1J0BA

Crystal structure analysis of the acc deaminase homologue complexed with inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
325
structure length
325
Chain Sequence
MHPKIFALLAKFPRVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIRKLEYLLGDALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKGNYLLDKIMGIETRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQSEVKFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAELLGVKVEVRPELYDYSFGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGELGEKILFIHTGGISGTFHYGDKLLSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 1-aminocyclopropane-1-carboxylate deaminase
publication title Structural and enzymatic properties of 1-aminocyclopropane-1-carboxylate deaminase homologue from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 99
structure length 325
sequence length 325
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 3.5.99.7: 1-aminocyclopropane-1-carboxylate deaminase.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j0bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j0bA02
2O2EA 4D9FA 1VE1A 1A5BB 2CLMB 4LI3X 3ZEIA 1J0AA 4OFXA 3PR2B 5IWCA 1OASA 2RKBA 3BM5A 2ECOA 5JJCA 5I7WA 2RH9B 5I7AA 5I7OA 1TDJA 3R0XA 3L6RA 1K7FB 5CGQB 5I7RA 1WBJB 1J0DA 2CLEB 2D1FA 4L0DA 4QYSA 4ZQCB 5B1HA 4PCUA 2DH5A 2GN2A 4HT3B 3PC4A 1A5SB 1TYZA 4L28A 1M54A 1C9DB 1PWHA 3VBEA 1TTPB 4AECA 3FGPA 3L6BA 3RR2A 4D92A 4D9IA 5B1IA 4KKXB 3TBHA 1F2DA 2GN0A 3VC3A 5B36A 3L6CA 4D9KA 1V8ZA 3SS9X 3X43A 1TJPB 1X1QA 1TZMA 4F4FA 5B55A 2GN1A 1J0BA 1WKVA 5DBEX 3V7NA 4D9NA 4LMBA 1V7CA 2J9XB 1VE5A 1O58A 2C2BA 3R0ZA 5IW8A 5IXJA 4D97A 1CW2B 1CX9B 2CLIB 5D86A 1C29B 3IQIX 1UBSB 2EGUA 4LMAA 5CVCA 3T4PA 1PWEA 5DW3A 5BW6B 3PC3A 1Z7WA 5B53A 3IQGX 3PC2A 3IQHX 5C3UA 1KL7A 5I6DA 3DWGA 5KZMB 1WDWB 5D87A 2J9YB 4ZU6X 3VSAA 4COOA 3IAUA 1QOPB 4HO1X 5I7HA 5KINB 2BHSA 1J0EA 1FUYB 4Y6GB 1BEUB 1J0CA 4XUGB 1KFJB 1KFKB 5B3AA 1K3UB 5E0KB 1Z7YA 4D9GA 3CEPB 4NU8X 4D96A 2C2GA 4JBNA 5EY5B 2CLHB 5HBGA 4I1YA 3AEYA 3DWIA 5DVZA 4D9BA 4ZU1X 3VSDA 1BKSB 1K7EB 1KFEB 2ISQA 2JC3A 1K8ZB 2PQMA 5JISA 1QOQB 2TSYB 2CLOB 2ZPUA 4NEGA 4HPXB 4IL5A 5DBHX 4D9CA 1Y7LA 2Q3CA 1TZJA 1K8YB 1KFCB 3DKIA 4JBLA 1V71A 1TZKA 3AEXA 3SS7X 2Q3DA 4L3VA 4D8TA 2V03A 4D8WA 2Q3BA 3SPXA 1K7XB 4HPJB 2ECQA 1FCJA 1TZ2A 2BHTA 5J43A 4HN4B 1KFBB 2CLLB 4L27A 4D99A 2TRSB 2ZSJA 1RQXA 3FCAA 4D9MA 5DW0A 1D6SA 3HMKA 1C8VB 4H27A 1A5AB 2RHGB 5T6MA 3VSCA 1VB3A 2EFYA 5D84A 2TYSB 4D8UA 3X44A 2WSYB 1TTQB 1UIMA 2DH6A 1P5JA 1A50B 4WX2B 2O2JA 2ZR8A 4OREX 2CLKB 2J9ZB 5D85A 4AIRA 1WTCA 2CLFB 1K8XB 4D9EA 1UINA 5J5VA 1E5XA 1JBQA
chains in the Genus database with same CATH superfamily
3HA2A 2QJFA 2C5BA 1M0WA 4JNKA 1VGQA 2YY7A 4G5QA 1XRQA 2P9JA 3P9RA 2GN8A 3PXEA 3IIMA 1JSZA 2MOKA 2AJLI 3TL3A 3ZE1B 4YCDA 3PL1A 1U2DA 2ZBPA 3U9TA 5BT8A 2JIOA 4B6JA 5DTIA 2PY6A 1RZRA 4R7ZA 2EFCB 2WG0A 5JI2E 1L4FA 3NORA 4HT3B 4IRUB 3G02A 4LJ8A 4EI9A 1T0IA 1QO9A 2ZJ8A 2BE7A 1R4ZA 2FUG6 2ODQA 2X0NA 4G5RA 5FUQA 4KC0A 4HAVA 4D92A 4EFMA 2VJPA 4O4LA 1CY7A 3O03A 5BQPA 4Q3KA 2XIJA 1WU8A 1KYIA 3QITA 1MB3A 4KWTA 4MITA 4IIHA 3UW1A 3ABRB 3PCXA 3G0OA 3MHPA 1PFUA 2FN7A 4QOIA 4EI2A 1XD2A 3QFFA 3E5MA 1Q3HA 4KRXA 1KPHA 1FDSA 1IAQA 1YQTA 3AEQB 3RSQA 2J46A 2P3OA 4DUYB 2UUCB 5K4GA 1M8PA 3UMBA 1EWKA 3HJRA 3WLTA 4ZVKA 2XWQA 4GLJA 1Z4KA 3UWPA 2C8KA 2EGUA 1ZM2A 1ZOOA 1GARA 3L9WA 5JRZA 5KYWA 3RSFA 1RRKA 4TRRA 1VKOA 1KBQA 1E5TA 4HHEA 2NG1A 2SKCA 4KNWA 5BP7A 4F3KA 3MGCA 4TYQA 4B2LA 4HC4A 1C3VA 1KVSA 2ONCA 2E18A 4GM4A 4I5IA 1JXAA 1YI1A 3JYPA 2YRWA 4Z4FA 2AZXA 5D87A 4QDOA 2FPGA 1QV7A 1TCUA 3V8MA 1XP8A 3OPYB 2ZXEA 4UCFA 1G98A 4BKRA 3ZWWA 1HDEA 3JZIA 4FBMA 4LWZA 1QO0A 3DKRA 3PRHA 2V54A 1PEKE 3RLIA 3VNRA 3VR5H 1U98A 5HPYB 1V1JA 3Q12A 4UHJA 3RASA 1DLJA 4FD2A 3VC1A 3P2OA 1WOMA 1X7GA 2P6MA 2QTVA 2X0JA 1IL0A 4RK4A 4B44A 2SECE 4LJ6A 2JI4A 1AN9A 3AU9A 2JZOA 3EZFA 1E2DA 1U3WA 4LK3A 5JZBA 1Q1AA 1AGPA 4MA5A 1RC1A 4EF6A 2QRUA 4LOHA 2AEFA 2D7JA 1F60A 2CYCA 3B9QA 3CZQA 4M1EA 5CH8A 3O38A 4DW8A 3ZI4A 3DFMA 2Q3CA 1KEEA 3L4KA 2CFCA 2QYHA 4QTXA 1H4SA 1KQNA 5EEGA 5IT4A 4FYXA 3AL3A 4WN9B 4H59A 1NMYA 1SOUA 2IHKA 1GTVA 1LVHA 2J67A 1LSUA 5A6SB 4E5PA 4F5EA 4AG5A 5BNFA 3ETJA 4CM7A 4ZTUB 1GA6A 1SCBA 1TQ2A 5E3HA 2Z6QA 1O4WA 2IOQA 3ZCPA 4CKBB 1Z6YA 3VZSA 4BMDA 4MHSA 5G1OA 4QPDA 1Y6QA 1IPHA 2QLNA 4NMWA 2X9LA 3FYDA 3OHPA 2BGUA 1V9LA 5EWLB 4CEJB 4PQFA 4IJQA 4L02A 4M87A 1N9GA 2OE2A 4RCZA 3VSCA 1JFSA 1PSZA 4ERXA 3IO3A 3LUGA 4C0SA 2P4QA 1D0IA 2FZCA 4O2BB 1G8JA 1U3FA 5AK5A 3WLLA 4N3NA 4D9HA 5AW6A 2CV0A 4LZNA 3AM3A 4C0HA 2C7QA 3LCVB 1T5DX 3QVWA 4K87A 1VE7A 2I0FA 4YAWA 3WGLA 3E81A 4LI3X 1RXSA 1VKNA 3CR8A 3GFTA 3FOFC 3BB1A 3DAYA 3ME5A 4Y9TA 3VV2A 4TYPA 1MA0A 4GYYA 1T24A 3PVCA 1Z8NA 4U00A 4AKIA 3H4IA 3I6MA 4JZYA 1T6NA 2BKAA 5EFOA 5KYXB 2QQFA 3RIHA 4MH0R 1S7CA 1KJZA 4FZJA 2RGXA 1I3LA 4ZAXA 3AUAA 2UVPB 5CRIA 1RI5A 4Y2VA 2UXDB 4U7TB 4RK5A 1G3UA 4I4IA 4L28A 5AMXA 5M3BA 1BE8A 5T3YA 4HFNA 1QUEA 3LYLA 4DYHA 4GWLA 4PNHA 1G8GA 5IX8A 3V00A 3FSEA 5EIBD 4X1IA 5A4JA 1SCUA 4W1SA 4AMBA 2XGMA 1I3MA 3NT5A 1P39A 3A9WA 1N2CE 1XJ5A 1IEVA 3FGNA 1K6MA 3H87A 1MT0A 4II2A 4TL9A 1D7OA 2PAAA 4REQA 3NIBA 1NL3A 4MV9A 3W9YA 5DM2A 3P4YA 3EY9A 4RHYA 2UZ3A 4LFCB 4CLOB 4Y9UA 3RT9A 5I9LA 2C5EA 1DBWA 3R0JA 2J6IA 3BFKA 5JUWA 4NNOA 1WVIA 3G59A 4EARA 1PBTA 4FGWA 5BW6B 3HU1A 2OCPA 4DJDC 1DXYA 2VUIB 1EFTA 1Y3CE 2C95A 1N6IA 2FPIB 5IU6A 5G0SA 4NBRA 1KS2A 2IEAA 1N25A 1KC1A 2NO0A 5KWVA 1LQUA 1WM1A 3ZWNA 4MULA 3C3CA 4FS8A 1NI4A 5LA6A 1LDEA 1VG1A 2Z5LA 3I9OA 1G7CA 1XHFA 4NDAA 5FBKA 4UASA 1TC2A 3HZZA 1ECCA 3PQCA 1SXGA 1DBSA 5CEEA 3SFTA 4Z9BA 3G2HA 4KVZA 1N5LA 4KQCA 4Q01A 4Q9IA 2AVNA 3EIQA 2MSWA 3PQDA 1MJFA 2ONJA 1CP2A 1KJNA 4LGVA 1F06A 2JCYA 4H15A 4I8DA 1PJAA 2DMRA 4DR3B 4W8OA 3SC3A 4HQNA 1N6NA 5FLXA 5E6UB 2FLKA 2NO7A 2XZPA 1TZKA 2JGMA 2QM0A 2F17A 3EXG2 3MN1A 1MO3A 4L1KA 3V6MA 4QXRA 4BGVA 2NT4A 4CLDA 5K8UA 1M8FA 3W4JA 3MERA 1FS5A 1RWKA 1VJGA 2ZSKA 1PYDA 4JQYA 4KXQA 1PZFA 1HDZA 1N8TA 1SQFA 3GN2A 3UHAA 1WXEA 2WT9A 2IU0A 4O63O 3O8NA 4NBNA 3BKWA 3TEMA 3LUPA 3U3MA 2AEEA 3G6KA 4ZT3A 3NS7A 3W2HA 3SSOA 5JTTA 4KPEC 2G4LA 4OQEA 4F84A 2ZU6A 2DLDA 3N8IA 4WPGA 4OF4A 2OV4A 2YQ5A 1JMYA 1NNUA 4P4TA 3B3JA 2ABWA 3V9PA 2AA3A 2O2JA 3EJ6A 3FFAA 2C4KA 5HIIA 1P60A 4UREA 2CL0X 4RHXA 2BFFA 5GP1A 5FORA 2GPWA 3BXOA 2O0HA 2R6FA 2BZSA 3LX6A 3ADDA 3MRTA 5AVYA 8ADHA 2EP8A 4ASUA 3I73A 2DETA 1L7EA 4G8DA 4IUBS 1RJDA 3MS7A 1SOAA 1YB2A 4KE8A 3JQPA 1JQEA 2H9YA 4OU4A 5F12A 5CW2A 2CD7A 3M6IA 3ITKA 5EVCA 1GRRA 1M7GA 4S05A 1PF7E 5AM3A 3ZOZA 4KEAA 4GPBA 4PCUA 1U2ZA 4WIAA 1ECFA 2A86A 3AHFA 3F0TA 3FDJA 3PC4A 3FLBA 3K0CC 1IC6A 3NEPX 3VR5A 4D81A 4EHJA 4FE7A 4D80A 3QXJA 1RE0A 2VK8A 3A7DA 3H7AA 2Z2XA 4OXNA 3VU3A 5KNBD 2JLXA 1P5ZB 3VYSB 5BQFA 1XTZA 4ARZA 3DVAB 1RU3A 3R5FA 1C80A 3DF9A 2C5SA 5EKDA 7AT1A 4DCPA 5JIBA 3LBYA 2OP1A 3IAS6 2CXSA 5LQNA 4HDMA 1KJJA 2ZFUA 1ISJA 2CVHA 1OY1A 3K8QA 1ANKA 2M1XA 3BEOA 3ZIDA 5EE9A 1EJ2A 1GGVA 1B4DA 3G8DA 3TXXA 2PLRA 2GXUA 4JVLA 5JXHA 2PUVA 3U1TA 3L0BA 4MR7B 4LV8B 1KMHB 2JLCA 1FU4A 1OLSA 4LNUA 4AU1A 2VRWA 5BN5A 2F48A 1DBIA 2I6SA 2VDWB 2VDQB 4OD0A 5FV4A 4YJ3A 3OZWA 3H6HA 4DRYA 1WDWB 1EVIA 1M8KA 3ZKAA 1GPNA 2JFOA 3HN7A 4KREA 3DZIA 2H7CA 3N2GA 4BE4A 1H6AA 3O93A 5DT9A 1PS9A 1TMOA 2RDMA 2WHEA 2WILA 3ESAA 1UKEA 5E0KB 5J4VA 4CVNA 2ZZNA 4PPGA 1Z5WA 3BL6A 2Y1FA 4BNMA 1D2CA 4ZTZB 3AEKA 5JV5A 4Z0HO 3TQIA 3KBOA 3R3UA 5EAIA 3WQSB 3K0BA 2ZSHA 1Z82A 4KQ9A 3RVPA 4Y9SA 2ZZKA 2QUBA 1Z2OX 2XWSA 3QHQA 4LF9B 1UKBA 1DKMA 4G37A 4AWAA 1ETUA 1UPTA 5JW6A 1C0IA 2JZCA 2DPYA 1QK3A 3HBJA 2J6CA 3THWA 4ZVPA 1EUDA 1BN6A 3L06A 4UEOA 2AQKA 2QXTA 1W36B 1JSLA 4URHA 1G9XA 5IPFA 5A1JA 2AOXA 2OCKA 1MF7A 1JSXA 2DUJA 2XUPA 4N6OA 3DM5A 1Z37A 1N1GA 1P2VA 3AERB 3DEKA 4MV3A 2F1IA 1NVDA 5IC4A 1N2SA 3ASYA 3O91A 5B5SA 5KTPA 1N8SA 4B1FA 4WMLA 4BTEA 4CQJA 3A6DA 4ZT4A 2PUEA 1JB9A 2EGGA 3F2IA 4GOKA 1NFFA 1CIPA 5D7BA 1KETA 1IPEA 1QKKA 1YRAA 2QORA 2WD7B 3H11A 1A5ZA 1CJBA 1VYHA 3NYIA 5EIOA 1VHDA 3H8WA 3BMQB 4GZLA 3RJ9A 4OXXA 4F96A 4S1VA 2F3SA 3I92A 2R87A 4RD1A 2PUHA 2FFRA 2O2EA 1MXHA 2HTFA 3T0GA 3VZCA 1JXOA 3HU2A 4OFXA 4JC5A 4UQPA 3A6KA 1CR2A 2JGIA 5JWRA 3WBJA 1UDAA 2F8LA 3TQRA 1L7PA 3W4KA 4IH1A 4FN5A 4MKGA 4UUPA 4PLCA 4C5CA 4RSGA 2NYAA 4H08A 1G5TA 3CWQA 4FFRA 5FA5A 4FYPA 4OKIA 5AUQA 3N2NA 2Z6AA 2RGRA 4E2WA 4F6RB 1IHXA 2L19A 1JV2B 3DZDA 2GCEA 4D9IA 1DIRA 5TJHA 3THYA 5MN4A 1DAMA 5EZYB 1QJCA 1Y34E 2ZRPA 4KZPA 3L7AA 4LYDA 2CCKA 1NQUA 1AJEA 1V11B 3GVPA 4ENRA 2VZEA 2XZLA 1CY4A 4YJFA 1CQJA 4RULA 4C7OB 2IZ6A 3GC6A 2OBXA 1G3IA 1F9EA 2A14A 1KOGA 1EUZA 1YS9A 1ONPA 3OY2A 5D3KA 1NBOA 1RZUA 2YUIA 3IUBA 5CIWA 2H1HA 5L8VA 2E5FA 3FTPA 3RPEA 4ZCPA 5DW3A 4KIFA 1LWOA 1V1RA 1WB9A 2BGKA 4E5SA 1VLVA 4KWHA 3HDGA 3CKLA 3EA4A 5DLYA 2GCOB 4C0KA 3AKDA 2DHCA 2DY1A 3KRTA 3K73O 5JNVA 6CHYA 1I7SB 1WP9A 3D3WA 4ND8A 4OM8A 2G6BA 4QREA 2W5UA 3I2HA 3PVSA 5JS7A 3WJ1A 4KGXA 5KAMA 2CFRA 4P5EA 4DMKA 5KVAA 3WLEA 1DELA 3VPFA 3DZFA 4PVCA 3C6XA 3KEMA 4DNXA 1FTWA 4DLRA 4M53A 4Y0NA 3C1OA 1ZNZA 3HJFA 4RPHA 4BMVA 1J5EB 4FE3A 4H0CA 4FYJA 5BV7A 2YWJA 3R3WA 4ZCSA 4JGGA 4PGMA 1E6MA 4EJ0A 2VBFA 1JFRA 3I4LA 4GZ6A 4O4HA 3AVOA 1AQYA 2HHJA 4Z1MD 1R6AA 4IZHA 2RH8A 6ABPA 3V7FA 1OC2A 1A27A 3K0FB 4DV7B 2ANBA 5JWOA 4UUOA 3IT2A 4B6FA 2B20A 4PF1A 1QRAA 3IDSA 4O5OA 1QH0A 1T9GR 2BZ0A 4R01A 4ZJYA 4ICIA 3G0CA 5T6BA 1ORIA 4KUEA 3A1CA 5CJJA 2ECPA 4BRSA 4TLBA 1ZUNA 5DYNA 1M1YE 1CEYA 4AY2A 1C1DA 1DQNA 3VO2A 1WUIS 3W06A 4EB3A 2V0NA 1Y8RB 1O5IA 1RI4A 3M9WA 1DEHA 4IUCS 1M1NA 1UR5A 4FQ5A 1DC7A 1LVUA 3TAXA 4C7VA 4KYVA 1YHNA 1E1CB 3Q3EA 4I7EA 5C4MA 3PPVA 2FZWA 1HC7A 4M6WB 5CCBA 3TRDA 1RQNA 1ISGA 2ZJ3A 1MORA 4FN4A 4UQOA 1RC8A 1Z4LA 2YWRA 3V1MA 4U3JB 3FOZA 1GKIA 1W85B 1XQ6A 1ZGBA 4R51A 3NKFA 1Q0LA 1SD5A 3W5JA 3DD5A 3S3TA 4N76A 1ECGA 1DCMA 2XECA 3SQDA 3RUAA 1HEUA 4RJJA 3K9QO 3WK5A 1I2ZA 1X19A 3E8MA 5FTJA 4PZCA 1LX7A 4M1WA 4PC3A 5GVSA 1XWFA 4ND5A 3WIEA 5IP5A 4J4HA 3IMKA 3RKSA 4WE3A 3KZ1E 3EFHA 5CFZA 2C3MA 5COBA 2JLVA 1GRQA 1O4VA 3R0XA 1WXQA 4V02A 2QUIA 1P7VA 1N2IA 4P92A 3LWBA 1FX0A 2O06A 3EVNA 4BIMA 1NNEA 5KTSA 2J5BA 3GJRA 4MP6A 2ZUFA 3LSTA 3U13A 1KE2A 2WM9B 4Q3DA 3E9ZA 1GG2A 2PKXA 4DDMA 4LJRA 1GL9B 3PA6A 2RCYA 2C9DA 1G5IA 1HLDA 3CGGA 5K09A 5FPPA 1X42A 4MZDA 2G9NA 1PFYA 3OC6A 1PK7A 4GS5A 4HEJA 1P44A 1NXOA 5TE9A 1KEKA 3ZU4A 4DHWA 2XMCA 1UJCA 3M49A 4MARA 3S1AA 1JQLB 3I5XA 1G8KA 1AOXA 4HNUA 3UMCA 3EE6A 2G06A 1NBEA 3GVXA 2PK3A 1UKYA 2J08A 4KO2S 4W5OA 4AY4A 4QGAA 5TQVA 2I7CA 5DYTA 2VWHA 1VTKA 2FV8A 4KJXA 3L07A 4IMPA 4QTYA 3BMXA 5REQB 3N8HA 4KAAA 5HNKA 2P2CA 1Z7WA 4P38A 4G8JA 3IUEA 3DBIA 4LJYA 4ZQFA 3W1EA 4C6TA 4CL0A 3GD7A 4GKVA 5DX0A 3LX5A 1NN5A 1QHYA 2P5SA 1KDZA 3TQQA 1DRKA 1GPLA 3W90A 3W77A 4C0AC 3U4MA 4LX8A 4YS6A 2O0JA 1XDBA 5KYNA 3TFQA 3THOA 2F7SA 1F3OA 1I7PA 3O4JA 4F92B 4NQRA 3ICOA 4K6CA 3BMOA 2AGVA 2V7EA 4NZOA 3RRFA 4WH0A 2ZBFA 4ZVQA 1NC3A 1BG6A 5SY6A 3X2FA 2RIPA 4EUNA 1JHPA 3N2KB 2C78A 4HWPA 4I4TA 3LYAA 2D2FA 4BNZA 3NIWA 2F1OA 1MRSA 1U7UA 1W96A 2JC3A 3LZ6A 2UYQA 4K6KA 1J56A 3IOEA 3DV0A 3S6JA 2Y92A 4ARIA 4NABA 2BAGA 4L4RA 1QYWA 3VKFA 4ACBA 2XZOA 1FU8A 1LVGA 2QROA 2XOKD 4DLKA 4F2WA 1GV0A 3BRQA 2G1UA 2VP0A 2ZJAA 2CHUA 1SHKA 2J30A 3EOZA 3ESYA 4HDKA 4ARBA 5BRAA 1JIUA 6Q21A 2ORYA 2MU1A 1LPBB 3SKYA 2D5BA 4WLUA 1N1MA 3UENA 1EEXB 1K68A 3VMMA 4CEHB 3IE1A 2OUIA 2R86A 1WPQA 2CVPA 2RHLA 2JVIA 2VLIA 4IIUA 4L57A 2WTUA 1QNLA 2BHNA 1ZA1A 3ZTWA 2I9PA 1FXSA 3ZV3A 1NE7A 2JH9A 4P2BA 5TQ2B 2J3LA 3AUYA 4F9TA 3QKUA 4MV6A 2VTVA 2G4VA 2ZRQA 1JPJA 2DLNA 5EXPA 4ZQIA 4Y2YA 3TMKA 3LCUA 1WUKS 1Q1BA 3HCPA 4GLFA 1GDDA 5FI5A 3UFXA 3N7AA 3EF0A 4N1AA 3J81A 1IY0A 1U5BA 3FKSA 2AQHA 1JXQA 3BGDA 1MD9A 1U0RA 2HBZA 1FZTA 1D2HA 3BCHA 3B9RA 4GXNA 1PI3A 4HDNA 1FDUA 3UYKA 4AUEA 3OI7A 4OI0A 4LS3A 2YVAA 3U7JA 4BKMA 3VYRB 1YFLA 2ECOA 3FPHA 4DIFA 1HXHA 3HXPA 4YAIA 1LLUA 1LTKA 3QA9A 3QEMB 4RPJA 5AJXA 1MHTA 2IH2A 4P5PA 2GD0A 5ARDA 3BBLA 4BLWA 4WLVA 1ZL0A 3ZD7A 2WFLB 2XWPA 3A28A 1G64A 1EFLA 1YB1A 4HDOB 4I1PA 1SEPA 1SCAA 2BTOA 3PEEA 1JSCA 1M0TA 4HVAA 4NATA 5EJGA 2XMGA 4QG3A 3DBLA 5ICGA 4DMLA 4Q24A 2HB6A 1Z8FA 4W5NA 4LJ9A 2GN0A 3GOHA 1NG1A 4JL6A 2J09A 1M0SA 3H2SA 1KEEB 1VKHA 4M8IA 5M29A 1W36C 1RTTA 4GYKA 1KJIA 1NUUA 1JJAA 2AK3A 2WTNA 1WF3A 5GV8A 2FMUA 3JWPA 3B6EA 1L7DA 4IQ8A 4G5XA 2ZROA 5SY4A 2PL1A 4NARA 2NSDA 1BMTA 8AT1A 5C53B 4O29A 1YOBA 2YWGA 3AUTA 5DOVA 5E6RA 4Z0TA 2NUTA 4EGAA 4EAQA 4WKGA 4I6GA 3QSYA 2J32A 5SY9A 3TLYA 1SR8A 2HL6A 3UGTA 1HSOA 1KAGA 2A3RA 2WR8A 1ZIXA 3R09A 4QYIB 5K4HA 4II7A 2Y0PA 5E9WA 4MVXA 1GQQA 1YB7A 2OORA 1ZN8A 5JANA 5LUAA 4JLSA 4X92A 3EH2A 3HDTA 4H6VA 1L7BA 1P6QA 2BW0A 2GEFA 2HU5A 4JKOA 2J1LA 3PG5A 2VR1A 4LY6A 4M8KA 4BU0A 2YOHA 3J7TA 1A04A 3QU7A 4Y2RA 3PFIA 5I7UA 3RU3A 3WQBA 4JR0A 1V95A 1R9MA 1ZJ6A 1HOXA 4HRXA 3THRA 1NVWQ 1B8UA 1TJNA 4BVJA 4KPUA 1MC5A 4PTLA 2W2TA 4R98A 2XGGA 1E3JA 3RODA 1TGYA 7REQB 5FWYA 3DNMA 1UZNA 2BR5A 3F5SA 1L4MA 4IV8A 4LE2A 2GSWA 4KUHA 3G17A 3IH5A 4BO9A 2XYRA 3FMFA 4TLMB 5KYYB 1GPUA 3GA7A 3QV1A 1EDBA 3OZBA 4K9KA 3FNFA 3U7FB 4ZV7A 4S0XA 2P5YA 2IXAA 2IZOA 2O2DA 2Z58A 2XF2A 3B6JA 1FFGA 2AEJA 3JQGA 4JMLA 3VHXA 3IDFA 4YASA 3ROTA 3SXJA 1Y81A 4Q02A 1SPBS 4HDSA 1X1RA 2CHGA 4CIYA 1EK1A 2GPSA 3C7TA 5DGTA 1K7XB 3B1VA 3ECCA 4HPJB 3C4VA 5HGJA 1LRKA 1TUIA 1M2WA 5TF4A 2OYCA 1BDJA 3GJZA 2TS1A 4MV0A 4YEDA 1SVLA 2JVKA 1EVLA 2NYUA 4TL7A 4D99A 1WXIA 1TCBA 1IEXA 1XLTA 2PWZA 3TQCA 3UWMA 4FMPA 1VSQA 1RHQA 2PEYA 4TTRA 2PA3A 5IKPA 2WIJA 4JJAA 3TIVA 1D09A 1YS6A 3DDWA 3O82A 2WZDA 1C30A 2CHEA 1X7ZA 1PUIA 3AP3A 3KHUA 5E2BA 3R3SA 2EYQA 2RAUA 1TB4A 4U8GA 1YBFA 3CFYA 4DRXA 5EMMA 3OTHA 3TDKA 4CIDA 3QVKA 3JQFC 4UU1A 2ENWA 3A6LA 1FLNA 2A9JA 4JENA 2Q5QA 2ZBUA 1KOFA 3ZI7A 2DWUA 4LTDA 3CN7A 2QNRA 1OBVA 3MLBA 3OPMA 5PGMA 3SYMA 3RG2A 1F0NA 1ZGJA 4KO8A 5DIFA 2JG3A 1TCAA 1GO2A 2Y1GA 3KR9A 1SA0A 4RPCA 1I2DA 1FUEA 4KO3S 4QBTA 4W99A 2ZVPX 4FSDA 3OPNA 4WI1A 2UZ0A 2ZRKA 3DJYA 2F43B 1ZJJA 3L6RA 3DOHA 2CVZA 4OKNA 1FTNA 4K03A 3JZFA 4RGYA 1UK7A 1DAGA 4EKNB 4GBED 1EINA 4PW0A 2BKLA 2QMEA 3K0SA 1YS1X 1FX1A 2GRAA 3KEGA 1QIMA 1PAUA 2GUWA 5D7NA 2PPLA 3OIYA 3K20A 1JWBB 3QF4A 1O5TA 4ZHQA 5B6IA 5NLLA 2XR1A 2ZKIA 4RH1A 4O4IB 1AG9A 2V7QA 3O3NB 4JHLA 1Q1ZA 2NXJA 2VHZA 4DZRA 4JN6B 1ZLXA 1XVVA 4ZV9A 2AS0A 3ZBPA 3MWGA 1PZMA 2O20A 2AQIA 3BL8A 4AURA 1HT3A 4F97A 1GGEA 1ZH6A 2Y27A 1CB7A 4MKZA 2G63A 4GMFA 2XWBF 2WKWA 1F20A 4DV2B 3A2LA 4ITUA 1ESDA 5IJXA 2AWNA 4FYWA 4H16A 1GZHB 1H05A 1UF9A 2VHTA 3Q0EA 4EOGA 1I4EB 4YONB 1NAIA 4KI0A 5JXIA 5IT9A 1XZAA 3N58A 3UMJA 5IFKA 1F6DA 1YDMA 3DE1X 1U65A 2YFHA 4YLGA 1GPH1 1K5PA 1ZGAA 4CTKA 3DD1A 1E3WB 1X80B 4PHTA 1JFVA 3OFKA 1E1MA 2DTXA 5A06A 1A4IA 1T4BA 3A0RB 3OZRA 4FHEA 1FRZA 5B12A 5ILGA 4FMBB 1E3TA 5TQJA 1EI9A 4MA4A 4I5GA 1W0JD 4ARSA 2P4UA 5I4CA 1H42A 1K6JA 1NBWB 2V6BA 4HP8A 1ECLA 1G21E 3FPAA 2HV9A 1UFRA 2Q21A 4R2MA 4ZQEA 5KJEA 2EX1A 2QP3A 3EC1A 3EGEA 3HFGA 3ILXA 4MWDA 3ZYCA 5C8XA 2CT8A 1J06A 1OLOA 2A9VA 1IY2A 4A36A 3GRAA 3L49A 3STXA 3ONWA 1GYRA 1TF5A 1VA5A 3E9RA 1I7QB 5DSZA 1CRWG 1DIOB 1PTJA 1WSWA 4FOTA 4BMOB 3ZCUA 2ATIA 3U5ZB 3CLRD 3RSZA 2CB9A 1K9SA 4F6LA 3N28A 4I19A 2FW0A 3R5SA 2VCEA 3I39X 5GINE 3B89A 1PR1A 2HC9A 2K7ZA 3K15A 1Z34A 2HZ7A 3HMKA 5F2KA 5FO0A 1E9CA 4C4TA 5H3HA 4KAFA 4GX5A 4LJ4A 2EKZA 3L7OA 5EOVA 2QTRA 3IPCA 3M70A 3ROQA 3CZ9A 5BSVA 4DEVA 2RBKA 5JD6A 1HZJA 3RC3A 5G53C 1QNFA 3DO6A 5J2TF 3IB3A 3ZBQA 1DDGA 3T7TA 1GLGA 4GPAA 1R5OA 5AXDA 4AP5A 5AM4A 4XD2A 1KYWA 3DWEX 2OO5A 1PWHA 3COWA 3L40A 4WFQA 3FYHA 5AESA 2HWUA 3ZK8A 4GMGA 1E94E 2P7IA 5BSKA 2KLBA 1UP6A 4M0FA 3AWIA 1HM5A 1H3NA 1LW6E 1XFAA 1EG2A 4GYJA 1NE2A 4TWRA 1JXMA 2BMJA 4BVFA 1JMVA 3MTAA 2B82A 3TLGB 5EYPB 1LF0A 3TIIA 3AZQA 1OVMA 2R7KA 1EHCA 2VHYA 3QFHA 4IDNA 1M9NA 4QLAA 2NUAB 5B7NA 3IVMA 1EU1A 4TV8B 3RIGA 1JEQB 1T13A 2ONZA 4HADA 1PGQA 1TPYA 2CBXA 1BN7A 1NX9A 1AIPA 3FWPA 4BKUA 5CA1B 1QP7A 2C58A 5G4KA 2IODA 2VPWA 3BA6A 4FYVA 5B1IA 1C4XA 3ED5A 1HE2A 4FZ5A 4M9UA 5A6SA 1E2HA 3QEAZ 4DYDA 1DCTA 4KR3A 2D0DA 3QYJA 5LR6A 1R8QA 3ORQA 5ITWA 4KQGA 3CBGA 5DDIP 4QYXA 2QAIA 5F5LA 5C8VA 4OJYA 2LR0A 5B55A 5DMXA 1QGUA 3G9XA 1EX6A 3ZXYA 5KTNA 1RAFA 2GAOA 1IXZA 4BY9E 1YULA 1NQAO 2HJVA 3BS4A 3E22B 3EB9A 1XZ8A 3GDGA 3IHTA 1AH2A 1NBMD 2VEDA 1E3IA 1M7HA 3DMYA 3L3BA 2PWAA 3KYIB 4BO0A 1KWKA 3K30A 3K70C 3O8QB 4JOBA 1P7PA 4BDTA 2CMFA 2YWXA 2HCBA 4KU4A 3RIXA 4TKVB 4RA9A 2CVOA 2FSIA 3K9GA 1ZJZA 1O6CA 4MW1A 1XZQA 4X7PA 5G2OA 3W6OA 2PN1A 4A1OA 3HVRA 5EJ9A 2UU9B 3CRQA 3TZEA 4LF4B 5JHGB 5IG2A 3I8OA 2J9YB 2FW7A 3T12A 2AN4A 5ERGB 3U40A 2IYQA 4M1QA 4YV0A 4Y1RA 1I6LA 1PJSA 5IT0A 1PCXA 3L0PA 1LS1A 2OGWA 2AB0A 2ZIEA 3PYLA 5B1EA 4MVJM 1ZD5A 4Z49A 5JNRA 4NS1A 3MBOA 2G7MC 2WFAA 4MWCA 3CZMA 3BERA 4OCZA 1FFDA 2XHZA 3IR7A 2GF9A 3GT7A 4LC9A 4OXIA 2RHTA 5TVKA 5AW3A 2FDCA 4AO7A 1ZONA 2AR0A 4OBWA 4KQKA 1N3IA 3BZBA 4LRUA 1VRVA 1S8NA 3D1JA 4ZI7A 4PYQA 1O97C 2QX7A 3I4CA 1KTVA 1P9RA 1N92A 3OTQA 2UZ1B 4ATNA 3GVIA 3PNVA 5BSRA 1X0XA 1CBUA 1GQRA 1QZXA 1YK1A 2C5LA 1O6FA 2JJQA 1KH2A 2G5TA 3JR3A 3KKQA 3D2CA 4LOAA 4J1NA 3NV9A 4PHHA 4QEKA 3OH8A 4WNYA 3JPYA 5GONB 1EWQA 3Q9NA 1E9RA 4R7TA 2F3UA 1X2EA 2PJUA 4DG5A 1DJNA 4LF8B 2XODA 2FWAA 2QMZA 1MEJA 4H7FA 3X1WA 3GV0A 2YJ3A 4J29A 1W0KD 2C04A 3WOVA 4CL2A 5KTRA 2D06A 4UVIA 1TRKA 1M1YB 3GMIA 1EB8A 2Y2VA 5K2OA 4B6QA 3A4TA 5M2QA 5JD3A 4IQFA 1H2ZA 1IMOA 3M9LA 3CWZA 4KLZA 3H5TA 3L46A 2ZJ4A 4OQFA 2R2GA 3PNQA 1CUWA 3NUZA 4YJGB 4D9KA 4IIGA 1JB1A 3HA7A 1YDGA 4RJ2A 4V38A 2AT1A 1XTSA 4QOGA 4OBXA 3D9QX 1YO6A 1Z6PA 5P8WA 2GOYA 2JJ2A 3V4ZA 1FYVA 4GEKA 5UKDA 4M9XA 3VXKA 3BM5A 3OMLA 4HZIA 1T3HA 4HUTA 5IDXA 2EW8A 2QP4A 5JBIA 5M5BA 3CG0A 3G8YA 1F0YA 2IFTA 2V7XA 3HJUA 2ZT6A 3BFVA 3IP8A 3KQPA 4OB7A 4BO3A 4YCNA 1GNRA 3AUJB 2IS2A 4FHCA 3D8TA 2GPJA 2POQX 4XE5A 4LTNA 1ODCA 1D3AA 4F6CA 2FSSA 4HPWA 1HX7A 3WBKA 5I7SA 5B64A 3KJEA 1YAHA 2FYTA 3AEUA 1X8JA 4RAOA 5DISB 3UGQA 1CIVA 1MQ9A 3D1VA 1CS0B 3Q1LA 4OHKA 5AH0A 2GH1A 3RC9A 4X8HA 4ZODA 4F5YA 5KOHA 3KSBC 5HE9A 3DBOB 4C01A 2GAIA 4J75A 3JAMA 2ZBRA 3ZNNA 3FR7A 5JCJD 1E8NA 5ALOA 2BCGY 1Z39A 2TECE 3VTAA 3NJRA 4HYTA 4CKEB 5A2QA 4BJ5A 4P81A 1S6YA 4FW8A 3DOFA 1KORA 2XXJA 2NNWB 4INJA 4KRGA 4X95A 2XSZD 3WGVA 4RZXA 3R6TA 4ZN6A 3EPLA 3AM5A 3UICA 2BELA 2OLJA 4KGZA 2XMDA 3BB3A 4GR4A 5HF6A 4EP1A 1MLDA 1U1DA 1N6PA 5K8LA 2V58A 1MA3A 4J16C 1BH2A 2PSSA 4UEQA 1R3UA 3GT4A 4MCJA 2X4GA 2ZUWA 2RAFA 3NVMB 3U37A 2AFIE 1ZPDA 5FX2A 1BMQA 2IRWA 1Q7EA 4OMUA 3MWJA 1Y4UA 5EIAA 4FWTA 2RB4A 1XEFA 3L0ZA 1T3LA 1XGKA 3DV2A 3Q85A 3S2UA 3REFA 4AZSA 4DMUB 4YUWA 4AUMA 1N36B 3HWWA 3EGIA 4XFDA 4PTZA 4XUGB 2ZKLA 2QPAA 2YHIB 1Z75A 1OZHA 3EXHB 2BN4A 4ZDKA 2WAAA 1AC5A 1M6WA 4FCWA 1KP3A 1M7BA 1UBEA 3Q7IA 4TX1A 2PGDA 1J8DA 2FY8A 4K7JA 4OUDA 5IK2A 5U1PA 3CUVA 4ZYUA 4XKJA 4RD2A 3U16A 5JROA 4ZMBA 4MVCA 3H7IA 1A9ZA 4G5FA 3IJPA 1IY9A 2H2WA 2EVWX 2L17A 2Q1WA 4H1VA 5ALNA 1EP3B 4DPKA 4I9FA 2EFJA 4D26A 1XC7A 2DT8A 1SU7A 2PYDA 4EFLA 4ES6A 1HL7A 3NHBA 1KP2A 3FTFA 4XYMA 2QR3A 2PRZA 2QN6A 2VNIA 4IMIB 1C5KA 1SBHA 2YHBA 1CJVC 1QZZA 1M76A 4WHMA 4XIFA 1NTRA 3WYAA 5FPKA 2JBHA 1WV1A 3UB2A 1U2GA 4KVAA 4NMHA 4TTIA 4BQIA 1K7YA 1SVUA 3M5CA 1SVOA 1YVDA 3DVSX 2IVZA 3SK0A 3WGYA 1QB8A 2OGSA 2ZBVA 2WTBA 3ZKWA 1H23A 3WGKA 1OH8A 2PGXA 1KMHA 4LF7B 5IXYA 4E2YA 3MT0A 1NU8A 3L8FA 1K6IA 1C8VB 5AVOA 1RPTA 2P6NA 1B74A 2QUJA 4TVBA 4EGCB 1LBIA 5JDIC 2KQUA 2ZUUA 3CF4A 3K2BA 1D0SA 1U8AA 5AHOA 4QXQA 2V5VA 4BZWA 3KTDA 3BGVA 4HYYA 2E4ZA 5KQPA 2B61A 1QP4A 2ACKA 3H18A 5FPTA 1SBZA 3W04A 4X62B 4FW9A 5EXEA 2HDOA 1VCNA 2NXCA 1L7VC 4GQIA 4MRNA 3H0KA 4PPNA 5E7JA 1Y9JA 3C5HA 4C9BA 5AKEA 5EGNA 5AXCA 2XQKA 1VPLA 5JO0A 4WJKB 1T5LA 3QXCA 3L43A 5BSHA 3OCUA 2WNIA 4IIFA 3WLKX 4L8FA 4RTLA 2QKYA 5CFQA 4W4TA 3HS3A 821PA 2FX2A 4FFMA 5JYEA 1X1BA 1XU4A 3A4VA 4MUYA 2WM2A 3EVZA 2QG6A 3I2GA 1G1MA 2HQSA 4IHJA 4IVRA 4PPFA 2QAJA 4JJ4A 2GBFA 2OPHA 1K2VN 1J0DA 1SBCA 3IQZA 2Y4NA 3WMWA 5K8JB 1QE0A 5A9SA 2W2LD 2FQWA 1OILA 4KH1A 2HSDA 3FFXA 3OVMA 3Q7SA 4Z7OB 4L0CA 5AVZA 3IE0A 4U1RA 1QFZA 2CHQA 1ULUA 2Q1SA 3H9EO 3AFGA 1EQUA 2IU6A 5KQLA 2R85A 1H8HD 3K9HA 4IDQA 4YJ2A 1IXYA 4UEJA 1GKUB 1PTKA 1XTVA 2JIRA 4Q0MA 2C07A 3F6YA 1C1XA 1QTNA 3NHLA 3DHVA 4MIOA 1MFPA 4DILA 5BV2P 1ZW6A 3G1WA 4KOAA 5D6OA 2GS9A 1J39A 1OROA 1LBQA 1ZD2P 4GOJA 3G2IA 2QU7A 1EFDN 1QVRA 3QYPA 1GTMA 3HCDA 4JU9A 2FG5A 3PEFA 2WD7A 4LVUA 5CTJA 4DM3A 4YAKA 2YWEA 1NLMA 3KTFA 1EGQA 3IVXA 1X2BA 1GN8A 2WJPA 1J2EA 1OFHA 2ZR7A 4NEHB 3S8EA 3PGMA 2XUFA 4CFYA 2NO6A 4M21A 3L18A 4JHXA 4BQFA 1H6BA 5E1MA 3EIWA 3PE3A 5F21A 3WYGA 4D4HA 1PZEA 1RFGE 2FZ5A 3W79A 4LVNA 2BFAA 1XXLA 2HY7A 1YMQA 2Y4OA 3HJBA 5ALRA 4ZRNA 5L3QB 3H2KA 2QD3A 1GU1A 3CMCO 1I0ZA 2ZI4A 1CNMA 2JFQA 3OE7D 4PZPA 1DBRA 3GDFA 3TW0A 5BY2A 2F3PA 2PUAA 1VBNA 4BGUA 5KHLB 1THMA 4TVKA 3HVUA 4XYLA 2JHGA 4FPXA 4NF2A 3OKFA 3B5JA 5F1PA 3OJLA 3M33A 2YY5A 3PGXA 4NYJR 1CZHA 2P40A 2IZ7A 2QVGA 4GO1A 1J2JA 2E55A 3GX1A 1A0OA 3W3ZB 1SIBE 2QLJA 4OQZA 4M0EA 4MQFA 4YJKA 3I3OA 1F7VA 3C3XA 4ZVLA 2CLOB 1Z06A 3FROA 4YCCA 1V11A 5K0FA 3QWBA 1V1MB 3T3IA 1BYUA 2FGJA 2YHUA 3NBUA 3NHRA 2JLRA 3DT8A 1Y37A 3SZRA 1GDTA 4C4PA 2OV6A 3AEXA 3A1FA 4BCDA 4ZVSA 1ZM7A 4TMKA 1OI2A 3FUVA 5LC1A 4XZ3A 2Q2VA 3UC5A 1EIZA 5KJFA 2VDMB 1T4GA 4O1IA 1V8FA 3QENA 4ZOLF 4DY4A 2VYND 1RAEA 4B71A 2NTEA 3FCAA 2XJ4A 2X5XA 1RHRA 3WFZA 4EJ6A 1NNSA 1QVVA 2C4TA 1M2VB 2XDYA 3Q8XB 4OHBA 4CXMA 2H1VA 2JH8A 3NHWA 1OAKA 1RAHA 4GD3Q 4LGCA 4IVQA 4R2XA 1QIKA 3RU9A 4F4CA 2GYWA 5A62A 4FB5A 3QW4B 4JY7A 5SICE 4MWSA 4KN9S 2OFXA 1OFGA 2ZK7A 5J40A 2CB0A 4L4SA 1G19A 1DAPA 3QG5A 2EBFX 3QKRA 1DMRA 3NHSA 4KXYA 2Y9PB 3KPVA 3QVLA 4BAUA 1NKSA 5JSZA 3OX3A 4I9GA 1XTRA 2IW3A 4MS3B 3CPEA 4I8IA 1JH8A 4AN4A 3ESXA 4LUCA 3GUCA 3PPXA 3PWTA 2XQVA 4M0PA 2J45A 2OMEA 1I5EA 3VHQA 4CF4A 5HTOA 4I50B 2PUJA 1AA9A 2YVUA 5DSXA 2AQ8A 3OHSX 3K0FA 3WLHA 3KSUA 3ZLUA 3WGZA 3CF2A 1D1SA 1SWWA 3W78A 1M34E 4QGGA 3V55A 3AYZB 1T0BA 1Y5LA 4BB5A 1P7YA 4Q3AA 4WY5A 3W2IA 4ER7A 1LU9A 3TPFA 1Y8RA 4TTQA 2IK8A 4KIGA 1W5EA 4BB9A 4BP8A 5KYUA 4RFSA 1ZX1A 1F9AA 2JFNA 3AF4A 1YQXA 1U0FA 2HLPA 4M6WA 4NYIQ 4HWGA 4MB2A 1S96A 3FTDA 2X0EA 5KSOA 1IOVA 4ISCA 1QKIA 1AKEA 3CJRA 3I28A 4U3JA 2ZBDA 3KR1A 1PV2A 4EO9A 4Q9AA 1LZKA 3WP0A 4WNAA 2GPTA 4RVDA 1OXXK 1AO0A 2NMVA 1NSYA 4P9NA 1A7KA 2CXPA 1T35A 5EQDA 2FWRA 1NXXA 3U6KA 3WLIA 4N01A 1RRFA 3GH3A 3UCEA 1HBJA 1Z4OA 4HLUC 1BE1A 1EB9A 1GZ7A 4QSMA 3LHFA 3AL2A 4N82A 3PUHA 1Q19A 3OOYA 4IH9A 2AE1A 4QWMA 1G5PA 4J90A 1JTVA 3QVOA 4PHFA 5KNDD 1LF5A 1IK6A 5BWMA 2JIDA 2HHLA 4MWTA 2I4MA 3IBCA 5FF9A 1NKVA 3L05A 1KDYA 4ZJZA 3U3OA 3AEYA 5IUNC 3NHMA 1VXOA 4MVWA 4ZMSA 2P3SA 3KJQA 3QG1A 2JLAA 4PAGA 2C7PA 3KEOA 4A3SA 5DM1A 4EJSB 1P0QA 1EUQA 3EDQA 3UXYA 2QE7D 1ULBA 4G01B 2QI9F 1ZHOA 4RUKA 5DN9A 1H0KA 2X2PA 1RBYA 5ALDA 5FTMA 2HU8A 2J48A 2YXLA 1X38A 5TXGA 4OK5A 1O08A 3E8SA 2NV2B 1IWPB 3KPWA 1KKMA 3LUHA 1DEOA 4IG4A 4YMUA 4RW0A 1HF3A 1NR5A 1T26A 2I6UA 2J3MA 2ON6A 2Z09A 2FW1A 3EOAI 3R5XA 3I58A 4L3WA 2N9UA 5IAGA 1G21B 2IU4A 3I61A 1R5JA 1PJ4A 2C5HA 2Q1UA 3NTVA 2ZR0A 2R97A 3PUVA 5BXQC 3AF5A 1R9NA 2HOQA 3C41J 1XRLA 4QFMA 3S28A 3TMAA 2O7SA 5JNSA 4HN4B 3KB1A 3KLMX 2HSJA 3LV8A 4P53A 5GIPE 2FE4A 4CQMD 4P5DA 2QRKA 5F1OA 5CB6A 2OV1A 1RLIA 2EZ4A 4H1TA 4IOJA 3W6NA 3G2OA 4KMSA 2I2BA 2X13A 3M1LA 4JEUA 1U28C 1XZBA 1SIWA 4LZZA 4ZYXA 2K2WA 2ZYWX 4RTJA 2G04A 4ME6A 4MRSA 3MS4A 4JH0A 2O7VA 3NALA 2VUUA 4DREA 3ANTA 3AHIA 4IJVA 1ZXLA 1WTCA 4P3XA 3CGWA 4HRYA 5JVDF 1IQUA 3I1JA 3GJ3A 1FBNA 2QN8A 4KODA 2FCRA 3EXHC 2WNHA 4HAIA 3TKAA 4QXPA 2FMTA 1PSWA 3DDZX 5F35A 3VTZA 4PLVA 4RELA 2G5CA 1XV5A 1J33A 4I5EA 2O3UA 2WVHA 4TWAA 4YPVA 1NN1A 5ED4A 4CTJA 3KXKA 5TS2A 4X65B 3T1YB 4IV0A 4CM3A 1FPMA 2ZAYA 1NLYA 1WMBA 2HH9A 2ZRCA 2I4TA 4PZZA 3KWFA 4YXFA 3AXSA 2J3DA 4K9MA 1QCDA 3DE7X 4AECA 2X0IA 5BMVF 3GCZA 1ODLA 2G8NA 2P1DA 2R751 4RPIA 5G41A 4F12A 3C97A 4N5MA 4FQ7A 4NE2A 1A8HA 3V1UA 1V8ZA 1QFXA 1WEHA 2BR3A 3UGJA 3FZYA 4GBGA 5AQ1A 1DBPA 1MMFB 5LMUB 3ZJ5A 4PLFA 4TWIA 1UZMA 5C52B 5FNVF 4G4JA 4E13A 4C06A 4GP7A 1O1YA 1ARZA 3D2AA 2EJCA 4NFYA 2Z8ZA 3K5PA 4YHBA 3SDZA 3E2IA 3C98A 2OM6A 4JT8A 4PZDA 3U1BA 2QVCA 1U9IA 2FRXA 3JAWA 3OY7A 4GMDA 4PSAA 2ODEA 3OFND 5K01A 4WXEA 3PGKA 2Z1DA 1XJ0A 2BM8A 3NTOA 3OHMA 5ICCA 3C5VA 4YT4A 4HQKA 2I1WA 9LDTA 4TLDA 1LEHA 3DNFA 4XLTA 1EZ1A 1P0IA 2GHQA 5I8ZA 3PC7A 2IV3A 2HFKA 2V7WA 2XB6A 3PKJA 1M2GA 4RDIA 2ODPA 1U4SA 2PU7A 1B1AA 3I64A 3OIVA 3SHVA 2QN7A 3I5AA 1CC1S 3TOSA 4B2IA 5J3JA 2GJ9A 4WZAE 3SU8A 4BCBA 3ZJTA 4GUAA 1S2MA 1VYUA 1E1NA 1POWA 4GR5A 3CJQA 1UC8A 1CJTC 3HP7A 4HXYA 2JLZA 3IERA 5KTMA 2XGOA 3GHYA 2ZAIA 4ND1A 3D4LA 5LVAA 3Q7PA 1QIFA 1OH6A 5DTQA 1X94A 4PG5A 4JR1A 4ALIA 3I1YA 4EL5A 2D1SA 3G2PA 2Q4BA 1NHGA 1QPBA 1YJCA 1OD6A 2CLSA 2VDKB 4RGQA 1K0UA 1T3TA 3VYTB 4E32A 1EGVB 4F11A 1RKUA 4IGAA 3ZHVA 1G8SA 3F47A 1L4LA 1SBYA 2G1AA 1GRVA 1R64A 2IA5A 3KP1A 1QF7A 3BILA 3GVCA 1ZGZA 2P1ZA 1Z35A 3VNAA 4A82A 3I8XA 3PEVA 4JI7B 1I4LD 1W75A 3BD6A 2WBLC 3TXYA 5AJVB 4B4WA 3T5AA 2QQ5A 1TD9A 3RAEC 5JAPA 2H48A 2PL9A 2CZCA 3NCHA 1M1ZA 3PQ8A 5AXBA 4U6SA 3K2IA 4ZP1A 3UV3A 3RQSA 1EM8B 5HIJA 3ULKA 5LYJA 5JNTA 3MVEA 2HLDA 3MWFA 3JARB 1N2CA 1E79A 1RYZA 4XUEA 1N1EA 1RLJA 4GT1A 4YLEA 3ZHUA 4G24A 2IV2X 2X0KA 2ADOA 3ZS8A 3GLIB 2C99A 4DSUA 1UM8A 1PS0A 4CEIB 1YRHA 1PVDA 4TKZA 5JS8A 1P2TA 2ETXA 5EC8A 1CRZA 1ZISA 5J2UB 5EI5A 1SG6A 2ZIXA 3EZ9A 4L74A 4BQRA 5DSTA 3GGSA 4PZUA 1VL2A 1Z5UA 2O2HA 1KPIA 2II6A 4Q9JA 4G63A 3X3HA 3CWCA 5L4LA 1AM4D 1OI3A 1DIBA 1ZBDA 2VJAA 2ZS9A 2VF2A 4B7XA 3A1VA 3OOHA 3OZCA 4MYSA 4D4JA 1IONA 4DMFA 1E7RA 3IV6A 1QIEA 3HQ4O 1VRCA 3IKJA 1PX0A 4B75A 7REQA 3LFTA 3D8RA 4DRZA 4GZMA 5FQNA 1XRSB 2QUKA 2ZUDA 3MIZA 2A0XA 3IT3A 3MAJA 3KPJA 2VHXA 3C7KA 2IXBA 4FT4A 4K9OA 3L01A 1XP5A 1NGSA 3PDIB 4MYTA 3GA0A 1R8YA 1LFAA 1YKSA 5SZHB 2F8MA 1U3TA 5JAUA 3FA2A 2FXVA 5KSPA 5CP8A 1YBHA 3ZQUA 2QR2A 5FUWA 1B42A 4YT2A 3NRCA 5ECGC 4Q1FA 5TPZA 3USCS 4FJ2A 5CMLA 1V5IA 3T7DA 1R8JA 1E5DA 3BIWA 3NUGA 5JAQA 2X9VA 2P2GA 3C6MA 4XR9A 4S24A 1RLMA 3TJZA 2XXAB 5JZOA 4Z7NB 5KNCH 4C14A 3LJKA 4H3HB 4L9SA 3WMXA 3P0HA 3RROA 4OAOA 3NAMA 2RG1A 4M0DA 4CT4B 3P9IA 4FIDA 5C5IA 1LH0A 4RVNA 1LPNA 4HZGA 5L3ZA 3SYLA 4B4DA 2GJ4A 1IVNA 3H2GA 3F9IA 1W9MA 5JSHA 1Z38A 1C29B 3OUTA 1TVKA 3LT5A 3B38A 1E61A 2QLFA 1LW7A 4QNNA 4DBLE 1HDCA 3ZZTA 4NNPA 5FWDA 2EDAA 5FB3A 4AQ7A 2B8EA 2O8EB 1JHXA 1Y4SA 2GO7A 2LUOA 4D44A 3AB7A 4MKFA 3W2EA 2V7GA 2GM9A 4QRHA 1CVIA 2B21A 3OT1A 3R9WA 2LIVA 1Q7GA 1BXRA 4N40A 3G82C 1PSDA 2Y1WA 1KK3A 3MINB 1M2EA 1TF7A 2B5VA 4PLHA 1K1EA 3JYQA 2I2DA 2HMWA 3VV3A 4K6HA 4YQZA 2ZI6A 2DBYA 4LISA 1TCCA 4NAHA 4XOIA 4FHDA 4UNRA 4BECA 2RB5A 2DP4E 3NONA 1GXSB 1MX5A 3IFSA 3T1HB 1J8MF 3L0IB 2WKSA 2EKQA 2V8OA 3T5DA 3EZYA 4CUZA 1WIWA 1CJMA 4HWOA 3K53A 3EOBI 4HB2A 1Y82A 5CCDA 4D0LB 3QMMA 4F0JA 3JQAB 4BWFB 1GZUA 1RACA 2ECKA 5EZ6B 4X6XA 1QHEA 2QM7A 1UKCA 2YH2A 2Q29A 5LDGA 2DKFA 3EEBA 4FZ3A 1PFKA 2HJWA 4QC2A 2W6PA 3KSZO 3QV2A 3ZDAA 4ANFA 2FN8A 1W4RA 3II6X 1X7WB 1FIUA 3ZDCA 3FPLA 5L6MB 2A67A 4ZEOA 5E8RA 3IJRA 1ZC4A 2H59A 2QX6A 1MT3A 3B78A 4KXWA 1IHUA 4CLHA 4EJMA 2CJWB 2O2ZA 1RQRA 3EODA 2WSIA 2JRCA 4FOOA 1TXGA 1OX4B 2Q50A 3KLPX 3GJQA 3NHJA 4EO4A 4Y2XA 5TR9A 1J0XO 3EDCA 4FFBA 4J1TC 3LZCA 4KFTA 1GUZA 2BHRA 1Y89A 5C1OA 3O1JC 5AHWA 3STTA 4HUQA 5LJIA 2J9ZB 2G5PA 5FV7A 4Q7QA 4K9SA 4MGHA 4ENUA 1QQ5A 2GAJA 2ZYRA 2PS0A 2EXXA 3QGMA 4IBOA 3ZDRA 1TFRA 3K9LA 4D2IA 4IJ6A 2H29A 5EVJA 4MAMA 3Q0IA 2JLSA 4MSUA 2CE2X 4B6SA 4CFSA 1PK9A 5BWOA 1OIXA 1VG0B 1VHJA 2DFKB 5H5JA 4EJSC 1CDOA 5D3MA 5F98A 4D4IA 4OI2A 5ADVA 1CF9A 4RLFA 3WIUA 1XFDA 1O96B 4XQ9A 5LXTA 1JEJA 2G80A 4C1BA 4ZYVA 3WWDA 3FMPB 3RR2A 5DCYA 5ALZA 3RF6A 4BYMA 1ODTC 2H1IA 2GLTA 3LGXA 4L5IA 2GBPA 1X15A 3HK2A 3BN3A 5H4HA 1SBQA 3HWRA 3R1IA 3JQCA 2O3SA 1TT5B 3MGKA 1S02A 3NUQA 5DYGA 4AJJA 2XTNA 3IAS1 5IF3A 4QBKA 1D1QA 2HO5A 2QHXA 5EHNA 2NP7A 1A4XA 1E2FA 3BGOS 4YMWA 6AT1A 4ZVUA 3BGWA 5DM0A 1KSFX 1SEVA 1GG5A 2AH5A 4JL8A 4KAXA 4BO7A 4BX0A 5BSTA 3HDJA 1NU6A 4OXKA 4WVFA 4A0SA 4CM9D 1BH6A 2XBMA 5T41A 4A5OA 3V80A 1S7GA 3SDBA 1Q3TA 4O08A 1RRVA 2E87A 2JCVA 5HKLA 4C3OB 1P19A 4C6HA 2RONA 2VDLB 3A1NA 4N8SA 4RE6A 4CU5A 1DLIA 1QLJA 5K3EA 3EVGA 3MPUA 4G85A 1E9AA 4K9LA 4HZUA 4NX2A 3DC2A 1NR1A 1YMUA 4C0JA 1AMNA 3OCXA 5LD2B 5DNAA 3TLGA 5ALJA 4URWR 5EYPA 2Q0SA 1PGPA 1DJQA 3F5DA 5AKKA 3WL8A 3PQ2A 2NUAA 3QKWA 3IXLA 4TV8A 2CVFA 4I0WB 1KAHA 1J2RA 1Q95A 1JFFA 1WB5A 4XQCA 5CW1A 2V5UA 3ZZUA 4WTOA 4DUGD 2PX2A 2B34A 4XD7A 3AJDA 2PLWA 4E5KA 3B1YA 2HPVA 4RHFA 5MFZA 2NT3A 2OO7A 5TGDA 4JFAA 2JB9A 3OFVA 3CRMA 3Q8LA 3A3OA 1RWWA 4RYDA 3A1DA 5CJPA 5CLQA 3JWGA 1NVXQ 4MW2A 3ROEA 4MYCA 3AHDA 3LUCA 2VPYA 3E22A 3GMSA 3ISVA 1N75A 3KQQA 4XVCA 4DQ0A 4DQUA 3RT1A 1EDDA 1JAYA 3VO9A 3BHNA 4XA8A 5BPHA 1VIDA 3PRKE 1FE8A 2DBVO 3LPCA 4XX0B 4EHFA 1R4MA 3N7UA 4C07A 1NW5A 4YRQA 3A27A 1JL3A 4IV5A 4LJ7A 2ZJ0A 3T3GA 4TLAA 5FPHA 1NXTA 2WHYA 4TKVA 4TXJA 3ZVNA 2QVBA 4R1QA 5JCOA 4G1MB 2HZBA 1LBSA 1WO8A 4J91A 2F55A 3W4IA 1Y3FE 3AR7A 1YBMA 1A5AB 1C3OB 1L6IA 1E20A 2VCHA 3OQJA 1IN7A 2XJ9A 4I36A 1L5FA 3BJRA 3S2ZA 3WDKA 1SZJG 1JG4A 4E22A 3IOBA 2D62A 4MVJD 5KKAA 5T4EA 4CF3A 1RZ3A 2QVYX 3PLAE 3MXTA 3FY4A 1USWA 2D5AA 3R0IA 5JD5A 3BHMA 4KHPB 3IOMA 1F1JA 1KHHA 2FWMX 2P9GA 1O0SA 3F3YA 2QX8A 4R3WA 5I9TA 4DUPA 3W5IA 2ETVA 1L5QA 2HWXA 3GRKA 3SY8A 1A9XB 4J49A 5JMPA 3FM9A 1U6IA 4EHHA 4QJ5A 5DHRA 4ETNA 5IS2A 3V34A 4Z51A 4QQ8A 2WHPB 4I8XA 4ZYWA 1PR4A 3CX6A 2B1QA 2ZAMA 2BBSA 2UZ1A 1GGKA 4X1KB 3KUKA 1NP6A 3C6YA 4YGXB 2HNAA 4AF8A 3CF4G 3MLAA 2O5RA 1HT0A 1EYZA 4MVJG 3HI4A 3U3XA 3OTWA 5K99A 3SZOA 5FWNA 4L72A 4MV1A 3K6RA 4QXAA 2YMQA 3C8UA 3WGIA 2Q1YA 3HYTA 4YCLA 1QIIA 4DV4B 1NONA 2A8YA 5GY7A 1W36D 4AKHA 3FWYA 4H7DA 1ESNA 2JDID 2ZIUB 1X1QA 2V7BA 1V3UA 2DFNA 3GLHA 1K4MA 1M1YA 1WW8A 2JKYA 2RC6A 4JLBA 1RZVA 1WKVA 5FL7D 5JY6A 1S8AA 2J9XB 3NP7A 1L5LA 1WHTA 1II8B 1ZD8A 2FK8A 2V1UA 3HKCA 4KMOA 4D97A 1E2QA 2FZ4A 5IM4F 2QU8A 2H1WA 5F3WB 4FC6A 1XJCA 4ZEWA 2P4HX 3LDFA 1XI2A 3KYDA 3VISA 4RZHA 2Q41A 5F2EA 1PGOA 4PPYA 1H94A 1HKUA 5LWQA 3MHTA 4L85A 4PNEA 2PE5A 2BMVA 2B7CA 4ZREA 2O2CA 3GO4A 2JASA 1HEIA 3G7SA 3QLJA 4EGQA 1PO7A 1UFKA 4Q66C 3R7WB 5AOCA 2YJ4A 4LNAA 3C5WP 5IBPA 1BWRA 2BCEA 1FLAA 3AIOA 3G7NA 2DWPA 1PVOA 1IDN1 2WF8A 4U2GA 5KUTA 5BR1A 4CR8A 2VATA 1O87A 2BFCB 1JX6A 4EKIA 1TU4A 3IULA 3ELWA 4QOSA 5H68A 1UEJA 2HADA 5CDSA 1USVA 4K0KB 2QNBA 1UXGA 3K8YA 3WG9A 7MDHA 3F8SA 5K0JA 1E0SA 3PQ4A 1GNLA 2XI4A 3OM8A 2FPUA 2UDPA 3CY6A 3H2ZA 3PXGA 1CY6A 2DUUA 2Y1OA 3DCIA 1NNI1 3KB6A 4UJ3A 4F2DA 2QTBA 4UUBA 4RKQA 2B69A 5CA0A 1P1JA 1SKBA 3SHOA 4AJIA 1XWIA 1L7XA 4CKEA 3DKIA 4ZYZA 2YNMA 4WGGA 2HIGA 4LRWA 1TM2A 3GXBA 4BBPA 4NK5A 3TRHA 4HF7A 4B3SB 4QTTB 1PL0A 4RS4A 1KERA 2C00A 3AW8A 1P5HA 2O8NA 4RF2A 1COWD 3RAPR 4N7JA 4TKUA 3RVQA 4QDZA 1QH9A 3ETCA 2HWKA 4Y9RA 2XNJA 2IY7A 4PLWA 2VH5R 3M8KA 5HRCA 4AJHA 3JTEA 3B8EA 3ZVMA 3NKLA 5JPIA 5BUZA 2WMNB 3BAFA 4B3BA 5TMBA 2G08A 4ZYYA 3FVVA 4M0LA 1E2GA 3U81A 3T7SA 2IDZA 5FBZA 1ZN7A 1U04A 2ODAA 4L16A 2DQ4A 1S3FA 3Q0TA 4QJIA 4Q7MB 4RS3A 4C04A 3VNVA 1EVJA 2NU9A 5ALHA 2XDWA 3MYRA 5KVVA 1HQCA 2Z30A 1KJ8A 3WLSA 4C5AA 1M2OB 1O3YA 2VQ6A 3UATA 2XNKA 2JL1A 1Z07A 3NTXA 4P3KA 1LX6A 4XARA 5BR7A 2IDMA 1XXHE 4TZ6A 1SVKA 1G291 1I2AA 4EFKA 5JOQA 4EB6A 3SXPA 1L5HB 4KACA 3FWNA 3H9BA 9LDBA 3S2YA 3ZQ4A 3LTNC 4YK7A 1NFRA 1AF4A 1M54A 1RYNA 3BWYA 5HUJA 2FQXA 3QM1A 3ECSA 4LE1A 4UTPA 2YTZA 2YV3A 3PCRB 4AZ0A 4RTPA 3JATA 1KBZA 5FUYA 3VC3A 2CJPA 3GN1A 1Z0SA 2GVNA 4U63A 1V96A 5IKOA 2VOJA 4ER0A 3BULA 4G56A 3UUGA 2HK9A 2B5WA 3FSGD 4RC9A 3M2PA 2VUTA 1MAUA 3NWPA 3A26A 1H22A 1JFLA 1QHGA 1P4AA 3BMNA 2R60A 5LBIA 4EHDA 1JEAA 1GTG1 2AF3C 2WNSA 3BQMB 4ARCA 4A0HA 4FGUA 1GOTA 3HNOA 4GNRA 4GM1A 4ZHSA 1KVUA 1SK9A 2VK4A 2J0EA 2EERA 1ZHFA 2OVFA 2QSUA 3LPLA 3OAAA 4KG7A 5DP2A 4EIWA 3CZRA 3UEOA 1ZUD1 2MYTA 3A1TA 3NAGA 5BSWA 2ZWAA 1LNQA 1E9SA 2BBTA 4UUQA 5EXXA 1WW3A 3WFJA 4HTAA 2PL3A 1P1IA 1XAIA 4B0OA 3GI1A 5EWMA 2O7RA 2PTHA 3RS2A 3L8HA 3DQQA 1BAPA 5B30A 4MQ5A 1C9NA 3NRJA 4K1LA 1SY7A 2HA5A 2YWCA 1JDJA 5L45A 1U80A 1G5FA 5J1TB 2ZTSA 4Q4DA 4A23A 2GAFA 3D0RA 4OUKX 4WN3A 4IEFB 1OTYA 2YZ7A 3SYRA 1BJTA 2O54A 1J42A 2UAGA 1QH1A 2PH5A 4JXJA 1C8BA 1OHHA 4WBNB 1RPZA 8MHTA 5LKAA 3G9ZA 4KR7A 3ZJ4A 3CJTA 2A1UB 1QOQB 3P0JA 4KE7A 4RLQA 3U2QA 2ZDHA 3A2KA 2V5AA 4OG2A 1AT1A 2WAYA 1TM7E 3LSYA 2GFQA 1XEWX 3KX2A 4NEGA 4DNPA 5JH7F 5DB4A 4E3ZA 1TZBA 1CK4A 2BEWB 4O59O 3QXSA 1EK5A 3EQ9A 1UPXA 2EDCA 1P1RA 2IHYA 3DHYA 4JCOA 2PLFA 3RBAA 3WDMA 2Z0MA 3OE1A 4YJHA 1X8LA 1L1QA 1BCRA 1QCZA 4QJBA 4MXDA 4RENA 3T8YA 4H3KB 5FTLA 5LP1A 2WTAA 3ONNA 1YIOA 2OA0A 1FC0A 2CGEA 2HSEA 3BYZA 3QPDA 1STOA 3ECAA 3TZKA 2XUGA 1BWPA 1V3QE 2C4HA 2Z2IA 1UK9A 2ZETA 3I32A 3N2LA 3PGA1 4NMLA 3RYHB 3VGJA 3IL2A 4RY8A 3T5MA 5IRCD 4LRYA 2PX6A 1Z62A 4BFWA 1FFXA 3FJ1A 1JLLB 1VZ3A 1CLEA 2EYUA 1FP1D 3GCGA 3PNYA 4BLOA 3R40A 1SB8A 1IJBA 4IJMA 5A5VA 1Q0ZA 4IW3B 5IMSA 1J5XA 1M8JA 4DLZA 1XYYA 4YRCA 1Z63A 2D8AA 2BBOA 4E15A 1IG0A 1PHPA 5HZGA 2IUSA 3ONVA 4IP0A 4MUNA 4MCAA 3VPGA 2FWPA 3VR2D 4HXGA 1BEEA 1WXXA 2R44A 5B37A 2CD9A 3WMRA 3UXEA 3ROGA 3KDAA 5EP1A 3W9BA 3QPBA 2QZ4A 3DOCA 2H5LA 2HN9A 2XCTB 2JFUA 3QBTA 3S2SA 2QRHA 1SQ0A 3E7DA 3HCOA 3SZ3A 1PKXA 4FDTA 3S1SA 1V1MA 2IHVA 3OKPA 4GOND 5LQAA 2EG5A 2PKRA 3PRJA 2QWXA 3QE2A 4O4JA 1WW2A 2WPNA 5AM5A 3RUCA 1J2TA 5ALTA 1MW8X 1KOLA 3NHFA 4BO4A 1LK7A 1WE2A 1JQJC 2PSEA 4R6XA 3ZV6A 2W2KA 5FTWA 3WKCA 5CDHA 4M83A 5EJAA 3GLSA 2PGOA 2H4JA 4BFXA 5J5AA 2D3TA 1GQFA 2QRPA 1UDBA 2JIQA 5F64A 5AVSA 2GBGA 3GRVA 1PYGA 5B58C 4OHYA 3KE9A 3C7CB 5IBQA 5CB4A 2OYSA 3E9MA 5BNIA 2HJGA 4BMSA 1LPMA 4D4GA 4HAUA 5BWCA 1TMGE 3AYXB 3RRMA 4PS0A 1PZXA 4BRZA 1PL6A 1US8B 2VTEA 4L5CA 3BXPA 2GTHA 5JATA 5K0BA 3K70D 1ONSA 3G85A 1ENYA 4DPLA 1D1PA 1T9CA 4GI5A 5EIFA 2D1QA 5EJ4A 1WU7A 3DZJA 4QD3A 3VM6A 4F9EA 4ZI2A 5CLJA 1B76A 1L8QA 3NBQA 1WWKA 1FDWA 2GNPA 3K0HA 2QTMA 2PRIA 3C16C 1DPFA 3TUJC 1N32B 3GLQA 2Z04A 2CDCA 4MIEA 4B8WA 4Z2AA 2VQFB 3SFVA 5C2JB 1KZYC 2CV2A 2HREA 4GQAA 2QSZA 2QTZA 2P68A 2V45A 3O74A 5IAAA 5SZKB 3T5PA 3M6MD 2XY4A 1DTSA 1ZH0A 3GNQA 3OO1A 3OLWA 4GVPA 5BN4A 4QGSA 1UJ4A 2VDUE 2RSLA 5AJHA 3N39C 2R4UA 3HKEB 2I3GA 3GUVA 2CHVA 4H6PA 1VLZA 1MO4A 4C0BA 4I1UA 1RKVA 1KZ7B 3INNA 2PR7A 4MCIA 3Q3CA 2X0FA 1QS0B 3VR3D 4M89A 4CF5A 1O97D 3CLHA 4S35A 5L3SA 5K3AA 4E5MA 1AN0A 2GPNA 4L76A 2XITA 4YR9A 3C4QA 5B4TA 3GPDG 3I6QA 4GHWA 2WE8A 4KV7A 5DGHA 4YRZA 1JNXX 1ZEMA 4N5DA 3VO8A 4DMHA 4XXHA 3EDOA 3O8OB 4LOJA 1E5QA 4A8JA 2Y1KA 2FPLA 3A9TA 4Z4GA 3AINA 3QLVC 4OXYA 2VPTA 3I1IA 3ON5A 3P7MA 1RM3A 3HGMA 1XZFA 5HDBB 5DNYB 4GYWA 4R1SA 5CT6A 3D6UA 2WICA 1M6HA 4GMKA 3AXTA 3IMFA 5BYBA 5MN5A 3QXHA 1DO0A 3SYTA 3S70A 2DVMA 1H4QA 3OLQA 1E79D 1GN9A 5I3CA 4A2WA 4GH5A 1ZJYA 2BHLA 3E23A 2HPHA 4MEBA 4J1TA 2FJUA 4LI0A 4UHFA 5ED0A 1FBTA 4RGBA 3TNDA 1XMQB 2P90A 1C7JA 3GLUA 3PQ7A 1D04A 3DNPA 3R3HA 4LW8A 3VVLA 3ZDXB 1LD3A 4EQ6B 3RWMB 1GZDA 2WYHA 1GSHA 2BFBB 2HXYA 2UYYA 4OHXA 5E38A 4QGHA 3U3DA 1DPGA 4FGSA 2IC5A 3AUKA 4WCFB 4AVYA 3L4JA 4ZC8A 1VP9A 1KQOA 5P21A 4OB8A 4LZJA 4HBZA 5HMMA 1A5TA 1IDOA 1N8KA 3IEIA 4IGFA 3B60A 4WESB 1MC8A 3PFFA 4RHUA 4NZNA 3RSSA 4KRYA 3WGUA 4N39A 4P98A 5TC4A 3SXUB 3GY0A 1E1RA 2GO1A 4S0ZA 2C98A 3R6DA 1E96A 2E4YA 1V4BA 3IT0A 4MRMA 1GQ2A 4RTMA 3WNDA 3OEWA 2BE9A 3SSAA 1EFPB 3WTBA 5FOWA 5IHPA 2R6HA 5ELXA 3FNHA 2H11A 2Z3WA 4ZEMA 1HNNA 1W30A 1Z6AA 1PEYA 2OWDA 2JIBA 1RNLA 1ZICA 2IQ5A 4JBHA 4M38A 1OT5A 5JQGA 2Y1CA 1FMFA 4RNCA 1YJXA 4B73A 2FSHA 2XCSB 4MGZR 4OHFA 1U7PA 2QRVB 2X86A 1SOWA 1TKBA 5I9IA 1GAJA 2Q2NA 3R9XB 1CVLA 1WZIA 4M86A 3TXAA 1SVWA 4W9RA 3F74A 5DE3A 3TZBA 1L5RA 4L8WB 4UXHA 3V48A 2GN1A 3C3JA 2H1RA 1JKXA 4AJKA 2PX3A 2GDZA 2X9GA 2C0QA 4M2LA 3SYNA 3FYUC 2JAXA 1II9A 1DAIA 1LDBA 1SC4A 2F67A 4QJ3A 4TV9F 1H1TA 4P7KA 5JG7A 2FEPA 3HU5A 3EGDB 3O47A 2Z3VA 2FF7A 1TJ4A 3IQWA 4RIFA 5HQ3B 1JR3E 3LUFA 2A78A 3DDOA 1VA4A 1NJ1A 3NEAA 2LTAA 5F2NA 3NC1C 1N2OA 3GRRA 2JBWA 4JYBA 3TPCA 3OQNA 1ZJ4A 4GW3A 2GZ3A 4LPKA 3QSGA 3AESB 4FTWA 1F48A 3A6JA 3JTMA 1J99A 4PXYA 3PQ6A 4QO7A 2NU6B 4KZKA 3AKYA 4KVGA 2CNWD 5AJWA 2GKGA 4O3FA 3AW9A 1ZOLA 1ND5A 4WFKA 2E1RA 1FYXA 1T6BY 2P5TB 3EEFA 3KOOA 1XMVA 2HRRA 4AZTA 2H63A 1TJ5A 3V4RA 2E1PA 2VF4X 3PZRA 4TTSA 1U94A 4WW0A 5GZ6A 1FJGB 3A05A 3HGQA 3PGVA 3WWZA 1R0KA 3IVCA 2IT1A 4S12A 1FTGA 1WCXA 2OCLA 1PYOA 2C4UA 2VDJA 2OQRA 3GZJA 4JIGA 1YRQA 3GEGA 2CDAA 3PQEA 3RUIA 2D7CA 4UAJA 1BWSA 3D8UA 4TXMA 4BXOA 1EE1A 1GCUA 1KXZA 2HDHA 3O8BA 5HOEA 2BLNA 1RP1A 4IXDA 2OBLA 1NR7A 2LVBA 3R5KA 4RJKA 1TYDE 1PT5A 2XF8A 1SJ9A 4PYKA 2VUSA 2OAEA 3DL2A 3PYXA 4WEOA 3G5UA 2OKGA 4UM9D 4AK9A 5THQA 2RHHA 3I04M 4L2IB 4TUYF 1K89A 3V97A 1RYFA 2R3SA 2VAXA 3AHCA 3IV9A 4AUKA 3EAQA 1TTQB 5CVDA 2QVLA 3LPMA 1Y9DA 2JBAA 5EXSA 1PNQA 2Z5VA 5JXGA 1OWNA 4XH9B 1SZPA 5E6SB 1NXQA 2IXEA 2VSFA 4ZVNA 2DR0A 2BFDB 2RGDA 1SQGA 3FH0A 3M83A 3QUAA 1EAYA 1VMIA 3MAGA 1P9WA 1QK4A 2QL6A 5CB8A 1VJ5A 3A6PC 1A7AA 1TUEA 3SS8A 3W5HA 3TKYA 2ODTX 4XTRA 2CJXA 4KXLA 4BWVA 1GAWA 4B80A 4J6FA 5CB4B 5J4HA 3LXRA 2OMKA 3I2KA 4BUCA 1HH4A 1ZZEA 4ZT2A 5TDHA 4EFDA 2RGEA 4A10A 1YRBA 4X6UA 5HOQA 4MO2A 2DH5A 1W6UA 3VO1A 3E03A 3LBNA 2IQIA 4JWTA 3E7WA 2QBYA 1H6CA 4L8YA 3BB4A 1HNWB 3P9PA 4FDMA 2YV5A 2ZSDA 4W9NC 1C50A 3JQ9C 2I8CA 4QPPA 2GJAA 5HHTA 1Q2XA 3IBGA 1RXCA 3VPHA 1AA6A 2XQIA 1W46A 1N5MA 3MJCA 1B7GO 1ACJA 4WZBB 5LP6A 2PKWA 2O8FB 2OCAA 3OIWA 3ESCA 4CEIA 1U6JA 2QYSA 4BFTA 1OGIA 1BDMA 3CW8X 1YNOA 1OYYA 4QNMA 5J2UA 4V3BA 3HB9A 3NWEA 4M0KA 1U2QA 3RHTA 4F60A 3WNCA 2FWBA 3KLOA 2IV7A 1J8FA 2DPHA 3T9BA 4RFLA 1G8PA 4EABA 2WWVD 3VYWA 1MNAA 5PNTA 1C7RA 5EUBA 3CW2A 4QE3A 3EVTA 2MSNA 4O2AB 1I51A 3LK7A 3FCCA 4JNCA 1T34A 4IRMA 2BM1A 2VA9A 2Z43A 3C3PA 4DLTA 4G5HA 4J0IA 4UAGA 3WDLA 3MWDB 2DPLA 2YIDA 4ZZIA 2OPBA 4MGIR 3R3VA 1Y5NA 2BTQA 2ZJBA 3VH2A 4FYKA 5C37A 1AKYA 1HSZA 1PT8A 4TLCA 2WIBA 3HNRA 4EHAA 1PR6A 1N5DA 2CUZA 3ZUGA 3FNBA 4DSOA 4KITB 10MHA 1CS4C 3FNGA 4B4UA 4YT5A 1H2HA 2QQ0A 3ITEA 5CIQA 5EJFA 5A0TA 4ZO8A 3TSAA 4RFVA 3FAZA 1VHLA 1CIJA 2G1KA 5DHSA 1XLWA 1UOEA 1O94C 1Z4IA 4R16A 4FB4A 4JX8A 2XOEA 4N0MA 4Z86A 4WLOA 1GPAA 1Q84A 3CU5A 2D4HA 3E1SA 3M6FA 3CZAA 3JAKA 3L5KA 2O1EA 4I14A 4S1OA 1YCFA 1HG0A 5CDFA 5K6AC 4JI8B 1Z0ZA 2XZTA 4JSYA 3ETLA 1BGWA 3ZVLA 4E7OA 1SXJE 4CKCA 1DE0A 1QSGA 1ODJA 1VECA 3SS7X 3EG9B 1EFCA 2V97A 1LUAA 1UMCB 1ZJ5A 2JFZA 3IUYA 3M5PA 3ENVA 2R1ZA 3INGA 3H5WA 1CZRA 2VJKA 3VNBA 1TZ2A 4E31A 2Q5EA 2A9PA 2CLCX 1PK8A 4DQDA 3MOSA 2MSLA 1KYZA 3RYFB 3FCYA 1FUKA 4P54A 4KR9A 2PMCA 5DM60 1FLDA 2FXIA 4HGRA 5LZ9A 2P91A 4CMEC 2F64A 4H27A 2OK7A 3UJ6A 1QFYA 3CYFA 2O7NA 1MHPA 2Q8NA 3LL7A 4IDCA 2K7FA 4JB8A 4YVFA 2QTAA 3H4VA 2AFIA 1QZTA 2JFHA 3LL4A 3OZGA 3SVZA 1QPZA 4KE9A 1W2HA 3FDZB 4TTJA 1QP0A 4R2IA 1E8DA 3D3EA 3TH5A 3Q6MA 2P78A 3GAMA 4HMPA 4M7OA 1DWOA 2E21A 2KE5A 2X41A 4NBSA 4OHUA 2UKDA 4N5HX 4BE9A 3FWZA 4C5BA 4LSWA 2ZGVA 1B15A 5EKSA 4PEVA 5GJWC 5JD4A 4IUDS 2D2IA 5CXUA 1QFJA 5LZ8A 3R7LA 1QE5A 4DZZA 2FG6C 3QE3A 4IDFA 4JLNA 1HY3A 4OHMA 2EL7A 2CLEB 4MUBA 2CJFA 4NCNA 1SC9A 1WTAA 1ENOA 3ZWOA 2Q27A 2W6QA 3KZKA 2A6PA 1PU2A 1QMPA 1DADA 3MJRA 4ZV4A 2A1TR 2VYVA 3CZCA 3EA5A 3ND8A 3O21A 1PW7A 4RIIA 4CJXA 4E09A 4TVOA 5ADHA 1NJSA 2I29A 1CCWA 1MZVA 2R9VA 2VDNB 3DJFA 4KDCA 3WAKA 4ZMRA 1X7WA 3LLMA 4BU1A 5GJBA 3H5VA 1GZVA 1U0SY 2C1ZA 2RGUA 3LDUA 5A9TA 1RMQA 4DLUA 3TK1A 4D02A 4JQOA 2BMDA 4H0NA 4RACA 4G4GA 4IDOA 4D4MA 3DQPA 3DXYA 5JASA 4TYNA 3JASA 4AZ3A 1VI6A 3BSFA 5CTAA 1K2WA 1FW6A 4AN1A 3JW8A 3OQIB 1MVNA 2I7XA 4IIJA 3LY9A 2NSLA 3LXUX 1E59A 1D2MA 2QNIA 2A4KA 2UZAA 3GFBA 4RM3A 3FZEA 4CT5A 2O57A 4UTRA 1FEZA 1WB6A 5BV8A 5EJ5A 1SUSA 2OESA 3C1AA 4PO3X 3HVIA 4R1TA 3EULA 3CE6A 2C61A 2W71A 4MS1B 4WCFC 5EHQA 2IX9A 3T7KA 2GWHA 2XTMA 3WGJA 4UHDA 2NSYA 2IYEA 5A71A 4JELA 1KDPA 4LC0A 1VL6A 1GQYA 3WGNA 3FLAA 3CR3C 5JAZA 4FHGA 1IXSB 4XUDA 3UC9A 1YCHA 2CHFA 2O3JA 3U62A 1HKHA 1RHMA 3ZX4A 1HFWA 1HDXA 4YRPA 2Q1XA 1JRLA 5BUCA 1JBKA 5K0SA 3U7HB 2HDWA 3MC1A 1JH9A 5BXYA 4C7BA 2B25A 2YX1A 3B52X 2PKCA 1IN5A 4QQRA 2O8CB 2QRGA 4HWSA 3PE4A 1Z13A 4HMQA 4KNVA 3ZU2A 2Y71A 2VJCA 1ZSYA 2EF0A 3TTXA 5IJAA 4OAQA 1TT5A 4F21A 1N5RA 1SQSA 3NP9A 2GHRA 2WYOA 2JAHA 3QFCA 3RU7A 3EASA 4GVXA 1GPJA 3EHDA 2NU7A 3LFHA 4A2QA 4DNFA 2XUDA 4Q16A 1K9VF 4DT1A 4EY8A 2QRNA 4DJAA 4F3NA 5A3VA 4A0FA 2GX6A 3SPXA 1YZ3A 4EA8A 1E2PA 2VHWA 2JGKA 4I55F 1ULTA 2ECQA 3CVUA 2WYUA 1YBAA 2H7XA 1C7QA 3AP1A 2RKWA 3NHAA 2QT1A 2WHQA 4BL5A 2W0MA 1IUOA 2OAQ1 2HRQA 4DV6B 3EXEB 4UM7A 4YAFA 4BQSA 3R5HA 4B7ZA 4ZQBA 2RHGB 5GGYA 1AMUA 5LB2A 2YXPX 5LOVA 3E3OA 1TYEB 5CFRA 3SQNA 2JHPA 3RGWS 3CB2A 3E9NA 2X77A 2FRVA 2GFHA 3RD5A 2AFHE 3P52A 1GCIA 2RGNA 4YY3B 3FMVA 2ZI5A 3GRFA 5HS6A 1KEZA 5SZIA 1N77A 1GNPA 3AHJA 1NC1A 4BC1A 3KOXA 4P35A 5AI4A 1QPGA 4WOKA 2EG9A 2B8WA 3M6LA 1F5NA 3FIJA 2QW0X 4F9FA 4OEHA 2XCIA 3NEYA 5KVSA 3CVYA 1UJ6A 1TC1A 1WPXA 2OCXA 2JK1A 1HYHA 1TDJA 4HJRA 3BAZA 4MQLA 2DOKA 2FUCA 2IL1A 5I7VA 3ZEAA 3WLOA 4FI3C 3ZU5A 5GM2A 2XB4A 1PJRA 4L6IA 1Y3DE 3I6YA 4R0VA 3HXMA 2HHHB 2ZI9A 4JP1A 3V2HA 1KAMA 2OY0A 1MV8A 1XPJA 4GXQA 3EG5A 4C43A 4BFCA 3V4PB 1PZGA 2PT9A 1B73A 4LOKA 4OYHA 3KPUA 4TPKA 5IAEA 3TW6A 1E4EA 1UPCA 1FP7A 3AU8A 4XYBA 2GR9A 3X43A 4HUJA 4G5YA 4YFVA 1KEUA 5FBLB 5DV9A 3FNQA 3VUEA 3UBTA 1Z0FA 3SWWA 1J1IA 4DB4A 4P7FA 4QIHA 4YCBA 1BKYA 1EFVA 3HO8A 3MCZA 3R0ZA 3QKSA 5IZCA 3HDYA 5AOBA 4LVCA 4AKGA 2W0SA 1L4EA 3UW3A 3LWZA 4G0OA 3HCNA 3DFKA 3OPQA 4J0HA 4E2XA 2SHKA 4OMDA 3RVKA 4Y6SA 3I2FA 4EG5A 2EW2A 3VTFA 5CAEA 4I1RA 5KEIA 2DB3A 3K16A 2FFQA 1JQDA 1P9LA 2GVZC 3O1HB 3PJGA 1JDZA 1K4YA 4QDKA 1OE0A 2JGLA 3I42A 3IAUA 4C4RA 1ORDA 1VGRA 4E4RA 5B7QA 3NT4A 4O4LB 1N0VC 2WHPA 5EIWA 2RIRA 4D96A 4UFPA 3WNZA 3R6WA 2OHVA 3O83A <