3TOSA

Crystal structure of cals11, calicheamicin methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGFPDVNDVDRVGPTAYQGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalS11
publication title Crystal Structure of CalS11, Calicheamicin methyltransferase
rcsb
source organism Micromonospora echinospora
molecule tags Transferase
total genus 75
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3tosA00
2XYQA 1WY7A 2GB4A 5EMMA 1G60A 3B3JA 5GOZA 4G56A 2AR0A 5EOVA 1QZZA 2OB2A 3VSEA 3NDJA 3P9IA 1KHHA 2UYOA 3PFHA 2XYVA 2VZ9A 3NTVA 3NVMB 1KPHA 1RI5A 2QYOA 2WA2A 4E31A 3NJRA 1NW5A 2JHCA 2PX8A 3D2LA 1FJXA 2I62A 3I9FA 3KHKA 3EGVA 3LHDA 1ZGAA 4QQKA 5HEKA 3HNRA 2OKCA 3G5TA 1EJ6A 5E9JA 1G6Q1 3SX0A 5D1HA 1G55A 2PKWA 3LCCA 4QTTB 4BY9E 2IPXA 9MHTA 2B78A 4P7KA 1FP1D 5CCBA 3BKXA 2UYCA 3QOXA 4XUCA 5F2OA 3PX3A 4PINA 5FQOA 3UA4A 4C08A 2N47A 1VPTA 1JSZA 2HNKA 3CVOA 3UJCA 4E2XA 3HVJA 1EG2A 1KXZA 3A7EA 1XXLA 3OCJA 4RV9A 3HEMA 2JH8A 3U81A 2AOUA 3CJRA 4F85A 2OY0A 4PNEA 3G7UA 1KYZA 3I58A 5GWXA 3RW9A 3TRKA 1RI4A 5EMLA 2AN4A 1XCLA 4KIGA 5E8JA 4GOLD 3AJDA 4RTSA 3UBTA 2Z6AA 4P7JA 2OZVA 3SGLA 3FPHA 1EJ0A 2G71A 3MERA 3PS9A 3GDHA 2O57A 5DX0A 3TM4A 4CTJA 5FTWA 2ORED 3PB3A 4MHTA 1R6AA 4QQNA 2IDKA 5EVJA 5LQCA 4ATNA 3FRIA 1TPYA 3I53A 3V97A 3KQSA 3OFJA 4UOEA 3BZBA 5BW5A 2ZWVA 4R8SA 1VBFA 3NW9A 3G2OA 4XUDA 5E9QA 5FCDA 1O9GA 3HP7A 3THRA 5GIOE 1Z3CA 4PIPA 3EEOA 2ONYA 3AXTA 1RJFA 3EVBA 3UJBA 3LDFA 3GRZA 3DMFA 3BWYA 3C0KA 2PWPA 4MWZA 4B17A 1NKVA 2ZIFA 3REOA 3HVIA 3LSTA 3MB5A 4F84A 4RVDA 4YUWA 3DOUA 3TOSA 5K0NA 1JG3A 2AVDA 3HA5A 5C1IA 1KR5A 1F38A 3ME5A 4O29A 5E1DA 5E2BA 3E7PA 3UJ9A 4BLUA 4C05A 3SSNA 4OBWA 3DMHA 2H11A 1M6YA 1QAOA 2YX1A 4GC9A 4L7VA 1QYRA 3VYWA 4RTPA 3O4FA 5CIYA 3BGIA 3CGGA 4HSGA 2UYQA 3AWIA 1JQ3A 2FK8A 4M38A 1NBIA 1X1DA 3R0QA 4PCLA 3BWBA 3SVZA 3GWZA 5EQJB 1XDSA 5DM2A 1YUBA 2E5WA 3FZGA 4CTKA 1U2ZA 4P58A 4R6XA 4DKJA 3EVDA 5EIFA 2ZZNA 4HH4A 5FHRA 1FBNA 3KPUA 3IV6A 1NW7A 2BM8A 2VP3A 4QPPA 5LQNA 1VP9A 4PYQA 3DULA 5GP1A 2V7EA 3OPNA 2UYHA 5DTQA 5BXYA 2ZIEA 5DPMA 2ZWAA 1FP2A 5CD1A 2I6GA 4IKPA 1UFKA 5K05A 2IFTA 2PY6A 4YUZA 4E70A 3KQYA 1N7JA 3IEIA 2IDJA 2P7IA 3A25A 2ADMA 3TM5A 2C7RA 2I9KA 5DTRA 5KYGA 4AUKA 4ER0A 3M6XA 1KIAA 5FA8A 3OU2A 3I5UA 2GAFA 2EX4A 3KR2A 3GGDA 4HC4A 2ZSUA 1P1CA 2NP7A 2YTZA 4EVIA 5EPEA 1OR8A 2BR5A 1NE2A 1NBHA 3P9NA 3GRRA 1JG4A 2YXEA 2PGXA 4WVLA 5FWAA 3BXOA 3NDIA 3R24A 4YV0A 4MQ4A 4GC5A 4RTJA 1YFJA 2YR0A 3KQTA 4FSDA 4FZVA 5K03A 3LDUA 4RVFA 5FWDA 3CKKA 2H1RA 4F86A 2GS9A 3HA3A 4BP1A 3DR5A 4FGZA 5K09A 5E1OA 5BP7A 3DMGA 3GRVA 4E2YA 1VIDA 3SM3A 1G8AA 3TR6A 3JWJA 1KPGA 2AOUB 5DM1A 1V39A 3LX6A 2P41A 3BGDA 4OA5A 2I7CA 5DTMA 2BR4A 2CL5A 3LBYA 4ZTBA 3B89A 3LDGA 3PX2A 5C0OE 3SXJA 2IH5A 4C4AA 3TQSA 4GEKA 2AOVA 3OFKA 4K6MA 2ONZA 4PGHA 3V8VA 4C07A 5F2NA 1FPQA 3ORHA 3M33A 3DH0A 4FS8A 3PVCA 3FTEA 4BP3A 5EG5A 4HG2A 4CKCA 1M0EA 2OO3A 4IV0A 3ID6C 4KW7A 4XUEA 2KW5A 4PYKA 1RJGA 4U7PB 5FULA 1BKYA 3THSA 5DT2A 3KU1A 3P8ZA 4WXHA 5DXJA 1INLA 5EMKA 3ANXA 2H00A 5HOQA 1DCTA 1NW8A 1ZHFA 3EMBA 2ZCJA 1YB2A 4C06A 4YV2A 3HTXA 2NP6A 5DXAA 3EEYA 1SUSA 1ZG3A 3SMQA 4HTFA 2IBTA 2PLWA 4DZRA 3P2EA 5ERGB 1ORIA 1ZQ9A 1QANA 3PFGA 4LG1A 1VE3A 3OE5A 4PGGA 3CC8A 5JR3A 3DXXA 4ER7A 2WA1A 4X61A 3QOWA 3B3FA 1L3CA 2PSSA 4U7TB 3K6RA 3EGEA 3EMDA 5HIIA 3VC2A 4PYIA 2R3SA 3M6UA 2FCAA 1R74A 4MTLA 2GLUA 5GM2A 4PIMA 4AZVA 3E23A 2K4MA 1DUSA 1BOOA 5CUQA 2PXAA 3KPVA 3DLCA 3WSTA 5GINE 5DRTA 3RODA 4DMGA 2JG3A 1X19A 3G89A 5F2KA 3JWHA 3SSOA 2PX4A 4RTKA 1I4WA 1X1CA 3CBGA 3K0BA 2ZULA 3G5LA 3MGGA 2P1DA 5E1BA 4KRGA 1XDUA 1JQDA 5GIPE 3GNLA 3P97A 4H0NA 5MHTA 4NECA 3MAGA 2BH2A 3E05A 2ZBRA 3AXSA 2OPBA 4E2ZA 3JWIA 2Y1XA 4FSXA 2XBMA 2P35A 3FUUA 4QTUB 1JTFA 4E2WA 3R9XB 3UZUA 2FRXA 2PV0A 2AOTA 4X63A 4CWAA 2JHAA 4OQDA 3FPFA 1UIRA 2C7PA 1MHTA 1WS6A 2VDVE 2AVNA 1VLMA 3A4TA 1IXKA 1YZHA 1L3BA 3DP7A 4QDKA 3TKAA 4BLWA 4RTRA 3CCFA 4MIKA 1EAMA 2OYRA 2AZTA 3ELYA 3FTDA 3KQPA 5EZQA 5K0GA 4X60A 5DRYA 3ER8A 2P40A 3NWEA 5LQRA 4RVGA 2ZLBA 1BC5A 2FK7A 3LKZA 1Y8CA 3BUSA 4GOND 4GQBA 3TPZA 2C7QA 2B9EA 1G8SA 3KQQA 4GOMD 3PTAA 2HR1A 1EQAA 1NW3A 1RJDA 3M70A 2GA9A 3HCAA 4KIFA 4RSRA 5ICEA 5EC8A 2EG5A 4KWCA 1R00A 2Y1WA 5E1MA 1VQ1A 1MJFA 4R05A 5E8RA 1P39A 3KQVA 1JR4A 3KQOA 1X1BA 5HFJA 4EKGA 2OB1A 5P8WA 1F3LA 3UJAA 1D2GA 5K01A 4RTQA 4EQZA 2Z6UA 4FP9A 1SQGA 1QAQA 2PX2A 2IH2A 4QVGA 4GOOD 3GJYA 5GM1A 1EIZA 3BWMA 2QRVB 3UJ7A 2PT9A 5KS2A 3E8SA 1NW6A 1DL5A 3LL7A 3UJDA 1YZ3A 2VDUE 2ZZKA 5FQNA 4PYMA 3S68A 4PYJA 2YXDA 3T7RA 3G8BA 4IWNA 5LQUA 1R8YA 5LSAA 4OBXA 3I64A 5HIMA 2QM3A 3KQWA 4RWZA 5KQSA 4Y2HA 2C7OA 2Z6QA 2PVCA 3DUWA 4PCAA 8MHTA 1N2XA 3VC1A 4AZTA 3DXZA 2G8NA 2JHPA 2FHPA 1Q0SA 1YFLA 4GUAA 1QAMA 1WG8A 3EVFA 4DCMA 4E33A 5K0BA 1X1AA 5DSTA 4HRAA 1KP9A 2YUIA 3FUTA 5ICFA 1VP3A 4E32A 3OZTA 4IV8A 3FTFA 5D1NA 1D2CA 2NXNA 2CWWA 3HCBA 2PT6A 3DLIA 4LWOA 3TFWA 5K0EA 2O05A 2IH4A 3PLAE 3MCTA 4FT2A 3MCZA 1UWVA 5EZSA 5HZMA 5KVAA 3ERCA 3IYLW 4KVZA 5DLYA 1PJZA 3BT7A 3NMUF 2GH1A 4PYLA 1JG1A 1NT2A 4X1OA 5T6BA 1ORHA 2P7HA 4P7GA 2B25A 4QVKA 5ICGA 5K8VA 5CM2Z 2CMHA 3LGAA 2NNWB 3OU7A 3MTIA 2CKDA 4RVHA 1O9HA 4R8RA 2DULA 4OA8A 3CJQA 3UJ8A 4ER5A 1HNNA 3FRHA 5EKUA 3ELDA 2FYTA 4R6WA 3RIEA 3ELUA 3KKZA 2XVAA 4QPNA 1M6EX 3HM2A 5CVJA 7MHTA 4E30A 1NV8A 2HWKA 5HIKA 2ZBPA 2QE6A 3LECA 3LPMA 3PT9A 2PJDA 1SVUA 4M36A 4C04A 4DA4A 3C3YA 4RX1A 2ZBQA 4A6EA 2AOTB 3KR9A 3MQ2A 2HTEA 2V74B 3HCCA 3KPYA 3Q87B 3UFBA 5K0LA 2Q41A 2F8LA 3ELWA 2DPMA 4AZSA 2PXCA 5CCXA 2P3LA 2ZVJA 1G38A 3BWCA 2BR3A 1RJEA 2JH9A 3G2PA 5K0JA 3UJ6A 3EVZA 10MHA 4EKIA 2NXJA 2PXXA 2R6ZA 2QY6A 4KDRA 1XDZA 4DF3A 2BM9A 3G8AA 3KPWA 5EGSA 3FTCA 5EMJA 3NWBA 2YVLA 4DM3A 1IY9A 1L3IA 1Q0TA 3KQMA 5EEGA 4Z2YA 3R3HA 4LWPA 2A14A 2ZZMA 3BGVA 1L9KA 5EIWA 2EJTA 2G72A 4ER6A 1XVAA 2WK1A 1XCJA 3HCEA 4HGYA 1BHJA 3EVAA 1L1EA 2IGTA 4DQ0A 2VDWA 1VL5A 1WZNA 1XTPA 3TMAA 3CJTA 3SSMA 3T0IA 3KR0A 2B3TA 3SR4A 3MTEA 4YMGA 1YF3A 4LECA 3BKWA 3LKDA 1R8XA 5CVVA 3ER9A 1SKMA 3TKYA 3P2KA 2PWYA 3DXYA 3M6VA 5K0CA 5FHQA 1JQEA 5DM4A 3A26A 2P8JA 1I1NA 4FT4A 4OQEA 2P3QA 5FADA 4PONA 4A6DA 1P91A 3O31A 4CKBA 4RTMA 2P3OA 3FUVA 3LCVB 4GBED 5IH3A 3G2QA 3FUWA 1TW2A 5KQRA 1R18A 3B3GA 1KPIA 4V0QA 4BLVA 5FUBA 2OBFA 2EJUA 3FPGA 1RI1A 5LR6A 4RYLA 4ISCA 1KYWA 3GO4A 3KPJA 3HVKA 3DTNA 3FPJA 4RTLA 5LQKA 3R6TA 2PBFA 1IM8A 1AF7A 3FYDA 5G02A 1JG2A 3T7TA 5CVEA 3AY0A 1PRYA 3GIWA 5HIJA 2O0LA 1ZGJA 3OE4A 3JWGA 5CVUA 3H2BA 3LBFA 2BZGA 4Y30A 4AX8A 1B42A 4DCGA 2O07A 1WXXA 1ZKDA 3O7WA 3HCFA 4M37A 3UWPA 4XCXA 2AN5A 5HILA 4PWYA 1I9GA 3HVHA 3GRUA 5E9WA 4YMHA 3M6WA 3GRYA 2OXTA 3EVCA 1AV6A 5H02A 4RTOA 1AQIA 3TLJA 3A7DA 4YUYA 1T43A 3MHTA 5EEHA 1XJ5A 2AS0A 3GCZA 4YUVA 3C3PA 5ICCA 3B7PA 2NXEA 4PYOA 4KDCA 1P1BA 5IKMA 5EHGA 2IP2A 3G2MA 3C6MA 3P71T 5DX1A 1SG9A 4GF5A 4M7RA 3OZRA 1TW3A 3EPPA 2XYRA 4CKEA 1N7IA 3EVGA 5K0FA 3T7SA 5M5BA 1H1DA 3B5IA 3Q7EA 2ZFUA 3FUXA 2CMGA 1WXWA 1JTEA 2IIPA 2ZTHA 2LD4A 5JUWA 3P9CA 1SUIA 4CXMA 2HV9A 3KR1A 5T67A 5U4XA 1JSXA 3OU6A 4JXJA 4QDJA 2FPOA 4HGZA 5EHIA 4ER3A 3P9KA 3LCUA 2G1PA 2VS1A 1AQJA 4V0RA 2AOWA 2YXLA 3EVEA 4HTFB 3FYCA 3HA7A 3GU3A 5DSXA 5DX8A 4AZWA 4POOA 2YQZA 3FPEA 2JJQA 5DWQA 4OX9Y 5T64A 2ESRA 1O54A 2EFJA 1HMYA 2AN3A 2GPYA 2B2CA 2HMYB 3NVKI 3A27A 2UZ4A 2O06A 4YUXA 3X0DA 5DM0A 3QV2A 2G70A 2ZIGA 1SQFA 3G88A 1NV9A 4X41A 4RTNA 3P2IA 3IHTA 4P7FA 3EGIA 3L8DA 5C9ZA 2NYUA 3F4KA 4C03A 3C6KA 2PX5A 3HCDA 3UA3A 5LQAA 2ZW9A 4FR0A 5CVDA 5FA5A 1D2HA 5BW4A 4YV1A 2IBSA 5LQJA 5B1SA 5E2AA 3OZSA 2NXCA 3M4XA 4EK9A 2ERCA 1RI2A 4EMSA 2QRVA 5EKXA 1RI3A 3GXOA 2XVMA 2AOXA 4PYNA
chains in the Genus database with same CATH superfamily
2DHCA 2PKQP 2QPTA 2C58A 4FFBA 3BCRA 3G8YA 2NO1A 3H6HA 3NIBA 4RFLA 1TT7A 3RVNA 3VSEA 1BXKA 3ZW7A 4CLXA 2ISCA 3T5MA 1RRMA 1UOEA 4BMDA 4CHGA 5EJ7A 3GJ8A 3ETEA 2R8ZA 2ZJYA 3AUSA 1O9BA 5F7JA 1T4GA 3UXYA 1NW5A 3ZS8A 1JDBC 1FTQA 3BEDA 3KAQA 5B4TA 2J3EA 4MULA 3QVWA 3RUIA 1KJJA 4K2AA 2OKCA 2DETA 4R7ZA 1T8YA 5ETJA 2RK3A 3PQ7A 4WY8A 1RLMA 1NLZA 2NYVA 2ZRQA 5C7OO 4X94A 4DILA 2VRWA 1E3DA 1Q0PA 3ORRA 4IF4A 1QE0A 4UHJA 1GDTA 3N0VA 2D3TA 5KCMA 1FFHA 5CCBA 2HSWA 3MT8A 4OP1A 4WKGA 1ZN2A 2KM1A 3B2NA 1W29A 2GEFA 3GUHA 3QUSA 2FPPB 5F2OA 2UZ3A 5H3LA 4BMOB 4D5GA 2O8DB 4DSUA 2JCGA 4I1YA 1KBQA 4UKDA 2PM8A 3SZ3A 3A7EA 3H3JA 2HBRA 4M99A 2XNDA 4FPXA 4LF8B 2R1TB 2ODTX 3PDCA 3QBJA 2WTBA 2XGOA 2VYQA 3IFSA 4PZDA 2VTVA 5KZMB 2WZCA 3PV0A 5HWSA 2ZYTX 3GA5A 3HV0A 1YNSA 5AKJA 2E49A 1J0EA 2EHJA 2IQ5A 4ZT4A 1Z5OA 4ZI2A 4GLFA 2IEDA 4OQZA 1M83A 1DQZA 2CSUA 3Q9NA 1M6WA 4XWGA 3S2EA 5LQCA 5CB4B 1A8PA 2DZDA 4M76B 3ZHCA 4UEWA 3OFJA 5CTAA 2IYFA 4ZQCB 4UOEA 3IULA 1U2DC 4FWBA 4IIEA 3JZAA 1GOTA 4GRAA 5L3SA 1X42A 5GIOE 5FX2A 3D1JA 4I4TF 2EL9A 1NQVA 4ZDWA 2IF2A 3MN1A 1ZH2A 4CM7A 1T2AA 4LXHA 4DV6B 1B23P 3K70C 3G9ZA 3PKZA 4OI2A 2IYOA 4KN6A 3RANA 3WXMA 2UDPA 1LPBB 2WT4A 2YJZA 1OX4B 1Z4MA 3DFKA 4EB6A 3MWJA 1XIVA 5CK4A 3VAZA 1R6BX 3CFYA 3QVVA 4E4YA 1DQRA 2Q5CA 2ZYIA 3LHFA 3UJHA 1XMXA 4ABYA 4BGDA 3DMHA 4IH9A 3R41A 1TIBA 4FGUA 4IFIA 3WXBA 4DW8A 1HG1A 4Q9AA 5LWQA 1AIPA 3CTPA 3L92A 4RPGA 5LPNA 4Z9YA 2HCBA 1XPUA 3WLQA 3ZHTA 1OCEA 1V8ZA 2QT9A 1USWA 4KKVA 4PCLA 4NCAA 4TRRA 1PP4A 1JHZA 5EQJB 1NX6A 3X1MA 2BC9A 1LFAA 1RVV1 3QXXA 4N6NA 4P58A 4DKJA 1PR5A 2XAUA 3IKVA 3IB3A 4JC0A 1KO1A 2AXNA 2GARA 4EYGA 1J9ZA 3TD6A 2AHRA 1P6XA 2RJNA 3C43A 2EEPA 3BG5A 3II6X 3KOZA 4IIGA 3F6CA 4RK4A 4QRIA 9GPBA 5LYJB 4DR5B 1ZSVA 3D5TA 1T5SA 4LYJA 3AY3A 4YRQA 1N7JA 2VQ3A 4TSKA 2FPIA 1ECLA 1K3FA 1WMEA 3HFJA 4BUZA 3OIYA 1ZISA 3E7WA 1OFUA 1I4DD 3M5PA 2E5LB 2W2LD 2W8BB 3I5UA 3K05A 1O0SA 2KWIA 2IQIA 1LNZA 4G5XA 4IDBA 4IUDS 1U8TA 2UUOA 2YNMA 3PE4A 4ISBA 2PA3A 4J0DA 4MLDA 4D9IA 1OBVA 1SULA 2HCRA 3OTGA 1ZEMA 4MK4A 3V1TC 5BY2A 3O6VA 3UG7A 2NZVG 5ALHA 3WKDA 3NKLA 1PUXA 4F4JA 1HFJA 3CQ9A 3R6DA 4IEEA 5LMNB 4ZRNA 5G2OA 3K9FC 1NVAA 4G41A 4HBGA 2QM7A 4DARA 3BE6A 1X1QA 3A32A 3PDWA 4J6EA 4UMEA 1FDSA 3OG9A 2VF8A 3R0VA 1WW3A 4H17A 5EQFA 3GGSA 4N3NA 1F8FA 3CUVA 5LD2C 1JB9A 2DFDA 3L0BA 2A0XA 2ZDQA 3CCCA 1XVUA 2XCUA 1T5LA 4LHVA 3ZEIA 1M2GA 3DCIA 4TROA 4ESOA 3G0GA 1V39A 1XMJA 3EXEB 4IWYA 4BKPA 4ITVA 2ZPAA 1H4QA 1IN7A 3NLLA 2BN4A 4P93A 1N2GA 2Q1UA 3DE3X 4MV0A 2X3UA 1FPQA 3RG2A 1E9DA 3LA6A 4EA7A 2AQKA 4FS8A 1QDEA 1PFWA 4HG2A 2OSBA 4TQGA 5LM3A 2EKZA 1V7PC 2RE8A 2VWGA 3SJAA 1FLAA 2H1WA 4HRYA 1L7XA 1TF5A 1LBSA 3AEUA 3KYBA 3LQYA 3G1WA 3THSA 3UV7A 2OC9A 4NV1A 3I28A 2JIQA 2OECA 2WPNA 3SR3A 3EHDA 3GJ6A 1TAUA 4P4SA 4QOJA 5TGZA 3SKXA 2Q6LA 1WV1A 1YB2A 2WF8A 5K8IA 3IHKA 1VG0B 2O9JA 1JHXA 3SXPA 3WLIA 3SBEA 4Q4LA 4OFZA 5AESA 2YVAA 2IBTA 5C34B 4DZRA 1OLXA 5ERGB 3EZ7A 4S3MA 3ZLVA 3K5HA 5B7PA 1YQXA 2ZJ8A 4QGHA 4XGIA 3CC8A 4LHSA 2ATXA 4JAVC 1T2NA 2QTFA 5C37A 3CEMA 4EA8A 1GSIA 3AV3A 1ORRA 3Q7SA 5IH7A 3REQA 4A36A 2BKEA 5I3ZA 4CVNA 5HQ3A 2JAOA 4Q12A 4INPA 3Q12A 4L27A 5HGXA 5GM2A 2WF7A 2JB9A 5CUQA 3PE6A 1C5KA 1NSTA 2P69A 3DLCA 3KPVA 3RFVA 1OKKA 3EXFB 4NATA 2CFRA 3T3HA 4UBOA 1X19A 4Y1FA 5CYGA 4MAFA 1DG3A 5CBPB 2BGRA 5E1DA 2M2IA 2ZULA 4G84A 4BQPA 2P2ZA 2P5YA 4PZ9A 3OCCA 4ZANA 5BR1A 4YJ2F 3BTOA 4H7JA 1EGHA 3TPCA 3W34A 5MHTA 1JDJA 2RK4A 2ZBRA 2OPBA 2QJTA 3OF2A 1GRVA 3BH6A 5E2IA 1K8XB 5J2UF 5TSDA 3QVOA 1JEQA 2PUEA 1GUFA 1K1EA 3HP1A 3L6RA 3GEDA 3LF2A 1DC7A 2GN2A 2ZRGA 3QPBA 1YFZA 2IXTA 4U4AA 1D2RA 3AR2A 1BVRA 3NEAA 1GUBA 1PFQA 5J3JA 1RWVA 2C5FA 1LSSA 1T9DA 4B6RA 5LFAA 1ODSA 3OQIB 4JJ4A 4HQFA 2WF6A 2WU3A 2PTHA 2XSZD 2HC9A 2VJMA 3HN2A 3S2FA 4A0GA 1UMCB 1FUKA 2GNAA 2A0FA 4PLYA 4EYEA 5BO5A 4C7XA 1RRGA 1E5XA 1G8SA 1PT9A 2JIRA 4EMUA 2VPQA 5KYYA 3R0IA 3RQIA 3QRWA 4L2IB 3CW8X 1KE1A 1P6UA 2R5NA 1KP2A 1BFDA 2LVBA 2ZYGA 4FDUA 4JR1A 4MKZA 3KJEA 1X7XB 1M9NA 3VPXA 5TQ0A 4B44A 4ZIRA 1HA3A 4LJSA 2MSLA 4UNSA 5K01A 4LJ7A 1U3TA 5A0FA 5DM60 4BVLA 1T9ZA 1G64A 4MVJF 1AKUA 5JPDA 2VUUA 4NCBA 1SCUB 1DO2A 1DO8A 3EQ2A 1TZKA 4NX2A 5K3DA 5TC4A 1NG1A 4M60A 5EKDA 1FUUA 3EUAA 1WX1A 1QG2A 2IP4A 3HI6A 2IYSA 3CLRC 5IULC 1M8KA 4L02A 3G5AA 3O90A 2I6UA 1L2TA 1THTA 1Z0KA 1KMQA 1XRMA 2HI0A 3FD8A 1IEWA 1XEXB 3NTXA 2PZJA 5COAA 4E14A 1WULS 5T41A 3KJNA 5KQSA 2QVCA 4QQFA 4PM4A 2GYWA 5JBQA 4I1PA 1BDMA 1C7QA 1K4KA 3DUWA 1IH8A 3LWBA 4IX1A 4M9XA 4V0ME 1MDFA 3H13A 1BMDA 5EXEA 2EFHB 2XTNA 1K5GA 4RL4A 3ZE6A 4CDGA 4XWWA 1FMLA 1DDOA 5DSTA 4FCVA 4RACA 3LE8A 1L9XA 3UJ3X 2YUIA 4LY9A 5G41A 4UU7A 1Z7WA 1J2EA 2GJ8A 4V0LA 4KGVA 2RGWA 5CH5A 7YASA 2JI6A 1P2UA 3DZIA 1W19A 3UMBA 5JJBA 1AMUA 1L6RA 1YK0A 1EWVA 3H9BA 3A9CA 2C99A 2PL9A 2UYYA 4LQ4A 2H6EA 4EAQA 3ICEA 4K1LA 4W8OA 3ANTA 3MCZA 3OTIA 5U4QA 1RABA 1LZKA 3RSOA 4WZAE 1L7OA 4D8VA 4CMJA 1E1QA 2ZVQX 2ZSDA 1LQ2A 1MPTA 3ZD8A 4YJDA 4QJ3A 4MWBA 1EFKA 1GTSA 2YV4A 2XF2A 2QS9A 4FOLA 1NHGA 3LQQA 2PMCA 3Q11A 3Q6NA 1H2BA 3V7UA 3VKWA 1Y3FE 4QNMA 1B2RA 1N57A 1CUCA 1DZIA 2G4CA 3H1EA 4XVQA 1WV0A 3EA0A 1ETUA 2YYZA 1PI3A 4YIKA 3R3WA 3F6RA 2WTMA 3NIWA 4FEGA 4Y2UA 3W04A 1YE3A 1XA3A 4YDSA 1ZIPA 2W4QA 3N2IA 1M6EX 1QC5B 2BSXA 1Z2CA 4AJNA 4B71A 1YBAA 1BSVA 3LW8A 4B1FA 4HV4A 1T8WA 3FPCA 1REQA 3I9JA 5EHNA 1R0XA 5BSMA 1CVLA 1XZJA 3V1MA 2V65A 4C0XA 1Q1QA 3KSMA 1TTTA 4BBJA 1A2QA 5KVSA 1I6MA 1A77A 1PX0A 1IULA 3IE1A 3ONVA 3UT0A 1JFFB 4BNJA 1E94E 2QV7A 2WYVA 4EARA 4RPHA 4BMNA 1GZ3A 5AM2A 1G8KA 1XZHA 3A1FA 2ZVJA 3AYZB 4N49A 1L5WA 1U31A 2QXUA 3RT1A 1UDRA 2I03A 3ESZA 3EVZA 3I05A 4M22A 4MYUA 1QVZA 1JKIA 1QF7A 4Q1FA 2DHDA 2H1IA 1YRHA 1KETA 1PR0A 3GNSA 2PQMA 2IKQA 3Q7IA 4I9GA 3GZ4A 5DYIA 3SHQA 3ZGYA 4EGAA 1Q0TA 1GU0A 1MEOA 4QO8A 3OICA 1LLFA 5KYUA 4HGYA 1P81A 1H05A 4O1IA 2NZJA 3F2VA 4O4HF 1MP0A 2XQJA 4I8XA 3PFIA 2WNHA 3MK31 3PDJA 3SR4A 1YF3A 3OWXA 3ZVLA 4ARAA 5DHTA 3NTUA 3O8NA 3DPUA 1EJ2A 1MOZA 3FCXA 4IIYA 4WOBA 1L4FA 4UDNA 1R4NA 5LQDA 4BN5A 1JKFA 2HXGA 2GZAA 2ZIXA 3C3EA 1W5EA 2QTCA 4E5NA 1YHYA 2YFHA 1WL8A 1TM7E 5B3LA 1N2CE 4BO1A 3V4SA 4DIOA 5EQTA 3S2ZA 1XF1A 3N1UA 3TNFA 1G8MA 1DQSA 3ZXIA 3U56A 1OBOA 1AZLA 4Y67A 2EWVA 5JO0A 3NHSA 4MUEA 4TKUB 4AJKA 4G09A 1HTWA 1PKEA 1CR4A 1RI1A 2GD1O 3O3MB 1XWIA 1UM9B 1U9YA 4RL6A 3UNXA 4BB5A 3BAFA 4O2AF 1DOHA 1S2NA 2UVPB 1GSOA 2IXFA 3C8MA 3DVAA 1WB9A 5JMTA 5JWRA 2J5KA 5C8YA 3RTBA 3AM3A 4UVEA 1WTCA 1B8VA 3A28A 2ZG6A 1KSJA 4AJ4A 3VKHA 3NC1C 3KB2A 3RRMA 1HMPA 2NV0A 2QRKA 1JRLA 1ZOOA 1GGEA 4H4DA 4NK5A 4ZCRA 4BATA 1Z4QA 2OO5A 3PC3A 2HF7A 1A7AA 2DLDA 2FN4A 2ODBA 3BMQB 1QSGA 1X8KA 3KJGA 4FFMA 4IF6A 1E61A 5C32A 4G8CA 1E0KA 1QZTA 2B1GA 2D5AA 2XR1A 1R7RA 3HXMA 2PKEA 2EARA 3OC6A 4O8CA 3OLXA 2BGLA 5K1ZA 4C5BA 5A02A 2NO4A 5EHGA 2PS3A 3N58A 4BRZA 4EW6A 1MV5A 2ODEA 2VP0A 5J40A 4TYYA 2IP1A 3RJ5A 3R5JA 3V8MA 2BFPA 4HWSA 2ZT6A 4DEVA 1ULTA 1JJAA 1CDOA 2BFEA 3B20A 1W73A 3C5EA 4GBJA 3WVNA 4YCMA 2CMGA 3WYCA 1LSJA 1YZVA 4MZDA 5K8TA 4NYIQ 1GFZA 1NMQA 2FW7A 5JV5A 1LU9A 1UPAA 2OHOA 1SKQA 2G0NA 4MLPA 4BAUA 3SC4A 1GG2A 3TECE 4NCKA 3PA6A 2PMDA 1FQOA 2DMRA 3AUYA 1IZ8A 3CW9A 3A3PA 3BGWA 4QLOA 2Y93A 4V0RA 1T4MA 2V7XA 2QYHA 1JIVA 4C7KA 1VMEA 4E13A 1Y7IA 3DWIA 1PHPA 1D2MA 4IDHA 4A0RA 1F2TB 1GV1A 2C7BA 2GPYA 4V24A 1P5HA 3QUQA 3UYLA 4BE7B 3CBQA 2JIMA 4KFTA 2CVOA 1ZNZA 2V5VA 4JHLA 4C9BA 3U1TA 5B53A 1NV9A 1QRDA 1NQOA 5FLKA 3O95A 4MO2A 4HDSB 3VR5A 3BD6A 4ETWA 2VF5X 5C9ZA 1QFZA 2V45A 1M0TA 3A1NA 4D25A 2QRHA 1AY0A 4QDTA 3CF2A 2GGSA 1KEZA 3V1NA 2J08A 2PL3A 3NXSA 4QAQA 3C5CA 1A97A 2GJAA 4KXXA 3R7FA 2GEJA 4GVPA 4KHZA 2JLRA 4OK5A 3WJ2A 3JVDA 1H5NA 2JANA 3T4XA 3M4NA 2ODNA 4Q3AA 4KBYA 3RVSA 4C89A 5ADVA 1JHYA 2XYQA 3I2IA 2AD1A 3B3JA 4TVBA 5GOZA 4F2PA 2VDPB 3SJCA 4L5JA 2UU9B 3R20A 1Y4ZA 1ICEA 2EP8A 4IZIA 3ZYCA 4DHEA 2NVUA 2QYOA 2BBTA 5IYZB 2Q3HA 3GEIA 1XTIA 3GLUA 2H51A 1XTRA 2ZCUA 3ITNA 5FTLA 1D1PA 5E9JA 2AFVA 1J6UA 2ACEA 2Q5QA 1TNDA 3I9KA 2DH6A 4JFAA 4U39A 5HMLA 1HKUA 4QGAA 2Z43A 4WGFA 3VH2A 3KB8A 4DXDA 2HPAA 1DBIA 1NM5C 5EZ6B 3BTSA 4EKEA 1W76A 2QVXX 2C0PA 4JSYA 1QVAA 2B78A 1LUAA 1OWOA 2J9FB 3IE2A 3IV9A 1E1YA 3MG9A 5KVQA 3DZHA 3C16C 4S0XA 3QOXA 3T7DA 1H1LA 1HT0A 1S9HA 3DDHA 1L7DA 2V3CC 3DZ8A 3G0OA 2CL0X 2ZT5A 1OGJA 2FF7A 3KVOA 3G2KA 4PZ0A 4JI0B 1T15A 2CFCA 3GVCA 1CC1S 1PVVA 4G5GA 4XR9A 4C6RA 1WDKA 2E1PA 4MQBA 1BH2A 2YNMD 3HGTA 4Q9NA 3VNAA 5KJFA 1QRUA 3GFVA 2G67A 2MIIA 2VDKB 1R10A 3PPVA 3LYAA 2O8BB 2CFOA 4RTSA 2WVJA 5I9TA 1GQ2A 3MERA 2FMTA 2O57A 2XVZA 1SXJB 4MKIA 1J0AA 1J5XA 1DAFA 2RH5A 2WWYA 5LUBA 1BCSB 1FP4B 2PHZA 1TPYA 2EX0A 1D6JA 1Y6JA 3GFQA 4IJMA 1OZFA 1JWAB 3UY4A 1OBCA 4F5ZA 4WZBA 3F90A 1T3GA 3PCTA 3D3WB 2EW2A 1QHXA 2WYIA 4YJFB 7REQA 3DGEC 5CJ2A 2F3UA 5IWAB 1VLJA 5HBRA 2HXYA 4GG1A 4M53A 1O5TA 2XNKA 1EU1A 4O2BF 4EI2A 2ZM5A 5IC5A 3BWYA 4I8DA 5SZKB 1HE5A 3EA5A 3FVVA 3R6WA 4UD6A 3OQOA 2XTAA 1P75A 4AX4A 1QB8A 5JY1A 1A50B 1T4CB 2PAFA 4BASA 4D9BA 3VPDA 4H7PA 3TJZA 4OEHA 1NMZA 2ZTVA 4RPCA 2V7TA 4TMXA 4ACAA 1JSRA 1X3SA 1CERA 1XMSA 4KQJA 4A2QA 2HA0A 2DKFA 4LNUB 4RPLA 2YX1A 4GC9A 1C3EA 3KSDO 1DWOA 5JH7F 2C3UA 3TFQA 3CO5A 3H87A 1NUPA 1KGDA 1J21A 1RKXA 3GWZA 3MFQA 3UMFA 3NIDB 4C3UA 5AKYA 3NT2A 2QTVB 1V1RB 4CM3A 1C4XA 2WU4A 2IUUA 3A4IA 1TO1E 3LWZA 3P0EA 1UAGA 3H5WA 4LIPD 4NCHA 4TKZA 4WW0A 5TPZA 3U3XA 1LY1A 1RYBA 1BWQA 1GNRA 3KPUA 4R1LA 3U37A 1RC8A 4AIRA 4QPPA 3ML1A 4J1QA 1J2UA 1HETA 2J1LA 3N2KA 3OKFA 4QE3A 4JYPA 5JSZB 3DLHA 4D4GA 1TEXA 4DY6A 1P33A 4IKPA 2VK1A 3PUIA 2BUCA 3GRAA 1WHTA 1GZ7A 5EZYF 4E70A 3KETA 1U4SA 1QTIA 1OKKD 3OLWA 3W5CA 2CNDA 3I0ZA 1F2UB 2J07A 1KIAA 2NTEA 1Q11A 1MAHA 2VNKA 3MGBA 4UTOA 3GLIB 4KXLA 2ZIUB 4NZOA 5D7BA 4LKRA 4RENA 3R7DA 4JGIA 4LYFA 5G1PA 4F2HA 1ZPDA 5L4LA 2JAHA 4UUMA 4WCFC 2QRPA 3CLHA 2GEKA 4TWJA 5I7AA 1JG4A 2VJQA 1R8QA 4GM1A 4P83A 3JRXA 4ZEMA 3NDIA 1A9PA 3R24A 1DOZA 4XASA 4ZYXA 3L46A 1HOXA 5BUQA 3EF3A 5FWDA 5K9ZA 4MZXA 3T1HB 1QVVA 5LCXA 1NFFA 4F4DA 3CB2A 3DMGA 3GRVA 1CZRA 1P74A 1SWWA 3EDRA 3HKBA 3PITA 4CMKA 1G8AA 1GN9A 1S2MA 5BSUA 3VDNB 2Q62A 3W6OA 3PQ5A 1LLCA 4ZDJA 4J7XA 4JJZA 3G9UA 2FLKA 2VNHA 3P0IA 3FVRA 2OBBA 2NUTB 4HQNA 5I3CA 1Z4PX 4EJSB 2YOHA 2AOVA 2K2WA 1YRWA 1ZIYA 4K6MA 3GX1A 1LFDB 4IIJA 2FKNA 1XDGA 3CR3C 2Q5FA 4P3NA 3RYHB 3ZGVA 5MF6A 3RYTC 5CT4A 1DKUA 3GCWA 2FWRA 4UEJA 4EMBA 2ATVA 1M0EA 4L8FA 2VC2B 5HOEA 1L5YA 2C2OA 3ID6C 4H3KB 2XUKA 1FYEA 1HQCA 3IP3A 1K6EA 2JAQA 4RCVA 4JKYA 2DPLA 2V9CA 2RJ3A 2H00A 3HWWA 4B3GA 4PQYA 2VHQA 1TZBA 3USES 3EMBA 5KX5F 4KQ1A 2ZCJA 3KTAB 2D3WA 3BQ9A 3HDTA 3EEYA 2XTMA 3WNQA 2QG4A 4CG3A 3E9DA 4LTDA 4XVRA 1NQAO 3ESBA 1UWCA 5DASA 1ZQ9A 1X2EA 3Q6MA 5DGTA 3HYNA 3PDIA 4OJNA 2Q3LA 3EVNA 2J0SA 2Z8XA 1IBCA 1SXJC 3SFVA 3RG8A 1DQPA 2VJKA 1L3CA 2PDAA 1EK5A 5TQJA 1U7WA 2Q3MA 4MRPA 3UGQA 1DPGA 5CVTA 2UVQA 2PZLA 2FFQA 5H68A 4JYCA 3CLSD 2XZDA 2XMQA 4F21A 2LUOA 3G1UA 1YR2A 4MTLA 4HLQB 3F71A 4ZU6X 3FG9A 3HYTA 3QU7A 2QQEA 5C4MA 1F1BA 4CEIB 5IAGA 5CX4A 3G89A 4YWHA 2BT4A 3GA7A 2YV3A 4F56A 1EA5A 3F5DA 3ZDEA 3IBYA 3MGGA 3E5NA 3KOWA 3V2UA 4FFWA 1F8GA 5TDHA 4TXLA 2BHNA 5AM1A 5DNCA 1JSCA 1IDN1 2C1EA 2VQSA 4D56A 4DVJA 4XM2A 4I5GA 5HKLA 1XNGA 1GY8A 2IUFA 5JBNA 1JHQA 1USGA 2BMEA 1IK4A 3CNHA 4W1PA 1E1QD 4LXIA 1V3UA 2FMKA 5D2CA 5AKEA 5AVRA 1AGYA 3JQ8B 4RQBA 4CEJB 2C07A 2BY4A 2QV0A 1VLMA 4RTRA 3DP7A 2B98A 3DLAA 2AG0A 3RU3A 4V2UA 2AJLI 1JLRA 1QIFA 3AI1A 2R79A 4RKEA 4N47A 3S27A 3I45A 2VJBA 1N6HA 4ZV9A 4BGUA 3NWEA 4HXYA 4LC1A 4LJ5A 5CA0F 3C74A 2QOEA 4U2GA 5BWOA 3QEOA 4PSDA 1TUBB 4GOND 2VSQA 5B6PA 4RO0A 3U4MA 1THMA 4GD3Q 3ZBQA 3U39A 1SXJE 2CUKA 1YUMA 4C4YA 4B2YA 1M2OB 3TNDA 4DV1B 1W4CA 3DAPA 2DBZA 1MJFA 1TCCA 1G20E 2HU5A 3UUFA 3VO2A 2F9FA 4TV9B 3DFMA 4YAIA 5CPFA 3NH9A 2A4MA 3HSSA 3TLBA 2IT1A 1OJLA 3UJAA 3I1IA 3MQFA 5CT8A 1M76A 1M3SA 2G04A 4R8LA 1N8NA 4DJEC 3N07A 4KX3A 3TQOA 1XZLA 1QAQA 3C7AA 3QWFA 4E03A 4E5MA 3PNQA 2HB6A 2N46A 2XHEA 1PUJA 2WWWA 4RA9A 2AX4A 4RGQA 4EY3A 3V4FA 2W98A 5KS2A 3OPVA 1VE1A 1F9AA 4XYLA 1XHLA 1ISFA 2POQX 2R8BA 3UJDA 3IC5A 1V4BA 1E9SA 1U4NA 2DVMA 3D1VA 4CI9A 1PDOA 3CX6A 4KV7A 1V11A 3K8ZA 1NUUA 2JFPA 1J0CA 1LEHA 1PTJC 3BIXA 4HQLA 1IJEA 4YREA 3GBSA 5CXSA 2D4HA 4AM8A 1S3GA 3GLHB 1KQPA 3ZW8A 4BBZA 1Q0SA 1U2GC 4PAGA 3EBPA 3T9BA 1OU4A 1II8A 4JGBA 3HUDA 5AK3A 5DCLA 3EBLA 5LXTF 4KR7A 4EB8A 4EY4A 2J6BA 2FLWA 3L0ZA 3CVWA 3IP9A 4DBZA 4Y6SA 3TGWA 5EGNA 1XF9A 3NPAA 1UK7A 4I0WB 1WXGA 2GHQA 1XKQA 1XU4A 1U3UA 2QMHA 2R87A 2C5EA 3UATA 4FT2A 2R7MA 4FMCF 1ZOPA 2WSLA 1E79D 1BA2A 5DLYA 3U2QA 4BEVA 2AV6A 3GY0A 3BSFA 1J1IA 2GH1A 5ALSA 1ENOA 2F2TA 2QL7A 1GV0A 3L79A 2UV8A 3RBVA 2VKQA 3GLIE 2LKDA 1JECA 3KLPX 4Q9DA 2HDWA 1UPCA 2H57A 5F78A 3SQWA 4R8RA 3OTHA 4QOGA 4CM8B 1WB4A 3FRJA 3JSAA 4NF2A 1VPWA 1BN7A 4C43A 1V3VA 4BVGA 4OX9B 3FTNA 3M6AA 3C70A 3U7QB 1P18A 4QPNA 1RWBA 5CGQB 4F71A 2ETVA 1AGNA 1CV2A 2CXSA 1T8PA 3AF1A 3QVSA 4F97A 2ZBPA 2QE6A 4K9LA 4XDZA 4HXEB 2OGUA 5FDFA 1A1VA 1Z6YA 1B0ZA 1JLLA 2GBFA 3AVOA 1T2DA 2FZ4A 2NTVA 2BP7B 2AOTB 2MSEB 4MUHA 4U2BA 1NNUA 4REQB 2D1YA 2D1FA 4LF4B 2PR7A 3P7MA 2FMXA 2IY7A 3E1SA 2B92A 3FOBA 3C45A 3I32A 3QUAA 4D9MA 4HAWA 4IXWA 5EKSA 2IHJA 3TH5A 4B9EA 2H7YA 1D8AA 4HAZA 4IFBA 2R4UA 4GVLA 2G6BA 3C4QA 5DU2A 5DI3A 3V8RA 2ZATA 3N59A 4EJMA 3ZU2A 4L76A 4OYYA 4B84A 1OH5A 4BEWA 1Z4OA 1L5HB 5FR2A 3P19A 1TMOA 1QHIA 1QS0B 1FXSA 1PGPA 2ST1A 1CR2A 1YS4A 2Z5GA 4HN2A 4RGBA 2IEAA 1V7CA 1VFPA 5L7TA 1YQQA 5LQMA 3WHIA 1K5DA 1EK6A 1KXJA 5B58T 5KCZA 2WIDA 1HDXA 3ISJA 3NUZA 4D57A 3ASVA 3K96A 3P5BA 1X7WB 1VSUA 1U8EA 1ESEA 2AK3A 2VDRB 3K6JA 4BLRA 3Q2OA 2I4OA 2HLHA 1JPUA 4WY2A 2QU7A 1P77A 4I3FA 4FQ5A 3GIDA 3ONEA 2X1LA 3DL7A 3VR5D 3ON5A 1XKXA 1FQJA 2HA4A 5BV1A 1PU2A 1C3VA 4EZIA 1Y8ZA 5FFNA 3GF4A 4CG1A 2C95A 4PLZA 5HMMA 3SFTA 3AFOA 5IXSA 4PSVA 1FXUA 1E99A 2HU8A 3OSUA 5FUBA 5B37A 5D3MA 2PMBA 3FTQA 4XEHA 4K5QA 2VPWA 1PAUA 3HVKA 2XQFA 3VOTA 2FPPA 2JL1A 1SB9A 3DFIA 4GPTA 1YRAA 3T4UA 3TEJA 2CSXA 1KTVA 1YZFA 3UM9A 2X1MA 1D8TA 4QDXA 5BRNA 2DM6A 2HQ1A 5IVHA 4FD2A 4DLUA 4LZOA 4FHFA 3ADPA 5F9MA 3V1YA 4EBBA 4QXPA 1M1YB 3QEAZ 2R1TA 1Q91A 5F76A 4CIWA 1ZGJA 2GO7A 4NZZA 2ZRIA 3GRPA 4YDQA 2LCIA 3DW3X 3N3AC 5IUKC 3T1NA 2AXQA 3V1LA 4LK3A 1WXXA 5BT8A 4M37A 4RXUA 1PJSA 3ZOZA 3S55A 1KAQA 1VBMA 4O4JA 5E9WA 3UMVA 4BVAA 3GRYA 3RVKA 2B1QA 4HWGA 2P68A 1T9BA 3OUTA 5IP5A 2QGNA 4WBXC 1XU7A 1D6NA 3WLKX 5HPYB 2AKYA 2P8SA 3AI7A 3C6MA 3P71T 5B1IA 3WLMA 5DM70 2PBLA 3LG2A 1SG9A 3UMSA 1JQKA 2J3DA 3HHPA 1MN6A 1XBTA 1II0A 1N7IA 1NXWA 4BNGA 4IIHA 3ZHSA 1SVKA 3ZCQA 3IQDB 4YDHB 4K6KA 1U11A 1XVIA 2VTBA 1QIHA 4U2CA 1WB5A 4CXMA 2HV9A 1ZICA 3D2CA 1OX4A 4CMHA 2GWHA 4RANA 1NJ1A 1ZK1A 2HCFA 4RPIA 4KPUB 5E4FA 2CVFA 3OO1A 3PPWA 1J42A 2VS1A 2PUDA 1W5SA 1D6SA 4JR0A 3FF4A 3OJXA 4I9HA 5DX8A 4DDVA 4NULA 2CF6A 3CLVA 2IYNA 3U48A 2PG3A 4XM0A 2JJQA 2OFXA 1ZMRA 2HK7A 2BF4A 4V0MA 3C3KA 3EWAA 5KNCA 1UBHS 5CLIA 2CNWA 3SR0A 3OOJA 3R0JA 2DSTA 1IRXA 1G5HA 3P9PA 5K3EA 5K5EA 1M66A 5AOCA 1A5SB 1J23A 1Z68A 3PLRA 1SQFA 1K08A 1T9CA 1KARA 3DG9A 4X41A 5EJGA 4F4UA 4XFJA 4P3XA 5DK4A 3NTLA 4IMPA 2IS2A 5LQAA 5CVDA 1E98A 3TRHA 3CNLA 4YV1A 3EXIB 4DIMA 1EVLA 2LNDA 5JXGA 5GGYA 2Q1SA 4CLRA 4LOJA 2B21A 3NOOA 2VCEA 4MGEA 4PZZA 5LYJA 4AY5A 5E4JA 3UT6A 5I7HA 3MWEB 4RJIA 4C0QC 1I5RA 2Y0PA 2IV7A 4FONA 2D5BA 3NDJA 1D9XA 3GWGA 4R2KA 1W85A 2SBTA 3L93A 1DCFA 3N5KA 1IDOA 3GPBA 3FPSA 4E31A 1T5IA 2JHCA 3OQBA 4YGYA 1VC2A 3I9FA 4I4TB 2CB9A 3KAKA 4TOIA 2REBA 2ACVA 4LV8B 4LAFA 5TPZD 3GZNA 4HVTA 5EUQB 5HQTA 2FDXA 5AUPB 3QI2A 3KSAC 1B43A 2JLWA 5C46F 1NXXA 1U6IA 3LW7A 3MJSA 1EB9A 3NONA 3NOXA 2B9VA 4Q7JB 5K0ZA 1OFIA 3I5YA 2WM2A 1EVEA 1QZ3A 3U3MA 2JFHA 3ZY4A 3K4QA 5EYPB 3VFDA 2E4AA 5ITWA 3O4RA 6PFKA 3H75A 3K3PA 2F1JA 3MWDB 2ZBFA 1BMTA 5AVTA 1TLFA 1P3JA 1EG2A 3OCJA 4E4TA 4ECEA 3DO5A 2IXDA 1GQSA 3QEJA 2NO6A 3CE9A 3L8HA 3PUYA 5ITVA 2M1XA 3DL0A 1GZHB 2FSSA 4BFCA 4Z0HO 3VJLA 4YX9A 1G66A 4PNEA 3NP9A 1RI4A 4U5XA 4WPGA 2RGNC 4XUGB 4FYYA 1V26A 1YKFA 5EMLA 4A4DA 4OREX 1PEDA 1QGDA 4GPAA 4IVNA 1Y5NA 2PH1A 3R44A 2HLPA 3N2EA 4GSKA 3FYUB 1WCIB 3L1KA 2ORED 5C5DA 1Z37A 3FJOA 1GPDG 4FEYA 4GMDA 4KFRA 4NU5A 3A1UA 1WEHA 2Z9DA 5L7YA 1BX1A 2ATCA 2FX2A 3EEQA 5HJ7A 1L4HA 2WU0A 3OH8A 3V2IA 2VQ6A 2FXVA 3SQOA 3ZXUB 2XYHA 1RQNA 4CKZA 2IHNA 1U0JA 5E9QA 5ALNA 1U3GA 5FNZA 3THRA 4YRNA 4YCLA 1GRRA 1FDRA 2CLEB 3NORA 4MUBA 5LBIA 3W5SA 2PLAA 3G6WA 1OQAA 1MW8X 2GM9A 1II9A 5IJ0B 1UBEA 2NACA 4DLTA 1F8YA 2BTQB 3O8LA 4OHWA 4PANA 1H6AA 3PEVA 1JA0A 4AK9A 3BIFA 2GK7A 1N2CA 3C0KA 4FLMA 3MIZA 2F1RA 4NCIA 2Z2IA 2QLLA 4BO7A 3MAJA 1Q3HA 4BO0A 3VSBA 5A7FA 1N75A 2BKVA 2XUQA 2HMWA 1Y98A 3Q72A 5K0NA 4MQEB 2AVDA 1D0IA 3ITKA 2CEAA 5C1IA 5HS4A 1GPJA 4D4LA 3AEQB 1UDBA 3GHYA 3D5EA 1G21B 1CUXA 1RXEA 3BTVA 1WXHA 3L0DA 3LGSA 4HFRA 4KLCA 4GDFA 3RIYA 2JIDA 2YZNA 3KBOA 4PPQA 2WUDA 1UXJA 5T4EA 4UBKA 1M1NB 3EXFA 4HSGA 1SBHA 2AUMA 1VHTA 3UK7A 1U7XA 1XYVA 4WX2B 5TY0A 1FW6A 1X1DA 5CBPA 2LGJA 4QXAA 4JYZA 4MV1A 1YCDA 2BUBA 1VJGA 5DYWA 2FOIA 4ML3A 3ZJYA 4ARZB 4Y0NA 4DMMA 1WRBA 3TRIA 2H31A 2ZZNA 1BNCA 3CKMA 3DYBA 3HB5X 4ZJYA 5EE1A 3R75A 2RI0A 4LTMA 2Y1FA 5GP1A 3LKBA 2R6DA 3TAHA 4B6QA 3IP1A 2P0AA 1QLJA 2IY9A 4XJVA 4ZOAA 3BS4A 2I7VA 1XV5A 5FL3A 3SNHA 1VE9A 3HE3A 1CT9A 3PFKA 3IAS1 4QOHA 4GW3A 3OQIA 2I8AA 1GL9B 3JD2A 5AIBA 2ECQA 1D07A 1RYHA 5T4FA 1HG0A 4R31A 1UMCA 3QY9A 3OU2A 4L3VA 3ILVA 4L4UA 3OZXA 3S6JA 2E89A 2ZI5A 1H9BA 1T91A 3FWPA 2F1HA 3R3YA 4N0DA 4ZARA 2H7CA 2BR5A 2VSYA 4ZAWA 2OA0A 1JXQA 3ZDCA 4EO7A 2I1LA 2LKCA 1U9IC 1OILA 4YV0A 1BQEA 3X1ZA 2N1BA 4V3CA 2Y1DA 4O4IB 5IT9A 2EW1A 2GLTA 2R11A 3GH3A 3HWRA 3PIRA 2JKVA 1S3IA 5BNZA 4G81A 4B6EA 3QW4B 4DIKA 4DDMA 4Y1RB 3NBXX 1OC4A 1ZGGA 4AVYA 1IHYA 1Q2UA 5BP7A 5K09A 2J67A 4E2YA 1OA0A 2EBFX 3KBBA 3KUCA 3OWHA 5DTMA 2WYUA 4QYSA 3E27A 3OZGA 2OQ2A 3LY9A 2VAMA 2J85A 3EAQA 4FX2A 4LRQA 5LBTA 4ROTA 3RJTA 2ECFA 1D2EA 5HUJA 3CG4A 3E9YA 4DAOA 3QLVC 4KCGA 4YJ2B 5H81A 3SAJA 1NC1A 2X2FA 3ZI7A 3DT6A 3M6IA 4OSEA 2V7PA 4LSZA 2H3HA 3VBEA 4P98A 4DMRA 3GQBB 4IJKA 2DQKA 1PGQA 3A04A 3D0RA 3ILSA 5EJEA 3AIOA 2RONA 2RH8A 1QM5A 4XD7A 2HY7A 1KI6B 4DV7B 1C0PA 3TVYA 2WZBA 3ANXA 5THKA 3RFUA 3ZTWA 3RTGA 2WRZA 4YV2A 4WKOA 3ZWAA 3PE3A 4YFVA 3EBOA 4R3WA 2XI4A 3CF0A 4HS9A 1JQAA 4BB6A 1BYIA 3VR0A 4RZQA 1QP4A 4NP6A 1QANA 1I3LA 5KQLA 2W0SA 3FYUC 3N2LA 3S3TA 2WA1A 3M7IA 5TMPA 2HLDA 3IHWA 2ZIVB 3BMXA 3QBTA 4R2MA 4WA8A 4A2WA 1WETA 2O8EA 1U7OA 2QMYA 4FHGA 4PYIA 3QSGA 2KYRA 3VV3A 4EHLA 2O2YA 4AL4A 5DBGA 1R74A 4BN4A 2X0RA 4MI9A 2OP0A 5EWMA 1E2KA 3SS7X 5ARBA 3P94A 4Q18A 1FJHA 2X76A 2BTOA 3T5BA 1AS0A 1P7PA 4QBHA 5KOHB 3AKYA 4Q7EA 1KP3A 1VYVA 4MIOA 1J24A 2VRCA 3NHJA 3K70D 1QC5A 4FM9A 1S1MA 5CB0A 4DDKA 4UE3S 3P2YA 1OLOA 3MAGA 4JQSA 3E05A 1RAGA 1K7XB 1O6BA 2PWBA 2Y1XA 3OIFA 4G9BA 4BFLA 4AUMA 1AXRA 4AMYA 4J7CA 1JTFA 1R1DA 2IDZA 1KAMA 3AFIA 4NKRA 3C87A 3NHFA 2ID9A 5LOVF 2R8RA 4OQXA 2IHKA 4XVHA 1TJYA 4A0HA 3NYQA 4J0IA 2K2QB 3ILXA 1JFFA 1GFIA 2O7NA 5DNEA 2FUG1 5ALDA 4NG5A 2ORYA 4X5OA 3U6BA 2G6TA 2JJYA 5AKGA 3JV7A 3T4EA 4AJIA 1Y1RA 2A0WA 4DCCA 1QUFA 4JP3A 5ELLA 4YRIA 1PFVA 1XFAA 4OXNA 5CAEA 1EQAA 1RJDA 4QEDA 2A5JA 4UVHA 3ULKA 3DFUA 3P2OA 3ZZNA 2Q9CA 3EF0A 4Y9TA 3JD1A 2PCJA 4J07A 1NM5A 2DOKA 3WWCA 3W7AA 3CVJA 3L0YA 1SK8A 5C31A 4YFYA 1D1QA 3KQOA 3CH5A 2XUFA 3CSUA 5HFJA 1DJOA 1QR6A 3GVHA 3NTQA 1KAHA 5CDHA 1QUEA 4JKOA 4IAOA 2KSQA 4MR9B 3DEZA 4L0MA 1J33A 1JR3E 4XTCS 1RLUA 5EUMA 3WJAA 4BV9A 1WDMA 1FUEA 4CW7A 4ZVLA 5CLFA 1A7UA 1H0KA 5JDCC 1RPZA 3UJ7A 2ID7A 2JGLA 3E8SA 4FGWA 2AJBA 3CISA 3OCWA 1DL5A 2OESA 3B7GA 3JRWA 4UUBA 1A9QA 3FCCA 4LUCA 1YZ3A 4PHGA 4R8VA 4KN5A 3OPYB 1P1FA 5CTJA 1RYNA 3CEPB 4DMLA 1L4KA 1L5ZA 4GP6A 4IWNA 4TKUA 3I64A 1XTVA 4RWZA 1H9CA 3LV8A 4NEGA 4EHJA 1UM9A 5HHTA 1AH2A 4PCAA 3RYIB 4JLAA 4TRJA 3VC1A 1CUYA 4JBGA 1KO4A 4CF3A 2VPYA 5DGCA 1XL0A 1K7EB 2FHPA 1QAMA 1RIFA 4QPDA 5FPPA 4NE7A 2XDQA 3BF8A 2Y3IA 3Q85A 1W75A 3GAFA 5JQGF 4RLHA 3FUTA 3GUCA 5BPHA 4KUGA 2BFWA 2OBYA 1O97D 2QTNA 4AI6A 1LD3A 2DJIA 1W88B 1V2HE 2QMOA 1RHKA 1JIKA 1SJ9A 1U2QA 1SIWA 2DWQA 3OEEA 4UDXX 1ZD3A 4TTSA 4IUBS 5A5EA 3BMQA 5GONF 3IX7A 4D80A 1B6GA 1J20A 1Z39A 3NT4A 3KCQA 2MYPA 2AFIB 1NIPA 4EHNA 4FZ3A 1UWVA 5HZMA 2AMVA 4G07A 4PHTA 2WU1A 2QPOA 3AUKA 4HH1A 4O4HB 4RE5A 4TL6A 4A1FA 1F7VA 2OYCA 4BPRA 4MXDA 2OFFA 1UEIA 5IFLA 3VHLB 2XMPA 3H5RA 3COZA 4QVKA 3QELB 2EFEB 4S2EA 4WNYA 2YQ5A 3CLTC 4YRRA 2JCXA 1SVNA 2NT3A 2V59A 3DLPX 1YA8A 2WWGA 3A2NA 3OUUA 4NFYA 5AW2A 1VDZA 3IKTA 1QGUB 3DMRA 1HNNA 1MVLA 3NDBB 3PGLA 1GQFA 1WSDA 1K3TA 2R86A 5HVNA 2XZPA 1C7FA 1ZZGA 2A4KA 4EHIA 1FNNA 2VDQB 1DAMA 5AHOA 2MYUA 2JFUA 2EGHA 2NM0A 2PLNA 3FMFA 1FA9A 2WOJA 4FKBA 1ZGHA 5H83A 1TO6A 4C04A 1Z6QA 3QVGB 1DAGA 5H80A 1DFGA 1GP2A 2A0KA 2UKDA 3DMDA 4TQUS 3U3RA 1QIDA 3DC2A 4QBIA 1HI9A 5FXMA 3EYAA 3V7FA 4M0UA 4X00A 3OD5A 3ZQUA 5CCXA 3LD9A 4BNMA 4FE7A 4FFLA 4U0JA 1UJ6A 1YDMA 3VQTA 1IBSA 1MT0A 3BX1A 3GEHA 2H92A 3Q5DA 4OQQA 3ZNQA 5B6IA 3IPCA 4DM7A 1L4BA 1CHNA 2HA3A 2OEPA 4HDSA 5JNVA 2IF0A 2Z4SA 3PTLA 4KIUA 1H3EA 2CHQA 3IP6A 4OGKA 4WCFA 4WKBA 4DQKA 4J29A 4OHOA 2XIJA 3ZU6A 5B3KA 3DM5A 1IN4A 3HJFA 3LVFO 2QP9X 1XTPA 3UANA 1GPKA 3C2QA 1G2OA 1NN1A 1UEXC 3DC7A 3H84A 4I46A 1A0OA 2G5TA 3QWIA 3UN1A 3EZYA 1ULUA 4L85A 5BNIA 1FYWA 4CM9D 1T2UA 2B8WA 5TEVA 4F1WA 2IZ7A 2DPGA 1CX9B 2CLMB 2XD9A 3DOFA 1C3LA 3RU2A 2ACKA 1VI6A 2OHVA 4OQEA 2C3PA 4WBSA 3NVAA 1JX6A 3H2GA 3KUUA 1S96A 1UPFA 2OV8A 2HIGA 1WVIA 1ZQ1A 2HK8A 3A6KA 4RC9A 3RWBA 4RTMA 2HUNA 3EX7C 3P4UA 3THYB 1EQ2A 1YH3A 4WESB 4ONEA 4MQ5A 4L5CA 4J16A 1U7DA 3E9MA 3MRTA 4RIEA 3MJFA 1Y6FA 2WIFA 3SZLA 2J9FA 1C3OA 4GQAA 1EK0A 1J2JA 2QTHA 4YMIA 4CLEA 1PQUA 2QZ9A 3IQIX 3ZG6A 3UUWA 1XLTC 3K32A 1D7OA 3EOAI 4D26A 4CCSA 3CZPA 4Y98A 1ENZA 5M3BA 1ORWA 4CGYA 4BFVA 5L9AA 4G4GA 1U0SY 2R9VA 1NZDA 3MTGA 3S2IA 3VNQA 4BNDB 1GCUA 2AWOA 3FBWA 3VKUA 4CETA 4FHCA 1ZKDA 3DHVA 4G0WA 1T9HA 4OM8A 3GJZA 3LO8A 4I9NA 1OX5A 2Q3EA 2EP7A 4PWYA 1UDXA 1JHVA 3RC9A 5JXWA 4NXMB 4DBVO 2JLVA 1GARA 4HYYA 2ODPA 1SXJA 2YCBA 3CUWA 3IA7A 4RD0A 1NP7A 4C6HA 4U7HA 4NV0A 1ADBA 1BCSA 1FP4A 2GEBA 1M2VA 3MCVA 3RS2A 1G20A 3MLAA 3UKDA 1WW8A 2QBYB 4QPCA 1LH0A 1G2QA 5DX1A 1XXHB 3OX1A 4UXIA 5IEJA 4YJFA 1PLLA 4UTXA 4R0VA 4A3SA 1UQUA 4IRMA 1GCAA 2HWXA 1KJ8A 1RS0A 1JTEA 2AC7A 1IVYA 2ZSKA 3IVCA 1O3YA 3W90A 5C8ZA 3ILYA 3NP7A 3KR1A 4PSKA 1JSXA 3LUKA 1GL6A 4HR7A 2HDOA 5J2TF 3C3CA 5KDLA 4D41A 1VIVA 4BFWA 4KPFC 4EL0A 3P9KA 2COUA 3QPUA 1T4CA 4ACBA 1FIUA 5J4LA 1GTRA 4P5DA 3EYWA 5DSXA 1IIRA 3PNYA 3UWSA 4MR8B 4AZWA 2GAAA 4MSUA 2BISA 3MAAC 4KYUA 2C54A 1B4DA 4X6UA 3R09A 3KHUA 3ZHRA 5EFZA 1E2DA 1CUJA 4GXTA 2XCLA 5FTMA 3EG5A 3FH0A 3LP5A 1BEUB 3ET5A 4CNQA 2UZ4A 2R7AA 2W6NA 1R50A 2PS1A 2AXPA 3GJ3A 2F3QA 4IUYA 3UK2A 4N0PA 2NV6A 4BEJA 2A9VA 1V1RA 4OMUA 2R62A 4TQ9A 4EEKA 2GASA 1H2WA 1OTHA 4HNUA 1COWA 3NQ41 4HADA 4QTXA 5BW4A 1ULHA 1LXCA 4CFSA 5JD6A 2GPJA 1AZTA 2X19A 5HQJA 1B8OA 2NXCA 3MMNA 5DLDA 5TT1A 3PFWO 5JSZA 4PPNA 2AI1A 2PIAA 1Z4IA 1M7BA 2WMOB 2WQZA 4FHZA 5K0JA 3N8IA 1CY8A 3WI7A 1NZJA 3ZPXA 5EOVA 5IAJA 4Q4CA 5IXJA 2UYOA 1QVWA 2QT0A 2PKXA 4EI8A 2XB9A 2PFSA 2UXDB 2Q0SA 3RTEA 3GLIA 1L8AA 1N5OX 1RI5A 1H4VB 2WINI 5L40A 1I0IA 4K3VA 1C0LA 3FWZA 4HAXA 3DBIA 1B26A 4KVFA 4QQKA 4C08A 2AFIE 1TLLA 3KT8A 1EJ6A 4H77A 5BQ3A 3HDQA 4F1JA 2ZRPA 1G55A 4RAQA 3FWNA 1W2HA 2FFHA 2KPOA 1E5DA 4O2BB 2AH5A 4WLOA 3ADDA 3VZRA 2IPXA 4C3OB 3C4VA 4YTEA 4U7GA 3GR6A 2WD7A 3A58B 2A9OA 1MEEA 2Q4DA 1F4LA 4Z1MD 1W1IA 1U2GA 2C4NA 2VJOA 4IEFB 4ZAYA 1OT5A 3LX5A 3DVRX 2V9PA 2PUBA 1XC7A 2PGLA 4MP6A 3RKSA 3JRNA 1EVYA 3P4XA 3IO3A 4G0XA 5JH7B 2ASVA 3EZGA 3JD0A 1AHHA 3A6DA 4KOAA 4F85A 1EDBA 4W6ZA 5JJKA 4XTRA 1NVBA 2XWSA 4CJXA 1LNSA 4EJSA 2ZP1A 1XCLA 4DBLC 2QLNA 2ZUCA 4GOLD 1JAIA 1X94A 3AJDA 4QULA 3W2TA 3ASUA 4E5UA 2H06A 1Y1QA 3JVEA 3BMCB 4YJ3B 5DX0A 1M0WA 1ADGA 1FDVA 3QF4A 4ES6A 3AM4A 5HRCA 5EVJA 3NIFB 1MLDA 1LRJA 2EYQA 3B2QA 3LC2O 4GKBA 3VZSA 2XCRB 1Y3HA 1SO8A 3G49A 1ZMBA 5EZYB 4WA7A 4YJGB 3EUEA 5CFMA 3EE6A 1TRHA 4PZUA 3BA6A 3EIWA 3H1FA 3BGOS 3VPGA 4QM7A 4YECA 4QXOA 4H6XA 4YQYA 4EGCB 3WLRA 4ZYZA 3FXAA 5BWBA 2GTHA 3SEZA 3U1BA 3HKCB 1UJBA 4II3A 4BFSA 3WA7A 4QFBA 4MYTA 5AQEA 3AW9A 5FI5A 3IIEA 4MUYA 4RWEA 5KOIA 1EDDA 1RRVA 2WWXA 4B3FX 2GXUA 2NUBA 2EX1A 3FWKA 4YUWA 1TI7A 4L57A 3KS9A 1ORDA 2BDTA 2AEEA 1L4UA 3E7PA 1RTTA 4XD7D 3UJ9A 2B36A 3M82A 4B3XA 1MNQA 2HNBA 5DHPA 3KQLA 3HJBA 4RTPA 2BGUA 4CEIA 2NYRA 3FVWA 2JJ1A 4RDXA 4DC1A 2VJYA 3WGGA 3TSOA 4BFXA 3CCBA 3F3SA 4DBLE 3N05A 3YASA 1E63A 4GO1A 4MGYR 4KRFA 5DHAA 3M3HA 1N0VC 8ABPA 2HLDD 3PFFA 4X91A 4LXYA 3R40A 1KYXA 1AK9A 5BWMA 3HJRA 2DGDA 4KRXA 1H85A 3U40A 3JQ8A 2X5OA 3WK4A 3F97A 1UFKA 1W94A 3E22B 1S3FA 4FINA 3A6HA 3D6UA 1G0OA 1TQ4A 2IDJA 2HIAA 2VP2A 4ZT6A 3MS7A 3INRA 1ZJ4A 2ZR8A 4A5SA 3PUHA 1ACMA 1LPPA 2EX4A 2W4MA 3KR2A 2VRCD 3PXXA 4FEAA 4Q7KA 3LVQE 1TUBA 3L7AA 1ODKA 1QBGA 3VYVA 4UNPA 3DCNA 3PD0A 2NAPA 1ACLA 3AHCA 4AIIA 1X7GA 5IUNC 1PV4A 3TBFA 4IFEA 1Z5NA 4GS5A 1X1RA 1ZMXA 3PKJA 3TNJA 4TV9A 1ADJA 1KGSA 2YR0A 3IUSA 1YSCA 2AFHE 2HEGA 3QBDA 4PHFA 5CH3A 1ZRHA 1NF2A 3OP4A 1NC3A 4K9PA 4F4IA 3TIGA 1I10A 4IOJA 2HFKA 2H5LA 4KJZA 4RKQA 4XQ9A 3V7YA 4HNVA 4LF6B 1N33B 5K3SA 2GXSA 5FWNA 2Z08A 3NV7A 1PQWA 3CUUA 3LX6A 4I66A 2FE4A 3S2SA 5AD1A 3R8XA 1OASA 2QUHA 3LBYA 4WVFA 5A4KA 5I9SA 2Q5OA 2YIVX 1Z45A 2G63A 3BD9A 3PX2A 3QMPA 3UMRA 1GUAA 4CM6A 2ZAGA 1QE5A 2AJDA 5JS7A 4OHZA 3OFKA 3WK8A 5TS2A 5EE3A 3KJIA 1V9LA 2BSAA 1GT6A 4J0EA 1OPXA 1WE2A 4BNVA 1W44A 1ZNWA 3KNZA 4LISA 4DKXA 1CS4C 2P5UA 2RBKA 2C31A 1N8KA 3AB7A 3GLHA 3IDOA 4G8BA 4F72A 3FTEA 1QP7A 1E2IA 4ZTUB 2GT1A 3BE5A 3ISTA 4DSOA 1TCUA 2JFXA 4A15A 1MQ9A 3JQQA 4KBGA 4MVCA 3FUCA 3EH2A 3WS7A 4TX1A 4BGEA 1ZVVA 2BTEA 3DQPA 3KG2A 2NU7B 1Z2NX 5I9LA 3KYCA 4YRMA 3ROZA 5CA0B 3KZNA 3A1SA 3I9LA 3D4IA 4K3UA 4MRMB 4OBEA 4B4WA 4DOMA 2CDAA 3AZPA 3GBVA 5CB6A 4AWAA 2OAP1 4IOLA 1Z6AA 2H9AA 2NG1A 3A2KA 2PO5A 3AT1A 3DVSX 4EMTA 3SLRA 1OZGA 5IK2A 4G25A 3K6RA 4NIMA 1YJ5A 2AJCA 2HHJA 2J48A 1UPBA 4Z1OA 1H0HA 3BJEA 3TIIA 4BVFA 4IIDA 5L6LB 1P4JA 1Y8RB 2IHUA 1NTOA 3CZAA 5TE9A 4LV5B 2GK3A 2P4QA 1XZ8A 2K4MA 1BOOA 1DUSA 2V7UA 1R6UA 2ZJAA 2C94A 2VH5R 3CTMA 3D4OA 5A9TA 4CM8A 4DIBA 1I7DA 1MO2A 2H16A 3DMTC 4KG7A 3K4PA 3KXIA 4NOKA 4H4EA 3UCEA 3ACCA 2PX4A 2DLNA 2ZI3A 4JP5A 4NU8X 4AO8A 2H4FA 2J32A 2MT9A 3I9V1 1AMOA 4G8DA 1Z8FA 1JQDA 1OXXK 4Q3NA 4ZVTA 3GNLA 1MAWA 2AZ4A 1L1QA 4BHTA 4NMHA 2YJ4A 5K2MA 1Y37A 3SEQA 2WZDA 4HYQA 3QWHA 4MRSA 4YAWA 5AXAA 4CDRA 4OHBA 3G2IA 1XZDA 1O95C 3Q2KA 2WG2A 3FUUA 5LP1A 4PXSA 4LXTA 1QV6A 1XVVA 4FC7A 5K3FB 3IOMA 4Q7MB 2OCDA 2BP7A 2AOTA 2VFAA 3UZUA 3SY8A 1CWUA 1DEHA 2ZXFA 2WJ6A 3DBLB 2HYIC 1WQ3A 4G3XA 3H0EA 5DGHA 1EFTA 2YHIB 3IP7A 3UMGA 3OZWA 3WDLA 3GAMA 4Q1VA 2QW0X 5LXTB 2CZQA 1P1RA 5KWSA 4GZ5A 1H2FA 1L5HA 1P3Y1 1CIJA 4YALA 1GM5A 2V97A 2HR1A 3FYHA 3M70A 5NLLA 3ITEA 2FOLA 1X87A 4ZOLF 3SWWA 3I5XA 1IY1A 5B3AA 3UO8B 4EHBA 2H48A 1Q6ZA 3C24A 4L1KA 5DF1A 2O0JA 3HN7A 3JAWA 1X13A 3R3VA 1E6CA 3LIIA 2PIDA 4PU0A 2Q5HA 5JNRA 4FTWA 4CCWA 1O4VA 1VPLA 2J4DA 1ZLXA 2JLCA 2WG0A 1VM6A 4HNRA 4AMBA 5TB5A 4DV4B 5GGXA 1UK6A 3HCPA 4QYWA 3MOGA 3ABZA 3HYRA 4KLNA 1OZ0A 4C01A 1ZO8A 3UHFA 4BCDA 3GMSA 1PEAA 3CY6A 5ALKA 1Z0SA 2A8YA 4CM4B 3TLAA 4ZFNA 3AUAA 5H9WA 1KK2A 3MYYA 2O6HA 1LPNA 4D0SA 5BYJA 2RGNA 3Q6IA 4Q19A 3JAMA 4Q7LA 3OFVA 5HTOA 1H8ED 2OD7A 2WMNB 4HWPA 4XDGA 3EFEA 1T25A 4NOMA 2X0NA 4G85A 2JNWA 4GZ3A 5JRJA 4JA0A 1VECA 1BYUA 2NAFA 3ZHQA 1K98A 3WWZA 1E1CA 2CHFA 3DP9A 3EVFA 5AK5A 2VN8A 3NB0A 3IUPA 4ZAFA 2EGGA 4FNMA 4IMIB 1DFIA 4TN5A 3P9SA 1S1CA 1L5OA 4NBVA 2V7WA 2B5WA 2OCGA 3B8HA 4O3FA 4ZVVA 1ZC4A 1D2CA 1H4TA 1C9EA 1Z06A 2QRNA 2XECA 2PZKA 2ZUSA 3FN4A 4EOGA 3WSWA 4TKMA 1FP7A 2AI3A 3T1OA 4MVJP 4ZI7A 4LWOA 4ESVA 4CF6A 1DJLA 3LY8A 3RC3A 3IEMA 1ZRMA 3HY6A 3KL2A 1LDMA 3KJQA 5A5DA 3LOPA 5LLDA 1UFOA 4P08A 2D8AA 2IYLD 3RVBA 2NO0A 2GI4A 3TDKA 2NZ2A 3DCYA 5B2EA 4UCWA 4N6OA 3OU7A 2VZ8A 4MVWA 2IUEA 2R6AA 1D6MA 2H4JA 1NRIA 2D4AA 1A8HA 1ZK2A 2GRUA 2W6IA 3HJHA 1PD1A 4OA8A 3WGHA 1RDFA 5CDGA 3CMMA 1WDTA 1O4WA 3AKCA 1AS3A 2HX1A 4BNHA 4BCCA 3H6GA 4EKYA 2J9GA 4M9CA 1QG6A 2R8PA 5CVJA 5LKRA 2O8DA 2VOJA 1FNMA 3LT2A 5KQGA 1LI7A 1XLWA 2RDMA 3VBCA 1SXJD 1V6AA 4EX6A 4KPUA 3B3AA 2C3OA 2H8GA 3C3YA 1JI0A 3D7SA 2J3IA 5FO0A 1JDNA 3MQ2A 2YXBA 3VZDA 3R7WA 3U4DA 4AG5A 5KSOA 3QEMA 3H16A 5K0LA 4BU0A 4KO3S 2XH8A 1KMHB 1KS2A 1OROA 1YNOA 4Q48A 3UCXA 4V1CI 5IXYA 4FNGA 3DKVA 4BN0A 4ENWA 1IOLA 1K63A 2BFNA 4W5QA 3Q40A 4EKIA 3IGFA 1YRLA 5EGSA 2FUKA 5JLJA 1LTQA 1G2PA 2IYUA 3BJIC 4OGLA 3BZWA 4DIDA 2P6UA 1GU7A 3ASZA 1ABFA 3PHCA 2BZ0A 3L01A 2WJIA 4WH0A 2WK1A 1ECBA 5JCXA 5GJBA 4DV5B 4BUCA 3EXIA 1SMKA 3U3JA 2YASA 5JMWA 1IEVA 5ALVA 2JLSA 3T0IA 3EC1A 2B83A 2QZZA 2F90A 1MX1A 1R8XA 3FBTA 3T94A 5JZ9A 2HREA 3ER9A 1U0OC 1ZUHA 3KYIB 4E5DA 1D1TA 5DM4A 2P8JA 1I1NA 1U28A 3INNA 2HF9A 4RIIA 3EPHA 5DIZA 1P91A 4J43A 2IYWA 3A6EA 4MYCA 4BO2A 2ZYSA 3VV2A 3LCVB 3MOIA 1ONSA 2RAFA 4M1KA 1COWD 1TW2A 4ZO9A 4ZVUA 5KQRA 5AJZA 1KPIA 1RPJA 1J5PA 4GVXA 2PGNA 4KQGA 1OIVA 4V0QA 2FWBA 3SD7A 4IILA 3AIIA 2GFHA 2JD2A 2OBFA 3WNDA 4IEIA 1I4OA 4ZKDA 1KHTA 3WOHA 4LJAA 4TTPA 5JAQA 4X1YA 1VKNA 2AMJA 2YJNA 2FEPA 3L4BC 3DONA 3FPJA 2PRKA 2F43A 3A37A 5EYPA 4Q3KA 5FBWB 1V71A 3R6TA 1OWLA 3HCWA 4IHAA 2IPOA 4LWZA 3MWDA 4MQFB 4NPHA 3SDBA 1QQBA 1E6LA 1IZZA 1IYZA 1ESMA 1JG2A 1G98A 2X1HA 3KLMX 4RYDA 1NFQA 2AC2A 2MSCB 3AY0A 3BQNB 3C39A 1I5OA 2EJCA 5EIBC 3RHFA 4TMZA 4EITA 3OE4A 5L7WA 3JWGA 4P3PA 5F4ZA 3LBFA 3Q3EA 5CXXA 1HE8B 5HCNA 1U7ZA 4TT3D 5I8WA 2QLMA 1Y7PA 2AN5A 3KXLA 1GCOA 1I9GA 4YP7A 1F9EA 1MG5A 5LVAA 2BLLA 1MIHA 4X7RA 3FYUA 1DUIA 1WNFA 2VJAA 4KWHA 3UW3A 5KJ6A 1AMNA 1T43A 1NFRA 2HQBA 3RUCA 4ETNA 5BN5A 1C4WA 3AR8A 3KV3O 4D6PA 3B7PA 1I1OA 1ARZA 1GR0A 2W6OA 5FWYB 2X0DA 1OXUA 2X4LA 4F93B 1AQLA 4ZT2A 4EIWA 4BQEA 4KH0A 2FI1A 3ITDA 3L05A 1WLYA 5ED0A 1NU6A 3ZDQA 4V0OA 3C14C 3EIQA 1TA0A 4ALLA 1S9DA 1R37A 4CKCB 1VE5A 2WP8J 2FW0A 1JR3A 1MH1A 5IJ0A 1BD4A 2CE2X 1M7GA 2NQ2C 4Q6WA 4YJHB 4BZQA 1OJ7A 4KPYA 2NNLD 1YKGA 2CT8A 3E7DA 1XZCA 4BBPA 5J1SB 3H2IA 4F2GA 1VPEA 1ZWKA 3VR4H 3LCUA 2G1PA 1YTUA 4MQEA 5JI3E 2GPSA 1NPYA 4U8GA 4BX0A 1I7SB 3HBFA 3AEQA 2NZYA 3EUFA 1VLLA 3UFXA 3DOEA 1U0EA 4MV5A 1MR3F 1X8JA 4QBGB 4CN9A 3FDZB 5T4HA 5A03A 4F91B 4KNWA 1M1NA 5TR9A 3W1EA 5KREA 4EA6A 3CLUD 5FBVB 2W4IA 4UTVA 4WFKA 3HYLA 2XMCA 3VGPA 4ALNA 1N1GA 2YJ6A 4RZUA 5BNFA 5FPYA 2QUAA 3EWNA 4QWWA 4ARZA 5A06A 4RTNA 3SG0A 2H4WA 2BDUA 3EDOA 3F4KA 5L3QB 3GUZA 2XXAB 2Q4EA 2ZW9A 3ROMA 3WBBA 4JLMA 2EDCA 1MKYA 4P1ZA 1J9GA 1GGJA 2YV1A 2H18A 4TUYF 5B1SA 2OZEA 2UXCB 2BI8A 3NGLA 1CE8B 2CMFA 4J7AA 1XO1A 4BMZA 5F7XA 5ALPA 4NV3A 1K86A 4MV9A 5BVHB 1YOBA 1R6VA 7REQB 1G60A 5DYGA 4MS4B 3MJTA 4LZLA 3U19A 2JJ1D 3JQPA 2I7XA 1PS0A 2B8TA 3KU4A 4RHEA 1DTWA 2B99A 2NTNA 3TE7A 2WA2A 1R0WA 1P9OA 3MUFA 3F7MA 3NM4A 1Z5ZA 3ZU3A 1W1WA 1ZK0A 1H65A 3KHKA 4M8IA 1N6LA 1RWKA 3T06B 2WV7A 1HLFA 2W2VA 4ETMA 1U8YA 4LX0A 2PS9A 1VKHA 1PR4A 2WV9A 5BYBA 4M1WA 4TSFA 6Q21A 4AJPA 4LZWA 3N76A 3O2QB 3P0RA 1U98A 2FN8A 4WECA 4G4SO 4O4IA 1HLPA 2GILA 1YHNA 2W58A 3RRFA 1MIOA 5ESWA 4RLQA 5H4HA 4BP9A 5HJEA 1TEHA 4FDTA 4Y1RA 4FOSA 4E2XA 2WR8A 3E61A 4C4PA 3U61B 2EKQA 2GN9A 1QWSA 3ST7A 3KEQA 3TINA 4F5YA 3SLGA 2IODA 1SQSA 3ESXA 4BJ3A 2B30A 2OY0A 5KMGA 1PQYA 2XQVA 5DP1A 1HZZA 4WQMA 1CY1A 1X80B 3IQXA 1R5NA 5JW6A 1F8XA 1ISHA 1V4NA 2Z1NA 3NVDA 3SGLA 2RHRA 1BG6A 2H4XA 4ZMRA 3GQBA 2FUG6 1SUCA 1B0PA 1T6ZA 3JW8A 4N65A 4WXEA 1NIJA 2N42A 5JAOA 1EFVB 3NRJA 3C7CB 4CV3A 3W77A 2PUCA 3EISA 1SOWA 3SF8B 4ZICA 2DHQA 1ZD8A 2J3JA 3O9ZA 4JJIA 5BWLA 5HR5A 3ZW9A 3FSRA 4MJ3A 4OM7A 4AUEA 2JCYA 2O8CA 4OXRA 1V8BA 5CEJA 3CPSA 1CQIA 1NUQA 1K6IA 3F2IA 1USIA 4PG6A 1SC3A 3AUXA 1KQOA 3SF0A 3P96A 3L7DA 3KRTA 2ERXA 1G8JA 1TYCA 3CRZA 3IVXA 1N4AA 1IJBA 3SZMA 3U4HA 3EGDA 4G37A 4B17A 5AVVA 1PWXA 3MB5A 4F84A 1S8NA 2O8VA 4MUMA 2PX3A 4RVDA 3HO1A 1EI9A 4LBVA 4US2R 4KBFA 2YVKA 3U9TA 1K5HA 1Q7RA 1WJGA 1WF3A 4OBWA 1HEYA 3NV9A 2ORIA 3H0KA 3IQHX 3LX4A 4I5FA 3PXGA 1Z82A 4BX3A 1Y6GA 3AHJA 1RRCA 3T1YB 4IPTA 1L5RA 2J5RA 3UAXA 1E6MA 4KXUA 4QRHA 3IJEB 3KQKA 2J0QA 1YHZA 1LJ8A 1IN6A 2X14A 1ZR2A 2RHJA 1KOFA 1N8TA 1D3AA 1RXUA 3AO0B 1W36B 3QK7A 1W34A 4PLHA 2VUIB 2X2OA 4GR9A 5DPMA 4EW2A 1FP2A 3SS8A 3DO8A 1XT6A 2DBYA 1QQ6A 2FPGB 4YUZA 4R2IA 2D54A 1ZXLA 3W5VA 3ZTTA 3LLCA 2OENG 4D82A 3RVDA 3KQUA 1Y6ZA 2A1UA 2EBWA 1ZS9A 3DAHA 3JR7A 4AUKA 3HSYA 1BIFA 1OAKA 2WJJA 3M6XA 4JXZA 3ZD6A 4RH0A 2HA5A 1DC4A 1Q20A 1FDWA 4YAGA 3TGLA 2YTZA 1IQUA 5EPEA 3O4IA 3TZLA 2XE7A 1H5QA 1WD5A 1FFEA 3NJ4A 4UVGA 4ZI5A 4MRNA 3U7IA 5CW1A 1ZIOA 1D04A 3HUTA 2Y27A 4IZOA 1YVRA 4UFOA 4TKVA 2PGXA 3DZDA 3UGJA 3BXOA 3A06A 2ENWA 2J0UB 1XA0A 4R5MA 3PHHA 3ZZTA 4ZJUA 5F51A 4FZVA 3A9UA 5K03A 2XADA 5AW5A 4GI3A 3DOJA 2GESA 4IFTA 4BMPB 1XLTA 4ZI3A 2QRUA 3GJTA 1PGNA 4MR9A 3AHIA 3D8HA 3NHLA 4BMSA 1XEAA 2REQB 3VNBA 4QSHA 1PCXA 5FI3A 2G36A 1UBSB 1PZXA 5JVDA 3OEYA 4MWSA 1C8VB 3VNRA 2BR4A 1DMSA 1DQNA 2HPHA 2WVGA 2YWGA 3ZWNA 1LF5A 4JLSA 1NVVQ 3LBIA 3A8TA 4X95A 3H5AA 1FF9A 2NLOA 4JFRA 4X1KB 3TQSA 2OLKA 4B33A 4G97A 5C1OA 4JOQA 5LDDC 3O74A 2X9QA 3OCUA 4TS4A 2NU6B 1A2KC 1EX7A 5LA6F 3WRXC 2Q3FA 4FYKA 4RW0A 1G3QA 1KQNA 1QYDA 2VQDA 3AHHA 5LOVB 3BDAA 3T7EA 2HK9A 3D0OA 4KW7A 3AHEA 3I2GA 4R71A 4HQ0A 2EZ8A 5E95A 4Z4EA 3JPWA 2Z1DA 1JAHA 1NBOA 3FNEA 3A9WA 1KY4A 3UWDA 5C3MA 2JZCA 3AFMA 3BK1A 2RI1A 3L43A 4KQHA 4OHXA 5JNLA 1HXHA 1YD7A 4HJXA 4QUIA 5DW3A 4UM9B