4TL6A

Crystal structure of n-terminal domain of kaic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
222
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRVSIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942)
total genus 80
structure length 222
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl6A00
1K5GA 2GCNA 4LWZA 2GK7A 2NPIA 3ZJYA 4A2QA 2D62A 3WP1B 4EFMA 1E9RA 4TWZA 3V4RA 4UNSA 8OHMA 2ANCA 3TVDA 5FL3A 1G8FA 1KMHA 1JXOA 2CE2X 2JIZD 4HZUB 3AP3A 4IDNA 3TUIC 4BFUA 5C46F 1IN8A 5C2JB 4IOKA 1SQ5A 2CL7X 1DELA 1T8TA 1JR3D 1VG9B 2BBWA 4LBWA 4DWJA 2QPOA 5JJLA 4AKGA 2AXPA 1G41A 1HUQA 4II7A 1GVNB 4KFUA 2W58A 1ZD9A 2X2EA 3LY5A 3TR5A 1C9KA 1NVVR 1IONA 5KUTA 3R7WA 2AFHE 2PH1A 1BYUA 2IUUA 3UG7A 4TZ0A 1KI9A 1WBBA 2DFKB 1XMVA 3AKEA 3VX4A 3VR2A 5CIQA 1E94E 4TLDA 4EUNA 2GXQA 2JLSA 2O0JA 2J7PD 1EWRA 2WJHA 5FR2A 2R9VA 1JEEA 1US8A 5CM8B 5JWRA 2J0SA 1GILA 1DAFA 5FBQB 4RD0A 2ZYWX 3PVSA 3QBTA 4F4CA 5L3SB 4GL2A 4M1MA 3KKNA 3AKCA 2WAYA 4BFYA 3L2OB 3RANA 5JECA 1RJ9A 5FBVB 3ZD7A 2V9PA 1JQJC 4ARZA 1AGRA 2QA5A 2FZ4A 1CU1A 1VDZA 1E9SA 5FOSA 2C78A 1MH1A 4MRPA 2CK3A 1S2MA 5EXXA 5BXQC 2ZAMA 3QKRB 4S2EA 4FW9A 4PQFA 5DHAA 4YXWA 4RCZA 1UKVY 3AF2A 4QOSA 3FWYA 2FSIA 1H8EA 2WM9B 4U5XA 3WMGA 3IIKA 1G3IA 1UFQA 3SOPA 3PFIA 3MJRA 4UXIA 5J4KA 3ADKA 3HU1A 3QJYA 4LGMA 4MUBA 4Q1AA 5IK2A 2QAGA 5KYKA 4EJSB 5GJBA 4B3BA 4PHTA 2F7SA 2XTMA 4PSKA 2IF2A 1G7SA 5FOUA 3PXGA 3SYKA 3J81k 3KQKA 5JS8A 3CX7A 3LW8A 3QY0A 1Z07A 3QEJA 4MYHA 1GSIA 1JXMA 2R6FA 1E1QD 4PSVA 1VG0B 4EAQA 1RC8A 4DSTA 2VSXA 1N0VC 2D2EA 2FNAA 2IEZA 4CW7A 2VF8A 3CRW1 4LK2A 1OSNA 5DN6D 5HE8A 4LJ4A 4PHFA 4LJAA 1CJMA 4X8LA 1KOFA 1J8YF 1KO8A 2WHXA 2V8OA 2QAJA 1OE0A 2F1JA 4FMCB 2J0UA 4CEJA 4WBSA 4Q1FA 4AG6A 5J47A 3QF4B 1NP6A 2D3WA 2HYIC 1VECA 4ESVA 5JEDA 3O8DA 1AS0A 3E2IA 1GZSA 2V4ZA 3DHWC 3VR4A 4MGIR 4GOXA 4OI0A 4OKSA 4CIDA 3CR8A 4JLPA 3WRYC 1EFCA 2G3YA 4Q4LA 1Q3HA 1W5TA 4V02A 3ADDA 1GTVA 3BWDD 4V0ME 1EESA 1TUEA 2F1IA 1X8LA 3DVLA 4JBXA 1TL7C 4RKEA 2ZS8A 4KHZA 2FN4A 4YDHB 5C18A 1Q0UA 3TW8B 4A15A 3CUEF 2GK6A 2HF9A 3X2SA 3UANA 1VCNA 4QG7A 4IOLA 1N0UA 5K8TA 4JL8A 1FUUA 3A4LA 1WCV1 5DO9A 2IUSA 4ZDKA 1A1VA 4NCJA 1UF9A 3S1AA 1CR4A 4M1KA 4G01B 4E07A 2L0XA 2CLSA 1RIFA 1R6BX 2FMXA 3U3RA 4FWTA 4DT1B 4M21A 3BH7A 1NVWQ 4AKHA 4BEBA 2OAQ1 1TTTA 1B23P 4EPWA 3BIFA 4LI0A 1U0HC 2X2FA 1YKSA 3NC1C 1KDOA 3IDQA 2B8WA 2QE7A 4KJZA 3PIRA 2CHGA 2CK3D 2A5GA 1S96A 2GEVA 5IF9A 1ZJ6A 2CLDX 2KI5A 4FIDA 2FDCA 1A5TA 1LS1A 3LDAA 3TUZC 1OH8A 2XGJA 5SZKB 4HZUA 1ZNWA 1X8JA 2QY9A 2AKAB 4CT4B 3KB1A 1H8ED 2GCOB 5IHPA 4Q5IA 4GP7A 4LHXA 3AH8A 2WBLC 5KO2A 1DAIA 4A4DA 3CNNA 5IK2D 1FZQA 1N2CE 3FGNA 1FP7A 4DXAA 2FFHA 1BH2A 3WBJA 1HURA 3ZS9A 3CKLA 1CXZA 3RRYA 4QBGB 4ZDIA 2JCSA 1CLUA 5F2EA 5JWOA 1GRRA 1VYUA 1NNEA 1KO7A 3OIVA 1Z0KA 3H4MA 1RYFA 4B33A 1RPZA 2B6HA 2GXSA 1NF3A 5CB6A 1F2TB 3C4JA 3CH5A 5L3SA 2C9CA 1HH4A 2ZXUA 2C04A 2MSCB 1ZIOA 4HSEA 4Y0VA 1BMFA 1ZRHA 3B1WA 4EQ6B 1PUJA 4Q66C 4PC7A 1KI2A 2HV8A 1G5TA 4LY6A 1Z29A 3B9PA 3CH4B 4CVNA 2RHDA 2QEQA 1OXVA 3GJ8A 3CIOA 3QKRA 4RD2A 4HLUA 2A5JA 2WJGA 3ND8A 4BLTA 2B92A 5EUQB 4GDFA 2ZRBA 1ZUIA 1PLKA 4LCBA 2BMJA 1NBMA 4L5BA 5EXTA 3V9PA 121PA 5K8IA 1OYYA 3PJRA 1ETUA 1LV7A 3UMFA 3LLUA 3OEED 3IQWA 1J70A 4L15A 4W5JA 4EPVA 1E9DA 2MSDB 2QG6A 4EJSA 4A6PA 1UBCA 4M1TA 4JBWA 2YOGA 4QJ5A 1Q1BA 4WZAE 4X8MA 2XZOA 3GLHB 1JI0A 1E2EA 3AVXA 1KJZA 4ON9A 2Q9CA 2GZAA 4DUGD 1WB9A 3JVUA 3EC2A 4FMDF 2ERYA 1QHHB 4KFRA 4XSGA 1RRCA 4PHHA 3I73A 1NIPA 1HV8A 2P3SA 1KSFX 1UDWA 1G3MA 3FE2A 3ND9A 3GFOA 2CLCX 3PQCA 4P3YA 3ZZUA 1UKYA 2GDJA 4XIGS 3W8RA 1YU9A 3CX8A 2GKSA 3HU3A 3EC1A 3SHWA 3L0IB 5HKKA 3PR1A 2UZIR 3AF1A 3X1DA 4PO9A 3ZGXA 1QHGA 1R5OA 3MAAC 1ZUHA 3AF3A 2BEKA 1AKEA 1HT2E 4TYNA 3ZDQA 3QF4A 1Q1EA 3N2EA 1BS1A 2JLQA 2WIBA 2Z83A 3AKYA 4LPSA 2IX3A 4US2R 4HB3A 4ZV4A 2WWYA 1OIWA 2J3EA 2DFLA 4MKFA 3ZIAA 4JLOA 5KTYA 3QXXA 1XCPA 3DEFA 5GJWC 1T8UA 4P31A 1X6VA 4R2HA 4Q1DA 3W3ZB 1LNZA 2W0MA 3TQCA 2QPAA 1D6JA 1U99A 3OE7D 3SZRA 4GMDA 1P3JA 3NIBA 2ZRKA 5CIWA 2F1RA 1AS2A 3QENA 3T1VA 1ZD8A 5TMPA 1Z63A 3QVUA 1U9IA 2WMOB 1IQPA 4C0SA 3QBVA 2YYZA 2ZSAA 2J41A 4G5GA 3B82A 3PUVA 2Z0MA 4FWIB 4I1SA 4TL7A 1W36B 4IDHA 3QPVA 3K09A 1TADA 1VG1A 3OHMA 4RCYA 3EPKA 4JJZA 4FCVA 3MGCA 5JWHA 4B74A 1YR6A 4NZYA 5FH9A 3GJ6A 3HDTA 2YKGA 3QUSA 4OHXA 1M8PA 4D0NA 1LF5A 1XNJA 1PUIA 4A8JC 2EFHB 1AZTA 1HY3A 2B8TA 4HZIA 4CEHB 1NVVQ 2NZJA 3CBQA 3BE4A 2VH5R 4DT1A 3KQUA 2HCJB 1KY3A 1BMFD 2Q0HA 5D3QA 4TMKA 2XJ9A 1ZM3A 3H2YA 5EXPA 2IF0A 4EIWA 2PLRA 3VHXA 4LYAA 1KSHA 621PA 1IJEA 1FMJA 3M1IA 5HZKA 1P72A 1E2KA 3QG1A 4Q00A 1N6PA 2R6DA 3GLFE 1I2MA 5G40A 2FOLA 2LWIA 4Q4AB 4DEXA 2GEUA 2HXYA 1GL9B 2QMHA 4PPQA 2GCOA 2P67A 1ZC3A 1KDTA 2W6ID 1ZCAA 5DNYB 2LKDA 2VSOA 1TEXA 2EQBA 1SVMA 2J5XA 4NCHA 3I8XA 4HDCA 2WZQA 4C3ZA 4EKDA 1SGWA 1K5DA 2PX3A 3IO3A 4LV8B 5B64A 1QZXA 2OCBA 4MQBA 1Z08A 4I4LA 4HUQB 5JCZA 3RRNA 3QKUA 2GJ8A 5D3MB 3SS8A 1HYQA 2F1HA 2X8AA 4HB2A 5AJYA 3TK1A 4B47A 821PA 2IYQA 3DZDA 1LTQA 5FI0B 4B71A 1F2TA 2H18A 2AX4A 4P0TA 2WJYA 3EAQA 1F60A 3NWJA 4NCNA 4TYWA 4KFTA 4B3CA 1LB1B 4B35A 4EQ6A 3FB4A 5JRJA 2EW1A 4FD2A 4POAA 4NP6A 2GESA 4Q1EA 1EX6A 4TL6A 1KNQA 2AWOA 1QBKC 4XH9B 5EQTA 4Q4HB 2BMDA 3TAUA 3TSWA 1I4LD 2RGCA 3E70C 4QRHA 4LYJA 3ZIAD 1T91A 3LLMA 5JJKA 4JSTA 4O3MA 1KKLA 3PUXA 1I4DD 1U8AA 2V54A 4DLYA 5FOTA 4BLOA 2A3RA 3GJ5A 1E4VA 4PR0A 4C4PA 2ZAOA 1AK2A 2WKQA 3L43A 2J0QA 1R0XA 1UADA 1XD9A 3GJXC 3RHFA 4JLNA 2XB2A 2C9OA 3AKDA 5FPHA 2AWNA 2J0VA 2ZR0A 3GLHA 3EZ9A 3CONA 1GFIA 4TQUS 3R8CA 3K09C 4LJ8A 1IHUA 2ORVA 2VYFA 3AGQA 1HA3A 3AGPA 3ZS8A 2FJUA 2ZI7A 3KQLA 3HPRA 3IILA 1KO5A 1QHHA 1EXMA 2YWGA 1DE0A 1E96A 2NG1A 1YR9A 1FUKA 4G5SA 1LFDB 2PT7A 2VHQA 4TT3A 2YOHA 4YDSA 5KSPA 4QGGA 4XWOA 4QL3A 3EZ7A 1E9EA 4KAXA 1BYIA 2NO7A 1Z0FA 2ODEA 2OESA 2OFOA 3BD9A 2J46A 4MA4A 1OFIA 2XITA 1R7RA 2ZRHA 2O5VA 1W4BA 2P5SA 1ELOA 1VYTA 1XEXB 1J99A 1N6IA 3RWMB 1S8FA 3KL4A 1S1CA 3C5CA 3B2EA 1TQ2A 1JNYA 3IBGA 2EWWA 4TL8A 1MV5A 3A8TA 4QBFA 2V3CC 1P9RA 3BK7A 3C16C 4TTPA 2BJVA 4HLDA 1XXHE 2JDIA 1FP6A 3LQRA 2WVJA 2P5TB 2BDTA 2ZVQX 1VYVA 1Y3AA 3KX2A 4XD7A 4M8NE 4MDEA 2ZETA 2QGNA 4LHYA 4EDHA 4DCTA 3ASZA 1WE2A 4M22A 4A0RA 1XB2A 1W4CA 2JLYA 1M2OB 3MD0A 5J5CA 4CF7A 4BRWA 3LNCA 4TL9A 2EFEB 1UJ2A 2DBYA 1TAGA 3KTAB 4OK5A 2C2HA 5DSZA 2ANBA 1RKBA 3OFNA 1JJ7A 4AYXA 4PPGA 2GVDC 2ZM5A 2QQEA 1W2GA 2P65A 1CRQA 4QBIA 2XAUA 3BJIC 3RS4A 4C0AC 3RSOA 3U4QB 2IYWA 2F55A 2F6RA 1OT3A 1O87A 2QNRA 4B75A 4CEHA 4GPTA 3L8YA 2O8FB 5G3YA 1O3YA 3X1ZA 1W0JA 2PJZA 3K9NA 4ZDWA 2HYDA 4R9UC 4QKQA 1FQKA 2F9LA 1S3GA 3QIAA 4OQXA 3A37A 3CF0A 1JR3A 4LDJA 3RLFA 3CWZA 4HUTA 1U90A 4URVR 3IQXA 1E0JA 3NEYA 3EPLA 3C8UA 2O8CB 1VIYA 2OCYC 3EIQA 3TE6A 4TMXA 4IHQA 1HE8B 4B2IA 4Q4AA 2YHSA 4RD1A 3AEZA 1OXXK 4V0NA 4JLAA 3X1XA 2C95A 4BLQA 3VQTA 2PCJA 2ZRJA 2QP9X 3QE0A 4PPNA 1TQ4A 4QHSA 3TVTA 3WNDA 2IYRA 2EYQA 2WOOA 3LVQE 3FHCB 5EE3A 3T34A 3LWNA 3P32A 1L4UA 5DI3B 3TUJC 4HUQA 4MH0R 3SQWA 1DBSA 2VRWA 5D3MA 3HP1A 4BLPA 1IOZA 5AK0A 2YWFA 1GKYA 1T5LA 5E7IA 1D2MA 4F91B 2H1LA 1XZPA 3M0EA 4K81B 1XTSA 2NIPA 2QENA 4TT3D 1IN4A 2O0HA 1X1SA 1OH6A 1T6NA 4B76A 1ZMXA 5GADl 4QXAA 1BKDR 3U2QA 1NMXA 3GJ3A 2XNSA 1IM2A 5CYOA 3P4XA 1P61B 3U7GA 5EXSA 1CKEA 1FPMA 2JAQA 4PC6A 4OQNA 1E9AA 1FW6A 3LBHA 3SBEA 2CCKA 3PUZA 3LXRA 1NN0A 2PZFA 1G7RA 2RGEA 4IFBA 1E9FA 3W9YA 3CPEA 1YHNA 2KE5A 4Q4HA 3CRRA 1XFAA 1E6CA 4B32A 1FTNA 2OZEA 2OT3B 2JEOA 1W47A 2RCNA 5FPKA 3AVTA 2GAAA 5K8UA 1KTVA 4H1UA 1CR0A 4QGFA 4WA7A 4XD7D 4KU4A 2QPTA 3T1OA 3I8SA 3PENA 4HB0A 4KVGA 4JJKA 1KI3A 1QF9A 1OXTA 3NVAA 2VP9A 4B2PA 5AUOB 2FSHA 1UBEA 2H16A 2Q9BA 2RKOA 2Z5FA 2R6AA 4NYMQ 4CGZA 3I72A 2BJWA 4NMMA 2HT6A 1OYWA 4DDUA 3N5CA 4PFSA 1W36D 3OFND 1S9DA 1R10A 5DN6A 4AG5A 1RRFA 1CR2A 5HTKA 2IEYA 3E5HA 3EPHA 4US1R 3BFVA 2J1LA 2G83A 1UDXA 3KKPA 1C4OA 1U8YA 1E0AA 4LC0A 2K5UA 4M1WA 3PEYA 3IHWA 2GTPA 4F4JA 5CITA 3AVVA 2GEDA 1GL7A 2RHMA 1E9CA 1W0JD 3ECCA 2A7QA 2ZRDA 2ZQ5A 4AYWA 1XEXA 3BB1A 4DSOA 2CDNA 2ZITA 4KLNA 4OL0A 2REBA 5HCIA 1VCOA 2ZRLA 3VMFA 4GRAA 4XWKA 4NYIQ 3TLXA 2W6JD 4A0HA 4LX0A 1IN6A 3OZXA 2OILA 4MYCA 4KSBA 1QG4A 1CR1A 1ZM2A 2P6RA 4M9XA 2CCJA 2IHYA 1T3LA 4B44A 2VP4A 3QKSB 4DHEA 1MKYA 4E09A 5LD2C 3Q85A 4MGKR 2CJWB 2BBSA 1Q1QA 2A5DA 2BBOA 1YRBA 2HCBA 4GMXA 4RD6A 2NGRA 2QTHA 4D82A 1JAHA 4WW0A 3KTAA 4R71A 5JCPA 4C7OB 4HI0E 1KJWA 2ZUDA 4BQSA 3TR0A 2MMCA 1XJQA 1G19A 3SC3A 1DEKA 1N5KA 3SJZA 2BBTA 2CVHA 3T5GA 3A1UA 2OUKA 4A8JB 4ZCMA 3WRXC 1L7VC 3JZMA 4NPHA 3U4QA 4Q9IA 3K70C 1E2IA 1KK2A 3EG5A 4M2LA 3T1TA 1OFHA 2O8FA 4V03A 4PTLA 1GAJA 2OAP1 3FMOB 2IYVA 1QHNA 2P6NA 1S3SA 3IEVA 1Z6AA 3CO5A 1R2QA 1L4YA 4A2WA 1W5SA 1RYHA 2YOFA 4ILEA 4Q7JB 2IXEA 2REOA 4QHTA 3SN6A 2O8CA 1QVAA 2J87A 1D9XA 5TV2A 5AJWA 3GJ7A 4TMVA 3O8CA 2QI9C 2QM8A 2YJTD 5BWMA 1A7JA 1PJRA 3UKDA 1NKTA 2FH5B 4FMBB 1Z0JA 2C99A 4LHVA 1S4QA 1IJFA 4JLBA 4C0HA 2CHVA 3I4LA 1IN7A 2RGAA 5HZHA 1JPNA 3VU9B 1CJTC 1KI1A 2J59A 4I1UA 2ZIAA 4QGAA 4LSGA 4OHVA 1R0WA 4C0QC 4F38A 3IO5A 1KO4A 4N1AA 5CJ2A 1CIPA 1IN5A 5DI3A 5EZ6B 3DZ8A 4KSCA 3B1XA 4V0MA 1GNPA 4ZPXA 3D3QA 1KK1A 3GMTA 3KKMA 3THYB 1J2JA 4BRUA 2XZLA 3K0EA 1LW7A 3U3MA 2X19A 3IBYA 2AD5A 4B2LA 4PZYA 1TU3A 5BN3A 2V55B 1T5IA 3BORA 1NVUQ 4V0LA 3T35A 1FNMA 3AB3A 3WNCA 3U7FB 4ZKDA 1PLJA 2CL0X 2W2TA 2AK2A 2OCPA 4G5RA 3K0SA 2H5EA 5HCNA 1N25A 5JLJA 1BOFA 3IPYA 2YINC 4F4IA 2VPPA 2QBYB 2DWQA 2WICA 1GITA 4DLTA 4ACBA 1CJUC 3OEEA 3C14C 5FPSA 3A6PC 4O2LA 4TLBA 1IY2A 1P9NA 4IRUB 3BBPA 4YC7A 4HDOB 1COWA 1DAHA 2H8KA 2J7KA 1MR3F 2ZYUX 3IIMA 4DUGA 1ZU4A 3P26A 2BOVA 5AUNB 3GLFB 3BGWA 3UMRA 3CX6A 5KSOA 1EFUA 3DOFA 1DG1G 4EPYA 2F3TA 4URZR 3MWJA 4Z8XA 3VR3A 4IVPA 4OI4A 1XBTA 1MRNA 4Q9LA 1P5ZB 1RVDA 3T5DA 2XZPA 4IVQA 1IY1A 3CRMA 3FKQA 3D8BA 3UXMA 2OM2A 2ONJA 3QXHA 4ZO4A 1G6OA 3RSLA 3PCRB 4W5WA 2BVNA 3GP8A 1OXUA 2GJAA 2WMNB 2ZI9A 3IGFA 3O47A 5AJXA 3VKWA 2Q21A 4RD4A 4CYMA 2VP6A 2AR7A 2IYLD 4OK3A 3B7GA 3CRVA 4IDOA 3M6AA 3LQQA 4BLRA 3AQ4A 2DFTA 4QGHA 2BCJQ 3MFYA 4ZCIA 1R5NA 3OE7A 1XEWX 4MKGA 3LBIA 1VCIA 5FOWA 4WZ6A 5FTKA 1YRAA 4LOAA 2ZJBA 4OK6A 5EZ5A 3VX3A 3WMEA 5KOYA 3AV0B 4FCTA 1XTRA 4JLJA 4A82A 1K8RA 4DLZA 2VP5A 4Q7MB 5J40A 3ADBA 4X8HA 3CPHA 3QKSA 3K0FB 1ZM4A 3ZVLA 3LH5A 1Z6YA 3CNLA 2FPKA 2CJWA 4D2IA 5KDOA 3FFAA 1N6RA 5AJZA 2JLVA 3P27A 3AVQA 3HYRA 1CS4C 2ZR7A 3LAWA 3CZPA 3TGPA 1ONBA 4C7OA 4TMZA 1ZNZA 1YZQA 2RH5A 1W4AA 4M9SA 4RY2A 2RGBA 4KITB 3VHLB 1FQJA 4P4TA 4JT2A 4XVRA 4JLKA 2I1QA 4A8JA 5J4VA 1M74A 4Q48A 1XTJA 5AWFC 2GNOA 3I62A 4UQOA 1Q12A 2V6JA 2A5YB 4WXPA 3MSXA 3AVUA 2IXFA 4CT5A 2PZEA 2JLXA 1XTQA 3B9QA 2C03A 4CDGA 2D7DA 3TIFA 4U02A 2IS6A 3MUFA 3MWLA 3PUYA 2W6IA 2XEXA 2HLDD 4TYYA 1L8QA 2Q3HA 3K1JA 1D8TA 4DSNA 5E7JA 3CLVA 4DB4A 2AK3A 2DPXA 1G9XA 3TJZA 1XX6A 2WOJA 1XPOA 5M04A 3KFXA 1N0WA 1XMSA 4LYHA 1COWD 1SVIA 2XNDD 1CBUA 4Q9HA 1E2NA 3WXMA 3ETLA 3T61A 4GZMA 1E79D 2F43B 1XXHB 2VEDA 2QGZA 3VFDA 3VU9A 5CB8A 3HU2A 3NHBA 2CBZA 4NBSA 1GNQA 2ODNA 4WIAA 1YQTA 2ZRIA 3EZ6A 4M9QA 4RJLA 4KLZA 5HPYB 1DAMA 4MDFA 4JZKA 4MGYR 1G3UA 1W49A 4F7WA 3GEIA 2ZROA 2O0KA 3SU8A 1ZW6A 2WSSD 4ASUA 3NBYC 1M7GA 5DLQC 1U94A 4DVGA 1ZINA 2FX3A 3THOA 3THYA 1PVOA 4UJ3A 4HLCA 1E0KA 421PA 3KUDA 5TY0A 3GLGE 1RE0A 3UPUA 5EE0A 2CMKA 5BN5A 3K0CC 5JHHB 2ZRPA 1XD2B 3CZQA 3W3AA 5L3QB 2YV5A 4FMCF 4FXPA 5LB4A 2DWOA 3Q9LA 1KK3A 2G6BA 1IBRA 1I2DA 5F9HA 3W5IA 2PJRA 1TF5A 1H8HD 1G7CA 4AURA 4Q03A 1KYIA 4ZI3A 2OLJA 1JBKA 2QBYA 4DLWA 3Q72A 3A4MA 4TSFA 1YVDA 4PPFA 4DLXA 3AVYA 1NN5A 3BFKA 2JLUA 3V4FA 3B85A 2FA9A 1Z28A 2FGKA 3F0TA 4NONA 2Q3FA 4JS0A 2PT5A 3WYAA 3VKHA 3KB2A 1E9BA 1GKIA 2VP2A 1SHKA 3KXIA 1SULA 4OJKA 4HATA 1Y63A 2ZRFA 5LPNA 1TX4B 3EZFA 3GLFA 1YR7A 2FGJA 4XVUA 1P2VA 3SBDA 3NC0C 1QHIA 4RVCA 4OQLA 3H0KA 5EP3A 4NHOA 3QNUA 1XWIA 3DKVA 5DYGA 3FDIA 3I92A 5TARA 4EFNA 1KKMA 3GLIE 4PO8A 2B21A 3DOEA 4IEEA 1GP2A 4AY2A 1T9HA 3U6BA 5EE9A 2QRNA 1CULC 3O8RA 3U61B 4LC1A 4L8GA 2HJGA 3R9IA 3SJAA 2DWPA 4HEJA 2KSQA 2GILA 3CWQA 5CK4A 4B73A 4D80A 4XOIA 3GJ0A 2ZI3A 3KZ1E 5EE5B 3AP1A 1F3OA 2AN9A 2R6GA 4Q02A 1NMYA 1E2GA 3EIHA 1G3QA 1E2FA 3ZYCA 2ZPTX 2QP4A 2WPDA 5KDDA 3THWB 1G64A 2ODWA 3VTKA 4CEIB 5LD2B 4P33A 4MUAA 3RS7A 1OHHA 1G4AE 4QFMA 3R9XA 3CF6R 1QRAA 3K0FA 1G6HA 4BUJA 3GD7A 4P32A 2J45A 5ELXA 2GF0A 1B0UA 2NPFA 3NH6A 1SVKA 1HE1C 2A2ZA 1P2TA 2EFGA 1ANKA 2FFQA 4B3XA 3LX8A 2CNWA 3MJHA 4JSYA 4ASUD 3FKSD 2FZLA 4B34A 1MRSA 2AKYA 1YZUA 3K70B 4QM7A 3KKOA 2VA8A 4L9WA 1E2DA 4AWXA 1CJVC 3KXKA 1DG3A 2ECKA 2PEYA 1N6NA 1ZC4A 4H1VA 3G5UA 2DYKA 4ZI2A 1EFTA 3LVRE 1PLLA 1XP8A 5A5GA 3WHLA 1AZSC 4D4MA 1HQCA 3NH9A 1QHSA 1VCMA 1XTIA 4TYQA 1DS6A 2OO7A 5JSZB 4OHYA 2ZTSA 3KKQA 4GBMA 3RC8A 1ZAKA 3IUYA 4DCVA 4AK9A 1SVWA 2BCGY 4TMWA 2FF7A 3CW2A 2GBLC 3QQ5A 3REGA 3AVWA 3MG9A 5B57C 1M1YE 2DHRA 2C5LA 2RMKA 3D31A 3TMKA 4TSFD 3UMSA 2PMKA 4ITRC 3ZZTA 1YJ5A 1ZNXA 1GOTA 2OEPA 4GFDA 2DCUA 4C0BA 3FTQA 2C8VA 2GETA 2PX0A 3EPJA 5G53C 4B3GA 3I1FA 3RAPR 3W6PA 2QSZA 2VHUA 3VR1A 4XJXA 1PZNA 2WKPA 3OIYA 4PC2A 2ZI4A 2ZU6A 221PA 2F43A 1UEJA 1XXHA 1W7AA 1N6HA 4BPBA 5JMTA 4PQYA 1T0JB 4D26A 2IYYA 4GT1A 1DVRA 1GDDA 3K9HA 4Q47A 1ZVQA 2B7CA 2DY1A 1OFTA 3MMPA 2QMEA 4C30A 3K9GA 4RSGA 4OI1A 2BM1A 5LDDC 3FMFA 1WDTA 1F2UB 1KZ7B 2ZRCA 2RGGA 1Z6XA 5G41A 2XB4A 1JEDA 1W0KA 3EA5A 4BLSA 5AR1A 1VKJA 4RFSB 1GRQA 1XD2A 5L3QA 1NIJA 1U8ZA 1GIAA 4O0MA 5EP1A 3A1VA 3LD9A 3R20A 4BFXA 5CK5A 1XD8A 4L9SA 4PHGA 4M1YA 2BMEA 2O8DB 1NG1A 4G5OA 2RGNC 4KODA 3Q5DA 2W2VA 2YVUA 4MITA 5JI2E 2HF8A 1G21E 2WPDD 4D6PA 1QHXA 1FNNA 2Q6TA 4OYHA 3Q7QA 4BGDA 1OB5A 2ATXA 4KVAA 1GRNA 1U81A 1Z6TA 4M1SA 5J4LA 1AKYA 3QEOA 1G18A 1G5RA 4I99A 1AM4D 4ZIRB 1GG2A 3BERA 3I5YA 1OHHD 2O8BB 2ONKA 3AP2A 2OFWA 4IXMA 5CLLA 5HE9A 5BYJA 1T3HA 1VG8A 2V1XA 1OFUX 4D4LA 2ZE5A 2YWEA 4RZXA 2XXAB 5TVKA 1T4GA 3A4NA 4A6XA 3UK6A 3PEUA 4MYUA 1LF0A 1W1WA 1Z2AA 1FL9A 4KBGA 3T12A 3NBFA 4B6EA 1IXRC 1KI8A 1FTSA 2CNWD 3CM0A 3FFBA 3R8FA 5FFMA 1NG9A 3LRPA 1AN0A 1XMJA 2NO6A 1WMSA 4NYJR 3U5ZB 3RVBA 3I5XA 2V6IA 4MYTA 4JBYA 1II9A 3UWKA 3U7HB 3Q5EA 1GNRA 3RRMA 1P6XA 4IVRA 3NG1A 2WWGA 4Z1MA 2QQ0A 3U44B 1S1MA 2XTNA 2ERXA 2VL7A 5DE3A 5KPJA 4UNPA 2WSMA 2W6JA 3C7KA 1SKQA 1E99A 2GVZC 5AJVB 1OIXA 1IAQA 3MRSA 4P4UA 3IHLA 3BFXA 1F6BA 1EFRD 4V0KA 4EPXA 1VMAA 4DCNA 1R0YA 5JI3E 3CR7A 1W46A 3CB4A 2Z6VA 5DISB 2H57A 3THWA 1E32A 2RGXA 4NE2A 1TF2A 4CEIA 4AC9A 2IT1A 3ZZ0A 2NQ2C 2W2XA 1KHTA 4U7DA 1G8GA 2IYSA 1JQLB 1SXJE 3QXJA 5FR1A 2NZ8A 3W8NA 5EE1A 4G1UC 4Q19A 2P2LA 1G17A 3REFA 1ZIPA 1NVXQ 2BM0A 4URWR 4W7SA 4YMWA 2G9NA 2V7QA 2G0NA 4MRSA 4JLVA 4RZ3A 4JLMA 5GJCA 2YZ2A 1JJVA 3DPUA 1E69A 3EWSA 1V5WA 1W0KD 1NKSA 5JFGA 3GCGA 1TNDA 1TQ6A 3U3JA 3D7MA 1VIAA 1SVLA 1XCMA 3C41J 2D2FA 4BEJA 2VF7A 1GWNA 2FE4A 1ZYUA 2ZE8A 4A92A 4EPRA 4DB2A 2EFDB 3LW7A 2R8RA 5JSZA 1HQYE 3OAAD 1Z0AA 2QZ4A 3DL0A 4CRWB 3A1WA 3T06B 1G20E 3H84A 3V00A 2EVWX 1X3SA 3QPUA 3RS2A 1P62B 2AXNA 2YC4C 1D9ZA 1XTKA 1OB2A 1EWQA 2WWHA 4BECA 1DPFA 3Q3JB 2GJKA 5C1BA 3OEHD 4C9BA 3G82C 2CEAA 3B1ZA 3ICEA 1GUAA 5FOVA 2O52A 4QC2A 2W00A 1G8YA 1XEFA 1XU4A 2KBEA 3DMDA 1HT1E 2NTYC 1EX7A 3PV0A 4DCSA 5AUPB 3PEVA 4PAOA 3I3SR 1KO1A 4IKEA 1OW3B 4LJYA 1KNXA 4IDQA 4PANA 2Z43A 3BRWD 3N70A 2IK8A 4KI0A 3K53A 4MRRA 5F98A 1AJEA 2MMGA 2ASEA 3NDBB 1BIFA 1K6MA 4C0JA 5H8WA 4DCUA 1R4AA 4EFLA 2QORA 4OQFA 1SXJC 2Q3MA 1RZ3A 1F2UA 2CE7A 4GSYA 4B3DA 2ZREA 4NU0A 5FTNA 1TEVA 5JBQA 4AIIA 3GJ4A 4RFSA 4UKDA 5E3HA 4ACAA 5FPYA 1A82A 4Z1MD 5IT5A 3KQHA 1W2HA 4K46A 4Q01A 2JJ1A 4LJ7A 1N6OA 5FBRB 2QP3A 1SKYE 4I81A 5FBLB 5BYKA 2O8DA 2ZJZA 3G0HA 4XTRA 3GPLA 4D4KA 3AF0A 1G16A 3WBKA 5J4HA 2VHCA 2JATA 4XWAA 3SE0A 1A2KC 1SZPA 1UPTA 3GQBA 4LRWA 2DB3A 5JS7A 3RRZA 721PA 1MO4A 4ZCLA 4UNQA 4DBLC 2QT1A 3QG5A 1LY1A 4ZIRA 4BZPA 1P2UA 2O8BA 1NJGA 2AHOA 2FFAA 4JKYA 3TSOA 4JKIA 2OV2A 5FUWA 2YNMA 4A36A 1IXSB 2VBCA 1D2NA 4G0NA 5FOXA 2XXAA 1G5PA 1Z22A 1R8SA 2XOKA 2ZRGA 2GZDA 4D0GA 2OBNA 2V7QD 1OLOA 2OLKA 1NI3A 4BZXA 1YZNA 2IS1A 2N1BA 3TSZA 1Z2CA 5FTJA 2TMKA 2MSEB 4R2IA 3K70D 1QDEA 3QOFA 2IYUA 3AUYA 4PX9A 4AKEA 4IJMA 3QI2A 4JIMA 3JZAA 1M6NA 4HYYA 2HEIA 3B1YA 3DDCA 3U44A 2X77A 5EP4A 1D5CA 3ZQ6A 2HT1A 3F5FA 3GLGB 1YZKA 2UZ3A 1CTQA 4KO8A 1LS6A 1R5BA 4LV6A 1RRPA 4LJ9A 2QRZA 3FMIA 1QHYA 1CP2A 1ODFA 2NO1A 4I1OA 4LYFA 1FX0B 1I4TD 1HEIA 5B58C 2OFXA 1M34E 1EFHA 5FUXA 3TW4A 4G3XA 4KV9A 4Z54A 5H1YA 2FG5A 2GJSA 4EPTA 1UM8A 3ZLJA 3RC3A 1YZLA 4MKIA 5JEEA 3WYGA 4GI7A 3JVVA 3D6TB 1R0ZA 4WOPA 3TBKA 3GFTA 2C77A 5CDFA 4QNRA 5GVRA 1XMIA 2OXRA 1N5JA 1AIPA 4GOJA 4WVFA 1MO3A 5CYPA 3T15A 2QUZA 4FMDB 3LXXA 4F92B 4JL6A 3BOSA 5UKDA 1MT0A 3KDSE 4D81A 2FV8A 3HYTA 1XPRA 2Y8EA 1WF3A 4CZ2A 3QSYA 2IC5A 3RABA 4MKHA 4U00A 1MO5A 5B30A 2IHBA 3AUXA 3OIWA 5C4GB 2JLZA 3F8TA 5FTMA 3K9LA 2IL1A 2N46A 2GA8A 4HB4A 1XRJA 4TN1A 1QVRA 1P73A 2CCGA 3W34A 3I61A 2OBMA 4E03A 5F3WB 3HR8A 3FHOA 1D2EA 2R6CA 3VAAA 3GLIB 1Q20A 4IXNA 2EU8A 3SYNA 5J4YA 5AUQA 3I32A 2JJ1D 2HLDA 2KB0A 4YMUA 5CDFE 4H9GA 1SHZA 3VKGA 4MRVA 1Q1ZA 3KJGA 5JRZA 1XF9A 3IIJA 1E1RA 3SDZA 3QVVA 2E9SA 2XNDA 2XTZA 4PSAA 1LVGA 3ZVMA 2V1UA 2ZUBA 3C5HA 3BXZA 1YR8A 1E79A 2CVFA 1IY0A 2WWIA 4LJ5A 3FYHA 2ZVPX 3BC1A 2NO0A 4FN5A 1TQDA 2ZE7A 2IWRA 1E2HA 2BIFA 1DAGA 5SZJA 3GEEA 1N5IA 3W90A 1KGDA 2E87A 2WSSA 3L8ZA 1DOAA 5KNDA 1OPXA 2CXXA 1E2PA 2VQSA 1OKKA 2KWIA 2DR3A 3PG5A 2XOKD 3TQFA 4B48A 4YMTA 1XZQA 4XTCS 4P4SB 2PL3A 4TLEA 3DO6A 2H17A 2WWWA 1M7HA 1R8QA 3KFVA 2FEMA 2G1KA 3K0CA 4JL5A 4OI2A 3RDPA 2UKDA 5ANRB 2C9YA 3Q7PA 4NCKA 1E4YA 3A58B 1H8HA 1KJYA 3QXCA 4YMSA 1KI4A 3W6OA 2N42A 5L3VA 2QN6A 3K0AB 4D4JA 3VNUA 2ZYVX 5G3ZA 3PITA 2RB4A 4DSUA 3NBZC 1AS3A 5CLQA 2O8EB 2XSZA 5FUVA 1TU4A 4DZZA 1FMLA 4JLDA 4K8OA 2KJQA 2R2AA 3GFPA 4HAXA 4YXWD 4NYJQ 3NEJA 4FI3C 2AFIE 4Q1BA 4BE7B 2JASA 3AVPA 2ZSDA 1KI6B 2QAGC 2R65A 2J9RA 3ZVRA 4LHWA 5KSZA 4KCGA 5KDLA 3SJBA 4TQ9A 2E1RA 3ZH9B 2ZRNA 3ADCA 3U6KA 2ZEJA 1F48A 1G4UR 3EASA 1S0UA 4JVNA 4L16A 4S35A 1XCGB 2GHIA 5A0FA 1J8MF 2BKEA 3UWOA 4LBZA 2ATVA 1P60A 3WYFA 5KU1A 1DARA 1NY5A 1KAGA 3BB4A 5SZIA 3SHFA 5FPTA 1OJLA 4GNKA 2PZGA 1SVSA 5FBWB 3FPAA 3K8YA 2JGNA 4US0R 4ESHA 1NLYA 4Q21A 4LHZA 1KIMA 2G77B 2WJJA 4UXHA 2ZUCA 3RS3A 2WV9A 1MOZA 1NMZA 3B1VA 4GOKA 1KSGA 3O8BA 4MGZR 2JLRA 3TRFA 5B2ZA 5H70A 4M0LA 1UKEA 1AA9A 2BC9A 1Z6GA 4GZLA 2P0EA 3GLGA 2IYZA 3MLEA 1VPLA 4O25A 2VO1A 2D06A 2ZU0C 4B6FA 1E1RD 5TXGA 1ZU5A 3ASYA 4E22A 2QMUA 1E0SA 2ZJAA 5KNCA 3SQXA 5KNBA 3LO5A 3U3OA 1FX0A 3HR7A 4UNRA 1P2SA 1XDBA 1YE8A 3EA0A 5CM9C 5FI1B 2FWRA 3SI7A 3FOZA 1XJ0A 3TAHA 1Z5ZA 4OHZA 1X8KA 1Z47A 1E2QA 2PCLA 5DIFA 1AQYA 3TNFA 2A30A 1NL3A 4Q9JA 1UKZA 1X1RA 4N0EA 3U60B 2GAOA 3FKSA 4BFZA 1E2MA 4LBVA 5C4MA 2D7CA 4BFTA 2GRJA 1OKKD 3W5JA 4A9AA 4R7ZA 4Q4JB 4TMTA 5FUYA 2LKCA 3AVOA 2QL6A 3TH5A 4JVSB 1OXSC 1II0A 3TKLA 5GVSA 4OBEA 4A0FA 3PEWA 3SYLA 1VHLA 2H7VA 1U0LA 4F93B 2XJ4A 3NDPA 2X1VA 3RS0A 2G1JA 3CPJB 4RKFA 3KJEA 3N2IA 5JZVA 3WP0A 1CRPA 4QBHA 4N3NA 3GLIA 5E7MA 1UAAA 2OE2A 1JALA 4B43A 1NBME 3B5JA 2EWVA 4M9ZA 1ZNYA 1N3BA 4IOMA 4C0KA 1BO6A 1KDRA 1N6LA 2OSBA 2GBLA 2R62A 5E95A 4ZKEA 2FPMA 2QE7D 4NYMR 4DEYA 4O2RA 1WA5A 3L0SA 2XSZD 1RFLA 2UVQA 4JYCA 3P1JA 3BAFA 2ZSEA 1MABB 5BN4A 3BH6A 2EFCB 2PLFA 1DO0A 4TTQA 1N6KA 3A1SA 1FFHA 1JR6A 1ESMA 4NCIA 3UATA 4DIEA 1G1MA 3P20A 1ZCBA 2BV3A 2VTKA 5DGXA 2Z4RA 1JECA 4GP6A 1YZTA 1WP9A 4IW3B 4KYIB 3WNBA 1Z3IX 4UJ5A 2I4IA 3IPXA 2EYUA 1IXZA 4FCWA 1Z06A 2ZSFA 3FMPB 3RWOA 4DJTA 3E1SA 3QXSA 3RS5A 3THXB 3DMNA 2HDNB 2BWJA 3LX5A 4DDWA 4YLGA 1C1YA 1OF1A 1SXJB 3OIUA 3UG6A 3IEUA 6Q21A 1RRGA 4P4SA 2HUPA 3MWYW 4NYIR 2Z4SA 3RYTC 4KFSA 5TDHA 3KQNA 4D0LB 1NN1A 2IUTA 4PC3A 3CF2A 4Q7KA 2YC2C 2YWHA 1V43A 2QROA 2ZANA 3OF5A 3L0PA 4HAUA 4C2TA 2IYTA 3K0AA 2ZJ5A 3LBNA 2RGNA 3NBXX 4OQMA 4HLUC 5KHOC 4ABYA 2B7BA 4JMPA 5H68A 4BWYA 5A4JA 2O8EA 1T3SA 1Z0DA 4IDPA 2BHRA 4W9MC 1ZD1A 1ESNA 3HPQA 4WAUA 4LPKA 4FINA 1TUIA 2D4HA 2KBFA 4Y0AA 1G8HA 1EK0A 1OIVA 1DAEA 1KI6A 1KMQA 1NBMD 4EJSC 3RNLA 2WJVA 4M4SA 2ZSBA 4XVQA 1A2BA 2ZJYA 4R98A 4RFVA 1NY6A 5CJPA 5E4FA 3T1QA 1U2RA 3CRQA 1OV4A 1W4RA 1XJCA 1PV4A 1P75A 4KBFA 3BS4A 3CNOA 2AD1A 3WY9A 4PC1A 2FSFA 5LB2A 1VHTA 3BB3A 3QPWA 1Z8FA 1AQUA 1ZP6A 3EWAA 3W6NA 4LJ6A 3SNHA 3L82B 4RD3A 1W44A 3ZQJA 4IEIA 1W48A 4MRNA 3NTUA 4DDVA 2FFBA 3P4YA 1UBGA 1Z83A 4LV5B 2IS4A 4JT4A 5HKKD 3B78A 4QHYA 1P7CA 3QKTA 1EFRA 1DO2A 1RW4A 2ZJOA 4YONB 3X1WA 1OH5A 2GWHA 4PAMA 2OG2A 2VLIA 4QJ3A 4URUR 4DLRA 2CL6X 2VIIA 1JAIA 1DADA 2ZRAA 3U3KA 4BASA 2H92A 4C0LA 1CJKC 2D74A 2BMFA 4L4UA 5P21A 4LBYA 2QMOA 2F9MA 1E2JA 1SKYB 2PEZA 521PA 1NSFA 1G7TA 2ZI5A 1KSJA 1WBDA 2WJIA 3FVQA 4A0GA 1E98A 4PAQA 3EZ2A 2WAXA 1JPJA 3LV8A 1KY2A 4Z51A 3EIEA 4DRZA 3SR0A 1II8B 2C96A 1JB1A 2WKRA 1U9IC 4DLVA 4KXFB 2NMVA 2ORWA 1GKUB 1ZM9A 3C15C 5IDVA 1P4SA 1DAKA 3SFVA 5SZHB 4JVLA 2QTVB 4Q4JA 1NSTA 4AD8A 4DC9A 1KI7A 2QM7A 4V0OA 3A1TA 1Q44A 1U98A 1KDPA 1KZGB 2CHQA 2QT0A 5FTLA 4KYUA 3KJIA 4JVMA 1G3RA 4BZQA 4W5HA 1YZGA 3HWSA 1E2LA 2REXB 3EX7C 4DLUA 1EG7A 3OAAA 4DKXA 2HJVA 1WQ1R 1X86B 4RZ2A 1WRBA 5FL7A 1KMHB 2WTUA 3ICQB 4QM6A 1U0JA 4AKIA 1KK0A 1A4RA 2PBRA 5JHGB 2Q9AA 2QTFA 4YQFA 2PMDA 3EW9A 1ZUNB 4TZ6A 3GLHE 3OEHA 4TYPA 4J0QA 5DHFA 2VSFA 2HXSA 3ONWA 1MABA 3BH0A 3B13B 1NRJB 3R7WB 1H65A 3A36A 3WMFA 3UIEA 1OH7A 2AL7A 1VTKA 1UBFA 4Q1CA 4M53A 5EJEA 1S9HA 3VR5A 4HDQB 3U7EB 4AYTA 4URYR 4LUCA 3SJCA 5DI9A 2QU8A 3KJHA 1EGAA 3HJNA 1DTSA 3B60A 1US8B 1ZM7A 1UEIA 3THXA 2JJ2A 2A78A 2R44A 4DLSA 1SXJA 3M4YA 3AM1A 2I1VB 3AF4A 2VP0A 3ZD6A 2ZJ8A 2OBLA 4Q18A 4BFVA 3KXLA 4UNNA 1RJ9B 1G8PA 2IYXA 4NTZA 1HTWA 2G88A 5KPDA 1F5NA 4ARZB 3NHAA 1FOEB 4N0DA 2P6UA 4DIDA 4AI6A 2W0SA 5TB5A 1J7KA 1TMKA 4HAZA 3OESA 2ZJ2A 1Q22A 5EUMA 4LZZA 3VNVA 4NKRA 4ZDJA 2JIZA 2FPLA 3Q8XB 2GXAA 2JA1A 2LCFA 4X8OA 3NKVA 2A9KA 1M7BA 1WXQA 2VHTA 1N5LA 4M1OA 4NH0A 4RZUA 2NOAA 4TLAA 4OHWA 3MWKA 5EP2A 2BKUA 4C2UA 1E3MA 5GJVC 2QAGB 2JLWA 5DH9A 1G291 2GCPA 2ZS7A 2IW3A 4ERNA 4I1VA 2GZHA 2NO9A 4YMVA 2ODBA 4NDZA 4OJQA 2ORIA 4PO1A 2WIAA 3QF7A 4Z8YA 1J90A 2W83A 1GL6A 4A2PA 1CEEA 4IOJA 1Q21A 2C98A 3R9WA 2J7PA 3L0OA 3LA6A 2IA5A 1SVOA 1Z0IA 3DKPA 4WZBE 5LBIA 4HLQB 2OXCA 2GF9A 5JJIA 2FEOA 2ZR9A 2ZE6A 1JR3E 3MCAA 2ZS9A 3SFZA 1XPUA 2I3BA 1CF4A 4TTRA 2A5FA 2ZYTX 1KAOA 1XEWY 4HAYA 3VR6A 3ZVNA 4URXR 1NLFA 2RAPA 4IFEA 1P9WA 2J0UB 4CEJB 5KSYA 4QJ4A 3DM5A 4E5UA 4D25A 5DYIA 1NN3A 3B6EA 4UXJA 3EARA 5FL7D 2OHFA 4TLCA 5F9FA 1L2TA 4TQAA 1T0HB 2BEJA 3B8HA 4JYBA 3H1TA 4PZZA 1Q3TA 2XX3A 4Q9KA 4A1FA 1AGPA 4WXRA 5K8LA 3SEAA 3F3YA 2IWHA 3WHKA 2SHKA 2WWXA 1Q57A 3LFUA 4PXAA 2JJ8A 4G5QA 3PUWA 4HAWA 1TF7A 4DDTA 4XSHA 5BW8A 5HR5A 1TPZA 3IKJA 4QNMA 3X1YA 2FSGA 1ZBDA 4BFWA 2ZRMA 2IXGA 2DFNA 5BQ5A 4PQRA 1NJFA 4HAVA 5IRCD 2JDID 3DM9B 2IBMA 3KUCA 4B3FX 3EXAA 3GEHA 4PZLA 2G0TA 2GJ9A 3FHTA 3NXSA 4Q7LA 2FU5C 2VHJA 2ZI6A 1II8A 5L3RA 2QSYA 1W36C 1E1QA 1NLZA 1QG2A 3S1AB 2JJ2D 2GXUA 5L8VA 4NL4H 1SXJD 1GM5A 3H86A 1MO6A 2WWFA 2RGDA 2F3RA 2OCAA 2IS2A 4BFSA
chains in the Genus database with same CATH superfamily
2GCNA 2O48X 1MXFA 3EW7A 3BHJA 2GK7A 1TOAA 2VJOA 2D62A 1QR2A 1E3SA 4HK4A 1E9RA 1L7PA 2OG1A 1XCJA 3F8WA 4NJMB 2DPGA 4UFNA 3K1TA 4BP8A 4E3WA 2Q2VA 4UNSA 2HMAA 1TJ3A 2ZQYA 3LSTA 1DMSA 4JUIA 4HZUB 3TUIC 3H4VA 5ALYA 3R7NA 1O6GA 5HZMA 3R5KA 3SLGA 4NXMB 4N82A 3HNOA 4AKGA 1ZUNA 5FORA 4MR7B 4DWJA 5JJLA 2G08A 2QPOA 1UQUA 2IYOA 3L7MA 1ODCA 4GG1A 2IELA 4II7A 4KFUA 3HBMA 4N6NA 4OA5A 1NJ8A 3GRKA 2CXSA 1FVHA 2UYGA 3EXFB 4Y2PA 1C9KA 1NVVR 3G2JA 4UUQA 5K6AC 5IDYA 4HBZA 1MX3A 2JAXA 3NRBA 1SIWA 3HYLA 4M0CA 4WK4B 3A1CA 5AT1A 3O84A 5BP7A 1J8VA 3ML1A 3PP8A 5HK8A 3AKEA 3FUWA 1ZKDA 2BE7A 3PXCX 2YFKA 2ZLBA 4YBRA 1M34A 2VHEA 2AT1A 2VYCA 4YP1A 1W2WB 2H4JA 4WBNB 2FSVA 3A6GA 2F64A 2WJHA 2GKGA 2V45A 5FR2A 4YUZA 5EOVA 1JEEA 1US8A 2A1TR 1FBNA 3GJZA 4TROA 2RH9B 2ZYWX 3ESYA 3LOQA 4RHTA 2FEPA 4X1IB 4GE3A 1G5FA 3KKNA 4M1MA 5FFFA 3SG0A 4GL2A 3KXPA 1WXGA 2ZSHA 3IC5A 4QJBA 4YACA 3RANA 1J0BA 4C6HA 2FVXA 5EIXA 3SBOA 3UTDA 1O9GA 3QITA 1AGRA 2YFHA 1B8UA 4IVNA 4YALA 2FZ4A 4JBHA 4R2WA 1S5PA 5JVDB 4MYSA 1VDZA 5CBKA 3TDNA 2C78A 2CK3A 2VDLB 3D6MA 3NAGA 3R6GA 4RW0A 4ABTA 3K05A 4YCAA 3QKRB 2ODQA 5A03A 5FBZA 2H1FA 1V1MA 3U19A 4RCZA 2OPBA 4FS3A 3RK1A 2I6GA 2HQOA 1YDMA 2G82A 4QOSA 3NM4A 2O19A 4B81A 4P35A 4U7TB 4YCBA 2WM9B 5ICMA 3JS5A 2NXJA 3WMGA 2AC2A 4KO2S 4QLAA 4XASA 3SOPA 5EHZA 4UXIA 1LPNA 3HU1A 2H48A 2X5OA 3IURA 3B38A 3AI7A 5D87A 4Q1AA 2QAGA 4D8XA 4LMPA 4IIJF 2QLBA 2X4LA 1CZOA 3PQ4A 5CJJA 5DBOA 4B3BA 4GSLA 4BDTA 4CQLA 1Z74A 2DC1A 2VAWA 1P4HA 4G24A 4IV0A 3D5EA 2A94A 3MGAA 4HNHA 3C87A 4WA8A 1BHSA 1VLJA 1SU7A 3CX4A 2RHJA 3PXGA 1PUXA 5CLJA 4ZVRA 3CX7A 3ZHBA 1HKHA 2Q4OA 5G0UA 2AJDA 3QY0A 4LGYA 4MYHA 2H2AA 2PMWB 1E7WA 5IBRA 5ALFA 1FNBA 1Y34E 4C7XA 3UWSA 4QDKA 1Q0HA 4YYEA 1EGQA 1MJGA 2CKDA 3JQBC 1IU9A 4GM4A 4MLDA 4QWWA 1PS9A 3E18A 5LQCA 3K3PA 1H4TA 3OPYB 3TM5A 3PT9A 4MPTA 1GAEO 2WRZA 1CJMA 1NLMA 5EC8A 3V33A 2Z2KA 1MGOA 1J8YF 1KO8A 2CFSA 1ECPA 2WHXA 1H0HA 1RQNA 2V8OA 3D43A 3DFIA 4RZHA 1DCKA 1GN8A 1OPRA 3HDVA 2HLHA 3N2LA 3QF4B 5A4KA 4TVSA 1CEXA 4B5LA 4H3KB 1VECA 4E6PA 5C8VA 1RYBA 1EI9A 3O4FA 3KEFA 3FLAA 5MFZA 2OOKA 2IBSA 2VA9A 4AF8A 1AS0A 1ORIA 3E2IA 1GZSA 2Y99A 1ZVMA 4J16A 4MGIR 3Q3GE 4GOXA 3MTDA 4HDRB 1DKNA 5ALOA 1G1AA 5F2OA 5B1IA 5KVAA 1DX4A 4CLOB 1ABBA 2CNLA 3ONDA 3MWEA 3WRYC 2G3YA 5C37A 1L9KA 4Q4LA 2HL6A 2W93A 2MSLA 4KWCA 1NHWA 3R0JA 4V02A 1N7GA 1Q6YA 4RKYA 2HK8A 2GH1A 2OWDA 4V0ME 4EATA 1O0CA 1U7HA 1EESA 1X8LA 2HZ7A 4RKEA 1HE5A 4OPMA 3SHVA 4A15A 1Q0UA 1XK7A 3HCCA 4MV6A 3QVKA 2MTBA 3MB8A 4OH1A 2HO5A 2PUFA 2GK6A 4ZGWA 4B3TB 1D04A 3UANA 1MEEA 1RSZA 2AFIA 4BB0A 4PWYA 2BONA 3TLKA 1EBBA 4RADA 2KX7A 4XXHA 5K8TA 1UOQA 2R8PA 1M75A 2BR3A 3TIIA 3TTWA 3HR4A 1WCV1 2IUSA 1ESEA 3IUPA 4WFKA 4XYBA 1P80A 3VOAA 1KMCA 3PDIA 4G01B 4E07A 3LP5A 3OPVA 3GY0A 5HM8A 1NW3A 2JIBA 2VPWA 1RIFA 2A0UA 2FMXA 3U3RA 1HMYA 2XADA 3BQ9A 5ARCA 1KRHA 4PCUA 4JI4B 4CGYA 1NVWQ 4XZ3A 5LDGA 1BEUB 1B23P 4KRXA 1BXGB 3I6MA 3KP1A 3NC1C 1KDOA 4BJ1A 4EY7A 3DLPX 1NUHA 1NDQA 2CHGA 2IBTA 3GROA 5HXAA 1MW9X 1ZJ6A 4F9EA 1L4KA 3I42A 4IQ0A 5DV9A 3CO0S 3SC2B 4FIDA 5FWXB 2FDCA 1A5TA 3TUZC 2NM0A 1OH8A 4HRAA 1ZNWA 2V7VA 2FF5A 2WVAA 4CT4B 3JQCA 1STOA 1H8ED 5H0IA 4FYWA 3ZX4A 2E2WA 4RL6A 2GPBA 3CPSA 1L8AA 4OBXA 4LHXA 1NGSA 2RJ3A 1B2RA 1F8FA 3K0BA 4GMFA 2H9AA 4JA2A 4TTAA 3VPCA 5KO2A 1DIRA 5IK2D 1GUZA 1FZQA 1LDGA 3U13A 2NP6A 3FGNA 5GP1A 4F45A 3R3ZA 4EECA 2YV3A 3PLNA 1RQPA 1XKQA 2FWNA 3I37X 1IH8A 3GOQA 4LFCB 3EWNA 1B16A 3GU3A 3PDCA 1EBFA 4NOJA 2XNJA 2PT9A 3IDSA 1CJCA 1JAZA 4O08A 4QYXA 4MLZA 1CEYA 3G9UA 7MDHA 5DLYA 4FDUA 3TNYA 2V58A 3D6FA 1NNEA 3LL4A 2YXBA 3WL5A 1RYFA 1SOAA 3ZDDA 2ET6A 1NF3A 5DTIA 2D8AA 2Z9DA 4G07A 4RWEA 4KPGA 3CH5A 5BOSA 2PLWA 4HGZA 2CBGA 5L3SA 3LIPA 5EL0A 2C9CA 4H4CA 2C4UA 2ZXUA 1UBHS 2QRJA 4P3KA 5I8PA 3H3XA 5T6BA 1V41E 4GUAA 3OE4A 1CUCA 4UAGA 4Y0VA 4X94A 2VK8A 4Y9UA 3RGGA 4PG8A 2DBRA 5A0VA 3PD7A 3AU8A 2HV8A 1G5TA 1PX2A 1T4MA 1Z29A 2MR6A 3B9PA 2QEQA 2VPTA 1H2HA 3I6IA 4RD2A 1L0BA 4HLUA 2C58A 4U2KA 3TLJA 1MPXA 2BGUA 4GSKA 5JBNA 3FOAA 3T5CA 1DRVA 4OJYA 3SNKA 5BVHA 4CL0A 2P27A 4CG0A 3OTHA 4GLJA 1VMIA 3G8YA 1CY4A 3AJAA 5C81A 5EHQA 3GVHA 3UH0A 1LPPA 4YN3A 4A26A 2H4WA 1YB1A 2O2HA 2Z2JA 3ZV3A 3ZX5A 3BDVA 3O8LA 3VJMA 1ZL0A 4W5JA 2QG6A 3LG2A 2J0EA 2XUGA 5EFZA 4EJSA 4V1CB 4RTSA 2FP4A 3I01M 1WU7A 1JI0A 1E2EA 3AVXA 4TS1A 3WGMA 2GZAA 1JSRA 5C1DA 3IMGA 3EC2A 1QHHB 4R0NA 1Y8QA 1RRCA 4QUIA 1PW5A 4N9WA 1YB6A 1I4EB 5DULA 5IH7A 1NIPA 2P3SA 3GRYA 1V3TA 5ILGA 2FZ5A 1CUEA 4EKYA 1KQ3A 3ND9A 1EUDA 3FE2A 1Q0QA 2ZAIA 2NU7B 3PQCA 1JE0A 4BJ6A 5ECGC 2GRUA 4ZHQA 5LJLA 1YU9A 2X7XA 4ZMSA 4QIHA 4ESEA 2Q0XA 3SHWA 5HKKA 3PR1A 4R3UC 1PL0A 1NW9B 2H51A 4BTLA 4PBRA 4C87A 2QN7A 1ZGHA 1FUYB 2RH4A 5ENVA 1ZUHA 1SB9A 3DD1A 3ZDQA 4FW8A 4QDJA 5ISMA 3PXXA 3EMVA 1BS1A 2A0WA 2JLQA 2VBGA 1EUCB 1GLNA 2Z83A 3AKYA 3DBRB 3BWXA 3E9ZA 4LE2A 4C76A 1GR0A 4Y67A 5K8VA 4ZJZA 3H2KA 2J3EA 2DFLA 1L9XA 4MKFA 3ZIAA 4JLOA 5D85A 2XZDA 4MUMA 5KTYA 2EP8A 1NYRA 1ACMA 1WZ2A 5DSTA 3T9EA 2OENG 1LWOA 2NXEA 1Z37A 2RARA 3RF6A 4HVLA 5KQPA 4AJIA 2MJLA 4FOPA 1V4VA 4H7EA 3L1UA 1AUQA 3SZRA 3T7AA 3LT5A 3VH2A 1P3JA 2UYOA 3NIBA 4F84A 2NV0A 3FSJX 3DT6A 4U6QA 3M5DA 4IMPA 2ZIXB 3KQQA 4GPEA 5EZYA 1IQPA 2I4MA 3QBVA 1GGKA 1QH8B 4PXSA 1RWOA 4WESA 4TXLA 3D02A 2ACKA 5AFSA 2XMDA 3WLRA 1DC4A 2P6MA 5JD4A 3QPVA 4RHYA 5AXAA 4B80A 3W9BA 4DA8A 1FP1D 1CZNA 4U2BA 3OHMA 1NUAA 4RCYA 5LXTF 4B74A 1YR6A 3BG5A 4TQGA 1A72A 2AFVA 3HBNA 3QUSA 2GZ2A 2BGJA 4OHXA 2BH9A 1I9GA 4A6DA 3K96A 3O2JA 3ZCUA 1RMYA 2B8TA 4DYHA 3KQUA 2O1EA 2MWMA 4DT1A 3H9EO 4RY0A 4NNJA 1UBKS 1KP2A 2WE7A 4IHKA 2DSTA 4IQ4A 1ZM3A 1Z4PX 2CUNA 5EXPA 3OC6A 4OGGA 2PLRA 2JVIA 3TB6A 5IWAB 3V2GA 3TZQA 1ULZA 3KOWA 4WINA 5IYZA 1IJEA 4CKEA 5HZKA 1UT6A 3QG1A 3ZOZA 1SU4A 5AK4A 1PCXA 3GLKA 3SXPA 3UUFA 1L7XA 3EUAA 2ZB2A 3ZUGA 4R6WA 1GU1A 1B14A 1I2MA 5G40A 3VRHA 3WWOA 1R74A 2QMHA 4QX6A 3OTOB 1TECE 3IEXA 4C7BA 3HFGA 4MOWA 4TLMB 2P67A 2V5VA 1F5SA 4OHPA 2IEGA 1D09A 4IWXA 1GUDA 4C05A 4CIWA 4UZFA 4MMYB 2XVMA 2AW5A 3QOXA 4TV8B 3AFGA 4BQOA 2VSOA 4F7DA 3JQ8B 1GTMA 1TEXA 1YB4A 4F85A 4OGKA 3MWDA 5B3KA 1PX0A 4EMTA 4NCHA 2QJFA 1X94A 2AG6A 2FJ0A 3I8XA 1HNXB 2PX3A 2Y0BA 3IO3A 1A9OA 3IMFA 3A3YA 2OCBA 4KSYA 1DJOA 1Z08A 2P68A 2WJPA 3QMPA 1M5TA 2QLNA 2ILTA 2Y76A 4EX6A 5FX2A 4ZVPA 3AKZA 4HMPA 1VIMA 2JFGA 3K9WA 4K6CA 5NLLA 1OROA 4TSRA 2NVOA 5A4MS 2G25A 3R24A 821PA 2GBCA 4B47A 4O6VA 4DIOA 2IYQA 5IFKA 3IE1A 4NZMA 1GUBA 1K06A 1NF8A 1LTQA 3DB1A 2X0RA 5FI0B 1F2TA 4RK6A 3KJXA 4H7HA 3HUUA 2PIAA 3ZV5A 3TB4A 1OTXA 4P0TA 1SBIA 2R84A 4JOQA 4KLAA 3NWJA 4N41A 1PS8A 1LZLA 5I7AA 3TSAA 4UEKA 5G0VA 4DNPA 5IM4A 3IAUA 1I51A 1K8QA 3FB4A 5JRJA 1PYDA 3ZW7A 4FD2A 3DVRX 1C3VA 2GESA 1EX6A 1HDGO 3O03A 2QHXA 3OHPA 4Q1EA 4YRLA 5EVJA 1PZGA 4QYMA 2AWOA 2C88A 3PPVA 3TI9A 2Q7XA 3X2EA 5LYJB 3RUCA 4O4LA 1J7JA 1M2VB 5AP9A 5HKLA 1WKVA 3I01A 2FSSA 3OP4A 5CVJA 3E70C 4M83A 4JROA 3G8BA 1PSWA 4F9FA 4NJEA 4HUJA 4IILA 1I4DD 4DLYA 1LZKA 3W5HA 4BLOA 2CZGA 2AHRA 3OURA 5EHXA 2H1RA 3EN0A 3NRCA 2R6R1 4BOYA 3B7PA 3ZGOA 1TVKA 1ZUWA 3SKXA 3QU2A 3ADPA 3GJXC 1BJTA 4ZXPA 5FPHA 4CLOA 2H08A 2EIXA 4BO4A 3CONA 4ZN6A 1B2LA 1NA5A 1SCAA 2FRXA 4X00A 5LZ5A 1VB3A 4Z3DA 3SEZA 2ZI7A 3ZS8A 1FRZA 3LBFA 3HPRA 3NHJA 3PXAA 1U5BB 4FJ1A 4MUXA 1XNQB 4HWGA 1E96A 2NG1A 4OB7A 3M5CA 2PX4A 1J00A 4MI9A 4G5SA 2P8SA 3HABA 1H2AS 2PT7A 3BSSA 3DAYA 4TT3A 2YOHA 4YDSA 5CXUA 1GZDA 5K4GA 6ABPA 1NE7A 3N8HA 3DWFA 3FNQA 1JW9B 3V4LA 4M99A 4QL3A 3EZ7A 5LZ9A 5LUAA 5JS2A 2NO7A 3LDHA 4MSUA 4JJEA 3K8QA 1ORDA 1R0RE 3MJCA 4DLNA 2ZRHA 1W4BA 3N0VA 2R1VA 2MSKA 2IODA 4MKZA 3RWMB 3NHPA 3OE5A 3C5CA 1TQ2A 2EJTA 1JNYA 2AG5A 2H9IA 2DP4E 5CDFE 3WLLA 5JZSA 5PGMA 3A8TA 4QBFA 1DCFA 2VT2A 2V3CC 5KJFA 1NXSA 2YVLA 3DAOA 3BK7A 3WK5A 4COOA 2KM1A 1BHJA 1VBMA 1FTWA 3IUQA 1XRSB 1U8EA 3EQZA 1IDOA 1RHKA 1S8NA 4CR6A 2WVJA 2WIFA 2ZVQX 2J4DA 3BZWA 2JI8A 5EYPB 2RHWA 1T9BA 3SQOA 3D3WA 1UQRA 3RTBA 3QLVC 3P9CA 4EDHA 4EMUA 3S2YA 3M8KA 1CC1S 5A2QA 2GD2A 4FEEA 2Q45A 5CTAA 1M2OB 3MD0A 1KAMA 1YCFA 4LFBB 4HRVA 3LNCA 3RVPA 1RWNA 3U9TA 2ZUSA 1UKBA 1KQFA 4OK5A 5DGCA 1M3SA 2QL5A 4S2UA 3UF0A 1ZGGA 2Q41A 1KTIA 3JASA 4G86A 2XLBA 2VYND 1OFGA 4OVKA 5E6UA 4AYXA 3PLAE 2BR4A 1GPMA 4UHJA 5A9RA 2GVDC 2P65A 3EJ6A 3Q5GA 2BGMA 3O1IC 2UXBB 1ZS9A 2A84A 4KDFA 4I1RA 5F1YA 3ROTA 4J9UE 4M7WA 3V8EA 3T7KA 4CM5A 2DWCA 2J3QA 3U3DA 3G9ZA 1QMGA 3I12A 2F6RA 4K3VA 1OT3A 4CM1A 3NUZA 4IKPA 4B75A 2AXQA 3AFHA 4GPTA 2IZ5A 1O3YA 1PHRA 1W0JA 2PJZA 2RC6A 4IHJF 1NE2A 2AMFA 2HYDA 4MQLA 5E6SB 2O7VA 1EX9A 3AM3A 4GOMD 5KX5A 3VX4A 4OQXA 3QIAA 2AE2A 3CF0A 3CWZA 4HUTA 1M9NA 1Z2EA 3GLUA 1NX6A 4UVGA 3GRCA 3U37A 2FW6A 2B1JA 2OCYC 3MJEA 10MHA 5GV8A 1M8GA 3RJTA 1T36B 1QIKA 4KI7A 3T3GA 4G0PA 2WKWA 4C0XA 4P98A 3TQIA 2V3VA 5KOJB 2YHSA 4C4TA 4HWRA 1H0KA 4KAFA 2HIMA 4V0NA 4YRSA 3SWWA 1KYVA 4JLAA 1MVNA 2Q6IA 1SUBA 1RCFA 1EE2A 4G1MB 1DQZA 4RK7A 3G2MA 4E31A 1A8PA 1SUIA 1VKOA 2GPJA 3FTNA 1OR8A 4YRAA 2D1FA 3GV0A 2ABWA 5IXSA 3DNMA 1JSZA 2OQRA 2E6UX 3P32A 8ATCA 3FETA 4MH0R 4EJFA 3STTA 5JATA 1M33A 1BQ3A 2DFPA 1FEZA 2O1WA 2QD2A 2JGMA 2LE0A 5D3MA 1G98A 4BLPA 1X39A 4Q82A 1JL3A 4F91B 3D1JA 1XL0A 3BMOB 1JZQA 3LSYA 2WTMA 3MUNA 4IJ5A 4V39A 4W9NC 2XQVA 4B4WA 2GEKA 1Y37A 3OJXA 1A7UA 4NE7A 4ES6A 3GARA 4QYSA 1NATA 5BN3B 4C3VA 1UJ4A 2FW1A 1NMXA 1L7QA 3QVSA 2AW3A 1IM2A 2YHIA 3F78A 3P4XA 5AI6A 1QH1A 2ACWA 1WCIB 3BMNB 5EXSA 2JAQA 3SX0A 1FW6A 4OQNA 1E9AA 1XU9A 3LBHA 4Z86A 5KYXB 4IF6A 2CCKA 4PVCA 3AYZB 3LXRA 5L3ZA 4RX1A 3SBEA 5C80A 3IERA 5D7BA 1KJNA 3VU8A 3BHIA 3RJZA 3VYSB 1YQXA 1LDMA 2B2CA 4PCVA 2P2GA 4H0FA 1FLNA 5AKKA 3RG2A 1YHNA 4Q4HA 3CN9A 3CXRA 4XFDA 2HO4A 2PMBA 5GQSA 3O3MB 1L4HA 2OZEA 4KXLA 2OT3B 3C3MA 3AVTA 1N2EA 4LSMA 1EP3B 4H1UA 4ML3A 2P5YA 4PU0A 4U2EA 3ICWA 4XD7D 5AKGA 4D9KA 1GSHA 1IFXA 1N5DA 4DVJA 1I33A 1M72A 4JJKA 1QF9A 2C9DA 3NHFA 3NHWA 4IJVA 4LXYA 4MW2A 1XWWA 4WCFC 1XZDA 4ANFA 1UBEA 1N2XA 1R9NA 4CTKA 2H16A 2RI6A 4GRIA 3OJFA 4CGZA 1KVQA 2XBMA 2P2NA 2QTTA 2BJWA 2HT6A 1C7ZA 3JARA 3STYA 5L6LB 3EBLA 4OTZA 5CMLA 2JCYA 5F4ZA 3N5CA 1W36D 4HG2A 1G59A 1H2YA 1FSGA 1CR2A 3USZA 5AW3A 1E2BA 3ZDEA 4IXTA 1JHRA 3E22A 2A4MA 3E5HA 3WV4A 4YJHA 1W9MA 2WD8A 1JMYA 3GRRA 2NNWB 1CLEA 4NG4A 4US1R 4C7VA 1BFKA 2CV2A 3K30A 1V6SA 4IQFA 3E48A 2K5UA 1O9HA 3IELA 1F8GA 4KPFC 3PEYA 2NLOA 4IIDA 1QGUB 2GTPA 3EXHC 4C29A 3AVVA 8GPBA 2OOSA 2GD1O 1Y3FE 3ECCA 3BMQA 2A7QA 2ZRDA 4R9SA 5AW7A 4KDEA 1R6AA 5KYVA 3PRKE 3DBLB 4AVYA 3S8MA 3A1DA 4DSOA 5J2TA 5EMMA 1I3LA 3CCCA 3LC7O 4KLNA 2JF0A 4JQSA 4L0MA 3VMFA 5IU6A 4XWKA 2FR8C 3S2SA 1IWPB 3O74A 3RVJA 5KWVA 4IDFA 3FRJA 3TLXA 2W6JD 4A0HA 3EQ2A 4NXNB 4OATA 2XPCA 3BEDA 3IAEA 4MYCA 1Y4DE 4KSBA 4G85A 2AJTA 2WUFA 2GAFA 4MTLA 4I4IA 1ZM2A 3T7JA 3RAEC 2P6RA 5IDXA 2PAAA 4B44A 4MCIA 3QKSB 4KQ6A 3C1AA 4DRXB 4E09A 1SUDA 3AHIA 2MINB 1A2OA 1FJ2A 1T5TA 2IYNA 1I0ZA 4KG7A 4K1XA 1YRBA 3LY7A 3PVZA 4GMXA 3GGCA 2W6PA 2NGRA 1YRQA 4WADA 4HEA1 4R8MA 4D82A 3D0RA 2ZCJA 5BRNA 3KTAA 5EIFA 3L4EA 3NQ41 4PINA 4XUCA 3PWKA 1G2IA 2MMCA 2PQ2A 1XJQA 1C1HA 3D7LA 3GEMA 1JHUA 3OQ6A 4WZAB 5DHUA 4AKSA 1DEKA 4PG7A 2WSBA 2BBTA 3IA7A 1WMFA 4MVJF 2QD5A 2IV2X 9LDTA 2RH8A 5IHXA 1GGJA 1I3MA 3F8SA 4ZAGA 3RHZA 1HYHA 1ZCJA 2PA3A 5AKZA 1ZVKA 5DOZA 1FRVA 1FK8A 2VT6A 1KK2A 3EG5A 4M2LA 4C04A 5IAJA 3BTSA 1PT7A 1GAJA 2QN3A 3Q0IA 3WHKA 2MCFA 5B53A 3COSA 3NUGA 1KVTA 3BWEA 3P9RA 3PRHA 4S1TA 3W7VA 3KR1A 4ECEA 3UPTA 1V8ZA 1LDNA 1B43A 4HAIA 1RYHA 2DKFA 4Q7JB 1DT3A 3SN6A 2Y1WA 3M3PA 2J87A 3ABOB 4HWPA 4MQEA 3GJ7A 4MUHA 2QI9C 1XG5A 2QM8A 1CZUA 2ST1A 2SKCA 3PQ5A 5FOQA 4PLYA 3E15A 2V96A 3KJNA 5GTDA 1IY8A 3E9MA 3E7FA 1Z0JA 3RT7A 1W4ZA 2OECA 2HR1A 3K0HA 4EHFA 5IJ0A 3IALA 1B8NA 2HHHB 3DOUA 1EVLA 2HWKA 2VTEA 3ZHZA 4IZHA 1WM1A 2D00A 4I1UA 5EN4A 3W05A 4GYJA 2E1PA 4BAUA 1FMTA 3E35A 5K99A 1FDWA 4C6RA 1VL2A 1EK1A 2D8MA 4C0QC 4ZJPA 2YVKA 1RPJA 4YRTA 2QD3A 1CIPA 5BPHA 5I5EA 4J8PA 2J32A 4JJIA 4KSCA 1VMEA 3B1XA 3HGTA 5B3LA 3ZWYA 3W9UA 2IU3A 3G2LA 1MOPA 4I14A 5K0LA 5HCUA 3GMTA 3KWJA 4Y7CA 5LMCA 1PQ4A 3KKMA 3THYB 1J2JA 2PUTA 4MWSA 4BRUA 1XQVA 1EVYA 2PFKA 4DRYA 5K03A 2XZLA 3U3MA 1TYEB 1E3TA 5BYBA 3K5WA 4B2LA 4PZYA 4ARIA 1OQAA 1TU3A 3DMTA 2HI0A 4LYEA 1T5IA 3IMKA 4V0LA 1NVUQ 3AI1A 4YJGA 1K98A 1PP4A 3OBIA 1U6KA 1MX1A 1NJ6A 3PJEA 5AVQA 3OZGA 1PLJA 2AB0A 3IBFA 4ZYVA 1MF7A 1J5XA 2AJCA 2V65A 1Z73A 1WSBA 1KJIA 1M1ZA 2EZ4A 2X9VA 4EVQA 2IDMA 2ZJ3A 4G5RA 7REQA 2H5EA 3CLTC 1N25A 4GYKA 2Z2YA 3DEZA 3ITEA 3JD1A 3FOFC 2CXNA 2GI4A 2YINC 3DFMA 3KD3A 4I6JA 1OLUA 3H75A 4WOJA 2WICA 4NATA 4GF5A 4DF3A 1BVYF 1DIAA 3OPXA 1VDMA 1GPH1 3B3GA 1NP7A 4O2LA 1Z6PA 5REQB 3AEKB 1IY2A 4QAQA 5JC8A 5ITSA 2UZ1A 1R3DA 1Y5NA 3QOYA 4HDOB 4JFAA 4LY0A 5I9LA 3ZK9A 2BFWA 1MR3F 2J7KA 2RKBA 3HA3A 2AEEA 3IIMA 5K45A 1ZU4A 3DCYA 4W99A 3P26A 3BJEA 3Q7RA 4HO1X 2J8ZA 4GMGA 1EFDN 4H60A 4ALJA 4LVOA 4BAGA 5KSOA 1EFUA 1SHTX 1X70A 2EBWA 1DG1G 1DUVG 3AR9A 2FMHA 4URZR 3MWJA 5JZBA 4R31A 2G7ZA 4Z8XA 3ZHTA 3VR3A 4DREA 2HJRA 3FVRA 2X1HA 1XBTA 1MRNA 2P2YA 4N8EA 4JB3A 1P39A 3UNXA 4RV5A 1CZHA 3T5DA 1XPJA 1EQAA 3KEOA 1I0IA 3IA2A 4UD2A 5IUNC 2XZPA 2NZYA 2ZOSA 3FKQA 4CETA 1PWXA 2YDXA 3D8BA 4Z6KA 3BCSA 1N5OX 4BN0A 3WL6A 4FYMA 5DX8A 2MU1A 3PCRB 1YL7A 2VDJA 1O95D 3DXFA 5JJCA 2R79A 2I34A 2DEUA 4C4AA 2HPAA 2PM8A 1NT2A 5I45A 5TEVA 1QHFA 2GUWA 4IP0A 4QUDA 4CKWA 1XE3A 3STXA 3PRJA 1QOZA 1VJ0A 3TQQA 3COWA 4BLRA 3LQQA 2ZVJA 1YIAA 3HUTA 4LJKA 4P38A 1IC6A 1ACJA 9ATCA 1GU7A 1UMCA 5GGYA 3TIGA 3VISA 3WLPA 1R5NA 1YJQA 2PDAA 3KYIB 4ARAA 4BTVA 4MKGA 1QYXA 4DHWA 4TS3A 4B9EA 1GV1A 3CF4G 4NEQA 4OLHA 4KR2A 4LOAA 4OK6A 1UH5A 2HJHA 3JYOA 4YP5A 4NDAA 2CXHA 3AV0B 1SCIA 1XTRA 1BJKA 3GT3A 3JZFA 1BFUA 4KL8S 3ILSA 3ADBA 1SXQA 3K0FB 3DZIA 3ZVLA 1NXWA 2PGNA 3NWOA 2CJWA 1LJUA 1PHPA 1N2IA 2XGOA 5EERA 5EMJA 3U7QB 3VGPA 4EFKA 4FZ3A 3BXPA 3KPJA 4KXWA 1GPBA 1Y80A 1Q3KA 1MB4A 3A6FA 3C39A 3PGLA 2BGKA 3KYCA 1SJ9A 2A0YA 2YMMA 4X61A 4TMZA 4AJKA 1ZNZA 4KGDA 4M9SA 1FLDA 1T1GA 2RGBA 3BFPA 1JHPA 2GK3A 3IBTA 1IHDA 4V3CA 4PGFA 3VHLB 4XVCA 2XVAA 3IE2A 1ZZGA 1GCIA 1ZMTA 3L84A 4JT2A 4CMIB 3KB6A 5CCXA 4MV7A 2QTBA 1WTCA 4A8JA 3TECE 1JU3A 5JCOA 3RRJA 3RVDA 5J4VA 2UYYA 5BN1A 1DHTA 1R9GA 1M2FA 2ATIA 1X1BA 4LIPD 2BFDA 4BJ5A 3AM5A 3MQ2A 1G0OA 1YS9A 4Q15A 4WXPA 2I6SA 4GWGA 4CT5A 3FWKA 3O90A 3GCDA 3P2EA 2WHRA 3N58A 2PZEA 4N65A 3TTYA 2CVPA 3MXTA 5BMVA 1HL7A 2TMYA 4B0PA 4D9EA 3O4IA 1XWFA 4MDHA 3VBCA 3D54D 2HA5A 2RE8A 2IS6A 4MCJA 3MUFA 2NSDA 1C7JA 4JAVC 5FNVB 4BNJA 5IASA 2XEXA 3T1HB 4TYYA 4KYTA 2VFAA 2E6KA 4PFJA 1R16A 4K2HA 1IRXA 1ATZA 1H5UA 2APJA 4L8YA 1CIJA 2AK3A 2DPXA 1G9XA 1BDMA 4ZOEA 4P34A 5D6NA 2ZBDA 4C5AA 5M04A 5HQTA 3KFXA 4NCAA 1XMSA 1O94A 5TC4A 5INTA 4D0NA 2E55A 1CBUA 2RHBA 4XUEA 3L41A 2HPVA 1E2NA 1N1GA 1SQFA 3BL6A 3A4VA 3VU9A 1TA9A 3VFDA 1T2CA 3HU2A 3FROA 2CBZA 4CN8A 3PL1A 4KBYA 4NBSA 2ODNA 1H5NA 4RJLA 4KLZA 1X42A 2JGRA 3EXEA 1DAMA 3PWZA 3PPWA 5TX7A 4MDFA 5LA6A 1XZIA 3FFXA 3DF7A 4ECAA 3N0RA 3GEIA 3Q3EA 2C7BA 1SUWA 1O5OA 2WSSD 3IEKA 1I7SB 1SHLA 3DTVB 1YA6A 5D00A 1SG9A 1H4SA 1LKZA 1P33A 4O8ZA 4XYLA 5L4LA 4HJRA 4WLNA 4HH4A 2I3DA 4Z1OA 3GLGE 3UPUA 5TY0A 3ZZNA 2FEAA 1PI3A 4PNHA 3VHQA 2CMKA 5BN5A 2JCVA 3K0CC 1PJ4A 3CZQA 4X95A 4I6EA 5K0GA 4YRPA 2Z8YM 2YV5A 1IVYA 4DR7B 2DWOA 3Q9LA 1ZICA 2FAXA 5I7VA 1KK3A 4N40A 3S7TA 3D2LA 4EO9A 4YCJA 1S2LA 4FX5A 2B78A 1Z4QA 1VP3A 5HBGA 1T6XA 3N6RA 1XMPA 3GD5A 1KXJA 5FOUA 1ONSA 3U0VA 3OPQA 1K6JA 1YF3A 4TSFA 1KYZA 1YVDA 5IDQA 1VSBA 1X77A 2I8LA 1Q5PA 3UCXA 1ZHOA 4ENSA 2ZP1A 2FGKA 4NONA 3KZCA 3VKHA 4JS0A 5ESWA 4WCFB 1TJNA 2ZGVA 2H0QA 3EEOA 1P18A 2DETA 2VP2A 4FJ0A 3KXIA 4HATA 4EB3A 2KQUA 4RTJA 2NUAB 1T1JA 4MS1B 1G6KA 1N0HA 3ZE0B 4XVUA 3LQFA 4JYZA 3PFKA 3ZHOA 1KY5A 2QZ9A 2YXEA 4UTOA 5IJAA 1CQIA 2X13A 5C8XA 4OQLA 3H0KA 4PFKA 4NHOA 4AF7A 5IAOA 2LZ0A 2OORA 3L7DA 1YS6A 2YUTA 1WUYA 3DKVA 5DYGA 2FCAA 2FSPA 3DMFA 2VF2A 1FXWA 3G8CA 4RVNA 5TARA 4EFNA 1AQNA 3RAFC 5EMLA 4TXHA 3NBQA 2NU8B 1F4LA 3L8CA 5DCYA 2C57A 4J7AA 4A16A 1CULC 3O8RA 2K6GA 1UK9A 2FWBA 2IITA 3EXHB 3FA2A 4PLCA 4M9UA 3U61B 4DDHA 4L8GA 5CH3A 2IY7A 5CYGA 2HJGA 1XXLA 2XNKA 1JIXA 3FPEA 3IYLW 2H4YA 3R9IA 1QPGA 2DWPA 2I2DA 5JISA 5LXTA 5CD9A 1E9VA 2HU2A 4BBJA 1R5JA 3AWIA 1GARA 2AEMA 2IU4A 3L7KA 4E30A 5ERYA 2BFBB 1ZGBA 2ZI3A 3Q6MA 3KZ1E 2A0KA 2JFUA 4WY5A 3S3TA 2V0CA 3C1TA 3AP1A 5KTKA 2I7TA 1E2GA 1QP8A 1UZNA 2CF5A 1QCZA 2DVMA 4X45A 3KG2A 2XF2A 1EDOA 3FLEA 1YI1A 4NNPA 4P1ZA 2G04A 2QP4A 5EAIA 4D3ZA 2AUMA 1T8SA 5KDDA 3Q7SA 3LLVA 1G64A 1WZNA 1K75A 2ODWA 2X9NA 3WIBA 1EVEA 4D3DA 1HNNA 1UJBA 4JV5B 3QZUA 3OFKA 3N1UA 4QA9A 3RS7A 3DV2A 2C3MA 4QFMA 4BP1A 4DAEA 2LVBA 4PYKA 5JSFA 2O8VA 3MTQA 2BGWA 4G8DA 3BXFA 4LXTA 4P32A 5AHRA 4JDPA 2QSJA 3AHHA 1T13A 1B0UA 5K7SA 1NBAA 4LNUA 3NH6A 5BOVA 2A2ZA 1TO2E 1P2TA 2E0IA 4BVHA 3AFIA 4ZZ0A 2G70A 2BPOA 1Z15A 2FHPA 3LC1O 4XE5A 2Y66A 5JNTA 1DXHA 2JLBA 4PZPA 3V3KA 1IAVA 3PUIA 4K0KB 4A8TA 2GPNA 1QIHA 2PXCA 3EDCA 4JI1B 2VN8A 1DV2A 1K4KA 4L9WA 3DAHA 4TUYA 5JDIA 3E9NA 1DG3A 3T5TA 5AM1A 1T9DA 5AK3A 4ZEVA 2PEYA 5ALHA 1O5TA 2VTVA 2B1IA 1OFVA 3W3AD 2DYKA 2DXIA 1CE8A 1PJAA 1Q92A 1XP8A 2ECPA 2JEZA 4OXQA 2Y9MB 3V97A 3WHLA 2IUEA 4POOA 5A5GA 4D4MA 2VJCA 3NH9A 4RZIA 1WXIA 1NFFA 5JSZB 1L7RA 2ZTSA 3ZCXA 4G8BA 1ZAKA 2VAPA 1R4MB 3IUYA 4ZOLB 4AK9A 1SVWA 4DCVA 5EZSA 5JAZA 1GA4A 2GBLC 2XB6A 5E9WA 3R44A 4LOKA 1M1YE 1NWHA 3UMSA 2IPNA 5DOVA 4E33A 2J5KA 2FPOA 1YRWA 4P6VF 2BF4A 2GM9A 4UD6A 3BE5A 1FIUA 3Q9NA 3QPDA 3S2ZA 3EB9A 3GN2A 4GFDA 3OT5A 4B3GA 2ZRQA 3RB8A 4KK4A 3H11B 1J0AA 4EKNB 3I1FA 3HXLA 5KINB 3AIOA 1Z34A 4XJXA 3ENWA 4EO7A 1P0PA 4KWIA 1GCOA 4CBVA 3IXQA 2ZI4A 2ZU6A 2PL1A 3FNEA 1W7AA 4Y1GA 3PNBA 1N6HA 1DWPA 4Z7QB 4BPBA 5JMTA 5IMBA 4C88A 1JLLB 3NX4A 1DVRA 1ULUA 3U9LA 1I3OA 4K9PA 1ZVQA 2R4TA 1CPYA 2Z8YA 3TCNA 4D8UA 3QMMA 2O9JA 1C9NA 3QU5A 2JKVA 4RSGA 1AB5A 3ETDA 1UEXC 3FMFA 1WDTA 3ZHUA 1KZ7B 3EIWA 3I9MA 4ZRNA 1Z6XA 1NC3A 1ODLA 1KA9H 2PJDA 2XB4A 1JEDA 4D5EA 4AG3A 4JUDX 5AR1A 4ZGGA 1VKJA 5HJ5A 1V25A 1JDSA 2BI8A 2QX9A 3U7JA 3H1AA 1IIBA