1NVTA

Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
287
structure length
287
Chain Sequence
GPLGSMINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of shikimate 5-dehydrogenase (SDH) bound to NADP: insights into function and evolution
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
molecule keywords Shikimate 5'-dehydrogenase
total genus 94
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nvtA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1nvtA01
9LDTA 2PD6A 3GG2A 2DBQA 3PPIA 2UYYA 2Q1UA 4R5MA 3VDQA 1GFSA 3WBFA 5I7VA 1QLHA 1HT0A 4IGEA 2VHZA 1ISHA 4KQWA 1EFLA 1Q7CA 1ZKMA 4QO8A 4DBVO 1QYCA 4U0KA 1Y9AA 4A2CA 3FPCA 1GEEA 1DO8A 1EE9A 1YB4A 1U7HA 2QRKA 1HLPA 2QRLA 1PU2A 5DCUA 2XXBA 3RKRA 3KYDB 2X7HA 4TRRA 5A3VA 3FTPA 4CM6A 1Y5MA 4MKZA 2CZCA 1IUKA 4ZN6A 5JY6A 3EC7A 2XXJA 4JXKA 3GEDA 1PJ2A 3OH8A 4HXYA 4MVJM 4HBGA 4QSMA 2EP5A 2PLAA 2CFCA 4ND2A 2PZMA 4ZQHA 1UP6A 1GD1O 1BSVA 4WUVA 2NQ8A 2AEFA 4I9NA 2IZ0A 4FW8A 3FTNA 4PZDA 1XSEA 3CUKA 2IZZA 4AJLA 4FPXA 4YR9A 5KVCA 1ISFA 4NR0A 3OETA 2VTEA 3VC7A 4CMEA 1A5ZA 4RLHA 4MP3A 1E7MA 3JQAA 1U4OA 3EMKA 3HADA 1PS0A 3TWOA 2BMAA 1U5AA 4Q3AA 3JD2A 4B8ZA 4E5YA 2DTXA 4MVJH 3DZKA 4KDFA 2YQ5A 3U4DA 4PRKA 2PA3A 4KZPA 5K0ZA 4A26A 1DSSG 3ZHYA 3QIVA 9LDBA 3UICA 1ZK0A 4HUJA 2FHSA 3C1AA 2YV1A 3WOHA 1E1LA 3LYLA 2EGHA 3OJOA 2PTGA 2ILTA 2JCXA 3E9NA 1PZGA 3K2EA 2XF8A 1X1TA 3QVOA 3P2OA 2FPIA 2QQ5A 2C5EA 3JYOA 2ZB3A 3WBBA 1EDOA 4PG8A 1U5CA 1LEHA 1PJBA 1WZIA 1Z73A 4JK3A 2B36A 5T8KC 2VT3A 1XIVA 3I83A 2Z5LA 1FXSA 3IJRA 2VHWA 4DYDA 2CY0A 4HX5A 3GHHA 4QECA 4YYZA 1ENYA 2P9GA 1NQ5A 4J49A 4BNFA 1W4ZA 3EY4A 1YOVB 3WJ7A 1E5LA 1Z45A 4BVAA 5A02A 3IMFA 1K5HA 5AOVA 1XGKA 1VI2A 1WMBA 5JY1A 3UVEA 1D1SA 4NDNE 1MC4A 2DFDA 1IE3A 1LSUA 1R4MA 4JQCA 3A9WA 2VTDA 4NU6A 5GZ1A 3F5SA 4HFRA 1CJCA 2UUPA 3OJEA 4IINA 1G0NA 4RVFA 5EINA 4DLBA 4E21A 1AUPA 4LN1A 4H3VA 4EJ0A 2BF7A 2EHDA 4Y6SA 1UJMA 3D64A 1LLQA 1W73A 3HDYA 4GX2A 4AJJA 1T2CA 1ARZA 1JN0A 4YA6A 3HN2A 3W6ZA 1DDOA 3HG7A 2P5UA 2BGLA 4NI5A 3KSUA 2D3TA 3CXRA 5A06A 4XJSA 1LDBA 1N5DA 3O26A 3PHHA 2AQIA 4OAQA 1E92A 1KVQA 4YJFA 5JMWA 1N1GA 1KOLA 1ZIDA 4RQTA 4DLLA 4LSWA 3ROQA 3I9KA 1GYPA 4K28A 2VZ8A 1NNUA 2X1HA 2EJVA 3FBGA 4U8GA 3ZHZA 4NZ9A 4J1QA 3JD3A 5CP8A 1G6KA 2VOEA 3MJEA 3I6QA 1UDBA 1A7AA 3UN1A 4FFOA 1EVJA 1LNQA 1UXKA 3QJ5A 5TQVA 2WYWA 4PLFA 5DBGA 2DPHA 4M86A 2Y0DA 4CR7A 2Q49A 4CM5A 1HDGO 2VZ0A 3OBBA 4MINA 3JQCA 1B15A 2JAHA 4RGBA 4CLEA 2W98A 3WSWA 3WWZA 5CEEA 3FHLA 3SJ7A 4J43A 3B20A 1HKUA 2EIHA 2AQ8A 2EW8A 3JCZA 1O95A 4BNIA 2HAEA 1XQ1A 3PQFA 1E3IA 1DC3A 2EERA 3B1JA 3V2GA 3BMCA 2C07A 2C82A 3DBVO 3MWEB 4BV9A 4EI2A 1EBFA 4O1MA 1O89A 2QYSA 3K31A 1E3WA 4ALLA 3HZZA 1Y9EA 3OJLA 5L95A 4FR5A 2VYNA 1BXKA 4QO7A 2YFHA 1N8KA 2GO1A 5BQFA 2NM0A 5DBIA 4YRDA 4D3SA 4LRTB 4N54A 3MJCA 5HA5A 3ROMA 4OMUA 1DFGA 4ALNA 2HK9A 3UHAA 1T4DA 3E82A 4EEZA 1BTOA 1WVGA 4Z0PA 3GRKA 5U4QA 3ZWXA 1F8GA 4KTVE 1N9GA 5DCWA 1EE2A 1AE1A 3PWKA 2JL1A 4D3FA 2EWMA 5A5EA 1PJTA 2DUUA 3LZ6A 5AXDA 5G4LA 1NPDA 1EUDA 4UUOA 4LRSB 4LW8A 5JMPA 3DL2A 1TT7A 3RIHA 1R66A 5U1PA 3RC7A 3MJ4A 4O0LA 5IDQA 2X9NA 1GUYA 3FNHA 1U9JA 3FNGA 2NTVA 2E6UX 3AJRA 1Y6JA 2PY6A 2Q1TA 1V6AA 3ROKA 1MA0A 4MVJE 4MDHA 1GQ2A 3OQBA 3EZLA 4E3ZA 3PFWO 3W1VA 1C14A 4S3MA 1J4AA 4BO9A 1Y81A 4PFJA 1B7GO 3ZCXA 4CPDA 1Q7BA 3ZH2A 4J6FA 3TRIA 3ZW9A 2HLPA 3ORFA 1E77A 1NXQA 1YGYA 3RBVA 1GAEO 3WIDA 4CJXA 3WYCA 4XD2A 2GZ1A 2EXXA 1U1IA 4FCCA 3TQHA 3ZWOA 2VWGA 3L77A 1DJNA 1M75A 1MLDA 3JQEA 3PIDA 3H5RA 4XZ3A 3UCFA 1SNYA 3BTOA 4R1SA 5KWEA 3GVIA 3GEGA 3FCOA 3DB2A 2DKNA 4J2OA 3ZWVA 1HDOA 3L0DA 1Z6ZA 4U5QA 2CVZA 3NRCA 5L53A 1PS9A 4AJKA 1OC2A 2EV9A 3JD0A 4XEHA 5TF4A 1C1XB 1P1RA 3CMCO 4WLUA 3QA9A 2Y1OA 2G76A 2G82A 1GR0A 4Y9DA 2Q4BA 3ZV5A 3DZHA 1NAHA 4NHEA 1GZ4A 4P22A 4EW6A 3UUWA 4FOSA 1VRWA 3D1LA 5CG1A 3B70A 4BNKA 3HUDA 3MOGA 5JDCC 4O6VA 4MVJP 3V1TC 3PQDA 1Z7EA 4UVHA 3NT5A 4AJPA 5TS3A 3WQRA 3DZBA 2I65A 3DTYA 1PSDA 1BW9B 5CDYA 3WNVA 3S1LA 4JLWA 3NX4A 2GNAA 2GZ3A 3AU8A 3F4LA 2YHIB 1QV6A 1TT5B 3BTSA 4RDIA 3GY0A 2PNFA 2PD3A 4B7CA 3M1LA 4JBHA 5COAA 2GLXA 2O48X 3ZNPA 3GZNA 3OJFA 3LSYA 1ZSVA 2G5CA 4FIZA 2B5WA 3CEAA 1X0XA 4K6FA 5A9SA 4GX0A 4IDAA 1HDXA 3WFIA 5I9NA 4ALMA 2FZWA 3PJGA 1I3LA 5HS6A 1QYXA 3H2SA 3HFSA 5TLSA 3K73O 2YV2A 1BWSA 2R00C 3AFNA 4R41A 3WGTA 4D3DA 1VL6A 2IODA 3HDQA 4IMRA 1ISGA 1R4NB 1YKFA 3K9QO 1NR1A 3WMWA 2AW5A 3PYMA 4GH5A 3LF2A 4MO2A 4PVCA 4NBTA 2C29D 4MVJG 3AY7A 1Q7GA 5BR7A 3QP9A 1KC3A 2NVWA 4LK3A 4XA8A 3ONEA 3CMMA 3ZU2A 4DLAA 2V65A 3F3SA 5JCJA 5B1YA 4CL3A 4WJZA 2RH8A 4CR6A 1XU7A 1R6DA 3IKTA 2D0IA 3O8QA 2GD1O 4U6SA 4NMHA 4GGPA 2W90A 1UDCA 3I1JA 1RPNA 1KVTA 1ZH8A 1U4SA 3GDFA 3IKVA 1UZLA 3PGXA 3ZU3A 5A1TA 4ITUA 8LDHA 3C7DB 2UAGA 5KIAA 1BRMA 1P0CA 4NJMA 5G2OA 4FJ2A 3DDNA 1RWBA 4FFRA 2Y1DA 3OMLA 3OECA 1OI7A 2I3AA 3FF4A 4DGSA 1HSOA 2X6TA 1HYGA 2Q50A 1LC0A 2VNAA 1U3WA 3AUTA 3U62A 2A92A 1LDNA 3LU1A 3IP3A 2CMDA 3D3WB 2VUUA 4IMPA 5ER9A 4DTIA 2CVOA 2D1YA 1PL7A 3AM5A 1BXGA 4U0JA 3KXDA 4YJHA 3HE3A 2Y67A 5A04A 3IC5A 1GDHA 2ZYAA 1XYGA 2OP0A 3R3SA 3PI7A 4LVUA 2BD0A 1Z74A 3CZMA 3ZHXA 1C0PA 1IYZA 1GUZA 1LA2A 2HMUA 3D7LA 4HNHA 3T7EA 1IY8A 1P33A 3H9JA 5CPBA 1RJWA 3NDIA 3OEWA 4IJKA 3DBLB 3PJFA 1I36A 3OICA 2NACA 2Q1SA 1EBUA 4J7CA 1U3UA 4E2ZA 3WGHA 4IQ8A 3U09A 3IP1A 3H3FA 3FSRA 4M87A 4Q3DA 1WPQA 1NQTA 3MZ0A 2HO5A 2NVUA 4CMBA 2J3HA 2Y1EA 5HM8A 4PLWA 1PJ3A 1NWCA 3WWYA 1U3VA 4HADA 4E5MA 3RFTA 1VKNA 1T4BA 2EJWA 4Q9NA 5T8KA 4DRYA 3RC2A 2W4QA 4JX8A 4BNXA 4BNGA 4F46A 5DP1A 3TNLA 2YQ4A 4PZCA 2JHGA 4FB5A 4A5OA 4OH1A 1DB3A 4IDGA 1YDWA 3P7MA 4WLNA 4D7AA 3V1YA 1P77A 4ZHSA 3MJVA 1FJHA 1PEDA 2X0RA 1P1IA 2ZB8A 1Y7TA 1R0SA 1CIVA 2GR9A 3HDHA 2YV3A 3JQ8B 2EKPA 1T2FA 1KERA 2W2LD 3AOEA 2D8AA 4YJDA 4BNYA 3I9MA 1ZCJA 4OIMA 3BMQA 3T7CA 1A72A 1DRWA 2BLLA 2GERA 1I33A 2NSDA 2X5OA 4OJNA 1I2BA 1P31A 3RVDA 4AJ4A 1E3SA 4QXMA 3F6YA 2OL4A 5L7TA 3B1FA 3ZWYA 3GT0A 5FI5A 4ZQBA 4BO8A 4F3YA 1VSUA 1NHWA 5FWNA 4FD3A 3QQPA 2ZYDA 1E6EA 2DTEA 1QRRA 4Z3DA 3WJAA 4RPGA 4R9SA 2CD9A 4IXTA 3OFSA 2DPGA 1M76A 2ZKLA 3PXXA 1K3TA 1LBEA 1QR6A 4BGUA 2W2KA 3TPCA 1EZ4A 3HQ4O 4P8RA 4F45A 1O6ZA 4BO5A 5U9CA 5DN9A 3S2FA 4NJOA 4BMNA 3Q6IA 2PGJA 3WS7A 4ZJUA 1MV8A 5B4TA 1UZMA 4KUEA 4E2WA 2J8ZA 2C5AA 1K89A 3SX2A 3PDUA 5IDXA 2X0NA 2C2YA 4XGKA 2FSSA 3X2FA 1JKIA 3VAZA 4E5KA 4E4YA 3AW9A 1IOLA 3PEFA 4I1IA 4CMJA 3ZWCA 5ICSA 1UXIA 3WYBA 3CINA 3JTMA 2YFQA 3P5SA 5DOZA 3PFFA 1V3TA 3QRWA 3RKUA 3DOOA 4H16A 2X4GA 5A03A 3QWHA 3K6JA 1ENPA 1ZSNA 3LT2A 4PVDA 5IF3A 4J4BA 4JJIA 5TRTA 4PLHA 2P4QA 1PJSA 1V3VA 1DC4A 3PWZA 3RUHA 5CPFA 4BGIA 2NNLD 1Q0HA 3CZRA 4CQLB 2V6BA 3LC1O 1FK8A 3EW7A 4BO1A 1C1DA 2FMUA 3WTBA 2AEMA 3GFGA 3WXBA 1HDCA 1R0LA 4L73A 4CQMB 1DRUA 2X0JA 4IZIA 2EG9A 2OBYA 3GOHA 4S1VA 3U4CA 4U7WA 1RM3A 2P9CA 3UCEA 4JN6B 4CM4A 2V7PA 3KUXA 3WFJA 1NWHA 4FFPA 4GSLA 3DZGA 4XB2A 4W9NA 1LLCA 2FP4A 1NQAO 3MTGA 2FR1A 3EUWA 4O5OA 4G65A 3TZCA 4P4NA 3ZV4A 3UKOA 3DOJA 3QVSA 2VNSA 2Y99A 3U4IA 2RBEA 1WNTA 4D42A 4NBRA 3F46A 3OHSX 4NBWA 1FDVA 1QYDA 4N5NA 2ZIZA 2J5QA 1HWYA 4K1LA 3TZQA 3WLFA 1FDTA 3E5MA 1LUAA 4AFNA 1AN9A 3PYLA 1JW9B 4IS3A 5EN4A 1T26A 1X13A 3RU9A 1ZMOA 3K8ZA 5ITVA 4RCVA 5H82A 4CM1A 2Y66A 2VCYA 4WCDA 2X22A 2BKAA 1NPTO 4GKVA 4B4UA 4R01A 4WK6A 1BVRA 1UR5A 3TFOA 4ZRMA 4X54A 1YQGA 1EMDA 1VKOA 1Y8RA 1J5PA 3AFMA 5JAZA 1I24A 4CV0A 4YT5A 4R5HA 1EQ2A 2HQ1A 1KBZA 2O2YA 2VYND 1HL3A 1ISJA 4OXNA 2O3RA 3MOIA 2C54A 3JQGB 2ZTMA 3GEMA 4J2HA 2PZKA 3BIOA 2R6JA 1GQQA 5HS4A 5L4NA 1MGOA 4UULA 3A06A 2GN8A 3JQAB 2FSVA 2VOJA 1T1RA 2YW9A 2YDXA 1NTOA 4XRRA 3VPXA 3GPIA 3PLRA 4J4HA 4B3JA 1MP0A 1H5QA 2WWRA 4R3NA 3BMNA 4XIJA 4FFNA 1ENOA 2D5CA 4L9RA 3UXYA 2EEZA 3LC2O 2I3GA 5A9RA 4A7PA 4FC7A 3VPGA 3HNPA 4UUPA 4G2NA 3Q11A 3W4IA 2OBNA 2VWQA 3G1TA 2WJPA 4PLTA 3ZW8A 4YAGA 3UOGA 2JD0A 1Q2XA 5JYDA 4GVLA 3S2IA 4EITA 1A27A 5A5FA 3QSGA 4ID9A 8ADHA 2UDPA 4R54A 3S2EA 3DMTC 3UH1A 4AG3A 2O4UX 4FSHA 1UDAA 1XQ6A 3BYZA 3H9UA 4IDEA 1ONOA 4GLOA 2JJYA 5IAAA 1F14A 1ZBQA 1TA4A 2O3QA 3M6IA 4K26A 4PG6A 4R9RA 1RKXA 1LSJA 4E5NA 4UAGA 5JCXA 4NK4A 1EK5A 2VHYA 4BHTA 1P0FA 1E7WA 4QQRA 5IXSA 1CQIA 4BMSA 4KUHA 1XEAA 7ADHA 1N2SA 4PZEA 1ORRA 3PGJA 1LC3A 3ROPA 4W99A 1QYVA 4MIOA 3AK4A 3AOGA 2YDYA 1N7GA 3TJRA 1WWKA 1HLDA 3BZUA 3AOEC 2VQ3A 2X58A 4WNIA 4BNLA 4RPLA 4XQCA 3WYEA 1JLLA 1XG5A 1YS4A 4GMGA 2Y68A 1O0SA 1LLUA 4NPCA 2I5PO 1W8DA 2FZEA 1IHYA 3U49A 5KKCA 1JVBA 5KVQA 2EKQA 1ZUD1 3EAGA 4TRMA 4EGFA 1N7HA 3ZZNA 3K30A 3TZ6A 3BTUA 2P68A 3GVPA 1E5QA 2BI7A 4TROA 3PJEA 2NLOA 4G5HA 4TRNA 1W0CA 2O7SA 4ONEA 1ZVMA 2FR0A 3RCBA 2G1UA 3JQFA 4IM7A 1QMGA 3KB6A 5GMOA 3AU9A 3C1TA 4Z0TA 4FBGA 5KJCA 1ZEMA 1SMKA 2JFGA 3VKVA 2Q2QA 3DZFA 2IZ1A 1PGQA 5L9AA 1B3RA 2YZ7A 1GEGA 3VKUA 4B3IA 5JSFA 1QV7A 1I32A 1KY5A 4OO3A 2C7VA 3JYQA 3ETEA 1DBVO 4CLOB 1AHHA 4R69A 2Y1FA 2V6GA 3GDOA 4CV2A 2AXQA 4CMHA 2CDCA 1DPGA 1P1KA 1K6IA 4UUNA 4IBOA 3JV7A 3WGQA 2EF1A 2HUNA 1LTHR 1UUFA 4OQYA 5CEJA 1E6UA 1ZMTA 4ND3A 4YJGA 4EYEA 2CNBA 4Q3EA 4ZQFA 1FDSA 4AJHA 2XAAA 4YCAA 3D0OA 1VE9A 1H0KA 3U0BA 1B16A 4KUGA 4E32A 3R0IA 3INRA 1Z82A 3JD4A 2G17A 2EW2A 2HKIA 3TZKA 4BKUA 4C7KA 2TMDA 1QXSA 2D59A 3HWRA 1SOVA 4NQZA 4BB5A 1UXGA 1ZO8A 1LX6A 1WLYA 3FPLA 4ZVVA 3H9EO 2WE8A 1SO8A 4M89A 4J0EA 4L0QA 1JWBB 5TJHA 2WD8A 3LLVA 4WASA 1I3NA 4ILKA 3L6OO 4I5GA 4XDZA 1QSGA 1M6HA 1SB9A 1YQXA 5G4KA 3UFXA 1MX3A 3H5NA 2Y0EA 3M2TA 3W4JA 2A4KA 1IULA 1JDJA 1S6YA 3WGZA 2VRCA 5B4VA 1GV1A 3AM3A 1M2WA 4GVXA 5JLAA 5KCZA 1U7TA 3MEQA 4P4LA 2D2IA 4GX1A 3QY9A 4XYEA 3NDRA 1FDWA 3OF2A 5CDGA 4NG5A 1X7GA 3Q0EA 5JPIA 3ZN2A 1OZAA 3CH6A 4JBIA 4YQYA 4QUKA 1WXDA 2JD1A 3U4HA 1LQUA 2AEJA 2J5KA 3DXFA 5EQFA 1ZW1A 1DIAA 4R16A 4IDDA 4BIIA 3WGIA 4KTTE 2DQ4A 3S55A 1ZK1A 4MKRA 5AXCA 4A03A 3DAFA 3GUCA 3JQ7A 5DT9A 3RJ5A 2DBVO 1K2WA 1G1AA 2HCTA 3GH3A 1HZZA 4IGFA 2O3TA 4FFMA 1YE3A 4WCFA 4TZKA 4KP7A 4WLEA 2JD2A 3WB9A 1YJQA 3QWIA 3GAFA 4M54A 1YOVA 1H2BA 1WDMA 2Q4EA 1PGJA 1YB5A 2VYVA 2ZYGA 2HU2A 3FWNA 3HHPA 3RU7A 5FYDA 1NVGA 3TOZA 4F6LA 3RASA 1AHIA 4RPKA 1R4MB 4Q3CA 1E1NA 2FWMX 2V6MA 1H2HA 3DAPA 3GAZA 3V2HA 5TT0A 1CWUA 4PLPA 5BNIA 1HYEA 2ZTUA 5THKA 3ZWWA 3H9GA 1U28A 3CKYA 1VSVA 3D4OA 2GF2A 1F8FA 4GQAA 4OXYA 1Q0LA 4CUZA 3ITDA 3KYCB 4IDFA 1KVUA 1BW9A 3KM0A 4OGWA 4RVDA 1YWGO 2YUTA 2ZJ1A 5I9MA 4M8SA 3VVCA 4CLDA 1YVEI 4DUPA 3GMDA 1X14A 3QVTA 5T67A 5FF9A 2GN9A 4FN4A 3WX0A 4E0BA 2LDXA 5KKAA 2CF6A 1LI4A 3GF4A 2NTNA 5A9SB 3HDJA 4HV4A 1G0OA 2WTBA 3ON5A 4RV9A 2PKQO 3IS3A 3RWBA 4D44A 2GYYA 3JQBC 2HMVA 4BNMA 2I76A 3NV9A 3QVXA 3DEYX 3WLEA 1JAXA 3CTMA 2DVMA 4H15A 4L75A 5JW6A 4GGOA 3I9OA 3NGLA 1GUFA 4LSMA 3DBHB 2E4AA 3DONA 1NM5A 3UGKA 2X9VA 3I23A 4I5FA 4IXWA 4WLOA 5BSFA 5K9ZA 4RZIA 4BO3A 1JQBA 3VZRA 3JQBA 2BGKA 3BMCB 3PZBA 1VPDA 3QE3A 3IUSA 4ESOA 1E6WA 2PKRA 3ENNA 2GN6A 1VJ0A 4E31A 1KEWA 3O8QB 1SZJG 2NQTA 2P4HX 2Q2VA 4CL8A 2DLDA 4XWYA 4E33A 5IXYA 1DIRA 1Y1PA 3KETA 1DAPA 4RVHA 6LDHA 1SEVA 2AQKA 5JO0A 3NYWA 1J49A 4XRGA 5TNXA 4NJMB 4N5MA 4YWJA 3EZYA 2YHUA 4A27A 1AXEA 2GCGA 5TIIA 1N9GB 5JDIA 3IOYA 2O50A 2H1SA 1E3LA 2RCYA 2X5KO 1E7SA 3DBRA 4OSPA 4CM8B 1VL8A 2QZZA 4DYVA 1YL6A 1EVIA 4RQUA 1LLDA 4MIYA 1H6CA 4J7UA 4LGVA 3ZDFA 1I3MA 1YONA 4WGGA 2GSDA 3MCVA 4R1NA 1DJQA 4D79A 3SJUA 1LDGA 4NK5A 1ZXBA 1IPEA 4J0FA 4WCFC 4PLGA 4YXFA 2ZK7A 5TGDA 4Z3KA 4EUHA 5ITWA 2JCYA 2WYVA 5T5QA 4DPMA 2BHLA 2E49A 2X23A 4WEQA 2F00A 4DQXA 2O3UA 1LDMA 2BFPA 3DOCA 3WGGA 3GN1A 2OP1A 3ZV6A 2BFAA 1PQWA 2Q99A 3C8MA 2GPTA 1B26A 3PVZA 5I8ZA 3U5TA 1LSOA 4L76A 4JJGA 3QWAA 5A05A 2BH9A 4IIUA 4Y98A 5KJFA 3ANNA 4P38A 1ISIA 1ONPA 1XELA 4B7XA 1SBYA 4AJNA 4BQRA 3W4KA 3WR5A 4YPOA 2JAPA 5A3JA 3INGA 1ADFA 3CSDA 4QT0A 1IB6A 4C7JA 3NAQA 2E37A 3JYPA 3AY6A 4RF4A 4CMIB 2IXAA 3BMOB 4PLZA 3ICPA 5IN5A 5JC8A 1ULSA 4BGEA 2ZJ0A 4XYGA 5L40A 4DIBA 4UVDA 5DZSA 4W9NC 3H6KA 1ZJYA 2DAPA 4CLHA 3EVTA 1HTBA 3F4BA 1GZ6A 1PL6A 4W82A 3WG9A 4NFYA 4IDBA 2OMEA 5LDHA 3JYLA 2Y1CA 3L9XA 1HZJA 2WM3A 3K2BA 3NT2A 2HDHA 4AJEA 3GMSA 3BMQB 3LK7A 1H93A 3DWFA 2Y0CA 3NKLA 7MDHA 4J16A 1VM6A 3A4VA 4GAEA 1B2LA 1HDYA 4J9UE 4NBVA 3CE6A 3I9LA 2XOXA 3E9MA 1JKJA 2GASA 4GX5A 4YTEA 1I30A 3B6ZA 4KWIA 3N74A 1B0AA 1QLJA 4O59O 3ZWMA 4ZQEA 3ANMA 1QKIA 3F47A 4OXKA 3L6EA 5L3ZA 3RC1A 1Y8QB 1KC1A 4AICA 1TT5A 4GI2A 1NVMB 2PGDA 4JROA 2WD7B 3C85A 1P1JA 1ID1A 2OGUA 1BDMA 3GC6A 1MXFA 2O2SA 4LVCA 5BSEA 2IYPA 3ZNNA 2AG8A 1L7DA 1PS8A 1NFFA 4UEOA 2B0JA 4IS2A 2J3IA 3GQVA 3AI1A 1Q0QA 4RDHA 4BNWA 3D4NA 1SAYA 1WP4A 3PRJA 4BMVA 4NBUA 1ONNA 3FNEA 5G0UA 1WDKA 1I3KA 1X1EA 3C3XA 4LCJA 4UEKA 2G0TA 1B14A 3KOUA 4MVJA 4R1UA 3I6IA 4EJMA 3H8VA 3OIDA 4Z9XA 3SEFA 5HRUA 4W6ZA 5IFLA 1BXZA 4RJTA 4XQ9A 5K6AC 3HSKA 1ADGA 3I4FA 3ONFA 4BNJA 2PZJA 3RUEA 3PDJA 2HMTA 2O4CA 5I8WA 3TDKA 1GADO 1SB8A 2BFMA 4CLRA 1DIGA 4OKIA 1Y5RA 4CUKA 3H3JA 5TT1A 2LDBA 3NT4A 5IDWA 1ZXLA 1I2CA 3KEQA 3NTOA 4GBJA 2F1KA 4BB6A 1SOWA 3D5TA 2C7GA 4CV1A 1V35A 4JJFA 1CQJA 4PLVA 4NIMA 3QV1A 3ZNQA 4CQLA 4E5PA 4DWVA 1DFHA 3M1AA 3OIFA 4ROSA 5EPOA 1K0UA 4M55A 2DBZA 4DVJA 2A94A 3Q3CA 5BT9A 3L4BA 3DAGA 3VH2A 4URFA 1HRDA 2DT5A 2IRWA 4JIGA 1R12A 1T2AA 5KTKA 3KZVA 4YAKA 5GY7A 2HK8A 4XGIA 4BQPA 3SC4A 1XLTA 4CMEC 4XR4A 3LT0A 3B1KA 4ND1A 2OOSA 3LT4A 1P74A 3RI3A 3KLMX 3D3WA 3AI3A 3EYWA 5FEUA 4RORA 4WNCA 2FPGA 1ENZA 1NAIA 4WPGA 4DBZA 4JP3A 4PCVA 4YJHB 4UVGA 1M6WA 1T2EA 2VRBA 3KYBA 2D5AA 2OHXA 2PH5A 2DC1A 3LVFO 3WGOA 3MJSA 1P44A 3GDGA 4FJ1A 4Q3BA 4DQUA 1U2GA 3DMTA 4YT8A 2O3JA 4B3HA 4WECA 4UVIA 3FR8A 3NDJA 3K92A 3O38A 5AYVA 3RBXA 1A7KA 3VHRA 4AJIA 3DBLA 1Z75A 1NFQA 1DLIA 1UXJA 2Q45A 3A28A 1K6XA 2OZPA 2X5JO 5IDYA 1A71A 3ZU5A 1UAYA 1E3JA 1OOEA 4XQEA 2I67A 1CRWG 1B8VA 5KJEA 4CLXA 5ER6A 1HEUA 3QHAA 5ES3A 3W8FA 4CMCA 1RM0A 4KDEA 2D4AA 4PGFA 1O94A 5ILGA 2X0IA 4DQVA 3GN2A 4E6PA 3F9IA 3SC6A 5AXBA 1H9AA 1RYDA 3JQGA 1HE2A 3DTTA 3ZWAA 3Q2KA 3RROA 4CM3A 3ONDA 5F5LA 4R1TA 2OUIA 4UVEA 2RHRA 3AUSA 3KO8A 2DU8A 3GGOA 5IN4A 5EERA 3PJDA 2VZ9A 3SBOA 4FC6A 2UV8A 2BFOA 5F21A 5AVOA 3TZHA 3KSDO 4JGBA 3DFZA 5C7LO 3VH1A 3VTZA 4YEDA 4BO7A 3OP4A 3JQ8A 5DDIP 4E2YA 3E8XA 1UP4A 4R51A 1MXHA 1SCUA 1UXHA 1F12A 4J91A 1DLJA 4L4SA 3PTZA 1MB4A 4NNJA 4BNUA 1LU9A 4U6QA 1C3VA 1HF3A 2FRDA 2HSDA 4KQXA 4HP8A 1HE4A 3E6AA 5DBFA 5TC4A 3RSHA 1PZFA 1P45A 5JS6A 3NUGA 2C20A 4WE3A 3X2EA 2J3KA 3GA0A 3LF1A 4IJVA 3GGGA 1HDRA 5KOIA 1E7YA 3A14A 3DZJA 1CETA 4BO6A 4HFMA 1E7RA 4QTZA 4HWKA 2B35A 3IL2A 5FFFA 1K6JA 2V6FA 1BHSA 2H9IA 3IUPA 3E48A 2VT2A 4IJUA 2VYVD 2FOIA 3EGOA 5DOVA 1YXMA 4JBGA 2W2KB 1DHRA 4TZTA 4N7RA 1LDYA 1J0XO 4YRAA 1O8CA 1PQPA 1HE5A 5HBRA 1N1EA 1U8XX 5C37A 5IZ4A 3BA1A 4QX6A 3V8BA 1IZ9A 1IL0A 2NADA 2DFVA 3FR7A 3O9ZA 4O63O 3E18A 4BKRA 4GWGA 3PHLA 5CHEA 4MPDA 1PWXA 1GTMA 3L07A 4QFCA 4CM9D 3R6DA 2QZ9A 3PIIA 1Z7BA 2ZTVA 5I7FA 3LDHA 1BDBA 3L9WA 4XYBA 2AQHA 4XR9A 1I8TA 3G17A 4N18A 1FDUA 4RZHA 4PG5A 4IQ0A 5KVVA 5LDGA 4MVJI 4B4WA 4ZRNA 1SPXA 3ANLA 5TSDA 1I2ZA 1PWZA 2ZTLA 2RAFA 2DUWA 4IPTA 1KIFA 2Z95A 5KJ6A 2I6TA 3ZWNA 2IE0A 2YYYA 3DR3A 3VPHA 1PX0A 3IIEA 4FQ8A 5CAEA 1NASA 5LCXA 4DC1A 2X9GA 1H9BA 1P1HA 3RAJA 2IXBA 4IJWA 1KEUA 1TVEA 5HTOA 1KVRA 4J1TA 5DULA 5A9TA 4IDCA 3RUFA 2HJSA 3WDSA 4CM4B 3BXXA 4DIOA 1GY8A 1JVSA 2Q3EA 1LXCA 2P5YA 1DC6A 3PWSA 3UF0A 2WYUA 2NU6A 3LLSA 3ZI0A 1KVSA 2W8ZA 1DOHA 5JO9A 1FF9A 2R2GA 2QG4A 3JSAA 4XYMA 1CDOA 3JQAD 1ZJZA 3HB4X 4CR8A 4MP8A 2B4QA 1TEHA 5COQA 1T1SA 1XU9A 1YBVA 5EMHA 3R3JA 1E3WB 3E1KA 3F5QA 2JHFA 5JAMA 4XIYA 2JCVA 3F1LA 1EUZA 1PGPA 3H4VA 5L4SA 3GG9A 4IIVA 1HYHA 3UW3A 3KYDA 1PJQA 2QHXA 3Q9NA 4RO0A 3LQFA 4C4OA 1DRVA 3E9QA 5F5NA 1PZHA 4R4JA 1LRKA 4PLCA 4XQGA 5TX7A 3ADPA 1JWAB 1YB1A 3IJPA 3NTQA 3Q1LA 4HFJA 5JYEA 3L4SO 3QW2A 4R3WA 4RF3A 3LC7O 4HNGA 5KNLA 1E7QA 3DC2A 4GSKA 1KETA 1W6UA 5G4KB 2OXIA 2NUAA 3GLQA 4TVBA 1MC5A 2O7QA 4L8VA 5JAIA 3JQ9C 3WSVA 1GPJA 2DTDA 3G1UA 4IY1A 3OSUA 4BO2A 3N58A 1CEQA 1XWFA 3AUAA 2R00A 3ICCA 4NFSA 4BNNA 1JTVA 5AXAA 3VTFA 4FFLA 4EUFA 3BMNB 3GK3A 3ZWBA 2FR8A 1WDLA 2NWQA 4J9VA 3WGYA 5C7IO 4DPKA 1MFZA 1CERA 4II3A 1E1MA 3FWZA 3O03A 4YVFA 4AJ2A 1L7EA 3HFGA 3KHUA 2B4TO 1I01A 1I5RA 1DEHA 3F1KA 1D7OA 2P9EA 4P4GA 4I9HA 3VH4A 5I7SA 4LMRA 4XGNA 5J23A 1V0JA 2CDAA 2ZQZA 1B3BA 1YL7A 3H2ZA 3K5PA 2A9FA 4WCFB 3TFQA 4NU5A 3QWFA 1DIHA 3H65A 4BO4A 1XR3A 3H7AA 3S8MA 4EBFA 2OFPA 2AHRA 1F06A 5EL0A 2CSUA 3GPDG 4GPD1 3CPSA 1GQYA 3ITKA 5GZ3A 2PGLA 5MDHA 1WMAA 1C1XA 4WOKA 1YJ8A 2H5LA 1N92A 4CMAA 3RUCA 3OA0A 3RQSA 4BGVA 1EFKA 2NU8A 3BAZA 3V5NA 3C24A 2VRCD 3INTA 3RFVA 1D1TA 1YBMA 2VWHA 3OA2A 4INAA 4CMKA 4TQGA 2OORA 1NP3A 6ADHA 1QORA 4Z6KA 5GZ6A 5IZCC 1HE3A 1RM4A 3GGPA 3H5AA 5DF1A 5JCJD 4XX0A 5ADHA 2VUTA 3U9LA 1S7CA 3V1UA 2CDBA 2FY8A 4ZQGA 1PJLA 3GFBA 2BI8A 1BMDA 3WICA 4YJFB 3RUDA 1ZNQO 2YHIA 3Q2IA 4PN3A 2J5RA 3ETDA 4B79A 3I9NA 4L74A 5G0TA 2GDZA 2NTJA 2ZQYA 4J1NA 4RVUA 1MUUA 1KEVA 2I99A 3DQPA 1V8BA 1XA0A 4QEDA 4Z0HO 5THQA 4FOOA 3TL2A 1LDEA 1F0YA 1DC5A 4HY3A 3GVCA 1ULUA 4D0SA 4EEXA 1GL3A 4L4XA 1LRLA 1V3UA 1YDEA 3DMYA 4ZU3A 5TJ9A 1KYQA 2CVQA 1YBAA 3Q9UA 2AA3A 4YAEA 1R4NA 1IHXA 3C1OA 4XJTA 4CLOA 4BNTA 4NH4A 3G49A 2GN4A 3D3EA 1C0IA 1PL8A 4JNKA 1YRLA 3G3EA 5DP2A 3GVXA 4I5EA 2B83A 4YJGB 3ASVA 2B4RO 5T6BA 3TOXA 4TWRA 5L7WA 1EDZA 1ML3A 5CDTA 4FS3A 2PFGA 1NR7A 5C7OO 1XHLA 4B7UA 1FMCA 2XPCA 5KVSA 1EQUA 4NFHA 2ET6A 1I10A 3DO5A 2PV7A 3P19A 4CM8A 2C0CA 1CYDA 1DXYA 1PR3A 1XCBA 4MVJD 1NHGA 5AQ1A 4PRLA 3VDRA 4BKQA 1C0LA 1H6DA 2Y93A 2QIOA 4WLVA 3W6UA 1YH3A 3MWDB 4I8XA 5JBIA 3V2UA 2JKVA 1R37A 1E0DA 2DBRA 2J6IA 4IQGA 2QRJA 5ENVA 1BVUA 4AJ1A 4KWHA 3OM9A 4EUEA 3IAHA 3ZU4A 1U2DA 2AMFA 3NJ4A 3DHNA 1LRJA 3KRTA 1A9YA 1TI7A 4YDRA 3NGXA 2E48A 2X8LA 3VZSA 3EK2A 3RUIA 4A10A 3PHIA 1X15A 1NBOA 4UREA 1UH5A 4DL9A 4BKOA 4F6CA 4XCVA 4M1QA 3S2GA 3HB5X 1PIWA 3GNSA 4RF5A 1XKQA 1MG5A 3GNTA 3N7UA 3H9QA 1OAAA 2I66A 2ZATA 5JE8A 1WW8A 3PK0A 4FDAA 1I0ZA 1ZK4A 5EQDA 4MVJF 5F1KA 3ZV3A 2Y1GA 5CDSA 1ISMA 2IEBA 5EIOA 2WSBA 1EUCA 3I52A 2NVUB 1O9BA 3JQ7B 2GRAA 3WIEA 4JCOA 3UCXA 3FI9A 2VUSA 5I7EA 1A4UA 4II2A 5K6AA 1JAYA 4DA9A 3D5QA 4OM8A 4CODB 3BMOA 4WLFA 3ETGA 4MJLA 2B5VA 4ND4A 4Q3NA 2AE2A 4KMSA 3AWDA 3DHYA 3L6DA 1A9ZA 1HETA 2GUGA 4D41A 4BS9A 1GV0A 3MTJA 3QLJA 4K6CA 3W8DA 3JYNA 4D43A 1YO6A 1YL5A 2X86A 3KTDA 4MOWA 5C5IA 1UZNA 2GGSA 1LQTA 4RPJA 1Q1NA 4PG7A 1PZEA 4AVYA 2PR2A 1PJ4A 3KLPX 3VPSA 2PH3A 1OFGA 2CF5A 3KYCA 4CUJA 4B8WA 4XYLA 4ALIA 2WDZA 4OKNA 3ABIA 4UUMA 4CV3A 1ZSYA 2ZB7A 1DHTA 3NTRA 5JDIC 4DMLA 2GZ2A 2O23A 4K9DA 1RM5A 1ZZEA 3RUAA 3DFUA 4OOFA 1ZFNA 2VWPA 3RC9A 5KJ1A 2TMGA 4IZHA 4E2XA 1WZEA 3FBTA 3IQDB 1B8UA 2WD7A 3IDSA 2Q46A 1ADCA 4BV8A 4DC0A 4E12A 3JQ9A 3SXPA 4DREA 2POQX 1IPFA 3W8EA 1VJTA 3CIFA 1L1FA 2AE1A 1PQUA 1VL0A 2C59A 4BNHA 3I3OA 3GZNB 4YQZA 4EZBA 3TSCA 3M2PA 4YAJA 3O4RA 4WOJA 5F1OA 5ICMA 2I9PA 1R16A 3DBHA 3EVNA 4D45A 5DNAA 5L4LA 5G0SA 3HJAA 3KBOA 5LC1A 1DIBA 1UAGA 4OOEA 1XDWA 1O5IA 1T24A 1T2DA 2J3JA 3OJ0A 4ALJA 4YB8A 1MFPA 1M66A 2ZB4A 5F1PA 5CDUA 3KSZO 1H6AA 2YY7A 4XDYA 4TSKA 1TLTA 2IDZA 4XKJA 3A1NA 4Z9YA 4R68A 5JXWA 1ADBA 2HJRA 5ILOA 4I5DA 3NJ8A 4PLYA 3AUUA 5T64A 4TKLA 4LMPA 5C3MA 2IEDA 3FN4A 1BGVA 2EP7A 3LT1A 1TB4A 5FI3A 3VZPA 1OC4A 4GKBA 1WAMA 3BHMA 3FNFA 1P9LA 1QYWA 3AM4A 1P3DA 3R1IA 4G81A 1C1DB 3AI2A 3DBRB 1NFRA 4TKMA 4DXHA 1PGOA 2QW8A 3G79A 4E30A 4YT4A 1HDZA 1PR9A 2BGMA 1V9LA 3PQEA 3GVHA 4L4RA 4Y6PA 5BSHA 3SVTA 4W7IA 1X7DA 4BUCA 2EGGA 4OHUA 2NV6A 2W2LA 4I9UA 4BL5A 5IJZA 1PGNA 4A73A 2BELA 4YAIA 3SLGA 5I9LA 3STHA 1NVTA 1J6UA 4J90A 4Y8VA 5A4DA 3T4XA 4LISA 1AXGA 4OL9A 3RFXA 3BHJA 2FN7A 2RHCA 3ZGYA 1HSZA 2NU9A 4YRBA 2B69A 2H6EA 2WE7A 3UAGA 1BXGB 4B4OA 2Q1WA 5IZCA 3VH3A 5G0WA 2ZCUA 3JD1A 1A4IA 4H7PA 4ZD6A 5BSGA 3E5RA 4Z9FA 5JFOA 3JQFC 1OBFO 4I08A 1YQDA 3WQSB 4CQMD 5B12A 1BG6A 1E1KA 3AY3A 1NX6A 3QWBA 3PHJA 4J7XA 4J1SA 4E13A 5CEFA 2DM6A 2OO5A 2ZCVA 2WMDA 4N5LA 5T57A 2H63A 2PK3A 3GRPA 5BNFA 4EDFA 1JA9A 1DFIA 4MKXA 4TRJA 3FD8A 1GCOA 3NEPX 3TN7A 4D46A 1IZ0A 3JQ6A 1NQOA 3QVWA 1C0KA 2C2XA 2VN8A 4TVOA 3I9JA 3G0OA 2CUKA 1GZ3A 5ENDA 1GPDG 4B4VA 3KVOA 1Y8RB 1KEPA 1LJ8A 2HMWA 1GU7A 4RF2A 4WEOA 3E03A 4ND5A 3RBZA 3ENKA 4CMIA 1AGNA 1SEPA 5CG2A 5H83A 4PG4A 5IG2A 1D3AA 1X0VA 3GUYA 1GYQA 1GCUA 1SC6A 3TF5A 4MIEA 1M67A 3EDMA 1U8FO 3RD5A 3JQDA 4HFNA 3C7AA 3KV3O 3VPFA 2UVDA 5B37A 4RPHA 1JKFA 4KOAA 4PIVA 2Z1NA 4CMGA 4YBZA 1VJ1A 5EESA 1VLLA 1H94A 4A0SA 4BOYA 3RJ9A 4W4TA 4YACA 1EK6A 1ZK3A 3SLKA 2B37A 1B8PA 2JFFA 1RYEA 2Q2WA 3T4EA 1F17A 3OEYA 4RLSA 2VHXA 3BHIA 4D0RA 3KEOA 4DIFA 2VHVA 3OQ1A 3I5MA 4FGSA 2FPPA 4YT2A 1Y8QA 4LCEA 2EKLA 3BTVA 4DMMA 3FRJA 2RH4A 1QP8A 3U3XA 5B4UA 2QX7A 5EJ2A 3DZIA 2PKQP 3GZ4A 2WEKA 3VVBA 4FGWA 4IUYA 2NVBA 1VC2A 1HXHA 1EVYA 2PWZA 4BNVA 2Z1MA 4ZGWA 4CM7A 3ULKA 2HK7A 2IYOA 1R15A 3ADOA 3GNQA 3PYXA 5HWSA 3ZNOA 2SCUA 2HMSA 4GMFA 5JC1A 1E3EA 3COSA 4BKPA 2AG5A 4FJ0A 5L7YA 5COBA 3WQQA 2P2SA 4ALKA 3HN7A 3WMXA 4Y67A 2YJZA 4OSOA 1TXGA 2P91A 3EHEA 1P1FA 1OMOA 3L4BC 5BNTA 4UEJA 5DCYA 1EVZA 2RIRA 1MG0A 4ZICA 5CFZA 2HRBA 4QFDA 1KS9A 4GLLA 1PJCA 3MJTA 1R0KA 4BNZA 3GR6A 3DHEA 3ST7A 1ZEJA 3PLNA 3PZRA 3ZHBA 4GL4A 2BRUA 4M49A 4OYRA 4WKGA 1KY4A 3ASUA 3GHYA 5JAQA 3D4PA 4CLRB 1X7HA 1NYTA 4AJOA 4RVSA 4XB1A 1LSSA 5L51A 4RL6A 2PZLA 4HKTA 3WTCA 3PP8A 4Q39A 2NU7A 4Y6RA 1UP7A 4CM9A 1PTJA 2O3SA 3OQ6A 2UUOA 4J3FA 1JU9A 3ZWPA 2A35A 5L45A 3OIGA 5H81A 2PD4A 1ZK2A 4MP6A 2QYTA 3VZQA 1QG6A 3C7CB 2JFHA 2E82A 4OQZA 4BO0A 4EJ6A 4ZA2A 4RVGA 5MGBA 3P2YA 1H6BA 2Y05A 3VOSA 5F3RA 1GYRA 3K96A 4J4TA 3WNQA 4AL4A 5JDCA 5JNLA 1D8AA 2HRZA 1NPYA 1CF2O 4CQMA 5G0VA 4W7HA 1U3TA 3PHGA 4DPLA 3TL3A 4GWKA 1T25A 4JP2A 1D4FA 4TMFA 1EEHA 3I4CA 1DAOA
chains in the Genus database with same CATH superfamily
2CFIA 4HD8A 3DCJA 2DBQA 3DWGA 2UYYA 3GG2A 4WK2B 5JQWA 2JLUA 1SK9A 5I7VA 4KRGA 3L1VA 4UTPA 1P0IA 1DAEA 4LZPA 5LOVB 1ZKMA 4U0KA 3BQMB 4O2RA 4C0HA 2G9VA 1ESNA 2N3ZA 1EE9A 1UBMS 2Q6KA 2WJIA 3FDZB 3R5JA 1I2DA 4FE3A 4I1SA 1U7UA 1HLPA 2QRLA 2Z08A 2AUMA 2GVZC 3PX3A 3TX6A 4WXHA 2XRMA 3AKDA 3BEDA 3IUJA 4LBWA 3T1QA 4AJ9A 3BT7A 2AMVA 2QTGA 3O93A 5LZ7A 4CCYB 1R0CA 4C01A 4MKZA 4YCJA 2AT1A 3LD9A 5TGTA 4ZN6A 1E2KA 3P0HA 1DBWA 3EC7A 5JY6A 1D2RA 1VL5A 4HXYA 1IWBB 3OZCA 1T36B 2EP5A 1NSYA 2PLAA 5DLDA 1B0PA 4MW4A 5JH7B 4YN3A 2BIFA 3E84A 2ES4A 3L7BA 3P2EA 5FI1B 2ECPA 4A2QA 3BIWA 3TXAA 4HI0E 4U3JA 4IWXA 4B9EA 4FW8A 3T5BA 2OORC 3PD7A 1OASA 3E35A 3PKIA 3EOAI 1OZGA 3KLBA 4YR9A 3FWPA 3WGMA 3FPKA 3SYNA 4JP5A 3OETA 3AVOA 4AZ3B 4LJSA 5LQUA 2PL1A 2WHXA 4RLHA 3UEOA 5IH7A 1E7MA 4KN5A 4ML3A 4QYIB 2V4MA 2IEYA 3EMKA 2SKDA 5MN5A 5C8DA 5HJEA 2DTXA 5JCZA 3ZD8A 3DZKA 4HSGA 3EZ2A 1R6VA 1CS4C 3SN6A 2YQ5A 1KE1A 5KWVA 1RPZA 2WJJA 4JUIA 2PA3A 2Q0QA 4KZPA 4PR3A 4LWOA 5T4FA 3FTQA 1DSSG 2YJ3A 3IPCA 4IIHA 3F0TA 4ZAWA 2BHTA 1T9BA 3BA6A 1A9QA 1C3OB 1MIOA 2PSDA 4ZHQF 1ZK0A 1W25A 1DRJA 1FFEA 1T5OA 2RBKA 1MHPA 1V1MA 3A1CA 3C1AA 2OCDA 3F7TA 4PBRA 1A1SA 4B6FA 5BWNA 1E1LA 3QKRA 5KNDH 3NM5A 3NWEA 4X1IB 3REQB 3MHTA 3TKLA 1Z3CA 3AWIA 2Q3MA 3E9NA 4RJKA 3U7HB 1HNZB 2XF8A 3RYHA 3URMA 3E9ZA 2XGMA 4H7JA 1U98A 5DLPA 4CKEB 2QQ5A 3BS4A 4J29A 1EDOA 3RREA 1F2VA 4RK7A 2HBYA 4DV5B 2QP3A 3ZBTA 3HI6A 1Z73A 4IWNA 1YFJA 3R9XB 5T8KC 2VT3A 4JR2A 4E4TA 4L72A 1T5DX 2GVNA 4M0PA 3VKFA 3U5ZB 2QMHA 2WZCA 2WWHA 2CY0A 1C9JA 3KDSE 1ND6A 2G4VA 2O7RA 1ENYA 4YDHB 1NVFA 1PWEA 1XF9A 4IX9A 4L5CA 4UBLA 5EWLB 3TW8A 4B3RB 4IUCS 1YOVB 1ADYA 3WL3A 5HE9A 2EJCA 3OCZA 4JS0A 3RM3A 1U6JA 2WFLB 3NM4A 2QA5A 1E59A 2XW6A 1XGKA 2OFOA 3M7IA 3R5FA 1EFRD 1KJNA 2ZRLA 4BDSA 4C03A 1JTEA 3GLFE 3I92A 3P0RA 3UMVA 3WL6A 5LP1A 4D0GA 2RCNA 5CNKA 3CUEF 1SZDA 4NU6A 5GZ1A 4KQKA 4HWOA 2UUPA 1B6RA 2J9ZB 4IINA 1N2JA 1Z07A 1GKLA 4U7PB 4B32A 5JQGA 4H3VA 4Q82A 2HZ7A 1F5SA 1S1MA 3D64A 2AXNA 1LLQA 1W73A 2JFOA 3OJXA 3QFFA 4Y6SA 5TVKA 5F9FA 1JN0A 3DE0X 3W6ZA 2AMJA 2ARKA 3EEIA 2AG0A 2P5UA 3U7EB 2BGLA 2J5XA 1XJCA 2ESRA 3KSUA 4HR7A 4X3PA 1UANA 1XP8A 3O8CA 3O26A 5FOSA 2DXIA 1CG6A 7GPBA 1DQRA 1VCIA 4YJFA 1Z4NA 1PUIA 4GU5A 3TB4A 2IP2A 1WETA 1ZIDA 3BKWA 2ALJA 3FJOA 4RKEA 3VISA 3VYWA 4DLLA 1GYPA 3UA3A 5HQTA 1Y63A 2GNPA 2NXJA 2WSLA 2OWDA 4IVRA 5HZKA 3EPLA 4LOLA 4REMA 1IVSA 3Q6NA 4MGEA 3PVSA 3LVQE 1E0SA 5FFNA 2BEWA 1PEYA 1VLJA 1G6KA 2MMGA 2JB9A 3KP1A 4M7RA 3H2JA 4D9JA 1SUIA 4JQSA 5TQ0B 2H0RA 5BXQC 1LNQA 2HU5A 3Q12A 3HSSA 5IBQA 3QJ5A 3H1EA 4LJLA 3KZMA 2XCRB 1KP9A 4TTAA 1IDN1 1FX0B 4ZALA 1TM3E 2J5BA 2CFRA 3AP1A 1J0BA 3CUWA 3OBBA 3P9CA 3JQCA 2PT6A 4OXIA 2W98A 5HQ3B 5IC5A 4C88A 3SJ7A 5EXXA 2HQSA 5HW0A 1ZKDA 4CKWB 5LMNB 2EIHA 4PZYA 2IU3A 5ESRA 2B98A 4YMHA 4GOKA 1RS0A 2OILA 4RSGA 3TIVA 1C7FA 5JCPA 3DVAB 1CZHA 3DBVO 2C07A 3PIRA 3ENWA 2RFLA 3Q8XB 2IE8A 2YOGA 4M9SA 1GPNA 2NO1A 2QAGB 1PQ4A 3UJDA 3SXUA 1EHIA 2FFBA 2VXYA 4NCNA 3E7PA 4FR5A 4B8YA 5FO1A 3R8XA 4QO7A 2C98A 1I6KA 1A8HA 2GO1A 2YNMC 3AINA 1XTRA 5GGXA 4KQFA 1JFSA 4D3SA 4LRTB 3X1WA 1P5FA 3USZA 1EWYA 2XWJI 3ROMA 2C42A 3RPEA 2BCEA 1Y80A 3OLWA 4IIVA 3TQOA 3UHAA 8OHMA 3MTDA 3V8VA 1RYYA 3DEFA 1VRVA 2JGEA 2Q0XA 3CCBA 3GRKA 3H9CA 4WT7A 2V98A 4YRPA 4ZVKA 3WK6A 1F8GA 3B8EA 3DL4A 3CWQA 5DNUA 4V0RA 1BMFA 3ZUPA 1EE2A 1OREA 3RRZA 3AVPA 1O96B 3SQOA 1PJTA 2DUUA 1Z68A 3FMVA 2PBZA 5AXDA 1NPDA 4EFNA 5K8UA 2FX2A 4UUOA 4H3KB 4LYDA 5BNWA 3BL6A 1UBRS 3DL2A 3E3MA 3QU9A 1R66A 4L50A 5U1PA 2D2FA 3Q8WA 4DDWA 1JHQA 1GGEA 3EULA 3WRYC 1RXIA 4Y30A 4DCNA 2ACWA 1U9JA 4FE4A 2NTVA 4OHRA 2Q1TA 3EVAA 5CFLA 3L0PA 221PA 2XCLA 2A0WA 1JMVA 1GRNA 5GAJA 3WGNA 4DCCA 2HA4A 3QNUA 5EPEA 3WP0A 2AN5A 2J9XB 3FX2A 4M83A 3UIEA 4MR7B 5DK4A 1N0HA 4DUZB 4Q5IA 1Y81A 4PFJA 1B7GO 3SDSA 3RHZA 5AW4A 5J5VA 4CPDA 1QHHA 3HXQA 3ITEA 4U4AA 5A5VA 3LPNA 3TRIA 5JZSA 2R8OA 1JHYA 2HLPA 3A1SA 3ZW9A 4EQZA 2V1UA 1ECGA 1BFUA 4Q4JA 2LCQA 1GAEO 1Z5PA 3NYRA 2A30A 3WIDA 1MJNA 4BVKA 4AI6A 3FZNA 4CJXA 1IZYA 2PANA 2JHPA 4HS4A 4M1ZA 2GZ1A 4TV9A 3WYCA 3HKBA 3ONNA 1OGIA 3L0BA 3MTIA 2YWCA 4FCCA 3M5DA 3ZVLA 2QUIA 3L77A 1FP4A 1T8SA 4I50F 3W5AA 1OBOA 2QR2A 3KKQA 1BE6A 1KMIY 3O73A 5FTMA 1RSZA 1H05A 3JQEA 3K0BA 3KR0A 2QTFA 5AKKA 1KWGA 2VTVA 4CKZA 4A36A 1L5KA 3HCBA 3UCFA 1SUWA 2IELA 5IK2D 1DMSA 5KWEA 5CLHA 1G9XA 2MDTA 2X13A 3I2HA 1P7VA 5DGIA 1XZPA 3L0DA 1C4WA 4TKZA 4TTTS 2JKYA 5L53A 1XPOA 1VPWA 3AEUA 1WPGA 2QE7A 3BB3A 2XTNA 2JIOA 3JD0A 5TF4A 1C1XB 3PNLA 3UZUA 3ZQKA 4PQRA 1P1RA 2Z9CA 2BGTA 3QA9A 4WLUA 4E3WA 2DLCX 3E9RA 2N46A 4JT4A 2OGWA 2AOTA 3VV3A 2XD9A 3VX3A 2NO0A 3IRVA 2N42A 5KOJA 2EQ5A 1VJCA 1E3QA 2PGIA 3AR3A 1US8A 2ZR9A 2ISSD 5IYZA 1NAHA 2XF2A 3ZCSA 4KPEC 3E9EA 1S3SA 4IYRA 3P27A 4FOSA 1HE8B 1ORDA 1Y3AA 1IM8A 1WU8A 4S1NA 3HLKA 3MOGA 5JDCC 4NZNA 3UHOA 1JHDA 4KV9A 2ZIUB 5F7ZA 4KX5A 4D8YA 5JISA 4FGJA 3PQDA 1U28C 2NW6A 2GCEA 1G9TA 5BW6B 4F1WA 1CSEE 2HGSA 2HMYB 4ZVTA 3TKAA 5HKOA 5F2NA 4TMVA 2A78A 4NYMR 4RTQA 5AVUA 3FMFA 4ISBA 2VJOA 4R2JA 5EIWA 3H2YA 4M8KA 1G16A 3CWCA 1AOXA 1L5VA 1SOUA 3AVUA 4JLWA 1XCLA 3NX4A 2X2EA 3M89A 4GZ6A 4HB4A 1QV6A 2X4LA 3ELBA 1YT5A 2XMSA 3NP9A 1CJBA 1JILA 4JI4B 1RU3A 3PQ8A 2CHQA 1DEAA 3ZNPA 2O48X 4A15A 1ZM9A 3IELA 1UFOA 3RAGA 2G5CA 5A9SA 3CEAA 1ZH4A 1EK0A 3F71A 4NMMA 4GX0A 4B3BA 3A1TA 1O2DA 1A4XA 3P9KA 5I3CA 3CVVA 4IG4A 1XEWY 3BERA 3VU8A 4IRUB 1COWD 1M1YE 1QYXA 3H2SA 1KH3A 3B1XA 1K8RA 4PAOA 3TTWA 1WCWA 2N9UA 1NZFA 3AFNA 2G28A 3KVRA 3LI2A 4P93A 3GP8A 4TYNA 1LPBB 2XDYA 2QMQA 3I04A 2QTVB 2JCBA 3RGGA 4RK5A 4S1TA 2P90A 2PL9A 3BBPA 1N6OA 2W43A 1IHDA 1RNLA 3LQ2A 5IAEA 3PYMA 3A2LA 3V4PB 1U9IC 5ENZA 2GEBA 2XE4A 1XRPA 1ZJWA 2C29D 4MVJG 3OT5A 4HQ6A 1UEIA 3F7NA 4LK3A 5DHSA 1NUSA 1NMQA 4HEJA 4RIEA 5SV2A 2IZ7A 4M0DA 4EA8A 3QPAA 2YN0A 1NBHA 3H5WA 4CEIA 1OWMA 2FE1A 4F7WA 1BXRA 2W6CX 3QUAA 4C21A 2CNWA 2C84A 2VH1A 3A2KA 4U6SA 1E2DA 1MW9X 2GD1O 2IZ5A 1FTSA 2VQDA 4FDVA 4GGPA 1UDCA 4A5SA 2BI4A 2AFIA 2NXEA 3IQZA 4UHJA 5AVYA 3A0RB 3AYXB 4KIGA 3NBAA 2QLFA 5FL7A 1A0OA 5HVNA 1SQFA 1KJJA 10MHA 3MT8A 3NHLA 3P9PA 3T95A 2BMWA 1XTKA 3K32A 1G8KA 8LDHA 2UAGA 4COKA 3BXGA 1BRMA 1P0CA 2A9VA 4XVQA 1T9KA 5REQA 1BAPA 2IY9A 4HL6A 1WE2A 3DDNA 1QCZA 1U2RA 4FFRA 4JP1A 2GK3A 4FHGA 4OP1A 4WBNB 4ZMSA 5CBPB 3OMLA 3PUIA 2JLCA 1OI7A 2I3AA 3FF4A 3CXUA 3H86A 5EUCA 1Y37A 1J90A 2X6TA 1P4SA 2Q50A 1ZW6A 2VNAA 3EAQA 1U3WA 3IODA 3O9MA 4N5DA 5FL3A 3U62A 2OAGA 1LDNA 2XZTA 2CMDA 3VYSB 3RS2A 4O8ZA 2HWXA 4QPPA 2OG1A 2FPGB 5ER9A 4BJ5A 5CXQA 5C3UA 2D1YA 4CF4A 3GFTA 3P0JA 1QCYA 5KYUB 4GXTA 3T8YA 5FXMA 4C2TA 4UXIA 3HUEA 2QRZA 2REQA 4C78A 1DTEA 3UNXA 2ZJ8A 3T4PA 1IC6A 2J07A 1GDHA 4FB4A 1G3MA 3F74A 4K3UA 5AJTA 3ZHXA 4XPZA 1C0PA 2GF0A 1LA2A 1X92A 2HMUA 2Q4RA 1FP6A 2FPLA 2JGFA 3Q7QA 4HNHA 3HUTA 3T7EA 3IP7A 4AURA 5CPBA 3QA3E 3FSEA 1WCIB 2QL9A 3DV9A 3DBLB 2YJGA 4BDTA 1SVIA 3DL0A 3PJFA 1Z8NA 3HB1A 4R1LA 1HNNA 4XTRA 4YRMA 2H16A 1EBUA 3HB0A 5EEGA 4GO1A 3SZGA 4UZEA 3THOA 4BEJA 3IP1A 4DG5A 1QH1B 3OTQA 3X1JA 1YJAA 1GL7A 3JALB 1OT5A 2HLHA 1V7CA 3Q5EA 4Q3DA 4AYXA 4TUYA 2GZSA 1H2EA 5E6UB 5DM70 1U04A 5JANA 1N6HA 1PJ3A 1NWCA 1XZAA 5HUQA 5E7MA 2XDQB 4RAQA 4TV8F 1KYVA 3RFTA 1VKNA 3SKXA 5B3LA 1T4BA 4L07A 4Q9NA 3SIRA 4KLNA 4BNXA 2JGDA 1SBHA 3FG9A 3G7NA 5ARCA 3ZWKA 5AVZA 4KXYA 4YP1A 1RE0A 2PE5A 3TTSA 1R5BA 2I03A 4JWTA 4CT4B 4PZCA 3RYFB 5AUOB 1LY1A 1RMTA 2P4SA 2PBLA 5ILQA 5TQ2B 4A5OA 2FK7A 4OHCA 4BWGA 3IE1A 2CXNA 4OH1A 3IOEA 3AKEA 4IDGA 1YDWA 4R83A 5BW8A 3PDCA 4QPNA 4WLNA 3V1YA 1P77A 3IMGA 3IPYA 5C0OE 3UHPA 1QDEA 2AD5A 3EG9B 4ZHSA 5KNCH 5DHFA 3MJVA 1ZVJA 3C5EA 1G291 1RLTA 2X0RA 4N65A 4F0JA 2QVGA 3VNQA 3CB4A 2ZB8A 4CDNA 2BZ0A 3TVDA 1CW2B 1ODKA 3HDHA 3JQ8B 1Y1RA 4MYTA 1YR9A 2AXPA 3HEBA 5IH3A 4ZV7A 1T2FA 5T3YA 3ODPA 2D8AA 4YJDA 1O1YA 1GQRA 3E2MA 3I9MA 4DSNA 4O2AB 4OIMA 3T7CA 1FTQA 3FCXA 1D0VA 4RD4A 4BP8A 1I2BA 3YASA 4AJ4A 1E3SA 2OL4A 2YICA 4XCXA 2HFKA 4NP6A 1FSZA 1C1HA 1P5HA 2IA5A 3FLAA 5DX1A 3U81A 1IZ8A 3MWYW 1RJGA 2EX4A 1V37A 4QQNA 4ZQBA 4F3YA 1T5BA 4II7A 2CWWA 4AU1A 4ZFNA 4IMJB 2EDAA 2GBPA 2ZYDA 4AO6A 3H8JA 3O4VA 1JT9A 1QQTA 3CCCA 3WZ2A 2FETA 2W2TA 3WJAA 3T7JA 3OFSA 1M76A 3P96A 2DG2A 1V4NA 5ALEA 4BATA 3TPCA 2GM3A 2QTMA 3JPWA 4L7QA 1O6ZA 1WDTA 4LCBA 3LTNC 3VHXA 3EIXA 2R7LA 3O90A 4EL0A 1EGMB 2PAFA 4NNPA 4DDHA 4Y9UA 4UBMA 5JPCA 4HQ0A 2OESA 1DOAA 3CSUA 4B7ZA 2J8ZA 2PUGA 2C5AA 4RHCA 3DQQA 3KWMA 4XGKA 1AGPA 2QSYA 3MNFA 4KH0A 5ISMA 2EATA 3AUKA 3O1HB 4E4YA 4JOQA 3AW9A 3RIYA 1QRUA 2ZRMA 4P5DA 1DTWA 4W1QA 1D2AA 2P6PA 4UQPA 3O4JA 1ZDMA 1G3IA 5ICSA 1UXIA 2RSLA 4Q7MB 4YO7A 3ZBPA 5CB0A 1XZGA 2OBMA 3WNDA 3VR5D 5JNUA 3JTMA 3P5SA 2XUDA 4H4DA 2HSEA 4OYLA 3QK7A 2B9EA 4JJZA 5K8LA 3QRWA 1HV8A 1QZZA 4US0R 1QR2A 1X9HA 3I5UA 5ALZA 5A03A 2IVFA 4MKIA 5CH5A 3EVGA 1RQRA 3I8OA 5AKHA 5ANRB 1V47A 4F8EA 4PLHA 3STXA 2P4QA 4BQSA 4RKRA 1HRKA 2HXGA 4DM4A 4LFBB 1M2JA 4LF9B 2R8BA 4GS5A 3WJ1A 5KTYA 1W1IA 3DMGA 3O4HA 3IO5A 3I42A 4HDCA 4LC0A 3BRQA 5MGNA 5DW0A 1JQDA 2RJOA 4HN4B 3NCTA 2VP5A 2AEMA 3GFGA 3NHUA 3CR8A 1OZ0A 4C3OB 1ECLA 2BYTA 4WH0A 3X44A 4CQMB 7MHTA 1ZY2A 1XZIA 4JB2A 3ZGOA 4IZIA 2OBYA 4H0NA 1KMQA 4I1VA 2R87A 5CTJA 1ZZGA 1CD5A 4L78A 2UZIR 3AFHA 3B48A 3E61A 3N07A 4A9AA 2J31A 4CM4A 5GJBA 2IXTA 2NZYA 1SUPA 3OTWA 4URXR 1AB6A 2RGAA 4FFPA 1MJHA 4GSLA 3B3AA 4Y1RB 4ZT6A 1CS0A 4OAPA 1A69A 1LLCA 2FP4A 3MTGA 4UMFA 2FR1A 1HLGA 1Z88A 2JFBA 3DFFA 3HM2A 3SE7A 4ZYXA 5DVZA 1QFSA 4G65A 1SGWA 4QBFA 2QB5A 1FPQA 1X42A 1VYVA 1UCFA 4PNHA 4Q3OA 3SZRA 1W1UA 1O6FA 2VNSA 3W3AD 2XB2A 4RZUA 3U9TA 1WNTA 3JQRA 2PJDA 3F46A 4N12A 3DT6A 3OHSX 1FMJA 4NBWA 2PX4A 4NBSA 3L8ZA 2XOEA 1QYDA 2YJNA 4N5NA 3ADDA 4F97A 2J5QA 1HWYA 4K1LA 4IIJB 4JX9A 3TZQA 1LUAA 5LWHA 4IS3A 5DX8A 5EN4A 2ZIXB 5T4BA 1X13A 1GT91 1WXGA 4H7DA 3K8ZA 1L5SA 4OJYA 1JHMA 1IY0A 3ZLTA 3EIEA 3R5TA 4ND8B 5DTRA 3DLPX 4Z4IA 2ECKA 1EXNA 2Y3IA 3H17A 4B4UA 4GKVA 2O14A 4R01A 1BVRA 4G24A 4OXRA 4XPIA 2KX7A 4B40A 1EMDA 1W49A 4G84A 4DMHA 1J5PA 3AFMA 1I24A 3SP1A 5IJ0A 4P9NA 1TPZA 4R5HA 1W8IA 2HQ1A 4G9BA 1KBZA 3QEKA 1QC5B 4CTOA 4JYAB 4HRXA 1E18A 1V8PA 2C54A 2O3RA 3JQGB 2V9PA 4RK6A 1BJRE 4G1FA 4J2HA 2WWVD 3U2QA 3BIOA 1E1CA 1GQQA 1Z2DA 2H4WA 2R6JA 2WF6A 3DCNA 3RT9A 5HS4A 2BDEA 4CDGA 4PHFA 4QDKA 1U1EA 2OSBA 3TE7A 2AFRA 2QBYA 1T1RA 2BRUC 3KPVA 2YDXA 3O31A 5IVIA 4XRRA 5BWCA 1A1VA 1KYZA 2QN9A 4CKBA 1OBHA 3S3TA 3QHQA 3DV0A 2VNIA 2WWRA 2EFJA 2VJNA 2YJ5A 3UWDA 2GPBA 1V5EA 1O9HA 3K3PA 3ZY5A 2HRCA 4C4YA 5LFAA 3DMFA 4OG2A 1RWNA 5K03A 2IU0A 2LGJA 1Y3HA 3CJRA 5C51B 1XXHE 3D6JA 3QHPA 2KBEA 2ZYUX 3P9XA 3D4BA 4I55F 3OPYA 3HNPA 4DFDA 3Q11A 4KO2S 1QGUB 1KI3A 4G5FA 3W4IA 4MRPA 2WTNA 3G1TA 1NVDA 4EHNA 2WJPA 4PLTA 3CLRD 3ZW8A 4YAGA 1LBHA 1P61B 3UOGA 3U6KA 4LRQA 2BH2A 1E4VA 3S2IA 2ZRKA 3T7RA 2Y1KA 5I4KA 5DTIA 1T35A 3JARA 1FYFA 4MCIA 2GAOA 4RFLA 8ADHA 5AW1A 1T1GA 2C4NA 2P0AA 3MMPA 3PE6A 4OGLA 4R54A 5AHWA 5J1SB 4P0QB 2C9MA 3JQQA 1G5HA 4FSHA 5AUPB 3BYZA 3H9UA 4DIKA 3PXGA 3HVJA 5J4VA 2JRCA 4R9RA 2CJXA 4W1RA 4E1AA 1LSJA 2Y6UA 1GN8A 5HILA 4E5NA 5JCXA 5DO9A 4NK4A 4F85A 2B2CA 1EK5A 1WIWA 1P0FA 4GDMA 3VMMA 2JG3A 3TSZA 1QK3A 2Z30A 2Y4NA 2OOKA 2DFLA 4IR7A 3GOQA 4KUHA 4PYIA 3HY6A 4KMOA 5DI3B 7ADHA 1BGXT 1OBVA 2PYZA 2AV6A 1KU6A 2C95A 2PWAA 1ZMXA 2AVDA 2PL5A 3H19A 3PGJA 3ZHOA 1HI9A 1KTVA 1RIFA 1L7QA 3C16C 5FWAA 2ZBPA 3E9CA 4W99A 4MIOA 4IIDA 4X8MA 1JA0A 3AOGA 3RSLA 2E3JA 4JC8A 1JBQA 1N7GA 3IDQA 5AOAA 3MIIA 3C5WP 1H0HA 2H59A 1PNTA 4PQGA 4CT0A 2QPOA 2F8TA 4X85A 5HE8A 4KXNA 1G6OA 2HFJA 3GFVA 3M5WA 1HA3A 2VQ3A 3OZRA 4WNIA 4RPLA 4PAMA 4BNLA 4ARIA 3RH0A 2HJ9A 2GYUA 2I87A 5F2KA 5HJ2A 4CG1A 5JV5A 2R66A 4ZI2A 1T91A 1SHZA 1N5KA 3PQ2A 1IHYA 4H7FA 3U49A 2ZSAA 1T8PA 4RENA 4MLCA 3ILVA 3KCNA 3ZZNA 2QZJA 3PX7A 2GK6A 4KREA 2P68A 3KDAA 4MR9B 4C0KA 1E5QA 1RYMA 2NLOA 2AOVA 4G9GA 3U4AA 3ERCA 3HO8A 1TQ8A 1PDVA 4ONEA 2IL1A 1W59A 3PRKE 2NUPA 3H4TA 4IM7A 5CIWA 4Q15A 2BPOA 3BXOA 3C1TA 4Z0TA 1SU7A 2EL7A 3RVRA 2M1XA 1F2UA 1N2IA 1ZEMA 2OECA 1M2OA 5CNIA 4DLYA 4POOA 5A6SA 1Q7RA 1THTA 5JPDA 2D74A 1PUXA 1SUFA 5CURA 4LI0A 1E2IA 3NXKA 1TYEB 3OZWA 1QV7A 3DS8A 3FYTA 2QTHA 2C7VA 1P18A 1STOA 5E6SB 4FFVA 4JI2B 1VZ3A 2Y1FA 1J0AA 3GDOA 1GDTA 3AEKA 4S1PA 4CTJA 5LOVA 2CDCA 2ZAGA 3IAM6 1V8FA 1P62B 1YVRA 1K6IA 1ZXXA 4OV6B 4TTJA 4YECA 1I7DA 5CVJA 2EF1A 1EZZA 4LXTA 3TO5A 5LQMA 1H3EA 4MUNA 1ZMTA 1PG5A 3COPA 1VSBA 4HH4A 2FFAA 4Q3EA 1WHTA 5BPFA 2WKSA 2F62A 2XAAA 1TAHA 4RHXA 5JSZB 2D5IA 4E32A 1VE5A 3INRA 4BFSA 3KT8A 1ZI9A 4P3PA 2DBYA 1PR4A 1XMSA 1ZX1A 2EW2A 2JBAA 1EXMA 2FKNA 2HKIA 2WF5A 3TZKA 1XL1A 3NLLA 3ZJYA 4OHBA 1FNMA 4XJVA 4W9RA 2D59A 3NHFA 4B4KA 5KX5A 3FOAA 3ICQB 2F3UA 3AETB 5CD9A 2AI2A 3B6EA 2OA0A 1SK8A 5DNEA 5M34A 1G8AA 4IDHA 3B1WA 4D98A 5C35A 2OPHA 4M89A 4J0EA 3E22A 3WP1B 4L0QA 1JWBB 1MQ9A 1Q7EA 2WD8A 3D3NA 1I3NA 2DHCA 3LLVA 1FTGA 1TM7E 1ORIA 2M9MA 1YQXA 2PKEA 2PQ2A 3DXZA 4XDZA 5TPZD 3T99A 3ZGVA 1HBJA 1RPAA 4HEHA 3PNKA 3U7RA 4AZ3A 1CZRA 5K4HA 2QTZA 4TYWA 5K45A 2XZLA 3CF4G 1USGA 2G9UA 3FPEA 4LI3X 3HA5A 4RY8A 2MYNA 3A6HA 1DXOA 2EBUA 4YHBA 2QXUA 4KXQA 3W5BA 2I2DA 1U7TA 3UAVA 3PSAA 2RH9B 2D2IA 4MW2A 3C6BA 4BRUA 3QY9A 2VPWA 2OGSA 4ZT7A 1BN6A 2DHRA 2HLNA 4AQYB 2A7QA 5B6PA 1ZR4A 1FDWA 2F1JA 5AJWA 2JGIA 2OV2A 3PKZA 4P08A 5K3FA 4NG5A 1Z62A 4GFDA 2CKMA 2KB0A 2CLIB 1JDTA 1V1MB 3Q0EA 1P7ZA 1IM2A 3CH6A 4I3FA 2QTWB 1AVTA 4AUEA 5CRIA 4Q01A 2GBCA 2A84A 2IXEA 1RHQA 4JJ4A 2MYUA 2JD1A 3AXTA 4MGZR 5CNJA 1TO2E 5HR5A 3U4HA 5AP9A 2QROA 1OZFA 3UENA 1ZUNB 1E6LA 5EQFA 5EXPA 2ZETA 1G18A 3R8FA 4IDDA 1IQ0A 4XUCA 5MN6A 4BNDA 3S4YA 1ZK1A 2OXCA 5AQEA 3DAFA 4RM2A 5CMLA 5AHXA 1N6IA 3RJ5A 1W2GA 1NY5A 3LBIA 4NMLA 1P72A 4FMCB 1FSSA 4YAOA 2BMDA 1HZZA 4IGFA 3UV6A 3VYRB 2O3TA 3P9NA 2H3HA 3NM6B 4TZKA 3FUVA 4EY5A 5EWLA 3JVDA 1K8XB 5ALNA 1K08A 3TW8B 4BXOB 1YOVA 1EJ2A 1XWWA 2VF2A 4MV3A 2FUNB 2FWPA 3LMKA 4WKBA 3NNSA 1CUVA 1K1EA 3TOCA 1M5TA 1O97D 2VYVA 2ZYGA 2PT7A 3FWNA 3IBGA 1I2MA 4AF6A 2GD2A 4IO1A 2Y76A 1LNSA 4F6LA 2IS6A 4LHYA 3RASA 1D4OA 4MW9A 4XIFA 1ISPA 1U4NA 1CP3A 1FRVA 4ATNA 2WJVA 1QE5A 4V1CB 2D7DA 4PS1A 1BNCA 1H2HA 2V6MA 3DAPA 3QFHA 1BD3A 4PLPA 1HYEA 1J97A 4RQBA 3D1VA 4Q1CA 1ZA2A 4RY0A 2XH8A 3CKYA 1NP6A 5JQGB 3I09A 1F8FA 4XWGA 2JGKA 3VKHA 4ERXA 1KVUA 2AUNA 4P36A 3SHQA 4F4IA 3CEHA 4HRYA 4ZVUA 2WZDA 1RLOA 3UPTA 2ZJ1A 2ORVA 4G4SO 4RE5A 1W5FA 1IBSA 3TQFA 3GMDA 3I1FA 2ZWVA 4QYTA 3QVTA 2X5NA 4F6RA 4RVNA 5T67A 1NUUA 4UJ5A 2NYRA 4MPRA 3EIQA 4RSMA 4UDOA 4FN4A 1L2TA 1Z2EA 4K7JA 2LDXA 4M76B 3DGFC 2W6JD 4NG4A 5EP1A 1AMOA 4HATA 1P7WA 4DKJA 8MHTA 3GF4A 2NTNA 3SYLA 4Y0NA 4G8JA 5AKJA 1YR8A 4DJ5X 3QU5A 1MEOA 2JCGA 2ZM6B 3ON5A 3IS3A 4LRYA 2E21A 4FNMA 3JQBC 2HMVA 1A9PA 3TS1A 5TQ0A 3OOYA 1VIYA 5JRJA 4FOPA 5LUBA 5B58C 4BPRA 4BNMA 1W36D 1ZVKA 5D7NA 2PEYA 1QRAA 1E9SA 2I76A 4IIXA 4JSYA 3N6RA 5EKXA 2N1BA 3X43A 2DVMA 2ZBUA 5CTAA 3U7JA 1L6IA 3O8NA 3CZCA 2PZ8A 3KZ1E 1MOPA 4JU9A 2NTYC 4PTZA 3WZMA 2JA2A 1QG4A 3T0FA 1GUFA 1RI1A 1P3JA 4DXDA 5HZMA 2K2QB 5K9ZA 4I5FA 2IU4A 4AY5A 5BSTA 2AUTA 3BX1A 3OY7A 4CRWB 1V8OA 3OPYI 4H6WA 4G0VA 5EE0A 4JASB 2V0NA 4Q9JA 1TOAA 4MLPA 4G0MA 4A2PA 2YHSA 2I6SA 3IUQA 3LQKA 4QELA 3EVBA 3KBBA 5FB3A 2QAGA 3IUSA 3F5DA 3SMVA 5I7OA 3NMUF 4JBWA 3L8HA 4OY3A 3SXUB 2QLNA 3T34A 4HMPA 1R4ZA 1JJIA 4JLUA 4CU5A 4E31A 3LQ4A 1RBMA 4WWHA 3I2JA 4ZT4A 4RGQA 4XWYA 4G2TA 4E33A 3OD5A 1DIRA 5I4IA 2QUAA 2JFWA 1B74A 3EVEA 3WNCA 4DY4A 1NJ8A 2UUCB 1Y4UA 1S9HA 3U7GA 1UK6A 5JS2A 1T4CB 1EGVB 1OWPA 4XRGA 5CLJA 3JVEA 2H18A 1AK1A 5AW5A 1GPH1 1L3CA 5J4LA 4YWJA 2DZDA 4P33A 1DAIA 2ZQ5A 3BDIA 1XNHA 2PO7A 4GOND 1QVZA 2D00A 3JVUA 3I62A 1H3NA 3HLTA 1N1DA 4QFBA 1Z4IA 4KYIB 4QDOA 4OSPA 1E7SA 2RGNC 2B7LA 1VL8A 2XUFA 4F4CA 2MMCA 1HFJA 2MSCB 3IPXA 3O3MB 1SXJB 4JJAA 4NH0A 1DBSA 3CYFA 3D1JA 1H6CA 4DV6B 3NUZA 3JZMA 4L8YA 1E69A 4LJ9A 4OQPA 1YONA 2Q5OA 5EIBC 5I8PA 4JLVA 3IPAA 3RVSA 3GUUA 3MCVA 4R1NA 4RYDA 5F98A 4PC3A 3SJUA 5AW6A 2CV2A 2EFHB 1ZXBA 4BP3A 5FI0B 1Z16A 1FC0A 4ZXFA 3T3NA 1OAKA 1K5PA 4PLGA 2WTMA 3EH1A 3DOEA 5TGDA 4B31A 3ZVNA 1CUBA 1GXSA 4EMUA 3HXLA 2WYVA 4PSAA 3ZTWA 4DOMA 3GLHE 4DPMA 1ZRNA 2F00A 5GP1A 1QHHB 5E2IA 3ESAA 2C3MA 4NS1A 3GN1A 3SSOA 4DLPA 1XK7A 3AFOA 2X8BA 2BFAA 1PQWA 2Q99A 3GO4A 3ZV6A 2H4FA 1PLKA 2GTHA 2XQIA 1GTRA 2ZFUA 5I8ZA 1GLGA 1RW4A 1KDRA 4FXOA 1KI4A 4K9NA 4WSOA 1FP4B 4X8LA 4X84A 3MERA 5KJFA 1S8AA 2AKEA 4P38A 1XELA 1YHZA 4OJTA 2BSQA 4M9XA 3FPFA 4BQRA 1CZOA 2H5EA 3LFUA 1KYIA 4K9LA 2OB1A 3INGA 1DXHA 4TLBA 4LHWA 4P3KA 4Z8XA 2RGNA 1IB6A 2OUKA 4E7PA 1RAFA 1OB5A 2R8YA 4BQFA 2GSWA 3TZBA 3LW8A 4TN1A 4ZTZB 1V11B 1ABBA 1MPTA 1ZJ4A 2CNOA 4HTAA 4HNAB 4Z53A 3GJ7A 4RC9A 5JC8A 4IHJF 4WTOA 4BGEA 2JS7A 1WBDA 5L40A 3OUUA 3R41A 5HCIA 2CSXA 2I8LA 2AOTB 2AYYA 1NXSA 3L7YA 1ZJYA 4KBYA 4YLEA 4MPTA 4DCPA 3ZZTA 3EVTA 4L8GA 2XMRA 3B7WA 4W82A 1VIDA 2XB8A 1IATA 1QIMA 2EW1A 4YMWA 1Z33A 3RGWS 1QPBA 5IYZB 2Y1CA 1NLMA 3L9XA 4JC4A 4AJEA 2QU8A 4O25A 4QLAA 1W2WB 4WADA 3DWFA 3MWLA 5L3VA 3L4KA 4EO9A 2GBFA 4NCXA 5JS7A 3NKLA 2DQKA 3NIBA 4MTCA 4J16A 5F2EA 5HOEA 1G19A 1IIRA 3M1IA 4OBEA 3A4VA 3EQZA 4GAEA 4RY9A 4EY6A 1RBZA 1B2RA 3DLHA 1TU3A 3CE6A 1ONBA 3NC4A 2XOXA 1U0JA 1YIDA 3E9MA 1G7CA 3K1ZA 4KSCA 1UJ5A 1C9EA 3TSYA 3KJZA 1GQFA 4DJFC 2MSNA 2VEOA 1WBBA 3NEYA 4O59O 3LC0A 1EM8A 4MQ5A 3RU2A 1TUIA 3F47A 5L3ZA 3Q1KA 4C7XA 1VMDA 1KC1A 1NGSA 4AICA 5KYYA 4GI2A 2ETVA 4JROA 2XA2A 1XMJA 1C9MA 2F9MA 4WACA 3EOZA 4JJKA 1MXFA 2ZBRA 1AKWA 2IYPA 7AT1A 2GEJA 2OCAA 4FYXA 4DCVA 1L7DA 4BLRA 3OFND 4UEOA 4M0MA 4OB8A 4J1TC 4F21A 4RDHA 1C30A 5DXFA 3CW9A 2C03A 1WP4A 2ZT8A 4BMVA 5FORA 1T5HX 3KR9A 1UEJA 1UKYA 1H0RA 1U8UA 4OGGA 2ZSDA 4ZO8A 1NSTA 621PA 1B14A 3KOUA 1H42A 3D6NB 2XYVA 2FW8A 2XA9A 4R1UA 1LWNA 1NRJB 4N3GA 4MWSA 4NHOA 3AHDA 1U2DC 4W6ZA 1R1DA 1O4VA 2JIBA 3ELUA 4FCTA 4LOIA 2XIJA 4ZCQA 1RJ9B 1ZLYA 4UHHA 1U1GA 1WPXA 4IILA 3MVEA 4ZCSA 3I4FA 5GIOE 1V43A 4TV8B 2R96A 5J5CA 4F38A 3RUEA 2F90A 3T7IA 1GSHA 2J3MA 4D5GA 3G5LA 3BZWA 2RHBA 3O8OA 4MUBA 2LNDA 3F6CA 1EQAA 2LDBA 4CEIB 3FSJX 2W6IA 4PNEA 1K75A 3G2MA 2QXYA 2VAWA 1L4FA 3H75A 2J33A 3HL0A 3NTOA 2IP1A 4MW6A 1GFIA 3EGDB 3D5TA 4HVTA 5LD2B 2Q3LA 1Q6YA 4CQLA 1RADA 1NQXA 4CFYA 1KI9A 4DWVA 3M1AA 4TT8A 4XD7A 1J0CA 2QM0A 5IKEA 2DBZA 2WPDD 3IVCA 4PC1A 2PKWA 3QU7A 1FXUA 2A94A 3QBTA 2JLAA 2FZGA 3EUEA 3F6BX 1K4MA 2WPDA 2ZIWB 3R5KA 2DT5A 4XARA 3LP8A 4JIGA 1T2AA 2PGAA 4EECA 4PQYA 3HP1A 4NSNA 5CBPA 4OGFA 2VT7A 1HLFA 4YAKA 2W5UA 4BQPA 4IJ6A 2OHGA 3OE1A 3QYPA 4KQGA 4XR4A 5FUXA 5E0OA 5IABA 3C4JA 1LD3A 3KTAB 5CBKA 3AILA 4I4NA 4XTCS 5MFPA 1FYEA 3LT4A 4TWBA 5K3SA 3X1YA 1UZAA 2O2IA 2M6LA 5ELXA 3O2NA 2FPGA 4YV2A 1NAIA 3DE1X 1KPHA 1PT8A 2DLNA 4K3VA 4LHEA 5E1BA 2ZANA 4J3NA 1TUBB 4JP3A 3UKJA 4DBZA 5KWSA 5K0CA 4UVGA 2VRBA 1OFTA 3KYBA 4FW9A 3N2YA 1WQ1R 2DC1A 5I45A 3OQOA 4NXMB 4GUDA 3FVRA 2D1SA 3MJSA 2X14A 4NVRA 3OPXA 5HKKA 2Y77A 4B3FX 2Q5EA 1NLUA 1A9OA 1P2TA 2Q0HA 2FW9A 4RHEA 1RI5A 2QUHA 3FUCA 4WECA 5AK4A 4ZWNA 4UVIA 2IYVA 1UBKS 3FR8A 1TAGA 2BEVB 3K92A 2WNHA 3NDJA 5AYVA 5TPWB 3RBXA 3TSAA 5CB4B 1WCIA 3Q8KA 1M8JA 3DBLA 2PLWA 2Q45A 3IDOA 1UXJA 4C0WA 4DILA 5CJJA 2PGOA 3ZU5A 3D6MA 1A71A 2V7UA 5GONA 5IDYA 2C5SA 2YJ4A 3BHNA 1Q14A 2A58A 4XQEA 1CRWG 1MHTA 1XMOB 1B8VA 2V3VA 1FJXA 5KJEA 5C1DA 5EIEA 4O4HF 3RVKA 3QHAA 4KPFC 2F3SA 1W5AA 2Q6LA 3I1YA 3NG1A 1ZUIA 3IT2A 3M70A 1GG8A 2ZRQA 3AIMA 2A86A 4KDEA 5ILGA 2WAYA 2X0IA 1P9OA 6REQA 2WWIA 3FWKA 3ZWAA 1HE2A 3DTTA 3Q5GA 1EWRA 5KTNA 4R1TA 2H08A 4KAXA 2APJA