4BWYA

P4 protein from bacteriophage phi8 (r32)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
288
Chain Sequence
b'NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSRGAVFNQFLLSGQSAFLGPNIPESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P4
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
molecule tags Hydrolase
total genus 88
structure length 288
sequence length 303
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bwyA00
2BVNA 3BFXA 4MRPA 5TB5A 4B76A 4O0MA 1ZNWA 3A58B 4W5HA 1DAFA 2X8AA 4D4LA 4X8HA 4E5UA 5DYGA 1H8HA 1HYQA 1M6NA 1XZQA 2ZRKA 2P67A 3ND8A 3TR5A 4HDCA 4EJSC 2QTFA 4DIEA 2L0XA 3PJRA 3FMPB 3AVYA 2O8EB 4CEJA 2HUPA 2FEMA 5H70A 3W90A 3BH7A 1Z6AA 4MGKR 2WWYA 4F4JA 2DR3A 1E2NA 1F3OA 3AM1A 1HE1C 2EFHB 5M04A 1JAHA 1ZNXA 1QVAA 4OHWA 1E9CA 4A2QA 4CT5A 2WSSA 4AG6A 3AP3A 4AC9A 4M9ZA 3RS4A 2OFXA 1JECA 1IOZA 4U00A 1NF3A 2IS2A 3GJ0A 3DMNA 2X2EA 3H0KA 4M21A 4JT4A 4RD6A 4QHYA 5C18A 1OHHA 2CE7A 4MQBA 2RGXA 2UZIR 1M34E 3OEHA 2W6JD 2C99A 1E9EA 2DFKB 3NKVA 1F2UA 4PPQA 4TMXA 1YR6A 4C0JA 2Z83A 4YC7A 2W0MA 3A4LA 4ERNA 2B6HA 1TX4B 5TV2A 3HYTA 2ZYTX 4MYCA 4A0HA 1AIPA 2QUZA 1NIJA 4LC1A 1S4QA 3W5JA 2BKEA 4OK5A 1YZQA 4TYNA 1TF2A 4W5JA 3RS7A 4PSAA 4DCTA 2CJWA 3KUDA 2O8FB 4PHTA 1QDEA 5JSZB 5DLQC 1XD9A 1J90A 1SKYB 1YU9A 4YMTA 4IOMA 2PEZA 4TQ9A 1P2SA 4YMWA 1X8LA 1E69A 4JLMA 2TMKA 2OCAA 5KNDA 2OESA 4FMDB 3L0SA 1G19A 4ASUA 3EIHA 2XGJA 5B2ZA 2HF9A 3PR1A 3HPQA 3EPJA 2VHQA 1ZCAA 2CDNA 1TUEA 4GPTA 3THXB 1MH1A 1U81A 1JR3D 3LDAA 1N6IA 1ZMXA 4G5OA 1E1RA 1KJYA 2VSOA 4O25A 1G18A 4PAMA 4F4IA 4B3XA 1KI2A 2BBWA 3KB1A 1VCNA 3B1YA 2IS1A 4PC3A 5CDFA 2DCUA 1KYIA 2HLDD 1CR2A 4KSBA 4RCZA 2Z0MA 3ZD7A 2HXSA 4JKIA 1SVLA 2GCOA 4DCSA 1CULC 3QEJA 4M1OA 3VU9A 5FPSA 4BLPA 1G6OA 2FV8A 4B2PA 1N6LA 2WTUA 2ODEA 4AG5A 3TGPA 1IN7A 2G0TA 1N6RA 2R65A 3Q9LA 1TNDA 1M8PA 5FL7A 1FQKA 3E70C 2CHVA 1A2BA 4HAWA 3UATA 2ZI4A 4IDQA 4MGZR 4ZO4A 2VSXA 2JDIA 1U0JA 4XTCS 2RGCA 2VQSA 3GLIB 2AFHE 4ZKDA 4BFSA 2F43A 4BRWA 4Q4LA 3WNDA 4LJ7A 3ZZ0A 1LF0A 4TSFD 1H8HD 2DFTA 4XIGS 1WBDA 1TQ2A 1J8YF 1D8TA 1KTVA 2WZQA 1OFIA 4MUAA 1FMJA 1TAGA 2GVDC 3NBXX 4Q7JB 1N5IA 4NONA 4CEHA 2FSFA 1W2GA 1OF1A 4JVNA 2OFWA 1O87A 1RRGA 3ONWA 1HTWA 4ACAA 2ZM5A 3QPUA 5JHGB 3EASA 3SBEA 1NN3A 3GLHA 4PFSA 3B9QA 2BWJA 5BXQC 1ZW6A 1P9RA 2C5LA 3LAWA 3SJCA 1LF5A 1UDWA 1UBEA 2IYYA 1RVDA 4UXIA 4G0NA 2O8CA 3RNLA 2MMCA 1HA3A 1T3HA 1YKSA 1OHHD 4CYMA 4OHYA 3QSYA 4PSVA 4RD3A 3I8XA 5G53C 3OEHD 1FZQA 2CMKA 3R8FA 2VIIA 1WDTA 4HLQB 3L2OB 5BYKA 1XD8A 1S1CA 1U99A 1RIFA 4JVSB 1ZUNB 1TQ6A 4HLUA 1LW7A 3VFDA 4CW7A 3C14C 3RHFA 3GLFE 1PV4A 3ZD6A 1UBFA 4HDQB 4LV8B 3A6PC 5AWFC 2ATVA 2ZRAA 5AJWA 1KY2A 3FDIA 4HEJA 2HT1A 2N46A 4UKDA 5DYIA 2JJ2A 2RAPA 3W3AA 2VHJA 3B78A 3KDSE 1NLFA 4XH9B 3U61B 2QMUA 1OIVA 3E1SA 1IONA 2WJGA 4B44A 1P2VA 4EFNA 1G3UA 1E2JA 1W46A 1GL9B 3GEEA 1GNQA 3ZIAA 221PA 1ANKA 1VCIA 2AN9A 3OHMA 4P33A 4TTRA 2FZLA 4YONB 3W5IA 4LRWA 1CF4A 4ASUD 1C4OA 1ZM2A 5D3QA 3BH6A 4GP6A 4BUJA 1NG1A 3GFPA 1IY2A 4B74A 1KJWA 2FF7A 2R9VA 3SBDA 4NP6A 1T3LA 3I3SR 4GSYA 3TUIC 5BN3A 4BLOA 1HV8A 3TR0A 2ONJA 4LZZA 1GIAA 4D81A 3QXHA 1E1RD 1Z47A 2J0VA 1CIPA 5D3MB 1II8B 2C9OA 4CDGA 1E2HA 3ZVMA 4EPXA 1QRAA 5UKDA 3SYKA 2B8TA 1CRPA 2QM8A 1ZIOA 4DLRA 1UM8A 5FOTA 3BERA 4Z51A 2NZ8A 2R6GA 2C77A 3KQUA 3LV8A 4V0LA 4LJAA 4HUTA 3QXJA 1MABA 4TTQA 3DO6A 4QGFA 1NJGA 4MGIR 3WNCA 4PZYA 5FL7D 5DHFA 4II7A 2QT1A 1R0XA 1YZUA 5ELXA 5FTKA 4BFYA 1P4SA 3KZ1E 4KBFA 1TTTA 1Q1BA 4Q21A 4D26A 1E2IA 3AEZA 1NVUQ 5CIQA 4A6PA 1SXJA 1E9RA 1GAJA 2OBLA 4HYYA 2MSCB 4UXJA 1LS1A 4TMVA 1WP9A 3SDZA 1ZC4A 3SC3A 3BFVA 1E1QD 1Z6TA 1U94A 5SZIA 3B13B 1SZPA 2JLYA 4I4LA 1T91A 4IXNA 4Q1AA 1G8GA 4CEIB 4URUR 5DHAA 2JLVA 1WF3A 4Q03A 3EW9A 2Z6VA 2ZI7A 3KB2A 3BC1A 4MKFA 4A15A 3QUSA 3RLFA 2QQ0A 5HKKA 2J87A 1FNNA 3HU3A 2Y8EA 1KZ7B 4JYCA 4Q9LA 3WYAA 4QBHA 1W1WA 4JLDA 1A1VA 5L3QB 2Q9AA 2ANBA 2BMDA 4PO8A 421PA 1HURA 3WYFA 3CPHA 4XVRA 3BB1A 2FGJA 1GOTA 4HUQA 1G3MA 1HQCA 4BRUA 3KTAA 4WZAE 4B3CA 1QHYA 4OQMA 1LB1B 3AKCA 4PPGA 1GKIA 1KSGA 4HAZA 3CNLA 3KL4A 3NHBA 3VQTA 1VKJA 2O0KA 4GP7A 5B30A 1VECA 1SHZA 3CF0A 5DISB 4GOKA 4Q9IA 2Q6TA 4ESHA 1LV7A 1FFHA 2AL7A 1ZC3A 2V4ZA 4WAUA 2QGZA 2JJ2D 3U5ZB 1W5SA 2QP9X 2W0SA 2UVQA 1LVGA 1N0VC 2ZUDA 4QHTA 1VG0B 1Q3HA 1T6NA 2D7CA 2QMEA 4G5GA 3QG1A 4TZ6A 4DLUA 1F2TA 3ZIAD 2CL7X 4RD1A 3EPHA 5A0FA 3VX4A 5KSOA 1E96A 3QE0A 3S1AA 1VHLA 5C4GB 1Q1ZA 1E2QA 2DPXA 2XNDA 4M1YA 2ZAOA 3U60B 1MRNA 5DE3A 2RCNA 3U3OA 3CZPA 1GKYA 2C96A 3B1ZA 1ZIPA 3VKWA 2GXUA 2SHKA 3QKSA 3VNVA 3CRMA 2ZRMA 2KBFA 4FWIB 4LYFA 4BLTA 1G16A 4X8OA 4Q4HA 4FI3C 1VYTA 1G1MA 4UNPA 4D80A 3F0TA 4DRZA 2FSIA 4G5SA 1SQ5A 2XAUA 1W5TA 4YDHB 2YWHA 3LQRA 4OQXA 2XOKA 4AKIA 1IN5A 3EIQA 2ZITA 1KI1A 1W0JA 3CNOA 4QJ3A 1Z07A 4JLNA 1K5GA 4YXWA 4XD7A 3UIEA 4Q19A 3QPVA 3BWDD 4QRHA 3EZ6A 1DO2A 4GNKA 5JCZA 1VPLA 2BM0A 4PR0A 4DCUA 4F92B 1RJ9A 2QNRA 1ETUA 5KDLA 1FX0A 3PENA 3H1TA 3O8RA 5K8IA 2J0UA 2BHRA 2BIFA 2FG5A 2W83A 3EC2A 1KMHB 4GDFA 2QSYA 2OCBA 4C2UA 1R8QA 2BMJA 2JLZA 1GITA 4P4SB 1Z0DA 1US8A 3B2EA 4GFDA 3A1SA 4TMZA 5H1YA 2QG6A 4P4TA 3P26A 2GILA 4IVRA 2QSZA 5DSZA 1KO8A 4KYIB 4PAOA 2V1XA 5GJVC 1OJLA 2BCJQ 4OHXA 1KSJA 2OXCA 3C8UA 2QBYB 5DO9A 4NYMQ 1R0WA 4C30A 2A30A 3KQNA 2F9MA 2ZRGA 3QF4B 1G8YA 1XU4A 2GNOA 3AF1A 2CEAA 4LBYA 4WZ6A 2V8OA 4D4JA 1XTQA 1S96A 2V7QA 4H1VA 3SQXA 2YNMA 1G6HA 1P7CA 1P9NA 4QM7A 1L2TA 2WWHA 2BDTA 3KJIA 2WKRA 4IDHA 3W9YA 2QMHA 3VHXA 5C1BA 4X8MA 1VYUA 1QG2A 1VCMA 1ZUIA 4OKSA 4EFMA 1GM5A 2ZREA 3CB4A 2P65A 1GRQA 1IN6A 3U7HB 3QXSA 1DAKA 2ZRLA 1XEFA 4IW3B 3QQ5A 4NCJA 4KSCA 4P4UA 4BWYA 3U44A 4TN1A 5CYPA 2IHBA 2IYVA 3TAHA 1WE2A 3IBGA 4NYIQ 1W2HA 1XEWY 4LBWA 4AYTA 2JLQA 1D6JA 2LKCA 5JS7A 2G1KA 4TYWA 1RZ3A 1VMAA 2FDCA 3ADCA 2XX3A 4N0EA 4LHYA 1XTRA 1WCV1 3EA0A 3NVAA 3CX6A 1HQYE 2OM2A 1P5ZB 3UANA 2JLRA 2HYDA 5JHHB 2WWXA 4JS0A 4HZIA 1FQJA 3SYLA 4DEXA 4ON9A 2OCPA 4IRUB 1P75A 1RE0A 3T06B 2V3CC 4OHVA 2P5SA 2FX3A 2R6AA 2KSQA 3L0PA 4HLCA 1C9KA 4UJ3A 1ZU4A 1ESMA 4FXPA 3ETLA 4XSHA 1COWD 2QU8A 1NVWQ 1Z63A 1OXXK 2AXNA 2QPTA 3CF2A 5SZKB 1MOZA 4DDUA 4DVGA 5JRZA 1RYFA 2BCGY 1UFQA 3AB3A 3PEUA 3FMIA 2YVUA 4FD2A 4JLKA 1T9HA 4HATA 4MKHA 2F3TA 3M4YA 4PZLA 1DAHA 1YZKA 3R9XA 3LLUA 1TF7A 2YINC 1KK1A 3PEVA 5E3HA 5HPYB 4M9XA 4QG7A 2XOKD 2WMOB 4Z8YA 1ODFA 2PEYA 2OBMA 3RRZA 5KSYA 1W0JD 3THWA 3BB4A 4DLWA 3BD9A 2C8VA 4XD7D 4E03A 5TXGA 1ZD9A 3CZQA 2MSDB 4WXRA 1H65A 4Q1BA 2DHRA 2YYZA 4MUBA 5JZVA 2EFDB 5BYJA 1QVRA 3JVUA 2FMXA 1Z0JA 2REXB 4XWAA 3WMEA 3N5CA 1KI6A 4Q00A 1OXUA 1S9HA 1VG1A 4DIDA 3PUYA 2BJVA 1SKYE 2OBNA 1IBRA 3ADKA 4LHZA 1XD2A 3GEHA 4JBYA 1BS1A 3EPKA 4NMMA 3TK1A 1YR8A 2AKAB 3MJHA 1VYVA 2KI5A 1Q1EA 2ZRFA 1XXHB 3I32A 1AQUA 1KDRA 2JJ1D 4RVCA 4ABYA 2FFHA 3B9PA 5FOUA 5JI2E 3F3YA 5L3SA 2HXYA 1W47A 3GLGA 4ZCLA 1G5PA 4NDZA 3K0CA 3NG1A 4RFSA 1KGDA 5IK2D 2HF8A 5FBQB 4TLEA 3GMTA 2BBOA 1XX6A 3AP1A 1W49A 3M0EA 2V7QD 1SHKA 4K81B 3KKMA 3ICQB 2CLSA 1FTNA 4LWZA 3RABA 1G20E 2PT5A 2ZJYA 4BFZA 1E9SA 3DL0A 2BBSA 1Q0UA 5EE3A 1KI4A 1SKQA 2CLCX 3K53A 3WYGA 1RKBA 3NWJA 4B6FA 4MRNA 3ZVNA 2W6JA 2FE4A 2QRZA 4M1SA 2FPKA 3U3JA 4Q48A 2VPPA 4KU4A 3B60A 4US1R 621PA 2PL3A 2ZR7A 2ONKA 1N5JA 3NIBA 3KFXA 5DI3A 1BH2A 3REFA 3KXLA 4GT1A 3KX2A 3VR2A 4JJZA 3SEAA 5B58C 3GLFA 1QBKC 1ZM3A 2GJKA 1LTQA 2JLXA 4L4UA 3GJ6A 3H84A 3T1OA 4M1MA 2B7CA 1RFLA 2ZRDA 5FUXA 1UBCA 5JS8A 4POAA 4NCNA 5FUWA 3Q8XB 1FTSA 2IYWA 4BZPA 1DELA 2RGNC 4JIMA 3SZRA 2F43B 1P62B 3LX8A 3RYTC 4M4SA 2AR7A 4A82A 4TL7A 1BYIA 1PUJA 2GXQA 4AKGA 3LW8A 3KJEA 3EZ2A 4M8NE 5SZHB 4IDPA 4B32A 5C2JB 2XTNA 5EP2A 2FZ4A 3DEFA 5GJBA 1IJFA 1A7JA 5KSPA 1CS4C 1J8MF 1Z22A 3HDTA 2H57A 1OT3A 4QXAA 4FMBB 3ADBA 4KCGA 3TSWA 4DT1A 3ZQ6A 3FHOA 1X8JA 3MWLA 2OV2A 3GLHB 1XPRA 2FEOA 2O8DA 3P4YA 2F3RA 3BGWA 1E94E 1Q3TA 4LI0A 2JLUA 1P60A 2GBLC 3I5YA 1ZM9A 1KO4A 1DPFA 2JLWA 2GK6A 1I4DD 1L8QA 1SVIA 4D25A 2DFLA 2Q9BA 3QBTA 2IUUA 2ZE6A 2GF9A 5GADl 3U4QB 2OCYC 4C2TA 3K0AB 3KKNA 5L3VA 4Q7LA 2ZETA 2H18A 1XF9A 2ODBA 3RC3A 3T34A 4QKQA 3BJIC 3CF6R 3EWSA 1E2PA 2A5GA 1G64A 2ATXA 4IOLA 4LHVA 1CR1A 4JYBA 2E87A 5BN4A 1R10A 5A4JA 2A5YB 1SVMA 3GJ5A 2CHGA 2VL7A 4AD8A 4I1UA 1CRQA 4C0SA 2ZI3A 3AKDA 2OHFA 2ZRHA 4TSFA 3TNFA 4BLQA 2QN6A 1J7KA 1OKKD 2VP2A 3EXAA 4PQYA 1ZBDA 4LHXA 4ZDIA 1ZM7A 1JAIA 2OG2A 2RB4A 3IKJA 4IJMA 5FBWB 1CJVC 2VTKA 3HJNA 4Y0AA 1O3YA 3Q72A 1IQPA 4NYMR 1W44A 2OUKA 1CEEA 1VCOA 4A0FA 4DSOA 4RKEA 3CR7A 4ESVA 3R20A 2GDJA 2JIZA 1KIMA 1U2RA 4AKHA 3ZQJA 2IF2A 2JA1A 4M9SA 3THOA 4B3BA 1DAIA 3X1ZA 3BE4A 2MSEB 4DSNA 2HJVA 1T3SA 5EXTA 3TW4A 3WNBA 4AKEA 1OB2A 4GBMA 5A5GA 4DDTA 1D2EA 3M1IA 1M7BA 1GZSA 1IHUA 1R4AA 1Z29A 3CM0A 3AKYA 2QAGB 3CX7A 3OF5A 2NIPA 1TQ4A 1MABB 2R62A 3MLEA 1NI3A 4Q1EA 3CKLA 4PC1A 1Y63A 1M74A 4C3ZA 3OESA 2EYUA 4RFVA 4LJYA 1DAMA 3GJXC 3CIOA 2OFOA 4GOXA 5FR2A 1G21E 3SHWA 2XB2A 4A6XA 2QMOA 1UEJA 2IEZA 4JL5A 1XCGB 4KAXA 2EYQA 3SN6A 4AIIA 3F5FA 1SXJB 4DBLC 5DNYB 2VP6A 3N2EA 1XMJA 5FPYA 1VIAA 5EE9A 5J5CA 5J4YA 1KY3A 1DO0A 5AUQA 2CL0X 4QM6A 1CBUA 1AKEA 2KWIA 5KU1A 3K8YA 2J0SA 2ZJZA 5KYKA 4C0HA 2F1IA 1QG4A 3CPJB 3K0FA 4K46A 2ZU0C 4E09A 3LBHA 1KO1A 5FL3A 2G1JA 1WB9A 1EWQA 4EPWA 5F98A 1TEVA 3AVQA 3P1JA 1AS2A 3GCGA 4LBVA 1G3QA 2R6CA 2R44A 3DMDA 1QHHB 4HZUB 1MO3A 2GXAA 2HV8A 2VYFA 1GP2A 2BM1A 3DDCA 2HEIA 4IVPA 2QAGC 4M53A 2RHDA 2RMKA 2UKDA 3CNNA 4BFUA 2CBZA 1G4AE 2ZJ5A 2WOJA 3ZLJA 3K0EA 5CK4A 4NKRA 4FIDA 4GMXA 2BOVA 4CVNA 1NNEA 5FOWA 4CT4B 2VHCA 4B35A 4LY6A 4C7OA 4ZKEA 3A1TA 1T5IA 8OHMA 3GLGE 2Z5FA 3CR8A 3V9PA 5LD2B 1E1QA 1N6HA 2IK8A 1Q44A 5JECA 1IN4A 2EWWA 3WRYC 1Z6GA 4WBSA 1KI3A 2I1QA 1UPTA 4O3MA 1Z0IA 4Q4AA 1NN1A 3Q85A 1UEIA 2KE5A 1GRNA 3FKSA 4URVR 2VP5A 1W36B 5JJLA 1R5NA 4YMSA 1XEWX 3EX7C 4Q4JB 2GEVA 3C5HA 3SFZA 2QGNA 3TVDA 1E2DA 4EJSA 3OIUA 2JIZD 2OO7A 4R71A 5JCPA 3U3RA 2ZROA 1NVXQ 1Q1QA 5HE9A 3X1XA 3ZZTA 2AD1A 4LSGA 3V4RA 3PUZA 1NRJB 1S9DA 4PX9A 1DS6A 1V43A 1RRFA 3FVQA 3OFNA 4O2LA 1OXVA 3W8NA 4Z8XA 4EPVA 3T1VA 1NSTA 4A8JB 4B2IA 4MYTA 1XDBA 3UKDA 3QKRA 5F9HA 4LJ4A 3U2QA 3WP1B 4ZIRA 2J41A 3AKEA 1Z6XA 5L3RA 1ONBA 5JWRA 3HU1A 4QJ4A 2V6IA 1YZLA 1GWNA 1W4AA 5TARA 1M7GA 2VHUA 3RAPR 3VKHA 2WWWA 2P6NA 3EG5A 4BFWA 3KKPA 2PCJA 5JLJA 2BMFA 2JAQA 4R98A 1G291 2O8BB 2X2FA 1N5LA 2G88A 3W6NA 1HY3A 1FX0B 5LD2C 1E2FA 2GZDA 1GKUB 3AUYA 3CONA 3C5CA 5EE5B 3FMOB 3LW7A 2IX3A 1NN5A 1QHXA 1E4YA 5KPJA 1I4TD 1HEIA 3A4NA 2KJQA 4L8GA 1YZNA 1EESA 2ASEA 1ZINA 2V55B 2IT1A 2J45A 4NBSA 1K6MA 2QT0A 3IHWA 2W2TA 4EUNA 1W36C 3I8SA 1EX6A 1E0AA 2J0QA 1TMKA 2A7QA 2QPOA 3B82A 3UXMA 2FFBA 3UG6A 4RJLA 2GVZC 3ZYCA 2OAQ1 1KI7A 3K0SA 1OH5A 2O8EA 5E7MA 5LB2A 2GJAA 4D6PA 2RGEA 2NGRA 2GZHA 1ZD8A 5J4LA 5AUOB 3PV0A 1XMVA 2CCKA 4JLVA 3N2IA 4Q1CA 3ZS9A 2GJ9A 4MKIA 2WSMA 2HCBA 4A8JC 5EUQB 1OB5A 1E3MA 1PLJA 2IEYA 3EA5A 2QQEA 1IAQA 4Q18A 1J99A 1PVOA 4RSGA 5EP1A 4L5BA 4AYWA 1UBGA 3CO5A 3MMPA 1Z3IX 4N1AA 2XSZD 1E2MA 2AWNA 1DAEA 4KFUA 4TMKA 2LKDA 2ORWA 1T8TA 1KNXA 2ZI6A 2ZRNA 3GFOA 3D3QA 3KKOA 2ERYA 521PA 3B5JA 3VKGA 5ANRB 3RRMA 4DEYA 2QA5A 3BB3A 1S3GA 3SS8A 1H8EA 1GDDA 2CVHA 4TTPA 2HT6A 2FJUA 3FFBA 5EZ5A 2PX3A 1XCMA 3RS0A 3GJ3A 1NBMD 1U8ZA 4Q7MB 3FKSD 3PG5A 4IKEA 2LWIA 2WM9B 3QIAA 4Q02A 1DTSA 2ZVQX 4LJ8A 1GL7A 3KUCA 5KTYA 1S1MA 1WXQA 4MRVA 1HH4A 4MITA 3L0IB 2PLFA 3THXA 4H9GA 4DLXA 1AGPA 2F6RA 3OFND 2R2AA 4NYJQ 1KK0A 3IO3A 4GZMA 2O0JA 4G1UC 1E2LA 1DE0A 2PCLA 2XTMA 4EFLA 1OXTA 1KI9A 2ZE7A 4JSTA 4LPKA 1RC8A 2PJRA 4DSUA 1KKLA 3UMFA 1QHIA 2AKYA 3NH9A 4IDOA 3THWB 2JCSA 2VHTA 4XWKA 4QBFA 1UKEA 4FN5A 4R7ZA 4U02A 1JB1A 3OAAA 2AK3A 3EPLA 2QTVB 2VBCA 1AKYA 1JNYA 3AVTA 4I1VA 4QBIA 3R7WB 1MO4A 5FUYA 1OIWA 5HCNA 4G01B 1GG2A 1DBSA 3WBJA 4AY2A 1ZRHA 4JZKA 1XXHE 5KDOA 2FPMA 2X77A 5LPNA 4OI0A 1DAGA 1IXZA 4JVLA 4L9WA 4LJ9A 3PXGA 1K5DA 2WJVA 3KFVA 3K70B 2C9CA 2ZIAA 5F2EA 4WZBE 2QE7D 1COWA 4R2HA 4QNRA 4URXR 5FTLA 4BFXA 2VLIA 3BAFA 2IYQA 2J7PA 2AX4A 2PMDA 4QNMA 2EWVA 5HTKA 4JLPA 1G9XA 2HCJB 3PITA 2O5VA 4MYHA 1ZAKA 2PZFA 4RFSB 4UQOA 4W9MC 2RH5A 1XTKA 3SJBA 3AVVA 1EFHA 2FSGA 4G5QA 3VR3A 3SI7A 3WHLA 2ANCA 2XXAB 1D9ZA 1XJQA 2ZXUA 3G0HA 2G83A 3I61A 1FP6A 3EWAA 3HWSA 3QVVA 3AGQA 1NY6A 3QI2A 1CJKC 1W7AA 4DLTA 4FWTA 1OIXA 5DGXA 1II9A 1XB2A 4EPRA 3K9NA 4OYHA 2IYRA 4RD2A 3QENA 1KK2A 1Q21A 5CJ2A 1ELOA 3KXKA 2NO7A 3FHTA 1XEXB 3LRPA 5AR1A 2J9RA 2JLSA 4V0ME 4PTLA 3O8DA 4RZUA 1ZP6A 4OI4A 2NO6A 1R0ZA 3NHAA 1NBME 1II0A 1GFIA 2VF8A 4KVGA 4XWOA 1KKMA 2ZI9A 1PUIA 4PHGA 1H8ED 1NVVQ 2J3EA 3ZGXA 3LXRA 4B3FX 1E99A 4PZZA 4AWXA 2JJ1A 1GVNB 4HAUA 1W48A 2X19A 2GZAA 5FBLB 1T4GA 4EKDA 2BC9A 1J70A 3K09C 3TLXA 5BW8A 3K1JA 3K70C 1U8YA 1KNQA 1EFCA 3TBKA 2WHXA 4B3DA 2QRNA 1IN8A 2ZSDA 3D8BA 6Q21A 3A8TA 4US2R 1R0YA 1D5CA 2KBEA 3AQ4A 3K9HA 1NJFA 2PBRA 5IK2A 3UMRA 5JEDA 4KO8A 2A5FA 5B57C 4R2IA 5FH9A 5JWOA 2R8RA 1U9IC 5G40A 1D9XA 3LWNA 4DUGA 3A1VA 3EC1A 4S2EA 3MFYA 1YRBA 2GXSA 2ZYWX 4OJQA 5FUVA 2N42A 4DDWA 4CIDA 4ARZB 3SFVA 4YMUA 2YOGA 5E7JA 5D3MA 2ZJAA 4M1WA 3GD7A 1G8HA 1II8A 4Q01A 3MRSA 3LXXA 4OQLA 5J4KA 1XFAA 5KNBA 4TT3A 3HPRA 1Q22A 3ASYA 4NPHA 4PO9A 1RYHA 2J59A 2Z4RA 1NP6A 5AK0A 1JXOA 4KHZA 2IS6A 3OAAD 1EFTA 4M2LA 3SU8A 4B34A 3NEJA 1M2OB 2PT7A 1JQLB 2XTZA 2D74A 4MGYR 2H8KA 4JLJA 4UNSA 3DPUA 1U98A 3H2YA 4HB3A 4PHFA 2ZSAA 4KYUA 3RVBA 1SVWA 4A2WA 3TMKA 4GL2A 2ZS9A 2H5EA 2PMKA 4F7WA 4CGZA 1JI0A 4NL4H 3IDQA 3BH0A 4LHWA 2C03A 5C46F 1U0LA 5FTNA 4OQNA 4I1SA 5KSZA 1B23P 2ORVA 2WPDA 2W6IA 2CCGA 2WMNB 3IILA 4LOAA 4UNNA 5CK5A 3W6PA 5EZ6B 1G8FA 2J7PD 4CEJB 3DM5A 2MMGA 4FMCF 4P31A 4TLCA 4DHEA 3KQKA 1W36D 3TJZA 3HU2A 1UDXA 3RWMB 4NTZA 1X1RA 2QP4A 2IYUA 4LYAA 1F5NA 3G82C 2D06A 4BE7B 3BOSA 1YQTA 2F1HA 4B33A 5L3QA 2XZLA 2DY1A 2ZUBA 1Y3AA 1JPNA 2RGAA 3RS2A 4IVQA 5EP3A 3EZ7A 2BV3A 3OIWA 3B7GA 2W00A 1F2UB 1TUIA 2V6JA 3NBYC 2PH1A 2ZAMA 2VP0A 1AN0A 2ZRBA 1Z6YA 4GZLA 1YHNA 1ZU5A 2ZSEA 4BQSA 3MJRA 1AS0A 3JZMA 1ZJ6A 4A0RA 3KJGA 4KITB 2GA8A 2CJWB 5FOSA 3WRXC 3PIRA 4TQUS 2VRWA 2IA5A 4QC2A 1F6BA 1CJTC 2IWHA 4TL6A 3SJAA 1OKKA 3A4MA 2ZR0A 2ECKA 2XITA 3TQFA 4CRWB 2WWFA 1FNMA 3OE7D 3T15A 2OXRA 4PO1A 1JJVA 2B92A 2FOLA 3QG5A 2YC4C 4EIWA 3WXMA 2BBTA 4LYJA 3O8BA 4MRSA 2ZEJA 4M1TA 3U3MA 1WBBA 3AVUA 3MAAC 4C0AC 1NIPA 3FYHA 2YJTD 1KHTA 3LNCA 5CM8B 1RW4A 4DUGD 1P2TA 3L8YA 3W34A 2HJGA 4NE2A 1KDTA 4NHOA 2WAYA 1KAGA 2CLDX 1E0SA 2O0HA 1R5BA 3ZDQA 3DZDA 4NYJR 4LX0A 1AQYA 2PZEA 4TT3D 3BXZA 3DKPA 1OYYA 3IEVA 3QJYA 2OAP1 3WMFA 2GCOB 5JJKA 2RKOA 1E9FA 5FR1A 1AZSC 5E95A 3AH8A 4JLOA 1E79D 3VU9B 3CX8A 5SZJA 1N5KA 4JKYA 4S35A 3VR5A 1EG7A 1CJMA 1Z0KA 5KNCA 2GK7A 4FMCB 1FPMA 2P6RA 4PC2A 4LV5B 4BASA 1ZM4A 3U6BA 3QNUA 5JBQA 3GLIE 3P4XA 5EXXA 4I1OA 4PANA 4RD4A 2D62A 5KUTA 2LCFA 1OYWA 1FL9A 4Q9HA 3GPLA 1UKZA 2FN4A 2J46A 4BZXA 1D2NA 4YMVA 1KMHA 4LGMA 1BO6A 1J2JA 2EQBA 2Q3FA 5KPDA 1DADA 2DFNA 2QZ4A 5GJCA 4M1KA 2WPDD 2W6ID 4P4SA 5CYOA 5E4FA 4BEJA 4C9BA 2J1LA 4CEHB 1JEEA 2WJYA 2ZE8A 2XJ9A 1T8UA 2GETA 3IPYA 4Q9KA 4TYPA 2ZJ8A 4Q4AB 5AJVB 2G3YA 1XRJA 2WVJA 4QL3A 1S0UA 2W2VA 5JI3E 4FW9A 4OK6A 3E2IA 2YC2C 2QBYA 2YKGA 4URWR 2R6FA 1EFRA 3QF4A 4RD0A 4M0LA 3QKUA 4P0TA 4A0GA 3I62A 2BKUA 4BFTA 1MR3F 3HR8A 2O8CB 2ZRPA 4E22A 4ITRC 1KZGB 1U90A 4NCHA 5P21A 4K8OA 3IQXA 2ZJOA 5EXSA 1X3SA 1FOEB 1ZUHA 4IDNA 1XCPA 3UG7A 1NY5A 3X1DA 4JLBA 1E2KA 2FNAA 2WIBA 1FUUA 3OIVA 3LA6A 4JJKA 2XZOA 2IYLD 1N3BA 2WJJA 3RSOA 4TLDA 2H92A 4AYXA 2E9SA 1N6NA 2AWOA 2QL6A 2GRJA 4TYYA 2CL6X 3SNHA 3B1XA 5J4HA 1RRCA 3LLMA 2BJWA 2FSHA 2REOA 4WXPA 1DG3A 4C0BA 3Q5EA 1NVVR 3A37A 5BN5A 3DZ8A 3IEUA 1L7VC 5GJWC 1BKDR 1M7HA 3UPUA 3IIMA 2ODNA 4Q9JA 1GSIA 1Z06A 3PVSA 3EAQA 2CHQA 1Z0FA 2CNWD 2IYTA 3A36A 3WY9A 2WOOA 4PQRA 5FPKA 5TMPA 4D0LB 3OEEA 2BMEA 4MH0R 5IHPA 4M22A 4V0NA 4QBGB 1KOFA 5CLLA 2P0EA 3D7MA 1S2MA 1YZGA 4LC0A 4RKFA 3K70D 3U7EB 1XBTA 2VO1A 1N25A 3T61A 1XMIA 5JWHA 5FBRB 2WJIA 3BK7A 1UKYA 3Q5DA 3WP0A 2G0NA 3ICEA 2QM7A 3CRRA 3L43A 4DLSA 4BGDA 3CH4B 1QZXA 3KKQA 2ZSBA 1N2CE 1S8FA 3IHLA 2VP4A 3MSXA 5AJZA 1FMLA 3TH5A 4NYIR 1MO6A 2GKSA 4D2IA 4B48A 4PPFA 1EGAA 1JPJA 4JLAA 4HLUC 5CB8A 1G7TA 2EFCB 4C4PA 1FW6A 2Q9CA 2A3RA 5AUNB 1R8SA 3A1UA 3QPWA 3REGA 4KVAA 2ZJ2A 2YV5A 2A5DA 2IYZA 4L9SA 4C0LA 1E9AA 4IFEA 3W8RA 1OFUX 2F7SA 3T35A 2GF0A 2C9YA 1R5OA 1AK2A 2W2XA 3F8TA 3FKQA 4ZCMA 1ZCBA 3NBFA 4EQ6A 4LJ5A 2GWHA 2QEQA 1PZNA 2OLJA 1P72A 2QP3A 1CLUA 2PX0A 5IDVA 1DG1G 5TY0A 3QVUA 4V0KA 2RGNA 1XXHA 1Z2CA 1OH7A 3NC1C 2FFAA 1DEKA 1UKVY 3DOEA 3K9LA 2AHOA 1PLLA 4HB4A 1YR7A 4A9AA 4U7DA 1CXZA 2ZUCA 3RC8A 1HE8B 1P73A 1F60A 4CF7A 1EFRD 1G8PA 2EW1A 4Q47A 1OSNA 2DYKA 2ORIA 4X8LA 4TZ0A 1ESNA 4KBGA 1Q20A 1SVSA 2QI9C 3AF3A 3B85A 5K8LA 2YWGA 3IUYA 5AJXA 4DJTA 3BORA 2I4IA 1XTSA 4HUQB 4A92A 4BLSA 3KTAB 3WBKA 3FWYA 3FOZA 1G17A 4TYQA 3ASZA 2VH5R 3BRWD 4KXFB 1NMXA 4ZDWA 4GRAA 2ZQ5A 4RZ2A 2RGGA 1E98A 2GBLA 1SULA 2WKQA 2IHYA 3DHWC 2XSZA 5H8WA 1EX7A 2OLKA 4V0OA 4DZZA 3V00A 2CK3D 4GI7A 2IC5A 1Z83A 2WWGA 1SXJC 2DWPA 2FFQA 3FFAA 3QF7A 4D82A 3BFKA 5FOVA 3WHKA 4ILEA 3FMFA 3TQCA 3ZVLA 4V0MA 4ZDKA 1KDPA 1F2TB 1LY1A 2QY9A 1TEXA 3B8HA 3NXSA 3FB4A 1NBMA 1VG9B 3SHFA 2ZE5A 2GCNA 3S1AB 2R6DA 2CXXA 2D2FA 3LVQE 5GVSA 1L4YA 1Q57A 1GNPA 1G7CA 3OEED 2OSBA 2EFEB 4BECA 1VG8A 2GHIA 1W4BA 2DBYA 3UK6A 3LBNA 2NQ2C 3QKSB 1FP7A 3O47A 2QAJA 2ZR9A 3PUVA 2DWQA 1CJUC 3TUZC 3JVVA 3ZS8A 1CKEA 2P2LA 1NG9A 1X8KA 2VEDA 2E1RA 2GEUA 4LPSA 5FI0B 4F91B 3EZ9A 4Q4HB 2GTPA 3QOFA 5EXPA 4DB4A 5F9FA 3FPAA 1BOFA 1I2DA 5DH9A 5FFMA 4DDVA 3VHLB 3L82B 5H68A 3U6KA 3O8CA 1YJ5A 1VIYA 1SVOA 2GAAA 5LBIA 3ZZUA 821PA 3GQBA 2WSSD 4B75A 2WJHA 1KI8A 4HB0A 4JBWA 1KK3A 4F4CA 1ZYUA 2AK2A 3QXCA 3THYA 3MUFA 5CJPA 1RPZA 4JL8A 1YZTA 2W58A 3FGNA 2IXFA 4HI0E 1Z08A 3U4QA 5G3YA 3K0AA 3LH5A 3CUEF 4TLBA 1RJ9B 1W4RA 2ZVPX 3BS4A 1KO5A 5HCIA 2X1VA 4HB2A 3NDPA 5FBVB 1R2QA 1SVKA 2J0UB 3X2SA 3D6TB 1Z5ZA 4KLZA 3LBIA 1E0JA 2YOFA 4PAQA 2NMVA 1P3JA 1HT2E 5C4MA 1L4UA 1P6XA 1US8B 4C0QC 5HR5A 4DLYA 1LNZA 1IXSB 1R7RA 4D0NA 2QE7A 3N70A 3AVXA 2ERXA 4DCVA 3Q3JB 2H7VA 4ZDJA 2G9NA 1X1SA 5TDHA 1MKYA 3DVLA 5TVKA 2FPLA 1OV4A 3FTQA 2ZANA 1F48A 3PEYA 5J4VA 4OL0A 4WOPA 4B47A 3VNUA 1ZNYA 1JR3E 4N3NA 3J81k 4US0R 4Y0VA 5JFGA 5L8VA 3AGPA 3C41J 3NTUA 1XJ0A 2GJSA 3HP1A 4FCWA 2WWIA 1E9BA 2IXEA 3CRQA 1KSFX 3R9WA 5AJYA 1FUKA 1E4VA 4BLRA 3RDPA 3SQWA 1XWIA 3D31A 4Q5IA 3UWOA 3KQHA 5JJIA 2OZEA 1T0HB 3CRVA 1SGWA 3R9IA 3U44B 1CP2A 1LS6A 1E6CA 2QAGA 2GESA 1JJ7A 5EQTA 3VR1A 3KXIA 5DN6A 1BIFA 2CE2X 2NO0A 3CRW1 4YQFA 3G5UA 4XVQA 2O8FA 5CIWA 2PZGA 4MDFA 4RZ3A 5JSZA 4KI0A 1I2MA 1YRAA 1T0JB 2NOAA 3PQCA 1A4RA 2D3WA 1AZTA 3TIFA 4PSKA 3LD9A 3IBYA 1G3IA 2JDID 4KODA 2V1UA 2DWOA 2O52A 4KJZA 1EWRA 1GL6A 2J5XA 4IOJA 4PC6A 4XSGA 1JR6A 2AXPA 2IUTA 2VA8A 4AI6A 1KDOA 2FWRA 3GJ8A 5CLQA 4D4MA 5FOXA 1QF9A 3DM9B 4B3GA 3SE0A 1G5RA 1UF9A 4OQFA 5CM9C 3QEOA 1G4UR 2FA9A 4WA7A 2YZ2A 3IPXA 4IEEA 3CWZA 4F93B 4D0GA 2ZTSA 4XJXA 4URYR 2JATA 2WKPA 2EFGA 4ZPXA 2QPAA 3IO5A 5HE8A 3I92A 1E32A 4KFSA 3C16C 3AF0A 4QFMA 4EAQA 1KMQA 1QHNA 3Q7QA 4R9UC 2F9LA 4UXHA 5B64A 4YLGA 1AJEA 3A1WA 3E5HA 3U7GA 1QHHA 4HZUA 1PLKA 2GCPA 5EP4A 3ECCA 1X6VA 3QY0A 5JMTA 4TQAA 4GOJA 4XTRA 1ZVQA 2BEJA 1TQDA 1V5WA 4TWZA 4QOSA 2ZYUX 4FCTA 4RY2A 4EPTA 3IIKA 1KI6B 3VTKA 4TMTA 3PUXA 4EQ6B 2FH5B 4RZXA 3ZVRA 1XD2B 1G7SA 4XOIA 1X86B 3GLIA 2QENA 1YVDA 2PLRA 2WAXA 3ZJYA 4EDHA 1TADA 1XZPA 3TVTA 1OH6A 4JSYA 2EVWX 1OH8A 1IY1A 1YE8A 2I1VB 3IIJA 4ZI2A 2XZPA 5L3SB 1N6KA 3AP2A 3GLGB 2EU8A 2RGBA 1P61B 3X1WA 121PA 4DLVA 1ZNZA 3TUJC 3WMGA 1PJRA 5KDDA 4MA4A 1MT0A 2QORA 2FU5C 3ZH9B 5HZKA 1I4LD 3PCRB 1OXSC 1NLYA 4Q4JA 2GJ8A 3P32A 3B1VA 3VR4A 1DVRA 1XPOA 1IJEA 4ACBA 2D7DA 5CDFE 5FPTA 3R8CA 3NDBB 3B6EA 1LFDB 3OZXA 2CCJA 1OFTA 2GAOA 3CWQA 3RS3A 1U8AA 4DC9A 3VAAA 2KB0A 3CW2A 4NU0A 4U5XA 3TRFA 2F1RA 4PXAA 4HDOB 3RWOA 4DLZA 4YDSA 2JGNA 3B1WA 3NBZC 1E9DA 4A8JA 4KFTA 3SR0A 3T1TA 5DI9A 3H86A 2A9KA 4B73A 3AUXA 2J7KA 1NMYA 4LJ6A 4TL9A 5DN6D 2ZS8A 3TE6A 2RHMA 4V03A 3FE2A 5DI3B 5JEEA 3OIYA 4Z54A 3GJ4A 1D2MA 4Z1MA 4C0KA 2ZI5A 3AVPA 2V9PA 5FTMA 3GLFB 2Q3HA 2NZJA 2D4HA 3LQQA 4QJ5A 4M9QA 3SOPA 4PC7A 1UADA 3L0OA 4MKGA 4PHHA 5EUMA 4CZ2A 3Q7PA 2O8BA 1TPZA 2C95A 2IL1A 3OE7A 5HZHA 3AVWA 3RS5A 1SXJD 4QHSA 1JBKA 2QTHA 3LY5A 1IM2A 5KHOC 1U0HC 3LO5A 3KJHA 5KO2A 3EARA 3AF4A 3K0CC 4KLNA 4MDEA 3CH5A 3I72A 5F3WB 2XNSA 4JL6A 1ZD1A 1Z28A 1XMSA 3GLHE 4KFRA 3AV0B 4NCIA 3LX5A 4QGHA 4N0DA 1IY0A 4B2LA 5G41A 1E0KA 1N0UA 1RRPA 3K9GA 4OHZA 3PEWA 2RGDA 5DIFA 1NL3A 1A82A 4KV9A 2G77B 4DT1B 2Q3MA 4JVMA 1QHGA 5HKKD 2AFIE 3NEYA 3CPEA 5BWMA 2VF7A 4Q66C 4EPYA 2O8DB 1XP8A 2A78A 4V02A 1OPXA 1XTJA 1N6PA 2Q21A 2V54A 4FCVA 1E79A 2NO1A 4FINA 4PPNA 5FPHA 5J40A 1CU1A 2ZSFA 2VP9A 3EIEA 5LB4A 2H1LA 1JXMA 3BBPA 3NC0C 4O2RA 4IFBA 3EZFA 1NMZA 3IGFA 4URZR 4OJKA 1TU4A 3HR7A 3I73A 5IT5A 2IW3A 1JEDA 4UNQA 4TL8A 2ZS7A 3RSLA 4HLDA 1OW3B 1W0KA 4QGGA 2NPFA 2UZ3A 2YOHA 2XJ4A 3RRNA 1GRRA 3MCAA 3P20A 1N0WA 4HSEA 1BMFA 3FHCB 1AGRA 2P5TB 1G5TA 4G5RA 4LDJA 3LFUA 4JBXA 4DCNA 3VMFA 4CEIA 3UMSA 3QKTA 4HAYA 3GFTA 3M6AA 2H16A 4LK2A 2IYSA 2HDNB 3SJZA 5E7IA 4A36A 1Q12A 2YWFA 1AS3A 2NG1A 2XNDD 5G3ZA 5CB6A 4OI1A 4Q7KA 4J0QA 1VHTA 2P3SA 1C1YA 1G3RA 5FTJA 3PFIA 5IRCD 2B21A 4IEIA 3C15C 3MWJA 4BZQA 3W3ZB 5IF9A 3VR6A 4LYHA 2F55A 3KQLA 1BYUA 2PJZA 2ODWA 3P27A 4NH0A 4ZV4A 2WIAA 1HUQA 1E2EA 2FGKA 4WIAA 5AUPB 4LV6A 5EE1A 2ZJBA 1WMSA 2NTYC 2A2ZA 4NCKA 1TF5A 4Z1MD 1R6BX 2IWRA 1VDZA 2Z43A 1GUAA 3JZAA 3TSOA 4AURA 4YXWD 1SXJE 4IOKA 2JASA 2C2HA 5GVRA 1DOAA 2YHSA 2XB4A 4OBEA 1GILA 3R7WA 4W5WA 5FI1B 4Q1FA 2H17A 4DXAA 1UJ2A 4BPBA 5JRJA 3TAUA 1QHSA 3W6OA 2NPIA 2GEDA 2CNWA 4G3XA 2ZRIA 2QROA 1NSFA 1KSHA 3C4JA 2C78A 3I1FA 2F1JA 3BIFA 1JALA 3DKVA 1Z8FA 2YWEA 2OILA 4AK9A 4LUCA 4P3YA 1E2GA 3K09A 3TSZA 4LCBA 5LDDC 1MV5A 1XNJA 4I81A 721PA 3K0FB 3NH6A 1MO5A 1XTIA 2IXGA 3U3KA 2IYXA 4ZCIA 1NLZA 2G6BA 2ZU6A 4DB2A 1GNRA 1S3SA 3ND9A 1U9IA 4E07A 1K8RA 2P6UA 3I4LA 3L8ZA 1Z2AA 1HT1E 2ZPTX 2Z4SA 3LVRE 4OI2A 1B0UA 3MWKA 3CBQA 3T1QA 3SYNA 2IF0A 2IS4A 3PUWA 2C98A 2XXAA 4B6EA 4IHQA 3I5XA 4DWJA 2OE2A 3QBVA 5CITA 2B7BA 1NKTA 1M1YE 1A5TA 1YR9A 3GJ7A 3T5GA 3MGCA 4H1UA 4HAVA 1CTQA 4B71A 3T12A 2XEXA 4RCYA 4L16A 1XEXA 1OLOA 1W0KD 4C7OB 2D2EA 2IUSA 4DSTA 4NZYA 2CVFA 2JJ8A 3AVOA 3IQWA 1TL7C 5EJEA 4OK3A 5J47A 5K8UA 2AD5A 4LBZA 1BMFD 3T5DA 1WA5A 1GTVA 3U7FB 3AF2A 3MWYW 4JMPA 4D4KA 3RRYA 2REBA 5K8TA 3MD0A 1WRBA 4Q1DA 4F38A 3C7KA 2WBLC 3V4FA 2OT3B 1CR4A 4MYUA 4IXMA 3DOFA 4TMWA 3HYRA 2WICA 4A2PA 1KAOA 1AM4D 4GMDA 5BQ5A 4UNRA 2Q0HA 1UAAA 2ZRCA 1KJZA 2NO9A 4EJSB 3H4MA 4PQFA 1WQ1R 3X1YA 1A2KC 4L15A 1EK0A 4WVFA 3RANA 2C04A 2DB3A 4BEBA 3QXXA 4A4DA 1OFHA 1G7RA 1VTKA 1DARA 4ZI3A 1JR3A 3CLVA 2N1BA 2OEPA 4ARZA 1T5LA 4MRRA 5EE0A 4HAXA 1OE0A 1W4CA 1G41A 4TLAA 2I3BA 2BEKA 3UWKA 4WW0A 1EXMA 1JQJC 4W7SA 2WV9A 2K5UA 4BFVA 1NKSA 5KOYA 2HLDA 3QKRB 1AA9A 2A5JA 4I99A 4QGAA 4JT2A 2IBMA 3THYB 4ZIRB 3VX3A 4XVUA 2B8WA 1MRSA 1XJCA 2HYIC 3ADDA 3GEIA 1EFUA 4B43A 1N6OA 2CK3A 4A1FA 1KO7A 2ZYVX 4FMDF 1Z0AA 4P32A 1IXRC 1TU3A 2VSFA 3MG9A 1NN0A 3GP8A 1P2UA 1CR0A 3TW8B 3TKLA 1XPUA 2JEOA 2ZRJA 4DKXA 4UJ5A 1P9WA
chains in the Genus database with same CATH superfamily
4MRPA 4NU6A 3WYCA 1CUBA 1M8JA 1WB6A 1Z13A 3GDGA 3KZOA 4R51A 3ZE2B 4X8HA 3ETDA 4W6QA 1TU0A 1NQVA 1PJZA 4AMZA 3O38A 5DYGA 2QJRA 2VPTA 4L51A 4NHEA 5BWCA 1HYQA 1YBFA 2DPGA 2YZGA 3B48A 3SYMA 2F3UA 1LPOA 1YXMA 2HEGA 5AKYA 4EJSC 1VBFA 1JWBB 1C2YA 3NHWA 4R1TA 4DIEA 4WK4B 3FMPB 3AVYA 3DV9A 1M6EX 2BE7A 2HUPA 5T41A 4B6QA 5H70A 1JLRA 1XQWA 3OZWA 3FSGA 1F3OA 3G23A 2W98A 1E7QA 3WR5A 4N65A 2C4WA 4AP6A 3ZDAA 1YT5A 2N3ZA 4X7BA 2YZNA 3AO0B 3HN2A 2OVFA 4QAJA 5IARA 3MK31 1FSSA 2GKOA 3W05A 1CUUA 1DAPA 1IOZA 2FWNA 4R54A 4U00A 3FNBA 5BT8A 2IS2A 2R97A 1CSEE 2X2EA 3H0KA 2AG6A 4MWBA 1F0NA 2XI4A 3FGPA 3FZNA 3C8HA 4RD6A 3RRJA 1OHHA 1EINA 3DE6X 2WTEA 1RC1A 4UM7A 3RYCB 3TUIC 1M34E 3NKVA 3QVOA 2YHAA 5DNEA 2NP7A 4C0JA 2Z83A 4YC7A 3D6UA 5ADHA 1JDVA 3QQPA 1ODSA 5TV2A 1J06A 3HYTA 1USUA 1O6ZA 2ZYTX 4MYCA 4NR0A 1NIJA 2FCAA 3FTCA 1U8FO 4HVLA 3J81A 2VBFA 2B1QA 5LM3A 3F67A 3PF9A 5CXSA 1IPHA 1RXUA 4IIGA 4OH7A 3RR2A 4W5JA 4DR2B 1ZJYA 1WPQA 2FPGA 3KUDA 5AXDA 4PHTA 2O8FB 1QDEA 3RQIA 3D8NA 1H2BA 4LOLA 3VJMA 3AX6A 3IELA 4AJJA 1YU9A 1XYYA 1MTZA 3GJYA 2PKQO 2J0SA 2W2LA 1MZVA 4PX5A 4TQ9A 2V6BA 3P9SA 4YMWA 1SUBA 2EOAA 2M98A 4RGBA 3AFGA 4JLMA 1L5GB 3SX0A 4F04A 5AM2A 1IBMB 1SK9A 1CNFA 3CGGA 2BTQA 4FMDB 3G0IA 3OU2A 4I36A 3BE8A 4FZVA 5K3FA 4PFQA 1V9LA 1M6YA 1NBIA 3BSSA 4UUMA 3CFYA 1P45A 2VHQA 4X3PA 3N3BC 5KX5A 2WILA 4REOA 4JC4A 2FRXA 4KQGA 1QGED 4ZVSA 4FC7A 1JR3D 4EKYA 2VTBB 4ID3A 1PEDA 2SKCA 1Y3FE 4F4IA 2J9FB 3D54D 4PAMA 1ZHFA 4WL0A 5JMPA 5FWAA 2BBWA 5ICCA 3KB1A 5DM0A 2HPVA 4EJFA 5CDFA 3EZYA 4PLTA 2DCUA 2O6HA 4OD0A 4YV1A 5JZBA 1CR2A 4IKOA 4L4XA 3C8ZA 4PFKA 2XWSA 3ZD7A 3AHJA 3MTBA 1SVLA 5F12A 5ALOA 1BDJA 1FX1A 3K7EA 3ZJVA 2E4WA 2V7WA 3JQAA 4JA0A 4M1OA 5M29A 5FPSA 1G2QA 1NUAA 4DMFA 1N6LA 3KXPA 1WUHS 3LGXA 4JN6B 3STUA 4QUKA 3DLAA 3RFCA 2IIVA 2PKEA 2G0TA 1ONSA 1WTCA 2O6LA 4GQBA 4IGAA 5FL7A 4WN9A 3VH3A 6AT1A 1K97A 1KAHA 1A2BA 1Q7RA 2R25B 3A28A 4R4JA 5THXA 3U31A 2HGZA 3ZHTA 5LQKA 3L4EA 1QO0D 1CWUA 2VSXA 3A9RA 3KJQA 5AQ1A 2JDIA 3MNFA 4XTCS 2RGCA 3C8DA 1SPXA 2NV0A 4ODIA 1K4KA 2FLKA 2IYFA 3GPCA 1N1DA 3FDJA 5C1IA 1BD3A 1ECLA 2AFRA 2F43A 2HJHA 3RYFB 4AN0A 1PVDA 1EKXA 1VL6A 2YRFA 3H1AA 4BRWA 1U7OA 4C08A 2QD4A 1NDHA 1TKRA 1O9BA 3JWHA 4L2IB 2FW0A 1WBDA 2XODA 1J8YF 3V7UA 2INGX 3PD7A 4Q7JB 4CEHA 1FMJA 3DV2A 1FYWA 3CF4G 1GPBA 4FS3A 4JVNA 5JCOC 5D1HA 4IHJA 2OFWA 4LNUA 4X54A 3G6KA 4ISCA 1U9YA 1RRGA 3WIOA 3FSGD 2IGBA 3INNA 1UMBA 4BNKA 4RGYA 4H7IA 1JG3A 4WJKB 5KYYA 5HGJA 3SBEA 1NN3A 2BCEA 4PFSA 1V1MA 3B9QA 3VVLA 3LCVB 2C5LA 2ZZKA 1N8SA 1AE1A 1UBEA 2J5KA 3LYLA 5B1YA 4UXIA 2O8CA 2P3QA 2NP6A 1OHHD 2IHKA 4B9EA 4CYMA 3K94A 3B51X 4DRXA 3I8XA 1XO1A 1ZDMA 1W30A 2QW8A 2Y9PB 3EBOA 3I0NA 1E1NA 4N5LA 5GQSA 4DRYA 5LL6P 4Z9XA 1ZMTA 3FR7A 4P22A 1V41E 5D00A 4F84A 1RIFA 2X8JA 3FF4A 4JVSB 1TQ6A 1MORA 1OOEA 4HLUA 4JI3B 1V47A 3ZDEA 3RHFA 2WTXA 1PV4A 3ZD6A 2WQ7A 4HDQB 3AOEA 4V3CA 5AWFC 5AJWA 1GD1O 1KY2A 1SC9A 2IE8A 4HEJA 3DVAA 4PAGA 2N46A 1YHYA 2CEKA 2I7DA 1YRWA 3W5SA 1SBTA 3MJDA 1NPTO 3NV7A 2Z30A 5DYIA 5T4FA 3TZCA 5T8KA 1DUSA 2P62A 4ZZIA 1K75A 4XH9B 3U61B 1YMQA 5M7EA 1IONA 1JIVA 1L3IA 1EVKA 1NWCA 1QOZA 1FSZA 4IJVA 4EFNA 1G3UA 1AF7A 4MS4B 1GL9B 3EISA 1OXKB 3JQCA 3V1MA 2UV8A 1JLLA 1ANKA 4K9RA 4BJ1A 2VKTA 4WBNB 3AJEA 1VCIA 1V8PA 3OHMA 3RKRA 5K6AA 4WECA 5AW5A 4O5AA 4OMDA 3W5IA 1DJNA 1KEPA 7ABPA 1NW8A 1A5ZA 4GP6A 1NG1A 2EFJA 2WTAA 3GFPA 1PKXA 4GQAA 1KJWA 4B74A 3I3SR 5L40A 3FWNA 5LLSA 3HVRA 5EL0A 4LZZA 4PFJA 2JKVA 3V4ZA 3AG5A 4OQEA 2WF6A 1JTVA 1E3SA 1QWOA 2G04A 2R7AA 2Z5GA 1O1YA 4J0JA 3SVLA 2HHHB 4LK3A 4CDGA 1GYRA 3RVNA 4UUNA 1ACJA 1FFAA 4RMJA 3SYKA 2B8TA 4Y2YA 1RADA 3VPBA 2QM8A 1ZH6A 2I4OA 3FCXA 1U1CA 3BERA 2EJVA 1RBMA 3NTLA 3ZD9A 4UOQA 4EW6A 2NZ8A 2R6GA 2VH1A 4N6GA 4DMUB 2BKVA 2QRJA 3IH5A 3BQNB 3QXJA 4AUEA 4D9CA 4TTQA 4HUTA 5I01A 4GAEA 1NJGA 1ENPA 2R6R1 3AL3A 4ARSA 2AUMA 4PLZA 3FTEA 3TM4A 1AY0A 5FL7D 4U1RA 4A5OA 3GXBA 1R0XA 3QEMA 3ZCQA 3C3YA 4RETA 1TTTA 3D4IA 2DE0X 3ZQ4A 1SJ9A 1XK7A 5HJ7A 3FUWA 1NVUQ 2P2SA 2V0CA 4QO7A 5SYNA 2ISSD 4MUYA 3QYPA 2J6IA 3ST7A 2X4GA 4HYYA 1UXOA 2JCGA 4Y1FA 2GR9A 4UXJA 1XZIA 3GAFA 3SDZA 3I39X 1OBCA 4WINA 2HSJA 1DBVO 3H3JA 2VZ9A 2QL9A 4K3VA 1VJ1A 5T6BA 1U94A 3QUAA 1J8DA 2HTEA 2NNWB 3B13B 1WABA 3BTUA 3V2UA 1WU8A 2X0KA 3PS9A 4I4LA 1S3FA 2QRKA 4NI5A 2ENWA 1G8SA 4OB6A 2XA1A 1D1TA 1SU8A 2X6TA 3CW8X 3U4AA 3D64A 4ZOLB 3F1LA 1P0FA 1QC5B 3AY7A 4KX3A 3H9CA 5GONF 3D2LA 1QLHA 1INLA 4MQUA 1H5UA 5EWJA 5H3HA 1DIOB 2LCQA 3IV6A 3RLFA 3DW3X 5AESA 3E15A 3GJTA 3HU3A 2GRAA 2Y8EA 4K28A 4Q9LA 5ALYA 3WLOA 1NATA 1SC4A 2BMDA 5ALFA 1VE9A 4F5WA 1T6YA 1UBJS 2P8JA 1CUIA 3GAMA 3INTA 2FF5A 4PO8A 2WM2A 2VF4X 4I1RA 1G5HA 1EJ2A 1FDOA 1GOTA 2FGJA 2LIPA 2XUIA 1PR9A 1BU5A 4EARA 3AKCA 3RTEA 1BDIA 1RHQA 1CQZA 3CNLA 3KL4A 2OXFA 4KUGA 1Q3KA 5F3DA 1VKJA 2Q49A 2Y1WA 3BREA 3T3GA 2O2HA 1X38A 1SHZA 3GDHA 3CF0A 3LXMA 5DISB 4Q9IA 3K9WA 1PGPA 4ESHA 1U28A 1L5QA 1SHLA 4X92A 4MEAA 2F1OA 2V4ZA 2QGZA 2JFWA 3U5ZB 1YV9A 1P2BA 2C4MA 2QP9X 2JGMA 2WVHA 3PVCA 3CTPA 4DCOA 4GIBA 1KEVA 4QHTA 2TSYB 4JYZA 4PXYA 1H1LA 4G5HA 3I6IA 1AU9A 3QG1A 3CV3A 4DLUA 3BJMA 4KWHA 2IV3A 3EPHA 2ECFA 2XY4A 3VX4A 4G0WA 3VR5H 1IJBA 2ZYAA 3S1AA 4HOYA 1A7KA 3Q9SA 4M83A 1Q1ZA 2DPXA 1JJIA 4IL5A 2PZBA 2XNDA 4EY5A 1KFBB 2RCNA 2IHJA 3E0XA 3UB2A 4MCHA 1DEOA 4YK7A 1MAVA 4AKSA 3GH3A 3WZMA 5IP5A 3PQ3A 2V7EA 4BNWA 1LI7A 4YCBA 2KBFA 4UBMA 2JJQA 1FUIA 1WOYA 4LYFA 4WLNA 1WW3A 4X8OA 1A71A 3PC6A 2GPJA 4I1YA 4KZKA 2WNSA 1WUIS 4Q4HA 3LCMA 2FW9A 4X6UA 3TQTA 3WDMA 2FSIA 3M4NA 1BE1A 4FEEA 4ZTZB 3OC0A 2XQFA 1IQUA 1PZFA 3ENZA 2CVPA 4GI2A 4PW0A 2JHFA 4L3OA 2YWHA 2BEUB 1ML4A 4K87A 1W34A 3PCXA 2QB5A 2ZWPA 4AKIA 3QLVA 4W7HA 2ZITA 3N0WA 4AY6A 3CNOA 4O6VA 3DOUA 1PT5A 2HC9A 1ZWLA 2PUJA 2YMPA 2RG1A 3TOVA 4DWVA 2ZLBA 4WFKA 3SIRA 4G85A 4CL8A 5C1OA 3BWDD 4UARA 3C24A 2WM3A 5IVIA 5JCZA 4WKOA 1B76A 1CZHA 3VPDA 1RJ9A 3G7NA 2M1XA 3PNMA 1WSAA 3NXKA 5KDLA 3PENA 4BE9A 3O2QB 4OHBA 4H1WA 1ZOSA 2W83A 3HLKA 1L1QA 1XTZA 3I2YX 5H83A 3EUFA 5F23A 1YGYA 5DLYA 4C2UA 1LZLA 2CYAA 1IG0A 1FS6A 2Q4DA 2EP5A 1ADYA 2JLZA 4YCJA 3TW6A 4L74A 1Z0DA 1US8A 4GFDA 4MO2A 4CE6A 4YAGA 3PXUA 5H1YA 2IQ5A 2QG6A 4P4TA 4C7BA 5L6LB 2GILA 2H7XA 2VN8A 4X7MA 1PJSA 3QSGA 3RU3A 1UFOA 2DHQA 1EMDA 2OK8A 1ISMA 2XMDA 2FN8A 4MVJI 4KYIB 1QHFA 1DLJA 3WFZA 4YJ2F 5GJVC 1OJLA 4A8HA 3L0ZA 3GR6A 2OXCA 4M1QA 4AMBA 4BKUA 1H22A 1WW8A 4NYMQ 5CR9A 2ODAA 4ESEA 1R0WA 4C30A 2NU8A 2A30A 5F5NA 2WKWA 3CR3C 3ED5A 5AJUA 1OTHA 1JHYA 4L57A 2EKDA 3JRNA 4UEJA 5HUJA 3P9PA 3ONVA 3LLCA 1BQEA 3RIHA 1P9NA 4BCDA 4L4RA 2E7ZA 2FUNB 4LF4B 3W9YA 2Q1TA 2QMHA 2R00A 5F64A 5C1BA 3PTAA 3K0KA 1QG2A 3L6RA 4IH4A 5IT0A 2VAWA 4I4TF 5SY6A 4KAAA 2X4LA 1NJ6A 4H18A 2P65A 3DTYA 2PD6A 3U7HB 2ZRLA 4IVNA 2SCUA 3O3CA 1N7JA 4IW3B 1NR1A 4LMRA 4RENA 4BIMA 4NCJA 4G8DA 4KSCA 1E7RA 2HIAA 5AHXA 3FJ1A 2ILTA 1NVFA 4YP5A 5DNAA 2OGUA 2VPYA 3KOUA 3OA2A 3IJRA 3KYIB 4KE8A 4UHDA 5EMHA 3TQHA 4C6SA 4YLEA 1LLUA 3LIPA 1NXVA 5BOVA 1B8UA 2XRMA 2G1KA 5BN5B 2R7NA 4RPIA 5EJIA 4BU1A 4TUYA 3EB9A 2DUUA 5F78A 1WCV1 4JB2A 1QYRA 3H5RA 2RKWA 2OM2A 1P5ZB 1JAYA 2JLRA 3WOHA 4IIJB 5EG5A 3QRWA 1XIVA 4RS4A 5ELLA 2OCPA 2R5NA 3EVAA 3Q41A 2D6FA 1MFZA 2P5SA 2R6AA 2XCRB 4KV7A 3UMJA 1SBIA 3CEPB 3WGYA 1SB9A 3K6JA 3L0PA 3SF8A 4KR6A 3CVYA 3IRUA 1PKEA 5D3KA 1UODA 1WB5A 4Z7QB 3TZQA 2NWQA 4FXPA 4LA4A 3U1TA 1MOZA 1S8AA 4HADA 3ZUPA 4PE5B 2WD7A 1KBQA 2BCGY 3S1LA 1LUAA 4E5DA 2YRXA 2O59A 2YVUA 1DBQA 3ZCPA 1BWPA 4LWOA 4Q34A 5JXJA 2FPWA 1X1AA 4MUHA 3OFSA 4G4GA 4ZYVA 3OCUA 5JYBA 3AHFA 3FPSA 1V37A 1VXRA 4QGBA 3NBQA 3OTWA 3RUCA 1RWPA 3DOIA 1O08A 2H1HA 1KK1A 2VDVE 3LLUA 5AVKA 4QG7A 4EHNA 1HDIA 1MDFA 1UXGA 1DV1A 3P2EA 1NNUA 3RRZA 1B6TA 1Y7TA 5HBGA 3WSWA 2ZSHA 4V1CA 5KOHB 2GDZA 3IJEB 3T4XA 4JI7B 4FVTA 1G8MA 3PUJA 1H65A 2BEWB 3K2IA 1EJ0A 1FDIA 2C3UA 4DJEC 1F9EA 3D8TA 2DHRA 3H05A 3HM2A 4HFNA 3U40A 1PD0A 1UBMS 8LDHA 1K7EB 1O5OA 3CISA 5DSXA 4ALNA 4Z4GA 1AZWA 2K2WA 2EFDB 3Q8WA 5ALNA 4MS1A 1NF2A 4E0BA 1CERA 1T2UA 5ILGA 2CYBA 1VG1A 4Q00A 4EQ6A 3IOCA 3PUYA 4R9VA 5JISA 1IBRA 3TLMA 5JANA 2JLAA 2AF3C 2I2WA 2XQKA 3MAGA 3NQ41 3RSFA 3EPKA 2RIRA 3BYZA 3L8GA 1YR8A 2GBGA 3IMKA 2WG0A 5E2BA 5LMUB 1VYVA 1VI2A 2FPIB 1P4RA 2G82A 5A7HA 2GM5A 2EP8A 4ABYA 4W5NA 3JAKB 4KO1S 4C7VA 2AFHA 2GBCA 4NBRA 3LSYA 1PO7A 1YL5A 3UENA 1GRCA 1QYCA 1XVVA 4FLMA 3IQIX 2I2FA 2O3TA 4LTDA 4NJEA 3NG1A 2H1CA 2WK1A 2A33A 4JIGA 5DN9A 1ISJA 3UFXA 3PFFA 4I46A 2IITA 4TLEA 2E4YA 5EEHA 1BFDA 3I83A 3KAJA 4A27A 2DUJA 3KOMA 3FRHA 2PS0A 1WAMA 3GZ4A 3FLAA 3KKMA 4QEZA 1FTNA 3O9MA 3GUZA 4RQBA 2PT5A 2PZAA 4Y9TA 4EMTA 2J6CA 2DHEA 4EW3A 2VCHA 1CT9A 1Q0UA 1E3WA 5AKIA 1SKQA 1JS1X 3K53A 3PDIA 4KOAA 3DBRB 5K3DA 3LF1A 1QR6A 4B6FA 4EA8A 3CNQS 3DDZX 4WNCA 1L5ZA 1NV9A 5I9MA 4ER3A 1GPWB 2GKGA 2J30A 2Q4EA 4Q48A 4A8PA 2J0EA 4GICA 4NMHA 3H2IA 4FONA 3ZTWA 4BNHA 2ZR7A 2DEUA 2WSIA 2A1IA 2ONKA 4AJOA 3AZPA 3Q1KA 5IHXA 4FYJA 2C5SA 4JT9A 3NIBA 3KFXA 2P6PA 5DI3A 3M6LA 2BP7A 1UP6A 3GA0A 3REFA 2V6GA 3EIXA 5CXXA 4DSAA 3LY8A 1N5DA 4R8SA 3GLFA 1DCTA 1VMIA 1QBKC 3H2ZA 2H1OA 3W5VA 1VPVA 3BRCA 2ZRDA 1RFLA 1ISHA 3V6LA 3RWBA 2WKSA 4JFAA 3GT3A 2Q5JA 4POAA 3Q8XB 5AI0A 3VISA 1FTSA 1E60A 3K6KA 2BI4A 1FNCA 2RGNC 4IDCA 4ND8A 3HRKA 4X66B 1MA3A 3W7VA 1YQUA 1XNHA 3KQSA 4DMGA 4FGWA 3S2SA 3SZRA 5HOEA 1P62B 3LX8A 1WEHA 4M4SA 4A82A 5DM2A 2AN4A 3LW8A 2OL4A 3C4VA 1KWKA 4IDPA 2O3SA 2BDUA 4B32A 2PYIA 3GOHA 4KK3A 1IJFA 2EGHA 1CS4C 1NM5C 2D0PB 1Z22A 4CMBA 4GOMD 2B0CA 4UD2A 1IRXA 3R6LA 4UMDA 2C2KA 3F3MA 4M0PA 1W94A 4JHLA 4QXAA 3CVUA 1AB5A 4L6AA 3JATA 4KCGA 1FMTA 1AO3A 3GQBB 3NFRA 3L7JA 1U0FA 3GLHB 4X90A 4MEBA 1UBUS 3IX7A 1V7CA 2F3RA 2HJSA 1E94E 3HCEA 4OXNA 3W04A 4F9TA 2R1VB 1Q3TA 4LI0A 4P3OA 5EQJB 2HSWA 1DU4A 3ZJ4A 2C61A 1KO4A 4PEVA 1R0SA 1FLNA 2QJOA 5JD4A 4GR9A 1B74A 2DU8A 3AZQA 3NR2A 2Q9BA 4S2UA 5EJMA 4UW9A 4D25A 2GF9A 2OCYC 3UAXA 3K0AB 3KKNA 3NALA 4Q7LA 3T34A 4QKQA 5FHRA 2HLNA 5LZ8A 3EWSA 2X2OA 1G64A 2QTCA 4IOLA 3DHVA 1ATZA 2X8BA 3M6WA 4JYBA 1EFPB 3BMCB 3RNOA 1PQUA 1VBNA 1XVUA 4Z9BA 2A4MA 1GEGA 2A5YB 3A1EA 1LQTA 3GJ5A 4ABTA 2V6MA 2QTNA 2YHBA 5FUMA 5BOSA 5A6VA 2ZI3A 4Y9SA 3R3YA 1A69A 1E3DA 1UMKA 3DR3A 5CVJA 2X6QA 3AETB 5B7PA 2DQ4A 2GA9A 4KB5A 4M86A 3IE1A 1NC1A 1L7DA 4GM4A 1BMQA 2DXIA 2X13A 1FP4A 1R6VA 1ZM7A 2PD3A 2RB4A 3DFFA 4IJMA 2GEKA 3ZC3A 4LOHA 1DQRA 2EARA 3HJNA 3OT1B 4RA6B 1M2HA 3T5BA 3KEOA 1E8NA 3BTSA 3FPGA 1RMQA 4EYGA 2HJRA 2I6FA 4HQKA 1ND6A 4AJ9A 1BNCA 3X44A 1TD1A 4X20A 1GKLA 3AFIA 1SCKA 4DSOA 4IUBS 5ARBA 4RKEA 4ESVA 3R20A 3G9XA 4FGSA 4HG2A 4DLKA 1KIMA 1FFDA 1R8YA 1GG9A 4Y2VA 3P96A 4AQDA 4DMKA 5BN3B 2ZAGA 3F8WA 4YRQA 3KQYA 3WFJA 4IICA 2PZLA 3L7IA 4JEMA 2P0YA 1FB5A 5CCXA 2HF2A 4HH3C 2B9VA 2PGLA 3L1JA 2E85A 1AHNA 2I8LA 3DC2A 3OMLA 2B61A 5JCXA 1QTQA 4FYMA 1L0BA 1YHZA 3LHDA 2BFFB 3BK2A 4X45A 5A04A 1MC4A 3FHJA 4L0MA 5AVQA 1HXHA 3S5UA 2J67A 3EDRA 1R4AA 1UXIA 3EF0A 1YAHA 4DNXA 2NIPA 2XGSA 3VH2A 5JDIA 4HKTA 1RJDA 1U2EA 2R62A 3GUHA 4KSYA 6CHYA 4N0MA 3GEMA 1NOIA 4B1FA 2MR6A 1J39A 3HR4A 5CP8A 4M88A 1MOQA 2EYUA 5DF1A 3MW8A 3WISA 2P4UA 2B4TO 1KS2A 1CZKA 2CD7A 4YRGA 4PPGA 4U4AA 3CIOA 3HCRA 3E84A 4P6VF 3JQRA 1T15A 1T1GA 2QMOA 2XB2A 4JL5A 4BX3A 3OG9A 1XCGB 3OKAA 3NW9A 1YI0A 4JMLA 2EYQA 3SN6A 4AIIA 5I48A 1SXJB 1WNTA 5ICGA 4Y2SA 1CHDA 2K4MA 1L4GA 2MTBA 2VP6A 4KTVE 1X1QA 4RVHA 5FPYA 1RCFA 4JP5A 5J4YA 3WGZA 1XZLA 2CL0X 4ZYTA 2EIHA 1CBUA 4GUDA 2CBGA 5KU1A 2G5CA 3EUWA 5C4IA 3BZWA 3BFPA 4MX8A 1VHQA 4C0HA 5CVDA 1T9DA 1LNQA 4IYRA 1ZMOA 3NLLA 1BG6A 4K46A 3A70A 1YDHA 1ESDA 2OD9A 2ZOSA 5FL3A 4ZC1A 5BRNA 1SCBA 3VTZA 4UASA 1W85A 2LGJA 3U4CA 3P1JA 4K6HA 3RASA 4KW7A 3A4IA 4KXYA 4HH0A 4M7RA 2H7CA 4RPGA 4ZZ0A 1B1AA 1NT4A 2Y1CA 3JQBA 4WBNF 2H9YA 3E7WA 2CNBA 1GPJA 4EITA 2R5FA 2X0NA 3O8LA 1O9GA 2BM1A 4YAKA 2OD2A 2Q6IA 1UC5B 3G79A 3NIWA 4H7HA 4UMVA 2QAGC 3G85A 4WDRA 2RMKA 3MIIA 2UKDA 2Y93A 5DXFA 4BFUA 2CBZA 2C5FA 5E3JA 3JV7A 4PRKA 2VYND 2W37A 4XWYA 1QXSA 3VR4H 4BLUA 4Y6PA 3O3OB 5ALXA 3ULKA 4E2XA 4YUXA 3ZLJA 4UDOA 3UO8B 1DTWB 2B3DA 4EB3A 5ALKA 1UH5A 2AOVA 1J07A 2BOVA 3CNBA 3OJWA 4EGSA 3HK2A 1M1YB 2CDRA 4YRFA 1E8MA 3V97A 4ZYXA 1T5IA 1QPZA 4RQUA 4S1WA 3CR8A 3BMNB 3CG0A 3NC4A 4JGBA 3SC6A 3O26A 5JAMA 4ARIA 3B3FA 4E2YA 6ABPA 3K6SB 3AIMA 3KVYA 4FYXA 1WQ4A 4OIMA 3TB4A 1P7WA 4YQZA 3MFQA 2QLBA 4BDTA 2XCOA 2YY6A 4TMYA 1ECJA 5J2UB 5K0ZA 1B73A 3TZKA 5DXJA 1NN1A 3IVRA 1UEIA 2IVZA 1L1RA 3E8MA 3FKSA 4QTXA 5FKJA 1GQFA 1V1JA 2C3OA 2JFBA 5JJLA 4BNMA 4W82A 3C70A 3GGOA 3SKXA 3EX7C 3KTFA 5B4UA 4EF4A 3DZFA 4JX9A 5KZMB 3OIUA 2C2BA 3T9CA 2GSWA 4P53A 1L8OA 2D2IA 2Q5OA 1NVXQ 1Q1QA 2RC5A 4GVPA 4M7WA 4P8RA 4I4IA 4KNWA 6GPBA 3HDGA 4LSGA 3KT6A 3EHEA 4UHEA 3PL5A 1YCGA 2XE6A 1W8DA 3PUZA 3MJCA 2C20A 5AW1A 1J0BA 1K7CA 4RCVA 2O7RA 3WO1A 2A0YA 3OTQA 5I47A 2FZ5A 4KQXA 4RF3A 4CMJA 4RPJA 3COVA 3WL5A 4NMWA 5FCDA 5B1HA 1XDBA 3EGCA 1Y3CE 2R84A 3QKRA 2I6GA 5F9HA 3DMTA 1VPEA 3KE9A 1R4MA 1YA8A 3OF3A 1BS2A 4OV6B 4ZOLF 1DUVG 5E6UB 5BSWA 1TM3E 1ONBA 3FB1A 1PBNA 4RWEA 1GWNA 3DHNA 2VHUA 3T5PA 4DOMA 1RAHA 2V7XA 2JGFA 1LJUA 2P6NA 1HZZA 5G4KA 3ZE9A 4BFWA 1MHTA 1UPFA 1ZCZA 1H5QA 4QXOA 4OHCA 5DM1A 2Q4BA 3F98A 2W4QA 5FUQA 1HY3A 1YJQA 2RHLA 3VZBA 4JYPA 4HY3A 3CZ9A 5GOZA 4LRQA 3VYSB 5I4BA 2LW7A 3AUYA 1MOSA 4UDXX 3L4BA 1QTIA 1XV5A 4JBIA 2XYGA 4JGIA 3LW7A 1NN5A 4G4JA 1QRRA 5TT0A 4L7VA 5ALEA 4BGEA 4BGUA 2KJQA 4U7GA 5IC5A 3LPMA 4NBSA 3ZWDA 3KQOA 1MFPA 4O4JF 4HH1A 4TWBA 4K0KB 1PGOA 4CM7A 1QLWA 1VA5A 3OJ0A 1F4VA 2MSNA 4FXOA 1H2XA 3TRIA 4AZTA 3K0SA 5JFOA 1OH5A 1UXJA 1UP7A 3HI4A 3I9V1 2IXBA 3VO1A 2UYHA 4D6PA 2VYQA 5GV8A 2NGRA 1PFWA 3IBSA 3FDFA 3HYSA 2GZ1A 4WEQA 5AUOB 2XOEA 5EUBA 4RTLA 3MWEB 2Q5QA 1UK9A 2CCKA 3N2IA 4KDFA 1UT8A 5EPEA 4MKIA 3ZS9A 3SE7A 1E3MA 4Q37A 2UUOA 3RF6A 1PLJA 5A05A 5HG0A 2BSQA 4X85A 4HH4A 1WD7A 2IEYA 2R6HA 2QQEA 2PH5A 4INAA 5IVKA 1IAQA 6YASA 3W4IA 2HH9A 3RYCA 1VIMA 4UZSA 2JS7A 1TFUA 4TMKA 3LCJA 4X63A 2XUJA 3DSRA 3GFOA 3KKOA 3MPOA 1RI5A 3OKPA 3D6AA 4OSOA 3L7BA 3KOZA 3NHPA 4GLOA 1PS0A 3W5AA 3VKGA 1J2TA 1WU7A 2FR0A 2QA5A 3AOGA 3BB3A 1S3GA 4AJNA 1SU6A 1KEZA 3TPFA 1LBEA 4TTPA 3WWEA 4FSHA 4BMDA 2FJUA 4IP0A 1R0LA 3PQ4A 3RS0A 3ZW9A 3CN9A 3SY8A 2B4AA 1U8ZA 4HTFB 1YQGA 3OCCA 4Q7MB 3FKSD 5AM0A 2P2CA 1PHRA 1B3RA 1E1LA 3SZLA 2ZYSA 4MP8A 5E4JA 4ZOQI 2I3DA 3R3SA 2CLEB 1CIVA 1DDIA 2OOKA 1BVRA 1UDBA 2XW6A 3KUCA 2E55A 4J7UA 3BILA 1A96A 4MRVA 4QUIA 3M3PA 2FEXA 5KYUB 1R88A 1Z34A 2PJUA 4ETWA 2EGGA 2OORA 2XUZA 1E1YA 2PLFA 4H9GA 4AP5A 4C6RA 4DLXA 1I3LA 3IAAA 3RI3A 1RQ2A 5L6MB 2J9FA 4GZMA 2O0JA 4G1UC 3VH4A 3QE9Y 4ZCPA 2VPXA 4BBJA 1IZ8A 3QFFA 4EFLA 2PUDA 1KI9A 5CM2Z 2JFHA 1RC8A 1JQ5A 3NYWA 3OLQA 5JPDA 3B7WA 4Y2HA 1KKLA 1VZ3A 1JEOA 1XRRA 3VSAA 2CF6A 4Z0NA 1BSVA 2OHJA 3ZHRA 4IX9A 1WY5A 2RONA 2W11A 5AM4A 4DM3A 1A9SA 2CWDA 5TR9A 1JB1A 4H7PA 1PDVA 1FYXA 2X9QA 2ZT7A 1DXHA 3H1PA 4NDNE 3EPLA 1QSGA 4PLYA 3AVTA 4WLUA 2G36A 2WA1A 4JU9A 5DJ5A 3ODPA 3V1NA 2X0FA 3WOVA 2GAJA 4L76A 3I34X 4AY2A 1ZW1A 1XXHE 6NULA 3JU3A 5LPNA 4JV5B 2Q07A 3P9RA 1GU0A 5FFNA 3RYFA 1CY8A 3KFVA 2DFPA 3I52A 4QBKA 4WPGA 4QUBA 4TV9B 2OWDA 4L2IA 4L0DA 4PCLA 4CFYA 4E51A 5KINB 1QRTA 4BFXA 3CINA 4C5CA 1U0SY 1ZQ1A 2DJ5A 1UFRA 2ZPUA 1KJ8A 1CR6A 4NZMA 3A9SA 2J7PA 2PMDA 2ISCA 2OPBA 3BKWA 4W9MC 4UQOA 4RFSB 2A92A 2EAUA 3R23A 1HI9A 4GXQA 4CDRA 1XTKA 3RS8A 2O5CA 1UC8A 4IIJF 2IP2A 1NXWA 2JGDB 2XXAB 1D9ZA 1XJQA 3OJOA 4JWKA 4YACA 4LY0A 3G0HA 4B6PA 3EWAA 4XLLA 4F3KA 3INGA 2QYTA 1V0JA 2LDBA 5DTRA 3PEFA 2OZLB 4G37A 4K2AA 3VVMA 5KVCA 1W7AA 1DI0A 1PL0A 5ESDA 1BVUA 5IJAA 1W73A 3ZDBA 4J4BA 3TIIA 3T99A 1MQSA 1DC4A 4OYHA 4J16C 4FTWA 3COYA 4GNRA 1C14A 5CJ2A 1ELOA 3JVEA 2AUTA 2A1UB 2NO7A 3KXKA 1REQB 3AFOA 4H4EA 4MJLA 5JNLA 3I76A 2POCA 4E3ZA 1M1ZA 4G8JA 1BGWA 5CHYA 4MW4A 5AR1A 4V0ME 5GM2A 4MWZA 2WZDA 4REMA 4BO5A 4XWOA 2QRQA 3GFQA 5DT9A 1GFIA 2F3PA 1KKMA 2Q9UA 2ZI9A 1XAIA 3F4LA 1PTJA 4ARAA 1PUIA 3BM5A 1RZVA 2XXBA 3LGSA 3MN1A 1CEQA 4OBBA 3ZGXA 1YCDA 5NLLA 5IT9A 1A8PA 3JASB 1SQFA 4HAUA 1W48A 1H4QA 1F6WA 4K6FA 4MS4A 4EKDA 2A88A 1J70A 5AW9A 3TLXA 3JYHA 3K1JA 1KNQA 1T2NA 2QRNA 4WBNA 5LA6B 1IN8A 4EOGA 4F56A 5KHLB 3HKBB 1R0YA 1D5CA 5IK2A 3K9HA 1GPNA 4X1IB 3KYBA 3L0YA 4R2IA 5KVQA 3QWBA 1JDUA 3MT0A 5AI8A 5I7RA 2JF0A 3RV4A 4BFLA 3LWNA 3A1VA 3EC1A 3I9MA 5FYQA 1JF8A 1YRBA 4NS1A 2JNWA 5LC1A 3DNFA 2QX6A 1R0BA 4IILA 4RY0A 1VKNA 4CIDA 3SFVA 4AX4A 2IXAA 5I7VA 4YMUA 2YOGA 2ZJAA 4Q01A 1VPTA 1T0IA 3LXXA 3M4JA 5FWXA 4CLDA 4ZRDA 4TT3A 3HPRA 5TGTA 4EGCB 2VYCA 4PO9A 5LZ9A 4BL5A 4DILA 1TQHA 2VT2A 8GPBA 3OZSA 5IZCC 1DWPA 2BGJA 2X0RA 3AM5A 3R24A 4JUCA 2C82A 5MN5A 4NS4A 5AK0A 2QTMA 2VT6A 1V2HE 1Y7LA 2DFDA 2PPVA 3ETHA 4M46A 3GPDG 3RSQA 3FAZA 3WNZA 3J7TA 4M2LA 1WLYA 5HF9A 2PYZA 4AWAA 4LRYA 1JQLB 1QO9A 4HNUA 1PWEA 3IPRA 1IPEA 2D74A 3C6YA 3ZBTA 4B0PA 4G4SP 3BL8A 4DPKA 3IP6A 1U98A 2ET6A 3MWGA 4DQLA 4D79A 4TZKA 2FQYA 4NNJA 2FR1A 2APJA 1SUSA 1KE2A 1GAQA 5I7EA 1OVGA 3HEMA 2JBWA 2OHGA 3IUMA 2EG9A 4L9AA 1ZAYA 1U4NA 2H5EA 4EGJA 4CGZA 3ZWAA 1E7YA 1OWPA 4NL4H 3EDYA 3IDQA 4B5KA 2GLXA 5FAXA 3OZCA 5FTNA 3F6EX 1QB7A 3MEQA 1G21A 2PTGA 3LMKA 3U7RA 2DULA 1B15A 3HB9A 4I1SA 2B2XA 3DE5X 5SY9A 1ORIA 2C4KA 1B23P 2WMNB 5CK5A 3IILA 1K5PA 2JJYA 1ZR4A 3LGAA 4MIEA 1TMOA 1KQPA 4TXMA 2QZZA 5JROA 2J7PD 1DC3A 3DEHA 2VR1A 3ZOKA 2BFAA 3AR8A 1ONPA 4ZOLA 1UEXC 1OPRA 1IEVA 2D00A 4P31A 1H2YA 1QC5A 1RKXA 5ADUS 4H16A 4EL0A 4AO6A 1I2AA 1JYSA 2ECOA 2HMWA 4H0FA 4NV1A 1NYLA 3OA0A 1F5NA 5AOAA 3K4PA 3G8YA 4OQ4A 4MWSA 2P27A 1FCJA 1E3IA 3EWNA 2XZLA 4D8XA 2IHNA 2IVFA 1JPNA 2RGAA 4G09A 5ICEA 3PPVA 2BKLA 5HA5A 1CZNA 1NQAO 5EP3A 4JUBA 4EB0A 3FPCA 4I2VA 1TMGE 2E49A 4KX5A 2IV7A 5CDHA 1IWPB 1UMCB 2C4UA 4QU0A 3RODA 4RQTA 2RHCA 3DDHA 4MPJA 2ZAMA 1CHNA 3A05A 3A6LA 1S2DA 4J4TA 4D4IA 5JQGF 3MJRA 3T9EA 2MSWA 3MBIA 1W581 1GQOA 1Y34E 3KJGA 4RHUA 5FULA 4A0RA 5I8WA 3F90A 1C0IA 2QZJA 1O95A 3AW8A 3Q15C 4HWGA 4QYTA 5FOSA 1MAAA 2FI1A 3WDSA 1CJTC 4EG6A 2IU4A 3GRFA 4IWXA 1EK2A 1NAHA 2FOIA 4MVJF 1GUYA 3VU0A 4D9HA 1E3QA 2ZAYA 3IS3A 4MJ7A 1L4MA 3DF9A