3TOSA

Crystal structure of cals11, calicheamicin methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGFPDVNDVDRVGPTAYQGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CalS11
publication title Crystal Structure of CalS11, Calicheamicin methyltransferase
rcsb
source organism Micromonospora echinospora
total genus 75
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3tosA00
2PX2A 3KQPA 3KKZA 1EJ0A 4HC4A 3B7PA 2BM9A 2OY0A 4RV9A 3QV2A 2OZVA 2QYOA 3P9NA 3T0IA 1WZNA 3SVZA 1F38A 3KQWA 3NWEA 5DTRA 5K0NA 1AQJA 1JQEA 2PXAA 5E9JA 4PIMA 2QY6A 1V39A 4E2ZA 3V8VA 2IH5A 2PWYA 2FYTA 2FK8A 4FS8A 3JWHA 4GBED 2P41A 3CJQA 1WXXA 3G5LA 3IV6A 1MHTA 3IYLW 2G8NA 1PJZA 1N7IA 4YV0A 4OA8A 4RTPA 3SSMA 2ZBRA 1VE3A 1O54A 3SX0A 4CTKA 2NYUA 3FPHA 5U4XA 2OO3A 2BM8A 2JHPA 1YUBA 2P3LA 2JH8A 4FR0A 2ZZMA 2ADMA 4PWYA 2AVDA 7MHTA 3GCZA 5EGSA 4EVIA 3HEMA 2IPXA 3FUXA 5ICEA 2ZFUA 1JG4A 3I9FA 2B25A 4HSGA 3TKYA 4WVLA 2Z6QA 2GB4A 1SG9A 4BLUA 1X19A 3G2QA 1FP1D 1NV9A 3BWMA 2PJDA 3A27A 4P7FA 4YUVA 3LDGA 3CJTA 3GNLA 5FWDA 5P8WA 3LKZA 2PV0A 4PYKA 3GXOA 4U7PB 3FTDA 5BW5A 2AOTB 1JR4A 3DP7A 3GRUA 4DF3A 1RI5A 2ERCA 2OPBA 3O7WA 2V7EA 4CWAA 1MJFA 2FK7A 1DL5A 4NECA 4PYMA 4FZVA 4HTFB 3LBYA 3BKXA 4L7VA 3UZUA 4DCGA 3DMHA 2NXJA 4MTLA 3GIWA 1AF7A 3HCAA 1NW3A 3THSA 3GRRA 3TLJA 1ZGJA 2EFJA 3U81A 4AZVA 4C4AA 5C9ZA 1ZG3A 2UZ4A 2QE6A 1QAMA 2G71A 1WG8A 4P7GA 2NXEA 3PFHA 1NBIA 4PYIA 4YUZA 5BW4A 3FPJA 1UWVA 5E2BA 4DMGA 3QOXA 1QANA 5EMMA 4IKPA 1Q0SA 1U2ZA 5FHQA 3VC2A 4K6MA 3Q87B 4ER6A 5K0BA 1NKVA 3EMDA 2AR0A 2HV9A 1JQDA 4GQBA 5CVUA 3FTFA 3G7UA 4QDKA 5G02A 2A14A 2UYOA 3EVBA 4RTRA 2VDUE 2ZW9A 1HMYA 4X1OA 4UOEA 4RVFA 2UYCA 4DKJA 1Q0TA 3FYCA 3BXOA 2BR5A 3GJYA 5DX1A 3OPNA 1VP3A 2XVMA 4HH4A 5EC8A 3TOSA 2Y1XA 4E33A 3EEYA 4RTLA 2E5WA 3G88A 2G1PA 1I9GA 4XUEA 3G89A 1SQGA 1UIRA 3SSOA 4QVKA 2CWWA 3VC1A 5KVAA 3PLAE 4X41A 3TM5A 3GDHA 2C7RA 1KR5A 5GIOE 5DRTA 2PGXA 3FPEA 1SUSA 3NJRA 4FSXA 5K0JA 5HIIA 3DXZA 9MHTA 3P8ZA 1ZQ9A 3BUSA 3LDFA 1JG3A 1FJXA 4PNEA 5GWXA 3P9CA 1XTPA 2AVNA 2C7PA 2B2CA 5DTMA 1WXWA 3PB3A 4X63A 5EHIA 3M4XA 5FQNA 1NW7A 1SUIA 3A7DA 3AJDA 1P39A 1YZ3A 4MIKA 5KYGA 3G8BA 3K0BA 2YTZA 2PT6A 1AV6A 2ZWVA 5DSTA 2OYRA 1VP9A 3TR6A 4DQ0A 4KDRA 1SKMA 4PCAA 4C04A 2ONZA 1Y8CA 5LQRA 3C6KA 4PONA 5CVVA 5DSXA 2NXNA 3UJDA 1ZGAA 1RJDA 3FUUA 4C06A 5LQKA 5H02A 2ZLBA 3EMBA 3ME5A 2XYQA 4ER5A 4RTQA 2ZVJA 4ATNA 4C07A 4HRAA 4RTNA 5FQOA 1NBHA 3MTIA 4ZTBA 4CKEA 4DM3A 4RSRA 1XDZA 1L9KA 3HCCA 5DM1A 3KPVA 1JSXA 4OA5A 3ER9A 1ORIA 4EQZA 3MHTA 3TFWA 2JH9A 3OZRA 1M0EA 3KQQA 3HM2A 3A7EA 4IV0A 3OZTA 1X1AA 3JWIA 4Y2HA 3IHTA 3EVCA 4RYLA 4X60A 5HIKA 2IDJA 2O0LA 4CKCA 2BH2A 4AZWA 5MHTA 2PX5A 3CCFA 4PYLA 2H1RA 4HGYA 5CUQA 5F2NA 5T6BA 3ORHA 4KDCA 3HTXA 5LSAA 4DA4A 2BR3A 3DXYA 1RJEA 3I53A 5C0OE 2P3OA 3HVIA 3I58A 1QZZA 3LDUA 2F8LA 1NV8A 5GM1A 5DTQA 2IDKA 1FPQA 4RTKA 5EMLA 2P40A 2ZIEA 2PBFA 3KPYA 3VYWA 3REOA 4R6XA 3ANXA 1F3LA 1SQFA 4GC9A 4MWZA 5EHGA 3TKAA 1VBFA 4QPNA 5LQCA 3GRVA 1PRYA 4M36A 3I64A 3UJ9A 2UYHA 2R6ZA 5FA5A 5CVDA 2XVAA 3SGLA 3AXTA 1T43A 4ER0A 4YUWA 1NW5A 3BT7A 1QAOA 2JHCA 2AOUB 3DOUA 3EVEA 2P35A 2PLWA 3LBFA 3OU2A 2AZTA 3KR1A 3Q7EA 2ZBPA 3T7RA 5ICGA 1R00A 1JTFA 3B3JA 4KW7A 1Z3CA 2LD4A 4E70A 3B3FA 3JWJA 5K03A 5KQRA 3R0QA 5BXYA 3LL7A 2FRXA 2H11A 2P3QA 3EVZA 1YFLA 4RTOA 1JTEA 4X61A 5HIMA 2YXEA 4YV2A 3NWBA 3MGGA 3ID6C 2PSSA 1OR8A 3KQTA 4GC5A 2ZULA 3CVOA 3EGIA 2IFTA 2WK1A 3B5IA 4PYNA 2PXCA 3VSEA 3MCZA 4LWOA 2CL5A 3KHKA 1O9GA 3LCCA 3LKDA 4KRGA 4LG1A 3UBTA 3T7SA 5KS2A 3FZGA 1VQ1A 1JG1A 3OCJA 4E2XA 4B17A 3UA3A 3HNRA 2DULA 3CBGA 2I6GA 3R24A 3KPWA 1NW6A 1R18A 2YQZA 4P58A 5FWAA 5FADA 2AN3A 4EKGA 3TM4A 3DULA 4FGZA 5HILA 4MHTA 3AWIA 1N2XA 4XUCA 3KPUA 5DXJA 1EIZA 3MERA 1RJGA 5HEKA 5GIPE 4IWNA 3M6VA 4GUAA 4KIFA 2XYRA 4E2WA 3PFGA 2IH2A 1L1EA 5DXAA 5LQAA 3BWBA 3BGDA 3UWPA 5LQJA 3EGVA 1ZKDA 3TRKA 2P1DA 3LHDA 1NW8A 4M7RA 3GRYA 5B1SA 1KXZA 5DRYA 2OB2A 5EKUA 2BR4A 3NDIA 5T64A 4A6DA 2ZWAA 1L3IA 5EPEA 3UJCA 4BLVA 4OX9Y 2WA1A 3MAGA 4GF5A 3GGDA 1R74A 1KYZA 1RI1A 3HCBA 2GA9A 4R8SA 1DCTA 4ISCA 4Y30A 4R6WA 2HR1A 4V0QA 1B42A 3UFBA 5CD1A 1P1BA 3EGEA 3FYDA 4GOND 1G8AA 1X1BA 3BKWA 4RWZA 2XBMA 2ORED 3P71T 3A26A 5E9WA 1BKYA 1VLMA 5K8VA 2VDWA 1EAMA 4PIPA 5GP1A 3C6MA 3GU3A 1KYWA 2Q41A 1BHJA 2EG5A 5EMKA 4C08A 4BY9E 2IGTA 4AUKA 1G6Q1 5HOQA 3ELUA 1KPGA 4FT2A 5CVEA 5FCDA 3JWGA 1FP2A 1G55A 3FPFA 3PT9A 4EK9A 4YMGA 2VS1A 1QAQA 4RTSA 3CJRA 5E8RA 2PT9A 2OBFA 2YXLA 3HA3A 4RVGA 3AY0A 8MHTA 3G5TA 1EG2A 3DH0A 3EVGA 3IEIA 3LGAA 3P9KA 4KIGA 5EIWA 3M6XA 5HFJA 3PS9A 1YZHA 2V74B 2NP7A 3G2PA 2WA2A 3MTEA 4DCMA 4ER7A 1YFJA 4JXJA 3QOWA 5FHRA 1KP9A 4P7JA 4PYQA 3DTNA 2CKDA 4IV8A 4O29A 4YMHA 1EQAA 5E9QA 3KPJA 3T7TA 3DUWA 2N47A 4BP3A 5BP7A 4FSDA 5LQNA 1M6YA 3E8SA 5K0GA 3B3GA 5DM4A 1XXLA 5JUWA 2ESRA 2YXDA 3C3PA 5EVJA 10MHA 4YV1A 3M70A 4FP9A 3LECA 5E2AA 2ZSUA 1INLA 2AN4A 2R3SA 3BWCA 5EEHA 4RTMA 2NP6A 1L3CA 3WSTA 4PYOA 3DMFA 4V0RA 3SR4A 1JSZA 1BOOA 1XJ5A 1XCJA 1KPHA 3E7PA 1EJ6A 3KR9A 5EKXA 3GRZA 3AXSA 3ER8A 1M6EX 4DZRA 4EMSA 3EEOA 3R9XB 1G8SA 2ZZKA 3CKKA 3P97A 5K05A 4QQNA 3C0KA 3FPGA 5EEGA 1KIAA 1HNNA 3DLCA 4GOMD 3HVJA 3LPMA 4HG2A 2AOTA 2AOXA 2YX1A 4C05A 4CTJA 1QYRA 2YVLA 3RW9A 3M6WA 1JQ3A 4CXMA 3SXJA 4PGGA 1IXKA 3LSTA 5CM2Z 1D2CA 4HGZA 1KPIA 1SVUA 5LQUA 3HP7A 3KR0A 2GLUA 3S68A 3M6UA 1RI3A 2G72A 3EPPA 2BZGA 2YR0A 4PCLA 1P1CA 3FUWA 3G2OA 2VP3A 5DX0A 3ERCA 2HNKA 3TQSA 3UA4A 3FRIA 5K0EA 3E23A 2EX4A 3FUVA 3X0DA 1TPYA 2PWPA 4R05A 3PVCA 3NTVA 4LWPA 1NT2A 4BLWA 2HTEA 2Z6AA 1O9HA 2K4MA 2AOVA 2VZ9A 5DLYA 5JR3A 4RVDA 1DUSA 3RIEA 5IH3A 3SM3A 4PGHA 4POOA 3MQ2A 5FUBA 3OE4A 4KWCA 3OU7A 3THRA 4XUDA 1I1NA 1IY9A 4GOOD 4QVGA 3HCDA 1RJFA 3NVMB 2XYVA 2IBSA 4PINA 3P9IA 2I62A 1YB2A 1BC5A 4Z2YA 2GAFA 5CCBA 3HVKA 3PX3A 3BWYA 3DR5A 2EJUA 2PVCA 2O57A 2JHAA 3ELWA 2PX4A 5K0CA 4RTJA 1TW3A 4GEKA 4OBXA 5FTWA 1XCLA 3R3HA 3DLIA 4BP1A 1R8XA 3O31A 4QDJA 5DX8A 2HWKA 5EZSA 5T67A 5ERGB 1XDSA 4ER3A 1RI4A 5ICFA 4M38A 3A25A 2B3TA 3FRHA 3HVHA 4QTUB 4FT4A 5E8JA 2ZIFA 2C7QA 2NNWB 5CIYA 2PX8A 2PY6A 3ELDA 3L8DA 3MB5A 5GM2A 4E31A 4MQ4A 3GWZA 2QM3A 4GOLD 3FTEA 2PXXA 3V97A 4QPPA 2H00A 3KQYA 4AZTA 1I4WA 5D1NA 2QRVA 3BGIA 4QTTB 2CMGA 5EZQA 3G2MA 4H0NA 2I9KA 2IH4A 3H2BA 2CMHA 2FPOA 4P7KA 4F86A 5KQSA 3OU6A 4RX1A 5LR6A 2PKWA 3NVKI 1UFKA 3B89A 5E1MA 1R8YA 2HMYB 3KQMA 4XCXA 5CCXA 2AS0A 2NXCA 2ZBQA 3DMGA 2B9EA 5HIJA 2P7IA 2ZTHA 5HZMA 2EJTA 3SMQA 3LCUA 1VL5A 3EVAA 5DPMA 5FA8A 1WY7A 3RODA 5ICCA 3TMAA 1N7JA 2AOWA 3P2KA 3HA5A 2DPMA 3TPZA 4AX8A 3OFKA 2ZZNA 2P8JA 4EKIA 5F2OA 5DT2A 4AZSA 3OE5A 3UJ6A 3A4TA 3OFJA 2GH1A 2VDVE 4OQDA 2Y1WA 4A6EA 3UJBA 1AQIA 1P91A 3FUTA 3LX6A 1G38A 2Z6UA 3UJ8A 1KHHA 5K0FA 3UJAA 5F2KA 3NDJA 2OB1A 1YF3A 1FBNA 3OZSA 3EVFA 5EOVA 3NW9A 4YUYA 5K01A 2G70A 3MCTA 5FULA 4QQKA 2C7OA 3M33A 4U7TB 2I7CA 1X1CA 5DWQA 1TW2A 3HCEA 3PX2A 5DM0A 5E1BA 5E1DA 5EQJB 2JG3A 2IP2A 3D2LA 2YUIA 3BZBA 3P2IA 4OBWA 5EMJA 4F85A 2ZCJA 4PYJA 1WS6A 5EIFA 1VPTA 3ELYA 4E30A 2FCAA 4CKBA 1ZHFA 2IBTA 4E32A 3C3YA 4KVZA 2ZIGA 5IKMA 1XDUA 3R6TA 4RVHA 4YUXA 5C1IA 1ORHA 2GS9A 4E2YA 3EVDA 1RI2A 2QRVB 1NE2A 4R8RA 2AN5A 3DXXA 2AOUA 1XVAA 3LCVB 5E1OA 1L3BA 4F84A 1VIDA 3K6RA 3KR2A 3I5UA 1D2HA 2UYQA 3G8AA 3GO4A 3KQOA 3O4FA 3KU1A 2ONYA 3KQSA 5EG5A 5D1HA 2P7HA 3FTCA 5CVJA 2O05A 5K09A 1R6AA 4M37A 5GOZA 1JG2A 1D2GA 1G60A 2KW5A 2O07A 3F4KA 5GINE 3SSNA 3P2EA 5DM2A 5M5BA 3BGVA 3HA7A 4G56A 3HCFA 3KQVA 3UJ7A 1X1DA 4WXHA 1H1DA 4OQEA 2JJQA 2B78A 4C03A 2FHPA 4HTFA 5K0LA 3NMUF 2OXTA 3E05A 1IM8A 3CGGA 4LECA 3PTAA 2IIPA 3CC8A 2GPYA 2OKCA 2O06A
chains in the Genus database with same CATH superfamily
1XTQA 1JWBB 4JITA 4MQFB 5LZ8A 4EW3A 2LDXA 1JDNA 1TAGA 3O0DA 1YK0A 3P9NA 1W2WB 3A1DA 4FYIA 4QNRA 4XWYA 1F38A 5B58T 2QGZA 5K2MA 3RS2A 3SVZA 4F2GA 1JQEA 4DOMA 1TZKA 5JV5A 3OLYA 1FYVA 1SN7A 2FYTA 4AKEA 3I9JA 1N5KA 4D0RA 3R0JA 3ESYA 3FWKA 3IDQA 1UPAA 1LPNA 1SR8A 2E6KA 4DLSA 5IT9A 1GG9A 2AB0A 2PLAA 4EZBA 4L02A 4OOEA 1Y3CE 3TVTA 2ZS9A 1UQUA 3R3JA 4D4LA 1XD2A 5F33A 3ROXA 3QKTA 1D03A 2W2XA 4FYYA 1NN1A 2ZZMA 1NY5A 5IFLA 1ETHA 3UN1A 3VR3D 2W6ZA 5J4VA 5EGSA 2TRSB 2O3TA 2XSZD 4DPMA 4Z9AA 3S81A 4CGZA 5BN1A 5F9FA 3QY9A 3K1YA 3ZWPA 2WQZA 5J5VA 3RRZA 1RZRA 3NTLA 2QD5A 2QLTA 3Q1KA 4IRXA 3KHSA 1ZHOA 4PLFA 1QF6A 3EUFA 5B7QA 5I7OA 1TO2E 3LHIA 1P80A 1KFEB 2I4IA 2P5TB 1BCSA 3CJTA 3LDGA 1WW8A 4QHSA 1NVVQ 3RTDA 1SG0A 1QO7A 3LRTA 1OLSB 2WUGA 1ECLA 3OQIB 1BU5A 4IF6A 4PO3X 5F35A 5FWDA 3TTTA 1J8YF 5JO0A 3EEBA 1UPFA 4PAMA 1XA3A 1U7XA 1L4YA 2VA8A 1XPJA 3KZOA 3UMFA 4TV9A 1Q74A 1T2UA 5G0TA 2ZS7A 1L4EA 3N0WA 5IC4A 4J16A 3EPLA 4NSNA 2IITA 3TLJA 4E3ZA 2FZCA 2RSLA 3T9BA 2W98A 4ZZIA 4OAQA 5JMPA 1MENA 2Q6OA 4E03A 2CF5A 3TH5A 4IIUA 1JT2A 1SY7A 3RC3A 1NW9B 3T94A 4NG4A 5A5EA 5BRAA 3VC2A 1Q0SA 4BBJA 1EFVB 3EOZA 4AURA 4EY4A 5AVXA 4PZDA 1X7YA 4GPZA 3ZV3A 1R37A 4JUBA 3HRIA 1L2TA 2HJ9A 1PV1A 2A14A 1FRFS 3W3ZB 4X1OA 3R6LA 5I9BA 3TQHA 2QRKA 2R47A 3OPNA 4WZBA 4K6OA 4RQBA 3H9EO 1A4UA 3PFIA 1VJ0A 3I05A 4U6NA 3QPBA 4PAGA 1I80A 2Z8YA 4A6PA 1D3AA 4NDZA 4DQVA 1DPGA 3HBLA 3G89A 1T5OA 1XP5A 5JROA 1Q16A 2CSUA 5J2TA 3TM5A 4BPRA 2GHTA 3BJRA 2GF9A 3QMMA 4K9DA 4DB4A 5AVOA 5K0JA 2BT4A 5B6PA 1AA6A 2AEFA 4TV8F 3K8YA 3D6VA 4DQDA 1ODCA 3SBOA 4IHAA 4PNEA 1UMKA 3Q3EA 3I5XA 4TUYB 1Q15A 2VDNB 2PLFA 4M0KA 4X7MA 3FR7A 2QVYX 2ZRMA 3JD2A 3KO8A 4B6PA 5JZBA 1QS0A 16PKA 3L0DA 3L1JA 3NUQA 3O8DA 4JOBA 2RHJA 3X44A 1PT8A 3LUJA 5LKRA 1THGA 2PMKA 4DLVA 4Q3AA 2R8OA 5CVVA 1M72A 1UK6A 3BSYA 1Z73A 4I5FA 4E5SA 5FI3A 2YMQA 2AFHB 1PNOA 4HH1A 3T3OA 2CDBA 4Q9IA 4R2HA 2IUUA 4C07A 2G7MC 5FJIA 5J1SB 3QVKA 2BGUA 3RUHA 4L4ZA 2DPLA 3ZDRA 1H2EA 4OK3A 2APJA 1FJHA 1XTTA 4JA2A 2ZSHA 1TMOA 3U2QA 3UC9A 5BNIA 4ER5A 4A15A 2GCIA 3EW9A 4TTVA 2DBRA 1TK9A 1UT8A 3Q8LA 3OICA 3LPDA 3AVTA 3KCQA 3K32A 2Z1DA 3OO1A 1HYEA 4BNXA 4CM9A 2J3QA 3HXLA 4J07A 2QORA 3QU4A 2HA4A 3N3BC 5MHTA 5IJ9B 4YY3B 3A1SA 3AIKA 5HGJA 4NAVA 4Q00A 3N0XA 3UG6A 4KOEC 1JR3D 1OXVA 4AKTA 4B3FX 3MJHA 3TBHA 2UZ0A 5FA6A 4BEBA 1DEOA 5HJ5A 2BR3A 2ZATA 1AGRA 1K6EA 1FDIA 3BIWA 1JMVA 5K0TA 1UXJA 1T1SA 1ZIDA 3GJXC 4GLFA 2ZT7A 4MKHA 4P3XA 3QE4A 1QK4A 2GHQA 4R6XA 3KSUA 4MV6A 3DT8A 1QQTA 3EUEA 3HE3A 1PI3A 3Q12A 5H4HA 3IAEA 2BBTA 5JSZB 2XQJA 4R1LA 2RBKA 3VO9A 1DV2A 3OCWA 3EAFA 2J45A 4JL8A 1FUYB 1AVTA 2GT1A 3AR7A 4Q47A 2HF2A 2VXBA 4TSFD 3LBFA 3Q7EA 3V9AA 4P4TA 4JH0A 1KTIA 3UUEA 4YDHB 1G8JA 3LRPA 4ZAVA 3NMUF 1RC1A 4EAAA 4KPGA 2QTHA 3KJNA 3VR5H 4TXHA 3QLVC 3L40A 1GL7A 3LC0A 3NBUA 2JGEA 1RIIA 2BFBB 3HNOA 1Q14A 3RAFC 2VPYA 4EA8A 2HIGA 3TL3A 4BN0A 1O2DA 2JDID 3BAFA 4P9NA 4WESB 3ZJYA 1NX9A 3CVOA 5G3YA 2XYGA 1WPQA 2Y77A 1WXFA 2RHCA 3ENQA 4F9TA 3W8RA 1S3SA 3OUTA 3AK4A 3HYTA 1PE0A 1A8IA 3BMQA 1QK3A 3V2UA 4G23A 1Z62A 4MUAA 1YL5A 2PM8A 3OCJA 5CGQB 1QVAA 3JTEA 1WXHA 5JWRA 2BRUC 4G5QA 2IUFA 4KNVA 4G0ZA 4OHFA 4Z86A 3SSAA 1YACA 2GEJA 3V46A 1I4LD 1C5KA 1CVIA 1OHHD 1EWKA 2C83A 2OZLA 3BQ9A 1V26A 2O52A 2DY1A 4YJDA 3G0BA 4YPFA 4F06A 2Q0QA 4O2AF 5HEKA 4GKBA 1P5RA 3PC2A 4ECAA 2Z57A 1Z7EA 1ID1A 1IY8A 1W581 2FZVA 4G0PA 2DE0X 5AKIA 5IHPA 4CCYA 1Y1QA 4HH0A 2C04A 3QVGB 4H1VA 2XEXA 4P54A 4Q3EA 1TJ5A 5B2ZA 2VAPA 2DLNA 1TK2A 3LHDA 2TS1A 3M1YA 1MAWA 1VRWA 4Q39A 2IT1A 5AI4A 2JL1A 2YYZA 3ZKWA 3MSXA 3IE0A 1SVIA 1BEZA 1ZJYA 2XA1A 5AMXA 1DCTA 2OO5A 3RUPA 5KQLA 1O6BA 1JZQA 2Z3WA 4XX0A 2QSYA 4LYGA 3O8QA 1MG5A 1LZLA 4M7WA 1RJ9B 1LZKA 1DAPA 1Q77A 2WKQA 1L5SA 4C6SA 1FNCA 3T5TA 4GPTA 1H0RA 3KTDA 5F76A 3KLPX 3QPDA 3UG7A 1CY2A 4UBNA 4C88A 3IP6A 1D2EA 1ZH2A 3AI3A 2RH4A 1MAHA 3I34X 4MCAA 2JFFA 5HP4A 2Z58A 1OB2A 3O47A 1ISRA 4URHA 2QMZA 3A04A 4R9SA 2HPHA 4OIMA 5SY6A 3L2OB 5JSFA 4RF4A 1C7EA 3CF4G 1OTYA 1RYBA 4JX9A 3MCVA 3Q3GE 4PRKA 3NANA 3KQKA 1SCUA 2FQ1A 2AQIA 2GBGA 4FDAA 3SLRA 4KH1A 3W77A 4DNPA 3LVFO 1DV1A 4A8HA 4MULA 4YP7A 1WHSA 1M6HA 4XD7D 5LMNB 1LSUA 4HLCA 1P29A 3GGCA 5CA0A 3W6NA 1QZTA 4JJ4A 4V0KA 3KSBC 4IGIA 4ZHQB 4A73A 4HQ0A 3BJIC 2QRZA 1THMA 1Q1NA 3HDGA 5B3KA 4RK6A 1P8JA 4B76A 3BMCB 3Q0TA 4YRLA 3TQIA 2GZAA 2FMIA 1UBUS 4M7OA 1SNYA 4YV1A 10MHA 2F64A 2OHOA 5E2AA 2FMFA 3S44A 1UPCA 1WQ4A 2REQA 3CY6A 1SIOA 3DMDA 1OWNA 2OHGA 4YP6A 2ZUFA 3DMFA 5DGCA 1C81A 1MO5A 2QVXX 3UEOA 5ECGC 1BFUA 1I36A 5LQSA 3EK2A 2EP8A 2I66A 2EFHB 3Q5DA 4LDRA 1WZIA 1M6EX 3CF6R 3Q8XB 4YONB 1LPBB 1L7AA 3AFHA 3I62A 3UMBA 2HEGA 1LC0A 4GPBA 1W4ZA 3PZRA 3QEOA 4EG4A 4L4SA 4I1SA 2P0EA 2NTNA 4D97A 1KOLA 3W2GA 3NOXA 4KGXA 4JUAA 2VHVA 3EH2A 1A5ZA 3M6WA 4MITA 4NU0A 4PGGA 1CY1A 4NU8X 2VJMA 1THZA 5FP0A 4LJKA 4V0NA 2GLUA 2A59A 3U7QB 1NWHA 1MA0A 2JANA 3DYIA 1GJRA 3UA4A 1U2GA 3C1OA 2AJBA 2ZXEA 5I9MA 4KPYA 1MCZA 3F9RA 5DGTA 4BTVA 1KFCB 3M34A 1TPYA 1LH0A 3N9IA 4I50A 1GSIA 4MJXA 4ZJPA 3BE4A 1KL7A 2WAYA 1LSSA 3QELA 1HYQA 1YRYE 4AY2A 1GPAA 5LLDA 5JIBA 1POWA 3DE1X 4L6AA 4PZCA 1VL8A 4RHFA 2H2IA 3W5HA 1UBGA 1Q12A 1CJUC 1NR1A 4LCBA 5IH3A 1AG9A 2HRQA 2L42A 3FA2A 3X1XA 3WDSA 2J3LA 1P1RA 1VIVA 3THOA 3O4JA 2YWFA 1QHHA 3II6X 4TKVB 2BFDB 1VYHA 3V7FA 3OQ1A 3VZBA 2RGRA 3AL0C 4B6SA 4FHDA 3E70C 2MMCA 3L9WA 2FRDA 2V3WA 3L8YA 2PZAA 3CR7A 3EB9A 4HB0A 3NLLA 5F2EA 1R9JA 3RWMB 1U0TA 5JZOA 4DDMA 2N42A 1YQEA 4FC6A 3H13A 2H0QA 4J4TA 2HI0A 1XCLA 1DU4A 2MJLA 2QR2A 1RADA 3A70A 4LZAA 3RYHB 2AJLI 2LGJA 2P4HX 5IN5A 4NXNB 2WHXA 4K9QA 2HY7A 4PNPA 5IP5A 4MQ6A 2MTBA 2Y66A 2XYPA 5ICFA 3WVNA 1DRVA 1DBWA 3NKFA 1QFXA 2IZ0A 3ELDA 3KS9A 3O0TA 4IDOA 4PLTA 3GZNA 3GWZA 4PXAA 1GUFA 3B8HA 3ZQJA 1LLCA 5CVTA 1HF3A 2G9ZA 2O1XA 2H00A 2X8LA 1RPNA 4X20A 2W83A 1U04A 4L8YA 2NZ2A 2QRVA 1G1MA 2Q0XA 4ZAFA 2B0CA 3HDYA 2GEKA 2IH4A 3H2BA 2NVUA 1QCYA 4P4GA 4DGQA 3U1BA 2DGDA 4ZMBA 5J2UB 1Z2DA 5KTOA 3VKWA 5SYMA 4OIFA 3H8WA 3WGIA 1G5FA 5LL6P 3FWYA 3F8TA 3I3SR 1IMJA 4LBVA 1OI4A 5CW2A 3QVTA 3L7NA 1FXWF 2VLIA 1YDMA 1NMYA 2K7ZA 1RXWA 1OLXA 4S1PA 3FSGA 1KO5A 4EW2A 1P2UA 1XRMA 2B61A 4XRRA 2ZR0A 3SD7A 3K0FA 3GLHA 2P8JA 4FFBA 2UXBB 4AKSA 3U4HA 5AFSA 5LQDA 1B93A 2BEUB 4PLHA 3EASA 1YHZA 4PC7A 3L6CA 3CH7A 4N5HX 3E2IA 2P6NA 1E0SA 1SEPA 1M8PA 4U7TB 2E21A 1E1QD 3MTAA 1NHWA 4K86A 3RASA 1V4VA 2VLBA 3RFVA 1Q84A 2X5JO 4PG7A 1NI4B 5T8KC 3EXHA 2B1RA 1ORTA 2FEXA 5EQFA 4LSGA 1P73A 2RIPA 3ELYA 2I6UA 3TIVA 4RVSA 1C8LA 1SELA 4CKBA 2BSQA 3G9ZA 2IZZA 1URPA 4L4UA 1J49A 1HG0A 1PEAA 4KR0A 4RZXA 4UHEA 3K35A 4RMIA 5ENDA 1J56A 1FTSA 3O8BA 1DS6A 1CUHA 5A0VA 3GGJA 5LZ7A 3I2KA 2M2IA 2X8JB 1NE2A 3X1YA 3QUQA 1N2IA 5CR9A 1JPVA 2ZI7A 4JY7A 1L3BA 4ZQBA 4M0FA 2E37A 4B1FA 4CU5A 4YRBA 4MUJA 3LC1O 1U9CA 5IVKA 2FDXA 3ZE8A 2YDYA 2BGLA 3Q2IA 3H5TA 2I5PO 3MXOA 3OZ7A 2OCBA 1WXDA 4M37A 1FZQA 2J4DA 2IUEA 1WCV1 5AICA 3VR3A 5IU6A 1CUZA 2YVKA 2XSZA 4BN4A 2GJ9A 1UWLA 3D8UA 2A88A 3AB7A 3WNZA 2J6BA 4AB1A 2OV4A 5TEWA 3TGPA 1OAOC 4ZKDA 2QG9A 621PA 3PSAA 2DHDA 4KYIB 4TVKA 2QXTA 2XQGA 4F96A 1LY1A 5AIBA 3GOHA 5AVWA 5A6SA 3WZMA 4C0AC 3OE1A 4W7SA 1A0OA 2NO0A 1H2XA 2BLNA 2D0PB 5IPFA 1AQ6A 4N7MA 1ZCFA 1EBBA 4I6JA 3VHXA 4AUNA 1KF0A 1IM8A 3CGGA 2Q8PA 3DMTA 2QMOA 2JAHA 1JLLB 1HOTA 3CH5A 3HPRA 1BWRA 1DLIA 1BKDR 1EPUA 4J3NA 3MELA 1Q0ZA 3ND8A 5IJXA 3QKIA 3WYCA 2E85A 4MA0A 3WL6A 1G9TA 7YASA 4ESEA 3J7TA 2KB0A 2HN9A 3UJHA 2IXBA 4QIHA 5T4FA 1E7WA 4PIMA 1V39A 4ZT6A 2B92A 5CX1B 4NTZA 1JKIA 1I2ZA 2EFYA 2REOA 2CLKB 3QJ5A 3VBCA 3WGYA 5ABPA 2P41A 3ZU2A 3UMSA 4JC0A 1PJZA 5FI0B 3SICE 4KR7A 1HFKA 1SGWA 3QF4A 2MU1A 1PFGA 4ZVPA 4C20A 2HMAA 3IQIX 1G8MA 4E08A 3JQQA 4IMIB 4IIHA 1P3DA 2WKSA 3GC6A 4IHQA 2OM2A 1VE7A 3BBLA 1NOJA 3I6QA 3K2BA 1UINA 1THTA 2PS3A 2VSYA 2DC1A 4NZMA 5A1JA 7MHTA 3FNHA 2YNMD 5AYVA 2JFXA 5E4TA 3ZE2B 3VSBA 2EKQA 2ODBA 1LPMA 3DZKA 3GLTA 1JHOA 4U2DA 3RS4A 3SC3A 4HSGA 1OBVA 4L72A 3K73O 2BSXA 4BGVA 2ID9A 1I6LA 3IX7A 4Q1VA 3UAVA 5C8VA 5AVTA 2OXFA 4QGGA 5LZ9A 1K3FA 5KNLA 2PE5A 4GDFA 2PFKA 1FTWA 3HWRA 4BO0A 4BB9A 3ZBUA 2CK3D 3OX2A 2AZ4A 4MRSA 5ARBA 3AVYA 4LI0A 4PZYA 4FYKA 4HNRA 2Z4SA 2G09A 1XOIA 2ZJ1A 3MWLA 3UB4A 4ABYA 3AB8A 3BBPA 4YBRA 1P74A 3KYCA 1E6EA 1O8CA 4FZVA 3ZX4A 3D6UA 5EIEA 1Y1TA 1NU6A 2R96A 3ADOA 1ATIA 2FE1A 4IOKA 4UW9A 2GYUA 2D0DA 2XA9A 1S3GA 4RYDA 4EWLA 1PLLA 4EW1A 2CHVA 4IKOA 1ULUA 3VH1A 4IUCS 5H5JA 3TIIA 3HKEA 1E7MA 3N70A 3QFTA 4JNCA 1T36B 3FKSD 4ERXA 4ZALA 2PZKA 3IP1A 1DTWB 3VA7A 1CR6A 3D3NA 3P5BA 1YHYA 1DQPA 1NKVA 1N34B 3DDNA 3GLGA 2YYYA 4TN5A 1E1KA 1KDOA 1KP3A 2B99A 4L4RA 1Q0TA 2IWHA 5L3SA 3CPHA 1J5XA 1WBBA 3G5UA 2C2BA 3KJFA 2ECKA 4GLOA 4RY2A 1XAGA 3V3TA 3EEYA 3WGHA 1R9GA 3CU5A 3LC7O 2GEFA 3KVYA 4GP9A 4JBXA 4URZR 2HT1A 1QU2A 4MVXA 5DM60 1I7LA 4XYBA 3OWOA 4N5IX 4PSVA 1SBIA 4RPIA 4X41A 5THQA 4QXPA 4D3DA 2XHZA 4C7MA 5DCYA 3I28A 1ZI6A 2PGLA 4N54A 1ZI8A 2C58A 1D1SA 1JR3A 4QJ4A 4RD1A 2EZ9A 4PGMA 5L3QB 3HYSA 4JLMA 5EXSA 2SCUB 5JC8A 4EB8A 1TF7A 2QT9A 2XD4A 2FTKE 1WVMA 4WOCA 4XE5A 5FPPA 5M34A 2C7PA 3H9CA 3DVRX 4TQ9A 4X63A 2FV8A 4A8JA 5IK2D 4IWYA 3SDBA 5A3QA 2HK8A 2QRMA 2L82A 4W7HA 1XCMA 2YTZA 5HJ2A 5BVHA 2CVPA 1CF4A 1XAIA 4HNAB 5CK4A 4PCAA 4N5DA 5CFLA 5K9ZA 3CSUA 3MFQA 4LY3A 3KB2A 3H5RA 2NXNA 3KE9A 3LCMA 3L79A 4R8LA 2QNBA 2A86A 3DOJA 2X6TA 4UUPA 3LQFA 3W7AA 5AW0A 1AKQA 3GUCA 2EIXA 4O4JA 2QTTA 4TSFA 2BKUA 1Z4KA 5EKSA 3SKYA 1ODJA 1CUBA 1RRVA 4HWTA 3GT0A 4MWEA 4PLCA 4RFLA 5J43A 1HFJA 1XCBA 1XK7A 4DBLC 3NHWA 4JLBA 7ADHA 3EC7A 3OCCA 4W5WA 3WB9A 3AR6A 1JSXA 5KREA 5FLXA 3ER9A 3F73A 1ORIA 2JKYA 3H87A 3KZMA 4R31A 3T9FA 3SVLA 2BGKA 3LVRE 3U31A 1E4EB 1UKAA 3A7EA 1GPBA 1X1AA 2AUNA 5TQJA 4TZ0A 3RG2A 3VH2A 4RH1A 4UATA 1M6VA 3ZU4A 4BVKA 4EF5A 2Q5JA 5CLHA 2DQKA 2PX5A 3CCFA 4LRWA 1DBQA 2EDCA 3EWSA 1I5EA 3S2GA 4HFJA 3WZ2A 4DIKA 5BWMA 4OEHA 2HC9A 2QZ4A 1U4NA 2WIDA 3D81A 5GJWC 3N6VA 1Y8AA 4P3YA 1OHHA 3LFTA 4GX5A 1AQUA 1JQLB 1UM8A 2OHXA 3CLVA 4GBJA 3RSHA 2FEOA 3VJKA 2ANCA 2FFBA 3WBJA 1GA6A 1UXOA 1KEEB 1WQ1R 2MSNA 1J0EA 2OESA 3PFNA 3OPYB 4YEDA 4Z9BA 4KLAA 1P9OA 3S1SA 3ZVRA 4EF6A 4ZN6A 4W5RA 1A7UA 2XJ4A 3OOYA 2DBYA 3ZV4A 1U0OC 4NJMA 3FLBA 4LZNA 2PZEA 3O93A 4O3MA 2REXB 1N2OA 1LQUA 4M46A 3Q9LA 5BN3B 2CV2A 1YMQA 2FJ0A 2OGSA 2RGXA 3A06A 1BWSA 3BRQA 3IMKA 3KJGA 3P2JA 3DOCA 4V0OA 1P9NA 4LTDA 1WUKS 1PDOA 1NXSA 2NUTB 4JHLA 4HUTA 1CW2B 1ACMA 2R7MA 3LPNA 1G9XA 1EUDB 3PNKA 2D06A 1RQ2A 5GVRA 3V5NA 1DC8A 1PW5A 2CL7X 1TPZA 1Q3HA 3KT0A 3CRZA 3TECE 2GM9A 1I3LA 2V1XA 2PXHA 3EVTA 2DFVA 3O21A 4DADA 4JXXA 3ZCRA 5KSOA 4X7PA 3DD1A 3HBAA 4NL4H 3HXOA 3BB4A 1C1XA 2FOIA 2IHZA 1O9GA 3IVAA 2QDXA 3IUJA 4L9RA 4B46A 4MEAA 3E53A 3ODPA 1W6RA 3TBFA 3QM1A 1ORRA 1FFAA 3N0RA 4F4JA 3Q1LA 3K9LA 1KA9H 1XZEA 3HNRA 3T7EA 1Y37A 3OTWA 1M7HA 3T61A 3NXKA 4Y2PA 1NW6A 4E7PA 2ZRGA 3WGNA 2CXPA 2AN3A 1N8NA 2JI8A 1X15A 1JGTA 3MOGA 3DOFA 3D7MA 4GZ5A 4PFQA 2A1IA 5D86A 5AKYA 3ESXA 4MHTA 3AWIA 1XFAA 1PVVA 1T0JB 1U5CA 2WF8A 3KOUA 3MERA 2YL2A 4RZUA 3EPKA 3A3PA 1OLUB 4XD7A 2AYYA 2HQ1A 5I9TA 4LWZA 4U2CA 1B73A 5JAPA 5I01A 3ZBPA 4UMVA 3BWBA 3SIPA 2WDPA 5LA6A 1XPRA 1X9IA 4JLNA 3KOXA 5TMEA 1ZKDA 2P11A 4L73A 2HWWA 5EESA 3EY4A 1HEIA 4NFSA 4QFDA 3VDNB 4CL3A 1AMNA 3K16A 1HEUA 1WTAA 3D5TA 3HV2A 4ZCPA 3JWPA 2HM7A 1C0IA 1BXGA 1YA8A 4BLVA 2XZOA 1DADA 1OZFA 3NP9A 2Q4BA 3DAHA 5I5GA 2ZR8A 4RA9A 2ECPA 5CT6A 4JI4B 3ZHXA 4PCVA 4W1PA 3NI2A 4LC9A 1TKCA 1V96A 3HU2A 4Z54A 4IFTA 4PZUA 1VJRA 1GL6A 4GRAA 2C9OA 3AETA 4Q3NA 2A5LA 2OD7A 4R0VA 4XM2A 5DYTA 2ORED 5KKAA 4CKWB 2H4JA 1CZUA 4NYJR 2DETA 1GCUA 2EGHA 2HL6A 4HDMA 1FS5A 1Q95A 3HB0A 1R5JA 2EG5A 1L7QA 3HJGA 1VMIA 1YRQA 2VYFA 3AGPA 2PBRA 4FZ5A 1KVTA 4PF1A 3R75A 2H4XA 4ZP1A 5C1BA 2H08A 1E2JA 4RA6A 1G55A 1KJIA 4G5FA 3IBGA 4K9LA 3ZWVA 4DHEA 3VU8A 3N2ZB 3RQIA 1NF3A 2PT9A 4Z9XA 5ITSA 1AQNA 1NMXA 3MZ0A 2X3UA 4JP2A 3ZZMA 1ZQ1A 5HF5A 4PZ9A 5HFJA 3EXEB 4FYXA 2QP4A 3G1WA 4QDZA 4RM2A 3E48A 3ETHA 3SEQA 1T0BA 2YC4C 1SHLA 3QUTA 4YRDA 4JP3A 2QRGA 2P8SA 1HETA 2PKQP 2GLXA 1L4UA 2SKEA 4H6PA 4YBZA 5E9QA 2Y27A 3VX4A 2QENA 4WK4B 4BWGA 5BP7A 3BTVA 1YI0A 3WIDA 1E9VA 4QOGA 5FUMA 4NJEA 2CV0A 2Q07A 1Q0PA 1G18A 2O0MA 4MLPA 4PX9A 1QV7A 1AUVA 2EYUA 3PUJA 4C2UA 3RHZA 5C8DA 1VL1A 4D4MA 4EGCB 2OZPA 3W5DA 1KI6A 4EY3A 3AF1A 1G66A 3IIJA 2FPSA 5EJFA 1VLQA 1ABEA 3COPA 4UHDA 4YRNA 1TD9A 1YIDA 1R50A 4CHTA 4N8SA 2ZPTX 4FIZA 3PUVA 3UAZA 4PGAA 5TJHA 2I2AA 1RPZA 4E46A 4KG7A 2HGZA 2JBWA 1K92A 1R64A 2ZJZA 4MGZR 4N47A 1AV7A 1E2QA 1Z0UA 4BAUA 2R1TB 3MWEB 2O8EB 2EYQA 2J9YB 3RVBA 5KX5A 4JODA 2ZSDA 2A9KA 3F47A 3IP3A 2N1BA 1WX1A 5D3MB 4WCFC 1REQB 2HLHA 4IG9A 1GG2A 1RNLA 3H2HA 4KJXA 4IDEA 4OBBA 4ROSA 4NCAA 2OBLA 3T0FA 3ZE1B 4DTCA 5IMSA 3NVDA 2DLCX 1KGDA 1EGQA 2FSVA 4RHUA 1DQZA 2EX4A 4NONA 4D98A 1DWPA 3M6MD 3ZGLA 4HOYA 3O03A 1VMKA 1G2OA 3JR3A 1N8SA 4F3KA 2AG6A 3FI0A 2OEPA 3EFEA 4F8JA 4CMEC 2XRMA 3ASUA 1FPMA 4PTLA 3GA0A 2PGAA 1JALA 2PEZA 5KTNA 3GT4A 4C0HA 3L1KA 4BLPA 1SMKA 4WZBE 4YACA 1V2HE 1XD9A 1J07A 2QTAA 3MUFA 3QRWA 4RDXA 4G8DA 1YB2A 1TIKA 2PPLA 2ZYTX 4LV6A 4OLHA 2ZQ5A 3NZEA 1Z2EA 4Z2YA 1IMOA 1JHVA 8AT1A 5BNTA 2UXDB 3JD0A 1ADBA 2PX4A 3LMKA 3H6HA 4PPYA 5KCZA 5FTWA 5JISA 3T1YB 3JALA 2VUTA 1ANKA 4YQZA 1X80A 3O31A 1UP6A 1MAVA 1EFKA 5T67A 3CVVA 2VQDA 3RAJA 1OFUX 4U9HS 3N8GA 1PG0A 3HCNA 4DR3B 4H17A 1E1QA 4Y2QA 3GAZA 4CTMA 2GPTA 2W48A 3GEMA 4TKUB 2PX8A 2X6QA 3AEKA 4JP5A 5DBEX 3OD5A 4UUAA 1V5IA 3CNQS 2B69A 3MILA 3SS7X 5FPKA 3QYFA 3OOJA 5CB4A 4FI3F 4LDNA 1TQ6A 2IQ5A 1K98A 3NGLA 1YB4A 2DPGA 1F51E 2Z43A 3AW9A 4K1LA 3IPYA 2ES4A 2GVNA 3WKDA 1IRXA 3HZRA 4MQEB 3Q7RA 4G1CA 5AW8A 4H27A 4LWQA 2A5DA 3N58A 1YB7A 4LRYA 2C5AA 5DU2A 3KXDA 3GPLA 5DCWA 4K03A 3IKVA 1QBGA 1XE3A 2HRRA 4CLOB 2H7YA 2KMLA 2PRIA 4TMWA 1XNJA 5LNK6 1BE8A 2F1OA 3ZOKA 4LSZA 4K0KB 3HKBB 2EL9A 5FJJA 4OQLA 3ZJ5A 1TVKB 3RLFA 1HDOA 3BHJA 3HNPA 1DOAA 4YJ3A 1LPPA 2BMDA 2XLCA 3H8VA 4MMXB 5DT2A 2IYNA 3UJ6A 3UO8B 4CETA 1O1YA 1EZZA 5K20A 4JVMA 1IM5A 1LI7A 1RDFA 4HDSA 2BH9A 4MS1B 4N18A 3TRIA 1P91A 4F11A 5IXSA 3HXQA 4MDFA 5DNCA 4N3AA 4KFUA 3HJNA 2QG4A 4OGKA 1BSVA 5BN4B 1GGEA 5TXGA 2Y4NA 3JQ6A 1BMFD 3RR2A 3UWKA 2ZRPA 1EP9A 3NW9A 3MCTA 4JJ8A 1X1CA 1FYXA 1XCPA 3QGMA 3ZNPA 1Y5MA 4KXLA 1N3BA 1ZIXA 1A27A 4JS0A 5J4KA 1K6MA 1TQ8A 3BZBA 4BO9A 3IE1A 2KPOA 1WS6A 2WTEA 3OZCA 3QKSA 3R9XB 2VZ8A 3QUCA 4X54A 5CB8A 3VSDA 3W5BA 2GESA 2Z9BA 3FCCA 5CLIA 4JT2A 4AJJA 4EY7A 1FJGB 3FCAA 1JNXX 5DP2A 4ZOQI 1U8EA 2RHHA 3CURA 3DLAA 4BKMA 4O4LB 4GVXA 4PRLA 2C20A 4D5EA 2GERA 3BULA 4JFRA 2QTZA 4OU4A 4L5JA 1U1CA 4AD8A 5B5SA 2GXSA 3LBAA 4M1ZA 4E5UA 1RHRA 3THWA 3FW1A 3C7TA 5AVYA 5J47A 2R5FA 1KXJA 3SYLA 1I7PA 1K6XA 1M0WA 4RF3A 4QTYA 4OQ4A 5CYFA 1BO6A 5T4HA 5FFNA 3E5HA 2YNMA 4ENTA 4M8KA 3IDFA 5DBFA 4D8VA 5BN5A 1BVUA 1U0HC 1N77A 1OXXK 2WR8A 3PPIA 1V2GA 4F9FA 2AX4A 3NM6B 1GUYA 4EEZA 5M5BA 2B7CA 2MDTA 2DHQA 1O97C 2J3MA 3I12A 3VHLB 4DIBA 4JP1A 3L06A 4M99A 3TL2A 3KOMA 1B76A 3CEHA 5ANRB 4AJIA 4B0OA 1H1DA 3V4ZA 1U2RA 2JFZA 4NBRA 2X0DA 2CK3A 3G0HA 3C1AA 4G0XA 3SJCA 1F2UB 2ATXA 2EJVA 2YKGA 2CNWD 4JR0A 4BRSA 5D8DA 3MMZA 3SFTA 5A3RA 4IILA 1YVRA 2BM9A 1ONBA 2GHIA 1EWTA 2XUHA 1CUCA 1ULSA 3DCIA 1U8FO 3V80A 3TD6A 3KQWA 3GFPA 3DE4X 2V6MA 3G6WA 4HWGA 1TLLA 2PXAA 4LVUA 1TZ2A 3EBPA 4UDYX 5FNZA 3UC5A 4E2ZA 2CLHB 4OB6A 3FKSA 3E9MA 4DA0A 3R23A 4N4AA 4UEWA 4NNPA 3ORYA 2PWBA 1YDGA 3G5LA 1A5BB 2H63A 4NIMA 3KTOA 2PUDA 1CY8A 1FFHA 3JQGA 2CFRA 1I7NA 1VE3A 1HBJA 3LT0A 4IQGA 3STTA 1CR1A 3DR3A 4ARBA 2ZJ2A 4ZT3A 4MRAA 3ZEIA 5C1OA 3IL2A 1MGPA 2XHEA 1S7CA 3F6YA 1QHXA 4AAYA 2PUWA 3INRA 4Q1DA 5HQ3B 2R84A 3BXEA 2JASA 4B6JA 4ZIRA 4NPCA 5E6RA 5K3FB 3HZZA 3CLTD 4DS3A 3DMYA 3HUTA 3W6UA 5B6JA 5FH9A 4Z4FA 2C82A 1SG9A 1RYHA 4X0EA 4BLUA 1NV9A 4J1TA 2C84A 3PT5A 2NU8B 4TXNA 2Q7DA 4ETWA 5JQWA 2QBYB 5FEUA 4RJTA 3ROTA 5IBPA 1F17A 5HOEA 3PC7A 1GPJA 1J2YA 1GZHB 1TYEB 3C41J 3HR8A 5KKNB 3W3AD 4DCCA 2AOTB 3DWIA 3NP7A 3UWSA 1A8PA 1Z07A 4FILA 3A8TA 4MR8A 3GDGA 4NECA 5JNLA 2WP8J 3NWJA 4L7VA 5IK2A 2OORA 5DMHA 4MTLA 3A58B 4MRPA 4HAVA 2PU5A 2KQUA 3EFOB 2EFJA 4FXPA 4WHMA 1ZNQO 3BVPA 1JIKA 1SZJG 1U80A 1MPTA 3AIOA 3UGKA 5LIRA 1WG8A 3WE7A 5LFAA 3WYDA 4UBJA 1Z0JA 2MSDB 5IZCC 3FPJA 4OP3A 4D4IA 3ZVNA 3TE6A 5EE9A 2FR8C 3KTAA 1ZLXA 5BNFA 3ZGYA 4DPLA 3UMMA 2PO7A 1X1TA 4K6MA 1B6TA 3UQYS 1XFDA 3Q15C 4QE3A 2GZSA 4IXDA 5FPHA 5JFGA 2FOLA 4HRXA 3RG8A 5LB4A 1PT5A 2OMEA 1IK6A 2BFWA 2QUZA 2RB5A 3BXOA 1P2SA 3IAFA 5CT5A 2WZBA 3ONDA 4QRIA 2BKVA 2D2EA 4QUDA 4RHCA 5DK6A 1GGKA 4H08A 1B26A 5ALHA 5DHAA 5EC8A 1VLZA 3WLNA 4B32A 1SXPA 2QZSA 2G1PA 4F5EA 3G13A 4JT9A 1OB5A 1QKIA 2H31A 1O5OA 2IHBA 2VRNA 1RFGE 1PS9A 3KFXA 4GU5A 5JYDA 3DVLA 1GPNA 2LTAA 1HE4A 1J8QA 1KR5A 1WMDA 2KX7A 3A4MA 1N2ZA 2QOEA 2DPXA 1ZITA 2PGXA 3L0IB 3R44A 2XB8A 3WIVA 4CMAA 1RP1A 3KJZA 5K6TA 4B7CA 4RY8A 1JBEA 3RAPR 3P8ZA 1JG3A 3FF4A 1ZJWA 4JJFA 1T8PA 2WWFA 1AOXA 1ZXXA 4FKZA 1ORVA 2IHTA 1T0PA 5D5QA 1B0AA 2FAXA 2QP9X 4YJGA 2XKBA 2GBFA 3AJDA 1BYUA 4YRFA 5FR1A 2FF5A 4FBLA 3UCXA 4N82A 3KM0A 1T3SA 3C14C 3O8OB 4UULA 4C7VA 3R3UA 3DB1A 3OA2A 3S40A 5HKAA 2V1UA 5F3WB 1WB4A 2ZRHA 4XB1A 2HSEA 3CUTA 3FTNA 2GAIA 4IGKA 1ST2A 4LMPA 4U2FA 3OQVA 2QX7A 1JXAA 1Z3IX 2IWRA 4JYMA 4MV3A 1R6VA 1RM0A 3EF1A 5TV2A 3CYFA 1JR6A 2FWNA 1LJLA 1MDBA 2D5LA 5JASA 1IONA 3OCVA 3PQ4A 4KXUA 4R1NA 3TUJC 3KPVA 2X19A 4MW7A 2QX8A 3ZZNA 4DV5B 3HDTA 1D6NA 1Z17A 4UJ3A 4UKDA 3RYTC 1U8AA 3MHTA 4KQ1A 1E1CB 1G63A 2CBGA 3H2JA 3OZRA 4WV3A 1ORWA 5TDHA 3L7BA 2ZU0C 1FY2A 2WVJA 2POCA 3AHHA 3VAZA 5GTDA 3U56A 4G0YA 1IDOA 1T15A 1KAEA 3FWPA 4JI2B 4Q05A 4ZAZA 5HA5A 1DT5A 4M8IA 4G5RA 1XP8A 2CL6X 3EA4A 3IQEA 2OHVA 3JAKB 2O1WA 3L41A 4TT3D 5F9MA 4EB0A 1KDTA 3GGSA 5JAQA 3K8QA 4KYUA 5SYAA 2D5AA 2YRFA 4P36A 3VNAA 5IF3A 3DXYA 1Y80A 3QVMA 3ANTA 4HWSA 2GTIA 2BC9A 3AY3A 4X90A 3TTSA 3WRXC 5C7IO 4JK3A 5KVQA 2AZXA 1DKNA 4F0JA 4ENUA 3JZMA 5TQVA 4F6CA 3H1BA 5CXUA 2Q1SA 4ZYTA 4FQ7A 1SQFA 2NZJA 4OUDB 4K7JA 4KQ2A 5E7IA 5J2UF 1LVGA 1E6KA 1SIUA 1Z4PX 4Q34A 3SXUB 2UYHA 2FPXA 3UK2A 2VUHB 1ZUHA 3STUA 4FYJA 4B4VA 2XCSB 2D2XA 1NW5A 1UJCA 4DRZA 3NFYA 3VPFA 5A1TA 2X1LA 3NJ4A 1OIXA 5BSGA 3OF3A 3AR4A 1O77A 3TVDA 1PUIA 2H5IA 1GZVA 3DFMA 3B3FA 2WWYA 4HATA 4F21A 1ARZA 2H11A 1W5TA 2Y1LA 1PKEA 3CZAA 1H2AS 2GNAA 3GLHE 3UH0A 1R3DA 2D5IA 3ZGVA 3OHSX 4LDZA 3U7FB 3MGGA 4FHCA 4I0WB 1IEVA 4OO3A 4BB6A 1CUUA 1OX5A 1AIPA 1LBTA 1QSGA 1XHEA 4U7HA 1YTUA 4A8PA 1IU9A 2JFGA 4L51A 5ILQA 1PGOA 4DB2A 1AHPA 2P6OA 4OXNA 1I13A 1Y6JA 4LQLA 1JG1A 2X2PA 4HF7A 2C95A 1OV4A 4PLGA 4TLBA 3D3WA 2P27A 1GRVA 4IHJB 2BBOA 2DULA 4OU5A 1Y98A 4PO8A 5JU6A 3R24A 4TXJA 1JWLA 4IAOA 4JXKA 2H7XA 1H85A 4G09A 4RKYA 2YFYA 4KX3A 2D7DA 5DM70 1W85A 1JDJA 3NM4A 4V38A 5AJZA 3T41A 3X1KA 2WV9A 3AUSA 4EHJA 5SZKB 1N6PA 2FWAA 5C35A 1K1EA 1Q1BA 3QU5A 4CT0A 3QE0A 2GN8A 4G9EA 2VCEA 3NCHA 3RT1A 2MSWA 1LFAA 4IDGA 3ZHBA 2OK8A 4AQYB 1GTZA 3ZKAA 2OBXA 2ZJ5A 4Q9JA 3GPIA 2YRXA 1EXWA 1M1ZA 3QVUA 1EVJA 2E3JA 3ISTA 4G37A 2FQXA 2ZB3A 1AKVA 1FNNA 2H1CA 2HU5A 5EQTA 1ZM7A 4OI0A 4BATA 4E0BA 3IRUA 1XD2B 3P45A 4W1QA 2QX4A 3HCBA 3NT4A 1LJ8A 1XVIA 2CBZA 4KPUB 4NCXA 3R9IA 1UK8A 4YRZA 2PR2A 2XMBA 4UQLA 1B42A 4I5IA 1XZKA 6REQA 1PFVA 2JCVA 3MGKA 2Q8NA 5AK4A 1MORA 3CNNA 5CNKA 3U4AA 3UM9A 3MT8A 4ZT5A 1KYTA 1EAMA 2CLLB 3ENVA 4LHEA 4EPXA 2BI7A 1FU7A 2HLPA 2VK2A 1BCRA 4G2NA 5FBRB 5LOVB 4FOSA 5B3JA 1ACJA 1V11A 3RUFA 5DYIA 4YR9A 3CUWA 4LQ4A 4O0MA 3AR2A 3KTFA 1KI7A 2ZP1A 5FCDA 5C37A 1JXMA 3FBGA 2A5FA 2ZUTA 4NZPA 4D9KA 5FL7D 3PWZA 1SQSA 4TV9B 3CJRA 4YQYA 3A6DA 4BXOA 4I9UA 1N0HA 4IBOA 2FMKA 4YMIA 4YCLA 4D25A 4J91A 3UT0A 1C9KA 4OX9B 1GAXA 1FLVA 2JGAA 2VH1A 3F4BA 2GN1A 2A1TR 3FF1A 3IEIA 1N33B 1I51A 3EWIA 1II8A 4HEA6 5HS6A 4UM5A 5KWEA 3U4QB 2VF7A 3G2PA 4UVIA 3AVXA 1SHTX 2YQ4A 3KEMA 2IS4A 1KVRA 1OXKB 2AHRA 4UBMA 4H0FA 2PNJA 1LS6A 1YQQA 1JJIA 3KPJA 4ZRDA 2ZBDA 3RPEA 4CDGA 5LQNA 1X7YB 5K0GA 4W8OA 3UUWA 2C8KA 2YXDA 5A9SB 1SXQA 5EVJA 3ZI4A 2QV0A 2IZ7A 3TGLA 3AFNA 2ZSUA 3GJ5A 1CQIB 2R3SA 4Y9TA 4PYOA 2JI7A 4PFSA 3V34A 2IL1A 4DC9A 3WKBA 2FUEA 1GT6A 4Z4EA 3P9ZA 4EP1A 4WJLA 3HABA 4DQXA 2EWWA 2P1RA 1ZW6A 3AXSA 1FLNA 3DEJA 3AY7A 4NQZA 4O4JF 3FDFA 5C80A 1NZFA 4JMPA 2Y1DA 2RHDA 1JFVA 3FVVA 5I9IA 2G6TA 2I33A 4DUPA 4OXIA 4RKEA 2OC4A 4ED9A 4MWZA 4XWAA 1A4IA 3QX3A 1TA9A 3UGQA 2HOQA 1EMDA 1XKXA 1IY0A 3O91A 5K3CA 2AH5A 4Z1OA 2GPWA 4I7EA 1A9TA 1AO3A 2VPQA 3V1MA 3PI7A 2XUKA 4LRQA 1ZA2A 3RV4A 2OYSA 1XXHA 2I2FA 3CO5A 1O94D 1X2BA 1Q1QA 1FU8A 1BTOA 1CC1S 2BGJA 2I7TA 5A05A 4EBBA 3R5JA 3CCCA 5DGIA 2OQIA 4Y6QA 2QNIA 3CW8X 1CTQA 2D0OB 4NYMQ 1XGKA 3PV0A 3HUDA 4V1CA 3DZ8A 4XSHA 4GL2A 1IG3A 4EQ6A 2VUUA 3GLGE 1ATZA 1RM3A 1OBHA 4MRVA 4MVJF 5IUKC 3OKPA 2XADA 4GH5A 3U61B 1ZXBA 3WMRA 4AXXA 2DF8A 4IDCA 2E1PA 4KWCA 2LCQA 1FXSA 4GOOD 4UD2A 3WK8A 4JLWA 4MVJH 4QJBA 1RJFA 3KWLA 5EZ6B 3A2KA 3P4XA 1RYEA 5HFNA 2IBSA 2W2QA 5JQGB 2F9MA 3LL4A 2AG1A 1JA9A 4P35A 3ZD9A 2PS9A 3FIJA 1G20A 4TZ6A 1Q11A 4GEKA 1B16A 2OBNA 2VYND 4ZXPA 5C51B 3ED1A 1BMFA 2NMVA 3GRCA 1QTQA 1VBKA 1XQXA 4C4SA 2L2QA 3HKDA 1E9SA 4RVOA 4UNIA 1RI4A 1JR3E 4YV7A 3HYLA 3DHYA 2C7QA 5KUTA 1DAMA 3H2KA 3HADA 4DLNA 3DL7A 2DSTA 2QM7A 3MB5A 1IIRA 1RR6A 3U62A 2VR1A 3M4NA 4PNZA 3A32A 4MQ4A 4MGKR 1KAQA 5CLQA 5JDIA 1VKZA 3IBSA 4TM8A 1S2LA 4LXYA 4QPPA 5JTUA 5TGTA 1I4WA 2FZLA 4PHFA 2CYBA 3BGIA 4LZZA 1VSUA 3VZQA 1P77A 5MGNA 3NDBB 2QS9A 2CMHA 4HQFA 4IJWA 3AUFA 4QYIA 3OU6A 4UVHA 2VSNA 3ABSB 2HIHA 4WL0A 3W2IA 1QFMA 4XCXA 3T15A 4B8YA 3G7NA 1MMFB 1QH1A 1T26A 1UFVA 2WM2A 2JAUA 1ZH4A 2E0IA 2ODWA 3GDFA 3K9HA 4KQWA 4YECA 5EWMA 3U3RA 3T1QA 4CDRA 1UJ5A 3HCOA 1V5FA 2VSXA 3LCUA 2IHVA 1JI0A 2Q6KA 3FCEA 3N2YA 1D7OA 1EA5A 1GUDA 2XCRB 1PS0A 1A9SA 1BOFA 2FDRA 5HHTA 4F4DA 4LYEA 2F59A 3E27A 1X1RA 3MBKA 1JPJA 3Q10A 4HZUB 4TL8A 4D8YA 121PA 1SIBE 3LZDA 4MB2A 4TLCA 4UU0A 5F51A 4FBGA 2H4HA 4HNTA 5F1YA 1FFCA 5LA6F 1JAIA 1XKTA 1XC7A 2WFLB 4MW6A 2GH1A 2VZLA 1LRKA 2AMYA 2PBZA 4KL8S 3TL6A 4WH0A 2OV1A 5G4KA 2R1VA 4PBTA 2ZWMA 1XZFA 4KSBA 1KHTA 1X3LA 3CX8A 1UBSB 4XEHA 4FINA 5HRCA 3D31A 4I6EA 5TF4A 2O54A 1E77A 3F3MA 2CNWA 1RCFA 5JNTA 2YV1A 1W8IA 3ED5A 5ALGA 4IJUA 2W2KA 4FMDF 4C7OA 2P75A 4BNJA 2VJQA 4U7DA 1Z6GA 2OFFA 2J9FA 1SC3A 3NHAA 1IBMB 1W75A 3OF5A 3OLWA 1OJLA 3FRJA 4ZVVA 5C4IA 1NFQA 1SVSA 4CIAA 2QG6A 1XTKA 4QGAA 5IHXA 2JLWA 1KZ6A 2ET6A 4LEIA 2P2YA 4R2LA 1HYHA 1RTTA 3SY8A 1M34E 5KJ1A 4WZZA 1CZNA 4IM7A 4PANA 3N2IA 5CLFA 1L4LA 1VIDA 3COZA 2ZQZA 3H3FA 3ACBA 2QPAA 3KR2A 5CJ2A 5BSHA 4G0QA 3ADBA 2DVMA 1H2RS 3DV0B 5EFZA 2WP0A 2P7HA 3HA2A 3WLOA 1M33A 3GP3A 4IIGA 3ZKWB 3HMKA 1KTVA 3QEJA 3NHUA 2NPFA 5GINE 2O07A 1M54A 2EL7A 3HM9A 3QVXA 1XDGA 4XX0B 3NU1A 5IYZB 4CQMB 2HD4A 2OGUA 3PDJA 5JADA 3O8QB 1N0VC 3K1JA 3DQQA 4M89A 4DIMA 3OX1A 4ZDKA 3ADKA 3TSYA 4FJ0A 3ZQ6A 1Y48E 4C7JA 3LT5A 1WW2A 3S8MA 3SFZA 4QFBA 3VO2A 5DB4A 3W3AA 1EA7A 4Q7MB 5L8VA 3TNJA 1JZSA 4H6WA 2AG5A 3U44A 4MEBA 4CPDA 4ZO9A 4DKXA 1DQYA 3PQEA 4N40A 1DRJA 2CUKA 2XKAA 3V1YA 4RV9A 4NEQA 1VYUA 4MWGA 2E6UX 1RTKA 2PYZA 1WZNA 3F7NA 4RFSA 5JNSA 2CLFB 1X42A 5DTRA 3ZE9A 4R84A 1ZD1A 3D4BA 2X8AA 4MJ3A 1WV0A 3V4PB 2Q8QA 2R25B 2O5EA 4J0HA 5CA0B 3W8EA 4B09A 5KSWB 3HSKA 1ULZA 1SBZA 3VO1A 1T9GR 1F4LA 1XYGA 2HBRA 2X1HA 2HWYA 1QMGA 1NQXA 4MV7A 4P80A 3SSMA 4MDYA 4ZQCB 2NYUA 4U8HA 1R4MB 2C4MA 3FMPB 3QFFA 5U4XA 4FR0A 3PU6A 5IC5A 4D96A 4EITA 2XGSA 1XJCA 4NJOA 1U2DA 2PL9A 1XEWX 1F2VA 1SUBA 4HZGA 5FWXA 4BNVA 3OZVA 5EE5B 5A4DA 2FP4A 2VPWA 3NNSA 4HD8A 3PE6A 4BC1A 1X19A 2H17A 2X0KA 4EENA 3I2JA 3PDHA 3GFFA 4IQ8A 1EB9A 1K8XB 3Q40A 4BJ6A 4OSOA 1ESMA 2QT1A 3TR5A 3E9NA 4WCVA 5KC8A 1SCDA 2FMXA 1MOZA 4HXEB 5BQOA 3VKVA 1JU4A 1M8FA 3JAWA 3OAAD 4U7PB 2XWJI 3OQPA 2IDZA 2XT0A 4O1MA 5JALA 1GNQA 2VJMB 2RI6A 2IYFA 3I09A 3OO0A 4YLEA 4Z7QB 2Y1EA 4IDBA 4M9ZA 4DCGA 4FLMA 2JK0A 3THSA 3VTKA 3P9XA 2YY6A 3E15A 1Q1GA 4GXTA 2CHEA 3MWYW 4MXDA 2ODEA 3O4IA 5JAOA 3HP1A 4A4DA 2DUMA 1KZGB 2E2WA 5EYPA 1ZP6A 2AZDA 1NUAA 2XNDD 2QMEA 2VQEB 3HFRA 1GTG1 3QELB 3PUHA 3V00A 4Q4CA 1G3QA 1BVYF 3W4KA 3E3MA 3FPBA 5C7LO 1L5QA 1RBZA 2OV8A 1KMMA 3DTYA 2BGRA 4CMJA 4ZJZA 3DEYX 1OASA 2JI9A 4Z4QA 1Z2PX 2FA9A 4LJ9A 4P5DA 1SG6A 2RBEA 4HH4A 2XVMA 3D8SA 3TOSA 4EUEA 1L7MA 1EM8A 4KLZA 2J3IA 1E2IA 1FLDA 3HYCA 2HUNA 2N3ZA 4I9FA 3HPQA 3JV7A 5TPWA 3VKUA 1OGIA 3Q2OA 4DABA 3R8CA 2A1UA 1UPTA 3O1IC 2XUOA 4R3WA 3GFBA 1JAHA 4TT3A 4LF4B 1SB9A 4XM1A 1RJWA 4NOLA 5KNDH 1R4NA 2G06A 4YNBA 5T41A 1HNZB 3RYFA 5JAUA 5CBPA 3D4PA 2EKZA 4BN5A 2J41A 5D7BA 2QD3A 3U09A 5DBOA 4N03A 4L76A 3H18A 1SUIA 1YS6A 1L1FA 3NTUA 2JRCA 3Q3VA 1ZXLA 4X20B 3BA1A 4DQ0A 2UVPA 4KDRA 1H3EA 3PDWA 4DHWA 3NBQA 1TCVA 2C4TA 2X0RA 4HVCA 1BS9A 2FN4A 4LYYA 3WLIA 3EZYA 3HN7A 1Y4DE 4FGSA 1CRPA 3BMNA 2G7ZA 5HX7A 3KAPA 3QTBA 2WYOA 2DR2A 4AICA 2PMDA 1KZ7B 4EEXA 3F5SA 4HRAA 2YIDA 3IAM6 2VAMA 3RWOA 4N3GA 1UEIA 2PQ0A 4DM3A 2FN9A 4CQLA 4R3NA 5ITVA 4RSRA 2QGFA 5G40A 2BFCA 1FFXA 1PR0A 5IH7A 4AJHA 5F3DA 3TLGB 1PV4A 3NRJA 4UNQA 4K81B 3S99A 4EB3A 1C7JA 2QKYA 1NQUA 3K0FB 1FB5A 1RT9A 3GLHB 3H99A 5A03A 1V71A 5JY6A 4JQYA 2OVBA 2VTBA 1T9AA 1I4DD 1P2DA 2BBSA 2F3PA 4PSCA 3S2IA 1IXYA 2MYUA 4IX1A 1N6RA 1GPDG 1ZMBA 4JJ6A 4II3A 1L7RA 3ILXA 4H7FA 3NHYA 3R3SA 3AF2A 1P33A 3ZK9A 4MQUA 1YI1A 1GGHA 3WB2A 1HLFA 5KINB 2BKLA 1IUPA 1UOQA 1XLWA 2PQ6A 1T1JA 4H1WA 4HAOA 5T5QA 3SZMA 5BOSB 5LSAA 4JJ7A 4G85A 3GCWA 4BMDA 3O95A 4AO6A 5GM1A 1NR7A 1V48A 2J0VA 4QC2A 5ER6A 1S0UA 2P4SA 1A96A 1E20A 1RYNA 3WJ2A 2EZUA 5B64A 4GC9A 4JL6A 1LKZA 4ZOEA 3L8MA 1PVOA 4ZI7B 1X7XA 2HCFA 2AGVA 3ONEA 1P4JA 1Y1PA 3K9NA 3PNPA 3ZY4A 4O4HB 2IOYA 2HADA 3LKVA 4FEYA 1N5MA 3CEJA 2OLKA 1FX0A 1RKUA 3LLUA 4IW3B 1GPYA 3MQFA 1CEEA 3G2LA 4QD3A 4HTAA 2J46A 2O7NA 5A62A 1IVNA 2WQ6A 1LBEA 2AEJA 3N0VA 2VJKA 3LL7A 1B6RA 3PQCA 1V6SA 2JAOA 3FYHA 4Q9AA 1P8AA 4WPGA 4OSPA 3T1NA 3IQGX 1RHUA 4X61A 1GNSA 4PAWA 4IH4A 2X4GA 3P26A 1A5AB 4P0TA 4G5SA 4EGAA 2KWIA 1EVKA 1PTJC 1G59A 1CRQA 3EIUA 2C0PA 5A6SB 3WNQA 1VDMA 4GECA 2I9PA 3SDZA 2BTEA 2ZRQA 4GI3A 3ZXYA 1BVRA 5T3UA 2GILA 3Q3JB 1YWGO 1RVV1 4JELA 8ABPA 1VQ1A 4AKGA 2NV0A 3EIXA 2CZCA 3H11A 4PZLA 3X1ZA 2P1ZA 4GPEA 4CN9A 1NVXQ 4MR9A 2G4LA 5CA1A 3ES9A 4RGBA 5FL7A 3ZDCA 3IVXA 1FL9A 4OHXA 3L0ZA 1IHYA 4KLCA 5EI5A 5FAKA 1FNDA 2J9ZB 5HILA 4HR7A 4LX8A 3VOSA 1KJWA 2WOOA 2POQX 3C3AA 4IWNA 3SYTA 4L4XA 5FDFA 2HZ7A 3B82A 2VCHA 4OAOA 4Z0HO 3PFGA 3UANA 3FUCA 1EFDN 3ZY3A 3ZIAD 2IH2A 2CNKA 3BGDA 1OUMA 5CXSA 2Z5FA 4M8SA 4EDFA 1ZVKA 2GVZC 4O59O 2EJBA 4GKJB 1U8TA 3CVWA 1YR3A 1QGOA 3BXHA 4WDRA 3DDHA 2BR4A 3DD5A 4OSEA 1GRQA 3VISA 2A0KA 4LY0A 1W2GA 1H2HA 1ZM2A 4G5GA 3PGKA 1D2MA 4MW4A 3O1JC 4WASA 1J09A 4Q01A 3EA5A 2YMPA 3FLEA 5JBIA 2HR1A 4RHEA 5L6MB 2RGEA 2YV3A 1IOLA 1U7WA 8ATCA 3IT1A 1YT5A 2O0KA 4NBTA 4O08A 2IPMA 4RPCA 3O73A 4WUTA 4Y18A 2CHFA 5TMPA 1CNEA 3SXPA 3OT1A 3W79A 1ZEMA 1ZK3A 5CFNA 2W42A 1D0VA 2QTLA 4N5MA 1DHRA 1JX6A 1USWA 2AXQA 3EYAA 4WMLA 3T7DA 2IHJA 1DO2A 2VUSA 3I9OA 1X87A 2WPNA 2DH6A 1E9RA 5CDHA 1U3TA 1UKEA 3ELUA 1BROA 4MUYA 4XX1A 1R0BA 2WG2A 4BMCA 5L45A 4I36A 5KYXB 3ZHCA 1I2MA 1PZFA 1QG6A 2JJYA 1N2BA 2B37A 2RB4A 1QAQA 3JASA 1MA3A 1BIFA 1R1DA 5DW3A 5E8RA 3NXSA 4D8WA 1K3TA 4EB6A 1O94A 1ZNYA 4TYYA 4EVQA 4KRXA 1WZUA 2FUCA 3SM9A 2FEPA 3PS9A 2I71A 4Q4HA 1XG5A 3R4VA 3G0OA 4Q9DA 3VNUA 2C3OA 3QOWA 1F14A 1A8UA 4I5EA 4UAGA 4ZOLF 3DOIA 1VKHA 2ZUDA 1SOMA 3KKOA 1U7OA 5HKKD 1CYDA 3VZCA 4LYDA 1H0HA 5C5CA 1Y6FA 3QWHA 3FJOA 3V8QA 1N2HA 1WD5A 4Y9RA 1O58A 3FMFA 5DHQA 2CYCA 2DHEA 2SKDA 4EYKA 2WJPA 1L3CA 3TI9A 1P0QA 3O83A 2GLTA 3K9CA 1NDHA 2I78A 4XXHA 4IVQA 2AX3A 1NBAA 1EJ6A 2XIJA 3DE7X 4Q1EA 2DFTA 1DJQA 3GRZA 4FW9A 4RZQA 4BEVA 2F55A 5I9SA 4GT1A 4IIJB 9GPBA 5H1YA 5HPYB 1UIMA 1MX9A 3SMVA 4FB5A 4F2HA 1ISPA 4HG2A 5A4FS 4MO9A 4TX1A 5M3BA 3HY6A 1LDGA 4UJ5A 5CM2Z 1O6CA 6CHYA 4QPZA 2IYZA 1YR1A 5LBUA 4EUKA 5TGDA 1AN9A 3C16C 4E1VA 2CNDA 4DIUA 1TKBA 5ES4B 3THXA 3MLEA 2PJUA 3JYNA 3LKBA 1PWYE 2YR0A 1QG4A 3IVMA 4Z3DA 1DX4A 3A9WA 3PHLA 1M2HA 1I1HA 1W88A 3BOSA 2DJIA 1HQDA 4A5OA 4EDHA 2CJWB 1C30B 4JZYA 4PN3A 4AY5A 3T9EA 1PWEA 4D99A 2HK6A 3ZU6A 1FDVA 3NKVA 4NULA 5ELMA 2V7GA 3R7BA 1SVOA 3C6QA 1K6IA 3OCYA 2ETXA 1QJ4A 3HWWA 4ZEOA 4MO2A 4HDKA 3OFVA 1ECJA 1YS9A 1N75A 2YFQA 3WRYA 4IUBS 4WZAA 3TOZA 4X1KB 8GPBA 2Q0SA 3WNCA 2B4QA 3L49A 4B6RA 1FQOA 1HLGA 3MQ2A 1N6NA 3PF8A 2QN1A 4XUDA 3TR0A 2WU8A 1MB3A 4YDRA 5TQ0A 3UW1A 4BQSA 4L6IA 1U8CB 4ZCLA 4C21A 1F20A 1IK4A 1CFZA 1YK1A 1P7ZA 1SBHA 1L4KA 3H4VA 1VRCA 1DO8A 2WTNA 2X22A 3I5YA 2H06A 1GU0A 2GF2A 3W2HA 5I7SA 4BP1A 1P72A 2IY9A 3DLIA 1CKEA 1JNYA 4H4EA 4HH3C 1I33A 5DGHA 2OKGA 3GIDA 4NR0A 5DIFA 4C87A 1M6VB 2SECE 4IYJA 5ERGB 1CRZA 1JIUA 3E0QA 3N7AA 3R5TA 5IF9A 1Q1AA 4QNMA 1ND6A 4MEJA 3DQZA 5U1PA 4RZSA 1H65A 4U3JA 3BMXA 3GUVA 2B4KA 4G1EB 1IIBA 2IGBA 4S1TA 1XAJA 4Q1AA 4Z7OB 4GMGA 1H4QA 1V5EA 3L0CA 1C0KA 3CISA 1LVHA 2VNHA 3FAZA 3KJEA 4FOLA 4BFWA 4ND8B 2VDQB 1PEDA 1YU9A 2VT2A 3OVMA 4DE5A 1EE2A 3X2SA 4AJ1A 1U6JA 1P1KA 2XPCA 4JWTA 4B48A 5B57C 8ADHA 2FETA 5JYCA 1M34B 1CIVA 3D1VA 5KYWA 3AZPA 3DMGA 3LH5A 3C15C 1FS4A 5HIJA 4EUSA 1XCOA 1TGYA 1UR5A 2DQYA 1LBSA 1U8ZA 3F74A 3DPIA 4A27A 4EHLA 1Z6TA 1E4YA 5DPMA 4F56A 3S55A 3M4ZA 4KVAA 5I7RA 2AOWA 2WG1A 4TQGA 4Q3DA 3EIEA 3OFKA 1F8FA 4XFJA 2RGCA 1LSJA 1Z8FA 2B1GA 2F17A 3T4EA 3F96A 3GN2A 4AMVA 1PG5A 1A97A 2F62A 2GCGA 1TT5A 2CEAA 4M1YA 2NACA 4UHKA 3TKLA 4EARA 3GVIA 3GAFA 2ZJOA 1HE8B 1JKFA 2ID7A 4NLLA 4YCJA 2YJ3A 1RQLA 3N5CA 2BHLA 1A5TA 3SIWA 5AJXA 4Q7KA 2CL0X 4JBYA 2BM1A 3GXBA 1PVDA 2GCOA 3JSAA 2YXBA 2OB1A 3H4IA 3N2KB 3NHSA 3HJBA 4M1QA 1W9HA 1EFPA 1B1AA 1N2JA 1ZGGA 4TWBA 5ALIA 1NM5C 3GZJA 1V25A 3VNSA 2V6FA 3JQAD 1IN6A 2ENWA 4ZKEA 2E82A 2WJIA 4RMJA 3PX2A 5EGNA 5A6VA 3VMMA 2J48A 3KJXA 1B15A 4GNRA 2CVOA 1QE5A 2AD1A 3OTGA 4ZT2A 3BSSA 1L7XA 5NLLA 2JFQA 3DZHA 2M6LA 2K7FA 4HUQA 3AM1A 1L7NA 3URKA 3VKFA 1VPTA 4E30A 2CJPA 4EHBA 3AEUA 3O8LA 2SICE 1Y3FE 1BVHA 4FX5A 4OHVA 3UMCA 1KKMA 5IKMA 1XDWA 3I1JA 4W7IA 1AZWA 1W36C 4Q16A 3FZQA 5LNK1 2VHCA 4BZQA 3QYAA 3U49A 4F4FA 3THYA 2GS9A 2AWOA 4CIWA 1XN4A 2GKOA 1TO1E 4R41A 3MWKA 4HNVA 5ALVA 2Z2YA 1ECBA 1ZBQA 1WXQA 4ZFNA 1RWVA 1XVVA 4FUTA 4I55A 1OBFO 4KV7A 5EG5A 1BXGB 1L4MA 4MVCA 5GOZA 3EZ9A 1KR2A 4N7BA 3T0GA 1S3FA 1NVFA 1G60A 3KJHA 4RA9B 1WVGA 4ZZ1A 3RADC 3B48A 1N4DA 2A9QA 3A1CA 1BXKA 4O1IA 4WDQA 1Z6YA 3KWJA 2PGIA 3N5KA 5BPFA 5JEEA 1MHPA 3AETB 3T5PA 2Q3FA 3V6LA 2VP6A 1GD1O 3HCFA 3QVLA 3UJ7A 4CFZA 1E1DA 2P9YA 4YWJA 2NXWA 2D4HA 2VBGA 5FBWB 2NGRA 3B12A 1Y5LA 4HEHA 2N75A 4HTFA 2H9YA 4LUCA 4BFCA 4L0DA 2OXTA 3E05A 1I6KA 2W8BA 5FLYA 3N86A 3OAAA 4ALLA 3OJOA 4M60A 1UBCA 3EISA 4H4DA 4KH0A 3HU3A 3T5CA 1EJ0A 4Q93A 4RA6B 2JEZA 4ZC8A 3WOHA 3WKAA 2Q62A 2NX2A 4MUMA 1E79D 2QYOA 3AH8A 4AIIA 1EX7A 2C5BA 4EYSA 4H7JA 3AT1A 3CUYA 1LF5A 1XRJA 3RBAA 5REQA 3ZD6A 3RFXA 4A6XA 1VFNA 3LT4A 2OXEA 3A1EA 3OMXA 3DC2A 4FHZA 4IO1A 1WM1A 4MKXA 1EUQA 2XNDA 5IULC 2XE7A 3JRWA 5FEMA 3GGGA 4OQQA 1FQJA 3PR3A 3V6MA 4IXTA 2XDWA 4BL5A 3B36A 2PPVA 2RGYA 4D9CA 2TMDA 4IIXA 4ZO6A 5LU9A 5AM2A 1G7RA 4JBIA 3GRFA 1G4UR 2XOEA 2AJDA 2JCYA 3GJ0A 2PKEA 1PK8A 1NOIA 4NJEB 1QTNA 1PLJA 2DCMA 4MV5A 4YWHA 3WICA 4K87A 2JAPA 1XALA 3ZCQA 2SKCA 3G2NA 2E48A 1W5SA 3LUGA 1TK3A 1ONSA 4FYMA 2Z6QA 4D3YA 1K5HA 3LHFA 4B3RB 3MJRA 1G8FA 1Z7GA 2BE9A 3K0CC 3JQ9A 3AERA 3DUFA 1FOEB 4FFRA 2IVFA 2EBFX 4O02B 3N8IA 3PHJA 4DG9A 3I2HA 4CR7A 5KMGA 2JNWA 3OZUA 1K5GA 3O5AA 3FVQA 3GXOA 5CDYA 3FTDA 5BW5A 3GRUA 3DP7A 3LX8A 4JLPA 1M1YA 3K9WA 4DF3A 1BJKA 1NAHA 3O7WA 2JLZA 3L5OA 4IOMA 1Y5NA 3U16A 5KX5B 2HCJB 1KYQA 2CLOB 1T9CA 2H18A 5CRIA 3DTVB 3GRRA 4RJ2A 3TIFA 5H0IA 4UTNA 2ZAYA 3VOAA 5B1YA 2QE6A 3JPWA 4Q19A 1KKUA 4YAEA 4DJEC 1TVCA 2I67A 5DYWA 4PYIA 2VDRB 3TX2A 2WYVA 3ZE0B 2P6RA 4HYTA 2E9SA 3TAHA 2UZAA 3TK1A 4JJKA 1S02A 3N7UA 4BNHA 5KTRA 5ALSA 1J9EA 4W9RA 5KHLB 3GJ4A 4MCHA 4OATA 4ZYZA 2ZREA 2LUOA 5K0BA 2O50A 3S8YA 1WAMA 2GXUA 1F4PA 5C8YA 2FPPB 2VDUE 1N7HA 3EGOA 3UBMA 4UOEA 1XMIA 4G9BA 3K9GA 5LBIA 3VRHA 1AS3A 1O6ZA 2GSDA 4XKJA 1YQUA 2I54A 1FW6A 2WE7A 3A6GA 1GGMA 4E33A 4XYLA 3T4PA 4F91B 2PFSA 1N1DA 1UIRA 5LP6A 2CWWA 3R5SA 1F7VA 4B74A 1M2OB 3C3EA 2R6JA 5IC6A 3E81A 1LA2A 1WPXA 4YX9A 3BFPA 5LIPA 2FJPA 4IDFA 4S05A 5AO9A 3EQ8A 1X80B 4BQEA 2V6BA 3RVMA 2D3TA 2G36A 2CNNA 2ZBVA 2LRHA 3N05A 4O3FA 4ZGBA 1ZQ9A 1UXGA 3FWZA 4F2DA 1R8QA 1FUUA 1A8HA 1F5SA 3ZXUB 4DMLA 3U48A 1KEWA 1MTOA 3JQDA 4IHKA 1DG3A 1H6BA 4IIDA 4YT5A 3FZEA 4ERNA 5J4LA 3SOPA 3TG2A 3BA6A 4B82A 1XXHE 3ANLA 2BDUA 1WUHS 2RG7A 4UAUA 1NVUQ 3WK6A 1YRWA 4F38A 1OOEA 5CB4B 4WRRA 2ZTSA 1GDDA 3WP1B 4XTRA 1KARA 4BWYA 5FI5A 2AF4C 3KSRA 4BO8A 4NS1A 3I23A 1L8OA 2VHWA 3ME5A 1FP4A 3EBOA 3H5AA 2P9ZA 4NE7A 4E7OA 3ONNA 4HI0E 3GVCA 3TZ6A 3PWTA 4BVHA 3U13A 5KWSA 2EZTA 1QOPB 2IP4A 1XD8A 3BZWA 1EVYA 3BPSA 1UEJA 4UBLA 1QRAA 1RRFA 1WCYA 2WZQA 4YRMA 2YRWA 3GB9A 4YJ3B 5BRNA 5EERA 4XASA 5F1KA 4J94A 4DMRA 4NPAA 1D1TA 1G20E 4ON9A 3EUAA 3AFGA 3U9SA 2B1QA 3IHTA 1PFKA 3IS3A 2BWJA 4M49A 5JJ5A 1PK9A 5HIKA 1KU0A 1V8PA 1H5QA 3C6ZA 5DMXA 4Q1CA 3KVOA 3IR5A 4PO9A 1DDGA 2FFRA 2BEWA 1ZICA 1N9ZA 2BKAA 2BMVA 3BH7A 4KB5A 5LB2A 4BJ5A 1GQ2A 4XIFA 1R6TA 3KEQA 2OCKA 1R0WA 4F5WA 1OT5A 4PM4A 4P5EA 2P9FA 3LV8A 3OLCX 3PRKE 1EEXB 2F1IA 1T6BY 2IDKA 2IHUA 3EG5A 3MMXA 4N39A 2PFGA 3W4IA 1NJGA 1C7FA 4QFMA 3REOA 2HHCA 4Z6KA 4KBFA 4Y1RA 3ZIAA 4Z53A 3F3KA 3PXBA 3OOEA 5KJCA 4KKVA 1KEVA 1UAGA 2Y1FA 3UJ9A 5LXTA 4L9SA 1CF9A 4ER0A 1O89A 1Z29A 3INYA 5EE3A 3LK7A 4CKZA 3GLRA 2W6JD 3FD8A 5A9RA 1A9RA 3F5QA 5DNVA 3OSZA 1MXFA 4NYMR 3B3JA 3LNCA 3W1WA 4DCJA 1A2KC 4DCPA 2H1F