1J0BA

Crystal structure analysis of the acc deaminase homologue complexed with inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
325
structure length
325
Chain Sequence
MHPKIFALLAKFPRVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIRKLEYLLGDALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKGNYLLDKIMGIETRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQSEVKFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAELLGVKVEVRPELYDYSFGEYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGELGEKILFIHTGGISGTFHYGDKLLSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-aminocyclopropane-1-carboxylate deaminase
publication title Structural and enzymatic properties of 1-aminocyclopropane-1-carboxylate deaminase homologue from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lyase
total genus 99
structure length 325
sequence length 325
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 3.5.99.7: 1-aminocyclopropane-1-carboxylate deaminase.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j0bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j0bA02
5DVZA 4Y6GB 2PQMA 2BHSA 1VE5A 1K3UB 4JBNA 1TZKA 1KFBB 4QYSA 4D8TA 1WDWB 3FGPA 1J0CA 1FUYB 3IQIX 4JBLA 4NU8X 1FCJA 5DW3A 1TZJA 4COOA 1TZ2A 1A5BB 2BHTA 2V03A 1TJPB 4D8UA 5KINB 1UINA 1KFEB 4L0DA 3L6BA 1TYZA 4I1YA 1K7XB 2J9YB 2EFYA 5JJCA 5JISA 1C29B 1Z7YA 2J9ZB 4OREX 3AEYA 4D92A 3R0ZA 5KZMB 5DBHX 4WX2B 5D87A 3T4PA 2TYSB 4D9IA 1E5XA 1PWHA 4H27A 2GN0A 4D9BA 1K8XB 1WBJB 5HBGA 4LMAA 3PC4A 5IWCA 4D9GA 4XUGB 1QOPB 2GN1A 2CLLB 2D1FA 2RH9B 5CVCA 4ZU6X 1C8VB 1QOQB 3PC3A 3VBEA 3VSAA 2CLHB 4LI3X 5B55A 2ECOA 5T6MA 4F4FA 1C9DB 1A50B 3TBHA 2CLIB 2TRSB 1V7CA 1D6SA 1Y7LA 5DW0A 4D9MA 5B1HA 1K7FB 1O58A 4D97A 2EGUA 4D9EA 5I6DA 3PR2B 1Z7WA 2O2EA 3VC3A 2ZR8A 4IL5A 1K7EB 2CLMB 1CX9B 2Q3BA 4HO1X 4D8WA 3IQHX 5IW8A 4D9KA 4PCUA 5IXJA 3FCAA 1J0DA 1TDJA 1TTQB 1VE1A 4D99A 5D84A 1P5JA 1UBSB 1JBQA 1J0EA 1TTPB 2ISQA 1KL7A 3ZEIA 5J43A 3X43A 4HPJB 2GN2A 5BW6B 3SS7X 3L6CA 4ZU1X 1J0BA 3DWGA 3AEXA 1V8ZA 3IAUA 4LMBA 5C3UA 3VSCA 1PWEA 3CEPB 5EY5B 1X1QA 4L3VA 3PC2A 3X44A 3HMKA 5DBEX 1BEUB 2Q3DA 1RQXA 2ECQA 4L28A 3V7NA 5I7WA 2WSYB 3SS9X 1A5AB 1J0AA 1WTCA 2RKBA 2TSYB 3VSDA 4D9FA 5I7HA 3DWIA 2Q3CA 1VB3A 4D9CA 2CLKB 2RHGB 2C2GA 5B1IA 5I7AA 3SPXA 1TZMA 3L6RA 5J5VA 3BM5A 4AECA 1V71A 2DH5A 2JC3A 2ZPUA 3DKIA 4L27A 3IQGX 1F2DA 4KKXB 4HT3B 4ZQCB 3RR2A 2O2JA 4D9NA 1KFJB 2DH6A 2J9XB 5CGQB 1UIMA 4HPXB 4NEGA 5D85A 1WKVA 5B3AA 1OASA 2CLFB 5B53A 5E0KB 4D96A 1CW2B 2C2BA 5I7OA 4HN4B 1KFKB 1A5SB 1KFCB 4OFXA 3R0XA 2ZSJA 5I7RA 1BKSB 1M54A 2CLEB 1K8YB 1K8ZB 2CLOB 5B36A 5D86A 4AIRA
chains in the Genus database with same CATH superfamily
2HGSA 1MOZA 5DRYA 3K0KA 1EJ6A 1MENA 1FCJA 4EELA 3EDMA 2UZAA 5FPYA 1KDVA 3SLGA 1QHIA 3L7OA 1MO6A 1XLTC 1Y5NA 3DCYA 3HM2A 4J1SA 4Q7EA 3FOBA 3ICVA 4JLJA 4TS3A 4WCFC 2XDWA 4DLLA 1NJ2A 5CYPA 2FOIA 2BFEB 3R2JA 4ZT2A 1PS8A 3L40A 4LXHA 3ASYA 2DFNA 3BFXA 3LCVB 4GOXA 1DPGA 4JYMA 4OQFA 1WQ4A 4P82A 2GCPA 4NE9A 1F8XA 4NNOA 4UVDA 1FJ2A 3BDIA 4D4LA 3RAFC 1GPJA 1QKIA 4DLRA 2Z2JA 4CLDA 4L02A 3MELA 5JBQA 4DS3A 1F2TB 1WLSA 2VEDA 2JLWA 4Q4HA 5J2TF 2GF2A 3HZOA 3JQ6A 2PZBA 3EVNA 3AINA 3LV8A 2VSQA 1VLHA 5SZJA 4M1KA 3NGLA 4L0QA 2GCIA 4M22A 3S5UA 3V7FA 3ZC3A 4DILA 3QI2A 3ZTWA 1VKNA 2I78A 2ZI9A 4GNKA 1U0OC 4KOEC 2EW2A 1XEWY 1LPMA 2AYXA 3CIOA 3L02A 3PC3A 1EP2B 4M0CA 5FWDA 1IMOA 2CBGA 2IDKA 2H5JA 2WDZA 1SBZA 4OHPA 2CWDA 1N6LA 5AKJA 2CXTA 3HCDA 5E6SB 2X3FA 2ZSAA 1CLUA 3ITDA 3EASA 2JGEA 3PQ5A 4BEWA 2QAIA 4TM7A 4QM6A 2XTNA 4ERNA 1SC6A 5J5AA 3SK0A 3LNTA 3D8NA 4MW4A 5EMNA 3WGLA 4FX5A 2GLXA 2LUOA 3I1JA 1DDGA 1YI1A 2BCGY 3FDFA 2PWBA 3Q9UA 4PR0A 5L53A 3LL7A 4XWAA 4F8YA 1ABBA 3U60B 3S1SA 3FKSA 2NU6A 2P6NA 3NWOA 3K09A 1YDGA 4MCJA 4QBKA 3H1EA 3UEOA 1SO8A 2VPIA 3V7WA 3AUUA 4BCDA 3T34A 4RVCA 3A3KA 3MLBA 4L1KA 3VKWA 1F9EA 2OD2A 2Y9PB 3BD7A 1YJ8A 4OHUA 5GJCA 4A0GA 4BP9A 1G21E 4ZU1X 5AJTA 2AXPA 2CUZA 1BYIA 2NQ2C 3JR7A 4DJDC 5BV0A 2VXCA 1LVUA 3W4KA 1HT3A 1PN3A 1ZAKA 4UAJA 5ECGC 1ISRA 3DDSA 5EZQA 3MF4A 4I55F 1SCQA 2J5QA 3PTZA 4CIDA 3STYA 1XOIA 3HJCA 5I9SA 5G1PA 1BN6A 3IP6A 4WLVA 1RS0A 2YH2A 5CPBA 1KAEA 2D59A 2VNHA 2VQSA 4HMOA 4PZZA 5ETJA 1XA4A 2X0JA 3ZPXA 2HF7A 2JD2A 3GROA 4TS1A 5G1OA 4BV8A 3I73A 5EGSA 1OAKA 2YJGA 4J07A 4OQDA 3BWBA 4Y2YA 4BEBA 3CF4A 3LUPA 4FBMA 4UM9B 1A2QA 3ELYA 4BVGA 2QUBA 2H08A 1R2QA 3JWHA 4FILA 5THQA 2IS1A 1VPLA 4U63A 5IDVA 2VLBA 3BB1A 2PUJA 2R6R1 4A92A 4ZZ0A 4DMRA 5BR8B 1QQAA 2VRWA 2DT5A 2RAVA 4XM2A 3HBMA 1E8MA 3V33A 5LIPA 2R1UA 4X93A 4LYEA 4EIWA 1XN1A 3SQNA 4CKBB 2IHBA 3H5AA 4BO9A 5A0FA 4B84A 4EHJA 1PR2A 4J1QA 4BFLA 1EXDA 1V25A 1QK4A 3AR7A 4ZO7A 4C1BA 2NWQA 2PUAA 2F59A 4Q21A 4FD3A 1F06A 4RKYA 2YX1A 3KYDB 4MVJG 1N6KA 3PXUA 2GPNA 1KJJA 4B81A 3N7AA 1COZA 4JR0A 3GH3A 1HDZA 2FI1A 2H1WA 4OOEA 4PLVA 4M1ZA 4BKMA 2BGMA 2PL5A 3FR8A 3NOVA 2DMRA 2JATA 4MAAA 1OFTA 3W9YA 5HSGA 1JW9B 1V4VA 3DW1X 4NK4A 3G5TA 3QWBA 3AB7A 3QVMA 4OSEA 1EVEA 3ESDA 4FFVA 3VZRA 4DCJA 5IJ0A 4EFMA 3C6ZA 1C0EA 4L4UA 2PH5A 3IPAA 4OXIA 2E3JA 3I53A 4HLCA 3RRZA 1PR0A 1T9GS 1O3YA 5EZ5A 3MBKA 3U7FB 1JHDA 4WA7A 3FOFC 1SVUA 4MAMA 4R1UA 5IKEA 1Z2CA 3V7YA 2BFAA 4DIEA 4KX5A 5JSYA 1NRIA 3OCWA 4BUJA 2HSJA 2ZP1A 3C7CB 3FBGA 1EK0A 2ZAYA 5LQCA 3M6IA 1WQ3A 5KYTA 1GDDA 3TX6A 1R4MB 1OKKA 1VZ2A 2MIIA 5DHQA 2GX6A 1FW8A 4UMEA 3AVVA 4G2NA 2C5FA 1OXXK 3NOOA 2J41A 5EYPA 1WNTA 2H9IA 1OOEA 3O2NA 5K45A 4N8SA 4TWAA 3EGCA 3SXUB 4A2CA 1JDUA 2G28A 3EODA 621PA 8ADHA 1BS2A 5EJ2A 2RHHA 1YS7A 2PO5A 1G2OA 4A0HA 2XYVA 2W6IA 5AKXA 2RH5A 2EBHX 3D8BA 8GPBA 3WKEA 1JZTA 1HDRA 1E9SA 3E53A 3U40A 4L8YA 4ARBA 3NPMA 2Y2UA 3A2MA 5COAA 1HQKA 1AHIA 1T6NA 2HLDA 1KVRA 4XM0A 4EQ6A 1Y8AA 4KL8S 1DX4A 5I9MA 1UBOS 3C6XA 1GIAA 3WLAA 3DEHA 4ZYYA 5KHOC 4OXXA 4U7WA 1DIBA 2VATA 1PO7A 3K0FB 3K0SA 2WW8A 5T3UA 4N7BA 1ZU5A 5EJ4A 2QM7A 5TPZD 2DECA 3MMSA 1Z37A 3MJSA 1RPTA 2CNWD 3N7TA 1D2EA 1B0PA 3R77A 5LQSA 3BRSA 3IAUA 5ALQA 2D4HA 3QXHA 2XVXA 4UPDA 2LW7A 1CJTC 4O1IA 1EJBA 2YHAA 2A0WA 2YOGA 2ZJ8A 3LS2A 3QHPA 4ON9A 5F78A 4KXUA 3N39C 5EJ8A 4MW6A 2HWYA 3P0FA 2ST1A 3DBIA 4RHEA 5CB4A 2QUZA 1GA6A 4JBGA 5IFLA 3AP3A 1S2MA 2NZXA 3INGA 3VR4A 4JHLA 4KFTA 3RBVA 3RFXA 5DT2A 2F3UA 2D13A 4PIVA 4B6OA 5EQFA 2PT7A 3DGFC 3UG7A 4IDBA 3X1YA 1UCFA 1JQJC 3GBSA 3J80A 5LQJA 4HH1A 3CZQA 1G0OA 3BHMA 3E6AA 1P1IA 5FAXA 1Z82A 4QOGA 5DNDA 3TNDA 5KTNA 4D0LB 5CEFA 4DEYA 4D9JA 5JRDS 3P9KA 1Y9DA 2OXFA 1DTSA 4HADA 4IIYA 2HIAA 1Q7BA 4G63A 2Q8QA 3E8XA 2H7XA 2QUKA 4NVRA 3S2EA 3GBPA 4RIEA 1RWVA 4OIFA 4HQOA 1Y3CE 4C0QC 3ZJTA 3HDYA 3EXHA 4NFYA 3ZK8A 2IOYA 5H8WA 1XTVA 1ZVQA 4ZOQI 1PJZA 1W4LA 3GLFA 3ECCA 3MTAA 3VKHA 3AHIA 1IVSA 1JE1A 3Q3JB 1DJMA 4TTTS 1KGSA 4CV2A 1M6NA 1TGYA 4OYRA 2XWSA 3AF5A 3IUMA 4FMCF 3ZE9A 1CIVA 3I2GA 3PD0A 4DEVA 2A57A 3GZNB 4UVHA 5CNJA 5EHGA 4G0UA 4L74A 4B6SA 5TXGA 2I76A 2YY7A 1OLSB 1OHHD 1B41A 1FDSA 5AW1A 1T9DA 4H1WA 2WWRA 5KKCA 2JJ1D 4PE5B 3QEMA 5KTRA 3HR8A 3ZXYA 4EY3A 1F8YA 4WZBA 3SZ3A 2X2EA 3WLFA 4D80A 1I8TA 4UNNA 2R8OA 3B1JA 1I36A 3HA3A 4E31A 2CNOA 4GLOA 3C5CA 5JNRA 1VMAA 5J2TB 1K3FA 1SHJA 3MAGA 3C6KA 5A4DA 2Q6OA 4RA9B 2JG3A 2ZRCA 4O2RA 1YR8A 3GGGA 3NU1A 2OFOA 3A05A 3INRA 3OCCA 1U1DA 4LBYA 4LIPD 4MSUA 5EKXA 2OR3A 3S8MA 4F06A 3VPCA 1PKEA 3NAMA 1MFZA 1FFXB 5J2UA 1CEYA 5FF9A 3WE7A 3W5JA 4H6VA 1T3GA 2KHZA 1XLVA 2V6MA 2EFHB 3HZHA 1ECGA 1YCHA 2ATXA 3U4AA 2EGUA 2ZE7A 5ESXA 4M9ZA 5JD6A 1TUEA 2P6OA 3N8KA 3M4JA 1ENOA 3M6WA 3OPVA 1HGXA 2CLMB 3OCXA 2UYCA 1J25A 4HVTA 1WMFA 2BM9A 1ONNA 3BB4A 3S2SA 3SS8A 5IG2A 2J6HA 3FCAA 1UKCA 2HSZA 4GIBA 2PUTA 2RMKA 6GPBA 3KT3A 5HZHA 3AOEA 1HURA 4S05A 2J6IA 1D6MA 2XT0A 5E7IA 1SHTX 2UUCB 4RFLA 5L7TA 1T8YA 3AJEA 2WUFA 2VF7A 2BMFA 5HMLA 2P2NA 5ALKA 4C89A 3GMDA 3ZIDA 4E03A 1B8NA 1EK1A 4KXXA 4I55B 2X8LA 1Q44A 1P75A 1PT7A 1VPVA 3DE1X 1H1TA 2JAXA 1RE0A 3AERA 5IC6A 3IALA 3I83A 3EDYA 4HEQA 4F2WA 5F7OA 3LAWA 1U5BA 1TZCA 2IHZA 1PHRA 2XOXA 3GUVA 3K09C 4GP7A 4HYTA 4WN9B 5DGDA 5LZ8A 2AJCA 4BV9A 1GGJA 2E48A 3KEFA 3IBCA 1DT3A 2VDPB 5TGTA 1GTG1 2YWGA 4G5OA 2GKSA 3VSDA 5BR4A 5ITSA 1Y6GA 1BW9A 1CY0A 2Z83A 1UDRA 5DGXA 4Q01A 2JFYA 3LDGA 5U9CA 4B6QA 1JR3E 2O1XA 3LRXA 3RYCB 3C70A 4DRXA 1TF2A 4NJEA 4O0MA 4QUDA 1QG4A 5EVCA 3UK2A 2GM3A 1R0CA 1YBMA 1O95A 1EJ0A 2IUEA 2QD2A 3IQGX 2DH6A 5CGQB 1C9MA 5K8CA 2C20A 3COPA 2YWXA 1EI9A 5BQPA 3RDPA 1YJXA 3A2KA 1QVRA 5C8XA 5CFLA 1OGYA 1FNDA 1NP3A 4LPSA 3NIDB 4G5YA 4U1RA 1EHIA 4WJKB 3BXPA 3RQSA 1G9SA 4OFXA 2GILA 1U8ZA 3DAGA 3UT6A 5K0BA 1GN9A 1TYCA 4KFCA 4XEHA 5T4EA 3JW8A 2P90A 4GD3Q 1W0KA 3GARA 1AB6A 4I3FA 3PXBA 4GRDA 4HX5A 1YFLA 1J8DA 1P29A 2JGDB 4FSHA 4XASA 2YHSA 4DA8A 4BP3A 2AQKA 3OJEA 3N0VA 3RJTA 2CXXA 2LCIA 3T3GA 3ADPA 4IJ5A 1ZH8A 1QB8A 2NSDA 3F5MA 4TWIA 1ULTA 1GCGA 1WCV1 3EVBA 4O08A 4Z9AA 1ODTC 1AG9A 1A9OA 4RVOA 4IIGA 3D8SA 4WY8A 2X8WA 2WIBA 2EHJA 4JGGA 3STTA 1DO8A 1W88A 1CPYA 1WXWA 1X70A 3Q3VA 3VDQA 1A9QA 4IH1A 4X1OA 3SE7A 1F5NA 3DMDA 1SG6A 4LECA 2AUMA 3NUGA 2R11A 1SN7A 1XSEA 3WGYA 1QJCA 1U8CB 2VSOA 3QBDA 4B48A 4X66B 1QONA 3QMPA 1FYEA 2A88A 3FRJA 3EXIB 1P17A 1THZA 3AR5A 4TGLA 5B55A 2IEGA 2YQZA 4MRMB 4XSVA 4C6SA 1KRWA 2BFEA 3AKEA 1WMAA 4QO7A 2BGRA 2X0RA 4YT5A 4J9UE 1X87A 3HUDA 1SQGA 3RVBA 1GG9A 5IVDA 3RIGA 3QVSA 4BUZA 4JI2B 1WUJS 2AFRA 4XIJA 4PFSA 5IH3A 4L50A 3H83A 2G0TA 3PZBA 5T64A 3WLTA 3RADC 1JU9A 5JAPA 1F2TA 1DBQA 1GYRA 4QDJA 4HNUA 4K9PA 4QBIA 1J8MF 1R4AA 3D7MA 5MDHA 2A7QA 2PGDA 3STUA 1GXSB 3PKIA 4KQ2A 3TSAA 5KHLB 1YZGA 3ANXA 3KTOA 5DIFA 4NV1A 3ZW7A 4F3NA 3A32A 1WB6A 1TJNA 3ORSA 5DLQC 1XUOA 4PGFA 3PUVA 1ZVMA 4S12A 4PS1A 4E5UA 5A3QA 1UXIA 2Q41A 2HUPA 3KAKA 3WADA 5E6SA 3V8BA 3FAKA 4E5SA 3HLYA 4C9BA 1Z08A 1UT8A 2ZB2A 4TLMB 1DKPA 2XPCA 4NZZA 5ALRA 3OCJA 4EO7A 3Q7EA 4BQSA 3IP1A 5FUMA 1L5QA 2CFOA 2AR7A 2VDKB 1KRXA 4RZXA 3D54D 3AJ8A 1CB0A 1U3UA 2JD0A 3FROA 2SHKA 1GSIA 1JDBB 4G81A 3BE6A 1I7SB 2AC4A 1TMKA 2BFWA 2INGX 5KU1A 5DI9A 1XQXA 2GVNA 1OXVA 3NJRA 3SF0A 3FVVA 4JH0A 1ONBA 1FRFS 1E2GA 1S8FA 2OOKA 4NMLA 3EZ7A 2C8KA 4MUAA 4KX3A 5EJGA 4ND8B 2YYSA 1XVTA 4OHZA 4PIPA 1H23A 5JWOA 2GZDA 4JVSB 4BGDA 3ABIA 3K2QA 3WKDA 4CTMA 1CV2A 4UVIA 2PR2A 3NTOA 3SX2A 3OFND 3PIDA 3EG9B 3GCWA 1A4RA 1TXGA 3PGLA 2C7GA 2BDUA 3LLSA 5JH7F 4M0LA 5KNBD 1DBIA 2QENA 2NIPA 1ZA1A 3SSNA 3DOUA 2GXAA 1I32A 3NEJA 2JPDA 4Y2UA 4KIUA 2QUIA 1SD5A 5CTAA 4AF6A 3VR5A 3HR7A 3LVBA 4O8ZA 2QY9A 3HY4A 1QDUA 1G1MA 1UPBA 3U3KA 4LF8B 1C0LA 4I3GA 5CIQA 3A9WA 5IK2D 4RF5A 1ZESA 3GJ5A 4FMCB 4Z4IA 1JHOA 4M55A 1KFBB 3MWEB 3VC1A 1TM5E 2WHXA 3PUYA 1V96A 2HBQA 1SVMA 3HYTA 5F51A 2EKDA 1P2UA 5A3JA 1U3FA 3ROFA 3PQCA 2CC2A 3OEEA 2YFKA 3EXHC 3CF4G 3MG9A 1S5PA 3CURA 4PBSA 2BC9A 3VR6H 4CKBA 4ENQA 3VYUB 4HDSA 1ZMXA 1W46A 2CB9A 3JQPA 2UDPA 3EAGA 3RSQA 5JDIA 2JEYA 1ZSYA 1YKSA 4H7FA 1E1LA 1NXWA 1GPYA 3HC7A 3MQ2A 3IJEB 1UJ4A 3KYDA 1EE9A 1LSUA 1Y3AA 2J3KA 5LDGA 3T4PA 3TOCA 5JIBA 1GITA 2Q9UA 4Q3CA 1LLDA 3OCUA 1FLNA 1K6MA 3QVJA 1EDDA 2CFSA 1T5TA 1J4AA 1Q11A 3HB1A 4UEOA 4JVMA 2HZ7A 4GEKA 1MT3A 1DIGA 3RRFA 3W7BA 3WK7A 3ZI7A 4DKXA 1LNSA 5DX1A 3ZZ0A 2FETA 2FNAA 1J70A 3DBVO 3Q8WA 4A91A 1QZXA 1VSVA 3FVTA 4L6IA 2XUHA 2XRZA 4EHDA 4F9EA 3RG8A 1SUFA 4DA7A 4K6CA 4BJ1A 2CEKA 4CLRA 4B40A 1M73E 2RC5A 3HCNA 4G0NA 1T0IA 2ZXEA 2NXEA 2IU3A 4KRGA 4F11A 5HZMA 4GE3A 5FPKA 1O9HA 2XJ9A 3IUYA 3LW8A 4FJ2A 3WMXA 1RRVA 3O92A 1Z5NA 5ILGA 4ZKEA 5DGCA 2XUQA 3DULA 5HIKA 1OLXB 3BHIA 3FMGA 2G77B 2H5IA 4Y2XA 1NNI1 4Q7JB 1NQVA 1WOYA 4RC9A 4Y2JA 4YMTA 3X2EA 1O4VA 3GJRA 1DXOA 4Q24A 4UNSA 4IOKA 4XQCA 3TAHA 3AEUB 3SXUA 2AFHA 1V1RA 3H16A 2WTUA 3ROQA 1KL7A 4RFSB 3KQUA 4PBTA 1WXFA 2OCIA 3F7MA 1QV9A 3U4IA 1RYDA 2HK8A 3HABA 1IBMB 4BV3A 1V8FA 3ZNNA 4CJXA 3K1JA 1AKYA 1VB5A 2ZJ1A 3HWX1 1RLMA 1QU2A 2QB5A 3JSAA 4EW2A 2W90A 1GUAA 3IJPA 3FBWA 1KETA 4N6OA 4BQQA 4HTFB 2HHAA 4UTRA 2OG1A 3FB4A 3A6HA 3AOEC 3X44A 2L18A 3WDLA 3FNGA 4K81B 3G8DA 4O5AA 3JQGB 1R5BA 4R2KA 4JYCA 3OM1A 2Z08A 4M49A 3TZHA 2JASA 2PUWA 3K0FA 5CCBA 3DDWA 4JJEA 5I7SA 5ELMA 1PJTA 2PMBA 4U7TB 2CXNA 3T3IA 4MS3B 1H93A 3E0QA 2FB9A 4KDCA 1SUBA 1X7WB 1PUIA 4FR2A 1STOA 2YY5A 4CUJA 3K7EA 4R1TA 1DDOA 5B58T 3MRTA 4D8VA 3K9NA 4DB2A 1N33B 1LVGA 2G83A 1XVLA 2V5VA 2Z4SA 4PLZA 4Q5IA 2C7PA 1A7JA 2GEJA 3QGMA 4FU0A 2HDNB 3BJIC 3Q98A 4LZPA 4NF2A 2CL7X 5JOQA 4BYMA 3B7WA 4Q34A 2RFLA 4LK2A 1XA3A 2CE7A 1L0BA 3LGXA 1SU6A 3GJYA 4WHMA 3SBXA 5K2OA 1LBEA 1Y6QA 2C0QA 1BRTA 4BKQA 3FCSB 3QE9Y 4LCBA 2BKLA 3DR5A 3E1KA 2YDXA 2J3HA 1KVTA 4YRGA 1ZXXA 2X5XA 1P4JA 1O95C 4M54A 1FXWF 2C8JA 3DMFA 4BNMA 5FDFA 4X95A 2DQKA 3HH8A 2RGGA 4DZTA 2Q8NA 2N42A 4F3CA 3RRBA 3QFRA 1TJ3A 3QBTA 2O0MA 4CF3A 2IFTA 1TZJA 1DC8A 3N2YA 2FN3A 1H6DA 4Y3UA 3WNQA 3WGIA 3RSZA 3JRWA 5LUBA 2IX3A 4KPEC 1U02A 1K8QA 5SYAA 1VJ1A 2CZCA 2R6CA 1SQFA 3C4JA 3V2GA 2JJMA 4C4PA 1Z0DA 1V4NA 3IVXA 3X3HA 3DV2A 1GTMA 2J9ZB 3QV2A 2ZWVA 1XZLA 2Y0PA 4NPAA 4P6VF 4DYHA 4R8SA 2H63A 4YYEA 5HJ7A 2QBYB 3PXDA 421PA 3P71T 1NLFA 1V5GA 2WJIA 4NZ9A 4D79A 4RVSA 2JZOA 1WPQA 3EGWA 1OLSA 1FRVA 4Q19A 1JX6A 2FMFA 3C7KA 3N0WA 3OQ1A 4JEIA 3A9VA 4DIFA 1C1XA 1NDHA 2AGVA 4LFCB 5K8JB 4A36A 4LE0A 5CNKA 4UQLA 1JYEA 4RK5A 5AP9A 3MOIA 4Q3EA 5IDXA 4CHTA 2CNKA 1PX2A 3ZGLA 5ED4A 1PI3A 2OCPA 1VPDA 4J3JA 3CT4A 2IYNA 5KEIA 3CEHA 5J2TA 4ZVRA 1HNZB 3CR8A 4KC0A 5AVUA 2NQTA 3W8DA 4BWVA 3D59A 2WTNA 5ANRB 1MOSA 2VUUA 1LQUA 2CZQA 3BK1A 3GJ8A 3HG7A 4NH0A 4RA9A 5CIWA 4LSWA 2BKXA 1T35A 4UMVA 4YP7A 1W25A 3CA8A 3NO4A 3NV7A 3U80A 1M2HA 3C7TA 1JIXA 3KZXA 3LCCA 5FOTA 3TLYA 1BFDA 4PAQA 5DNVA 3QUCA 1JTEA 2W70A 2Q7OE 4U9HS 3IQEA 2VPPA 1AQNA 3LC1O 2PX4A 4MLPA 3V9PA 4LMBA 2W2PA 4JLSA 5HF5A 3UY4A 1N4DA 1GNTA 3FVQA 4NYMR 3GD5A 3H9EO 2JIDA 4S1PA 1A96A 2AMVA 2WU4A 5EXTA 5K4GA 1SNYA 1YI8A 4LKOA 1Y3DE 2VNAA 1KP2A 2VDRB 3D7NA 1XDSA 1GKKA 1KEEB 1XEXB 3UMSA 4G24A 3MNFA 4RWEA 4QVIA 2PXCA 2VRCA 5DISB 1TIKA 2L2QA 4IGAA 2QPAA 2C5HA 5B3LA 1HQCA 4BQEA 2HRCA 4N5IX 3HCEA 1I3LA 2R7MA 2WIGA 3L77A 2HPVA 4YCSA 2GHQA 4UBIA 1VLVA 3A6LA 3B6ZA 5HM8A 2X2FA 4AG5A 3IJ5A 3U44A 3AHGA 1TUBB 3EQ8A 3N70A 1GEEA 3EDOA 4UE2A 5JH7B 5GWXA 4WN9A 3VU0A 5CA0A 5JRJA 3QOXA 1SCIA 2B3TA 1Z2NX 4W4TA 5EHXA 2IOFK 3QLJA 4DWVA 3D3EA 1B6RA 5SZHB 2JI6A 4EM6A 3D1JA 1RABA 1G8HA 4OHXA 3TEFA 4NYIQ 4UMDA 3W6PA 2RAPA 3JQDA 3WLKX 5ALNA 4YT8A 2C9YA 4QPZA 1UL1X 4GMFA 2B78A 3RIMA 3RYCA 3PPXA 4BGIA 3AV3A 3ZGYA 5CNMA 5JI3E 1C1DB 3KKOA 3TK1A 3UMCA 3UW1A 3IIKA 1WXDA 2WIKA 3A14A 3CX6A 1GT6A 4DUGD 4MDFA 3STWA 2W4IA 2HRQA 4YNBA 2XUOA 5HG0A 3U0BA 1JH8A 1R00A 4YUXA 4J1TA 1JA0A 3EH1A 3VH1A 1T4DA 1FK8A 4L5IA 3ZE8A 1JJFA 5E7QA 4BKOA 5BWMA 2R6FA 2G70A 4DR3B 1IJFA 2H59A 2QNBA 5KTMA 1GWNA 2FN8A 2OO5A 3EUWA 1GQQA 1TK9A 2IXDA 3BJZA 3NT4A 3O74A 1Z62A 1LU9A 4K8OA 4ZAZA 1E7RA 2XIJA 1T3ZA 3EPJA 1YB4A 1UJNA 1SBTA 1YI0A 2E4XA 2GBCA 1QKJA 2JGDA 4BO4A 2CJPA 4JI6B 1W0JD 3DDZX 4G23A 3W5IA 4POOA 4XUGB 3UJBA 1H3FA 1QOPB 4P3OA 1KQ3A 3V4SA 3IHKA 5D01A 3TTVA 1EIZA 5ENDA 2W71A 5JDIC 1ESNA 2PZ8A 2QG4A 4N18A 5KX5A 3PDIB 4A2QA 1ABFA 4FOSA 2NSYA 1FNBA 1YJ5A 2JVJA 3BFVA 3DJYA 1I0IA 3Q8XB 1UEXC 4JR2A 4MUIA 4R3WA 5FYQA 1U0BB 2PUFA 3RSSA 1V6CA 1VJCA 2JFWA 3P97A 3H3FA 1MXHA 1R5OA 2OKCA 4KH1A 3ZUPA 4XYLA 1I6LA 1ADCA 3N2NA 2M98A 3HCBA 3LPDA 4MO2A 3SBOA 5LSAA 5H7XA 2QL5A 1J0DA 1L5LA 2Q3LA 2B4AA 3RWMB 5JNTA 4W5RA 3EXIA 4DLUA 1M8JA 1Y82A 2DKNA 3B1FA 4HYEA 3MD0A 1YQWA 4DLXA 3VOAA 2O54A 4JL8A 4KGXA 3ZCPA 4YJFA 3WL4A 1I5OA 4Q00A 5AOBA 1JA9A 3R5JA 2JI8A 3FPSA 1V43A 5ED0A 3ER8A 4IMRA 4LXGA 3T9EA 4MQLA 3EIUA 1HV8A 4JJIA 5D7NA 3UQYS 1TM3E 2PKWA 2XCUA 2IPNA 2GA9A 3CCFA 3K4QA 1NUUA 3IAXA 4LQLA 4BX0A 4JL6A 1JWBB 2JAOA 1YASA 2PT5A 3EUFA 1I4TD 1NC3A 4L5CA 4N5HX 2PMDA 4F6RA 1CY1A 3AVYA 2P68A 9MHTA 2TSYB 1QX4A 3WA6A 3PIRA 4G86A 3DEIA 4HAVA 1PR1A 2BELA 1B1AA 1EG2A 4M21A 2HJVA 4MJ3A 4X7PA 3PQ3A 1TCVA 4AP6A 5JT1A 3IIJA 1JIKA 2HJSA 4TTVA 3D2BA 1ZD5A 3I9V6 1Z22A 3B12A 3KAPA 5CH8A 2H17A 5J5CA 4EUSA 2PUCA 3N1UA 5CLLA 2UXCB 1OH5A 4FR0A 1G6KA 4ZTBA 1VBMA 2QN3A 4RY8A 4GW3A 2A3NA 4MKGA 1JDPA 1M8FA 4BFTA 3MWDB 3GQBB 3V5NA 2PGAA 1DB3A 1GTJ1 1A88A 1TM2A 4KOAA 4PC2A 2YHIA 5KTSA 4JHXA 3SYMA 3WGTA 4F9TA 2WFLB 4QTUB 1VM6A 3T54A 4YDSA 2Y1KA 2AX3A 4FS3A 4YDQA 1TAGA 4QBHA 1RFGE 1RQ2A 1Z9BA 2WM2A 2ZWMA 3OF2A 5A3SA 2CLOB 1B3RA 2AEJA 4I1OA 3WTCA 5DYWA 1HETA 4ND8A 2CDBA 1BMFA 2C03A 5SY9A 1WULS 1VJGA 2PGNA 3M6VA 4MUNA 1M34E 2JLXA 1GQ2A 4CN9A 1Q0ZA 2RHWA 4K3UA 1ZMBA 4HQ6A 1DJPA 4RKQA 4AMZA 3KKLA 5AHXA 4AO7A 4IKOA 2C3YA 3INTA 3O3OB 3EG9A 4PHFA 1G60A 2J0EA 1A5ZA 1W4ZA 2YWCA 1AQUA 1XU4A 1EWRA 3WKCA 1JA1A 3KZKA 3OLVA 3UAOA 1XYGA 3ZGNA 3DL7A 1FFWA 2G04A 3IE1A 4Y2QA 2AKYA 4G09A 3O1JC 1PR5A 4JQZA 5AM1A 1PU2A 2QE7A 4L6CA 5DX0A 1BG6A 1IHXA 1U2TA 2W2QA 2SKCA 3I6ZA 3MWEA 4V3BA 3ZY4A 4LV8B 4QJ4A 2DUUA 2FCAA 2G25A 2WWFA 1U2PA 1ZRHA 1ECFA 2NTYC 1XX6A 3AUFA 1NJ5A 1IUPA 4DN6A 4YYZA 1CUIA 3BE8A 4AF8A 4OAPA 9ATCA 3IOYA 3BVPA 5F2KA 2YN2A 2DPYA 2ZBQA 3IEIA 1NNSA 3SR4A 1KZ9A 2NZJA 4C07A 4U7JA 3IDQA 3Q2KA 1T26A 5K2MA 5I6DA 1RKUA 1RQNA 2WUDA 3BORA 4DANA 2JGIA 4CV0A 5DO9A 3OT1B 3MZ0A 2A33A 3DXZA 4NCAA 2XRYA 2YVAA 2J4FA 4KZPA 3ZGXA 5BXQC 1FSGA 1NFQA 3JZAA 4O4JF 1RJDA 1VKHA 4Z54A 4BBPA 2GPWA 2ZITA 3EOBI 2NT3A 3ETGA 2DWPA 1SURA 2Q2VA 1MH9A 2Y0BA 1K68A 2ONCA 2V96A 3KK0A 3KNZA 4H3HB 5AJZA 5DCLA 2WSIA 3NFYA 4UZEA 2CV1A 2H4ZA 2HF9A 2RG7A 2NT4A 3GRKA 4Z7QB 1NBOA 1YUNA 1YU6A 1EA7A 1SPBS 3RTEA 3UHJA 3RRXA 1I30A 1V8ZA 3FNHA 1Q7EA 1ZK3A 4KIWA 5AFSA 1S2DA 1YL5A 2YICA 3VNSA 4DKJA 4BDSA 4Q7QA 1U0NA 2EV9A 2VDQB 4L3VA 5DK4A 3RQIA 1A4UA 3U1TA 2WG2A 3K6SB 3K4HA 4N6NA 5DB4A 3ZZ1A 4BNFA 3THWB 1QRSA 5F5NA 1ISHA 4RPGA 4LXIA 3BWVA 4LYFA 4WFIA 4E09A 2ZW9A 3QKSB 4ETWA 4BRWA 2NO6A 1W5EA 3EXEB 5CH3A 3ZWBA 5FX2A 1VE7A 1BE6A 2IHKA 4JIGA 5EZSA 5CYFA 4I6EA 3B5JA 4YRLA 4BNDB 3H97A 4PG8A 1AUVA 2X40A 1AGRA 4MUXA 5BYKA 1P3JA 2OD7A 5C8YF 5JZVA 1KNXA 4DCUA 3O26A 1RLOA 4TV8F 4PW0A 4FMPA 4ARAA 1UM9B 3CVJA 4UHBA 5THKA 4FOPA 4GXQA 2WT4A 1SQ5A 4MKFA 1ZWLA 4EARA 4YT4A 1V2GA 2ILVA 1NYQA 4W5HA 2WWHA 2YJ5A 3AKYA 2Z5GA 3PHIA 3KPUA 1JMKC 1MB9A 1P1JA 1JP7A 2DBZA 4HY3A 3I6BA 4MEJA 1IBSA 1CW2B 1ZI8A 4U2KA 4ZDWA 4AG6A 5KREA 1JH9A 1RRMA 1WO8A 4XFKA 4C4TA 4OU5A 2QZJA 1F0YA 2HA3A 4MS3A 2WMDA 4H6PA 4MVCA 4LRQA 1YFZA 4IQ4A 5CM8B 2YN0A 2XUKA 4BX8A 4TZ0A 4KSBA 1X7WA 4FMBB 2I7XA 2EP7A 4OA8A 4HDQB 4XDHA 2BGUA 2QRGA 2XKJE 3CNNA 5DJ5A 4DTIA 4B71A 4NCBA 4TKUB 2Q0HA 5C7OO 3FFWA 1O6ZA 4CT5A 3NHLA 4A03A 3TZEA 4P34A 2APJA 3KLOA 3L1UA 3Q7SA 5C0OE 4RZ3A 4B3IA 4AVYA 4HNGA 4KAXA 1J06A 4MUKA 5HOEA 4W6QA 3E4CA 1U11A 4P93A 2FN9A 4KXFB 1POWA 1V3TA 4HDCA 7REQB 1AS0A 2D00A 3UMRA 4ER6A 2AYZA 3IERA 1I3KA 3GLHB 3PUHA 4X90A 2IH4A 1PEAA 3BSWA 3KB1A 3LBYA 1PV1A 4H31A 3HCOA 1NSFA 4J1TC 3MCWA 4PC7A 5MN5A 1T3LA 1UOPA 3HACA 3MTIA 4C0AC 2WIAA 2OUKA 2ZTVA 3IEKA 1MUUA 3OECA 4P3XA 1R3UA 2BBSA 1ADFA 2O2ZA 1SUPA 1Z4MA 3CH4B 4HWKA 4JWTA 1XL1A 3HJAA 4HPWA 3DHEA 5HZGA 2WAAA 4D9MA 3TRDA 2JLUA 1EWQA 4PZ9A 4TWRA 5H9VA 1HLFA 4R81A 4KREA 1Z29A 4GKBA 2UUOA 2KS6A 2JKZA 2OGWA 2AOUB 3TBKA 3E58A 3E9MA 4N9WA 5EE1A 5AQEA 1JHZA 2JCGA 2PMKA 3M5CA 4A8PA 2QBYA 1JAXA 2GDJA 2ZJ6A 4F97A 3PSHA 3WL8A 1E2PA 1V41E 2Q5IA 1QHYA 2A1UB 3ESAA 2ODEA 4QHTA 3SEFA 1OA0A 1BH2A 4OXRA 5CURA 3WLPA 4ARVA 3QVVA 1XHFA 3VJRA 4L8GA 2YJ4A 4LBWA 2H57A 2Q9CA 2AUTA 3KPJA 2Q2OA 3OZWA 3PQ7A 1HOTA 3I9JA 2C8VA 2DG2A 3WLHA 3DAPA 4X1YA 1QMGA 3A06A 4GX0A 1QNFA 4PWZA 2Z58A 1DIAA 3U48A 4HSEA 3ONDA 3U4QB 4DBVO 1Z33A 4OGKA 1IVNA 3V1TC 1JT2A 3DMHA 3AP2A 1S2OA 3FZNA 4F56A 3CLKA 2XMQA 4IS2A 1NF3A 1QIEA 2DBRA 3ZHRA 3NGXA 3PCRB 4U6SA 5ER9A 3HB9A 4ZPJA 4DIMA 1SKYE 3FPGA 4MWSA 1KIMA 2XCOA 3G6KA 1CQZA 1MAHA 2Q6VA 4IZOA 2WG0A 2F9MA 4Z1MD 2PWYA 3AY6A 4TWJA 3GJ7A 1WDKA 1ZM3A 2QTRA 1T29A 2RGEA 3O4HA 4UKDA 3DVSX 5K20A 1GLNA 1XXHE 3JQAA 3ZVMA 3H2ZA 3K96A 3VUFA 5B6PA 5FUYA 1NBMD 3KPWA 2O59A 5FULA 3IUSA 3QJYA 4UQOA 3OZAA 3EZYA 2LVBA 3HBJA 2FDRA 3OZEA 3ZLTA 3CPJB 3IQFA 3MILA 1JAIA 2XF2A 2VRBA 5IBPA 1XPOA 1QFJA 3F1KA 1CUGA 4TV9F 4OHKA 3JQFA 1TJ4A 2O2SA 4M6WB 2P9ZA 1KEEA 5U4QA 3BD9A 3NDRA 4P36A 4RQAA 1II0A 1T6BY 1T0HB 1O97D 5C5DA 2IYLD 3DDNA 1FU4A 3H2IA 3AH8A 2A2ZA 4QARA 3WWZA 4XJVA 1CBUA 4BL5A 3IQDB 4ES6A 2CHEA 1IN4A 1GJRA 5IJAA 3TTUA 2DM6A 3PD1A 1CEQA 1G7SA 1JPUA 1MRSA 1M2VB 1NT2A 1JDBC 4QOJA 5FR2A 4HN2A 1TUBA 3TQFA 1KU6A 3GDHA 1TIPA 5JH7A 1ZP6A 2V03A 1UXKA 4P9NA 1R6TA 1FPQA 3LRTA 1N3LA 1QJ4A 4H60A 5AKEA 3IP5A 1E20A 1QQ7A 2Z6VA 1DEXA 3JWJA 2JIZD 2J9YB 2HMWA 1J5EB 1N2XA 1Z0KA 3F3KA 4MQ6A 4F93B 2R1ZA 4D92A 3C24A 1C2YA 3F9IA 3I3OA 3W05A 4XZ3A 4ZCQA 1C1DA 4TX1A 2BGJA 3C8MA 1LSSA 1MG5A 4L5BA 3FIUA 1OLUB 1DC5A 2EKBA 5KAPA 2BJWA 4B0PA 1NPTO 1NVKA 3PYMA 4G8CA 2XITA 4DIUA 2XB8A 2C59A 4FGKA 3SIWA 5AW4A 1ZNQO 3VNRA 3TSOA 3FPFA 1Q0PA 2O2HA 4JB2A 4OFWA 3CVOA 1YJCA 4HNTA 5KNLA 1EFCA 4IF6A 1Y7LA 1J6UA 1IQUA 3FPLA 3WX0A 5BUQA 2ZUFA 3OJCA 1JVBA 1ZICA 1F0KA 2O05A 3EVCA 1L7MA 2PK3A 4HDAA 1W49A 2BT4A 2RGYA 3I9KA 4X5OA 1TVEA 1JSCA 1M1ZA 2ZULA 1NLZA 2M9MA 2V8BA 2P79A 3B3JA 3S1AB 4N9QA 4JVNA 3FG9A 4DYVA 3JPYA 2VKTA 4O4JB 2R7LA 4IHKA 4IJVA 4IV8A 1G6OA 3RK0A 4IJKA 2XT9A 1UUFA 4MIOA 4AMUA 3HM9A 2OZVA 4URZR 3M3PA 1YMUA 2ZJ0A 4LZOA 3A1WA 2X0EA 1L7VC 1UPCA 4DLSA 2V59A 1R8XA 1JI0A 3WLEA 3T5GA 3ZQ6A 1Y9AA 2H4WA 3FNQA 3OMXA 2XEDA 1YR9A 5BW6B 2A1TR 2WJHA 3SC2B 4HQRA 4AQ7A 1JEYA 1NVWQ 1DBVO 1R8QA 2FJPA 1HE5A 3BWCA 4PG4A 1HPLA 1LF5A 4C2BA 2VP2A 3M33A 1NMXA 3OQNA 1HK7A 2C1EA 3ZJUA 5C8DA 4LJ9A 4Z8YA 4YEDA 4F96A 3GFBA 3WOVA 2FW7A 3RSLA 1KA9H 1VG1A 1VBFA 4D0SA 2J09A 4XJTA 1XROA 4JCOA 2J0QA 2ZUVA 4OUDB 5BW4A 1I3CA 5C8YB 4RDXA 1GQRA 4TV8B 3NHFA 5C51B 2I1VB 5JS6A 3E22B 3H5WA 3HQ4O 3Q5DA 4RORA 3GRCA 5ESDA 5JALA 1ILEA 4E4TA 4HGRA 3DT6A 3O8LA 4DXDA 1DDIA 1WMEA 2AKAB 3FYUB 1AXRA 5FLYA 1SKAA 4CQJA 1BE8A 4V0ME 2VSFA 4EL0A 2XDQB 4TMKA 3R3JA 3UH0A 2EAUA 1VA5A 2P5TB 2WILA 4YP0A 2H1FA 3UB3A 1X92A 4O4IF 4DLPA 4YXWD 4IXMA 2WYWA 2O1WA 1F9AA 1W48A 4G1VA 4A1FA 3L4JA 2ZJ4A 3E27A 3CH7A 2VCHA 5HGXA 3GP8A 1XDUA 1QFXA 2OBMA 1M67A 4BEJA 4AROA 2HEGA 2BHSA 2LDBA 3EUAA 1EAYA 3DLPX 3EZNA 4QYSA 1RJ9B 5HM6A 1KHTA 1C81A 1TQ2A 1QGYA 3OTGA 2J59A 2EJTA 1V5WA 2P2CA 3LQ1A 1WHSB 4MR9B 4A5OA 4BQRA 5LJIA 1N34B 2OD9A 1L6IA 4U8GA 1IUOA 1NUHA 3KWLA 1M7HA 3GQBA 3AFOA 2Y0CA 4P54A 3O4GA 5JO9A 4NNJA 1TB4A 1HTTA 2IL1A 2WFLA 3DUFB 1PF7E 5M3BA 4UU0A 3U49A 5JJKA 1FXWA 3AM3A 1ZNZA 4LQDA 1G3MA 3OIDA 3IPYA 1NUSA 2R85A 3BH7A 2Y76A 4BRZA 2WP8J 2XOEA 4JVLA 1EX6A 2NUPB 4UTZA 4X1IB 1Y1SA 2X1VA 1J0XO 2VTDA 3MPUA 4UUQA 1M66A 2BM8A 2J9GA 3E8SA 2AFIA 1L2TA 3IV9A 5E95A 3CRMA 4CR7A 2MSEB 2XZLA 2QK4A 2Y1LA 4MW0A 4YMLA 4MKZA 1TM7E 3PXAA 4Z0TA 3SSAA 1VL6A 2GJAA 3H9GA 2M6KA 2O3JA 4IDAA 4WTOA 1G9TA 2Y4OA 3L7KA 4J6EA 3F47A 1B8PA 3Q2IA 2Q4DA 1JG3A 3E4DA 2GD1O 3G9QA 3OPMA 3AL2A 3VGPA 3E18A 4Q3LA 3B9RA 2AWNA 3FMIA 2RK4A 2VBGA 2OV8A 1U7XA 1UKEA 4GXTA 3F4BA 4MPTA 4BCBA 4CG0A 4DBLE 4DEXA 2PXXA 3FPJA 1P80A 5MFZA 3PKZA 5FB3A 3Q4GA 5HE8A 2R7NA 1J22A 4H7IA 4CM8B 1P5RA 3C3DA 4ZAVA 3ZZTA 4PTYA 2IGBA 4EX6A 4GLFA 1LPNA 4HK4A 4S1NA 2VJAA 1DTWA 2ZUTA 3N2IA 4M9CA 1YBAA 2HBRA 2IU4A 2FA9A 1AGYA 4F84A 3LGAA 3UGKA 3R23A 3HB0A 4BWGA 3BCRA 4F60A 2C29D 2P6PA 4YJKA 1XCGB 1LLQA 4BTEA 1UK6A 4N48A 4MGZR 4LFAB 2GETA 3H9CA 3H1FA 1QQ6A 1RBZA 3KTFA 3WNZA 1OWLA 3KQHA 2WABA 2VH1A 2ECKA 3OT1A 1CR0A 4XVRA 2QHXA 3H4VA 1SOMA 1WW3A 4JBIA 4S2UA 2ZYGA 3AONB 3THOA 1KTIA 5LQUA 3DVAB 2YTZA 1GFZA 4LAFA 1G8MA 2DBVO 4RPKA 2OORA 3G8AA 3KQTA 1WVMA 1BMQA 3KT6A 3GVHA 3OPXA 1O2DA 4ID3A 2AVNA 4HAIA 4OY3A 1WPRA 4ABTA 1UR5A 2XD9A 3ROTA 3W8NA 5AT1A 3ZLUA 2XT6A 4IKEA 1ARZA 4MICA 1WXHA 3L7DA 4V0NA 1GCIA 2PCLA 3CKKA 3Q2OA 1XU7A 2OXRA 5LYJF 4ZT4A 3VSBA 4DRYA 1H4TA 1KZ7B 4TKVB 4TV9B 4BNYA 3THWA 3ODPA 3O8RA 3DEAA 3COZA 2A5LA 4FNGA 4NWIA 3WGQA 2IH2A 5FTMA 2RHDA 3QKSA 1C3JA 1YD7A 5THXA 1Y1LA 3EXEA 1P62B 3C6BA 4QXAA 2OXIA 1WCYA 1OA1A 2IOFA 3IIIA 3L1IA 3PDCA 2V7QA 2JLQA 3KDAA 3L0YA 3PWTA 2XMSA 3P5SA 5CG2A 4PLYA 2AJBA 4WOBA 3UXHA 3IR6A 2P11A 1QYDA 2Q4TA 4DLBA 1PJLA 4ZEXA 4TTAA 4J03A 5EWJB 1KIAA 1UM9A 2H7YA 3HPRA 4N5NA 2DR0A 3PVZA 5JJBA 2YZ7A 3JQFC 1T5LA 2FMUA 3D4IA 2PXHA 3Q9NA 2DB3A 2HTEA 3IAAA 1ZNXA 3I9OA 1TJPB 4YRCA 3TR0A 4HN9A 4GI3A 2Q4BA 1Q1ZA 4Y9UA 5IM4F 1UC8A 2KMLA 4GQBA 1SB8A 3P4XA 2C88A 4DBZA 3R8XA 4CKEB 4D3XA 4YCNA 4DMMA 1E59A 3REQB 1ICEA 3R8CA 2EJVA 3T1HB 1DKRA 3V9AA 3IOMA 5A3VA 1R8YA 3E9QA 1C7EA 3ILYA 3SY8A 4JN6B 3TD6A 5JSQA 5KOIA 3ZCXA 2WB4A 4HS9A 2PJUA 2P2ZA 5H82A 1I7PA 4BHTA 2UU9B 1G5QA 4V0RA 3FWKA 3ZWXA 3I05A 4BBZA 3HYLA 4ZQEA 4JX8A 2O0JA 4D25A 4RNDB 4ZZIA 5I4IA 2NNWB 4H4CA 4K2HA 5CT5A 4HZIA 4D1YA 3V4ZA 3QPAA 1OX5A 2YFHA 2EOAA 1JFRA 5BPHA 3TLKA 3FCOA 1QF7A 5AXAA 1IN5A 1FXSA 5B1HA 2IYZA 1MZPA 4E5MA 1E3MA 7REQA 1Q50A 2CEAA 3FDIA 3SJAA 1LX6A 2BHRA 2GXQA 2I54A 4J7CA 1BJKA 1GV1A 2OFPA 3GLHA 4HNVA 3D4NA 1E7WA 1E4EB 4RKWA 3W1EA 4EP1A 5E0OA 3NYQA 3R9WA 1GU0A 1T10A 3CN7A 3JQEA 1EXVA 4R7TA 3JWEA 2J4DA 2P9TA 2JVKA 1CZRA 3URMA 4CV1A 1Z6GA 5EIEA 2AN3A 3WGNA 3TYXA 2KSQA 3ZDZB 5JD5A 3LY9A 1WXIA 4UUBA 2QTMA 5EUBA 1FP6A 1PJ8A 3AVWA 4BAZA 4WOPA 3GVXA 2JHFA 1U0GA 4IIDA 4U02A 5E7JA 4JYBA 1VHQA 3UCEA 1ESMA 1XD8A 2AOUA 3N8HA 4NECA 1LD3A 2P78A 3VQTA 3WXBA 4Q66C 1BHSA 1N6IA 5JAQA 3V97A 3BFKA 5JW6A 3O2QB 4QICA 5IAKA 1A5AB 2HMSA 2VHXA 3DE5X 4QE3A 6ABPA 5JARA 3ETDA 5DK6A 4FZRA 2VHUA 2XA9A 4A1OA 2XQFA 3ZDXB 1TW3A 2NTJA 721PA 1KO7A 2ZZKA 2XEXA 1QV7A 4QD3A 1L1EA 2JI7A 1RVDA 1US8B 1DSSG 1KZGB 1IEWA 2C94A 2QJOA 2HZBA 1VP9A 2VHJA 3RVMA 3WWYA 4BIMA 3U4QA 2PUGA 1TQDA 2R6JA 3AFHA 4C01A 3RR2A 3STHA 5FUWA 4CIWA 5DEIA 2HNAA 1JWAB 4EYOA 4MW5A 4C43A 4A26A 2OM6A 5C5EA 5COBA 1LTKA 4D0NA 1OTXA 1KAOA 4WGFA 4AUKA 3K1YA 1N2GA 1XYYA 4I8XA 3MTEA 2JGMA 1T43A 1KHHA 4RL6A 5K0EA 2R1TB 3OP1A 4AY3A 4C20A 2IDZA 3QENA 3SZRA 2OMKA 2ZYUX 3W3AH 1U6KA 2IUSA 5CM2Z 1O7JA 3E3OA 3QOWA 4DLYA 1NLMA 3H6GA 3ECSA 4TPKA 3JQBA 2JVIA 3MMNA 4J0DA 4WEQA 5FFNA 2REQB 4K0KB 3R0JA 4GR5A 4JB3A 1JHRA 4MRSA 1L8AA 3I72A 1NVAA 2DKFA 2O07A 4F9GA 2X86A 2OAP1 2Z4TA 3H84A 5FNVA 3OOWA 4J29A 2OBLA 1LQTA 2QM3A 4WDQA 4WXRA 3ZVKA 1ZYUA 1EZZA 2X5KO 3L4BA 1AT1A 3LBNA 4DABA 1WW8A 5AK5A 1RC8A 2A5JA 2I3DA 3G5AA 1U8UA 4B85A 2IEDA 5LDHA 4TMVA 1D4AA 5LR6A 3N3BC 1NURA 4BVFA 3VI4B 3QXJA 5K4AA 1AZWA 2CBXA 2NU9B 4BMDA 1KKMA 3JR3A 1JECA 2IYVA 1M2VA 1D2AA 3HUUA 1CRPA 3C3KA 1KO8A 4O25A 2YR0A 1QANA 4L5AA 5CVCA 4ZU6X 2PRSA 2OHGA 5HBRA 4ALJA 4UXJA 3LBHA 5LNK1 3LDUA 5TF4A 1R5JA 4MK4A 5AI6A 1TA9A 1HY3A 2ZR0A 2YZ2A 1JFFB 4L0CA 1YO6A 4Y9TA 4O33A 4JSRA 2DYKA 3IBGA 4Y2PA 3NAZA 1AS2A 1Q0UA 3BA1A 4UUAA 5E2BA 4BECA 4F6LA 3WICA 3URKA 2Q3BA 1VFPA 1FP4A 1JG6A 5IW8A 3I1IA 2PSDA 1OLUA 1U1CA 4PVCA 4F3TA 1P9WA 4H77A 1CJUC 5BYAA 5L6LB 1YBHA 1JKFA 4EW6A 3AHCA 1HT0A 1JHAA 2BTQB 3P9IA 2VQEB 5MHTA 2OENG 3B2QA 5IZCA 1JBEA 1XCJA 3DEZA 2DR2A 1GGEA 4MW7A 1AF7A 2PH1A 4CVNA 4J94A 3H3XA 4CL2A 3IKTA 2V6JA 3R6LA 2W2KA 4KFSA 1L5NA 2PS0A 3U2QA 1SK8A 5LXTF 3HE3A 4G8BA 1DO2A 4UUMA 1OAOA 1VLLA 2PBZA 1E2NA 3T6KA 4AULA 2IELA 3D6AA 4B6FA 3S1AA 2R2GA 3EBOA 3LHFA 4DM4A 1G4UR 3F5DA 5FWAA 1SIUA 4O4JA 4WD3A 5BSMA 3G5UA 8ATCA 1JIVA 3WJ2A 4IRXA 5CPFA 3E84A 4RVUA 1KZHA 2CUKA 1IL0A 3IT0A 3TKLA 2XMBA 2ZBUA 3LE8A 2PKEA 3UYKA 5EZYB 3WYEA 1ECCA 1R0LA 1L5ZA 3MLAA 3ZBPA 3ZLVA 1F20A 1Y5RA 3BKXA 4Y2TA 2XKBA 3VC2A 1QYXA 4NY1A 2FUG6 2YVUA 2V45A 4GKAA 1TZMA 5I01A 3EPHA 1TZBA 2VSYA 3QKRA 4WZAE 4D41A 3SFZA 4EJ2A 5E38A 5LMUB 2JHPA 2GYVA 2QIPA 3FZGA 5K1ZA 1Y80A 5LYJB 1W2GA 5KYXB 3EMVA 4RTOA 1MW8X 4BO5A 3TH5A 5C1DA 1BKYA 4DLNA 3Q40A 3OY2A 4EVIA 1CERA 4K88A 2CFRA 2IV3A 2FPGB 2OORC 1C0KA 1VLMA 2HJGA 4EGCB 1RRCA 1J2TA 1ZHFA 5FORA 4BEVA 3UJAA 1FZTA 4K0RA 4TXJA 4N54A 1R4NB 2PH3A 2O4CA 3A4TA 1UDXA 1WP9A 1DV1A 2XVMA 4HGQA 5F1PA 3QEOA 1L5OA 1EFHA 3CEMA 3H9QA 4QSHA 3U7GA 4JJZA 1K8YB 3O6VA 4OUDA 5GINE 1I5EA 1QAMA 2Q1SA 4FHDA 1ZAYA 4TV8A 5L3RA 3E22A 3CX7A 3KWFA 4KWEA 1V11B 2CVFA 1BHQ1 1VL0A 2VF5X 4M9QA 4QRDA 3A8TA 3FYUA 2W43A 3NC0C 4UNRA 3AR9A 4PXYA 3ESBA 1G5RA 5BQFA 9LDBA 2XDQA 5JC8A 3D0OA 3LNCA 2HO4A 2BFOA 3SHQA 5DDIP 3C8UA 2GM4A 3RLIA 1BWPA 1F4PA 5ENVA 3O4JA 4CHGA 2W2OA 1II9A 1EFPB 1JU4A 3SX4A 3HXTA 4ENUA 3C7AA 1NVXQ 2QAJA 1IQRA 3ZU3A 4D42A 4XAQA 4DT1B 2B1JA 1C2TA 1XZFA 5DU2A 1DIRA 1VHWA 4LW8A 4RVHA 1PWHA 2AG8A 2Y77A 5BNTA 2OAQ1 4AO8A 2AFVA 5HRUA 3JD4A 1RJ9A 2WPDD 4GZ6A 2P6RA 1QLHA 1TTHA 3K9LA 4P7KA 2I4NA 2QD1A 1WHSA 1E1RD 2KBFA 2QQFA 3JVIA 3QFCA 4MR9A 5DHSA 2VAVA 5EQJB 5NULA 5KDOA 1J09A 4RULA 2JANA 2PV0A 3IQXA 3DNMA 1ID8A 2WD9A 2QN8A 4KQEA 1CR4A 1QQBA 1YS2X 4JL5A 4MW9A 5CIYA 3D4LA 3DUFA 3MHTA 4KXYA 8ABPA 1U65A 3QQPA 1J9GA 4QQRA 4GDFA 2O8DA 3HB7A 1HFKA 1P0QA 2B7LA 3N87A 2GLUA 3AMVA 4UHCA 5FUVA 3ZY6A 4CF5A 5EJAA 3TLEA 3WAKA 3DV9A 4ZD6A 5C8ZA 1TQ4A 2FW0A 1Y8RB 2NUPA 3PEUA 4DJEC 5B7QA 3W8EA 2BW0A 3NM5A 2OBNA 4IVNA 3PT5A 3O95A 4XIGS 5EUCA 1B74A 3LXMA 1BA2A 1XPRA 1MPTA 2HHJA 2OA0A 4MA5A 1P31A 5G1NA 1E7QA 4RQUA 1HL3A 4XPIB 2C99A 2VG8A 3QSYA 3I2IA 4B3SB 4L9WA 5JMOA 1Q83A 2VF8A 5BR1A 2EZ4A 3COSA 4GWKA 5KPDA 3UAGA 2P9BA 2OPHA 5H16A 1GPBA 3NHAA 3GJ3A 2FPMA 3GJZA 4YCDA 1BVRA 1X1QA 1A1SA 2W37A 3S27A 1Q57A 4WASA 4JOBA 2GN8A 4FT4A 5K8LA 5JAMA 1VJDA 2W6JD 4CM8A 1KNQA 4DIBA 4LX8A 4EHHA 5CW2A 1BHJA 3P9PA 3FI0A 4GI2A 4UDXX 1A4IA 3DA8A 2I4LA 4QQFA 4X41A 5G3ZA 3PUWA 4YONB 2I3AA 4PCAA 1I6MA 2IYPA 4I9FA 5DGHA 2FVXA 1V95A 4ZK2A 4KR3A 2P1RA 3TVYA 5ERYA 1A3CA 3ADKA 1QE3A 5K3AA 4NCNA 2IHNA 4HEA1 4HG2A 1FS5A 5FPQA 3HU1A 3GEEA 2IY7A 4MRAA 3Q1KA 4A23A 2HYIC 3KT0A 4IM7A 3O93A 1MZVA 1QUFA 4IX1A 5HKLA 4CCYB 4ZHQA 3WP1B 5C5CA 3LC7O 4DJAA 3I23A 4JIMA 5JNLA 3UBTA 4WADA 3BQMB 4ARUA 4ND4A 4KR7A 2VRNA 1NZDA 2Z3VA 3EPLA 3JWPA 3U7IA 4BJ5A 2W7TA 3L7CA 3PLNA 4NCJA 1D1QA 3ZXSA 3JZIA 2OVFA 1N2EA 4EKIA 1POXA 3W7VA 4C0JA 2JA1A 2I2DA 3F7NA 2R25B 3L7LA 3PCXA 1ZQ9A 1SD2A 1NR5A 4EGAA 5AI9A 1O4WA 3CGGA 4JEHA 2OP1A 4R4JA 2QT1A 3BMQA 5BQOA 3UG6A 2WWTA 2QZSA 4PN7A 4DA4A 2C2HA 1JFSA 3UWMA 2IW3A 3O90A 3W6ZA 1DIHA 1D0IA 4KR9A 1JLSA 1JXQA 1TW2A 4TV9A 3DEKA 3EJWA 4ZT3A 4TKVA 1A0OA 1JR3D 1MU0A 1YKGA 1GYQA 1TYZA 4MA0A 2QVLA 1EP9A 1BAPA 2F00A 2IYTA 2BBOA 1C9KA 3RYHB 1NQWA 1VYVA 4ZKDA 5I9NA 5JISA 3QLTA 1GZHB 2YXEA 1SUIA 3OE4A 1DJNA 3JQBC 5D87A 4YT2A 4HNAB 2C07A 1UJ5A 4Q9AA 2D06A 4FB4A 1T4MA 5FQNA 3MT7A 5EWJA 1PR3A 2Z9DA 4JUCA 3ND9A 4ZEMA 4IJUA 5CDHA 1A2KC 3ZE6A 3FJYA 4R1PA 2X4LA 5C8VA 4MUGA 1L7OA 4HH4A 4KDEA 1T9HA 3L4BC 4KWIA 3SZUA 5IUNC 2ZI6A 3O7WA 2EL9A 3OJFA 4RCVA 3AY0A 4LISA 2KM1A 4U9IS 4CKEA 2Y1FA 3REQA 2OCAA 1D1SA 1A8QA 5JRZA 4GU5A 2P2LA 2VBCA 4JITA 4IL5A 4CCSA 4D8WA 2HWWA 3GX1A 3E3MA 3IIMA 2ZKLA 2ZRAA 5MN4A 1JJIA 1JLMA 1TAQA 3HEAA 4HRXA 4RENA 1U81A 5DWQA 3MN1A 4E12A 3WS7A 4FOTA 5DBOA 4KYUA 2GO7A 5TMPA 1SIBE 3PE3A 4RD2A 3I58A 3PFGA 3ZHUA 1P5JA 2ALJA 4RO0A 3L7MA 2FP4B 3ROGA 4JBXA 1ODSA 1AKNA 1SJ9A 1QIJA 3TM4A 3ZY5A 4V1CI 5LXTB 1EP1B 1ZK1A 3A1FA 3ABOB 1X1DA 1RKXA 4Z51A 2IUFA 1DAFA 3MS4A 2AQHA 3OIVA 4OHMA 2AJ8A 1HFEL 1KEVA 1RZVA 3D6NB 4YO7A 3W78A 1E4EA 3QEJA 4HAOA 5GAJA 1HTBA 4BO2A 2VQ3A 3AL0C 3KZ1E 3SJCA 1XMQB 2ZTSA 1F3OA 2PRJA 1BXGB 1GUBA 2PANA 2VK4A 3QK7A 4JASB 4LJ4A 4DG8A 4E4YA 4YQZA 2L69A 1O94D 5TRTA 5DASA 3MQ4A 1X1TA 1X0VA 2IIPA 2MOKA 3PSAA 5JAIA 3H3JA 1KY2A 4AN1A 3ZJVA 4I5IA 4EZIA 2NUBA 4G5SA 2DTDA 1OAOC 3GW8A 4GMKA 1DUSA 1I51A 2P2GA 2VIIA 1LC3A 1NFFA 2UVDA 3VAZA 4M8LA 1DP4A 4XRRA 4DV6B 2I2FA 3CXRA 5IRCD 2PU5A 3HHPA 1P61B 1A95A 1U0RA 1SH7A 1QFZA 2HLHA 4HR7A 4R6XA 4RIIA 5GONB 4MWEA 2GAOA 3GVIA 3P32A 3PRHA 2A1TS 2Q5HA 4I1RA 5EAIA 4C0SA 4ZMRA 1I9GA 4UEJA 1R27A 2RONA 3EZFA 2JH8A 4L9RA 4IG4A 4M37A 4WNYA 3AZPA 3GVCA 4KITB 3NFRA 4Z1OA 3DE4X 2HR1A 2PLRA 4Q9LA 2QL6A 4C14A 2ZAIA 3AV0B 5HA5A 2I33A 3K0CA 3C5EA 4IH4A 1JLHA 4X8HA 5AKZA 3UB4A 4RZIA 2P3QA 4LRUA 5IJXA 2JRLA 3AETB 3SR3A 2I6QA 2J46A 1US8A 3L0BA 1I3OA 3I0NA 2B1IA 1RVV1 3DXXA 3Q85A 2NPIA 1CZOA 3AESB 5DNWA 1MRNA 4OAOA 3G82C 5HVNA 3IXMA 1UKYA 1HM5A 1S0UA 1WR8A 1Y1PA 4JJ6A 5H81A 5P21A 1G0NA 4IJMA 2GSDA 1FS6A 1ZK2A 3TTSA 1Z45A 2RHBA 1L4GA 3R6DA 1AKTA 1UWKA 4CMKA 1F48A 1NW6A 3WIVA 2XE6A 1YQQA 4ENVA 3AUJB 1KMIY 5ITWA 4BQNA 2R1TA 1U1EA 2IXTA 3FYUC 2QTAA 1FQJA 4HXYA 1R9GA 1PLJA 1WOMA 3C6QA 1Z25A 3RROA 4U39A 3A6KA 4P92A 4ZO6A 3QWHA 2P1DA 1WY5A 3IUQA 4JP2A 3CUKA 5IARA 1YA4A 2HQBA 3FRIA 2X58A 2REQA 4P8RA 5LLDA 2G08A 2HUNA 5D3ZA 4UCQA 4B3RB 1OFGA 2QTBA 2XDAA 4UUNA 4RJ2A 3AHEA 2BKAA 3QP9A 1WQ1R 1MV5A 2RBKA 1KZ6A 4OBBA 1AD2A 2TRSB 3LUFA 4ZVTA 5EMHA 1XEAA 1TO6A 2FZEA 1X7XB 1XKXA 1QQTA 1UBRS 1VA4A 2R79A 4S35A 4IGEA 3TLJA 3OWOA 1M1NB 4AYXA 2F8SA 3GDFA 2J6CA 2O2IA 3T15A 2NU9A 1L5SA 1KI2A 1USVA 1ZCJA 3H11B 3LFHA 4G0QA 3PNBA 1T8WA 3UENA 1X1BA 4AAYA 4MVJE 2JJYA 4PZAA 4LPKA 3G0OA 1SVIA 4OQQA 4M88A 4CUZA 4B6JA 3TG2A 4UNPA 5ALVA 3UKDA 5JSFA 2HU5A 3D2CA 2CMKA 4FYHA 4YQEA 1OXUA 1UMDB 1F14A 2D2VA 3DJFA 4NJMB 2O8VA 3RV3A 2ET6A 2G09A 4M87A 3IUEA 5HDQA 2BWJA 5HTKA 2EFDB 4B6EA 5HCNA 3RJMA 2GB4A 2YWRA 2ZG6A 1BU5A 3DFZA 1AB5A 2BCEA 3WG9A 1E3TA 4W1QA 3KQSA 3MJ4A 4FC7A 4Y7CA 4J2OA 4DE5A 3M6UA 1GQFA 2IF2A 3WYGA 4R31A 1H4SA 3JZDA 3USZA 1MJHA 1UMKA 1II8B 2MYUA 1YMQA 3C8HA 2BTQA 3IDOA 4IIJA 2WICA 3HN6A 3F4LA 4XQ0A 4PM4A 4RAQA 2B30A 5CM9C 5AKKA 5A05A 3ZDEA 4G56A 3L8DA 3RU7A 3T1YB 1EFKA 3RC7A 2X9QA 3T9CA 1M6YA 1TNDA 5FBKA 3OO0A 1E2FA 2P4QA 3EFOB 1C30A 4II7A 4PLFA 1P81A 3P9SA 3M0EA 4KKXB 4RPLA 5DYYA 3BRWD 1J8YF 2NO4A 2GD0A 2RHRA 2XB6A 2HWXA 5GM1A 1NWHA 4DCTA 4NCXA 1L5KA 5CDSA 1UZLA 1RJFA 2XWQA 2DU8A 3QNWA 2IYWA 5EG5A 4JGBA 4KO8A 1XWIA 4WXMA 5B53A 4BMCA 2QR2A 5L7WA 3DFUA 1I6KA 2IP2A 2Z2ZA 2C3UA 3GNSA 3PENA 2OCXA 3RVJA 1U7OA 2H7CA 4W7SA 5EZYA 4BYGA 4ZGWA 3EX7C 4DLVA 4I9GA 4G0PA 5E4YA 3BGVA 2ERCA 2P9GA 4UJ5A 1MEOA 1QH8B 3DHVA 4E3WA 1DFIA 2BY4A 2I67A 4GC5A 2FSPA 1NVVR 4NMWA 5F76A 3VTKA 5KWSA 3IT2A 5LYJA 1C4XA 1R16A 2I65A 2VH5R 5KYXA 3FOEC 4JI0B 4C5BA 3OMWA 4MB2A 1XJQA 1NE2A 2V7UA 4KPYA 3VHRA 4QDXA 3SJBA 2EKQA 4EAAA 1CLEA 3K0BA 3KL2A 4HFMA 1RFLA 3WO0A 5CD1A 2IOQA 4Q9DA 5CB0A 1R4NA 2IT1A 2Q99A 5BUCA 4ASUD 2VDJA 4B1FA 1RQGA 1WRBA 2IZOA 5AHOA 3ULKA 5IKPA 1EA5A 3TJMA 3UYLA 2QJRA 3TI7A 2Q2QA 3W77A 1W5SA 3KYJB 4FNMA 3L18A 1JXOA 3QPCA 1NN0A 1OD6A 3DHWC 4MXDA 3TQIA 4YJ2F 1E9AA 2DY1A 3DVLA 1W73A 3OZFA 1P2SA 4L8LA 4Y2RA 2OYCA 5FOSA 1V11A 2PFSA 1H2BA 3SEZA 4LZWA 5CDTA 1X7GA 4OK5A 3ZHCA 4LJKA 1GGNA 5IXSA 3MWFA 3HA5A 5ADUS 5IM4A 1EGQA 2WU0A 2GHTA 1ZD8A 4MCHA 2A59A 1FJHA 4GKVA 4H7DA 4KUHA 3VZSA 4DLWA 4FDTA 3BF7A 3IDZA 3T3EA 1TEXA 1U7ZA 5B7NA 4PYKA 1ISMA 2Y8EA 2ERXA 2PY6A 2RIPA 4P5DA 2PA3A 4F38A 1XZDA 1I13A 1M83A 5C35A 3SVLA 2QP3A 3BHNA 5DHUA 4DT1A 1YDEA 2XLBA 3L49A 2ZPAA 3C3AA 1VZ3A 3TXXA 2IUUA 3IQHX 3PDHA 1MX1A 4LRTB 3M82A 4WKBA 4CCWA 1FMTA 1FU8A 3R76A 4Q48A 4C30A 3SC4A 2F3TA 1VE1A 5CNIA 1KEZA 3BL5A 3GRFA 3QITA 4C3VA 4D99A 3S0JA 4L7VA 2IZ7A 4CF6A 3HA7A 4LRXA 3TF5A 3TQTA 4M83A 3FJOA 4D43A 5AESA 1DNPA 3EUEA 1KQGA 2WTXA 4EA9A 3ERCA 4PZ0A 1HR0B 2OQIA 4W5NA 3VSCA 3EVAA 3K4PA 3LBIA 4MV0A 3WY9A 3W2TA 1BWSA 3FW1A 4KACA 2HV8A 1ZD3A 3PGA1 4BPBA 1C8LA 4Y8VA 2W0MA 2CZGA 1OXSC 2OMEA 2WJWA 4FYPA 4ZMSA 4QAJA 3JAMA 2GPYA 3WLIA 3Q0TA 4RCYA 4G5GA 5KYGA 1G21B 1NVTA 4RY0A 3MUFA 2IBSA 4V0LA 1Y7HA 2ODPA 1RTTA 4UHHA 4XPIA 5FOWA 3ZE7A 5KSYA 2DCMA 2MTBA 3K8YA 4OGFA 4PSAA 3RUAA 2FEKA 2VJPA 4WUVA 1NBMA 3UNXA 1T36B 5JEEA 3B1ZA 5JDCA 2V3WA 4UM5A 1JFTA 4I9HA 4P4NA 1GFSA 3VYVA 4DCSA 3UMMA 2ZU0C 4HDRB 3RGWS 1M1YB 4ER0A 1BXRB 4UFPA 4YCBA 3Q72A 1XJWA 1Q6YA 3N58A 5T4HA 1V0JA 2DKOA 4Z7NB 4B45A 2BGKA 4D8YA 4E0BA 2FZWA 3OQHA 1VRWA 1Y6JA 1L5WA 4CUKA 3L79A 3CLUC 4BLUA 3TTYA 4IY1A 1DINA 1FSZA 3ZE1B 3D6UA 4YRKA 3OH8A 1NGSA 1ADJA 3UAXA 3QLUA 2E4VA 1OH7A 4WOKA 2YJ3A 4UOQA 4EFDA 4LN1A 2N75A 3K31A 3KYCB 3V1NA 3HU5A 4CCYA 4HQFA 2YXLA 1EIWA 4XA8A 4D81A 4U7HA 1W5BA 5KINB 5DNEA 4KQXA 3S44A 2O7NA 2XUZA 3S81A 1NV9A 2H16A 1Q14A 2BJVA 3GJQA 3K0CC 3DW3X 1BXZA 4FUQA 3I8OA 1QC5A 3LQYA 4DQKA 4FFPA 4XDZA 2B1QA 3KJGA 5AOVA 4CLHA 3T5TA 3DYIA 2JIZA 4RF3A 1M0WA 3TD2A 4PYJA 2JCXA 4D5GA 1C9EA 2XYRA 1GV0A 1DTEA 2FSVA 2ZIZA 1ORVA 2V55B 5CVEA 3U39A 3KJXA 1ODCA 1LA2A 2HY7A 2Q1UA 1WZ2A 1PAUA 3EA4A 1CY6A 3TIXB 1FY2A 1BQ4A 3WJ1A 4C7MA 5BSWA 3T9BA 1LZKA 4AKIA 1QIIA 1T5DX 2ZU6A 4PSVA 1QVWA 2CVZA 2MYTA 3H1BA 1Z5UA 1KQFA 2R4UA 1BDBA 1DQSA 4J1NA 1D6SA 4QDUA 4WT7A 3BE4A 3RYHA 4QUGA 3NYRA 1JQKA 2FWPA 3VHQA 4ZYWA 1D2NA 5ENZA 3GNLA 1ONPA 3Q88A 2J3LA 3TLZA 1SM4A 2QX7A 2HNKA 4KUGA 2AWOA 3NEAA 4I1PA 1Y7IA 2DF8A 3T1NA 1A2OA 3U16A 2Q3EA 5IUJC 3OE7A 1GQYA 3L4SO 4FQ5A 1B6SA 3OEYA 2J9FB 2PX0A 4ER3A 1KPIA 1TMOA 4AJEA 5GGXA 1ZMTA 2QTTA 3B9BA 3HYRA 1K92A 1SUCA 2ECPA 4HBZA 3SEAA 1CJVC 1T1IA 3H4MA 1CQIB 1V8DA 2WYHA 2Q5QA 2BFCB 2VDVE 4XLLA 6LDHA 3KTAA 1CR1A 1GY8A 5D8DA 3SHFA 2BR4A 2ISCA 1BE1A 4QUIA 4DWWA 2ONKA 2W2XA 5CVTA 1HZJA 5F4ZA 1F6DA 2OFFA 3BIOA 1VL1A 3E15A 4G85A 2PDAA 4EY4A 3GHYA 4YLGA 3IAEA 1GRQA 1LS6A 3ZK9A 1M8PA 1QPGA 4JJAA 4QTZA 2HHLA 2ZR9A 2C2OA 1ONSA 4GPBA 4TLLB 1UJCA 3VA7A 3M3HA 1TJYA 1PBNA 2BD0A 2C5EA 2C2XA 2FP4A 3RIHA 5JYBA 4BMZA 2V7TA 4FDUA 1V9CA 3CY6A 4OJMX 4RJKA 2FYTA 3BM5A 5LXTA 1I2CA 4MUEA 5CITA 4KAJA 1MTZA 1D2GA 1XN4A 3E9YA 2IEYA 4R84A 2P6MA 1WB5A 1KJQA 2NO0A 3CXUA 4K6OA 1M2KA 3AXTA 3G8CA 4G5RA 3T7IA 4P4UA 2OGSA 1XZAA 2HJHA 2L42A 2H51A 2WEKA 4RL4A 3T7CA 1T2VA 3U4MA 1JJVA 2P40A 2L19A 2RGNA 1GPH1 2AH5A 4KXLA 1BXGA 5K0ZA 1VE9A 2XBLA 3PK0A 4Q7MB 5JANA 3VO8A 1MJ5A 2FPXA 3LBAA 2WU1A 2XCTB 3IPLA 4MS1B 5J59A 2G8NA 2YWDA 3JVEA 1M54A 4YXWA 3U4HA 1MX9A 2LTAA 4PZEA 1ZM2A 3WA7A 3DB2A 1G20E 3M1YA 5EIOA 4UDNA 4ZTUB 2XYGA 3T12A 5KTPA 4WK6A 5I3CA 5IFKA 1AO3A 4DWOA 1A69A 2H7VA 4BGVA 1W1UA 3QU5A 4JP8A 5GONA 2GO1A 2YJ6A 1JHYA 3AI3A 4XXHA 1UINA 1AXGA 3CTMA 3GLSA 3RFFA 3VO9A 1KFEB 3IRVA 2FW9A 4RVNA 3BIFA 4P32A 1WB4A 1ZONA 5JJ5A 4OHVA 4WLUA 2AV6A 2BPOA 3FOZA 2EYQA 4JROA 3LUHA 1DX6A 2H4HA 3KM0A 4IHJF 4YJ2B 5IN5A 4XSGA 4RJIA 5TS3A 1OXKB 4MEAA 3AETA 1U8AA 5IHXA 1ISJA 1CQXA 3N74A 3AVUA 5KVAA 5D5PA 2QX9A 1UZUA 1TA4A 2AZTA 3AESA 4HYYA 3UMVA 1O0CA 2N1MA 1G3IA 4LBVA 2VFAA 3EF1A 1M0TA 5HKKD 3KAJA 2F67A 2FW8A 3OOJA 5B1EA 3MINB 1LCIA 4M8IA 2F17A 5ULLA 3HXMA 3OT4A 2JLVA 2A5FA 1VLQA 2YXPX 3DTNA 3EYAA 4P33A 4X7BA 3SBDA 2Q5JA 4LRYA 3SDBA 1NQOA 4NBNA 2AG1A 1UOEA 1ZUIA 1NT4A 1UEIA 3GMIA 3M5PA 1XLUA 2D62A 3O8QB 1AV6A 4WSOA 3KE8A 1YS9A 2I2CA 1O9GA 4MJXA 2XUPA 3QSGA 3WV4A 1SWVA 4QFCA 2QRKA 4AIIA 4RS3A 1T3TA 2CNDA 3A9RA 3SKYA 1Y1RA 2VXYA 4M9XA 1X1RA 5L45A 3QEBZ 2ODNA 4OF4A 4X0EA 4XWOA 3IHWA 3I30X 4JS0A 3SQXA 2B3DA 3JU3A 1IXSB 3UBMA 3JD0A 5JCOA 5LD2C 1F6WA 8LDHA 5I9BA 2ZFUA 1ND5A 1X7XA 4RK7A 1T5IA 1J1IA 4MIEA 4RSHA 3W3AD 5IC4A 1KOFA 2IHVA 2VA8A 1M1NA 1B2RA 3KETA 2DLCX 4UU7A 2Q3DA 3BYZA 4EKYA 1W52X 1VI2A 2EF1A 1U8YA 2QJFA 4KODA 2QTHA 4AB1A 5JYEA 2CJYA 2X0FA 1YB2A 1U28A 3JALB 3UMYA 3ZDCA 4WCVA 1NJSA 2BOVA 3A4NA 2O2XA 4XIFA 3OY7A 3ZWVA 3DKVA 4FOLA 1FDRA 4OATA 1YBFA 1UMDA 3ILHA 3N7UA 1ZITA 4YRFA 3QU7A 4JSTA 3KHTA 4NJMA 3SDSA 5AW3A 4C04A 1A76A 3IXQA 4CF4A 4ZAFA 2VKQA 3I8XA 2IF0A 1M74A 1G59A 3SNKA 5DIZA 4CQMD 1PZNA 3SE0A 1O03A 2C4TA 3K1AB 4XD2A 2Q1WA 2C77A 3FVWA 4JC5A 4PLPA 4H7KA 5G4LA 3M34A 2B5OA 3TN7A 2XODA 3M4YA 2QMEA 4OGGA 4RHUA 1TOAA 4LRWA 4PPGA 3U61B 2BR5A 2ZQZA 5IBRA 1E6WA 5JDCC 1P91A 1V7ZA 7AT1A 3EFOA 1NMZA 2GNAA 1TCCA 4LY9A 1X1EA 1FMFA 2VAPA 3IKLA 1H1LB 1VRVA 3DZDA 3OCYA 4B4DA 3ZHTA 2NGRA 4YPOA 3F5QA 2JI4A 4X6XA 4LUCA 2A84A 2Z04A 1Y9EA 3CC8A 3OICA 3ONEA 3B1XA 4K9SA 1SBNE 1WX1A 2AN5A 4WNIA 3S3TA 4BQIA 4CMIB 5B12A 1RQRA 1E9EA 1Z7BA 4FT2A 3OBBA 4QYIB 3QLUC 1THGA 1JLKA 1EYZA 1NU6A 2O3TA 3TRKA 3ZHBA 1USGA 4KYTA 1ADGA 2BJHA 3ZH9B 2H06A 4MULA 3KX2A 3OP4A 3H17A 2DPXA 4YAGA 1QH8A 1Z4KA 1FUUA 2ZATA 4ZC8A 3RTBA 3TOVA 4GGPA 3DM5A 1XXLA 1AOXA 4ENSA 3PUIA 3L7NA 2C7BA 3AJRA 4Y7DA 1KVUA 3VNAA 5JC1A 4GPEA 4RTSA 4B17A 5FI1B 5BW5A 4LWZA 2DTEA 2QTWB 2ZDQA 3GZ4A 3P0JA 5P8WA 3BOSA 5FFMA 2DXIA 1M6EX 4G5QA 4WJLA 4UUPA 1RC1A 2ARKA 2IIBA 1DEHA 1VBNA 1DQPA 2FSVC 2P3LA 2R7KA 2ZWOA 3LSTA 3TEJA 3K9HA 4WUTA 1JNYA 2A7XA 3BXEA 2O2EA 4C0WA 3H1GA 1EQUA 5HEKA 1DAPA 2XSZD 3EDCA 4GSKA 4JUFA 5DYGA 4P53A 2O3RA 2VYCA 4ZEOA 3WRYA 1QVZA 3W1WA 2A0FA 4OHFA 3ORQA 3E9ZA 5FPTA 3DMYA 3I01M 2WWXA 4WESB 1SRRA 4ZVKA 1MC8A 2BISA 1N7HA 2C5AA 4LE2A 1QDEA 1CD5A 4RLQA 5IP5A 1JAYA 3HCAA 2JW5A 3AVOA 5HJ2A 5PNTA 1FTWA 4CDMA 5JU6A 2XTMA 3R4VA 1YOBA 3FH0A 5AW5A 3BSFA 1W6RA 4ARZB 1NYRA 2DY0A 1SCUB 4X94A 2DE0X 1Q17A 2VT6A 2W0SA 1DUIA 1RWKA 1Z5WA 3M9LA 4LYJA 5I5EA 1WV1A 3C41J 5IDWA 2E2WA 3QELB 4M0EA 1HLDA 2M6LA 4DLTA 4DM3A 3SP1A 4AUEA 3MPOA 3GIWA 4H6XA 2H0AA 3CO0S 4J2HA 2D2IA 2XW6A 3CX3A 3FNFA 4KRXA 2PEZA 4XPZA 1GDHA 1NRXA 4W7IA 4XE5A 4DQ0A 3KZOA 4XDYA 3VXKA 4B3XA 1JDVA 3KEOA 3B51X 3NRBA 1XQVA 1YT5A 1NDUA 2P4SA 1V9SA 3DL4A 2ORYA 4D9CA 2QPLA 1G3QA 3BCSA 2PPLA 2CFIA 4EFNA 1BYUA 3GK3A 2EFEB 5AJHA 3KHSA 1NUAA 1FVOA 1H4QA 3HCPA 2AMLA 2YFQA 4IJQA 2X0IA 5BORA 1DCTA 1USIA 4MRPA 2PHZA 5AJXA 3GZJA 5A7FA 2PZAA 3CLSC 3HVHA 3SHTA 1FVXA 3COWA 2PG3A 4FHGA 1FXUA 4RPIA 4TZ6A 4AS3A 2ADFA 2OV2A 4TL6A 4R5MA 3GFSA 5LZ7A 1CJKC 1QQ5A 1W2WB 1XALA 2HIGA 2R9VA 3EB9A 5JYCA 4PO9A 3AM1A 1VSBA 1K8ZB 1N2SA 1N32B 3B8HA 4TSKA 2P0EA 1HDGO 4DG5A 1RI1A 4ZVVA 3BGWA 3VR6D 4AJKA 4XR9A 1T2UA 4WZBE 5C1OA 1QR2A 1DAOA 2RGNC 2V97A 1HDEA 2YYZA 3BWMA 4I2VA 4K9LA 4HLQB 2Z1DA 1T36A 4H7HA 4M98A 4Q12A 4DCCA 1N1EA 1FZQA 1LRKA 1PDOA 2G63A 3GI1A 2AIRA 1REQA 3KCNA 3MK31 4JP5A 1M1YA 5AVOA 4R98A 1IJEA 2X76A 4YRSA 1KMHB 2PLNA 4L0DA 3TAUA 3NATA 2PGLA 3V4LA 2JIPA 2ZI5A 3G0GA 2QSUA 3TW0A 5T3YA 3EULA 2GHRA 4E5PA 1RAHA 1WP4A 3RFVA 4XWKA 3AUAA 1E1CB 4YRQA 5EE3A 1N2OA 5B7PA 1OU0A 3K73O 3QTLA 2G40A 3KUCA 4LFBB 2W5UA 1KI4A 1XIVA 5JFGA 1KQOA 4MVJH 3H1PA 3K9CA 2WR8A 5HHTA 3KXPA 3KYCA 4DXAA 2ZZNA 2ONJA 1VG0B 4WAUA 2RGWA 4J75A 5CJJA 4TRRA 2IXGA 2FPRA 1MA0A 2VK8A 3UXEA 4CEHB 1SCDA 4TKMA 1EINA 2VHEA 1SCJA 1H2YA 3MCAA 4M0UA 2IEIA 2DSNA 2VP4A 1RNLA 3DBRA 4KVZA