1J0BA

Crystal structure analysis of the acc deaminase homologue complexed with inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
325
structure length
325
Chain Sequence
MHPKIFALLAKFPRVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIRKLEYLLGDALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKGNYLLDKIMGIETRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQSEVKFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAELLGVKVEVRPELYDYSFGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGELGEKILFIHTGGISGTFHYGDKLLSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic properties of 1-aminocyclopropane-1-carboxylate deaminase homologue from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
molecule keywords 1-aminocyclopropane-1-carboxylate deaminase
total genus 99
structure length 325
sequence length 325
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 3.5.99.7: 1-aminocyclopropane-1-carboxylate deaminase.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j0bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j0bA02
4ZU6X 1TZJA 2O2JA 3SS9X 3L6RA 4XUGB 2ECQA 2GN1A 2WSYB 1M54A 5E0KB 4WX2B 4D9MA 2CLHB 5IWCA 3AEYA 5D86A 2RKBA 4D9BA 4D9FA 1FUYB 4JBNA 5IW8A 4D99A 2EFYA 2CLKB 2PQMA 1K8XB 2TYSB 4L0DA 1K7XB 3IQIX 4NEGA 3T4PA 4L3VA 1A5SB 5I7HA 4ZU1X 3X43A 3V7NA 4PCUA 1C29B 1BKSB 4D9KA 5BW6B 1CW2B 1O58A 3DKIA 2CLEB 4JBLA 4D8WA 1PWHA 5JISA 5JJCA 1KFBB 1UBSB 2BHTA 1TTPB 1PWEA 2C2GA 4NU8X 1JBQA 5DBHX 4IL5A 1K7FB 2Q3CA 1J0DA 2V03A 5J5VA 5HBGA 1TTQB 3BM5A 3VSAA 5DVZA 4D9EA 5KZMB 2Q3DA 5I7WA 2D1FA 2ZR8A 2GN2A 3DWIA 1UINA 2DH6A 3PC3A 4LMBA 1CX9B 1TDJA 1WTCA 3PC4A 4D9IA 1KL7A 5D84A 1Z7WA 1WBJB 4D8TA 1A5AB 1QOPB 1V7CA 1K8YB 1RQXA 2CLLB 3AEXA 4HO1X 3SS7X 2ZSJA 1WKVA 1X1QA 2CLIB 4D8UA 1K7EB 5I7RA 2CLOB 4D96A 1K8ZB 3RR2A 5B36A 2TRSB 5I7AA 4HN4B 3ZEIA 5B53A 2TSYB 3DWGA 4D9GA 1V8ZA 5CGQB 1J0EA 2ZPUA 1KFJB 3HMKA 3TBHA 4D9CA 5B1IA 4HPJB 4L28A 1VB3A 3IQGX 1KFCB 2J9YB 2CLMB 5EY5B 1C9DB 4I1YA 3R0ZA 5I7OA 1TZ2A 1TZKA 3PR2B 2EGUA 2RH9B 4KKXB 5DW3A 5KINB 1TYZA 5B1HA 5IXJA 4Y6GB 4D9NA 2JC3A 2O2EA 4LI3X 2BHSA 1QOQB 2RHGB 1V71A 5CVCA 1J0BA 5DBEX 1Z7YA 4F4FA 1A5BB 5B3AA 4D92A 1J0CA 1VE5A 2ECOA 3VSCA 2Q3BA 4H27A 3PC2A 4AECA 1C8VB 3VBEA 2J9ZB 1D6SA 2C2BA 3X44A 5T6MA 1TJPB 4ZQCB 3IAUA 5DW0A 4AIRA 1P5JA 3FGPA 3L6CA 1J0AA 1K3UB 2J9XB 3CEPB 4OFXA 3FCAA 1A50B 4QYSA 3SPXA 5J43A 1E5XA 3IQHX 5C3UA 1UIMA 1KFEB 2ISQA 5D85A 4LMAA 5D87A 2DH5A 1KFKB 1TZMA 1FCJA 1VE1A 1F2DA 2CLFB 3VC3A 3L6BA 4OREX 4D97A 3R0XA 5I6DA 1OASA 1WDWB 4L27A 5B55A 3VSDA 4COOA 4HT3B 1BEUB 2GN0A 1Y7LA 4HPXB
chains in the Genus database with same CATH superfamily
1Z08A 3PUIA 2FI1A 3S7TA 2AFRA 4MOWA 1GHTA 3FLMA 4FMBB 3FCEA 4JWTA 3L7AA 3MC1A 3REOA 3QIAA 4A0HA 2C2OA 3SVTA 1YQWA 2P79A 3FKJA 2OCAA 3FFXA 4YP0A 3R3HA 2R6JA 1JPNA 2XNCA 3R6WA 3TR0A 1E59A 1SULA 2G4CA 2VDUE 4G8JA 5DRTA 2UUAB 1WABA 4GYYA 4WK6A 4DHWA 3GUYA 3H2YA 3R8XA 3KBBA 2OO7A 2ZG6A 3BMXA 3RWBA 4UDXX 4C20A 4TRNA 4YDRA 2I8LA 4L3VA 4UBIA 3VPFA 3RYCA 1E2JA 2OLEA 3FXAA 3Q9SA 1BKSB 1AT1A 1E6KA 2I6SA 5DM1A 1B0UA 1QHGA 3FZQA 5LYYA 1T0IA 3TXYA 4BX9A 2GCGA 2ILVA 3HY6A 4LW8A 1B6RA 1NVKA 2CNLA 4RAQA 3N05A 1Q14A 2DZDA 4FHFA 3QSYA 1NW4A 2BOVA 5A4AA 2EGHA 4PZPA 4YMVA 1OW3B 4P2BA 1PTJC 3LPNA 2PR7A 4GE3A 1QTNA 3JWIA 1DFHA 1I36A 2QT9A 3HCPA 1ST2A 4MR8B 1HE2A 1EXNA 4Z9YA 2LW7A 4KJXA 3FYTA 3A6FA 2VF5X 1O9HA 1OFTA 5D51S 3NJRA 3GH3A 4CF5A 3URMA 3SSNA 3Q41A 3GP5A 1GPH1 1YZFA 1NJGA 2X19A 5G3ZA 4BIMA 2JKVA 4I1IA 4MQ4A 4Q4DA 1HLDA 2JD2A 2G76A 2QD1A 1Y6FA 3HVUA 3HMKA 4DJAA 4C78A 3ZXXA 1B16A 4IDBA 5EE3A 2J0VA 4Y6SA 1TB4A 3Q7EA 1FFXA 2XRFA 1Y1QA 2OM2A 4BL5A 1XE3A 2XYVA 5BXQC 2CKMA 3C6XA 3ZQJA 3CPEA 4FHZA 1ZZGA 3M6VA 4IDPA 4V3CA 4KPUB 1BU5A 4M0CA 3KVVA 2F3TA 4LDJA 1AKNA 1A9RA 3DL4A 4FP9A 4YUVA 2D6FA 3OUZA 3DEKA 2JARA 4KVGA 3DBVO 4YDHB 2O3QA 4EHLA 2GZ1A 4F4FA 2BMDA 3WAGA 3D3EA 4KO2S 1QYRA 3GNSA 4DNFA 3TKYA 1BDIA 4AP9A 1TZBA 1M5UA 1Y81A 5H9WA 1ODJA 2Y8EA 1X1DA 1A95A 4U6QA 1L6IA 2WKRA 1AO3A 4PW0A 2HBZA 3L7CA 2NZ8A 4MKIA 3K1AB 4NR0A 4YJ3B 1XPRA 1GZ6A 1P3Y1 3PXBA 4GM1A 3RIGA 1TECE 2ZIEA 2OZEA 1S1MA 3B5JA 2VT7A 3FDIA 3K0BA 3R3XA 5FFFA 4XQEA 1XAIA 13PKA 2BE9A 4YWJA 5SY6A 4O4LB 2AI1A 4NECA 3SPXA 4YHHB 1T26A 3VPAA 4D8XA 2CMGA 3H8JA 3OQ6A 2JLUA 3EPHA 1RQGA 1A1SA 2A5GA 4X95A 1R6UA 2J3KA 3ZDFA 4RJIA 1FXUA 1JXOA 1NHGA 4YMHA 4X6XA 4PQRA 2C2XA 4F7DA 2VNSA 2YICA 4JQCA 1QS0A 4X7PA 4XGRA 4HT3B 5C32A 5B2FA 1NDQA 3LL7A 1K6IA 1W48A 1QZTA 2CEAA 3N8DA 2ZSIA 4GOMD 3ZYZA 2MT9A 5CMLA 1RRGA 2D3WA 2WWRA 4E5SA 1BWPA 1RM0A 1KEZA 3TPCA 3DPIA 5JEDA 2GEDA 2NWQA 2HWWA 3WL7A 3L1UA 4MKXA 3D4LA 3N7AA 4IKEA 3D4PA 4Z9AA 3RVNA 1Q11A 1FVHA 1RCTE 3IE0A 4CODB 3HP1A 1VIVA 1K88A 1ISHA 1TCCA 1NVBA 3L8FA 4NENA 3M1YA 3LOQA 4UVDA 3CE9A 1TT5A 1V9LA 2ZSEA 3DDUA 4K0RA 1NIJA 5BWCA 4C5CA 4N39A 3IVCA 1WG8A 4QXPA 1ID1A 4QUIA 3ID6C 4F8YA 4KIUA 1O5TA 3HVIA 3I5YA 1Z5NA 2VKTA 4NY1A 5AFSA 5DHQA 5LQSA 2OGTA 4TV9F 3MN1A 4L22A 3QVKA 4POAA 4Z2AA 4D0NA 4C07A 2H1CA 1M1NA 2N1BA 4GX5A 3HG7A 4WKNA 2G40A 1O95A 4BFUA 2EXXA 1K98A 4INAA 2FEAA 1ZL2A 5THKA 4AG6A 1YRLA 4CM9A 3ZBQA 1XZPA 3BL5A 1OE0A 1VLHA 4JP2A 1W4ZA 3QEOA 1Z5UA 3FZEA 3NVMB 3DDOA 1FTQA 3NALA 2VEDA 3AEUA 3PPIA 4MW4A 4O1MA 5EZYA 1E3DA 2D8AA 1HOTA 2LIVA 1P4HA 1O5IA 2JIBA 2QTCA 2VPTA 5TF0A 3M8KA 2RJOA 4O1IA 5GV7A 3ET4A 4BKUA 4EK9A 2MSLA 4E2YA 1OTXA 1XDGA 2XE7A 3WLQA 4COKA 5KTOA 1F6WA 3SX2A 3HHEA 5DNCA 2CLLB 1GZ3A 1JYSA 2FQYA 2NAPA 3DW1X 3G85A 5I7RA 3HJBA 3OY7A 3L7MA 5K0TA 3PGVA 1UJ4A 1RYDA 5LQAA 4CKWA 2I9PA 3LT4A 1VDZA 2DOKA 2AB0A 2JA2A 2ZWPA 1VKJA 1FP4A 3WGVA 1NRWA 1A96A 3AIOA 5FTKA 2FPMA 5BQPA 1NQAO 1RRKA 1U0LA 1X3LA 4L75A 3BHMA 5EERA 1TJ4A 2TECE 5LB2A 3WYEA 1YE3A 4OL0A 2WTMA 4U9UA 2I2AA 4B47A 2UVQA 4CLXA 2O2HA 3O92A 4QRHA 1KAEA 3P32A 2DBZA 4UVHA 4IIYA 4HNVA 4XSHA 2R84A 3JYNA 4QGHA 5F76A 5TMEA 5HRAA 1VJGA 2L82A 3AI2A 5CXUA 3A0RB 2ACVA 1ORVA 4G25A 4TX1A 3LX5A 1XSEA 1U28A 5CA0A 5ILGA 4EG6A 1ZD9A 4WZAA 1MRNA 2WLTA 5HP4A 2VF2A 3OQJA 3EZGA 1UBEA 1NQXA 1BXKA 1UMBB 2FEKA 3DV0A 4BEVA 4J43A 1UODA 2Y0CA 3KB1A 3CVYA 2R4TA 2WABA 5FNZA 1ZN9A 4BO7A 1I30A 4K86A 3L05A 4TRMA 3GLGE 1CJVC 4PBSA 2XOEA 1DFIA 1NA5A 3T7SA 1NBME 4OHXA 3L79A 2CUZA 2PM8A 2QVCA 5IEJA 3ZNPA 1Q83A 1XTJA 1ZGAA 3Q3GE 1TLLA 5K8CA 2GLUA 5JJLA 4ZCMA 3LQYA 3LUBA 4J16C 2PUEA 4MVYA 1E58A 2CY0A 2HX1A 1H6DA 3VC1A 3LC0A 4DA7A 6LDHA 1M2HA 1MAUA 3AP1A 2V9PA 1SCBA 4IX9A 4J0EA 4UPDA 3V9AA 1NVEA 3H16A 4AYXA 1Z4NA 1M6VA 1X13A 2D1SA 1R6TA 4OA8A 4TT3D 1DTSA 2PUWA 2OFFA 3RVOA 1OY1A 1Y3DE 3FOBA 4GPZA 1KJZA 2EIXA 3OKCA 1VYUA 1S96A 2OBYA 4IDAA 1KZYC 1LGYA 1PT9A 4I50A 4WNYA 4ZPXA 3I62A 1WMEA 4O2BF 2FSSA 3KZXA 3UJAA 5CBKA 5I7VA 1W94A 3K0HA 1N6RA 4D9FA 1LEHA 2QG6A 4OGGA 4JU8A 1XCOA 3WTCA 4LIPD 1YVRA 2G1PA 5C8YB 1BKYA 1C9JA 4L4YA 2V97A 1FVXA 3WLFA 3PQDA 5HS6A 1EUDB 1ENZA 1QKKA 2KBFA 3I73A 4ND7A 4ZAFA 1G64A 2VJMA 3LXUX 4O4IB 2P4SA 5CNKA 2XMGA 4O4JF 1XRQA 1K2VN 4KQ9A 4IR7A 3KQKA 1KJ9A 1Y1SA 5TGDA 3PT9A 1YHYA 2ZYWX 4J0QA 2XZOA 2IYZA 2JB9A 5CVDA 3EMVA 1P5ZB 4G4IA 1OILA 2BM8A 3ZIUA 5KTYA 1HL3A 3B3FA 4EW1A 1G8MA 1XNGA 4XD7D 4D81A 1TUBA 1O6GA 4Q18A 4NU8X 1CDOA 1CUFA 1Q91A 2AUNA 3H5LA 1H2BA 4KX3A 4MUHA 5AXCA 2GS9A 2CNKA 4H4EA 3OCWA 1IM5A 5JFTA 4R1TA 2QVGA 3VSAA 4DCMA 3ZVKA 5AVUA 3AVVA 1KDRA 3U39A 1KI4A 1KJQA 4ARZB 2DHRA 1CS0B 1WNFA 1F0NA 2JLBA 3P2JA 3W3AH 1VPEA 1QHEA 3R6LA 4ICIA 1QG0A 3SJUA 4DQ0A 3W5VA 1QCCA 1G9TA 1Q2XA 1T4DA 3A1WA 1XMPA 3GJYA 2E55A 1K6EA 1C7IA 3IA2A 5JNVA 3MTDA 3OZGA 2VTVA 4I1UA 4A4DA 1BJRE 1AZWA 1L5YA 4LJ7A 2ZXFA 3HK2A 4D3DA 2INGX 2JD1A 2PRZA 4MW1A 1Q0HA 3WKAA 3TDKA 1O9BA 2J9YB 2WFMA 1USWA 5EESA 1LDEA 2BGLA 5F33A 3H5NA 3TLYA 2ZB2A 1EE2A 1RR6A 2PH7A 2VT2A 3LS2A 3N0WA 5JBNA 1WF3A 3T7TA 1FYEA 3L8CA 4HDNB 4LV5B 2IDJA 1JKJB 1MB4A 2P1DA 2Q1SA 4RZSA 1H9BA 2FG5A 1UM9A 2GR9A 1ZQ9A 3O1HB 4AMVA 5BOSA 1Y5IA 3IB6A 3LDFA 2QD3A 3CCCA 4YCLA 5AVTA 1NJFA 5LLDA 4FIZA 3P2OA 1B2LA 3BORA 5CB4B 4IJQA 3P9XA 4L4RA 2LNDA 5CT4A 5EG5A 3SOZA 4ID9A 3GPBA 2N42A 1JIJA 4L8LA 1N34B 4YGYA 5UKDA 3ZHQA 5IZCA 4E32A 2MOKA 3G9QA 4XH9B 1IZ8A 4I6JA 4AS3A 1INLA 5CFZA 2ESRA 2GDZA 1YA6A 5CPBA 5IAOA 2IEDA 2R8BA 2ZUBA 1E1MA 3QENA 1X9GA 3AJRA 2BV3A 4DCJA 5FDFA 3GRAA 4JJIA 3HC7A 5CJPA 1CUIA 4AAYA 1RAHA 2IOYA 3A3PA 1D03A 1E2BA 1J97A 3W1VA 2IYOA 2XCUA 3ZZMA 5K4AA 3B6EA 4DSZA 3KQYA 4YRIA 4JT8A 4RF5A 1BMDA 2A5YB 1CWUA 2BWJA 4L2IB 3UXEA 3RRNA 1HNZB 1ACJA 3EVZA 4TRRA 3F6SA 1FNNA 4EA6A 2ZCJA 3DJFA 4IQ8A 1YHZA 2VPIA 4QU0A 5FOXA 4URXR 1PX0A 5D3ZA 3T4EA 3R5TA 5FULA 3P96A 1U2EA 3F6EX 2J0UB 2X23A 1U2TA 5IT9A 2EFYA 1OXSC 4HUQB 3A25A 1CEYA 2QUIA 5KX5B 2M2IA 3OZIA 1VPTA 2E85A 3WXMA 1P0IA 3BXZA 5FUYA 1MC8A 4B8WA 1I2AA 2XYHA 3AW8A 4GEKA 1F9AA 2PG3A 3SYMA 2GQ0A 1T8WA 3BXGA 1M0SA 3PC8A 2EFJA 3T15A 1PR2A 1KHTA 1PNRA 3OOWA 4WFKA 3OQ1A 2CV0A 4A0SA 4EFKA 3B5EA 2Y27A 1JDJA 1M1NB 1U9JA 2PUHA 3PC6A 4BUZA 1CUAA 2VWQA 4YDSA 4LXIA 1VL8A 2P75A 1ZC4A 5DF1A 5A71A 1KHHA 1ZISA 2I3AA 4CW7A 3I2KA 2Q99A 1YFKA 3QW4B 3TTXA 3CBQA 1H1TA 3IJPA 2QVLA 1MAWA 2PU5A 3S55A 3TN7A 1IUKA 5JCXA 1A4UA 1MOSA 2AFHB 3H4TA 3KEMA 4LSMA 4TWIA 4Y2VA 2VOJA 5BYJA 3SI7A 2QX9A 5HJ2A 2IYFA 4B80A 4M8LA 1OGIA 1BW9B 5EI5A 3RB8A 3UHJA 3KV3O 3KXLA 5LDHA 1K6JA 1FNCA 1E98A 1Q1BA 5AH0A 4AM8A 4YMTA 3T9EA 2V65A 2BSAA 3QJ5A 1PSZA 2YMLA 3HM2A 4G89A 1Z34A 4OL9A 1TQ4A 1KWGA 3PQ7A 1QE0A 1LVHA 1JG7A 2CZCA 2PH1A 4LJLA 5HTOA 4FYWA 2F48A 3PLRA 1BVHA 1MJNA 4I5DA 3X1JA 3ZI0A 3VDQA 4MGZR 1NW8A 4WUTA 5I9SA 3UH1A 3ZU2A 4BC0A 4BE9A 5K20A 3A10A 2XSZA 1MXFA 1U2RA 4QGBA 3QW2A 4MQFB 1R2QA 1NMEA 2WWFA 3H04A 1B14A 1LRJA 1S7GA 1UWLA 1BN6A 2ECFA 4IOLA 3LHSA 1WOMA 2XHEA 1JXQA 2FN7A 4AZ3A 1NQWA 1XLTA 2EG9A 4XIFA 2AEMA 5NULA 3FWHA 4X93A 2W70A 4E11A 4PTLA 2YYAA 3DWFA 4S1WA 3S3TA 3C43A 4G09A 1KAHA 4C1BA 5FOQA 3Q0EA 2DFDA 1HDOA 3L7JA 1XZKA 3KB6A 5HZMA 4HEJA 5DTMA 1Z13A 1ZM7A 2WU8A 3COYA 1PO7A 3KDAA 5K0JA 3K5PA 2OD9A 2PA3A 1WE2A 3BQNB 4JJKA 3TSZA 1Z5OA 3N2KB 1TVMA 1FP4B 4MQMA 4CDMA 1YB6A 2J0QA 3L4JA 3I6BA 2W2TA 4JBGA 5DYGA 1TZMA 5EJ8A 4AU1A 5KSWB 4GP7A 4IP0A 5F5LA 1SBCA 3BX1A 4KYVA 3SZRA 4D97A 1XEWX 2H4ZA 3D2AA 3FBWA 1CY7A 2QTMA 4G0YA 3RSCA 1E3QA 4HJXA 5DU2A 2OV2A 2NU7A 2DHEA 2CFIA 2DBVO 1X1TA 1Z73A 3FOZA 3SJCA 1I5EA 3DONA 3SU8A 1I6KA 4L1KA 3U31A 4F06A 2GN1A 1P9WA 3NONA 1DIRA 2RHBA 4HWOA 1N5DA 2HMVA 3HVRA 4IZHA 4EJ0A 2IDZA 1L7QA 2M6RA 2WM3A 4A1OA 1J2EA 2XECA 3OSUA 2HU5A 4RK5A 4I5GA 3GBSA 5B1SA 4K6KA 1IIRA 1Y4AE 3GOQA 2OWEA 3ROKA 3ZTWA 1JAHA 4DMMA 4DHEA 2P8JA 3UK1A 2QPTA 4JV5B 4Q4HA 1LJ8A 3HA2A 2YC2C 2RBKA 4RJJA 3H9QA 4HRAA 4ZVVA 3NUGA 3CVUA 2ZEJA 1AKMA 1GQFA 2PRYA 3DE5X 4MYDA 5HK8A 4CNQA 3JSAA 1WZUA 3AIIA 4BECA 2EAUA 1LSJA 1DQSA 1Q17A 3V42A 3ICEA 1R1DA 4BP9A 1WPXA 2KJQA 2GAJA 5AWFC 5T3UA 4DKJA 1JHMA 3WGLA 4RM2A 4F2WA 5IN5A 4BVEA 3VJKA 2I4NA 4NH4A 2QPOA 3DZFA 3SQDA 3WGMA 5ALTA 1WCXA 2I6UA 5KUTA 4CHTA 2CNWA 3VDMA 1HDIA 5KC8A 5JALA 4I6EA 3IEMA 3E27A 3BGOS 4FGKA 4MS4A 2QX6A 4I5IA 1R7RA 4HDMB 4DIFA 4RIFA 3SZMA 2VP4A 5L7TA 5AXDA 2X0DA 1ADBA 3LCRA 3EJ6A 5JV5A 5EUQB 3KR0A 3MT7A 4X24A 1GWNA 3Q5DA 1JHAA 3D81A 2J4CA 2V0CA 1U4NA 2C3MA 1YHNA 4EG7A 1N5LA 2HYIC 3H87A 4X64B 2FPLA 2C4UA 3BK1A 3M6XA 5EJ9A 1L4KA 2ACEA 2X1MA 4EY3A 1PK9A 2I54A 1EUDA 3GJTA 3HVJA 3EX7C 1VJRA 1X92A 3KD3A 4GMKA 5CLGA 4OUDB 1SUPA 4ZVOA 1KEVA 3I5UA 1H23A 1PU2A 4KXUA 1R6BX 1P91A 1OQAA 2OPHA 1S2NA 2HNKA 4BFSA 5C7LO 1UPAA 5D1NA 3RHTA 1M1XB 4JI3B 2P9TA 3NHLA 7ADHA 2NXCA 3EUAA 1VFNA 4L5IA 1Z6XA 2WAOA 2CWWA 2KYRA 2XYGA 4F4IA 2EBWA 3Q40A 4XXHA 3WNDA 3QFFA 4AFNA 2RHGB 3LCJA 3WJ2A 4EB6A 5C1PA 4CRWB 1FLVA 3FZGA 3ZXSA 1QH0A 1E92A 5JNUA 4DIMA 1OFHA 4ZQBA 5F7OA 3OOYA 3FVTA 1GPYA 2X0NA 4KTTE 4HY3A 1R8JA 2Y6UA 5KOYA 3OF5A 2ZIXB 3AV0B 2ZSFA 3G0DA 3MQ4A 1WMAA 1MEJA 2NO6A 2Q3LA 2XMZA 1J0AA 3BWMA 4I99A 4Z0HO 2FZEA 1A50B 2OP0A 4EY8A 1EVQA 3BMQB 5IUNC 3B9RA 1XZIA 2Z5FA 1Q1ZA 2NZYA 3I6YA 3TW8A 1WQ4A 1JHXA 1ILEA 2O8DA 1JIUA 2D2XA 3H18A 1XD9A 1A82A 5JQWA 1T4GA 2WOJA 3BGSA 3GJ5A 1YRQA 4M0DA 1MIOA 2EQAA 2I7DA 5I9LA 1WDWB 1S0UA 1P2FA 3VSDA 1GPWB 4BQQA 3LGAA 1JLLB 6ABPA 4DCPA 1SIBE 3DVAB 4MEAA 2GXSA 2ZKLA 1M67A 5I9BA 3CW2A 2O8EA 2QLNA 8GPBA 2HK6A 3JS5A 2A1TS 2OM6A 4DGSA 2IU4A 5KVSA 1CUUA 4EEZA 3PYMA 4R31A 2O2XA 2C9ZA 4NU0A 5A4IS 4C0HA 4M6WA 3ZXIA 2ORYA 3DR3A 3DT8A 2GWRA 5TPWA 4ISBA 2XT9A 5DNEA 3GMIA 3OO1A 4OMFG 1YZYA 3EYAA 3PF9A 1KH1A 2C0PA 1C5KA 1QGAA 2WAMA 4MA4A 4JP5A 2EP5A 2YXPX 5LWQA 3IULA 2ID8A 4P31A 4NU6A 5HJEA 1AKRA 1H22A 4Z49A 1MW8X 4IIJA 2HCFA 1YS2X 2Y9PB 3HWWA 3ZK9A 4AWBA 3H11B 4UE6A 1H65A 3L0BA 4R3NA 5ENDA 4PHTA 1VP9A 4R1UA 1A1VA 2W4QA 1M6YA 2HA3A 1L7EA 3ZQKA 2AKEA 4HR7A 3PEUA 4FOSA 1VL6A 1C81A 3H2HA 4QTUB 2PBRA 2HRBA 1XF1A 3FR7A 4XQCA 3KQVA 1NMQA 1SBYA 2L69A 1UDCA 3AERB 3F7TA 1KNXA 3PS9A 4X92A 4HAZA 3FNIA 4WL0A 2XWSA 4D41A 3JQBA 2BEKA 1C7EA 2G1KA 3AR9A 5H9VA 3RRMA 4DMUB 4GW3A 2R68A 1SMKA 2YYYA 4LJ4A 4Y9RA 3P9SA 3W3AA 5HF8A 4BQEA 1UKZA 1ZOPA 5T4BA 4CM5A 3ZJ4A 3OT1A 1SUBA 2XUIA 3Q3HA 4CDNA 2FR1A 2COKA 2V6JA 1U8YA 1RWMA 2QGFA 4OQLA 4EABA 3RBAA 5CX1A 4UUMA 4CFSA 2PN1A 3L8EA 3S27A 3A4YA 2GPTA 3C97A 4JVSB 3GLGB 3STVA 1JIXA 1V8PA 3LAWA 4Q24A 4UAUA 1JR3A 4J6EA 1OH5A 2QN1A 2BCJQ 3ZOKA 1I32A 1HF3A 5CTAA 1PQ4A 1QK5A 2P4EA 3U3JA 1UK9A 2AJCA 3H6HA 4ZC8A 1AB5A 2WHXA 1E60A 5AW0A 1JWLA 4BPBA 4H1VA 4MDHA 1PQPA 1B8PA 3RVDA 1KEKA 2IXFA 1J0BA 6YASA 5JJKA 2JLSA 2RIRA 3ZLVA 5I7EA 4Z4IA 4FS3A 4FDTA 2PO7A 3N5CA 4B7UA 5A4FS 4U2KA 1I9GA 5AW3A 3HN7A 3JASB 3LY7A 3TR6A 1T2FA 4BE4A 3OZTA 1SBIA 4KQ1A 5AVJA 2C4KA 3A36A 4GM4A 2GD2A 1F0PA 1P4AA 4XLLA 5JZVA 1PZGA 1P2SA 5KVAA 3LK7A 4FKZA 5ICGA 1XNQB 1IPEA 2FK8A 1RXUA 1A72A 1JDSA 3ELBA 2OXTA 4DSNA 1RZRA 2Y1GA 3O93A 4WPGA 4BQFA 2C7PA 1B6SA 2P2GA 3K1JA 2E5WA 3EFOB 5ALYA 5GM1A 1NJ5A 2FLWA 1ZMOA 3DDNA 2X2OA 2X5OA 2BBOA 2FPGA 2RGCA 3HKBB 4UHCA 1AHPA 1DJPA 1YQEA 2CL0X 3P19A 2CJPA 1KERA 3HJRA 3OD1A 4RGVA 4JI2B 4TROA 3ROPA 4R40A 4NBVA 3PRYA 4RV9A 7AT1A 1OJLA 3LZDA 3GLHA 1OT5A 1RI2A 1SCNE 2E89A 3BK2A 1XCGB 1EIZA 5DCWA 5EIBC 1U8EA 5YASA 3G13A 3ZE9A 1VPLA 3THRA 2J1LA 2J67A 1I01A 4KK3A 2HN9A 2J9RA 3AY7A 3FZYA 3ICPA 3W5SA 4E5NA 4KPFC 3VMMA 3MZ0A 3DLBA 4W5HA 1FDSA 4QSHA 2DPMA 4NBWA 1GGMA 1M2NA 4X5OA 2X2FA 4U8GA 3F6BX 5KPJA 3FNEA 5EJ5A 5FXMA 3DE4X 5F51A 4KXVA 5CURA 2KWIA 1SCKA 2FFBA 2NUTA 1KYTA 3ADCA 2PPVA 2YC4C 3AOEC 1IE3A 3HFSA 4NESA 5ADUS 3HCDA 2UVPA 3MA0A 4DB2A 1SG0A 2OZPA 3EIXA 3AF1A 4GSKA 4E3ZA 1MUUA 4TTQA 5ALDA 4U8HA 2PS0A 3URKA 4GOJA 1MF7A 5JSZB 1XHLA 2A4KA 4HUQA 2FRVA 1FXWF 2NYUA 4UFNA 3O82A 4QDUA 3ROEA 3R74A 3TD2A 5TV2A 1Q7GA 4WXPA 1B0PA 2OY0A 5E4YA 2O7RA 3RUIA 3UWOA 1DQRA 1GR1A 3ZK8A 4CKYA 4QQRA 4AZTA 2FR8C 2PLRA 4QG3A 1IN1A 1Q0LA 2NU7B 3OC0A 2IYPA 1OXKB 1WS6A 3BA1A 1GSHA 5CW1A 2GFIA 3NR2A 2KI5A 1G8YA 4QU8A 1T5OA 1IUPA 3LY5A 4KSBA 4UUPA 5EJIA 5B7GA 3NXKA 4CJXA 5KOJA 4JEUA 3CZAA 1IONA 2FPUA 3IMKA 4P3KA 4GGOA 1QRUA 1EG2A 3VH1A 2B94A 4A26A 4DAOA 1EP3B 1HORA 1MEOA 4TMVA 3EF1A 3BYZA 1V7CA 4DOMA 3T5AA 3QKRB 3SR0A 4QPDA 3PQFA 5I3CA 3BMCB 1KZ1A 1Z7GA 4JQOA 4MW9A 5CITA 2YTZA 2R7KA 3EEIA 2P3OA 5B4UA 2Q62A 3QPVA 1ZYUA 4W1PA 2ZPUA 2GM4A 1ZN8A 3B82A 3LUPA 4MUMA 4N0QA 2ZZNA 1YQDA 2FZGA 5ALQA 1KPGA 5J3JA 1YFJA 2RONA 5I7UA 3E9EA 1UFKA 4KRYA 1JA9A 2D7DA 1TM3E 4FGJA 3GRZA 3VOSA 4YIHA 2R1TB 2A0UA 3GCDA 2ONJA 1Y63A 5AVQA 4DR3B 2GESA 4NV0A 3QWBA 1UM9B 3MTIA 3O31A 2AI3A 2VRBA 4RLQA 1H94A 1GKYA 1Q3KA 4L5JA 1E2QA 3HZHA 2YWDA 3P0JA 5IFLA 3I8OA 2DY1A 2C59A 4ETMA 4AO6A 2PGAA 3O1JC 1ULSA 1UOOA 3ZUPA 4EQZA 2P6PA 4CQJA 5L6LB 2P91A 1KK2A 3HCBA 4I2VA 4L8GA 2BGRA 4ZO8A 2UV8A 3ZU6A 1OLXA 3NVDA 1ZAKA 3GYBA 4UNNA 5CEJA 3W5JA 4M9SA 1Z4KA 2YNMD 2ZIXA 2C92A 4RQTA 4GHWA 3G7UA 2P9YA 4I2NA 3GJ8A 4N7RA 1Q0PA 3O7WA 1W0KA 1WUIS 3TSCA 3F78A 2X0EA 2ISQA 5JXHA 1DBWA 1R4MA 2V58A 3HXPA 5EQTA 3CF4A 3NO4A 3R20A 4IBOA 4RGYA 3DT9A 5DM0A 4DLYA 3B2QA 2OKCA 4UD6A 5U4QA 5KREA 4M1EA 2QY9A 4TTTS 3R0XA 4GRDA 4NNOA 5KKNB 2XQFA 1UKEA 1E1CA 4KQXA 3VKUA 2JFBA 1MIOB 4FWTA 2OHIA 3HDTA 3JYQA 4LC1A 2GCPA 4KP7A 2WSLA 1HYQA 3T4UA 3ZDQA 4EMTA 3MUEA 3IXQA 5IDYA 1EWYA 1RQ2A 4GMGA 4XUGB 3K1YA 1W8DA 4WBXC 4Y6LA 2ODTX 1RU3A 4RH0A 1SOUA 1EWQA 1PAUA 2NNLD 3RJZA 4Z1MA 2CLHB 2G9VA 3IO5A 4Z3KA 3I58A 1ZCAA 5CLIA 4E14A 2Q28A 3A3KA 1RYEA 5TSDA 1G20B 1IZZA 3RTEA 3R8FA 1IUOA 4XFJA 2O5CA 4X20A 4FKBA 3O2NA 4U3JB 3VKVA 4E5YA 4MUJA 3BJZA 2V7UA 2LCFA 2BEUA 3U80A 3D6FA 4OGKA 3UXMA 1MA3A 2G1JA 2VNIA 4G0PA 3BRWA 4QQFA 4WEOA 1L5LA 1RE1A 3V7WA 1WLYA 3FVQA 3HWSA 5B37A 5GZ3A 4UD2A 2EERA 3DHVA 4CLRB 2JAOA 4TL9A 4EVRA 2R60A 1BMQA 2FPIA 1NMXA 1QGZA 4R41A 1V7PC 4QOJA 4WZAE 3U7JA 1ZVJA 1FZQA 3PXXA 3U7GA 4NAHA 1LVUA 5F73A 1GPDG 4AROA 4HZUB 1XBTA 4HPWA 4BNLA 3FDXA 4TYWA 4O4LF 3TM5A 3ZIAA 3UATA 1VI6A 4M53A 4JMLA 5D6NA 1TTQB 5MGBA 3JQRA 4XWGA 5HUJA 1HE1C 2QD5A 5BSWA 4LF9B 1EXMA 4M9XA 4PXSA 4TTVA 2ZOSA 1I4TD 3NFYA 3C1OA 3CZ5A 3QKTA 5K3CA 1YIDA 2J5BA 3NDIA 3ROZA 3SR3A 5TEWA 4C0LA 4EJ6A 4GKVA 2HA7A 5D3QA 4CTJA 2ZTVA 4J1TA 4OLAA 3S2ZA 5IUJC 1GGJA 2CZQA 1EWVA 3RDPA 3PPYA 4B4UA 2X8WA 3ZGZA 4OV6B 2E48A 5KAMA 1A71A 2XX3A 3AH8A 1Q3HA 3AHCA 5IANA 2XTJA 3ETEA 3MVEA 3UGTA 2RHCA 1G3MA 4W5OA 1OWNA 2A57A 1O89A 5A5DA 4DEXA 4AJ9A 5CK4A 4FBMA 4TMWA 1NLZA 5BMVB 1R5JA 4H1TA 2O0HA 4FB4A 5JAUA 3NLLA 1M2GA 1T91A 4OQDA 4I1YA 4PO8A 1ZJ6A 4IWYA 3SC4A 1JFFB 3ZD9A 3RSSA 1NF9A 4ODIA 1BA3A 1NVAA 2NO1A 2VHWA 4FYXA 3E3LA 3RQSA 1Y6QA 1MHTA 1B43A 1DPGA 2HRQA 1NJ2A 2A88A 1V0JA 2VK8A 9ABPA 5J2UF 4TXMA 1V4BA 1ZNXA 2EJWA 4N7JA 2B6HA 1VJ0A 2OUIA 3RYFA 5K8TA 5CCEA 1ZGBA 1C7QA 3SM3A 3OPYI 1ZVQA 4HRYA 1FIUA 5JQGA 4N18A 1PR4A 1FP2A 1C8VB 2BONA 3MJTA 4I36A 4R51A 2WWWA 3E61A 3GA5A 3NIFB 4QFDA 1PVOA 3ROQA 4NNJA 4DLLA 3EE6A 5FX2A 4HMQA 3FGPA 4B6OA 1QNLA 2JLWA 2CUTA 4GR9A 4W7IA 5K2OA 4LOLA 5CVEA 3NBFA 1L5NA 3ERCA 3PKIA 1ZOSA 5DISB 4Y2TA 5JLAA 2PXXA 4QOHA 1NP3A 2FW1A 1IB6A 2QT0A 4MWOA 1ZH8A 3EFOA 1ZMXA 4TKUB 4BO0A 3HYTA 1KU0A 3OMXA 5L4SA 1HE5A 3L01A 2PMWB 2DETA 1ZM2A 4MRRA 5IYZF 3E8XA 2YOFA 4MEJA 3QYJA 1IXRC 3WQBA 2Q0QA 1O4VA 5AJHA 1Q57A 2A1IA 1AY0A 2QX8A 5D7BA 1E69A 2IL1A 5E2BA 1NBWB 2Q1XA 3A14A 3DDZX 3H2KA 4TVBA 3T5BA 4A8JA 1SKYE 3NOXA 3T1VA 1OX5A 1U7TA 5EPUA 1Z0AA 3TLJA 4LNUA 3ESYA 3GAMA 3O8OB 3RSLA 1XHEA 2ZU6A 1J0XO 4A8TA 1MB9A 5IWCA 4HAXA 4WH0A 3ZCQA 3AGPA 5LYJA 2QW0X 4AKSA 3WLKX 2EDAA 4EX6A 4NS4A 2D2FA 2Q2QA 3KZCA 1ZH0A 3QIVA 5K3FA 1L5MA 4PSUA 4CLOA 4JLUA 5K1ZA 4X62B 1ODLA 3ZLJA 3ULKA 1R50A 4ZVRA 3EDRA 1JZSA 3WLOA 1NLYA 2Z6QA 5AOBA 3DOUA 2X8JA 4U7TB 3M6IA 5DEOA 3IE1A 2EBFX 3ENZA 4ESVA 3AVQA 3SZOA 4YQYA 4IDNA 4K9LA 1B3RA 1AMUA 3DOIA 4BRUA 4B76A 4Z6KA 3E23A 1XTVA 1DDOA 2G28A 2QL9A 3DMDA 4TTJA 1QPBA 3ND9A 4MB6A 1CRPA 1TT5B 2HJRA 2OZKA 1U2DA 2R65A 4FGUA 3KLMX 1U0TA 4ZD6A 1IVSA 5DGIA 2CC2A 3ACDA 4XKJA 4UU1A 4JH0A 1FSSA 3BUSA 1JMVA 3QELB 2Q2WA 5BQXA 1QP4A 3BWYA 3ROMA 1DDIA 4OJYA 5BXYA 1HG1A 2NU6A 4MGYR 4DM4A 1VOTA 3UT5A 5BUQA 2BBWA 3BXPA 1Z7WA 2V3WA 1CQJB 1P6UA 3OECA 4K26A 3TGWA 1YTUA 1P81A 5TE9A 2B83A 3KTAB 3KXPA 2NUTB 2YVQA 2X4DA 4AJIA 1WPQA 3BSSA 2K87A 2XTZA 1YH3A 5BSVA 2IZ5A 3HBJA 2PKXA 3HNOA 4ZYUA 2BJVA 1USGA 1IC6A 2P9GA 4JXJA 4AJPA 3I64A 3PL1A 4EEKA 3WE7A 1GDTA 1QYWA 2CYBA 1HFJA 4ES6A 1USIA 5CYGA 5ARDA 4J0FA 2WPDA 1N5MA 1V47A 3DCIA 4BWGA 2B0CA 4GLLA 2D06A 2H1WA 2A1TR 1Z47A 2YBDA 3CM0A 2PKRA 5EJ6A 2Y4OA 4XE5A 4P3XA 1FX0B 1Q7CA 1T9AA 2WRZA 4BBZA 2GAOA 1JKXA 5H4HA 5JCJA 1P9RA 2YMMA 4CM3A 1EKXA 3BRQA 3PTLA 4ONEA 4WW0A 3RYIB 1VHDA 2JJ2A 3VQTA 4EGJA 5EPEA 1MDBA 3B1FA 4OHZA 2Q5CA 2HRDA 4Q1AA 5CA1B 1E3EA 4MXDA 5IJAA 4BNHA 2ACWA 1DBIA 2AYYA 3NKFA 3T9FA 3O4IA 4HSEA 2Z56A 3A0UA 2GXQA 2OOSA 5KJ6A 2G6TA 4MVJD 1GSOA 4Q7JB 1AU9A 1YKFA 2REXB 3NTVA 3VU0A 3WWPA 4F3CA 1GUBA 3FNHA 4QAQA 5DTJA 4QYIB 2ID7A 1F7UA 1J1IA 2LP4Y 1S7CA 3LDHA 1DCKA 5K2MA 3A2MA 2ZJ5A 4PGFA 3WA6A 3T7RA 4QOGA 2GHTA 2VYFA 4GI1A 2WM8A 1UPUA 3NGMA 3E22B 2F00A 1ZHFA 2XT0A 2BDUA 1JEQB 4B4WA 5K0ZA 2IYQA 1PJQA 5ILOA 4NG5A 3CNBA 2G06A 4K9DA 4ER0A 1RD4A 4BMZA 1SVMA 3F6PA 1XQYA 3BBLA 3N6VA 3I4LA 4FQ7A 2CVHA 1VECA 3AHFA 4H35A 4JX8A 3S1LA 2R5FA 3TVDA 3JCZA 4RCZA 3KWMA 5F9MA 1PZMA 3IJ5A 5TMDA 3WGZA 5J59A 3IIEA 3JWEA 4GSYA 5IDWA 3NBXX 2X9LA 1GNSA 2WE8A 1XDBA 4EHFA 3GJ7A 1QMPA 3CW9A 1N6OA 3G5MA 2ZLBA 5K4HA 3ROTA 1AXRA 1SAYA 1XD2A 1JLHA 2AHOA 2ZJ2A 2XEDA 3BC1A 1BJTA 2SHKA 3IPLA 3PTAA 2FDCA 3BSFA 4F04A 3KCQA 7REQB 1IHOA 3M34A 2OLKA 2YRFA 4N6GA 2AD1A 2REQB 4EO4A 1KK1A 2CLEB 1PBTA 1Z2AA 3LRPA 1AO0A 1Q12A 5NLLA 2MDTA 1UMKA 3AERA 3S40A 4JI1B 1TYAE 2WTUA 1DIAA 2NSJA 1PV4A 2PGOA 2D0PB 4GWLA 3VVLA 2VI5A 1WHSB 4ZT2A 4QO7A 4HCJA 3TGLA 1W581 4ZGGA 2I65A 3DMGA 2HNBA 3DL2A 4MR7B 3THWA 4U7GA 4Q4AB 2VCEA 1NFRA 2C07A 4NK4A 4F3NA 4JCCA 4RENA 1WVMA 3PGJA 4YO7A 4TVSA 5C4MA 1R6VA 1YC5A 1ZNYA 3AF6A 1NVXQ 2QKYA 3HR4A 1SU8A 2VPWA 3A28A 4BLQA 1A9YA 3ENKA 4D4HA 3RS8A 1JSXA 2BI4A 2YVUA 4UBMA 3KE9A 3MWDA 4LYYA 1ZUHA 4G5RA 5EZSA 4AG3A 1JHDA 1C9EA 3I4CA 4MUAA 3L6OO 2BMFA 1OH7A 4R7GA 4BS9A 1FW8A 1ZIDA 3OPMA 4W9NA 2A9JA 3ITNA 4JC5A 5GP1A 5IRCD 3MGGA 2ZRIA 2C54A 2I34A 3TNLA 1DC7A 3PR1A 2DFTA 3CVOA 3OCCA 1QYCA 1Z12A 1RTTA 3EMDA 1T9ZA 1X1CA 3SLRA 3JYPA 5KCMA 3W3ZB 2P2SA 3CUVA 1II0A 4N5IX 5IC5A 5KIAA 3WGIA 1M73E 5TQ2A 1MENA 1UJMA 3BWDD 1JWBB 4KN9S 2MYNA 3E2MA 5FWDA 2ZYUX 5AYVA 3TF5A 3I04A 2NAFA 2ZB3A 2JEYA 3BFVA 3QNWA 2QHXA 4LNAA 3FPCA 5TY0A 2ZRFA 3X1KA 1HNXB 4H7IA 4HNTA 1H85A 4MVJF 5PGMA 3QE3A 1P1FA 3I2JA 2IY8A 4IMIB 5FPTA 4DG9A 3ETJA 5FR2A 1TW3A 2XOKA 2CNDA 1AKUA 3L7LA 1OBHA 3LCCA 4F8EA 1F7VA 4GWGA 1P8JA 3A1VA 3H17A 1SUWA 4RPKA 1E9FA 2MU1A 3DBOB 1WZCA 5JYCA 3AY6A 2NW6A 2X9VA 2WTXA 3C2QA 5ESWA 3EPJA 3C4VA 4PZAA 1E5XA 1GEEA 2WI8A 3ZDYB 3KLNA 1TQ2A 4AXBA 2YWHA 3PHCA 4KU4A 3FBGA 1Z39A 4HKTA 3GDHA 3HKDB 1UEXC 4FQ8A 4IY1A 2R8RA 3SJAA 4MUBA 1E7YA 2UYOA 4ENRA 3O8NA 4I3FA 4N7BA 1S2MA 4HLUC 4PFJA 2ZWAA 4Q02A 4C3VA 4CG1A 5BWOA 1ONSA 3OOJA 3NCTA 3OJXA 1EQ2A 3C98A 1TZJA 1FDRA 3G1UA 3WLHA 2OGSA 3PEFA 4ZT5A 1REQB 3TUJC 1PUIA 2JCYA 1N8TA 2JFZA 3DLPX 3GJRA 1XAGA 4G97A 3F67A 3QF4B 5L4LA 1J5EB 1HMYA 4M1MA 1CUDA 4CUZA 5DEIA 2ISCA 5I8WA 3A6DA 3MRTA 3TSOA 4NH0A 4Y2UA 3O8QB 4B7XA 1CR1A 2QAIA 4J7AA 1NJSA 1Y1RA 4PLTA 4EHAA 6AT1A 3WMEA 1CY0A 1PFUA 3PQ4A 4NJEA 3I1JA 3OOSA 2V1UA 1QAOA 2PWZA 3JAKB 3Q8XB 4FI3C 4LUCA 1KMQA 3V1TC 2D5AA 1QANA 1ADGA 3TRJA 4FMDB 4X8HA 1GRRA 3A1SA 5EGSA 3AF4A 3U4HA 1V1JA 4N48A 5JG7A 1RWBA 1UWVA 2NVBA 4Q7MB 4B31A 2IXGA 3QLVA 3X1MA 3LDAA 4NL4H 1KBQA 3COJA 1NUTA 3BD6A 1PL8A 2EOAA 7GPBA 1C3LA 3QA9A 4BLUA 3ZR4B 4BCCA 1OXXK 3IQEA 3JWPA 4J75A 1TZCA 4JHLA 5B6JA 2PVPA 5KX5A 5I5GA 4PSDA 3R76A 2L42A 4E7OA 1LTQA 1ULHA 3VM6A 1NBOA 4JB8A 3KAPA 4A0QA 2XYRA 1VHQA 3OTOB 2BGWA 4FFPA 1E5VA 3F90A 3NHPA 4I50B 3SJZA 4BX0A 1F1JA 3GV0A 3E3OA 1VBKA 2A5JA 3NU1A 2P4QA 3RAPR 1MABB 3OLCX 1DT3A 4OQYA 2EKZA 2A7XA 3RRYA 3M5PA 3ED1A 4O4JB 1W0JA 1XTQA 5C8YA 3HCRA 1ZEMA 3N0TA 3BHJA 5EC8A 1PBNA 2HHHB 2WSSA 2PJDA 1QRSA 1H6CA 3DMNA 1NJ8A 2ZSHA 1OKKA 5GADl 2NTYC 1J0EA 5JSFA 2YJNA 1F8YA 2RGDA 5EMMA 4XYBA 2H16A 2VP0A 3ADOA 3IEIA 4QTZA 2C0CA 4ZI7A 2HSJA 2WB4A 2NSLA 2Y1KA 1YT5A 1HRKA 3JV7A 3VO2A 3BZBA 2QTNA 1LV7A 2PBLA 4EZEA 3EEQA 4G0MA 1TADA 3KLOA 5KSYA 2IZZA 3DAHA 3ETNA 1EFCA 1XVLA 4HEA6 2ADMA 3QWHA 4U7FA 5IXJA 2OLJA 4LXXA 3QZUA 5EUCA 4DM3A 1UDRA 4ARIA 2OVBA 3CLTC 4FZ3A 2J3MA 4XD2A 2VTKA 5FP0A 2CMDA 5LUBA 4YRZA 2F3RA 4A92A 3QVGB 2XNDA 4D0GA 2KS6A 4MUYA 2IP2A 4UHJA 4N6NA 5F2KA 5FWAA 3TNFA 5K3OA 5FO1A 1C0EA 4JLJA 1WXWA 3DAPA 1E62A 3GDGA 4JX9A 1NXPA 2VRCA 2R7NA 5DW0A 1T10A 2YHSA 2WHPA 5IABA 1E1RA 4JSYA 5I9IA 3E4CA 3O47A 3O8OA 4RX1A 4H4CA 4NKRA 2EWWA 1V37A 3N2GB 4JJFA 1Q21A 3G2MA 2CJYA 4U0KA 3TRHA 5AM3A 2NN3C 1FYVA 4K88A 1K63A 1U6JA 1YMUA 2Z95A 3B51X 3AR5A 4GC5A 4EBBA 3CZRA 5HRCA 4ZHSA 1P5FA 4Y2XA 2OV6A 3JR7A 2HD4A 1MBZA 3C7TA 3TYXA 2H0AA 2H48A 4ENWA 1EFHA 1P0QA 2XMCA 3CGGA 2WFLB 3K5IA 3CLUD 1VHWA 3V33A 4GBED 3EDMA 1GGEA 4C3UA 4JNCA 1F2VA 2DT8A 4ZRDA 1VG9B 4Q47A 1Y8QA 3G6WA 3IBSA 1N0UA 3NRJA 4RTSA 1LBEA 1VRWA 4BKRA 5HQ3B 5HK9A 4XYGA 4DA6A 3LBHA 3VC2A 4HLDA 1OA0A 1YOVA 3W1WA 3W8RA 1XMXA 4BVLA 1GSIA 2JIZA 3PQ3A 4UCXA 2SKCA 2OC9A 4WGFA 2XVAA 2H2GA 4O4IF 3TZCA 1PWZA 3B9BA 5BSGA 2ZETA 1Q0TA 4KR6A 1YQXA 2NGRA 2CCKA 1Y5RA 3GR6A 2HDOA 2QAGC 4B3DA 1W0KD 1JLMA 4JIMA 2OK8A 2F1HA 3WJ1A 4L4UA 4BNYA 4IDGA 5AW1A 5LQJA 4GP6A 4MJXA 2ZYIA 2CE2X 2DBYA 5IN4A 3ZBTA 1D8AA 2J08A 1ISMA 2NVUB 2DWOA 2G5TA 5CFQA 3FVVA 2YYZA 2TS1A 5E6SA 4Q1FA 2K7ZA 4W63A 2AC4A 5FI1B 1WW2A 3DKRA 4G5XA 1SXQA 2HU8A 1L4FA 2YVLA 1SXHA 4AT1A 3O2QB 2YNMC 3WWCA 4HLCA 1TUBB 3MWGA 3JAMA 3L9WA 3OM0A 3C0KA 2YJZA 3BJRA 5LQCA 3TTYA 4LBYA 2OV1A 4NV1A 2J0UA 3C85A 2JI8A 3OFND 3HM9A 3BMNA 3R5FA 4DAEA 1G5QA 1H0SA 5A4JA 3FY4A 4Y2SA 3ESCA 3NH9A 2IWHA 5IVDA 2HADA 1GVHA 1IN7A 4O08A 5LZ7A 4M22A 4YJ2A 3HEAA 4RTKA 4MSUA 1GYQA 5EMNA 2Q8QA 2VYCA 4DKXA 4GPIB 1CEQA 1YS7A 4JROA 3HWX1 3GLIA 1Q7RA 4X7RA 2NMVA 4QX6A 3ECAA 2BFAA 3O7MA 3KDSE 4RCYA 2ZRGA 4YJDA 3WKCA 3GQBB 1MJGM 5TEVA 4C4XA 1T6BY 4O5OA 4Q15A 1IY2A 1U3GA 4MP3A 3MT0A 3WAKA 4DDWA 4DV5B 1TF2A 1HQCA 1DKQA 2FZ5A 1BH6A 1IXZA 1MQ8B 2JAHA 4KR7A 3AVYA 3MQFA 4Z51A 1AQLA 1Y80A 3FYUC 4OD0A 4MWTA 5CJJA 1HI9A 4FCVA 1GNQA 4OGLA 4ZT4A 5AI0A 4Y9TA 2O2ZA 1IOVA 2GJ8A 3V6MA 2GHIA 2YX1A 2YH2A 1WKBA 2DQYA 3ECSA 3VYSB 4BUCA 1XB2A 5E7JA 3EAFA 3W9BA 4UM8B 2VXYA 3DFUA 5FA8A 4QOEA 1RRMA 3MNFA 2H1FA 1J2YA 4EYKA 4ZVKA 2EIHA 2H7CA 4FNOA 1C1HA 1C4XA 3EVFA 3OHMA 3HDHA 3KPUA 4RLHA 1YCDA 1X19A 3ESZA 2Y1WA 2BGTA 1QDLB 2IE0A 4NCJA 4RDHA 4TSKA 5DHSA 1C1DB 1O6BA 4NYMQ 4DA9A 1IK6A 1X1SA 4KSYA 3UEOA 4OOFA 2VJQA 2RAUA 1HE4A 3ORSA 1G8SA 3IKLA 1JG1A 1JIIA 4IVRA 1X74A 1E0AA 2MSNA 5AOVA 3WK7A 1NQ5A 2WTNA 3T94A 3VZBA 2FWIA 3CSSA 5CLQA 3MYYA 4BJHB 4DQDA 4YRKA 1O03A 1CR4A 4RNDB 2F17A 1ZIOA 1W5TA 3K1AA 3FIJA 3VZQA 2UZ3A 3OLWA 5M5BA 2W6NA 3C24A 2EP8A 4YI5A 4FDUA 5CLHA 4KBYA 4AUMA 1TTHA 4MZDA 2CHGA 5HIAA 1CZOA 1PTKA 1WBBA 2DR2A 1ES9A 3V4FA 2ZTMA 5A5FA 4LSGA 2O2IA 4ZZ0A 2PQMA 2G9UA 5CEFA 1J8VA 4LVCA 3CKLA 3SC2A 3WP1B 5LOVF 4HQOA 1IY8A 3SVZA 4CEJA 2GPAA 4G0QA 3HZZA 4ZI2A 2C00A 5B1YA 3WGGA 2P0AA 3NP7A 1JAXA 3K35A 3TEMA 1NY6A 3P97A 3H13A 4PZCA 2O2CA 4A73A 1HTTA 5I5EA 2ZBPA 3FYCA 2PMCA 3PG5A 2JCVA 1EFVB 3QV2A 3K8QA 4Q12A 4F5EA 1CXZA 1SCJA 4EEXA 1PFYA 4JR2A 1NVVR 5JDCA 3C48A 2FXIA 4W5QA 2Q6VA 4O25A 1I0LA 4WK2B 2XGJA 1T2NA 3KVNA 2B4AA 3IP7A 3KKPA 1IQPA 4OHVA 1ZQ1A 1U3DA 3AYZB 4AF8A 4IV8A 1AQJA 4DV4B 1XNJA 4BZWA 1FBTA 4TS9A 4HNUA 2FW6A 2X1HA 5LMNB 2Q3HA 1SHKA 4ZXPA 2JFWA 4LI0A 2B3TA 4JLAA 2QE6A 1G2OA 3R41A 3SXJA 5CDGA 5IH7A 1T2CA 4ZQGA 2REQA 4X7MA 1ZMRA 2A9QA 3M2TA 2PLFA 3JY6A 1C9KA 1DAEA 2F7SA 1U8FO 2J5QA 3DF9A 4QDOA 3L4BA 2A9FA 4KMMA 4QICA 5HKBA 4WN9B 5IARA 4CEIB 2GZ3A 4KWTA 2O19A 1N3BA 5CCBA 1H6BA 2GETA 1OD6A 2PNFA 1RRVA 3EXIB 5IJ9A 1L5FA 1VL5A 4ZFNA 4YRGA 2GNAA 1XZEA 2VDOB 3HDVA 4FZ5A 4ERXA 2BN4A 3DGFC 4U1RA 5ALRA 5K0EA 1TTTA 3EBOA 1IWOA 3E9DA 3UAGA 4DYDA 3PR3A 1DCMA 4AX8A 2XB8A 1Z7EA 1OOEA 2NNWB 3LBNA 4TVKA 1ZJWA 2JI9A 3PK0A 2ZT8A 4MQUA 5BWNA 2ZSBA 3EQ2A 4KR0A 1U7OA 1BD4A 3WMXA 4JI0B 4AQDA 4LVOA 1U98A 4GE0A 1KVSA 5A7GA 1UBCA 3RANA 2F8LA 4AJ2A 4F21A 4Z3DA 4URWR 1U2GC 3K0AB 1KAOA 3HRHA 3GPCA 1YCFA 1TK3A 2VWGA 4LGCA 4MPRA 2VNJA 2UDPA 3LVRE 2G9RA 3WJ7A 4QQ8A 5J2UB 1YCGA 3MS4A 2CXQA 2JGDA 1SPBS 4KXYA 1K2WA 4H77A 2CDBA 4CI9A 5JWRA 3I39X 3A4MA 4LPSA 2UXBB 3LGXA 1ONBA 1EFTA 4KITB 4JXXA 4TOIA 1O95D 3VZDA 3DF7A 4CDGA 4P7FA 5LLTA 2QZPA 3B60A 4NFSA 1Z5PA 1B8NA 4L72A 3SICE 3TQTA 4MVCA 1XJWA 2BDTA 1LLFA 4ZDJA 2WUVA 3K5WA 4BEBA 2FMFA 4AY4A 2R62A 3A3OA 1BHSA 2B1JA 2PO5A 4B7CA 2OZLB 3SS9X 1NMSA 3NBUA 2E2WA 3MJDA 3ONNA 1KYIA 3AFNA 2B4YA 2D1YA 4GZMA 2UAGA 4P84A 4ZALA 3L84A 4A9AA 1E3WA 2V5UA 5FYQA 5C8VA 1GTRA 1XRRA 1Q5PA 1MG0A 1WULS 4ZI3A 4ZO6A 4ZAWA 1MO2A 1T3GA 3V8EA 1P7PA 3D3QA 3N74A 3W2EA 3DTTA 2JLQA 2RKBA 5CB6A 4YP6A 1FTNA 3HKDA 3NBAA 3OPYB 1NX9A 3U7RA 1O4WA 2Y99A 5BR4A 5K0LA 5JAHA 1QGDA 4K9OA 5LD2B 3K1TA 4IO0A 4MB2A 1K7XB 1NXXA 7REQA 3E9YA 2RHMA 1JILA 2YZKA 2ZI5A 2Q4TA 2HHAA 3O8QA 4QNNA 2QXUA 4RTOA 3S2SA 1I3MA 4U5XA 1CQPA 5K09A 4BX3A 1PJRA 3I05A 4PX9A 1G8GA 4J49A 3GU3A 2B34A 2WLSA 2R7MA 4CDRA 1BD3A 3JATB 4BU1A 4BKMA 5LZ2A 2R44A 4LCEA 4RS4A 4JP1A 4P1ZA 4DRXB 3AJ9A 5IX8A 2AQIA 3PE4A 4FFSA 4BLRA 4CT5A 2Q9BA 4L0CA 2H00A 3AFMA 4CQMB 1WVGA 4ER3A 4US0R 4ZZ1A 4X0EA 1UKAA 4D3XA 1M72A 2BFOA 1S4QA 4TL7A 2HLPA 2FN3A 2OEPA 3BIWA 2GAFA 2O8CA 2H1SA 5A5EA 1F5NA 4JSTA 4DNPA 1ZSYA 3KUCA 4ZMBA 3D8BA 3MJRA 4J0GA 4M8IA 1LLUA 1YONA 1D5CA 2IKQA 3MXTA 2PFGA 3GFVA 2R97A 3P0HA 5AJTA 3NIBA 1BDHA 4RADA 1N2XA 4C22A 4J0JA 1ZK3A 1JBEA 4HN9A 2V7TA 4MP6A 2CL5A 1ULUA 2ZRNA 1TM1E 4LZJA 1UADA 1H3FA 1PR5A 1COZA 2BLLA 4UKDA 3UUGA 3EXEA 1CULC 4MEBA 1DSSG 4BNVA 3L7IA 4XWWA 3NWEA 1OLUB 2C95A 1C9DB 4FLMA 5JZBA 3U7EB 3RBZA 3G8DA 1CF4A 1G7CA 4EH1A 4F4UA 1FB5A 1OYVA 1EAMA 2EKDA 4MW6A 1EBBA 2V6FA 3LY8A 3O03A 1TGVA 3EH2A 3UQZA 1KO8A 3OZDA 3IP3A 1LBQA 5ARCA 1HT3A 1FYDA 4JYBA 4C4RA 3SNKA 3CZPA 5AKKA 3I01M 1W2WB 5B1DA 4TTRA 1ZCJA 2BEVB 2DWCA 1C3VA 1RXCA 1AGNA 2GYWA 2Z3WA 4MLZA 3OT1B 1D6SA 4Q48A 4BB6A 4BNWA 5LQDA 1TW2A 2GUWA 3IDSA 2FDRA 4P7JA 4BMXA 1ZA2A 1LRLA 1XOIA 2YJTD 2XUKA 4BZZA 4AO8A 2PSHA 4REMA 2QNBA 4GYJA 3OHPA 4ZCRA 1T4BA 2BH9A 4MPPA 4OFXA 4XPIA 4Y2HA 2JGLA 1YDFA 2GTHA 3X0DA 4ND4A 5GGXA 2VYVA 3D3JA 3RF6A 5J47A 2QRNA 4YAFA 5EQDA 4EFDA 1E4OA 1ONOA 3BE5A 3SC6A 3I9OA 4TLLB 5ER9A 1Z0KA 1H1LB 3GZ4A 4Y7DA 3VC3A 1NW5A 1S4MA 2QI9F 3IERA 4Q01A 4C4SA 1KBZA 1PK7A 3HZRA 1VBNA 1B0ZA 1XQWA 4CLHA 1DXYA 1N2SA 1RRPA 3L1VA 4GL2A 3ACCA 5IJZA 5I47A 3UC5A 2JF0A 2Z1DA 5EXSA 3SKYA 4CV0A 4DC0A 3EEOA 3F71A 2GK6A 1NN3A 3M81A 1KH2A 3IGFA 2OTCA 2PS1A 2WD8A 4FHDA 2RBGA 2R47A 2W0MA 2FJ0A 1JS1X 1Z5WA 3OBBA 4KWCA 1JAIA 4ZU3A 4E5UA 1NZDA 1QQ5A 3PSHA 4E31A 1ISSA 3CRVA 1DTEA 1XVTA 1UWCA 2JVKA 1LLDA 4A3SA 4D9BA 1N9GB 2DHQA 3LVBA 2B98A 2MYTA 1CY1A 1X8JA 2UYQA 1ZVVA 1H2YA 2QLLA 4FX5A 5G53C 3VZPA 2C04A 1GKIA 3KOWA 4KUHA 4L0DA 4WXHA 4F93B 3IQIX 4Q16A 3LT1A 4NEGA 5ESDA 3C45A 1XP8A 5G0SA 1KI1A 2EYQA 2XMDA 3FMOB 5DH9A 3WLLA 2IVZA 4EHDA 4EF6A 5JPIA 2DFKB 1G4AE 4RMIA 4RFVA 1V96A 2PGLA 3ONEA 3IOEA 4RHTA 2PSDA 3FCYA 1DAKA 1UJ6A 2CGEA 1OWLA 3CIFA 3HKEB 2XUFA 3PHLA 4KUGA 5BVGB 5MDHA 5MF6A 3WOVA 2ZRKA 3AC0A 3C4QA 1O0SA 3BD9A 3KQSA 4P7GA 3RRXA 1MZPA 4MRNA 1KO1A 2QNRA 4G1UC 5KTPA 2W42A 4C7OB 3KSDO 4DWOA 1A9PA 3F5FA 3TDNA 3ROFA 2ZBDA 4HZGA 5EIAA 1A9QA 1GAQA 5DHAA 5MFPA 3SS8A 1OZHA 1NR1A 3V8PA 5LP6C 1DBPA 3EQ8A 2EX4A 4MAFA 4LRTB 4GI7A 2FPIB 2JG3A 1ZUD1 4LDQA 1N6NA 4PBTA 2J6IA 1SUFA 1H3NA 5TRTA 2ZZMA 4CM9D 2C2WA 4HFNA 3IQWA 4B45A 2J3EA 1YL7A 4WBNB 4DR5B 2YJ4A 3VFDA 2OCKA 1EM6A 1QH1A 2XUZA 3KAKA 5E7MA 3S99A 1U3UA 2LE0A 4OH7A 4R83A 1T3HA 5SY4A 4BAUA 2WNSA 4IKPA 2CL7X 3C5WP 1R0BA 1QCYA 4K40A 2GJSA 1H9AA 2ZJ0A 1YK1A 1I7DA 3VGJA 3LQQA 4IEFB 4YQEA 3IP5A 1I4OA 1M2EA 1JEAA 2PMFA 1DQNA 2VNHA 2SKEA 4GUAA 4YJHA 2PVSA 3I09A 3WK6A 1HA3A 2GOYA 2NYRA 5EE5B 1NQTA 3PQ2A 4OP1A 3GUCA 2BPOA 4BIIA 4C3ZA 2HCJB 5FNVB 1A9XA 2O8DB 2WOOA 2RKOA 5B7QA 2RGXA 1NV8A 4XB1A 2Z2YA 1NSYA 3AZOA 3FMVA 4HTFB 2PS9A 4O02B 1XVIA 5AKYA 2Q41A 3PITA 2WVAA 3FYSA 3A4NA 4R9VA 4A6XA 1SY7A 3GROA 3KZVA 4MQ6A 4KQGA 5ICFA 3IT3A 1A27A 3R8CA 1VPWA 1G21E 1LPPA 1SC9A 5BN4B 2DUNA 2HQRA 4PLFA 4MAMA 4WIAA 1SC6A 4LQ4A 2P11A 5FA6A 3N2GA 4H6XA 1TF5A 4KH0A 3T7KA 3VUEA 1T1EA 4L6AA 4V03A 1DKLA 1WP9A 1NFQA 2AJ8A 4KE9A 1L5HB 4CMAA 2IS2A 2GF9A 5D85A 4M1YA 4QFCA 3UF0A 3H9JA 1PZXA 1ZGGA 4FIDA 4U2EA 3NX4A 3SSMA 3HADA 3WWZA 2QN8A 3HXQA 1Z2EA 4XYLA 5FBLB 2C2MA 2B9EA 4MQFA 3HCWA 4AVYA 2VUIB 4H7HA 2KLHA 5ENZA 2JIOA 5EMJA 5KWJA 3KM0A 3DL7A 5G0UA 3F8WA 2Q7OE 5A3VA 3UNXA 3WC4A 5F9FA 3HUTA 3D7MA 5DXAA 1R0ZA 2ZDHA 4MRAA 2I7TA 4QVKA 3WLSA 4MVJA 5BWLA 3BWCA 5IT4A 2CF6A 4IXTA 1V8DA 2Q6LA 2YFHA 4G5FA 3GJ6A 1V4VA 1OX4B 1M1YA 1EZ4A 3REQA 4W8OA 1YE5A 1U7DA 4DQXA 2ZR7A 3GFRA 4R1SA 4ZU1X 3QXSA 2I91A 4LZAA 3TZBA 4TUYB 1UBKS 1X9IA 2C4MA 3W6UA 4AP6A 1QX4A 2O7QA 5TARA 1J8QA 1PYOA 5JMTA 1P9LA 4RXUA 3CF0A 2RK6A 4LYHA 5A2GA 2H92A 3TQCA 3EIWA 1XELA 2YZ7A 2FG6C 3MCTA 5ADVA 4CMEA 1U63A 2W8BB 2XAAA 3HBNA 3PT5A 1SIUA 2V6GA 1QF9A 2AD5A 1CK4A 3G1WA 3LO8A 4IGEA 4S2UA 1FSGA 4X85A 4D1YA 5EXPA 3DWIA 1Z18A 2AXEA 4P4TA 3JQ6A 1WTCA 3GLRA 4IIXA 5TVKA 2O2YA 2ACKA 4ND1A 1DC8A 4HX5A 3M89A 2PCLA 4KRXA 5DPMA 4BLTA 4Q7QA 2BFWA 1N6IA 4H7DA 5A3JA 2ZSJA 5IKXA 1Y34E 3V8MA 5EHGA 5KYTA 5IUKC 1QG4A 1PE0A 3BSWA 3GEGA 3P2MA 1CUEA 3D7KA 2ODQA 3DWGA 2GAIA 1PLLA 5JI3E 1DIGA 4PIMA 4S1OA 3IVMA 1P3DA 3R75A 1S6YA 4J07A 4YR7A 3ZHCA 3TPFA 4MIOA 5J2UA 1Z17A 1KKUA 4EX7A 3HL0A 4WD3A 5AKLA 3UJ6A 5IKPA 5KINB 4BGUA 1TQ6A 2H1LA 1T5IA 2XB4A 5HIJA 3UMYA 4FGZA 1A8HA 3R4CA 4DDMA 4BU0A 521PA 4AWAA 2RC5A 1QZUA 2LXNA 3AQIA 4JBWA 3RFCA 2O57A 3PNLA 2P9BA 3T61A 1G59A 1UZUA 2NM0A 1AM4D 5FV7A 1AQYA 1E6WA 1IHYA 3JD3A 5KTTA 4LJSA 1VRVA 1LZLA 3C7KA 3UA4A 2FSPA 5KYGA 2A1UA 1ZICA 3DE7X 3EGXB 3G3EA 3JTMA 2H4WA 3MJEA 4IAOA 2ET6A 4AC9A 4B09A 4C7XA 3FTFA 3KFLA 2Q45A 4BQIA 3X1DA 5CX4A 5HM6A 4KXMA 4L4XA 4V0RA 1E3WB 2HPHA 2D54A 4RQUA 4D56A 4OK6A 1I13A 3PRHA 2F8MA 4JJEA 4G1MB 4EW3A 1LBSA 2OYCA 3LWBA 1EX6A 4B6RA 1IOWA 2QGNA 4YVFA 3VUFA 4CCYB 3WGOA 2WF6A 1RACA 2VH1A 3BILA 3WBFA 3RASA 4EGQA 1Z5VA 4B6FA 3ORQA 3RWMB 3UJ8A 1N5IA 2CNWD 2NIPA 2W6IA 1RHKA 1W4CA 2FCAA 2WNHA 2AMYA 2YIVX 3DUFA 1F06A 1QO7A 4RF4A 5EHXA 1RIIA 2XD9A 2BKVA 3KNZA 4M0UA 2FP3A 1KSHA 4PNHA 1S2GA 4AY3A 4MVJI 5LZ5A 3UHPA 5T8KC 2AG6A 2YHIB 3VNRA 1E3TA 5KYXA 1A5TA 3OQHA 2ETXA 2JJ8A 8OHMA 4LOIA 1O97D 3U9LA 4AMUA 5K03A 2PZAA 1S02A 1PJSA 4K9PA 1QGYA 5DP2A 1Y5NA 4XARA 1KO7A 2VA9A 3D6UA 4E1VA 4EKEA 2ZI6A 1X0XA 1K89A 2ZIVB 1MZVA 3V4SA 1T0BA 1W9HA 5LPNA 3T99A 1JVBA 1HDXA 2GYVA 3RK1A 4XVRA 2Q0XA 2BMVA 2H5EA 1QBKC 4FSXA 3B85A 4EVIA 1G20A 2FQWA 1M6HA 1VIDA 5ECWA 3TSWA 2AKAB 1RM3A 2PKEA 1I14A 4P0TA 2PK3A 3EDYA 4U02A 5ITZB 4KREA 1OB5A 3KL2A 1N25A 1GSAA 1MXHA 2OP1A 1KRHA 3QBDA 1OFUX 2H31A 3U4QA 1F38A 3L2OB 1G0NA 2P68A 4D82A 1Z29A 3ENWA 3QX8A 2C7GA 4F11A 1V6SA 3K0CA 1GN9A 3ZV4A 3WWYA 3HKEA 4ZJPA 1BCSA 1FVFA 1Z8FA 4L5AA 5BVGA 1XMOB 3IELA 1EFPB 2W22A 1BQ4A 4QT4A 4R2MA 8ATCA 1T6ZA 5BSFA 1NIPA 1R9GA 2PX4A 1BNCA 4H60A 4RD4A 3WNVA 4C0AC 2XDQA 4KO1S 3IIIA 3W4JA 4NBNA 5BSHA 3EGOA 3LUKA 2G08A 4ESEA 5C8YF 2YIDA 3C5HA 3OT4A 2IHKA 2IXEA 2JGIA 3PEVA 5AW5A 4C08A 3UJHA 2OYRA 4IIJB 2B99A 3DBLB 4V1CA 3JATA 2RCYA 3EVCA 2TSYB 3N3AC 5CFNA 4I0WB 5JZSA 4G5HA 2W8BA 5LL6P 4KV9A 2B9VA 3MJ4A 1JL3A 3U44A 1KQFA 2BEVA 1P2UA 3OZAA 1ZJZA 4ZYZA 5GIOE 2I03A 4DY4A 1JDBC 3IP9A 2BTQB 4HAYA 1EUZA 1UFOA 1Q16A 1N2CE 4TTAA 1KIFA 5D5QA 1O57A 2FVXA 2WU4A 4NBKA 2ODNA 4IQFA 4OEHA 4TWJA 3MW8A 1P44A 4LYJA 1KVRA 4MR9A 3D6VA 4UFOA 3WWDA 3WWEA 1E8MA 5A6SA 1NRXA 4RTLA 1YL5A 3QHPA 4GZ6A 1ZJ5A 4MGKR 4UM7A 4UREA 2Q3BA 1EUYA 2YXBA 3IOCA 3DP7A 4MYRA 3JXEA 3O74A 6CHYA 1GPJA 4D8YA 2O0JA 2OYSA 2QM3A 2SICE 5ALOA 5EVCA 8ABPA 3IUYA 4MYSA 3FCOA 4GNKA 1WL8A 3HKBA 3NFRA 4DLUA 3PGA1 2FFRA 2G9QA 3EXHB 3SJ7A 1EJBA 1ZOIA 3KJEA 4B3BA 4BN4A 4L15A 3OIUA 5DI3A 1BC5A 4RWEA 4G8BA 2Q2OA 1JQ5A 1TRKA 1Y8RB 3AUKA 2PUTA 3H1EA 4B71A 1NN0A 2H29A 4FONA 3B13B 4NJMA 1DLJA 3BBPA 2PIDA 3A4LA 3EGVA 1LCIA 4CG2A 4NP6A 3JYOA 1QQ6A 1NSTA 1PHPA 1BEUB 1VJ1A 2BF7A 3PUXA 4RKFA 1JNYA 3K9QO 1XNRB 1F4VA 2HRRA 3CINA 1LPNA 2VUHB 4WXMA 1A7AA 4B85A 1UBNA 4L4SA 6GPBA 3QG1A 1AZSC 4DYHA 3K6SA 1GT6A 1T29A 1HZZC 2PX3A 3G0IA 3NC4A 3VV2A 3E58A 5M29A 5FLYA 1E1RD 3ML1A 3FLEA 5FHRA 5JI2E 1P74A 3HN6A 1FS4A 1G5FA 3M4NA 1FFWA 1R0XA 5MHTA 1IRXA 4UCFA 1JDNA 1KI3A 2IITA 4R1OA 5AXAA 3ZBUA 1SN7A 3NWJA 2FPKA 1WSWA 1YB7A 2E6UX 3H6GA 5DJ5A 1GTG1 3IR7A 2GFQA 3V1NA 4ADSG 4FYPA 4EKYA 1LC3A 4YRNA 3LLSA 1M5RA 2XXAB 1L4YA 2WJ4A 4V38A 3OEED 5EIOA 5KQSA 1MN6A 1H8HA 2FETA 1SG6A 2FY8A 3O91A 4P3PA 5ALXA 1JEYB 4X1YA 2AOWA 4E03A 1JJAA 3KJXA 4E51A 2E37A 2C9DA 3TG8A 1XZNA 1AQUA 1E7SA 2JBAB 3ETLA 4P93A 5HZGA 4XW2A 2VXOA 3QXJA 2F9MA 4FEAA 1GARA 3H2JA 3UV3A 2XB6A 1T6YA 3PFFA 1A2QA 3EXFB 4PSAA 2M32A 2AK2A 5T6BA 3TX6A 4L4ZA 2FYTA 4D2IA 6PFKA 1UF9A 2GA8A 3T3EA 3NWBA 3PLNA 4YMLA 1ESMA 3TLAA 4ZEWA 1EFDN 4YRFA 1XZFA 4AJEA 4BO8A 1B1CA 3KLPX 4KXWA 3VPDA 5CEEA 4G1BA 3F7MA 1L4UA 4GPAA 1JV2B 3O1IC 4IDOA 4MVJH 4Q9LA 3GUHA 1XZLA 2FZKA 2ZZKA 3AG6A 4DCVA 3JRWA 2JIRA 1RKBA 3A9TA 1XD2B 3JW8A 4JK3A 4UU8A 4Y6RA 4MVJM 4U7DA 3N7UA 3NS7A 1BWQA 5JO9A 2QX7A 4N8EA 4DCGA 1Y6JA 2QL7A 4I66A 1G0OA 4OYLA 1Z28A 3DEFA 3VHLB 2GVNA 4ZYLA 2CLMB 3D54D 1KEEA 5L45A 5LM3A 3MWYW 2DHDA 5GONB 4HDKA 2A94A 3QHAA 1EFAA 1YNOA 2B7LA 2E7ZA 2Z3VA 3EISA 5D2CA 1V3UA 2GPSA 1CUYA 1WUHS 3NT5A 4XLTA 1WHSA 3A9VA 4GKBA 3AM4A 2Q3EA 4ND6A 1PR0A 3W9YA 2GK7A 3T3GA 2C96A 4BJ5A 1V3QE 3MAAC 4Q3DA 1DCFA 4LF4B 3F9IA 1IVNA 1EXDA 1AHHA 2JGAA 3G0CA 2ZANA 1SBNE 1T9HA 2G9ZA 2QLMA 4K1LA 2BFBA 3O4FA 4BV2A 5FBQB 4F6RB 4MTLA 1U7UA 3B5IA 1YI1A 3AVXA 3LUAA 4I1RA 2XQGA 3V32A 5DYNA 2O6LA 4DLWA 5ED0A 4Y8VA 2VJNA 1R12A 2KQUA 1NDUA 1RQ7A 4GXTA 1JDVA 1VE3A 5ECYA 4GPBA 4RVUA 3GC6A 2X22A 4F86A 1Z62A 1XHFA 1RAAA 1UUFA 3AFIA 3HY3A 4UHEA 3WTBA 1E3IA 2HSGA 3Q10A 3TDMA 4LVNA 5KDLA 1T5BA 5GTDA 3O2SB 3SGLA 2OGUA 2HJ9A 1CDDA 4Q34A 5IAAA 1JECA 2QXTA 3I45A 1E8NA 2Q3MA 3HCCA 3MCVA 2V4ZA 3QM1A 4WOKA 4DV3B 1OF1A 4ALMA 1AH2A 2C5HA 4TMKA 1HDGO 4TXHA 3V3TA 2V8BA 3DMHA 4RJKA 4PICA 1XVAA 1ZXBA 1FUYB 1GRVA 3HYNA 1TYCA 4WLEA 1XXHA 4NZ9A 3F5QA 4MUIA 1WCIA 3Q98A 1ODTC 5ALJA 2OCGA 2WIAA 4C2AA 1P2GA 3T9BA 4H7EA 2I2FA 2VK1A 3ZX5A 1N78A 1KWKA 3ZLUA 4URVR 1DC3A 4LVUA 2HGSA 1QVWA 2R87A 2Y1DA 2IPLA 3MWLA 4XWAA 4RM3A 2XQKA 4ZQHA 3KUDA 2R7AA 3NANA 1SHZA 2JAUA 2B3DA 3ZD8A 1WUKS 3PNQA 5L3RA 4LYDA 1N2HA 4ALLA 4P7KA 4GMDA 1XIVA 4MWCA 1C80A 4IG9A 5GZ6A 2DGDA 2XODA 3OKAA 3AFGA 4AMGA 5BOSB 2ZP1A 4KAXA 1TJ5A 2V9CA 2D74A 1CX9B 1JAYA 3LRTA 2OBNA 3WNZA 4K9NA 1RADA 1E3MA 2Q2NA 4KSCA 1CHNA 1GTZA 2DHCA 2FFQA 4RHFA 3IH5A 1L5KA 5BV7A 3DLHA 1KZ7B 4WCVA 3GB9A 3MMZA 2HA5A 2IFTA 2XRYA 1U8CB 1JGTA 2XUOA 3PV0A 3GLVA 4LK3A 4UXHA 2QQ0A 3O8CA 1U94A 2Q4EA 2R8ZA 5DM4A 1BXZA 1D2MA 5JROA 4OX9B 3UWPA 1B74A 4V1CI 4WFQA 3LW8A 4Q9IA 3U4AA 1RWVA 1NZJA 4JELA 3LZ6A 5BSEA 5KAPA 3C1UA 4JOBA 3LT0A 2X4IA 3FNGA 2VBIA 2JAPA 4FFNA 1HWYA 2A4MA 1SM4A 1OXTA 1ADJA 1X7GA 3IFSA 1QYIA 3HEBA 5EN4A 2IPMA 3U3XA 5KOHB 4R1NA 5LOVB 1FSPA 3DDCA 1JDUA 3EZ7A 1CZUA 5LP1A 3MIIA 4ENQA 3GCWA 5FPYA 2OAGA 1A77A 3ZWPA 3INNA 2JL1A 3HJHA 4QEKA 2BHNA 4KNWA 1VE5A 1JFSA 1A97A 1TUGA 1Y3IA 3HABA 1BE6A 1NURA 1H93A 4XB2A 4ATNA 3N6XA 2QLBA 2ZQYA 4JOCA 2XNHA 4F1JA 1IAQA 3HKCA 1CY2A 4CKBA 1KJWA 1XCBA 5FOUA 4E1AA 2IOFK 1VMKA 2UZ1A 4B3GA 1P0FA 1QHNA 2R4UA 5LMCA 1X8XA 3GNLA 1GPUA 3ZHRA 1QHXA 5JDCC 1GR0A 2B8JA 3FF1A 1DEAA 4BNUA 3GJ0A 4YV7A 2PKQO 1W7AA 2ZGVA 4F2DA 3KKKA 1QHFA 1SHTX 3MFYA 2RB5A 1ISPA 3Q9NA 4PHGA 1J8FA 2Z2IA 4NJMB 4QHTA 2OFOA 1VYHA 5ELXA 2L18A 4JOSA 4OP3A 5T4FA 3T8YA 3GDWA 5KHOC 1L3IA 3BIOA 1QCDA 2OVFA 1QIHA 2BFFB 2EWMA 4L74A 1CUHA 4JLDA 4KOAA 3ZNOA 4ZVQA 4KAFA 5FPSA 3IP6A 2ORED 3FGZA 3WVNA 2HBRA 1CRZA 4A15A 1T0HB 3B6JA 4R01A 1GO2A 1V45E 4BDSA 4ZP1A 3LT2A 4GD3Q 4OQXA 4FD2A 1GU7A 4HOYA 5KYUA 4EI7A 5AVXA 3EC1A 4E33A 1ZRMA 1EM8B 2CT8A 3VKHA 5H8WA 3H0EA 3HGTA 2CK3D 4MWGA 5TPZD 1ORWA 2MTBA 2ORIA 4YAWA 3B1YA 2MMCA 1OAOA 3AIKA 1YRHA 3SSAA 4LYAA 1TF7A 1XKXA 1M7BA 1DAGA 1NW7A 4D44A 4G1VA 4U7JA 3CA8A 5AKHA 3A11A 2XVXA 2EEZA 4CT0A 3FG9A 3JQAB 2BY4A 4R2XA 1Z6GA 2UXDB 1ZCFA 3JWJA 2CV1A 2YJ3A 2K2QB 3U7QB 2EKLA 2QTTA 2YCLA 4J0IA 2V7XA 3RIEA 1OCEA 3CWCA 4FEYA 1MX9A 4WK0B 1L9KA 2LR0A 4HWGA 3G2KA 1WCIB 2IYYA 3EFHA 4HMPA 5DLEA 5FIUA 3WB9A 4AWXA 4G36A 4C05A 1C4OA 1Q6ZA 5CM2Z 3C4JA 3FH0A 5FOWA 4CCWA 1KAMA 3A2LA 3M7IA 1FFEA 4RLFA 4YRDA 5EFZA 3EDOA 1JALA 5DBGA 5DX1A 5TPZA 2B1GA 1JXAA 1ZONA 2J3IA 2O0MA 3BM5A 2PU7A 4X94A 1Z2OX 1OH6A 1D6MA 1RW4A 4KN5A 5G0TA 4RHUA 4WV3A 1QH8B 1I3LA 1DELA 2JAXA 2JRLA 1F8UA 2WSBA 3DZIA 1FFYA 1QV9A 3PC4A 2H51A 1ZW1A 3K9NA 3CS3A 3EB9A 1WXFA 2WWHA 3ADBA 1J8YF 5FL7D 3DLTA 1P2BA 5AVYA 4LDAA 3NC1C 4ND8B 4MDEA 4O4IA 4IFBA 1P4SA 2W4IA 1UBHS 5B53A 5HS4A 3CW8X 3E03A 2ZSDA 3CTPA 3LTEA 4A2CA 3R24A 3SXUB 3O5AA 5B1IA 2XXJA 1GD1O 2COEA 5DT2A 4UEKA 5G1NA 1G5RA 3STHA 4J94A 3JQFA 3WL8A 2F4NA 4Q3CA 1JFRA 5FT9A 4IOMA 3P27A 1UK6A 4KVAA 3ZW8A 4R68A 4C88A 4FSHA 1W59A 1VPDA 1Y5MA 3R0IA 5DI3B 4WZBE 2FX5A 3E35A 4DC1A 3OU2A 1ZI6A 4EVSA 4W5JA 2I1LA 1S89A 4ZOQI 2K7FA 3I5AA 3AY0A 1U0FA 4UAJA 1U65A 1Z83A 3ODGA 2P9CA 3VR1A 1IAVA 3V8VA 3ZJTA 2VJYA 4YMSA 3D6JA 3FUCA 1SVKA 3I61A 2WPDD 1H8ED 3AXSA 4TXNA 2X5KO 5DBFA 2D5BA 3WL6A 4UC0A 4I4TB 4R8LA 1VLLA 1W76A 2C3YA 4C29A 3CRW1 5IXSA 2I3ZA 3OZFA 4GEGA 1P3JA 2PY6A 3R7FA 1W85A 1X1AA 4G63A 2Q2VA 3SD7A 1UMDA 5FPPA 3K20A 4X41A 1Y1TA 3DHWC 2RHJA 3PFBA 1D04A 3S8MA 1D0SA 3VRHA 3E0XA 3TPZA 1CPYA 1KFEB 1U5AA 1YQGA 2XSZD 2Z2JA 1YNSA 1E1YA 3EVDA 3GFSA 3WK4A 4CM7A 2GK4A 1H1DA 4OXNA 4KUEA 5AD1A 4RL6A 1KSFX 3ZV7A 1LSUA 3AU8A 1BE8A 1QRDA 3AR7A 5EL0A 5ECGC 3ASUA 1ODCA 2FMUA 4WESB 4D4JA 4HGRA 1OKKD 1SOMA 2CLDX 3AX6A 3WQHA 1S3GA 4YRRA 1BKDR 4PLPA 2FEMA 3DZHA 2GSDA 3W4KA 3NYRA 5EP3A 1PP4A 3MINB 3DOHA 4IMPA 3ZCPA 1UAYA 2C82A 1BOFA 1UP4A 1JDZA 3WLNA 3O0TA 4E7PA 4ZT6A 1IEQA 5FOSA 3ZVMA 1QZZA 5ALFA 3WIVA 1OREA 1FF9A 5ALZA 5TXGA 1CJMA 5CIYA 4UUBA 1Y8QB 2HIAA 5KNBH 3ONVA 2W2OA 1J4AA 4OHOA 4BNXA 5A2QA 2QM0A 3RYFB 2PX0A 1FMCA 2YHAA 3C6KA 3GH1A 3I2HA 4TMXA 3WRXA 5JDIA 4Y2YA 1M75A 3C3DA 3Q8LA 1KARA 4RV5A 1Y3AA 3IDAA 2FQXA 2I1VB 4B4VA 1P61B 1ORIA 2R8XA 4W9RA 4KN8A 4PYKA 2Y0BA 4BAZA 2JDIA 2X6RA 2IEIA 3FCUB 3JWGA 5EJ4A 3DFIA 2DFPA 1FDUA 1BMTA 3KG2A 2ISSD 5ALPA 4B5KA 2PZEA 4IQ0A 1R4AA 1AVTA 1OI3A 4WEQA 3X1WA 1ZGZA 4DIOA 4DQVA 4EGAA 2ZJZA 3BEDA 2AEJA 1EA5A 1N8KA 1UOEA 2XGOA 3G8CA 4OYYA 4RJ2A 3PJGA 2OXRA 3C6BA 3DOJA 4IL5A 1Z0DA 2JJ2D 3LHDA 1NE7A 2V59A 2CUKA 2R1VB 2D1FA 3P2EA 2AW3A