1NVTA

Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
287
structure length
287
Chain Sequence
GPLGSMINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Shikimate 5'-dehydrogenase
publication title Crystal structure of shikimate 5-dehydrogenase (SDH) bound to NADP: insights into function and evolution
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 94
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nvtA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1nvtA01
1PS9A 2FPPA 4RPGA 3E9NA 5FF9A 2FPGA 4JBHA 2FOIA 1BDBA 2PGLA 4D0SA 4RZIA 3LC1O 1DFIA 2RHCA 4HADA 1DHTA 4E2WA 4I9UA 1V6AA 3TFOA 2P9EA 5KTKA 1P9LA 1YL7A 1DC6A 3R0IA 1B3BA 1VPDA 2NADA 3IAHA 5JAIA 3UAGA 4FBGA 3C7CB 2DAPA 1I32A 1GQYA 2PD3A 2Q1SA 2ZB3A 3W6ZA 2Q1WA 1NR1A 5KJCA 3BHIA 4OOFA 3GC6A 1DBVO 4BNHA 3DHEA 3QW2A 4RF3A 1QYVA 3PGXA 1SC6A 4BO4A 5KVCA 3G3EA 3DAFA 1Y81A 3BMQA 2X23A 2HMTA 4IY1A 4HFJA 3GNQA 2H9IA 5CDSA 3QIVA 2VUUA 3S55A 1ADGA 1R6DA 3ZV5A 1GYRA 1X14A 4JJGA 3HWRA 4PLGA 4BNZA 3RC7A 3KZVA 4W7IA 5JDIA 1E3LA 5TT0A 3F1LA 2I6TA 4PCVA 2DC1A 1O8CA 4D41A 4JX8A 3OA0A 4ZGWA 4IDEA 4KTVE 4CMCA 1PZGA 3WGTA 4RVFA 4FOOA 3RWBA 2EW8A 4YRAA 1ZK4A 4UVIA 3WBBA 2JKVA 3WB9A 4HP8A 2PKQP 1WDMA 1NFRA 3EVNA 2QQ5A 1CQIA 4GH5A 4WKGA 1PQUA 1R16A 4OH1A 4PLHA 5L7WA 1VC2A 3GDGA 5TGDA 3GLQA 2W98A 1PGJA 3JQ7A 1EZ4A 2I76A 4Q3CA 2ZB7A 1HEUA 3S2FA 1T25A 2BD0A 5CEFA 2VYNA 1TT5B 3LVFO 1BDMA 3VKVA 4M1QA 3SC4A 1PJSA 2VYVD 5T5QA 2X22A 1A9YA 3I83A 1MXFA 1I5RA 5IJZA 3OQ1A 5C3MA 3H9EO 2BFPA 2NV6A 5F1PA 1HT0A 1W8DA 4QFCA 2O48X 3SLKA 1ENOA 1OAAA 2AQHA 1JKIA 3PDJA 4PG8A 2EKQA 1PQWA 4BVAA 2W90A 3OHSX 2X1HA 2JFGA 3IUSA 4M8SA 3S8MA 1N92A 4B7CA 2GD1O 4U6QA 5DBIA 1GFSA 1LDYA 3FR7A 5DULA 4BIIA 3A9WA 3E5MA 3CMCO 4Z0HO 4YJHB 5GZ3A 5L4SA 4DMLA 4MVJP 3KUXA 2QW8A 3AU8A 3AOGA 1R12A 4FR5A 4IS2A 3G1TA 3WG9A 3Q11A 3VZPA 1NR7A 1BSVA 1F06A 1DJNA 3HN2A 2NM0A 1NXQA 1XU7A 2SCUA 3ONEA 4FN4A 4EEZA 3DL2A 3E18A 4A03A 3PRJA 2H6EA 4YBZA 1W4ZA 3DTYA 3DBHA 3ITKA 1ZZEA 3H3FA 3MJSA 1NNUA 4B7XA 2IZ0A 4CM4A 3ZH2A 2DUUA 4FGSA 1U8XX 4FSHA 1YVEI 1TA4A 5HA5A 3VZSA 5KJ1A 2P4HX 2PFGA 3TWOA 1UXGA 2QZZA 5A9RA 1Q0QA 3NV9A 4RF2A 2Q50A 4Y6SA 2OP1A 3INRA 1TB4A 1HDOA 5ITVA 3ZNOA 4MIYA 4BNVA 1C0LA 5DBFA 3OJFA 4QX6A 5TQVA 1YB1A 3ICCA 3RC1A 4ZRNA 4BV8A 2BGMA 5EQDA 2DFVA 2HLPA 4IDGA 4Y98A 1PJ3A 2WSBA 3EGOA 4MOWA 4BNGA 4CJXA 4E5PA 3WGIA 3LLVA 3C3XA 1B8VA 1HE3A 2Y66A 2WWRA 4QQRA 1XYGA 4FW8A 3E1KA 2VCYA 5TNXA 1O5IA 1UXHA 3L07A 1P1RA 3H4VA 4NI5A 4RQTA 5B4VA 1WAMA 1LDNA 3ZV3A 3TSCA 1ZUD1 3PFFA 4IGFA 1DIRA 2PKRA 4WASA 2AQ8A 2ZCUA 3WGYA 2A92A 3TZHA 3TZQA 1UUFA 1WNTA 4B79A 4IQ8A 3BTSA 1WZEA 1QORA 5KCZA 4XB2A 2NU6A 3OICA 4JJIA 3RAJA 4RVHA 3ENKA 1E3WA 1SPXA 1GQQA 2YFQA 3L4BC 5G2OA 4LSWA 2R00C 1XG5A 1R66A 3EZLA 1E1LA 1SNYA 3GA0A 3R3SA 3KYBA 4RPHA 1LLDA 3MZ0A 3D3WB 3AK4A 4CLOA 3SJ7A 5LDHA 1EDOA 4RVSA 2FZWA 1RM3A 2ZJ0A 1CF2O 3HFSA 3EW7A 3GRKA 4P38A 3P2OA 5HRUA 4CMJA 4WOKA 2AG8A 4YWJA 1CIVA 4RV9A 2EGGA 3HUDA 2WE8A 1MGOA 2EJWA 5AYVA 4CLXA 1WP4A 4LVUA 3V1TC 5HS4A 3PWZA 4PLWA 1GYQA 4L75A 3PGJA 2ZB4A 1HE2A 1QMGA 2FZEA 2GNAA 3FTPA 4GX0A 3F1KA 1YDEA 5JC1A 4MP3A 4RPKA 4WE3A 1YOVB 4YAEA 4IM7A 1PJBA 4GX2A 4CL8A 3QWBA 3RC9A 3Q2IA 4CMKA 5L9AA 3EAGA 3DDNA 4DUPA 4MJLA 4OAQA 3FBGA 4R9RA 3Q9NA 1DIGA 1LQUA 3WJAA 5CEJA 3Q0EA 1LX6A 2X7HA 4ZQBA 1F17A 4HV4A 1DAOA 4XR4A 2NU8A 3H6KA 3JYLA 1MB4A 1Q2XA 4GWGA 3QJ5A 5CG1A 1EK6A 2PK3A 3L4BA 4D43A 5KNLA 3PLRA 3DAGA 2D59A 4BNUA 5GY7A 2R00A 3JQ9C 4M89A 3RBVA 2V6MA 2G17A 3PIIA 1KVTA 1SBYA 1X1TA 3KBOA 4J1SA 1VKOA 4AVYA 3DZJA 1I3KA 2I67A 1BXGA 1T1SA 1LDGA 1P1IA 1YL5A 1TXGA 1GPJA 2OUIA 1NQOA 2PH3A 3KM0A 1MLDA 3KYCA 3JTMA 4K28A 4O5OA 3RC2A 3OJLA 4XYLA 3EMKA 2O4UX 4AJNA 5CP8A 1QG6A 1ENZA 3ORFA 4UREA 3WYBA 3I9OA 4L4SA 4CV1A 2VHZA 1XU9A 1ML3A 1Z74A 2X9VA 5U4QA 3M1LA 3ZWYA 1ZSVA 3PJDA 3L9WA 4PVCA 2JD1A 2X9NA 3PIDA 1WPQA 5DP2A 1K6JA 4JGBA 1U7HA 4IDDA 3AFMA 5TIIA 4E33A 4J16A 1GDHA 3AWDA 1HDXA 3Q6IA 4PLPA 1PJQA 3DFZA 2JAPA 4B3JA 4N5NA 2O3TA 2V6GA 3WYCA 1B3RA 3BIOA 3KLPX 2YDXA 3VAZA 1DFHA 3E03A 2VYND 1I3LA 5DZSA 3CSDA 3WJ7A 3G49A 2Z5LA 3U4CA 3JQAA 4HXYA 4I9HA 4I5FA 2GZ1A 1LTHR 2XPCA 1HLPA 4HWKA 1KC1A 1LNQA 4Z9YA 4DXHA 3GN1A 4OOEA 1V35A 3GR6A 4AJLA 2JD0A 1GZ4A 4MPDA 3JQ9A 4CQLA 4ZQGA 2OBNA 1BTOA 1E1KA 3EHEA 4IZHA 4R51A 2VOJA 4QUKA 3H3JA 5EMHA 4HUJA 1MC4A 5HBRA 4IJVA 1F8FA 1PL8A 4NDNE 4LMRA 4W9NC 3KYDB 4FFPA 3ZWOA 1O95A 3KLMX 1NVMB 1Z7BA 3PP8A 4DC1A 5KIAA 1I10A 3OA2A 3DBLB 2RIRA 2B5VA 3Q3CA 4WOJA 5JS6A 1ZFNA 3SX2A 3WR5A 4AJHA 4E21A 4A7PA 4DBZA 1A7KA 5K6AC 1LSJA 1N9GB 5TJHA 3PHJA 4DPLA 1CDOA 1AHHA 4RDIA 3U9LA 1NAIA 1JW9B 1ADBA 4WNCA 3QP9A 2OHXA 1KEPA 1SZJG 2FR8A 5ILGA 2NVBA 3PZRA 1HDCA 4XYEA 4PG6A 4DA9A 4FS3A 2I65A 4IMPA 2Q46A 1ZCJA 1KERA 2C0CA 1UR5A 1P1KA 2JCYA 2BI7A 3OM9A 3I23A 4A10A 1A7AA 1O94A 5G4LA 3L6OO 1WWKA 1B8UA 4MKRA 4C4OA 3B6ZA 4RGBA 5L40A 3ZHBA 3GPDG 1R15A 3GMDA 4R3NA 3AOEC 2WD8A 4NJMA 3BMCB 5JO0A 3CUKA 4J2OA 5IDWA 5JCXA 4CM9D 4NPCA 3K9QO 1PGNA 3KSZO 3WX0A 2CF5A 1LDEA 1NFFA 4AJKA 3RFTA 2B4TO 2IYPA 2J5QA 3EYWA 4YJFB 5BT9A 2VN8A 1KIFA 3IL2A 3MOIA 1BG6A 1CQJA 4H16A 5AXBA 4AJ2A 2P2SA 1VJTA 2W8ZA 2DQ4A 3GUCA 3UKOA 4D3DA 4W9NA 3UHAA 4GAEA 1TEHA 2D5AA 4A2CA 1PWXA 3LT0A 4E13A 4BGUA 1BXKA 3E8XA 1UXJA 2ZATA 3W8FA 5A9SB 4OKIA 4YXFA 4C7JA 3PQEA 5IZCC 3GGGA 3AUUA 2WD7A 3T4XA 3S1LA 1ZO8A 4PVDA 1IOLA 2PD6A 3LU1A 2B83A 4NBWA 1P45A 3GZNA 1AHIA 1TLTA 3NTRA 1CERA 2DPGA 1EVYA 4XGIA 1PZFA 3L6DA 4CLRB 4J7XA 1D7OA 3UH1A 3FCOA 4XD2A 3VVCA 5BSFA 4BKPA 2RCYA 2A94A 4A27A 4ILKA 2WDZA 4L76A 1Z82A 1HE5A 4Y67A 3P5SA 3FBTA 4XIYA 2UV8A 3JQ8A 2AA3A 3GRPA 3K8ZA 3VVBA 2J3JA 1H9AA 4N5LA 5A02A 4GSLA 1JWBB 5ICMA 1XA0A 3DOCA 4RF5A 2Q99A 3LLSA 1SB9A 4WCFC 2EERA 4PG5A 1M2WA 2BGKA 2EHDA 3AUAA 3K31A 9LDBA 3QWFA 1C0IA 1UDBA 1FK8A 1ULUA 2J5KA 4EEXA 2EP5A 1I24A 3AOEA 3OSUA 3ZWWA 3E82A 4MVJG 5G0TA 4GMFA 1R4NA 1C1XA 5DDIP 1F12A 2PWZA 1UZNA 1O6ZA 3K2EA 2W2KB 4BKQA 4ZN6A 1H2BA 3C85A 1M66A 1UP6A 3RASA 1Z45A 4Z9FA 3UXYA 4OYRA 4RLHA 5B4UA 5TX7A 2I66A 4XDZA 3ZWAA 7MDHA 1B15A 5C7OO 4BMVA 3WWYA 4RQUA 4MP6A 4A5OA 2B4QA 4EDFA 2NACA 2IEBA 3W4KA 1Y8RB 2PGDA 1XQ1A 3E5RA 1DC5A 4IPTA 4Q9NA 1E6EA 4OXNA 4ALLA 5AQ1A 1JTVA 1RKXA 4QO7A 5LC1A 3DZIA 1W6UA 3BMOA 1R0KA 1Q0LA 3GNSA 5U1PA 1YO6A 1A4UA 3CPSA 1S7CA 4DLLA 3JYOA 5IZ4A 2X5KO 5BNFA 2HJRA 4Q3EA 1GUZA 4G2NA 4DMMA 1C1DA 3MWDB 4L73A 2WEKA 2DTDA 3GZNB 3RD5A 3WSWA 1Q0HA 5G0UA 1DSSG 2C82A 3CINA 4WCFA 3L77A 4GLOA 3ZDFA 4ID9A 2X9GA 3IMFA 2YHIA 4YQYA 3KV3O 5T8KC 1CWUA 4BO3A 2Q3EA 1VSVA 4NU6A 4RORA 3L4SO 1E1MA 3KTDA 2DPHA 3N7UA 3ASUA 4GGOA 4HKTA 5JYDA 3U4IA 4CQMA 2P4QA 4BNIA 2Q4BA 1E5QA 1DDOA 5IN4A 4TZKA 2QX7A 4JXKA 2CDCA 1X7HA 4QFDA 5IXSA 3M6IA 4ND5A 1HYGA 3RJ5A 1CETA 1GADO 4N5MA 3MEQA 1GV0A 1IZ0A 3BAZA 4OJNA 4ZQEA 4R9SA 1C1XB 4XGKA 3U3XA 4XQ9A 4LMPA 3AM3A 3C1TA 2NSDA 3GY0A 3PK0A 4JN6B 4IIUA 4DLAA 1XDWA 1EVZA 3SC6A 5F3RA 1HXHA 1CJCA 4KDEA 2GN9A 1IE3A 1SOVA 1QYXA 4TRMA 1GYPA 1HSOA 4DVJA 4Z0PA 1ZW1A 4JP2A 1HZZA 2Q49A 4GX1A 4TKMA 4E6PA 2OFPA 4PLFA 3I6QA 5AVOA 5FWNA 1IULA 3LT1A 4PG7A 5KJ6A 3WFIA 1M76A 1ZK1A 4RLSA 1U5AA 2FR0A 5G4KA 1P0CA 3AI3A 5JDCC 3ZHZA 4E5NA 1K5HA 3MOGA 4FPXA 2EIHA 4YDRA 3WOHA 1N1GA 1XHLA 4MVJF 5H81A 4ZHSA 4AJJA 3P7MA 2B4RO 3BMOB 1QYDA 3H5AA 4PLTA 4DIBA 1UP7A 3EVTA 5BNIA 1DLIA 4NBVA 4BO0A 5T8KA 3DOJA 4BNXA 1J5PA 1NHWA 2AEMA 4XB1A 1U8FO 4NU5A 1DC4A 3ZWXA 5KKCA 9LDTA 1C1DB 2BFMA 2D1YA 3VH3A 2J3IA 2IXAA 2O7QA 3AU9A 2ZTLA 5F21A 1EQ2A 3OIDA 2BGLA 2D0IA 1S6YA 4R68A 1OMOA 3JQ6A 3BMNB 3W4JA 3P2YA 1K2WA 3V2GA 3Q9UA 3D4PA 4OHUA 3G0OA 5DNAA 2HMSA 3BTUA 3NAQA 4YCAA 3C24A 3WIEA 1AN9A 4KQXA 3UVEA 4YRDA 2FR1A 1W73A 2OP0A 1KEVA 4OGWA 2LDBA 3MWEB 2F00A 4ITUA 5JCJA 2TMDA 1H0KA 1SMKA 4IXWA 3WGOA 3GOHA 1XQ6A 4G81A 4PRLA 4TQGA 4XKJA 3ETEA 1ISHA 2ZTMA 5G0SA 3D1LA 4R4JA 5C37A 4LK3A 2NVWA 5AXAA 5ICSA 4L8VA 3U09A 3ZNNA 4E2XA 2VT3A 4UAGA 4D44A 3WICA 1GUYA 1PWZA 5JW6A 1GEGA 5CPBA 4J9UE 3S2IA 1O9BA 4CM3A 2GRAA 3R3JA 1YKFA 4BKUA 3OJOA 3O8QB 4Q3DA 1YJQA 1T4BA 4XIJA 4FQ8A 2NU7A 4A26A 1K89A 1EBFA 2C7GA 4XRRA 3FSRA 3QRWA 4F3YA 1KVQA 3DBRA 1FDVA 4NFYA 2AHRA 2UYYA 1LU9A 4BNNA 3DHNA 1E7QA 1MV8A 4M54A 4FJ2A 1KVRA 4P4LA 5JMPA 1E1NA 3D0OA 3VOSA 1R0LA 2Y1DA 5DBGA 2ZYAA 3U0BA 5HTOA 3FHLA 3INTA 3OP4A 2BH9A 4AL4A 3WS7A 1E7SA 2AW5A 1HSZA 1R0SA 1WDKA 4NMHA 5DF1A 3VC7A 4J4BA 3QVTA 1PR9A 2EWMA 2OL4A 3ZWBA 4YT2A 3UCEA 4R3WA 4YJGA 1HDRA 4FD3A 2FSVA 1PJ2A 6ADHA 1YS4A 4TZTA 4KUEA 2C5AA 4MKXA 1UXIA 3B1JA 3LT2A 4J9VA 3ROQA 5EINA 4YQZA 5AOVA 1JKJA 4CLDA 1T2AA 4IDFA 2PY6A 1B8PA 4HNGA 3RUEA 4NBRA 4A0SA 1YQGA 1PJLA 3ANMA 4W99A 1C0KA 1J4AA 1RYDA 4XWYA 2PNFA 2QYTA 3I9JA 1JN0A 2NQ8A 4B4UA 2X6TA 3HADA 3I9LA 3KB6A 1QYCA 3JQCA 2Y1OA 3NT5A 3SLGA 2YJZA 4YYZA 2JHGA 3BMQB 3FNEA 1PR3A 3GHHA 4MKZA 3GPIA 5EPOA 1YBMA 1XLTA 4EYEA 2EV9A 1H93A 2A9FA 2PZLA 4IJUA 3FWZA 3Q2KA 1IHYA 2HDHA 4R41A 3WGQA 1H9BA 1M6HA 4YACA 2C29D 1SEVA 2DVMA 3GK3A 3PHHA 4OMUA 4XGNA 1A9ZA 4LVCA 4EJ0A 4BO8A 4Z3KA 3RUAA 4OQYA 2H63A 3KHUA 4Y9DA 3TN7A 1NVGA 3AY6A 4CM6A 2C2XA 1H6AA 4ZICA 3ETGA 4XR9A 5CDTA 2HO5A 4JCOA 3RSHA 3VZQA 1NAHA 3JSAA 4FIZA 4MIOA 5I9MA 3W8DA 2VHWA 1B26A 3PQFA 3UGKA 3V1UA 1HKUA 1QLHA 2UAGA 1CYDA 5A1TA 3NDRA 2VZ9A 1WMAA 4BOYA 3R6DA 2CVOA 1UZLA 2IZZA 4DTIA 2NTNA 2NWQA 1LI4A 2YV3A 4CV2A 5KJFA 3JQ7B 4J0EA 1J49A 5KJEA 5L7TA 1C14A 3WTCA 3DO5A 3ENNA 5B4TA 4GVXA 3W6UA 2HKIA 5I7FA 4AJPA 4GPD1 2B69A 4JP3A 4BNFA 4KP7A 2V7PA 3GGOA 3FI9A 3C1AA 2Q4EA 3LC2O 1H6DA 2NVUA 2C59A 2I99A 1N2SA 1QSGA 1VM6A 4R1NA 1CEQA 4PIVA 1DC3A 1X15A 3FWNA 3UF0A 2Q2VA 3PHLA 3GNTA 5CEEA 4BV9A 3A28A 4FC6A 4EW6A 2X4GA 4ND3A 4WLFA 3AJRA 4ZU3A 4XQEA 2X8LA 1JAYA 1BVUA 3ZCXA 3STHA 3AFNA 3ETDA 4RDHA 5BQFA 5LDGA 3ZU5A 4B3IA 1NPYA 3MJTA 5DOZA 1CRWG 5JXWA 2VRCA 1DOHA 4H3VA 3WIDA 1VRWA 3E6AA 3F4LA 3IOYA 4G65A 5FFFA 4YAGA 5BSHA 1OC2A 2CDAA 4PGFA 4FB5A 3JCZA 1VE9A 2RH4A 4WLEA 2Y68A 1E3JA 4I1IA 2VZ8A 4E3ZA 3UUWA 4ZVVA 3ZNQA 3OIGA 3DBHB 2B35A 3DTTA 3T7CA 4ZD6A 4CM4B 3MJCA 4XCVA 3RFVA 3PYLA 1JDJA 1E6UA 1BW9A 3VTZA 3I4FA 2DFDA 1BHSA 1P1JA 3HB4X 3PQDA 4GKVA 4AG3A 3OEWA 2BRUA 2D2IA 4I5DA 1U28A 1HZJA 2RAFA 3BXXA 1W0CA 3GDFA 4HFNA 1OC4A 1H2HA 3PJEA 4HFMA 4P4GA 4F45A 3JQGA 3T7EA 5IDQA 1IB6A 1RM4A 2VHYA 4H7PA 3OEYA 3QA9A 4YT4A 5DCYA 2BI8A 4J1QA 4D45A 1DEHA 4YJDA 4MVJA 2AEJA 1ZSYA 4FJ1A 1R37A 4BQRA 3EZYA 4OSOA 1ZKMA 1KS9A 2PD4A 3PJGA 2X0NA 1I3NA 4KDFA 4F46A 2VNSA 4R1UA 3JV7A 4UVGA 5DCWA 5KVVA 2OGUA 4R1SA 5I8WA 1A27A 4IIVA 3M2PA 5JLAA 3K30A 2O4CA 2XAAA 2O3UA 3DHYA 1P74A 4GSKA 1ADFA 3FN4A 4GX5A 4J6FA 1E3WB 3GZ4A 3KEQA 1T24A 2EEZA 1UDCA 4EITA 4RJTA 1JA9A 5ADHA 4ZQHA 3D7LA 2EKLA 2VHXA 5JAMA 3BHJA 1N1EA 4MINA 1T1RA 1UJMA 4CLOB 2NU9A 3NX4A 2B5WA 3HHPA 3U62A 5L45A 4PLZA 3PI7A 3PWSA 3NGXA 3GEGA 5L3ZA 1QV6A 3OIFA 3RJ9A 3RU7A 3A14A 4GL4A 4RVGA 2B36A 2IRWA 2O50A 2G76A 1Z73A 4M86A 5JMWA 1DIHA 4EGFA 3HDQA 2EKPA 1EQUA 1FXSA 4DRYA 1WW8A 4E2ZA 4YRBA 4XJTA 4KWHA 3RU9A 3ZU4A 3O38A 2NQTA 4ALKA 4ONEA 5A5EA 2OBYA 4CUZA 1D1SA 4RZHA 5B1YA 1XSEA 3WDSA 3ZWPA 2WM3A 1P1FA 1U2DA 5JO9A 2VUSA 3IJRA 1A4IA 1U9JA 2AQKA 4Q3NA 4U0JA 4W6ZA 3MJ4A 4IUYA 3VTFA 4UUOA 1IUKA 4AFNA 4IINA 3CEAA 4GWKA 1KVSA 1JU9A 5I7EA 1HTBA 3OF2A 2CVZA 1ZBQA 4HNHA 1QP8A 1RPNA 2HMUA 5MDHA 1GQ2A 3GN2A 2D3TA 4B3HA 4XX0A 1ISFA 4QO8A 3VPXA 5JSFA 2CY0A 1Y8QA 2X0JA 4CM5A 4K9DA 1E3SA 1I01A 1LRLA 4OO3A 1P31A 1LXCA 3FNFA 5DP1A 4YT8A 3JD3A 1ZXLA 3IQDB 5I7SA 3DXFA 3GFGA 4LW8A 3SXPA 3U4HA 4TVOA 4BNTA 1YDWA 3IP1A 2UUOA 2VWHA 1BXGB 1LDMA 4ALIA 1ZXBA 3C7AA 3WNVA 1G0OA 3KYCB 1J6UA 1PGPA 4II2A 3TPCA 4UEKA 2ZYDA 3WLFA 1VL0A 1I36A 1LC0A 1HWYA 3RI3A 2G0TA 1UH5A 2PKQO 3PLNA 4ZQFA 1M6WA 4UUPA 4IDAA 2ZIZA 1F14A 2E82A 1A5ZA 4U5QA 1NQAO 5TF4A 1T2EA 3RIHA 4IDBA 2FHSA 2I9PA 1XIVA 3P19A 3RCBA 2DTXA 3S2EA 1SOWA 2GZ2A 1N5DA 1L7EA 2GCGA 4ND2A 1DHRA 1FF9A 1LQTA 4LCJA 4E4YA 1BXZA 1LBEA 5JBIA 3CMMA 4AJ4A 2Z1MA 3TZCA 1KEWA 2E4AA 2P9CA 1HYEA 4EI2A 5ENDA 3IKVA 4GI2A 3HDHA 4KOAA 2BELA 1L7DA 2VWQA 5IAAA 1QV7A 2HU2A 8ADHA 3KOUA 1ZK3A 1ZJYA 3CTMA 1LRJA 3NGLA 1B0AA 4WEQA 1RWBA 3JQAB 1RJWA 5L95A 1PJCA 1WZIA 4WLOA 4ZJUA 1AXEA 2EW2A 3U4DA 4J4TA 2O3RA 3ZU2A 1P44A 4FGWA 5JNLA 1EEHA 4CQLB 4TRRA 4J2HA 3SEFA 4NBTA 3VHRA 1LLUA 2J5RA 3WWZA 3NDIA 3I4CA 2OXIA 3RKRA 2OO5A 5K6AA 1EUDA 3NEPX 4FFOA 2Y05A 4J49A 3DWFA 1UZMA 3RROA 4MO2A 5CDUA 4BNLA 3LK7A 2EGHA 3F46A 1H6CA 3ZWNA 2WE7A 1Q7GA 2E37A 2Q1TA 3HZZA 3NYWA 4MDHA 4BO6A 1GUFA 4AJ1A 2VRCD 3FNGA 1KY5A 4J43A 1ZEMA 2BLLA 2BFAA 3B70A 4ALMA 4PN3A 3JQFC 1K6XA 1MFPA 4AJOA 1O0SA 5A3JA 3WQRA 4E30A 3LYLA 4L74A 3BA1A 4NR0A 5TJ9A 5ILOA 4NQZA 1ISJA 4UUNA 3NDJA 1KYQA 5COQA 4XRGA 4E2YA 3F5QA 4J1NA 3LC7O 1M75A 1DFGA 4MVJM 3JQBC 4W4TA 5T57A 3DAPA 4JK3A 2QRKA 2FN7A 4XQGA 4RPJA 1NM5A 3ZI0A 3QWHA 4M49A 1GCUA 3ZGYA 4YR9A 2Y1CA 2P5UA 2TMGA 1MXHA 4Q3AA 2Y67A 4Y6RA 4CMEC 3RFXA 1SB8A 1ZVMA 4I5GA 4NNJA 3KVOA 4HY3A 1A71A 1V0JA 4NJMB 3WQQA 2PZMA 3EY4A 1JVSA 1VJ0A 2EF1A 2YW9A 3JYNA 4PZEA 4TSKA 1HF3A 1YBVA 3K2BA 3QVSA 1NFQA 4JJFA 5IZCA 4AJIA 1Y7TA 1AUPA 3NJ8A 3VH2A 4LN1A 2O3JA 4W82A 2NNLD 2C7VA 3ONFA 3L0DA 1H6BA 5JPIA 2P5YA 2POQX 1RYEA 2JCVA 4DQUA 1X7DA 5KOIA 3JD4A 4FFRA 3RQSA 5IG2A 3L9XA 5L7YA 1KBZA 2Y93A 1ZIDA 4CODB 3TFQA 2WD7B 3DOOA 1NQ5A 3ZHXA 5H83A 4TRNA 1OZAA 3GVCA 3WMWA 1GAEO 3MTGA 4R54A 1SEPA 3JQFA 4X54A 3RUFA 1D4FA 1PEDA 4BO7A 4CMIA 3UCFA 4CUJA 1R4MA 1N7GA 4PRKA 2AEFA 2HCTA 2GPTA 1J0XO 2PZJA 1BGVA 1T2DA 3B20A 3GAFA 5BNTA 2UUPA 3AI2A 4XYBA 1IZ9A 3JQ8B 1VLLA 3B1KA 3PWKA 1ZEJA 1WDLA 3PDUA 1NASA 3GHYA 5TT1A 4DLBA 3QQPA 3GG2A 3H2SA 1EBUA 2OOSA 5FI3A 2ZTUA 3FTNA 4YT5A 3K73O 2ZTVA 1BVRA 3QHAA 2CUKA 4IBOA 1G6KA 3DZHA 5U9CA 1GL3A 3A4VA 1R4NB 1H94A 2R2GA 4CUKA 3VPHA 3H8VA 3VPFA 1JVBA 5CHEA 3V2HA 1E7RA 3ON5A 3WSVA 4R69A 3C7DB 1WVGA 3OECA 3TF5A 2IDZA 3COSA 4YVFA 4FDAA 4BO5A 2BKAA 4EUFA 2IYOA 2DBQA 3JQAD 5COAA 5K9ZA 5A4DA 1NTOA 3MCVA 1X0VA 4WLVA 2DUWA 4DWVA 5C7LO 2PTGA 3WMXA 4PZCA 1B14A 4YAIA 5I9LA 1PGQA 5BSEA 1IPEA 1LEHA 1YL6A 1VKNA 3K6JA 3VZRA 4CR6A 1I2CA 1KC3A 1X0XA 1Y9AA 4CR8A 5TLSA 1HE4A 3HQ4O 1Y5MA 3ZV6A 3GVIA 3SVTA 4XJSA 1Y5RA 1EFLA 4J7CA 4IXTA 3ITDA 5AXDA 3V5NA 1EVJA 4ALJA 5KVSA 1Y9EA 4OIMA 3H65A 3LSYA 5DOVA 1RM0A 2C54A 4IS3A 1U4OA 2YHUA 1EUZA 1MX3A 2ILTA 3OMLA 4GBJA 1YGYA 3ZWVA 1DB3A 1QKIA 2CMDA 5JDIC 2C5EA 1FMCA 1B16A 2O7SA 4B8ZA 5TSDA 5CG2A 3GH3A 3ANNA 4WCFB 5TRTA 2ZKLA 3PPIA 2E49A 4A73A 1R4MB 2Y0EA 4YAJA 2GF2A 2C2YA 2A4KA 2Q2WA 3SJUA 2YHIB 1QR6A 4R01A 3DFUA 4BHTA 4IJWA 5DT9A 5HWSA 1L1FA 1QXSA 1TT5A 3WGHA 4P4NA 2CNBA 5I8ZA 3SBOA 4GMGA 4CQMB 4LCEA 4S3MA 4NFHA 3ROKA 1NQTA 3KSDO 1GD1O 1U3WA 2Y1EA 3FR8A 1E3IA 3IP3A 4ESOA 2FP4A 1T4DA 4I08A 2VNAA 4J4HA 5ER9A 4FC7A 5FEUA 3OETA 2OZPA 3LF1A 2EG9A 4TRJA 3AY3A 1U7TA 1I3MA 4J1TA 5JDCA 1PGOA 1VSUA 5EJ2A 3G1UA 5JYEA 1IPFA 1E7YA 2FSSA 5G0WA 2XXJA 4YJHA 3TL2A 1TT7A 4PLCA 4YA6A 5GMOA 3ABIA 4BKOA 2RH8A 2IEDA 3VDQA 3G79A 5THQA 4CLHA 3ROMA 3W8EA 4DQXA 3F6YA 2V6FA 4ROSA 2HQ1A 1JWAB 2CF6A 3D5TA 3OQBA 5G4KB 1Y6JA 5AXCA 3GEDA 1PIWA 1SAYA 3FNHA 2DT5A 1UP4A 4BO1A 1JLLA 1PJ4A 1VI2A 1TVEA 4K1LA 1Q7CA 1BMDA 4E12A 4KQWA 5KWEA 4Z3DA 2IXBA 1AXGA 2BF7A 4FFMA 3H9QA 3M2TA 3CIFA 2CFCA 1VL6A 1ENPA 5F1OA 1K6IA 1TI7A 1YJ8A 3IS3A 4PFJA 1AGNA 5A06A 3KSUA 1D3AA 3K5PA 4MIEA 2X58A 1JKFA 2ZB8A 4BB6A 4CV3A 3G17A 3DEYX 5L51A 4PZDA 4L0QA 2VRBA 3QVWA 1KY4A 4XDYA 4MVJH 5TC4A 1ZK2A 2ZYGA 3PTZA 3T4EA 2NTVA 3PEFA 4QECA 3UFXA 4R1TA 4AJEA 1OOEA 4K26A 3NJ4A 3ULKA 3D4NA 4BGEA 3VKUA 2YQ4A 5A9TA 3IDSA 4IGEA 5KVQA 4NIMA 2FWMX 2H5LA 3PZBA 2Y0DA 1EDZA 3QWIA 4KUHA 3ANLA 4L4RA 3KXDA 3TOZA 3OJEA 4DBVO 2YY7A 4HFRA 2RBEA 2CVQA 5EESA 3GVXA 1PQPA 2Y1FA 3KO8A 5ES3A 4EUEA 5MGBA 3WQSB 4BUCA 2UVDA 4CLEA 4DC0A 2JAHA 3HE3A 1MG0A 5HM8A 5TS3A 1A72A 2E6UX 1PL7A 1B2LA 1Q1NA 3VDRA 3DBRB 3ZW8A 3H7AA 5L4LA 3O03A 4QT0A 5ITWA 3GF4A 3D3WA 4E31A 3H5NA 2QRLA 2DLDA 4KMSA 3WBFA 3H2ZA 1XWFA 3RBXA 4YPOA 2LDXA 1EFKA 5EERA 4RCVA 2WYWA 1N8KA 2G5CA 5I9NA 2Q1UA 3F9IA 3GAZA 1DO8A 1Z75A 1DRWA 4QTZA 4WPGA 3DZKA 1ADCA 4YJGB 4CM1A 1G1AA 1U3VA 3UICA 1NP3A 1FDUA 4D3FA 2VQ3A 1EVIA 4FOSA 2FRDA 1C3VA 2WTBA 4NG5A 1NBOA 4ZRMA 1JQBA 3F4BA 3WGGA 1E7MA 2V6BA 3I3OA 2VHVA 3TNLA 3UOGA 3OH8A 4OXYA 4Q3BA 4CQMD 3UW3A 1YB5A 3ONDA 2HK7A 1YOVA 4O63O 4D46A 4CM9A 4N7RA 4J90A 4CV0A 3UN1A 3V8BA 3NT2A 2OORA 3TL3A 4PLVA 4LSMA 1V8BA 4D42A 4I9NA 1GTMA 2OMEA 1I30A 1HYHA 4BS9A 1ISMA 5G0VA 2YQ5A 4NK5A 4UVHA 4TWRA 3EK2A 1EK5A 3VPSA 4CMHA 3LT4A 1HDZA 1MA0A 5EL0A 2DKNA 2D8AA 4Z6KA 4D0RA 3TZ6A 2HUNA 4WLUA 3PHGA 1V3TA 1ZJZA 4K6FA 3I6IA 5JAQA 4DPMA 1NWCA 2GDZA 1HRDA 2DBRA 4G5HA 2AG5A 3A06A 3BZUA 2GYYA 2AQIA 3NTOA 3UCXA 3HJAA 3WGZA 5CDYA 3QVOA 4OXKA 4RL6A 3NTQA 2ZJ1A 3H9UA 3INGA 3OBBA 4UVEA 3ZWCA 1I2ZA 2WJPA 3C8MA 4DYDA 2JCXA 1ISGA 3KEOA 4YB8A 1YRLA 3QWAA 5J23A 1ZMOA 4L9RA 3GQVA 3WTBA 4L4XA 2PZKA 4BB5A 1EE9A 2ZK7A 1Q7BA 3DZBA 3Q1LA 4E5KA 1MFZA 2W4QA 3CH6A 2GR9A 2B37A 5HS6A 2I5PO 4B4WA 2CD9A 4DQVA 3DMYA 4I8XA 3K92A 1P77A 5L4NA 5JY1A 2AMFA 4DIFA 2I3AA 4D3SA 5H82A 2VOEA 4BMSA 4I5EA 2GUGA 2Y0CA 2B0JA 4MP8A 1P0FA 3IUPA 1PU2A 1Z7EA 2HK9A 2P91A 2PV7A 3VPGA 5C5IA 2J6IA 1ZK0A 5F5NA 5T67A 4D7AA 4FFNA 1D1TA 4CM8A 4NH4A 4Z9XA 2GN4A 1H5QA 2HMVA 1UDAA 2DTEA 1XR3A 5F1KA 1WLYA 3DBVO 4EBFA 2NVUB 2EXXA 1FJHA 1I33A 3ZV4A 3JD1A 3U5TA 1OFGA 3FPLA 2HMWA 3WXBA 3DB2A 3PHIA 5JCJD 3HSKA 2PR2A 2ZQZA 3NKLA 4JBGA 3DMTC 2DU8A 1WMBA 3NUGA 1KVUA 3PYMA 4OQZA 1AE1A 3AI1A 1O89A 2D5CA 3HDJA 1LLQA 3FF4A 4U7WA 3KYDA 4JBIA 3ZHYA 3NT4A 1IL0A 1JAXA 1EMDA 1LA2A 4NZ9A 1N7HA 3TDKA 4AICA 1XELA 4LISA 3DBLA 2P9GA 3QLJA 4KWIA 3FD8A 3WNQA 1DRVA 2GASA 3WFJA 2WYVA 2J8ZA 4EJ6A 1N9GA 3HG7A 4O59O 3OQ6A 4H15A 1DIAA 3CXRA 5DN9A 2HRBA 5EN4A 3ZNPA 1QLJA 1KOLA 1NWHA 3ICPA 1DAPA 1IY8A 3S2GA 4BGVA 2AXQA 5B37A 4D79A 1ORRA 1HDGO 3MJVA 3PXXA 1BW9B 2QHXA 2IZ1A 3PJFA 1U1IA 1LC3A 2X86A 4EUHA 2C07A 1ONOA 5JY6A 4E5MA 3JQGB 4QSMA 4WLNA 2Y99A 3ZN2A 5A04A 1E3EA 1VL8A 3DQPA 5IDYA 4ZA2A 4XYMA 3MTJA 4CM8B 5IN5A 3BMCA 1Z6ZA 2VUTA 1NPDA 3DMTA 3E9QA 1DLJA 3BHMA 4KZPA 1GV1A 2JFHA 1RM5A 1ONNA 1T26A 2GLXA 2ZCVA 2YYYA 2IODA 4FCCA 4YJFA 4WK6A 4F6CA 2QIOA 2JFFA 4EJMA 5CAEA 1LJ8A 3GEMA 3GVPA 4HBGA 6LDHA 3V2UA 3PFWO 3L6EA 1ISIA 1YBAA 2XF8A 2EP7A 2W2LA 1ZMTA 3O4RA 4ND1A 1E77A 4JNKA 4WUVA 1FDWA 1YQXA 3RUDA 5A9SA 5CPFA 4BNKA 1SO8A 3FRJA 1KEUA 3IJPA 2UDPA 3KETA 1KETA 3F47A 1ZNQO 2F1KA 2CZCA 3D64A 4W7HA 3DR3A 4YTEA 4C7KA 5C7IO 4IMRA 1T2CA 4IDCA 3RBZA 4CMBA 1YONA 3N74A 4INAA 1G0NA 2AE1A 2HAEA 2O2SA 4XA8A 1PTJA 2YDYA 3X2EA 3AUSA 1V3VA 3AW9A 3W1VA 4CLRA 3A1NA 4PG4A 3HDYA 5BR7A 2NUAA 4BO2A 1NVTA 1LLCA 2QYSA 3BYZA 1E92A 1DPGA 4FFLA 1HDYA 1ULSA 3ADPA 3HFGA 4WCDA 1MG5A 1UAGA 2XOXA 3I5MA 4GGPA 3ZU3A 3I9KA 3AM4A 1XKQA 2HSDA 3LQFA 4E32A 3RUIA 1YH3A 5COBA 3CZMA 1P1HA 4MVJI 1QYWA 4NJOA 2P68A 2PH5A 5L53A 1LDBA 1U5CA 2R6JA 4CPDA 3O26A 1PS8A 4QEDA 2YV1A 4BNWA 4LRTB 3M1AA 2H1SA 2GN6A 4CL3A 2YV2A 4TMFA 4OM8A 3QV1A 4J3FA 5KKAA 4RPLA 3I9MA 3IIEA 3PVZA 1NHGA 3ZZNA 2WMDA 1LRKA 4BO9A 2W2KA 2FY8A 2NTJA 2YUTA 3D4OA 3R1IA 2VTEA 3I1JA 2JD2A 3GGPA 2G1UA 3U49A 3GUYA 1FDTA 3JQEA 2JHFA 3EUWA 4WGGA 4DREA 5EQFA 4LGVA 4RO0A 1UAYA 4JIGA 4OSPA 2DBZA 5A3VA 4B4VA 3QY9A 4XEHA 3EC7A 4JLWA 1YXMA 1DXYA 3NRCA 3TOXA 3DONA 8LDHA 3D5QA 5GZ1A 5THKA 2O2YA 4U8GA 1E5LA 4R16A 1Y8RA 2RHRA 4BNYA 5T64A 1Y8QB 1PZEA 1U4SA 3I9NA 4GKBA 3TQHA 1X1EA 4O6VA 3V1YA 4CR7A 5CFZA 1LSOA 4WJZA 1EE2A 2GO1A 4IQGA 1YB4A 1NYTA 5IF3A 4ALNA 2D4AA 2PLAA 1I0ZA 4O0LA 1GU7A 4OKNA 7ADHA 5K0ZA 3AM5A 5GZ6A 1X7GA 2NLOA 2FMUA 3AUTA 5JAZA 5DCUA 4JQCA 1DRUA 1NPTO 3GG9A 4QXMA 1GPDG 2CSUA 3GVHA 4BNJA 4TVBA 5CDGA 1M67A 4BKRA 2I3GA 4XQCA 2YZ7A 2Z1NA 2BMAA 2FPIA 2Q2QA 1ID1A 4R5HA 1U3UA 1T2FA 3I52A 3JQDA 3LZ6A 5IDXA 5F5LA 1MC5A 1GEEA 2VYVA 1P33A 2Z95A 3DC2A 1YQDA 2YFHA 4Y6PA 1IYZA 1GCOA 2E48A 3GFBA 1B7GO 4NFSA 4OL9A 4P8RA 4M87A 3JD2A 2ZQYA 2Q45A 2GZ3A 3CZRA 1ENYA 3CE6A 3MJEA 1GY8A 3E48A 2G82A 1F0YA 3GDOA 1C0PA 1GZ3A 1U3TA 3QSGA 2PGJA 4DGSA 3X2FA 4B7UA 4U0KA 3RKUA 4CM7A 2Y1GA 2CDBA 2C20A 3VH4A 4B8WA 4RVUA 4DIOA 4N54A 1ZSNA 3TJRA 3ZWMA 4RVDA 4S1VA 3ADOA 4R5MA 3C1OA 4YAKA 4JROA 4MVJD 3JYPA 2O3QA 2QRJA 4WEOA 4GQAA 2AE2A 3GMSA 4NK4A 4Q39A 1BWSA 1FDSA 1PL6A 4Y8VA 4BL5A 4NHEA 1E7WA 4DPKA 4HX5A 3HB5X 3KRTA 4J0FA 1OI7A 2XXBA 3OJ0A 1SCUA 5A03A 3D3EA 4DL9A 1GR0A 2JL1A 2DM6A 3F5SA 4E5YA 3ASVA 4E0BA 2X5OA 4IZIA 2GSDA 3F3SA 3RVDA 1YWGO 1HETA 1V9LA 1XGKA 3QE3A 1MUUA 3TRIA 3N58A 2VWPA 4CMAA 3FPCA 3H5RA 1OBFO 5JE8A 1Y1PA 4GLLA 4XZ3A 5A05A 3GT0A 1YE3A 1PSDA 4II3A 4UEOA 5B12A 1PS0A 4P22A 4BGIA 4PLYA 1PX0A 3PYXA 5FI5A 3JQBA 4GVLA 2GGSA 4F6LA 2VZ0A 1PJTA 3ROPA 1HL3A 1DJQA 5JC8A 1GZ6A 2O3SA 5A5FA 5LCXA 1HLDA 4WECA 3BTVA 4U6SA 3OFSA 4XYGA 1U2GA 1LSUA 1E0DA 3ZW9A 4CMEA 3QVXA 4UUMA 1XCBA 1MP0A 2VWGA 2IE0A 4KUGA 3BMNA 1QRRA 4BQPA 1IHXA 1VJ1A 2QG4A 4LRSB 4TKLA 4YEDA 2VT2A 4FJ0A 4WNIA 1BRMA 3H9JA 3H9GA 1ONPA 4K6CA 2V65A 1I8TA 3WLEA 4UEJA 1LUAA 3TZKA 1E6WA 4TROA 1UXKA 2BHLA 5I7VA 3E9MA 5ENVA 4IQ0A 4MVJE 1XEAA 2GN8A 4UVDA 2X0IA 3CKYA 3HNPA 1EUCA 1V3UA 3ST7A 4EZBA 4Z0TA 3VH1A 4IJKA 5JFOA 4J91A 3LF2A 2BFOA 1I2BA 1X13A 2O23A 2X5JO 2HRZA 3LDHA 4O1MA 3IKTA 3RUCA 5FYDA 4DYVA 1K3TA 2HJSA 5BSGA 2J3HA 2GERA 4M55A 1D8AA 4URFA 4UULA 1NX6A 2VTDA 2HK8A 4CMGA 3DZGA 1WXDA 4N18A 2EJVA 3K96A 3O8QA 1ZH8A 2DBVO 2JJYA 3JYQA 1LSSA 4KTTE 3AY7A 4BNMA 1F8GA 2W2LD 1P3DA 4RF4A 5IFLA 3RUHA 1K0UA 5ER6A 2PA3A 2X0RA 4NBUA 2QZ9A 1ARZA 3BTOA 4ND4A 5IXYA 3W4IA 5EIOA 3JD0A 1PZHA 2J3KA 5T6BA 1DIBA 3O9ZA 3DZFA 4BMNA 2ET6A 4CMIB 3WYEA 3B1FA 3EDMA 2A35A 4J7UA 3IC5A 3HN7A 2WYUA 4B4OA
chains in the Genus database with same CATH superfamily
2P9ZA 3CKKA 3N3BC 1OWLA 1T5BA 1YSCA 3E9NA 4R6XA 3W9UA 5JSZA 3U3KA 1MTOA 2F64A 4BCCA 5JXHA 3QX8A 4YP1A 4F6RA 1BDBA 4PBRA 2OD9A 3LC1O 1AV6A 2RHCA 3O1HB 4R9NA 5ALJA 2KJQA 2CL0X 4R2WA 1QGAA 1EXNA 3LNCA 3TAXA 5KTKA 2ZTSA 1KXZA 1DC6A 4I1OA 3BIFA 3IAHA 3FHJA 4MQ4A 4WGFA 1V5EA 1RXWA 3TIVA 2ENWA 5FLXA 3ND6A 5K8TA 2WJ6A 2DAPA 3DD1A 3H1EA 1I32A 1GQYA 4DR7B 2Q1SA 5JRZA 3CVWA 3IHTA 4HQFA 2HCBA 1V5FA 1XZDA 4I2VA 2IYUA 4W1PA 1OX5A 5ULLA 4L6IA 1BE0A 2VSFA 3O75A 3QW2A 3T3EA 2OV2A 3H2YA 1QYVA 1M54A 1WXWA 2RHOA 3B6EA 3CGWA 3EGIA 2V5UA 3DAFA 1JB9A 2DP4E 1EX6A 1SQGA 1T3LA 2H59A 3IAEA 1Z06A 4QFBA 2ZE8A 3RT7A 3SNHA 1T0PA 1T3SA 3BRQA 3GNQA 4X7PA 4PFKA 3ND5A 2H9IA 3IAXA 2YWRA 2CCJA 2V7XA 2VUUA 5ALUA 3ROEA 4IIJF 5C1DA 1LPNA 3S55A 3RYIB 3ZGZA 1ADGA 4D8UA 1R6DA 4YWHA 3CB4A 3ZV5A 1B6GA 2VUHB 3OVMA 2FFAA 1ZN7A 5L3RA 1PAUA 2ZUDA 4U2FA 3A1CA 3RC7A 4M9CA 2ZYIA 4KACA 3F73A 4BLQA 1LLFA 3F1LA 4CKXA 4D3ZA 1O8CA 4D41A 1M8FA 1RWKA 4JX8A 5IJ0B 2HB6A 3OA0A 4JITA 4ZGWA 4HDOB 2XGJA 4Y2YA 4YAWA 2CNKA 4OG2A 2DWQA 1PJAA 1YQUA 2XITA 4KVZA 5EZYA 1O8BA 2C5BA 4MV9A 3WGTA 3ZH9B 5C8ZA 4YGXB 1VA4A 3G2NA 2ZM5A 3LQQA 2H2GA 1SVIA 2JKVA 3NP9A 3MRSA 4EF6A 1SJ9A 4FMCB 2ONJA 3DWEX 1W46A 1YUBA 4QBTA 3RYTC 5DASA 1Q1ZA 1BS9A 3DE1X 4WKGA 1B42A 5HTKA 4RL4A 4OH1A 3DFMA 1NTRA 1CQWA 2FFJA 3W3AD 1VC2A 3COPA 1SU7A 2RKWA 1MOQA 3JQ7A 2VNKA 4G24A 1Y7HA 3B13B 1HEUA 2SHKA 2BD0A 7REQB 4MZXA 3HKEA 3OY2A 2HXGA 4B46A 1M3SA 1ISSA 4N0MA 1XJCA 4MI6A 3C4JA 3OZDA 2GT1A 2HQSA 3QBVA 4HWGA 4CFZA 1SBHA 5KINB 3B1WA 1XF9A 2HBRA 1FRFS 1AO0A 1TMYA 4ZEWA 2HI0A 3A9CA 3QEMA 3U7FB 3GGJA 4I19A 1BROA 4QFCA 4MGIR 4OV6B 4YJKA 3SLKA 3UJBA 2WWYA 1XPUA 1OAAA 4MR7A 3NIBA 3ET5A 2EKQA 2P6PA 1PQWA 1W4AA 1JSLA 3Q7PA 2HPVA 1NV9A 2X1HA 2YWBA 3LECA 2JFGA 3BL5A 4UBIA 3TNYA 3EXHB 5D3KA 4EVIA 1I7DA 1YNSA 4M0PA 3I37X 4H0NA 3OM1A 5CA0F 1GCAA 3MCAA 1LDYA 3FR7A 3GBVA 4G1UC 3T41A 5A5VA 2HJHA 4F1JA 1M8GA 5JAUA 5TPZA 2O1WA 4LZAA 3E27A 3FCSB 2QW8A 2KW5A 2I0FA 2Q5FA 3ZBPA 1W94A 2EZUA 1Y1SA 4ND6A 4ZCQA 1R6BX 3WG9A 4C4SA 3B3GA 3GJ6A 4B43A 2XUFA 3L1IA 1JEEA 1TM2A 2B8WA 2OUKA 4ND8B 1JQKA 5LL6P 4URYR 3QEAZ 2YYSA 3OZBA 1ZD9A 9MHTA 3A6GA 3E18A 3PRJA 1DPFA 4PO9A 4YBZA 1G59A 3DTYA 4KDCA 3LUJA 1QHNA 3S6JA 4Z4FA 1QVRA 4DQLA 3KQVA 4PYLA 3T54A 1JFVA 3NYIA 5KS2A 4UFOA 1QZZA 2HA6A 2B8TA 4CM4A 5GV7A 5TQ0A 3OZTA 2ZIVB 4FGSA 2O8EB 3GJTA 3KAPA 2F55A 4J75A 3TWOA 1UXGA 2QZZA 3R7AA 3K0CC 3UANA 4DADA 4QG3A 2GO7A 4X1KB 1UC4B 2ZVJA 4Y6SA 1CQIB 4JV5B 4GOMD 2B7BA 1TB4A 2ENUA 1GVNB 1RRVA 4P54A 5FBZA 3DJFA 4UZEA 5ITVA 4BVFA 2IS2A 2GAJA 1C0LA 1TW2A 3BD6A 3B2QA 1AKYA 4JLKA 2IL1A 2FPXA 3B82A 1Z47A 1OH6A 2APJA 5CVTA 3UMFA 4PCUA 2Q5OA 1QHHB 2AX4A 2RMKA 3R7WA 4Y98A 3CN9A 3EGOA 1PG5A 3VYVA 4CJXA 3UFXB 4E5PA 5HKKA 1LJLA 5GM1A 2D3WA 3B8EA 2XRFA 3LLVA 4HDCA 1B8VA 2E89A 1KTIA 1K3FA 4QQRA 2BRUC 1PV4A 1HK7A 2RAUA 4MKHA 2QRPA 3GLHB 1UPCA 3NHJA 3LC0A 1O5IA 1OGIA 4B48A 1JH9A 3KALA 3GJ4A 5B4VA 4KRFA 1NJFA 3G7NA 1CY1A 3U9TA 5CTAA 2LGJA 1UDRA 1L4LA 1LDNA 2E6KA 3MN1A 3TNFA 1XTTA 1TTPB 3ZV3A 3IDOA 3O4HA 3DDOA 4JQZA 1EA7A 3S70A 1LS6A 3MC1A 1T6ZA 3GXBA 1V8OA 1SG9A 2HWKA 4G3XA 5JCPA 3V42A 4E09A 4DA7A 3GLTA 4B79A 2AUTA 4B2YA 5ALYA 1WZEA 4EHLA 4M37A 4XB2A 4NMWA 4HQNA 2IUUA 4R8KA 3CVVA 4JJIA 1GPLA 4D4IA 2I1LA 4LHVA 1FJ2A 2F7SA 2HYDA 4KKVA 3PDCA 4TLBA 4TWZA 4Y2QA 5AO9A 4DTCA 4DB4A 3BKXA 4UM8B 3W9BA 3GA0A 4FX5A 1DG1G 4TSFD 2DR3A 3KYBA 1LLDA 1N0VC 3U56A 2ISCA 2JASA 3D3WB 3GRRA 2OCGA 3LBNA 4LC0A 4LNUB 4ZVOA 3U44A 5KYTA 3I53A 1E60A 3SSAA 1XVLA 13PKA 1KH3A 1TJNA 2K5UA 3HCFA 3SC2A 1CF2O 3E9DA 3K0CA 4P38A 1OH5A 2E5LB 1QFMA 3OX1A 4F21A 3PX7A 1D6MA 1UQRA 2AJDA 1CIVA 4P3YA 3A1SA 4RV9A 4DZTA 5CT5A 2H3EA 3W5IA 4FONA 3ME5A 2WFZA 2ZLBA 4AKHA 3HUDA 2WE8A 3QTBA 5JH7F 5KDLA 3ZIAD 1IDOA 3B38A 4UE2A 4JYMA 5DTJA 2I54A 4NZZA 1SBZA 4MQLA 3V1TC 5HS4A 2XKKA 4DILA 4PLWA 2ZUCA 3EAFA 2WJJA 5FIUA 3KYIB 1QMGA 1XL0A 1X74A 3GFSA 2C9YA 3ED5A 4PZZA 1AS0A 3FTPA 4UMDA 2DUJA 4GX0A 5BN4A 1HTWA 5ED4A 1VCMA 2HZ7A 3EXIB 4RPKA 4WE3A 3SQWA 1RRCA 5KQRA 1PJBA 2B8JA 1EX9A 3MYRA 3EAGA 3L82B 1PFVA 3NIFB 1ACLA 2P8JA 2BY4A 2GAAA 1FBTA 2ZBRA 5E8JA 1QC5B 2ROQA 5ELLA 3Q0EA 3GBSA 2OM2A 4HEHA 3RRZA 4QZVA 2Q8PA 1QAQA 3A2NA 2GEJA 3IBYA 1MO4A 3ESYA 4AZ3A 4Q19A 4FYHA 2QX6A 3MJFA 3U17A 4D9CA 2IS4A 4NZMA 4XR4A 1CQXA 2NU8A 1MO6A 2A5JA 1X7YB 4FILA 4WV3A 4Z2YA 5A0FA 2Z6UA 2BMFA 5FKJA 4D43A 3DAGA 2D59A 1PD1A 4QJ4A 1RHJA 1ZOLA 2QTNA 1S01A 3I0NA 1JIKA 4RH3A 4M89A 1SK9A 1U80A 2BSXA 4QTXA 1YZHA 3NJRA 4GKAA 4QOGA 1JPNA 3EGEA 3CRRA 1KVTA 1FSZA 3WB0A 3NBFA 4A0QA 3ZCRA 3VC2A 1U0EA 2JIMA 2XMQA 3S2YA 1YL5A 4JWTA 1SKUA 2ZWIA 7ABPA 2F48A 1DEAA 1MLDA 3E7DA 3HCNA 3RC2A 1Z3CA 5HOEA 3CVXA 4XYLA 7GPBA 2L2QA 5KSOA 5JZMA 4RY9A 4PY2A 3R8XA 4WK2B 3GWZA 3I9OA 5J47A 1ZUHA 5BWLA 1D6JA 1CK4A 3RLIA 3MTIA 1Z74A 2ZE7A 2FEMA 3IPCA 3HVJA 3ZWYA 1S5PA 4EM6A 2IY7A 1UT5A 1E2DA 4XTRA 4TM7A 3G88A 3AFMA 2FR8C 2XHZA 4IOMA 4JLDA 2JLCA 4UDXX 2TS1A 4M1ZA 1HDXA 2O52A 5E4JA 2INGX 2RI6A 5C4MA 1V16A 3DHVA 1ZU5A 4PLPA 1PJQA 4UUBA 2V7VA 3JRNA 1GU1A 1YCGA 2C84A 4RSHA 2AOUA 5DNVA 2RC5A 1UPUA 2P6OA 3JARB 1A2QA 3NHYA 5GJCA 4B3JA 2O3TA 2XUOA 4GMXA 3VHQA 3WYCA 4Z9BA 3EF1A 1DL5A 1Y33E 2YDXA 2FWAA 1DKMA 3BIOA 3DCJA 3VAZA 2JAOA 4BB0A 5CBPB 1WR8A 1D0SA 2LTAA 1MGPA 2WC1A 1KI6A 2WM9B 1I3OA 2V59A 3CSDA 3IT0A 4QIHA 2RHHA 4PCAA 4QU0A 3W2EA 3WJ7A 4Q4HA 3AKZA 1HPLA 1N0UA 2W5UA 3O94A 4GQIA 4HXYA 4LX8A 2G09A 3NHMA 1CNEA 1UM9A 2DQSA 4FMCF 4HWKA 2FZ5A 2Y0BA 2ZU6A 4UMEA 1P0QA 2GBGA 1YVDA 1SIWA 3C14C 1T0UA 1V35A 4AJLA 5KI6A 2GYUA 5DBEX 1HL7A 4HDRA 4ZQGA 3NPAA 1H1LB 2BJWA 3O8LA 3TNDA 4KG7A 5AVZA 5ALEA 2G9ZA 1ZRSA 3OKAA 2OA0A 1Y8ZA 3VR3D 3FCUB 3JWHA 3H3JA 2AI2A 3N8HA 4NXMB 4ZEMA 2XCQA 1YU6A 1F8FA 4N9QA 3A25A 5KDDA 5JNRA 1W1IA 4LMRA 2FMFA 3GCXA 5D84A 3TSZA 1GKUB 4BCDA 1YAJA 1O95A 2CUTA 5BV1A 5KIAA 3OA2A 3T5GA 4PC2A 4DRZA 4LCBA 2OCAA 4F7DA 3EB9A 1TJYA 3PGKA 4HNAA 4NCHA 3WR5A 1FXWF 3LUDA 1A8HA 1RPTA 3VO1A 1ZH4A 4QL3A 4S1WA 4X84A 1R3UA 1N9GB 5TJHA 1QZUA 2MJLA 3ADCA 4DPLA 3I9FA 3PUXA 4EJ2A 2OR3A 3QU9A 3OFNA 3Q8XB 1CY0A 3P4XA 3THRA 1ADBA 3T5CA 3QP9A 3F9CA 4RD6A 2A0FA 1GGVA 2D5IA 2Q9BA 2PZFA 2QMOA 2ZYRA 1ODLA 3P0HA 5D00A 2FR8A 3AL2A 3LA8A 3IGFA 3LE8A 3PZRA 4RLFA 3TTYA 3WAGA 3UQZA 2XSZD 4PONA 2H4ZA 4B76A 1R0BA 2HGZA 2TMYA 2X4IA 1KERA 1KHTA 2C0CA 3K4PA 3PXBA 1USVA 2GK7A 2OCXA 3W6OA 2BI7A 3OM9A 3I23A 2VUIB 5HKAA 5G4LA 3LT5A 3VSAA 4TWJA 1T15A 2AI3A 2M6RA 2P4SA 4TLMB 3L1VA 4CE6A 4BU1A 2BOVA 2R6GA 2K7FA 3PNKA 3PRKE 4G5RA 3VDXA 2JLUA 3ZHBA 4LRQA 1XTRA 4RKEA 4HVLA 3GMDA 1OH7A 3CJTA 1JAZA 1YD7A 1K7FB 3AOEC 3GLHE 4NG4A 2WD8A 1HT2E 4PYOA 3BMCB 1S1MA 3KXPA 3ND7A 1BEZA 5BNZA 5IDWA 2V97A 4CM9D 4BXOA 1YR8A 2P6MA 1GPKA 3FSGD 4HWSA 3AR6A 1LDEA 1NP7A 2I6SA 3EYWA 1KGDA 2J5QA 3BH6A 5D5HA 1F5NA 2IHUA 3MD9A 5J1TB 2D0DA 5BT9A 4DCJA 3LRXA 3IL2A 2A58A 3M0EA 2P2SA 5JQGB 3I6YA 2Z8YA 3VFDA 3JALA 1YT5A 1AF4A 1WHSB 4RVNA 4IUBS 2NZYA 1PWXA 5K3CA 1KJIA 4JD5A 4E13A 4F0JA 1MW9X 4BGUA 2O2EA 3EZFA 2GJ9A 3V33A 5A3SA 2HY7A 4JKYA 4L8LA 4FW9A 1FFSA 3TTUA 4G41A 1J2RA 1YZNA 4G5GA 4KI0A 4C7JA 3PQEA 3EASA 3RANA 3AEKA 5IZCC 1OI4A 3C74A 2D8MA 4Q66C 4INAA 2WD7A 3ZPXA 5HJ5A 1Z0SA 2NP6A 3FW1A 3KQWA 1XRMA 1IVSA 4EFLA 5CD9A 4ISBA 4UMFA 1UKCA 4NCXA 5KYNA 4QUBA 1VRVA 4EAQA 3QA3E 5KTMA 1CEEA 2ODTX 4J7XA 5EY5B 3DM9B 1IK6A 3FCOA 1D4OA 3IBTA 4XD2A 2QR2A 3VNBA 2RCYA 4BKPA 4ZT2A 1ZYUA 4ILKA 3AI7A 1PF7E 1FSSA 2V9ZA 4C0JA 1P0IA 3FBTA 4COOA 3GPCA 3GRPA 3VKWA 5EJ5A 2D5LA 2J3JA 3R40A 4N5LA 4P4SA 5CX1B 3UUEA 4V2IA 5ICMA 1DC7A 2QP4A 2RGNC 4RF5A 5LSAA 1XMOB 2X8JB 3BORA 2ATVA 1SB9A 1X42A 1T9CA 3KPJA 3WFZA 2H2DA 4TQAA 4D4LA 2R0QC 1Z7YA 3QWFA 4BQOA 3I2IA 4MV3A 5E1DA 3ACBA 4QC2A 1XNHA 4B2LA 5FDFA 1SKQA 4LQ4A 2EP5A 3ZWWA 3AOEA 3R5SA 3E82A 5KNBD 5LZ7A 2WY2D 1KZ4A 4TUYF 5AHKA 1D2CA 1Y9ZA 2QD2A 1F12A 3MIZA 5DDIP 3N6XA 3NVMB 2VKQA 5CA1B 1Z36A 3P2KA 2F1HA 5L3QB 4ZN6A 1SKMA 3FKQA 3BL6A 3C85A 3CW9A 1I6LA 1ZGHA 1UP6A 2D2XA 1NR5A 3UXYA 4RLHA 1BCRB 2C8VA 2I66A 5TX7A 3ZWAA 1W2WB 4X7BA 3AF2A 2I8LA 5E9WA 1JBQA 3O4VA 4LHWA 4HTFA 3QPBA 5K09A 4P7GA 2BW0A 1RJ9B 1U2SA 3F5MA 4MP6A 4ZCPA 1J20A 1ZH2A 5SYMA 2B4QA 5FUYA 5AT1A 4EDFA 3JVIA 2NACA 3W4KA 4L28A 1U0LA 1Y8RB 2A2ZA 2PGDA 1TNDA 2QSYA 5A1JA 5JH7A 4C0SA 1CUWA 3L8FA 1DC5A 1I14A 4IPTA 3HKDB 4JVOA 4MAAA 5TY0A 2PNJA 1E6EA 4DY4A 2VA9A 2Y71A 1EWRA 4QO7A 5LC1A 3O93A 5LNK1 1P60A 1W5TA 4Y1GA 1R0KA 3V34A 1Q0LA 3K16A 5U1PA 4EW1A 4XD7D 2PZBA 5LA6B 5JFGA 2I2FA 4DLLA 1US8B 1W34A 1GNLA 2NZXA 5IZ4A 1QLWA 3EQ8A 3O92A 4MUNA 2OZKA 4DXAA 1GUZA 1AXRA 2GK4A 4G2NA 1OGJA 1C1DA 2PGIA 3AV3A 4KAFA 3Q7IA 2RGNA 1YC2A 3X2SA 4IOJA 2DTDA 2AYYA 5K0JA 4D8XA 1RWOA 1ZONA 2C82A 2WNHA 2ZT8A 2WIDA 2ZI7A 3HJCA 4EPXA 4D26A 3ZU6A 3PUHA 1ZLYA 1CWUA 3UK0A 4DUZB 3L4SO 1WZCA 1L5WA 2X6RA 4RTLA 3KTDA 3DMRA 5JYDA 2X42A 1L5KA 4LOJA 1UJNA 1CFZA 1DTWA 3V7WA 3U4IA 2YINC 4OHFA 1UKEA 1VBFA 5LYJF 1PDOA 2Q4BA 4JLVA 4KGXA 5DM2A 3FIJA 3GJYA 2NO7A 4WKPA 4BCBA 5IN4A 3PX3A 1DTSA 3K6KA 1GFWA 1VKHA 5CK5A 1D1PA 3LVQE 5AIAA 4ME6A 4PGHA 4RHYA 1Z56C 1VJ5A 4U5XA 1HYGA 1U0NA 2IYZA 3OZWA 3UT5A 3V2IA 3SG0A 4E11A 3EC2A 1GPYA 3RRJA 2OKGA 4LXYA 3HPQA 4OJNA 4R9SA 4ZYWA 1L3IA 3HA7A 1VCNA 2Z04A 2ZJ6A 2ZSAA 1Y7IA 3C1TA 3KHTA 3GY0A 4II7A 4LUCA 3OESA 1EVZA 2EKZA 1E98A 4NZYA 1QCYA 1D5CA 4AZSA 2O8FB 3JZAA 1H0HA 1SOVA 5IAKA 5DX0A 4TRMA 1FS6A 4EO9A 2XNDD 4JP2A 1GRRA 1MOPA 1BD3A 3ELUA 4P1ZA 5K7SA 3BWVA 4KVFA 1RVV1 1VPLA 2AWOA 3O1JC 4K2AA 3ZE7A 2UYCA 2PH1A 5F4ZA 5HPYB 2JAQA 1YUMA 1QHGA 2GRUA 2J6BA 3ZZUA 4AKEA 4DXDA 2YASA 4URXR 1NDQA 4ZVNA 3ZHZA 4D9BA 1KDPA 4GO1A 4BWYA 1IM5A 1ZM7A 2NIPA 4YDRA 3IV7A 4JODA 1VCHA 3Q72A 5LP6B 3OTWA 4QT4A 4C7VA 3SHFA 3W8RA 3N8KA 2FSGA 1Q17A 3PKJA 4ZHSA 1E9CA 2AMYA 3V4OA 2B4RO 1H3NA 3ED1A 4EMBA 1Y6RA 3ECAA 1BA3A 3VR6H 4C6HA 5BNIA 1BCSA 4DIBA 1UP7A 4GLFA 3ELYA 1KYVA 4RETA 1X94A 4NBVA 1RQ2A 1G19A 2VJDA 2LCQA 1QM5A 1Z4NA 4BO0A 2AW3A 4Q9KA 1YTLA 3SJBA 1J5PA 1NHWA 2AEMA 3ZWXA 1U8FO 2QTVB 1NRIA 1EJ6A 3SS8A 3VR5H 4ECAA 5INTA 5JT1A 2P3SA 3OPYA 4PX9A 1Y3DE 3RSFA 1XPJA 2VDRB 4X20A 3AU9A 1Y6GA 3AR5A 5ALHA 1OTHA 1S6YA 3LKVA 2WJAA 1I7PA 1OX4A 3JQ6A 4UM7A 3DOHA 4QU8A 4JI0B 4ZAYA 4B45A 1OYOA 3D4PA 1BFUA 3G0OA 4YCAA 1M7GA 4XM0A 1QNLA 3I2YX 3C24A 2J7KA 4XOIA 5M04A 3AHJA 4E2FA 4P31A 4YRCA 2P9FA 3DE7X 2FR1A 2CFSA 2WJGA 1T8SA 3AESA 4BBAA 1E6MA 1XNQB 3ETJA 3NEYA 2DHRA 4OGWA 5JIBA 3SBXA 3EUAA 4MWOA 2LDBA 3MWEB 1ZP6A 4ITUA 3TSYA 5LQMA 4K9RA 4D96A 3RVJA 1SMKA 2O0JA 1PHRA 1Z15A 4Z1OA 3KB2A 4PYJA 4BATA 1ISHA 2D1SA 2ZTMA 2O0HA 1XE3A 5CNJA 4OU5A 1W0KA 5DI3A 1DAGA 2IOQA 2ZRLA 4L8VA 4WKBA 2HGSA 1I4DD 1UJ5A 1V9CA 4JYCA 3WICA 1TCAA 1GUYA 2IYYA 5AKHA 2X1MA 1PWZA 2HIMA 1GEGA 4WHMA 1IZ8A 3HJFA 1F51E 4UEQA 2QN7A 1ML4A 3ICOA 3WBKA 3R3JA 2AWNA 1XTQA 5AIBA 1QUEA 3O8QB 4GP9A 3C48A 1SVOA 1Z4OA 4RTOA 1OV6A 4A26A 4A0FA 1QZXA 1K89A 1U8YA 1EBFA 4XRRA 4F3YA 2BTEA 1L1RA 1FDVA 4Y7CA 5AKZA 1OLSB 2XV1A 3GP5A 1E58A 1H4VB 2X15A 4NFYA 4XWOA 5KKNB 2OLEA 3AYZB 1DDGA 1MO5A 5HQ3A 2ZXEA 5JMPA 2OSBA 3QLTA 2Y1DA 1S2MA 1OFUA 3T5TA 4PPYA 4MHTA 4DB2A 3A04A 3TLCA 1G3IA 1XA3A 1UL1X 2BKUA 4OLHA 1D04A 3CLUC 1WBDA 2V1UA 3Q2OA 2X3UA 3PKZA 1E7SA 3NBXX 4NMHA 1WDKA 4YMIA 2BJVA 2QZ4A 4AUMA 1A9XA 3WA6A 3K70C 2OL4A 1TYBE 2GPWA 2QUKA 3SF8A 4EY8A 1ZI8A 3IESA 1QU3A 2C4VA 1XPOA 2XKBA 2VNIA 2IP1A 3SF0A 3UAXA 2D62A 2EHJA 1JG6A 1A88A 4KUEA 4DV4B 1YRAA 2IYLD 4CHTA 4WFQA 1B0ZA 3PDHA 2IKSA 5EINA 4COKA 5ALPA 2PUJA 2XQKA 4ZREA 4F4DA 4UW9A 1T2AA 4FEYA 5AVUA 3BB3A 3OCVA 4JSRA 4P0TA 1Q3TA 4JGIA 3F5FA 1RCTE 1YQGA 4W99A 1ITZA 2LR0A 3LHIA 4XWYA 3PNOA 2FUEA 2DECA 5C52B 4EG8A 2NQ8A 4PS0A 4TKZA 4B4UA 2YS7A 3OQVA 1U1EA 3AP3A 3UUGA 3TG2A 4N7JA 3T34A 1QG2A 2EARA 2BEUB 3HADA 4G1EB 1QYCA 1HO3A 2Y1OA 3NT5A 2X0FA 3IUMA 5YASA 4C22A 4I6EA 4KBGA 3RHTA 2GHQA 1XALA 5SV2A 1TL7C 1M1ZA 1TTQB 3MILA 5TXGA 4YCNA 1XRJA 3ZHOA 3MGGA 5E6UA 3H17A 1J0CA 1MDFA 5CM2Z 1O87A 4ZV4A 3LO8A 1KWKA 4YY3B 4YP6A 3TOVA 3OU7A 4QELA 2Q4OA 2FSUA 3QE4A 4M9RA 2HDHA 3VI4B 1HOTA 4OPMA 3WGQA 4TTTS 3W5VA 2R1TA 1V4NA 1WMSA 4ZCRA 3CEJA 1Q77A 1SEVA 1CRZA 4B2IA 3GLIA 3ZVNA 3D3JA 3QLEA 1XAIA 3STVA 4CKCB 4GF5A 5EFZA 3F7OA 1BRTA 1U81A 4AKTA 3KHUA 4PAQA 4TUYA 5FBRB 1X80B 4ZAWA 3CNEA 2WA1A 3R41A 4Y3UA 5D5PA 4ZQIA 2C2XA 1J33A 1H6AA 2QMEA 4BFVA 4ZICA 5CDTA 4Y1RA 1RRPA 5I3ZA 3N28A 1R8JA 4FIZA 1AM4D 2N75A 1TQ2A 1L7XA 5BQOA 4CEHA 1BO6A 1ODCA 5FOXA 4IIHA 3RRNA 3PF8A 5A4MS 4P93A 2IE8A 4KAJA 4Q37A 4B3MB 4JR2A 4R84A 4WBNF 1Q6ZA 1KMIY 1WUHS 1CYDA 3DH0A 5A1TA 2A1TS 3R6DA 4DTIA 1II0A 1Z13A 2E55A 2NTNA 3OC0A 4MW6A 2E4ZA 4CV2A 3CH4B 3LQKA 2QJOA 1ZGJA 4P58A 1DUIA 4OUDB 3WTCA 3V7UA 5EUCA 3ML1A 3DO5A 3K6SB 5AK5A 1Z38A 4UCXA 1GUDA 1KDRA 2AT1A 3CURA 4EB0A 3FJOA 1JEDA 2HADA 1HDEA 5DYWA 5CXUA 1ADYA 1AZSC 3U1BA 5LZ2A 3FWKA 1E89A 2ZXUA 1Q7EA 3FI9A 3C1AA 1KTVA 2Q4EA 3LC2O 3BD7A 3DLBA 1U9YA 1MBZA 1N2SA 2NSJA 2PAAA 1DX6A 5T4FA 3Q4GA 3E3LA 1GUBA 4R1NA 3RQIA 3WVNA 3ETLA 3NCTA 1UJ6A 1JU4A 1X15A 4M76B 4HYQA 2QR3A 1N75A 2GS9A 2H2AA 3URMA 2FZLA 3C6ZA 4BV9A 1SOAA 4X65B 5ESDA 4RTPA 1C81A 3FH0A 2XGOA 4XB6B 4B3BA 3P9CA 1WUYA 4QYMA 1YDHA 3BE5A 3DLPX 2P1ZA 2BFDB 5F5XA 2I3ZA 1CCWA 2G9RA 5FTWA 3ENQA 3UPDA 3QSYA 1T2VA 3OCWA 4RMGA 4GWLA 5NULA 4DLKA 4J0JA 4NBKA 2HBYA 5DNEA 1NVFA 3U3DA 1GZUA 4GD3Q 5E7JA 3TMAA 2QX8A 2VDOB 1CRWG 3JWJA 1N5KA 2VRCA 3WIDA 3G13A 1KP3A 4G65A 5BSHA 3EZGA 2CDAA 5LYJA 3JCZA 3H1FA 3GMTA 3IO3A 3ADBA 4DG5A 4WLEA 3KOMA 3EGDB 4EHNA 2PS0A 4RD2A 1FVOA 1PFWA 2VHCA 4K9NA 4I6JA 1MO3A 3O4IA 4ZVVA 3MTBA 3ZNQA 2EX1A 2OCBA 2AOXA 4GRAA 5BQ5A 1GZVA 2IBSA 1QRTA 2BC9A 4KR2A 4ZD6A 3R7BA 3U1TA 1NXSA 3Q5EA 3MJCA 2IHZA 1VTKA 3ENZA 2H4WA 4IJQA 1JVNA 2AKAB 1ULTA 1M0WA 2EZ4A 4EHFA 2RGWA 2PR7A 4JBNA 3COVA 3RFVA 2WA2A 1UFRA 4TQUS 3TIFA 1BW9A 1M2VB 1NLFA 4DIEA 3V6MA 4F1KA 4DQKA 3BMXA 3HJTA 2X3YA 2QX4A 4MWDA 2PBRA 4O0MA 4JU8A 4PO3X 2WKSA 4JQYA 1O1YA 4WK4B 3DF7A 3WOVA 1HZJA 4HFNA 1W0CA 3C5WP 4U2EA 3PJEA 4HR7A 1IN5A 1JIIA 1XJQA 2A57A 3M34A 2H7XA 1JHUA 5K0GA 4OMCA 1H5NA 5GJWC 2VHYA 3FPFA 4H7PA 1V39A 3B52X 3GLVA 4YT4A 1JR4A 2NXWA 1QRSA 3A1DA 1JLHA 3TQIA 5DYIA 1DEHA 4FGUA 4A0HA 2GBPA 2OBBA 4C2TA 4FJ1A 1RIIA 3DYBA 2FZGA 3AR3A 5BVHA 4X6LA 1X2EA 3EZYA 4A6DA 3HUTA 3T5PA 1PFGA 2QV0A 4FHCA 1MVLA 3OJCA 1RXEA 1ZKMA 4RTQA 3P0EA 1DADA 1N5IA 1KS9A 3C97A 1Y3IA 3PJGA 4BWGA 4F46A 1A9SA 1A76A 1E61A 1MF7A 3B36A 4HZGA 3JV7A 5AVKA 1LZKA 5DCWA 3CONA 2OGUA 2ECQA 2V98A 4R1SA 3HA3A 3RTAA 3ZDDA 4BEJA 1XZHA 1XF1A 1SVUA 2CUZA 5DWQA 2IIQA 1FNDA 1RCUA 3SR3A 4HUTA 2XUZA 5JLAA 5K2OA 5E6SB 3K30A 2O4CA 4G8BA 1EFRA 4RHFA 3ZHVA 1AHNA 1QBGA 2QT0A 1AUQA 5SY9A 1OPRA 3E7PA 4CIAA 1ADFA 5EKDA 4C9BA 1D2GA 3ESAA 4J6FA 1L3BA 3GZ4A 4NMXB 4D56A 5JAOA 1C4KA 2DLNA 4F2WA 2OXRA 3IXLA 3JWIA 5IAJA 3UG6A 2PIDA 4RHEA 5ADWA 2R2AA 1F6BA 3F7NA 4XTCS 3D7LA 4AP5A 4OF4A 5JAMA 4IZOA 1QGYA 3EF0A 1KZHA 2PZ8A 5A5DA 5C18A 2JIRA 4QOIA 1MKYA 1AKEA 1MJGM 2L69A 3L7CA 3S40A 3S7ZA 4CLOB 2H51A 2UZ3A 3NVKI 5JU6A 1P72A 4PLZA 3PWSA 1Q22A 3OTOB 3P0RA 1JZTA 2JGDA 2G08A 2B36A 3GQBB 1B0UA 4KQCA 2J3MA 3K71B 1C0EA 3OT1A 2BR4A 4M86A 3ZK7A 1LNSA 2OZLB 3HDQA 2OXTA 2WILA 3TMYA 4KNVA 1D0VA 1DXHA 1HTTA 4NICA 1BX3A 3E4CA 4EGJA 3PFIA 4L5YA 3FZGA 4QGAA 4YYEA 3OUTA 5JSHA 1NURA 3WNCA 2QP9X 4WIAA 3TW8A 1VMAA 2IW3A 2NQTA 3ZKWA 4MDEA 4PRZA 2EIXA 4CUZA 1A8UA 4ESHA 3L05A 3LOUA 3OIVA 3WHPA 3UGJA 4RZHA 1KSHA 4FHDA 3WNDA 3VGJA 3S68A 1N6NA 1P1FA 2C00A 3DXZA 3QUSA 4TV8B 3N0XA 4C0KA 1OZGA 1P4JA 1T13A 1VKZA 2AQKA 3QOWA 4U0JA 2CLMB 3E05A 3OKFA 3ZR4B 4DBLE 4IINA 3PUWA 3CEAA 2OGTA 4D5GA 1TO1E 2H1IA 2QJFA 3AONB 4TS9A 1ZBQA 3GIWA 2ODNA 2CLIB 1ILWA 2C1EA 1WV0A 3GN2A 3RVRA 1FP4A 1Z5GA 1YFKA 4XUDA 1Y4ZA 3L7IA 5AHOA 4MGHA 4O2AB 4HGOA 4LOIA 3VPXA 5JSFA 2Z8XA 3FVRA 4H3KB 3JVDA 1I01A 1COWA 3CU5A 2GJSA 3PLAE 1BFKA 3OPNA 2IYSA 4HDNA 5FPPA 3BWDD 1GNQA 3G9ZA 3OT4A 3QPCA 3OAAD 3U4HA 2OO5C 4TVOA 1NMSA 4YCSA 4BNTA 5BWCA 1M0EA 3IP1A 3PBKA 5IJ9A 1BXGB 1LDMA 2C57A 4ALIA 3HXMA 1PVOA 1M6NA 3WNVA 5AD1A 3KYCB 3L79A 1J6UA 1JDZA 4N3CA 5JJLA 4WTOA 3L43A 3LUGA 1USWA 4AWAA 3CEHA 2VBFA 1P2FA 3FETA 4NZNA 3RI3A 2G0TA 1UH5A 1ZGZA 3CUTA 4LE0A 3PLNA 5CLIA 3ZDEA 4ZZ1A 2QI9F 3CLKA 2CNWA 1PRYA 2A5FA 1FU7A 4EO4A 1JQDA 3F96A 3ILXA 4U5QA 5TF4A 4IDBA 4R8RA 1WKCA 2I9PA 2F8TA 2OK8A 4UATA 4A8JC 1QVWA 2DTXA 3S2EA 1XDGA 2AN1A 1FUIA 3VR6D 4U3JA 4IYJA 1W4RA 4ND2A 4EOGA 2QTFA 4TLAA 1DRJA 1UADA 3WZMA 4D9FA 4EJSB 4WVLA 1U2EA 1NT2A 2OCKA 1DBIA 2B21A 1LQTA 2BAGA 3LUKA 2O2IA 1LJUA 2XUIA 3VR5D 1BXZA 4URUR 3C6YA 5E3IA 4P84A 2Z1MA 1N8TA 1TIKA 3CUYA 3FMPB 3KLNA 5KNCH 1W36C 1HI9A 2E85A 1HYEA 5ENDA 1T9BA 2WPNA 4RHCA 5DSXA 1PKXA 4Q1VA 1E99A 4XM2A 2BELA 3EJWA 4C0QC 2I1QA 5IAGA 1QV7A 2HU2A 2FN3A 3EIWA 4QBHA 5FWDA 2JDIA 3H1PA 4MWCA 3CTMA 4R05A 4WEQA 2HCRA 1RWBA 3JQAB 3K1TA 3PF9A 1VSQA 2OFFA 1JWLA 1AJEA 1AZLA 2ZCJA 1VYTA 121PA 1OYVA 1UK9A 4TXMA 1P7CA 1WA5A 1YJXA 1Z8HA 4ZYLA 1JDNA 1GTJ1 2ARKA 2O3RA 4LYGA 2B2NA 1P44A 3OZSA 3K1YA 4OJQA 4P0QB 5JNLA 4DT1B 1JB1A 1PVDA 3C3DA 4CQLB 4TRRA 3SEFA 2YZKA 5JLJA 2J5RA 1EQAA 4R2MA 3RKRA 4F12A 1M1NB 2ZSDA 5SZIA 5FHQA 3VX4A 2OO5A 3NR2A 3B6IA 4JUCA 5K6AA 1KO1A 1Z4KA 1DV2A 2OT3B 4RE6A 3U40A 4UHHA 1ZIXA 5CDUA 3PFNA 5ALSA 4HB4A 1G8FA 1KI1A 4I1PA 1Y6ZA 4F2DA 3SDZA 1Q7GA 4REQA 2XKJE 5IEJA 3NYWA 3KL2A 3LUHA 2XE4A 1P9RA 3EZ2A 3LHSA 3QPDA 4LRYA 2ODQA 4ALMA 3UJPA 1GG8A 3LX4A 4A8JA 3D8UA 1K6XA 1MFPA 3IUBA 3OX4A 5A3JA 5HKOA 1FEZA 3RJTA 4L74A 1P2VA 1ZMXA 1QG4A 2IPOA 1FLDA 3DE6X 4MR9A 1CJVC 3JTEA 3CTPA 5EEHA 4RABA 4E2YA 3F5QA 3NWPA 4J1NA 3GEHA 1TC1A 5AP9A 4K0KB 1YA6A 4MVJM 2ORED 1CUYA 2AC2A 1K66A 1T6BY 3UAZA 3MBOA 1OZ0A 3DEJA 3F3KA 3FBWA 4RPJA 4WCVA 3R0JA 1PR2A 4A0RA 3P5BA 4DCSA 4PTYA 3ZD6A 1IVNA 1EXDA 1V4BA 2CZQA 1QOZA 4FS8A 4GI5A 3NALA 4WXRA 2IPXA 4Q3AA 3LHFA 3U37A 1E6CA 1V26A 2H4FA 1ZVMA 2J48A 4NNJA 2J33A 3F6BX 2R11A 1QFXA 2XCOA 5HIIA 1L7VC 2MR6A 5HSGA 3MT9A 3H1TA 4V1CB 1VJ0A 2YW9A 5EFOA 3VYUB 4BASA 2PL1A 4JUIA 3JYNA 1HF3A 1E2JA 1YBVA 2ZRDA 3HVIA 3ZUPA 3I04M 4AN0A 1Y7TA 3RDPA 3VH2A 2X7XA 3K1ZA 3RAEC 4YXWA 4J0DA 1QQAA 5JEEA 2NNLD 2B98A 3QE9Y 2DLCX 4DLRA 3RHSA 4P2BA 4HDMA 3RS4A 2P5YA 2ZRIA 1TMKA 1X7DA 1Z68A 3ESCA 3FUCA 2REQB 1G60A 1F0KA 3K1AA 1OTXA 4FFRA 4GLJA 1RI5A 3RQSA 3UK2A 4B3DA 5IG2A 1QH9A 1VQ1A 5L7YA 3W6PA 2C9ZA 2IVFA 2QTTA 2V7UA 4KITB 4TYPA 4CODB 3HLTA 4QUHA 4ZCLA 1NP6A 1SUPA 2H07A 2HV9A 2NAFA 3V9PA 3ROGA 5GJBA 1OZAA 3MMZA 1GAEO 3MTGA 1P6QA 3REQB 2LVBA 4X54A 1RLJA 4CIDA 4DNPA 2IQ5A 1Z16A 4CMIA 4BO7A 3HL4A 3PEUA 1QS0A 3N2GB 2D5BA 4CUJA 5KDOA 4G86A 1M2NA 3J7AC 2O19A 2AEFA 5BW5A 2HCTA 1MAHA 1B76A 1J0XO 1B6RA 2P6UA 4L3OA 1T2DA 2I8CA 3L1HA 1Z6PA 4LY3A 5B30A 2MT9A 2FWNA 4JYBA 4MV4A 3DVSX 1JMVA 1VLLA 2R25B 2BMJA 4HGYA 2X8WA 3COWA 3LQRA 4IGKA 1ZEJA 4CL0A 3GLFB 1UCFA 1EH5A 1NBAA 3PPXA 3F98A 5LD2B 3QQPA 4ENVA 2NOAA 2IDKA 3BRCA 4A8PA 5JNSA 2QLNA 5B3JA 3QEBZ 2ZTVA 1IOZA 3RWMB 3CBGA 3KC2A 1T9DA 2EOAA 2YZMA 3WL3A 2PHZA 4U2DA 4CIBA 2H1RA 2XB9A 3O2SB 4IV8A 5U9CA 1C3EA 2X8AA 1R4NB 1H94A 2R2GA 3A4VA 4HGNA 1LF5A 3G0DA 3PD0A 4GS5A 4LY0A 4N1AA 3PRHA 4LWQA 3EBOA 4C3VA 2D4HA 2RG7A 5CHEA 1E7RA 3TM4A 3VJMA 1KAGA 2NPIA 2IDZA 5EC8A 2DT8A 3COSA 1J07A 5JRDS 4ARBA 2QORA 2XT0A 3DP7A 3IMCA 5CM8B 4EUFA 1T0BA 1B6SA 2X4LA 4G0VA 1JHXA 1DAEA 2BKLA 4IHKA 3JQAD 2X9LA 4RHXA 6REQB 3BB4A 2KYRA 3C8UA 3Q3JB 1L7MA 2MTBA 5LBUA 3ZG6A 1QRUA 1ZU4A 2H29A 1E2PA 5G1PA 4DWVA 2B1IA 5PNTA 3ANYB 2ZYSA 1JQEA 4NMLA 3O31A 4YAIA 3ZLUA