4TL6A

Crystal structure of n-terminal domain of kaic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
222
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRVSIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942)
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 80
structure length 222
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl6A00
3EWAA 4IRUB 1MO6A 2KI5A 1XCMA 3EZ7A 3M4YA 3MWLA 2A5FA 3CPJB 1G8FA 1GWNA 2QT1A 3NVAA 1OH7A 2ZYUX 2YNMA 4DJTA 4IOKA 2QGZA 4GOXA 2JLVA 1AZTA 2FSHA 4FMCB 3SBDA 2JAQA 1XMIA 1YZTA 2HXSA 2QMOA 1JXOA 1ZU4A 2GETA 1OXUA 2ORIA 3VQTA 3LQQA 1RJ9B 4GFDA 5F98A 2IYXA 4FINA 3THXB 3P27A 1Q3TA 2R6DA 5BQ5A 3UMRA 4JKYA 3WMFA 1VTKA 3L43A 4KFUA 4MH0R 3PIRA 3IILA 4NHOA 1OV4A 3W34A 3K70D 2ORVA 2CMKA 1CS4C 2V1UA 2XZPA 5L3QA 1K5DA 1IXSB 2PLFA 3VMFA 4PAMA 1MR3F 2W83A 1S96A 2XNSA 2YVUA 1DG3A 1JJVA 2CK3D 3THWB 1KK2A 5B57C 2ZRLA 1E2MA 3ZDQA 5KNBA 4Q03A 4JYCA 4DLWA 3AKEA 1OLOA 1N5KA 4BASA 3WHKA 2VL7A 3QKUA 1OSNA 3UK6A 5LD2C 3A1VA 3FFBA 2BV3A 4PQRA 1UADA 2WWYA 1GRRA 3JZAA 3P4YA 4M1KA 3FMPB 3VAAA 1D9XA 2ZU0C 4C30A 3KUCA 4ZPXA 1OFIA 2GEVA 3K9HA 1FFHA 1VYUA 1XB2A 5B2ZA 3PUWA 2ZUCA 2E1RA 2NO9A 1P2SA 2FFHA 4TMKA 2AKAB 2IYZA 3AVVA 1YR9A 2FFAA 4QHTA 1MRSA 4U7DA 1YRAA 1OIXA 3BJIC 4PSVA 4AKHA 4V0NA 5TY0A 1M7GA 4XD7A 1QHNA 1UKZA 3NDPA 3IO3A 1OXVA 5FI1B 2KWIA 4B2LA 5FOVA 5KDDA 3H84A 3VR5A 3K09A 2UZIR 2IW3A 3PG5A 1PUJA 3GJ6A 4M1WA 4A2PA 2BMDA 1A2BA 3B82A 1HV8A 1KMHB 2QL6A 3DOEA 4BLRA 2WM9B 2JJ8A 2I1VB 1U98A 4PPQA 5DYGA 4L4UA 1AM4D 4Q4HB 1DAKA 4ZDKA 1HURA 1NVWQ 4XWAA 4B74A 4M2LA 1FMLA 2QTFA 4NCHA 2IL1A 1XPUA 3CWZA 3A1TA 4FW9A 5JCPA 5JCZA 1TF5A 1KO7A 4R2IA 2CJWB 2ZI4A 2OESA 1EWRA 2RGAA 4RFVA 2ZRHA 2RGEA 4OI2A 2C04A 2IYWA 3KXIA 1P9NA 4X8HA 2BBOA 4Q9LA 3FMIA 4PSAA 3TUZC 4ESHA 1KJZA 2ZRDA 3P1JA 4QNRA 5EJEA 3QPVA 2OILA 3RWMB 3K70B 1G7SA 1GDDA 1YE8A 4P4UA 4US1R 3SBEA 1GZSA 2H16A 3BD9A 5J5CA 4Q1FA 3CIOA 3EW9A 4JT2A 2A5JA 1CKEA 4NCJA 1W2HA 2DPXA 2WMNB 5KO2A 1XF9A 2JGNA 1ZJ6A 4OL0A 3EPHA 1HH4A 3G5UA 1U0LA 4IOLA 4LV6A 5L3RA 1S9DA 2GZHA 4AKGA 1IN4A 1T4GA 3HP1A 2IS4A 1MOZA 1NVVR 3U3JA 2XOKD 1NKTA 1UM8A 1ANKA 3I1FA 3SN6A 4FCTA 2GDJA 4JSYA 4M9ZA 4HZUB 1VCIA 3FE2A 2J9RA 1GILA 1TEVA 4R71A 1QHYA 1ZC3A 4WA7A 3B9QA 3EZ9A 2PMDA 2YJTD 4RD1A 3A1SA 1OHHD 2ZE6A 3Q9LA 3C5HA 4B6EA 2ECKA 2JJ2D 2IYUA 2FDCA 1NP6A 2QT0A 2I4IA 1SVIA 1TAGA 3KKPA 3LDAA 4M22A 2BVNA 5HCIA 5KNDA 3I72A 1CU1A 1RRCA 4KCGA 4FIDA 1TU3A 1HY3A 4NKRA 5FR2A 2IYSA 4DIEA 5JECA 4DSUA 4MKHA 1W36C 2VQSA 2V54A 4GOJA 4KFSA 3BFVA 4JZKA 5UKDA 1PLKA 3TR0A 3M6AA 3J81k 1G5RA 4RD2A 4EJSA 1NN1A 4XTRA 3BWDD 3A58B 4KVAA 2WSMA 1AA9A 1KO4A 4YDHB 1IJFA 2HF9A 2YV5A 3GPLA 5ELXA 3TLXA 1W36B 1E98A 2N1BA 3AVWA 2AL7A 1XEXB 4HLUC 1N3BA 4RFSA 2DWQA 2IWHA 2FFQA 2ZVQX 2IWRA 2PCLA 3BB1A 3K0AA 3BK7A 1W48A 3GLHE 4MDEA 2SHKA 4YC7A 4ZCIA 3A4NA 4FMDF 1G3MA 4C4PA 2NGRA 2GZDA 4CEHB 4BFZA 2GK7A 4NONA 5HKKD 4MUBA 4PHGA 3NXSA 3NBYC 2ZJAA 5JWOA 1JECA 1FP6A 5KU1A 4XTCS 3I8XA 1CRQA 4ASUA 2Z43A 4OI1A 2P3SA 1G18A 1YZKA 3RS4A 2JJ1A 1IY1A 2JCSA 2BBSA 4F4IA 2ZU6A 5A4JA 1P9WA 2BKUA 1Z0DA 3B9PA 1D8TA 4BEBA 1I4TD 1ZM2A 4OQNA 4Q4LA 2C77A 2QP4A 5JZVA 1Z6TA 1DBSA 1GL6A 2RGNA 3MSXA 5FUWA 1G6OA 3CWQA 1RE0A 1FL9A 1CIPA 3TW4A 4AYTA 4WXPA 2ERYA 3BGWA 3LWNA 4IFEA 2OUKA 4JLAA 4TQ9A 3IUYA 3QIAA 1L7VC 3CR7A 5TXGA 2Q9CA 1FZQA 1NVVQ 2A5DA 3GFOA 4S35A 4TL9A 1GTVA 2C96A 1HE1C 4UXHA 3EARA 4HAWA 4PC6A 2IS1A 4W7SA 3VFDA 1ZC4A 3X1ZA 4HDQB 2NO6A 2JLYA 3WMEA 1VCMA 1Z47A 2C8VA 2C9CA 3K9NA 4LPSA 1V5WA 5DHFA 4GPTA 3THOA 2HYDA 1HTWA 2H7VA 5CM8B 3EG5A 3L2OB 4RZ3A 3GLGA 3OAAA 4D2IA 1VMAA 1MH1A 2RAPA 1CR0A 1E2JA 3PENA 4LHVA 4OI0A 3K0SA 2WJVA 5BN4A 3LY5A 1R0ZA 3W90A 1GUAA 5J4YA 2FZLA 3D7MA 4FCWA 3NDBB 1KKLA 1WQ1R 4GP6A 5BW8A 4L9SA 5FTMA 1QVAA 2J0UB 3IQXA 3MWKA 3OIVA 2QRNA 1DAMA 4QHYA 5SZJA 2C98A 2XJ4A 1Y3AA 3PUVA 2YOGA 1SXJA 3AEZA 3KX2A 1Z06A 4HI0E 3TH5A 4AKIA 4BGDA 1T8TA 3B7GA 4GBMA 4OQFA 3LW8A 1ODFA 2QY9A 3KKOA 3THWA 2IYVA 4A1FA 3OF5A 2D7DA 4DLYA 2ZI3A 4PC1A 4ARZA 3B78A 1W0KA 1XD8A 4L5BA 3LFUA 2OV2A 1M74A 4G5GA 3T12A 3ETLA 4D6PA 3FKQA 1CULC 1KHTA 2WKPA 4KV9A 4KXFB 3ZJYA 4OBEA 2ZJ8A 2GCPA 4LX0A 1T3HA 3L0SA 1P2TA 1IQPA 5HE9A 4BRUA 3REFA 4B35A 3OEHD 2CLSA 2YHSA 3LVRE 4IJMA 2VLIA 1OXXK 2AWOA 2UVQA 1OIVA 1IBRA 2PZGA 2W2TA 1PUIA 3CB4A 4OHXA 4P31A 1M34E 4UNSA 5J47A 2O52A 3QVVA 2OE2A 1VIAA 2VF7A 4HLDA 2FSGA 3ZH9B 3BE4A 1S2MA 2OCYC 3QBVA 1LS1A 2C78A 4TMWA 4QBHA 5CIQA 2IYTA 4PQFA 3ZZ0A 4LHYA 1CF4A 1NG9A 2PLRA 5DI3A 2X8AA 1NIPA 4PO8A 3GD7A 5JLJA 2DWOA 5FUVA 3R7WB 4TQUS 4UNNA 1JPNA 5CK5A 3LRPA 5DO9A 3GLGE 1G3RA 2QSZA 3SC3A 3SFVA 1GFIA 4WIAA 2GJKA 3ADDA 4IW3B 5DSZA 1AQUA 2GJ9A 1G1MA 3PXGA 4B44A 3ICQB 2V9PA 2QAGA 5FBVB 1DS6A 4WXRA 2ZJYA 3QSYA 1G7RA 3GJ8A 1JAHA 2QE7A 4QGHA 2O8CA 2HJVA 1PLLA 2ZAMA 4ACBA 1S4QA 1WBDA 3KUDA 2O8CB 5LPNA 4QJ4A 3P4XA 2F43B 3LNCA 3OIUA 3VR6A 5EZ6B 3NBZC 1GNQA 2PCJA 2QP9X 2QN6A 4PR0A 1YJ5A 4ARZB 1B0UA 2QUZA 3FMFA 5FL7D 1R8QA 4KHZA 3RRNA 4DLRA 1M8PA 4C2TA 3H2YA 1KI6B 1LV7A 2IA5A 4TYNA 5FOXA 4CRWB 3IKJA 3GJ7A 2OO7A 4M4SA 2EFGA 4A6PA 4A0RA 1R10A 1OT3A 2B21A 1UFQA 4LJ5A 3DDCA 3RABA 4B71A 1BH2A 1P4SA 4B3XA 2OT3B 4LJ8A 1A5TA 3JVUA 2N42A 1HA3A 3NH6A 4O2LA 2ZS8A 4HUQA 3EA0A 3WRXC 4CT4B 1KIMA 5GJVC 4XWKA 3U7HB 2DFNA 1OYYA 4LJ6A 1D5CA 1WE2A 2F1IA 4H9GA 2W6JD 2HLDA 3MFYA 1OKKA 2YC2C 4JLNA 2R62A 1XRJA 2P6NA 4C2UA 2AK3A 4LK2A 3NG1A 3IEUA 1OHHA 4F4CA 2ZSBA 1CRPA 1IY2A 2GEDA 2GBLA 4TMVA 2GK6A 2Q3FA 1NIJA 1CR2A 1ZNZA 3LX5A 4KU4A 4KLNA 2QTHA 3TE6A 2J45A 4YMSA 2RGNC 3H1TA 1YVDA 1TEXA 2WIBA 4P4TA 3S1AA 2BBTA 3CX6A 3A4MA 2W6JA 4AWXA 2VHUA 1BYIA 2RGBA 2XEXA 4O0MA 2VEDA 2WPDA 2CHVA 1GKYA 3QEJA 2GCOA 4Q4AA 1G3UA 4DCUA 4OQXA 4JJKA 3D31A 1E9FA 2ATVA 4B3CA 4XVQA 1N6LA 2G6BA 3BFKA 1ETUA 3N2IA 3AKCA 1L4YA 4ZI2A 1DPFA 2G88A 1ZRHA 4XD7D 1YZGA 3AVYA 3WMGA 1EK0A 4FN5A 4TYPA 1KGDA 2AFIE 1N6PA 4BFUA 1E79A 3LO5A 4DBLC 4PC2A 4LGMA 4NZYA 3Q5EA 2J7KA 5HKKA 4GZMA 1X86B 4X8LA 3AVPA 3X1DA 4JYBA 2RGGA 3WNCA 1NNEA 2ZSDA 4B32A 2ZRPA 3KKNA 1E3MA 1E6CA 5J4LA 2DFKB 1JQLB 4G01B 2F1JA 2OCBA 3OFND 4C0HA 4M0LA 4MITA 1ZIPA 1KJWA 1JEEA 4BFWA 1JAIA 3HR8A 3EASA 5JBQA 1U0HC 5KSOA 5L3QB 2C9YA 3C14C 1E9BA 1N25A 2JLZA 1E1RD 3VKGA 1W2GA 3PQCA 1NL3A 1N6NA 4LJ7A 5CK4A 5KDLA 5GJWC 2Q21A 2W2VA 1X8KA 1N6RA 4JLDA 4QBFA 3A8TA 5CYPA 3I73A 1KKMA 1XEWX 3KL4A 2BM0A 1KI6A 3MG9A 4R2HA 3T1TA 5EP1A 1G8GA 2P6RA 1Q12A 4PC7A 1QHIA 2YWEA 2AK2A 2BKEA 4L16A 2J41A 1IAQA 5IRCD 3EPLA 4DLTA 2ZRJA 1ZINA 2FNAA 5KOYA 1OH6A 3ZVLA 2JLUA 4A8JB 5IT5A 3F5FA 1FQJA 2WJHA 1Z0JA 1R5OA 4JL8A 1FNNA 5H70A 5IF9A 2WKRA 2ZJZA 4Q48A 2W6ID 3VHLB 4MGIR 1U94A 1P5ZB 2RKOA 3NBXX 4IEIA 2OFWA 5F9FA 2V55B 2DFLA 5BWMA 4EJSB 3TSWA 3IBGA 1E0SA 1KK0A 2Z6VA 5C46F 3LBNA 3LA6A 2GTPA 2Q6TA 2CCGA 4Q7JB 4LYFA 2O8EA 1AN0A 1VG0B 1VG9B 5D3QA 3KQKA 2QM8A 3T1OA 4EQ6A 5ANRB 1UKVY 4PO9A 4RFSB 5IDVA 3IPXA 1TQ4A 2GF9A 2PJRA 1P61B 3HDTA 1NI3A 1G21E 4C7OB 1GRQA 2G77B 2RGCA 3BH6A 4Q9IA 4A0HA 4QOSA 4E09A 2WBLC 2RMKA 1T8UA 5EXXA 4C0JA 1UBCA 1N0WA 3DEFA 4G5RA 4GOKA 1CEEA 4YDSA 5DHAA 4DEXA 5FBRB 4GZLA 1KO1A 4M21A 3SHFA 2CE2X 4XVUA 3PEUA 1R2QA 3TNFA 1SVLA 1SKYB 4Q9HA 3LXXA 4XOIA 1RJ9A 4DHEA 1K6MA 4BFTA 5H1YA 2BWJA 1TADA 1XXHB 4J0QA 4HLUA 4CEHA 1W46A 3FYHA 4DCSA 3VX3A 5FBLB 5C1BA 3TAHA 1E96A 1VHLA 1ZW6A 3C4JA 4UNRA 4E5UA 4HSEA 1XTRA 4WOPA 4UNPA 5FPHA 4C0SA 1DARA 2CL0X 2J46A 2QENA 2WJYA 4NYIR 1BKDR 3RAPR 2G9NA 4EPTA 4TYWA 2IS2A 3GJ4A 3GLFA 4F92B 4JSTA 3GJ0A 1ZMXA 2RH5A 4PAOA 1BOFA 1FMJA 5JSZA 2J0QA 1NKSA 4WBSA 2VP9A 4AD8A 1P3JA 2OXCA 3UWKA 3WYGA 5JMTA 4OHWA 3TQFA 3W9YA 3QPUA 3W8RA 3GLIB 3FHTA 4EPRA 1GOTA 3F8TA 3T5DA 3M0EA 3AVUA 4DT1B 3TRFA 1JR3D 2WMOB 4JLKA 4MYTA 2GXQA 3ZGXA 5IHPA 2JLQA 1KAGA 2W00A 2ZRMA 3MJRA 4TWZA 3BRWD 2B8WA 1FUUA 1W4BA 3RS5A 3FTQA 4C7OA 1X1RA 1WB9A 1G7CA 1XTIA 4OYHA 2DBYA 4A0FA 5AK0A 4JL5A 3EPJA 4NP6A 1G4AE 2BCJQ 1ZNXA 1UDWA 3SEAA 2O0JA 1DAGA 3AUYA 4A36A 2DFTA 1FX0B 3CNOA 1JR3A 2OAP1 3CBQA 4LV5B 4OHZA 3AF4A 4B3BA 3U4QA 2CXXA 1SXJE 5DIFA 3SJBA 1Q20A 4DCVA 4MUAA 4BE7B 3A4LA 2YC4C 2RB4A 1JEDA 1MT0A 1IN8A 2A30A 4QGGA 2OCPA 1G6HA 1GKUB 2X2EA 1I2MA 3SI7A 1BMFA 2QPAA 4KI0A 3LXRA 1CJTC 2XX3A 3RVBA 5B64A 3QI2A 2FG5A 1U8ZA 3UMSA 1QRAA 2XNDD 3DO6A 4BZPA 5EE9A 3E5HA 3H4MA 5IK2D 2HUPA 2KJQA 1TQ6A 3GLHB 4DLUA 4JLPA 2W2XA 2PZEA 2ZE8A 3QENA 2QQ0A 4QJ5A 3UPUA 1YR8A 1NF3A 4GP7A 2JATA 5AJZA 4PPGA 1TQDA 2OAQ1 4I4LA 1UKYA 3R9XA 5JRJA 3R8FA 3E2IA 3CX7A 1OKKD 2AR7A 1C1YA 2JDIA 4RD3A 2WJIA 3Q72A 4AC9A 2CVFA 2QTVB 2YWFA 1EESA 3FGNA 3HYTA 2CLDX 3QKSA 1DAIA 3ZS8A 1UDXA 1T3LA 3AP2A 2PMKA 2A78A 2R2AA 2J0SA 1XXHA 2R65A 2VSXA 2CL7X 4GNKA 1CR4A 2VIIA 4A82A 1LY1A 3GEHA 3GEIA 3ND9A 3ZZTA 1D6JA 4D0GA 4WZ6A 2O5VA 1HE8B 4AG5A 5TB5A 1SGWA 1NN3A 3CNNA 3LW7A 1O87A 1X6VA 4DLXA 2O8BA 1KI3A 4BFXA 4H1VA 3THYA 5EE3A 4IOJA 2FA9A 5CJ2A 4ZV4A 1RYHA 2AFHE 3MUFA 2CNWD 5FUYA 2XB2A 2C2HA 2ZANA 3NHAA 2JEOA 1E9AA 2G1JA 3SE0A 2LCFA 1VCOA 3RDPA 3HJNA 2J3EA 5FOSA 1XP8A 1H8EA 3MRSA 3EIHA 4RKFA 3E1SA 1E79D 3BH0A 5L3SB 3DMNA 3LLMA 3ZQJA 2V6IA 4Q1AA 3U44A 1R0WA 1GITA 1L2TA 4CZ2A 2GESA 1JNYA 2FPKA 2X19A 2DB3A 3NH9A 2B92A 1ZUHA 3K9GA 4KO8A 4NYJQ 2CE7A 3QG5A 4OHVA 1W47A 3EIQA 3TK1A 4B33A 1G20E 4FWTA 1MO3A 1BMFD 4BLQA 3AUXA 3IIMA 1SVKA 3Q3JB 1P73A 3RS3A 4EPXA 1RZ3A 1W36D 3ZIAD 1DVRA 1UAAA 1JXMA 4EKDA 121PA 2BHRA 2R9VA 1MRNA 2AD5A 2GBLC 3K53A 2ZQ5A 3ZVRA 5CDFE 4Q1DA 4BLSA 2VHJA 1N6KA 2PZFA 3PITA 1E0JA 3VKWA 3AM1A 4MGYR 1U99A 3VR2A 4JMPA 1E69A 2N46A 1OH8A 1GAJA 2V8OA 2JIZA 3BFXA 3KJIA 2XB4A 4A92A 3X1YA 1ONBA 2FEOA 1S3GA 5DNYB 2HJGA 4G0NA 2FSFA 1DAFA 1CP2A 1II8B 4URVR 3CH5A 2HEIA 4KODA 1LF5A 1ELOA 2A7QA 1II8A 3LD9A 4OHYA 3NBFA 1IJEA 5HR5A 5FUXA 1GL9B 1G5TA 1G19A 4UQOA 1X3SA 4CT5A 1D2EA 1R0YA 2BM1A 1EFCA 1SQ5A 5HZKA 2HCJB 1T0HB 3EZ2A 3AVTA 2OHFA 2RCNA 1AS3A 4B43A 4CW7A 5EUQB 4TL8A 4OI4A 1J70A 2J7PA 4Q1BA 1SHZA 3U4QB 2H92A 5FTJA 3MWYW 2GXAA 2ZRKA 1E2FA 3HR7A 3GLGB 4M9SA 1ZM3A 4B2PA 1N5LA 5BYJA 1MABA 2Z4SA 3QOFA 1J8YF 1WRBA 1DO0A 5DI9A 3WBKA 5GJBA 1OFTA 4A6XA 2Q0HA 2OFXA 3TKLA 3NTUA 1UPTA 3EA5A 3EPKA 2ODEA 5H8WA 2KBEA 2ZI7A 1E2NA 2CBZA 4M1YA 5FFMA 4ZCLA 4BLTA 1AKYA 2CVHA 3ZS9A 2QROA 3FHCB 5EXPA 2D3WA 2F9LA 1LB1B 4JLOA 2I3BA 4TSFD 4B3DA 2JA1A 4JT4A 1XEWY 3ND8A 3EWSA 4WZBE 4QNMA 2QPOA 1KSFX 5BXQC 1NLZA 2JLSA 4BFYA 2J1LA 1C4OA 2Q3HA 2EWVA 3BS4A 4II7A 5HCNA 3RWOA 1XZQA 1Z6YA 4IXNA 5D3MA 2XGJA 4P32A 2QBYA 1T91A 4U5XA 2ZVPX 4ZI3A 4YLGA 2GA8A 5E3HA 3QEOA 3HU2A 4HZIA 5CJPA 2OLKA 1QHHB 1R5BA 2ZM5A 1S3SA 3K0FA 2IYYA 5L3VA 3DM9B 4D4KA 1AGPA 4EFMA 1R0XA 3U3KA 5EXSA 3DKPA 3EC2A 1G7TA 2OEPA 4DLSA 5AJWA 1LVGA 3K8YA 3RS0A 3OESA 1EFUA 4Q01A 3SS8A 2PEYA 1E32A 4F93B 2YWGA 5FOUA 4P33A 5GJCA 1D9ZA 3Q7QA 2CK3A 2NQ2C 4QC2A 3A1WA 4N1AA 3U3RA 2HDNB 4BFVA 5KYKA 4D26A 3U60B 4HB4A 4NTZA 2NIPA 3PEWA 3C15C 2WWWA 4TT3D 3IIKA 4G3XA 4JKIA 3WP0A 3V9PA 1CTQA 4KFTA 2JLXA 3CRQA 2O8DA 4MA4A 1VYVA 1S9HA 4Q1CA 3AB3A 4XSGA 1W1WA 4QKQA 1E9CA 1GKIA 2CDNA 3SQWA 2Z5FA 1OE0A 4HUTA 1E2EA 1ZAKA 2ANCA 2L0XA 2O8BB 2QAGC 4A8JA 1NJFA 4NYMR 3T1VA 4D0NA 3EZFA 4EQ6B 3L8ZA 4URZR 4WW0A 1WP9A 1GNRA 1NSTA 3QKRA 2IXFA 1UF9A 4V0ME 4AYWA 1LW7A 5L8VA 1VIYA 4L15A 2A5YB 1BO6A 2VA8A 3EAQA 4ZKEA 2VO1A 2NPIA 2V4ZA 1P2UA 5B58C 2WPDD 1BYUA 1KK3A 4P0TA 521PA 1QHGA 2A2ZA 4KITB 5DE3A 3OE7A 5DLQC 1XJQA 1FUKA 2IUUA 1Z6XA 1SZPA 3QXSA 4IVRA 3UIEA 2QORA 2FN4A 2ZR7A 4NH0A 1FW6A 1XD2A 3I5YA 1ZNYA 2HV8A 4OK5A 2CHQA 2AXPA 3AF0A 2QMHA 1WBBA 4Q66C 2WSSD 4Q9KA 2EFCB 1KO5A 2FOLA 4HLQB 2F1HA 2C03A 2WV9A 3RSOA 1G3QA 5BN3A 2GCNA 2H5EA 2EVWX 1JPJA 3QF7A 2Y8EA 1FTSA 4DDTA 3KFXA 4IKEA 1H8HA 1QHXA 2WWHA 4B3FX 4MRRA 2VRWA 3OFNA 4RCZA 1GVNB 1Z83A 3NC0C 5EE5B 5SZHB 2BIFA 3O8BA 4TLEA 1NMYA 3EZ6A 4EIWA 5AJYA 1NRJB 2KE5A 4ZDWA 3KQHA 1XBTA 1J99A 2DY1A 1CJUC 1KMHA 4JVSB 5CITA 2VHTA 3V4RA 4S2EA 1IN5A 3V00A 1N5JA 4CEIB 4PZZA 2P5TB 4V0LA 4CEIA 3AGPA 1Q44A 1LS6A 2XSZA 4NBSA 4U02A 2OBNA 3TW8B 1T9HA 5JJLA 5KHOC 1XU4A 1G64A 1R5NA 4ASUD 3W5JA 3B8HA 1XNJA 2ZE5A 3WNBA 4AYXA 3HPQA 2ZRFA 4BUJA 2DR3A 1N0VC 2PH1A 1JB1A 2ZUDA 1UEJA 1SHKA 2FPMA 4E03A 4JL6A 1J90A 2AWNA 3TGPA 2O0KA 4A2WA 4Q18A 3A6PC 3RRYA 1I4DD 2IEZA 2PL3A 4DXAA 1R6BX 3VKHA 1XTSA 3KQUA 4TTRA 1NLFA 1VDZA 1KSJA 1GNPA 1KO8A 4HAUA 4PHFA 3BB4A 2NO0A 2G0TA 4YQFA 1KI7A 1X8JA 4NMMA 4AI6A 3BB3A 3LV8A 4TN1A 3VU9B 2WOOA 1TU4A 2NTYC 4MYHA 1G8YA 5DI3B 4QBIA 3UWOA 3A37A 2KSQA 1KOFA 2LKCA 3RC3A 2C5LA 4DDUA 1YQTA 4HAXA 5EZ5A 2F6RA 5FH9A 3RC8A 1SKYE 4PTLA 4DSTA 2ZUBA 2WJJA 4HAYA 2R6FA 1YU9A 2O0HA 1E1QA 5KPJA 1XJCA 1KY3A 2P5SA 4P4SB 1KJYA 4TLCA 1Z29A 5EP4A 4TZ6A 3T61A 3QKTA 5C2JB 2FWRA 3OAAD 4C0LA 1XCPA 1JQJC 4MGKR 3SJZA 3KQNA 2UKDA 1XEFA 4Q7KA 2OLJA 4RJLA 4BQSA 2FF7A 2YINC 1P75A 1W4CA 3QKSB 2OSBA 3DMDA 3MGCA 5JSZB 2ZRGA 5F3WB 3CLVA 1KI9A 1TUIA 2ERXA 4H1UA 4RD6A 4UNQA 1NY5A 2BOVA 2WICA 3QPWA 3TSOA 1TF2A 3I61A 2QZ4A 2NZJA 5G3YA 1WXQA 1KI8A 2IXGA 1JALA 2PX0A 4I81A 1A2KC 3OEEA 1E1QD 4RD4A 3PEVA 4MRPA 4TMXA 5EP3A 3TR5A 3UG7A 2E9SA 2JDID 2P2LA 3OIYA 3A36A 3B1ZA 4ZIRB 2YZ2A 2ZITA 1EGAA 4NCIA 1X1SA 2XSZD 3BBPA 4DDWA 3C7KA 2ZJBA 3RHFA 2RGDA 2RGXA 1F48A 3RNLA 2IYRA 4F91B 1B23P 2XTMA 4Q7MB 3BH7A 4HZUA 3TMKA 2X77A 2H57A 1PV4A 2XXAB 1A1VA 3QJYA 3DHWC 4MKIA 3WNDA 2ZRCA 2W0SA 1XTJA 4EAQA 4W9MC 5FOWA 4ILEA 1IM2A 2X2FA 1FNMA 2JLWA 2LKDA 4LHXA 3TUJC 1G4UR 2MMGA 2BCGY 2Q3MA 2V6JA 1TUEA 1KY2A 2VP4A 3CX8A 4V02A 1OF1A 3W6NA 1GP2A 2IT1A 1EX7A 2ZYWX 1U9IC 3AV0B 5AJXA 5JWRA 2IK8A 4Q4JB 3U44B 1NVXQ 4DWJA 1LFDB 4O3MA 3TUIC 1PLJA 1XD9A 3QXCA 4JLJA 3AQ4A 2PBRA 4LC1A 2G83A 3ASZA 3O47A 5FPYA 4OK3A 1XZPA 2YOFA 3QY0A 2F3RA 3M1IA 3X2SA 1OJLA 4NL4H 4DUGD 2FEMA 2FPLA 3K0AB 1Z5ZA 2FX3A 2LWIA 4O2RA 1EFRA 1ZU5A 4FCVA 3IIJA 2XTNA 4M53A 5DH9A 1P2VA 1W5SA 2ZI6A 1HT1E 1YHNA 4M9QA 3RYTC 2F1RA 1CJVC 2MSCB 4QM7A 4KVGA 1NY6A 1NBMA 3LBIA 4M8NE 1G8PA 3K0CC 1T5IA 5FL7A 2QE7D 1COWA 1G17A 3G82C 3K9LA 1Z63A 3QE0A 4UKDA 3UMFA 3GMTA 3GLIA 5EE1A 2ZRNA 4DC9A 2ZTSA 3K09C 4MYCA 2J87A 3FWYA 5HTKA 3CO5A 4A2QA 3WBJA 2GZAA 4ERNA 2D62A 3B2EA 3FVQA 4MKFA 1WDTA 2G1KA 5FPKA 1N5IA 4KJZA 2B6HA 3B60A 1DG1G 2ZR0A 4DB4A 1JR3E 1KI2A 1Q1ZA 2REBA 3WRYC 3CKLA 5FPSA 2AX4A 4RZ2A 4LHZA 1IXZA 4YMVA 5J4KA 1NBMD 3IQWA 2D7CA 3B1YA 3FKSA 3GEEA 3TVTA 5A0FA 4ABYA 1X8LA 3AGQA 5JHGB 2BDTA 3PJRA 2VSFA 2IHBA 1RRPA 1Z0IA 1P72A 2FU5C 4YONB 2G3YA 3MJHA 2O8EB 4A4DA 2ODNA 4MRVA 4F4JA 3R9WA 3K0CA 2YWHA 2VP5A 3DPUA 1ZBDA 3FHOA 5JJKA 1F2UA 2XAUA 1JR6A 3C41J 4L9WA 4QJ3A 5FBWB 1OFHA 3DM5A 4B2IA 5CDFA 2K5UA 1Z8FA 3RSLA 1E0KA 1SKQA 3KXKA 1Q21A 4IVPA 4CYMA 1EXMA 4F38A 3IHLA 2ODWA 5EP2A 4N3NA 2P6UA 2FGJA 2QBYB 4V0KA 4MGZR 4HB0A 2DWPA 2ZRAA 3TQCA 3EXAA 3N2EA 4XJXA 2HT1A 1YZUA 1ZM7A 3GLHA 4ZO4A 4P4SA 4TL7A 3SJCA 2NMVA 3B1VA 4DUGA 1U2RA 4RSGA 1VG1A 1XFAA 1Z07A 3EC1A 5BYKA 2ODBA 1I2DA 4D81A 4TSFA 2QM7A 2AD1A 3T35A 4JJZA 1LTQA 3K1JA 3I32A 2BEKA 4NE2A 2BC9A 4EUNA 1P62B 3EX7C 2EW1A 3CH4B 4LZZA 3AVOA 1V43A 3I5XA 2D2EA 1Z2CA 1F6BA 4OJKA 4C9BA 3C16C 3I4LA 5CLQA 2HYIC 4DB2A 1XMSA 4QM6A 2V1XA 1DEKA 1MV5A 4O25A 4QHSA 3GFPA 3B5JA 4PAQA 2QQEA 1COWD 4I1UA 4LYHA 4Y0AA 1YKSA 4LC0A 4RKEA 1VKJA 1I4LD 1E2HA 3DZ8A 421PA 1QF9A 1UBFA 2QU8A 1KSGA 3X1XA 5FI0B 4ZDIA 3T1QA 2XXAA 5JS7A 3P20A 4W5HA 4UXIA 3GLFB 3ONWA 4Q5IA 4C3ZA 1U8AA 4LBWA 4PPNA 5EQTA 1AQYA 2X1VA 4D4LA 1P7CA 4RVCA 2VBCA 3TVDA 4W5JA 4PANA 1NN5A 1JBKA 1K8RA 1KNXA 4B47A 3P26A 2BMEA 4I1SA 1BIFA 2G0NA 2PX3A 4KLZA 4LI0A 1E1RA 1NJGA 2VPPA 1W4AA 1W7AA 3H86A 1KZGB 3FKSD 4PZYA 5D3MB 2IC5A 1Q57A 4Z8YA 1CLUA 3F3YA 3CRW1 3I92A 2NZ8A 2OCAA 3BC1A 4JBYA 4UXJA 2A5GA 4Q19A 3QXHA 3QXXA 2J7PD 4WZAE 3UATA 1CJMA 2QA5A 3U61B 5J40A 5JFGA 3RANA 4LJ4A 3EIEA 1G41A 2VP2A 4N0EA 4EPVA 2AXNA 1F2UB 1XX6A 3B1XA 4MKGA 2WKQA 5E7IA 5J4HA 1E0AA 2W6IA 2QI9C 5C18A 2Q9AA 2EFHB 1T0JB 1R8SA 1T5LA 3VU9A 3LH5A 1LF0A 2JJ2A 1U9IA 1DAEA 4M9XA 3HYRA 3PVSA 1ZM4A 1CXZA 3ZD6A 1F2TB 3UG6A 3ADCA 3ZVNA 4HYYA 1HYQA 3KDSE 1KNQA 2ZIAA 4L8GA 4U00A 4TLDA 1XD2B 2EFDB 4KYUA 3SJAA 1UEIA 3C5CA 1A82A 4ZKDA 5JHHB 2ONKA 5H68A 2ZSEA 1DOAA 5A5GA 1Q1QA 4PX9A 1OIWA 5K8LA 5KUTA 1EX6A 3WYAA 3H0KA 3HU3A 4QRHA 4G5QA 4JVMA 4PPFA 4US2R 1AGRA 2ORWA 2D06A 4Z8XA 3RS2A 2OFOA 4D4MA 3KJEA 2ZYTX 3T34A 5KSZA 1E9EA 2C99A 2NO7A 3U5ZB 3VR3A 2IXEA 1NLYA 5GVRA 2ATXA 5JEDA 3AH8A 3DZDA 4ZCMA 3PEYA 2VP0A 3CONA 2DYKA 1DE0A 4FWIB 3JZMA 1QG4A 1IN6A 4IFBA 4TYYA 2CEAA 2H18A 4V0MA 1ESMA 3NEYA 3TBKA 4GL2A 4TMTA 1C9KA 4R7ZA 1RYFA 1Z2AA 2MSDB 2UZ3A 4B75A 1ZNWA 3D3QA 2TMKA 4AIIA 2WVJA 3FB4A 4TT3A 3TAUA 1Q1BA 1TTTA 3CNLA 5SZKB 2JJ1D 1E2LA 2VTKA 1TX4B 4EFNA 5AUNB 2ZS9A 4DZZA 1XPRA 3RRMA 1E2IA 2QAGB 4NDZA 1EWQA 1MO5A 2B7BA 2CJWA 2DHRA 2ANBA 2F3TA 4CEJA 4ITRC 1TF7A 4FI3C 4IVQA 3T15A 2EYUA 1P9RA 2WJGA 1EFHA 3AVQA 3F0TA 4N0DA 1IN7A 4D4JA 2EQBA 721PA 3FOZA 5FTLA 5KTYA 1QG2A 3QF4B 2O8FA 1DO2A 1Z3IX 4NYJR 5AUQA 3MAAC 2HT6A 2CCKA 2J0UA 3MMPA 4DEYA 2QAJA 1N0UA 5DYIA 5FTNA 3B6EA 1XEXA 4HB3A 3MWJA 4US0R 3WP1B 2WWGA 3RLFA 1FPMA 4GT1A 1M2OB 2GXUA 4WVFA 4BPBA 2ZETA 1EFRD 2VH5R 2ZJ5A 4DKXA 3VX4A 3DL0A 2ONJA 4Z54A 4BLPA 3GQBA 3G0HA 2FE4A 5AUPB 3NIBA 4XIGS 2IYLD 2P67A 3OEHA 4FMCF 1FP7A 2FSIA 2R44A 4KSBA 4ACAA 1A4RA 3BERA 1Z6GA 4FXPA 3U6BA 4C0AC 4HUQB 2IF2A 4TQAA 2ASEA 2PT7A 3NEJA 3U2QA 5E95A 2IUSA 3QQ5A 4Z1MD 4RZXA 1OB5A 2XTZA 2GRJA 3AP3A 1AZSC 4A8JC 2MMCA 1Z28A 1ZP6A 4IDHA 4DCTA 1DADA 3Q5DA 5LB2A 2MSEB 1F5NA 3SOPA 4ZIRA 5KPDA 2FGKA 4LWZA 1II0A 4CDGA 3R8CA 1SXJD 3SYKA 5CB6A 1WA5A 1RPZA 3AF3A 5IK2A 5CYOA 2H1LA 1GRNA 3Q85A 1OYWA 4GDFA 1Z0AA 1QDEA 5FBQB 2VYFA 4LJAA 2F55A 3O8CA 3UXMA 4PHHA 1WCV1 4BECA 4G5SA 3WHLA 1F60A 1U90A 4QL3A 1KI1A 1KYIA 3KTAA 2F7SA 4Y0VA 4ZDJA 3OEED 1UBEA 4TTQA 3PR1A 2BJWA 4DRZA 3L0OA 2W0MA 5K8UA 1HUQA 2R6GA 3GCGA 1J8MF 1PVOA 1S8FA 1SVSA 5AJVB 5B30A 2WZQA 1MABB 3QUSA 3RS7A 1XPOA 1RW4A 1S0UA 2GJSA 1YR7A 1F3OA 1HT2E 3WYFA 4D0LB 4BEJA 3TJZA 5AUOB 4HDCA 1KI4A 4IOMA 1FOEB 4JS0A 4DCNA 2VP6A 3VTKA 4YXWA 2IUTA 1YZLA 3BIFA 1A7JA 1SVOA 2ZI5A 3W3AA 4K46A 4LBZA 3X1WA 5KSYA 1E4VA 3SR0A 2R6CA 2VSOA 2ZJOA 3B85A 4CF7A 2ZXUA 1NVUQ 4M1TA 1ZVQA 5F2EA 3W6OA 3GJ5A 3GP8A 1PZNA 1FQKA 2GKSA 2YYZA 1E9SA 2NOAA 1YZNA 4HB2A 3CM0A 5TVKA 3U6KA 2GEUA 1TPZA 2ZREA 4Q47A 1E4YA 3ASYA 1FTNA 1R7RA 4MRSA 4URUR 4NYIQ 4DLZA 1Q0UA 1M6NA 4HAVA 1RVDA 1ZD1A 3LAWA 4FMBB 4BFSA 1OXSC 4JBWA 4QFMA 4URXR 4P3YA 1DTSA 2REXB 1CR1A 5G40A 4QXAA 4Z1MA 1XDBA 3CUEF 3IHWA 3LVQE 1II9A 2A9KA 5HZHA 3OZXA 1ZD9A 1XWIA 5E7MA 5JRZA 2AHOA 2OG2A 3ADKA 2I1QA 2GCOB 4Q4AB 2BMJA 3MLEA 1ZCAA 2PEZA 1SXJC 3ZIAA 2Q9BA 2VHCA 2KB0A 1KDTA 2BMFA 1XJ0A 5F9HA 4QGFA 4BZXA 3S1AB 1UBGA 3R7WA 3SHWA 3BOSA 4BZQA 2QP3A 2IHYA 2QMUA 2IYQA 4ESVA 4JLBA 3PUZA 4YMWA 1T3SA 2F9MA 3SZRA 2C95A 4M1SA 4JVNA 4A0GA 1TMKA 2CNWA 1Z0FA 3OIWA 2FMXA 4POAA 1GG2A 1RRGA 3PUXA 3SYNA 4Q4HA 2WOJA 2XZOA 4YMUA 1E9RA 1KAOA 2QG6A 3MD0A 4NCNA 5TDHA 3L8YA 3SQXA 1L4UA 4RZUA 2ZR9A 3QKRB 3LQRA 4LCBA 2YKGA 2ZI9A 3I8SA 5KNCA 4D82A 2D2FA 2FFBA 2AN9A 1AS0A 3K0EA 4TLAA 821PA 4YXWD 3IEVA 3T06B 2CL6X 1D2MA 1Q1EA 2GF0A 2HF8A 3PUYA 5TMPA 2IX3A 5DN6A 4IXMA 3WY9A 3KTAB 3SYLA 3VHXA 4GMXA 3O8DA 4AURA 1SVWA 3AP1A 3LLUA 4QBGB 2HXYA 2Z4RA 3KJHA 4LYJA 1HQCA 2WWXA 5FL3A 5TARA 1W0JD 4MDFA 2WWFA 1Q22A 2WIAA 1QHSA 5E4FA 1GIAA 1IONA 2E87A 3W8NA 4DT1A 3ZLJA 3ZVMA 1G16A 3KKQA 3VNUA 1AIPA 1Z08A 5C4MA 4E22A 2XJ9A 3NC1C 5JJIA 1OH5A 2EU8A 3R9IA 4Q1EA 1E2PA 2CHGA 4W5WA 3D6TB 3BXZA 4OJQA 1XMJA 1WMSA 3AKYA 3Q7PA 5DN6D 4PHTA 3VR4A 1NBME 1QZXA 1RFLA 3LX8A 1CJKC 2PJZA 2D74A 2ZEJA 3AF2A 4NCKA 1ZUIA 4AY2A 2REOA 2ZAOA 4NYMQ 2BEJA 4LRWA 2GVDC 3QXJA 1Z22A 4EPYA 2O8DB 2R8RA 1W0JA 5G3ZA 4DSNA 5HPYB 4HDOB 2J5XA 3THYB 4YMTA 1CBUA 5EXTA 1RC8A 1KDPA 3QNUA 2ZPTX 2JIZD 4CVNA 2FH5B 3IDQA 3WXMA 4PO1A 2EYQA 1QVRA 1SULA 2RHDA 3SNHA 4IDQA 2EFEB 5KSPA 2OXRA 2QPTA 1ZCBA 2GAAA 3IO5A 3CW2A 4DIDA 1MO4A 4BWYA 4C0KA 4G1UC 3L0PA 2A3RA 3JVVA 1ZUNB 3ZZUA 4LBYA 1U8YA 2P65A 3CZPA 4K81B 4B48A 1TQ2A 3HWSA 2FV8A 4KFRA 2AKYA 2F43A 2J0VA 1E94E 2WWIA 2XITA 3B13B 1IY0A 4E07A 1N6IA 1M7BA 5BN5A 1N2CE 5DGXA 4EPWA 221PA 2NG1A 2GHIA 5K8TA 4LV8B 4HEJA 1RRFA 4AKEA 3AKDA 3CZQA 3GJXC 1G291 1T6NA 4LJYA 1W5TA 4Q9JA 2GNOA 3MCAA 1KDRA 1EG7A 3U3MA 1Z0KA 4MRNA 1J2JA 3PCRB 1ESNA 3W5IA 3U7EB 3W6PA 5KDOA 2OBMA 6Q21A 2ZJ2A 4TL6A 4LYAA 4TZ0A 4CGZA 4XSHA 2W58A 2XOKA 5GVSA 4JBXA 1MKYA 2OBLA 3NHBA 4OQMA 4AK9A 3DKVA 1VHTA 4QG7A 2FJUA 4IDPA 5GADl 1NMXA 1M7HA 3U7GA 4HAZA 1G9XA 2D4HA 2R6AA 2Z0MA 1AKEA 2NPFA 3GLFE 3VNVA 2ZROA 4LBVA 1RKBA 1NMZA 2VHQA 4DSOA 4QGAA 4IHQA 4K8OA 2QMEA 2FZ4A 3GJ3A 4URYR 3ICEA 3OHMA 4M1MA 3TSZA 5M04A 3QG1A 3DOFA 4LY6A 4TTPA 3IPYA 5TV2A 1XTKA 2JLRA 1G3IA 3AF1A 1XCGB 4KBGA 4URWR 1ZD8A 3OE7D 4LSGA 4M1OA 4B34A 1E99A 2WAYA 4OK6A 2ZRBA 2RHMA 8OHMA 1N6HA 3CPEA 1QBKC 1XMVA 3IGFA 1E2DA 4FD2A 4EFLA 3BAFA 2QGNA 2B7CA 2CLCX 2GJAA 3REGA 4UJ3A 4KSCA 4GRAA 3K70C 4WAUA 4JLVA 5K8IA 5G53C 3CRMA 4Q02A 4KYIB 4Q7LA 4B3GA 1KMQA 3FPAA 1H8HD 5CIWA 4DLVA 1Y63A 3CRVA 1N6OA 1TL7C 3CF0A 3E70C 3SU8A 4EJSC 2QEQA 1IOZA 1OXTA 2GILA 5AWFC 4LJ9A 1G8HA 2GWHA 5J4VA 2QNRA 1OFUX 2ZE7A 1ZYUA 3THXA 2XNDA 3NWJA 2GJ8A 1W49A 5CM9C 3QBTA 1NN0A 4RD0A 4B6FA 3KQLA 4X8OA 3D8BA 3KXLA 621PA 1HQYE 1YR6A 2H17A 2QSYA 3PV0A 2IF0A 1EFTA 4R9UC 1H65A 1LNZA 4Z51A 1D2NA 4NU0A 4XH9B 3V4FA 4OKSA 2WTUA 2ZYVX 2HCBA 2C9OA 2OM2A 4LDJA 3P32A 4RY2A 1IHUA 3VR1A 1RIFA 1XXHE 4FMDB 1U81A 3N70A 4I99A 4JVLA 2IS6A 4EDHA 3K0FB 5JWHA 4B73A 3GFTA 3I3SR 2GVZC 3QVUA 2IEYA 2ZRIA 3KFVA 4NPHA 3T5GA 3U7FB 1P6XA 4PC3A 2EWWA 1WF3A 1PJRA 2WAXA 1OPXA 4X8MA 4CIDA 3TIFA 3SFZA 1KSHA 1AK2A 5CLLA 1SVMA 2WSSA 1GL7A 5JI2E 5CB8A 4GI7A 3Q8XB 4OQLA 3I62A 2XZLA 3SDZA 1YZQA 1OB2A 1Q3HA 1YRBA 2VF8A 3IBYA 4B76A 3KZ1E 5JS8A 4V0OA 1AS2A 2P0EA 3UANA 3CF2A 3ZYCA 1K5GA 2CCJA 4ON9A 3W3ZB 5HE8A 3FDIA 2V7QD 3LBHA 5EE0A 4CEJB 4JIMA 1H8ED 5E7JA 5P21A 1NG1A 5JI3E 3KJGA 5SZIA 4D25A 1U0JA 1S1CA 3QF4A 3R20A 3DVLA 2O8FB 3L82B 1O3YA 4PQYA 2H8KA 5FPTA 4DDVA 2ZS7A 3HU1A 4D80A 1G5PA 1GSIA 1KDOA 4IDNA 4PXAA 1OW3B 4KAXA 2GXSA 3L0IB 4I1VA 2QRZA 4HLCA 3O8RA 3CR8A 1IXRC 1VYTA 4Q21A 5G41A 1ZIOA 3RRZA 3A1UA 3ZD7A 4AG6A 3ZQ6A 5L3SA 2V7QA 1W0KD 4PZLA 1GM5A 4HATA 3BORA 1JJ7A 2OZEA 3CPHA 3FMOB 2IBMA 3U3OA 1FX0A 3N5CA 4TLBA 1BS1A 3B1WA 3KB2A 1SXJB 1ZM9A 2GAOA 5LD2B 4GSYA 4BLOA 1P60A 4XWOA 1HEIA 1DAHA 2NO1A 3ECCA 2HLDD 2ZSAA 3HPRA 1W44A 4Q4JA 2B8TA 3FFAA 4LHWA 3UKDA 4G5OA 1QHHA 3KB1A 4A15A 1F2TA 1NSFA 4V03A 1AJEA 1TNDA 3PFIA 4C0BA 4F7WA 5FTKA 1KTVA 1US8B 2YOHA 4BRWA 4MQBA 1VPLA 2KBFA 3GLIE 1US8A 1UKEA 4LPKA 2JASA 4RCYA 5AR1A 2BBWA 4MYUA 1S1MA 3C8UA 3CF6R 4A9AA 4I1OA 5EUMA 4KBFA 5LBIA 4PSKA 1KZ7B 4LOAA 1R4AA 3KKMA 4Q00A 4GMDA 1VCNA 1E2GA 4TMZA 5DISB 2BJVA 4IDOA 1Z6AA 1M1YE 4TYQA 2PT5A 4LUCA 1KK1A 2V3CC 5LDDC 1E2KA 2ZSFA 4DVGA 2J59A 1E9DA 2WHXA 4C0QC 3NKVA 5FOTA 5JEEA 1XTQA 3ADBA 4R98A 4XVRA 5LB4A 4PFSA 1L8QA 1DELA 4JLMA 4UJ5A 3CRRA 1UJ2A 5FR1A 1E2QA 1VG8A 4IEEA 2Z83A 1VECA 1J7KA 1W4RA 2DCUA 3AVXA 5C4GB 1JI0A
chains in the Genus database with same CATH superfamily
1VFNA 3E9QA 4IRUB 4FDTA 1MO6A 1UC9A 2KI5A 2OXTA 5BWBA 4FYYA 1SNYA 2XYRA 1UT6A 3RFUA 3CLSD 4UAGA 1JB9A 1ZOPA 3LL7A 2J3DA 1TZBA 2QV7A 1EA7A 3M4YA 4YCAA 3TTSA 1G8MA 2Z5GA 3NVAA 5A7HA 3V55A 5DHTA 1R50A 2ZYUX 2MT9A 1I1OA 2QGZA 4LWPA 4Z4FA 4OYLA 3M3DA 1MIOA 2AUNA 4RDIA 1AUVA 4PG5A 1YZTA 2HJ9A 2HXSA 2Y4OA 2RCYA 4F2WA 2GETA 3FPEA 3AHFA 2ORIA 3VQTA 4NRDA 4RHCA 2P9GA 3UHFA 3V2GA 1AGNA 1IK6A 2IYXA 3AINA 2HA0A 1YDHA 4RNCA 4RF5A 4RPLA 5H7XA 2PKRA 3ZOKA 2NTEA 4MQ4A 4GVLA 3S40A 3VGPA 1LSJA 3UK7A 3W4IA 1VTKA 2AOTA 4YJFB 3PIRA 3IILA 1OV4A 3E4CA 1PDVA 2LD4A 3I1JA 4GZ6A 1XKQA 2CMKA 1B41A 3AHHA 4I46A 1A98A 1GUYA 2HRCA 1RHRA 3VMFA 1B26A 2FB9A 4QNNA 2N1MA 1IXKA 2QMYA 3I53A 4R9SA 1OV6A 4RY9A 3THWB 4JB8A 1KK2A 2FMUA 4L3OA 1WSAA 3UJPA 1JIJA 1R64A 5B57C 2IX9A 3ZV7A 1KC3A 4JYZA 2FVXA 1J39A 1C9DB 2RI0A 2WZDA 3WHKA 3QKUA 5AVXA 1NQUA 4CCSA 2VDJA 3WK9A 1X38A 1QVVA 2V65A 1MEOA 4F2PA 4K26A 3DMTA 4PQRA 3AG6A 3P4YA 3Q8KA 1D9XA 3D6FA 3DZKA 1F9EA 3IQDB 4OXXA 1ULBA 4QWMA 4C30A 3V1NA 2WD8A 3VU3A 1OFIA 2GEVA 4DNXA 1F6DA 3NHFA 1XB2A 3C8MA 3PUWA 4XPIB 5HOEA 4UE2A 1P2SA 3EXIA 3HUUA 4IHJF 1NVGA 1WM1A 2CMHA 2IKQA 2ZP1A 2VHZA 4MJLA 2SBTA 3D8NA 4W8HA 4U7DA 4YCNA 1JHXA 1GYQA 2BTOA 2JCXA 4JJIA 4TTVA 4E3WA 3FOFC 1ULSA 1WZ2A 2FQQA 4JDPA 3PCXA 2C20A 1UJBA 1V1RB 4H27A 1UKZA 1DL5A 3WMXA 1RMYA 3MJ4A 5FI1B 2P2ZA 3IVAA 5FOVA 1MJNA 4COOA 5EJ5A 4O4LB 2Q7OE 5KDDA 3RV4A 1MDBA 3NT5A 5TGTA 1Q2UA 1ZD5A 1LX7A 2E4XA 3SGLA 6AT1A 1NZFA 3N0TA 4RV4A 4IWYA 1A2BA 2P90A 1JW9B 2Z8ZA 3R7SA 3UMGA 4WBNF 4J0IA 5FT9A 2DTDA 1SU6A 2HSJA 2WM9B 4R8KA 4PPQA 5DYGA 4B8YA 1DWUA 1F2DA 3OX1A 3TLCA 4D3FA 1EUZA 3OCUA 1DAKA 1YC5A 4X1KA 2KMLA 5BPFA 3PJEA 3UUWA 4B74A 3VZRA 1FMLA 3JWGA 4BO0A 6REQA 5AIBA 1JH9A 4FFLA 3BKXA 2O1SA 5K3SA 3F1LA 3H0CA 4FW9A 3GRYA 3FVTA 5MN6A 5J2UB 4PCVA 4F3YA 2YZ7A 4ZARA 2NSJA 5CDUA 1W76A 3RO7A 5LP6B 3SIPA 1F06A 3JQ9A 2ZI4A 4FDAA 4JMLA 3LWDA 2RGAA 1FRZA 1L1FA 3RREA 5A03A 4EI2A 1P9NA 3D59A 2B36A 1V37A 4TRRA 1MH9A 3OO0A 5CDHA 2HKIA 1N9GB 1Q7EA 4LQCA 1BCSB 1T2AA 2YFQA 4XFJA 1MENA 3AEXA 2CLIB 2G4VA 3FWPA 3P1JA 4NABA 3E9NA 4RVGA 2B1QA 5IT4A 2QN8A 2OILA 5DTRA 1AU9A 3K2QA 3IQZA 1OGIA 2XLCA 2ZBUA 2WNIA 3HRKA 4U0KA 2ZBDA 4D9NA 1G7SA 4J2TA 3ZW9A 4Z4HA 2ZZMA 4DFDA 1MHTA 2Q3LA 1GZSA 3G5TA 3QXGA 2I67A 1XLTC 4MKRA 2VJNA 4FUTA 1N7HA 5E1MA 3AR7A 1CKEA 3H5RA 4NCJA 4RPCA 5IJXA 3KJFA 4JI7B 1P1IA 2V45A 3DGFC 3KEGA 4K1LA 3WGZA 4JZYA 1IH8A 1Y4DE 3HZOA 1HH4A 4KQFA 1PP4A 1U0LA 1TUBB 2A33A 3OPNA 4LV6A 4IUBS 5L3RA 3KYIB 3ZHQA 4JYAB 1IN4A 3HP1A 1U31A 1RWXA 2O2CA 1NVVR 2AC7A 3FI0A 4X65B 4XUEA 5MGBA 5BT9A 5THXA 1ANKA 3K8OE 1N57A 3CMCO 1P3DA 4FCTA 2GDJA 4IJQA 2QN1A 1TAQA 5I8PA 3HHPA 5I7VA 2HMVA 1BDHA 2GEKA 4FBLA 1TJ5A 5K2OA 2QUBA 4JA2A 5LQNA 5IP5A 3P0EA 1QHYA 3K0BA 1M2VA 1U1CA 2YHAA 3ZOZA 3HUEA 1ZC3A 4WA7A 3HXTA 3LPLA 5AD1A 4RD1A 3DCNA 3A1SA 1JE1A 1MB0A 2QYOA 4TWBA 3PFBA 4HRXA 3C5HA 1EE1A 5ICSA 2QT0A 2I4IA 5KNDA 5HCIA 2BVNA 1AKWA 4BAGA 1P33A 1G1AA 3KU4A 4HDRB 4NKRA 1HY3A 4RWEA 1NDHA 2L42A 1BW9B 2UV8A 2IYSA 4MKHA 2VQSA 4KFSA 2IOFK 4OU4A 1UM9B 1DCMA 1QYDA 2ADOA 2ZJ3A 3SOZA 4WZBA 1GPDG 4EJSA 1NN1A 3L1KA 3ZW7A 4EA7A 1ULTA 4D45A 5L7TA 1EYZA 1H2YA 3EZLA 3RSGA 1KO4A 3O73A 3EN0A 4YDHB 2B4YA 2HF9A 2YV5A 3WKDA 4DADA 1GTMA 3CUVA 4ITVA 4WOJA 4EBBA 1W36B 1E98A 3FGPA 1F2VA 2I2WA 4J0DA 4B4WA 2HMUA 4GMGA 4BJ1A 2C2YA 5LQSA 3SZLA 1N3BA 5LA6F 2RJOA 2QD1A 3P2JA 4RWZA 2FN7A 3E03A 2IQ5A 1KFJB 1TA4A 1YXMA 1W48A 2GDZA 4LY9A 5T8KC 1VC2A 3GLHE 1JN0A 3FOWA 5DK6A 1T5TA 4X45A 1G3MA 1M9NA 2OV8A 3I5UA 3HYLA 2QVYX 4C4PA 2NGRA 1AQJA 4CN8A 1OREA 2L19A 3BWMA 4MUBA 3H2JA 5F3DA 1X1DA 3NBYC 4GI2A 5CT8A 1SQSA 5KU1A 1QAQA 5C8DA 1QV9A 1RYDA 1V8ZA 3A6FA 2HPHA 3OZTA 1I51A 2WUEA 4ASUA 1URPA 3DEJA 1DQZA 1FLAA 2AOWA 4MVCA 3RTAA 5LQCA 2SECE 2P3SA 4MIKA 2ATEA 3R7AA 2J9GA 5EIFA 1T8SA 3H9BA 3RS4A 2JJ1A 4DG5A 3A25A 4RK0A 1L5HB 1WDMA 1U02A 3OE5A 4R1PA 4B84A 4BMYA 3OZCA 1DC6A 1P9WA 2BKUA 1S5PA 4O1MA 1CV2A 2NPOA 4CETA 1OH7A 3NPAA 3BE5A 1ZM2A 4OQNA 4Q4LA 3UT5B 3QWHA 4GMFA 5JZVA 1Z6TA 3Q2IA 3R3HA 1GL6A 3MSXA 4IIJB 2OVFA 5FUWA 2ENUA 5JXIA 3LHFA 5B3JA 1L8LA 4CQLA 4IFEA 1QIFA 2EBHX 3GI1A 3IUYA 2UZ0A 3CR7A 4E46A 7REQA 5TXGA 3TW6A 2Y99A 5FWAA 4CU2A 2ZTUA 4DQUA 1J42A 1FZQA 5EUCA 1H6CA 3GFOA 2A5DA 3HWWA 3FGZA 4S35A 2C84A 5E4TA 4EUSA 3SE7A 2XE6A 3SYRA 4EEZA 4BXOB 1DKRA 1JMKC 1HE1C 2C96A 2ZAIA 3GG9A 3DTTA 3ESXA 3O6VA 3PIIA 4PC6A 1RP1A 4W7SA 5EPUA 4XWWA 3VFDA 4ZD6A 3IAFA 1R0SA 4MWZA 2PGOA 3NT2A 1R18A 4D8YA 3OCWA 4Z4GA 3E0XA 5E4JA 3GGGA 1VE7A 4GMKA 3THOA 1F8UA 1YC2A 2YMMA 3FNRA 3VZSA 2PL9A 1HTWA 3TVYA 2WTNA 4ZVUA 3L2OB 4RZ3A 2CJXA 3NIFB 3NOOA 3RYFB 3SMVA 3W5JA 4D2IA 1VMAA 2A0WA 1SHLA 3FTDA 3TOCA 3TRHA 1XNRB 4G4SO 1OZ0A 4OI0A 2BEUB 1T0UA 3GLVA 2WG2A 3FNQA 2OY0A 1QLJA 2QGFA 2GTHA 3N0VA 1GUAA 3SVZA 5J4YA 4BJ3A 3GROA 4X24A 1KE1A 1AURA 1WQ1R 1XWFA 4UEKA 2XUPA 5BUQA 4BGVA 3IQXA 5SZJA 3OIVA 4YRSA 1MG5A 2XMSA 2XJ4A 3KVOA 1AV6A 1ADFA 2YOGA 3CSDA 3NM4A 3OBBA 3Q5GA 4M36A 3ZDYB 4E21A 3CEMA 3ZU6A 1MUUA 4BIMA 4YYZA 3TH5A 2Y1WA 4BGDA 2ZG6A 1E6LA 4HWSA 5BOSA 1BFKA 5BV2P 3T4UA 2RBEA 4OF4A 1LPPA 1DIGA 2AN5A 2H2FA 1RBMA 1UBJS 1E1MA 3UXYA 3TZBA 2D7DA 2CMDA 4BVGA 3CKMA 4DLYA 2P4EA 4O2AF 4ZAVA 1JLSA 2CXQA 2PBFA 4MKXA 4L5BA 4RF3A 2V7BA 2OV2A 2WUFA 4G5GA 2UDPA 1CQWA 1E66A 2QRHA 4D8UA 3QE4A 1CULC 2VJAA 3D7LA 1XZ8A 3I12A 1DKMA 1MTZA 3JQBA 4G86A 5D51S 5T6MA 3UFXB 5F7XA 2C7PA 2UZAA 4OBEA 3LYAA 1H85A 4LX0A 4XJSA 4WBNA 2QZ9A 1U04A 1ZL0A 2DUWA 4ZMRA 4KBYA 5DX1A 4E2ZA 3S8MA 5PNTA 1IM5A 2UVQA 4Y6SA 2FOIA 1G0NA 1IBRA 2PZGA 1X7YA 2Y4NA 4UNSA 5A71A 3W77A 3ZGOA 3TBFA 2H51A 4Q3LA 4HLDA 2FSGA 3ZH9B 4KMMA 4KRXA 4XJVA 3BE4A 4LZOA 1LS1A 2C78A 5P8WA 2C3UA 1XQYA 4QBHA 3RJTA 3ZZ0A 2VQFB 4MYRA 2A59A 5TEVA 1PTJC 4QICA 3MB5A 4U7WA 1NQWA 5KNLA 2DWOA 2JFOA 1W30A 3GLQA 3JYHA 3MEQA 1QQ7A 1VJGA 4ID3A 2X1HA 1JPNA 4IV8A 3T95A 4ZJYA 5TIIA 4J7AA 4UNIA 1FTYA 3QPCA 1U7TA 4KZKA 2GJKA 5DNUA 1PR9A 1FQWA 1X9IA 3HUDA 5KQMA 2C88A 1IY9A 1WVMA 1DFIA 1N1DA 4JR0A 3ICQB 2GPNA 2QAGA 1DS6A 2VHWA 1JDBC 1O96A 2PQ6A 3WVNA 1XRSB 2KM1A 2P9CA 3IPLA 4Q05A 5DSTA 3SEFA 5BMVF 4QGHA 2HJVA 3H9JA 1PLLA 4M9RA 4LSZA 2OBXA 4QODA 1S4QA 1WBDA 2IKSA 3U5TA 1KQOA 3KQMA 4QJ4A 4JX8A 5JVDB 2F43B 3OIUA 1TZCA 5DLDA 1CUZA 1M75A 1UAGA 4RH3A 2PCJA 4RKQA 1P8AA 1B0UA 3FLMA 4X64B 2QUZA 4KHZA 3RTCA 4RMJA 1WMEA 1HG1A 3RB8A 1LDNA 1KI6B 1LV7A 3I5MA 3UKJA 2LRHA 1PS9A 2H2AA 2ZWVA 1O0SA 3MT8A 4JXXA 1E6MA 4U9IS 1Y8QA 4YJ3B 1NJ1A 4YAGA 4O5AA 3S55A 3L6BA 4GOND 2GUGA 1C8LA 4DA4A 2EFGA 3R0VA 4DWVA 1I3MA 3AR8A 3R5KA 2B21A 1UFQA 4G07A 4LJ5A 4DA8A 3BIXA 4Y3UA 3WLRA 4Z9YA 3FCUB 1HZZA 1XTPA 4OSOA 4M38A 2OP0A 4P3KA 3ZU4A 1OTXA 1UJMA 3EK2A 3F5SA 4LJ8A 4A5OA 2D5CA 4B71A 5AVTA 5JBNA 2AKEA 1R3UA 2N42A 3FOBA 1S3IA 1KJQA 1CUEA 1U3UA 1V26A 4B46A 3U7HB 2PS9A 4ND3A 3WKAA 2XMCA 4LJ6A 2V98A 4B5LA 2X3UA 1TRKA 4QXQA 2D1SA 3CW9A 4OPMA 1UOQA 2QBYA 1K2WA 2DC1A 1CUGA 4GYKA 2BUCA 2PUFA 1I1NA 1O5OA 3MIIA 4C2UA 2VXBA 3UJHA 1C81A 2F59A 5EVCA 5REQB 4LDAA 2VHXA 3N2GA 4IO1A 4LK2A 3K9QO 3PLNA 2HCRA 3BQ9A 3CE9A 1KYWA 2IPNA 4HNGA 3RYCA 1BQ4A 1IY2A 2QYHA 4TMVA 1C7IA 1JAYA 3D7KA 3QK7A 5BWNA 1SG0A 4KU4A 1RAAA 3LX5A 4NFLA 4ALLA 2FJ0A 5K03A 4U3JA 3HJAA 2JFYA 2RGNC 1RBYA 4KV7A 3F7TA 5CA0A 1SEVA 2VA9A 4J6EA 1QYRA 4EHIA 1BRMA 1N2IA 4ER6A 1GZ7A 1L5ZA 3CX6A 3LVFO 4JN6B 4OBBA 5AXCA 4EY3A 1LDEA 4AWXA 2VHUA 3F6YA 4GX2A 3AERB 4R2WA 4RL4A 1BYIA 4L0CA 2RGBA 2XEXA 1F1JA 3TD9A 3BCHA 2PXHA 5TPWB 4W6ZA 1PNRA 2OCKA 4U2KA 1E5QA 3KHUA 2JGDA 2EZ4A 4PZPA 4Q4AA 4RADA 4NNPA 4KIFA 4BP1A 2J5RA 1GPUA 3NVDA 2WU0A 3QVKA 4MHOA 1D6NA 2AV6A 3GK3A 1OU0A 4Y9SA 3AKCA 4PLZA 1HKHA 2WHPB 4GO1A 2VDWB 3D0QA 3V8BA 3C3AA 2G88A 2RHLA 4QVKA 1YZGA 1ZGZA 5DRTA 3MGAA 5EWJB 4IG9A 4FN5A 4ENQA 1KGDA 2VDOB 1RPNA 3LO5A 2FMFA 4BNFA 3KLBA 1TCAA 4NZYA 5DGDA 4HP8A 5HKKA 4GZMA 1KJJA 3PX3A 1U2EA 2PXAA 4JYBA 4V3BA 1B0PA 1E77A 1SY7A 2FJPA 2A35A 2JS7A 2LPMA 2YASA 4URFA 1CQZA 4B32A 1WXFA 4GKJB 4R2HA 2Q2OA 2DFKB 5JCOA 3DE1X 2WUWE 3ZWPA 3R9KA 4BQQA 1ZJJA 4MWCA 1U0HC 1KEPA 1PR2A 1QDUA 3C14C 4N7BA 3HSYA 2GK3A 5AM3A 3UO8B 3TL2A 3VKGA 2FZGA 2VNIA 1KS9A 5F7JA 3E22B 3DB2A 4LAFA 4LOJA 4LJ7A 4FOSA 5CK4A 1WMDA 5GJWC 1EXNA 5AXAA 2LIPA 1CRLA 1FFAA 1PTKA 1UZMA 3D81A 2G6TA 3TNLA 4QBFA 3KCQA 5C31A 4DMLA 2EDAA 2WF9A 3G5LA 3AEQB 4UARA 3FNHA 3G2MA 1A9OA 1KI6A 3MG9A 3T1TA 1ZPDA 1ZVVA 1FFYA 3GRKA 5FPPA 3CCFA 4BDSA 2AK2A 3EDOA 1T6BY 2JIOA 4AICA 4J3NA 2Q2QA 2GVNA 4DLTA 4HT3B 3EBPA 3F5QA 4MUGA 3NASA 4QOGA 5G2OA 1JG3A 2F8TA 2VK1A 2NTJA 1W59A 4LNHA 4NULA 5JQGF 3HJCA 5KOYA 4OXKA 2XCLA 4Q37A 3NHMA 4QEDA 2JLUA 5DNCA 3LBAA 3EFOA 4JL8A 5H70A 3T54A 4A03A 1G8KA 1T3ZA 4BN5A 3OFKA 5IF9A 2WKRA 1C7RA 1BXGB 1UH5A 2PUHA 2H1WA 3KLNA 4YFYA 1UK7A 4Q48A 2W6ID 3LCMA 1ISHA 1WLYA 1EVYA 3N58A 2I78A 4OGKA 3W1WA 3NBXX 2B5VA 3IDZA 3QFRA 1YR1A 2GRUA 3L5KA 1E5VA 1WY5A 3HVHA 3S44A 1IXYA 1C7ZA 2WVHA 4B4UA 1E0SA 3TDMA 5C46F 1W5EA 5T57A 3FDFA 2GTPA 2Q6TA 2O1XA 2Y1KA 4DN6A 2HWXA 4N5LA 1DEXA 4Q7JB 1N2JA 4LYFA 1VG9B 5IVPA 2O8EA 4Y9RA 4QFDA 5FTWA 1JF8A 4NESA 4PO9A 2O3JA 1EG2A 1TQ4A 1EHYA 2D5AA 3LF1A 4NK4A 1GRQA 6REQB 1P1KA 3IV6A 5TJHA 2Q49A 3HCBA 2CHFA 3FOAA 1Q1AA 4PX2A 4F3NA 3LXUX 4QOSA 4E09A 3L7MA 2RMKA 3HFJA 1CEEA 2YWRA 4KXWA 4LE2A 1YDFA 3IKTA 4FC7A 1RFGE 2FW8A 4GXNA 4X84A 4IMIB 3BD7A 4GZLA 2HPAA 4Q39A 4EJ2A 2CE2X 1YB6A 3PEUA 4PYJA 5J47A 1C5KA 1P4HA 1RI1A 3DB1A 3LXXA 3AFMA 4TM7A 4XOIA 4CHTA 4DHEA 1MU0A 3L92A 3WJ2A 3HC7A 3P5BA 4J0QA 4HLUA 3SXUA 4DAOA 4CEHA 3O2SB 5INTA 4UHCA 3VX3A 3ENQA 2QUJA 1Y9AA 3VH1A 5C1BA 4RTSA 3TAHA 3ZHCA 1R6VA 2M6LA 3GO4A 2ZR8A 4R1UA 2VPTA 4WOPA 5HWSA 5FPHA 2WJYA 2CL0X 2PN1A 1JEYB 3WZ2A 2BI4A 3BE8A 3KR9A 4JH0A 3V3TA 3O94A 4XA8A 4NCXA 1EP3B 3NOQA 3PDUA 4EELA 5EWJA 2RH5A 3PNBA 2VJCA 3TZLA 2Y2UA 1DT3A 1GTZA 3K96A 2Y9PB 4TXHA 2J0QA 1CPYA 3IQEA 2QTTA 2VP9A 3QYJA 2H0RA 4AD8A 4HQFA 5FNZA 4DPKA 4CI0B 3RVSA 4O4IA 5CDSA 3LBYA 3IB3A 2G72A 1QC5B 3GLIB 4P2BA 2XQFA 1X1EA 3F8TA 3RC1A 3T5DA 5DCWA 4EENA 2ENWA 4OYRA 1IY8A 1JBQA 1RWWA 1EE2A 3QKWA 3LG2A 3U1VA 4JLKA 3CVXA 2JLQA 1KAGA 3OH8A 3T8YA 2ZRMA 3UUGA 4E4YA 4G26A 3GN1A 3HB0A 4MINA 2I54A 4G65A 2QJFA 3CNQS 4C06A 3T3NA 1PGPA 1JEQA 1JHDA 1P1FA 3LZ6A 4YUWA 3D3WB 3FBTA 3DW1X 5ES3A 1NZDA 4BMCA 1KU6A 3B12A 1XTIA 1XZEA 2QV0A 1CD5A 5CPBA 4I5FA 1Z6QA 5AK0A 4CKBA 1JE0A 4YAKA 3LNTA 5ED0A 2HFJA 2BCJQ 1N78A 4IMJB 2IQIA 1NYQA 1X77A 3FHJA 3AUYA 3HXKA 3NDRA 4GPAA 5CU7A 3U16A 4H31A 2DFTA 4BV8A 1PK9A 2XUZA 5FO1A 2EC5A 1PK7A 2QIOA 3AF4A 5HUQA 1T8WA 1Q11A 1LCIA 1FDWA 2HSEA 4G2TA 4G8DA 4BMNA 4QOIA 5AVKA 1CUXA 3WYNA 1JFTA 1OFUA 3IH5A 5EWMB 4A1OA 4EHBA 1IEXA 5AVRA 3A4LA 1JTFA 5DCLA 3CZRA 2AW5A 1J9GA 5EVJA 2DY0A 1JEDA 1HE2A 3KWFA 3ICWA 3PNVA 4BNNA 1YS7A 4DCOA 2ZZNA 3QU4A 2A30A 2R8ZA 4EG5A 3H8SA 3G2IA 4LRSB 4M1EA 4QU8A 4UTZA 4N7JA 2X2EA 3Q8WA 5FD8A 1KJIA 3DFKA 4L9RA 3MELA 2IOQA 2IZZA 3QI2A 1U8ZA 1QRAA 2XNDD 2YUTA 3DO6A 1HYHA 3EGVA 3H4MA 1JH8A 5EE9A 5IK2D 2HUPA 1I0ZA 5KOHB 2M6RA 4UM5A 5JJBA 1T6YA 3SX0A 2ZE8A 4WN3A 1BCRA 4NNOA 3QYPA 2JCGA 4N65A 2JATA 4I5DA 1ZONA 2JB9A 2O6HA 4K03A 3RF6A 2OAQ1 5KYNA 4I4LA 2AG6A 3KD3A 5C4IA 2NP7A 1PR5A 4AS3A 5KVCA 3E2IA 4RD3A 1OKKD 3H05A 1HEUA 2FWMX 4YT5A 3RAFC 2PXCA 4BMOB 2CVFA 2WNHA 3FGNA 4RACA 5DXFA 1XTZA 2HHAA 2R6R1 3PC8A 4FDVA 3RU3A 1J0EA 2Z2XA 3L8GA 1MHPA 4RTLA 2H4XA 3FPKA 4FSDA 3JQAA 4WACA 5CBPB 5KBYA 2VYCA 3DWIA 1NVTA 3SXUB 1LLUA 2R65A 5F4BA 3AB8A 3RUDA 2LZ0A 2VTBA 1PYOA 4CR7A 2CL7X 3NHSA 1J20A 1D5WA 1YBHA 2ORYA 1ZH2A 3GEHA 3GEIA 2MSKA 4A82A 3W3AH 2QXUA 1CNEA 3QHPA 2AI2A 5A1JA 4EG4A 1SGWA 1YJ8A 2MHCA 3CNNA 3KEOA 1XCJA 3R5SA 4MP8A 3EQ7A 1QK3A 1KI3A 1FP4B 1UMKA 4QRIA 2CMFA 4H1VA 4PHCA 5DGCA 5BNIA 5KQRA 4K6KA 5JW6A 4RTOA 1NUHA 2MTBA 2LXNA 3K2EA 1FEZA 2XADA 3WL4A 2JCYA 4BQOA 1Y48E 4PIMA 5TGZA 3EPRA 2I4OA 1U2QA 5FUYA 5KJ6A 5LIPA 2DHCA 4AQDA 1E9AA 2I03A 4WKGA 2LCFA 4NMHA 2JW5A 3OICA 4XWGA 3DWEX 3RDPA 4FHEA 3C6BA 5LMCA 4ZZIA 1KETA 4FI3F 1DRWA 5G0TA 4AW9A 2NSLA 4RKFA 1P45A 1P80A 2AYZA 3ETNA 5JYEA 1V3UA 3BEOA 3VC3A 2DFVA 1L3IA 3WLFA 3ZQJA 1L4KA 4JBHA 2C3PA 4H3VA 3PRHA 1P4AA 5G4LA 1GITA 3R24A 4CZ2A 4M9QA 4FEYA 4YWHA 1XI2A 2I3DA 1HLPA 4F1JA 1TT5A 1MJHA 2FPKA 3R5HA 3E58A 4LF7B 3CFYA 4WCFA 5CX1B 1J24A 1O8CA 2GFHA 2OA0A 2B92A 4KO8A 1L5GB 2HNAA 3C85A 4FKBA 2CE7A 4NYJQ 2DH6A 3EIQA 3TK1A 5JY6A 2PVSA 1G20E 4G36A 3IPRA 4AFNA 2J67A 1QS0A 4BNDB 2GK4A 3AY6A 2VOEA 2G5CA 1GKKA 2CF5A 3V97A 2WYWA 2FCRA 5B1HA 2PRZA 3UGTA 2A58A 2AN4A 3ILYA 1S2DA 1JHQA 3RKUA 2XNJA 1DVRA 3ODPA 2BHRA 5JXGA 1V11B 1JGTA 2EIHA 2II6A 2Q1TA 2AD5A 2PH7A 5CDFE 3ZVRA 2FN9A 1QP7A 4ND2A 4X7RA 1V48A 4BLSA 3PSAA 1AKVA 4JEHA 2PZFA 3F90A 3EA4A 3LJKA 4MQFB 1U5CA 2H0QA 3VKWA 1U99A 3ER6A 4O2BA 4CQMD 4FB5A 3T5AA 3LKBA 2N46A 4PO3X 3NANA 1GAJA 2W70A 2JD1A 2BISA 5DMXA 3KJIA 5F77A 5GPBA 4D8VA 4EL0A 5BN1A 1ONBA 2FEOA 3BKWA 1VE5A 4DARA 1S3GA 2Z04A 5HZGA 1QMPA 1RQNA 1GGJA 5HYVA 4PS0A 1CG6A 3R6GA 1GV1A 1BA2A 5KOHA 3LS2A 1XZBA 2O7NA 4P83A 2HEIA 3HFSA 1ELOA 1II8A 3LD9A 5BMVB 5CFRA 4A5SA 3G1WA 1IJEA 3PGKA 1X7XA 1DCFA 3UAGA 2RHRA 2NUTA 4BFCA 1I2AA 1BZYA 5HR5A 1GL9B 1NAHA 1K27A 1WOYA 4OJTA 5BSWA 3Q41A 1BWRA 4Z1OA 2YWCA 1EFCA 5AQ1A 3HDGA 2FLKA 3I9MA 3HLKA 3NAGA 2X9LA 1AS3A 1JWBB 4ZRMA 3WFJA 1RAHA 4MV9A 1FXWF 5EUQB 4TL8A 4OI4A 2XYVA 3DXXA 4YXFA 2V7VA 4XYMA 2CXSA 2Q4BA 2VJPA 2FCAA 3IHTA 4JR2A 3ZHOA 5IAKA 3DMGA 4GLJA 4KC0A 1NUPA 3C70A 4URHA 4RETA 3KE9A 5KNBD 3GLGB 1ZM3A 1ST2A 1KEEA 5BSKA 2ZFUA 1LK0A 1RKUA 4FLMA 4QD3A 3L9XA 3OQHA 3O84A 3FLEA 3QOFA 3GDGA 5DI9A 2X40A 2JFNA 5GJBA 5HQ3A 2Q0HA 2OFXA 2OZPA 2P91A 3EUEA 2P30A 5LP6C 1NV9A 1NQAO 2C5FA 5IFKA 1R00A 4BLTA 4RHTA 1AKYA 3F5MA 5ALRA 2FWJA 3FHCB 4RA9A 4BBAA 1LB1B 2BMWA 4DLKA 2I3BA 4B3DA 3KWLA 4P3XA 1POWA 3F3MA 1E5LA 2QMZA 2WM8A 2HX1A 2QPOA 1V7PC 5BXQC 2JLSA 4BFYA 3BS4A 4H60A 3VPBA 1OGYA 3EOAI 4OGGA 3EQ2A 4MW7A 1ACLA 1Z6YA 5CLHA 5AKGA 1XZGA 1YCGA 3MRVA 3BJZA 2ZVPX 4XVCA 4ZI3A 3H1EA 4YLGA 1Z6ZA 1KZ6A 3PYXA 2FZVA 3CHYA 3FSRA 4JNKA 4DM4A 1U80A 2D8MA 3EE6A 4HDNA 4AMBA 1R5BA 4ND4A 2ZM5A 1IBLB 3SDSA 5I7FA 1FU7A 4P08A 1WZCA 2IYYA 1WSDA 3DEIA 3RS9A 2WQ6A 2BKXA 1G55A 1Y8RB 2YCLA 4KGDA 3TLBA 2E4ZA 3DKPA 2XODA 3KSRA 1UDRA 2OEPA 4IFIA 3DW3X 3RS0A 1LVGA 2D4AA 2VZLA 1CYDA 3K8YA 3OESA 4WNCA 4AMVA 1APBA 2BMVA 2PEYA 5CFQA 5EJ6A 1E32A 1EQ2A 4JI1B 5ITZB 2P27A 3IVCA 3OBIA 4NEGA 4NG5A 2BGKA 4P33A 4QDXA 1ZGBA 3TZ6A 3KTDA 4O4HA 5HBGA 2PE5A 3KOZA 4BLWA 1IUPA 2ZW9A 4HB4A 1EX1A 1JVNA 4X61A 1EJBA 4OBWA 4X20B 4K87A 5AHWA 5JNWA 3GCXA 4WLVA 3CUSA 2MR6A 3RK0A 4JKIA 4KRGA 4UTOA 1CTQA 2ZJFA 4L5AA 2X5KO 5B6IA 3C7DB 3C1UA 2O8DA 3PTZA 4MA4A 2R3SA 2PT9A 4N3GA 4PNHA 4I0WB 1XKXA 3HKDB 4C5AA 3F6RA 3LRTA 2O06A 3DUWA 3I6IA 1PRYA 2NSHA 3IQGX 2CNLA 3QYFA 1TIBA 4D5EA 2Z5FA 3TNDA 2IIPA 1TMOA 4MS4B 2L0XA 4BTLA 2O8BB 4BGIA 4PEVA 1MA3A 3EZGA 4M54A 1YI0A 3TLGB 4YV7A 4A8JA 5ITWA 5LLDA 2FXIA 2XMQA 4LXYA 1DHRA 3L8ZA 3C1OA 3RUIA 4WW0A 4A23A 2Z98A 2QKYA 2ZT7A 4U7GA 3V46A 2I8LA 4GWLA 2VH1A 3QKRA 3A1NA 3MWEA 3SQDA 1MC5A 2IXFA 3Q4GA 4V0ME 2NP6A 2AZDA 3RVKA 2VTEA 4E4RA 5L8VA 4QAJA 3DDWA 4CG0A 4RVSA 1BE8A 4QEZA 3H5WA 2A5YB 3E5RA 3GCZA 1BO6A 3EAQA 5H9VA 1FDVA 1RHKA 4D8WA 1Z5PA 5FA8A 1J9ZA 1T1SA 3R0IA 4Q24A 1QQAA 3WA7A 1Q0SA 1GG9A 1VI6A 2CJFA 5DE3A 5FIUA 3SPXA 2Q6OA 2IUUA 2Z4TA 2XB8A 3DVAB 4KXQA 4D4GA 2GPBA 4KLRA 4MRMB 5C7IO 5JOQA 4NH0A 1FE8A 1FW6A 4TTAA 1CZHA 1WTAA 1XZCA 1GZDA 4CQMB 2P2GA 3PNYA 2CHQA 3AF0A 2QMHA 2AI3A 2BFOA 3ZI0A 1K88A 2XXBA 4TTTS 3S29A 4M8IA 4RIIA 1ZZEA 2PKCA 3DNMA 3KSUA 1SBHA 5MN5A 3G9UA 1JL3A 1FTSA 3P9YA 2HJRA 5HP4A 3FAKA 1H8HA 3IUJA 4IKEA 1QHXA 3K73O 2R8EA 1J0BA 1PJAA 4IGEA 3UM9A 3AR3A 2VRWA 2FSSA 2WD9A 3OFNA 5EE5B 3LSTA 1M5UA 2WM2A 2JIDA 2BIFA 4G4JA 4TLEA 4ZAXA 3WLMA 3I2HA 4F6RB 5ER9A 2MYUA 4HDKA 3U4DA 5AJYA 1NRJB 2I4MA 2KE5A 3ELWA 1XBTA 5DHRA 5LR6A 1J99A 4MAAA 3BXFA 2TMYA 4DCJA 1P1JA 3JSAA 3I39X 2QZPA 2CXPA 2IEGA 2VHTA 1O6GA 4S2EA 5EZYA 3ZNPA 3W5BA 2OCGA 3KJQA 5DM1A 4V0LA 2EX0A 1LVHA 1C3EA 1XDDA 4EJ6A 3L49A 3NP7A 2XSZA 4EQZA 2JZCA 4NBVA 1E1DA 1XJ5A 2QPLA 4ZRNA 3RF7A 4ZGBA 3D7RA 1A9XA 4ML3A 1Z62A 3U1TA 1G64A 3T7IA 2NVWA 4YJ2A 3T0GA 1XROA 4AYXA 1YVPA 2LGJA 3U0VA 2DR3A 4KAFA 1HYGA 4MR7B 1VE1A 1JIXA 2IZ7A 8ADHA 4C6HA 1UEJA 3L06A 4MQ5A 2FPMA 3BDIA 5DHSA 4GM1A 1Y80A 2DQKA 1D4ZA 2AWNA 1XAJA 4CMIB 4NDNE 2Z1NA 2QS9A 1ID1A 1EVLA 4I4TA 4UU8A 5B5SA 2IIBA 5HK8A 1WNFA 2ORED 5ECWA 3NJ8A 4P5EA 1I4DD 2IEZA 4DXAA 1G6Q1 1XTSA 2IELA 5AVQA 1NLFA 1AHNA 1VDZA 3H7IA 4HAUA 5H3LA 5KWSA 4DC1A 1NJSA 1FJXA 1D2HA 4KQCA 4BNZA 3BXHA 2GAJA 3CH7A 1ZBQA 3BB3A 3CLTC 3D8RA 3LV8A 3KPVA 2ACEA 2J32A 3I58A 1EXWA 2IIQA 2A9RA 2PR2A 3B70A 3LXMA 4MYHA 3SSNA 2AR9A 2FK8A 3IVGA 3OLYA 3UWOA 2LKCA 3K92A 1UMDB 4HAXA 3T4XA 3TG8A 3RC8A 4L22A 1XKLA 2BEWA 3DFFA 2ZUBA 4UEOA 4WHMA 5IX8A 2O0HA 4JP8A 5A4AA 3DLHA 4Z9BA 1FMCA 1QE5A 4YECA 5LNK1 1NWHA 4W63A 5FKJA 2XCOA 3QKTA 4B6RA 3KP1A 1DKQA 1UZUA 3OAAD 4C0LA 1XVVA 2FPPB 5D1NA 5J43A 4XGIA 4LYYA 4W99A 3SJZA 4HXFB 1GG8A 1OYOA 2OLJA 2XWPA 2YN2A 1MRZA 2YRXA 3EXIB 3KVYA 3H8VA 3MINA 4ARIA 2YINC 2WYVA 5KWVA 1V71A 4KB5A 4HMPA 3QKSB 4IDFA 3MT0A 1BFUA 3D3WA 1M2NA 3QPAA 1IQUA 1P5RA 4WSOA 4H1UA 2ZAGA 4UNQA 1NY5A 1V41E 1POXA 3DDUA 1L7AA 1TF2A 2B4RO 4GGMX 3I6MA 4BU0A 2NTNA 4IJKA 2QJRA 2IV3A 1ODKA 4I81A 4HFRA 1A2KC 3OEEA 1DRUA 4LTNA 3O3NB 5KNDH 4FE4A 3AJEA 3PEVA 5EP3A 3KVRA 3ZNOA 5JC1A 2PGIA 3U19A 1J21A 5ALYA 4D57A 2E9SA 2P2LA 3OIYA 1WW8A 3B1ZA 5E6UB 4ZIRB 2ZITA 5A06A 4NCIA 2PJDA 3LP6A 4BB9A 4DDWA 1TW2A 3C7KA 3NTLA 1EK6A 2PSFA 4PYOA 3SG0A 4EF4A 2CEKA 9GPBA 2ZJBA 3RHFA 2RGDA 5ECYA 3W5SA 4XGQA 2ZJ6A 3CKKA 3ET5A 3RNLA 2FPGB 2IODA 2XTMA 4Q7MB 3E9MA 5LBTA 4YCDA 4QU9A 4HZUA 3TMKA 2HRBA 2H57A 1BJTA 1E5DA 1DRKA 1SD1A 4UMVA 4PGAA 2XXAB 4CCAA 3D2AA 4RA6B 3QJYA 3DHWC 4MKIA 2GHQA 2RHHA 3WGMA 1F17A 4J1TA 4EAQA 4W9MC 1L7MA 5FOWA 3ZKWB 1J0CA 1SOWA 1EXDA 3E15A 1IM2A 4J16A 1ORTA 1SOVA 4LHXA 2FEXA 2C5AA 3G49A 3TUJC 3R74A 1ZSYA 2BCGY 4O4JA 3N0RA 3TFOA 2ZXFA 2HA6A 5K0NA 1KY2A 1OT5A