4TL6A

Crystal structure of n-terminal domain of kaic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
238
structure length
222
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPFDLSALIERINYAIQKYRARRVSIDSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Circadian rhythms. Atomic-scale origins of slowness in the cyanobacterial circadian clock.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942)
molecule tags Transferase
total genus 80
structure length 222
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tl6A00
3ADDA 1R8SA 3UMSA 4BFSA 2CVHA 3MD0A 2V55B 3R7WA 1M8PA 1W44A 3TSWA 2GJSA 2ZR7A 1IBRA 3LX5A 3MLEA 4A4DA 1GL6A 1HUQA 1XFAA 3EG5A 4NBSA 3FE2A 4RZ2A 3SQWA 1ZCAA 1VHLA 3KUCA 1Z28A 4A8JC 3DM5A 2WIBA 3A37A 1DPFA 4TL9A 2W58A 5LD2C 1KI3A 1Z2CA 3DEFA 1XEXA 2F1JA 3D3QA 1MRSA 2MSDB 2VHJA 4IDNA 4LWZA 2J87A 4TMVA 4V0ME 3EC2A 3NWJA 3UATA 4QBFA 2EYUA 4M1MA 1GUAA 3X1YA 4Q5IA 2UKDA 3E5HA 2VP9A 3T1VA 1GTVA 2AR7A 4IRUB 1N5IA 1E2IA 3IDQA 1S1MA 1D8TA 3JVVA 3TAHA 1NIJA 3BERA 2BMDA 3TUIC 1Z8FA 2WZQA 3VU9A 3CM0A 4JBXA 4Q1FA 4C2TA 5EQTA 1YE8A 1ZM7A 2R6FA 3OIYA 5JI2E 4LHYA 2WMNB 3OZXA 4TYNA 4HDQB 1KDTA 5CIWA 3QG5A 2A3RA 5B64A 4QRHA 1D2MA 2J5XA 1RFLA 5FPTA 3NH9A 3AUYA 2OEPA 2H7VA 4ZI3A 2ODNA 1GKYA 3PITA 4PC3A 3I61A 2NMVA 3EWSA 2YC4C 3FDIA 4B2IA 2VSOA 4WAUA 1GOTA 3IBGA 5KSZA 2ODBA 3DKPA 5EE9A 1AN0A 4PHFA 4PZZA 4C4PA 2ZS9A 1EFUA 1JPJA 3VR1A 2NO1A 4L4UA 2BCJQ 1OKKA 3Q7QA 1BMFD 2OG2A 2ZQ5A 3A1SA 3LQQA 4LBVA 3W9YA 3DDCA 4DC9A 1BH2A 1DOAA 1NJFA 1W47A 3HU3A 2SHKA 5JJLA 5JEEA 1J7KA 4Q9LA 2D3WA 1XJCA 3VFDA 4G5SA 1RPZA 1CXZA 4Q02A 2IBMA 1AM4D 1VMAA 3NC0C 2J7KA 3BORA 3B8HA 3KL4A 1CEEA 2A5YB 2BEJA 1N6KA 4AC9A 4R71A 1GNRA 2GZAA 2C98A 4MKHA 1OH7A 4UNSA 1TTTA 4O3MA 2WWIA 3QKRA 2XGJA 3JVUA 2EWWA 3H86A 2GF9A 2FFQA 4XIGS 4JVMA 5FOVA 4B3XA 2O0KA 4TLBA 3GLFB 1H65A 3UWOA 1IN4A 2WICA 2LKDA 3PG5A 4TMZA 3SS8A 4ZIRB 2AK3A 4GP6A 4D4KA 5L3RA 2QTVB 1WCV1 4FD2A 2R6AA 2ZRLA 2G1JA 4KLNA 4M8NE 2GA8A 2FSFA 3SQXA 1J8MF 3Q5EA 4CZ2A 2RKOA 2QBYB 4W7SA 2GVZC 4OQXA 4Q1DA 1SXJA 2J0QA 3FWYA 1WE2A 3FVQA 2O8FB 3M1IA 2GETA 3EZ7A 5FUXA 3ZGXA 4A6XA 3LA6A 5FL7A 3U3KA 4DLRA 3Q5DA 2YNMA 3SFVA 1R4AA 2KI5A 2W00A 2O52A 2PZFA 1B23P 4IKEA 3TR5A 1IM2A 4WZ6A 2WWGA 1EESA 3IQWA 4XD7D 2R62A 1XJQA 1II8B 4M9ZA 2AD5A 5F3WB 1G7TA 2NOAA 3LNCA 1TAGA 2VBCA 1UDXA 3LBHA 3T34A 2DR3A 3K9LA 4CW7A 3VAAA 3HPQA 3NBYC 2NGRA 1E94E 1OSNA 1Z0IA 2AL7A 4KJZA 1EX6A 2JDID 6Q21A 4ITRC 4BLQA 2O8FA 3U4QB 1TX4B 4JLVA 4ON9A 3SOPA 3E70C 1G5PA 3TLXA 3B78A 1O3YA 4V02A 1IXZA 1QHNA 2QM8A 4TQAA 2ORWA 1QF9A 1ZCBA 1ZUIA 3B1ZA 5FUYA 3THWB 2DHRA 1NG1A 3SU8A 2IWRA 1JQJC 1CJTC 3RRMA 2CHGA 1OB2A 4OJKA 2KBEA 1M2OB 3AKCA 2P6NA 4Q1CA 5E7MA 1NSTA 2XEXA 2BM0A 3T1QA 3UK6A 1K8RA 4JVLA 1G18A 1EWQA 1HQCA 2QEQA 2VHCA 1R5BA 3MJHA 4D0NA 4EPYA 1XTJA 3PIRA 1E9SA 4N0EA 1NN1A 3FYHA 3MWKA 521PA 2IHYA 3MGCA 2GZDA 1XMIA 4DIEA 3CPEA 3ZIAA 1TNDA 1KMHA 2XZOA 1E9BA 2OFOA 3AVOA 5EE1A 2ERYA 2OT3B 5SZIA 2OUKA 1FOEB 2P5SA 2ERXA 1EWRA 2D4HA 3U6KA 4J0QA 1H8HA 1TU3A 2IEYA 2BEKA 1ELOA 2FN4A 4H1UA 2UVQA 3QENA 3VTKA 3U7FB 1UKZA 4JKIA 3K09C 4Z1MA 3W8NA 1OXXK 1P9RA 1MKYA 4C9BA 4MKGA 1JNYA 1SVLA 3AGPA 2HLDD 1AS0A 2GJAA 3EARA 4DJTA 1F60A 1KK1A 4D25A 3KJEA 4HATA 3IIJA 4B73A 5EXXA 4LV5B 5FBRB 2EFCB 2PZEA 5JWRA 2GCOA 1ODFA 3G82C 2CCKA 2W6JA 3QF4B 5CM9C 3WMEA 4BUJA 1E0KA 3SEAA 4EDHA 1NSFA 1W0JA 4R7ZA 3LVQE 5L3QA 1G3IA 4B44A 2IYVA 4LJ6A 2ZRPA 4WZBE 5BQ5A 2VHTA 4QKQA 4YQFA 2DCUA 4HAVA 1RRGA 2QA5A 4BFWA 4BEJA 1Z0JA 2BMEA 1WQ1R 4DCVA 3I92A 3RRZA 2QSZA 1QHHB 3PV0A 3RAPR 2Z43A 3AF2A 4UXJA 1F2UB 1N2CE 3SBEA 4URWR 1OIVA 2PCJA 2ZREA 2C77A 4MGYR 4TTQA 821PA 5DNYB 2NTYC 3PEYA 2FDCA 2AFIE 3CKLA 1FUUA 3N2EA 3QXCA 3BC1A 2A78A 1UBGA 3NKVA 1NLYA 1TUEA 4UKDA 1E1QA 1U98A 3DM9B 2CCGA 3EZFA 3V4FA 2WKQA 1IONA 1XXHA 4IXMA 2WJJA 4DLWA 2O0HA 2PLRA 1PJRA 3F5FA 4A2PA 5TB5A 5TXGA 4FN5A 5P21A 1S2MA 3Q9LA 4Y0AA 4NKRA 3UXMA 5K8TA 5DI9A 2VF8A 2J7PA 4D4MA 1QZXA 2XTNA 3IHWA 4O2LA 1JB1A 3J81k 1FZQA 1P7CA 5TVKA 1G5RA 1QHHA 4K8OA 1GILA 1HH4A 4AY2A 3W6OA 3OEED 3U3MA 2OSBA 2VP6A 3WP1B 2TMKA 4JLAA 2AKYA 1UPTA 3H1TA 2QQ0A 2OILA 4QNRA 3ZZUA 3AVXA 2QGZA 2IL1A 3GCGA 1X6VA 1N6IA 4RSGA 2ZJZA 1S1CA 1TF2A 3SHFA 5FPKA 4B6FA 2GJKA 3CX7A 4OI1A 3GD7A 5FOTA 1VCNA 3RS7A 5BYJA 2W6IA 1F3OA 3CRW1 2JLQA 2HDNB 1HURA 2BOVA 3NHAA 4PAQA 5LB4A 4A1FA 3RHFA 2HCBA 5JLJA 3LY5A 3KXIA 2ORVA 3EZ2A 2V54A 2PEZA 2V6IA 3HPRA 3SR0A 1G19A 1KDRA 1P2UA 2AXPA 5KDLA 2QT0A 3QKUA 4C0SA 4FWTA 4US0R 4MDFA 3Q3JB 1IJFA 5G41A 1P3JA 4OHXA 4B33A 1RYHA 1Z22A 4GP7A 3WMFA 2F1RA 5EP1A 3ZZ0A 1JPNA 1RRCA 3P4YA 2ORIA 2R44A 1GKIA 2F43B 4QGGA 5HCIA 2OM2A 5J40A 1Z83A 4EJSB 3QKSA 4MRPA 2O8BB 2ANCA 4IDOA 3RS2A 1BYIA 2FOLA 1ESMA 2PZGA 1E9RA 4ZKDA 2GK6A 3R20A 1P2SA 2GBLC 1AKEA 4RFVA 1A82A 4IFBA 3BBPA 3SYKA 3G0HA 1PUJA 3UIEA 1L7VC 4OYHA 2CXXA 1LB1B 4RCYA 3A4NA 2VLIA 2A2ZA 1E9FA 2EFEB 2E1RA 4WVFA 3RNLA 2QMUA 5CJPA 2GXUA 3QVVA 4Z51A 4LC1A 4AD8A 3VHXA 1Q57A 2ZRBA 5DYIA 4DSTA 1IY1A 3KQLA 3L0PA 2J0SA 3RS3A 2DFNA 2QAGC 4BFUA 1D9XA 1IY0A 1VECA 2AWOA 2QU8A 1Z6TA 2O8BA 2KB0A 1G8GA 4LX0A 4Q1EA 1YVDA 2HV8A 4LV8B 1G9XA 2VTKA 1KJZA 4LYAA 4Q1BA 1E2GA 4R2IA 3K70B 3IIMA 2R8RA 4C0BA 1MOZA 1LFDB 3FMIA 4WIAA 5HE8A 1E96A 2BJVA 3A4LA 3VKWA 3GLHA 3SYLA 4PZLA 5KNBA 1W0KA 3DL0A 1CIPA 2FWRA 4FMBB 2EU8A 5EE0A 4JSYA 1MABB 2J59A 2OO7A 3MG9A 2FA9A 2YOGA 5GJWC 1KAGA 4AG6A 3EPJA 2JJ1A 3GMTA 5FTJA 1JR3D 1JEDA 3QQ5A 2AK2A 5JS8A 1T0HB 1KZGB 3ICEA 5FUVA 4F7WA 5JWOA 2JCSA 3VR3A 1S3GA 1SZPA 3TK1A 3W3ZB 1F5NA 3DPUA 2ZETA 2EVWX 1P73A 4MA4A 1OLOA 2OHFA 2ZYVX 1KY2A 3B13B 1WBDA 4LYHA 1N6NA 1DAIA 2EW1A 2R6CA 2RGBA 1MR3F 3RS5A 2X8AA 2J0VA 2ZYTX 4D6PA 1Z6YA 3AM1A 1FFHA 1YZKA 3C4JA 2XNDD 5A4JA 2I1QA 2FX3A 2QPTA 4NPHA 5CK5A 2UZIR 1W48A 4HZUA 4D80A 4CEHA 4IEIA 3HYRA 1MABA 4LK2A 4A82A 4BE7B 3GLGA 1D2EA 1IQPA 5DH9A 1NF3A 3UMRA 1Z5ZA 4BZPA 4ZV4A 2QENA 3GJ0A 3K8YA 4Z54A 4DKXA 3MMPA 2ATXA 1E2LA 2D2FA 2F55A 3BD9A 2WOJA 5E7JA 3ZJYA 1JR6A 4G01B 3QJYA 2ZE8A 3KTAB 1ZVQA 3PCRB 3RYTC 3QSYA 2EFHB 2ZROA 4HDCA 3CRRA 1I4DD 2WJGA 3C5CA 4RFSB 2QP4A 4Q47A 5HKKD 1U94A 3NHBA 5CLLA 3CRVA 4ZPXA 4YMUA 5J4VA 4Q9JA 2ZRKA 1YU9A 1BIFA 1L2TA 4GDFA 2QL6A 3RABA 2OAQ1 3BE4A 2GWHA 2HEIA 3TSOA 4NYIR 5FOUA 4CEIB 3WP0A 4DDWA 3W6PA 3RSOA 1OXUA 4LHVA 3I73A 3IUYA 4MGIR 4N1AA 4OK6A 4QHSA 3V00A 3O8CA 4NONA 1AKYA 1QRAA 3L0SA 5BWMA 2VL7A 4QGAA 1W36C 3L0OA 4P4TA 4EFNA 2IXFA 1CLUA 1EGAA 1ZAKA 4HAXA 1TQ2A 2I3BA 4P31A 3KFVA 5H1YA 2WTUA 1COWD 3I32A 1G7RA 4QXAA 2W2TA 4TSFD 3LQRA 1N5JA 1S0UA 1ZM2A 4HYYA 1T4GA 4QJ4A 1SHZA 3CR7A 4BFVA 3EPLA 2GXQA 1CJVC 1OHHA 1T91A 2WWHA 3GJ8A 3OIVA 4GL2A 3KZ1E 1Q21A 3B85A 2FSGA 1JAIA 3DO6A 5D3QA 4IXNA 4TTPA 5TV2A 5B30A 1I4TD 2BWJA 4B76A 1FX0A 4ZI2A 1XZPA 3DVLA 1W4RA 3VQTA 4DDTA 4JL6A 5EUMA 4ZDIA 4KFRA 2OBNA 4P0TA 1E79D 1S9HA 2H17A 2IYRA 1QDEA 4PQFA 4A8JB 621PA 3K1JA 1R0ZA 1MH1A 4WXRA 1ZM9A 4IDPA 3T5GA 2PMKA 1UFQA 3BGWA 2CNWD 4KCGA 4OKSA 4LZZA 2ZM5A 1QHXA 4HZIA 3ZLJA 4GT1A 1KIMA 3C41J 4MYTA 4OHVA 5JECA 2ZRHA 1G3RA 2EFDB 2RAPA 4FCWA 2J9RA 2JATA 1PUIA 3JZAA 4GPTA 4HUQB 4IVRA 4DUGD 4BLTA 2Z5FA 5D3MA 4EPWA 5JWHA 4O25A 4A0HA 2RMKA 3MCAA 1E99A 4LBZA 4M1KA 4S35A 4DLXA 1VPLA 5EUQB 1G20E 2WM9B 1K5GA 2FEOA 3D8BA 3HP1A 5C4MA 2YOFA 3EPHA 1T3SA 1EX7A 3E1SA 3OE7D 3H4MA 1ZYUA 1NY6A 4JLOA 2IXGA 5FI0B 4TMXA 3NIBA 3IILA 1FMLA 1M34E 2QI9C 1Q1QA 2ZANA 2F1IA 4WA7A 5EJEA 1E2FA 2ZI6A 3A1UA 5JEDA 4P4UA 1EFRA 1E2JA 4GI7A 1P2VA 4MRNA 2ODEA 4KFTA 5JMTA 3R9WA 3AVUA 3PXGA 2JEOA 4IOKA 2DFKB 3A1VA 4HUQA 5SZHB 3AV0B 4F4IA 2ZAMA 3FB4A 3VR6A 4B6EA 1TPZA 4AIIA 4G5QA 4EPXA 1YR8A 2PX3A 2WWYA 4QBHA 2ZSBA 4M53A 1FNNA 4TMTA 4A6PA 4RZUA 5LB2A 4KVAA 3AVPA 2JLUA 4DXAA 1Z63A 1SVMA 2JGNA 3B9PA 1OFIA 4TWZA 3U5ZB 2VHUA 4GOKA 1SHKA 3T61A 5JCPA 1P72A 1VG1A 4LSGA 4QHTA 1N0UA 3P1JA 3LX8A 1HT2E 1PLKA 2OESA 1P5ZB 2B21A 2Q0HA 4Z8YA 1Z0KA 2OFXA 3X1ZA 3KQHA 2C8VA 3QG1A 4MRSA 2DB3A 4UXHA 4XWKA 3SE0A 2WHXA 4BEBA 4UNQA 2FPMA 2B8WA 3P26A 4FMDB 4HLQB 4LBYA 4TTRA 1KI4A 3ASYA 4IFEA 2IYYA 3I4LA 1F48A 5F2EA 3FGNA 2QSYA 2XB2A 2CHQA 1EXMA 1J8YF 3BFXA 2YZ2A 5IK2A 3WYFA 4DDVA 1XPRA 1GNPA 1OV4A 5GJVC 4K46A 3GP8A 4RZXA 4PXAA 4NTZA 1GKUB 2IXEA 1AA9A 4I1SA 1R2QA 2V9PA 3CPHA 4FMCF 4UNRA 2QT1A 1ZP6A 3SJAA 1XEXB 4FCVA 3N2IA 3I62A 4YXWA 4N3NA 3AP1A 1H8ED 4LDJA 4EUNA 2W83A 1XEWY 5AK0A 2OV2A 4X8LA 1N3BA 3AGQA 2GJ9A 5HTKA 1TF5A 4R98A 3BS4A 2BDTA 4OBEA 2ZRIA 1FTNA 1M1YE 4HUTA 1NBMA 4OHYA 1JALA 2QMEA 3VU9B 3WMGA 4V0KA 1IY2A 4HSEA 4BWYA 5G3YA 1C4OA 3Q7PA 2DPXA 3QNUA 1E0SA 1IXRC 4UNNA 4LOAA 4DDUA 2IF2A 3GFPA 4ILEA 3EASA 1SVWA 1Q1BA 1VKJA 3O8DA 3IPXA 1RW4A 4Q7KA 3L8ZA 1KGDA 2OCPA 1ANKA 1NVVQ 4Q48A 1TADA 4O2RA 1XD9A 4NYMR 2PX0A 4ASUA 4PSKA 5CITA 1HY3A 4V0LA 1Z0FA 1NMXA 1G3MA 5AJWA 3U7EB 2VYFA 1ZMXA 3PENA 4B2LA 2O8CA 4ACBA 2J0UA 4O0MA 2ZSFA 4CF7A 2J46A 1TQ4A 1Z07A 5ANRB 2WBLC 2RGNC 3ADKA 1KDOA 4LCBA 1DS6A 1CF4A 2HF9A 3VX4A 3FOZA 4TYYA 1YJ5A 1T3HA 5KDOA 3NVAA 5H70A 2V1XA 3GEEA 5J4YA 1KI9A 2KBFA 3GJ4A 3C5HA 2GAAA 3KQNA 3DKVA 3QKRB 2RGEA 3WYGA 4TZ6A 4UXIA 1AGRA 3FKSA 2BC9A 1XTKA 1Y63A 4PPQA 2ZRJA 4C3ZA 2O5VA 1Q1EA 3AQ4A 2IYLD 4I81A 3R8FA 2QTHA 3KB2A 2VHQA 3TQCA 4KO8A 4OHZA 4U7DA 1HEIA 2CK3A 3IQXA 4HB2A 3X2SA 2JJ2A 2DWOA 3OFNA 3ZVLA 2YHSA 3OIWA 1LW7A 1XZQA 3DMDA 2IYXA 3T12A 4MITA 3RWOA 1XWIA 3TW4A 3TH5A 4M21A 1SXJB 1X8KA 3TE6A 4L5BA 5EXSA 5JBQA 4ARZA 2C95A 3F0TA 2ZI3A 4KFUA 3LLUA 2O8DB 3ZQ6A 3M4YA 4M1SA 4D0GA 4L15A 4B3BA 1SVIA 1AGPA 3PEWA 5KNDA 5L3SA 2WPDA 3TNFA 1NP6A 2QMHA 3P32A 4AG5A 1L4YA 1KTVA 3K09A 3LWNA 1MO6A 4EIWA 1XPUA 2ZEJA 4IVPA 4JLDA 5AJXA 4AWXA 5GVSA 1P75A 1G8PA 4TLEA 1FNMA 1TU4A 4RCZA 2LKCA 2YWFA 3DOEA 5B57C 2ASEA 3GJ6A 1NKTA 5JFGA 2N42A 4OI2A 5AUOB 1NMYA 1R7RA 5IDVA 1W49A 3EC1A 3B5JA 3Q8XB 4LHZA 2XNSA 2IUSA 1TQ6A 1KSFX 3BOSA 3SFZA 1G64A 2P6UA 2O8DA 2XZPA 2Z0MA 1GFIA 1LV7A 2VF7A 1XNJA 1DE0A 3OHMA 2OE2A 3ZD7A 3T5DA 4PX9A 3MWLA 3NG1A 4D0LB 4IVQA 4NH0A 4TT3A 3HJNA 3GJXC 5DN6D 3C8UA 3SBDA 4I1OA 2JLXA 1J2JA 1ZNWA 5AUPB 3Q72A 3TBKA 2GVDC 5HZKA 4TLAA 5TY0A 2QUZA 2BBOA 2GRJA 3GLHE 1X1SA 4B43A 1T0JB 5CIQA 4QJ3A 4POAA 3UKDA 1KMHB 2WWWA 4Z8XA 1DVRA 4PC7A 5HCNA 4NE2A 4EQ6B 4GMDA 3U61B 1LF5A 1R8QA 5FOWA 4B71A 2OCYC 3C16C 3B1YA 4JSTA 4P32A 5FTMA 2V7QA 1CS4C 2R6GA 4U00A 3S1AA 1NL3A 1QHGA 5G40A 4S2EA 1NKSA 4MYCA 2L0XA 4LGMA 1QG4A 2DY1A 4PSAA 2AX4A 1NVVR 3AF3A 2GZHA 2ZJBA 1GWNA 4A15A 2IYUA 1NRJB 3TKLA 2ZUBA 3SYNA 3TW8B 1T8UA 4GMXA 3NEJA 1CJMA 3CNNA 1RKBA 3KB1A 4JLPA 2GCOB 2EFGA 2IX3A 2F1HA 4Q03A 2HXSA 4L16A 2R9VA 3U3JA 2GEDA 1E2NA 5L3QB 4EQ6A 1KK3A 2V3CC 2AFHE 3IO3A 4TLDA 3QIAA 1DAKA 1GP2A 4EFMA 2UZ3A 3BFKA 2H57A 1XRJA 5DO9A 2XSZA 3O8BA 3K0FA 3MSXA 4CT5A 3PUVA 2RHDA 1GM5A 1OFTA 1AS3A 3REFA 4KITB 3CH5A 4YMSA 4DB4A 2XZLA 4JVNA 4NCJA 4DLUA 1XEFA 3IKJA 1AZSC 4ZCLA 3A1WA 4CIDA 4QL3A 2ZI9A 2QE7A 1XXHB 1NVXQ 2ANBA 3EXAA 2JLRA 2RGAA 3EA5A 1XPOA 4U5XA 5EP3A 5FTKA 1A5TA 4G1UC 1T5IA 2A9KA 1W2GA 2Z4RA 3EA0A 5KOYA 2WWFA 3CZPA 4KYUA 5E95A 5K8LA 1CBUA 3DHWC 2ZRMA 2GBLA 1BOFA 1YKSA 3KQKA 1F2TB 4YLGA 1OKKD 5G53C 4URXR 1HQYE 4WOPA 5E3HA 5JZVA 2YINC 5EP2A 2KSQA 2JASA 4NYJR 1E9EA 1A7JA 1D6JA 1WMSA 2XOKA 2OZEA 4ACAA 3ICQB 2C03A 4OI0A 1JXOA 1MO3A 3B1XA 3AP3A 4IOLA 1X8LA 5UKDA 1R10A 2PBRA 2BBWA 1CU1A 2QAGA 1D2NA 1S4QA 5FPYA 3R8CA 4BFZA 5K8UA 1ZNYA 4QM7A 1E1RA 4IOJA 1A2KC 4RD4A 1E2EA 5KU1A 4XTRA 1S9DA 2ZUDA 2CE7A 3LVRE 4ESHA 1XMSA 4EKDA 2XNDA 2PL3A 1YZGA 1F2TA 4XOIA 3JZMA 2V4ZA 2JIZA 2J1LA 4LHXA 2GJ8A 4EAQA 3BJIC 3GJ3A 4MGZR 3VX3A 4RD1A 4Q7JB 2VPPA 4OK3A 4OK5A 4V0MA 2ECKA 1ZU5A 1WF3A 3GEHA 3TQFA 2F7SA 4C0AC 1KNXA 1LVGA 5FL7D 4DLSA 1IN6A 2AWNA 3DOFA 4R9UC 5H8WA 3L0IB 4BGDA 3QKSB 4NYIQ 2GNOA 3R9XA 4QBIA 1OH5A 4C2UA 4B35A 2ZVPX 1KDPA 2AN9A 4DCSA 4MDEA 4NCKA 1YR9A 2QP9X 2QROA 4Q4LA 3AUXA 4AI6A 4ZO4A 2KJQA 2IC5A 1GRNA 1U0LA 1WXQA 2ZRNA 4UJ5A 4ZKEA 5J4HA 3THXB 1OFUX 4B48A 4TYWA 1LS6A 3PUZA 3GFOA 3CNLA 2F9MA 4F92B 4KSBA 4H1VA 2MSEB 1KNQA 1W36B 2FGKA 5CJ2A 2YVUA 5DYGA 2OFWA 3F8TA 3AVTA 1I2DA 4JKYA 5IHPA 3WHKA 3O8RA 2ZITA 3QXJA 4NP6A 3WBJA 1Z47A 1G1MA 1NLZA 1VIAA 1UBFA 1OF1A 1E32A 2WJHA 1L4UA 2YYZA 4RD6A 4LYFA 4AK9A 4NHOA 4D81A 3A36A 3LBIA 4DCUA 2W0SA 1VYUA 3AVQA 2ZRAA 3FHOA 3GLHB 1R6BX 2QQEA 3THXA 1DADA 5FUWA 1HE8B 2Q3MA 721PA 1E2KA 4JT2A 3OEHA 4LC0A 3SHWA 4C30A 3TVTA 4LRWA 1UBCA 2FF7A 3CH4B 3SJBA 1IXSB 3G5UA 4I99A 4GRAA 3HWSA 4DT1B 4M1OA 4ZCIA 2G77B 4JLBA 4AURA 4ABYA 3FMFA 5DI3A 2QMOA 3H84A 1RVDA 3T15A 5HPYB 2MMGA 1IN5A 3SN6A 1YRBA 1SQ5A 2Y8EA 3KFXA 1H8HD 4UNPA 2BMFA 4A0FA 3SJZA 3W5IA 4DWJA 3SNHA 1AS2A 3CPJB 4Z1MD 2Q21A 3EAQA 4P33A 4AKEA 1IN8A 1JBKA 1OYWA 1XB2A 1UJ2A 4JL5A 5KSPA 3LFUA 2DBYA 4HZUB 2FJUA 4CEHB 1DAMA 3GLGB 1Z0AA 4TMWA 2DFLA 4HB4A 4FINA 4JJZA 3FPAA 4XTCS 3ECCA 2RGXA 2W6JD 2O8EA 2X1VA 4DT1A 1OB5A 3B60A 2R2AA 3UG6A 4B3FX 2WJIA 5TARA 1YR6A 1ZD8A 3CRQA 1Q44A 3LXXA 2ZUCA 1NMZA 5F9HA 4TZ0A 4HDOB 4E5UA 4B34A 4Q9IA 4F91B 1KI1A 2OLKA 1XCGB 4PC1A 2IYWA 3WRYC 4DEYA 1W5SA 4G3XA 2F3RA 2ODWA 4PSVA 2DWQA 3ZDQA 4Q4JA 3REGA 3NEYA 1A1VA 2JLYA 2PEYA 3FFAA 1IOZA 1UBEA 4B74A 5CB6A 1G7CA 3I1FA 1KI7A 3U2QA 1E1QD 4G5RA 4KI0A 4M9SA 3W6NA 1IAQA 1E2HA 1KKMA 2J41A 1E9AA 4PAOA 1HTWA 3QKTA 2EYQA 1KK0A 4JYCA 4LJ5A 1SVSA 4I1VA 2FH5B 2VP0A 4Q4AA 4P3YA 5FOSA 2J7PD 2V8OA 1D9ZA 2ZRGA 4RZ3A 1TEXA 3R9IA 4LPKA 1JEEA 4N0DA 3WYAA 3BAFA 1FX0B 2OLJA 2JLVA 2CBZA 5EXTA 4F4CA 4CGZA 1KSGA 1G5TA 1Z6GA 3UMFA 1M6NA 2BKEA 4GZMA 5AUQA 3QVUA 1ZINA 5DSZA 3K53A 4PHGA 3T1OA 2GEVA 1JQLB 3AF1A 3ONWA 2WSSA 4BRUA 3GLIA 3ADCA 4WZAE 2ZE7A 2WMOB 1KI6B 3M6AA 3OF5A 5LPNA 1VCOA 1W4CA 2AD1A 2GCNA 1KJWA 2DYKA 2W2VA 5D3MB 1JJ7A 2P0EA 4IJMA 5BW8A 1OXTA 1RJ9A 4EFLA 1TUIA 2BBSA 2W6ID 1AQUA 1WP9A 2ZJYA 3EIEA 4W9MC 2BMJA 3C14C 2I4IA 1ONBA 5JCZA 4W5JA 1JI0A 3B7GA 3ADBA 3TGPA 3DZ8A 4GOJA 1T5LA 4NYMQ 2ZRDA 4TL6A 4JLNA 1UDWA 1U81A 4Q9KA 1AZTA 1CULC 3VHLB 3B6EA 4C0LA 2D7DA 4B3CA 5LD2B 3I8XA 2JLWA 4DRZA 1SXJE 4RKFA 2VO1A 1E0JA 2A5GA 1C1YA 3I8SA 2B8TA 4TMKA 5JJKA 1CJUC 4EJSC 3T1TA 1K6MA 4MYHA 2RCNA 1KMQA 1KI6A 1TL7C 5FBQB 1R0WA 5A5GA 2NPIA 1GDDA 3QBVA 4Q66C 1S3SA 1UADA 4LBWA 4URUR 1EG7A 3IIKA 1ZW6A 3AKYA 1KZ7B 4RJLA 2G6BA 2C9YA 2NO6A 3K0SA 4LJ4A 4X8OA 5KTYA 2WVJA 1G7SA 1T9HA 2W2XA 3IHLA 3IEVA 4URYR 1JXMA 1N5KA 4OQNA 1DAHA 3I5YA 4NL4H 3K0CC 2X19A 3W3AA 1VDZA 3SDZA 1TEVA 2A30A 2MMCA 3BIFA 3PUWA 1P9WA 3A8TA 1NVUQ 3FKQA 1XTQA 2QAJA 3TMKA 5FFMA 5JJIA 4HAUA 3U6BA 4KODA 4BLOA 2WJVA 4C0JA 4ZCMA 4K81B 1E9CA 2ZJAA 1BMFA 4NCNA 5FBWB 4B2PA 3PEVA 4JMPA 3ASZA 1R0XA 1OXSC 4YC7A 1WBBA 3L43A 2KE5A 4PANA 4IHQA 3FTQA 3QPVA 1EFCA 1IJEA 1E4VA 4CVNA 3CIOA 5G3ZA 2RGNA 1UKEA 1Z2AA 1TMKA 4BLRA 2XXAB 2IUUA 4QOSA 3THYA 1Z06A 2VP5A 2ZR0A 3ZH9B 2R65A 3CB4A 3VMFA 1X3SA 4DCNA 4DSNA 2PJZA 4MYUA 4TYQA 4KVGA 3TVDA 1U9IC 1GRQA 1G3QA 3RC8A 3KX2A 2JJ1D 3U7GA 4M22A 2ZJ5A 2H18A 2ZYUX 4LJYA 1CKEA 3LH5A 2Q9BA 2FEMA 1ZRHA 2ONJA 5FR1A 1KI8A 3NBFA 1ZJ6A 4ZDKA 1QHSA 3ND8A 1DG3A 2GK7A 1YR7A 5KPJA 1OE0A 1HT1E 4A2WA 4DLVA 5BN4A 4JT4A 5JHGB 3QEOA 1NNEA 1JAHA 2ONKA 1HV8A 3CBQA 2HYIC 4XWAA 1N5LA 4LJAA 3K70D 1DBSA 4GNKA 3I5XA 1UM8A 2XXAA 5KPDA 2C9CA 2C96A 3LRPA 2ZI7A 2VA8A 4FCTA 2IYTA 1UEIA 4CEJA 3ZVNA 2V1UA 3LV8A 1VIYA 2PCLA 2H92A 2H8KA 4LJ9A 3BXZA 3HR8A 3FMPB 4XSHA 3NBXX 3X1WA 1G17A 1ZU4A 4DBLC 4OHWA 4XD7A 3AVWA 2P67A 1DO0A 2ZXUA 4QG7A 1HYQA 2BHRA 1G8YA 3KKMA 1G8HA 2NO7A 1FL9A 1N0VC 1E3MA 2RGDA 2P2LA 4HLDA 4U02A 1XD2A 3IBYA 3U3OA 1N25A 2O8CB 2J0UB 2C9OA 3E2IA 4CDGA 1US8A 1FPMA 2X77A 4MQBA 4Q21A 4XJXA 1RRPA 3P4XA 4E09A 2JDIA 3CF0A 3VNVA 2F9LA 3AP2A 3FFBA 4YMTA 2GHIA 1GVNB 1DO2A 4W5WA 4AKHA 2GDJA 4KV9A 3U44A 4M1YA 3TRFA 2ZIAA 2PT5A 3CF2A 5J4KA 2VP2A 4MUBA 1XXHE 1KO4A 2QRZA 2IF0A 3CRMA 2RGGA 4HAYA 4JLJA 1GL7A 4JL8A 4DSUA 1YRAA 4PFSA 4F38A 2ZJOA 5JHHB 1MRNA 5KNCA 3AVYA 4E07A 2G0NA 1W1WA 2CL6X 1OHHD 4Q4HB 2VIIA 1OT3A 2ZI5A 4NDZA 5C46F 2QTFA 4C0HA 2D74A 3O47A 2YKGA 3CUEF 1W5TA 1KSJA 3KUDA 1E9DA 3NH6A 3KKQA 4NCIA 4DEXA 5CB8A 3PJRA 4M9XA 4ARZB 4HLCA 1PLJA 3LO5A 1I4LD 1CR2A 4E03A 2C5LA 2FGJA 1IHUA 5L3SB 5HR5A 2D7CA 1DAEA 2CE2X 2FNAA 4BASA 3ZS9A 2NPFA 3U3RA 1E2MA 2FE4A 2ZE5A 1QG2A 2HLDA 5DHAA 2OXRA 2EWVA 4D2IA 4DIDA 4NZYA 1VHTA 4YDHB 1XF9A 3OAAD 1NN5A 3LDAA 3K9GA 3MWJA 1ZM4A 2XTMA 4Q4HA 1ZIPA 3PUXA 3KJIA 1XTSA 4G0NA 4D26A 3VR2A 2PH1A 3QPWA 1QHYA 2QGNA 4W5HA 5J4LA 1SULA 1U99A 4TQUS 5EXPA 1UF9A 4M0LA 3GPLA 1U90A 1ESNA 1Y3AA 2GILA 2CHVA 5IF9A 1LF0A 1N6HA 4JBYA 4M1WA 1LNZA 2FSHA 1N6RA 2HYDA 3SI7A 5KO2A 1EFRD 2CEAA 4X8HA 3GJ5A 3QUSA 3RRYA 3V9PA 1E2PA 2C78A 3NC1C 4IDHA 4NYJQ 5CDFA 1PZNA 2BIFA 4JLMA 4RD0A 5EZ5A 1O87A 5C18A 4QJ5A 1YQTA 3GFTA 2QN6A 2G0TA 3CX8A 3M0EA 4HAZA 5FI1B 3GEIA 2Q9CA 5B58C 3LW8A 4UQOA 4PPGA 5HZHA 2B7CA 4PO8A 3MAAC 2XITA 4C0KA 4BECA 1ZNXA 3WRXC 1KKLA 1P60A 3ZQJA 3VNUA 3F3YA 3PUYA 2RGCA 4NMMA 1NY5A 4Q1AA 1KO8A 1W46A 4V0OA 1SVKA 1ZM3A 2NQ2C 4GSYA 1PV4A 5C4GB 4AYWA 1ZUNB 2JJ8A 3WNCA 3WNDA 2JLSA 2D06A 1LTQA 4OI4A 2OAP1 2QPOA 2VSFA 3S1AB 3FHTA 1ZD9A 3OEEA 1G4UR 2Z6VA 5K8IA 1E69A 2OCAA 1G3UA 2RHMA 3ZYCA 4I4LA 1G6HA 1R5OA 1YZLA 3L82B 5LBIA 4HLUA 3RS4A 1FMJA 2BCGY 5JRJA 2JA1A 3TIFA 5BXQC 5HE9A 1M7HA 1RYFA 1Z3IX 2OBMA 3KKNA 2HT1A 2K5UA 3BRWD 3H0KA 5IK2D 1E0AA 1KI2A 4X8MA 3UANA 3WY9A 1XP8A 4QC2A 1NLFA 1EK0A 3P27A 5AJZA 2FMXA 3AH8A 2G1KA 2FV8A 3BB1A 4BRWA 3GLFA 1SKQA 1JECA 2R6DA 2H5EA 2VSXA 4XH9B 2E9SA 3ZVRA 4B32A 3CX6A 4YXWD 4LUCA 2WV9A 5KHOC 1DTSA 1SKYB 1AQYA 3BK7A 2IHBA 2YWGA 4ZIRA 3K0FB 2A7QA 4QGHA 1G8FA 3EX7C 2ZVQX 1W2HA 3BH7A 3TAUA 4CYMA 3TJZA 4D4LA 2A5DA 4MUAA 1AJEA 1NBMD 4QM6A 2QBYA 4JZKA 1S96A 4FW9A 4A0GA 3QY0A 1XEWX 3Q85A 1LS1A 3HU1A 4PO1A 2LWIA 2VP4A 2PJRA 2ZSEA 3NDPA 2AXNA 1E4YA 4G5GA 2QM7A 4B3DA 3GLGE 2FFAA 4TL7A 3QPUA 1U8ZA 2NG1A 4C0QC 3THOA 1BO6A 3QXXA 1ZNZA 3GJ7A 1HE1C 2QZ4A 4RVCA 4FMDF 4YMWA 3VR5A 4CT4B 4QBGB 1LY1A 4ASUD 5JS7A 1II8A 2BVNA 3CR8A 3A1TA 5BN3A 1M7BA 2CVFA 3B1WA 1KJYA 1T6NA 3HU2A 3K9HA 3RRNA 3WHLA 3A4MA 1T8TA 2BM1A 4B47A 3ZZTA 4A0RA 4F4JA 2YJTD 3BH6A 4D4JA 1M7GA 3U4QA 3B82A 2VQSA 3C15C 2HF8A 1S8FA 3THWA 2FU5C 3RLFA 2Q9AA 4LPSA 3GLIE 2QAGB 5KUTA 4PZYA 4LYJA 1D5CA 2QORA 3FKSD 1CP2A 121PA 1Z6XA 1ZC3A 2YWEA 2WIAA 2LCFA 3EIHA 5IRCD 4JJKA 4BPBA 2CL0X 1P62B 2CK3D 2JJ2D 3D6TB 2GXSA 1J99A 3OFND 3IPYA 2QP3A 2XJ9A 4BFXA 2CLSA 4HLUC 1CR4A 1JR3A 1SXJC 2REBA 2IS6A 2CDNA 1B0UA 2ZYWX 3PEUA 3T35A 5LDDC 4QNMA 4Q9HA 2C99A 5EZ6B 3LW7A 1GG2A 4PR0A 4BQSA 1NG9A 4M2LA 5AR1A 4YDSA 3CZQA 2N1BA 2QG6A 5JSZB 1E2QA 3X1DA 2WPDD 1YZTA 5KYKA 3EPKA 1KO7A 4IEEA 1PVOA 1VG8A 1WRBA 3U60B 2AKAB 4KAXA 2IA5A 2F3TA 4AYXA 3WXMA 4KYIB 3CW2A 4M4SA 5ELXA 5GJBA 4RD3A 1WA5A 4PPFA 2F6RA 1A4RA 1KK2A 4MGKR 1P9NA 3QF4A 5F9FA 3RANA 1IN7A 1Q20A 2H1LA 4A36A 4MKIA 1ZBDA 4HAWA 5DE3A 4DLZA 4MKFA 1SXJD 2GAOA 2ZJ8A 3BWDD 4MRVA 4P4SB 1NI3A 4LI0A 1XTIA 5HKKA 1BYUA 4QFMA 2GKSA 3L8YA 3VR4A 2AHOA 4PPNA 3B1VA 4XSGA 1M74A 1Q3TA 5JSZA 4Q19A 5FR2A 1F2UA 1UKYA 5C1BA 2EQBA 3T06B 4TT3D 5AWFC 3MFYA 4PC6A 4ERNA 3KKPA 1P2TA 1XTRA 5FL3A 2ZE6A 1GITA 4LJ8A 3AF4A 4Y0VA 4PHHA 1ZUHA 2QY9A 3AVVA 2HJVA 2VH5R 5DIFA 5FPHA 2XJ4A 2FPLA 4WW0A 4C7OB 1DG1G 3B2EA 3LXRA 1COWA 3ND9A 3QBTA 1KSHA 5FH9A 3ETLA 4TSFA 1KYIA 1SVOA 3LBNA 1KO1A 4FIDA 4P4SA 3RWMB 1K5DA 2IK8A 2J45A 3UWKA 1Z29A 1OPXA 5DI3B 5M04A 2HJGA 2HT6A 4KLZA 3X1XA 2REOA 2ZAOA 2FFBA 1TQDA 2QRNA 2JLZA 3CF6R 1GSIA 1E2DA 3AKDA 4YONB 4XVRA 2V7QD 3RS0A 2FZ4A 3OIUA 2FPKA 3SC3A 4KHZA 1G16A 2RB4A 4R2HA 2A5FA 4HB0A 3I3SR 3QI2A 1E79A 2HUPA 1ZC4A 5DLQC 4KXFB 4V03A 5L3VA 4XVUA 4JBWA 3D31A 4TN1A 1MO5A 1KO5A 1GIAA 4CRWB 2CNWA 1U8AA 3UG7A 2FG5A 2GF0A 4DB2A 3PR1A 3KDSE 1G4AE 3P20A 1L8QA 4WXPA 4C7OA 5GADl 221PA 3CONA 3EIQA 4Q7MB 1GAJA 3ZIAD 4DUGA 2O8EB 2C2HA 4HEJA 2P6RA 2REXB 2XAUA 1NIPA 5JI3E 2IS4A 4H9GA 5FBVB 4M9QA 3ZD6A 4FXPA 3IGFA 5EE3A 2CLCX 2CMKA 4KSCA 3NXSA 4NCHA 5BYKA 5AJYA 4ESVA 2XSZD 3OE7A 2IYSA 3BB4A 4FI3C 1XMJA 1NBME 4PHTA 5FTNA 1KHTA 4DZZA 1Q1ZA 2WJYA 3KJGA 4Q4JB 4RD2A 4DCTA 2ZI4A 3MRSA 1UAAA 2OCBA 2X2EA 4US1R 1OH8A 1DAFA 2ZRCA 5L8VA 2IS1A 1P6XA 2N46A 3RC3A 2F43A 1YZQA 2W0MA 4FMCB 2QE7D 4EJSA 1ZD1A 2I1VB 2QNRA 3DZDA 1UEJA 1VG0B 1W0JD 1Q22A 4A92A 4IDQA 1V5WA 1YZNA 4JIMA 3QEJA 4Q4AB 3MWYW 4Q01A 3V4RA 4II7A 2ATVA 3PFIA 2NIPA 2PMDA 3HDTA 1VYTA 1TF7A 2NZJA 4L9SA 3EW9A 3HR7A 3LD9A 2WKRA 4LV6A 2IWHA 1E98A 1YZUA 2B92A 2A5JA 3K0CA 2YOHA 1XD8A 3EZ9A 3HYTA 4OQMA 1N6PA 1P4SA 4GOXA 3VKGA 3AB3A 3D7MA 4URVR 1Q3HA 2XOKD 1ZIOA 2GCPA 3KJHA 5GJCA 3GLIB 2GXAA 2P3SA 1MV5A 1Z0DA 3KXKA 1XCMA 3CWZA 2Z83A 1OYYA 4PTLA 2WKPA 2BV3A 2DWPA 5AJVB 2ZSDA 1G41A 1QBKC 3NBZC 1JJVA 4M1TA 3TSZA 1E1RD 4LHWA 3FMOB 1J70A 2JAQA 4BFYA 2VRWA 2QPAA 4QHYA 1RJ9B 4LY6A 3RSLA 2XTZA 4IW3B 1II0A 1OIXA 3SJCA 1CJKC 1U2RA 2CCJA 2FZLA 4V0NA 4OJQA 2B6HA 1FW6A 3TUJC 2FFHA 1DEKA 2Q3HA 1GL9B 4DHEA 5F98A 1NN0A 4Q18A 2JIZD 4PQYA 3K9NA 1QHIA 1XCPA 2GEUA 2H16A 1QVAA 5FBLB 1U9IA 4QGFA 1RC8A 1H8EA 1VTKA 1OFHA 2YWHA 3CLVA 4JS0A 421PA 1OJLA 3BB3A 5BN5A 3AKEA 1Z6AA 1WDTA 1HA3A 3NDBB 3QXHA 5E7IA 5H68A 1OXVA 1W4BA 2GESA 3CO5A 3QXSA 5FPSA 1RE0A 1Z08A 2IEZA 4PQRA 5KSOA 2WAXA 1CR0A 5CDFE 4G5OA 1VG9B 1AK2A 4Q00A 3SZRA 1U0HC 4PC2A 4KBFA 5EE5B 4EPRA 2ZRFA 1XMVA 3CNOA 1CRQA 3KQUA 3C7KA 1CR1A 3RDPA 1GNQA 3MUFA 1C9KA 1KY3A 2Q6TA 1FQKA 5AUNB 5KSYA 2Q3FA 4WBSA 3IEUA 3QOFA 5TDHA 1F6BA 2D2EA 4NU0A 3TR0A 3KTAA 1FTSA 1DAGA 4A2QA 5DHFA 5FTLA 4FWIB 4JLKA 2XX3A 4PO9A 4RFSA 4RY2A 4TYPA 1X86B 4URZR 2IS2A 2WAYA 4BZXA 1KOFA 4MRRA 4XVQA 3CWQA 3UPUA 4CEIA 1XJ0A 2MSCB 1VYVA 1RRFA 1R0YA 5KDDA 1MT0A 3ZVMA 4KU4A 4BLPA 4DLTA 3THYB 1W7AA 2O0JA 3H2YA 2NO9A 2OXCA 8OHMA 5B2ZA 2G83A 3EWAA 2P65A 2XB4A 3K0EA 4GZLA 2HXYA 4OL0A 1I2MA 3OEHD 1NJGA 1AIPA 2GTPA 2ZR9A 4ZDJA 2FSIA 3WNBA 2WOOA 1XX6A 4TLCA 3WBKA 4Q7LA 1W36D 4AKGA 5E4FA 4L8GA 1CRPA 1PLLA 2NZ8A 4GBMA 4GFDA 4TL8A 2CL7X 4OQLA 4BZQA 1NVWQ 1XU4A 3GLFE 5J5CA 3OAAA 4I1UA 1ETUA 1MO4A 2ZSAA 2ZTSA 2ZS7A 5FOXA 5JRZA 2D62A 4BFTA 3ZS8A 3K0AB 1OIWA 3K70C 1J90A 1T3LA 1YHNA 4OQFA 4UJ3A 1GRRA 2PLFA 5C2JB 1FP7A 1R5NA 2ZS8A 2B7BA 1E6CA 3IO5A 4A8JA 2V6JA 3QE0A 3W5JA 5CM8B 4KFSA 1X8JA 1KAOA 2DFTA 1G21E 1Q12A 1VCMA 1G291 1W0KD 4LJ7A 4CEJB 2CJWB 4B3GA 3FHCB 1QVRA 4HB3A 2BJWA 1Q0UA 2E87A 1EFHA 1UKVY 2IYZA 2WSMA 2ZJ2A 1RIFA 3B9QA 3NTUA 4EPTA 2IYQA 5A0FA 3OESA 3VKHA 3I72A 4XWOA 5IT5A 3A6PC 4D82A 1U0JA 3LLMA 2PT7A 1XD2B 4E22A 3MJRA 2ZPTX 2CLDX 3L2OB 1W4AA 3K0AA 5CYPA 1SKYE 2KWIA 3KXLA 3QF7A 1US8B 4RKEA 3AF0A 1GZSA 5DISB 2YC2C 1EFTA 2ZU0C 4L9WA 2C04A 3BFVA 4AYTA 2G3YA 5SZKB 2IUTA 1FUKA 5CYOA 1VCIA 1X1RA 3PVSA 1SGWA 3PQCA 3U44B 2YV5A 4IOMA 2J3EA 1BKDR 4MH0R 1NN3A 2CJWA 3KKOA 1BS1A 2HCJB 3AEZA 4PAMA 4DLYA 4US2R 1A2BA 3U7HB 4EPVA 3N70A 5CK4A 4JYBA 5DN6A 1P61B 1RZ3A 2OBLA 2WWXA 3W8RA 5J47A 3LAWA 1DELA 1N6OA 1WB9A 1XDBA 3R7WB 1N6LA 4ZDWA 1FP6A 2X2FA 2ZU6A 3W34A 3DMNA 4YMVA 3TUZC 4F93B 1V43A 3EZ6A 3GQBA 2RH5A 5GVRA 4A9AA 2G9NA 5CLQA 3N5CA 3RVBA 1G6OA 5TMPA 1II9A 4TQ9A 1JR3E 4B75A 4BLSA 1DARA 4DSOA 1OH6A 2BKUA 2Z4SA 2G88A 2VEDA 3A58B 2IT1A 1FQJA 4KBGA 5SZJA 4HI0E 3BH0A 1XBTA 1N0WA 1U8YA 2WSSD 2P5TB 1OW3B 5EP4A 2IW3A 2BBTA 2NO0A 4JVSB 5DGXA 4AKIA 3W90A 4DVGA 1CTQA
chains in the Genus database with same CATH superfamily
4TRRA 3PTAA 1S2LA 3MD0A 1SM4A 1GD1O 1VXOA 4Q4CA 4PVCA 1M8PA 2M6RA 3V8BA 3NJ4A 1A9SA 3VVCA 4L2IB 4Y0NA 3SIRA 1HUQA 3FE2A 2XRMA 5KMGA 1VHLA 4MR9B 4A8JC 3DM5A 4GBED 3ITDA 4NBKA 3T3DA 2XA9A 2XCQA 2H07A 4QUJA 1O96A 1MZPA 1PW5A 5KTOA 2Y27A 1U2PA 3BWYA 1ESDA 2F1JA 3GT0A 1CRWG 4Y1RB 3KHUA 4TMVA 4H7EA 3EC2A 2GS9A 1K6XA 3L0ZA 2EYUA 3I5UA 1GUAA 3NWJA 4M1MA 4QBFA 4Q5IA 2UKDA 2VP9A 2FPIB 3CSUA 1GTVA 2YZ7A 5CVTA 2YFYA 3F97A 1N5IA 4FFSA 2FR8A 4MZXA 4HWPA 5A0VA 1D8TA 3O1HB 3LTEA 1I1OA 3E23A 5HZMA 1PDVA 4LECA 3IT1A 1Z8FA 2WZQA 3ZQUA 1SAYA 1Q7RA 2BHTA 3FOWA 5EQTA 3C5WP 3NU1A 2AT1A 1X7HA 4PQGA 4AJ2A 4GVXA 1P7ZA 4JUIA 4XASA 3LPDA 2COUA 4E3ZA 1R0CA 4WERA 5B64A 4QRHA 2J5XA 2OHGA 1FJXA 5EJ2A 3NH9A 3CWCA 5AMXA 4D8TA 2OVFA 3W3AD 5A2GA 1PR5A 1NKVA 1ZLXA 1BHJA 3PITA 4U2EA 4J9VA 1X7GA 4UM9D 2IH4A 5KYGA 1ZISA 3PGXA 4WAUA 3UYKA 3VBCA 1Y81A 2WC1A 1KH2A 2NVBA 2ODBA 2PKWA 3KQSA 5EE9A 1O9HA 2Q5QA 3UXEA 2B4AA 4FBMA 4C4PA 1SEPA 2XKJE 3A1EA 4L4UA 5LZ7A 3VZQA 1UBKS 2PYDA 2PZBA 3AW9A 3HCBA 4LBVA 5CD1A 3DDCA 4PAWA 2WA1A 4RJJA 4XQGA 4ZPJA 2Q4BA 4Q9LA 5JEEA 4V2IA 3DXYA 3VFDA 4ZJUA 1THGA 4G5SA 1RPZA 1YDWA 3CG4A 3PD7A 2TS1A 2H2HA 3DE1X 1UQUA 4ISCA 5JBIA 2V7EA 3MD9A 2RE8A 3L9XA 2AOUB 1BWSA 3BORA 2ZKIA 3D8SA 1CUBA 2WWRA 3B20A 3KL4A 3PNLA 4PPYA 3EMVA 3CCBA 1RKVA 4RWEA 5IXYA 1U0GA 2H4JA 4LKOA 4YWHA 1MX3A 1GNRA 1R5JA 2GZAA 1OH7A 2QTBA 1ZSVA 3WTBA 2Y99A 2JHFA 2GF9A 2FFQA 3P9YA 1ECFA 3NRJA 4E21A 5KWVA 3QNWA 4MUXA 1EGQA 1XWWA 4B3XA 3GLFB 2BONA 2YQZA 3UMCA 4Z0TA 4YJFA 3PQ4A 5K3SA 2LKDA 1VLZA 1FXWA 3BHNA 4L08A 3SS8A 3K73O 5JQWA 3OBBA 1RI3A 4ZA2A 3OZSA 4GP6A 1XAGA 2QTZA 5L3RA 2QTVB 4FD2A 4N5NA 4D4KA 5IULC 2ZRLA 3T6KA 3W0LB 1AOXA 2FN8A 1VXRA 4D9NA 2GA8A 3ZW8A 1J8MF 3JAKA 4EA6A 2XB6A 5TEVA 2YFKA 1WPRA 3WL8A 1FTGA 3FVQA 5JYDA 5CCBA 2WJ4A 4IUDS 4D41A 1WCXA 1NATA 3LA6A 4E32A 3AHFA 1JWAB 3SFVA 4DRXB 4E12A 3AEXA 4UBJA 3NYWA 2O52A 2PZFA 4GR9A 4N76A 4IKEA 4X41A 4YT8A 1PGPA 3R0XA 1GTL1 4QWWA 1P0PA 1PEYA 2FFJA 2WWGA 1BXRB 4WZ6A 1EESA 3G9TA 4UDYX 1GGVA 4JI0B 1XJQA 5BWBA 3D2LA 1RJEA 3GLKA 4GGOA 4GNRA 4HGYA 3HDQA 1II8B 4RVDA 5EWLA 1T8RA 2ZTMA 2AD5A 1SD1A 1GPNA 2HZBA 3H9BA 3LPAA 4K3VA 2IODA 4L7QA 5G1NA 3WFIA 5BN3B 3T34A 4AJKA 4GE0A 3PGKA 4OOEA 4X6XA 4P0PB 1OZGA 1WMEA 2DU8A 3GOHA 3HPQA 3NBYC 5EAIA 4ZO7A 3UO8B 1GXSB 1V7ZA 3R41A 4I5EA 1G98A 4J0CA 5JJBA 2IIQA 3TZQA 3VO8A 6Q21A 4BMZA 1ZOSA 5DTQA 3ZY3A 4ALLA 1TX4B 3SOPA 3BMOB 4KN9S 1G5PA 1EDOA 2I4RA 4ME6A 3IEXA 3THWB 3B1ZA 4BOYA 2Z5GA 3RT1A 4DG5A 1RAIA 3R3HA 4QXOA 4J91A 4NU8X 3QM1A 4JI1B 3C6YA 1CIVA 1CJTC 3QWHA 1TKRA 2XGMA 1NJ1A 3MXTA 3QKWA 4C1BA 5F1OA 3R2JA 4OJKA 3AKCA 1M2OB 1VE1A 5E7MA 2XEXA 3GPDG 2VI5A 2X2OA 3T1QA 4JVLA 4AJ4A 2VDWB 1HQCA 1SMKA 4K0KB 2P0YA 1H2BA 2GT1A 5KNCD 4KQ2A 4Q05A 1NN1A 5T3UA 2IHYA 3MGCA 4K9OA 1VKRA 1I10A 4DCGA 1P45A 3T9BA 4NBLA 1KMHA 1N7IA 4A8TA 4O4IF 3HBAA 4TKMA 5EE1A 2ERYA 2ZIGA 3NW9A 3GA5A 4YUXA 4F6RB 3BCSA 2ZTVA 1DT3A 5HUJA 1RQ7A 2ATIA 1O03A 2P5SA 2H54A 1GR1A 2HC9A 4IBOA 5ABPA 5LQAA 4GC5A 1GPDG 1JHAA 1TU3A 4A5OA 4UNIA 5HBGA 1QF6A 3WK5A 5LQSA 2W2PA 4CM6A 3QENA 3L6DA 3GMSA 3CBGA 5SYMA 1UDAA 1H5NA 1UKZA 2P3QA 1A9YA 4JKIA 1FDWA 1C9DB 4ZEXA 2BEWB 5I6DA 4PO3X 1P9RA 3TZBA 2F8LA 1VIVA 3AYXB 1V1JA 1MKYA 4C9BA 4MKGA 3S70A 4KNYA 3IODA 1TFRA 1C29B 1QC5B 4ENPA 3DE2X 1LTHR 4D25A 3TW0A 4F12A 5J1SB 2VHEA 1GNLA 3NPMA 1UAYA 3NM6B 2MSLA 4OSPA 5T4BA 1DXHA 5C7YA 5EWJB 5JWRA 3G82C 1ODFA 4HBZA 4HGRA 2W6JA 5CM9C 5DGIA 1E0KA 3HFJA 2DUMA 1SHUX 5L3QA 3KQQA 1KJ9A 1A1SA 2JFGA 3OZWA 3BIOA 1WXDA 2IYVA 3HJHA 3QVOA 3WRVA 5IT4A 4DIOA 3H5AA 1QX3A 5BQ5A 2O20A 5FWAA 5J5AA 2VN8A 3EVNA 1Z0JA 2BMEA 2C2MA 2VJCA 5EC8A 4ZCPA 3TKYA 3C3KA 4DCVA 5ILOA 5F51A 5A5FA 4QPPA 4KIFA 4IYRA 4UXJA 2QTGA 3U9TA 1MA3A 3KYCB 1XLVA 4OHUA 5KWJA 1F4VA 1K08A 1VJRA 2WAMA 2FUNB 4TTQA 5K0NA 4JJFA 2NTYC 3SXUA 1MJNA 2AFIE 4PN3A 4W5OA 5EZYA 2PUCA 1UBGA 2HLHA 1NLYA 3EN0A 4J0DA 3UF0A 3R44A 2WU0A 3EEBA 4YUAA 1UPCA 7MHTA 2J9YB 2WKQA 3QLVA 4RVOA 1IONA 4UD6A 4ALKA 3NBAA 4L85A 2PLRA 1PJRA 3F5FA 4I1YA 4WNYA 2JCVA 2G17A 1VE3A 3R3XA 1TA4A 4M0PA 4U2BA 5P21A 4NKRA 3LVBA 1OVGA 3UXMA 3WIVA 3EGVA 5IANA 3OZIA 3OCYA 3ZG6A 3ESDA 4XDZA 5F35A 4O2LA 3UUFA 1FZQA 1P7CA 3NCHA 4HOYA 4O29A 2YY6A 5BSHA 3KSAC 1G5RA 2PRKA 3A32A 4HRVA 4HS4A 3ETJA 3UWSA 1HH4A 1VBKA 2VQDA 2WYHA 3GVXA 1IJBA 2GHQA 4LYDA 4J76A 3STYA 2UUPA 4JCOA 5BXYA 2IDMA 3W1WA 3I34X 2TMKA 4A1OA 4CMGA 1E3JA 3H1TA 4OGFA 5TQJA 2QQ0A 2W4IA 5B36A 3ONDA 2G1UA 3OWHA 4PIMA 4UFPA 2FPGB 5B1SA 1RXIA 3G1UA 1BCRA 3ZXIA 3GCGA 1X6VA 5T57A 4ZYUA 1ENZA 2D54A 4EKGA 4V3BA 5AI4A 3WGUA 5B6JA 1Q84A 3OT4A 2V4MA 4JYAB 1FW8A 1S1CA 5AXDA 2Z2YA 3V5NA 3A2NA 5FPKA 4B6FA 4N40A 4GYYA 2MJLA 4OI1A 3IB3A 3ROKA 4JDPA 3SQDA 2HA5A 2JRCA 4MW4A 1OTXA 3RS7A 1WMFA 3H2GA 5IVKA 4DPLA 1T9GR 1IIRA 2HDNB 2BOVA 4PAQA 2D1QA 1CSEE 2II6A 3ZHSA 3VZPA 1B42A 4A03A 1R8JA 4MB6A 1U5BB 1P2UA 1KDRA 4RKQA 2QT0A 4MS1B 5M2QA 4X7RA 2NSDA 4O59O 4R68A 2GAIA 4HDAA 4RXUA 3IVGA 2EBUA 3LKZA 1FXUA 4MDFA 3VHXB 1LTKA 2ZWOA 3RK4A 2DBRA 1RYHA 1Z22A 2CFOA 2OKCA 2WMYA 1A69A 3E7PA 2F1RA 1CDEA 1RM3A 1PQUA 1F4LA 3ZZ0A 1RRCA 4RIIA 2ORIA 5TC4A 2R44A 3M6LA 3F67A 1C9YA 4ND5A 5HCIA 3PICA 2EGHA 5F2KA 4RTQA 3T5AA 2A3NA 3V8MA 2DH5A 4MDHA 3L8CA 5BMVA 1E3DA 2AYZA 2PQ0A 4U2DA 1BYIA 3PIDA 5CA0B 2H4YA 3OU7A 4ZKDA 1T24A 1N3LA 1VBMA 2JFYA 1E1YA 3DAGA 4C4SA 1A82A 5KOHB 3BBPA 3SYKA 4IQ8A 2J30A 5F1YA 3UTDA 3UIEA 3D6MA 1VSQA 3RIEA 4QEKA 1X80A 3JZFA 2QTTA 3NV7A 2R48A 1NVFA 4X90A 1EVZA 3JD2A 2E1RA 2RH8A 2QTNA 1Y8QA 2YRXA 3IVCA 5JASA 5CJPA 1L5FA 3N0XA 5F3DA 3AI1A 4KRFA 3NRCA 4LFBB 2E1PA 4B82A 4WFQA 2ZRBA 5DYIA 3VO1A 1DC7A 1CE8A 1H94A 1IY1A 1EHYA 1OASA 2IZ7A 3RVNA 1PEAA 3AR2A 4JHLA 1I30A 5JNVA 1AMOA 2QAGC 1LFAA 2GN0A 3C6KA 4XUGB 1VECA 3MOIA 3FPKA 3L49A 4Y1EA 4BFUA 2DPGA 5J2TB 1OAAA 1Z6TA 3L4KA 3WL6A 1XMQB 1ZUD1 3LCCA 4MB0A 4LV8B 4Q1EA 3V7UA 2VTKA 4FFBB 2XKKA 3U9LA 3CTPA 1ADFA 1Y8RB 1QE5A 3PVZA 4U7GA 4MUKA 2IYEA 4FJ2A 1PX2A 3DOCA 3FMIA 4D56A 1VQ1A 2OL4A 2D7JA 3IDSA 4MUIA 3VKWA 4XQ0A 4C2AA 3PRHA 4TT8A 5KNBA 2ECPA 4JWTA 4JSYA 2N3ZA 1RXYA 3FYUB 3OF2A 2IHVA 2YOGA 3ZU4A 3O8QB 4FGLA 4G1CA 5FTJA 3HYNA 4HRXA 1JR3D 3K32A 3MWEB 4BNYA 4Z6KA 1OJ7A 1CY1A 2XYQA 3PT5A 4HWKA 4CTNA 5JS8A 4RA9A 2DPHA 1T0HB 3ICEA 1R4MA 4DV7B 2DPMA 3DQPA 3FIJA 4Q3NA 5FUVA 2VRBA 3HS3A 1L4EA 2XMGA 1RE1A 3DV2A 3PNBA 3MT7A 2EVWX 2R6HA 3DZIA 5DM1A 3A3YA 1P73A 2AOWA 3OX1A 2ZYVX 4AX8A 4EJ2A 1WBDA 4LYHA 2HF2A 1N6NA 4W9NA 1ZOOA 1ZEMA 2R11A 4QUAA 1DAIA 1I1HA 1VSTA 2EW1A 2R6CA 1AXGA 2P9ZA 2X40A 5A6SA 1WSWA 3OU2A 4ZYVA 4JYMA 4YRFA 2J0VA 4D6PA 2AW3A 3PJDA 4PFQA 4B8ZA 3AM1A 3GFRA 4EHJA 1PKEA 1FTWA 2BUCA 2QSUA 2XNDD 3AZQA 4NPHA 4R9RA 5EESA 2UZIR 1GSAA 3BKWA 3WLHA 3DBRA 1MABA 4RORA 1KJNA 4BE7B 4KSYA 2UYOA 1QXSA 3CLHA 4GXTA 3TXXA 4EJMA 2CXNA 4KIUA 1MTZA 4C7MA 4ZV4A 1Z5OA 4DKXA 2AFHA 5CUQA 4BX9A 2YWRA 4S2UA 5LBUA 3LUJA 5KHAA 1SKMA 1V9SA 2UYHA 4OFXA 5B2EA 1UODA 3L40A 3TS1A 3RYTC 3L41A 5E0OA 3QSYA 2EFHB 3NWBA 5HKKD 2WJGA 2QP4A 2X4LA 4HAIA 5C31A 1O8CA 4I4TA 1NHGA 2I2XB 3CRVA 1M2WA 9LDTA 5J4VA 1DX9A 2FPXA 4Q9JA 2ODQA 5LMNB 1SPXA 2ZYDA 3I2KA 3QWAA 3MLBA 1JYEA 3WSWA 1MRZA 3RABA 2OAQ1 2Y0DA 2X7JA 4NYIR 4CEIB 1JVNA 4IF4A 2O0LA 1JN0A 4O5OA 4R8VA 3N0VA 2ZOSA 2O5EA 5FULA 5BUQA 4LHVA 4QHSA 1JHPA 4YCJA 1DEOA 1SO8A 4NONA 3O92A 2A9QA 1QRAA 1PZFA 4FZJA 2B4QA 2O4CA 3GLQA 4ZU6X 1CLUA 5EMHA 2IP4A 4GOND 5BWNA 3OOYA 2I3BA 4ZI7A 3P5BA 3O03A 1GEEA 4P31A 4NEGA 4YJ2B 2IV2X 3WWYA 4EA8A 5B1YA 2EFJA 1V16A 2FQ1A 4QQRA 1NRXA 1S0UA 3ETGA 3LQRA 1DUSA 4HYYA 3EEFA 4LMBA 4B7CA 4Q12A 1QH9A 4K9RA 2GXQA 5KYUA 3OIVA 3VPBA 3KZ1E 1NWCA 1PJLA 3AT1A 2AEEA 4RDCA 1KRXA 2EKLA 2FSGA 2QRKA 5D3QA 4TTPA 4LRUA 2A1IA 2B83A 5DEIA 4LVNA 3RB8A 4B76A 3FNBA 1Z75A 4ZI2A 1XZPA 3DVLA 4DDTA 3W2FA 4JL6A 5DK4A 4PZDA 1SBQA 5EUMA 1NAHA 1T3TA 3EMDA 3FR7A 4JUAA 4PQFA 4YI3A 1MHPA 3RJ9A 3SM3A 4A8JB 621PA 1R0ZA 4LISA 5KNDH 2QW1A 1MH1A 5KKAA 2CW5A 4IDPA 1YQXA 1S2OA 3KT3A 3JD4A 1YGPA 4KCGA 3LWZA 5K3FA 2YUIA 3BCHA 3PKJA 1Q11A 3ZLJA 4GT1A 1KIMA 4TLMB 5BNWA 2ZTHA 2FQQA 1JTEA 3C41J 4MYTA 2ZRHA 4OHVA 4BFCA 1R18A 1X39A 2JATA 3DTVB 4GPTA 5TSDA 3K15A 3LHIA 5JATA 4IGIA 4KQMA 1V5FA 2COEA 4KLAA 2ZBEA 4LWQA 2A88A 3OM8A 1QLHA 1X87A 2CFIA 2PAAA 2CFSA 5JLJA 4C6RA 4A0HA 2X3FA 1QZ3A 2O1EA 1VPLA 4ND1A 2BR3A 4ZO6A 5IN5A 2ZB7A 2I3AA 1FSGA 3G8DA 1NF8A 4GQIA 1IZYA 2FEOA 4JODA 1YB2A 5CEFA 1X1QA 5DFAA 4RX1A 4ZVMA 1MJGA 1OA1A 3MIIA 3BMNA 2IXGA 1QRSA 3NIBA 4JR1A 1MJ5A 3IILA 4YX9A 4FZ3A 2AF3C 1Q1QA 2ZANA 2F1IA 1E1KA 4HFJA 3ZU2A 3TTSA 1IHOA 2WDZA 5JEDA 5ERXA 4P4UA 5IUNC 1A7KA 4GI7A 1C7ZA 3VMMA 1L8OA 3GH3A 1ZZEA 3PXGA 3AVUA 2GBCA 3AR4A 1AZWA 4K5QA 4Y6QA 2WQZA 2DFKB 4C05A 1QZUA 5SZHB 5AW0A 3AV0B 4DM4A 2WMDA 4L0DA 1XZAA 4F4IA 3C74A 3FB4A 5LU8A 4AIIA 3CH7A 1KEKA 1KQ3A 2FAXA 3DE0X 3H99A 4QBHA 1VBFA 4IIXA 2N9UA 5EMJA 1TO1E 3DFZA 1W88B 1Y8AA 4A6PA 3AHGA 1M0SA 3FGPA 3LMKA 4RZUA 5CLGA 1AUXA 5LB2A 3W5CA 2XF2A 1S2IA 3A6LA 1KPHA 2ZXFA 2JGNA 3AIKA 1X1AA 1NVAA 3L8HA 2QQFA 1DQRA 4GOKA 5ADHA 1SHKA 1E3IA 5JCPA 1VJCA 2EDAA 5DM2A 2TSYB 4ER7A 2H1HA 1ZITA 1QFXA 4GMKA 2YXPX 3T52A 2I7CA 2OFXA 2VTVA 3QX9A 2C8VA 3MM4A 2P6OA 1BMQA 1X19A 1XN1A 3FSRA 3RLIA 4P5EA 5JZSA 1ISSA 5CDGA 4UNQA 4ML3A 2B8WA 4TTRA 5CVDA 4GL4A 2DFVA 5BN1A 5B58T 3ZWBA 4N5MA 3S3TA 3ZHUA 4M76B 1F48A 3FGNA 2XB2A 4UBMA 1BW9A 1EXMA 2YN0A 2YZ2A 2R7AA 5IK2A 1HFKA 3TCKA 1ZXXA 5DHSA 1XPRA 2YASA 3ZYZA 4NTZA 1IATA 4HDNB 3SCZA 1ZMBA 1R2QA 3COVA 4XUCA 3CPHA 1MOSA 2K2QB 2VK8A 3MC1A 2QT1A 4M60A 2B4YA 5IBRA 3SJAA 3ZIUA 4C3VA 4CQMA 1BOOA 4FD3A 5ALRA 3AP1A 1AD2A 4A7PA 3PC4A 2HO5A 1EUCA 1XEWY 2HRDA 5U9CA 1ND5A 4Y67A 5AVYA 2OV2A 2JC3A 4X8LA 3GLRA 5KOJA 3SBXA 2GJ9A 2XVYA 1WHSA 4YI5A 1CZUA 4FDAA 2BDTA 5HK9A 4FR2A 1FTNA 1NBMA 4OXRA 2NU7B 1CZLA 3M3DA 1ZGCA 3WWPA 4E1VA 2R87A 3M4JA 4CV0A 4DNPA 4HSEA 4QREA 1C4OA 1XZGA 3F98A 3GHHA 3Q7PA 4KBYA 2IHKA 5IC4A 1IXRC 3K2IA 4QD3A 4UNNA 2XCTB 2UUAB 5DTRA 3QYAA 5P8WA 3T9FA 1N36B 3GFPA 3CG0A 1RYDA 3I23A 4ILEA 4LCEA 4U9IS 1SVWA 2YXLA 1ECBA 1L4NA 1UFOA 2O8NA 4N0QA 2QG4A 3AETA 4C4RA 3UJ3X 3X0DA 1AKVA 4F56A 1EI9A 2Q5HA 3DWFA 4H7HA 4O1MA 4RA6A 4Y9DA 4IGKA 1JB9A 3QVTA 1XD9A 1YC2A 3KJNA 4BP8A 4FYMA 2QWXA 3JRNA 2R2GA 4MUHA 1F8YA 3KSUA 4V0LA 4C4OA 5CFZA 3DOHA 5GGXA 3IYLW 3U7EB 2QZPA 4HNRA 2NPOA 2PU7A 1TDJA 5ALTA 2C42A 1XTVA 1TQ4A 2J48A 3PI7A 2WF9A 2RGNC 3UCXA 3JATA 2HF9A 2I0FA 3FOZA 1Q0TA 4HDRB 2G67A 1ORDA 1T3HA 4ZEWA 3LUFA 5H70A 5T6MA 3GFFA 3U31A 1P81A 3FYSA 1L3CA 2JIDA 3M5DA 2GAAA 2L42A 1LCIA 3KQNA 3QKRB 4HWGA 4CG0A 4UXIA 4TZ6A 3M6MD 3SKYA 1AGRA 3CV3A 4RNDB 2DULA 5BVGB 1JPVA 3D4LA 2HXGA 3WDMA 2AMVA 5ELMA 3AOGA 1LJLA 4YA6A 3R8FA 2QTHA 3D4NA 3LP6A 2Y0CA 2BI7A 3AU8A 3GFSA 1VIMA 3N6VA 2EIHA 2C0PA 3D6UA 3GRCA 3R3SA 4M88A 1QYVA 2PIAA 1NW5A 3WK8A 1X9HA 4MCJA 3DMDA 1A8SA 3EQZA 1EA5A 1IB0A 1RLUA 3QEMB 4MITA 1QV9A 1XWIA 5B5SA 3TW4A 3IE1A 1QPBA 3LUDA 4H17A 4U9UA 5HIJA 4M21A 1SQGA 1DX4A 1DKOA 2VDOB 3Q0IA 4FYWA 1BVHA 2C95A 2VVTA 1U3FA 4PLYA 3ZQ6A 4M1SA 4J3FA 2R68A 3OJCA 4F1JA 1JSLA 2GD2A 4B4UA 2XA2A 4K9PA 5KNDA 2WPDA 1JU4A 3KKZA 2QMHA 3IAFA 3MQFA 3RIHA 1UT8A 4JJIA 3ONFA 1X8XA 4FGUA 4X1KA 1OPRA 4J4TA 1XPUA 5K2MA 4ZQIA 2VJAA 3H9JA 4QG3A 1JA9A 5I5EA 2YYSA 2ZBGA 3IP8A 4D46A 3OKCA 5JY1A 1P75A 1G8PA 1GPLA 3KSZO 2R8YA 3PDJA 4HY3A 1TU4A 2EKDA 4E5NA 3R3UA 2FR0A 3I9KA 4RMHA 4F2DA 1BDIA 1GA6A 2XUOA 2G70A 3GJ6A 4BNFA 4OQZA 1SC4A 4NBWA 3PGJA 1NKTA 3H8WA 5JFGA 4OQYA 4UUBA 3WDSA 2JARA 4BP1A 4H60A 1W49A 2D4AA 3Q8XB 4LHZA 4B8WA 1K6EA 1HO3A 4YR9A 3E61A 3K4PA 5G4LA 2C7RA 4FVTA 3I42A 5HRAA 2O8DA 1A9PA 3EWIA 1G5IA 1GRCA 2XKAA 3MCZA 1XNJA 3P9KA 1JBQA 2GPSA 3UFXB 1FZTA 2OE2A 2OBFA 3FBGA 3N07A 3HN2A 1NW9B 3T5DA 4QULA 3E58A 2BDEA 3WNQA 4NH0A 4C04A 4TT3A 2EFYA 2A9PA 2GB4A 4NG5A 3UW3A 4PG4A 5HJ2A 4W1SA 3QXGA 3PPYA 3W8FA 1WPGA 3VVLA 3SHQA 3Q72A 2AUNA 1WVIA 4ZQGA 4NU5A 4EMBA 1C1XA 1NQWA 1UCFA 2R60A 1XA3A 3ICVA 3IRVA 3OLQA 3DAHA 5AOAA 5TY0A 1VGQA 2GRJA 1ZGAA 3GLHE 4LXIA 3ZGZA 1RHQA 1X1SA 2XZTA 4F11A 1VPDA 3SVTA 2WWWA 3E15A 5J1TB 4Z8XA 2XA1A 2R5WA 4J0HA 5C5DA 4MR8A 1M2VB 4EQ6B 4LY0A 2RARA 1ZDMA 5J63A 4DM7A 1MO2A 1WU7A 1YVUA 3AV3A 4P32A 5AVQA 5FTMA 4OHKA 5AKEA 2JIOA 4OP2A 2V7QA 4CUZA 1RYZA 3A3PA 3R8XA 2BW0A 3HC7A 3FDZA 1UJ4A 4OFZA 4JAVC 1TMYA 1JG7A 4KO1S 4S2EA 5DRYA 3GDFA 1Y98A 3NP9A 4LGMA 1DJOA 2AZ4A 4M7OA 3VYVA 4BEWA 3IQEA 2DY1A 3HKDA 3R0VA 4H0NA 1NVVR 2GZHA 4ILKA 1T9DA 1Y33E 1E3TA 4ND8A 2ORED 5D84A 3SYNA 3PI6A 1T8UA 2JANA 2PGLA 3N8KA 4HQ6A 3BJRA 2A35A 1FBTA 5AKHA 4JLPA 2YV2A 1U2GC 4RHFA 4U7TB 2GCOB 3OLWA 3GGGA 3O8LA 5KVQA 1HYBA 4BNNA 2GRUA 3RBZA 2HXSA 4L16A 3U3JA 3W1VA 3JARA 3DC7A 3F5MA 2DSNA 2YY7A 1NXXA 3ABZA 1IWBB 4DDMA 5C9ZA 3PXEA 5A05A 4BVKA 4PCUA 4DA8A 3QIAA 4BTEA 4WY2A 4R0VA 4EVIA 1QIDA 4EFMA 2UZ3A 3F7TA 1YQ9A 3WIDA 1J42A 1ZK2A 3OQJA 4H3VA 3HXKA 5DO9A 4C7VA 2XSZA 1NXWA 1F14A 3O8BA 3K0FA 2RONA 4K1LA 5T8KA 4CT5A 3PUVA 4D0SA 2XGOA 1JKXA 1UBSB 2G5PA 4IZHA 1M0TA 2ZUSA 3CEJA 4YEDA 4WKGA 1YUBA 4KITB 3OPQA 1PS8A 3CH5A 3A25A 3VZSA 2C2YA 4CWAA 5AVVA 1YQEA 4E14A 1YHYA 3W04A 4PXSA 3IQGX 1E9VA 1UXJA 2BGTA 2W6NA 1AZSC 3HNPA 3A1WA 3HBMA 3PFKA 4IIYA 4QL3A 1NBHA 2VBGA 2JHPA 1Z39A 3GNLA 2IV7A 1EXWA 4MULA 1XXHB 2ANBA 4PYIA 4WLVA 5EA2A 4AKTA 3MHTA 1DBVO 1WDLA 2G06A 1KYZA 4GKVA 3L0YA 1Z7YA 3IMKA 4HADA 4MV0A 4PG7A 4PZCA 5THQA 4B7XA 1T5IA 4OHBA 4WLOA 1V0JA 2H06A 3TTVA 3PL1A 1T9ZA 1BEUB 1K9VF 1MX1A 1W2GA 2Z4RA 4FSDA 4ITUA 5EIOA 5J2UB 1G5HA 3B9BA 3PRJA 5LYYA 3VPGA 5C8ZA 1NBEA 5K8LA 3DL7A 3BK2A 1CBUA 3DHWC 3H0EA 1GL3A 1LJ8A 2O2DA 2BFMA 2IPAB 5LQKA 3P0RA 3HCEA 1H1LB 2PPVA 3DVAB 4WXYB 4AWAA 3AIIA 3Q40A 5EXDA 5E3HA 4URXR 2F17A 5JZVA 3A9WA 5EP2A 2BGKA 1DDGA 1EFPB 2KSQA 3STVA 1LZLA 2QYSA 2OLEA 3U17A 1E9EA 2C59A 1MX5A 2OZEA 3IUBA 1X13A 5GZ6A 1KWKA 2DTDA 3OE5A 3JQFA 1QPZA 1MO3A 2YFHA 3B1XA 4IHJF 4X0EA 1IFXA 4UCWA 3COWA 2I4OA 4MAAA 1X8LA 4MQEB 4PNHA 2BTQB 2SCUA 5UKDA 4OVKA 3T9CA 3O9ZA 4LK3A 3E3LA 4YS6A 2Q2NA 1U0OC 3ANMA 3AY0A 1N8TA 3RH0A 2Y1WA 2PT9A 4RD4A 1OQAA 2J33A 3DUFB 4UUMA 5CB4F 3AFHA 3LVRE 4NU6A 3ASUA 3GAFA 5LP1A 3DBVO 4IAOA 3Q4GA 5TT0A 4E08A 1YZGA 3E5MA 4JENA 3PXDA 4E33A 3TM5A 3AX6A 3KSBC 3G13A 3E82A 2JIZA 1CUWA 4LHXA 4KWHA 4EAQA 4EY4A 3BJIC 4BMVA 4ZVPA 3VX3A 1F38A 4HR7A 4BNWA 3KQMA 4Q7JB 4NSNA 2ZSUA 2YW9A 3QOWA 1ZU5A 4CIAA 1C14A 1XPJA 3L0CA 4PIVA 5H16A 4EJ6A 3FGZA 3GEHA 2HUNA 4XAQA 4NOMA 5DNDA 5ULLA 2F7SA 3EXFB 3T8YA 3TQFA 2C29D 4RSHA 4DLSA 1MAVA 2AWNA 1KRHA 3EZNA 3THSA 5H8WA 2P2SA 2O2ZA 4Z9YA 1VLLA 3R9XA 2VF4X 3LC2O 2AN9A 4DQDA 2QSJA 5L7WA 4NCKA 1YR9A 2VNAA 4HNSA 2VRCA 4Q4LA 3T3GA 3UV7A 3NUQA 4LE2A 4GEGA 2ZRNA 3GDOA 4CKXA 1UMDB 5CDSA 3KYDB 2GLXA 3THXB 2DBZA 2G8NA 2YWCA 4W82A 2R5FA 1T6ZA 1U3CA 2GCIA 2XCLA 3QELA 1MZVA 1L5GB 1L1FA 3S40A 4ZMRA 1RXWA 1U02A 1VFPA 3V2UA 1YVEI 3RHZA 2IZZA 3SYRA 3D3JA 1O6ZA 2W48A 4RVHA 2RHLA 1J33A 1TMGE 4UEQA 3RSGA 5CJ2A 1BFUA 5ITVA 1T5SA 1I2DA 3MS7A 4GLBA 4NZZA 1YNSA 5DSTA 1K1EA 1CUGA 2YXBA 4W5NA 2AI2A 3UB3A 2NZ2A 4RMNA 5IF3A 3SLKA 3QXJA 4KQGA 3EGIA 4NP6A 1G1MA 1VIAA 3TQTA 2P5YA 3MUEA 5CURA 2EKZA 1OF1A 2OXIA 4RD6A 1L4UA 4QJIA 4WCFC 4D6XA 3GJQA 4RWZA 2JK0A 1QGAA 1S8NA 3IBCA 4QYIB 3LBIA 1XFDA 2UZ4A 4AN4A 2ZJ6A 4Y6PA 5JSQA 1MX9A 1H2WA 1KEUA 2W0SA 2DOKA 3AVQA 2ZRAA 5AKZA 1L7AA 5JAHA 1HMYA 5KNLA 1QRUA 2HO4A 1HE8B 2HRRA 1X1CA 1W75A 721PA 1E2KA 1G2IA 3DCIA 2AHRA 2Q5LA 2E5LB 4NOLA 3ANTA 4IJ5A 2BEUB 1UBCA 4NBRA 2Q6LA 1JU9A 2CVPA 5LVAA 4I99A 5EVJA 3HWSA 3LXMA 4CIVA 1ZH0A 3SPXA 1J9GA 5K6TA 2LDXA 4I50A 1A0OA 1TVKB 5CVCA 1IM8A 2H48A 3PQ7A 1QYDA 4OH1A 2J6CA 3N74A 3QRWA 3AIOA 3KFXA 2Q5FA 3G02A 3OCVA 4CE6A 4CNQA 4XGRA 4QXPA 4FEGA 1ITZA 3SJZA 5IDXA 5LP6B 5DM60 3O2JA 4TV9A 1FDRA 1MB4A 1R16A 5TMBA 3FWZA 4P33A 2GPYA 1QTQA 1XB2A 3H7IA 4MPRA 4S0XA 4GYKA 5KAPA 4L27A 4IFTA 3DE7X 1TYEB 4FJ0A 3DO5A 3BSSA 4P36A 4KIGA 4QIHA 3CFYA 1W581 4DNQA 4ODIA 3GLGB 3NTLA 1Z0AA 4TMWA 1YK0A 5LA6B 4ZHSA 3SSOA 1TCAA 2Q3CA 4N49A 1J06A 4H16A 2RGXA 2W6JD 4IRMA 3ELUA 2O8EA 4DT1A 3T0IA 3B60A 2R2AA 2P2DA 5FT9A 2WJIA 2XVMA 3HCCA 3L79A 3K8QA 3OQIB 4MEJA 1XVIA 3CRQA 3LXXA 5ED0A 3F73A 4LDRA 3A2KA 2J4DA 1E5XA 1B6RA 1A5SB 1WZUA 1E6WA 4X60A 4F85A 3H87A 5ALMA 3I58A 2GMWA 1KI1A 3I9OA 3N39C 4BMCA 3M4ZA 1OFGA 1XQ6A 4QX6A 4LQCA 2O6HA 1UC4B 1MP0A 3UENA 4Q4JA 3WLEA 4D3XA 2NZWA 5ESWA 3REGA 3CURA 3WIBA 2LV8A 1GO2A 4QOHA 1C8LA 5D3KA 2JLYA 2PEYA 1SBTA 4ZAZA 3DZJA 5CB6A 2CV2A 3E1GA 3AM5A 3I1FA 1C7RA 1KI7A 3U2QA 2XYVA 4QDUA 3W6NA 5EHXA 5KTKA 1WKCA 3JWIA 1IAQA 1KKMA 1EB9A 4XPZA 1YASA 3H9UA 1FDOA 1S8AA 1SZDA 2H11A 2J08A 1FNBA 5EZQA 3AR8A 3FSEA 1BZYA 3R5HA 5FFNA 1KK0A 2R8BA 2J09A 2TMDA 1LBSA 1SVSA 2I5PO 3OJXA 3H17A 1Y1QA 2BGNA 2JCYA 4J29A 4UVIA 4KR9A 4ERXA 3FNFA 3JASB 5A6VA 2VP0A 3KPJA 4E2YA 4KRYA 3SY8A 2YHIB 3N7AA 2V8OA 2IOFA 2IJGX 3C3AA 1CFZA 1LDGA 4DPMA 1YJBA 4MCAA 5C1OA 1R9JA 2H51A 2R1TA 2JLVA 1S6YA 4RC9A 5EXTA 1QP8A 2XLCA 4OP3A 3IVMA 4KMOA 4MO9A 3FTFA 2P91A 1Q1NA 2O3SA 1Z6GA 5EJ6A 2ODPA 4CTMA 5JC1A 2C1XA 3QVUA 2C7QA 5K0EA 3HWRA 4LOKA 4I55B 3E9CA 4YPOA 5I7FA 1JQLB 1VC2A 4BRUA 3AUTA 1CK4A 4L8LA 3MUOA 3DGEC 3HM2A 3GPBA 4BNUA 1C8VB 4LXXA 4ND2A 2QM0A 3MTQA 1W4CA 2GCNA 4K26A 1LSUA 4X84A 5LBTA 1XR3A 2BR5A 2W2VA 4TS9A 4CM1A 1SUAA 5LZ8A 4HO1X 2HHJA 4IJMA 2FZEA 1RJ9A 4AY5A 1YA4A 4EFLA 1FJGB 4JXKA 4TXLA 1KZ1A 3TYXA 1AQUA 4G63A 3R6LA 3EG9A 4M3NA 1VJ5A 1Z0UA 2XT6A 4RS3A 1JI0A 2LVBA 5EY5B 4GLLA 2YJ4A 3TGPA 3PGLA 2ZSKA 2CBXA 3DZ8A 4GOJA 4KO2S 2ZRDA 3DT6A 3GCXA 4TL6A 4UM9B 3OJ0A 3S8MA 3LC1O 4B3CA 5LD2B 2BI8A 4NCBA 4DRZA 2VO1A 1E0JA 3I8SA 1D6MA 1T13A 4PRLA 1CJUC 1FP2A 1V26A 1L7MA 3IBSA 3NVMB 4D4GA 1F8FA 5EFOA 4MYHA 4GLJA 4EJSC 3T1TA 2QX4A 2Q6OA 3GG9A 5FBQB 2VYQA 1R0WA 4DIKA 1XTTA 2QUKA 3ORHA 5A5GA 2WUGA 3OY7A 1ULUA 1HDGO 3ZDAA 4LBWA 1XTUA 4HG2A 3T9DA 2P9BA 2PSDA 1XU7A 1E0DA 4EG4A 2G6BA 1H85A 1O6FA 4CKBB 1TLFA 2C2BA 4ARVA 2VK4A 1A95A 4RZQA 4IGAA 4E5SA 1T9HA 3IHLA 1CG6A 3DEHA 4URYR 4B31A 2W9XA 1WSAA 1DAHA 2DPLA 3QVWA 2ZWIA 4LTDA 3E0QA 4CMKA 4D3DA 4EB8A 3BRQA