4BWYA

P4 protein from bacteriophage phi8 (r32)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
288
Chain Sequence
NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSRGAVFNQFLLSGQSAFLGPNIPESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P4
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
molecule tags Hydrolase
total genus 88
structure length 288
sequence length 303
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bwyA00
1QG2A 2ZREA 1KI7A 3IKJA 4JT2A 4J0QA 2IYVA 3KTAB 2IYWA 5LB4A 3NBFA 2QQ0A 3CH5A 3FGNA 1NN0A 3IPYA 3DOFA 2Q9CA 1D9ZA 2VTKA 1HT2E 4C2TA 1II8B 1DADA 1QVRA 2OESA 3HU2A 3ECCA 3W90A 5K8LA 2WZQA 4PHFA 4GMXA 2H57A 5TARA 4XWKA 4UNNA 2AN9A 1GKYA 5EZ6B 4EPVA 4Q18A 1CTQA 4EUNA 2P5SA 1KDTA 4M0LA 5BWMA 1MO5A 5BQ5A 2ZI5A 4AG6A 2QM8A 1FFHA 4P3YA 4C9BA 5CB6A 2BBTA 2WBLC 2GCOB 3RS3A 4GOKA 3CNNA 3UANA 5BXQC 3THOA 4LBWA 1FMLA 2GWHA 3C4JA 3B2EA 4MUAA 3LH5A 3AP1A 1E2PA 3BE4A 4LHZA 5C2JB 1R5NA 2IHBA 3LBIA 1HUQA 1M34E 2BMEA 4QJ3A 2IYZA 1T4GA 3R9IA 1ZUIA 4GPTA 3DMNA 3GJ5A 1KSJA 1BIFA 3UWOA 4OI0A 1W36B 1LNZA 1W47A 2FMXA 2OCAA 1TQDA 4MITA 4RD0A 5FOVA 5JECA 3GLGA 3EPHA 1GVNB 2KJQA 4FMCB 1AKYA 3T34A 1LTQA 2AXPA 4R2HA 1Q0UA 2UZ3A 5L3SB 5FBLB 1YZLA 3KFVA 1F3OA 2CE7A 2ANBA 3T1TA 3OZXA 1KNXA 4IDOA 4PX9A 2DY1A 3FTQA 3GEHA 1COWA 1T0JB 5M04A 1DG1G 5EUQB 1G8FA 1XCPA 4JL5A 4O2LA 1W0KD 2EFGA 4QGGA 5FPHA 1J70A 1R0YA 3AUXA 5IK2D 2XTZA 3CR7A 4Z54A 5CJPA 2ZE7A 1KMHB 2WTUA 1GZSA 2C04A 4BFVA 5TXGA 1Q57A 1IXZA 1II0A 3UG7A 3AKCA 1QRAA 4P4UA 1S9DA 1KI9A 2VF7A 3BH6A 3T5DA 5JJIA 2P0EA 4HAXA 2YWHA 2PCLA 4RJLA 4LJ6A 4IOMA 5P21A 1A1VA 3TK1A 4IKEA 2CHGA 4DXAA 3KUCA 2AFHE 4I81A 5CITA 1NSFA 1W4RA 4B48A 4DB2A 5EE3A 2X1VA 4UNQA 1M6NA 1G6OA 4LPSA 3QKSA 2ZRFA 1NJGA 4P31A 1E2EA 5FOTA 1Z2CA 3QEJA 4URUR 5GVSA 4CEHB 2MMCA 1EFTA 5FL7A 3WMEA 4EIWA 5KTYA 1J99A 3LNCA 3QPVA 3MAAC 1N6PA 4B71A 2WKQA 5BW8A 2ZSEA 2GCPA 2D06A 4DLZA 2JJ8A 1DO2A 1N5KA 4TLBA 2ZU6A 4CYMA 4DUGA 3GMTA 2ORIA 2MSEB 1ZD8A 2IA5A 1O3YA 5EUMA 1ZRHA 1RZ3A 2AKYA 2AD5A 2D62A 4TTPA 1W5SA 3ASZA 3SBDA 3K53A 1LF5A 2XB2A 3THYA 3TUZC 1G16A 1CR4A 3NHBA 4M1YA 3RS0A 3EIHA 2ORWA 4HB3A 4I4LA 3LW8A 3RRZA 1JI0A 5AJYA 4L16A 1OIWA 3QF4B 2N46A 1BKDR 1Q21A 1F2TA 3TSOA 3IGFA 3QXSA 4OJQA 4PSAA 4PSVA 3QG5A 1XJQA 2C77A 2IYSA 2QN6A 3ZZ0A 4EFMA 1AM4D 2KSQA 5FOUA 2FEOA 5JS8A 1EG7A 4BLOA 1IY0A 4PHGA 1GRQA 2IF0A 2XX3A 5F2EA 3PEWA 1XTIA 5LBIA 2FU5C 3THWA 1AJEA 5KPDA 4GSYA 2OHFA 4MYUA 4KYUA 4LK2A 1J8MF 2WWIA 4MGKR 4Q66C 1MOZA 4JJZA 2CLCX 2C78A 3SYKA 1JR3A 4EFNA 1CR0A 2RB4A 4BLQA 4DWJA 3LX8A 4KITB 2A78A 2ZSDA 4KO8A 4NMMA 1D2EA 1KMQA 4F4CA 1P2TA 3PUYA 2QRNA 3GFPA 1X8JA 2DB3A 1DS6A 3E70C 1I4TD 5G53C 1Z08A 3QENA 4MRSA 1XWIA 2OM2A 3AVOA 4BFUA 1BH2A 1G20E 2ZI4A 1OFTA 1CLUA 5KDOA 2YC2C 4Q9LA 4C3ZA 4BZQA 3BWDD 4QNRA 1DO0A 4FI3C 1GKIA 4YMWA 2WAYA 3RS5A 1KK0A 3QXHA 2RGDA 2J3EA 2AD1A 3L43A 2X19A 2IT1A 2PZFA 1LB1B 2XSZD 2FEMA 1OIXA 2J7PA 1G8YA 3R7WB 3RWOA 1SKYE 1G3RA 1HY3A 1RE0A 2ODEA 2OFXA 5J4KA 1HT1E 5FL7D 5IT5A 2CBZA 5AJVB 1R0ZA 1LY1A 2FGJA 2CVHA 2IYTA 4LJ4A 1AQUA 421PA 1XEXB 1RFLA 2ODBA 2QTVB 4IJMA 4DEXA 3GLFB 4W7SA 3K9HA 3MFYA 1KYIA 3KJHA 1M7GA 1PJRA 5A4JA 1TTTA 1XX6A 5FBRB 2F9MA 1E2FA 1KOFA 2WVJA 1JEDA 1K5GA 1T3SA 4A2WA 5CB8A 3L8ZA 2OO7A 2ZI7A 1N6IA 1HH4A 3NVAA 2WSSA 3SJBA 1YR9A 3EZ6A 2WMOB 1OH8A 3ICEA 1DAHA 2KB0A 4OHZA 3AF2A 2IS1A 4WXRA 2V6JA 2OFOA 2VBCA 1SULA 2Z0MA 3GLGB 1ZUNB 5JLJA 2GBLC 3DOEA 3FB4A 5E7MA 3N70A 2H8KA 1NMZA 2ZE8A 4V0OA 5FBVB 4RCYA 1E2MA 3LO5A 3GLHB 1WF3A 3T5GA 5FTLA 4E03A 2VSFA 1KIMA 1Y63A 1DBSA 3FFAA 4E07A 2VP5A 5SZKB 1XPUA 3A1VA 4NCIA 2FWRA 2QSYA 4NCNA 2RMKA 2B6HA 4KSBA 3VKHA 2AWNA 2ZRDA 4JKYA 4DCUA 5KUTA 4FD2A 3T35A 5H70A 3SNHA 4R7ZA 4JLVA 3ADBA 3X1YA 1XP8A 4AK9A 2ZJZA 3RHFA 1NN3A 3PR1A 1Q1EA 1R8SA 1ZM3A 1JR3D 4QNMA 4TN1A 3D7MA 1IXRC 5CIQA 4URYR 2QMHA 3CRQA 4XTRA 2OILA 1WXQA 2VIIA 5KYKA 3PUVA 3FMFA 3KKQA 4QRHA 3Q9LA 4B74A 2WKPA 4C4PA 2GXUA 3PV0A 3THXA 1RW4A 3KDSE 3EA5A 5FTNA 4Q1CA 3BOSA 2R6AA 2IEYA 3W34A 2ZANA 3N2EA 4Q00A 1F5NA 2W58A 3GLIE 2BDTA 2YOGA 1XXHA 1WRBA 4UJ3A 5HE9A 1GITA 4ERNA 2HF8A 1G7SA 1HQCA 1CJTC 3R20A 1QHNA 2X8AA 5KOYA 1UDXA 3LXXA 1ESMA 3C14C 2J7PD 1XPOA 4NL4H 2QI9C 3AB3A 3MJRA 1GL9B 3MMPA 1FMJA 3QNUA 1D8TA 2J45A 4Z8XA 2PT5A 3LVRE 2BBOA 1NIPA 2BM1A 5KNBA 4P32A 3ONWA 2QZ4A 3MWYW 3U7FB 1XD9A 2VHCA 1G9XA 3WP0A 2WWFA 1BOFA 4EDHA 5H8WA 4ZI2A 3C5HA 3BGWA 1UBFA 2CNWA 3U7GA 2OBLA 3H4MA 1FW6A 2QBYA 3IILA 1VECA 3AGPA 1VG0B 4HATA 2QAJA 1XZQA 4OI1A 3THYB 4Q48A 3W5IA 4F93B 5DHFA 4ZI3A 1A5TA 5DLQC 3A8TA 5BYJA 3O8RA 1U8AA 1E79A 4TL9A 2NO0A 2P6RA 4V02A 3JZMA 5L3QA 3IHWA 4TMKA 5G40A 2EFEB 2V54A 5HE8A 4LBYA 5DH9A 4IEEA 2WSSD 4ZCIA 2FF7A 3IBGA 4TZ6A 2ZYTX 1KO1A 2TMKA 5DISB 4QXAA 3ZVNA 2H18A 4QL3A 4H1UA 2ATXA 4I1VA 4LV5B 4IHQA 3IIJA 4QBIA 1V5WA 2J87A 3NBYC 4P0TA 3KZ1E 1EXMA 4N0EA 1MRSA 1OE0A 4R9UC 3THWB 2ZTSA 4G5RA 1IQPA 4EPXA 4EPTA 1DTSA 1I2DA 1W2HA 2QTHA 4ZIRA 1CP2A 1R10A 2WWXA 4HI0E 1HE1C 2PLRA 2HYDA 1ZYUA 4BASA 2ERYA 1T3HA 2CL6X 4I1SA 1NBMA 1KI4A 5JS7A 5B30A 1O87A 3C7KA 2O0HA 2DPXA 4RD4A 3AKEA 3B1ZA 3UMRA 3CX7A 2FPKA 3DMDA 2GKSA 3OHMA 4KODA 3SR0A 1Z3IX 1P5ZB 3BBPA 4HAWA 4KAXA 4B43A 4DB4A 2JIZA 1XBTA 2ZR0A 3NH6A 3VR6A 2YJTD 3U44A 4PSKA 1AIPA 4DDVA 3SQWA 2QUZA 1UBCA 5FI0B 2XITA 3BFKA 4LC1A 1PVOA 4AURA 4NKRA 3AKDA 4BECA 1L4YA 3PJRA 4JSYA 1XTQA 4MRNA 2WSMA 3VR3A 4ACAA 4KBFA 2DYKA 4CEJA 4JLKA 2ZAMA 4JBWA 4LI0A 4XWOA 1OFUX 2IYUA 3OEHA 3TQCA 3CUEF 3U7EB 4A0GA 5L3RA 1Z83A 1X8LA 4B6FA 1P7CA 4LYJA 4ZO4A 4GP7A 2VA8A 5DE3A 1E2JA 2V1XA 3U3RA 1B0UA 3FMPB 4TLEA 3VAAA 1OKKA 3SS8A 2C99A 2JEOA 1ZNWA 3EX7C 3SQXA 3CF6R 1R4AA 4U00A 4KLNA 3GEEA 2R2AA 3EG5A 2P67A 2BJWA 3MG9A 4EKDA 5JRZA 4XJXA 2VP2A 5J47A 4XD7A 4B6EA 3H2YA 5JJKA 2CNWD 1IN6A 3I8SA 3KL4A 2I1QA 2J9RA 4JLMA 1Z22A 4MRVA 4DLRA 2NO1A 2H92A 5AUOB 3VR2A 4II7A 4DKXA 3K70C 1UKZA 2OCBA 3CKLA 3U61B 1YZUA 2YWGA 4OQXA 2QENA 2ERXA 2HLDA 1XMJA 2R6FA 1EFUA 2GRJA 1E79D 2XXAA 2GETA 1UKEA 2EW1A 1FPMA 3TBKA 1IJFA 4EFLA 1UAAA 1NVVR 4RZXA 4PC3A 3D6TB 2VP9A 4PHTA 5K8UA 3IEUA 4B3BA 4BGDA 2BCJQ 1ZC3A 4Q4HA 1JB1A 1WA5A 2JLRA 3TAHA 1BO6A 1UM8A 3M4YA 2JGNA 4WAUA 2G3YA 1VCOA 3OIUA 3CRRA 4JZKA 3W6OA 5BN5A 2WM9B 4TZ0A 4MGYR 3TH5A 1Z0KA 1YVDA 4OK5A 5EP4A 3K0FA 3P20A 1DAGA 2BWJA 2JDID 1RYHA 2AK2A 3WBKA 3ND9A 2JA1A 3W9YA 2GTPA 5B64A 2V1UA 4Q9IA 2FH5B 2GJ9A 4P33A 4AWXA 4EAQA 3V00A 2R62A 2O52A 4XWAA 5KNCA 4U02A 4O2RA 4Q01A 1E6CA 1QDEA 3FMOB 3AM1A 2ZIAA 3PG5A 4LHXA 1NBMD 3EZ7A 1LVGA 3UMFA 4C0QC 4XTCS 3ADKA 2R6GA 1YKSA 2PZEA 4IDNA 2I4IA 3BD9A 3L0SA 5EP2A 4N1AA 5A0FA 1ZAKA 1JJVA 3Q7QA 2JIZD 2OEPA 2Z43A 3CB4A 3I8XA 3CF0A 2ZETA 3FPAA 4AG5A 5TVKA 1GUAA 1ZCAA 1SZPA 1L8QA 3QBVA 3TVDA 2CJWA 4WIAA 2QQEA 3RRYA 3WYAA 4DBLC 1CBUA 1E2NA 1FZQA 1XMIA 2G0TA 5CK5A 1NVXQ 1Y3AA 1UADA 3KQUA 1GDDA 4ARZB 5H68A 1ZINA 2GVZC 2CEAA 3AVXA 4F4JA 1G64A 3GLIA 4TYWA 1S8FA 2OCPA 4ZV4A 1P2VA 3LVQE 3KB2A 3W5JA 2JLYA 1Z6AA 3RSLA 4DJTA 3EXAA 1XCGB 1MO6A 3F8TA 1OKKD 3ZVRA 2ZVPX 4YXWD 5HKKD 3CPHA 3AVWA 4M22A 4BFWA 1F2UA 3RC8A 2ZSBA 3T1QA 3FKSD 2YVUA 3QKRA 2QBYB 2JLQA 3ZS8A 1KI6A 3WRYC 1X1SA 3E5HA 3REGA 1UPTA 4L5BA 1OB2A 3OIYA 3CWQA 1SXJD 1HQYE 1W5TA 5HCIA 5KHOC 2ZS7A 4TMVA 5FL3A 2JCSA 1OH6A 4XD7D 1Z47A 5FTKA 3TUJC 4BEBA 5L3QB 1M7BA 2GESA 3CM0A 2ZJ2A 2GXQA 1H65A 2CLDX 1ZM7A 4C0SA 2CCGA 5IK2A 2VHJA 1W0JD 2XJ4A 2JATA 4MGZR 4PANA 4WVFA 4YMSA 2HLDD 3K70D 4GOJA 4RFSA 5ELXA 1OXXK 1JQJC 2R9VA 3NWJA 3QOFA 4RZ2A 3WP1B 1WCV1 4HAYA 5KSYA 4OI4A 5EXPA 2JLSA 3I32A 2R6CA 1N6HA 2HXYA 1P61B 3B1YA 1OB5A 5FR1A 4GZLA 1UEIA 1Z0IA 1KI3A 2EFHB 2JLXA 1N6LA 4IVRA 4MH0R 3KKPA 3ZZUA 3UPUA 2OBMA 1S1MA 2Y8EA 4A15A 3MLEA 4IFBA 1OXTA 5FPYA 3SJAA 2V4ZA 4A6XA 4XVUA 3BFXA 1KKLA 2ZROA 3RYTC 2J1LA 3U44B 2O8BA 4WXPA 3TR5A 1LS1A 1T5LA 2ZI9A 4F38A 5TV2A 3EC1A 3OFNA 5AJZA 1OPXA 2CMKA 1XB2A 2WKRA 3AVTA 1N25A 4ZKEA 3B1VA 1VHTA 2IS4A 4V0MA 2G1KA 2XNDA 3NDBB 3U60B 1A7JA 3DM9B 2ZRAA 4V0KA 4C0KA 2O8FA 1U94A 2GAAA 4U5XA 4DRZA 1NKTA 5K8IA 1C4OA 1W1WA 1QHIA 2ZS9A 3H86A 2GXSA 2J59A 1E9RA 3AEZA 5AJXA 3SEAA 1OXVA 1ESNA 5C4GB 1SKYB 4FW9A 1AS2A 4W5JA 4MDFA 3ZD7A 1NLZA 3MWLA 4MYTA 1QBKC 2ZJBA 3C15C 3RRMA 2KWIA 2OLJA 4FN5A 821PA 4AI6A 1IN7A 1FNNA 1S9HA 1UDWA 1QG4A 3JVVA 4RD3A 5CM9C 4CW7A 2J0QA 1E32A 3FYHA 1VG1A 2RGBA 1ODFA 5JWHA 1CRQA 3CX8A 2QEQA 5J5CA 3B78A 3RLFA 3HPQA 4Q19A 3K70B 2C9CA 1Z0JA 1SGWA 1LS6A 4NONA 4O25A 4P4TA 1KI8A 2IUUA 4TMTA 4FMDB 5AUNB 3U6BA 2A7QA 1RRCA 3DM5A 3I4LA 2VH5R 1OH7A 4BLRA 5KSOA 1KZGB 2XZLA 2ODNA 2GCNA 4TYNA 1DPFA 1BS1A 1G3MA 1GTVA 4NTZA 2WJJA 1QHSA 4Z8YA 4BRUA 4B3GA 2GZAA 3IEVA 4Q4HB 3C5CA 2NTYC 4LJ9A 4JKIA 1ZBDA 4ON9A 4GMDA 4JL6A 3ZGXA 4TQUS 2VP4A 4NYIR 5DNYB 1JPJA 2EQBA 2CCKA 4TTRA 1IJEA 4JS0A 4HUQA 4LSGA 1X86B 3DDCA 4NU0A 3DKVA 2NO6A 5JRJA 4BFZA 3LBHA 3ZIAD 4E5UA 3KQHA 2HF9A 2GJAA 1XXHE 3PCRB 1NG9A 1EWQA 5KNDA 1FNMA 4HDQB 1E3MA 2QL6A 2XSZA 4Q9JA 5CM8B 2GEUA 1E2KA 4UJ5A 4DDWA 3WXMA 4FWIB 2OXCA 2LCFA 5G3YA 4BRWA 2D7DA 4QGAA 3GJ8A 1N0VC 1CULC 4KHZA 1C1YA 1R7RA 3FWYA 2FV8A 5GJBA 2K5UA 1DE0A 2KI5A 3OE7A 2ZUCA 3OAAD 3I72A 3KJEA 3OFND 3U3MA 1JEEA 3MCAA 3VHLB 4G5GA 1OIVA 2A5YB 3ZZTA 3TSZA 4D81A 2HV8A 1ZM4A 2QTFA 4Q1DA 1ZNYA 3N2IA 2ZR7A 4ASUD 3H0KA 3Q7PA 4AYWA 4NDZA 3P26A 1VYUA 1FP6A 4A36A 3GLIB 2XNDD 3B9QA 1T9HA 2FSHA 2LKCA 4B34A 4BZXA 4TLAA 4TMXA 4GFDA 3LFUA 1EESA 5BN3A 4JIMA 2PJRA 2IYXA 2PEYA 2FSIA 2RKOA 5LPNA 5HCNA 2AKAB 1VDZA 1ZW6A 2NPIA 4A1FA 2EYUA 4YMVA 1YU9A 2QAGA 2E87A 1M8PA 4QHSA 4AKIA 3ND8A 2ZUBA 1F2UB 1L7VC 1FX0A 1R2QA 1KK2A 4Q03A 1EWRA 2OV2A 621PA 1KI6B 2J0VA 1AS3A 1U0JA 1Q1ZA 4IXNA 1VIAA 2D4HA 1U99A 2D3WA 3D31A 5BN4A 3EIEA 3SFZA 2G83A 2DBYA 3QXJA 3DZ8A 2QY9A 1TADA 1Z5ZA 3QPUA 2XJ9A 2A5GA 1SKQA 3TW4A 3I92A 1IN8A 3SHFA 2W0SA 2AL7A 2BCGY 4Q02A 4CGZA 4JL8A 3VHXA 1P60A 1P9NA 3VX4A 1G8HA 1NBME 2GK6A 1GNRA 2XEXA 4DSNA 2Q6TA 1CR2A 3AF0A 2QU8A 1LV7A 2WJHA 1K8RA 3BFVA 1KJZA 1P9RA 4KFTA 4RFSB 3AVYA 4DDTA 1S1CA 2B8TA 1T91A 4XVRA 5TMPA 1YR6A 1Z0AA 2C2HA 3L0PA 4TMZA 3ZH9B 1WP9A 2R65A 3OESA 3HYRA 4A0HA 4TYYA 3FOZA 3B82A 4DSTA 3QXXA 2EWVA 2F55A 3GJXC 5F3WB 3PEYA 2GAOA 2JJ2D 1U8ZA 1HEIA 4JLAA 1DAIA 1RKBA 1XEWY 3LD9A 4LC0A 1R6BX 5J4YA 4HZUA 1FQKA 2P6NA 2V9PA 3NBZC 1NLYA 3C8UA 4QGHA 5JWOA 1OH5A 3BS4A 1M74A 3JVUA 1DVRA 1DAEA 4HZIA 2W0MA 3EZ2A 1G5RA 3EASA 4D2IA 1G4UR 2BMJA 2FE4A 4PO9A 5TB5A 1VYVA 3KX2A 2IWRA 1FTNA 1E9SA 1KSHA 3IQXA 4P4SA 2V3CC 2O8BB 2VYFA 1KY3A 2O8CA 4B2IA 2AFIE 2JLWA 5IDVA 2A5FA 1Q12A 2C8VA 3GD7A 3PIRA 1PV4A 1X6VA 3I3SR 3M0EA 5EP3A 4HLDA 3W3ZB 3X2SA 2ZM5A 3LRPA 2A3RA 3PFIA 2IYYA 1RPZA 4NCKA 1WE2A 1XZPA 1YZGA 1S4QA 1SXJE 3OE7D 4IOJA 2BMDA 2CLSA 4Q1FA 1DOAA 1G5PA 4IVQA 4ZDKA 2VL7A 2BEKA 4CIDA 1US8A 4S35A 1RRFA 3X1XA 5F98A 2J46A 2J7KA 2I1VB 1JAHA 3RNLA 521PA 3PUXA 1G18A 2F6RA 1XCMA 3ZLJA 4EJSC 1DAFA 1GM5A 3SBEA 6Q21A 4WZ6A 4HUTA 5L8VA 1PUIA 4EJSA 4C0HA 2D2EA 3IHLA 1KO7A 4DLUA 2YKGA 2VSOA 4Q9HA 2Q0HA 1IN5A 2ZRPA 3SJCA 2CXXA 2WJYA 4N3NA 5C18A 4LBVA 2B8WA 1RC8A 3A36A 1FQJA 1NVVQ 4ZDWA 3CZPA 5E3HA 3U3JA 1TEVA 1OSNA 3HU3A 5A5GA 1JXMA 2IBMA 1G1MA 1E69A 2XZPA 1NKSA 2GILA 3IO3A 1MV5A 2CHQA 4WW0A 4LUCA 5FBQB 4G5OA 4FINA 3I1FA 3O47A 2VO1A 4URXR 1E9BA 3ZS9A 1E94E 3Q8XB 4KFRA 1N3BA 3X1ZA 2WJGA 1EX7A 1BYIA 1P62B 4OHWA 4QHTA 4RVCA 3B5JA 4B3XA 3I62A 2QORA 1T8UA 2Z6VA 3MSXA 3SZRA 1RVDA 3VTKA 1N6RA 2ZYVX 2NZ8A 4Y0VA 3FE2A 1Q3TA 4ZKDA 1GNQA 3GFOA 1GOTA 1MO4A 4IVPA 4B32A 3DKPA 4E09A 4OHVA 2V6IA 3PITA 4TMWA 2ZQ5A 3VR5A 4CZ2A 1G17A 2P65A 4M9XA 3BAFA 2A9KA 3BRWD 3BXZA 4M1KA 2YYZA 1UKYA 3QE0A 2WJIA 3CRVA 1SVSA 3AF4A 5SZIA 4YDSA 1EFHA 2ECKA 4IDPA 4IEIA 3LLUA 4GZMA 4Q4AA 3U6KA 3QKSB 4FMDF 2IUTA 3UKDA 4US2R 3GJ0A 2FPMA 3BB1A 4LOAA 1QHYA 1K5DA 3GEIA 1TUIA 3GJ3A 1OLOA 4M9QA 1ONBA 4Z1MD 5FH9A 1U8YA 3B8HA 4LYAA 1X3SA 3ZYCA 2H1LA 1N0WA 5FI1B 3E1SA 2JLVA 3AP2A 1N0UA 4CF7A 4DT1A 1OJLA 3OEED 2AR7A 1P2UA 3HR7A 2C9OA 2OG2A 2V7QD 3O8BA 3AQ4A 3NXSA 1IY2A 4LV6A 2FZ4A 3S1AA 1EFRA 5FR2A 2NO9A 1PLKA 3BJIC 3WNCA 3WRXC 3NEYA 2ZPTX 3SYLA 5HZHA 3X1DA 2ZSFA 4PFSA 1OHHA 5E7JA 4Q4LA 1MABA 2D2FA 4JLDA 1RJ9A 1OW3B 1I2MA 4LGMA 4DCSA 1E1QA 4G1UC 2PMDA 4A0RA 1E4YA 2QT1A 5GJCA 4EQ6A 4PPFA 1TPZA 1F2TB 5AUPB 1Z6GA 4B2LA 1HE8B 3I61A 2RGXA 1D5CA 5KDDA 5FOWA 3FVQA 2QP4A 4W5WA 3W6PA 4HB4A 2EWWA 2IYLD 1FOEB 5EE1A 1Z63A 1N6KA 3BIFA 4YMTA 3AUYA 1A4RA 3WMGA 2PLFA 3WHKA 5DYGA 5CDFE 4XVQA 1G5TA 3I5XA 4MUBA 4LDJA 3WBJA 4BFTA 4MDEA 2A5JA 1A82A 4I1UA 5FUXA 721PA 2JDIA 2Z4RA 1KSGA 2G0NA 4BLTA 4QOSA 3SN6A 1F6BA 5KO2A 4HDOB 3NG1A 3NTUA 1VCNA 4UXHA 2ZRJA 2REOA 5SZJA 3C16C 4LPKA 4BWYA 1B23P 5GJWC 4OQMA 3QI2A 5DI3A 1J90A 5KDLA 1Z29A 3MRSA 1IONA 2ZRLA 3DO6A 1XD8A 2OUKA 3K0AA 4IDQA 1OT3A 3Q3JB 4OK3A 3T12A 3BB4A 1ZU5A 4HB2A 3SU8A 4MRPA 2O8EA 2WHXA 1KDOA 3AF1A 2EU8A 5ANRB 4V0ME 5TDHA 1R5BA 4CEIA 3A37A 3CLVA 3PXGA 3UK6A 4JYBA 4L4UA 4OKSA 2B21A 2HCBA 3U7HB 4DCNA 2AHOA 3NH9A 1E2GA 3SC3A 1Z6XA 4D4LA 1GG2A 3PEVA 4M1MA 1W46A 4W9MC 3N5CA 3DEFA 4RD6A 5D3MA 1JALA 1ZJ6A 5CIWA 4YXWA 3CO5A 3BORA 1JQLB 3E2IA 5HKKA 4D4MA 3A4NA 4C2UA 2NMVA 4LJYA 2OSBA 2W2VA 3FKSA 1E0SA 1BYUA 4DLSA 2IK8A 5D3QA 1SXJC 4LYHA 2VSXA 4Q21A 4G5QA 1SXJA 4PPGA 1EFRD 4QM7A 4QC2A 1W4AA 3U4QA 2GXAA 4L9SA 1CJVC 4ABYA 4TYPA 4JLOA 2C03A 3AP3A 4CT4B 4TTQA 1FL9A 1YHNA 3QKUA 4HEJA 4LX0A 2P3SA 1OHHD 4UQOA 3KJIA 3HYTA 2R44A 5JI2E 4EJSB 4DSUA 1YE8A 1W0JA 2XTNA 2GZDA 1JNYA 3KKOA 4JBXA 4KFUA 1E1QD 1SVWA 1TF5A 2O8DA 1I4LD 1ANKA 3CW2A 2DFNA 2FFHA 2IYQA 1ZCBA 4F7WA 1WBBA 1Z28A 2H17A 3SI7A 2Q3HA 5HTKA 1CJUC 3QUSA 5DO9A 4ZDJA 2Q21A 3VKWA 1EX6A 2XGJA 1TEXA 4KLZA 2ZRBA 4HDCA 4URZR 4XSGA 5FBWB 4FWTA 1J8YF 1MR3F 1W4BA 2ASEA 2YZ2A 3BH0A 4Q1BA 4EPRA 3RSOA 1Q3HA 4JT4A 2O0JA 5L3SA 4AKGA 4PC6A 1Z6TA 1NG1A 4G01B 1XEWX 1GAJA 2NG1A 1KO8A 4NYMR 4JSTA 3WNDA 3MWKA 1GRRA 2ZRNA 1OFIA 1VIYA 4R2IA 3RC3A 3FMIA 5CYPA 2F1IA 4W5HA 3W6NA 1ZUHA 3ZVLA 4AYTA 2GA8A 2F1HA 3P1JA 3IPXA 4KCGA 1Z0DA 4URVR 3SYNA 4KFSA 1LFDB 1HYQA 1TMKA 2PMKA 1NSTA 2HXSA 2ZYUX 4PQYA 3B13B 3LW7A 2ZRHA 2W6IA 2B7BA 1AZTA 1C9KA 1P75A 3RABA 2ZJ8A 1XTSA 4YDHB 2IWHA 1P9WA 5FOXA 4M1TA 2C96A 2N1BA 4X8HA 1TF7A 2UKDA 1Z6YA 1CJMA 3EZ9A 3M1IA 5UKDA 3THXB 5EE5B 1U2RA 1A2BA 1E9CA 5AK0A 4ESVA 3EWAA 4JMPA 2W2XA 3QJYA 3OF5A 4RKEA 3TNFA 1XXHB 2G77B 2VHTA 1T8TA 4PZYA 1MRNA 1M1YE 4QGFA 1GRNA 2N42A 1L4UA 4L8GA 2QMOA 3UATA 3G82C 3IO5A 2L0XA 3L8YA 5DIFA 1IOZA 5FUWA 4CEHA 4TWZA 1UFQA 3SDZA 5AUQA 4A4DA 1RYFA 4OHXA 1W7AA 1DELA 5DI9A 3AVQA 3AVUA 4D0LB 1XPRA 1JXOA 5FPTA 3S1AB 3CZQA 1ZNZA 3EPKA 2NZJA 4D25A 3K8YA 1PZNA 1UF9A 2EYQA 3QVVA 1SHZA 2BBWA 4ZDIA 1CU1A 4RSGA 1H8EA 4HLQB 4JVLA 4GT1A 3TKLA 3CX6A 1F60A 1MABB 1CRPA 5AWFC 1RJ9B 3HU1A 4IFEA 5TY0A 4GDFA 2QMEA 2WICA 4O0MA 2JAQA 2FG5A 3CWZA 4DEYA 1WQ1R 1YZKA 3KUDA 4RFVA 1YRBA 2DWQA 3H1TA 3WY9A 1ZVQA 4LJ8A 5HPYB 1AGPA 2FN4A 4K46A 1W48A 1CKEA 2QE7D 2V8OA 3U2QA 3D8BA 1YR7A 2XAUA 5J4VA 2X2FA 1U81A 3WYFA 2F3TA 2FSGA 3QF4A 4TQAA 5EQTA 3ZJYA 3EPJA 1QHXA 1XU4A 2VPPA 2A30A 2ZRKA 3KQLA 1AZSC 5LB2A 3LQQA 2WAXA 2J0SA 2FFBA 4QG7A 4HLUC 3R9XA 1W36D 2ONKA 5DHAA 1AQYA 3VNVA 5JCZA 3TE6A 3PEUA 4QKQA 4S2EA 5EZ5A 2RGEA 2IEZA 1MO3A 4HLUA 2HEIA 3EA0A 4IDHA 1Z8FA 2IC5A 4JLPA 4POAA 3HPRA 4WBSA 1OYWA 3Q5DA 3ZVMA 3ZIAA 4RZ3A 4ZIRB 1SQ5A 3CRW1 2FA9A 4LHYA 3BB3A 3FFBA 5CDFA 3GFTA 2OFWA 4HSEA 4OL0A 1SVOA 1P73A 2FDCA 2ZJYA 2QSZA 4NBSA 1E2HA 1QVAA 2LWIA 2WWYA 2QRZA 4JVSB 2DFLA 1JJ7A 3LQRA 4LWZA 5JI3E 5DI3B 4H1VA 1GP2A 1X8KA 1NLFA 2CL0X 2WV9A 3FDIA 4ZCMA 3K0AB 1F48A 1G8PA 2YOHA 2B92A 4PZLA 4LJAA 1OXSC 2W6ID 1CJKC 2PH1A 3OAAA 1D2MA 2WIAA 4V0LA 4B2PA 5BYKA 4TT3A 1YJ5A 5J4HA 1NVWQ 2NGRA 4RZUA 2RHDA 4CEIB 4C0AC 2NPFA 1XJCA 2F1JA 4DCVA 4MRRA 5JCPA 4CEJB 4Q4JA 3QXCA 2XNSA 4ASUA 2WMNB 2VLIA 4F92B 1TU3A 2H5EA 4IRUB 3U5ZB 5CK4A 1E4VA 2VP6A 4JJKA 3KQKA 3KKNA 3TIFA 4Q5IA 3CR8A 3IIKA 2AXNA 3QIAA 5JWRA 2PX3A 5D3MB 4AD8A 3BH7A 3EIQA 4IXMA 1SVKA 4AKHA 3NKVA 4V03A 1XMSA 3R7WA 2VF8A 1CR1A 4JLNA 4NH0A 1AKEA 2YOFA 2RGAA 2QP9X 4A9AA 4PTLA 2XB4A 3LV8A 4FMBB 2ZJAA 2FPLA 3CIOA 3CNLA 4ILEA 1IN4A 2W6JD 2H7VA 4JVNA 2IUSA 1XEXA 2GZHA 1SXJB 4A0FA 1Z2AA 2HJVA 3GLFA 1XTRA 3VX3A 2CE2X 3A58B 4IOKA 4OI2A 5JBQA 3U4QB 4O3MA 4G5SA 3IUYA 4MKIA 5EXTA 1KTVA 3U3KA 4DCTA 3NBXX 1H8ED 4PC7A 4RCZA 3R8FA 2VHQA 3TVTA 4LZZA 4RD2A 3KXKA 2PZGA 4KV9A 1E98A 1TF2A 4C7OA 2O8DB 3HJNA 4PC2A 1FP7A 3VR4A 1RRPA 3T15A 3ADDA 1UKVY 3L0OA 3K9GA 1II9A 3CBQA 3WHLA 2FJUA 5AJWA 3ASYA 1NRJB 2REXB 2JLUA 1KAGA 1GWNA 1TU4A 2ZUDA 3REFA 1NY6A 2IXGA 4GRAA 4URWR 3TW8B 2JJ2A 1IAQA 4JBYA 3UWKA 5KSZA 2QGNA 3W8NA 3BK7A 1ZU4A 2G6BA 1Z0FA 2R6DA 4NYJR 1KI1A 2Q3FA 4QFMA 2GJKA 1H8HD 2J5XA 2LKDA 1X1RA 3GLHA 4DC9A 5J4LA 4C30A 1Q22A 3OIWA 3K0FB 1S2MA 4GNKA 4B75A 4DLVA 4RD1A 1E2IA 3B60A 2GJSA 3O8DA 4LRWA 3LA6A 4US1R 1G3QA 2RHMA 2QPOA 2OXRA 5G41A 1TQ6A 4X8LA 4KJZA 2IL1A 4ACBA 2VRWA 2XTMA 1KK3A 1Q20A 3RVBA 3R8CA 3Q85A 4PQRA 3VFDA 1E0KA 4FCVA 3SE0A 2AK3A 1N5LA 3A1SA 1E2QA 3F3YA 3MJHA 5CYOA 1QHHA 2PX0A 2XXAB 3AGQA 4B73A 2IF2A 1E1RA 1BMFD 2WWWA 3HR8A 4TSFD 4UNSA 1Q1QA 3A4MA 4NCHA 3DZDA 5JSZA 4TT3D 2ZE6A 2GJ8A 2CJWB 1UJ2A 4F91B 2OAP1 1NL3A 2XOKA 3DVLA 1SVMA 4KYIB 4B76A 3B1WA 1XFAA 5CLQA 3K0SA 3TUIC 1E99A 2DWOA 4OK6A 4OQNA 3VMFA 5E95A 2D74A 3EAQA 3KFXA 4BFSA 2QAGC 1ZD9A 1KAOA 1WMSA 1R0XA 2Q3MA 4BQSA 4Q7JB 1ZD1A 3T06B 3T1OA 4DIDA 1MT0A 3JZAA 2WIBA 3QKRB 3VQTA 4KVAA 2RH5A 3NC0C 2EFDB 4I1OA 3V4RA 2CK3A 2ORVA 3LAWA 5EXSA 1S3SA 4PPQA 1GKUB 3RDPA 4K8OA 5F9FA 4LV8B 2F43A 1ZM2A 1XRJA 3FHCB 1VCMA 2GDJA 1W2GA 3UG6A 3LBNA 5EJEA 4QM6A 3MD0A 4EPYA 1XD2A 4M1SA 4BFYA 4BFXA 2ZEJA 1NVUQ 3FHOA 1VYTA 1E9DA 3KXIA 3TMKA 3ZD6A 5FOSA 1S0UA 2ZRCA 4D0GA 4N0DA 5K8TA 1D6JA 5IHPA 5JMTA 1VCIA 3QEOA 3VKGA 3IBYA 2HCJB 5C4MA 4NP6A 3CRMA 3QBTA 1M2OB 4UNPA 5EE0A 4B44A 2ZS8A 1JBKA 4HYYA 1HTWA 2WWHA 1EFCA 1NN5A 2FOLA 2H16A 4AKEA 1KK1A 2VEDA 3GJ4A 3L82B 1YZTA 4OYHA 5IF9A 3PVSA 4G0NA 1CIPA 2GVDC 4OBEA 4RY2A 1G3IA 4DVGA 1CEEA 4TLCA 4JYCA 2P2LA 5JJLA 1COWD 2GF0A 1SVLA 2JASA 1Z07A 1XNJA 4KU4A 2QG6A 2O0KA 3MUFA 2UZIR 4Z1MA 2QGZA 8OHMA 1S96A 3KXLA 2WWGA 2OZEA 3L2OB 1XEFA 4ZPXA 3K1JA 2GHIA 3ICQB 1G41A 3OEEA 1ELOA 4MA4A 1NJFA 1FTSA 3B6EA 3B85A 3DL0A 4MGIR 4Y0AA 2C95A 1E0AA 4PAQA 2ZRGA 4DLWA 3QQ5A 4Q9KA 2V7QA 4DHEA 2J41A 1E96A 4Q4JB 5E4FA 1YRAA 1VHLA 4C0LA 3HP1A 4B47A 5B57C 3WNBA 5FUVA 3OIVA 1E1RD 2W83A 4PZZA 3LX5A 1NF3A 3K0EA 3AKYA 2UVQA 3F0TA 1ZM9A 1KY2A 1R0WA 2NQ2C 4K81B 4Q7LA 1XTKA 1MH1A 1G3UA 2ZRIA 3EARA 4WOPA 3W3AA 3KQNA 4A6PA 3LDAA 3ADCA 2XOKD 2O8FB 2BKUA 1ZIOA 1YZNA 2GEDA 2IS2A 2ZI3A 4QHYA 2CCJA 2RCNA 2FFAA 2ZE5A 5B58C 1G7RA 2QA5A 4GI7A 4MYCA 2FGKA 2KE5A 1ZC4A 2WOOA 2BJVA 4HAZA 1IM2A 1AS0A 2OAQ1 3RS2A 1VG8A 4DUGD 3G0HA 1AGRA 1PLJA 2ZU0C 4PO8A 4A2PA 3B1XA 2CK3D 3TRFA 1UEJA 2IHYA 3ETLA 4LYFA 1JR6A 2ODWA 1WBDA 4C7OB 4CT5A 2CDNA 2G9NA 1G19A 2VQSA 4NYMQ 3KB1A 4ESHA 1L2TA 2FZLA 1ZNXA 3BERA 1KNQA 5EE9A 2JJ1A 1SVIA 1ETUA 2QPTA 3R9WA 1XDBA 1R5OA 3SHWA 2F3RA 2QPAA 1LW7A 2EFCB 2VP0A 4YLGA 1VG9B 1NI3A 3M6AA 2GBLA 3WYGA 3LY5A 1IY1A 3C41J 1N6NA 4UXJA 4L9WA 3TLXA 1GL6A 4DLYA 2ZJOA 3IQWA 4NZYA 4A92A 4HUQB 3HDTA 2BV3A 2OCYC 2F7SA 4BUJA 2PCJA 1EGAA 4EPWA 1GFIA 2ZRMA 1FUUA 1GL7A 4TL6A 3LLMA 2IW3A 1TX4B 2A5DA 3PUWA 4M9ZA 1Q1BA 2BBSA 2BIFA 3LXRA 4ITRC 2DHRA 5J40A 4B35A 3J81k 1N5JA 2GF9A 2J0UA 4PAOA 1WB9A 2SHKA 4LJ7A 1WDTA 1XTJA 2WPDA 5E7IA 1NP6A 5EXXA 4OQFA 1J7KA 3CONA 1DARA 3AF3A 3GCGA 1QHHB 5C1BA 1HV8A 4M1OA 4FMCF 5GVRA 3TJZA 1GNPA 5JSZB 5JHHB 1W4CA 2WJVA 1NMXA 5GADl 4B3FX 2ATVA 1T0HB 5F9HA 4AIIA 2YWEA 4LBZA 2BOVA 3ZQJA 1NN1A 1W44A 4NCJA 4D4JA 1E2LA 4OHYA 3GJ7A 2BM0A 1KO4A 1Z06A 2OLKA 2PBRA 4TL8A 2P6UA 4LCBA 1G7TA 1U0HC 2NOAA 3F5FA 2CL7X 2PEZA 2P5TB 2OBNA 1JAIA 4ARZA 2ZITA 3TQFA 2VHUA 2ZJ5A 5LD2C 2ZR9A 4JLBA 2QAGB 4M21A 4JVMA 1G291 4Q47A 3SFVA 2HUPA 4Q7MB 1FX0B 2E1RA 3SJZA 4D80A 4WZBE 1UBEA 2ZAOA 3RS7A 2IYRA 4DSOA 5DYIA 3G5UA 1G7CA 1EK0A 1N6OA 4YQFA 1P6XA 4C0BA 1U90A 4AY2A 1KKMA 1CS4C 2F43B 1G21E 2RAPA 1CF4A 2HT1A 5EP1A 4FIDA 3EZFA 3NDPA 1XD2B 2KBEA 2D7CA 4UXIA 3MGCA 4E22A 2NIPA 2Q9BA 1KJYA 4IW3B 3FKQA 3X1WA 2IX3A 3K9NA 1YR8A 3B9PA 3EWSA 4LJ5A 4M8NE 3CPJB 1LF0A 4KSCA 4A2QA 4FCTA 4KXFB 4BEJA 2JJ1D 1XMVA 3RANA 1DAMA 2IXEA 3AVPA 2AWOA 3BC1A 1KDRA 3UMSA 4A8JC 5DN6A 4HZUB 3QF7A 3VU9A 1D9XA 3ZDQA 4A82A 2ONJA 2Z4SA 4R71A 4A8JA 1A2KC 4PHHA 4JLJA 3A4LA 1KI2A 2DR3A 4M1WA 1W49A 1XJ0A 3RS4A 1FUKA 3GJ6A 2MMGA 2QNRA 2R8RA 1RRGA 4YONB 2F1RA 1KGDA 1JECA 1K6MA 1T3LA 1TUEA 4NHOA 2A2ZA 5FPSA 4Q1AA 4WZAE 4P4SB 3MWJA 5L3VA 5FTMA 2O8CB 2CHVA 2PT7A 3KTAA 4V0NA 3T1VA 2QT0A 3I5YA 1NY5A 1OYYA 1G4AE 1KSFX 4Z51A 3EW9A 1XF9A 2Q9AA 2WPDD 5FPKA 2FSFA 1DEKA 1PLLA 3CNOA 2QROA 4IOLA 3I73A 5HZKA 5KPJA 1II8A 3VNUA 4BLPA 4CDGA 4AC9A 5FUYA 4BPBA 4NE2A 3GLFE 4DLTA 2GK7A 2AX4A 2YHSA 2BVNA 4MYHA 2YINC 2DWPA 3TR0A 1YQTA 5JZVA 2RGNC 5H1YA 2C98A 1VPLA 4L15A 3P32A 1T6NA 1US8B 2RGNA 3P4YA 3IDQA 5SZHB 5LDDC 1TNDA 4KI0A 2BKEA 4D0NA 3RRNA 4OQLA 1U0LA 3NEJA 4WA7A 2GCOA 4TLDA 1S3GA 3GQBA 2FFQA 2QE7A 4LHVA 3A1WA 4US0R 2WOJA 3GLGE 3A1UA 3GP8A 1M7HA 1RIFA 2C5LA 4UKDA 3NHAA 1PUJA 1GIAA 1W36C 1T5IA 1I4DD 2YC4C 3Q5EA 3B7GA 2PJZA 2Z83A 1KZ7B 3H84A 3NIBA 3P4XA 4PPNA 2X2EA 3AVVA 3GLHE 3LWNA 4PR0A 3K9LA 5HR5A 2E9SA 2F9LA 2REBA 5JEDA 2GNOA 2BC9A 4Q7KA 2QP3A 3A1TA 4GP6A 3CH4B 4B3CA 1QZXA 4NYJQ 1E9AA 4PXAA 1G8GA 1P2SA 4NYIQ 1JPNA 3EC2A 3DPUA 1KHTA 2C9YA 3HWSA 4MKGA 4OJKA 1DAKA 1NMYA 1TQ4A 3L0IB 2OT3B 3UXMA 4XSHA 3FHTA 3NC1C 4CVNA 4TL7A 4QJ5A 4GBMA 2BEJA 2DFTA 2ZSAA 4NPHA 4B33A 5KSPA 3CF2A 4QBGB 1D2NA 4LHWA 4M4SA 4MQBA 4X8MA 3TSWA 2IS6A 1E0JA 1KMHA 1OV4A 3AH8A 2G88A 2FX3A 4I99A 1KJWA 1P4SA 3Q72A 1NNEA 2OE2A 1VTKA 1NIJA 1ZIPA 2HT6A 4GOXA 4M9SA 4XOIA 3W8RA 5DN6D 2B7CA 2YWFA 3K09C 4HAVA 3QY0A 4DZZA 2J0UB 3K09A 1U98A 4PAMA 4Q4AB 4HAUA 3PUZA 4M53A 4C0JA 3V4FA 4ZCLA 121PA 2FNAA 1CXZA 4BLSA 4FXPA 3EPLA 4MKFA 4HB0A 1QF9A 1VMAA 1TQ2A 2ZVQX 1U9IC 2YNMA 2O5VA 3D3QA 3QVUA 1HURA 4DT1B 2JLZA 1U9IA 2NO7A 3KJGA 4PC1A 1TAGA 4PQFA 2Z5FA 3QKTA 4TQ9A 1V43A 2W6JA 1OFHA 4FCWA 3T61A 3TAUA 2BHRA 4AYXA 5C46F 4TYQA 1AN0A 5JFGA 1E9EA 1J2JA 1KDPA 2HYIC 4CRWB 2MSCB 2QMUA 3CPEA 3P27A 4BE7B 4MKHA 3QPWA 4QBHA 1N5IA 4R98A 4YC7A 4GL2A 3PENA 4YMUA 4B3DA 1DG3A 4D4KA 3OEHD 2IXFA 5FTJA 3V9PA 4F4IA 1G6HA 3UIEA 3TGPA 4G3XA 4RKFA 1OF1A 5JHGB 5LD2B 3VR1A 1UBGA 4D82A 4EQ6B 3AV0B 2RGCA 1MKYA 5CJ2A 2XZOA 2ZI6A 4KVGA 1YZQA 1P3JA 5IRCD 3ZQ6A 5GJVC 1GILA 4DDUA 2ZYWX 4PO1A 5DSZA 3KKMA 2QM7A 4BZPA 4U7DA 1Q44A 2DFKB 4H9GA 1AA9A 3RAPR 1R8QA 3O8CA 3QSYA 5B2ZA 2ANCA 1E2DA 1ZP6A 221PA 1H8HA 4HLCA 5CLLA 1N2CE 2HJGA 3QG1A 1E9FA 4DLXA 3DHWC 4QJ4A 1QHGA 1AK2A 1W0KA 2V55B 1IHUA 1JR3E 1P72A 1ZMXA 2G1JA 1KO5A 4LY6A 5DGXA 3U3OA 1OXUA 2MSDB 5G3ZA 2CVFA 2I3BA 1IXSB 3K0CC 2ZXUA 4XIGS 2KBFA 3IIMA 4X8OA 1TL7C 4M2LA 4UNRA 2DCUA 2GEVA 3K0CA 2W00A 3A6PC 3VU9B 4KBGA 3SOPA 4A8JB 1VKJA 2PL3A 2W2TA 3GPLA 4Q1EA 1HA3A 1SHKA 1BMFA 4D6PA 4TSFA 5FFMA 2O8EB 4DIEA 4XH9B 5KU1A 5AR1A 1GSIA 4D26A 2BMFA 2EVWX 3RWMB 3PQCA 3WMFA 2RGGA 2X77A 2YV5A 1IBRA 5JEEA 4QBFA 2HDNB
chains in the Genus database with same CATH superfamily
3ZE2B 1XTBA 2CGEA 3KTAB 4ZHSA 3NBFA 4LF5B 5LXTF 3CH5A 3P5BA 2PL5A 4GH5A 4EL5A 2VXYA 3DMFA 4GMGA 4MAFA 4MVJH 4D4HA 2VH2A 5CHYA 1HT2E 4WZAA 5ALSA 4HAIA 3VZCA 3ECCA 3UXYA 3QEBZ 4MARA 1DAPA 2WZQA 2YVAA 4QEKA 2WHRA 3FIJA 3M6WA 1OR8A 1PSWA 2C7VA 2NUPB 3A2MA 2H3EA 4UNNA 1MB2A 4QWMA 5HIIA 5IARA 4EPVA 4Q18A 1EMDA 3T1YB 1WDLA 2P5SA 1KDTA 3KWJA 4M0LA 3OJFA 2HXGA 1RKVA 3GDFA 4O4IA 5DYNA 3VVBA 2DBQA 3GFRA 3BSYA 1EJBA 1GHTA 3DF9A 1HQKA 1BFDA 1KEEA 3R75A 1FMLA 1RI5A 4IO0A 2CT8A 2JIBA 3B2EA 1GQ2A 2ZIZA 3BE4A 4LHZA 4W1PA 4XLZA 4AZ0B 4CR7A 3GUHA 4EYSA 1AHNA 1M76A 3EQ6A 3LBIA 2R8ZA 3M82A 4RHEA 1P8JA 1QO0D 2IYZA 3T7DA 4RC9A 2WR8A 2YMPA 2AI1A 3F6CA 5COAA 3GJ5A 3O26A 2PUVA 3H9EO 4FFSA 1G9TA 1D3AA 1CZLA 1XZHA 2FK8A 1YS7A 2FMXA 3EPHA 4H6XA 1YMUA 2H4WA 2NUTB 2YRXA 1GVNB 3Q3HA 2KJQA 4NOMA 8LDHA 3GLGA 3E2MA 1YVPA 1IHOA 1QORA 1ABEA 4NMHA 2J33A 4MI9A 5K3BA 2JLCA 3ZW7A 4RS3A 2HPZA 3KFVA 3WDSA 2ZUFA 1F3OA 1QV9A 1V9CA 2ANBA 2CE7A 1JUDA 3OZXA 1GPUA 2A1TS 4EW2A 4QA9A 1T8YA 2DY1A 2G4VA 3FTQA 4LX8A 3WTCA 1COWA 3B6KA 3SZMA 2L82A 3TOXA 4AWAA 1X7GA 4QIHA 4EYQA 2W8BA 4QGGA 2EFGA 2ODTX 5E9JA 4F84A 1FFEA 2JIOA 3HCWA 3SX2A 1NV9A 5HP4A 2Z6UA 1R0YA 2GQ0A 4M0MA 1RMYA 3HKCB 2R7AA 2JIDA 3D2CA 2AMJA 5AW1A 4Z54A 4CQJA 2ZE7A 1KMHB 4P4GA 1GZSA 2C04A 5EIFA 1K7FB 1Q57A 3EGCA 4BE9A 1VSBA 3MLAA 3MBIA 4M55A 1C8KA 1SPBS 3Q9UA 4MW4A 4MUGA 4D9NA 2JVJA 5HW0A 3BGIA 5AVUA 2PGNA 1J0BA 1NUAA 3PDHA 1JZQA 1Y3DE 2DUMA 1J6UA 4LJ6A 5HM8A 5L4SA 3NTQA 2E4UA 1A1VA 2A9VA 1EVJA 4RZSA 1G42A 2GM4A 2CD9A 3FLBA 3A4VA 5DULA 4DXAA 4KRGA 1H23A 3EGWA 4ZOLB 1KE2A 3ZHVA 1NSFA 4B48A 3U3MA 3DMTA 4PY2A 1K7XB 2PU5A 3H65A 3LWDA 3N87A 1I9GA 4QDJA 4UNQA 3T3EA 3G1TA 2GN9A 5GVSA 1NJGA 1E2EA 1I3OA 4TUYB 4URUR 2MMCA 5EHXA 5LLSA 1O6CA 3KLMX 5KYTA 4NATA 3MAAC 3DTTA 3LQKA 4RY8A 4B71A 3BMOB 2WKQA 3T3GA 1A9RA 1MC4A 2ZSEA 3BL8A 3T54A 3KU4A 4D4IA 3C6MA 1O4WA 3B9BA 3C3YA 3MTIA 1N5KA 3MUEA 4AZWA 1YCFA 4HFMA 2XCUA 2ZU6A 4XGQA 4V1CI 3WMWA 2ORIA 3ABQB 3GHYA 3E8XA 3KNZA 4MCAA 4MVJE 4LDQA 4EJMA 3AFGA 3LRTA 1EUDA 1ZRHA 5A9SA 4TT8A 4NMLA 4LYYA 1MOPA 4Y7CA 1L1RA 2W6NA 3FUUA 4O2BF 5E6RA 3QY9A 5EQFA 5TGZA 3ASZA 2XNJA 3BYZA 4E5VA 4FLFA 4OGKA 3CX4A 1NRWA 3GAFA 1MN6A 7REQB 3NHBA 3RS0A 1VSTA 2YXBA 4I46A 3EIHA 4OH1A 4WBNF 3HRKA 4EMBA 1EP1B 5FF9A 4R8RA 3LW8A 3G85A 3L8CA 4O3FA 4OHKA 1V1MB 5EMMA 3RUAA 1U7ZA 4EO7A 1RD4A 4NI5A 4L16A 1OIWA 2DWUA 2I80A 2NQ8A 4JQZA 2FR1A 1LNSA 1F2TA 1WDWB 2H4FA 5AHKA 4GF5A 2QX9A 4PSAA 3VDRA 3WKCA 4G1CA 2NU6B 3QG5A 3ZVKA 1XJQA 2QN6A 3D2LA 4WZBB 2Q50A 1Z4LA 5IAKA 1IXKA 3D6JA 2KSQA 3GLKA 5IWAB 1KPGA 3PE3A 5ENDA 1ZICA 2FEOA 2HDHA 3L1KA 4PHGA 4QRDA 4BNTA 1D07A 4B6GA 3A3OA 5CNIA 1JSZA 1HLGA 2A0XA 2A86A 2Y0PA 3K92A 4ZYYA 3PEWA 1G21B 5LBIA 1J00A 4XR4A 4FGKA 1WVIA 2AN3A 4AZTA 5BYBA 3NU1A 4TM7A 2QRQA 1G2PA 4L8VA 2BGGA 3P2KA 4DGSA 1FDRA 4LK2A 3A0UA 4ZJZA 3OPXA 4I19A 1X13A 4Q66C 5FWYA 3AUJB 4B6SA 3T3MB 4JJZA 1XA3A 4RTOA 1DFHA 1JR3A 2BFBB 3HDHA 2VUHB 2ZZKA 5IT0A 3VAYA 4FB4A 1CHNA 3FJOA 4KITB 1I3LA 1K1EA 2KM1A 4NMMA 4XX1A 4WXHA 1OMOA 3ADOA 1KMQA 2AYXA 3O8LA 2C9ZA 5EIHA 1JG3A 3TWOA 2QRNA 3VO1A 4U0JA 2CLEB 4J16C 1DS6A 3QKIA 1O9BA 5AO9A 1HM5A 2RI0A 3IPLA 4Q34A 2VHWA 3AFMA 4MRSA 4V1CA 4R5HA 3LC1O 4YCDA 4MVJF 3PNLA 1JU4A 1OFTA 2WJ6A 3DD5A 3PNMA 1IB0A 4N40A 1CDZA 4OXKA 4PZUA 5GV8A 3SS7X 3WLPA 2C7RA 4QGSA 1Y4SA 3I9FA 4QNRA 4TQGA 1N1MA 3SYTA 1QG0A 2M2IA 1GKIA 5DBHX 2UUOA 3RS5A 2W93A 1KK0A 1R3DA 2RGDA 3FCUB 4I9GA 4RK5A 2WU0A 2X19A 3D6FA 3Q88A 3V9AA 2IT1A 4M0KA 5KWVA 3JQAB 3LSYA 2FEMA 1L3CA 1B6GA 1OQAA 1U02A 2WU8A 5AJUA 2NVBA 3B8EA 4LF6B 3R7WB 3HDJA 3MN1A 3OZTA 5T67A 4KMSA 3LYHA 4H77A 5GY7A 4YV7A 3FWNA 2PLWA 4ISBA 1G3RA 1RE0A 3EIWA 5J4KA 3M6XA 5I3CA 3FPKA 3UGJA 4OGFA 2ZPUA 2CBZA 1RJFA 4L78A 5AJVB 1LY1A 1ZO8A 3G7NA 1NMEA 1U7TA 2FGJA 2IYTA 1AQUA 421PA 2ODBA 3IYLW 3N0RA 3F1KA 1XRQA 8AT1A 5KHAA 4J7AA 3PNBA 3DCYA 3UFXA 1PJRA 4HGPA 1TTTA 4HS4A 1P5JA 3K9WA 4Q3EA 3WLRA 5FBRB 2F9MA 5ER9A 1C7JA 3TCKA 1JEDA 5JASA 4X0EA 1F8GA 1NBOA 4KOAA 1IL0A 1HH4A 2WK1A 4F9GA 2YASA 2R68A 1Z2EA 3HGQA 3S2IA 3SJBA 1YR9A 3EZ6A 4NJMA 2ZWOA 1RQPA 3WFZA 3K4QA 4UHFA 4IICA 3PPYA 5H83A 1DAHA 1SC9A 2KB0A 1Y6RA 4OHZA 2OK7A 3D1LA 2P3LA 4WXRA 2YS7A 2OFOA 3TJMA 3DAPA 2BZSA 3Q6MA 1RMTA 1ZXBA 3KXDA 1TVCA 4Y9SA 3I12A 5CR9A 2PH7A 3TLZA 2A3NA 3ILYA 3S3TA 1QQ5A 1UZLA 3D54D 2UVPA 2CNBA 1ZG3A 2JD1A 3QHAA 4F4HA 1JHRA 3DMPA 4OP1A 1DBSA 5EYPB 3VZRA 3EWIA 4ZFNA 1JLSA 1USIA 1PT6A 2J3IA 1OD6A 3AG5A 3IQFA 1E3IA 2B37A 4FDAA 5F21A 2QSYA 1L7NA 1WXHA 3IP5A 4NCNA 4EHDA 3DLHA 3K7EA 5I7EA 5KWJA 1S5PA 3DEZA 3DYIA 4XIYA 5BVHA 3IEKA 3I2GA 1UPUA 3IL2A 2PK3A 2ZRDA 5JMPA 1NA5A 1YQUA 4NARA 5J2TB 2PIDA 4MUIA 1O9HA 1Z34A 1OBVA 3I6ZA 4X91A 3VZPA 4JLVA 4HVCA 4HEHA 5GP1A 3MWDA 4GI2A 3RT7A 4K05A 4I1IA 1PS9A 3KZXA 2WZCA 4GOND 4CGYA 4AK9A 5KHOC 1NN3A 1PL6A 3PR1A 2VC2B 4INAA 1JR3D 4QNMA 2O50A 4GR4A 4CN8A 4Z49A 5CIQA 4ZARA 4C5BA 5IM4F 5FCDA 3CRQA 1Y1SA 2VIIA 4L6CA 2ZSUA 2QMQA 3OC6A 1M2HA 4IKPA 4WK0B 4DF3A 3KKQA 3T3IA 3CJTA 4QRHA 1A8HA 3C7DB 2B4AA 2FPOA 4XQEA 2DP4E 1AHPA 4LIPD 2AZDA 1WW3A 4WK6A 3KETA 4M36A 4B6RA 1RW4A 4OYLA 1AB5A 3O38A 4B4DA 4CKZA 3THXA 3KKLA 3FHJA 2IEYA 1ULAA 2WD7A 3V80A 2ZANA 1F5NA 3G9TA 2W58A 3OHPA 1XKTA 2YOGA 1DDGA 1WRBA 2P4SA 1NJ5A 2H65A 4HGYA 1GITA 4XWTA 1D04A 5HE9A 1HQCA 1SMKA 3O1JC 4C78A 1X70A 2X3FA 2JGAA 3OLZA 2OCIA 1EJ6A 4EHIA 4X65B 4HWPA 4DJFC 4DA4A 3AM5A 5CA1F 4ZT7A 3EUEA 1H2HA 2WWRA 4CI0B 3FBTA 2PT5A 3LVRE 5B1YA 1Y9JA 1WLYA 1YZVA 2ZUSA 3CZAA 1H05A 4X6LA 3FB1A 3W5BA 3U7FB 4BWGA 1G9XA 1YXMA 2JAWA 4KNVA 1O0BA 1RM5A 4ZI2A 1U4NA 1RYDA 3BGWA 3E7DA 4HNHA 4KIWA 3JARA 1FIUA 3OJOA 1J7JA 2QAJA 1XZQA 3EH2A 3FCSB 3L92A 1R9GA 2AJ8A 2OAEA 3PS9A 1CJSA 4RKQA 4DCCA 1ZJYA 5EVCA 4F93B 1E1YA 1A5TA 1IFXA 4OXXA 1DKOA 3UCXA 4Y3UA 1U8AA 3GVXA 3SBXA 1V9SA 3EZLA 3RK0A 1YCHA 2Z2IA 4J1QA 5DNUA 3P9YA 5G40A 3B70A 2O57A 2GTHA 2UYGA 1F2DA 5DH9A 4BQNA 1V2GA 3IBGA 4F96A 4TZ6A 1QH1A 1KO1A 3ERCA 3QUCA 3TI9A 3BXPA 4RVOA 3PWZA 2IZ6A 1E3QA 3I6BA 2IU3A 4CM5A 1ECBA 1A2QA 5JCJA 4BO8A 1OYOA 1U3DA 3PEFA 3IIJA 4AO8A 4F2PA 3UH0A 3EEYA 5GQSA 4BRZA 4QSMA 1V5WA 2J87A 4EHLA 5JNTA 3WQBA 1L1FA 2Q7OE 1NXSA 2W2NA 1EXMA 4N0EA 3TNJA 1IM8A 2GH1A 3L84A 3R7NA 1KH3A 3IP3A 4G5RA 1EBBA 1G2IA 1LDNA 2FF5A 1DTSA 3LGXA 3VJKA 4EPXA 4EPTA 3I2IA 4JB2A 3GRVA 4P2GA 1VLVA 1QQ7A 3BQMB 1Q7GA 1U9JA 1HE1C 2BRUC 1EAYA 4HI0E 2HYDA 3H1PA 1XG5A 4U7HA 1XQ9A 1LWNA 1DHTA 1B74A 1SU7A 2Q5QA 1S2GA 2ECQA 3C5VA 3OPYI 5DHTA 1UBJS 2CL6X 5EINA 2PUDA 2YJ6A 4F7DA 1NDUA 3AFOA 3BCUA 3FZYA 2AS0A 5JS7A 2XHEA 2ZTLA 2AQKA 5A7HA 2FPGB 1VLHA 2O0HA 3SFTA 2JLAA 4NE7A 3UMRA 4R40A 1HYBA 2FPKA 2VDUE 1Z3IX 2WYHA 2D59A 2ZR0A 4YRQA 3VR6A 3U44A 1AIPA 2OGSA 3AV3A 5FI0B 1U5BA 1XAGA 2X4DA 1XLTC 5CXUA 3AKDA 1CVRA 5TQ2A 2WFLB 4NBLA 1ODCA 4MRNA 4NNOA 3FFXA 5F7OA 3M6VA 1XLTA 5EJGA 5KYWB 2DYKA 4JLKA 1LQ2A 2Y9MB 1JKFA 2I5PO 1NXTA 1NKVA 1XPJA 2EZ4A 3QLJA 3RBVA 1RC1A 1RXEA 5BUZA 1S2IA 2V74B 2VUIB 3OEHA 4I5GA 4P53A 3H2JA 4MQLA 4AICA 1Z83A 5TLSA 2Q6VA 4CTNA 3JQCA 3NOOA 1ZMRA 3JASA 1KQNA 4WEOA 1Y8CA 1W5BA 1PJQA 4GP7A 2EG5A 2ZJ7A 1FTGA 4XYLA 1FW8A 2V1XA 4PLWA 1DKLA 4QD3A 4TLEA 3GZJA 2R84A 3ON5A 4NC9A 2C99A 3L7AA 4RYLA 2G1UA 5FULA 2C3YA 4ADSG 2JEOA 3DDWA 1KDYA 1BE0A 2AFIA 3EX7C 1CD5A 1NOJA 3UENA 2XQKA 3I1JA 1M1XB 3AETB 4U00A 3OO0A 4MWBA 3EG5A 3TLAA 3BF7A 1PT8A 2X5NA 4YQEA 3AJ8A 4RK0A 5HRCA 5DM2A 2YMQA 4KO4S 1O08A 4PYIA 2G08A 2J6CA 5J47A 3ENVA 1JR2A 2NUBA 4B6EA 4GWGA 1H2AS 1YI1A 4AXBA 4OM7A 3TLYA 2BFEA 3MLBA 2I1QA 1M1UA 2CB0A 3OWXA 4MRVA 4R41A 4ZPJA 5AUOB 2H92A 3OPYA 3TLMA 5K8VA 2OCBA 3CKLA 1QZ3A 1TC1A 2PD3A 3DXZA 4JZYA 2QENA 2XQGA 2ERXA 1WXIA 1X15A 1HWYA 1M34B 1CZUA 4RPLA 3OCYA 4P7FA 4OHMA 5F73A 3ROTA 5IWCA 4DR4B 2G1AA 1IJFA 2GLTA 4RZXA 5IDYA 1EWYA 2H31A 2Q3JA 3D6TB 4I4TB 3G9XA 3GMSA 4O4IF 4PHTA 5FWAA 3H11B 3QFSA 1Z73A 4DSNA 4BGDA 1Q19A 1O95C 1UXGA 4RF4A 5KB3A 2XT0A 1FP4B 4B4KA 3TAHA 4D6YA 5IKEA 2VXBA 1BO6A 2JGNA 5JCJD 3MWFA 4WAUA 3TVYA 1A1SA 4CL2A 3FNIA 3OIUA 3JVIA 3PGKA 4NNJA 2C1ZA 2WM9B 3BGVA 2CYBA 3WIVA 2Z58A 3NIGB 1Z0KA 4DYVA 5K9ZA 4TZ0A 2E55A 4Q6WA 3LIPA 1QAMA 3PT9A 1FSFA 4OGGA 1KE1A 3SJUA 1RYHA 1F9AA 3VU1A 3ND9A 1EYZA 4E7OA 5B64A 4ODIA 1NF8A 2FH5B 2XUQA 5G4KB 3W7VA 4BP8A 1OZHA 1U65A 2ATEA 3VPAA 2R62A 4Y30A 3S70A 4LZWA 5KNCA 3NBUA 3EGIA 4O2RA 4Q01A 4AQ7A 1E66A 1E6CA 3S29A 1QDEA 4M37A 4ENWA 1O8CA 2VN8A 2ZIAA 4HNQA 3ELWA 3RRFA 1HK7A 3ZY2A 3MGBA 3RTGA 4DR6B 3ADKA 5EMNA 1MX3A 4DV7B 2CEKA 2VQDA 4TVBA 3V2IA 4WLUA 2K2QB 3IQZA 2AA3A 2E3JA 3Q7QA 3G9QA 2OEPA 3VR6D 4TKVA 2ISCA 4GM0A 3IEPA 2VA9A 3NOQA 4UCQA 4UMFA 1GUAA 2SCUB 2VSQA 1QIJA 1ZCAA 3NAQA 1H1TA 4HPWA 4PQEA 4QO7A 3WL6A 2PZ8A 1CZHA 4EHFA 5BV8A 4F9FA 2X5JO 3IT3A 2QQEA 2X0IA 1CBUA 1WR8A 4K9RA 3PQ4A 3ZE7A 4K1XA 3K1YA 1ICEA 4LSZA 2QDXA 1PWZA 2JZNA 4XJTA 3BIWA 4DJ5X 1Y6FA 3HVIA 3VH1A 3KQUA 3TL6A 4MV6A 5H68A 3LUFA 3DR5A 3MPOA 4JQOA 4LGVA 4QOFA 5K3FB 3AVXA 4GLOA 4F4JA 5CFNA 1N2BA 2OCPA 3BK2A 5ED0A 3RSGA 3ZE1B 2FY8A 3LVQE 3RVSA 1OZ0A 2CBXA 2QTCA 3MIZA 4P34A 4DJTA 1P9OA 4W7HA 4B80A 1TTHA 1LC3A 2PR7A 4YJHB 3RM3A 3SVZA 1T36A 2FWNA 1B3RA 4YXWD 1QLHA 5HKKD 3PRKE 2IKSA 2ZLBA 5FIUA 3R7DA 4B3HA 4HV4A 2QGFA 2FZVA 2A0WA 4DV2B 2HSGA 4M87A 1F5SA 4MLPA 4TROA 1X1SA 3E5HA 3VNAA 1OB2A 1BE8A 3S27A 1SXJD 1R66A 1K97A 1VL0A 1HQYE 1LCIA 1Y8QB 5HCIA 5AESA 4I36A 3O2NA 1OH6A 4DCOA 4QQ8A 5FTKA 3UBTA 1M7BA 3MTEA 1EH5A 2FZ5A 4BP3A 1E92A 2GXQA 4DQUA 3RWBA 2CLDX 2DGDA 5H0IA 3SPXA 1JJIA 4C0SA 5IK2A 3DXXA 3QYFA 4PCUA 3ULKA 1A95A 1ZI6A 2PS3A 4IJQA 1I2ZA 4DMFA 5IKXA 3RIGA 2K2WA 3AB7A 1TTQB 4PZEA 4UVGA 3ANXA 4EGFA 1JQJC 4DAOA 2ZXFA 5HG0A 2OZLB 5IM5A 3DZGA 2B8EA 5WRFA 1M2OA 1L7AA 4OI4A 2C4NA 5EXPA 4I8XA 2EKLA 1NVFA 1SZJG 1G0NA 5FR1A 4GZLA 4GXRA 4NBRA 2I2AA 3AEKA 2YS6A 1JSCA 2OECA 3ETNA 2C07A 4IZIA 3RR2A 1GPYA 3UJ3X 4K6CA 1ORWA 4MH0R 4ARZA 4OVKA 3WLAA 2HRBA 3OMWA 3UPUA 2IELA 2JIMA 3REQA 1PR5A 1C7EA 4Z0HO 5K0TA 5FA8A 4DTIA 1O0CA 3HA2A 4EB6A 1ZIDA 1EVKA 1OXTA 5FPYA 3FNRA 4A6XA 2VQFB 3HKBB 4QQFA 3RYTC 1I3KA 2ZJ1A 2J1LA 3T4EA 3T4XA 1H6DA 2D5CA 4WXPA 2GCIA 1P7VA 3GEDA 1KF0A 4FFLA 2UZ1A 1T5HX 4U6SA 2I4OA 3PDIA 2J4FA 2FSVC 5TPZA 1AXEA 4DV3B 2CMKA 3OQJA 1ORVA 1WXFA 3L8DA 6ADHA 1ISFA 3U4HA 2FSVA 3Q0EA 2PANA 4G85A 2OQIA 1E1KA 5LUAA 2FW1A 5FHQA 4BMCA 1PSZA 2H1SA 4CMJA 4YRMA 1G20B 5AVJA 1AHIA 2OD7A 2G1KA 4L7QA 3NDBB 1T0IA 5BVGA 3BF8A 1JSRA 3BWXA 3GZNA 1C7ZA 4BEWA 4FGLA 1WXDA 3ZGOA 3F4LA 3FCOA 3RT1A 2O8FA 4FQ7A 4G07A 4U5XA 1ZAYA 2ATIA 1DJMA 4O5AA 2ETVA 5K8IA 2Y05A 2YV1A 3E7WA 3NGLA 4ZC1A 3COYA 1KEPA 3OIDA 4XGIA 1NVEA 1UXJA 3AEZA 3STVA 3AW8A 4ZOEA 4BMOB 3WGKA 3OEYA 5C4GB 5J3JA 2C8KA 3TQQA 2GPTA 4W5JA 2IDMA 1XU7A 3AK4A 2BH2A 1Y4ZA 3IPCA 3I05A 2XMCA 1IDOA 1NLZA 2F9FA 3MWLA 3TYXA 4C6SA 4KDEA 4Y2HA 1QBKC 1PEKE 1XZEA 3FI9A 3C3DA 5E8RA 4TKMA 3CKMA 5JS6A 3DLPX 4U6QA 4FYYA 4QYWA 2CHFA 2VJOA 1BG6A 1XRMA 1QG4A 3RUFA 3JVVA 3FYCA 2J0QA 3L6RA 3VR6H 5FNVA 4Y0NA 2QEQA 1CUAA 4JP5A 1Z4OA 3CEPB 4XQGA 2P91A 3K70B 1IHDA 3FFWA 3QLUC 1N9GA 2X22A 1UDBA 3E4CA 4UU1A 2G9RA 4P4TA 2XXAB 2I4LA 3QLUA 4AMUA 4PYLA 5LP6B 2FPPA 1B4DA 2GCNA 5JOQA 3KSZO 1JFRA 4OFWA 1G3MA 4XWYA 4BRUA 1THTA 1ZSNA 3OPNA 1SXHA 2GEKA 3GA7A 3F1LA 4KIFA 1QE5A 3C5CA 5JCOC 1QPZA 3C7AA 4JKIA 1ZBDA 4ONEA 2JRCA 4ON9A 3CW9A 4GMDA 4JL6A 4X63A 5IN4A 4EY4A 2GD6A 5LQNA 2Q4EA 4X7PA 2QQGA 2VP4A 3JWPA 4GQAA 4NYIR 5A4IS 1UJ4A 2CCKA 2FFJA 2IBTA 2HQRA 3IHKA 1IJEA 4TTRA 4PW0A 4HUQA 4IJWA 3VOAA 4BHTA 4DM4A 4AY6A 2IDKA 2XBLA 2CVOA 1KZYC 2IU6A 2NO6A 3DDCA 1WHTB 2GYVA 5JG7A 4E5UA 3A1EA 5THXA 1N2OA 4RF2A 2PGXA 4NG4A 4E15A 3PCRB 2VATA 3Q3EA 4HDQB 5BNFA 4EZIA 4EY7A 3EPLA 4ZVVA 3TSCA 3GFSA 1V7CA 4ZU1X 4DA6A 2JGEA 1JHXA 1E2KA 1I6WA 4H4CA 2WD9A 3AZOA 4UJ5A 1BCRA 4DDWA 2XKKA 1GUZA 4FWIB 4HGQA 4BRWA 3TDKA 4B84A 3A9VA 3H2BA 4QGAA 4XCVA 3ABIA 4MOWA 2WSYB 1EK5A 2BISA 1LBHA 3FWYA 1N2IA 2K5UA 1FYFA 3D8NA 4FSXA 4WERA 2EBWA 3RARA 4AULA 4DC0A 5BWCA 5JADA 3DKIA 2ZUCA 6LDHA 5TPZD 1JILA 3MCAA 4G5GA 1OIVA 3DZHA 3C3XA 1G8JA 2P2YA 3TSZA 1BU8A 3ZZTA 1RTKA 2QTFA 4R7TA 5EI5A 5BW6B 1XHEA 1ZNYA 4R6WA 2ZM6B 1JLRA 4P7GA 3MOGA 3RUEA 2XH8A 5EZQA 3D3WB 3TRIA 3VSDA 1GPAA 4A36A 3VV3A 4UTXA 1T8WA 3BE8A 3JXEA 3GLIB 2FSHA 1P4RA 1M3SA 2LKCA 4QX6A 5JS1A 4EHBA 1Z2NX 1GNLA 4GFDA 3LFUA 2E0IA 3LZCA 1B41A 1ND6A 4HNRA 4XUCA 2IYXA 1GYQA 2N47A 2NLOA 2FSIA 2RKOA 2PJRA 4CG1A 2NPIA 4KJXA 2A33A 4JI1B 4KWIA 5F78A 4PO3X 1TA0A 2HIAA 2R6R1 3H2HA 4AKIA 3AFHA 4J1NA 2B8NA 3CEMA 3D7RA 3KT3A 5DWVA 1L7VC 1KK2A 4Q03A 1XZ8A 1KI6B 1X8XA 2H06A 2J0VA 4HJRA 4GPBA 4L85A 5KNCH 3AHCA 1Q83A 3W5VA 3ZHCA 1WCWA 1CEYA 3JPWA 1Z4KA 4DABA 5HIKA 3AZPA 3BIJA 4FZJA 1KAQA 1TADA 4ARCA 1J1IA 3QPUA 5J1SB 5DK6A 4Z4IA 1BXRA 3H5TA 3WL7A 1JYSA 3EDCA 1IN8A 4RQBA 4MIYA 4TMYA 1DWQA 4E12A 4Q02A 4RPKA 5LIRA 4HS9A 3G6KA 1D0SA 3P52A 4D79A 3DTVD 5I3ZA 5D00A 3A25A 4PINA 1GNRA 3FSEA 3TBFA 3KT8A 2Q6TA 4CMEC 1CR2A 3GN1A 2QU8A 1LV7A 1NV8A 1FSZA 1TC2A 1KJZA 2ZJFA 2AUTA 3BFVA 3L6CA 4KFTA 3SIRA 3SXUA 3HEMA 3UT5B 4YJGB 4CMEA 4XVRA 4MQ4A 2MT9A 5TMPA 1QAQA 3IQDB 4BQRA 2IQIA 1LW6E 1GR1A 1Z0AA 3EWNA 3L0PA 4X1YB 4TMZA 5K45A 1E1DA 2R1TB 4TYYA 2B30A 1UOPA 3E4DA 5IAAA 4DSTA 1KEKA 1P19A 4X54A 3GJXC 3S2ZA 1U9CA 2Q7DA 1U3VA 2O2EA 5AM3A 4ZCTA 1RKBA 1MCZA 1UJBA 2NADA 2VUUA 3LD9A 1WZCA 4GYWA 3W04A 4KK4A 5BV7A 5J4YA 3EEFA 3RUDA 5DP1A 4MKRA 3C8UA 1TVKB 2GZRA 4QGHA 4NVRA 4CKEB 4INPA 2Y1FA 5JXGA 3BS4A 1OH5A 1GYRA 1P31A 3LHSA 3JVUA 3HCDA 3PC6A 1DVRA 1ODLA 3JWGA 3F6PA 4G4IA 3TIGA 4UM8B 4X61A 1NP7A 1SK8A 1G5RA 3EASA 4LI3X 5CU7A 3WA6A 1CWUA 4K7JA 1QXSA 5TB5A 3A70A 3T0GA 2VTBB 3KX2A 1RBYA 2GO1A 5KOJB 1XJWA 1JAYA 3DA8A 4LF4B 1KSHA 1VLLA 3IULA 4P4SA 5DIZA 2O8BB 2VYFA 2YIDA 2HBYA 4J4BA 4UREA 2O8CA 3OLXA 4KN6A 4UEOA 1DQZA 1YFZA 2AFIE 2A5FA 3GD7A 2C92A 3Q0TA 1PV4A 3VC7A 4YAIA 1X6VA 2P9BA 3ETCA 3W3ZB 4HLDA 2HNBA 3X2SA 1FUEA 4NNPA 3L4BA 1JDSA 3TTYA 1QOQB 3GPDG 4NCKA 4C7MA 1C1DA 2V7WA 1SXJE 4WEQA 3OQNA 2Y1OA 4J9UE 1Y6GA 1A4UA 2CLSA 4RVDA 1I0LA 3SC2A 3ZU4A 2W2LA 4X85A 1XP5A 5CT5A 1OY1A 4ZDKA 2HPHA 4YV1A 2O19A 1DO8A 1LSOA 2ZJ4A 5IVDA 4C5AA 2Q5HA 3L4JA 5KKCA 5F12A 3UAVA 3HFRA 5JISA 1JAHA 1AN9A 1G18A 4TRJA 2EZ9A 2G06A 3ZLJA 5FNZA 5G1PA 3ZGLA 5EIXA 1I1NA 1S8NA 1W25A 1EBUA 4OUDB 4WZ6A 4FMPA 2DBVO 1W8DA 2QM3A 5C34B 1PUIA 3U4MA 1DB3A 4IGAA 2LCQA 4C0HA 2F00A 2D2EA 5L7YA 3QMWA 2R751 2JEYA 1PN3A 2RH4A 1YJAA 1Q0QA 4Q9HA 4CCSA 1BROA 1MX5A 1IN5A 4FE4A 2PNJA 2CXXA 3SJCA 2GYYA 3X1JA 1RFGE 1T9AA 1RAEA 3F46A 4LFBB 1NVVQ 3WWDA 1TEVA 3HU3A 2V65A 1JXMA 1QP8A 2IBMA 4MUNA 4XB2A 1O8BA 1REQB 3S2FA 5ALVA 3I9V6 2C3MA 2R79A 3UFBA 5HQ3A 5HF9A 3E15A 1IMOA 1D7OA 1KRWA 3H2KA 5LZ7A 5LZ5A 4MDHA 2CHQA 1SQGA 2GBPA 3ONNA 4QU5A 4UAUA 3GGPA 3PQ8A 4FINA 2YICA 4URXR 2MDTA 2GN8A 3DE4X 1CFJA 1VJCA 3IUMA 3QUTA 4KFRA 5CNKA 3MWEB 3GARA 1AK9A 2B7LA 4HLNA 3U3DA 3FOAA 4DA8A 2VK1A 4RTJA 2AH5A 4OHWA 3B5JA 3V8PA 4X6UA 3TMYA 4B3XA 3WRVA 3MSXA 1NF2A 2Z6VA 5DMHA 3SZRA 3H4TA 3VTKA 3WYBA 1N6RA 3GIWA 4N18A 2ZOSA 1HX7A 4EGJA 3RSZA 2NZ8A 5EPEA 5CA0B 1Q3TA 2GPWA 2YWCA 5BP7A 2PKRA 3HABA 1GNQA 3GFOA 4YROA 4FDLA 3OCJA 3G2HA 3B53X 3MQ2A 5TT0A 5CXSA 1UMCB 4OHVA 2V6IA 3PITA 2G8LA 4DIBA 1G17A 1A9XB 3BAFA 2A9KA 2JI9A 4M1KA 4XE5A 4MICA 4J2HA 2VJPA 1LLDA 4IDFA 1K3TA 3KLOA 2C57A 1AUQA 3QE0A 5EMJA 4AO6A 3HXOA 1DI0A 2HRCA 3W5UA 5SZIA 2VBIA 1EFHA 3CCFA 3KR2A 2ECKA 5KQPA 3CE6A 4TRRA 2NT3A 1Y1KE 4GZMA 3ZZ1A 4DCPA 3TTUA 4FMDF 4LF8B 4DG8A 1U0BB 1VI6A 1I94B 2D1FA 3UOAB 3LC0A 4M9QA 1FLDA 3W2HA 1ILEA 1QOZA 2G07A 3TI7A 1YUMA 1U8YA 5IP5A 4Z7QB 1O94C 1X3SA 3ZYCA 2B35A 3WYDA 5FI1B 4CM3A 2PZBA 1FS6A 8ATCA 2RAFA 4NXMB 4CF7A 3F9RA 4ZRDA 1BJTA 1O94A 2B9EA 1X1CA 4D9CA 5IX8A 2DLCX 5FLYA 1RVV1 3I52A 1T1SA 1ZHHA 3FYSA 2QX4A 4CR6A 3FR7A 1NX6A 1UPFA 3O8BA 3DOHA 3NXSA 1IY2A 1KOJA 1VLMA 1EA7A 1T43A 4UHEA 1PLKA 3MRVA 3VGJA 2XUDA 1J8VA 3UPTA 4YRRA 2SECE 2ST1A 4G5HA 3RVNA 1PFUA 3TEJA 2W2LD 2YCLA 2RK6A 4R1LA 5IXJA 4YT8A 5BN3B 2D2FA 3G68A 4A27A 1YUBA 4BKMA 1VXRA 4C7KA 3LXMA 2L42A 4LGMA 4U7FA 3INGA 4FS8A 1QYWA 3LXUX 4R3UC 3LCRA 2PMDA 4ZQHA 2YHAA 1W88A 4I5DA 2HQSA 4E5KA 4EQ6A 5BSWA 4Z3KA 1TPZA 3FPLA 2HA4A 4CQMA 4ZTZB 3KOMA 3HRHA 1HE8B 4KQKA 4P9NA 4IKOA 4QJIA 3S5UA 1QH8B 3RUHA 2J4CA 3ZHRA 1D5CA 3UHPA 5BN4B 1NVAA 3FVQA 2QP4A 4ZT5A 4MLZA 3SD7A 1KTIA 2PUAA 2QVLA 1WSDA 3CR3C 3KOXA 4ZEXA 4Z9XA 2IHUA 1NMSA 2IFTA 2PRJA 3O73A 2PRSA 3BIFA 4YMTA 3AUYA 1A4RA 2PLFA 3WHKA 4J6FA 3S1LA 5CDFE 2VWQA 4XVQA 5F7JA 1DOZA 1JIXA 1G5TA 3WBJA 2PUGA 1M8GA 1A82A 721PA 3KXPA 3NX4A 3WAKA 2PSHA 3H8JA 2W48A 3O4HA 4QOSA 2PZAA 3SN6A 3LYUA 1TYBE 3MAJA 3TCXB 5M7EA 2CUTA 1H0SA 3NTUA 4DWWA 4UXHA 3OTIA 5SZJA 5AXAA 1LBSA 3P9KA 4LPKA 2X0DA 4BBJA 4QFDA 2FHPA 1MQ8B 3ZU2A 2A9QA 4I6GA 5IZCA 1XC7A 4BQEA 4ZZ1A 5MFZA 3OU2A 1W35A 4NFSA 3DYVA 5FD8A 4OQMA 5DI3A 3TW6A 5AYVA 3BJRA 4MQEB 2I1WA 3WS7A 4F6RA 5EHQA 1IONA 4PN3A 1DG9A 3DO6A 2OUKA 2P1DA 3NXKA 3F5MA 1YRHA 4OK3A 3Q3JB 2QQFA 2VJYA 3Q6IA 1GU7A 3ORQA 2WHXA 4ENQA 3ILVA 2QUHA 1XDZA 3FYDA 5LOVA 1J9ZA 1VHWA 5TDHA 3VVLA 4BO9A 4N41A 4MQ5A 1ZLXA 3NHFA 1YE3A 3K94A 4JK3A 4O4LB 5DV9A 3HB5X 4L4UA 1E8NA 4OKSA 5AP9A 2XA2A 3EFOB 2P3QA 3RPEA 1Z6XA 4D4LA 4Q3CA 2C2MA 1H69A 3F6YA 3KELA 1EU1A 1O0SA 3PPIA 2DHQA 2IHKA 1NQUA 3JATB 3FNBA 1JHOA 3PYLA 3G2JA 3NQ41 4MJXA 3WAJA 2Q07A 4XD2A 1GQRA 3BJEA 3BRSA 2X9LA 1JQLB 1VDMA 1NP3A 5A7FA 5A4MS 4RGYA 2OSBA 3I28A 1N33B 2ONZA 3S1SA 1O94D 2NUPA 4O63O 2BI8A 3TF5A 3QITA 3AEQB 5EEGA 1P0IA 5T6BA 1E5XA 5A4KA 4JEIA 4N49A 2JH8A 2HRDA 5EIBC 4PLCA 4PPGA 2NU9B 3D02A 4HX9A 1Z36A 3UAOA 1TEZA 4NXNB 3IE1A 4TYPA 1JQ3A 2K6GA 3UCFA 1JE1A 2QLLA 3WJ2A 3M4JA 1FL9A 1YHNA 1C0EA 2Q2QA 4HEJA 3AY7A 2FDXA 1XCLA 4TTQA 5HFAA 1A5AB 1LBIA 5DM60 2GZ3A 5LQAA 4PYJA 4RTPA 1W0JA 4ESEA 4LXGA 5SY9A 3CTPA 2XTNA 3KYDB 2OGTA 3JD3A 3K30A 4MJ3A 2O8DA 1I5EA 4Y6QA 1I4LD 3CW2A 5B2FA 2DFNA 2OENG 1FJXA 2Q41A 1T9KA 1ODTC 4P7JA 4MRMA 3ELDA 3QPAA 4OJNA 4Z7JA 3IVRA 4ZDJA 4P22A 4FGZA 1TEXA 2QJTA 1L6RA 1IEWA 2CLFB 2ZRBA 2GK3A 1N0HA 3MINB 1MR3F 4HDCA 2NUTA