4BWYA

P4 protein from bacteriophage phi8 (r32)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
288
Chain Sequence
NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSRGAVFNQFLLSGQSAFLGPNIPESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
molecule tags Hydrolase
molecule keywords P4
total genus 88
structure length 288
sequence length 303
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bwyA00
3KUDA 4XJXA 2FEOA 5C1BA 4NYJQ 3K70D 3CNNA 2IF0A 5JJKA 5JRZA 3LD9A 4TLEA 2DB3A 3Q3JB 1Z28A 2O0KA 2CMKA 5K8TA 1E2NA 1VTKA 4NTZA 1SULA 1E9AA 4ZDWA 1KK2A 4NYMR 3JZAA 1TF2A 3DMNA 4QHTA 3X1XA 3W9YA 3OAAA 3UWKA 2XXAB 3PUVA 2PX0A 3O8DA 2E1RA 3MWJA 2V54A 4EJSC 1Z6XA 1XJCA 2DBYA 2DPXA 4BLTA 1EFRA 4LHXA 1FMLA 3HPRA 4M4SA 4MKHA 4DSNA 1GL7A 3L0PA 1FW6A 3CX7A 4Z8YA 1FUUA 1OXUA 2CHQA 4XVRA 3J81k 1YZKA 4A92A 2GEVA 2IX3A 4R2HA 1G8PA 2O8FA 3RYTC 4IJMA 3R8CA 1KI1A 3EWSA 3GJXC 4URUR 5F2EA 1NLFA 4JKIA 3SBEA 1JXOA 1E2PA 3ZD6A 1XJ0A 4EPTA 2V7QD 1EX6A 5JEEA 2F43B 3VMFA 4RZ2A 2JLWA 4QM6A 1J7KA 5EUQB 3OFND 1CIPA 2WAXA 2REBA 4ASUD 5L3QB 1SHZA 3FDIA 4P31A 1YU9A 3TAUA 1E94E 3A37A 2NMVA 1MRSA 1IXSB 2A78A 3TJZA 2ORVA 2GAAA 3EX7C 1PVOA 3W3ZB 4EUNA 4LOAA 1UM8A 3NH9A 4F93B 1LF5A 4OK3A 1Z6YA 2GRJA 2D2EA 3NC1C 3PUYA 1TADA 3CKLA 1EFRD 2IUTA 4TMWA 5EE9A 4C30A 1T3SA 1K6MA 1W0KA 2IC5A 3P27A 3OZXA 5EUMA 4GMXA 3QXHA 4GI7A 1CF4A 3KFXA 2KBEA 1ZC4A 4UNRA 1GG2A 3I72A 3DHWC 4BLQA 4IKEA 1J2JA 1II0A 4DWJA 3VKHA 2X1VA 1TPZA 4AC9A 1E9SA 5SZHB 2ZRLA 1SKQA 3K0AA 1KY3A 1YZUA 5EJEA 4EPWA 3HYRA 3I5XA 4HB3A 1VHTA 2WAYA 1A2KC 4R2IA 1LW7A 1YZNA 3ZVNA 1XZPA 2Z0MA 1XTIA 1MV5A 2O0JA 1M7HA 1N6KA 4YXWD 5H68A 4LCBA 1VHLA 2OCBA 4JZKA 1NSFA 1X8KA 4LI0A 3F8TA 5EXSA 4AG6A 3QXXA 3B1XA 1RIFA 1U99A 2J7PD 3SC3A 2MMGA 3U3MA 1UF9A 4EFNA 1QHGA 3UWOA 4RCYA 3U44B 4L8GA 1JAIA 4FCTA 2AXPA 5B58C 1G21E 1HE8B 1PJRA 3UK6A 2ZSFA 4ZPXA 2ZI6A 3EA0A 3GEEA 1EWQA 2OV2A 2BM1A 3DOFA 2IA5A 2XSZA 4ASUA 1E79D 1P2SA 3QVVA 4WXPA 2Q6TA 3TW4A 2EYQA 3QBVA 1E9EA 5BYKA 1LTQA 4DCUA 5JJIA 5CYPA 4PC1A 3NVAA 2FX3A 3MJHA 4JSYA 5JCPA 4GP7A 4DEYA 3SYLA 4OHYA 4ZCIA 4HAXA 1HE1C 3T15A 4B71A 3FB4A 1IONA 1O3YA 5DYGA 1E2EA 1OYYA 4NCKA 3L2OB 1AS0A 1NMYA 2CCJA 4W5JA 3VR2A 2PT7A 1WMSA 2QAJA 1GFIA 3K9HA 3G0HA 3DOEA 1KSJA 5KNBA 3GD7A 1SVSA 4BRWA 4P4SA 1S96A 2BM0A 2QENA 3EZ9A 1Y3AA 4MKIA 1FTNA 4KSCA 3AF3A 1CLUA 2WWHA 4RKFA 1EX7A 5BQ5A 3P20A 2B21A 3IQXA 1P75A 1R0YA 3TVTA 1E2DA 1JR3E 1Q20A 4P4TA 1D2MA 2PMKA 4Q03A 4AYXA 4BQSA 1TEXA 4XSGA 4TT3D 2H92A 4ARZB 4UKDA 1OB2A 3RS2A 1KYIA 2VSOA 3RS4A 4E03A 4LYJA 2QQEA 2IS2A 1T91A 1U94A 2W6ID 4JYBA 4Q4JB 3SJAA 2KJQA 5ELXA 4HUQA 3B6EA 4U00A 2ZRIA 1P2VA 2BMDA 1GWNA 2N1BA 1S9DA 3FMFA 4RD4A 3CIOA 2R65A 2YOFA 1CJUC 3THOA 3QKUA 4LJ4A 5J4KA 2JDID 1MO6A 2AWOA 3NBFA 3B5JA 4HAZA 2EWWA 3UIEA 1TTTA 5IF9A 1KO8A 4PTLA 2BEKA 1W0KD 3EA5A 5AK0A 2F43A 4BPBA 4JL6A 4BEJA 2ZI9A 2ZQ5A 4KVGA 1Q57A 1X6VA 2VSXA 3H2YA 2DWOA 4WXRA 3OESA 1KJYA 4A36A 1EWRA 3WMEA 4A0RA 2ZJ5A 5EE5B 3IDQA 3I8SA 2J0UA 1A5TA 1NIJA 1SHKA 4G1UC 1L4UA 5FPHA 521PA 1AA9A 4HLDA 4A1FA 2F3RA 3ZZUA 2HYIC 2EQBA 3AP2A 3AGQA 1S0UA 1V5WA 3GJ0A 1XMVA 1PLJA 2YC4C 3QBTA 3QENA 3QF4A 4LBYA 4P4UA 3U7GA 3AM1A 3VFDA 2ZRAA 3CLVA 4B3XA 1OKKD 2QAGC 2D62A 4BLPA 2BBTA 5FBQB 4W7SA 3K70C 1GIAA 1M2OB 1Z47A 1NY6A 5KOYA 4AY2A 3GLIA 1JJ7A 4FMDF 3T12A 1ZUIA 1GP2A 3W90A 2FSFA 3GLFE 1SVOA 2GBLA 3AKYA 3ICQB 3RC3A 4QFMA 1FNNA 1P6XA 2ZR7A 2EFEB 1F48A 4DCTA 2O8BB 4A4DA 1W49A 3K53A 3TKLA 4C0JA 2WJIA 4V0ME 1IJEA 1G8HA 5KDDA 4RZUA 2HEIA 3T34A 3RLFA 4TTQA 2GA8A 2W0MA 3AGPA 5AJXA 2R6GA 3KQLA 1OKKA 5G53C 3U60B 3PEYA 4Q21A 3GLGA 721PA 4TZ0A 4ZIRB 3LO5A 3RRZA 2V1UA 1VMAA 1XNJA 2REOA 5DE3A 3HR8A 2FA9A 2G3YA 2IYYA 1TEVA 3FE2A 2RGNA 1XXHE 4BFYA 2G6BA 3EXAA 4TYPA 2V4ZA 3X1WA 2AKYA 1OFTA 3RS3A 4YMSA 2HLDA 2RGBA 1OV4A 1AQYA 3SE0A 3B60A 1Q22A 2BCGY 1K5DA 2JJ2D 4B73A 3JZMA 4GOJA 5DI3A 1DEKA 1W36D 2R44A 1Z0AA 2XEXA 2OCPA 2BBOA 4RD3A 2F1JA 5DISB 3AVTA 1XD9A 2IS1A 1GUAA 3BBPA 1U9IC 1XFAA 2Y8EA 4KV9A 3A36A 3A4MA 4OQNA 2GJSA 1R0XA 4LBWA 4EJSB 1GSIA 2BMJA 4QGFA 4NL4H 1T3HA 3QPWA 2KWIA 3WRXC 3ETLA 4JIMA 5IHPA 2H57A 4QGHA 5J40A 4ZCMA 2A3RA 4O0MA 2NGRA 1HUQA 2ZYTX 3GJ8A 3TMKA 1ESMA 4AIIA 3SYKA 2QBYA 3LVQE 4URVR 4M1TA 4AKIA 3WY9A 3E1SA 4QM7A 1CULC 3CZQA 5TV2A 1KIMA 1VYVA 1L8QA 5G40A 2TMKA 3BGWA 1MO3A 3QXJA 1NL3A 4AI6A 1IY2A 4Q5IA 2CNWA 2Q21A 2GXQA 4MYTA 4OJQA 4BLSA 4MDEA 3KXLA 4N0EA 3ZIAA 1KI6A 1J90A 4C9BA 4A15A 3CUEF 4GOKA 1KMHA 5LD2C 1G5RA 1U90A 3UMSA 3QG5A 5LD2B 3QG1A 4Q9LA 2JLYA 1J70A 2E87A 1BYUA 4C0KA 2I4IA 4XTCS 1SXJC 3GJ6A 5B30A 2ZJ2A 2BVNA 4NONA 1G9XA 3D31A 3KTAA 3UMFA 4B2PA 1X3SA 5GJWC 2J9RA 3U6BA 5IRCD 2CL0X 2YVUA 5K8IA 1EESA 2QP4A 4EAQA 2VPPA 1E1QA 1JQLB 1Q12A 1T8UA 2J0QA 4MGIR 4MRSA 4U02A 3C14C 3GMTA 2ZJBA 1FPMA 2CLSA 3A1UA 4LYHA 4F4JA 2QP9X 5JEDA 4FCVA 5HE9A 2IUUA 1QHNA 4B34A 3ND9A 1OXTA 1U0JA 4OHZA 3DPUA 2YOHA 1DPFA 1E2FA 3THWA 1ZIOA 2W2XA 2ZITA 5DYIA 2O8CB 4ZI3A 2AN9A 2YKGA 4M0LA 4XD7A 4C2UA 4G0NA 2Z43A 1II9A 2NO0A 4D81A 1CJVC 2AXNA 4M9QA 2ZJZA 2DYKA 1G3MA 2X77A 4ZDIA 4NMMA 3M0EA 3U61B 1SXJE 5EP4A 2ANBA 1G20E 2XTZA 2PZEA 3KX2A 4QBGB 4GZMA 1ZIPA 2IT1A 3QE0A 5KHOC 1OH5A 2IF2A 2QE7A 2ECKA 4U5XA 3CWQA 4HYYA 4M1MA 3FKSA 1COWA 1R2QA 1FQJA 1KO4A 2CXXA 3UMRA 4WZBE 2AL7A 4NH0A 4D6PA 3OE7A 2GCOB 1D9XA 4LBVA 4LZZA 4BLOA 2ONKA 4D80A 1VG9B 5CLLA 4X8OA 1BO6A 1DG1G 2IYXA 1Z6GA 3VR4A 3IKJA 5BXQC 1KHTA 2GZAA 3B82A 3CPHA 4K46A 1NIPA 1B23P 4CEHB 1AM4D 3IIJA 1EFTA 5HPYB 1OHHD 2Q9BA 8OHMA 5C18A 3MD0A 1N6RA 1D5CA 3NHAA 3QSYA 1YZLA 2DFTA 4OI0A 4X8HA 2OEPA 3BH0A 1P60A 4XSHA 4C2TA 2O0HA 1QVRA 4RFSA 2VF7A 4D26A 4JJZA 4ZIRA 3E5HA 2ZSAA 3BB1A 3C8UA 1OF1A 1BIFA 2WJVA 5CDFA 2WJYA 2ZS7A 3BS4A 1KGDA 1NKSA 2ODEA 3FKSD 3C4JA 1OPXA 3LBHA 3Q5EA 2J1LA 3ZDQA 1UADA 2ASEA 3AQ4A 3AF4A 4TSFD 5TVKA 2VO1A 1KNXA 5AUNB 3SJBA 1U98A 3R7WA 1G41A 2FEMA 4DBLC 2V6IA 3SI7A 2BMEA 1G64A 1P62B 4C0LA 3QXSA 4IOLA 3ZVRA 1BH2A 1HURA 1IHUA 5FBRB 3WNBA 5J5CA 3W3AA 1CU1A 3L43A 2ZUDA 5A5GA 2ZRNA 3CWZA 3P26A 4JLNA 1M1YE 2HT1A 4WIAA 2P5TB 3FHCB 1II8B 4KFUA 2RGNC 4MYUA 2GK7A 2C9CA 4HI0E 3T06B 2Q9CA 3I32A 3FHTA 2CHGA 4ACAA 3B8HA 3MAAC 2ZJ8A 4RSGA 1KAGA 3EPJA 2QSYA 3N5CA 3OF5A 4QGGA 3U3JA 2XJ9A 3EIHA 3LFUA 4EQ6A 5SZIA 4TYYA 1ANKA 3DM5A 5KPJA 2ZE8A 4RFVA 2ZJYA 3BB3A 1VDZA 2CCGA 1E96A 2BWJA 4JLAA 1ZM9A 1ETUA 1KNQA 1ZU5A 3AV0B 4P3YA 4DLUA 2ZYUX 3ZLJA 4I99A 2NQ2C 5DIFA 2OFOA 2FPMA 1G5TA 2ZRJA 4A6XA 2JLVA 1RC8A 5HZHA 4B6FA 3QI2A 4LJ5A 1AKYA 5B2ZA 5LDDC 1DO2A 2CDNA 1DBSA 1ZRHA 2FOLA 2FG5A 4PZYA 4RJLA 4BGDA 3FHOA 1ZNWA 4LUCA 1D2NA 1Z0IA 3PQCA 4RCZA 1GL9B 3BE4A 4B2LA 1QDEA 4G5GA 4D82A 1HA3A 4MQBA 1NG9A 1T0HB 1G3QA 1E2QA 1S4QA 1XMIA 1QHHB 2QSZA 1RKBA 3P1JA 3VR3A 4RKEA 621PA 1WF3A 1E2KA 4BASA 3EARA 3LWNA 3UG6A 2FJUA 4B33A 1KO1A 1J99A 1Q3HA 3DL0A 1JJVA 4IDQA 2QM8A 2FPLA 3A1TA 4EFLA 3ZD7A 3BC1A 821PA 2YWHA 5EE1A 3RWOA 1WA5A 2QAGB 2VF8A 4Q66C 4O2LA 5JMTA 3CPJB 2R62A 4LJ8A 2ORIA 4TYWA 4KO8A 3SDZA 3PIRA 1CJKC 1KAOA 2A5FA 5BN5A 5JZVA 1R0ZA 2ZR0A 5SZKB 2PMDA 2W6JD 1EGAA 3IIKA 1KI8A 1PUJA 1QZXA 2QEQA 2OZEA 1HV8A 1KDRA 4KXFB 4B2IA 3GJ5A 3MWLA 1SKYB 3G82C 3AVYA 1NVUQ 4IDOA 5FPKA 5KNCA 3ZS8A 2DR3A 3OEHD 4A9AA 4M1YA 1QHXA 4GPTA 3K9LA 4JLVA 5AJWA 1E2LA 3D6TB 2QGZA 3LX8A 1Z83A 4EPYA 2VYFA 2Z4RA 1OXVA 2L0XA 3GLIB 4CRWB 1MR3F 5FOTA 4HZUA 2WWFA 3PG5A 3QPUA 2QTHA 3TSWA 5DH9A 1A7JA 1XPUA 1MH1A 2FFHA 3EPHA 3HP1A 4QHSA 4LHZA 4BFWA 3EPKA 1P5ZB 2FN4A 4RFSB 4D4LA 2R9VA 1LS1A 2D06A 1BMFA 4LC1A 3PFIA 2YWEA 4JVLA 2CL6X 2WICA 2A5YB 2IXGA 2I1QA 4Z1MD 4Z51A 4HATA 3CRRA 3GEHA 1F60A 4YMVA 6Q21A 2PCJA 4E22A 3GCGA 1W2HA 4DUGA 3H84A 1N5IA 2OESA 4JBYA 2J41A 2AR7A 2ZSBA 4OK5A 4M2LA 1NLZA 3AP1A 3IIMA 1N6NA 5C4GB 3TUJC 4LHYA 3QPVA 2JJ2A 4URZR 1M74A 1ZD8A 2A5JA 4WAUA 4JBWA 2FV8A 2BHRA 4PX9A 5DI9A 2QU8A 4L4UA 2AKAB 1CP2A 1DVRA 2JLQA 1RRPA 1XTQA 2QNRA 4RZ3A 5DI3B 5FI1B 3V4FA 5L3VA 3K0EA 3OIWA 4Z8XA 3LRPA 1B0UA 3EASA 2G1JA 4GRAA 3PITA 2F1HA 5FH9A 1EFHA 4O3MA 2AFIE 4V0OA 2J3EA 2BCJQ 1SQ5A 3VR5A 3X1YA 4CGZA 1KI2A 1Z29A 2D7CA 2WIAA 3AB3A 1U2RA 2H17A 4Q18A 1OH7A 5F9HA 4U7DA 1U8ZA 4I1UA 5IK2D 2QT1A 4TQUS 1KY2A 4GFDA 3HU1A 1W2GA 1N6LA 2VH5R 5EZ6B 4O2RA 2OSBA 5DSZA 5KUTA 3B2EA 1AZSC 2D7DA 3I61A 1OE0A 1NN0A 3ONWA 3K70B 1AKEA 3AUYA 4CEJB 3D3QA 3ZZ0A 4D0LB 1TX4B 5FPYA 2FWRA 4C7OA 3MJRA 4OJKA 1KMHB 2JJ1A 2QA5A 3CX8A 3OIYA 4HDCA 4P4SB 5AWFC 1TF5A 3MSXA 3MUFA 4V0KA 5HZKA 4HB4A 1MO5A 4MA4A 3WNDA 3K8YA 1FNMA 1E2MA 2RB4A 3CB4A 3TR5A 4YXWA 1R10A 3PR1A 2V8OA 1N6OA 1G7RA 5K8LA 4LSGA 1NN3A 3THXB 4WOPA 2F9MA 3NEYA 4EPRA 4TQAA 4WZAE 2ZXUA 4FI3C 3VX4A 5FUWA 4BZPA 2IXFA 4MITA 3BORA 2QP3A 2F6RA 1FQKA 1QHIA 3BB4A 5JWOA 4AKHA 2O8CA 4DJTA 1WXQA 2EYUA 1TQDA 4MUAA 3VR6A 1IXRC 3OIUA 2GWHA 3LY5A 3ND8A 3KUCA 3K9GA 4ACBA 1JXMA 2XAUA 3K0CA 1GL6A 2GK6A 2V9PA 2ZR9A 3B1ZA 4B3BA 1R8QA 4RZXA 1I4TD 4DLYA 1DOAA 3A4NA 4BWYA 2XOKD 1R0WA 2QUZA 5AR1A 3ZZTA 4V0NA 2OFXA 3BWDD 2C96A 2ZUCA 5JRJA 1FMJA 2A7QA 2HJVA 3GJ4A 2W6IA 3NIBA 2QG6A 1S1MA 3U3KA 2ZRGA 4QG7A 3KJEA 1MOZA 1TUEA 1M6NA 3PENA 5DN6A 3LNCA 5FUYA 2OBNA 4MRVA 3QF7A 4Q4HA 2WIBA 4AD8A 3T35A 1K5GA 1AGRA 3KFVA 5K8UA 5JJLA 1GKYA 1XWIA 1IY1A 1OIXA 1TQ2A 4JT4A 4EPXA 4NYIQ 3LQRA 5CJPA 4HEJA 3NDBB 1GTVA 3EC1A 4TMVA 1NMZA 1QBKC 2CE2X 4I1OA 1BS1A 4FMCB 4H1VA 1IAQA 2PX3A 1KJWA 2ZROA 2MSCB 4QGAA 1G16A 2QTFA 4EFMA 3ASZA 3EIEA 1KK1A 3MMPA 3QUSA 4BFTA 1Z8FA 2PBRA 1VPLA 3FTQA 5FUVA 1E9DA 2F1RA 3K9NA 4UXJA 3NKVA 4TZ6A 2WSSA 1IN7A 3AVOA 5BN4A 3LV8A 1UAAA 2REXB 4D0NA 1OYWA 4A2QA 3KKMA 3QKSA 1GDDA 2D4HA 4PQFA 1R8SA 4CT4B 4L16A 1ZP6A 2OG2A 1UFQA 5EP3A 4BUJA 2JLSA 4URYR 4PSAA 2D2FA 4PFSA 4IOKA 4WW0A 5BYJA 3R7WB 5BW8A 4PO8A 4NYJR 1RPZA 4B44A 4F4CA 4M9SA 5KDLA 4P0TA 5B57C 4HSEA 4GT1A 1YVDA 5JI3E 3CO5A 4PAMA 1E0AA 1TF7A 2JA1A 2KB0A 3RRMA 4D4JA 2OAQ1 4NU0A 5FOVA 5CLQA 2N42A 5H8WA 5FBVB 1SKYE 3GP8A 4CYMA 5KU1A 2PLRA 3OEHA 2WWXA 5CYOA 1II8A 1NVWQ 3HPQA 4M1KA 2DCUA 4QBFA 4C0BA 1DAIA 1P9RA 2YV5A 3WP0A 4OQFA 1AZTA 4K8OA 5KSYA 4QNRA 5JHHB 3U3OA 3SOPA 4MH0R 3ZS9A 1XXHB 1FZQA 2X2FA 5FBLB 2R6CA 5FOUA 2FSHA 3AKCA 1KO7A 3A4LA 3B9PA 5CDFE 1SVLA 3I5YA 4PC2A 1XTSA 3DEFA 1W36B 4PHGA 3VHXA 3SJZA 5FR1A 3RWMB 1G6OA 1OFIA 2GJ9A 1OIVA 2WJJA 2ZANA 4QRHA 4EIWA 1E1RD 2HXYA 4XVUA 3QY0A 1KI6B 3NHBA 1YZGA 4GDFA 3CRMA 3H4MA 2NPIA 5G41A 3TSOA 3IO5A 2WKPA 3THYA 5AJVB 2BKEA 1G17A 3HR7A 3K09C 3AH8A 1E0JA 5F9FA 3KJIA 4UNSA 3KTAB 3CNOA 3TQCA 2EFDB 3HDTA 2LKCA 5E7MA 2FDCA 1NP6A 5JLJA 4DT1A 5IT5A 1Q1ZA 5J4YA 3TE6A 1M7BA 4I1VA 2CK3D 2VLIA 2RHDA 1W5TA 1KI9A 1KKMA 1RYHA 2AK3A 2OCAA 3CM0A 3SEAA 4F91B 2QRZA 1ZBDA 2VP5A 4DCNA 1W0JD 2BV3A 2RCNA 4C4PA 1GOTA 1T6NA 1PZNA 4G01B 1Z0DA 2QAGA 1TQ6A 3EG5A 1VG0B 1JPNA 1ZAKA 3A58B 4G5SA 1OH6A 1QHSA 3LX5A 4ZCLA 1EK0A 1H8HA 2WTUA 1AQUA 1ZMXA 4Q19A 2OT3B 1XEXB 4LPSA 3AF0A 2WHXA 1WQ1R 2CEAA 1YRAA 1G3RA 1XJQA 5HKKD 4FMCF 1F2TA 5A4JA 2PT5A 2BEJA 2P5SA 2ZSEA 3ZVLA 5KDOA 4TL6A 2ZS8A 1X1SA 1RJ9B 4LV6A 3R9IA 4K81B 4KFTA 4DXAA 4AYWA 4BFZA 2RH5A 4CW7A 3SBDA 3BJIC 4TWZA 3RS0A 3UANA 1H8ED 1GM5A 3LW7A 1C4OA 1DAEA 2J0UB 3B1YA 3IHLA 4P33A 3T61A 2J0SA 1ZUNB 1UBEA 3UG7A 1AS3A 4JJKA 1KSGA 3SS8A 3NBXX 3NG1A 1DAMA 2ZRFA 1W1WA 1XDBA 4DEXA 4FIDA 4I81A 4OBEA 1J8YF 4HB0A 1GAJA 4YQFA 3I73A 2J59A 2J5XA 3RRYA 2PH1A 1VYUA 3BXZA 4BEBA 4CEHA 3Q7PA 1E2HA 2O8EB 4DSUA 1OFHA 4Q1CA 3FFAA 2XOKA 4PR0A 3SHFA 1PLLA 3LXXA 5JFGA 3LXRA 3ZVMA 1T5IA 2P65A 1WDTA 4MKGA 3LAWA 1E69A 221PA 4M1SA 3KL4A 3P4YA 3QKSB 2GAOA 3ZJYA 3FOZA 5JI2E 3T5GA 1UKVY 2ATVA 2XB4A 4PZLA 4WA7A 3VX3A 1GRQA 2IYLD 4FW9A 1JQJC 5FL3A 4MGKR 1W36C 3BAFA 1XD8A 5CK4A 2NO7A 2VEDA 2GCPA 4QKQA 4LYAA 3SJCA 3ZGXA 1XTJA 5FPSA 1ESNA 4A8JC 2GESA 4ILEA 3LA6A 2ZRDA 2ONJA 3WXMA 5HKKA 1E2IA 4WVFA 2H1LA 3NBZC 4HB2A 2ERYA 1MABA 1OHHA 2C03A 4EPVA 2QRNA 5FTNA 5FTKA 1G7TA 3SHWA 3FVQA 3R20A 4S2EA 5KNDA 4HAVA 2LKDA 5D3QA 5L3RA 4QNMA 5KSPA 1RVDA 1Q21A 5FOXA 4OKSA 1U0HC 1TL7C 5D3MB 2WWYA 1K8RA 3P4XA 2O8DB 3O47A 4MKFA 2WSSD 1DO0A 1XXHA 4TMKA 3UATA 3B85A 1EG7A 1JPJA 3GFOA 3GJ7A 2C78A 2G0TA 3NBYC 4IVRA 5FL7D 1IBRA 1UKEA 4AK9A 3BERA 1A2BA 1DAFA 1CBUA 2Q0HA 4HDOB 3L82B 1F6BA 3EC2A 2HUPA 2ODNA 4OHXA 4IXNA 3AF2A 1C1YA 3NWJA 4TTRA 2YWFA 4F92B 3AEZA 4DIEA 3AVWA 1DAGA 3SQWA 3SZRA 2ZI7A 3I3SR 3I92A 4V0MA 4C7OB 4FN5A 1G4UR 1U8YA 4EQ6B 5LPNA 3GLFB 1LY1A 1G19A 2Q3MA 4M1OA 2BJWA 4ZI2A 3ICEA 2PZFA 3ASYA 2WBLC 1IN4A 4IVQA 2D3WA 3DKPA 1Z5ZA 5L3SB 3OIVA 1VIYA 4E09A 1JBKA 2OCYC 2HF8A 1KI4A 1HQCA 1Z07A 2OILA 1U81A 3OEEA 4KU4A 3VKWA 3W5IA 1WE2A 3RNLA 2YINC 1DARA 3PEUA 3KZ1E 4DZZA 1NVVR 3R9XA 2BBSA 5B64A 4PPFA 5FBWB 2C2HA 1GNRA 4MGYR 4OK6A 1CS4C 4I1SA 2QY9A 1YZQA 2P0EA 3GLGE 1DADA 4NCIA 5HCNA 2RMKA 3O8RA 1KK0A 3GFTA 4KLNA 2WMNB 1VYTA 4KLZA 2VL7A 2W2TA 3GEIA 4IDPA 2DFKB 2VP6A 4Q48A 4Y0AA 1ZUHA 1N6HA 1UEJA 2X8AA 3KDSE 3L0IB 1DTSA 2GJKA 1L4YA 2FFBA 4B3DA 2IS4A 1XTKA 2FZ4A 2ZRHA 5KSZA 1P7CA 1I4DD 2V7QA 4MUBA 3DO6A 3OFNA 1W47A 2C04A 1S9HA 2ATXA 4JT2A 2DHRA 2FFAA 4UNPA 2QMOA 3CH5A 5FOSA 1Y63A 1NN1A 3FMOB 1G291 3NDPA 1XCPA 4DLXA 3X1ZA 1NVVQ 3X2SA 2ZSDA 2XZPA 3VQTA 1R6BX 3L0SA 4PO9A 1NBMA 4ZV4A 2FGKA 3ECCA 5EXXA 2VQSA 1E9FA 4DLSA 3PUZA 3IPYA 2H18A 4ZKEA 1BOFA 1FOEB 1HT2E 1IY0A 3HU2A 2MMCA 3RRNA 2IYVA 2BC9A 3I8XA 4RVCA 4D0GA 3EW9A 3LVRE 4ERNA 4LYFA 3TBKA 3KKNA 3W6NA 2Q3FA 4UNNA 4BFUA 1E98A 4TLDA 4EDHA 3LW8A 3V4RA 4M9ZA 4A0HA 2GCOA 5JECA 4PC3A 3K09A 3LH5A 2BJVA 4OQXA 4IDHA 2IYQA 1DG3A 1ZW6A 2C95A 3ZQ6A 3U6KA 2CCKA 1H65A 1IM2A 2ZREA 4OHWA 4GZLA 4AG5A 2WKRA 3BFKA 4CEIB 2C8VA 2XZLA 2XB2A 2WOOA 3AVPA 4W5HA 4BRUA 4M9XA 3QEOA 5KSOA 1S8FA 5E3HA 2CJWA 5AJYA 4POAA 2ZVPX 4C0QC 1HEIA 1F3OA 1KZ7B 2IBMA 3A8TA 4X8MA 1Q1EA 1SVWA 1G1MA 4R7ZA 2ZETA 2DWQA 3RDPA 2XNDD 3OHMA 1YR7A 4IDNA 4M8NE 3JVVA 3TLXA 2QN6A 4KYUA 1WBDA 1XZQA 3GJ3A 4TLAA 5FTLA 5KPDA 2Q9AA 3ADCA 2G88A 3Q72A 3TSZA 1JR3A 3QNUA 3CBQA 4RY2A 3RSOA 3NEJA 1Z6AA 4F7WA 4IOMA 4UJ3A 5CB6A 4L5BA 4TTPA 2OLJA 1I2DA 2IS6A 3Q7QA 3CF6R 4L9WA 5TDHA 2K5UA 4JS0A 3IBYA 2G83A 4MRPA 4TMZA 1CKEA 1S1CA 2ZEJA 4ESHA 2XX3A 1OLOA 2KSQA 2VHUA 1KI7A 4QJ4A 5CM9C 3O8CA 3KQHA 4P32A 1YKSA 2ZU6A 4V02A 3B9QA 2QPAA 4CZ2A 1CEEA 4D4MA 2WM9B 2R6AA 5GADl 3LDAA 4FMBB 1ZM2A 3RC8A 1IN5A 4JLDA 4A0FA 2P6RA 4Y0VA 2GDJA 2OBLA 1JR3D 3KJHA 4Q9JA 1AIPA 4YMUA 1E0SA 3FKQA 5J47A 3VNVA 1ZCAA 3IEUA 2VSFA 1X8LA 3IBGA 3ZIAD 4DLTA 1R7RA 1ZJ6A 1WB9A 2FGJA 2P3SA 1NG1A 1YJ5A 1ZYUA 2UZIR 3QQ5A 1MRNA 1XB2A 2LWIA 1N5JA 2GTPA 2ZRPA 3RS7A 4B6EA 4CEJA 2Z5FA 5EZ5A 1AGPA 3VHLB 4ABYA 1ZD1A 2NIPA 3CNLA 4QHYA 1IN8A 3CF2A 2NTYC 1UDXA 1YR9A 2GVDC 4AKGA 1P72A 4PXAA 1DS6A 5GJCA 1LB1B 5JWRA 2P2LA 4URWR 4DHEA 2NZJA 2ZE5A 1TNDA 2V1XA 4XD7D 4YDHB 2XTMA 1NY5A 4PC7A 1GILA 4L15A 3E2IA 1SVMA 3D8BA 2H8KA 4IXMA 4L9SA 1WCV1 4Q1FA 3I1FA 5KYKA 3THXA 1M7GA 4TLBA 1NMXA 1US8A 4IEIA 4IW3B 5P21A 1XD2B 2QMUA 3QJYA 1E9CA 1U9IA 1GZSA 4URXR 3ADDA 4G5QA 3DMDA 3REFA 4QL3A 4G5OA 5F98A 1E4YA 4PZZA 4JMPA 1Z3IX 2O8FB 1FX0B 5CIWA 4YMWA 2AFHE 4A2PA 4JLJA 3O8BA 1E6CA 4XWAA 4Q7LA 1Z2AA 1P61B 3SNHA 3W6OA 5J4LA 3SQXA 4HLQB 4QBHA 3PXGA 2IHBA 1F2TB 3BRWD 5JS8A 1ZCBA 4OI2A 3LLMA 5A0FA 2RGGA 2QROA 3SFVA 3BFXA 5J4HA 3NTUA 1UJ2A 2QT0A 1VCNA 2Z6VA 3MG9A 4TL8A 1T9HA 1JEDA 4JL5A 1I2MA 2XZOA 1ZM7A 1KDPA 2GXUA 3MCAA 4JLPA 1KK3A 4DLRA 1YQTA 3Q8XB 1XEWX 5FFMA 1R5NA 1Z08A 2ZYVX 3TUZC 3W8RA 1IQPA 1X86B 2B8TA 1OXSC 1Z22A 4XIGS 4TMTA 2IYWA 1JECA 4TL9A 1FFHA 3D7MA 1ZVQA 2DY1A 4BECA 5IK2A 4II7A 1ODFA 1NBME 4TYNA 1CR4A 3QVUA 2RHMA 5AUPB 4LJ6A 2ZRBA 1RFLA 2IYZA 4FINA 2VHCA 1W4RA 2UZ3A 5F3WB 2Q3HA 1TAGA 3IQWA 4M53A 1VKJA 4HZUB 4Q9KA 4PC6A 2FNAA 2CHVA 3QIAA 5CB8A 2CVHA 1EXMA 2OM2A 3R9WA 5AUQA 2CBZA 1E2GA 2I3BA 4IVPA 1G4AE 1S3GA 4TYQA 2YOGA 4ZO4A 5ANRB 2ANCA 4DDVA 3NH6A 4LV8B 5FOWA 3TR0A 1NSTA 2G1KA 2GXAA 1JALA 5E95A 4KI0A 3AUXA 4ZDKA 1AJEA 3GLHE 1G3UA 1CR0A 3B1VA 4TQ9A 3TK1A 3DZDA 4B43A 1KSFX 2G9NA 3BH6A 4JVSB 4DRZA 1P2UA 1FP7A 1P4SA 2GJ8A 4Q1EA 1E9BA 2WPDA 5EXTA 5BWMA 1P3JA 2IYRA 4A8JA 3A1WA 1HQYE 5CIQA 2DFLA 2DFNA 3M1IA 5DHAA 3S1AB 1L7VC 5DNYB 1W4AA 3U44A 2F55A 3IHWA 5TB5A 4R71A 4QOSA 2A2ZA 4MRRA 2XGJA 3EWAA 4KYIB 2WWGA 1QF9A 2GJAA 1LF0A 2JIZA 2QGNA 2YWGA 4JLMA 4C3ZA 1CR1A 3CPEA 4LY6A 3RSLA 2BBWA 1XPOA 1W0JA 4Q4AA 2O5VA 2B92A 2J7PA 5EXPA 1CR2A 2FZLA 5FPTA 1KJZA 4MGZR 2IEZA 1JNYA 3IUYA 5FTMA 3FFBA 2QPOA 1FUKA 2EU8A 1FP6A 2IWRA 3H86A 1ZNYA 2ZRCA 4DUGD 4D25A 3SR0A 4KFSA 3PV0A 5KTYA 3K0CC 2RGDA 4Q02A 4HAUA 4KAXA 2OXRA 4M1WA 2AK2A 3GLHB 1LFDB 3WBJA 3GLFA 2R6FA 4NCHA 1DAHA 2A30A 2YYZA 1BMFD 4Q1AA 1P2TA 2XTNA 3KQKA 4Q4LA 1GKIA 1F5NA 2WVJA 4NCJA 1TMKA 1Z63A 2VIIA 1KZGB 3FGNA 3SN6A 4LJ7A 4LGMA 5CM8B 2LCFA 1YZTA 1GNQA 1DAKA 4IFEA 1ELOA 4XWOA 4ESVA 1NKTA 3EIQA 2NOAA 1T5LA 3WMGA 4YC7A 1C9KA 2JLUA 2KI5A 1TUIA 2ZAOA 3HU3A 4JBXA 4Q4JA 5L8VA 1W46A 2JGNA 2JDIA 3AVXA 3G5UA 4HUQB 3R8FA 1CRPA 4Q1DA 4XVQA 2EFCB 4BFVA 1YE8A 2V55B 3BOSA 3F0TA 3U2QA 1SXJB 2QMHA 1R4AA 3ADKA 4DT1B 2WJGA 3L8ZA 4LV5B 3F5FA 1J8MF 2VRWA 4RD2A 1KDOA 3L0OA 3VNUA 5DO9A 1LNZA 3CR7A 1Q3TA 4CF7A 2HV8A 4TT3A 3M4YA 5FI0B 4TLCA 2JCSA 4TL7A 1VG1A 2OXCA 1E99A 4DDTA 1VCIA 1P73A 1Q0UA 3QKRA 4KCGA 1XCMA 2Z83A 3VR1A 3CRQA 1XEXA 3K0FB 5JBQA 1SVKA 1CJMA 3MRSA 4JSTA 1ZNZA 3CH4B 3CX6A 4UQOA 4FWTA 1DE0A 4GBMA 4Q1BA 2HXSA 2GZHA 1T0JB 1CTQA 4KSBA 3B7GA 4DCVA 2KE5A 5HTKA 1YR6A 2HDNB 3U5ZB 1BYIA 4NP6A 3ZH9B 4MYHA 1RJ9A 4N1AA 2PLFA 4QJ5A 1H8EA 3AVVA 5AUOB 4BFSA 1QRAA 3T1OA 3Q5DA 4GL2A 4CDGA 2ZI5A 4BZQA 4B75A 2GNOA 1N5LA 4IRUB 4A0GA 1UKYA 3WYGA 3IGFA 3GPLA 3RVBA 4Q4HB 1XU4A 4MYCA 2C98A 1G8FA 3ZYCA 2C99A 2ZS9A 4BLRA 2IHYA 1E79A 3W5JA 3WRYC 1IXZA 1GITA 4DLWA 1XF9A 1H8HD 2ZYWX 1QG4A 4UXHA 1N5KA 2O52A 1KSHA 2WOJA 1N6IA 4Q47A 3AVQA 3BH7A 5G3YA 1G5PA 4LHVA 5C2JB 5BN3A 1SZPA 1VIAA 1HYQA 1XBTA 2RGXA 2IUSA 2CJWB 4OYHA 1E1RA 4US1R 4H1UA 3K0AB 3M6AA 2ZE7A 2AWNA 4LX0A 3TNFA 4B3CA 2QL6A 2QZ4A 1MT0A 1RW4A 4NDZA 1QG2A 4C0SA 3VKGA 1OSNA 1NN5A 3CW2A 5E7IA 4BE7B 2XSZD 1KDTA 4R98A 5IDVA 3WBKA 4C0HA 1N3BA 2NO6A 1GVNB 2CL7X 1Q1QA 2W00A 2W2VA 1I4LD 2JJ8A 5TY0A 2GETA 3TRFA 1JB1A 1RE0A 3V9PA 4HZIA 3B78A 4IFBA 1E3MA 2ZAMA 1HY3A 2X2EA 3AVUA 1Z06A 1MABB 2SHKA 3WMFA 1XRJA 4S35A 3C41J 2FFQA 2R2AA 4LJ9A 1ZNXA 1KOFA 3KB2A 2P67A 3OEED 3P32A 4JLOA 1IOZA 2WWIA 3RAPR 3U7HB 1NI3A 4EJSA 2O8DA 2UKDA 5KO2A 1UPTA 1VCMA 2H5EA 2F3TA 2AD5A 1E1QD 1XCGB 4RD1A 4FD2A 1X1RA 2C9YA 1RRCA 1D8TA 2GXSA 3SU8A 3VAAA 4TMXA 4B32A 2YNMA 2W58A 4QXAA 1RRGA 2W83A 3EAQA 5CK5A 2XJ4A 3U4QB 4WBSA 2PZGA 4G5RA 4ZKDA 2HJGA 2C77A 2RGCA 2AD1A 2G77B 2ZIAA 3GFPA 3LBNA 4DDWA 5HCIA 4DDUA 3KKPA 2FH5B 2J45A 5SZJA 4DIDA 2WKQA 2NO1A 4V03A 5GVSA 4R9UC 1E9RA 4PO1A 5FR2A 2ODWA 2NZ8A 4NCNA 1NBMD 1NJGA 2BOVA 2IEYA 3L8YA 4NBSA 5HE8A 1W4CA 2ZU0C 4A82A 4IHQA 1WBBA 4AYTA 1MO4A 4B3FX 2V3CC 1BKDR 4PHFA 2QTVB 3T1TA 4E5UA 1PUIA 2QM7A 2AHOA 4QC2A 5JHGB 2GZDA 3TQFA 4US0R 5FL7A 2CK3A 1UEIA 2ZJAA 3CZPA 4ARZA 1QHYA 3TIFA 5JWHA 1OH8A 3ADBA 3THYB 1IN6A 4HLCA 5TMPA 2A9KA 3PEWA 4PPGA 2ERXA 2WPDD 5TARA 1A1VA 1T8TA 2FSGA 1CRQA 3T5DA 1FTSA 2VHJA 2XNSA 1ONBA 3QOFA 2G0NA 3T1VA 2UVQA 5E7JA 1W4BA 3THWB 4NE2A 4GMDA 1E0KA 3BIFA 4NYIR 3WNCA 5J4VA 2BDTA 5FTJA 3LLUA 1Z6TA 1LVGA 4F4IA 1DELA 2X19A 2F1IA 2FU5C 2GKSA 4KODA 2JIZD 1UDWA 4CIDA 2VP0A 4HAWA 2R6DA 4F38A 2WWWA 2IK8A 4JYCA 4DB2A 2W0SA 1AS2A 4KJZA 3U7EB 4JLBA 3IO3A 4BZXA 1JEEA 3PEVA 1HTWA 3WYAA 4Q00A 1RYFA 1EFCA 4QBIA 1OB5A 2WSMA 5DN6D 3E70C 4ON9A 4DSTA 2GVZC 1R5OA 2VP2A 4DLVA 2CNWD 2PJZA 3V00A 5JS7A 4DCSA 1E2JA 1CXZA 3C15C 1SVIA 1D2EA 1XX6A 4KITB 4YMTA 1G7CA 2JEOA 3PUWA 5L3QA 2PJRA 1XMJA 4B47A 1JAHA 3NC0C 5LB4A 1S3SA 4LBZA 1UBCA 2GF9A 3QF4B 1Z0FA 3FMIA 4LC0A 1G8GA 3SFZA 4AWXA 1U0LA 2B6HA 2IYUA 1EFUA 3MLEA 1AN0A 2WJHA 4LRWA 3U7FB 2HCBA 3LBIA 1A82A 2ZE6A 3VU9B 4DVGA 4Q9HA 1PV4A 1A4RA 1OXXK 4W9MC 3CRW1 2JATA 3MGCA 2FMXA 2VHQA 1T3LA 2IXEA 2VP9A 1IJFA 1S2MA 3DKVA 2CLDX 4LPKA 2MSEB 4PAQA 4PQRA 2PEZA 4PSVA 4EKDA 4OHVA 1KI3A 1KO5A 1XMSA 3MFYA 4NZYA 2GBLC 3SYNA 4OI4A 3A1SA 2O8EA 2N46A 4B48A 3T1QA 1T4GA 3WP1B 2YJTD 3EPLA 2F9LA 1V43A 1M8PA 4JL8A 2OBMA 3LQQA 2RGAA 5EE0A 2MSDB 1KKLA 1ZU4A 1D6JA 4Q9IA 5CITA 4OQMA 3N70A 3WHLA 3WYFA 1COWD 2QPTA 4PPNA 1ZM4A 2ZI3A 4Q01A 4YDSA 3W6PA 4DC9A 2IL1A 5TXGA 3AKDA 2BIFA 3A6PC 4A8JB 3KB1A 2QI9C 1OFUX 3FWYA 4PHTA 2F7SA 3K1JA 5JSZB 4WZ6A 4JKYA 2FSIA 2ZPTX 1ZM3A 4KVAA 3U3RA 4OL0A 5DLQC 121PA 3KXKA 4LJYA 1XEFA 2BMFA 4HLUA 1TU3A 4N0DA 3Q9LA 1GKUB 1N0VC 2R8RA 3CRVA 1KMQA 4B74A 1YR8A 2A5GA 2RKOA 1UBFA 3K0SA 4Q4AB 2GEUA 4OQLA 3KJGA 2JAQA 2ORWA 1P9NA 1SXJD 2CLCX 4JVNA 1NVXQ 5D3MA 3NXSA 3EZ6A 3CR8A 2IWHA 2V6JA 1OT3A 4KHZA 2ZVQX 1M34E 3WHKA 2JLRA 2CVFA 1KTVA 5EP1A 2J7KA 1UBGA 1YHNA 3DVLA 4FCWA 4XH9B 1N2CE 2B7BA 1GNPA 2NG1A 2QBYB 4M22A 2ZRMA 5LB2A 1WRBA 2CE7A 3KQUA 2HLDD 2JLXA 2IW3A 2A5DA 3DZ8A 4HLUC 1CJTC 4IOJA 3EZ7A 1OJLA 4LK2A 2GEDA 4GOXA 2B8WA 2FE4A 2VP4A 4Z54A 1F2UA 2FPKA 2NO9A 4DKXA 421PA 4D4KA 3QXCA 4B35A 5L3SA 3UPUA 3PJRA 4XOIA 4KBGA 3KQNA 2C5LA 3CONA 3B1WA 4FXPA 3DM9B 4PAOA 2FF7A 4E07A 2GF0A 2JJ1D 2J87A 2DWPA 4FWIB 4TN1A 4XTRA 3IEVA 4PSKA 2VTKA 1G3IA 3RANA 2P6UA 4V0LA 5JCZA 1SXJA 1W48A 5CJ2A 2ODBA 3BD9A 2EFHB 3KKQA 3H0KA 2GCNA 1U8AA 1OW3B 1QHHA 1US8B 5C46F 5H1YA 4CVNA 3HWSA 1XD2A 4UJ5A 2Z4SA 2OO7A 3I4LA 4J0QA 4A6PA 4Z1MA 5GJVC 3OE7D 1WP9A 3FPAA 1JI0A 4YONB 3DDCA 2QMEA 1XTRA 2XXAA 4G3XA 1VCOA 3HJNA 5DGXA 3TH5A 1FX0A 1G8YA 1RRFA 1Q1BA 3QKRB 2AX4A 2RAPA 2OAP1 2OUKA 1TQ4A 3K0FA 5EQTA 2P6NA 1GRNA 2WMOB 2BKUA 1OIWA 3VTKA 2ZI4A 3RABA 1O87A 1VG8A 3MWKA 4XWKA 2ZTSA 4AURA 1G6HA 1TU4A 4M21A 1W7AA 1ZD9A 1D9ZA 4TSFA 4NKRA 4W5WA 2YHSA 2OFWA 4LJAA 4NPHA 4HAYA 2XNDA 2EW1A 2KBFA 4O25A 3GLIE 2C9OA 4JLKA 2ZRKA 4H9GA 1N0UA 4X8LA 3TVDA 3GQBA 3PCRB 2HCJB 2JASA 3VU9A 1UKZA 4I4LA 3ZQJA 1LS6A 4D2IA 2VHTA 3W8NA 4C0AC 2ZM5A 1MKYA 1HH4A 3TW8B 1W44A 2VBCA 2NPFA 2VA8A 4DLZA 5GJBA 2YZ2A 3JVUA 2GHIA 2JLZA 3X1DA 3B13B 2WV9A 5G3ZA 5UKDA 3UXMA 3N2IA 4MDFA 4CEIA 2D74A 4DB4A 2QORA 4UXIA 5H70A 4LDJA 4B3GA 2HT6A 2B7CA 2O8BA 2PEYA 1AK2A 4ITRC 4LWZA 3MWYW 1XEWY 2E9SA 2IYTA 2QQ0A 5DHFA 3BFVA 4B76A 2HF9A 5M04A 4LHWA 1RZ3A 2OHFA 2XITA 1P9WA 2ZJOA 2IYSA 1NJFA 4GSYA 1NLYA 5JSZA 1Z2CA 5LBIA 1PLKA 1XP8A 1JR6A 3N2EA 3A1VA 2QE7D 5EP2A 1E32A 1Z0JA 3OAAD 3QEJA 1Q44A 1NF3A 3CF0A 3H1TA 3GLGB 3AKEA 3C5HA 4N3NA 4UNQA 3BK7A 4BFXA 1QVAA 4CT5A 4ZDJA 1W5SA 2J46A 4HDQB 3AP3A 3TUIC 4OI1A 4RD0A 4DSOA 3RS5A 2YC2C 4MRNA 3HYTA 4KFRA 4Q7MB 4US2R 3AF1A 1N25A 3EZ2A 3S1AA 5FUXA 1Z0KA 2GILA 1NRJB 4PHHA 2OE2A 5EE3A 3RHFA 3Q85A 3TAHA 3W34A 1X8JA 4GNKA 1YRBA 3FYHA 4JVMA 4HUTA 4NHOA 1HT1E 1N0WA 3FMPB 1ZC3A 1SGWA 2PCLA 3KXIA 3EZFA 3C7KA 1G7SA 1NNEA 4YLGA 4AKEA 5C4MA 3I62A 1VECA 1GRRA 2I1VB 2J0VA 4Q7JB 4QJ3A 4NYMQ 5AJZA 2EVWX 3C16C 3U4QA 4RD6A 3PUXA 3C5CA 5E4FA 5GVRA 4A2WA 4KBFA 4PANA 1G18A 3UKDA 5HR5A 1L2TA 4PQYA 2W6JA 3F3YA 3GLHA 3KKOA 2OLKA 1F2UB 2EWVA 4FMDB 3PVSA 4GP6A 4PPQA 3TGPA 1ZINA 1E4VA 2HYDA 2H7VA 3IPXA 2H16A 3QKTA 1FL9A 2WZQA 2ZUBA 3IILA 1N6PA 1R5BA 2PL3A 1LV7A 4IEEA 1XPRA 2EFGA 3REGA 2RGEA 4Q7KA
chains in the Genus database with same CATH superfamily
1XA4A 2OHIA 4JXZA 2NSJA 5CX1B 1Y1KE 4F3NA 3K6SA 4OGLA 2JK0A 1K8ZB 4EK9A 3IKTA 3JCZA 1VZ3A 1NV8A 2VCEA 3HBMA 3LD9A 1NLUA 4TLEA 4AJOA 3EVAA 5JRZA 1FP4A 3KO8A 3VOBA 1HFJA 4NTZA 3IP1A 2DLDA 4RVFA 2V03A 1Q0PA 1RKUA 2QG9A 4JN6B 2H2WA 3DF7A 4KE9A 4MCIA 4MWGA 5FADA 3A6DA 3DMNA 4B0OA 4WBNB 4RTJA 2DUWA 1QX3A 1Y9AA 3EVGA 3W9YA 5ALFA 2I33A 1DCKA 1L4KA 1NJ6A 3L8MA 1VKOA 3O90A 3I23A 4S0XA 3MTGA 1D3AA 1Q91A 1Z6XA 2P4UA 4N5MA 2X9LA 5AFSA 2DBYA 3MS7A 4LHXA 3N8NA 5IM5A 3QE4A 2LVBA 2QWXA 3CX7A 4Z8YA 1FW6A 1NFQA 3AWIA 1LBSA 2VNAA 3G0CA 2F62A 2YCLA 4KWCA 1O94D 3EQZA 3NHMA 4L0DA 1WX1A 2LXNA 4A92A 4D42A 2FPPB 3RYTC 2IZZA 3MINA 1K0UA 1KI1A 3GJXC 4URUR 1QFZA 3UAWA 5J58A 3SBEA 4BMXA 1JXOA 4OAOA 1YR1A 2FP3A 3CT4A 4NU6A 4UHEA 2V7QD 1EX6A 5JEEA 2BRUA 3R2JA 1PR9A 3UAZA 1HORA 1LC0A 1Z0SA 2REBA 3H05A 5DVZA 4BMYA 3FDIA 2BUBA 1YU9A 4IIHA 1B15A 1QP0A 1E94E 3A37A 2FN9A 2G0AA 2O5RA 1YJ8A 3FPEA 1NZDA 3GUVA 1IXSB 3TJZA 3H18A 2P3OA 1W0CA 4JQCA 3RBZA 4ZVOA 4EUNA 1ZR2A 1UM8A 3NH9A 4EEXA 5IBCA 1LF5A 1H4QA 2ZUTA 1X2BA 3QWAA 1GN9A 3D4BA 1ZRNA 1RABA 3IAEA 4R8SA 1B3BA 3K4HA 3R23A 4UCWA 5M5BA 5ALQA 1ZJYA 3NC1C 3PUYA 3CKLA 1M2JA 1T3SA 1UP7A 3MA0A 3ESRA 4J07A 4KQ6A 1W0KA 1V71A 4FU0A 2QMYA 4GMXA 3QXHA 1QG0A 4DBZA 2C0CA 2ERCA 3ICWA 1A1VA 3OTGA 3KFXA 5CW1A 1L7OA 4IDBA 3HBAA 3DHWC 2Q49A 3IP3A 1II0A 4I5DA 1QC5B 4J0EA 5CH8A 3NYQA 4AC9A 1B1CA 1PL8A 1G20A 1JQ3A 1T15A 1SKQA 1CUGA 3K0AA 4QODA 1YZUA 2PZAA 4B6SA 4V24A 2IELA 3AOGA 3OPXA 5CXSA 5LXTF 4DMUB 2ZQYA 4M89A 4ERXA 4BKOA 4LSZA 4BMCA 4L4ZA 2XZDA 1QH1A 4FK8A 5TGZA 3P2OA 3L7CA 2QVCA 4MWZA 4RDXA 2DZDA 5EKUA 1DKLA 1VJRA 2C3UA 3VZRA 4I14A 4DM4A 4FGZA 1MV5A 2E3JA 5LMZA 4EB6A 2O0JA 4BNDA 3VU8A 2WFLB 1KA9H 2VJMB 1L5OA 4G5YA 5H68A 1G8AA 4O1HA 2PKRA 1VHLA 3H83A 1OWOA 4EH1A 1NSFA 4R6WA 1C14A 4X62B 2FX2A 1ZNQO 1KAMA 1ONPA 2XUIA 3A2LA 3QXXA 4WRRA 4ZQIA 5EXSA 1JFVA 4UAJA 2D5LA 5A4MS 4Y67A 4XFKA 5BV2P 1XROA 5EMNA 4BMSA 2V97A 2XQGA 5FQOA 4V39A 1P81A 3C4VA 4MUIA 3ROQA 4ZHQA 3ADPA 4BVLA 9LDTA 5KREA 5A4FS 4BC1A 1G21E 3K05A 1ZRSA 2XKKA 3AVTA 1PZHA 4M0KA 3V8RA 3UK6A 3EY4A 4RA9B 2ZSFA 3JD0A 4AUEA 2JFVA 3GEEA 2BM1A 3NHJA 1Y1RA 2HRRA 1OLSA 1P2SA 2Z95A 2DPMA 4I50B 4J8PA 1E9EA 3EUWA 4DCUA 5EMJA 4PC1A 3INYA 1K7FB 1Y6QA 1ZFNA 3MPOA 1E8DA 2OXTA 3W1EA 4F9FA 3GLRA 1G98A 3N2KA 4Q39A 2EC5A 4CM8B 4M88A 5JCPA 1MBZA 1LKZA 4GP7A 2AW5A 1RZRD 1Z3CA 1QH8A 3A9SA 4ZCIA 4HAXA 3T15A 1MDFA 3SJUA 1CY6A 1O3YA 2X5OA 1E2EA 2FWPA 5DYGA 2Q4TA 5E4YA 3R5SA 5JAPA 3V4VB 1X1EA 2OCDA 2CCJA 2XEDA 4W5JA 1L8XA 2D1SA 1E6UA 1I7NA 4ADSG 4Q93A 5JNTA 3RSCA 2CW5A 2VG8A 4FZJA 5CX1A 2GX6A 3PNLA 1A7UA 2XRZA 3I2GA 3JWEA 5IUNC 1CNEA 3EZ9A 4FLMA 3W5BA 3NTQA 1FTNA 4IMIB 1HZZA 2G04A 2HDWA 1PBTA 3GCWA 2EGUA 3ZLTA 4RKFA 2ZWPA 3P20A 2CUTA 1WNTA 3JXEA 4V0SA 4JYZA 1F8UA 3GGCA 4P80A 3CVVA 4F4FA 1S2DA 1EWVA 1Q20A 4O2AB 1W8DA 1WHSA 1NW9B 5D3ZA 5ITVA 1L8AA 4BQSA 2VDPB 1HQDA 2BKAA 3DEZA 4XSGA 4ALIA 4TKUB 4TT3D 2H92A 3KOUA 4UKDA 3O2JA 3BQNB 3OQVA 4N0MA 1MAVA 1M2HA 1VMDA 2VSOA 3D54D 4NULA 5BSMA 1JU3A 4JUIA 1ETHA 1KR5A 1QVWA 3H17A 2FZKA 1NNLA 3LA8A 3MWFA 4HUQA 4WL0A 2BKLA 1U02A 2ZRIA 2Y9MB 2AG5A 3KLNA 3ZLBA 4F1KA 1P2VA 1Z18A 3QVTA 2YASA 4HSGA 3KETA 1J39A 1J25A 4O2BA 4Y1EA 2YJ6A 5L6MB 1I6MA 3NKLA 3ACBA 1PS0A 4NARA 4LRSB 4LJ4A 2JDID 5T7BA 3B5JA 4E33A 13PKA 1VXOA 3AONB 3BCRA 3UJHA 1TTTA 1KO8A 3OH8A 3ELYA 2PD3A 3R6GA 4PTLA 5C7LO 5FYQA 1J6UA 1Y7HA 2BFCA 4RLQA 1PYDA 4N3BA 1I7DA 4BEJA 4P7FA 4X7RA 5ALMA 2ZQ5A 4HVCA 3WIDA 1EJ6A 5IP5A 1YDFA 5J2TF 1EWKA 2VSXA 2PU5A 1TQHA 1DQSA 1WXGA 2JS7A 4G37A 1F8XA 2FFJA 4WXRA 4CLEA 4ZT5A 1F38A 3OESA 4OREX 2ZUVA 4A36A 5T3YA 4C7OB 3V8NA 1W6RA 3BRQA 3IESA 4N49A 4DZTA 1YQDA 1T4CB 2X1HA 2DQYA 1SHKA 2XD4A 4G1UC 5I9NA 1JQAA 4OM8A 3FSRA 4B17A 1CV2A 3WC4A 3MHTA 1Y8ZA 1P7PA 3L79A 2H65A 1TCAA 5AH0A 4RIHA 3GZNA 1GGMA 3JQPA 3WL6A 5JYBA 3QENA 3J81k 2ZRAA 4B3XA 1DC8A 4M1ZA 2D62A 4URFA 5AVSA 4HGQA 3FSGD 4ZGGA 3K70C 3VVBA 1IAVA 3IAUA 5AI9A 3BQ9A 4MYDA 4H1TA 4FMDF 4NJOA 3L8HA 3L7DA 1ZUIA 4DLLA 2QUKA 1RDFA 2XGGA 3TX6A 5EZYA 4P53A 2FSFA 3FUCA 1SVOA 3AKYA 3GLFE 2VBGA 3M6MD 5FORA 3RC3A 3PE6A 3I9V1 4ENSA 1YBFA 1L9XA 1ECJA 4JIGA 3WIOA 1ZWLA 5ALVA 1FTWA 1K27A 3HO6A 4IFIA 5KYNA 4ZVKA 5H3LA 2WTNA 5M2QA 4X92A 2UYYA 2WNIA 3AFGA 5EWMB 3J81A 4YRNA 1KJIA 4C0JA 5IJ9A 1MGOA 1FP2A 3HBFA 4OP3A 1IJEA 2PXXA 1I9GA 1W5EA 1YB5A 4J49A 5FO0A 3T34A 3VU3A 2EQ5A 5IVPA 2FZVA 2IPOA 3CW9A 4OQNA 2QRMA 3AGPA 1KBQA 3KWMA 5AJXA 3KQLA 3D0RA 3PVZA 1OKKA 3OZAA 3F74A 3GLTA 2I2DA 4HDMA 4Q21A 721PA 3LO5A 3NDRA 2TYSB 2IYYA 1NE2A 2AXQA 1TEVA 2D0PB 1V11A 4L2IB 2RGRA 2RGNA 2J33A 5LDGA 1XXHE 4RPHA 3O8OB 3NEAA 1CJBA 3K1ZA 3Q98A 3WIVA 4B6JA 4TQGA 2V4ZA 3X1WA 3HMKA 1NVDA 1A9QA 3ZWMA 2HLDA 2RGBA 3TM4A 2BFMA 2GJ4A 3HFSA 5G02A 1AQYA 1ABBA 2ZIGA 5LMNB 1VB3A 3DWIA 5I4BA 1LTKA 3M6FA 2JJ2D 3CLUD 4B73A 4GI2A 4CI0B 3JZMA 5BT9A 5A5FA 2VAXA 4DA0A 2CLLB 2ORYA 3T7DA 4HKTA 1T34A 2GCEA 2FEXA 3DZJA 4JHLA 4RANA 4QOHA 3SDBA 2R44A 1Z0AA 2XEXA 1MD9A 1RPNA 2NU7B 2OCPA 4RPLA 3D8UA 3KAKA 2P1DA 4RD3A 2M6LA 3D0QA 3RVDA 4CKCA 1NGSA 4DCCA 1TIKA 1X87A 3OZCA 4PSDA 4XGKA 1XFAA 1TEZA 2PAFA 4N8DA 3GG9A 2JI6A 4ZDWA 2P3QA 1GSIA 2PYDA 4QGFA 4BX8A 1KMCA 2HJRA 2NUTB 2QX4A 1ZCFA 1SCIA 2PIAA 4EA6A 5J40A 4BXOB 3GFVA 2A3RA 2NGRA 4UHJA 1M6VA 3TMKA 3C1TA 1XP5A 2LRHA 4AIIA 3SYKA 1JDPA 2Y6UA 5DGIA 3K7EA 2QBYA 5E9AA 4M1TA 5AM1A 3DBIA 1RQ7A 4AKIA 3WY9A 2Y1EA 3NTLA 1L1FA 3CZQA 1KIMA 4N82A 4KPFC 4UTOA 5G40A 2WNHA 4PV7A 5C9ZA 3QXJA 1IY2A 1U8UA 2O6LA 2CNWA 3PB3A 2GXQA 1W94A 4BLSA 2YTZA 4B3IA 1V8PA 2HXGA 3R44A 4Y2RA 4C9BA 4A15A 3CUEF 1G5RA 1U90A 1M1ZA 3QG5A 3U39A 4Q9LA 1KJNA 1J70A 2E87A 2G9ZA 5EYPB 4C0KA 5DHSA 3UQZA 3IFSA 5B30A 1PGJA 2CNBA 4O6VA 4NONA 1G9XA 3D31A 3K4PA 4B2PA 4C0XA 3X1KA 1L4BA 1X3SA 3HABA 5KJCA 4WBNA 3BRSA 1Y8AA 3LC0A 1CCWA 1SUBA 1Z2PX 1YNSA 2M6RA 3SGLA 3TCNA 2VPPA 1JQLB 5KI6A 2J0QA 3DO8A 5DB4A 4EGAA 3PT9A 4RACA 1FPMA 2CLSA 2FWMX 3AIMA 4BX0A 1A9XA 1OLXA 2QP9X 4OUDA 1BRTA 1N2HA 4WMLA 5JEDA 1TZMA 1Q2XA 1ZSYA 4HZGA 3ND9A 4HX9A 4CQLA 1U0JA 3GP3A 3QH4A 1SQ0A 1E2FA 1ABEA 2W2XA 2X5JO 2A1UB 4KQ9A 2O8CB 1AHPA 2X2PA 5IVDA 4BCCA 5JRDS 1NJ2A 3KVOA 1B76A 1L6IA 1RBQA 3C3XA 3IMGA 3R40A 4WK6A 3TE7A 4RK4A 4AJPA 1AV6A 1GR0A 4D81A 2YH2A 4W4TA 4W1SA 1T1SA 2AXNA 1SUPA 2UDPA 3EVFA 1L3CA 3PX3A 3TZBA 1H0SA 3L4SO 2H2DA 1G3MA 1VE5A 2BE7A 3D7NA 3KU4A 2OENG 3DSRA 1T8YA 2WD9A 4NMMA 1HYBA 3PNBA 4YRSA 4J16A 5CHEA 4ONEA 5EP4A 3V4LA 3VPCA 1IEWA 2ZYIA 1IWOA 4R9NA 1U11A 3KX2A 4M49A 4QBGB 3TDNA 1JP7A 4LDZA 4TS1A 3L06A 3QE0A 2R1VB 5D86A 2D1TA 3C3AA 2OZPA 2IF2A 3C48A 4RF3A 4U5XA 1NW6A 5DLEA 3E1GA 4M1MA 5G0UA 3UT6A 3RI3A 5KAMA 1R2QA 2CDRA 5LNK1 3WAGA 2CXXA 4K9MA 1EP2B 4TVOA 4F97A 2P79A 1HDGO 5LJLA 3DNFA 1UBHS 1TUBA 1CZNA 3MJ4A 4FX2A 4IIXA 4LZZA 4EBBA 2ONKA 2P4SA 2Z9DA 4FEGA 5ADVA 1J09A 1VG9B 1WR8A 2X4LA 3NS7A 4X8OA 4G97A 5JIBA 2IYXA 1Z6GA 5AKLA 2FZWA 2I29A 5JVDB 3VR4A 3V1KA 3ZQ4A 4OIFA 5JADA 1IOWA 1K4KA 2IDKA 5EIEA 4E1AA 1KHTA 1DL5A 2ZT8A 1WCIA 5DGDA 3OMXA 2Z1MA 4DV2B 4MZXA 1LBTA 2X15A 1YO6A 1TO6A 4K46A 1LPMA 3EN0A 1EUZA 4YAFA 5AVWA 1CHNA 5HPYB 1OHHD 2I91A 4PYNA 4R9VA 2YN0A 4B9EA 1Z68A 5C18A 1T5DX 4PRLA 4CN9A 3PSHA 4ZOCA 5TMDA 4AZTA 5CBPB 4OI0A 1KEUA 3BD7A 3KPYA 4GKBA 1U7DA 4XSHA 4C2TA 2B61A 2VF7A 4X84A 1IBLB 2D54A 1YASA 2H29A 3E5HA 3IURA 3RKRA 1OF1A 4ER6A 2WJVA 3BS4A 1BMQA 2ZS7A 4BTEA 2FW9A 2V65A 2ODEA 3FMVA 3QLJA 3NMUF 3JQBA 1J07A 2HQ1A 4KMRA 4NBNA 4F3TA 4Q3BA 4H31A 3HCBA 2PXHA 4GEKA 3EZLA 2QV7A 3ZDQA 4O59O 2OV8A 1H9AA 4EENA 5K6AA 1JDUA 1RM3A 2H48A 3BXOA 2AI1A 4GQAA 5B58T 1ZIXA 3WO0A 2V7VA 5DYYA 3BWBA 4N5NA 2R25B 3FI0A 5ICMA 4F11A 1DBWA 3IOCA 3TDMA 4D8TA 4RUKA 5B37A 3BD8A 3WMXA 4KNWA 1D1TA 2Z8YA 4YHHB 4CMBA 4EGFA 4MVJF 1P4HA 3P26A 4QFCA 4LVUA 4P86A 2ZTHA 1QZZA 4NI5A 2P91A 3HBNA 2B3DA 4KH0A 3CW8X 1JL3A 1M6VB 5K9ZA 4HI0E 3T06B 3I32A 3IAHA 1H2WA 3DWGA 1VI2A 2GWRA 5IXYA 4MQEB 4BNKA 2AJ8A 1PBNA 1UBUS 2QLNA 3IPCA 1VKNA 3L18A 1I1QB 4D41A 4RSGA 4EI8A 1ZESA 2IVFA 3I01M 1KAGA 3EVNA 3KEQA 4JJAA 4GC5A 3EPJA 3EG9A 3OF5A 3QYPA 5K45A 1THGA 3AR9A 2XJ9A 1TJYA 3A6LA 1LWOA 1G55A 2AI2A 1I7LA 3AWDA 4NZ9A 1EUCA 1FDIA 5JC8A 4TYYA 1YQWA 1ZGGA 3CXRA 3GLQA 4CG3A 2BH2A 3QYJA 1RHKA 2ZJYA 3FVWA 4RNDB 5CVCA 4B3TB 3NW9A 3OP1A 6LDHA 3RNOA 1XNRB 3GRVA 1BJKA 3AOEC 4JLAA 4XRRA 2J5BA 1ZM9A 1D2HA 1KNQA 4PZDA 4XQCA 4D5EA 3AV0B 4P3YA 5H80A 5DIZA 3ZLJA 4I99A 1QCYA 1WHSB 2FW1A 3H1BA 4WI1A 3P9PA 4BJ6A 3RUPA 5EY5B 2JLVA 1LDGA 5HZHA 4MHTA 4M7OA 4XLLA 1RAEA 5D3KA 1DBSA 1C4WA 2C4VA 3FJYA 2IXAA 1SXGA 3M7IA 1ZNWA 5DP2A 5L4SA 3PQCA 4EG8A 1GL9B 1XK7A 1VBKA 4AKSA 4DGQA 3QVJA 1QGED 4MQBA 2HR1A 5AO9A 2XMDA 3PNPA 1MZPA 4J0FA 3NX4A 4OSPA 2LE0A 1R9GA 2ID8A 2QSZA 4D9GA 4CXMA 2PQMA 1GSHA 3NYIA 1TYZA 1E2KA 2JD2A 2XECA 4IQFA 2C3PA 3PUIA 1NULA 4IDQA 2FPLA 2AG6A 3WICA 3B6KA 2WDPA 1YB6A 2YWHA 3CJQA 4IAOA 1EVIA 1P1KA 5AXDA 821PA 4PY2A 1R0LA 2LBPA 1FVFA 4HPJB 4MCJA 4TYWA 3UHPA 1L9KA 2HJ9A 1TK9A 2X13A 1B93A 1LW6E 1QIGA 3GWZA 2BZSA 4WCFA 5JZVA 1R0ZA 1B74A 5AXCA 1I4WA 1PUJA 1QZXA 3MRTA 4QZVA 4FB5A 1JHYA 4YPOA 4NV1A 3MWLA 1SKYB 3CLRD 3AVYA 2HBYA 3NP9A 4HRVA 3WDLA 1JSRA 2BRUC 2DR3A 2FEAA 2JG3A 3OEHD 5A6VA 1EB8A 3V1YA 2XB9A 2X8JA 3ICPA 1UJNA 1QHXA 1XCOA 1UM9A 3I6BA 3TZCA 1ZK3A 4KK4A 1GUYA 2I2AA 1GUDA 3LX8A 4EG3A 3AKZA 2VYFA 2PWPA 4OMUA 5JO9A 3BFJA 4CQJA 2YVKA 3BUSA 5JDIC 3FPBA 3QRWA 2FVXA 3F90A 4DNXA 1MR3F 3GRUA 3FCAA 5FOTA 3UJDA 1ZA1A 3G5MA 4TRRA 1OZHA 1JFRA 3G2PA 3HGMA 3QPUA 4OAPA 5CBPA 4M87A 3TW8A 3Q3VA 4BMDA 1Q95A 1M6EX 1XPUA 2YVQA 5G4LA 3KR1A 1HPLA 3WKCA 1EVKA 2ZBPA 3HP1A 5DFAA 3JD3A 4DQXA 1P5ZB 4RFSB 5A3SA 4CCSA 4BNMA 5AW1A 2D06A 2HK6A 2ZW9A 4LC1A 4EARA 1C9EA 1YMVA 3DR3A 1WNFA 2ZYAA 4QM7A 4ZZ3A 5IT9A 1JLMA 2IXGA 4MDYA 3CRRA 5I7RA 1PWZA 3GEHA 1F60A 6Q21A 1IH8A 1M2VB 2W37A 1AKUA 1UDRA 5A5DA 4YUAA 4MPRA 2VZ8A 3UKOA 4DUGA 2DBQA 3WFIA 2AQIA 1JFFB 1JKJA 2QYOA 3UJCA 2AR7A 1PQUA 2IXDA 4L0MA 2IYOA 5ECGC 2WUWE 1DC6A 1OA0A 1BXRB 2P27A 4OK5A 5CM2Z 1GXSB 3IIMA 3CLTC 1MA0A 3PICA 4B7CA 1UK8A 3CSSA 3QPVA 1JIKA 4G0XA 2JZCA 4RY8A 1M74A 2W2QA 4P08A 5IAGA 1KEEB 4OPMA 3WSTA 5DT9A 3HUDA 5BNTA 2FV8A 2O1WA 2VOJA 5M04A 4RGBA 3ELBA 2AKAB 1KH1A 4DUPA 4NRDA 1CP2A 4WY2A 1IWPB 3PQEA 5FI1B 3EDQA 2H7YA 5CXQA 2UUAB 2BR5A 1XU9A 3DEAA 5AW5A 3FR7A 4ZREA 3ES9A 2X58A 4BV3A 4F6CA 1UOPA 1N3YA 2X4DA 1D2GA 1V3TA 1IDOA 1ZXBA 2F1HA 1UUFA 4M8LA 3KOWA 4PBTA 1KRXA 3IQEA 3A9VA 4F46A 2Z2KA 3UUGA 4YJ3A 2LGJA 5BO5A 4FFRA 1PT5A 5KNLA 2BCJQ 4QYXA 1SQ5A 4FFOA 4CMKA 3LPLA 4CGZA 4F8JA 1DEAA 4IKOA 1IHDA 4Q18A 1C4KA 3FZQA 1KAEA 3I9V6 5B5SA 2CY0A 1YS9A 1E66A 1ZEJA 2P78A 4WACA 3VVMA 2WU3A 1KY2A 2YZGA 4H6XA 1W2GA 4MW7A 3OICA 4PF1A 3UXHA 2OSBA 3GZTB 2ZZKA 1SY7A 1OBHA 2I9KA 1AZSC 1DTWB 4I8IA 4M7WA 1OE0A 4RZHA 1GD1O 4WE3A 1ZY2A 1NUUA 3DFIA 5IZ4A 3K70B 3J80A 1WB5A 2O48X 3LIIA 4MIOA 4CEJB 2RC6A 1TX4B 2FWRA 1KYWA 1S7CA 1SA0B 5JALA 3WK9A 1S01A 1ONSA 4DKJA 2YV3A 5AWFC 4DA8A 3OIYA 2C97A 1VJ0A 4IGEA 4P4SB 5A4DA 4YY3B 2J4FA 4QUIA 4V0KA 1BDJA 2DT8A 2VHVA 3O4FA 4F21A 3L01A 2G1AA 1X9IA 5HQ3B 3TO5A 3HY4A 5D5HA 1E2MA 3JZDA 2GUGA 3TR5A 4YXWA 2FB9A 2PV0A 3Q15C 4FJ0A 1N78A 5IX8A 1U7WA 1VQ1A 1OC4A 3IKMB 4MUFA 4LSGA 1YTLA 2WPNA 2ZXFA 1OBCA 1IHXA 2E21A 1ZOSA 2P4EA 3HA7A 3NM5A 1CWUA 3U4IA 4RQBA 1I5RA 3VX4A 5AVUA 5FI5A 3K96A 4LTNA 3JRNA 4PNZA 5AJTA 4BZPA 2PKQP 3DBOB 3ZBUA 1EHYA 1Z0UA 4C03A 1JKXA 3HJCA 3LK6A 4BKQA 3K2BA 3LBAA 2FFRA 4YGYA 1KRHA 2O8CA 1EP1B 1IATA 3QYAA 1U3CA 3DLIA 5DCWA 3FUTA 4QOJA 4YAIA 1DX4A 1OPRA 2DJIA 3EF0A 1U7UA 3FNFA 4KR9A 4BDTA 1IXRC 3GHHA 5DASA 4CTOA 4ZI7F 5JYCA 4QVIA 3OZSA 4KEAA 2UYCA 2EZTA 4AXBA 1X80A 2QVYX 2YWRA 5KYGA 1D4ZA 2PL1A 3HKDB 3PPXA 2ZR9A 5KQSA 4B3BA 2IZ1A 4RELA 3P2IA 3U0BA 1M67A 4DARA 3EODA 3A4NA 3BSFA 1TM5E 5BUCA 2ZBEA 3UGQA 4KR6A 3HUEA 4PVDA 1IJBA 5AR1A 4EA7A 4I9NA 4V0NA 1SPXA 3MB8A 2C96A 3O2SB 4G67A 2B0JA 4JOCA 4NIMA 3STWA 4YP9A 1JF8A 5EA2A 5JRJA 4JP2A 1MHPA 1UJCA 4UD6A 3GJ4A 2W6IA 1S1MA 3OZEA 1O6CA 3B3FA 3PENA 4E5YA 5FUYA 2OBNA 4MRVA 4YRTA 2EATA 4OYYA 4X5OA 1PE0A 4Y9TA 3T35A 3TIIA 2V6MA 4AD8A 2XQVA 1ESEA 2FW0A 3R5FA 5BSKA 1DNPA 4BE9A 1BGXT 4ML3A 1Y6ZA 3UK2A 3R8XA 4YMIA 5AKEA 3S99A 2Z2JA 2RGYA 4QO8A 1RRMA 1PR2A 5BSVA 1TQ2A 4JT4A 3NUZA 5ALHA 5HIAA 3GJTA 4NG4A 5CJPA 3ZWQA 1IXYA 1LDYA 5TNXA 1YZ3A 3HZZA 3BWEA 3HUUA 4M98A 4A1OA 3RU7A 2Q3DA 1C0KA 4H1VA 1IAQA 3F3MA 4HDSB 3M83A 4GPD1 1KJWA 4GM1A 1YUMA 4FC7A 4KZPA 4BN5A 4DJJA 1G16A 3ASZA 4DUZB 3MMPA 3B3GA 4PU0A 1LK7A 1J2UA 3OZRA 3Q3IA 4TPKA 4X64B 3NGMA 2QK4A 1MEJA 4G0UA 3WLQA 1E9DA 2F1RA 2PSJA 1IUNA 3LXMA 3Q8MA 2WSSA 3OBBA 3WGQA 4BJ1A 3AVOA 2PANA 4OU4A 3WGVA 3NEPX 4ED9A 5IAEA 3IUSA 3EIXA 4D92A 3VNSA 2XCTB 2D4HA 3M1LA 1UMDB 2Z8ZA 4RJJA 3C3EA 4DIUA 2WQZA 4LYDA 2OG2A 2Z8YM 3U4AA 1UFQA 5EP3A 3ND7A 3SD7A 5HM6A 4ZV7A 3A9WA 1T8WA 5CA0A 2JLSA 1ADYA 3N2GB 4URYR 4P81A 2QPLA 4PSAA 5DCYA 4BO7A 4UCXA 4P5DA 4PO8A 4GYJA 4P93A 4CQMD 4F4CA 2WG1A 2ASVA 2ES4A 4P0TA 5C5EA 2OC4A 1C3EA 2PQ2A 4UDYX 2HB6A 4MLZA 5K3DA 1V2GA 1N2CB 1OCEA 3CO5A 3M49A 1A8PA 1PGOA 4PAMA 3U16A 1EUQA 2JA1A 3KYBA 3TS1A 5AI6A 2HPZA 1R0KA 4NU0A 1HYEA 4K9KA 5CLQA 1A7KA 4J0DA 2N42A 3OT5A 4ESEA 4XUDA 5H8WA 4H77A 2JGRA 3RU2A 2HQOA 2O2DA 3MCVA 1GGVA 4MQ6A 3VGPA 3WTCA 3ZPXA 3OEHA 2WWXA 4XGQA 5CVJA 3G85A 1NVWQ 2JANA 1CQWA 1F14A 1MJ5A 1V37A 2DCUA 3CUVA 2BFEA 3F97A 3HPQA 5DYNA 5TGDA 1XZAA 3IEPA 3WP0A 1P9RA 2JFGA 4H0NA 4UTVA 5DNEA 4MA5A 4NBTA 2JIPA 2EIHA 4R83A 3AUAA 1EE9A 1W8IA 3O1HB 4J6FA 4U7WA 3U3OA 2JGDB 4MH0R 1X19A 1XXHB 3EG9B 4UU7A 5FBLB 5FIUA 2R6CA 3ITDA 2FSHA 3TD6A 5K0ZA 4KNYA 1KJQA 2VYNA 4NBKA 3R3SA 4ZOEA 5ESXA 2NU9B 4KIUA 2R7LA 2ZIFA 4DXDA 2X3FA 5CNMA 1I10A 4OXXA 3P9NA 4H7KA 3LLSA 2YJZA 4K28A 4RF4A 4JI4B 1RBZA 1V41E 3H99A 2AOUB 3LKVA 1OFIA 3F98A 2X7XA 1ZH0A 3STXA 1GUFA 4EIWA 1E1RD 3QY0A 2L2QA 2NTVA 4BMNA 1L5QA 4F12A 1HRKA 1KI6B 4GDFA 1DKRA 3DL4A 1V16A 3W5UA 3BFPA 2NPIA 1RAFA 4D98A 3LUFA 3IO5A 3OQIB 2XWQA 4L5CA 3RREA 1ZH8A 2KMLA 1IOVA 2O20A 2WKPA 4QYIA 4XQ0A 5A03A 4CQNA 3THYA 3R1IA 2BKEA 1G17A 2WYVA 1ODCA 1E0JA 3SBXA 3EBOA 3W5HA 1TKAA 5F9FA 1GARA 3U1TA 2R11A 3TQCA 4LN1A 2LKCA 1GZHB 3FSGA 4GEGA 2OUIA 4LCJA 1DLJA 3DFFA 5E7MA 4AO6A 1NP6A 2O23A 1QYXA 4DABA 2FDCA 2E2WA 1PFUA 3GUHA 1EQAA 2D59A 4IS3A 1KYXA 1M0TA 1OUMA 1HI9A 2GFHA 1V8ZA 5BN1A 1M7BA 4HTAA 1V8DA 1Q1NA 3O74A 1IL0A 2FR0A 3KUKA 1JTEA 4GSKA 4WGGA 4YMGA 3D9QX 3LMKA 4F91B 4NMLA 3NRJA 4AULA 1ZBDA 1W0JD 2QSUA 3GJRA 4M7PA 4MV3A 3RIHA 3HKDA 3COSA 4FFPA 5TS2A 1GOTA 2DG2A 1YD7A 4JYAB 2EF0A 1WY7A 2J67A 2QAGA 5KYWA 3P0HA 1OWMA 5ITSA 2B69A 4AJIA 2QQ5A 1K7EB 1QHSA 1DO8A 3KQQA 1ORTA 4FYVA 5DLYA 4ZCLA 1AQUA 1NSYA 4MLDA 5I4IA 1XEXB 1GPKA 3U7IA 3JZFA 3H5RA 3ZN2A 5EIXA 1WVMA 2HZBA 3KJNA 1G3RA 5HKKD 1XQ6A 1F2TA 3BE5A 4IJQA 4JJ6A 4GX0A 2PT5A 1YOVA 3VISA 4TL6A 5GWXA 2ECOA 1SVUA 4G2TA 2IHKA 1M5UA 4K81B 3A31A 4AYWA 4D9FA 5CAEA 2DBRA 2QR2A 1XMXA 4CIXA 4TWZA 1JW9B 4IM7A 4BY9E 3U49A 4CUZA 2XA2A 2VUIB 1GR1A 3DMTA 1H6BA 1R00A 1UANA 2J0UB 4P33A 4R51A 3T61A 5BY2A 2J0SA 2UXCB 1V4BA 4TMYA 4DFDA 5F21A 1AS3A 4JJKA 4QU0A 3KHTA 1D09A 4H2DA 3WLAA 5BVHA 4OXQA 5I9LA 1QIDA 5I7UA 1W1WA 1X7XA 3JTEA 5MN6A 3GZJA 3CH6A 2XMGA 3CGGA 3JQAD 3JWHA 1J8YF 4HB0A 3RUFA 4Z4CA 2NZXA 5JJBA 2IBSA 4LTDA 2J59A 4JYPA 1MQAA 1OAKA 3BXZA 2ZAYA 4BEBA 1V7ZA 2HLNA 1PJ3A 2E4WA 5DGHA 4ETNA 1PLLA 5JFGA 1IZ8A 1H93A 4BEVA 3ZVMA 4CM5A 1AMUA 1OMOA 4JUFA 4NATA 4NJEA 4TS4A 2ZVJA 3WO1A 3ONVA 2Y0CA 1CNFA 2J5QA 2WU0A 3KL4A 2YW9A 1V5GA 1W4LA 2DU8A 5HKLA 5HIKA 5IAAA 3D6AA 3FOZA 4DR7B 1O08A 1GGKA 2VFAA 1PT8A 4ZAXA 5BWCA 2E5LB 4R1PA 5K1ZA 2X0JA 1LCIA 3JQ7A 2FLKA 4D3FA 1FXSA 2PGIA 2GCPA 1T1GA 5G1PA 3UFXB 2HWWA 3KSMA 1AKQA 4FHDA 3SJCA 3IUQA 4F4DA 3SJ7A 3ZDCA 5KSWB 1EEHA 1POXA 4HMOA 2GESA 1W9MA 3WLLA 3LA6A 1T9DA 4EI9A 3PQDA 4PFQA 4Z6KA 4IIYA 5K99A 3NBZC 5J1SB 3CS3A 3D3KA 1P0IA 3OCWA 3OHSX 1I3MA 2ODAA 4TV8F 1MABA 4G9EA 5IJAA 4CL3A 2A35A 2OR3A 3OTOB 1RE1A 1N7GA 4EPVA 1E61A 1T1EA 4ABTA 2IP2A 4ZD6A 3AYZB 4P7JA 2GD6A 4YH1A 3SHWA 3B89A 4S2EA 4CUKA 1Y0BA 3C1UA 3HYLA 1G8JA 1U4SA 4HAVA 4N6OA 4N8EA 3GJQA 3UJNA 3RK0A 3WQBA 2HFJA 3VKVA 2HUNA 1LSSA 3F7OA 2H85A 1U0HC 3BKXA 3RVJA 1TL7C 5B1YA 2C4MA 1K8RA 3JYPA 2WWYA 2O8DB 3T3GA 2R86A 1ZH4A 4C22A 4J0GA 4TSRA 2HMWA 3UJ8A 5BW6B 1XXHA 3T3NA 1PK7A 3B85A 1ZMTA 3GJ7A 1CZUA 2G0TA 3V32A 1PEKE 5HGXA 3G59A 3JWPA 1J20A 5THKA 1ZXXA 3W2IA 5A3RA 1SHUX 1WS6A 1DAFA 2Q0HA 2Q1TA 3F2VA 3Q7TA 4GRIA 1GYQA 2O50A 4DV6B 3ZY4A 4IXNA 1GCGA 3AF2A 3H9EO 3IAS1 5I9MA 1BXZA 1KBZA 3NWJA 4TTRA 1O0CA 1TAUA 3JQGA 4ZQHA 4F92B 2EF1A 3NAZA 3AEZA 3O7WA 4I4NA 1WDLA 1JWBB 3NWPA 3C3MA 3W2EA 1GZ5A 2PGAA 3WYCA 5CLGA 3C7AA 1J0CA 3C0KA 3HDYA 3PT5A 3WLIA 4BAGA 4D9EA 1ZJZA 1G19A 2Q3MA 3IVXA 4M1OA 3T95A 5K0JA 5H81A 3LUAA 1IN4A 4ZU6X 1NATA 3OIVA 3PYMA 3R0XA 1T5HX 3TLCA 3C6XA 3EGEA 4HX2A 2HF8A 1KI4A 2RJOA 1UFRA 3M1AA 3IXLA 2Q62A 3OUTA 1XLUA 4KU4A 3SX4A 1K4YA 1JWLA 4LF8B 3KZ1E 2JHAA 3G1TA 2XMZA 2XNHA 2Z5LA 3R9XA 1TW3A 1XV5A 5EAIA 1BCSB 4KK3A 3OO1A 4IDCA 3Q6NA 4PPFA 2Z30A 1GNRA 1EFPA 1WAMA 4HQNA 3H1EA 3IAAA 1KFJB 4O1MA 3LL7A 1YZQA 3A9RA 4A0QA 1DADA 1NQUA 3GLGE 2X8LA 1QYDA 3HR4A 4GI5A 5HCNA 4BWFB 4EGSA 2JAPA 4UPEA 4YT2A 3O8RA 3CUKA 1KK0A 1O8CA 3QOXA 3H9CA 1EHCA 4BNLA 1CG6A 4J4TA 1K7XB 4EUEA 4EJMA 1NZFA 3VTFA 4EYEA 4B4WA 3TX2A 2CJXA 2G17A 3L4KA 1W85A 2O4UX 1PW7A 1ZUHA 1N6HA 3D4IA 4KLCA 4WECA 5JQGF 1ZVVA 3KDSE 1F20A 4TV9B 1BE6A 3PYLA 2X7JA 1WETA 2IS4A 3A70A 4L76A 2CNLA 5KSZA 1KR2A 1I4DD 2CBGA 2OTCA 4LKRA 4RJKA 4YMHA 2ATXA 3LDGA 4HQLA 2BMVA 3T4PA 1XLVA 3CH5A 1GA1A 1YFLA 1Y63A 2EKLA 2GSDA 2DR0A 5B1HA 5D7BA 1FLDA 2J6CA 1BN7A 3B12A 2HHCA 3IB6A 2H2HA 4DLXA 3I9JA 3LOUA 1G6Q1 2C4UA 3OQ6A 1VB5A 3VDXA 4FGKA 4DIKA 4WZAA 3V5NA 3UENA 2INGX 2CNOA 4HFJA 2VC2B 2XZPA 4RVHA 2Q0SA 1G60A 4PLGA 3L0SA 5DNVA 1KMIY 2AQHA 1NBMA 2Z2ZA 3UMBA 4UOEA 4GPBA 4DPMA 5A9SA 4BWGA 4DLSA 1GNVA 4ZCRA 3DTVB 1G59A 4ZOLB 2H18A 3FH0A 1CE8A 1T26A 4RKQA 1FOEB 4Y1GA 5EJAA 2WM8A 3OOEA 4CL8A 5DJ5A 3C3PA 1W5FA 4ZV9A 3HU2A 2CFOA 3W4JA 2QJFA<