4TL6A

Crystal structure of n-terminal domain of kaic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
222
Chain Sequence
b'HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRVSIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942)
molecule tags Transferase
total genus 80
structure length 222
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl6A00
2I4IA 4F93B 4E07A 1E1QD 1KK3A 3U3KA 1ZUHA 4ESHA 4NCJA 3C5CA 4UXIA 1VCIA 5KSOA 1Q12A 3CPEA 3QG5A 5HKKA 1LW7A 5JS7A 1G1MA 4C0JA 1FPMA 2IEYA 2X1VA 3C7KA 2J7PD 2CK3A 2DB3A 1I4TD 3QXHA 3N2EA 4IXNA 4YDHB 1WB9A 5CDFA 4BUJA 1N6OA 5E7MA 1R5BA 3I73A 1AJEA 1XX6A 4BASA 1KMQA 1FNNA 1Z2CA 3PCRB 4TL6A 1Q3HA 1MRSA 3K1JA 3CR7A 4PSVA 2ZS9A 1NMXA 1H8HD 1XD2A 2EFEB 4QJ3A 3C4JA 2F1IA 3L0OA 4QHYA 1XD8A 3KQUA 1KI6A 3EX7C 1VPLA 4M9XA 2F9LA 1ZNZA 4YMWA 1Z6GA 2BC9A 2WJHA 3K70C 2OCBA 3VKHA 3TE6A 3DKPA 2E1RA 4JBWA 4Q4JB 1IN8A 3QKRA 4PC2A 4P4SB 4A0HA 3TBKA 5A5GA 4RD0A 1HE1C 3EC1A 5KSPA 3ZZ0A 4B47A 1XXHA 3BXZA 4NE2A 3QENA 2PZEA 3QJYA 2CHGA 2PMDA 1YR7A 1ZD1A 2ZTSA 5J4HA 1N5JA 1H8EA 2BJVA 2P2LA 4PAOA 4MYUA 4XIGS 4CEJA 3K0FB 5SZIA 2FSFA 1FQJA 2IUTA 2I3BA 4PAMA 2IK8A 1KGDA 4M8NE 2ZVQX 3EAQA 3WHLA 1N0UA 2G83A 2O8FA 1DAEA 3GJ8A 1E1QA 5FH9A 2OLKA 1NJGA 4A1FA 4I81A 1NKSA 1Z83A 2EFGA 1KSJA 3QXCA 5CLLA 2NIPA 2C04A 1US8B 4LPKA 2C95A 2FEMA 4RY2A 1XFAA 3LV8A 4A82A 2CVFA 2J7PA 1XTSA 2HUPA 3BIFA 2Q6TA 1XCGB 2QP4A 3DOEA 1VG8A 4RJLA 2WWWA 4H1UA 2V4ZA 4N0EA 3EWSA 1LTQA 1XMIA 2JJ8A 4TYYA 3LW8A 3QF4B 1CR1A 5KSZA 4XSGA 2ZXUA 4M9SA 3TGPA 4AYXA 1JALA 4LJ4A 1CJUC 3LFUA 2D2EA 1M2OB 1NN0A 1OXXK 4Z8YA 1FFHA 5JCPA 3AVQA 1DG3A 1NBMD 4XSHA 1U99A 4NCIA 4JLPA 1NL3A 2ZJZA 1VMAA 1NIJA 3D8BA 2NO9A 3W6OA 2BBTA 5TY0A 4HDOB 4PC3A 2QA5A 5EE0A 5J40A 1CEEA 1IY0A 1NVVR 4V0OA 4MUAA 1Z6YA 1RE0A 2QAGC 3HPQA 4LBZA 4PSAA 1OSNA 2IHYA 1UADA 4US1R 3SFZA 1HV8A 3MMPA 1U2RA 1M74A 4LPSA 1F2UB 4B3XA 5CK5A 2GF9A 3ADBA 4GFDA 4QOSA 3IKJA 1BOFA 1JI0A 4HLQB 3L0IB 5KDOA 2ZSAA 2IYTA 4OHZA 1X8JA 1BMFD 5LDDC 1FOEB 1YU9A 2P6RA 1OIVA 2FOLA 1II9A 1OXUA 3K09A 1AZTA 1U9IC 4XWOA 3A6PC 2ZPTX 1Q0UA 1Z6AA 2KJQA 4KFUA 5FPHA 1DAGA 3AQ4A 2FGJA 1U94A 3A4LA 2VF8A 2GNOA 4V03A 1CR4A 3TR0A 4Q7MB 3VFDA 5JLJA 3BERA 1W1WA 2G6BA 4D0NA 1GVNB 5TVKA 1DAMA 4NCNA 4B3CA 3FFBA 1XCMA 4IVPA 3I8XA 1LNZA 2VHTA 5GVRA 1B23P 4AKGA 5JJLA 1N6PA 1DBSA 2IYXA 2XZLA 1I2DA 1Z08A 3NBYC 1AQYA 1NN5A 4P4TA 4EQ6A 3T5DA 1MABB 1CKEA 2RHDA 2V7QD 1FUKA 4KVGA 4D6PA 3NDBB 4HUQB 2AD1A 2OEPA 4HLCA 3RWMB 4QBHA 4LYHA 1IAQA 3CF0A 2JLWA 2VP0A 5DN6D 1IXRC 4B3DA 3A36A 5FTNA 4BLSA 1E2PA 2B21A 1PUJA 4OHVA 1T0HB 3EIHA 3FWYA 3LDAA 4NBSA 5CYPA 1SVOA 3RC8A 4LK2A 4HAYA 4ZI2A 3N2IA 2B7CA 1RYFA 4A0GA 3CUEF 3OF5A 3QG1A 1E4VA 2DFNA 4BEBA 3W9YA 1UEIA 5FBQB 1D5CA 4PX9A 4DB4A 5TV2A 2G0NA 2VP4A 1NIPA 3TJZA 1PLJA 1ZMXA 2UZ3A 3CR8A 1DAFA 5B2ZA 2G0TA 3U6KA 1H65A 5FBLB 3HR8A 2N46A 4DCSA 1KHTA 4TN1A 1I4DD 5FOWA 5JWRA 5H70A 1YZKA 3W3AA 2CBZA 2QT0A 1SULA 2B6HA 2IYQA 1VCMA 3AVPA 3P4XA 4KVAA 1QHSA 4PHHA 5FOTA 4MUBA 4A2WA 5H8WA 2KB0A 5HE9A 2HV8A 4HAVA 3EARA 2XJ4A 5JJIA 1KNXA 2H92A 1XEWY 2GJ8A 4GOKA 3R20A 4MRRA 5A0FA 4OHWA 4ZKEA 3FHCB 5DI3B 1Z2AA 5F98A 1W4RA 1WP9A 1E1RD 1N5KA 2R6GA 2ZI9A 2ZJOA 3GEIA 2C99A 2BV3A 2V7QA 5D3MA 4E5UA 5B64A 4KBGA 1M7GA 1OFIA 1ZJ6A 2C77A 3MAAC 3FOZA 3U61B 1W44A 3AVWA 4KSCA 2FSGA 3OIVA 3SBEA 2HT1A 1SXJB 2N1BA 3K0EA 4EPXA 4RD3A 3TUIC 4B75A 1NN1A 1R0WA 4AIIA 2GA8A 2XAUA 3S1AA 1LVGA 3TK1A 1UEJA 1OYWA 4JLDA 1KY2A 5LD2B 4B71A 4TL9A 3TRFA 1T9HA 2H16A 1NMYA 4AG5A 2QM7A 4IEIA 5JCZA 4P32A 1HURA 2EWWA 2P6NA 4FMDB 4LX0A 2IXEA 4XTCS 1VDZA 1D6JA 1YZLA 2IYUA 4CW7A 5AUOB 3LQRA 1P2VA 4C2TA 3KJGA 2QAGB 1CF4A 2KBFA 5JRZA 4DUGD 3ZS8A 1AGPA 4L5BA 1ZM9A 2GZDA 1FX0B 4ZPXA 3GFOA 2XNDA 1TQ6A 4DLWA 4IXMA 4DSUA 1VECA 3A8TA 4RD2A 3B7GA 4DKXA 2ZVPX 1UDWA 2IUSA 3B1VA 2ZRFA 4FMBB 3C15C 1UKZA 3PUVA 2YWFA 2ZRGA 2AR7A 3C8UA 1LFDB 4TLBA 3W90A 2AFIE 3CIOA 4BZXA 2GEUA 1MT0A 1XNJA 3B82A 4NYMR 4URYR 2SHKA 4LHZA 4NYIR 2WZQA 4FCWA 1E79A 2OXRA 4ZV4A 4GP7A 4TMKA 1KJYA 3MWKA 4ARZB 3REFA 2A7QA 3D6TB 3PEUA 1JEEA 2FH5B 4XTRA 1EFTA 2H57A 5L3RA 3HPRA 4HLUC 2Z43A 1E1RA 1S3SA 2MSEB 2WICA 4C4PA 4IJMA 1VKJA 4OQMA 1SQ5A 4R71A 1ZD8A 5DISB 2D7DA 1QZXA 2KSQA 1NG1A 2XZPA 4RZUA 2W6ID 4IEEA 3DEFA 5IHPA 2QM8A 2V54A 4EAQA 1VYVA 3TQFA 2VHUA 3A58B 3VAAA 2GXUA 5HCNA 1A2BA 3PJRA 4DB2A 2ONKA 1DS6A 2EYUA 3GP8A 3TVDA 2FX3A 3TKLA 1CJVC 4W5WA 1XJQA 5GJVC 4EDHA 4NZYA 2VL7A 4LWZA 2R6DA 4DDWA 1F2TA 4Q5IA 4URVR 3HDTA 3KXKA 2BKEA 4ILEA 4C0BA 2IYWA 4CEIB 1LV7A 4OK3A 4JSYA 3CH5A 3DM9B 2CHVA 1U8AA 3AP1A 2BOVA 2ZJYA 1QHYA 3LVRE 1F3OA 3C14C 3PENA 3W34A 1PV4A 5JFGA 5FL7D 2KI5A 3R7WB 3DO6A 5JWOA 4OI2A 3HU2A 2NG1A 4HI0E 3OEED 1G6HA 1KO4A 4NYIQ 1RC8A 1FP7A 1KSGA 1X3SA 2ZYTX 2ONJA 3NC0C 4MGYR 3THOA 4DHEA 1VG0B 3T5GA 3U4QB 1Z8FA 1WBBA 3CB4A 2ZRKA 2FV8A 1WA5A 4I1OA 3U7FB 2J7KA 2ZRMA 1Q44A 1A82A 2CLSA 1PVOA 2CMKA 2FZLA 4MH0R 5GJWC 4D80A 1TF2A 1MO5A 4DVGA 2QGZA 1GKUB 3AVXA 3IIKA 1RKBA 4DZZA 1G7SA 3BRWD 4TQ9A 1VHTA 4B33A 5EXTA 2WJYA 3IQXA 2G1JA 3FTQA 1COWA 3FMFA 4M1WA 1IXZA 2D7CA 1G8YA 1S0UA 5GVSA 4II7A 3LD9A 2R9VA 3IHLA 1CJKC 5G41A 2GJ9A 2KWIA 2B7BA 2EFCB 5SZHB 3V4RA 1XB2A 4FWTA 1DELA 2RGEA 4I1UA 3V9PA 4WZ6A 2QPAA 3M0EA 4HDQB 3K0AA 4ASUD 1NLZA 3AVOA 5LB2A 2CDNA 1JR3E 4DT1A 1N6LA 2ZR0A 5EUMA 3GLHA 3KJHA 2H1LA 4ACAA 5FPSA 2IL1A 3AM1A 4PQYA 4M9QA 4KLNA 4JVMA 4WZBE 3WP1B 5FL7A 2W0SA 3K8YA 3CBQA 5AWFC 1W4AA 1WMSA 1E9DA 4UKDA 3OEEA 4HB4A 3B9QA 1GITA 3I61A 1E9CA 1UKYA 3U44A 2PZFA 1QHNA 3DMDA 4A0FA 1YR6A 3C41J 1GRQA 2GZHA 5DE3A 2J0UB 3VX4A 1VCOA 2WWIA 3D7MA 3MFYA 4RZXA 3FPAA 4UNQA 2A78A 1DPFA 4OHYA 4B2IA 2O8DA 2ZYVX 4EPTA 1E6CA 2ZROA 2YVUA 1E69A 5CIQA 1GKIA 1SHKA 3MCAA 4MA4A 4B43A 3KKPA 2HCJB 2F1RA 1G3MA 1KJWA 3Q85A 2IYVA 4EKDA 4NH0A 2OBLA 4B2PA 2EVWX 4LJ8A 2OXCA 3AVVA 1G6OA 4M1OA 3NTUA 5F2EA 1G8FA 3NDPA 5J4LA 4LJ5A 3BFVA 2YC4C 3DHWC 4MRPA 4RD4A 4D4JA 5E95A 2YWGA 4Q9IA 5DNYB 2OAQ1 3NH9A 2DPXA 3AKCA 3VR2A 4CIDA 1TF5A 1S3GA 2QU8A 1YR8A 3UG6A 4WZAE 2QG6A 2RCNA 1Z63A 3SE0A 3PUWA 4DIDA 1G21E 3GLGB 2ZSEA 1OH8A 4ASUA 5JHGB 4N0DA 3X1YA 2VP6A 2IYZA 1C1YA 5AJWA 4V0ME 2ZSDA 4JJKA 3FE2A 3PUXA 4TWZA 3TLXA 2RGAA 2GXAA 3R9XA 1E0JA 3IIMA 1CR2A 4P3YA 2FU5C 1T8TA 3QBVA 3ADKA 1E2MA 1GP2A 2ERYA 3E70C 1Q1ZA 2RGNC 1XD2B 1KDOA 2IA5A 2WHXA 4FCTA 3KJEA 1G17A 1T91A 1Y3AA 4DLXA 4QNMA 1RJ9B 3PEWA 3OE7D 1T3HA 3LXXA 3QPUA 1HE8B 1KI2A 3QKRB 4PC7A 1VIAA 4C0LA 3O8CA 4HUTA 2LWIA 4O2LA 5H68A 2QRNA 4QM7A 1XXHB 1KK1A 3VR3A 5M04A 5F9FA 1UJ2A 4PO9A 4GI7A 5K8IA 5JMTA 1SZPA 3A1SA 2D2FA 3PUYA 3R9IA 4CEJB 1Q1EA 1NLFA 1R5OA 4LUCA 3AF1A 3VQTA 5D3QA 2ZRJA 3U60B 4RFSA 1IBRA 4MGIR 1UBFA 4PXAA 2IYRA 3IHWA 2O8FB 2J0VA 1NBME 2VP2A 5L3SA 1K5DA 4JVLA 2EWVA 4YMUA 4A6XA 4L9WA 2FSHA 1II8B 1KI1A 4F91B 4M0LA 1TADA 4NTZA 4L8GA 2IS6A 1JB1A 4Q1AA 2AWOA 2P6UA 4HB2A 4TMXA 4B74A 1HUQA 2MSCB 1U8YA 2R65A 3I8SA 5EP3A 4EFLA 4O2RA 4G5GA 1U0HC 2ODWA 1P5ZB 1CTQA 3FMPB 1OIWA 2REXB 1D8TA 3B6EA 1TL7C 4RSGA 2ATVA 4P0TA 4NYJQ 1QRAA 4JL6A 1XZQA 4WAUA 3GQBA 4LHWA 1LB1B 3U2QA 2JATA 4JLMA 5DIFA 4D0LB 2ZE7A 2FFBA 2L0XA 3FKSD 5EE1A 5G3YA 4Q1EA 4TLCA 1QHHB 2Z4SA 1XPOA 4FMCB 5FBRB 5FPTA 1G64A 4LV8B 4N3NA 4TMWA 2ODEA 3OE7A 1IY2A 1HH4A 3QKUA 1II0A 2DFTA 2XITA 4D81A 1EGAA 4TTPA 3QXSA 2FMXA 2FN4A 3VU9A 3O8RA 4LC0A 1HT1E 2CCGA 3SHWA 1EK0A 4LCBA 1ZC4A 1G7CA 1ESMA 2PJZA 2ZEJA 3K0SA 1G5RA 4BPBA 1P75A 4QBIA 2FG5A 2ZR7A 4QBFA 4GMDA 1MO3A 2BCGY 3KB2A 3QNUA 2LKDA 1UFQA 4UXHA 2WIBA 5LPNA 4PPGA 2AFHE 3NXSA 4TTRA 3DZ8A 1T6NA 4OQXA 2DWOA 1T0JB 1P73A 4IKEA 1X6VA 4N1AA 4D4MA 2ZETA 1BS1A 2Z4RA 4EPRA 2A5FA 4IRUB 1J99A 1R4AA 3GJ0A 1GL6A 2QMHA 4V0KA 3UMRA 2F3RA 4PSKA 5EUQB 2B8TA 4HAXA 2REBA 3WHKA 4C2UA 1G3UA 1X86B 2O0JA 3CPJB 3PV0A 3SQXA 3SOPA 3G0HA 4JKIA 2IYSA 4OJQA 3T1TA 2YWEA 4OHXA 2REOA 1UBEA 3DKVA 4BLTA 4QL3A 1X8LA 1N5LA 2QTFA 2ZS8A 4K8OA 4V02A 2ZUCA 1YZGA 3KUDA 3MJRA 1CR0A 1JQJC 2J41A 1E2EA 3I4LA 1GOTA 2GJSA 1X1SA 2ERXA 4P33A 3QEJA 1WF3A 3T1OA 4DWJA 5FOUA 3NBFA 1UF9A 1VYUA 4LJ6A 5F9HA 2OCPA 5TARA 5JI3E 3CPHA 4JLOA 1IJEA 1NKTA 1EESA 2JLQA 5AK0A 2YJTD 5IRCD 1IM2A 5FFMA 1UKEA 3P27A 3VR6A 4U02A 3WRXC 5FR1A 3LBNA 4I1SA 4A8JA 1KIMA 5P21A 5TXGA 5C18A 1QG4A 2WSMA 2IF2A 2QMOA 4LJ9A 2KBEA 5K8TA 1IXSB 2BJWA 3L8ZA 3RLFA 5L3QB 3VNVA 1ZP6A 2ZU0C 3WBKA 4NCHA 4M1MA 4PANA 4EJSA 1OH7A 1E0AA 2O8EA 2X8AA 1FZQA 4JL5A 1TNDA 4HLUA 3PITA 1TUIA 1YZQA 4DLUA 4KFSA 4XVQA 5TB5A 3GLFB 3ASZA 4UJ3A 1SVMA 2Z5FA 1P9WA 4PPQA 3NBXX 2ZJ5A 4Q7KA 1ZVQA 4QFMA 1Q1QA 5EE9A 4E09A 3WMGA 3Q9LA 1KK0A 4XJXA 1NJFA 3NBZC 4YC7A 1AQUA 5J4KA 2BDTA 1KK2A 3B9PA 3SFVA 4D82A 4OI1A 1U98A 621PA 5FPYA 2A5YB 2HYDA 1A2KC 4LI0A 4PZZA 1DTSA 4BZQA 1KAGA 3VKWA 1G8GA 1A7JA 2Y8EA 4JJZA 2CCJA 1CULC 2PX0A 1GFIA 3F8TA 1YE8A 2VF7A 1W4CA 4LRWA 4RZ3A 1G16A 4FINA 4IVRA 5KHOC 4W5JA 2F1JA 1F48A 2ORIA 1JR3A 3S1AB 1T4GA 3X1DA 4EIWA 3DVLA 1I2MA 2VTKA 1OHHD 2EFDB 4HSEA 1FTNA 4LBVA 4M2LA 4C7OB 3PEVA 5B30A 1SXJC 4R7ZA 2OSBA 3NKVA 3W5JA 2RMKA 4AKHA 3WBJA 1NP6A 3DDCA 4CGZA 4IW3B 5LD2C 5HE8A 2WJGA 2AXNA 2FE4A 5EXSA 2XZOA 3EC2A 1HEIA 4V0NA 5JECA 1MOZA 1G7TA 2QGNA 1YQTA 1EFCA 1L4YA 4GOJA 2PLRA 1A4RA 2RGBA 5G3ZA 2WWFA 5GJBA 1DO0A 3SJAA 2QBYA 1G7RA 3ADDA 3IDQA 3P4YA 3GPLA 1W36C 2BBSA 1XBTA 1ZIOA 2ZE8A 3I72A 2QI9C 2J59A 3IGFA 2C9YA 4ACBA 1VG9B 1ZUIA 4JZKA 3SN6A 1O3YA 2FJUA 2QMUA 3P20A 3K9GA 1TPZA 2XNSA 2ZIAA 4C3ZA 4FXPA 2DY1A 4KO8A 2IS1A 1TQ2A 1TQ4A 2ZU6A 5FBWB 4Z1MD 5KTYA 1JPJA 2CEAA 3L0SA 3H84A 4ON9A 4ZDKA 2VO1A 2YZ2A 5EP4A 1I4LD 1KSHA 4BLRA 2ZJAA 2IHBA 2J9RA 1SXJE 2PEZA 4WW0A 1G9XA 5JSZA 1IN6A 2GBLA 3LBIA 2W58A 4NCKA 1KOFA 4C0HA 3C16C 4ESVA 2RAPA 3EZ7A 4DEXA 1OHHA 2QQEA 3MGCA 1RZ3A 2F43A 1ZCAA 4JBYA 3TUZC 1YRAA 1F2TB 4PAQA 5AR1A 3HYTA 1OF1A 1ZYUA 4TYPA 4AD8A 1R0XA 2DYKA 5G53C 4B6FA 2WMNB 4KSBA 5KPJA 1NVVQ 4EUNA 4GNKA 1CS4C 4BFXA 1RVDA 3K0CC 3B60A 3X2SA 2IYLD 2XGJA 3WRYC 1QF9A 3BH0A 4PQRA 3FHOA 3UPUA 1D9ZA 4EPVA 2BHRA 5ANRB 1A1VA 1DAIA 2QSZA 2VHJA 3X1WA 2CLCX 2I1VB 4MKGA 3KUCA 1KY3A 4NU0A 2J45A 4DLYA 5CJPA 3LNCA 3QIAA 3RABA 1KI4A 3X1XA 3HWSA 1GSIA 2O8CB 4BFSA 4YMTA 2IXFA 4X8LA 2AKAB 1Z5ZA 3BD9A 1S96A 3BFXA 4OL0A 3F0TA 4MRVA 1Q22A 4PZYA 2CNWA 2C5LA 3MWJA 2ZAOA 4Q4AA 1Z29A 1ZM4A 1L4UA 1ZC3A 3CZQA 1NNEA 5JJKA 1KMHB 2ZITA 4Z1MA 2WAYA 3N5CA 5BXQC 1L8QA 3W3ZB 1PJRA 2H5EA 3MSXA 2WAXA 2XNDD 3VKGA 3RS0A 1XTQA 1CLUA 2WKRA 4JS0A 3RVBA 3O47A 2OESA 1QDEA 2HXYA 3ZQJA 2CXXA 3RSLA 1R2QA 4QM6A 2D74A 5J4YA 2ZI6A 4Q03A 4LOAA 1FUUA 1TU4A 1YVDA 3MJHA 1W0JD 4JVSB 1QG2A 2YINC 3UMSA 3R9WA 4UNSA 1E79D 4X8OA 5EE5B 3AUXA 5DGXA 4ZDIA 2J5XA 5G40A 3NC1C 1R8SA 1XRJA 1Z0IA 2F55A 1JEDA 1N6IA 3OEHA 2B8WA 5EP1A 4G5OA 1KTVA 1N3BA 1G291 4DT1B 3BBPA 2RGGA 3GLHB 1G3QA 2G77B 4GZLA 5DO9A 3KZ1E 3AEZA 4M1TA 4E03A 4G5SA 3UWKA 2Q3HA 4FW9A 1ZW6A 2EYQA 2XB4A 4FD2A 2VLIA 1NF3A 3BS4A 3U44B 4MQBA 3I1FA 3QI2A 1JAIA 3SJCA 4TMVA 3FB4A 1Z47A 2ZRLA 4QRHA 1LF5A 2GJAA 3P32A 1EFUA 4DSTA 5FTJA 2OLJA 2ZANA 3ZH9B 1FNMA 1U8ZA 4YMSA 3ZQ6A 1XU4A 2BMDA 2OCYC 4KBFA 2ZUDA 1Q21A 5FL3A 3TSOA 4DLVA 1J2JA 3ZZUA 2CJWB 3RWOA 2O8DB 3MG9A 3WYAA 2V6JA 2F6RA 2FZ4A 4M1KA 2XSZD 3WNDA 5KNCA 2V1UA 1XP8A 1Z07A 4RCZA 3JZMA 2J0SA 1UBCA 2VBCA 2R62A 5JBQA 2A3RA 4B3GA 1W36B 3ZGXA 2QAJA 3B78A 1P72A 1MO4A 4MKFA 1QHIA 4GT1A 4O0MA 3QF4A 2BIFA 1GNQA 3CLVA 1V5WA 3IQWA 1SGWA 4EPYA 3SQWA 2J3EA 5SZKB 2HDNB 2HJVA 3U7EB 1W0JA 3FGNA 3HU1A 1OXTA 2ZI4A 3Q5EA 3EPHA 3EIEA 4PHFA 2BEJA 2KE5A 1AIPA 1F60A 2FPMA 5JI2E 3QPVA 2YOFA 2P3SA 4Q9HA 2BMEA 1SVKA 2GAAA 4HZUB 2RB4A 3LH5A 4LV5B 2X2EA 4AC9A 4AK9A 1VHLA 3A4NA 2NO1A 2YOGA 3KKMA 3SYNA 2V9PA 4O3MA 3RS7A 1BIFA 4HATA 2GCOA 4RD6A 3O8BA 1F2UA 3QPWA 4KLZA 4XH9B 3RC3A 5AJVB 1KDRA 2QNRA 1COWD 3TSWA 3REGA 1G18A 2MSDB 1IOZA 2VQSA 2WSSD 3IEUA 4NMMA 5KDLA 3K70D 2TMKA 1W5SA 1NVWQ 2Q0HA 3CX7A 1BO6A 3GJ5A 2VHQA 4MRSA 4KXFB 1ODFA 1EX6A 2W2TA 3FYHA 1WBDA 2C9CA 1E2GA 1ZINA 3SS8A 5KNDA 4ZDWA 2WWYA 4AWXA 721PA 2XSZA 1ZU5A 1E96A 1KKMA 2AN9A 3ETLA 1E9RA 1BYUA 3JVUA 3VMFA 4US0R 1B0UA 2GXSA 4TQUS 3QVUA 2ODBA 4POAA 3E1SA 4HB3A 1LF0A 3GFTA 1EXMA 2WWXA 3BB4A 4NYMQ 1HQCA 1L2TA 1VIYA 2HEIA 2JLYA 2FEOA 4MYTA 3NHBA 4IVQA 5C4MA 2ZJ2A 3KL4A 1E0KA 2ZRPA 4A4DA 4X8HA 2CHQA 2JIZA 2C98A 2QMEA 5EZ6B 3TR5A 5B57C 5K8UA 3ZIAD 2C2HA 2Q9CA 2HJGA 4DCTA 1G20E 4ZCIA 4F4JA 1CRQA 1XF9A 1OW3B 1VCNA 1R0ZA 1UPTA 1XTJA 2ZR9A 2RGDA 2ZS7A 3R8CA 3ZVLA 2GEDA 5CDFE 4D26A 3GLGE 4MDFA 1MABA 2CL7X 3GEHA 3RRMA 2QL6A 1O87A 2MMCA 2OV2A 2R44A 3OIYA 4KV9A 1P2UA 2YHSA 2PX3A 3TQCA 2PT5A 2VEDA 2JJ2A 2P65A 1CJTC 4JKYA 4R2IA 4JT4A 4EFMA 1UDXA 1R5NA 3P26A 3WNCA 2G3YA 4NONA 4JLKA 5DSZA 2OG2A 3ICEA 5FBVB 2ZYUX 2F1HA 1RIFA 4PZLA 4R9UC 1UKVY 3B13B 3GLIB 1YKSA 3KTAA 4CZ2A 2WSSA 2GTPA 3SDZA 2G88A 8OHMA 3VX3A 1W4BA 1AS0A 3VU9B 1Z6XA 1XXHE 3J81k 3TVTA 4S2EA 4B35A 2QT1A 3CNNA 4M21A 1Z0AA 4FN5A 2GCNA 1TTTA 2ORVA 3HU3A 1W47A 3LBHA 2RGCA 3H4MA 4KFRA 4LBYA 2QEQA 2XTNA 1AKEA 2QPOA 3OIWA 4KODA 3GJ6A 4QKQA 1M34E 1KAOA 2WVJA 4AURA 2BBOA 3OAAD 2P67A 1P61B 4L4UA 1NSFA 4WXPA 5FI0B 2PBRA 1CXZA 1KDPA 3KX2A 4PR0A 421PA 3PEYA 4RZ2A 4DIEA 2P0EA 2EW1A 1DAHA 5EQTA 2VIIA 2W00A 4DCVA 3ZIAA 4HZIA 1XMJA 3AKDA 3CRW1 5DI3A 4YONB 4HAZA 5KSYA 3V00A 1N6NA 3K09C 2WM9B 4GPTA 4KU4A 4UNNA 5KUTA 3B1WA 3CRRA 3HJNA 3IBYA 4K46A 3VHXA 2H7VA 3O8DA 4Q01A 3UWOA 4A2PA 1LS1A 4A6PA 1K6MA 3GEEA 1JR6A 1T8UA 3EA0A 3H0KA 1XEXA 2VA8A 4CYMA 2WV9A 5EXXA 1MKYA 1UBGA 1M7BA 4OK6A 2CL0X 4U00A 2QAGA 2GWHA 2PH1A 2VP5A 5FOXA 4B3FX 1G3RA 3RS4A 2QY9A 1QHGA 4BGDA 3BGWA 3ONWA 1AM4D 3BC1A 4NPHA 4A8JB 1FX0A 1R0YA 3KKNA 1C9KA 1P2SA 3ZZTA 3BH7A 2QE7D 4C0QC 4QGFA 4D2IA 2FPLA 3OAAA 1FTSA 2AK2A 5BW8A 1FP6A 2QRZA 121PA 4EJSB 2O8EB 4M53A 3BB3A 3X1ZA 2Q3FA 2HCBA 4I4LA 1GL7A 4IDPA 3EW9A 4W7SA 3BB1A 4P4UA 5AUQA 1KI6B 2GRJA 3ADCA 1OH6A 2GVZC 1U9IA 4DXAA 4LJ7A 2X19A 4Q7LA 2VH5R 3ASYA 4BWYA 2IWHA 1CU1A 4CF7A 4UJ5A 5CYOA 4TYNA 3KJIA 5BN5A 3K53A 2GZAA 3IO3A 1MO6A 3T1QA 4M22A 4X8MA 5EE3A 1E0SA 4DLSA 1AGRA 4M1YA 4XWKA 2ZRNA 3IO5A 1KZGB 3W5IA 4CDGA 2A9KA 3GCGA 4F4IA 2MMGA 1ZCBA 1IN5A 4GRAA 4MGKR 3CWQA 5GADl 3Q5DA 4P31A 5FUVA 4QXAA 1IQPA 1HA3A 2HF8A 1CJMA 4S35A 3UKDA 4IHQA 4Q7JB 4Q1BA 5EJEA 1GILA 4LBWA 3Q3JB 4CEHA 4KYUA 3AH8A 2OT3B 1E98A 5FR2A 5BYJA 1U90A 4KFTA 3BE4A 2O8BA 3QF7A 3W8NA 1NSTA 4QJ4A 3THXA 3N70A 5DYGA 2LKCA 1DADA 3RRZA 1S9HA 4AKIA 4JLJA 1OXVA 4Q21A 1KYIA 821PA 4FWIB 3QY0A 4OJKA 3A1VA 4RFVA 5BWMA 2QE7A 3CF2A 4IDOA 2DCUA 4FI3C 3SJZA 5E7JA 2JASA 2CLDX 4XVUA 3U4QA 2QENA 1ZM3A 2ZE5A 3T35A 1BKDR 2A5GA 4Q1FA 1MV5A 3QQ5A 2X77A 3TW4A 3GLFE 2XXAA 2BM1A 2PEYA 2WPDA 2ZRBA 4PHTA 4WIAA 3I32A 4XVRA 3WMEA 6Q21A 2JDID 3U3RA 2QN6A 3CNLA 4QNRA 1OIXA 1P4SA 5B58C 3UG7A 3IILA 1J90A 1VG1A 2H8KA 1KO5A 1XMVA 5TMPA 3ZVNA 4H1VA 1J7KA 1RYHA 2FFAA 1T5LA 3SR0A 1OFTA 5HR5A 2ZUBA 1GWNA 2QTVB 4MYHA 4TYQA 4UNPA 4OQLA 2ZI5A 5EP2A 1W5TA 2FA9A 1GIAA 3G5UA 3FVQA 4HYYA 1ZNYA 2NO0A 4Q47A 2D3WA 1AS3A 2UVQA 1VTKA 3EPLA 2ZSFA 1R8QA 3PUZA 3IPXA 3CM0A 3P1JA 3CZPA 4LZZA 3U6BA 4KI0A 1AN0A 4GP6A 1L7VC 3IUYA 3K9NA 4ZKDA 5JSZB 2F3TA 4JBXA 3U3OA 4G5RA 4XOIA 2YV5A 4B48A 3ZLJA 1ETUA 5JRJA 2EU8A 1A5TA 2VSOA 3QKSA 5KO2A 2FF7A 2Q3MA 2UKDA 1E9AA 5DHAA 5LBIA 3I5XA 1GG2A 1UM8A 1ONBA 5FTMA 4XD7D 2IBMA 4HAWA 4IDHA 4TLDA 1KI3A 1TUEA 4IOJA 4RD1A 521PA 3QEOA 1DEKA 3T06B 4EQ6B 1YJ5A 1W7AA 1RPZA 2YC2C 4OYHA 3AP3A 4GMXA 4ERNA 3DPUA 1LY1A 1YZTA 2AXPA 4DSNA 3EZ9A 1D2EA 2AHOA 2C78A 1E2HA 3EA5A 2JDIA 4HEJA 1NMZA 1OB2A 4C9BA 3U7HB 1JXOA 2GCPA 1JR3D 1ANKA 3L0PA 1M8PA 1RRCA 3KKOA 4LHYA 4YLGA 1HY3A 4CVNA 1CRPA 3BOSA 3L43A 4AY2A 3EPKA 3BH6A 1QHXA 1Q3TA 2OFXA 1OKKD 3OFND 3U7GA 1XDBA 1FMLA 2W6JA 2WOJA 3THYA 4FMDF 4Q4AB 1EWRA 5DYIA 2J87A 1XTIA 2D4HA 2FWRA 2V6IA 3CO5A 2GDJA 2IC5A 5FUXA 3LAWA 3A1UA 5K8LA 1AKYA 2CVHA 3B8HA 3H86A 5SZJA 3GLGA 4DDTA 1IN4A 1AS2A 1S4QA 1W2GA 3QSYA 4A36A 1R10A 2XTZA 4DSOA 2NO6A 1JAHA 3PIRA 4IOMA 2JLRA 2Z6VA 5J47A 2JA1A 1T3SA 4L16A 4PO1A 2IEZA 2ZJBA 3LX8A 1JPNA 4I1VA 4D0GA 3PFIA 1RJ9A 1ZD9A 4XD7A 4WXRA 2ASEA 1GUAA 4PPFA 3RYTC 3MLEA 2R6CA 1IY1A 1GRNA 4BLOA 3KQHA 1E2JA 3CRMA 3CWZA 5D3MB 3EG5A 3K9LA 1F5NA 3AF4A 3I92A 2VP9A 3AGQA 3AF2A 4KJZA 1VYTA 1EX7A 3QKTA 3WY9A 3TMKA 2CCKA 2WKQA 2XEXA 4LYAA 5C4GB 4DLRA 3VNUA 4EPWA 2VSFA 3ZS9A 1JJ7A 2FNAA 4ZI3A 2JLVA 2VYFA 4NP6A 4C30A 3OFNA 1OKKA 1IHUA 3LRPA 4ZDJA 1N25A 1II8A 1ZNXA 1OPXA 3AV0B 2F9MA 2JLSA 4KAXA 4JMPA 1FW6A 3WYFA 4C0AC 2WTUA 2QQ0A 3CF6R 5FUYA 2F7SA 1N5IA 1OV4A 1WE2A 3SBDA 4MGZR 4UQOA 2OFWA 4ITRC 4ZCMA 1RRGA 4YXWD 2V55B 3TNFA 2E87A 1P2TA 3NG1A 3GD7A 2IUUA 2ATXA 4B3BA 1Z0DA 3AVTA 1P60A 3FMOB 3CX6A 4L15A 2ZM5A 1ELOA 5BN4A 4M4SA 3RNLA 4Z54A 3U3JA 2NGRA 3KQKA 1H8HA 3CONA 2Q21A 1X1RA 4LSGA 5UKDA 1KI7A 1QHHA 4C0KA 4A2QA 1KI9A 3BK7A 1ZNWA 2CNWD 2H18A 5BN3A 1D2NA 4JYCA 5AUNB 2WJVA 3GLHE 4B2LA 4A9AA 2WOOA 1CP2A 3SI7A 1FL9A 4JYBA 5E4FA 1DG1G 1MR3F 1IJFA 5AUPB 2DWPA 2HYIC 5IF9A 2BM0A 2GCOB 3WMFA 4ZIRA 4BRWA 2B92A 3THWA 2X2FA 2ZRIA 5J5CA 3AUYA 5HPYB 2JEOA 1Z0JA 1XZPA 2E9SA 1SVLA 4V0MA 1W48A 5BQ5A 3AGPA 4US2R 5FI1B 3JZAA 1PUIA 2W83A 2ZI7A 2QROA 5A4JA 1E32A 4IDQA 4QC2A 4TMTA 4JLNA 2AX4A 4DCUA 3AF3A 3H2YA 3EWAA 1FQKA 3QXJA 4G0NA 4LDJA 4Q4LA 2UZIR 2GILA 3OEHD 4BZPA 3RAPR 4D25A 2R6AA 3U3MA 4Q4HA 1JXMA 4BLPA 4CRWB 1XTKA 1EFHA 1ZUNB 1SKYE 3QUSA 5FOVA 2NPFA 2ZREA 3H1TA 1P3JA 4DDUA 5TDHA 2ANCA 4IOLA 4YXWA 1WXQA 1W46A 2EQBA 2OM2A 4R98A 1QVRA 1K5GA 2JAQA 2VRWA 5EZ5A 2PCLA 4PTLA 5KNBA 1XJCA 3A4MA 3FKQA 3SEAA 1MH1A 1U0JA 3TAUA 2GEVA 2GKSA 1NBMA 2OFOA 1G8PA 4BFYA 3D31A 4TL7A 1HQYE 3ICQB 1PZNA 3CRVA 4LYJA 3KQLA 2IT1A 2WJIA 4AI6A 1GKYA 3RS2A 1EWQA 3RS3A 2RKOA 2DBYA 3F3YA 5E3HA 2V3CC 2XJ9A 2G9NA 3JVVA 1QBKC 2RGNA 3GJ7A 2PJRA 4G3XA 1NY5A 3TUJC 3ZJYA 221PA 5JS8A 4M9ZA 1GM5A 1SKQA 1XWIA 4F7WA 5L3QA 1GAJA 1G3IA 3KTAB 2GK7A 3SHFA 2RH5A 3K70B 3FFAA 4OQNA 1W2HA 1CIPA 3TIFA 1ZIPA 3B1ZA 2J46A 1OB5A 4JLBA 1BMFA 1M1YE 4URWR 3BAFA 1G19A 5JZVA 3DM5A 1GZSA 2A5JA 1JJVA 2GF0A 3GLFA 3K0AB 3NIBA 3BWDD 4MYCA 3ECCA 1U0LA 3T61A 1XTRA 1Z22A 1DARA 2C03A 4Q4JA 2XOKD 4P4SA 2Z83A 3VTKA 4B6EA 4CT4B 5IT5A 1XCPA 1SHZA 1XMSA 2GAOA 5E7IA 1M6NA 2C9OA 4TYWA 1RW4A 1BYIA 3L2OB 4RCYA 4UXJA 2QZ4A 4HB0A 1JBKA 1DOAA 2FPKA 2ZJ8A 3RSOA 1P7CA 2ODNA 4TL8A 4TQAA 4PC6A 3K0FA 1KDTA 2VHCA 1KI8A 4URXR 3KKQA 2GK6A 4QGAA 3UXMA 2OCAA 1Q57A 1Z06A 3WXMA 1E99A 3T15A 1S9DA 1SVSA 1EG7A 3TSZA 3KQNA 2FFQA 3NEYA 2ZYWX 1P6XA 4URZR 1HT2E 5IDVA 4W5HA 3LQQA 2HLDD 1E9FA 2GJKA 4BLQA 2D06A 1US8A 1OLOA 4L9SA 1TX4B 2YWHA 4LC1A 5DN6A 4JL8A 1SKYB 1TMKA 1GNPA 1G41A 4G1UC 5KPDA 2NZ8A 2QTHA 5AJXA 4TZ6A 4Q1CA 4RVCA 1XEXB 4HAUA 2ZE6A 3GLIE 2D62A 2PL3A 3Q7PA 4WOPA 4C7OA 3GJ4A 1DAKA 1NI3A 4LY6A 2JIZD 4MITA 3SYKA 3QOFA 5HZHA 3MWYW 2OUKA 4Q00A 1E9EA 3NVAA 1E2QA 2R2AA 4QJ5A 3LX5A 4QBGB 3NHAA 1KSFX 3QVVA 2BEKA 3RANA 2YYZA 2BMJA 4LV6A 3CW2A 4R2HA 2JJ2D 4PQFA 1SVWA 1ZBDA 5CB6A 5DLQC 1OFUX 2XOKA 5HTKA 3G82C 4Z8XA 3WNBA 2DR3A 1HYQA 4Q19A 3ZYCA 1XEFA 2FSIA 4A8JC 4IOKA 5LB4A 5KYKA 1V43A 1U81A 3CH4B 4PFSA 2WBLC 1GTVA 4Q66C 4HLDA 2Q9AA 3PXGA 1PLLA 1RFLA 4IDNA 3ZVMA 4DJTA 1TU3A 4K81B 1E9BA 4FMCF 4BE7B 3PR1A 3LA6A 1IN7A 4EJSC 3I5YA 2QUZA 3W6PA 3AVYA 5CLQA 1NG9A 4V0LA 5ELXA 4GDFA 2DWQA 1XD9A 2XB2A 1YZNA 2PZGA 4Q9JA 4LHXA 2WMOB 4JIMA 1KO1A 3B5JA 1JQLB 2HLDA 2ZSBA 3SZRA 3ND8A 4DDVA 4LJYA 3PVSA 4LGMA 3MRSA 2JLZA 2IYYA 2AL7A 1Z0FA 3EXAA 1Q1BA 3UATA 1RRFA 4RFSB 3TH5A 5L3SB 3KFXA 5CK4A 3SNHA 1KKLA 3EZFA 4KITB 2YNMA 1NLYA 4E22A 5AJYA 1NVUQ 3OZXA 3B2EA 4CEHB 2JCSA 4JLAA 2Z0MA 2O8BB 3WP0A 4YQFA 1J8YF 2XX3A 5KOYA 3U5ZB 4DCNA 1E2IA 4NHOA 4TSFD 3THXB 1UAAA 3M1IA 1N2CE 3LXRA 1E94E 4Q02A 3Q7QA 4DUGA 1CBUA 3ZD7A 1M7HA 3LVQE 3KXLA 4HUQA 1E4YA 4Y0VA 4FIDA 1Q20A 3GFPA 3L8YA 1X8KA 4YDSA 1E3MA 4RKFA 5HZKA 1SXJD 1G5TA 2ZAMA 5L8VA 4Q9LA 3CX8A 3KDSE 5JHHB 2CE7A 2EFHB 3F5FA 4OBEA 4AYTA 3RDPA 1OT3A 2YKGA 3E5HA 3BORA 3L82B 2O8CA 3NEJA 1Z3IX 2XXAB 4IFEA 5FTKA 4QHTA 4RKEA 3ZVRA 1XEWX 2WIAA 4C0SA 2R6FA 4JVNA 3VHLB 1NY6A 1KMHA 1N6RA 1QVAA 3A37A 4BRUA 3CRQA 2ANBA 1DO2A 3LLMA 1XPUA 3T12A 4F92B 2A2ZA 3Q8XB 1W36D 1SVIA 1ZU4A 3OHMA 3BJIC 3W6NA 1EFRD 1Z0KA 5KDDA 1J8MF 2O0HA 3DL0A 2W6IA 3LWNA 2VPPA 2ZRAA 3NH6A 4NKRA 1OJLA 3HP1A 1ESNA 2LCFA 2P5TB 4WVFA 4ZCLA 4D4KA 1K8RA 2OZEA 3UANA 5CB8A 2GHIA 5FOSA 2BBWA 2W2XA 3R8FA 5DHFA 3Q72A 3EIQA 3I3SR 3RHFA 5JEEA 1E2DA 3RRYA 1S1MA 4D4LA 4BFTA 5AJZA 3FHTA 2IXGA 2AKYA 1ZM2A 4AYWA 4TSFA 2OILA 3DOFA 3IPYA 1S1CA 3MUFA 1DVRA 4F4CA 2BKUA 2PCJA 2PLFA 1AA9A 3QBTA 3CNOA 4I99A 3OIUA 2BMFA 1LS6A 3QKSB 1HTWA 2JJ1D 4GL2A 3B1XA 3ZDQA 2BVNA 1SXJA 2GBLC 4JSTA 1KJZA 4MKHA 3ND9A 4KCGA 2GESA 2C96A 2NTYC 1N0VC 1NVXQ 1T5IA 5IK2D 3OESA 3VR4A 5C1BA 4HDCA 1WRBA 2CL6X 3CKLA 1Z6TA 1ZAKA 1ZM7A 3ZD6A 2WJJA 1E9SA 1KO8A 5FUWA 1GL9B 3FMIA 2CJWA 4B44A 3V4FA 2GVDC 2AD5A 3M4YA 4Y0AA 1GDDA 5HCIA 3SJBA 4QHSA 5C2JB 3T34A 1E2KA 1N6KA 2IS4A 1W49A 1WDTA 2A30A 5CIWA 5DH9A 5CITA 3MD0A 4TT3D 3UIEA 1T3LA 1GNRA 2PT7A 1EFRA 2HF9A 4B34A 4B76A 5FPKA 4A92A 5J4VA 1OFHA 3MWLA 1OH5A 2I1QA 3KFVA 2W2VA 4F38A 2ZQ5A 3IBGA 3THYB 4BFWA 4URUR 4M1SA 1G4AE 1IONA 5EXPA 4YMVA 2HT6A 4GSYA 4Q18A 3SU8A 2IWRA 4W9MC 1DE0A 1TAGA 4BECA 2XTMA 2WPDD 4BQSA 1F6BA 2W0MA 4JT2A 2IW3A 3B1YA 2BWJA 4ARZA 3EPJA 1NN3A 3EZ6A 3UK6A 2OE2A 2IX3A 2AK3A 2OBNA 1WCV1 4HZUA 4OK5A 1C4OA 1KO7A 2H17A 3SYLA 1P9RA 4PO8A 1G5PA 2AWNA 2VSXA 3E2IA 2JJ1A 4GZMA 4NYJR 4BFUA 2DFKB 3C5HA 1G8HA 3AP2A 1GRRA 2ORWA 4Q1DA 2V8OA 5IK2A 2P5SA 4PHGA 2OO7A 2K5UA 2RHMA 4LYFA 2PMKA 5JEDA 2GXQA 4OKSA 3K0CA 2NQ2C 4IFBA 2ECKA 4OI0A 3W8RA 3QXXA 4DEYA 1N0WA 1D9XA 2O52A 1W0KD 2WWHA 4CEIA 4O25A 2ZI3A 4ZO4A 2A5DA 5KU1A 4QGHA 3AKEA 1R7RA 4OQFA 4H9GA 4TT3A 3R7WA 2ZRCA 3A1TA 1MRNA 2CE2X 2NZJA 4OI4A 5DI9A 1JECA 3GJ3A 4MKIA 2FGKA 3NWJA 4BFVA 4TLEA 5GJCA 4ABYA 2JGNA 2OHFA 4LHVA 4B32A 2QP3A 1OXSC 3IEVA 4QGGA 4DC9A 2ZRDA 3QE0A 5BYKA 4B73A 1PLKA 2IS2A 2WWGA 5L3VA 5FTLA 2C8VA 2NMVA 5JWHA 2R8RA 4BEJA 4TLAA 3PQCA 4PPNA 4AKEA 1P9NA 1TEXA 3KXIA 3KB1A 4MDEA 1WQ1R 2QBYB 4G01B 3HR7A 1KZ7B 5CJ2A 1YHNA 2V1XA 4XWAA 4WBSA 2OBMA 1E2FA 3GJXC 2DHRA 4EFNA 1E2LA 4KHZA 3TW8B 5H1YA 1OE0A 3M6AA 3I62A 4GOXA 1XJ0A 2QORA 2YOHA 4DRZA 5C46F 4TMZA 3DZDA 3RS5A 4MRNA 2N42A 2HXSA 2QPTA 2W6JD 3GLIA 1AZSC 3A1WA 5HKKD 2FDCA 2QP9X 2NPIA 4PC1A 5CM8B 4Q48A 1S2MA 1KNQA 1D2MA 1BH2A 4DBLC 4A15A 2CK3D 2O0KA 3AVUA 2J0QA 1TF7A 2GETA 3AKYA 1JNYA 1OYYA 2NO7A 2O5VA 1RRPA 3DMNA 1Z28A 3WYGA 4ZIRB 1W0KA 3LLUA 3TAHA 3THWB 1S8FA 4GBMA 3GMTA 4G5QA 4JLVA 1Y63A 1P62B 2DFLA 1YR9A 3RRNA 2NOAA 4KYIB 4BFZA 1ZRHA 4NL4H 2QSYA 3B85A 3EZ2A 4NDZA 4WA7A 2BCJQ 3K9HA 3FDIA 4Q9KA 2F43B 2FFHA 4QG7A 1J70A 1E2NA 2G1KA 3LO5A 4U5XA 3VR5A 1XPRA 2JLUA 4DLZA 3T1VA 4TZ0A 2RGXA 2WKPA 5CM9C 1AK2A 2ZRHA 2J1LA 3LW7A 4Q4HB 1NRJB 1TEVA 3AF0A 4J0QA 4FCVA 4TTQA 4CT5A 5F3WB 3LY5A 1TQDA 4AG6A 2J0UA 3UMFA 3EASA 1G4UR 1R6BX 4Z51A 2JLXA 3VR1A 1FMJA 4A0RA 2IF0A 1H8ED 4DLTA 2OAP1 1YRBA 4U7DA 3SC3A 3HYRA 3PG5A 2Q9BA 1YZUA 1N6HA 3D3QA 4UNRA 3FKSA 3AB3A 3IIJA 3BFKA 4LJAA
chains in the Genus database with same CATH superfamily
4YJFB 4F93B 4UATA 5K8VA 3WKBA 2C3OA 3JQ9C 2Z9BA 3HEMA 3Q12A 4BNZA 3E8SA 4ESHA 3NEAA 4AL4A 4EQZA 1Q12A 1Y3DE 3AI3A 3CPEA 3L92A 1RBQA 3PEEA 2FZGA 2PUEA 3QG5A 2CWWA 3VPBA 5JS7A 4GE3A 1G1MA 1DQZA 1LRJA 1UJ6A 1T1GA 2CBXA 2C4MA 2IEYA 1E64A 4Y67A 1ODJA 2XNKA 3C7KA 5BWLA 4UTXA 3JQ8B 1I4TD 2XMPA 3N2EA 4IXNA 3O90A 3C3PA 2ZWIA 2ZKLA 1BU5A 3QLJA 5CDFA 3HCDA 1N6OA 3NS7A 2CNOA 1R5BA 2WHPB 5EHIA 4JI4B 3L1VA 2Q0XA 1C4WA 2IV7A 2R1TA 3WWZA 1XX6A 5FX2A 4D57A 1CQXA 4BHTA 4ZN6A 1WDMA 1QRRA 1DDIA 5F5LA 2XGGA 5GONB 3K1JA 3MWEA 4O4IB 1HFJA 2V3VA 2Z09A 6GPBA 2OQ2A 3HCAA 3PLNA 2RB5A 2DLDA 1UOEA 1J7JA 1JDUA 1XD8A 4BNFA 2I91A 3ZQKA 1S01A 1KI6A 2OSVA 3E5NA 1PF7E 1NM5C 3RVLA 2F9LA 2YYAA 3KSMA 5REQB 4TMFA 1Z6GA 1XAGA 3K70C 2OCBA 2Q1UA 1RP1A 2E1RA 2ZWOA 4JBWA 4Q4JB 1IN8A 1TCUA 3IMGA 3FROA 3LUJA 2IE8A 4A0HA 5BQFA 3TBKA 5A5GA 2A58A 3L4BA 3DBIA 2XWBF 5A1TA 2F00A 5K6AC 1QP7A 4PG7A 4OH7A 1EB9A 4G4IA 3QENA 4DLPA 1DUIA 4EBFA 3QJYA 2IEAA 3DBVO 1EPUA 3B36A 4DPLA 3NKFA 3C8MA 4J4BA 3M4ZA 2CMDA 3TJRA 4C7BA 1N5JA 2BJVA 4D42A 3S5JA 5SZIA 5GINE 1M34A 3F9CA 2I3BA 1L7DA 4RF5A 4JY7A 4PLWA 2IK8A 3TM4A 4UVHA 1E1NA 3NLLA 4LRTB 2PO5A 1N0UA 2HJHA 4KSYA 3C45A 1B76A 3GEDA 1LDGA 3GLUA 4ZI5A 5C4IA 2OLKA 1JV2B 3N9IA 3Q3CA 5JSFA 1PGOA 2EG5A 4TS4A 4AF6A 3DKRA 2I8AA 5T64A 1R27A 2HNBA 3TZHA 3QK7A 4JQZA 2NIPA 5DIZA 5TLSA 2C04A 4KTVE 2AMLA 4X92A 1EVJA 2PXCA 2YWJA 1HETA 1PEDA 3F90A 3RFCA 3SAJA 4V3CA 3RFTA 3F4KA 1VG8A 3Q5GA 1GPAA 1WXGA 1Y6JA 2V4ZA 4IDGA 4N0EA 4RJLA 3I6IA 2X22A 4JH0A 2JHCA 3II6X 3ZDCA 1SUAA 2H1CA 3UAVA 4R68A 4J3NA 1CR1A 2ZXUA 2JFVA 2CXSA 1Y9EA 1FSPA 1JALA 4LJ4A 5ITSA 1UK9A 1ZNQO 3QGMA 5DPMA 3BKXA 2VQFB 1OXXK 5JCPA 1IJKA 1FFHA 5I9NA 1YFJA 1N9ZA 1TYEB 3OOWA 2HTEA 4PV7A 4EZEA 3LUCA 4JLPA 1J0BA 1BCSA 1NL3A 2ZJZA 2VJCA 3W6OA 3H11A 1XA4A 3JARB 3LUHA 4F9FA 2BJHA 1DX6A 3RK1A 4BO9A 1QH0A 2KLBA 3EIWA 1IY0A 2ZDQA 4V0OA 3KB6A 4ALMA 4DXDA 1QH1B 1JPVA 2QAGC 2ZBDA 4PO3X 3OY2A 2DTDA 2GCIA 2GA9A 2I6XA 2I2DA 4HS9A 3TSCA 3P9KA 1W5FA 5THKA 1HV8A 4NK5A 1SOWA 5K2MA 2H54A 1M74A 3A9SA 4NBUA 2NU8B 4B3XA 1P2FA 1SZDA 2GF9A 4LJLA 4QASA 4YRKA 2AFRA 5DGDA 3U16A 5HTOA 3UN1A 5ER9A 3G23A 5BSFA 2ZIWB 1OLUA 4IQ0A 3AZPA 3VI3B 2BI8A 3QPAA 3ZEIA 2Z6AA 1X8JA 1B3RA 1C3VA 3CX4A 4Q3KA 1JR4A 3KXDA 4DMCA 3LPLA 3FIJA 1CZOA 2QVBA 2FOLA 4YV7A 4JEHA 1II9A 2FQWA 2M1ZA 3LBYA 2W22A 4TVOA 4AULA 2IUEA 4BS9A 1JIKA 2X9LA 5CFQA 5K05A 3CISA 4XWOA 3QU2A 5LIPA 3F5SA 3AESA 1DAGA 2PT6A 1NC3A 1ZOSA 2JAHA 2RBGA 3HJHA 3H75A 4LGYA 5E9QA 3TCNA 1SKMA 3QWAA 1YCHA 2FGJA 2I4OA 3A4LA 4U7PB 4GXTA 4V03A 5I5GA 3W3AD 3TR0A 3AX6A 4JCCA 2VZ9A 2G6BA 2JCGA 3AHEA 1ZOOA 4QA9A 2Z30A 1DAMA 5FYDA 1T5HX 4CM3A 1XCMA 4IVPA 3I8XA 1JHDA 4LVOA 3T7KA 3VVBA 1Y8ZA 1DG9A 3UHJA 2HLHA 3PC7A 1N6PA 2QSJA 4P84A 1UFKA 3KKKA 4L6AA 4QU9A 3V1YA 1I2DA 1Z08A 2VK4A 1T9GS 2H1SA 1VHDA 1DXHA 1EAMA 2NWQA 4WNAA 3VOAA 4YXFA 4TLMB 3O3NB 3NDBB 4HUQB 1QFZA 1RWMA 1Y1RA 4ENRA 4PAWA 4R40A 5I5EA 5L4SA 4LYHA 3V8QA 2JLWA 3CF0A 3L7MA 4EVIA 3QLUA 4XIFA 1DX9A 2NVUB 4YT2A 1X80B 1D04A 4OJMX 1AKTA 3BMCB 4B3DA 1E2PA 3G2OA 2RH9B 3CUSA 4GWGA 4ZYTA 5GOTA 1GPH1 5ENDA 3ZN2A 3D4OA 4OHVA 3VR0A 3EIHA 3LDAA 2NAFA 4IS2A 5CMLA 3AIOA 1SVOA 4ZQEA 2GPTA 1QDLB 3QFRA 4LK2A 3WB2A 3M6VA 4A23A 5DNDA 4MYSA 1OZHA 1U5BB 1W35A 5ESRA 1KR2A 5BMVF 3G88A 3QG1A 2DFNA 1ISHA 1LBHA 1YTLA 5H3LA 4BEBA 2Q7DA 3ETGA 4PX9A 2ZB8A 5CA1A 4DB4A 4LXQA 2G0NA 4YDQA 4IMJB 1YF3A 3H19A 4RTMA 1M66A 2RBEA 1M6YA 2EX1A 3MRTA 3A0RB 3N7UA 4O08A 5EKTA 1FB5A 3ZU6A 1QLHA 1NIPA 1Y1SA 2BFFA 2EF1A 2UZ3A 3U39A 1DAFA 3JD2A 2G0TA 4DMFA 5LQRA 1H65A 3TSYA 2E18A 3WKAA 2YV3A 3WX0A 2WYOA 1U9YA 1KFEB 3FIUA 4EHBA 5JCXA 1QQBA 3UCFA 2DKNA 1CQJB 1X1EA 3HRHA 2GYVA 3KZOA 4K6FA 5H70A 2IGTA 4DV4B 2WYVA 3ZD9A 3W3AA 2CBZA 1CB0A 2B6HA 5FADA 4PINA 2F62A 3CLRC 5FOTA 4JAVC 5H8WA 3BA1A 2YVKA 3AW9A 1TA0A 1I33A 3UHAA 4AZ0A 4HAVA 1T2AA 4YYZA 4GOKA 1V8DA 1XEWY 2PZKA 4MRRA 3WWEA 3GAFA 3IQHX 1P6UA 3ED1A 4HFRA 3ZDEA 4UAGA 1F2DA 5K0NA 5LXTB 4NBNA 4CM9D 5ESDA 3IUJA 4HUJA 4G9GA 1QFXA 1E1RD 2QM3A 3GEIA 3R6GA 1GGVA 1Z0UA 5D3MA 4CCYA 4OBWA 3G3EA 1OWOA 3OJCA 1XHEA 1W44A 3F6CA 3PGKA 1PGQA 4EG3A 3FCEA 1G9TA 1E3TA 2VSYA 4KSCA 1SXJB 4ZCSA 4NABA 3GGGA 3TK1A 3O93A 1CUEA 3U9SA 3KM0A 3OP4A 4FWBA 4AQYB 4B71A 4TL9A 3KETA 5LD2B 2WJPA 3BDAA 2VTDA 3KYIB 1NE2A 4DR3B 1ZO8A 1DCTA 1JEYA 4FMDB 3DOCA 3ANYB 2RDMA 3NHZA 5THQA 1GQQA 3DONA 1CQIA 1PBTA 1Y48E 2QRHA 4CW7A 4RTPA 1WLSA 2C0PA 5L7TA 1U7DA 2DT8A 5BOVA 1NJ6A 4FJ2A 3TG8A 1Z17A 4A5OA 1DEHA 4LRXA 2VPZA 2KBFA 3G13A 1JYEA 1AGPA 1N2JA 4L5BA 1ZM9A 3H9UA 4X61A 1OGJA 3IV7A 1LVUA 3GFOA 3N2GA 2XNDA 2WFAA 1NMEA 4HPJB 3I61A 1VIVA 3RKSA 5KOYA 1UDWA 3B1VA 3KKZA 3ZTYA 5K7SA 1X15A 2YWFA 3QELA 3JPYA 3TIVA 4F9GA 3VO9A 2N1MA 2JEYA 1TTHA 3DXYA 2Q46A 3QWFA 2JFZA 1JVSA 5ER6A 4CF4A 2W2MA 4QUKA 4E1AA 4D9IA 2WZQA 1QG0A 1O8BA 4PBSA 3UT5A 1P44A 3QVWA 4TMKA 1SG0A 1KJYA 4XWYA 2DPGA 5JPCA 1FUEA 2X42A 2R6JA 1KZ4A 1PGPA 1QIEA 3EDYA 1ADBA 3PEUA 4RVUA 4DADA 4ZT4A 3K1TA 4MARA 5K4AA 1E1RA 1QQ5A 5BN5B 2F59A 4IJMA 3VDNB 5A3JA 5IARA 5I01A 4KO2S 2XR1A 1JLKA 2H48A 5DISB 2D7DA 2KSQA 2PSFA 2IXTA 4RZUA 4L02A 3C1AA 4IEEA 2JIPA 2QM8A 4G0VA 3HRKA 3CZ5A 3DOOA 3G8CA 3QLEA 1MAWA 1PR5A 1HT0A 3GLFB 3L7LA 3PJRA 4CT0A 2O9JA 3GP8A 4LVUA 4KN5A 5ALHA 4INAA 1T2EA 1U9JA 1XMPA 4W5WA 4FNMA 5ALVA 5KNDH 1CEYA 1XWWA 4NZYA 5AICA 2R6DA 4EDFA 2YVAA 2BYTA 1JBQA 3U3ZA 4ANFA 3IBSA 4C0BA 3PLRA 5HIAA 3TPCA 1LV7A 2WA1A 2GBPA 4JSYA 3OT1A 4FGKA 5EGSA 4ITUA 1SC6A 2BOVA 2RC5A 4M8IA 1E1KA 1KDVA 3V5NA 4X7MA 3W34A 2FP4B 5CPBA 5E2BA 1XI2A 5JFGA 3E81A 3R7WB 3R5XA 3DO6A 1QVWA 5ICCA 1NAHA 4HI0E 1GTJ1 1BCRB 1D7OA 1VL6A 3HI4A 1XTTA 2WT8A 2C2OA 1M1ZA 2WYHA 4Y9TA 1FP7A 3P2IA 4RPIA 4E2YA 3THOA 4YRZA 2IPOA 3AOGA 3KYCB 3NC0C 3VTAA 4DHEA 4IRXA 1RM3A 5HCUA 3ZHCA 3Q3VA 1WBBA 4I9FA 5JCOC 2DPLA 3K8ZA 1E4EA 2AQIA 2ZRKA 1F51E 1USVA 4UUNA 1Q3KA 3WK7A 1PJSA 2Z4TA 1E5VA 1A82A 2E5FA 4BZZA 1PVOA 2CMKA 3ORSA 1JE0A 1UCFA 3AR5A 1D4OA 1LI5A 4DVGA 4MUHA 4PSDA 2B99A 2QGZA 1J0CA 3CLTC 4C07A 3AVXA 2O2HA 3EJ6A 2QL5A 3T41A 4C0XA 5L4LA 2FW1A 1HRKA 1BX1A 5HQ3B 4K5QA 1RKBA 4U9IS 3PR3A 4B3HA 4DZZA 1SC1A 4TQ9A 2I7TA 3O2SB 2WJYA 1K3UB 3IQXA 5LA6B 1WQ4A 1EHIA 4M1WA 1REQB 4FYHA 5DTJA 2J09A 2VN8A 3DQQA 3FNEA 2I6QA 1S0UA 5B7QA 2H3EA 5GVSA 2GUGA 2AFIB 2R9VA 3IHLA 3S1SA 2PGIA 4KE6A 3RSZA 5HDQA 1ZJWA 2OL4A 3SICE 4CLOB 3AF6A 1CHNA 2EFCB 4MS4A 5SZHB 3VM6A 3SQOA 4A6DA 3V4RA 1FS4A 5CA0F 1DELA 1NU6A 2VDQB 2RGEA 4I1UA 2PXAA 2XUAA 5AI9A 3M0EA 2C5GA 1JQDA 1TMYA 2J9XB 2XGOA 1SUDA 3AVOA 3D7SA 2RE8A 4OHCA 1PT7A 1ECBA 3GLHA 1E2UA 1PP4A 4M76B 2CXQA 2H00A 3N3BC 4JVMA 4NE7A 4N5MA 3K0KA 4HNHA 3BSWA 3OX3A 3CBQA 5NULA 2EKLA 2I6SA 4FSHA 5AWFC 5GGYA 3ODPA 3OOEA 3FOFC 1IWBB 4M46A 3L7CA 1E9CA 3UQZA 2CVQA 2PZFA 1BQEA 1O96B 1RWVA 2EJVA 2GKOA 3D54D 4QAQA 3TX6A 3ZV5A 4DA0A 1IATA 1PNVA 3ZV3A 2D1RA 1KARA 1CUFA 2F9FA 3P2YA 3DEJA 5DE3A 3UWSA 1W19A 1VCOA 2BN4A 3D7MA 1T8SA 4UUBA 3RG2A 3QVXA 3INTA 3FPAA 4RZXA 5HKOA 2XMBA 1CEQA 3OPYA 4QZVA 4B2IA 3GZNB 2ZYVX 1B0PA 3BCSA 4R1UA 1EFDN 1E69A 2VWGA 4RS4A 4JUDX 3LUAA 5CIQA 4F97A 1GKIA 4I4TB 1SHKA 3MCAA 4ND8A 5GY7A 2EL7A 3KKPA 2HCJB 2F1RA 3BG5A 1PK8A 4RIHA 2A7XA 3CY6A 5THXA 1ZRMA 4E12A 1HQKA 3UHFA 4EKDA 2OBLA 1JQ5A 4B2PA 1KJIA 4LJ8A 2G7MC 4OUDA 3WGKA 3AVVA 4MW5A 4Q3OA 4M1OA 5FULA 5F2EA 4N39A 4ZO9A 4LJ5A 1OUMA 3RF7A 4AROA 1P9OA 2YC4C 1QR6A 4TRMA 2DRIA 3DHWC 1FDTA 2ECOA 2NXNA 4YI5A 4N4AA 16PKA 2V3WA 3PJEA 4GQAA 4RDIA 2Z5LA 5AJUA 1XZBA 1TA9A 2QUBA 2F1KA 2OAQ1 3JQ7A 1VE5A 5DNYB 3GC6A 4HDMA 5CCBA 1TF5A 3R74A 4CLHA 3UG6A 1IYZA 2RCNA 5H83A 4BDTA 1Z63A 2F67A 3SIPA 1PSWA 4EK9A 5JHGB 4N0DA 1X7WA 1LRKA 3C3XA 4ZC8A 1JZQA 1C1YA 2FUKA 2H06A 1SQFA 3AEUA 1I2ZA 3D1JA 3DCIA 3PUXA 2OKCA 3GZTB 4TWZA 1JUDA 1TMGE 3UICA 4BLVA 5FOQA 1ODLA 1CR2A 4MJLA 4B4KA 2RG7A 4CLDA 4BQRA 1BKYA 3QBVA 1J1ZA 1E2MA 1H2HA 3MWEB 1GP2A 2ERYA 4JUFA 2D59A 4WJKB 2GSDA 3DS8A 3EXFB 4FCTA 4YK7A 1Q92A 2EIHA 1GTZA 4QNMA 3TNJA 2HBQA 4PCUA 4BLWA 2VLBA 1FP4A 4B45A 3LXXA 5CNIA 3MS4A 4MTLA 4F4UA 4YALA 2ZATA 5IJXA 2FJ0A 4GKKB 4PC7A 1I13A 1W34A 3N53A 5H68A 2QRNA 4EO9A 1AT1A 1KK1A 2R8PA 2YRFA 3T0GA 1T25A 4M0MA 3VRHA 4EKIA 5M04A 4PO9A 4BQPA 4N41A 2QXYA 3LF2A 2IZ1A 3EVAA 2D2FA 3A7EA 5U4XA 3H8VA 3EDCA 1NZFA 3FRHA 2DETA 4FC6A 1D6MA 4TM7A 1QF6A 3RYCA 3M34A 4REMA 1R9GA 1R5OA 4EJ2A 5I7OA 4QOJA 1M34B 2ID4A 2O1WA 3U60B 4TX1A 1Z39A 2E4AA 3JRXA 3C6ZA 5L3SA 4FEYA 5ES4B 1QAQA 1WHSB 2VJAA 1FJ2A 1VI6A 1G0OA 3LLSA 2WAAA 5JZBA 1CCWA 4XX0A 3DLBA 4XOUA 1KI1A 4KQXA 2ENUA 4RMGA 1FIUA 5EZQA 1GUBA 4BNTA 4L8GA 2FF5A 1UAYA 1RBMA 3HYNA 4HB2A 4EF4A 4TMXA 1WB5A 1WXXA 2PGJA 3LC1O 4LZWA 3GZ4A 2RH8A 1U8YA 3LY8A 2QSUA 3AO0B 3SM3A 4GLLA 3NNDA 1U0HC 2Y66A 3GFFA 1N4DA 1ZL0A 4M7PA 2GMWA 4FGJA 5E38A 1VIMA 5AP9A 1AGYA 2VATA 3USES 2WT9A 2O5CA 1QRAA 4CKEA 3GQBA 4O02B 4Y2XA 4LCEA 3FAKA 4QAJA 2P9YA 2ZE7A 5EE1A 1Q11A 3B6ZA 3TIXB 4IFIA 4TLCA 4ZT6A 2YL2A 1EBBA 1G5QA 3C97A 2BFCB 1BCSB 2X3FA 3CGGA 2I99A 1E6LA 4JOCA 1P45A 5T7BA 1G64A 4N3NA 1YVPA 1HH4A 2SBTA 1XYYA 2FFRA 3YASA 4DOMA 1RNLA 1Z4LA 2AE1A 3ZWCA 4XQ9A 4TTPA 2P2GA 1BWRA 1PD0A 4N7RA 2FUG6 2HFKA 2RARA 3G8DA 1SELA 4DQUA 1FDVA 3PXUA 3N0TA 4Y2YA 3O3MB 4J9VA 2CFSA 3WQHA 3H42B 4Q3BA 1GZ7A 1G5RA 4BPBA 2G5TA 5D5PA 3TQTA 3ZXIA 4O59O 4KOEC 4R31A 2RBKA 2YRXA 4QBFA 3HKDB 3HBLA 5G0VA 2EEZA 2E6KA 2W2QA 4MXDA 2C8KA 3MPUA 5AVOA 4L0MA 2BSXA 4ECEA 4UBOA 4PPGA 4PEVA 1U1CA 4OQXA 3R2JA 1RI1A 4BAGA 4N6OA 3R3JA 1P73A 4LGVA 1OFVA 3AR7A 1I10A 3P9NA 4IRUB 2QUKA 1GL6A 3UWPA 4IQFA 1H3EA 4PSKA 3U3DA 3AESB 2AJBA 4L3VA 2REBA 4KO1S 4BKRA 1VE6A 1G3UA 2O0JA 3AJ8A 2DH6A 1HC7A 3JQGB 4OM7A 2PTGA 4X7PA 5I7UA 3K4PA 3LVFO 1Y5MA 1SOUA 3UK2A 1DJOA 1IOLA 3GLRA 1E8NA 1GY8A 3GCWA 1UBEA 4WADA 3WGNA 4C20A 1X8LA 2QTFA 2ZS8A 3AOEA 4K8OA 1YV9A 4P5DA 5SICE 1YZGA 1RLMA 1R0KA 3KUDA 3LYAA 3MJRA 1JQJC 1XRRA 1XO1A 2EARA 3AF5A 4MV4A 3KKEA 4FYMA 1PJ3A 3F2VA 5CFRA 1B93A 1DKQA 2IYAA 3QEJA 1WF3A 4TUYF 4U2EA 4AJIA 4X6XA 4KAJA 5BMVA 1TYCA 3P9IA 4WNAB 2OHXA 3BXGA 3AL0C 3IJPA 1YIOA 4LJ6A 1PZGA 3MVEA 1V3UA 4RK5A 2HA7A 1U7WA 4Y9RA 1EA5A 3VR6H 1WHTB 2JLQA 1A4IA 3EOZA 5KYYA 5IRCD 4C05A 4B3SB 2Q3LA 4HVCA 1GN9A 5DP1A 1UKEA 2OCIA 1FY2A 2XWJI 3L7JA 3P27A 3PZBA 1NUHA 1DPGA 3RJTA 3NT2A 2JAUA 1M2GA 1BVRA 1T26A 4I1SA 4AP6A 5P21A 2VAVA 4H4CA 5ADUS 4RESA 2X5OA 2QMOA 4UCWA 3A3PA 3L8ZA 3RLFA 5FQOA 3STUA 3HZHA 4URFA 3OT5A 2A0FA 4JJ8A 1YJ8A 3IYLW 4MVJE 4BMYA 3OLZA 4LVNA 3NTRA 4M49A 3A26A 3ZGOA 1DMRA 4JL5A 1YC2A 3PITA 5H80A 1YZQA 4HQOA 3T7EA 1JFFA 1QR2A 4KFSA 1ZMOA 2BFFB 3HGTA 3ASZA 2ZUEA 3OZCA 2Z5FA 4QXMA 3OQ1A 4RDXA 1KYWA 4V0QA 4E3WA 3HBMA 1A72A 1NW3A 1JKIA 3PNOA 2Z2XA 5EE9A 4XQ0A 3Q9LA 4CMEC 4XJXA 1NJFA 2X1HA 1M54A 2IPLA 5J4KA 2H9AA 1IPEA 3B9PA 5GZ3A 1XNHA 4D82A 1CQWA 1XK7A 3HEBA 3JVEA 4I3FA 4QUAA 2GZMA 4G86A 1N5OX 2I03A 2LRHA 1ORDA 3AG5A 1T4CA 5JLAA 1L5NA 1WCYA 2QPLA 4ZTUB 4O0LA 4QEZA 3KZXA 3EZGA 3ANNA 3EVDA 1YBFA 1HMPA 4G0XA 1NF2A 4RIFA 4AIRA 1IHDA 3REQA 3EOBI 1A98A 1NP3A 3I3OA 2OYCA 2P5YA 3ETDA 1G8GA 1D1TA 1R8XA 3RGWS 2Y8EA 4JJZA 3VKWA 4IUYA 3S8EA 2VXCA 1VCHA 1CULC 4JP8A 1GFIA 4FFMA 4CCYB 4BUZA 3AFIA 1NF8A 4X84A 4EG0A 3VYSB 1MPTA 4OJYA 3RSQA 1YI8A 3BQMB 1KRXA 1ACMA 3TDMA 3LCJA 3R5SA 5CCXA 4XYMA 1ITZA 5JSUA 2PUBA 3DO5A 3MTAA 5CT9A 1IU9A 2OMKA 2ORIA 3KLOA 1ZI9A 5DGIA 4OMCA 1A27A 2R1VB 5KBYA 4J8PA 4QREA 4QVGA 3BTSA 1AK1A 1BVUA 2Q3CA 3I05A 1OHHD 4HSEA 1FTNA 1D8AA 1K6IA 1UJMA 3BE8A 4JN6B 4LBVA 4M2LA 1JEYB 5AXBA 5KHAA 3IJ5A 2HK6A 1CQIB 1GG8A 4R7ZA 2YX1A 2XB6A 3WBJA 5ALOA 3DDCA 4PZEA 3VTZA 3DFIA 3WBFA 4UHKA 3A9UA 2NT4A 2WJGA 4R2LA 2Z9CA 2UZ0A 5HUJA 3O4IA 1IJBA 2OZPA 2ZUTA 1KORA 1RMTA 1ECFA 3H83A 3I09A 3LSTA 3JAMA 3FWKA 3N2GB 4Q93A 3R0ZA 3OZTA 4D5EA 3U4MA 1PT8A 5G3ZA 1U0RA 1DJLA 4R41A 2AOTB 1BVYF 1WULS 1F0YA 3FNQA 5H02A 4PS0A 5CNJA 1ZCZA 3FYSA 3I9V6 4RSHA 1JILA 4RF2A 2H31A 3IUMA 4JJAA 5DGCA 5H4HA 1CF9A 1RT9A 4YAKA 2WUDA 4HX5A 2DFDA 1AQLA 2PQ6A 4JB3A 3I72A 3DZBA 4PYQA 1MT3A 4HBGA 4BWFB 1YQWA 4P34A 5E8JA 3IGFA 1E5TA 4DUZB 1IUOA 3WG9A 4KH1A 4A1OA 3UT5B 1VG9B 2V8BA 4ACBA 3SN6A 1O3YA 2FJUA 1SG6A 3MIIA 4MVXA 4WFJA 3UV6A 1T10A 4ETIA 4TVKA 2C4VA 3PXXA 1MQAA 2ZU6A 2BEWA 3UMVA 3WDSA 2R68A 1JPJA 3IUPA 2O19A 3VH4A 3L0SA 8ATCA 3HXTA 4K9OA 5EIAA 4ZDKA 2PX8A 5ALDA 2YZ2A 4MW7A 3RYFA 4CTOA 4BLRA 2HHCA 5D87A 3GGSA 2PEZA 3QWHA 5CEEA 3OMXA 2WP8J 1B6RA 4JR2A 5INTA 3MC1A 2GBLA 5JSKA 2Q27A 4WRRA 4NCKA 1ZPDA 1KOFA 3IALA 3TTWA 2XUDA 4MRMA 3OIDA 4HJXA 3C16C 4C0HA 4ESVA 2RAPA 4NJEA 1LLDA 2IGBA 1KETA 1OHHA 2QQEA 3GMSA 2HSJA 2OBBA 2DGDA 3U31A 4IIVA 1ZGBA 3OCUA 5A3SA 4D79A 1DIHA 1W85A 4JBYA 4EYGA 3HYTA 4EI7A 1TZMA 1RYDA 4TYPA 2GN1A 3A3OA 5IMBA 2GEFA 4ZALA 5BQ3A 1TK9A 1YBMA 2WMNB 1ATIA 3OT1B 1C1DA 3R7SA 4YYEA 1E7RA 1CERA 3K0CC 4DV1B 4MV7A 4Q7QA 5K20A 4J9UE 2IYLD 2R5FA 3BT7A 2K2WA 2JGFA 1QF9A 3GPCA 3Q0EA 4U2BA 5GZ1A 3FHOA 5IVPA 2D3TA 1Q7GA 1A1VA 3P9XA 1DAIA 2QSZA 4HDAA 3ZE6A 5LOVF 1F9AA 1RJGA 3PPXA 4MKGA 1U0OC 3CJRA 2C31A 4YHHB 3LA8A 2J45A 4DLYA 5IHXA 1PJTA 4TZTA 3D8HA 4ZREA 5TT1A 4E5PA 3QIAA 5DOVA 1T9KA 3HWWA 1CZHA 3RKRA 1KI4A 1EDDA 3JQDA 3ELBA 4UHJA 2E0IA 2IXFA 5EJ8A 4K9MA 5JQWA 4OL0A 1H85A 1VSTA 2R00C 3RHSA 4P38A 3VOTA 1VHJA 1HEYA 2W98A 3KE8A 3HV2A 3LPDA 4HQ6A 4RK4A 2ZAOA 1T5SA 3HCRA 1Z29A 1HZZC 2ZTUA 3LJKA 1L4UA 1ZC3A 4DANA 5KJ6A 1NNEA 4EO7A 5KNCD 2ZITA 4HNAB 2BRUA 5CA0A 3ET4A 2XRMA 1TMOA 5AKKA 3KV3O 3UUEA 5EIEA 5K0ZA 4IIJF 4Y2JA 3S68A 4JS0A 3RVBA 3S7ZA 3A3YA 4D9CA 5LNK6 4RULA 2JAOA 5LP6C 3BTVA 4FFBA 4H3SA 4P98A 1Y4AE 2CXXA 3OPXA 3WR5A 1JQEA 4HADA 5D01A 5ENZA 4D97A 1TU4A 1NXPA 1W0JD 4JVSB 1Y82A 2O1EA 1QG2A 5FWNA 1E79D 3ZCVA 4MS4B 4JT9A 3TOSA 2Y1WA 1TM2A 4M38A 4C78A 5AESA 4ZDIA 3GJTA 4KE9A 5G40A 3RI3A 4DIBA 4EW6A 3OCVA 3W5BA 1JXAA 4FBGA 4D9MA 2Z8YA 2NZWA 2F55A 1JEDA 1N6IA 3OLXA 4E88A 5EP1A 4F85A 1CX9B 1N3BA 1G291 1QYCA 3D3WA 2I2BA 3ABSB 3FCXA 3GLHB 1G3QA 1D09A 2VHZA 1EVLA 3ICVA 4DZTA 1APBA 4DA4A 3KZ1E 1LBEA 4I1PA 5JYBA 3H05A 3ORRA 5DHQA 3J7AC 1X92A 1RP7A 5ALKA 2EYQA 2OCDA 5CLGA 2VLIA 4BX9A 3RUIA 3G1TA 3BS4A 1LLCA 3QI2A 3IUNA 1E7YA 3PL5A 1JAIA 3ZDXB 4P3OA 3WLPA 2R6HA 3S81A 2IELA 3TDNA 3ZE0B 3ZHOA 2GJAA 2OK7A 1WQ3A 1QF7A 2R60A 3WLQA 2B8EA 3M7IA 5DEIA 3SDBA 1E1CA 3ZH9B 4RTKA 3A2KA 1QAMA 2QUIA 2ZUDA 2IZ7A 3W5DA 2YMPA 2BFNA 4DLVA 5LZ5A 1YMQA 3I9JA 1BFKA 2CNLA 5HYVA 4K6HA 3TTTA 4KBYA 5C8DA 1H6DA 2FZ4A 4XASA 4M1KA 1NLMA 3W79A 5KNCA 2V1UA 3PNBA 1B73A 1HZJA 2LXNA 4RMHA 3CLUD 2Y0CA 4IJKA 4YCAA 1B74A 2A3RA 1JG1A 5JBQA 2OORC 4DMMA 5TMDA 1OWNA 1N7JA 5FORA 2RAUA 3WDKA 5K2OA 4GW3A 3WS7A 4UPEA 1RPNA 1QHIA 3ZZ1A 5GOZA 4BV8A 4NV0A 3SQWA 3IQWA 4B0OA 4YA6A 3EFBA 3EPRA 3NU1A 4RORA 2HDNB 4X6LA 5EIWA 3RUHA 4DSAA 4YCCA 2H1IA 1W0JA 3JQ7B 1P6QA 3F47A 4HDMB 3A2LA 5GMOA 2NYRA 1ICEA 3SPXA 5IBCA 3EPHA 3VNRA 2BEJA 1GT6A 1CUIA 1HNNA 2C7BA 1AIPA 1F60A 1WV0A 2ILVA 3LRTA 3N1UA 1WUHS 2VTVA 5JVDF 1TZCA 5FYQA 1Z4PX 2FPXA 1P2BA 3A6DA 2XTJA 4OAOA 5AKIA 5ARDA 4E15A 2GAAA 2PUCA 1ND5A 3PX7A 4HZUB 4P53A 2AC4A 2YMMA 5CG1A 3HM9A 5LMUB 2JBWA 2X2EA 5B1HA 3CLSC 4AC9A 2NO1A 3A14A 3USZA 3DT9A 3GDWA 3RS7A 4L74A 1Z4IA 4HATA 5CVTA 4C7XA 3O8BA 1DC5A 1F2UA 2RHWA 3H6GA 3QPWA 3KC2A 1COWD 1PS9A 1G18A 4NMMA 2VQSA 2XUPA 4D6YA 3LY7A 3ROZA 3K70D 1Y5LA 1NVWQ 5JZSA 1NYQA 5FBKA 1JWLA 2PX5A 4PGGA 4HYEA 4OOEA 4ZVRA 1ADJA 3GJ5A 1T3GA 1GSHA 2FZKA 4KXFB 1NOJA 4GPIB 2JH3A 1WBDA 3QFCA 1B0AA 1ST3A 5F21A 1SBQA 4MDHA 1QP4A 2O1XA 2VHXA 2OXIA 5COAA 3G8AA 2Y9PB 2WWYA 4G24A 721PA 2Z95A 4KLCA 3RYCB 1KKMA 2Z08A 3KQSA 2OGWA 2AN9A 1KTIA 3ETLA 4I55F 1BYUA 4GWKA 3Q7TA 3ZNNA 1E5LA 3GV0A 1WXWA 2GXSA 4GYJA 2ODBA 1YDEA 2CJXA 3H5NA 5AVQA 4HB3A 1LF0A 3BRSA 2WWXA 3W8FA 1EB8A 1CVRA 4NYMQ 3F78A 4UU0A 1N36B 1L2TA 1VIYA 3JQ9A 3O1HB 4DPKA 4EAAA 5DNAA 5HM6A 5AW9A 4CKCA 5C4MA 2C4NA 4XX0B 2JGDA 3V46A 1W52X 3KJZA 5KVSA 4A4DA 2WU1A 3PSHA 2H4HA 1DXQA 4NMHA 4X8HA 3TR5A 5EZ6B 2HHJA 3CH7A 5B57C 1SRQA 2C2HA 4JLUA 2HO4A 4DCTA 4P6VF 2VXBA 4P3NA 4BJ5A 4DYVA 3ZDRA 3QWIA 4ZCIA 5A7HA 1OW3B 3F4BA 1UPTA 1XTJA 2ZR9A 3EWNA 3Q98A 4FN4A 3IQDB 1GCOA 1XVTA 2GEDA 5DM2A 4KXWA 4F2WA 3GLGE 4X54A 3GEHA 3RSHA 3RRMA 4AF8A 2QL6A 4J0KA 2OV2A 5G4KA 2ZZNA 3CIFA 4G0PA 3LMKA 1P2UA 2YHSA 3T5TA 4RXUA 4B3TB 7ABPA 1UINA 1XN4A 4XB2A 3QMVA 4G41A 4CKEB 3KYBA 2I8LA 2YWDA 4U2DA 4JT4A 1EK1A 1UMBB 1HDEA 1UDXA 2VHEA 2XCTB 1HYEA 2G04A 2B5WA 4JLKA 3U4HA 3GBVA 4GYWA 3PHGA 5FBVB 3G5TA 3TLYA 5A0VA 2JRCA 2P8JA 3O8NA 3ECAA 5F76A 4FHGA 4X1YA 1U8UA 4J91A 4WK4B 3M4NA 4MR9A 3RTAA 1C50A 1NM5A 3RSFA 1YKSA 4CZ2A 1VPWA 4TTSA 5BPHA 4H3KB 3FY4A 4GM0A 4EITA 1K5HA 1AS0A 2QUHA 3LQ2A 5A7GA 5K6AA 1DJPA 2QT1A 4KRXA 4LXGA 1Z0AA 4AZVA 1O0SA 1WXIA 2YIJA 1CZUA 1W47A 2QXTA 3H4MA 5LLSA 4LBYA 1UR5A 2GAIA 2QEQA 1AKEA 2QPOA 1UT5A 4EGFA 4QKQA 4IJ5A 1I36A 1KAOA 1XZJA 4PG5A 1IEXA 1IHYA 2WVJA 3OAAD 3O4FA 3QX9A 3RV3A 3TI9A 3ZWOA 3UCEA 5CTJA 3KOZA 4BMSA 1P61B 4BNNA 2CBGA 4L4UA 5CX1A 1ISFA 3BEDA 1OA1A 1KP3A 2DUMA 1GARA 2EHDA 2ZYDA 3C8DA 4X6UA 5AW3A 5L7WA 3LYUA 4XWGA 2ZTMA 3EQ9A 1P2GA 2P0EA 3OI7A 2CJYA 4J3JA 4DIEA 5KQSA 2IZ6A 3BQNB 1X3LA 1XCLA 5LLDA 3V8VA 3TGLA 2VIIA 2QR3A 3DE7X 4GRIA 2RGUA 3LQ4A 4TUYA 5AO9A 1CLEA 3FW1A 1VYHA 1BFUA 1U02A 4OP1A 4DIMA 1V9LA 2D5CA 3FJYA 3AV3A 3K1AA 2HA4A 3AKDA 3NTQA 4OQQA 2Q1WA 4YDRA 2E4VA 1IZ9A 1PGNA 4LOLA 4NICA 1W8DA 4EECA 2NYUA 1IN1A 5L51A 1N6NA 5D5QA 3K09C 2WM9B 5JXJA 3VU0A 4DNFA 3B1WA 2PUWA 3CRRA 3NGMA 3HJNA 2AYXA 1KY4A 2FKAA 3VHXA 1O6GA 3O8DA 3INNA 4Q01A 1WUYA 4BGUA 5BWBA 1C1XA 3ND6A 4QYTA 4A2PA 3RM3A 3O8LA 4Y9DA 2C5AA 5ALIA 1KIFA 2BGRA 4A6PA 4A3SA 1C80A 3GEPA 4IZ6A 1WBJB 2P68A 2QVCA 1T8UA 2VZ0A 3WLJA 3LDHA 3H0KA 2G4LA 1BEZA 1ZRNA 5BMVB 2H1HA 3U48A 3AUJB 5I7FA 5IG2A 3EHEA 4F8JA 1UBGA 3RJMA 3O4HA 1BX0A 1T2NA 5F7JA 2IYPA 3GUYA 4MWCA 3KALA 2FZEA 4QTZA 4AICA 1DQPA 1M6HA 2CDAA 5HIMA 2AZMA 4D0RA 2QAGA 1NTOA 2H0RA 2PH1A 2QX7A 2VP5A 1G3RA 3CU5A 4LKRA 4ND6A 1QHGA 4B3FX 3BGWA 5JU6A 3MELA 3UAZA 1MA3A 1AM4D 2YWCA 2X5XA 4NPHA 1YH3A 3T3IA 4GR5A 2NTEA 2E89A 1JIQA 3BH7A 5LZ7A 3ZI4A