL7A 2VP2A 3SYLA 2A5GA 1N6KA 1YRAA 3KX2A 3VX4A 2JGNA 4F4CA 2A7QA 3AVWA 4YMVA 3PUWA 4TT3A 5TXGA 1IXRC 1Z07A 3VR1A 4A36A 3SBEA 1D6JA 3AB3A 3THOA 4IEEA 1SVMA 1JR3E 2RGXA 5KO2A 2ZYWX 1JR6A 2D2EA 5K8LA 1XF9A 3KQLA 1E2FA 3EX7C 4QOSA 4YXWA 2VA8A 3FTQA 1G4UR 1JAIA 1E4VA 2GCOB 1E9EA 3EWSA 3QKRA 2PEZA 2REOA 3KDSE 4PQFA 1M7BA 2OXCA 3CPHA 3FPAA 3TNFA 1KO7A 5KNDA 3BAFA 5FTJA 3RHFA 4AKEA 3K9LA 3RSLA 4P4SB 4U7DA 3I92A 3FHTA 5EXTA 4BZPA 1AJEA 3L82B 1ZW6A 1SULA 2IHBA 1E9AA 2J7PA 4LC1A 2DFTA 4LHZA 1K8RA 3LBHA 3DKVA 2CNWA 2WWHA 1WB9A 2QMHA 1T5LA 2BHRA 4PFSA 3VU9B 1BIFA 4L9SA 3I62A 2O8BA 1AQUA 5CDFA 2VHCA 2J87A 4BWYA 3QBVA 1T91A 4Q48A 1FMJA 1TF5A 4POAA 4RD4A 2H16A 4Q18A 4IFBA 4M4SA 4NYIQ 4PO1A 4HB3A 2Q3FA 2XTNA 3GCGA 3GLHA 4FMDF 3NDPA 1SVIA 1OKKD 4DCUA 1IXSB 1AKEA 5FL7D 3ZH9B 4FINA 1XTIA 1D8TA 3A1SA 4QFMA 4LK2A 2ZR9A 5C4GB 4JVLA 4EKDA 3OESA 4ZV4A 1G291 3LY5A 3OHMA 4URYR 3SC3A 2PLFA 4DC9A 1U81A 5JMTA 1VG8A 4C30A 4IDOA 3BH7A 2OCPA 3MJHA 2DBYA 4JT4A 5M04A 3ADBA 2OBNA 4U00A 5L3RA 2ZROA 4YXWD 1N3BA 5KNCA 5EP3A 4M22A 4GSYA 4D82A 4HZUB 2R2AA 3QXHA 4RD0A 1WCV1 3T35A 2QORA 2X2FA 5TARA 2JJ1D 4PO8A 3LQQA 1F48A 1XEXA 4B71A 4TL9A 1E0KA 1FX0A 4PSAA 1TQ4A 4OI0A 4CEHA 2NZ8A 4BFXA 1JALA 1Y63A 5TY0A 1VHTA 4D6PA 2XSZA 3L0IB 1TEXA 2JASA 4RZ3A 3NBZC 1LTQA 1XFAA 2FOLA 3ASYA 3EASA 3OZXA 2J7PD 5DSZA 3THWB 1WXQA 1N5JA 2CNWD 2AL7A 3NBXX 4N3NA 2O8EA 5JCZA 4DEXA 2N1BA 3AVTA 2ZR0A 1MABB 3I1FA 3EA0A 1GVNB 1UKYA 3C16C 4G5QA 3T1VA 1KGDA 2F55A 2ZRKA 3DKPA 2WWWA 3QVUA 3WXMA 1G5RA 1FFHA 1GILA 2DWPA 1EWRA 4JT2A 4MKFA 2DWQA 2QRZA 2GJAA 2FA9A 4HAZA 2IWRA 2G0TA 5CB8A 3FFAA 2JJ2A 3WY9A 1XPRA 2BMDA 3FKQA 2JLXA 3IHWA 3SFVA 2ZRLA 4JSTA 4DCTA 5EE9A 1XP8A 4W5HA 1IQPA 2ZQ5A 5DH9A 3AKEA 1KK1A 3FMPB 1EFUA 3TMKA 2EFHB 4YQFA 4QNMA 4DHEA 3MD0A 421PA 3X2SA 2QROA 3BFVA 3F8TA 3K0CC 3B8HA 2QRNA 4ZCMA 2AK2A 2DPXA 4NCIA 3A58B 2QQEA 1Z0DA 2RGCA 3K70D 2XSZD 2BBTA 3PEWA 4NYMR 2OBMA 1GRRA 4P4TA 5DN6A 2IYSA 4AIIA 3DMNA 4A8JA 1GG2A 1X1SA 4LJYA 2GZHA 4DLXA 4BUJA 1AKYA 1CIPA 3WRXC 5FPYA 5FOTA 4B3BA 2WJJA 4XTCS 3V4FA 4LHVA 2NO6A 2ZE8A 1Y3AA 4WZBE 4BPBA 4L8GA 2GETA 3SQXA 4NTZA 1AS2A 1W36C 3OIVA 2PJZA 1WBDA 1J8YF 1RYHA 2V7QA 4RD1A 1EK0A 2ANCA 1R10A 2O8FB 1XNJA 3H86A 2PH1A 1E2MA 1LF0A 4Q21A 3LBNA 4KSCA 4IHQA 3K0AA 3SJCA 4Q1DA 4XSGA 2WWIA 4AKIA 1UAAA 2O0HA 2JJ2D 1KDRA 2GESA 3GJ4A 2JJ8A 3DPUA 2ZI7A 3EZ6A 3I8SA 1Z0IA 4MKGA 1OFHA 2LKCA 2ZR7A 3UWKA 4BQSA 3NKVA 3CH5A 2FFBA 2RKOA 5JEDA 2DY1A 1NP6A 1PLJA 1KZ7B 1WP9A 4C9BA 3PEUA 2A3RA 3U2QA 1E1QA 1K5DA 2BCJQ 3K09C 3GJ3A 4U5XA 4B34A 4LSGA 1DAGA 4A0GA 3WYFA 1CR2A 4DWJA 4Q1BA 2V6IA 1FP7A 2QAJA 4Q4JA 2V8OA 4A0FA 2C78A 3F5FA 2OFWA 4PPQA 5FTKA 1GITA 4TTRA 3PG5A 2ZI5A 1DE0A 4B43A 3RS4A 3AV0B 2H17A 3QF4B 4R2IA 1ZUIA 2ZYUX 4LV5B 3NEYA 1E2GA 5JRJA 1E99A 5HR5A 4JLVA 2V3CC 2IF2A 4JKYA 3PXGA 3PIRA 3GJ7A 2FN4A 5FOVA 4XWOA 3U4QB 1TNDA 2W2VA 3CIOA 1I4TD 3QSYA 2GF9A 2ZRAA 3C5CA 1G7RA 1A82A 3W5IA 3K0FB 1R8QA 1KAOA 5KSOA 1U2RA 2R65A 3AKCA 4JYCA 4GFDA 2J1LA 4TMZA 4ZKEA 1CEEA 4IXMA 5BXQC 1V43A 1AGRA 4MA4A 3KUDA 4RZ2A 3TKLA 2BJWA 2QBYA 4IDPA 4JLMA 1P2SA 3Q8XB 3BS4A 4FWIB 3W5JA 2JDIA 2H57A 1DTSA 1HQCA 4C2UA 1CJTC 2ERXA 1EXMA 1VCMA 1N0VC 4LWZA 3B78A 1GL7A 4GRAA 3B1XA 4A6XA 1Z2CA 3P4YA 1OW3B 3RRZA 2O52A 4DB2A 3M6AA 1ZMXA 3CRQA 3D8BA 4OHWA 4LOAA 1S3GA 4MDFA 1E2KA 3T5GA 1E1QD 5AJXA 4LV6A 4PC3A 4TMWA 3TVTA 1ZBDA 2OCYC 1R6BX 2FEOA 4GOKA 1G19A 1NVWQ 1JB1A 2A5FA 3BB1A 5CB6A 1Z29A 4B3XA 3RRMA 2ODNA 2VHJA 4B32A 3ZZUA 1P73A 2V55B 4RD3A 1Z0KA 4B3GA 3LX5A 4Q66C 1FQJA 4JLOA 4MUAA 1YHNA 5FPSA 1RPZA 3GLIA 1XXHA 4WAUA 3GD7A 4ESVA 2NG1A 1Z63A 1ZM3A 2YOFA 3R7WB 1TTTA 1ZVQA 5EUMA 4ARZA 1KHTA 3Q9LA 4PQRA 4X8HA 1OLOA 2UZ3A 3ICEA 1HUQA 1W7AA 4MGZR 1E4YA 2YV5A 5L3QA 4Q01A 1YE8A 5L3SB 3T61A 4Y0VA 4LBVA 5BYKA 3ZVNA 1ZM7A 2CVHA 4GOXA 3WHKA 1CR4A 1WA5A 3ZDQA 2QMUA 1TUEA 4G5SA 5CJ2A 2CLCX 2QAGA 4ACBA 5GJWC 1CF4A 2BBOA 3CRW1 1E9RA 4NYIR 4NH0A 4B35A 4JMPA 4A92A 2JIZA 1YU9A 5IRCD 1LY1A 1Z3IX 2JDID 1NRJB 2XJ9A 4KCGA 4BRWA 4MITA 3NWJA 2P3SA 1A1VA 3TRFA 1G16A 1US8A 3QVVA 3ICQB 4K81B 4PX9A 4NCJA 3Q85A 4MRSA 2XXAA 3TAUA 4S35A 2ZAOA 5F9FA 2PJRA 3PUZA 3EPJA 4YMSA 1YKSA 1JPNA 3CF0A 4OHZA 4BFSA 2ZUDA 3SQWA 3CH4B 4MRRA 3GLGA 4O2RA 1NY6A 4GL2A 2BKUA 2KSQA 3QJYA 4XWKA 4TYWA 1NN1A 3KXKA 4AK9A 2AHOA 3EIEA 3FGNA 3NC1C 3SE0A 3DL0A 3DZDA 3KJIA 2OHFA 1OYWA 2QU8A 2F1IA 5JHGB 5E95A 5CLLA 2F9LA 4NMMA 4OHXA 3ZQJA 1YQTA 3C14C 1CRQA 2NOAA 1F2TB 3JZAA 2CDNA 3AF3A 3FFBA 4K8OA 3PUYA 2FSIA 4LHXA 1N5IA 3PQCA 4MGIR 4IOKA 2E87A 4B74A 1BO6A 2RCNA 3R8CA 1LB1B 3RNLA 1T4GA 3GLHB 5AWFC 4WXRA 4NPHA 1HYQA 1HURA 2FGKA 3F0TA 4AYTA 1R0YA 1E0SA 3FHCB 4DEYA 5J4VA 2HT1A 3PEYA 4BRUA 5JWHA 4G01B 2W6ID 2BEJA 4B76A 2G1JA 5CDFE 3LRPA 5JS8A 4AI6A 1U99A 1E69A 3L8YA 2CJWA 3N5CA 2FPKA 4TYQA 5A0FA 1GNRA 2WJGA 4Q7KA 5KSYA 3UMSA 2VHUA 1Z6YA 4JLNA 3SNHA 2JIZD 3WNDA 3DOEA 3ADKA 1PVOA 3VKGA 2R44A 3CF2A 1OXUA 2D3WA 4V0LA 1Q20A 2A9KA 4IRUB 5KU1A 1DO0A 1GKUB 3L0OA 3LVRE 1DO2A 4L9WA 5J5CA 2ZJBA 5FOWA 5FPKA 4UNRA 4KFSA 2KJQA 3K0EA 4V0OA 5JJIA 1XEXB 4JBWA 5FOSA 2J45A 1MO6A 1FX0B 1XEWX 1E1RA 1S96A 1VDZA 4DZZA 5AUPB 1Q1EA 1FZQA 5CLQA 4QG7A 3TBKA 4CZ2A 1G20E 1KDTA 1N6RA 1HH4A 3A1UA 3LDAA 2AKYA 1OH7A 3WYAA 1OH8A 1Q22A 3CR8A 3NH6A 3ZQ6A 1IONA 3ZS9A 5B58C 2V54A 2O8EB 5FUWA 4CDGA 1E98A 5HE9A 4PHFA 1CS4C 1E2EA 1N6OA 1MRNA 1VTKA 3DMDA 4A82A 4B6FA 2IXEA 4Q9JA 4H9GA 1CJVC 3UMRA 2G0NA 2OT3B 1TADA 4HB0A 2DYKA 2C04A 2FE4A 2ZE5A 4ON9A 3T06B 1CKEA 1J8MF 1FOEB 3MWYW 4B3CA 2QA5A 2XJ4A 3W6OA 3MWKA 1ZIOA 2RB4A 3MSXA 2IYXA 4HZIA 3QKSA 5FPTA 3VR5A 4JLPA 2A78A 4HAYA 1KDOA 1T0JB 4PAOA 4Q4HB 2H7VA 5KDOA 1QZXA 1P5ZB 3U3MA 5FTNA 4X8OA 2QGZA 3BXZA 1FUKA 4JLBA 1S9DA 4GZMA 4HAVA 2NPFA 3REFA 2OUKA 3HU2A 2GEVA 1KNXA 2GF0A 2GBLA 3QG1A 4DCNA 4DSUA 3QXJA 2NTYC 1PLKA 1Z22A 4G0NA 5SZKB 4DUGA 3T1QA 4KFTA 5HZHA 3N2IA 3DO6A 4P32A 4WZAE 2JLYA 2WOOA 1FMLA 2G6BA 1E1RD 4EFMA 2ZYVX 2VP9A 3EZ9A 4BLPA 4DLYA 2QT1A 4HDCA 1NLYA 2GZDA 3TQFA 2GK6A 3X1ZA 2D7CA 6Q21A 3IILA 3QNUA 3ASZA 2EYUA 1JJVA 1W47A 4FN5A 4RKFA 5FH9A 1WDTA 4KYUA 5G41A 3JVUA 2ZVQX 4MKIA 2F6RA 4YC7A 1RKBA 5G3ZA 4HI0E 4QHSA 3PVSA 1VMAA 5EP1A 4C0SA 3R9WA 3N70A 3KQUA 3VHXA 1E2DA 4P31A 2FPMA 2ECKA 3U3RA 1U9IA 2OESA 2HDNB 2HF8A 2ZSAA 1JQJC 3NXSA 3OFNA 5DI3A 2GXSA 4MYUA 3D7MA 4A6PA 4W5JA 4DJTA 2J0SA 4IDQA 4TMTA 2C8VA 4Y0AA 4OQXA 2BMFA 1YVDA 4Q7JB 3RVBA 4QKQA 1ZD1A 2XB4A 3S1AB 4FI3C 4F38A 3IEVA 1NKTA 3EXAA 4OI4A 4F93B 1S3SA 4IXNA 1OXXK 1MRSA 2RGDA 4LYHA 1KSHA 4Q19A 1W4RA 2OLKA 4IDNA 1KYIA 2CBZA 4QBFA 1NSFA 3B1ZA 4PC6A 2ZITA 3BH0A 3AF2A 2RGBA 2CCJA 4M1WA 4OK3A 4US1R 3OEED 2ZS9A 1TPZA 2YZ2A 3FMOB 4TWZA 3RS2A 4EQ6A 1IN6A 4Q4JB 4LYFA 1OE0A 1QHNA 2YINC 4DUGD 2A5YB 4XIGS 1WBBA 1JNYA 4D4KA 1GSIA 2OXRA 3U44A 2IL1A 5DHFA 3LNCA 1IHUA 2EQBA 3ONWA 3ZJYA 3RWMB 5E7JA 4DCSA 2ODEA 2CHGA 2DR3A 3SHFA 2AWOA 4MGKR 1N6HA 2J0QA 2F3TA 5B2ZA 3KKQA 2UZIR 3DOFA 4HATA 4YDSA 5C46F 5G40A 1ZP6A 1VG0B 5FUVA 2BIFA 3PV0A 3RSOA 1OXSC 4DLTA 1HV8A 3QXCA 4HB4A 1T3HA 4O3MA 2CXXA 1EG7A 4URVR 2NO7A 1II0A 3R20A 2C99A 4XVQA 5B30A 3OFND 1G18A 1CU1A 3PENA 5DISB 1F60A 1ZU5A 5DIFA 5EE1A 2BCGY 1M2OB 1XPOA 3SHWA 2QBYB 2YC4C 5DI9A 2XZOA 2F43A 4ESHA 1W2HA 1SHZA 5CIWA 4OQNA 5AK0A 2IYWA 3VX3A 2HV8A 3VKHA 2GJKA 1DEKA 1GUAA 4Q1FA 1BKDR 5H8WA 2QSYA 1UPTA 4DVGA 2OM2A 3HU3A 1OH6A 4KU4A 2IBMA 1RJ9A 4LJ6A 1VECA 4PO9A 2VO1A 3ND8A 4NHOA 5F2EA 4B48A 2GILA 3AQ4A 1MO4A 1G3RA 4FCWA 4LBYA 2TMKA 2YVUA 1IJFA 5DHAA 3AVUA 4OK5A 2ZAMA 5DLQC 1NIJA 3X1YA 2ZUBA 3B82A 5J4YA 5FTMA 4DBLC 3GMTA 4NP6A 2N46A 4BECA 1FUUA 2ZI4A 721PA 1SHKA 1E94E 3AUXA 3FYHA 4Q4LA 2JLVA 3B85A 1J90A 1XTSA 4HSEA 4D4JA 1E3MA 3GLIB 1QHHA 1XXHB 2NZJA 1BS1A 1OF1A 3TW8B 1KK2A 5CM8B 2ZE6A 4ARZB 1VIAA 2VTKA 3SJBA 3PR1A 5ANRB 2EFCB 4LZZA 1ZNWA 2B92A 1XMSA 1ZUHA 4II7A 5EXSA 5L3QB 5AJZA 1F5NA 3C7KA 3QEOA 5CYPA 4DDVA 1Z5ZA 3H1TA 2P2LA 2YYZA 3RYTC 3E2IA 1Z0FA 2QSZA 4RZUA 2FF7A 3OIWA 2D7DA 1E2JA 3GLIE 4LI0A 3QKUA 4BLSA 1ELOA 3TQCA 2QAGB 1IJEA 4XWAA 1QHSA 3GFOA 4D25A 2A5DA 3VR6A 5LPNA 4OKSA 1E9BA 3B1WA 2HXSA 1VYVA 1S8FA 2J41A 2FU5C 3A4MA 1W4BA 5EXXA 3FE2A 1G8GA 4TT3D 4UNNA 4NCKA 2JLQA 3RDPA 5EUQB 1US8B 1E9FA 1GFIA 3QOFA 4JJZA 1XCMA 4G5GA 3MFYA 4LJ4A 2DFKB 4TLAA 4IKEA 2AXNA 3KJHA 3IKJA 3A4LA 3GLGB 3JZMA 4RVCA 1Z06A 3I73A 1D2EA 3BGWA 3LLMA 4NCHA 4P4UA 2D06A 4OI2A 1X3SA 4BFTA 1RE0A 2Z83A 1S2MA 3SU8A 1N6NA 1Q1ZA 4OQLA 4V0KA 1XBTA 1UKEA 2ZI9A 4PTLA 2NMVA 3X1DA 3IUYA 5UKDA 2AFHE 2WMOB 5KDLA 2B8TA 4DLZA 3GEHA 4M1KA 4QBHA 1DAMA 2W2XA 2WIAA 4HYYA 1X86B 2A5JA 5AR1A 2VIIA 1Q12A 4QJ3A 1NNEA 2QE7A 4G5RA 4DDUA 1IY1A 2ZPTX 4I4LA 1TMKA 2VP4A 3FDIA 1QHGA 1KSJA 2C03A 4G5OA 3PUXA 4D80A 5JEEA 3FB4A 3ZGXA 3U60B 1UJ2A 2KWIA 1ZC4A 1COWA 3TSZA 4C2TA 2VYFA 3AF1A 3MAAC 5HPYB 1MOZA 4IJMA 4BLTA 1VYTA 2QPAA 3CPJB 1TUIA 1W4AA 4CT5A 1R4AA 2GZAA 4S2EA 4Z54A 1KJZA 1ZC3A 2O8DA 4FIDA 2RH5A 2HYDA 3P1JA 4LJ9A 2CL0X 4HLUC 3U3OA 4B6EA 2ZEJA 1LVGA 3O8BA 4NONA 2CJWB 4IDHA 3HYRA 1YR7A 3W8NA 1L4YA 3H0KA 2WKPA 3BJIC 3G5UA 1KMHA 1A4RA 5P21A 5IK2A 5EE5B 2AWNA 3EAQA 3LXRA 2IK8A 1RC8A 3UMFA 2Z43A 4A4DA 1YJ5A 3PUVA 1CULC 2IYZA 1JEDA 2ZRFA 3BOSA 1H65A 2GXQA 4GBMA 4JL8A 3Q7PA 1P2VA 3GFPA 2XEXA 5GVRA 3RLFA 2GCNA 2W58A 3B6EA 2KBEA 2G3YA 2PBRA 1Q1QA 3AF4A 4ABYA 1JXOA 1U94A 2W6JA 4Q9IA 1DADA 1NY5A 1IY2A 1Q3TA 4KVGA 4U02A 5FI0B 1MT0A 4PQYA 3GQBA 4ILEA 3SOPA 3AVYA 2Q9BA 4Q9KA 3GLFA 2CEAA 1XRJA 1N6IA 1UF9A 2KE5A 1SXJA 2ZVPX 1GNQA 4HB2A 1GP2A 1QVRA 4HEJA 1OIWA 5EQTA 2QE7D 5HCNA 3QY0A 2GNOA 4KYIB 3IEUA 1AN0A 4B73A 5JHHB 4OQFA 4DDTA 5BN3A 1WQ1R 4TLDA 1KI1A 4DSTA 2D4HA 2FFAA 1SVLA 2ZS7A 1TX4B 1EFTA 1N2CE 1COWD 2OFXA 4AG6A 2CE7A 1H8EA 5AJYA 4CIDA 3WNCA 1KK3A 4PHTA 2R6FA 4PZLA 1OB5A 1S4QA 1NVVQ 2OCBA 3KJEA 3NIBA 1KZGB 2YKGA 4GZLA 4IOLA 3QKSB 1P9RA 4JS0A 4B47A 1II8A 2ZJAA 1M6NA 4R7ZA 2R62A 1KO8A 4CF7A 4FMDB 5AJWA 2QP9X 4EDHA 4TSFA 4BZQA 1E79A 1P4SA 4Q5IA 1TAGA 2X1VA 4GNKA 4KHZA 1P72A 4EIWA 4AD8A 2IYUA 1E32A 3IPYA 4DT1A 4A2QA 5EE3A 4M1TA 4OJQA 1SVKA 2P67A 5C1BA 5IK2D 3P27A 4BFZA 4KBGA 4MRNA 4DIEA 5J4HA 1Z0AA 2MSDB 4MKHA 2PZFA 4OL0A 1SZPA 2IEYA 3B7GA 2XOKA 4NYJR 3U7GA 4KBFA 3EZ2A 1S0UA 4JZKA 1KO5A 4PR0A 1KI2A 2RGAA 3RRNA 4C0BA 3K0CA 4CVNA 1XZQA 1PUJA 3IIMA 3R9XA 3OIUA 3CLVA 1DBSA 1E2LA 1R5NA 4I1OA 4TYYA 2Q3HA 2W6JD 1XX6A 2P0EA 5JCPA 1GRNA 3CB4A 1OPXA 2AR7A 2EFDB 2OLJA 3Q3JB 4HUQB 3UG6A 4I1VA 2JA1A 5KUTA 1JI0A 5BW8A 5DN6D 4C0AC 1SXJD 1XMIA 2QTVB 2VHTA 4Z51A 2WJYA 3ECCA 2ZJ8A 3T1TA 3K0SA 2JEOA 2WWYA 1G3MA 5DYGA 2GJSA 1NBME 2ZRGA 3HPRA 4HLDA 4KVAA 1HA3A 521PA 1YZGA 2ZRDA 4M1OA 5FI1B 2V9PA 4E22A 4F7WA 2WVJA 5KPDA 5C18A 3LO5A 4BEJA 1H8ED 1QRAA 2BV3A 2V7QD 3K9NA 4EPYA 1CRPA 1N0WA 4DLVA 1Q1BA 2CCGA 2OO7A 1RYFA 1W44A 2WZQA 1ZD9A 1PV4A 3L0SA 3EPHA 5EE0A 5HKKA 4A2WA 4JVNA 2ZREA 1I4DD 4TSFD 1E79D 1JEEA 2EW1A 4OQMA 5KOYA 4EPXA 3OIYA 5GJCA 3TSOA 4OBEA 3THXB 1HT2E 4IOJA 3UK6A 1CR0A 4EQ6B 1JR3A 1QHXA 2CL7X 4BFWA 4C4PA 1Z47A 1ZD8A 2QI9C 1GWNA 2YOGA 2BMEA 2QAGC 4D2IA 2RMKA 1T3SA 1JPJA 4LYJA 1RVDA 4FMBB 2QM8A 4QHYA 3RAPR 2XOKD 4JLJA 4D81A 1KIMA 1SKQA 1UEIA 1YR6A 5EZ6B 1UBCA 1VKJA 3I8XA 3KFXA 2F9MA 1EESA 5FL3A 5JRZA 2YWFA 3Q7QA 3WMEA 4ACAA 1Q3HA 4KI0A 1IBRA 1VCNA 2YWGA 2Q9CA 4URZR 2WICA 4M1MA 1FNMA 4M2LA 2ODBA 2QNRA 4RD2A 1E2IA 4W7SA 3LAWA 2PX0A 4XSHA 1W0KA 5CK5A 5EXPA 3T1OA 4ZDIA 4RCYA 3SR0A 1U8YA 3MG9A 4BASA 4MYHA 1Z8FA 3LH5A 3PITA 4BE7B 4LPSA 2ZI6A 3SBDA 1G17A 3QXSA 3H2YA 2WTUA 1D2NA 3CPEA 4WOPA 2NPIA 4V0NA 4H1UA 4PHGA 2FSHA 4Q47A 2F43B 4KFUA 2FJUA 1ZNXA 2HEIA 2OG2A 1ZRHA 2OCAA 2QM7A 2F1RA 4UKDA 3B13B 1RJ9B 1F3OA 3O8DA 5HKKD 1DG3A 1LW7A 4Q4AA 2WKRA 1AQYA 1KO1A 4QGFA 3QIAA 1KKMA 3QKRB 3E70C 3T34A 1ZYUA 4EJSA 4FCTA 2MSCB 4WBSA 4XTRA 2YHSA 1JR3D 2GRJA 4OJKA 4TLBA 2FV8A 1QG2A 2JLWA 1UBEA 2V4ZA 4EAQA 5G3YA 3BD9A 2WWFA 4MQBA 2HUPA 3AGPA 4BFVA 2H1LA 3TUZC 1MO3A 1MV5A 4NE2A 4Q1EA 1TU4A 3VFDA 1OXTA 4BEBA 4L5BA 1QHHB 3AEZA 3MMPA 3CNNA 4ITRC 1XTQA 2H92A 2VPPA 3NC0C 4PC2A 2O0JA 2OAP1 1AA9A 4WW0A 3QPUA 3SDZA 3TAHA 221PA 4QGAA 3HDTA 1M7HA 5C2JB 1W0KD 4Q7MB 3BORA 3WMGA 1W5TA 2R6DA 2PMDA 1E0JA 4LHYA 1X1RA 5ELXA 2L0XA 1CP2A 2QGNA 2RGGA 1CXZA 4PZYA 1G9XA 5GJBA 1KNQA 4D26A 3QQ5A 3HU1A 3NG1A 4XH9B 2VSOA 1W2GA 4GMXA 4UQOA 4J0QA 2ZTSA 1AS0A 4HAWA 4MRPA 4BLQA 4URWR 1LS1A 5L3VA 1UBGA 2H18A 4JKIA 1CTQA 1UKZA 1H8HA 1OIXA 3KQNA 1P6XA 5F9HA 4NDZA 5FOUA 2FZLA 4BZXA 3GLHE 4Q9HA 2WPDA 1D2MA 2QMEA 3PFIA 4LPKA 4HDOB 3SJAA 3W6NA 2BC9A 2SHKA 1KMQA 3TSWA 1W5SA 1SVWA 2HCBA 3BE4A 1XTKA 3AUYA 3LW8A 2VEDA 4QHTA 3WYGA 4PHHA 3MJRA 3LFUA 4IVRA 4CEIA 4RKEA 3ADDA 1XPUA 4CEHB 1KI6A 1OH5A 4Q1CA 1SVOA 2PMKA 5EP2A 3ZIAA 2ZXUA 2RHMA 3FMFA 3K70B 1R0XA 4YONB 4C0LA 3A8TA 3OF5A 3B2EA 1OSNA 2GBLC 1J99A 2FFQA 2WAYA 1Z6TA 2GEUA 5H70A 4D4MA 2P5TB 1E2QA 3REGA 3HJNA 1AGPA 4TTPA 1ZU4A 2VRWA 2ZSEA 2NO1A 4AG5A 3LVQE 3MCAA 1ONBA 1TEVA 4IOMA 2F7SA 4QM6A 4LRWA 2KBFA 2WJVA 3IBYA 2IX3A 3KXIA 5FBRB 4KV9A 4YDHB 3IPXA 1E9CA 4M0LA 4D4LA 3IQWA 2PLRA 3AVQA 2JATA 2PZEA 2O8DB 4LX0A 3NDBB 3NTUA 1QVAA 1PZNA 3KQHA 5H68A 2B7BA 2Z4SA 3VNUA 2FNAA 3WMFA 2IS1A 3V4RA 1LV7A 1LNZA 2D74A 1HEIA 2BM1A 3RC8A 1FTSA 1X8KA 1U9IC 2QN6A 1KMHB 5FUYA 2PCLA 3Q5EA 1XD9A 4MUBA 1H8HD 4Q00A 2IYVA 4B2PA 4DLRA 4ZDJA 2IXGA 1NVVR 1IXZA 2WPDD 4P33A 4Q03A 3GEEA 4TZ0A 5LDDC 3D31A 2B6HA 1VCIA 2Q21A 2W0MA 4LV8B 1NLZA 3TW4A 4IFEA 2HJGA 3ZD6A 3L2OB 1OYYA 1IN4A 3CO5A 3QI2A 1NI3A 3U61B 1G8YA 4MYTA 4R98A 4Z8XA 3IHLA 5HZKA 4UXJA 1A2KC 5EP4A 1RRGA 1OT3A 2Z0MA 2OE2A 5LBIA 2D62A 4LJ8A 3ZIAD 1MH1A 2NQ2C 4FMCB 3GLFB 4PZZA 1HY3A 3HR8A 1J7KA 1SXJB 1TL7C 3KTAA 3VR4A 4A8JB 3NBYC 5TDHA 2ZIAA 3U6BA 2WHXA 4C0KA 1OB2A 1Z28A 1FQKA 1ZM9A 3WRYC 3CNOA 5KSZA 1J70A 3M1IA 3ZS8A 1IOZA 1L7VC 4EPTA 1KY2A 4GDFA 1UDXA 2C77A 3CRMA 2VP6A 2O8CA 1PLLA 2DFNA 3B1YA 3LV8A 2W2TA 3CUEF 4DCVA 4YLGA 3WP0A 4TMVA 1T5IA 2RGNC 1AM4D 3A1TA 1SXJE 5AJVB 1YZLA 4ZDWA 3OE7A 3K0AB 3BRWD 3QUSA 1BMFA 1II8B 5CM9C 3T12A 5B57C 1E2PA 2J5XA 2VSFA 3J81k 2CLSA 2YC2C 2O8BB 4RFSA 2N42A 1QBKC 4B3DA 2V1XA 4TZ6A 5TVKA 1UFQA 2YWHA 1XJ0A 2DB3A 1XEWY 3V9PA 4MRVA 4OHYA 1KO4A 3I72A 3SZRA 1W49A 1R5BA 3U4QA 4I99A 3T5DA 4DT1B 2F1JA 2BBSA 3G0HA 3QG5A 4PAMA 4DLWA 1DS6A 2AK3A 5IT5A 2GJ8A 3LW7A 1NMZA 2FMXA 4JYBA 5TMPA 2FEMA 3BB4A 2ASEA 1XB2A 1G64A 3GJXC 1AK2A 1G3QA 3EARA 3A4NA 4D0GA 2CMKA 4HAUA 1DAHA 4XD7A 2YJTD 1KK0A 4L4UA 3SJZA 1U0HC 3AP2A 1DAIA 4B33A 2WKQA 3AM1A 4GP7A 4HUTA 2WBLC 1FPMA 3A6PC 1IN8A 1BYIA 3HR7A 2DWOA 4C0JA 2R6CA 4DB4A 1GL6A 1OFTA 1VYUA 4M8NE 2R6GA 4L15A 4ZIRA 3EZ7A 1YRBA 3I3SR 2V1UA 4O25A 2C2HA 5FBQB 4WXPA 1G41A 1NVXQ 2BDTA 3P26A 2EYQA 1SKYB 3GP8A 2DFLA 4M9QA 3MLEA 1LF5A 2VP5A 5DGXA 2GXUA 5J40A 4LHWA 1YZUA 3AVXA 3CRRA 1B0UA 1KI3A 1OXVA 2FFHA 2PT7A 1Z6AA 5EZ5A 4DXAA 4CYMA 2YNMA 5HE8A 4JIMA 4E09A 5SZHB 1ZAKA 3WP1B 3OE7D 2GWHA 4ASUA 4HLQB 2FDCA 2IS4A 4QC2A 1KAGA 2H5EA 4TQ9A 1CJMA 3RRYA 2FWRA 3R7WA 4US2R 5FR1A 1L2TA 2X8AA 3EPKA 3CONA 3U3JA 5F3WB 2XB2A 2A2ZA 5JSZA 4V0MA 2YOHA 2IS6A 5IHPA 2GEDA 2NGRA 2JLZA 3C15C 3CRVA 4UNSA 2QUZA 1KSFX 4AYWA 3VQTA 4AKGA 2WM9B 2HYIC 4NZYA 1U8AA 3I5XA 5F98A 4XD7D 5LD2B 2DCUA 1IN5A 2Q3MA 3BK7A 1G1MA 2RAPA 3CZPA 8OHMA 4C0QC 1WRBA 4O0MA 4R71A 1YZKA 1F2UA 3M0EA 2QP4A 4BGDA 4XOIA 4ZKDA 5JJKA 3VMFA 1DELA 3U6KA 1XTJA 4US0R 2JJ1A 4DSOA 3B5JA 3LXXA 4ZCIA 1E2NA 3WHLA 1E9SA 3EIHA 1W48A 3KZ1E 3GJ0A 2ZM5A 3K70C 2WIBA 2BEKA 4H1VA 1G8PA 1QHIA 4L16A 1XXHE 3L0PA 2J3EA 3P4XA 4F4IA 4UXHA 4C7OA 2KB0A 2XNSA 1W0JA 4CGZA 1E96A 5TV2A 1MR3F 4ASUD 2JCSA 1RW4A 2X77A 1R0WA 4Q4AB 1F2TA 1GZSA 2GTPA 1BYUA 3UWOA 4DLSA 2IEZA 1RRFA 2GXAA 2PX3A 2G1KA 2G77B 2V6JA 4QBIA 4EJSB 3BB3A 4DDWA 2XXAB 4PAQA 1A5TA 4TQUS 2QTHA 3QXXA 1B23P 4KXFB 4QL3A 1GRQA 1XWIA 3GJ5A 3RS7A 3U7EB 1JQLB 4M21A 1GKIA 2QEQA 4TL7A 4G3XA 2WV9A 5TB5A 3QKTA 1KI9A 3BERA 2Q0HA 3C4JA 1GOTA 5LB2A 5KTYA 4Q9LA 1MKYA 2HF9A 5FBLB 4P4SA 3N2EA 3ZLJA 3AH8A 3SYNA 2IWHA 2VF8A 4JJKA 4RCZA 1A7JA 4AWXA 4N1AA 1T3LA 3KB2A 2OAQ1 2IYYA 1G7TA 2Z5FA 3GLGE 5GJVC 4A9AA 2J0UA 2C98A 4KAXA 2JLSA 3T15A 3W8RA 4RD6A 4C0HA 4TN1A 5BWMA 1SVSA 2C96A 4F91B 4M9ZA 1ESNA 1KDPA 4UXIA 5CITA 2PZGA 1F6BA 1K5GA 4IEIA 5FBWB 3SN6A 4LUCA 4M1YA 3RS3A 3E1SA 4QJ5A 4BLOA 3U7FB 4D0LB 4OK6A 4LY6A 4WZ6A 4DRZA 1HTWA 1SXJC 1D9XA 2ZANA 4NL4H 1D9ZA 4PPNA 1W0JD 3CNLA 4A8JC 3AP3A 1UADA 1N5LA 1WE2A 1R5OA 5J4LA 1NMXA 1E9DA 1XEFA 2LKDA 2UVQA 3DDCA 1P9WA 3EA5A 1ZJ6A 3DHWC 3E5HA 5L8VA 3ZVRA 1ANKA 1G7SA 1T8UA 1OFIA 1X6VA 1CBUA 2ZS8A 3KKOA 2ZRIA 3ZD7A 1XMVA 4RY2A 1UEJA 4MYCA 2GDJA 1W46A 4GI7A 3W9YA 4AC9A 4GP6A 4NBSA 2C5LA 4TL6A 3TUJC 2P6RA 4CEIB 2WMNB 4GOJA 2WOJA 2ZJZA 1KI6B 2ZI3A 1NJFA 1XD8A 2IT1A 2QP3A 1MO5A 1TQ6A 3ZYCA 3CF6R 3QF7A 3AVVA 2REXB 3TVDA 2REBA 3NHBA 4KODA 1AIPA 1VG1A 1JAHA 2MMGA 4KO8A 4P3YA 4F92B 3FHOA 4Q4HA 3O47A 4NU0A 3SI7A 3AKDA 3NEJA 2BOVA 3IO5A 2PEYA 2B21A 4E5UA 4LGMA 3M4YA 4KSBA 3LX8A 2XX3A 4XVRA 2ZJ2A 4BFYA 4CEJA 3A36A 2F3RA 2R8RA 4X8LA 3AP1A 2ORIA 1LFDB 1L4UA 4FD2A 1HE1C 2ANBA 5LB4A 1G5TA 3THYA 1AZTA 1AZSC 1NIPA 2Q9AA 3B60A 1U0JA 2P5SA 2R6AA 4JL6A 2PT5A 3EC1A 4R2HA 5E3HA 3BFXA 1VIYA 5C4MA 2OZEA 3AVPA 3P20A 4HLUA 2JLRA 4JL5A 2Q6TA 2GAAA 4V03A 3TIFA 2C9CA 3CZQA 4UNPA 1E6CA 3P32A 4JLAA 4CW7A 5DNYB 1ZUNB 1JECA 2EU8A 1O87A 2E9SA 1ZINA 2CK3A 3B9PA 3RWOA 2VH5R 1M8PA 3Q72A 4LJ7A 2ZSBA 4JSYA 1ZNZA 2ZSFA 1N6PA 1U8ZA 1SQ5A 4AURA 4GPTA 5E7MA 4EPVA 1XD2A 2GJ9A 4YMTA 1DARA 3CX6A 4E03A 5AUOB 3S1AA 5IF9A 2CVFA 1Z2AA 4TMKA 1J2JA 4QNRA 4B44A 1CJUC 4JVSB 4EUNA 4QRHA 5K8TA 1RRCA 1FW6A 1ZNYA 1I4LD 2J7KA 3KTAB 5FBVB 4AYXA 1T0HB 3I5YA 1GM5A 3KKPA 4LJ5A 1X8JA 4LDJA 1KI8A 2MSEB 4KJZA 1JXMA 1HQYE 2IS2A 3ZVLA 4XJXA 3KKMA 4PPFA 1YZNA 2CHVA 5KSPA 5DI3B 3ZZ0A 3PJRA 2O8CB 2HXYA 4PC7A 4W5WA 4EPRA 1TF7A 3BH6A 2VL7A 1NG9A 3X1XA 3LA6A 1OV4A 2ZRBA 2IHYA 4F4JA 5LD2C 1KTVA 4TYPA 1G6OA 4I81A 1BH2A 2I1VB 5JWRA 1TU3A 1NN3A 2K5UA 1SGWA 4AKHA 1RFLA 1S1MA 2ZJ5A 4Q7LA 4RFSB 1G21E 5DO9A 3W34A 4EFLA 5JECA 3K8YA 4TLEA 2W0SA 2ATVA 1G6HA 4BLRA 4CRWB 5B64A 4QXAA 3H84A 2IYQA 5SZIA 3WBKA 3R9IA 3U5ZB 3NVAA 2IA5A 4HLCA 3UANA 3EIQA 3L8ZA 2J46A 4RFVA 3UIEA 1JBKA 3EG5A 3TUIC 4ERNA 5D3MA 2ZSDA 3ZVMA 1KJYA 1A2BA 3UATA 2CK3D 3QBTA 3IDQA 3SS8A 3K9HA 1D5CA 1W4CA 3AGQA 3FOZA 5J4KA 1II9A 3MRSA 1OJLA 2JAQA 3K09A 4ZI3A 2P6UA 2DHRA 3U44B 2XNDA 5A5GA 4ZDKA 3DM5A 4QBGB 5CJPA 1DAKA 3IBGA 5FUXA 3AF0A 4AY2A 3DZ8A 5J47A 2BVNA 4ZO4A 2G9NA 2B7CA 4B2LA 4ZIRB 1N5KA 1QG4A 1ZIPA 4FCVA 4EJSC 1Q44A 2FG5A 4IVPA 1NN0A 3ZZTA 1GTVA 4QM7A 2WAXA 5JI2E 4I1UA 2YWEA 4RSGA 1R7RA 2GCOA 2IXFA 3I4LA 1KI4A 5GADl 2FSFA 4TLCA 2WJHA 2FZ4A 1NMYA 2QPTA 1UKVY 1T8TA 4ZPXA 1NG1A 2EWWA 1NSTA 2FH5B 2VHQA 3KL4A 2NO9A 1I2MA 2QTFA 3NH9A 4DKXA 2BMJA 4HAXA 1Z0JA 4LCBA 5JFGA 1NVUQ 1C1YA 4BFUA 2IC5A 1EX7A 1Q0UA 3KFVA 3IIJA 3HP1A 1W36D 3LD9A 3TR5A 3KB1A 1DG1G 4M9SA 4NCNA
chains in the Genus database with same CATH superfamily
3AF5A 1MAAA 3JSAA 4LOLA 3HWRA 3UG7A 3GUHA 3LDFA 4PNZA 3IQHX 3TR0A 3G23A 3U26A 3KSUA 3I6YA 2CHQA 1OU0A 2HJHA 1T1EA 3BXHA 1EFRA 1XQXA 2BM0A 3E58A 1VG9B 3N9IA 3LFTA 5EKDA 1Y7PA 2B78A 3T3PB 1Z08A 3VKWA 1R8XA 3AVOA 4MIEA 4Z0PA 2CW5A 3CZMA 1KJIA 4UTVA 4U7GA 4LE0A 1L6IA 4DCPA 4ZZ0A 5JSZB 1BN7A 2XWSA 1JG7A 2IKSA 3SYRA 1EWQA 1O94C 4IJ6A 1U2EA 3QA3E 3GO4A 1KKLA 4MWOA 3SKXA 4MUFA 2GYWA 3PQ6A 2WDZA 3IC5A 2AD1A 1MD9A 1UK6A 1Z33A 2FG7C 3OU6A 4H08A 4NBNA 4U3JA 1CUGA 2WP0A 3E1KA 4KV7A 4RL4A 3VSAA 4BMCA 2I80A 2QLMA 1W581 3LWNA 4RJIA 3PRKE 4PSKA 2MTBA 2ODAA 2FN8A 3A2LA 5EIOA 3IERA 2PH3A 1BHO1 3U7HB 4FN4A 4GMDA 5F9MA 4BNFA 4DFDA 2ZFUA 1YHZA 1Z83A 4O4IA 4D0SA 5FWDA 5LQMA 3AETB 2HBQA 2PGDA 3EBLA 3LL7A 4FYPA 4H27A 4LK3A 4QUIA 4TSRA 1L1QA 2YX1A 3WLKX 3UJ8A 2ZUFA 2MSLA 1LS6A 5FD8A 5LQAA 4E33A 4FQ5A 3I76A 1GKKA 2CHFA 5EMHA 4JBXA 3RYHA 1MCZA 1UZLA 2ERCA 2R8PA 4MR8A 4OYHA 4KAAA 1N25A 2RHTA 3WOVA 4E08A 1V4BA 1FXWA 2A92A 1HL3A 3ILVA 4Q3KA 4L4XA 1KBZA 4JKOA 1X94A 4HFRA 2FLKA 2N9UA 4FX2A 5DCWA 3CM0A 5EIBC 3WJAA 4YI5A 4JV5B 5LC1A 2IFTA 3ABSB 5JWOA 5JJLA 1OOEA 3QUAA 4IYJA 4LNAA 3TTYA 3TLYA 3C3EA 1CVIA 4NVRA 3AI1A 3V7WA 2PE5A 1EFHA 1UXOA 3A1FA 3QEJA 2RHDA 3IO3A 3FJYA 4D3YA 621PA 3G2OA 1KR2A 4OP2A 3EW9A 4EI2A 3QM1A 1QVWA 4P92A 4DGSA 5G1PA 5AIBA 2BGJA 1CJKC 2ORVA 1XJQA 3MN1A 1QYVA 4P4NA 5CD9A 1GTL1 1P45A 3VPXA 2H2GA 1AUVA 2WSSD 3F4KA 3GDGA 4O2LA 1I2DA 3O9VA 1TFUA 3LLUA 4RHUA 4K6MA 3GRPA 4QGHA 4AZWA 5K01A 2NX2A 4WPGA 3DUWA 4OH1A 4RF4A 3WZ2A 4TKVB 5CB0A 1MABA 4X95A 4EHHA 5D00A 1BHQ1 2X9QA 1R64A 3N7UA 1ZLXA 3U48A 1CD5A 2GPWA 3LP6A 3FKSD 4GVLA 2YZGA 1GKYA 4TX1A 2H1OA 2BKEA 3G17A 1ENZA 2G5PA 3R74A 3TDKA 4OSEA 4D45A 1BCSA 2JLUA 4GWKA 2PCJA 1VBMA 2PQ0A 1ZFNA 3G6WA 4H7PA 1MVNA 3HCCA 4IHJF 2F1OA 5E9JA 2UXBB 1BXRA 2DPGA 4J07A 4YMWA 2QGFA 5ICFA 1COZA 1SIOA 2J30A 3EAFA 5EQJB 3TDMA 3GHHA 4FBLA 5JZVA 4F96A 1ZKDA 2Z56A 4OQDA 5ARCA 3LCMA 1IJBA 3D0OA 1E7MA 2M1ZA 5DE3A 4I1SA 1ZA1A 1U3TA 4IVQA 2PSJA 1MA0A 5KX5F 3L8DA 1Z4IA 1TC2A 1L5YA 1TCCA 2OBLA 5E7IA 2J0UB 1SVNA 2GVZC 3DFIA 4R3WA 1OZHA 2AN9A 4ER5A 4YAKA 4QGGA 4RQTA 4E31A 5E7QA 3N3AC 2VKTA 2QQFA 2GB4A 2DCMA 3FOWA 5KVSA 2PFKA 3CWZA 4X00A 1R6AA 2EFGA 3AERB 1C4OA 4UJ5A 2HT6A 1EX6A 1K4KA 3CW2A 2WMDA 4WBXC 3ZDRA 5IT0A 2NIPA 4K28A 5FTLA 5HCIA 1FUYB 2Q0SA 4PX3A 4BNKA 3A27A 4ENQA 1R3UA 4JLDA 5DDIP 4Z2YA 4F9GA 1W96A 4V02A 5IU6A 5IXYA 1JU9A 3IGFA 4LEIA 3GPLA 3QVOA 2WVHA 4JZYA 3QLUC 2HCJB 3EFOB 5IARA 3ZHRA 4PSVA 5IJZA 5M34A 2EWVA 3PDCA 3EWAA 1AUQA 5LN1A 4OHVA 3U0BA 1HOTA 1Y4SA 2ZYTX 2W90A 3DC7A 3S5UA 3O8CA 3NT5A 4UUAA 1QJCA 3UWMA 1U1IA 3R3VA 1V6CA 2YDXA 1KZYC 5JLJA 3GFQA 5A0TA 3UWDA 1L8XA 3UXEA 4M89A 4TMXA 1JWLA 3BWYA 5DTIA 1C7FA 3PFHA 3SVZA 4L85A 3NFYA 1L5MA 1N7GA 1QE0A 2ATIA 3H2ZA 1FTNA 4G0XA 4I55B 3UHOA 1OMOA 3GEPA 1NF9A 5JBQA 1GU0A 2CZQA 2IDJA 4A8TA 2XVYA 2AN1A 3QUTA 1DKUA 2OILA 3IKLA 4B87A 3I61A 2QG6A 1Q7RA 3VOAA 1DIOB 1JQEA 2MT9A 3RIYA 4B45A 3NBFA 4YAFA 4FXPA 1PW7A 5FNZA 5HSGA 3TR6A 4JA0A 1CC1S 1T13A 4LGCA 1E2UA 3LZDA 4PPGA 5F4BA 2FEPA 5CNKA 4MICA 2EXXA 2IW3A 3G1TA 3T7RA 2RGEA 4TYNA 2B94A 1H6AA 5E1BA 2VLIA 3T6KA 3DOUA 4DMUB 3VPGA 3W04A 1ZN9A 3L0YA 4LE1A 4CEJB 2Q0QA 2HQOA 1CCWA 1FS4A 3KWMA 2QMYA 4HKTA 2OK8A 2MCFA 5AW8A 1LJLA 3R5KA 1KMMA 4LRXA 2Y05A 3TYXA 3O4HA 1FVOA 3L8GA 1QOQB 1C9NA 2I55A 3VR3D 3OKPA 4M0FA 5C5IA 3ZGZA 2MJLA 4YP0A 4FW9A 3V42A 3I09A 5JYEA 1L3CA 4ZOCA 3NOVA 1H2ZA 3HDVA 5DBIA 2Z2ZA 1EFCA 1FB5A 1GNSA 2FFRA 2W00A 4DSAA 4NARA 1PSDA 1Z45A 4TROA 4X6LA 5T4FA 2VXBA 3FGZA 2XUFA 1OASA 5K8IA 5E2AA 5C35A 1X1DA 3BBPA 1UM9B 1SCIA 1KZ6A 3LPCA 3GFTA 4G0QA 2IGTA 3H8VA 1AS3A 4I6GA 2OWEA 4RUKA 3W78A 2R3SA 3QF4A 4CI9A 4ER3A 4LOHA 5BYJA 4J7CA 1YA4A 3HWSA 1AU9A 1FLDA 4KQMA 2B7LA 4ROSA 2UKDA 2EKBA 2QI9F 1LZKA 3PPIA 2RHGB 3ZZ1A 3PIDA 2QL6A 2R7AA 1ZN2A 1C3VA 3BFKA 1PEKE 4B4OA 4DIDA 1FDRA 1DAFA 1Y1TA 2VFAA 1KXZA 3IYLW 3RKUA 2R1ZA 5JJ5A 1DGQA 1TW3A 2VLBA 4PXAA 4B4UA 3K0FA 4TUYA 3AM3A 4KK4A 5HYVA 4I2NA 5HRUA 1JF8A 4N0EA 3O03A 3DEZA 4WCFC 3JD3A 4IUYA 2JGEA 2ZU6A 3MJSA 2Q4BA 2ZSIA 3FKJA 3H2BA 3OJ0A 4GX0A 2C3MA 1AHHA 1GTG1 1SUFA 2OXFA 4QWWA 1B0PA 1MF7A 1V7PC 2WSMA 3W5VA 1YZVA 2Q3JA 3VHLB 2AD5A 2IIPA 4EYOA 5GIOE 3MGCA 1TUGA 1K4MA 5DBHX 3CX7A 5TT0A 3O3MB 3DFKA 3EC2A 4HDRB 3LKBA 5BR4A 2I7TA 1CQWA 4PM4A 1WXXA 3OZ7A 4PYIA 3V8VA 3FFXA 3C8ZA 5LKRA 1GPLA 5ELMA 1XCJA 4F06A 5FRDA 5IJAA 2VEOA 4UU1A 2FXVA 1Z73A 9ATCA 1ZESA 1ORWA 5K6RA 1VHLA 1ZX1A 5AUNB 2X86A 2C9OA 3NATA 3GDOA 2DPYA 4NCXA 3A25A 2YXEA 1OUMA 3MWDA 3BJRA 5DNEA 5AUQA 1XRNA 5C8YB 5SZJA 1NNLA 3GR6A 5C1DA 2X9VA 5KTTA 5KYYA 1V37A 2PS9A 1N34B 4MGHA 2F1HA 4G5FA 2QUJA 4HP8A 4K46A 3U4HA 3HUFA 4ZI7A 3C41J 3OKFA 5BSWA 1JG2A 2FGJA 4Q05A 3GLVA 3O1JC 2JD2A 3T9EA 4DV1B 4N48A 1KP2A 1NBMD 3ZUGA 4DUYB 5EY5B 3CLKA 3R7BA 2M1XA 2QQ0A 3ZCTA 1IHDA 4JFRA 1EBBA 5FA8A 1PQUA 4BMPB 1XAIA 2JFNA 4N5NA 3TQOA 1BMFD 4KQEA 9LDTA 3K1AA 5KZMB 3RS0A 1M8JA 3UW1A 1EVZA 2O2CA 3L0ZA 3V8RA 1JHUA 3IVXA 4EYQA 1JQ5A 1SKAA 2D2FA 1MC8A 1SBTA 1W6UA 1AQLA 2IHVA 3IQGX 3NHJA 1O96B 3RIXA 3IHKA 3KKNA 4G0PA 4Z8YA 5EYPB 2VDPB 1G42A 3QPVA 1PIWA 1OCEA 1SCJA 1XZGA 3KM0A 3NORA 5AM5A 5B4UA 3IMGA 2E1RA 2R8BA 2FWMX 3F5SA 5BQ3A 3HO1A 2VP2A 2PIAA 3ANNA 1SPXA 3THRA 4KLAA 2ZIEA 1N6KA 1I2BA 2WE8A 3KX2A 1R15A 1RYBA 1HDOA 3QOXA 4BO8A 1U8FO 3HUTA 3PTLA 4WVLA 3K94A 2JBWA 3D4IA 4EZIA 2HK6A 1NLMA 1K5PA 5B3LA 4YMVA 3PUWA 1ZHOA 1RI1A 1P1IA 5IUNC 2QRVA 4OCZA 3SBEA 3AB3A 3THOA 5HDQA 2XLBA 1JR3E 3WFZA 4UTNA 3TB6A 5KO2A 5K8LA 4Z1OA 2B2NA 2C2BA 3OPYI 2C8KA 1E2FA 4QTYA 5JDCC 4QOSA 1EI9A 4YXWA 2VDNB 3EX7C 1MG5A 4WK2B 1E4VA 1E9EA 3RUFA 5DGIA 3UENA 3UJ6A 5T8KC 4FKMA 2VUTA 1DHRA 4E46A 5K4HA 3OSZA 1G60A 1WPQA 1U3VA 2WMYA 3R75A 3WKBA 4OD0A 3JAWB 2VWGA 3HKCA 1Z3CA 3BAFA 1M2GA 2ODPA 4Z3KA 1LDBA 4BXOB 3U4DA 4R7GA 4AKEA 4YRAA 3K9LA 1ZRNA 3BA1A 5IVIA 3ANSA 1TMGE 2QN9A 5AW5A 3VO1A 4F2PA 1AJEA 2ID9A 3QTLA 5CGQB 2IHBA 3L8MA 1ZJZA 2YZMA 1K8RA 2QW8A 3I8OA 3GB9A 3G8DA 1C4KA 1AGNA 2PK3A 1U2TA 2WWHA 2VDLB 3GCZA 1YRLA 3H11B 1T5LA 5J5AA 4PFSA 4RVNA 1L4KA 1OI3A 1UJMA 4L9SA 1ZSNA 2P5UA 2NU8A 1WW3A 3OETA 2VHCA 3ONFA 4P82A 4KOEC 3CZ9A 1QAOA 3UHAA 2Q4RA 5CG2A 3ZDDA 3F74A 3QBVA 1FYEA 1NHWA 3F3SA 4X9XA 3L3BA 4RD4A 1UPBA 1WXWA 1EVQA 2G28A 4L9AA 4CQMD 2Q3FA 1WHTA 3GCGA 4ND1A 1MUUA 5ALFA 3EVEA 2Z5LA 4X20B 1IXSB 3A6LA 3DZHA 1CDZA 3SZGA 1JVNA 4FINA 3ETDA 1XTIA 4OYYA 1CZOA 5CA0A 1Y6GA 4BO2A 2JFBA 1RBQA 3WZMA 5BSTA 2ZR9A 5C4GB 3E81A 4JVLA 5EINA 4ZV4A 1CUYA 3F46A 1A9ZA 5CXXA 1YIOA 1ZEJA 3AZOA 3BCHA 3UAGA 1EGMB 3KAPA 3LUCA 1Y5RA 1C3JA 2BN4A 4B6QA 2B30A 2HA2A 3BH7A 3S68A 2VWPA 3IVGA 1R88A 4FUQA 2H7YA 4U00A 4ARUA 1FNDA 2PV7A 5KQPA 4YO8A 2BFAA 2FDRA 2UUPA 3L5OA 3T7DA 4CLRB 5KNCA 2QL9A 3QV1A 3WMRA 4GX5A 2OAEA 2X9LA 4YJDA 3QXHA 4F1WA 1QRUA 2X2FA 3E9NA 4GKJB 1B15A 2DQSA 3BJEA 1KYXA 2X0IA 1T0PA 2HQRA 3R5HA 2HX1A 4TL9A 2AMVA 1MNQA 1KJQA 1J1ZA 1LK7A 2NZ8A 4BFXA 1Y63A 1R3DA 5AM4A 1N5DA 3S55A 2JGFA 4NG4A 1BROA 4TS9A 4KPUA 1MB2A 1PYDA 3UA4A 5EN4A 3THWB 5ITZA 5LSAA 2FR8A 3TTSA 1XG5A 2VYVD 4HQNA 4P6VF 1UMCA 1KQPA 2BDUA 1GRVA 3A04A 3ZHSA 3T1YB 1GPNA 4RY8A 3SMVA 3K9QO 3NTVA 4B83A 1YR2A 5BUZA 5JBIA 3R4CA 4BO9A 1ZIDA 4DEXA 4ERXA 4UFPA 2N1BA 2HSEA 2VBGA 1O6ZA 3R44A 4BQPA 3IJ5A 2X7HA 2Y99A 3UC5A 1YWGO 2EKZA 3EA0A 3KCNA 5E3IA 3N2KB 2EG5A 4TM8A 5JD5A 1UJCA 2W7TA 1AKWA 3FM9A 3GEGA 2F55A 3H87A 3E9DA 1U2DC 3DKPA 2WWWA 4QG3A 3OPXA 1QE5A 1A95A 5LOVA 5IZCA 3CLHA 4MKFA 4C89A 1H2WA 2QRZA 5DIZA 1J1UA 4Z4EA 1V1MA 5I5GA 3ZV3A 1SM4A 1U2SA 3R6WA 3MTEA 3W1VA 2A1TR 4TV9A 3KZOA 2MSWA 3C3JA 4RGVA 2LDBA 3KZXA 3BMCA 4NF2A 1G59A 3VH2A 3R5JA 2DLDA 2VBIA 2VHZA 5IBQA 1R9GA 1XP8A 2DUWA 1J8VA 1N1GA 2MU1A 2XKAA 3VDRA 1QTIA 1ZG3A 1IUKA 3C8DA 1V2HE 1P5JA 4K6HA 3WRVA 2BFDB 1IIRA 1KK1A 1X15A 3FMPB 5BY2A 2EFHB 2JIDA 2PPVA 2PXAA 5JSKA 4DHEA 3W7VA 3KQVA 3W7AA 3X2SA 1PNRA 4KE9A 2H4FA 5IAOA 1ZMBA 3ABRB 4M8SA 1GR0A 1JHDA 2QRNA 1PT6A 2WD7A 2EX0A 2CVZA 3EDQA 4O2AB 1N2CB 1ZWKA 3KSZO 4FYYA 1Z0DA 4O1MA 2SICE 4EL0A 2WSYB 2XSZD 1V48A 4NYMR 1V2GA 4P4TA 4WZZA 2E0IA 4AIIA 3EZLA 1GG2A 1ZQ9A 2UZ4A 2BGWA 4GXTA 1W5FA 2BZGA 2CMHA 2Q49A 3NW9A 4OAQA 3CTPA 2VTVA 4R51A 1R0LA 4DLXA 2CYBA 3I9JA 5FPYA 5BVHA 5ICMA 2C8LA 4ZGGA 4B3BA 1AKNA 1IH8A 2AA3A 5ES4B 5SY6A 5U4QA 1RMYA 3HKDA 1KORA 2NO6A 2HPVA 1OWLA 4RPLA 2DECA 1C0KA 1WCIA 2GETA 3GP3A 3LA8A 3P9SA 3UJCA 5J2UF 4BPBA 3SQXA 5AOVA 3L77A 5AW9A 4JITA 3PE3A 2V7QA 1N9GB 2GN1A 2O8FB 1DC4A 4W5QA 1PZGA 3AT1A 3F4LA 5IJ9B 5LZ9A 3DDSA 4ZVQA 1E2MA 1LF0A 4Q21A 3LBNA 1BA3A 3KKZA 2BE7A 1UIRA 2F48A 5KU7A 3EHEA 4XSGA 5LU9A 2WWIA 2ADMA 4ZHQF 1JTVA 2I4TA 3IR6A 4CKCA 5FX2A 1AO3A 2XGSA 1UAAA 2JJ2D 1KDRA 2GESA 2IEBA 1DDOA 2JJ8A 3DPUA 1OBHA 3STYA 1Z0IA 2BF4A 1OFHA 1LGYA 2H29A 2LKCA 2X5OA 2ZR7A 3O9MA 2JD1A 3OEYA 1NYTA 2ET6A 4BQSA 1IBMB 1TM5E 2GO1A 5JMOA 4HZGA 3D2BA 1LI4A 3OE1A 5JEDA 2DY1A 4FDMA 3BFPA 4ZYLA 1UXHA 4MHOA 1WP9A 2V5AA 2AE1A 2OUIA 5F7OA 2YW9A 2XDYA 3PEUA 2Y66A 1INLA 6REQB 2NTJA 3PXUA 1K2WA 3K09C 5DLDA 3GJ3A 4U5XA 1P4AA 3GY0A 4XWGA 3SZ3A 2PMWB 3WYFA 4F84A 1PR0A 1PHPA 4HX2A 4TRMA 5DULA 4RDCA 1OQAA 4LDQA 4Q1BA 3TOZA 4ND8A 4GI1A 5DX0A 1DOZA 1VHDA 3QFHA 4ONEA 1RP1A 1FLAA 3BCRA 2VZ0A 3P9CA 3C4QA 1TU0A 4OBWA 2BFFB 3DW3X 4C7MA 4YRZA 4OXYA 4W5OA 5F5XA 4LV5B 3NEYA 1E2GA 1UBOS 4MQEB 3OI7A 5FV7A 5EIEA 4JKYA 3PC7A 3PXGA 5HS4A 2GBPA 3E03A 3GJ7A 1ONNA 2FN4A 5H5JA 1L5QA 3U4QB 2W2VA 4JDPA 1NC3A 3TQTA 1I4TD 3MTGA 2ZRAA 3MOIA 3QMVA 4FDTA 5B6PA 3LNTA 3ZK7A 3Q6IA 1G7RA 1CUUA 5JCXA 1U2RA 2PVPA 2R65A 3TRIA 2ZB4A 5AKXA 2AMJA 1YA8A 3U7IA 5JANA 3VRHA 5AW2A 4GFDA 3NX4A 2PYZA 4TMZA 3FOBA 2VZLA 2PNJA 5BXQC 1QORA 2LDXA 2RG7A 1AGRA 4LDZA 3B3QA 4MA4A 2PS1A 1MC4A 3OBBA 4DQUA 6YASA 4ZOEA 1RYZA 3R3HA 5EIXA 4LZWA 5GV7A 2P3LA 3JSXA 3GLUA 3WISA 4IDPA 3HCEA 1A2OA 1P2SA 2P9GA 2QJFA 4OL9A 4UM8B 5BOSA 2IXBA 3BS4A 4FWIB 4JJEA 3SQDA 2H57A 1QYXA 1DTSA 4C2UA 3AIOA 1EXMA 1V7CA 2QQ5A 1N0VC 1Z17A 3B78A 4QQ8A 4R1PA 4UHDA 4A6XA 3P4YA 4RH0A 1OW3B 4YH1A 3RRZA 3RS8A 1RBZA 2ZIFA 3CRQA 4YCSA 5CDHA 1GTZA 4R05A 2PUCA 2CNLA 3NASA 4JP3A 4AB1A 1E1QD 3SHQA 4LV6A 1RZRA 4PC3A 4TMWA 3JWHA 1HF3A 3E84A 4GOKA 3ZBQA 5IJWA 2N1MA 1LPSA 1VGRA 2C2GA 1JB1A 1FFEA 1RQ2A 2CWWA 2F2TA 1CUFA 3BB1A 3Q15C 5DWQA 1WQ4A 2ZUVA 5EIHA 1PN3A 3ZZUA 4EHNA 4YUWA 1QK5A 4GS5A 4O2BB 4PYNA 4FHGA 4Z6KA 3W8DA 2ATCA 3PWKA 4JJ7A 4U2BA 3LL4A 3LX5A 4EW1A 1VPWA 2DTDA 1FQJA 3EE6A 4JLOA 4DZRA 3L4SO 2GSWA 1YHNA 2X5XA 3AKZA 3UYLA 1I7PA 1XXHA 4AJ1A 3GD7A 4DUPA 1DTWA 3FOAA 2QJTA 4UHBA 4ANFA 1ZM3A 1TTTA 1IRXA 5EUMA 3AJRA 1NXPA 3ICEA 3FFWA 3BTUA 2FEXA 1WUJS 2HAEA 2JIBA 2QR3A 5EZYB 4HOYA 4I66A 4CQMB 5A2QA 3ZGNA 1KOGA 2YV5A 4Q01A 3N2GA 3FNRA 3VNQA 3SJ7A 3VYWA 1ZPDA 5DHPA 3GOQA 3W8FA 5KYXA 2X0KA 1QLHA 4PYOA 3CG0A 4LBVA 1DBRA 1V9SA 2GYVA 1I0ZA 2Y4OA 1NULA 3GZNB 3QU4A 4GOXA 1RYDA 2BSAA 5DRTA 5JZOA 1CR4A 3TIIA 3D54D 4RYLA 2QN7A 1QZ3A 5AHRA 4JOBA 1USKA 4BO0A 2BBOA 2QN1A 4L8WB 4P3KA 3QEKA 3ZY5A 4V2IA 3PB3A 2XBLA 4EG3A 1RRMA 3IA2A 3AINA 4NU6A 5A3SA 1IBKB 2R7NA 4XCVA 1XN4A 4M7RA 2ZUUA 4IO1A 4BJ6A 1GPMA 1IZYA 2XJ9A 4KCGA 1JVBA 2P3SA 3TRFA 1G16A 2VRCA 1Y3HA 3QVVA 4K81B 2IDZA 4KYTA 4PX9A 3Q85A 4I9UA 1O6FA 3T8YA 1M2WA 3JQBA 3GLRA 5IT9A 4MCAA 3CLTD 2FEWB 3HVIA 1YKSA 2P1RA 2FF5A 4BFSA 1EE9A 1PSWA 4WESA 5EPEA 3CH4B 4HGQA 4MQMA 2IZ6A 2OORA 3DE0X 4B2YA 1BH6A 1XAJA 3D3KA 4MUHA 2BKUA 2OQVA 1C9EA 5ETJA 4M54A 3K4QA 3T5TA 2DWCA 3SS9X 1LDGA 4YPVA 1FXSA 1P2FA 3PC8A 4PNHA 1ACMA 2HGSA 2OHFA 3I9LA 1VA4A 3VVBA 1KVQA 1Y1QA 2RC6A 3KYJB 1L7BA 1R16A 3HL4A 2Q6VA 3IFSA 3OH8A 4NMHA 2JAWA 1PR4A 4UVGA 4D02A 1F2TB 1VHJA 2VJQA 3ZXUB 1PWYE 3V2GA 2NXCA 4CQLB 2JFXA 2EDCA 2XQFA 3P8ZA 5B55A 4G97A 1E6UA 4G8CA 2FWAA 3R8CA 5EFZA 1ZCZA 1LB1B 1U8XX 2Z09A 2E7ZA 3T38A 1H2YA 4PICA 3HBJA 2AOXA 3CQ9A 3IT1A 3BL5A 4DEYA 1JAZA 2HT1A 1CK4A 3ENKA 4R2KA 5F1KA 4NJMA 1D0IA 1EUDB 1T5TA 3IXQA 3NTRA 2I5PO 2W6ID 3L7AA 3KQOA 5L40A 1V11B 4EGQA 2G1JA 5FHRA 1PEDA 3V34A 5EEGA 4X6UA 3LRPA 1E9VA 1GNRA 2C2ZA 1U0FA 2WJGA 4N0QA 3TOCA 3GDHA 3HDJA 4WH0A 3QBJA 1LLUA 4ER6A 3TZ6A 4XDGA 4BVBA 3RIHA 3PNVA 4KP7A 1FRFS 3CF2A 1OXUA 2LE0A 1JMYA 1WUIS 3IVMA 4IRUB 4OGWA 1A27A 5EC8A 3LVRE 5F5NA 3QEAZ 4FEAA 3LPNA 1Q0ZA 3D8UA 5FOWA 4UNRA 1FSZA 4V0OA 5JJIA 1OC4A 4Y9RA 5BOVA 4PZ9A 2JC3A 4QPPA 1JG6A 1RWBA 5D86A 1E1RA 4ZRNA 2O2IA 4DZZA 2I6TA 3A14A 1N78A 4XGQA 1ZRSA 5BN1A 2PUGA 1LPMA 4BGEA 1G20E 2PAAA 4AZ0B 4QATA 4CZ2A 5I01A 1Q1NA 2HFJA 2DFVA 2I0FA 5FULA 3KPYA 1OH7A 2HHHB 3FYUB 3WYAA 5I8ZA 2FW1A 4LECA 1CDEA 2PX8A 1MOPA 3ZQ6A 3R0XA 3ZS9A 5B58C 2V54A 1XJ5A 1ZONA 2ZTHA 4OHUA 4PCAA 2PSDA 3QE9Y 3RAGA 1LC3A 4CDGA 1XR3A 4I50F 3K0BA 4RHTA 1YQEA 1CS4C 1GNLA 2CXPA 1E2EA 2OY0A 3CT4A 1CRZA 2QOEA 3D6FA 3HVJA 3DMDA 3GGCA 4UC0A 5EFOA 4A82A 4DSZA 1FIUA 5JQGF 4WLOA 2M6LA 2Q1YA 4H9GA 3UMRA 4ARAA 2BJHA 2G0NA 1LBTA 3WK8A 4BFLA 1T1JA 1BMQA 2A1UA 4JA2A 1QO9A 1QE3A 2RAVA 3DVRX 5KAMA 2ZE5A 2V5UA 2Q7DA 3T06B 4U2DA 1ZGGA 5E0OA 5FADA 5E3JA 4MV1A 2H65A 1D7AA 1L9KA 2YVKA 1D4OA 1ZUWA 3MWYW 4YV0A 1UMBA 3ZU5A 1LPAB 1T3ZA 1ZIXA 2QA5A 1Z12A 2ZG6A 1ZIOA 1LWOA 3MWKA 3UJ3X 3A6FA 3K7EA 5MGNA 4KR3A 2HW8A 4MW5A 1KDOA 1KERA 1T0JB 4PAOA 2G4LA 5CMLA 1DOHA 3T5BA 3ZWPA 3H1FA 2FEKA 4DE5A 3PX3A 3X1MA 2QGZA 1FUKA 1A1SA 1JL3A 2CDRA 3LUGA 3SOZA 3HU2A 1I9GA 3DGEC 3MCZA 1ZWLA 4PG4A 1M83A 2WILA 2IKQA 2PWZA 4LXUA 1FBNA 2ZT8A 3T9FA 1Y42X 3T1QA 5HZHA 4NQRA 1U1CA 3S8YA 4BWFB 2G8LA 4IAOA 1CUJA 2H2FA 3DO6A 1YC5A 2JLYA 2O20A 1I51A 1DXHA 2WOOA 3GA0A 5JW6A 3ONDA 2QYOA 2VP9A 5CXSA 4TVSA 5ELLA 2WG1A 1K6IA 4LXYA 3ZIAD 3X1ZA 4G0OA 2D7CA 2C58A 3IILA 1YVRA 1YQXA 1DT3A 1PGJA 3FWNA 2Q45A 4JB3A 1E62A 4RKFA 4M46A 1HG1A 1KYYA 4HWTA 1N3IA 2WNSA 4MUYA 3C3XA 4B4KA 5G3ZA 1U8EA 4QHSA 3PVSA 4C0SA 5K7SA 4WDRA 1T3GA 4H3HB 1E2DA 2WC1A 3KIPA 3RROA 5EXDA 2ECKA 3F2VA 2BAGA 4RZHA 4ZP1A 4MIKA 3A3YA 2Q2WA 1GZ4A 2UDPA 4Y3UA 3OFNA 1ZLYA 5IYZF 2GXSA 4MYUA 3D7MA 2FX5A 3WGQA 3EF1A 4GX2A 4IDQA 2C8VA 2D7JA 4Y0AA 3VO8A 4FGJA 4LFCB 4OQXA 2BMFA 3PHCA 3GFSA 1N1MA 2E5WA 2X5NA 3RVBA 3D9QX 1FU7A 1WKBA 2WFAA 3S1AB 3UN1A 4F38A 3QQPA 1OLXA 5KYUA 1NKTA 4OI4A 3T3MB 4EY4A 3RVPA 5JXGA 4CNQA 4IXNA 2Z1NA 4UPVA 1U5BA 2VCYA 2BEVA 3I4FA 1AB5A 5KTKA 1KRXA 4LYHA 1JDTA 2ECPA 5ARDA 2AEEA 1KSHA 1PFUA 3P9XA 3F49S 1YZYA 2HRBA 1W4RA 1JA1A 4KAJA 5K3SA 1R4NA 2NVUA 2Q28A 2CBZA 4DA0A 2C97A 1SQ0A 4HNQA 4EUFA 3B1ZA 3U80A 3BH0A 1SOMA 1DCKA 3NIWA 5L51A 2C92A 2RGBA 4ZHSA 4BO5A 1M0SA 2CCJA 3N6XA 2DRIA 2RONA 3KQYA 3OEED 4CM9A 1TPZA 2O57A 4CU5A 3F6CA 3RS2A 4XX0B 1UXGA 4UDYX 2F3QA 2QVZX 1YRQA 4ZCQA 1ZH8A 4G8BA 4LYFA 1UQTA 1JMKC 1SBNE 2AMYA 4UOEA 2A5YB 4HNVA 4XIGS 1WBBA 2XYQA 5E8JA 3SX4A 1QXSA 4BMZA 1GSIA 2J4DA 2OXRA 5F3DA 5KX5B 2CFCA 3U44A 2M32A 5DHFA 3BZWA 3KPJA 3DXZA 2EQBA 1XRPA 3ONWA 2ACKA 4HNRA 3U7QB 3OZFA 4QEKA 3WGMA 2ODEA 4UPDA 2PL9A 2NXEA 3M8KA 5GWXA 1ITZA 3SHFA 4Q3NA 1ZXBA 5CTAA 4YEDA 5FI3A 5JDIC 3L7LA 2WYOA 1APBA 1AMUA 2DHEA 2F3TA 3P52A 4YCBA 1WF6A 3K9NA 1XHEA 4HATA 4N7MA 4NAVA 4GE0A 4YDSA 5TSDA 2XKKA 5C46F 2UZ1B 4RQUA 1CUDA 1ZP6A 1X3LA 3REOA 3QFTA 1OGJA 3TPCA 3HB7A 4MCJA 5FWYB 4HB4A 2WQ6A 1I6WA 2CXXA 1RNLA 4WINA 4N54A 4UD6A 5TS2A 2DMRA 3SNKA 1II0A 1UC5B 2YZKA 3R20A 2QSUA 2I71A 4PWZA 3TZLA 3L06A 5B30A 1QAQA 3IDOA 4RIGA 2QTAA 5CM2Z 3BYZA 3RRFA 1F60A 4BMXA 2K2WA 3ACDA 2JARA 5DIFA 3SJUA 2YS6A 5IEJA 5EKXA 5EE1A 4IPTA 5IASA 3AFIA 3SHWA 2QBYB 2YC4C 3AM4A 4RSRA 5DI9A 3DVAB 4ZC1A 1N2EA 1Z5PA 3M2TA 3QPBA 5CIWA 3E7XA 3ZHVA 2FZEA 3P9RA 1QQBA 1DJMA 1CHNA 3SE7A 1M2KA 2VZ9A 3O3NB 4LF7B 4CV1A 2Z8ZA 3G7UA 1WAMA 1DEKA 3MGKA 3RR2A 2FWJA 2ETVA 2I2WA 1XAHA 3AJEA 3TLCA 1L4GA 1B42A 4QGSA 2XTJA 2FMIA 4B3MB 3BIWA 3DTNA 1A2QA 4LJ6A 3RFVA 1VECA 2GTIA 4V24A 4R68A 2W2LD 3AHHA 3ND8A 4DRXB 1QS0B 4QOJA 2YJGA 5JALA 1MO4A 4LBYA 4CKBA 4HPJB 3WGNA 3Q6MA 1IJFA 4NWIA 4G8DA 4HV4A 1KAEA 3H4TA 3NUGA 4N8EA 5DLQC 2QR5A 1UJBA 2ZUBA 3B82A 1V41E 3AR6A 3KZKA 3BGOS 1F9AA 1E1YA 3OJLA 3VZQA 1L5GB 1EFVA 4DDKA 2X0FA 1FUUA 2OBFA 4KQ2A 2ZBGA 1SHKA 5DTMA 3AJ9A 1EVIA 1QCDA 4HSEA 1UMDA 4H0CA 3GLIB 3ZU6A 2P11A 2OCIA 2O7VA 1BS1A 1P7ZA 1VE5A 1NXVA 3TW8B 4W8HA 4TS3A 1KK2A 3AETA 4HBGA 5CM8B 1EVKA 5LXTA 4XARA 4GE3A 2VTKA 5GZ3A 1SMKA 2ZB2A 4IJQA 4J4HA 3GT3A 2VXYA 4PHCA 1F5NA 4IGFA 4XYGA 1P8AA 1NVGA 3DLTA 3H1TA 2EFYA 2LR0A 2YYZA 4UMVA 2O06A 1PJTA 4C03A 5AVZA 1X7ZB 2QYTA 4LY0A 2QSZA 4RH3A 4UBIA 5DKFA 5HQ3B 1I3KA 1H2XA 4QDJA 2EFJA 3UQZA 1DQZA 5CRIA 1N5OX 4LI0A 5BVGB 5B4TA 1WVGA 5DOZA 2JHCA 3L4BA 2Y6VA 3C6YA 3GFOA 4D25A 3JQ7B 2O1EA 3HB4X 3C43A 3DT9A 4QVIA 1U3WA 3T3IA 2HXSA 4MP6A 1S8FA 5DXFA 4NECA 2QN8A 3ADOA 1Z2EA 1W4BA 4DR7B 1G8GA 4J1QA 3V7UA 2CXOA 4A5SA 2II6A 1X38A 3RDPA 4TPKA 3RUIA 3Q8MA 3V2IA 1VQ1A 1GFWA 1US8B 3C3PA 4PRZA 4X3CA 1NQ5A 1Y7IA 2AFHB 2V0GA 5EWMA 3G0OA 3MFYA 4LJ4A 1M0EA 4TLAA 5EA2A 4ZC8A 1D1SA 1PCXA 3UTCA 4RO0A 3T3GA 4TKVA 3ZGLA 3DXXA 1DEXA 4K88A 1SUBA 3KJHA 1EHIA 3RUHA 1M8FA 1LI5A 1QV6A 3NTOA 1Y3DE 4CG1A 4Z7QB 2IYNA 4X84A 4YRNA 4FOLA 3T9CA 2H1VA 3IBFA 2XB8A 3LLMA 5DM2A 4EZEA 5BUSA 4EW2A 4OI2A 3EG9A 4D6YA 2O54A 2POQX 2XRFA 2Z83A 5B5SA 3QY9A 3GC6A 4I9NA 2CFIA 1H6DA 4LFAB 5K0SA 3IKVA 4GPEA 2WWVD 2ZI9A 3U3ZA 2DXIA 3CGGA 3HDYA 1PW5A 5AHXA 3AOGA 2AW5A 5UKDA 4A8JC 1XZAA 2WMOB 5KDLA 1BW9A 1YU6A 5KIAA 1YFZA 4DLZA 5CEEA 4BFCA 2QX9A 3W9BA 2CSXA 2JL1A 2A5JA 2VIIA 3BQMB 4LC9A 1A76A 1OY1A 2QE7A 4GL4A 4YK7A 4G5RA 3T4UA 4DDUA 4I4LA 5TVGA 3T7KA 4QU8A 2VP4A 1QHGA 2C03A 2RE8A 4G5OA 1K8YB 5JEEA 1HYBA 3FB4A 3O1IC 3ORRA 3R4VA 1UJ2A 2H7CA 2HC9A 4J0FA 2AUTA 4N9WA 5AT1A 2GN8A 3KTDA 2D8MA 2VYFA 3AF1A 3MAAC 3CSSA 5D51S 4UTOA 1I1HA 5CT4A 4RDIA 4WERA 1OI7A 1Y4DE 3ZW8A 4EHFA 2JEYA 4CT5A 4Z54A 4P86A 2O8DA 4FIDA 1GADO 2HYDA 2ZP1A 3PTZA 4H0FA 1JFSA 1B26A 4J1TC 5IDWA 1MZVA 3O8BA 1LVGA 2CJWB 2WTAA 3HI4A 5KEIA 3S2ZA 3EJWA 3P2KA 2FZKA 2ZTLA 3EEBA 3DMTA 3CUTA 1TGVA 5FFNA 3H1EA 1XWFA 3H0KA 3DBVO 3BJIC 1XZBA 3G5UA 3PXEA 1KMHA 2WUDA 3VXKA 4J03A 2X0NA 4EZBA 5F51A 5P21A 4J94A 1JRLA 4DQDA 4MULA 3LXRA 2IK8A 5LLTA 1WKCA 4P7KA 5T67A 1U2PA 1JHRA 4DPLA 1U11A 3K6RA 4OLBA