1NVTA

Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
287
structure length
287
Chain Sequence
b'GPLGSMINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate 5'-dehydrogenase
publication title Crystal structure of shikimate 5-dehydrogenase (SDH) bound to NADP: insights into function and evolution
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 94
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nvtA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1nvtA01
4AJPA 2Z1MA 2RIRA 3BMNA 5C7OO 1FDTA 4IDFA 1XLTA 1H5QA 1CYDA 3AWDA 1P31A 2FHSA 2NSDA 2BFOA 3GEDA 5TT1A 5KJ6A 3H9UA 2O3UA 4HFRA 3UCEA 2AMFA 4YRBA 1U9JA 3F6YA 4O63O 5LCXA 3A9WA 2ZTLA 5JCJA 3Q2IA 1EVIA 4R5HA 3DHNA 4OSPA 8LDHA 1DSSG 2E4AA 5EPOA 1HLPA 2CMDA 4L74A 4UEOA 3GQVA 2PGLA 4PLHA 1T26A 1UZMA 1PWXA 4XQEA 1WDKA 1NX6A 3JD1A 2B83A 2CSUA 3HFGA 2AXQA 1R37A 4N54A 4DL9A 3GC6A 1VSUA 3SJUA 3V1UA 1VPDA 1TI7A 4DC1A 4R01A 4XIJA 3MZ0A 4BNMA 4LMRA 2WYVA 3IUSA 4KZPA 4S1VA 3HE3A 3RI3A 5CEEA 4E5PA 3RUIA 3QHAA 3TJRA 1XDWA 2PFGA 3GAFA 1BTOA 1LUAA 1RJWA 3EHEA 5ADHA 5JCXA 4WCFA 2V7PA 2VWGA 3I6QA 3GR6A 3JQAA 5ER9A 1ISFA 1Z75A 3WICA 4E5NA 3FSRA 2HDHA 1ENPA 3OIDA 5B4UA 1EFKA 1LI4A 4B7UA 1DO8A 3RVDA 4BIIA 5AXDA 4YAJA 3F3SA 1LA2A 2IRWA 1WXDA 1QSGA 3DFUA 2J8ZA 1H6BA 4IZIA 2QRJA 4UVGA 5G4KB 5HM8A 4CR7A 1TT5A 4BO3A 1Y5MA 2IZZA 3SLKA 4IS2A 1U7TA 2VUUA 4BGVA 1ENYA 4F6CA 3AOEA 3DAFA 2NADA 1HDCA 4ZQFA 3JD0A 4HADA 4CMEC 3U4HA 3WBFA 3E5RA 4GGPA 4XYGA 2YW9A 3AFNA 5KKAA 2BI8A 5JDIA 4YVFA 3NJ4A 2H63A 1GQQA 1W6UA 1E3IA 4RVSA 1RM0A 1ZIDA 2GSDA 2UAGA 3DOCA 4ZQHA 4CQMD 1MLDA 3UAGA 3GHYA 1SB9A 4GL4A 1OZAA 1XQ1A 3AI2A 4RGBA 4EGFA 4FW8A 4MVJE 5ENDA 4NBUA 3ANMA 3C7AA 1GZ4A 2BLLA 3H2SA 4AJJA 1CETA 2NU9A 4YAGA 1VC2A 4RF3A 4Z0PA 5JXWA 5KWEA 4B79A 1J6UA 1UXKA 1YRLA 2EEZA 5DCYA 2HO5A 2QQ5A 4K28A 4J49A 1VJ1A 2EKPA 2E49A 3LF2A 5EN4A 4YWJA 2GDZA 3QQPA 1HZJA 3B6ZA 3E03A 1PIWA 3PFFA 1KVTA 1QR6A 4R1SA 1SNYA 3U49A 4KUHA 1IL0A 1QV7A 5EL0A 1KVUA 4HNGA 3WOHA 5LC1A 4AICA 1KY5A 4DQXA 4D0RA 1OFGA 4CM8A 3OM9A 4ALLA 1GL3A 1JU9A 3L07A 3KBOA 2CD9A 3OJ0A 4IGEA 3PHHA 3IL2A 4CM3A 3FF4A 3K2EA 3RFTA 2QX7A 3EGOA 4YT8A 2Q4EA 3IOYA 3PWZA 1V35A 4KDEA 3I9KA 5EJ2A 3H3FA 2GGSA 3PXXA 1LDBA 1DLIA 1O9BA 3H9JA 5JAMA 3ZHXA 4RDHA 2VYND 3INTA 1JAYA 1UP6A 1U28A 4CODB 1P9LA 3ZWPA 1EVYA 1XGKA 1F06A 3IUPA 4TRJA 3H5AA 3H9QA 3VHRA 1Q1NA 2DLDA 3N58A 1BXKA 3E8XA 3S2IA 1PJ4A 3BTSA 1KBZA 3P2OA 4OQZA 1OI7A 4CLOA 3W6ZA 1MXFA 1I2ZA 3PYLA 3D3WB 5HA5A 1W73A 2HSDA 2GERA 3DZJA 3KEQA 5G4KA 3RJ9A 4BS9A 5KIAA 2PA3A 3SBOA 4QXMA 3BIOA 1DXYA 1Z45A 1QORA 4F3YA 2DFVA 1DPGA 1GPDG 3L6DA 1PS9A 1K3TA 1L1FA 4E2WA 4PFJA 3JYQA 5DF1A 3NTRA 1NWCA 4DWVA 3VOSA 4FOSA 5I7SA 3HFSA 4J2OA 1YKFA 1X0VA 4B8WA 1J49A 3ANLA 1V3UA 4NIMA 1M67A 1FF9A 1NVGA 1U7HA 3IQDB 4J9VA 1IB6A 4OOEA 2C82A 3WGHA 4KMSA 1I30A 3OEWA 2I3GA 1GAEO 2NNLD 1DLJA 2EV9A 1KC1A 1N92A 3D4NA 4TRRA 5ICMA 1JAXA 2A35A 2JCYA 3O9ZA 3RCBA 4BNGA 2VN8A 4IDGA 3RD5A 1YE3A 2FPPA 5CFZA 2V65A 2E37A 2QIOA 3A1NA 4IXTA 4XYBA 4RZHA 4Y67A 4B4WA 5L40A 2I9PA 1CERA 4RVDA 5BNIA 5LDHA 5TNXA 3ITKA 4ND3A 1J5PA 3G0OA 4MPDA 4DLBA 3UGKA 1GU7A 1MFZA 2Y67A 3TN7A 2G5CA 4B8ZA 1A9YA 4BNWA 3TZCA 1UDAA 1C0LA 2PGDA 4BV9A 4J7CA 3CMCO 1E77A 1WZIA 3ETEA 3WB9A 1DHTA 4GPD1 1SOVA 4NBWA 5CG1A 4QFDA 4YA6A 1MC5A 3R0IA 3I9NA 1CWUA 2Y1CA 2P68A 1C0IA 5IDXA 1A27A 5F5LA 3BHIA 1YBAA 4Z3KA 1W4ZA 2VCYA 5B4VA 3LU1A 3SC6A 3EY4A 3VH2A 3QWHA 4DMLA 2CNBA 2NUAA 4RF2A 3ZWYA 2PH5A 3FCOA 3K8ZA 1LSOA 3FTNA 7MDHA 3H7AA 1KVQA 1VRWA 4BQPA 4UVEA 3GFBA 3MJVA 1LLQA 4HX5A 4ONEA 3L77A 4TRMA 3IKTA 2HK9A 1LLCA 1GADO 4MVJF 4Q3BA 4H3VA 4J1NA 3CINA 1N9GB 5BQFA 1LRJA 4LVUA 4IBOA 1R15A 3RU9A 2H9IA 2ZQZA 1P45A 3ZHYA 2VNAA 2FSSA 5CPFA 4LW8A 4AVYA 3ASVA 4C4OA 2H1SA 3L9WA 3EK2A 2YZ7A 2AHRA 3GG9A 3M1AA 3SX2A 1EZ4A 1SMKA 2JAPA 3WLFA 2NTJA 5DCWA 2A92A 5AQ1A 3I9OA 4DTIA 1UXGA 2P9CA 2WD7B 3V1TC 1RPNA 1VJTA 1A7AA 1K2WA 3ZDFA 1N2SA 3CXRA 3FN4A 4RVUA 4XCVA 2Y0DA 4JK3A 3CZMA 1KEPA 2Y0CA 3TZHA 3ZV5A 4B7XA 5A4DA 4OYRA 4P4NA 1PS8A 4YXFA 4I5DA 1IULA 1FDWA 1VJ0A 4GMFA 3NX4A 5I7FA 1YL7A 2BF7A 3AW9A 5L4NA 2YJZA 1B14A 3AI1A 1E6EA 4Q3EA 4HKTA 4MP6A 3GN1A 5L4LA 3DOOA 1K5HA 2W2LA 3JQCA 2XOXA 4FFLA 4OM8A 3JV7A 2GN8A 1P0FA 3IDSA 1NFFA 3QWFA 3VZPA 1HYEA 1M6WA 4NK5A 4AJKA 3AK4A 2GN4A 3AI3A 2D4AA 3QRWA 2C2YA 2C5EA 2WTBA 2I6TA 3H8VA 3X2FA 3NT4A 4DXHA 1X1EA 3VPXA 4OHUA 1W8DA 1UXHA 3TQHA 1LSJA 3BTOA 4D45A 4IZHA 2QHXA 4IIUA 2C7VA 4YT4A 2YQ4A 4LSWA 4U5QA 1UDBA 2FPGA 3DL2A 4BNUA 2NQTA 1YL5A 3DOJA 2HJRA 4ILKA 1F8GA 2IZ0A 1YQXA 2O50A 3D5TA 1X13A 2AQIA 4DIBA 5A9RA 3OQBA 1V3TA 5THKA 1GR0A 1BVRA 1EDOA 4DYVA 4G2NA 2X23A 3QP9A 4GSKA 4M54A 2IZ1A 3FHLA 3C7DB 3G1TA 1B8UA 1BVUA 1ENOA 1N9GA 4DPMA 1QYCA 4W7IA 1K0UA 1GEGA 4I1IA 3WGIA 1JLLA 2HRZA 3ADPA 1ZFNA 1CF2O 1SAYA 1KERA 1PGOA 2Q49A 2UUPA 3Q9NA 1E1MA 3RJ5A 3SVTA 3ZV3A 1VKOA 3GHHA 1RKXA 2JL1A 1A4UA 4XRGA 4KWIA 5G2OA 2WD7A 5IG2A 2NACA 4YDRA 3GNSA 2JCVA 4OSOA 5TQVA 4JLWA 4XRRA 4ALIA 4PZEA 4MJLA 3WS7A 2O2YA 3M1LA 1EUCA 7ADHA 5A1TA 1A7KA 5DP1A 2DBVO 3ZWMA 1Y8QB 3ONEA 3CE6A 4CLDA 3UHAA 4Z3DA 4BO2A 5MDHA 2D5AA 3KYCB 1LRKA 3KXDA 3JYLA 1E3JA 2XXBA 2PR2A 2Y66A 4CV0A 2D59A 4BO4A 1E3LA 1M2WA 4J1SA 1B0AA 3WBBA 4Q3CA 1NR1A 3WYCA 4GX2A 3F46A 3FR8A 3MEQA 4RDIA 2JKVA 3GZNA 5COAA 1YBMA 4W6ZA 5TS3A 3FD8A 1KIFA 1O6ZA 2X9VA 1NHGA 3FWZA 3GGOA 1H6AA 3AY7A 2CF5A 3P7MA 1O95A 3S2FA 2Y1DA 3ZWOA 2P4HX 4Y9DA 1T4BA 2PWZA 4XGKA 4BNFA 5DBGA 3PYMA 2Y1EA 4WNCA 3RUDA 1HSZA 4JBHA 3ZHBA 2C29D 1BSVA 3RC7A 4XR9A 4NBTA 1WWKA 4J16A 1R66A 2P5YA 3PIDA 3E48A 1BG6A 3ZWWA 5F1PA 4BOYA 4YJFB 1I01A 5JSFA 4WNIA 4N7RA 3C85A 2POQX 2H6EA 4MINA 4KWHA 4S3MA 3F4BA 5JYDA 1PL6A 3RUEA 4CV2A 2Y05A 2HCTA 1MV8A 3LC7O 1TVEA 1ZEMA 4FCCA 3PYXA 2VOJA 2C59A 2J3IA 3KB6A 2OL4A 3L4BC 3C8MA 1E1LA 2WE8A 4KTVE 1PZHA 2XXJA 4JIGA 5K0ZA 1NPDA 4J4BA 1SOWA 1PJTA 1FXSA 4FSHA 5DOVA 3ZWAA 4UEKA 3AU9A 2PTGA 1VLLA 2J5QA 1MC4A 3U9LA 3S2GA 2A9FA 4DQUA 2B69A 3INRA 2ZB4A 1HETA 1UH5A 4H15A 4N5NA 3WJ7A 3I23A 3JQ7B 1P1FA 3LSYA 3JQEA 1UXIA 4WLVA 4XEHA 5DZSA 2B36A 3FPCA 4XYEA 3ZZNA 3BMNB 5BNFA 4KQWA 2GD1O 2UYYA 1ZJZA 1P1IA 3GLQA 4IQ0A 4BO1A 3TFOA 2D5CA 2V6BA 4I08A 1NQTA 3DXFA 3KVOA 4ZU3A 4B4OA 1KETA 3I9LA 2I5PO 2AEJA 3GGPA 3H65A 1Y8QA 1XCBA 3U5TA 2G0TA 2Y99A 4LK3A 5FYDA 4NU5A 5C37A 3KYCA 1ULSA 1HSOA 3F9IA 1O0SA 1CQIA 2E82A 3ANNA 1M76A 2J3KA 4P4GA 1AUPA 1P3DA 4FS3A 4PZDA 1V0JA 2PLAA 3VDRA 5HRUA 1PZGA 1ZEJA 3SJ7A 3KSDO 1I24A 4PG7A 1QYWA 3PEFA 4DPKA 4EJ6A 3CMMA 4JJGA 3W6UA 3QWBA 1ISHA 1EBUA 2PY6A 4PRKA 4IMPA 4XDYA 5THQA 2H5LA 4A2CA 4J91A 1PL7A 3DMTA 3WGQA 4KQXA 3GRKA 1P33A 2R2GA 2Q4BA 2HMWA 4ND4A 2Q99A 3KM0A 1EBFA 2C07A 3JQ8A 1LDEA 3LC1O 4E3ZA 1ADBA 2UDPA 4ID9A 4O5OA 4YJFA 4HFMA 3WIDA 4Z0TA 1QRRA 1VE9A 3Q3CA 4XIYA 4M86A 3HB5X 2YY7A 2HU2A 2AQ8A 4LRSB 3ASUA 2ZJ1A 1WMAA 2PKRA 4PCVA 4BNVA 3K30A 2VYNA 1HT0A 1ZH8A 1K6JA 2EP7A 3HSKA 2X8LA 5G0WA 1U5AA 5IZ4A 4WJZA 2NQ8A 4NR0A 4WUVA 1IPFA 3AY3A 1H9AA 4LRTB 1AHIA 2VRBA 4XD2A 1EE9A 3HQ4O 5IDQA 1TB4A 2GR9A 1D3AA 3LVFO 4QT0A 4CMIA 4Q3AA 2A94A 1Z82A 2DKNA 3PGJA 4RVGA 1XEAA 4TQGA 4WLUA 5TT0A 1JKIA 1R12A 2VWPA 4ITUA 1BRMA 3JQ7A 1ML3A 3ZV4A 2QW8A 2OGUA 1B8VA 3G79A 4QEDA 4OO3A 3ZN2A 3UXYA 4E13A 2ZCUA 3B1KA 3OICA 1MGOA 1XSEA 4R4JA 4AL4A 1I3NA 3JQDA 1M66A 3ZWCA 1MG5A 2AQHA 1GPJA 1ENZA 1YWGO 2DT5A 3UUWA 1GDHA 1XA0A 5JS6A 3OF2A 4A10A 4AJIA 4DIFA 4LGVA 3MTGA 4L0QA 1YS4A 2Y1OA 3L0DA 1K6XA 1ZK3A 3EVNA 1TEHA 2FR1A 1ZSYA 4XKJA 2Z1NA 3L6EA 4CM8B 1UUFA 2EF1A 1ZZEA 1P44A 2F00A 5IFLA 5KJ1A 4B3IA 4YJDA 5CP8A 1BWSA 3UN1A 2BKAA 1PEDA 3COSA 3NEPX 1DRWA 2HMSA 4E33A 3HB4X 1T2AA 3B70A 1I2BA 1E0DA 5IZCC 1U3TA 4MVJG 5LDGA 4A26A 1P1JA 2AQKA 3GMSA 4B7CA 5CG2A 4QO7A 1XU7A 4TKLA 1OBFO 3VKUA 4EITA 4HFJA 3H3JA 1PQPA 3CZRA 3VTFA 4PLPA 4NJMA 2YHUA 3NUGA 3RKRA 2PK3A 4BO5A 5C3MA 3E9QA 4CV1A 2X5KO 3ENNA 4CLOB 2JJYA 2YV3A 3E5MA 3RUFA 3H5NA 2WEKA 3LF1A 1GZ6A 3ITDA 2X9GA 1I3MA 1MXHA 5AXAA 1P1KA 3RC1A 5J23A 5B37A 3GVXA 3S8MA 1DC4A 5KNLA 3JQBC 4Y98A 3EDMA 3NTQA 4BKRA 2X4GA 3BHMA 3E9NA 2BFPA 3I4FA 5T8KC 1LRLA 3WQQA 1TA4A 1I32A 4YAIA 3MJCA 4IDEA 3DEYX 3JYOA 3RFVA 4EI2A 3QVSA 4N5LA 1AN9A 1KVRA 3TNLA 4J6FA 4R9RA 1LU9A 3GVPA 1H2HA 2DPGA 5JC1A 3UFXA 3ZW8A 1QYVA 3KSZO 1OAAA 1YH3A 4BNYA 2R00A 4W82A 4TZKA 1HE4A 3ZU5A 3M2PA 3WTCA 3IS3A 2DPHA 1ISMA 2PH3A 4U6QA 2IXBA 3JTMA 3HDQA 2I67A 4RQUA 5TJ9A 3QVOA 4F45A 4D3DA 3CTMA 1PU2A 3CH6A 4LSMA 1A5ZA 5GZ3A 3WIEA 3SC4A 5DCUA 1NAHA 1SEPA 3CEAA 5FF9A 1UZNA 3BHJA 4YQYA 4Z9YA 2YV2A 3DZFA 4CM4A 3PK0A 3WGGA 1HE3A 2I99A 4R41A 2EKQA 4IS3A 4PZCA 4A03A 4JNKA 2VZ8A 2EGHA 4CUKA 4R1NA 3ADOA 2IE0A 2HMVA 4IJVA 2VYVD 3OIFA 4MDHA 1H0KA 3WLEA 4DBVO 1ULUA 3TZ6A 5BSEA 1WDMA 4WPGA 5L3ZA 1JWBB 1D1TA 4I9NA 1A9ZA 1N1EA 4EUFA 4EJ0A 3JQ9A 2GNAA 1DRVA 3V2HA 4D79A 4R54A 4BO7A 5TJHA 1EVJA 4L8VA 3UH1A 2BI7A 2V6GA 3DDNA 3JCZA 3OA2A 3OBBA 1I36A 3HUDA 3MCVA 2AE1A 3WR5A 1YONA 5DBIA 2X5JO 4FJ0A 5I9MA 3O38A 4TRNA 4D43A 1HDRA 2RH4A 4CLRA 4JP2A 3DAPA 4OXKA 3AM3A 2GYYA 3KEOA 4GVLA 3F1LA 4ROSA 5K6AC 2ET6A 1ZXBA 3GEMA 5TX7A 4O1MA 4BV8A 2JAHA 1B8PA 5A5FA 4WLEA 5AVOA 3OH8A 1LSUA 5T57A 2Y1GA 3TZQA 4MVJM 1KY4A 3ZWVA 1NFQA 5KVCA 3VH4A 1T2DA 4LMPA 4QQRA 2O3QA 1HYGA 2GN6A 4BNKA 3ZHZA 2EXXA 5KVVA 2BFAA 4KDFA 2D8AA 4BB5A 1YOVB 4PG8A 3WGZA 5TC4A 3DZKA 3HDYA 4R3NA 3UCFA 3GG2A 1YB4A 2G1UA 3JYPA 4TVBA 3NGLA 4JN6B 4RO0A 1JVSA 3DC2A 4TKMA 1Z7EA 3RROA 1DIBA 4MIEA 2VUTA 4IQ8A 1SEVA 2CDAA 2BGLA 3WJAA 5KTKA 2NLOA 4U7WA 4Y6RA 1GEEA 4RPLA 1IOLA 1CQJA 2CVZA 2DFDA 3N74A 4YR9A 4B3JA 4W9NC 4F6LA 5EIOA 1YO6A 2RBEA 2X9NA 3PP8A 5F3RA 5FFFA 3Q11A 3VKVA 3JQFC 1UZLA 2CZCA 2HKIA 4HWKA 2ILTA 1VKNA 3ZGYA 4E4YA 2GUGA 4J9UE 1DIGA 5AXBA 4ZVVA 3RKUA 4PGFA 5JCJD 2J6IA 3HG7A 4RVHA 3HDJA 4XGIA 5JNLA 2Q2VA 4GH5A 4FFOA 3U4DA 4BNHA 1XKQA 3HJAA 4CM9A 4NFSA 4NI5A 4WOKA 2JD2A 3PJFA 3GDOA 1ZSNA 1F0YA 1JN0A 1WP4A 3KZVA 1MFPA 4RVFA 4RPJA 3LQFA 4JBIA 2B4QA 2TMGA 3WNVA 1E1NA 5BR7A 5T5QA 4KP7A 3SLGA 2P2SA 4J4TA 2Y93A 3FWNA 1Y5RA 4PIVA 1ZNQO 2BHLA 2YFHA 3LLVA 4RPGA 5U1PA 4B4UA 4JCOA 4XB2A 5DP2A 2VNSA 1XQ6A 2WSBA 4AJOA 5JAZA 1IPEA 4G65A 5CAEA 2WM3A 1PS0A 1ZSVA 2PGJA 1LDNA 3EVTA 3VZQA 2EW8A 3IP1A 3TDKA 4YRAA 4WCFC 4CLHA 1ID1A 5T64A 1P74A 4CQLB 2ZCVA 5HWSA 3GK3A 1PX0A 3IJRA 3T7CA 3PHLA 5EERA 2OBNA 3HADA 4NQZA 2Q2WA 1I3KA 4AJEA 1E3EA 1GYRA 1XG5A 4BKUA 1DAPA 5COQA 1FMCA 2HK8A 1EMDA 3RFXA 5AXCA 3ZWBA 2VZ0A 2OORA 3AUTA 3E6AA 3GDGA 3PWSA 1Q0QA 5GZ6A 4PVCA 1ZJYA 3D7LA 1YOVA 1FDVA 4L73A 3BMCB 1LDGA 3AOEC 3OP4A 4NFYA 5GY7A 2B35A 1PJSA 1LBEA 2EWMA 3H9GA 4BNNA 1C14A 2FY8A 2RCYA 2TMDA 3V2GA 4CR6A 5JDIC 3PGXA 3GPIA 1FJHA 4P8RA 3GUYA 3UICA 3G49A 4D0SA 1F14A 2PKQP 4RPHA 3PDJA 5JAQA 4D44A 1C1XB 1DRUA 4NMHA 4OQYA 3MWEB 1WW8A 4E30A 1FK8A 1PJBA 1U2DA 4JX8A 4AJ4A 4IDBA 2PD6A 4BUCA 2C20A 1WLYA 3TF5A 1R6DA 1C3VA 2HK7A 4UVIA 1QV6A 1JKJA 2C0CA 1E92A 2DBZA 4IDCA 2PZJA 3DONA 3GZNB 3AY6A 3OHSX 1LC0A 1NQOA 2QRLA 4YRDA 3EW7A 3Q9UA 3BYZA 2NU7A 3Q2KA 4YT5A 4EBFA 1GCUA 4EUHA 4IY1A 1ADFA 5ILOA 1KC3A 5FEUA 1YDWA 3H4VA 2YV1A 1NNUA 4ZRMA 4E0BA 4ZA2A 3BXXA 3K6JA 2HQ1A 4QX6A 5F1OA 5JO9A 4BMSA 3NYWA 3OFSA 4UUPA 1RM3A 2VTEA 2X0RA 3OJLA 2B5WA 1AXEA 5ES3A 2QZZA 3K31A 5KOIA 4XGNA 4NBVA 2ZKLA 2NTVA 3ZU2A 4WLOA 4CMGA 5JPIA 5A05A 4WKGA 3P2YA 5EESA 1IHXA 1JA9A 1YVEI 4MO2A 2R6JA 4BKOA 4BNZA 4U0KA 3IAHA 3PLRA 4Z6KA 1U3WA 4F46A 4BNXA 4CQLA 4GX0A 2EGGA 4NH4A 4I5GA 4XA8A 1GZ3A 1CJCA 1RM4A 3GH3A 3GVHA 3ZNPA 1J4AA 3ZCXA 3U4IA 5B1YA 3P5SA 4H16A 4FR5A 2JFHA 4GWKA 1Z74A 4E2XA 4XQ9A 5CPBA 4PG5A 2ZB3A 4I5EA 5KCZA 1ONOA 3JYNA 3RBZA 4CLEA 4YYZA 2YUTA 3QWIA 1GUYA 4BO0A 4BVAA 1BXGB 1C1DB 2X22A 5L7WA 4FFNA 6ADHA 1TLTA 2GLXA 3BMCA 1ADGA 4CM6A 2Y1FA 4PLZA 4J1TA 4AJLA 4NBRA 4YACA 1VL0A 1U4OA 2GF2A 1ZMTA 2W8ZA 2GASA 2EERA 1CIVA 4CQMB 3L9XA 4IQGA 1LJ8A 1ZK1A 1UDCA 1U8XX 2O2SA 1PGPA 4FJ1A 3HDHA 1Q7BA 1Y9AA 2VWHA 3KYDB 4PN3A 2NVWA 3I9MA 3I6IA 1C1XA 2AW5A 3ORFA 1IYZA 4FGWA 4XX0A 2A4KA 1SZJG 2JD0A 2X7HA 3IP3A 3OSUA 4WCDA 3WXBA 2ZB7A 4R5MA 2BGMA 2FZWA 1PJ3A 1KEVA 2PKQO 3AOGA 3ZU3A 1NM5A 3I3OA 3W8FA 5BSFA 5A9TA 3VPSA 5TIIA 1V6AA 1HE2A 1T24A 4FFMA 4J0EA 4KOAA 2WMDA 5ILGA 3FNEA 3ETDA 2PZMA 3GY0A 1MA0A 2NVBA 3K9QO 3TL3A 1LSSA 1E7RA 5KVSA 4CUZA 4BHTA 4BNJA 3PQDA 4UVDA 3UVEA 5IJZA 3RC9A 1PQWA 3JQ8B 4MVJH 4II2A 3GPDG 4YPOA 1YBVA 5A3VA 5L7TA 1PZEA 2ZTUA 1NP3A 2FP4A 5IZCA 3UOGA 4L4XA 4KUEA 6LDHA 1K89A 3RIHA 3WSVA 2X58A 3GUCA 5ENVA 4BMNA 4PLWA 1SCUA 1YJQA 4NFHA 2DUWA 3EUWA 3ZI0A 1NAIA 3EYWA 2B4RO 3F5SA 3QVWA 4PLTA 3WWYA 3SEFA 1PJCA 2EIHA 5EMHA 5F21A 3DBVO 4AJHA 5DDIP 1H6CA 2WYWA 4ZQBA 1R0SA 2DTEA 2HMTA 3NJ8A 5U4QA 1DC6A 3VZRA 2C7GA 4DPLA 1Y8RB 5KJCA 4FC6A 4FFRA 4UREA 1JWAB 4M8SA 3RUHA 4YB8A 3SXPA 4RJTA 3EZLA 4RL6A 1K6IA 2G82A 3BMOB 4ZJUA 4CMIB 2DTXA 3CIFA 1EK6A 4K6CA 5ITWA 5FI5A 1G0NA 1WZEA 3K92A 3FI9A 3E82A 3ROKA 4OGWA 4WE3A 4CMEA 3HN2A 3U4CA 2X6TA 5A5EA 4ESOA 1G6KA 4CR8A 1UAGA 4BNIA 2Y0EA 1G0OA 1DFIA 1L7EA 1A72A 1BXGA 2VUSA 3KYBA 3WMWA 3CPSA 1C1DA 1H93A 2IXAA 3DBHB 5I7VA 3IC5A 4H7PA 3FBTA 3U0BA 3ST7A 2W98A 4TZTA 2B0JA 3F47A 3QWAA 4RLHA 4YAEA 3TOXA 4LISA 3ZNNA 1Q7CA 1DJQA 3GN2A 1N7GA 1YJ8A 3I1JA 2VHZA 4EUEA 1R4NA 4CQMA 3ICCA 5JC8A 5HS4A 3T7EA 3Q0EA 2J3HA 2ZIZA 1RYDA 4YBZA 2HRBA 3KYDA 3TOZA 4Y6PA 3JD4A 3OEYA 1RWBA 2GZ1A 3D0OA 4PLYA 3JSAA 4OKIA 1SC6A 3C1TA 1C0PA 1JVBA 2VZ9A 4UUOA 4XYMA 1PSDA 4FD3A 1NFRA 3CSDA 4UUNA 1TXGA 4J2HA 3QIVA 2FN7A 2CFCA 2W2LD 4NZ9A 1XELA 1Y6JA 2Q3EA 4D7AA 4J0FA 2BRUA 3BMQB 4BNLA 3G17A 1DOHA 4GX5A 3M2TA 2GCGA 4ALNA 2B5VA 4D42A 3BTUA 4B4VA 3ETGA 4OKNA 5H83A 2OUIA 3S1LA 5DT9A 5H81A 4A5OA 5COBA 4TWRA 1EVZA 1U5CA 1JQBA 1ZUD1 4JROA 2O3JA 2VYVA 3D4OA 4DLAA 4E2YA 3RC2A 4BQRA 3WGTA 3K2BA 4D41A 4NJMB 4R1UA 1GTMA 2V6FA 5H82A 2ZYAA 4CMCA 1HDZA 1JDJA 4XB1A 1WVGA 3NTOA 1P1RA 3MJEA 2IDZA 3DTYA 4OAQA 3DZIA 4LCJA 3RQSA 1ADCA 2OMEA 3KLMX 4DRYA 3FR7A 3K73O 2VHVA 4OXNA 4EW6A 3PJDA 2X86A 3PIIA 3T4XA 3LT1A 4RZIA 1WNTA 4OH1A 3VVCA 4JJIA 3TPCA 3G1UA 2D0IA 4A27A 1Y8RA 4Z0HO 3ZNQA 4D3FA 3LT2A 5JY6A 2G76A 2EP5A 2O7QA 4GAEA 3DHYA 2Q46A 4X54A 4CMAA 3BMOA 1KEWA 4R1TA 2OBYA 2EJVA 2X0IA 1XU9A 2C54A 5AYVA 2QYTA 3BAZA 3DWFA 5CDGA 1SPXA 3OJOA 5JMWA 3C3XA 4L4SA 4YAKA 4QUKA 1IY8A 2Q1UA 3PHGA 5I9NA 1LLDA 4IGFA 3VH1A 4YJHB 1EQ2A 1HEUA 5KKCA 3DBHA 1FDUA 3PHJA 5I8ZA 4ZHSA 4L4RA 3FNHA 3ZWXA 3DMYA 5A04A 4MKXA 3A06A 3RWBA 3KLPX 4BGIA 2FPIA 5L4SA 2ZATA 4CM4B 3QVXA 1U1IA 3K5PA 1H9BA 1DIHA 4I8XA 2IYPA 1E3WB 3L4SO 1YL6A 4JQCA 1ISGA 1JW9B 1P1HA 1WDLA 4YQZA 1XWFA 4MVJP 5TGDA 4CM1A 3MJSA 2FSVA 4E12A 1Z7BA 5DN9A 2PD4A 3ONDA 4C7JA 1V9LA 2ZYGA 3STHA 1DFGA 4HUJA 3GEGA 3WQRA 3BTVA 4DMMA 4LCEA 3OMLA 3F1KA 2VTDA 2CVQA 4EJMA 4FC7A 3NV9A 1BXZA 3BMQA 4MP3A 1DEHA 4FBGA 3WNQA 5JFOA 2NVUB 1E7QA 1QXSA 1E7YA 3AM5A 1V8BA 5BSHA 1PGJA 2AEMA 1ZK4A 1HZZA 2XPCA 2YDYA 3G3EA 4XR4A 3AM4A 5G0TA 2ZTVA 4CLRB 1BW9B 3V2UA 4RQTA 3UCXA 5IAAA 1S7CA 4HY3A 2Q1SA 1D8AA 3LT4A 4IUYA 4J3FA 1IZ9A 2Q45A 4WLFA 4OJNA 4BGEA 4CL3A 2WWRA 1KVSA 1Z73A 5EQDA 2E6UX 3MWDB 4RCVA 5JDCC 2DVMA 3EC7A 2ZQYA 1B26A 2P91A 3GFGA 3NRCA 3MOGA 3W4JA 3C7CB 4W7HA 5TF4A 2Q1WA 4BO6A 1N1GA 2JFGA 4K6FA 4NDNE 4YJGB 5GMOA 2LDXA 3LYLA 1V3VA 1HDXA 4ZN6A 3U09A 3A4VA 2NV6A 2I66A 3PZRA 1WAMA 4HBGA 1B16A 4WASA 1PTJA 3DAGA 3NT2A 3QY9A 4JGBA 4K1LA 1ZCJA 1BDBA 1LQUA 2UV8A 5KVQA 4PVDA 3D5QA 1T2EA 4YT2A 3S55A 2P9GA 3PTZA 1NVTA 4J7XA 3MTJA 3ON5A 1GV1A 4FJ2A 3VTZA 2P5UA 1QP8A 3LK7A 3KSUA 3GZ4A 4HP8A 1D1SA 1HDGO 3AUUA 2X5OA 1DB3A 1H6DA 3INGA 2FRDA 4PLFA 4GLLA 2VRCD 1UAYA 3W8EA 4YJHA 4Q9NA 4FPXA 1GUFA 3JD2A 1PGQA 4MIOA 3GT0A 2OP1A 1NVMB 2HJSA 3D4PA 3NDRA 1Z6ZA 4B3HA 1P77A 4IINA 4RORA 1ZKMA 4ZQEA 5IN4A 4J7UA 4PG6A 3AJRA 2B37A 4E5MA 3AUAA 1E3WA 3IIEA 4O0LA 4OOFA 4HV4A 5A06A 5L45A 4QO8A 3FNGA 3O8QB 1LDMA 3X2EA 1RM5A 5HTOA 4JJFA 4O6VA 2NTNA 3GA0A 1YDEA 4Y8VA 5IXYA 1B3BA 3QW2A 3ENKA 2ZYDA 4UVHA 1QYDA 3V5NA 2SCUA 4AG3A 2E48A 4BO9A 1EDZA 4ALKA 4GQAA 4G81A 5F1KA 2Q1TA 4P38A 3FBGA 4E31A 1NTOA 1J0XO 1Y9EA 2I76A 4FDAA 3OJEA 3ZW9A 4CMBA 2NVUA 3QV1A 1GY8A 3PJEA 3T4EA 1N5DA 1HTBA 3K96A 4Z9XA 1SB8A 3PQFA 2NU8A 4E21A 3KV3O 4L76A 5JO0A 3RUAA 1BW9A 1GYPA 3D3EA 1EK5A 1GUZA 4RLSA 5F5NA 1OC2A 4ZGWA 4GI2A 3DMTC 4YTEA 4RF5A 4M1QA 2GRAA 2JHGA 4UAGA 3I5MA 3GF4A 5C7LO 2JD1A 4R51A 5CEJA 2ZK7A 3EAGA 4DYDA 5L95A 2XF8A 1GQYA 1PQUA 3VPGA 1AE1A 4MIYA 3S2EA 2GN9A 4DA9A 4IXWA 3DO5A 3KRTA 3LLSA 3NT5A 1NR7A 1GCOA 2IEBA 4M49A 5TSDA 5I8WA 1O89A 1BMDA 1E3SA 1B2LA 2DC1A 4YJGA 3WWZA 1NWHA 4MVJD 4R9SA 5CDYA 1PJQA 1T4DA 2YDXA 5BNTA 2CUKA 3RASA 3RBVA 1LXCA 5EQFA 4CUJA 2BELA 3KTDA 3VVBA 2GZ3A 1U2GA 9LDTA 1RYEA 4CL8A 3DFZA 4XZ3A 5DBFA 4RF4A 3ZV6A 3OIGA 3MJTA 3IKVA 3L6OO 4GKBA 5DULA 3V1YA 3QA9A 1E1KA 2EKLA 5IXSA 4PRLA 4U6SA 3PI7A 2O7SA 4GBJA 3AUSA 4DUPA 3OJFA 1F17A 2YQ5A 2AG5A 3D1LA 2FOIA 3ONFA 2CDCA 4WGGA 2OXIA 2DTDA 3VAZA 5ITVA 3WSWA 5A9SB 4RPKA 4L9RA 3RBXA 2GZ2A 3ROQA 5TRTA 4XWYA 1HYHA 3E18A 4AJ1A 4BB6A 3PHIA 4BO8A 5IDWA 1DIRA 3LDHA 4QTZA 1SO8A 2DBQA 2Y68A 1MX3A 3H2ZA 3KHUA 4M89A 4N18A 3ROMA 4NU6A 4EYEA 1E5QA 4L75A 1NQAO 4N5MA 5I7EA 4IJKA 4J90A 4WOJA 3VH3A 1ONPA 3GNTA 3QSGA 1GV0A 2D1YA 3O8QA 3DR3A 2X1HA 1ZO8A 3EMKA 2WD8A 3U62A 1NQ5A 5MGBA 5FI3A 1LNQA 4M87A 1M75A 1DBVO 2YHIB 3AFMA 4TMFA 4XQCA 5JLAA 1S6YA 2ZTMA 3VZSA 4MVJI 1UXJA 1R16A 4PLCA 1LDYA 1PJLA 1YQGA 1XR3A 4QSMA 4CMJA 1X15A 2CVOA 4AJNA 3DHEA 4A7PA 1T25A 4U8GA 4PLGA 4NPCA 4Q39A 3JQAD 4AFNA 2RH8A 5EINA 1ISJA 1I33A 3F5QA 3ROPA 4J4HA 3GOHA 1NPYA 3DBLB 2GPTA 2RHCA 1EEHA 1BDMA 1P0CA 1NYTA 3OA0A 1IE3A 2W90A 3NDJA 4MOWA 2QG4A 3HHPA 3UKOA 3DB2A 3JQ6A 1DDOA 4TROA 4HXYA 4IDAA 3L4BA 1AXGA 2IODA 1HXHA 5JW6A 1SBYA 2DM6A 2C5AA 1HWYA 3PLNA 5IN5A 3FPLA 5C7IO 4XDZA 4BKQA 1XYGA 3OECA 4DVJA 3QLJA 2FWMX 1HDOA 1IHYA 1MB4A 2VQ3A 1KS9A 4Q3DA 3TWOA 1HRDA 1PL8A 3N7UA 3W4IA 3ICPA 1T1RA 3D3WA 1PR9A 2Z5LA 1YB1A 4HFNA 2QRKA 4KTTE 4UUMA 3MJ4A 1N7HA 4NG5A 1U3VA 2R00C 2O3SA 3O03A 4MKRA 2JHFA 1L7DA 2X0JA 2OZPA 4AJ2A 2AG8A 3B1JA 5L53A 3ZWNA 5A9SA 1ZVMA 2PV7A 4YCAA 4FGSA 2RAFA 4J1QA 4CLXA 1I10A 2PNFA 3GVCA 4JBGA 5ICSA 3LZ6A 2WE7A 1DC3A 4URFA 1PJ2A 3FNFA 3VPHA 3ABIA 2OFPA 3WG9A 2CY0A 4MKZA 3GAZA 2NM0A 2LDBA 4ND1A 4UULA 4ZQGA 4JP3A 3RAJA 1X7HA 1CDOA 3PVZA 1BHSA 2OP0A 4DREA 5JYEA 3TRIA 1HDYA 2NU6A 4GWGA 4PG4A 4W99A 3DZGA 4ZRNA 3ULKA 4CMKA 1G1AA 2OHXA 1F8FA 2BFMA 4IM7A 1EUZA 4ALJA 2OOSA 3HZZA 1D4FA 1Q2XA 2P4QA 2DU8A 5C5IA 3LC2O 3R3SA 3KETA 4EEXA 3I83A 1UJMA 3RU7A 1IZ0A 1TT7A 2YHIA 5T6BA 1EUDA 1DFHA 1EE2A 2PD3A 4ALMA 4E5KA 1YXMA 2BH9A 4PLVA 1QYXA 3JQ9C 1ZXLA 3FTPA 4GGOA 4NHEA 4DIOA 1R4MB 3TFQA 4BKPA 4XJSA 1I2CA 4K9DA 5CHEA 3TZKA 1VL6A 1HLDA 5A3JA 1PR3A 1ONNA 3W1VA 3NGXA 3DBLA 3WFJA 1LQTA 1Y1PA 2RHRA 4NK4A 4OL9A 4OIMA 9LDBA 2UUOA 1XHLA 2EW2A 5ER6A 3DBRB 4R68A 2OO5A 1CRWG 1WPQA 2JCXA 3W4KA 4NNJA 1R0KA 3IMFA 3E9MA 2O4UX 3I4CA 4LVCA 3QVTA 3TL2A 2J5RA 4NJOA 5BT9A 5HS6A 3WDSA 5BSGA 4D46A 2WJPA 4HNHA 2QYSA 4DBZA 1F12A 3IJPA 3I52A 4W4TA 2BGKA 1AHHA 4CMHA 4YEDA 4GSLA 1EQUA 2YFQA 1NHWA 1R4NB 3VC7A 3W8DA 3JD3A 1KOLA 5L51A 2HMUA 4BMVA 2I65A 1X1TA 5DNAA 2X0NA 1UP7A 2FR0A 1T2CA 3OETA 3A14A 3QJ5A 2JFFA 4GX1A 4WLNA 4WECA 4ZD6A 5JE8A 1DJNA 3B20A 3WQSB 3GDFA 4CM5A 1R0LA 4ND2A 2VT2A 1HF3A 2EHDA 1A4IA 1E6WA 4FFPA 3V8BA 4EDFA 1E7MA 1MG0A 1A71A 5U9CA 1KEUA 1X7DA 2AEFA 3H9EO 4IMRA 1Q0LA 1IUKA 1MP0A 4U0JA 3H5RA 2C2XA 1U8FO 3ZU4A 1YB5A 2EG9A 3D64A 3PPIA 4FOOA 2WYUA 4GMGA 1JTVA 1QMGA 2F1KA 3BA1A 3GRPA 5G0UA 1XIVA 4ND5A 4CM9D 4ZICA 3GNQA 3DTTA 3RUCA 5DOZA 1YGYA 1Q7GA 4QECA 1LEHA 3P19A 4A0SA 4GKVA 3WYBA 4TVOA 2VT3A 5JMPA 1UP4A 4OMUA 2VHYA 1I3LA 4GLOA 1H94A 1VI2A 1OC4A 3DZBA 2AE2A 3GVIA 1E7SA 1VM6A 1T1SA 3PFWO 2IYOA 2W4QA 1QLJA 4D3SA 1ZW1A 5JAIA 3UF0A 2V6MA 1N8KA 4R3WA 5FWNA 1U4SA 2VWQA 5T67A 1R4MA 5IDYA 2DUUA 5G0VA 1QLHA 1E5LA 2NWQA 2P9EA 8ADHA 2BMAA 1I0ZA 5JDCA 1C0KA 1O94A 3NAQA 3O26A 3WGYA 1D7OA 3JQGB 5K9ZA 1Y7TA 3CUKA 4BL5A 3LT0A 4GVXA 3JQBA 3M6IA 2WDZA 4KUGA 3OQ1A 3HNPA 3U3XA 4XYLA 1O8CA 3DBRA 2O3RA 4A73A 2I3AA 3RSHA 4Y6SA 4LN1A 1ORRA 5T8KA 4CJXA 4DGSA 1B15A 1LC3A 5I9LA 2GO1A 1ZMOA 1ZK0A 2DAPA 4II3A 5L7YA 4R16A 3TSCA 1Q0HA 1E7WA 3PJGA 4JXKA 3VPFA 4Z9FA 3E1KA 3I9JA 4C7KA 2PZLA 4FN4A 4Q3NA 4E6PA 1ISIA 4IPTA 1OOEA 4E2ZA 2DBRA 4J43A 4FB5A 2Q2QA 3Q6IA 1AGNA 2D3TA 2VHXA 4M55A 2HAEA 4K26A 3PRJA 2XAAA 1NBOA 2W2KB 3GMDA 1X7GA 3WMXA 2B4TO 4G5HA 2VRCA 2Q50A 1DC5A 4WK6A 4R69A 1X14A 4XQGA 5B12A 3NKLA 5GZ1A 3KUXA 5CDTA 4OXYA 4E5YA 1QG6A 2HUNA 3O4RA 2O23A 4CV3A 3WX0A 4BNTA 3OQ6A 1QKIA 1UR5A 2DQ4A 3HWRA 1LLUA 3A28A 4BGUA 1FDSA 1HE5A 3DQPA 4IJUA 1BGVA 2FZEA 4CPDA 1U3UA 4O59O 2IEDA 4EEZA 2YYYA 4WEOA 3WYEA 5CEFA 3KOUA 3FRJA 5HBRA 1LX6A 2G17A 1WMBA 3R6DA 2D2IA 5A02A 5AOVA 3HN7A 2CDBA 2BD0A 3PWKA 2J5KA 4IIVA 3QE3A 1KYQA 1T2FA 2UVDA 2QZ9A 3ZH2A 4E32A 5CDSA 1GQ2A 4QFCA 1I8TA 5B4TA 3PZBA 5L9AA 2CF6A 4IJWA 4WEQA 3UW3A 1DHRA 1E6UA 5JBIA 4MP8A 3DZHA 1GD1O 2EJWA 4RV9A 3F4LA 4WCFB 3WGOA 4TSKA 5K6AA 3C1AA 1NPTO 3JQAB 1H2BA 4FIZA 2O48X 1PGNA 3PQEA 4XJTA 1NXQA 2Z95A 5G0SA 4P4LA 2AA3A 3ZNOA 1ARZA 3EZYA 2ZJ0A 5IF3A 5TLSA 1OMOA 2FR8A 3PDUA 2O3TA 1I5RA 1YQDA 1X0XA 4CM7A 3JQGA 3MOIA 1NASA 3Q1LA 5JY1A 1GFSA 1HKUA 4EZBA 1VL8A 5KJFA 1GYQA 3GGGA 1MUUA 4DC0A 1LTHR 3WFIA 1TT5B 3BZUA 1EFLA 2VOEA 2O4CA 4I9HA 4IDDA 1ZBQA 1JKFA 2FMUA 3H6KA 4MVJA 1M6HA 4P22A 5G4LA 1B3RA 1VSVA 3C24A 3NDIA 4UEJA 3CKYA 3KO8A 4DLLA 1O5IA 2VHWA 1DAOA 4DQVA 3R1IA 3C1OA 1PZFA 2J3JA 1HL3A 3R3JA 2PZKA 5A03A 2HLPA 4I5FA 4INAA 1B7GO 3B1FA 4W9NA 2ZB8A 4FQ8A 1CEQA 3WTBA 1PWZA 5CDUA 1ZK2A 5KJEA 3JQFA 4I9UA 3AU8A 1Y81A 3VDQA 1DIAA 1W0CA 2W2KA
chains in the Genus database with same CATH superfamily
2X14A 4PS0A 4AJPA 4FKBA 4EHHA 5L6LB 4FWTA 5C7OO 1FDTA 1PKEA 1P4HA 4IDFA 5DT2A 1A5SB 1UKEA 2PNJA 3T3MB 4CKEA 3MFQA 4OQNA 1P19A 4Q6BA 4Y2PA 2JLVA 1J25A 1QZUA 4JUFA 3GEDA 2PCLA 1SXJD 5KJ6A 4G5FA 2J32A 4PQGA 4HFRA 1JAZA 3UCEA 1ZD9A 1MH9A 2B4AA 4GM0A 4YRBA 3F6YA 5F7JA 1XVIA 3AEYA 1UDXA 3O2JA 4PXAA 4MDFA 3VC1A 4R5HA 3V4VB 4IZOA 2CXTA 4LYHA 3OTHA 2QB5A 4B34A 5EA2A 2XCOA 1ISRA 4DWWA 5JJKA 2CMDA 3KU1A 3NTUA 3D6MA 1O95D 4RADA 4L78A 3R09A 1UZMA 4I55A 1OFHA 1G4HA 1PWXA 2ZJAA 3FIJA 1KQ3A 4Y2XA 1WDKA 1DADA 1NX6A 3K32A 2QTHA 3N53A 3V34A 3HFGA 1TU4A 3N2IA 1R37A 4ZFNA 1QAMA 3GC6A 1RIIA 1VSUA 1BZYA 1XZGA 3FPSA 4JIMA 5FNVA 2ZAYA 1GPNA 3V1UA 4DLPA 1DRKA 4XOIA 1YB6A 4XPZA 5CDFE 4F11A 4O4HB 2Q0QA 3UUWA 4P32A 1BA3A 4KZPA 2I33A 1A9XA 3KOOA 1XXLA 3ETLA 4M8IA 3TJRA 4IQ4A 4DDHA 1XDWA 2PFGA 3GAFA 1FVOA 1R9NA 3ESZA 4LY3A 1RJWA 4DDUA 1SG9A 3B9QA 2Z2JA 2WAOA 4H17A 4X1IB 4X41A 4LQDA 2Z8YA 3GR6A 4J0GA 3ID6C 1UJNA 1BQ3A 2A1UA 3JQAA 5ER9A 4LWZA 5JAPA 1L2TA 2B6HA 5EYPB 5KWIA 2I22A 1F2TB 5B4UA 1A2OA 1DO8A 1T8PA 5BW4A 4IX9A 2Z8ZA 3ZDQA 1OB5A 4YAJA 2X6QA 2IRWA 2WZBA 4JJ4A 1R10A 3NHAA 3E9EA 2LKCA 1GCGA 1SVIA 2R87A 3M5WA 4TMWA 1JSLA 1P72A 1XMIA 3RYTC 4HH0A 3SLKA 1PFVA 1XPJA 2XUJA 2WJWA 3DL7A 2VUUA 3PC4A 5CYOA 4F6CA 1BU8A 1V1RB 1UK7A 5KQMA 3JD0A 3QU7A 2HHCA 3U4HA 5FO1A 3R5FA 1V6SA 2UZ3A 3EF0A 4GGPA 4EKGA 4NYJR 4DG8A 4BRZA 4HT3B 5JDIA 1ODCA 3H0KA 2YINC 4BMYA 1T8YA 2ECQA 4GECA 4M1WA 4DA0A 4CI9A 3QYPA 2H63A 4EL5A 1IBKB 2X2PA 4ZCMA 1GQQA 1EM8A 4K9LA 3BL8A 4CQMD 1FMTA 4D8TA 2AN4A 2HQSA 1I0IA 2N0SA 1TO2E 2YNMA 4EGFA 3TSZA 3PCTA 4WL0A 4IEEA 3C7AA 3LWBA 1WBDA 2F8MA 2FPPB 4QXAA 2E4UA 2I0FA 4X93A 4AJJA 3B3GA 1CETA 3AX6A 3ELWA 4FDUA 4RF3A 2JGMA 1LPBB 4GC9A 1L4NA 3RYHB 4B79A 1J6UA 1YRLA 3EC1A 4CL2A 3H5IA 1RYBA 4K28A 5AHWA 3K8QA 4NBSA 1QHNA 2EKPA 3HJCA 2E49A 3LF2A 3NRJA 1H1LA 5IHPA 3RAFC 3V3KA 3R7DA 3FOFC 2D0OB 1G8AA 3OBIA 1TPZA 1VL1A 3B6ZA 4FYPA 4MW6A 1PIWA 3L3BA 4FHCA 1QR6A 3IV6A 3QUQA 2C5HA 2XWQA 3FDZB 2JAQA 4K86A 4P98A 4CKYA 3QFHA 4ZV9A 3WOHA 2H1WA 5LC1A 2GK6A 3MBOA 4AICA 3ZDEA 1N6IA 4QXPA 5K05A 4JQYA 2QLNA 3AJ8A 3OM9A 3GD7A 1JU9A 2FUG1 2IF0A 4EATA 3KBOA 4XPIA 3GWGA 3QLTA 3HP4A 2ZULA 3PHHA 4IGEA 4B43A 4C3OB 2C2KA 1JQ5A 1C8VB 1DQYA 1TYDE 3O4HA 1D2AA 3K2EA 1GG8A 4CM3A 3EQ8A 3FUCA 3EGOA 1YZ3A 4GRIA 1S9HA 5IPFA 3T5AA 5EIXA 5DI3A 1MQAA 4LOLA 2XCRB 4KDEA 4B2YA 3I1FA 1JDTA 4LJKA 1CD5A 5EJ2A 2XUPA 1Z6YA 2VYCA 2GGSA 1LDBA 2NTYC 1O9BA 2Q4RA 4OCZA 4HNAB 5JBNA 1MIHA 1OYVA 4K6MA 3K09C 4AS1A 2FMHA 1YB2A 2P75A 3NEJA 3D59A 3L01A 4RDHA 3ZHXA 1W19A 1VKRA 4BLQA 4MWSA 3HP7A 1JAYA 4XCQA 2GCIA 5BT8A 1UP6A 1U28A 2K4MA 1G3UA 2W7TA 1Q14A 4PC6A 1P9LA 2AUNA 3QKUA 1XTSA 5LQNA 5A2QA 3A1EA 1VMDA 3VHRA 4DSOA 1Q1NA 4DR5B 2DLDA 1II8A 4OQZA 1KBZA 1XTZA 1C30A 4RTPA 1WSBA 3OZXA 3JZDA 1SUEA 4EB0A 4P1ZA 1T34A 3T1NA 1WB5A 4I4LA 3L49A 2GAJA 3ZBUA 5HA5A 1K86A 2LR0A 3RJ9A 2QROA 3V4OA 5KIAA 5IT4A 2CVPA 4KYUA 1Z45A 2BDEA 1P5FA 2E4XA 3WGKA 4ZDJA 2O5RA 4RKFA 2RSLA 3H5LA 2R25B 1DPGA 1SRRA 3ZKWA 4XB6B 2FN4A 4PIVA 2IPOA 3PEYA 2GCOB 3F96A 3NG1A 2CJWB 2HJHA 2Y1WA 5DPMA 1Z08A 1NWCA 4BYGA 4DWVA 1VE5A 3VOSA 4EO7A 1Z7YA 2QV0A 4FOSA 3DMNA 5AI9A 3K0FA 10MHA 2PUCA 2HA7A 2A0XA 3OQPA 4L51A 5IARA 3ANLA 3I12A 4Y2GA 3RS5A 3TNYA 4F38A 2MJLA 1K9SA 4IAOA 1FF9A 4FLFA 4MNTA 4N3AA 1IB6A 3EIUA 4ZVQA 4MQ4A 1A8PA 5FDFA 4EUSA 2QXYA 3MRVA 4JYZA 1NBEA 4OF4A 3UHPA 4KMSA 3OEWA 1FMLA 3FUWA 3QI2A 2EV9A 3R9XA 1ETHA 3D4NA 2JANA 1NOJA 1JAXA 4O25A 4C7VA 1PNTA 5I51A 3CNQS 3IHTA 4IDGA 1I4DD 1HPLA 3I04M 3WRYC 3BC1A 2E37A 1OXTA 2SKDA 5TQ0A 3K8OE 4ZMSA 2IHZA 2ORWA 5L40A 3PC3A 3ADDA 5JZSA 2I2CA 3M89A 2IV3A 5EE9A 3BFKA 3PE3A 5E2IA 1JFFB 1RBQA 1UBSB 2E9SA 3ME5A 1K0FA 4NX2A 2G5CA 3FSGD 4RE5A 1JBKA 3AMVA 3U7GA 5CCBA 1GZVA 3PT9A 4URWR 1S5PA 3TZCA 1OHHD 1X86B 2CK3A 3EFHA 1INLA 3ET5A 3HKCA 2C1ZA 2O2CA 4GP9A 4GYWA 1USWA 1DTSA 4INJA 4O29A 1E77A 1JHDA 2RONA 3ETEA 3EZ7A 1DHTA 3JVEA 4MQLA 3TLCA 5ULLA 4CTOA 3W78A 1YU9A 5TPZA 5JS7A 1KKUA 1Z4IA 2Z8XA 4CDGA 4TL6A 4YA6A 4I4TF 2ZBDA 3IX7A 3Q9LA 1FX1A 1RFLA 5E3HA 3WAJA 2P68A 1XTJA 4HXEB 5IDXA 1XRNA 5LQMA 1PG0A 3BHIA 3UANA 2O06A 2GXAA 2VXCA 2W6ZA 4JENA 3R9IA 3VR5H 1ECBA 1MJHA 2IBSA 2YUIA 3OJXA 2VJQA 1BEEA 3QWHA 1NMZA 2E87A 1EGHA 1LBTA 5JFGA 4ES6A 5CM2Z 2J3MA 2DPXA 3FCOA 4JWKA 4C4SA 1P0PA 3CX8A 3FTNA 2BZ0A 2WKSA 2X6RA 3PB3A 5AKEA 7MDHA 5KOJA 2WM2A 1DEKA 1MO3A 2HBYA 4PGHA 1Q2UA 1NKSA 1FDIA 4F5EA 4B45A 3L77A 4TRMA 1C7QA 4RZSA 1GGNA 2BFWA 5F5XA 2P2DA 4NRDA 3EXG2 5T4HA 3EH1A 3D7NA 2VQFB 4MVJF 2B0CA 4GPZA 1RYYA 1M2NA 4Q3BA 2OSBA 1DAIA 1C3OA 4H3VA 3QPBA 4J1NA 4KN5A 5GGYA 5BOSA 1LRJA 2WM8A 4MS4A 3RU9A 2M1ZA 3GLGE 4QYMA 3SHOA 3MYYA 5CA1F 3L7BA 1W29A 1FU7A 5LN1A 2H1SA 1MABA 2LW7A 4PNZA 4JR1A 1GT91 1QK3A 3LNTA 3M1AA 4A8PA 3TLZA 3E35A 1EZ4A 2ODPA 2BBWA 2VL7A 1R64A 3WLFA 4G25A 3ELUA 4JXXA 2Z2IA 1ZI9A 2QY6A 2WPNA 3T3HA 1RRVA 2JAUA 2MOKA 5DXJA 3WZLA 5GINE 1GG2A 1M6VB 1NE2A 2FRDC 2WIDA 4E4TA 1K2WA 3G2LA 3ZDFA 1UK9A 3KE8A 4OB8A 5FV4A 3VRHA 3CXRA 2UXDB 1ZNWA 1ZP6A 2DEUA 3AQ4A 4V1CA 4LQLA 3HRHA 4QTXA 4AROA 3AGPA 4BTVA 1CDEA 1CY8A 2H7YA 2Y0CA 1X7XA 3H1EA 4FBMA 1PJRA 3TJMA 2Z3VA 5EIFA 2VJAA 1JXAA 1VPTA 3ZV5A 2HCJB 1PS8A 4B6RA 4YXFA 5A4DA 5A4MS 5ITSA 4W9MC 1WCIB 5JNVA 1ULZA 1RPZA 5DWQA 2CJYA 4QGHA 1NF9A 2YJZA 3OQHA 4IMJB 1J2YA 4LE1A 3VU1A 4TQAA 5A5GA 1JGTA 2FFAA 1SXJB 1C9JA 3LWZA 5AW3A 2XDAA 3P2MA 1G7CA 4IFIA 4DDVA 4O2RA 1ZMRA 1M8JA 1NG9A 2GN8A 1P0FA 3IDSA 3UMVA 1AMOA 1IRIA 1QKJA 3AHFA 1M6WA 3AK4A 1X8XA 3CB4A 1Y8ZA 3WL8A 4M53A 3S2UA 3PQ6A 4W1QA 1FVFA 1XEWY 3BQ9A 2XR1A 4ENWA 5IM4A 3EXIB 3QRWA 2C2YA 2C5EA 1U0LA 3WK4A 1NT4A 3AB7A 3CVOA 1X1EA 4Y6GB 3NC4A 2CXHA 1TAUA 1W8DA 2YMPA 5C18A 1NXTA 1QHHB 2ZAOA 3R3XA 3CN7A 1QLWA 2C9CA 2XCIA 4IZHA 2UYOA 3G5TA 1W2HA 4LZPA 5CDHA 2EDCA 3LG2A 3HB1A 4KGXA 2AI3A 4IXMA 4DLKA 1VRVA 2G25A 4XASA 1RPTA 2YQ4A 1NKVA 4LSWA 4U5QA 2FPGA 2IVZA 4WX2B 4ZVOA 4BUZA 4DV7B 3QM1A 1JEQB 1YL5A 2AT1A 2B1GA 3S2SA 2W2VA 3P32A 2BTEA 1XP8A 5A6SA 3E4CA 3O74A 2PX5A 1NVXQ 4DIBA 1QOQB 3T35A 1Q44A 1KJJA 3CX7A 4FMCB 4GZ3A 1IWBB 4RCYA 1HDEA 5THKA 1QH9A 2I2BA 4EY5A 7YASA 1SIBE 5J4KA 4FMPA 1SVNA 4DYVA 4Z4EA 2QRUA 4G2NA 2GVNA 5JCOC 2X23A 1GUBA 3QP9A 2Q3LA 3CLUD 1V8PA 3K4PA 1AKNA 4TWAA 5G40A 3KKOA 4II7A 3QJGA 2VSXA 3TLBA 3E58A 4Z2AA 1IRXA 3AF4A 2I2FA 1ENOA 4CL0A 4HI0E 1NYRA 1YBFA 1KI1A 2D0PB 5E9WA 3HXMA 2BUCA 4NBKA 4DPMA 3JZAA 3AHIA 4EOGA 1CUGA 3UUEA 5FHRA 4W7IA 1FSGA 1R2QA 4LPSA 4I1IA 1LNSA 2QZSA 4H1UA 1GTZA 1CF2O 3IODA 4JMLA 3MHTA 1PGOA 2Q49A 2BGUA 2UUPA 1T36B 3SVTA 3MTQA 1XL0A 2KBFA 4OQFA 2QGZA 3ZCTA 2AL7A 4YNBA 3SF8B 5LMZA 3GFVA 3ZGXA 1C41A 2CYAA 3BB3A 4LXQA 4LY6A 2WD7A 2FWNA 1CR0A 2NACA 2PJZA 4KQIA 2WF9A 3GNSA 4OSOA 3IGFA 3PGA1 4JLWA 1FYDA 2G9UA 1YVUA 2XNSA 4DLXA 3MIZA 3ZGLA 4YCNA 2JGFA 3T7JA 1M1NA 3FYDA 4CNQA 4V2UA 3DQZA 2QVCA 3HEAA 3S6JA 5A1TA 2W93A 1E6CA 1E79A 3ZWMA 3A7DA 4NYIR 5F3DA 1Y8QB 4CLDA 1SXPA 3IURA 4Z3DA 1I7PA 3PNMA 4V2IA 5ELLA 3H6GA 3IPRA 4JL5A 3TQTA 3I6YA 2D5AA 1LRKA 1CZOA 3NBFA 4JC5A 5E3JA 3LCRA 4AIIA 1ORDA 2PR2A 4CV0A 1M7BA 2D59A 1W0KD 3IUMA 4KW7A 4I6GA 4BO4A 4J1SA 1B0AA 1KJQA 1NR1A 4JLDA 2ZRCA 4R98A 2OILA 4MB6A 4MO9A 4ZHQA 3NAZA 3BRQA 5LPNA 1TC1A 2BMVA 4WK0B 2PZ8A 2WYOA 4DLRA 3PHBE 1R8XA 1KYWA 3C43A 2OQVA 1KIFA 2IWRA 2IIBA 2VP3A 4MAFA 3GGOA 3A1WA 5KMGB 3AY7A 4I50B 4U9IS 2QXTA 4OU5A 2JIQA 2J0VA 4YP6A 1RRFA 3ZWOA 4DLSA 1JFLA 3BWDD 1L7NA 3PYMA 4PQYA 2NZ2A 2WKQA 3SS9X 3RYCA 4KHPB 4DQLA 4EPRA 2QE6A 3NAGA 5HTKA 4IDOA 4IIBA 4NBTA 5GJCA 1FFCA 3AKEA 1IFXA 1YZNA 3N0RA 3O90A 1Q0TA 2P5YA 4FDLA 4EHJA 2KMLA 1H8HD 1OQAA 1WOYA 4BOYA 1W94A 5F1PA 1PN3A 4YJFB 2X19A 3IP5A 1UCFA 1U99A 1I01A 4ZZ2A 1KE1A 3UWPA 1CK4A 1Y6QA 4R8LA 1JDZA 3R5JA 3EVGA 3HDTA 5JYDA 2O8EB 1K8ZB 1JSZA 1RXCA 2Y05A 2IYNA 4RY2A 1EX6A 2R7AA 4FCCA 2VOJA 1KAHA 3OZWA 1UBTS 5F1YA 3V8MA 4LYYA 2C59A 1M34E 3DWIA 3IQEA 2OL4A 5CMLA 4KTVE 4AW9A 1GFWA 4AYTA 1KDYA 3NR2A 1C4XA 1G20A 3A36A 4HQFA 5D5QA 1CTQA 1PQ4A 5LBTA 4D8XA 4PCUA 2W6OA 1W5SA 1RS0A 4J4BA 5ITZB 5BWCA 3WLTA 3HCEA 3QJYA 1PJTA 3GJQA 5TPWA 4I4IA 2ZJOA 4PZ9A 1O0BA 4P7JA 4DIKA 3KX2A 3TQSA 4KLRA 4NENB 3DMGA 4AS2A 2IDMA 2F1OA 3S2GA 4TS4A 4S1TA 5J2UB 1FFSA 4H15A 4N5NA 1JP7A 1QE5A 1L3IA 2OM6A 3CW2A 3OOWA 2A57A 4TSFA 4IWXA 4Q02A 4XYEA 3NB0A 3ZZNA 3BMNB 3KJEA 3M4JA 4KQWA 4CBVA 1ZJZA 4YAWA 3GLQA 1JDBC 4H35A 2ZBFA 3GBPA 4G41A 2O5CA 3KOWA 1R3UA 4Y1RB 5HQJA 4Y1GA 3LBFA 1D2RA 1RE0A 4RVOA 3GJ4A 3DXFA 2VAVA 2WRZA 2YFYA 5AJHA 5CDFA 4B4OA 1KETA 2I5PO 3FWKA 3KHTA 2XJ9A 2YIJA 5C5CA 1XCBA 4ZT3A 4QYWA 4NU5A 3I0MA 3D6FA 4AWAA 1ESEA 3FDIA 3I0NA 3OMXA 3KYCA 3LVQE 2C3UA 3VI4B 5EWJA 1ULSA 2H9YA 2PRKA 3OAAD 3RRYA 3EIXA 1O0SA 4GZ6A 1JIQA 5DMHA 1Y6GA 4QBHA 1R0CA 3LX4A 3CRW1 3HCCA 4IDPA 3ACDA 4FK8A 2E82A 3ANNA 3BZBA 1P0IA 1M76A 1W48A 2XV1A 2ZUSA 3U48A 3HRIA 4FS3A 4TXJA 2FDXA 5HRUA 1OKKA 4YGXB 3L5OA 1N2BA 5DYTA 2BTQB 1ZOSA 3KSDO 3AR3A 4XUDA 4BQIA 4FYJA 2QZ4A 3GJ8A 4V0SA 1MO2A 3PEFA 4TTAA 4ICIA 2BGWA 1IEQA 3ZJVA 2PRJA 5EE0A 4TKUB 3GIDA 4KE6A 4H4DA 4YGYA 3ZHSA 1EBUA 5LXTB 5GADl 5THQA 4C6TB 1WR8A 4HGZA 4GYKA 4G6ZA 1E9EA 2JCBA 1PL7A 2JEYA 1J00A 3DMTA 4MI3A 5DKFA 1GSOA 3UGTA 1AOXA 1S4MA 2OD2A 4G0YA 3GRKA 2R2GA 5ALOA 4XWOA 1H05A 3SS8A 1CFZA 4XWAA 4HAUA 3KM0A 1F3LA 2I4LA 2HPZA 3I64A 1LDEA 5CD9A 2XVXA 1PT7A 5FBRB 3WIDA 3K5HA 2OGZA 5KOYA 1AGYA 2V5UA 5IHXA 5JAOA 1PL0A 1QRRA 3HP1A 1BGXT 5JCPA 3OFKA 4M86A 3HB5X 2YY7A 2ZRKA 3ILVA 4JYMA 4UPVA 2RAVA 3ASUA 3UG6A 1SUWA 2UKDA 3I34X 1QQBA 1FDOA 3EGXB 4FCWA 2ISSD 1UK6A 3W05A 2PUVA 5J4YA 2HEGA 4MGYR 8ABPA 5K8CA 4KIFA 4BRSA 1K6JA 3C6ZA 5G0WA 4LE0A 2WUEA 3S29A 4NH0A 3UAYA 4EFKA 5IZ4A 2IYEA 3F6CA 2NQ8A 3AEKA 1BOOA 3WYFA 5E6UB 4MROA 1XZLA 2AOTA 1H9AA 2ST1A 2ROQA 1E2GA 2VRBA 1UKZA 3HQ4O 4MR7B 3UG7A 2GR9A 3LP6A 4X1KA 3RHZA 4CQJA 1AVTA 3HTXA 5JXIA 3SC3A 2GPAA 3UUGA 5TT0A 3VPBA 2FSGA 1XEAA 4WAUA 4WLUA 1N33B 2CVFA 1UOEA 3BXZA 1Z5NA 3VGPA 1BRMA 3LFHA 2GARA 3ZV4A 1P17A 3IMCA 4QUGA 5KNBH 3K35A 1NF3A 1R8QA 2RI0A 2XXAB 1PI3A 3OKFA 2ZCUA 5BV7A 2F8TA 1H23A 3K0AA 3OICA 1R7RA 1XSEA 4AL4A 4AM8A 5BW8A 3JQDA 5K0NA 1M66A 2VDWB 2XZDA 2NU9B 4CW7A 5K99A 4DE5A 2XWBF 3JPWA 3BCRA 5KC9A 2DT5A 2REQB 1DL5A 3RRJA 4W5RA 1EVQA 4YRJA 4YAFA 5D1NA 4IR7A 4BP8A 2GEFA 2VT7A 2N47A 3FSJX 2CKDA 3EMVA 1VFNA 3ZJ4A 5EJEA 3A1FA 4QT4A 1U0FA 1A82A 2OV3A 3E3OA 2GZHA 2BT4A 4I7EA 5D5PA 4WDQA 3L0DA 2GESA 1XOIA 4NYMQ 3C1UA 3MMPA 5P21A 3DMRA 2EBFX 3VR0A 3AC0A 3L1HA 4OATA 4EG7A 4W8GA 4ENVA 5B58C 1QRTA 4HUQB 2G9VA 1Z36A 1X19A 1ZUWA 5DX1A 4E09A 3RSOA 1ZZEA 3C8DA 4E51A 4GSYA 3O1IC 3OKCA 2WYHA 2MMCA 3H11A 4QVGA 4BLRA 4KBYA 3O75A 1BWSA 3AYZB 3IMGA 2PRSA 1XCJA 3C8UA 1OROA 4P33A 3EBOA 4UNIA 2JBHA 2HMSA 3MD9A 1VLJA 4PV7A 2P79A 3SHFA 4JB2A 3STVA 1R1DA 2DKFA 1FNNA 2ZXEA 3MTDA 4QGBA 3ZY6A 4A26A 2O8VA 4IWNA 2NXJA 1ZS9A 1J07A 1WZCA 2AQKA 3PQ3A 4B7CA 4OQ4A 4CN8A 1UJ5A 2J0EA 4JJAA 3AFHA 4NPHA 5CURA 5IASA 1L1EA 1XU7A 2AUTA 4TKLA 1V47A 1LW7A 2W11A 5EXDA 1H4QA 4HFJA 2XCQA 1YDHA 4PLPA 4P0TA 4HHEA 4HH3C 4AD8A 1QBGA 3RKRA 2G36A 2PK3A 3BKWA 4JI0B 3QIAA 2A9KA 2CXNA 2X42A 2X5KO 4R6WA 4QGGA 5L3VA 1ADJA 3AJDA 3E5MA 2EYQA 3DV2A 3LF1A 1O94C 1IG3A 4KJZA 4LJ6A 4MV0A 5AXAA 4BXOB 1P1KA 2QW0X 1ZI6A 3TLJA 1MPXA 5JXHA 5ICGA 4KQKA 2XQJA 3N2YA 1T9HA 1XZIA 3JPYA 1K1EA 2P77A 3JQBC 3NHLA 4LE2A 4B33A 3KXIA 1NG1A 3SZRA 4BKRA 5KYWA 1JG4A 1Z25A 2K7ZA 3I4FA 3R24A 3DOHA 3MLAA 2NO4A 2PM8A 2QJRA 3P9IA 1NUQA 1IEXA 3FKQA 3CTPA 4G5GA 3JYOA 4LPKA 1T9KA 3RFVA 1KVRA 1Q1QA 3B3JA 3BFVA 4PZZA 5D3MA 4R9RA 1V95A 3T6KA 5ALGA 2EZ9A 3GVPA 3SE0A 4D9NA 1H2HA 3UFXA 5GJWC 2Z4SA 2XUIA 3SIRA 3GW8A 2JARA 3ZU5A 4B4DA 5AVTA 4PC2A 4F3TA 1LBQA 3FKJA 4AZ0A 4CTNA 1ND5A 1G8KA 4U6QA 2WJIA 4MWCA 2BFNA 5EG5A 1RI2A 2B1QA 2RGDA 1TZ2A 3JTMA 5I7AA 3X43A 5TJ9A 2DQYA 2FX5A 3QVOA 4D74A 1CY4A 2GHRA 4D3DA 1OX4B 2BFBA 4CVNA 6GPBA 5MHTA 4LHYA 4DJ5X 3LKZA 1RJ9A 2Y77A 2F90A 5GZ3A 4ESEA 1VIVA 1U2QA 3BGDA 1YA8A 4OGGA 1KQPA 4HDRA 2RHDA 2XOKD 3RREA 5D3ZA 1JPVA 3SDSA 4CM4A 4NZNA 4HLCA 4AN0A 3IJ5A 3H18A 3PK0A 2I4MA 4YP1A 1P7YA 1ZWKA 4EH1A 2JLYA 2EKQA 4BMCA 4FE4A 2PX4A 4PZCA 5CB6A 2QJFA 3IDQA 2ID9A 3TQCA 4CUKA 2ZOSA 3HV0A 4R1NA 4EQ6B 1CZLA 2WINI 1DELA 4OHWA 2DHDA 2HIHA 1QP7A 3G2PA 4LGYA 1ZM9A 5BSEA 3WOVA 1A3CA 1NVKA 1X3SA 1HLFA 4HGPA 1JWBB 4WNAB 1J97A 5KYUA 4ARZB 1A9ZA 1KYZA 3KBBA 4D9GA 5H9VA 4EUFA 7REQB 1X6VA 2XNDA 5JJBA 3QNUA 4B75A 2Q6VA 2NO0A 5BMVF 4D79A 2OK7A 4RU1A 3QF7A 4B6OA 4A6XA 1XZMA 5EMLA 3AG6A 2A3NA 1EVJA 2B30A 5EKTA 5TJHA 2V9CA 3CLTC 1RYMA 1FYFA 4ARCA 3B1ZA 5I3ZA 3BMXA 5DNCA 3BQNB 3LZCA 1Z8NA 3GLGA 1SU7A 5HF9A 3V8PA 3WR5A 1CVRA 3D5EA 5DBIA 4FJ0A 4D43A 3Q8KA 2R86A 1YACA 1TQHA 3G9ZA 2AC2A 3R6WA 3P4UA 2OAGA 5E3IA 5AM0A 2VSOA 2F3RA 2G9ZA 2ACVA 4ROSA 1O57A 5FOUA 4FMCF 1CUUA 4O2BB 5K6AC 4LC9A 3L8ZA 2UVPA 4ZCSA 5U4XA 5HZMA 4O4IA 4M1YA 3OH8A 2ZJ2A 4ZV4A 1MVLA 2G88A 1LNZA 1N5RA 4LF6B 1JKMA 5SZKB 5HK9A 5DIFA 4MVJM 4KZKA 1KY4A 1DP4A 3ZWVA 3N0XA 1NFQA 1L3CA 1B8OA 1WL8A 1J1ZA 3KAJA 4V3CA 5K0SA 5KVCA 5ALDA 4LMPA 4KN6A 1W2WB 1QOPB 4S05A 4PTYA 1HYGA 1UT5A 1MTOA 2GN6A 3MT0A 4BNKA 1L1RA 3ZHZA 2EXXA 2XRZA 2BFAA 3BH7A 1ZA2A 3UXHA 2VAXA 1A8HA 4W1PA 1G8SA 1YOVB 3OEEA 4PSUA 1U80A 1V9CA 2MU1A 4LYAA 2O8DB 5AKIA 3UCFA 4ZU1X 3W6OA 1YB4A 3N0VA 3MRSA 1Y1QA 4JN6B 4TUYF 1EUYA 4RO0A 1ZZGA 4X7MA 3RF6A 1ML4A 3H3XA 2RJ3A 4KEAA 4MIEA 3OESA 1SEVA 3WJAA 4Q5IA 2RAPA 5ECGC 3QKRB 3RIEA 3KQHA 3U31A 3PNOA 1ZC4A 1BYUA 1DJPA 1NP6A 1QO0D 3IQXA 3RDPA 1GGMA 3N74A 2B98A 5ALJA 4YR9A 3MTEA 1OA0A 3NC1C 4WINA 1CZNA 1QF7A 2Q3DA 4TVKA 5F98A 1YO6A 3A1UA 2X9NA 1LVUA 4OHVA 1DAKA 3VR6A 4EVRA 5F3RA 3Q11A 3KIPA 4TXLA 3W9BA 2WC1A 1E32A 1KZYC 1JHAA 2CZCA 2HKIA 2W43A 5EMJA 3HMQA 2ILTA 3PGMA 1KSFX 2G8LA 4POOA 1QV9A 4UM8B 3OCCA 1SBHA 1I6LA 4PICA 2G67A 1UEXC 3R76A 4E4YA 1IY1A 1P18A 1JE0A 2FK7A 3DTNA 2NU7B 4PGFA 3AY0A 4ZV7A 4LJRA 4RVHA 3L7YA 3HDJA 4O4LF 4RKEA 4XGIA 4FZRA 5JNLA 4DV1B 4GH5A 4P86A 3FPAA 1MCZA 2FF7A 3SJZA 1E2MA 1W7AA 1OCEA 4CM9A 1QH8A 3OQIB 3SSOA 3NDBB 5ADVA 2JFWA 2IYUA 4Q1DA 1WOMA 2R8EA 1RKQA 2AWOA 2OHOA 4M9XA 1RWMA 2PKYX 2R4QA 4I50F 4RVFA 1X7YA 3K9GA 3QUCA 1CY2A 4X00A 5I3CA 4HDKA 4AS3A 5CBPA 4UQLA 3ZZUA 1U8CB 3CEJA 1VA5A 2XY4A 1YR6A 3JARB 2E6KA 4JBIA 1JYSA 3W34A 4B46A 3N0WA 2Y1KA 5T5QA 3LJKA 4KP7A 3C97A 3U1TA 1X9IA 5IJAA 2GHIA 3WK5A 4BC0A 3U37A 2XGGA 2P0EA 1XFDA 3FWNA 1D2NA 4NCJA 2NXNA 1XC7A 3PUWA 2YFHA 2HJGA 3JWIA 4N1AA 3U17A 3UFBA 1DARA 3AF0A 4B4UA 2VNSA 3GFSA 4JLKA 3R6TA 1XTBA 4AJOA 5CAEA 4XXHA 1AT1A 2HCBA 1IXYA 4QAQA 3EG9B 4KV9A 4A0HA 1I1NA 1GLNA 1OX5A 3CXUA 4CYMA 4DLTA 4KSCA 4YRAA 4CLHA 4TTSA 1NQXA 2FMIA 2N3ZA 1ID1A 3BULA 4CQLB 3IXLA 1CS0A 3KJGA 3LYAA 2DOKA 1KK1A 1CBUA 2J9ZB 4M7RA 1O9GA 5EIWA 5JEEA 4QUHA 4M8NE 1RQXA 2H2HA 3C45A 3THYB 4EKDA 1GYRA 1XG5A 2O05A 3UT5A 2P90A 2JI7A 1FUYB 3GJ5A 3LM8A 1FMCA 5COQA 3ZV7A 1EMDA 1VJCA 1YT5A 3LWNA 1DQNA 4PX9A 5DI9A 5AXCA 2XYRA 3VVLA 1GNSA 1Z56C 5IMSA 4GMXA 3GDGA 4TTIA 4NICA 4LX0A 3PWSA 3N76A 3O4IA 1Q0QA 3UBTA 2YIMA 1ZJYA 3ESXA 1BKYA 2BEVA 2DWPA 5J2UF 1AV7A 1QQTA 4JY7A 3T5MA 4JUDX 4YFVA 2EVWX 1LDGA 3RG2A 5BNWA 5DTIA 2B35A 1QQ5A 4G84A 3GRRA 4TWBA 4L5CA 1BS9A 2VK1A 3I3SR 3R4VA 1KU0A 2X3YA 5PGMA 3ZVRA 5CB8A 5IAJA 3GPIA 1FJHA 4QJIA 4P8RA 5KWSA 5AJVB 4HGYA 1ZJWA 5CBKA 4HDSB 2E0IA 4ZVKA 5DN6D 1JI3A 721PA 4MUEA 1E20A 1L5WA 3EXEB 2YHBA 3VZDA 2W70A 1DE0A 1Q0ZA 1D6SA 4RIEA 3RYIA 5SYMA 4E30A 4CF7A 1QONA 1GLVA 1HFWA 1P73A 3U3OA 2CHQA 4BUCA 3CO0S 5EJMA 2C20A 5LA6A 2JBAA 2VYQA 1C3VA 1QBKC 2GSWA 2N9UA 1E96A 1F4LA 2HK7A 2XOEA 2C0CA 2XUDA 3H1FA 3Q3HA 4UVIA 1EIZA 1UOQA 3DONA 4XWGA 4FUTA 3TD6A 3AR6A 1LC0A 2QRLA 3LCMA 4FW9A 3EW7A 3Q9UA 4Q1VA 3ZWQA 1M0EA 4IFTA 4EUHA 1G8GA 1HE8B 2Y2UA 4JT8A 2WIJA 4ZODA 2GHQA 5DM70 3KPWA 4JYBA 1YDWA 4L22A 4MUIA 5EWLA 4ZGBA 2DH5A 4OHPA 1OFVA 3DEAA 3KR2A 4PPQA 4L5YA 1KH3A 2XAUA 4YLYA 3TB4A 3CY6A 2PZEA 4D4KA 1IHPA 1RAHA 2PBZA 5JQWA 5LXTF 4PZPA 1A5AB 4ETWA 1C7JA 1MA3A 3GROA 4BLUA 4BMDA 4XE5A 1VJRA 5K3FA 1Y3AA 2AOUA 3RSQA 2DB3A 4RJ2A 3AR7A 4YRRA 1P4GA 2QM3A 1AJEA 1NLZA 2GILA 1J7KA 3HB0A 3EPHA 1DGQA 2ZKLA 1ABFA 1PLKA 3B7GA 2W6JA 2A5FA 4WLOA 5KTPA 2BM0A 3CKMA 3ZI7A 3P2YA 3F6SA 4U7JA 1T0PA 2DQSA 3VNBA 5LP6B 2WF7A 2Y9MB 3WYAA 4UBOA 3STXA 2FW0A 1JA9A 3LY7A 3UQYS 4IEIA 1JAIA 3UOAB 1YVEI 4QXRA 3IHWA 1J0AA 3UB3A 1BC5A 4KQJA 2PKWA 2BWJA 3DGEC 5BUSA 5K3CA 4CETA 1B6TA 1AKYA 2H4ZA 3VISA 4BNXA 2RHBA 1UWCA 2I6FA 4DFDA 3LY9A 4OHXA 1PX2A 4NH4A 4EW1A 1P2BA 2MCFA 3WXMA 1N57A 1OAOC 2VYFA 3GVHA 2J0UA 3DXYA 3B2EA 5EYPA 2HOQA 4HF7A 4LJSA 4QPCA 4YUZA 3U4IA 3CF2A 4DKXA 5B1YA 3P5SA 3IVXA 3UJBA 4BX2A 2OCXA 2P5SA 2LWIA 3OEHA 5SYNA 2O5VA 3A32A 4HK4A 4XQ9A 3GDWA 4BKMA 3OZSA 3HR7A 2LV8A 2ZB3A 3ENVA 4I5EA 2P11A 4UTVA 4TN1A 2YUTA 4FHFA 4NOLA 2JGEA 5FD8A 5TY0A 4B2PA 4LXHA 5DNYB 1TTTA 1NI4B 3EZ9A 1C1DB 3J81k 5L7WA 3AG5A 6ADHA 2BL4A 2GLXA 3BMCA 5DM0A 3VBEA 2ZJ3A 1N7IA 1CUBA 4CFYA 4NBRA 4CIDA 3MVEA 2G07A 1W2GA 4NU8X 1NSYA 1YR2A 5AHKA 1K3UB 3ZVLA 3A26A 3L9XA 1I94B 1LJ8A 4WQMA 1PYDA 3N6XA 4R1MA 3N6RA 1XMPA 3U3ZA 3WB0A 4C3ZA 1NRJB 1Q77A 3D0RA 3L8EA 4UUQA 3HGTA 2I2AA 2V3VA 3JYHA 2QSJA 4RKYA 2F9MA 3KYDB 1SA0A 2NVWA 2XTAA 3I9MA 3WVNA 3LGSA 4DDWA 4FGWA 1IYZA 2V4UA 4WZ6A 4XX0A 4B3SB 1LB1B 2A4KA 1SZJG 1Z0IA 2X7HA 3LY8A 1L7RA 1EX9A 4Q9LA 4R2LA 3BGVA 3Q5DA 4WK2B 4ZCIA 2H52A 1P2TA 1PJ3A 2BR4A 2SKEA 2PKQO 3M8KA 1IJEA 3AOGA 3M6VA 5KU7A 2ZAMA 3EEBA 3W8FA 4CKWA 1F9EA 3UMYA 3KU4A 3MQFA 5H1YA 2X8JB 5A9TA 3TH5A 1T24A 2G9QA 421PA 1YZGA 5I4IA 2WMDA 4JC8A 5K7SA 1BS1A 1UFRA 1M2FA 1NXSA 1IZYA 4D8UA 4F5DA 1C9EA 1V1MA 3V9AA 4AU1A 5TMPA 3J7AC 1A2BA 5AK0A 3K9QO 3BIWA 3TL3A 1RRPA 3SJCA 5BSTA 3PPYA 1Z3CA 1P5RA 4NE2A 1XQXA 4QUJA 3PQDA 1ZD2P 3DVRX 4YDHB 3CA8A 4UVDA 4LFCB 2H1OA 1OI3A 2ZE7A 3B82A 3RC9A 1PQWA 1K3FA 4MVJH 1DXHA 3GPDG 4I1VA 1YBVA 1CR2A 5A3VA 5GIPE 5L7TA 1JQJC 2BHNA 1E5TA 1U1EA 3SOPA 1O97C 3VHQA 1BEUB 3CRVA 1BFKA 4L4XA 5JD6A 1JR4A 6LDHA 2Q1XA 1K89A 1ST2A 2BM9A 3B38A 4IGKA 5D3KA 3WSVA 1XZHA 4LBYA 1TFUA 3ZQKA 4Q47A 1PK9A 4MKFA 2XEXA 4DV0B 1U90A 2GVDC 2VH5R 1HR0B 3PS9A 5MFZA 3EUWA 1U0NA 4V0KA 3BXGA 3ZI0A 5AI0A 2B4RO 3CIOA 3QVWA 4F21A 5CVTA 1IQPA 2FUCA 3LQYA 5DHFA 2EIHA 4EARA 2JLUA 3DBVO 5LNK6 3UK6A 2QEQA 1H6CA 8AT1A 2WYWA 5U4QA 2BYTA 1DC6A 2PT5A 2IY8A 3GXOA 5HCUA 3GAAA 5FA8A 2XLCA 5IBQA 5KJCA 3P0HA 3LBNA 3T15A 4BJ3A 5LIPA 5SY6A 2V7EA 2XGMA 4DLZA 5K03A 4RJTA 1G8JA 3EZLA 4RL6A 4NCBA 4IJ6A 3GYBA 3ZOKA 4ZJUA 3KSAC 3E84A 3LOUA 4JEHA 3D0KA 5FI5A 2D2EA 3COYA 4AY6A 4JBLA 3SKVA 4FDTA 2DH6A 2XUFA 3V42A 2H1HA 3BBLA 3K72B 4IKEA 2OHGA 4TPKA 4WY5A 3PA6A 4PTZA 3WKEA 4DF3A 1LFDB 5A5EA 3FOAA 3AO0B 2QQGA 5CFNA 2XZOA 2K5UA 3FYUB 2Y0EA 2ZIGA 3EMDA 4TV9A 4AZSA 4AO7A 1DFIA 5FPQA 1A72A 2IOQA 4HYQA 3WMWA 4HDOB 2VA8A 3VYRB 4HDMA 5K1ZA 2NO9A 3EWAA 3N39C 3OKAA 5JNTA 4H7PA 3VR2D 4TZTA 3ETJA 2AKYA 2R44A 2NUTA 4YAEA 4R0MA 3E9DA 2A2ZA 3GN2A 3L8MA 3I1JA 3DEHA 2I1VB 2J3HA 3A2KA 1JJ7A 4HR7A 1PCXA 1G2IA 4Y2HA 1SBTA 1F2UA 2ZG6A 3T94A 4Y6PA 1XF9A 1KK0A 5CM8B 4MAAA 4V24A 1QTIA 1RMQA 1QQ6A 1EH5A 2KI5A 3BJEA 5SZHB 1QVAA 1YFZA 2FE4A 1TAGA 1S8FA 2OM2A 4ZOCA 2VSQA 1SCNE 3ZQJA 9GPBA 2EQBA 2AKAB 4PAQA 3ELYA 1CJSA 5A2GA 2H1RA 4AP9A 4DNQA 1XDZA 3KJXA 2BRUA 4K6OA 4OUKX 1N6OA 4B3XA 3M2TA 4JLAA 3FUTA 2FZ4A 1XCGB 2Z83A 2P9JA 4LXGA 3JTEA 2I71A 4D42A 2ZUDA 4MLPA 4C2AA 2GWRA 4ENSA 3LIIA 4B4VA 5AUOB 3ETGA 5H83A 2OUIA 5FJJA 1L4FA 1TM2A 3QVMA 4A5OA 2Z56A 1GVNB 4HVCA 4JV5B 3D2BA 4A0GA 3QF4B 5AT1A 1RRCA