1NVTA

Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
287
structure length
287
Chain Sequence
GPLGSMINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate 5'-dehydrogenase
publication title Crystal structure of shikimate 5-dehydrogenase (SDH) bound to NADP: insights into function and evolution
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 94
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nvtA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1nvtA01
3JQ8B 1YL5A 4B7XA 4RVSA 2O3SA 1PJSA 3DFUA 2YY7A 4BKQA 2R2GA 3RC9A 4NBRA 4GLLA 4OSPA 4IDCA 3W4KA 4N5NA 4EJ6A 4Y8VA 1DDOA 3RC7A 5HRUA 4BB6A 4OQZA 2B36A 1KC3A 3ROKA 1UXHA 4W9NC 1OBFO 2EKLA 3ZWYA 1XA0A 1RM5A 1RM0A 3KSDO 4IMPA 3JQ8A 1X0XA 3IAHA 2EWMA 4DWVA 1ULUA 2GUGA 1Z73A 1U3TA 3ANLA 4BO7A 3PHJA 1L1FA 4MP3A 2OBNA 5JE8A 5A06A 1BMDA 4H16A 4GLOA 1LC3A 4GGPA 4J1TA 2JCYA 4XB2A 2GN6A 3H9UA 4PRKA 4YQYA 2HK9A 4TVOA 4CUKA 5A9RA 4BNGA 1DRWA 1XIVA 3KEOA 4CL8A 1PJBA 3E9NA 1UJMA 2GN4A 1WZEA 4L73A 3T4EA 4LRTB 3WGZA 3NDIA 1U3VA 3CMMA 4OSOA 3ZHBA 1PR9A 1WLYA 3VKVA 4CLEA 2HMSA 3NT5A 1K0UA 3U09A 1F14A 4DL9A 4J16A 3ZCXA 4IJWA 3PIIA 2ZJ1A 4HX5A 4KWIA 3NGLA 1XELA 3B1KA 4CMHA 5JYEA 4D42A 4KMSA 4NU5A 3E5MA 4PZEA 4B8ZA 2W2KB 4K26A 2PNFA 2JAPA 4BO2A 3TOZA 1ZXBA 3DZBA 4RPHA 2AQHA 2YQ4A 5B37A 1NPTO 3EHEA 4OO3A 2I76A 3FWNA 1HSZA 3PJFA 1E5QA 1H6DA 1YOVB 5DDIP 5FFFA 3WXBA 3TSCA 3U4DA 4K9DA 3GDFA 1MXHA 1WMAA 5BT9A 4DC0A 4ZQHA 1TA4A 4II2A 2NTVA 1HKUA 1AXEA 5ADHA 5ENDA 1KVTA 1VLLA 4HADA 2WYVA 3H9QA 3I9JA 1HDOA 4ZU3A 3VOSA 4IZHA 2AQ8A 3W8EA 2IEBA 4FS3A 4RF3A 3RBVA 2W2KA 1GU7A 4JROA 5ITWA 4RQUA 3H9GA 4DQUA 4C7JA 2OMEA 3BYZA 4CQMB 4TMFA 1W6UA 4Y6RA 3W6ZA 1JKFA 2J5RA 3A4VA 3BMNB 2PWZA 1YOVA 2YFHA 1WP4A 3OQ6A 1ZSVA 3M2TA 3LF2A 4MKRA 4MVJP 4YAIA 3R0IA 1P1RA 5DBGA 4D3SA 2NWQA 3ZWPA 1WZIA 5A5EA 4E5PA 4F6CA 4GVXA 1VKOA 2B4QA 3ZW9A 1QYWA 4YA6A 1VC2A 2OZPA 1GYQA 4BKPA 2E6UX 2H63A 2NUAA 1FDUA 1YL6A 2JCVA 4UUOA 2ZATA 1E7MA 2Q3EA 2Z1NA 3K92A 4UVEA 3E82A 1PTJA 3BHMA 2P2SA 4CQMA 4INAA 5F5LA 3BMNA 3I9NA 4FCCA 3A14A 2GZ1A 2Y0EA 4TZTA 1IL0A 5CG2A 1PSDA 4OJNA 2C29D 4BNHA 4E2ZA 3RUHA 2ILTA 4GWGA 4J0EA 4IJVA 4E30A 3GAZA 1FDVA 4RF2A 5TC4A 3PDUA 2W2LD 2IXAA 3RASA 4EI2A 4OOEA 4BNMA 3DBLB 4CR8A 4YRAA 2PD6A 4CLHA 3ZWNA 3RUIA 5DF1A 3STHA 4HFRA 3OJ0A 4RPGA 3UCXA 5IDWA 4Z0HO 4H15A 4OM8A 3RFTA 3DAGA 3HN2A 2DBVO 1XGKA 3PHHA 1I3MA 3GEDA 4WECA 5IFLA 1CETA 2QHXA 1Y8QA 3KHUA 2J6IA 2VRCD 3GMDA 3LVFO 4MDHA 4W4TA 1I2CA 3WBBA 2DVMA 4J90A 3TZCA 4DLAA 4UVDA 4I8XA 1DRVA 2BF7A 5ICMA 5JDIC 1MC4A 2O3QA 2C7VA 2LDBA 4R16A 4IGEA 1HRDA 3GVCA 2VQ3A 3TWOA 3ZU3A 5CDGA 1BXKA 5BSFA 3TL2A 5K9ZA 1K6JA 4Q3BA 3RKRA 3N58A 1OFGA 3DBLA 2B4RO 3OIGA 4HWKA 4TRRA 2B35A 1HYHA 3TZQA 4LMPA 1I3LA 3EZLA 1LDGA 1GDHA 4XGIA 4M8SA 2GCGA 1DFGA 1R4NB 3VH1A 4RQTA 1DO8A 1FDTA 4TWRA 4TRMA 2NLOA 1EK5A 3AM3A 5CHEA 2JD1A 4K6CA 3R3SA 1KETA 5G4KB 1ONNA 2O2YA 4JGBA 3F1KA 4FD3A 4W9NA 1NYTA 1R66A 3VAZA 1Z7BA 3ZV5A 4KUGA 2W4QA 2VTDA 3LDHA 3PP8A 2EXXA 3EYWA 4EJMA 1GUZA 2BGMA 3DQPA 1C0LA 1NR1A 1NQAO 4H3VA 2F1KA 4J7UA 3OQBA 1NQOA 3MCVA 1BWSA 1WPQA 3GGOA 3L4BC 2D5AA 1H0KA 3D64A 3F9IA 3FWZA 1H9BA 3L07A 4BO5A 1G0OA 1R4NA 1XWFA 4IQ0A 4IM7A 1K89A 4RF4A 2PGJA 3GY0A 4MO2A 4CODB 2FSSA 1AUPA 3HDHA 2GYYA 5C7IO 4NMHA 1ISFA 3QRWA 2ZK7A 5G4KA 7MDHA 1U8XX 1PJCA 3OIDA 4JBHA 2HUNA 3ROPA 3KETA 1UAYA 1LQTA 3AM4A 4XRGA 4A2CA 3L9WA 2Y68A 1ZVMA 2ZTMA 3SJUA 4GWKA 4D46A 1E6WA 2VYVD 4OXYA 4EITA 5IF3A 1CIVA 3NDRA 3MWDB 4OXNA 1Y7TA 2AE1A 4I9NA 2BMAA 1PS0A 1YL7A 3WIEA 3JQAD 3E8XA 1SNYA 3COSA 3HNPA 5B1YA 1PQWA 5K6AC 2VCYA 3FCOA 2E49A 4LN1A 2FHSA 1LXCA 4UULA 1YQXA 4QSMA 3TNLA 1GYRA 4L74A 3K2BA 3WFJA 3NTQA 4WLVA 2EP7A 1YKFA 5T67A 3UCEA 1BSVA 1NFRA 4YEDA 5F1PA 4JXKA 5AQ1A 4CMJA 1J5PA 2A4KA 4W7IA 5JW6A 4MVJD 1QG6A 4B3IA 5CAEA 1ZEJA 1ZK1A 1EVZA 4YQZA 4EW6A 5JC8A 4AJ4A 4OOFA 3D4PA 4Z0PA 5JAMA 2NNLD 1HLPA 2X8LA 4XQCA 2VT2A 1ZSNA 1I5RA 1YS4A 4HP8A 2PA3A 4BO1A 1E7QA 2HLPA 3H9JA 1T2EA 1XG5A 2OOSA 1YJQA 3PGJA 4CL3A 3DBRA 2OORA 4I08A 1LUAA 1TT5B 3FPCA 4L9RA 2V7PA 2QQ5A 2Y66A 3PDJA 4II3A 3OP4A 3OF2A 3QE3A 4Q9NA 1VI2A 3JQFC 3DMTC 4J49A 3ZN2A 4NR0A 2Y1FA 1X1TA 5L53A 3I9MA 3PJGA 1QLHA 4R3WA 1C1DA 1DAOA 1IUKA 4NJMA 4MVJG 4BGUA 4E12A 1B8PA 1PEDA 4ZHSA 4AJLA 4XQEA 5AXAA 3JSAA 4IDEA 2Y1OA 3LF1A 4WGGA 4XCVA 4XKJA 3VC7A 4GGOA 2EJWA 2B5WA 1YXMA 3SLKA 2TMGA 2I3GA 4RORA 5TF4A 2VZ8A 4HBGA 3RI3A 3WGQA 3S8MA 2VYND 3NJ4A 1YDWA 1QXSA 1VSUA 3BA1A 3EGOA 4UEKA 4Z3KA 1UZNA 1E0DA 3FR8A 1B26A 5H81A 4PLHA 2ZB4A 1A7AA 3OFSA 4FC7A 5IAAA 4I5GA 1SOVA 3C85A 4KUEA 3V8BA 3GT0A 1J4AA 4O63O 3ZHYA 3O4RA 1KC1A 2CMDA 4JJIA 3VVBA 4DREA 4CR6A 4NFHA 2EERA 1GL3A 2DPHA 2DKNA 4AJKA 1EBUA 3ZNNA 4J4TA 3FRJA 4IS2A 4ZQBA 5JDIA 3QSGA 3I1JA 1SBYA 1WVGA 3RD5A 3VH2A 1NFQA 3BHIA 5TNXA 4ESOA 1HSOA 1EZ4A 5THKA 2RHCA 1IYZA 3SXPA 3DO5A 1NWHA 3IUSA 5DP2A 1FXSA 2EP5A 5EJ2A 4IMRA 2AHRA 3JCZA 3AK4A 2OGUA 3DHYA 5HA5A 1DSSG 5CEFA 3AI3A 2Y0DA 4OHUA 3ZGYA 5ENVA 3M1AA 3NT4A 2IZZA 4XDZA 4DBVO 1G1AA 1EUZA 2DUWA 4RZIA 1LLDA 3ASVA 2UYYA 1UAGA 4GX1A 5COAA 1Y9EA 1Q0LA 5L4NA 3WMWA 4TSKA 1I33A 1KEUA 3CMCO 2ZYGA 5BNFA 3U4CA 3ZWAA 1EUCA 2Y0CA 4CMBA 4DPMA 3N7UA 4GX0A 4DQVA 2GZ2A 3SVTA 3S2EA 3KSZO 1HZJA 2G0TA 1E1LA 1XYGA 1D3AA 4IY1A 3TFQA 7ADHA 3L4BA 1P1KA 2X22A 4TRJA 4IDGA 3NEPX 5TQVA 3AY7A 2P5YA 1I32A 1BRMA 1NX6A 4BS9A 5TIIA 4J6FA 4YVFA 1IPEA 3WTBA 1SB8A 3BMOB 3L77A 1GEGA 1MA0A 2YHIB 3Q0EA 2X7HA 5MDHA 3DEYX 3FN4A 2BLLA 1GZ4A 3AFMA 3IMFA 2AQIA 4KTTE 1S7CA 4DPLA 3ZW8A 2GRAA 4YR9A 4X54A 4CQLB 1I30A 1JWBB 3RU7A 3EZYA 3HJAA 3W8DA 3DR3A 2ZQZA 4CM6A 1EBFA 3S55A 1DIGA 3WGIA 1OI7A 1DOHA 3DTYA 4NK5A 2I65A 4B79A 2XF8A 1BTOA 1P44A 4F45A 5BNIA 4IDDA 3SC4A 3GZ4A 1RYDA 5GZ3A 1EEHA 1RM4A 3T4XA 3ZDFA 1PJ3A 5JAIA 1HT0A 1LQUA 4FOSA 2E4AA 3PGXA 4IJKA 2EG9A 4XWYA 1MV8A 5K6AA 3BMOA 2VWPA 4Q39A 2YHIA 4MVJH 2I6TA 5U9CA 5IDQA 3KZVA 1QYCA 3QW2A 1PU2A 1KS9A 5FI5A 4CQLA 1P74A 3WJ7A 3WYEA 4XQGA 2UUPA 2CDCA 3BMQB 3GVPA 4UVIA 1HE2A 3UN1A 4HY3A 5L9AA 5CDTA 1IPFA 4RPJA 1JTVA 1LU9A 1OOEA 1GYPA 1N2SA 2VTEA 5KVVA 2YZ7A 2B83A 3O38A 3PHIA 4XEHA 1KY5A 4YAEA 1FDWA 2EV9A 3EW7A 1VL8A 2VWQA 3L6OO 4CMKA 3V2HA 1P77A 4NH4A 2IYOA 4YWJA 5KJ1A 2NTNA 4E21A 3PXXA 4RV9A 3GNQA 5JDCC 3BMQA 1MG0A 2X23A 3JQFA 3DMTA 1SZJG 1UH5A 3DZGA 3GFGA 3P2OA 5EESA 5JCJD 5B4VA 3B1FA 1E3LA 2HK7A 1HF3A 3WR5A 1NR7A 3DDNA 3V1YA 5A5FA 5IN5A 5C7OO 4RVHA 1LSUA 1ZEMA 3DL2A 3WSWA 5JMPA 4YJDA 1YVEI 3INRA 1OAAA 1XDWA 4AL4A 3ZZNA 4R4JA 3AFNA 3RJ5A 4OAQA 3OM9A 3CZRA 1DB3A 3ENNA 2D4AA 5TSDA 3CE6A 1QKIA 1GQQA 1E7YA 2WM3A 3E03A 4BO0A 5F1KA 2HO5A 1B0AA 4UUPA 3VPXA 1HEUA 5B12A 1R12A 2EHDA 3FNEA 4E2XA 2A94A 3ZWBA 4WEOA 1AXGA 4GSLA 4H7PA 4W99A 1OC4A 1YB4A 2CUKA 4PZCA 1WMBA 3GVIA 4U0KA 3H5RA 4R1TA 3PQFA 2R00C 3HDYA 1ZUD1 4BQPA 4Z3DA 3E9QA 1E3WB 3ETGA 3PI7A 2AXQA 4YT2A 1YBAA 2OUIA 1NQTA 3VZQA 1VM6A 3MEQA 1QYVA 3KYBA 3K2EA 3C7AA 3PPIA 3UKOA 2IRWA 4PN3A 1LDMA 3X2FA 2VT3A 4OIMA 3EAGA 4QO8A 4XRRA 4FJ2A 1X7DA 1N9GB 2IEDA 3MTJA 2YJZA 3PFFA 1M6HA 4XDYA 4FFRA 3RUAA 4GX2A 1ID1A 1LRJA 5BR7A 1XQ6A 1VRWA 3NV9A 3P19A 3WGGA 3D7LA 1U3UA 3F3SA 4JN6B 3ONFA 2PKRA 4PVDA 1E3WA 1HXHA 4YRDA 1NVMB 1LLUA 2EF1A 3GG2A 3EVNA 3GHHA 1MP0A 3S1LA 1S6YA 2GPTA 5GY7A 3OJEA 1T2DA 1LEHA 2ZB7A 1CQIA 3KVOA 3RU9A 2QRJA 2YW9A 1GY8A 3ZU2A 3D4OA 1N9GA 3RIHA 4AJEA 3OEWA 4J2OA 4HUJA 4DMLA 1YB1A 1D1SA 3B6ZA 4NBTA 3UGKA 4MVJI 1KVSA 4JP3A 4NHEA 4AG3A 4BGIA 4BGVA 5A3JA 4D0SA 3VHRA 4BNFA 4XA8A 4ZD6A 3IL2A 1EK6A 1NHWA 4QXMA 3TDKA 2Q1UA 1DJQA 5BSHA 4R5MA 2HKIA 4PLWA 2DBQA 4LSMA 2FRDA 3R1IA 1C1XB 2C2YA 2JHFA 1PWZA 1JN0A 1AHIA 1L7DA 2ZTLA 3AOGA 4BB5A 1KEWA 4A5OA 4NI5A 1E7RA 3PLNA 3GDOA 4DIOA 2O3JA 4EGFA 2J3KA 5TS3A 5ILOA 1TB4A 4OGWA 4FGSA 3PWKA 3H65A 4O59O 3CPSA 4ITUA 4KQXA 5IJZA 3Q11A 3QQPA 4LK3A 5CFZA 4KDFA 3OICA 2ZIZA 4PLFA 5DZSA 4LRSB 3I9LA 4AJOA 2PGDA 3VH3A 3GOHA 3HWRA 2G17A 5A9SB 5T8KC 2D5CA 2PH3A 2NQ8A 4DC1A 2BGKA 4CV3A 1ZMTA 4FBGA 3PWZA 3HE3A 5EMHA 1R6DA 2P9GA 1QYXA 2PGLA 3E9MA 4GX5A 4I5EA 3LT2A 3MOIA 3VPGA 1EFKA 3HFGA 5CDSA 4DBZA 1PJQA 4ALLA 4A03A 1HDRA 3QJ5A 5IN4A 3KEQA 3RUDA 1JWAB 2O7SA 4P4NA 5G0TA 3WWYA 1R0LA 4BNKA 1C14A 1DPGA 3WTCA 5A9SA 3ETDA 5JDCA 1LDEA 3RWBA 1TI7A 4L75A 4OMUA 3AUTA 2VHWA 1HYEA 4DGSA 1JA9A 4PCVA 1OC2A 2AA3A 3CIFA 3LK7A 1CJCA 2P4HX 4GI2A 4RPLA 4XX0A 5DBFA 4MIEA 1NXQA 3EUWA 1X13A 5I8WA 2DM6A 4JJFA 1A27A 2YV2A 3CKYA 3V1TC 1GZ3A 1ZZEA 2GSDA 3RUCA 3ETEA 1U3WA 3V1UA 2FPIA 4XD2A 4UREA 1H93A 4KZPA 1UP4A 3WGTA 1Y1PA 2EGGA 4BL5A 1N1GA 3KTDA 4LGVA 5AVOA 2HDHA 4OQYA 1O8CA 1LLCA 5FF9A 4BO9A 5L51A 3KYDB 1AN9A 1NPDA 4U8GA 4FFLA 1LSJA 4J9VA 5DCYA 5KWEA 1XQ1A 1IY8A 2WSBA 3FF4A 2B5VA 3JQ9C 3LT4A 2R00A 3IKTA 5GMOA 3ST7A 3AOEC 1MG5A 3BIOA 4ZQGA 4CLOB 1VL0A 4NJOA 4NPCA 4R9SA 5KVCA 1NP3A 4QECA 1UDCA 1PL6A 2DFVA 1JVBA 2IXBA 2CF5A 4D41A 3NX4A 4N5MA 1BG6A 2FR8A 3KYDA 3NUGA 2VUUA 4YACA 5ICSA 2V65A 5LC1A 4DVJA 4M86A 4R69A 1U28A 2X5OA 3I4FA 4FSHA 3HG7A 2DAPA 4PIVA 4Z0TA 3JQ6A 3U5TA 1QR6A 5JYDA 5GZ1A 1P1FA 2I99A 4CLOA 2F00A 3GH3A 1C3VA 1HWYA 3EY4A 1HL3A 4U0JA 4E2WA 2GN9A 3OMLA 1IZ9A 1CYDA 2Y1GA 4BMNA 3VTZA 1QV7A 3BAZA 3MJEA 1X14A 2P5UA 1E1KA 4G5HA 2P91A 4LW8A 1ZNQO 4GMGA 2VRCA 1EQ2A 3GPDG 3EDMA 4E33A 3H7AA 2HRZA 4FB5A 3QWBA 4I9UA 3IUPA 1PWXA 2BFPA 4IDAA 4JIGA 3DWFA 2QRKA 3MJVA 1R37A 2UVDA 3X2EA 1RPNA 4WUVA 3VDRA 3AUUA 4ZN6A 2FP4A 1SEPA 4QUKA 4CV1A 3IQDB 1EMDA 1U4OA 5FI3A 4GVLA 3OH8A 1K2WA 1DC4A 5LCXA 2NACA 4KP7A 3WIDA 1PGPA 4TKLA 1Y5MA 2CZCA 2Z95A 1ZCJA 5IZCC 4A27A 1OZAA 2H5LA 3LC7O 1KEVA 3QVSA 2NVWA 3D5TA 4LCJA 1W4ZA 1PS9A 3C7DB 3K6JA 4URFA 4BGEA 2E37A 3K5PA 1Z82A 4L4RA 4BNYA 4D0RA 1DIBA 1E92A 2VZ9A 3WQQA 4J1QA 3BZUA 5T8KA 1SC6A 3IOYA 4B4UA 2RH4A 3E1KA 2BKAA 4CR7A 2O50A 1K3TA 1ZJYA 4GBJA 3WDSA 1E3SA 4Y98A 3DBHB 3KYCB 3CZMA 1E1MA 4A7PA 5A9TA 1EVJA 2C07A 1J49A 5DP1A 2CF6A 1B15A 1IB6A 3H2SA 3LT0A 2JL1A 4IDBA 3SC6A 3TZHA 2FSVA 1O5IA 3GF4A 3WGYA 3WGHA 3JYPA 1NVTA 4BOYA 4GH5A 3FR7A 3RJ9A 4J4BA 3RFVA 1GUYA 4N18A 4ZA2A 4RVFA 3U4IA 3M2PA 1T1SA 5EQFA 1GUFA 3LC1O 4AFNA 3VPHA 3M6IA 4WLNA 3PHLA 4D43A 5DBIA 4WLOA 3VZRA 1B3RA 3AWDA 4DIBA 4NG5A 5GZ6A 3OSUA 1B8VA 3BTUA 2GF2A 1F8GA 2H9IA 1DIAA 3DBHA 3KYCA 3ZH2A 1PQUA 2WTBA 1D4FA 4HFJA 3SEFA 4ZICA 5J23A 1V6AA 2VUSA 3MWEB 2IZ1A 4EJ0A 5KJ6A 3HB5X 5TX7A 1T4DA 3U3XA 2D1YA 4YAJA 4CLDA 2JCXA 1XCBA 3F1LA 1ENZA 4KOAA 2ZB8A 1BHSA 2ZJ0A 4CM7A 1KBZA 4MVJA 5L3ZA 1GPJA 3RC1A 2AEFA 3NT2A 3SLGA 4R3NA 4ROSA 4F6LA 2JFHA 1DIHA 5H82A 5A1TA 5T64A 3PQEA 2DBRA 3TL3A 1JKJA 3BMCB 4OXKA 5KOIA 3KV3O 1GPDG 3ZV4A 2Y1EA 5EL0A 5JMWA 3HADA 2V6BA 1HYGA 3UVEA 4M87A 2Q99A 2FZWA 3BTVA 4W82A 1ONPA 3H9EO 2EKPA 4BO8A 3OIFA 4R01A 3FBTA 1GQ2A 5I7EA 3VPFA 1GAEO 1Z6ZA 3JQ9A 1M75A 2CVQA 3GNSA 3WGOA 5BSGA 1EDZA 1MLDA 3E48A 3AOEA 3DXFA 1I2BA 3ONDA 3NTRA 3H6KA 4PG8A 2J5KA 2X0IA 3NGXA 2HCTA 1LSSA 2OBYA 1TT5A 4BO4A 4YB8A 3ADPA 3I3OA 2DTEA 3BMCA 3RBXA 1G6KA 1DAPA 1YONA 3D0OA 4HKTA 1ADFA 3G1UA 3ZHZA 4E6PA 2JD0A 1DEHA 1RYEA 2DUUA 4NK4A 3QVOA 2Y1CA 2RBEA 1GD1O 3AY3A 2HAEA 2CY0A 2ZTUA 3WLFA 3ZWMA 1ARZA 4IQ8A 4XZ3A 4R9RA 1E6UA 2O2SA 3I9OA 4TRNA 2JHGA 1PGJA 1Y9AA 1T25A 2D0IA 4DYVA 3UUWA 2GERA 2PV7A 4OL9A 3ICCA 4TVBA 1PGQA 4U5QA 4DLBA 4E5KA 4DXHA 4J1NA 1ADCA 2J5QA 1B7GO 1SO8A 2XAAA 3FSRA 3JYNA 1YQDA 3ZV6A 1DJNA 2WD8A 1HE3A 2WDZA 5HBRA 3PJEA 1H6AA 1R4MB 1YDEA 3L6EA 4PG4A 4PRLA 3WSVA 1NM5A 3VKUA 4GPD1 1E6EA 1U7TA 1LC0A 2JD2A 5F3RA 1PX0A 2BGLA 3OJOA 4QFDA 4CM3A 3OHSX 4RGBA 2YV3A 4P8RA 4A0SA 1D7OA 4TQGA 1PIWA 2AG5A 5JLAA 1XU7A 1H9AA 4O0LA 4BNJA 3AM5A 2VZ0A 2O3TA 2Z1MA 5KJEA 2P68A 3AU8A 1LRKA 4BV9A 1Q7GA 1YB5A 1NHGA 2WE7A 5DCUA 4MP6A 5T5QA 3MJSA 2J3HA 1GFSA 1XR3A 3IS3A 1X7GA 4PGFA 2PZLA 4B3JA 3C24A 4CUJA 4J4HA 1ISJA 1YBMA 2C20A 1R4MA 4RVDA 4CM8B 3A06A 4JNKA 1Y81A 3G79A 3GLQA 2CDBA 1A9ZA 2OP1A 3PEFA 4WJZA 3I23A 4M54A 3KLPX 4DIFA 4KDEA 3JQCA 5CDYA 5KCZA 2BFAA 3HDJA 4DUPA 5I7FA 3I83A 5F5NA 5IZCA 1U5CA 5I9LA 4DMMA 3LU1A 1O95A 4Z9YA 4XIYA 1PGNA 3RFXA 1SB9A 3FNGA 4PVCA 5IXSA 4RDHA 4E5YA 4J2HA 1NAIA 1A4UA 4KUHA 5BSEA 1VJ1A 5EPOA 1UXKA 1F8FA 3H2ZA 3DZHA 4YT8A 5L4SA 3RUFA 3P5SA 4ND4A 4CM8A 5B4TA 1L7EA 2CVOA 1GTMA 4CPDA 5LDHA 2WEKA 3T7EA 2Q1WA 4IIVA 1Q2XA 3QY9A 5JSFA 3A9WA 4WEQA 3JQEA 2G1UA 2PZMA 4UVGA 4CMEC 3TN7A 2D3TA 1X7HA 4UEOA 4PLCA 3WYBA 1ISMA 1PQPA 3IC5A 1MB4A 1ORRA 1P3DA 3PZBA 5U4QA 4BIIA 3L0DA 1EQUA 4RO0A 3SJ7A 5TT0A 4B7UA 1PL8A 4PLGA 1AGNA 4J7CA 1ONOA 2W8ZA 3QWAA 3PTZA 1U9JA 1JDJA 1TEHA 4NU6A 3ORFA 3HSKA 3MOGA 4NZ9A 3FI9A 3PYLA 4XJSA 2OFPA 1WW8A 4M49A 3H5AA 1UUFA 4RDIA 1ZK2A 4ZRMA 3WX0A 1PR3A 4ND5A 4B3HA 1I10A 1QORA 2C82A 4ILKA 1X1EA 3RCBA 2Q50A 5EQDA 2CFCA 2G82A 5G0SA 2YHUA 3Q9NA 4Y9DA 4EDFA 3GGPA 2Q2QA 3UHAA 3PFWO 2NQTA 4S3MA 5JO9A 5JY6A 3RQSA 1LSOA 4QTZA 1ISIA 4YAKA 1E1NA 4HNHA 4MKXA 3WB9A 2QX7A 2Y05A 3DTTA 3LYLA 1UXJA 1V3UA 2C0CA 3K31A 3ZNQA 4WNIA 5TT1A 1BXGB 2TMDA 1CF2O 4CMGA 4YJFB 1EE9A 4ALMA 3CTMA 2I67A 1LTHR 4O6VA 1O6ZA 2FMUA 2XXJA 5IG2A 3GDGA 4E3ZA 5BNTA 2D59A 3EMKA 2GNAA 5JPIA 1YJ8A 3GN2A 1U2GA 2FPPA 1MX3A 1SMKA 5DNAA 4YYZA 3SBOA 3UOGA 5A05A 3W8FA 2PZJA 2YFQA 1PL7A 3LC2O 5A3VA 5JO0A 3F4BA 1DHRA 4NFSA 3ZWOA 1F12A 3PIDA 2IYPA 4U6QA 6ADHA 1BVUA 1ISHA 4I5FA 3DOCA 4PLVA 3UICA 4MVJE 2VHVA 4BNVA 4DPKA 4U7WA 1BXGA 4IDFA 2HQ1A 1HE4A 4YJFA 1LBEA 3ICPA 5C5IA 4EYEA 2WYWA 1SPXA 4WOJA 4IGFA 3QIVA 2X0RA 3V2GA 1KVUA 4J1SA 2B4TO 3LSYA 1V8BA 2I66A 3LQFA 1XHLA 2Z5LA 3ABIA 2X58A 5JCXA 3HN7A 1RJWA 3AI2A 4IZIA 1BDBA 3GGGA 4GKVA 1YQGA 4CM9A 4I9HA 1MFZA 5CDUA 3Q6IA 5AXCA 2DBZA 1ZMOA 4Q3NA 4FW8A 3D4NA 3DB2A 5JBIA 4WCFC 2QW8A 3JD1A 1HETA 4XYGA 3ZWVA 4WK6A 3QWFA 4M1QA 3AW9A 4LVCA 4FFOA 2Y67A 4YAGA 3LT1A 3UXYA 4L4XA 3KRTA 3KB6A 4A73A 3N74A 2H1SA 4AJ1A 3UH1A 1UDBA 3VDQA 2OP0A 1F17A 3W4JA 4FPXA 1QP8A 1N5DA 1YBVA 4GAEA 1UR5A 3IP1A 4QT0A 3DHEA 2VNSA 3U4HA 4YRBA 2PD4A 2ZCUA 2BELA 1FF9A 5FEUA 3FBGA 5G0VA 4IXWA 2ZQYA 4PLPA 5AYVA 3JQDA 1TVEA 4JLWA 2X6TA 4FFPA 4J91A 1H94A 4FIZA 2NV6A 1GADO 2D2IA 4CUZA 2V6MA 2NSDA 5LDGA 2QIOA 3KUXA 2UUOA 3TOXA 5KIAA 3ADOA 2EJVA 3RROA 4QX6A 2BFOA 3G3EA 2V6FA 1ENPA 4GMFA 4Y6PA 1U4SA 1P45A 3RBZA 1WNTA 3EVTA 2AEJA 2DQ4A 1TLTA 3KLMX 3ULKA 1U7HA 1WAMA 3FD8A 5TLSA 2BD0A 3FNHA 1ULSA 2FR1A 1SOWA 4R68A 3AU9A 3ONEA 3ZWWA 3WNQA 5C3MA 4HXYA 3IIEA 1ENYA 2QZ9A 3TJRA 1M67A 3C3XA 4WLEA 2AE2A 4IJUA 4IS3A 4WE3A 2IODA 3VVCA 1NAHA 3ANMA 3OBBA 1F0YA 4CMEA 4RPKA 4CV2A 1FK8A 1K5HA 5EN4A 3JD0A 4NBWA 4YXFA 4E31A 2FR0A 5HM8A 1ZFNA 1MGOA 3K73O 5I9NA 3F47A 3HB4X 4L76A 3I9KA 1P33A 4WPGA 3DOJA 3U9LA 2O3UA 4E5MA 4RZHA 3ZU5A 2B69A 4MVJM 1Y5RA 1N92A 5I8ZA 4E32A 2J8ZA 4FN4A 1V9LA 1E77A 4YJHB 3WS7A 4FGWA 4AVYA 2POQX 2X9VA 3GQVA 4KTVE 2VWHA 4W6ZA 4Y67A 4MINA 3RSHA 4K6FA 1JKIA 3GMSA 1C1XA 3NYWA 4P4LA 1YE3A 4R51A 5I9MA 2NTJA 5L7YA 2ZYAA 5G0UA 5CEJA 1QMGA 4M89A 1U5AA 4MIOA 1QSGA 1LA2A 2HJRA 3V2UA 3HHPA 3Q2IA 4J0FA 4PLYA 3A1NA 1JVSA 2GD1O 1Z45A 2UV8A 2C54A 2QYSA 1E7WA 3FTPA 3PYXA 4FQ8A 4ALKA 5JFOA 1A4IA 4JK3A 1VL6A 4BHTA 4AJPA 2O3RA 2YV1A 1W73A 2J3IA 4YJHA 5ES3A 4CJXA 6LDHA 3F6YA 1Z75A 2AG8A 2WE8A 5KTKA 2PK3A 4NBUA 4EUFA 5IDXA 1LDNA 4NNJA 1ZIDA 2YDYA 1JQBA 1SAYA 2BFMA 3HFSA 1RM3A 2ZYDA 5I7VA 3GFBA 4KQWA 3Q1LA 4OH1A 3QV1A 3K8ZA 4LSWA 2XOXA 1DFHA 2A35A 1VJTA 3C1AA 4OKIA 3D3EA 1YH3A 4HNGA 1CEQA 2VN8A 4PLTA 3E5RA 3O8QB 1PJTA 4WCFB 3R3JA 1IULA 3S2IA 4F46A 2H6EA 4ALJA 3I5MA 3WQRA 1BW9B 2PY6A 3G49A 1I01A 3G0OA 4FJ1A 4CMCA 5H83A 1FMCA 3RAJA 3O26A 4BNIA 4D7AA 4R54A 1CERA 2PZKA 4ZQEA 3JTMA 4CM4B 2Q4BA 2NVBA 1GEEA 3P2YA 2NM0A 3C1TA 4R1NA 1EE2A 1N7HA 2JFFA 1YRLA 1KY4A 1U1IA 2NU7A 3GA0A 5A04A 3PYMA 5EERA 3O8QA 4NQZA 1ADBA 1LJ8A 4J7XA 4WCFA 2A92A 2Q1TA 2QRLA 3L9XA 4LMRA 1JAXA 3UFXA 3WJAA 3PRJA 1GR0A 3H4VA 1BW9A 3JYLA 1GZ6A 3GN1A 2XXBA 5HTOA 1W8DA 1CRWG 1PJ2A 4TKMA 1HTBA 1HE5A 1T2FA 1YGYA 4UAGA 3E18A 3TZ6A 1MC5A 1TXGA 4J3FA 5U1PA 4CM4A 1H2HA 4WLUA 1MXFA 3GVXA 1HDGO 3KXDA 4S1VA 3UW3A 3WLEA 1O0SA 4DQXA 4B4WA 3WOHA 3PQDA 4XYMA 1R16A 4B8WA 1I24A 4IQGA 2HMWA 4CQMD 3Q3CA 3ZWXA 3WMXA 3NAQA 3T7CA 2BH9A 4HFMA 3O03A 3B20A 4R5HA 5DOZA 1D1TA 2WYUA 1NFFA 3B1JA 4ZQFA 5DT9A 3TZKA 2X86A 1WWKA 4P4GA 4FR5A 1YWGO 1VPDA 1Y8QB 2W2LA 1ZKMA 2HU2A 4AJ2A 3TPCA 1LRLA 4ZJUA 2JKVA 4XYLA 1E3JA 4BO6A 1X0VA 2I5PO 3DAPA 2LDXA 4YPOA 4ALNA 1I36A 1PZFA 2WWRA 4QFCA 5T57A 4JBIA 3RKUA 3WWZA 2DLDA 2X0NA 4TROA 3IJPA 3L6DA 1N8KA 1GQYA 1NBOA 1RWBA 3FNFA 5L95A 2X9NA 3GUCA 3UAGA 1CWUA 3FHLA 4XQ9A 2ET6A 1C0KA 1DHTA 3LLSA 4I5DA 4BKUA 3DMYA 2D8AA 3FPLA 3GG9A 3H3FA 4LVUA 2VUTA 3I6IA 2NU9A 5L45A 1I2ZA 1HDZA 3QLJA 2I9PA 4JX8A 1OMOA 2WJPA 4ND2A 4D44A 2FWMX 2FY8A 3RC2A 3FTNA 4MKZA 5F1OA 2HSDA 2C5EA 3QVWA 1FJHA 4FFMA 4GKBA 1V35A 2GR9A 1Y8RB 1LNQA 2W98A 3QVXA 5COQA 2PFGA 3GAFA 3CINA 2PKQO 1NTOA 1I8TA 2IE0A 3KBOA 2A9FA 3P7MA 4E5NA 2YQ5A 1QYDA 4L4SA 2QZZA 2GASA 3DFZA 3JQ7B 3HQ4O 1ZH8A 3PWSA 4QEDA 4DLLA 4ID9A 4BUCA 3C7CB 1VJ0A 3MZ0A 4LCEA 3AJRA 5C7LO 1IHXA 4NIMA 5L40A 3JD3A 1CQJA 1ENOA 2NU6A 2RAFA 1H6CA 3PLRA 4RJTA 4UUMA 5KVQA 3JQBC 1GCOA 9LDTA 4YT4A 1Y8RA 4Z9FA 4TZKA 3AY6A 5JXWA 3NJ8A 2ZTVA 3F46A 3JQAB 1BDMA 3ITKA 2B0JA 3ZNOA 2DFDA 3IKVA 3LLVA 1ZO8A 4XGNA 2Q45A 4A26A 4B7CA 5JS6A 4R41A 5ER6A 3RVDA 2O4UX 2X5JO 3JQ7A 4BNXA 2O7QA 4EUHA 3WFIA 1PJLA 1DFIA 1ZJZA 2IDZA 1LLQA 3WQSB 3MTGA 4HFNA 1E3IA 2EGHA 4ND3A 2VYVA 2O48X 1WXDA 3DZKA 2VOEA 3GHYA 4PG5A 4Q3CA 4ZGWA 2X1HA 3DBVO 4PLZA 1LI4A 1PZGA 4BV8A 3O9ZA 3ITDA 1EUDA 1EVYA 2P4QA 1RKXA 3DZFA 2XPCA 2OXIA 3JQAA 1MUUA 1XSEA 4WKGA 5TJHA 4AICA 4YTEA 1BGVA 5B4UA 2HMVA 2Q46A 3DOOA 4BNZA 5FYDA 3MJCA 4GL4A 3MJ4A 4C7KA 4BKRA 2Y99A 5KJFA 5L7TA 2VWGA 3DBRB 3ROQA 4N5LA 3H3JA 1EFLA 4JCOA 1YO6A 4NFYA 4RCVA 2EEZA 2O23A 4MP8A 2V6GA 2BHLA 4FJ0A 2GLXA 3G1TA 4D3DA 1BXZA 3CUKA 1V0JA 2RIRA 1E5LA 5CP8A 4N54A 4G65A 4A10A 3DAFA 3GC6A 1QV6A 3VZPA 1P0FA 1H2BA 4E0BA 3Q9UA 3HZZA 2Q1SA 5DULA 1I0ZA 3EK2A 3GR6A 3OQ1A 1IZ0A 1KIFA 2JFGA 3JV7A 1NWCA 3W4IA 2G76A 3L4SO 1W0CA 4YJGB 4AJHA 3TF5A 1QRRA 1M76A 1C1DB 4Z9XA 3NDJA 4NJMB 2AMFA 4RVGA 4DYDA 4HV4A 4BNNA 3H5NA 5L7WA 4XYEA 3LZ6A 1B2LA 1D8AA 1J0XO 2GN8A 3I4CA 1E3EA 4RLHA 4PG6A 3TRIA 1DLJA 3D3WB 1XU9A 1P1JA 2VOJA 4QQRA 4YDRA 3OA2A 2C59A 2PKQP 3PK0A 1NQ5A 2JAHA 3OJFA 1GV1A 4ALIA 2B37A 2HRBA 1R0KA 3K9QO 1T26A 2RH8A 5IZ4A 5HWSA 5CPFA 3GUYA 2HMTA 1ZK0A 3RUEA 3ZV3A 1VSVA 4E2YA 4YJGA 4KWHA 4AJNA 1ML3A 3A28A 4G2NA 4JJGA 1K6XA 5DN9A 1P1IA 4GSKA 2OO5A 1SEVA 3VTFA 4R1SA 1WDLA 2Q49A 2CDAA 2VYNA 2X0JA 4L8VA 3NTOA 4XR4A 4YCAA 4E4YA 1Q0QA 3D3WA 1V3VA 4XIJA 4WNCA 1Q7BA 1B14A 3E6AA 4JBGA 2NVUB 1ZW1A 3U0BA 1HDYA 2BI8A 2PLAA 2ZKLA 3DONA 4G81A 4Z6KA 5KKCA 5JY1A 3OEYA 1B8UA 4P38A 2Y1DA 4AJIA 1EDOA 2G5CA 4BVAA 3VZSA 4BNWA 1M6WA 3DHNA 1DRUA 3PHGA 3CXRA 1HDCA 2Q4EA 2QYTA 2DTXA 3QHAA 2X4GA 1ZK3A 3BTOA 3W1VA 2EW8A 3GZNB 1T2CA 1ZK4A 3PJDA 1B3BA 2FN7A 3F5QA 1F06A 2NU8A 3QVTA 1XEAA 2CD9A 4B4VA 3C8MA 4JQCA 9LDBA 5G4LA 5AOVA 1O89A 1N1EA 1C0IA 2YDXA 3CEAA 2NVUA 3GK3A 4F3YA 4E13A 1B16A 4XJTA 1CDOA 1K6IA 4WCDA 5G0WA 4PG7A 4BQRA 3NKLA 4NDNE 1A5ZA 4MVJF 1GCUA 1TT7A 5G2OA 3ZHXA 2YUTA 1DXYA 2FZEA 3C1OA 3QP9A 1PS8A 4UEJA 3TFOA 1P0CA 4NBVA 1P1HA 3CH6A 3QWHA 4K1LA 2DPGA 3DZJA 3KO8A 1M2WA 4ONEA 4CLRB 1UZLA 5ILGA 3GRPA 5TGDA 4FDAA 3GZNA 4O5OA 5KVSA 2ZB3A 3AI1A 1JLLA 4R1UA 1LDBA 2PD3A 2UDPA 1VKNA 4RVUA 3ZWCA 3EC7A 3WYCA 1JAYA 1X15A 5DCWA 1NASA 3QWIA 3U62A 5IXYA 4U6SA 5MGBA 1NNUA 3JQBA 5ER9A 1KYQA 3ZI0A 2CVZA 5HS6A 1G0NA 2HMUA 3UF0A 1WDKA 3JD4A 2DU8A 4J9UE 4ND1A 4CLRA 5CPBA 2QG4A 3JYQA 1LX6A 1IHYA 1PJ4A 3Q2KA 4Q3DA 4IINA 4IUYA 5EIOA 1Y6JA 4EEXA 4PFJA 5F21A 3D1LA 4BO3A 4DTIA 2PTGA 5A4DA 3IDSA 4XR9A 2CNBA 5TRTA 5JNLA 2Q2VA 4FFNA 1KVRA 1ADGA 1BVRA 2C5AA 1U2DA 5I7SA 1DLIA 4Q3AA 3GEMA 4Y6SA 2RHRA 4DA9A 1WDMA 3GPIA 4MJLA 3GEGA 1EVIA 3GNTA 5FWNA 2HK8A 1IOLA 2E82A 1Q1NA 8ADHA 1DC5A 3TQHA 3G17A 3WG9A 2X9GA 5AXDA 3KSUA 2GGSA 3JD2A 1XLTA 4BNTA 1PZHA 3R6DA 1KEPA 4RL6A 4BNUA 2SCUA 5THQA 3M1LA 4J43A 3WNVA 5JC1A 1UP7A 3AUAA 1DIRA 2EIHA 4CM1A 2Q2WA 2GO1A 5COBA 4XYBA 1A7KA 4PZDA 1XKQA 4XGKA 4MOWA 1LDYA 3HUDA 3OJLA 4L0QA 4YT5A 2JJYA 4D45A 2DTDA 1AE1A 3QA9A 4IPTA 4N7RA 5EINA 3D5QA 5AXBA 2ZCVA 4YBZA 1T24A 1NVGA 4CV0A 2AW5A 2BRUA 4MIYA 3K96A 3ENKA 4P22A 1Z7EA 3GVHA 3CSDA 2AEMA 4K28A 2P9EA 4QO7A 1KVQA 4ZRNA 2VRBA 2EKQA 4LISA 2C2XA 5CEEA 5L4LA 1H6BA 1ZXLA 4CMAA 1Z74A 4WASA 5JCJA 4BMVA 3VH4A 2UAGA 5CG1A 2NADA 3GRKA 2FOIA 2P9CA 3DC2A 4FC6A 3BTSA 3SX2A 4GQAA 1QLJA 1UXGA 1C0PA 2E48A 2O4CA 2GDZA 3DZIA 1AHHA 1UZMA 2FPGA 1P31A 1DC6A 2R6JA 2I3AA 3ZU4A 3INTA 4ZVVA 2X5KO 3AUSA 2WD7B 1KOLA 1VE9A 3H8VA 4OKNA 3NRCA 1R15A 3BXXA 1HLDA 1A72A 3KOUA 3OA0A 4DRYA 1Q7CA 3WBFA 2GZ3A 4WOKA 3W6UA 4RLSA 1PGOA 5IDYA 1T2AA 5K0ZA 5HS4A 3U49A 4MPDA 2W90A 1V3TA 2IZ0A 1I3KA 1UXIA 2YYYA 1HZZA 3ASUA 3BHJA 1T1RA 2CSUA 2PH5A 5JAZA 1DBVO 4EUEA 2PR2A 1SCUA 3OETA 4IBOA 4WLFA 1DC3A 3K30A 1Q0HA 4EEZA 5JAQA 3PZRA 4CM9D 1IE3A 3UCFA 8LDHA 1A71A 4CMIB 1I3NA 3MJTA 2WD7A 4IIUA 4CM5A 4JP2A 1NPYA 2EW2A 3B70A 4I1IA 3ON5A 2HJSA 4RF5A 3ANNA 3WICA 1A9YA 1JW9B 3JYOA 4FOOA 4AJJA 1FDSA 2DT5A 1ZSYA 4D79A 5BQFA 5T6BA 3HDQA 3I6QA 4D3FA 2OHXA 4M55A 4O1MA 4CLXA 3F4LA 4UVHA 1ISGA 1R0SA 1KERA 2J3JA 1N7GA 4Q3EA 2VHZA 5DOVA 1UDAA 4EZBA 5A02A 3IP3A 2OL4A 3S2FA 4BKOA 4XB1A 1J6UA 1PZEA 1HDXA 4CMIA 5KNLA 1O94A 4EBFA 3I52A 3VPSA 3V5NA 5KKAA 3JQGB 2DC1A 5KJCA 3S2GA 5TJ9A 3INGA 4C4OA 5ITVA 3KM0A 1U8FO 4B4OA 4BMSA 1O9BA 1UP6A 2VHXA 1MFPA 1JU9A 2VHYA 1GV0A 2BI7A 2C7GA 3F5SA 4OYRA 4W7HA 2VNAA 1ZBQA 2Y93A 4BNLA 1M66A 3ZNPA 2WMDA 4UUNA 5C37A 3ROMA 1T4BA 1P9LA 3OECA 2AQKA 4IXTA 5A03A 1H5QA 2RCYA 3PVZA 1E7SA 3IJRA 3JQGA
chains in the Genus database with same CATH superfamily
3JQ8B 4R84A 4UKDA 4F21A 4H1TA 6ABPA 1L8QA 1MQ8B 1AMNA 1G21B 2X8AA 4RVSA 2VQEB 2XOEA 1IVYA 2N0SA 2H0QA 2R2GA 3JWHA 3SM3A 3CY6A 1QQBA 4OSPA 3W4KA 1MAWA 1B6GA 5KKNB 1P4HA 4HDAA 3A6FA 3UO8B 2FZCA 4D8TA 4Y8VA 5CA1B 3W3AH 3O74A 1XJCA 4EG6A 3GLSA 1UMCA 2DMRA 1F6DA 3TNJA 1CJUC 3LIIA 2CT8A 5KQMA 1TK9A 5ESDA 3T3GA 3GJ0A 4QOIA 2B3DA 1JHQA 1M0EA 3NIGB 4YC7A 4H17A 4MQ5A 1J7JA 3QUAA 4RC9A 2WT9A 4W9NC 4Q3KA 2P8JA 4DIDA 2HBRA 1RM5A 3Q2OA 2GEKA 5C9ZA 3LNCA 5JBQA 2EWMA 3GELA 4PF1A 1YBFA 3RWOA 3CGGA 3HU1A 1UWVA 5DJ5A 4LHZA 1WP9A 2WG2A 3O3MB 5CVUA 1GGMA 4Z4QA 1DTWB 3PHJA 2NO6A 4XD7A 2PGNA 3TBHA 5EE0A 4BO7A 5K8IA 4GLOA 1LC3A 1ZVKA 2JCYA 2W43A 4JC8A 4XB2A 2XZLA 3N0RA 4PRKA 2E4YA 3V8NA 1I4WA 5A9RA 2UYHA 4BNGA 1XIVA 3KEOA 2GXSA 3IEMA 1T8TA 2NUPA 3M3DA 2I4LA 1UJMA 2H4HA 4L73A 1WZEA 1WBJB 3AUFA 2RKBA 2ZJ4A 3KZCA 1HQKA 1NT4A 3NHWA 1Y3AA 3OZTA 3HC7A 3QZUA 1U3VA 4X1IA 1EWKA 1A9SA 3FPEA 5HSGA 5EJ5A 4CLEA 4Q4AB 5KZMB 3R7NA 3ICOA 2PRYA 4FDVA 3MT9A 1K0UA 4U2BA 3KIPA 4ZEVA 2IBTA 2ZSUA 3D6FA 1A8HA 1GTZA 3GL9A 3GWGA 5HK9A 1LPOA 1PQYA 1E2DA 4KDRA 3N0TA 4IJWA 5EY5B 3V3TA 5JAUA 1NVXQ 4IJ6A 1NF3A 4UUQA 1ZC4A 3NGLA 4C20A 1XELA 1F6BA 1QFSA 1IWPB 2YWDA 3B1KA 3EIFA 5DX0A 4CMHA 3TW8B 2DHRA 1HG0A 3KFVA 2F17A 3WVNA 5KSZA 2QX6A 3DT8A 1GRCA 4TV8F 3DZBA 3FHOA 4U9IS 1YAJA 3PB3A 5TDHA 2I9KA 4KPYA 1TJ4A 1PUXA 5BUZA 1LJLA 1XTKA 1NPTO 3EHEA 4WY5A 3UMVA 4TYYA 1C7JA 1CHDA 1FDIA 1Y48E 1NXXA 2JVIA 4GP7A 4IG9A 3A1CA 3CLHA 5FFFA 4Z7QB 1T5BA 5BYKA 3L40A 2JLZA 2VP5A 1MXHA 1U99A 3W5UA 4MWTA 2J48A 1YRWA 4ZQHA 1L5SA 3QOXA 4DNPA 2QD3A 5ADHA 1GZ5A 1JYFA 1E5XA 4EY7A 1KVTA 5BVHA 2G9RA 1ZU5A 2JFPA 2PL5A 1QHGA 2R751 1HDOA 1OWPA 3D6NB 3I9JA 2QMHA 3W4JA 1IN5A 1YB6A 4ZU3A 2L69A 4MPRA 4HF7A 4TV9F 5BV8A 4RF3A 3RBVA 4GPZA 2W2KA 1GU7A 5AOBA 3TFWA 5ITWA 5FCDA 2CXTA 2R1VA 2BMDA 3BD8A 3MNFA 2ZU0C 4PRZA 5H02A 1ID8A 3DWGA 2Z8XA 4GE3A 2W9XA 1XDGA 4LY6A 4ZI7F 2H8KA 3W6ZA 5J4HA 3BMNB 3FOBA 4EPRA 3I45A 1C9KA 3ER6A 3CT4A 4CRWB 1SUFA 2JJ8A 4L50A 1PF7E 1M1NA 3SM9A 3JATA 3LF2A 2QE7D 2WVJA 4LV5B 5K3FB 3TNDA 3PFGA 4MKRA 3K4PA 4RM3A 1C4KA 3S70A 1RZRD 4JJ6A 4D3YA 2AMLA 3LA6A 2CEKA 1PL0A 2AS0A 2XCLA 3FOCA 4XLZA 4E5PA 2BZ0A 4F6CA 3HPRA 4IWYA 2ONJA 2B4QA 3ZW9A 2AXEA 4YA6A 2GD0A 5LZ5A 2OZPA 3KJEA 2C92A 1YL6A 2FE4A 2JCVA 4LYHA 5BW8A 2AXNA 1X80B 2GVZC 1E7MA 5GGXA 4EAAA 1VI5A 4FWTA 1PTJA 4CQMA 4RLFA 5F5LA 4LFCB 2VYQA 4X7BA 5AHOA 4C4YA 1K8QA 1JS1X 3A14A 3K6RA 1IL0A 2QEQA 3DXXA 3Q0IA 1NKVA 1QS0A 1E2UA 2C29D 4OJNA 4RXUA 1KI1A 1SQSA 4TX1A 4BNHA 5FULA 2B1JA 4GWGA 1PR0A 4U4AA 5J5CA 3N86A 4FE3A 4E5UA 1P9NA 2W2LD 3PXAA 1SVOA 1TIKA 3RASA 5HJEA 1OZFA 4CNQA 4OOEA 1ZGZA 2RK4A 1DKUA 1WW2A 2YCBA 1HOXA 4DJJA 1L4KA 2PD6A 3BF7A 3ZWNA 5BSVA 2E5FA 2CJWB 4HG2A 3GJ8A 1UWCA 2QX8A 4HFRA 4KXXA 1TD9A 1ND5A 2C99A 4QXRA 4WI1A 5AVJA 3TLMA 3PHHA 3C15C 1XGKA 3KWMA 4F5YA 1J99A 5MFPA 2R3SA 1Z3IX 4JJZA 1T10A 3DOIA 3GEDA 3L49A 2YIDA 5IFLA 2ZFUA 3LVFO 5GVSA 2VRCD 4L16A 1Q3TA 1U8YA 3CF0A 3G9TA 5CBKA 5ICMA 1V71A 2BF7A 3RS5A 5AI6A 2IGTA 1MC4A 3CVVA 2FWBA 2B92A 2QTLA 4AJ9A 1HRDA 3GVCA 2VQ3A 3TWOA 3ZU3A 5CDGA 5FOTA 5B57C 1IK4A 4Q3BA 4RY2A 2P3OA 2DOKA 4A15A 2CLDX 3ROGA 3TDMA 3DBLA 2B4RO 3CB4A 4AO7A 2ZUSA 4G09A 5I9BA 1XVLA 1HYHA 4NWIA 4RD2A 4LDRA 1V3QE 3EZLA 4OUDA 2YVLA 1G5TA 3T35A 4ZYWA 4M8SA 2GCGA 2J9FA 3VH1A 4HDMA 4RQTA 4JGGA 1FS5A 4RS3A 3WWPA 3R8CA 3VA7A 1V9SA 4K6CA 3WKCA 4UNPA 1FUEA 2WJJA 3AIMA 1AGYA 5G4KB 1BIFA 3FTCA 1XTUA 4QQFA 4GF5A 1I9CA 1NUAA 3FDIA 5AVRA 3LDHA 4FFVA 1CUJA 1W5FA 3CF4A 1P4GA 3C8DA 5CB4B 5CFLA 4EJMA 1GUZA 2JI4A 2BGMA 2Q5EA 1T9GS 2B2CA 3QEMA 3HA3A 5DWDA 2IU6A 2PANA 2JZOA 3CLUC 1PE0A 4J7UA 2ZIAA 3ZYZA 3OQBA 1NQOA 4UDOA 1WPQA 1LGYA 1X1CA 3KUKA 3NOVA 3QPWA 3DCNA 2AOUB 5E1OA 2IDMA 1HQDA 3FAKA 2JFWA 3L07A 4RD4A 2D00A 4AM8A 1XWFA 1PG0A 3AM1A 4BQFA 4G8BA 1K89A 2ZPTX 4ZVMA 1MU0A 2GTIA 3LDAA 2DWOA 3NBFA 3PVSA 4ZO8A 3R7WA 4ZMSA 4EH1A 3FDJA 3L92A 2K7ZA 2ZBGA 1U8XX 4DCOA 1S2NA 1FDRA 1WDTA 3TLBA 3ROPA 5ALXA 1DQPA 4LJ9A 5HKBA 3L9WA 2Q3LA 1D2MA 2Y68A 4X44A 1KDVA 3E35A 3SJUA 1X38A 4PIMA 3GLGA 4MQBA 5D7BA 3AVPA 2OHOA 1N75A 3EBOA 2J07A 1CIVA 4ZZ1A 2E4UA 3DGEC 2J59A 4A82A 1E2QA 2B94A 2W6ID 1MNQA 4NCHA 1X74A 2XMCA 3P0IA 4WIAA 5ALTA 5ADWA 2O2JA 3TIVA 1GCIA 2AOTB 4OGGA 3BGOS 4MEBA 1U7DA 2BMAA 2C9OA 2OK8A 3DNMA 2NGRA 5IDVA 4BVHA 4DHWA 5HIJA 3IQWA 3ZZ1A 3HNPA 4RABA 1K68A 1PQWA 3S27A 2XKBA 3SSMA 5I7WA 2VCYA 3FCOA 2E49A 4DM7A 3R40A 4YAUA 2XXAA 3OCYA 4XM0A 1W44A 4LRWA 3TNLA 3UT5B 5TEVA 3K9FC 1F7UA 5CH3A 4MPTA 2ZOSA 5HCUA 3DKPA 2DR0A 1XZCA 4BC1A 1EKXA 3C43A 2BT4A 5BUSA 4HLDA 4YEDA 4MWGA 5CGQB 5F1PA 3A1UA 4RIGA 5KAPA 1RAEA 2DJIA 1MAVA 3OQNA 5ALOA 1IQPA 3G2PA 4H7DA 1O4VA 3DE6X 3G8BA 3PR1A 2BFDA 4OMFG 5CUQA 1VLZA 4G36A 2GHIA 3EDQA 3OZDA 2O8NA 5BYAA 5JAMA 2X8LA 2AWNA 2UXCB 5JSYA 1I5RA 3RVKA 1VMIA 3HCOA 3JZMA 4OU4A 4OPMA 2BDUA 1E7QA 1PEYA 3B82A 2YVUA 1RQLA 3M82A 3QGMA 3H9JA 4TXMA 5GJVC 1T2EA 2OOSA 4MUAA 3SNKA 3UXMA 2QN2A 3OX1A 3IBGA 3IODA 1LUAA 2OB2A 4QXQA 5LQUA 4BVKA 1QZXA 3WTBA 4L9RA 4UCXA 3IP5A 1O9HA 1OQAA 1FFDA 2Y66A 3FNIA 3VMFA 3TLGA 1JBEA 1X9HA 3QG1A 2Q6LA 3QE3A 4IG4A 1B6TA 2BAGA 3KJHA 3ODGA 4O2AA 2IIBA 1D2HA 3J81k 3SWWA 4D97A 2EZ8A 4TUYA 1TMOA 3ZN2A 2R4UA 3JRWA 3PJGA 4UPEA 3CYFA 4Y2PA 5LD2C 2CLOB 4A92A 2FDXA 4NJMA 4BDSA 4MVJG 3K72B 4E12A 3GUUA 1PEDA 3EODA 4QRHA 1T5IA 1XP8A 3JU3A 3LO8A 2MSEB 5AW3A 5JMOA 4MGZR 2VH5R 1X7ZB 2ZM6B 3GYBA 3O6VA 1SCJA 2IXTA 3KPYA 4Z9BA 4ZYVA 2ZDQA 5HM6A 1PDVA 2L0XA 4X7MA 1EI9A 1VL2A 1NUUA 1WXGA 2GZMA 2TMGA 3CURA 4B34A 3DAYA 2AEEA 2I3GA 4F85A 3WWOA 3VNVA 4XWKA 1IIBA 1YDHA 1E63A 2JLBA 2JKYA 1AHPA 2F1IA 3HDVA 3U7FB 3Q88A 1TU4A 3WGQA 2IYQA 2VYND 1NBMA 2D8MA 3RWMB 3ZD9A 1VSUA 4UEKA 4KMRA 1OWNA 3T3EA 1UZNA 1WCIA 3FR8A 2QTMA 1L7PA 3M70A 3QSYA 1XE3A 2ZB4A 3GA7A 3RBAA 5JSQA 3ZWKA 3CEMA 4I5GA 3ET4A 3JR7A 3C85A 5F5XA 5ARCA 3C5WP 4ZI3A 2H1RA 1L5WA 3NBXX 3NWBA 4JYBA 3ZHYA 1IAQA 3O4RA 4PQFA 2FPSA 3PC2A 5K0SA 1LWNA 4JJIA 4QGHA 1L5GB 3RU2A 1RAHA 4NFHA 1GL3A 4PX2A 5DLQC 1KPGA 2DKNA 2FOLA 4AJKA 3BH6A 1C5KA 1HK7A 3RGGA 3MTEA 3HXKA 2UXDB 1I6LA 1K0FA 1HTTA 4IS2A 5JDIA 3FSEA 3IE1A 2WQZA 1ZIXA 4B6JA 3BEOA 2OGSA 2ZJOA 4PQYA 3E7PA 3DUWA 4G2TA 3VH2A 5C81A 1VLJA 1ORHA 3NWPA 4KCGA 4LJYA 1EE1A 4YONB 5THKA 5EP1A 1EFVA 1NWHA 4XDHA 1M2OA 1VLVA 3QVVA 5DP2A 5EXTA 3SQXA 2O8FA 3LCCA 4GPAA 5L3VA 1REQA 2AHRA 3SQLA 2VPWA 4IVRA 7ABPA 3FDZB 3EH2A 5HA5A 4D6XA 2F8SA 3AI3A 5IAKA 1B74A 2ACKA 2X2EA 3ZGYA 4FMCF 3L1UA 1GL7A 3MWKA 4DBVO 2IZZA 5LXTA 1G1AA 2P9QA 2GXQA 1X7XA 2PYZA 5FQOA 5D87A 3OIUA 2C3PA 5K3OA 2UYYA 3BB3A 4GX1A 1JEQB 4Y0AA 5L4NA 1NJ8A 5FNZA 4MH0R 2QV7A 1Q0TA 2PX2A 4CMBA 2ZYTX 2A5YB 3FPGA 4H7JA 2REQA 3VJLA 2Y0CA 5LVAA 2FA9A 3D43A 1VIDA 4FS8A 4DQVA 4TLBA 5KYGA 1LPNA 1XJ0A 2G0TA 2XT0A 4CF3A 5KI6A 1CDDA 1SXJA 1D3AA 1NLZA 4IY1A 4K81B 4LGCA 4QVKA 3TFQA 4Z1MD 3L4BA 2G08A 2X22A 4TRJA 1JRLA 4NE9A 5TQVA 2O0LA 3V48A 5J2TA 2P4EA 3DL0A 4G97A 3NHUA 4Z8YA 4GR9A 5IEJA 2YVQA 5SY9A 1YC5A 2R1UA 1X70A 3HCNA 4J6FA 4YVFA 3RSFA 3E22A 1S7GA 2CW5A 1DC7A 1KYTA 2PU5A 1DG1G 2QLJA 2IXEA 3BMOB 4PQEA 3V97A 3EA4A 3VO9A 1EWTA 1GEGA 1MA0A 1MW9X 3GW8A 3I4LA 1HMYA 1A88A 1ZMXA 3DEYX 2NZJA 3Q0EA 4KN5A 3U7QA 1GZHB 2YWEA 2YHSA 2PX5A 3AFMA 1S7CA 3LHIA 2AW3A 3LCJA 3TSOA 4CM8B 1I30A 1I51A 1JWBB 3PR2B 3VAAA 3P9QA 1NIJA 1T9CA 2O1WA 1CQPA 1ZD2P 4R2XA 1EBFA 1FP6A 1DIGA 3K15A 4N5IX 3S55A 2CV2A 1DOHA 2FW6A 2I65A 5M2QA 1SC1A 4LDZA 1P73A 1VE6A 1W5EA 2OO7A 1VKJA 1TPZA 1UFOA 3GZ4A 3KQYA 2Q3JA 1EEHA 2OZLB 3IUYA 3TD6A 4AI6A 1XX6A 3ORRA 3KAPA 3EJWA 1E2LA 2J45A 5JAIA 1HT0A 4QBFA 4KR2A 4IJKA 1SBIA 3N2ZB 1MV8A 2ISSD 4Q39A 3JASA 1KDRA 2YHIA 3AFOA 2DP4E 1QB7A 1X8XA 1LCIA 5U9CA 3LGXA 1UFVA 1A95A 1QYCA 3KQSA 1JHUA 1KS9A 3EIEA 4FDTA 2V3VA 4Y2JA 1J2UA 2GZSA 5FI5A 4F3RA 1KSFX 3BWXA 2CCKA 2NW6A 1M1YE 2P79A 1UMDA 4J6EA 3GVPA 4UVIA 5JUWA 1OLUA 5K0CA 3RV4A 3UN1A 4G5QA 4K0RA 3U9TA 3SHQA 3UAYA 1LU9A 3PICA 5HIMA 3P45A 4M1SA 3I2FA 1TRKA 3Q8LA 5LD2B 4X00A 1JXMA 3A9TA 4LJAA 2PKYX 3TIXB 2B83A 1BWPA 1GZUA 2FLKA 5AUQA 5LLTA 1P2DA 1KY5A 2Y27A 5HHTA 1JPNA 4HDQB 2XA9A 5SYAA 1ELOA 1SQ5A 2EV9A 2I0FA 3N87A 2X6RA 4C06A 4WT7A 4IF4A 3D4LA 1YDGA 3NVDA 4BZQA 5KJ1A 1TW2A 2JJMA 1XZ8A 3AILA 4WJKB 2HCBA 3PXXA 2JLXA 4XW2A 5JDCC 4LYGA 4CTKA 4EI8A 3BMQA 4MPJA 2X23A 3JQFA 4RY9A 1Q12A 1N8SA 2RGDA 3DMTA 4N3BA 2YJ3A 5NLLA 1XAIA 4CKYA 2HA3A 5JCJD 3HB7A 2E4VA 5B4VA 5IJ9A 1XD8A 2ZRAA 1SBNE 3GJ4A 3R3UA 4DZZA 5KTTA 3FGOA 3RS9A 1C8VB 1EM8B 1LSUA 2C9CA 1D2NA 1UT5A 4GEGA 1I4DD 3N8KA 5CD1A 2VATA 1NL3A 3DVAB 4YV1A 5K8CA 4HDCA 1XCJA 3KWLA 4UNQA 2QJFA 2GAAA 1OREA 5LZ7A 1H22A 3E61A 3K1AB 3R44A 1COZA 5A0FA 3TUZC 1NN1A 2OO3A 3LDFA 5BWLA 4BX9A 3ANYB 4V38A 3ZJVA 3RJ5A 1PV2A 4AN4A 2OHIA 3TIIA 3OM9A 3OF3A 3CQ9A 2B61A 1Y7HA 5JQGB 1QH8B 2AZXA 3IOMA 3AUXA 2WM3A 4G9GA 1YNOA 2ZRMA 1XMXA 1B0AA 2HO5A 4OI4A 1CUCA 4TLDA 4KLZA 4X66B 4TMVA 2AG0A 3E7FA 5L3SB 5IBRA 4E2XA 1SZCA 1GKYA 5K8TA 1NJ5A 1UDWA 2JHCA 2ZIUB 1CNMA 3ANTA 1NG9A 1R74A 1S4QA 2D0OB 2JGFA 5HDQA 4W8GA 1PFVA 3B89A 1YB4A 4OLFA 1SIOA 4LTNA 2OILA 2XUPA 4K86A 4ZVRA 1Y9DA 5JCOC 3E70C 2ZIFA 2CUKA 3EQ2A 3QNWA 4LWZA 1SUEA 4BPRA 4U0KA 5HGXA 3H5RA 3P52A 3PQFA 1ZUD1 3ZQ4A 2W2VA 5KNBA 2J7PD 4DJFC 1HLGA 5C5DA 2I3ZA 1E3WB 5EWJB 5SZJA 3T5BA 4YT2A 1YBAA 3DP7A 2EHJA 1R6BX 2OFWA 3FSJX 5BNZA 1FTGA 3TKYA 4LWQA 3MEQA 3DL7A 2R68A 1L4BA 3KYBA 4P84A 3HKEA 4UBNA 4PO8A 4EVIA 3UKOA 4BEWA 3A05A 1LDMA 2SKCA 4R71A 3IA7A 4OIMA 3NTXA 5MN6A 3OD5A 5KHOC 2G36A 1X7DA 3WMFA 3CR8A 2YJZA 4ZCRA 4ZCLA 3A2MA 5G1NA 621PA 4FFRA 4H0FA 1OX5A 4GX2A 1PVDA 1ID1A 2XVZA 3U1VA 4BMCA 3RHSA 1OH8A 1U28C 1XQ6A 4EMUA 5EQTA 4C1NA 1W0KD 2VCHA 3VUEA 2BJHA 1WKBA 1L5NA 3COPA 3IT1A 4IF6A 5FL7D 3QFSA 5H9VA 4KYVA 4MUBA 4HRAA 3UQZA 4GUAA 3OI7A 1I3OA 4ZMBA 3PC3A 1OZ0A 4JKOA 3SD7A 1K98A 1LLUA 3CRW1 2HRQA 3DXYA 1S6YA 2GPTA 1JPVA 2QJTA 1SWVA 4KE8A 3WHLA 2GZAA 1J2EA 2MMGA 1CQIA 1E2FA 4UM9B 5CT6A 2RD2A 4MQFA 3ZU2A 1A9XB 3ZJYA 3LSTA 3QU7A 1O57A 4UDYX 1HPLA 3TM4A 1LH0A 4GD3Q 5C1PA 1PJRA 1VYUA 1GPWB 4HUJA 3FYUA 2XUZA 2MCFA 1OASA 3ER8A 5DM4A 1EP2B 4DMLA 3IFSA 3P26A 3AHFA 2C03A 4L8FA 4LBZA 4FCVA 4NBTA 4S1NA 2Q0XA 1JQ3A 3DWEX 3USZA 3C3JA 3CCFA 1NW7A 4AG3A 2XA2A 3G85A 1XLVA 4KE9A 4RYDA 1Q11A 4YLEA 5JNTA 2HW8A 5JJKA 4QXMA 5TGZA 3TDKA 1BXRB 5LZ2A 3MM4A 2RI0A 4AROA 3QFHA 2CBGA 4TSFD 4RU1A 2VNKA 2XWQA 4GS5A 4R5MA 5FO0A 5M5BA 1C3LA 1GPAA 2QAGC 5L3QA 3V42A 2DBQA 4LSMA 1M6YA 3NHRA 4G9BA 1P2FA 2JHFA 2D5IA 1XDDA 5ALNA 3TBFA 3EQZA 1JN0A 1TVKA 4L5AA 4ZMRA 2ZTLA 3T3HA 1Z0UA 5J40A 2RGEA 2QX4A 3N8GA 3AVOA 2Q7XA 2GMWA 2Q4TA 4C89A 1P4RA 4D9NA 4CYMA 4Q9HA 1EFCA 2J3KA 4L28A 2QP3A 2OT3B 4BWGA 4PC3A 1ILWA 1Z36A 1H8ED 2AG6A 3CUUA 1RE0A 2JA2A 4QASA 4ZIRA 3H65A 2QK4A 1JJBA 4O59O 3T5CA 3ZPXA 4C0LA 1RC0A 3Q11A 3QQPA 4KMMA 4LK3A 4BVFA 4KDFA 2R84A 1FTYA 3AKYA 1XRNA 1RCTE 5JSKA 4LRSB 4AJOA 2ZE6A 2JLVA 2P0YA 4F9FA 1JG6A 4WZZA 1QC5B 5A9SB 2JGMA 4B7ZA 4ARCA 1NXVA 3Q9SA 1FSFA 3QVGA 4X91A 3U7JA 4Q34A 5JXIA 2CXQA 1QCZA 1JJVA 1KZYC 4H6PA 5JT1A 3K0BA 3DLAA 4FSXA 2IY7A 2BGKA 1YCHA 3G6WA 1I7DA 3BX1A 1ZMTA 3F5MA 4IHJB 1R6VA 5EHGA 1IJBA 4TM8A 3V8QA 5I4IA 4OHPA 1P0QA 3ZD7A 1GWNA 2P9GA 1A5AB 3WK6A 4I5EA 5E6UB 2YX1A 4MVYA 2ZROA 3VTAA 3LT2A 2Y2UA 1SCBA 4WN9B 2HHHB 4GRDA 1G7RA 1EFKA 3LJKA 2GAFA 5CDSA 1US8B 2FMKA 1HDRA 4DCSA 1G19A 5ICGA 4WK0B 1JWAB 2QN6A 4OXRA 1RYHA 1R0LA 2WZBA 3VU1A 1KJ9A 2IWHA 4BECA 3WTCA 1V6CA 3HRKA 3W5CA 2UUBB 1V1MB 1JHOA 1NZDA 2ZBEA 3TQIA 1KFEB 3RWBA 4MRMA 5FV4A 1TI7A 1FFCA 3QELB 4JBNA 4L75A 3UMGA 4KNYA 2V45A 1BKDR 1HYEA 1Q1GA 2E7ZA 3UG6A 1JU3A 4V03A 1QPBA 3CIFA 3P94A 2P4HX 1F1BA 3PITA 4RHTA 4XX0A 4U2EA 2ZTSA 1NOJA 2VDVE 3R6TA 1IUNA 4M21A 5ALRA 2ZQ5A 4X95A 3HSSA 1W47A 4LK2A 4JJFA 2PH1A 3OZBA 3LKZA 4FMDF 5SY6A 3ZHVA 1A27A 4O8CA 3ZY5A 2JF0A 2HBQA 2EEPA 2P35A 2QXYA 3KB2A 4L9SA 3NBQA 2HMAA 1ZLXA 3D3KA 2ZCJA 2PEYA 1XV5A 3ETEA 4MVWA 4HL6A 3U4GA 4WBSA 4YJ3B 2FPIA 4UREA 3DE4X 1H93A 4KZPA 3TOSA 1V47A 5FD8A 1E5VA 4PGAA 1N1GA 5HP4A 5M3BA 4P5EA 3D1VA 4UTXA 1WSDA 5AVOA 3B36A 4BLPA 5BV0A 1ICIA 1LLCA 1RAIA 3C6MA 4GZ5A 4L5IA 2FP3A 5FF9A 4C08A 5LUAA 3K70D 1FS6A 4HXEB 1DKOA 4U8GA 4J0QA 4GMXA 1OXMA 2OFXA 1LSJA 2CYAA 1XBTA 4QG7A 5KWEA 1RCFA 2WIBA 1IY8A 2WSBA 3JVEA 4I4CA 2AYXA 4A2WA 4JH0A 3ZGNA 3FNRA 3EULA 2M1ZA 1FPMA 4PHGA 1W5BA 2WLTA 5DM1A 1HY3A 5HWSA 3JAKA 3GLIA 2AI3A 3KE8A 4IL5A 1MOZA 2WU8A 3BIOA 4NPHA 2HF8A 2W6ZA 4BIMA 4NJEA 4ZRDA 2RHGB 4NPCA 1TECE 1GZ7A 3P4XA 4RX1A 4MUMA 3CX7A 3D2CA 2WUGA 5F4ZA 4JC0A 1NP3A 2VSYA 3GRZA 4QECA 2YN4A 3LX8A 4JQYA 1E9VA 4UEQA 5KNDA 2XUKA 2OPHA 5GONB 3DM5A 2CF5A 2IHVA 4D41A 3NX4A 5I47A 3A6PC 4F7DA 3PFKA 5JXGA 5HEKA 2FR8A 3FW1A 3NUGA 3RF7A 1YQTA 1DKNA 1USUA 4RCYA 4YACA 2XB9A 4Z53A 4D96A 1UBHS 4KI7A 3PENA 1KAMA 3QIAA 4N49A 4R9UC 1JFSA 5GJBA 3DT6A 3TTSA 1OJLA 4FSHA 4OQLA 1NA5A 2KM1A 3WLSA 4AZVA 1Y1RA 3HXOA 2WU1A 1J24A 3DL4A 2PLNA 2RK6A 5C0OE 4ZODA 1YE8A 1JECA 2FJ0A 5JTTA 2D2XA 4N01A 3U19A 2YTZA 3D8BA 3W7VA 2F00A 3A6GA 1MVNA 1C3VA 1C7IA 3G5UA 1D8TA 4KEAA 1KYVA 1SKBA 3DE1X 1L9XA 1N2GA 3IEIA 3QOFA 5TF0A 3UAXA 1IZ9A 1W0JD 3OESA 2XVMA 1NMQA 2QAGB 4DLRA 2C9DA 2QWXA 1VP3A 2BR3A 2DSNA 1JEYB 1P3Y1 2P30A 3ZCTA 4DJTA 4CNBA 3GGJA 3N9IA 5BMVF 5P8WA 4QJ3A 1EQ2A 3KXKA 2C77A 3GPDG 4JD5A 1KSHA 3H7AA 5HE8A 3CUVA 3TE6A 1T4CA 2WFLA 1G63A 3IUPA 2BFPA 2ZRIA 3D0QA 3GCDA 3IPLA 3DWFA 1FTNA 3KPWA 4TVKA 3UT6A 3BDVA 1ULZA 2UVDA 5DK6A 4FFBA 4JENA 4HBZA 1XN4A 4WUVA 2W93A 5JU6A 1M8JA 3AUUA 1CS0A 2RMKA 3QXHA 3OHPA 1NZFA 4OBBA 1FRZA 3VYVA 3ZLBA 1EVQA 2B0CA 4BGDA 3OTGA 4LKOA 2QN9A 1U4OA 1C8LA 1TMYA 4U00A 1TIBA 2FQYA 1P7WA 3EXFA 4EGCB 3C41J 1G20B 2ZLBA 1NN3A 2E4XA 2H3HA 3CTPA 3EXEA 3DOUA 4TKLA 1MIOA 1Y5MA 1TZJA 5AKJA 5AK0A 3R5XA 2CXSA 2IT1A 3FRHA 5CH5A 1ZCJA 4CN9A 1XMOB 3D7KA 3GB9A 1OZAA 2H5LA 2XZTA 4UXHA 3D5TA 2JDIA 1RIFA 2EKZA 4FZJA 4RETA 1DTSA 3KJXA 3KJFA 1Z63A 4J07A 5CU7A 4HAUA 4JI0B 3NAGA 5ECWA 1O6BA 1ZW6A 2QTRA 3RARA 4BGEA 2E37A 2Q0SA 5KHLB 1V8OA 2OFFA 1B6RA 3B2NA 1DIBA 4BX3A 2VZ9A 4D0RA 1ZZGA 2EL7A 3BZUA 4C7OB 4NCXA 1SC6A 1NE7A 2I54A 2VF4X 2XCUA 3HM9A 1YQQA 4L4YA 1DDGA 1E18A 5ALUA 4N6NA 4DSZA 1NUPA 3WDSA 1MZPA 2OAP1 1JG1A 4LV8B 1Z8HA 2M9MA 3L8YA 1A2QA 3KYCB 4M1EA 1MJGA 2J0UA 5IHPA 5A9TA 3E9YA 3MMSA 5GGYA 2CF6A 2OCKA 4ZCPA 1P2UA 2WKSA 3SC6A 3TZHA 4DIMA 1IWOA 4HX9A 1JI0A 2BFBA 4KU4A 1Q7EA 3ZGZA 1JH8A 4CG1A 3B1WA 3WGHA 5E9WA 4X1YA 5K0LA 3FR7A 3SHVA 3RFVA 1ATIA 1GUYA 1ZHFA 4MTLA 4YRTA 3M2PA 3EEIA 1GSOA 5EQFA 4NXNB 3LC1O 1E2JA 3VPHA 3KE9A 5HZMA 4MARA 1O6FA 5DBIA 1GNSA 2ZVDA 2YCLA 3TMKA 3AWDA 4UBIA 1K6EA 4NG5A 5J63A 4MA4A 5GZ6A 3OSUA 3NWEA 2ECQA 4DCNA 4D81A 1RDFA 4B87A 2KYRA 3BTUA 3Q6MA 2WQ6A 1PP4A 2GF2A 1LZLA 3UHJA 5KTSA 1T1IA 2H9IA 4QNRA 4M83A 4C3VA 1C8BA 3ABQB 3BGIA 4RBNA 2HWUA 2RGBA 3FFWA 4I3HA 5J23A 2VUHB 4K03A 2HK6A 4M9ZA 1DKQA 3IO3A 2EFJA 1FIUA 3G5MA 1T4DA 3HA5A 5L3RA 2D1YA 4LRQA 4LTDA 3CLTC 4LVOA 4H4DA 1TRHA 1LTQA 4F3NA 3B78A 1Y1KE 3PFHA 2YOGA 1V41E 5LN1A 4QNMA 1BHSA 2A9JA 4CM7A 5L3ZA 3RC1A 1QZZA 4WZAB 1ECFA 3BAFA 3GROA 1JSXA 5A1TA 4PN7A 1NNI1 4ZAWA 1N57A 2EDAA 4E1AA 3HJBA 3PPWA 4MUKA 5AVXA 3DHWC 5KOIA 1EZ1A 1ICEA 4OXKA 4RSMA 5IBPA 3ZE2B 4X45A 3VR5A 5IKMA 1QANA 3G88A 2C4MA 2ABWA 4IH4A 5FA6A 2VSNA 3O4VA 5DI3B 2QRPA 4AYWA 4EG7A 4GXQA 10MHA 1E79A 1U2GC 2ON6A 3ZQJA 3UH0A 1ONPA 3AUKA 2HA4A 1XTSA 4R01A 3FBTA 4FILA 3WV5A 5HZHA 1P7YA 1GAEO 1Z6ZA 1E64A 3IBSA 2A4MA 2CVQA 3Q41A 4LS3A 1WABA 5LNK6 3SSOA 2CFOA 3E48A 4TN5A 2F4NA 4M0PA 3AOEA 3DXFA 3WBKA 4YK7A 5CMLA 2YWBA 2YNMD 5BP7A 3UJHA 3AP1A 1GTVA 4MB6A 4AMYA 1J2RA 4BO4A 2QLTA 2XTJA 3CJTA 3M6MD 4KQFA 3I3OA 2HV8A 3BMCA 3D0OA 1XTVA 3IALA 3TO5A 1BCRA 2OBXA 1WW3A 3ORQA 3WLQA 3ZHZA 3SQWA 3EF3A 3PQCA 1Y3CE 4JU9A 4R1PA 4N65A 4P5DA 1DQYA 1GD1O 1VGQA 3WFZA 2HAEA 4KR0A 1V26A 2CY0A 2NPFA 4D98A 1OLXB 4V39A 4BBZA 3HRIA 3DZDA 3GJRA 4ATNA 3HR8A 3HWX1 3FUTA 2AUMA 3EXIA 5K3DA 1T25A 4O4LB 5D3MA 4AO8A 5F9MA 4MWCA 1N2BA 1KOJA 1PV4A 2ZAOA 4DXHA 3W9SA 1L5YA 4DDTA 5A4FS 4CXMA 5DM60 2IYRA 2ZWAA 4C0SA 2ZE7A 5FLXA 3FSRA 4O2RA 4EUKA 5LIPA 1M2KA 1HE3A 2ECFA 1FU7A 2JEYA 2WDZA 3PJEA 1H6AA 1HYQA 2WZCA 4N7MA 4PG4A 3ZE1B 3VKUA 4BQOA 4DAEA 4ACAA 3PGA1 4MO9A 5T3YA 4XM1A 1N34B 1S02A 2BTQB 1E6EA 1WF3A 1LC0A 2UVPA 2YASA 4GPD1 2QUHA 2G07A 1Z0IA 2IVFA 3OHSX 2O7RA 1TYZA 2NZUG 4A0SA 1D7OA 3A9RA 3GLRA 4NOMA 3HCCA 4TQGA 1R9JA 2IOHA 1CP3A 1XU7A 4JLOA 2IVZA 4O0LA 5EMKA 2Z1MA 1RMQA 2P68A 2F8LA 3O92A 3EGXB 1VQ1A 3M6UA 4X1OA 1ZCAA 4HB4A 4BNDB 2R5WA 4JI3B 2WOJA 5FPSA 1GFSA 3R7BA 4FYYA 1X7GA 3FUXA 4PGFA 5JS8A 1O0BA 3L1JA 2PZLA 3PVCA 2ODTX 4B3JA 3C24A 3VI3B 4XWGA 4CUJA 3LVBA 1YBMA 3SJZA 3B3FA 3S3TA 4W1QA 3K7EA 4WJZA 2E6KA 3OE7D 5CVEA 1TM2A 4DIFA 4AZTA 2O7VA 2J9XB 2BFAA 3HDJA 2Y0PA 3I83A 1UWLA 2BGUA 4DMMA 5KYKA 3LU1A 5T7BA 1RWWA 1DJPA 2FEAA 2FPRA 2CKDA 1KFJB 1IM5A 1W49A 2I7XA 3EMDA 3IDOA 1R3DA 1K7FB 3FTDA 2BHRA 3G2LA 2HU8A 3T5MA 1YZ3A 3OQIA 5FWYB 1KWKA 1GPLA 3OURA 3AL2A 4YCCA 3R9KA 1Z47A 3FNGA 4PVCA 2FCAA 4PNEA 2WSIA 3ZQ6A 2CFTA 2Z2JA 1A4UA 5BSEA 3VDMA 1T35A 4HAIA 5JOQA 4I2VA 1F8FA 3H2ZA 1ACJA 4NZZA 1R0BA 3AEQB 4OHWA 4RL4A 4XJVA 5J2UB 4BFVA 2ZRBA 3HEBA 4QDXA 4BO8A 3HMQA 1XYVA 4MWZA 5EP4A 3WIVA 1FFSA 3OKAA 4CPDA 2Q1WA 1Q2XA 5JSFA 1NDHA 1UZUA 4Q01A 1C8KA 2AF4C 2PZMA 4UVGA 4NF2A 2WINI 13PKA 4YV0A 3OZXA 5TPWB 4PLCA 5C8YA 3WYBA 1PQPA 5BURA 1IXYA 3RS3A 1MB4A 1LD3A 1S01A 3BVPA 1LPPA 3KQWA 3L0DA 4ICIA 3GIWA 1EQUA 4ZPJA 1WETA 4RO0A 1XQXA 4RE5A 3SJ7A 4PZYA 3G13A 2OD2A 3IGFA 3OSZA 3K2IA 5LIRA 1DP4A 1S3FA 3HU5A 1CY0A 1WMDA 3A4MA 5KS2A 4QOGA 1JVNA 2J1LA 4F71A 4FYXA 3L1IA 1FYWA 1U1EA 3WBJA 2BUBA 4Z0NA 1I7SB 4U5XA 3RVNA 2AFHA 1JDJA 3TSWA 3SQMA 4PPYA 1LX7A 3X1JA 4YMVA 3HWWA 1FLVA 4JT2A 2QRMA 4NZ9A 3F5FA 5EXXA 5LJLA 5IT9A 3ZBPA 3R77A 2PM8A 3QKUA 3VX3A 5I01A 4DR3B 4E51A 4UNSA 2HJ9A 2IPOA 2VK8A 1ABBA 2DKOA 1IRIA 1I10A 1QORA 1Z5OA 2VPTA 4ILKA 5EMNA 3RCBA 3BFXA 2Q50A 4A2PA 4C6SA 4RD6A 2Y1LA 5EQDA 2CFCA 3ISVA 4AS1A 3LBYA 3Q9NA 1WXIA 3MCZA 2WM9B 3AVQA 4JOBA 4YCLA 3PFWO 4S3MA 4DZRA 3LIPA 3RQSA 4DB2A 3GFFA 1LSOA 4U2GA 4YAKA 4TYMA 3WB9A 1XMJA 3DTTA 3B3GA 1UXJA 2F6RA 1V3UA 1ODLA 3D2BA 3OLWA 3AR9A 3CUEF 3E58A 2D7CA 1WD5A 3IA2A 1IJEA 5TMDA 5CB8A 4CQNA 2FX3A 3PQ7A 2I67A 3PUZA 3DNPA 5KCMA 4PCAA 4O6VA 4XPIB 3QX3A 3AF0A 1U0GA 1O6ZA 4I5IA 4F56A 1VCHA 5CJPA 3DNFA 5BNTA 1GCGA 2D59A 5IAOA 3GRVA 1JLSA 1Q22A 5JPIA 1NMEA 2Z83A 1OTXA 4F6RB 2DWCA 5DNAA 1BHQ1 2VJBA 3MRXA 4KFUA 3SBOA 5A05A 2BC9A 2YR0A 1PL7A 3ESDA 3F3KA 4LEIA 5IARA 5A3VA 4NFSA 3HEMA 2V5VA 1F12A 1N3IA 3BE6A 1YS2X 3PIDA 5LYYA 3ZWOA 4ER3A 2VDRB 3U4QB 1XOIA 3OZGA 4GXNA 2WAOA 4MGYR 3DOCA 4IGIA 4ZV9A 1AZWA 1T6XA 1J09A 3UICA 4D0GA 1GVHA 1KDPA 1COWA 1CW2B 1X1AA 2P2GA 5K0JA 4DW8A 3AG5A 3UFBA 5EQJB 421PA 3HXLA 1E9RA 5DYGA 1BXGA 2B8EA 4IDFA 2HQ1A 2IW3A 2PFKA 4PAWA 1Z7GA 3A31A 3E3LA 2C04A 4EYEA 5KTNA 1MORA 3QIVA 1RXUA 4MEAA 3V2GA 1KVUA 3RKSA 3WLLA 3HH8A 1XRJA 3LUFA 3L0IB 1LJUA 3P9KA 2F2TA 1NURA 3KVVA 3VX4A 1KJQA 1XHLA 4HDSB 5DSXA 5LBTA 3ABIA 1W5TA 5JCXA 3DDWA 4RZQA 1EFTA 1AKNA 1PR2A 2BN4A 5HCIA 1YQGA 3JWIA 1JDTA 1AF4A 1Z22A 2J87A 4I9HA 2RH9B 3TVTA 2OECA 1R10A 3I6MA 4Q3NA 2QW0X 4ZKDA 5JBIA 3CZ4A 1W88A 5AKYA 1IY1A 2HT6A 3DEZA 2JAQA 1H2ZA 3VNRA 3ZWVA 3ESAA 1CZNA 4DE5A 1IB0A 3FOEC 4M1QA 3P0HA 4Z8XA 1SBQA 4LDJA 4LVCA 3MB5A 4YAGA 4JSTA 1E0JA 2OHFA 4IRUB 3S4YA 4BXOB 5BPFA 5AP9A 3N74A 3RSZA 3WDMA 5HE9A 3SC2A 1ZNWA 4ZVQA 1KO1A 3A7EA 3ZS8A 2C96A 4DA6A 3PDIA 3PUVA 4FPXA 1I14A