3TOSA

Crystal structure of cals11, calicheamicin methyltransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
251
structure length
251
Chain Sequence
QDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMDALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGFPDVNDVDRVGPTAYQGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQTVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRWGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CalS11
publication title Crystal Structure of CalS11, Calicheamicin methyltransferase
rcsb
source organism Micromonospora echinospora
molecule tags Transferase
total genus 75
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05711 TylF Macrocin-O-methyltransferase (TylF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3tosA00
2PLWA 3FTDA 1Q0SA 3KQWA 3V97A 3EVFA 5KQRA 1WG8A 3THRA 3UJDA 5K0BA 3NDJA 4PYIA 5GM1A 1NV8A 2NP7A 3CBGA 3BWBA 5G02A 1UWVA 2CKDA 3B7PA 5KS2A 5DM1A 2JJQA 2JHCA 2YUIA 4CKEA 5MHTA 1NW6A 2O0LA 2PGXA 1R00A 4OQEA 5CVUA 4HTFB 3IYLW 1NW3A 3I53A 4BLWA 3CJRA 2HV9A 4E2ZA 3CGGA 3FUUA 5DXAA 3OU6A 3OZRA 1KR5A 1NKVA 4YUYA 1XXLA 1JQ3A 3SGLA 2NXJA 5KQSA 2PT9A 1O54A 5EIWA 1VQ1A 2NXCA 1XVAA 4GOOD 5DWQA 1KYWA 3FPGA 2UYOA 4QDKA 3LCCA 2C7OA 5CVDA 1JR4A 1R74A 1MJFA 3TMAA 5BXYA 2R6ZA 2JH9A 4DQ0A 1JG3A 2I6GA 3CVOA 1QAQA 3HNRA 2PVCA 2QRVB 3FUXA 4QPPA 3U81A 3GNLA 1D2HA 4LG1A 5H02A 3P71T 3EVAA 2HR1A 2EJTA 1Q0TA 1D2GA 1XTPA 2OB1A 3GDHA 4V0QA 5FWDA 1KXZA 2AOUB 2ZWVA 3O31A 4AZVA 3CCFA 2H1RA 2G72A 4X41A 5EEGA 1N7IA 4XUCA 5EZSA 4KRGA 1AV6A 3KR2A 2PV0A 4X63A 2P3OA 1SG9A 4AX8A 4CXMA 2AVNA 3KPWA 3ER9A 4RTQA 3JWHA 1SQFA 5EMJA 2R3SA 5FHQA 3DXYA 2PJDA 1IXKA 5FA8A 3DLIA 1SUIA 2VDVE 5DLYA 5EZQA 3LGAA 2ZLBA 2JG3A 1VBFA 2ESRA 2PX8A 3GRRA 2ZZMA 4CWAA 3AWIA 1L1EA 4UOEA 3LL7A 3PTAA 2JHAA 3LHDA 2P1DA 2QYOA 2Y1XA 3BGVA 3PB3A 5DX1A 5HIJA 4POOA 2K4MA 1O9HA 4E31A 3A27A 4KDCA 4OA8A 1VP3A 4U7PB 4FR0A 1TW2A 5FUBA 2C7PA 3HEMA 1ORHA 5DX8A 2OPBA 1X1CA 2IBTA 2PWYA 2QM3A 4GC9A 1IY9A 3G2QA 3P9NA 2AOTA 3WSTA 4YV2A 4DM3A 1T43A 3IHTA 5HZMA 3S68A 2CWWA 2YR0A 5JR3A 1L3IA 2GAFA 2PX5A 4HRAA 1D2CA 2PSSA 3AY0A 3M6UA 3KQVA 4C03A 2XBMA 4HH4A 4BP1A 3TPZA 1L3BA 2JH8A 1XCLA 4ISCA 5EVJA 3B3JA 3LDUA 3FRIA 5DX0A 3EVEA 4H0NA 3VYWA 4YV0A 3KQSA 4HGZA 1N7JA 2ZZNA 3QOXA 5GOZA 5EG5A 5DTRA 3R3HA 3P9CA 3KHKA 3NDIA 2FK7A 3KQQA 4QTUB 4RSRA 5FULA 3HCBA 3RW9A 1R8XA 3OZTA 1ORIA 4PYLA 2ZTHA 2AOVA 1NW7A 2DULA 3CC8A 2XYVA 5E2BA 4ATNA 2Z6AA 1G8SA 3BUSA 2FCAA 2H11A 2P40A 4ER0A 3D2LA 1F3LA 3GRUA 4RV9A 3X0DA 2AOWA 5P8WA 4E30A 3RODA 9MHTA 1EJ6A 1QANA 3C6KA 1NT2A 4L7VA 2IGTA 5HIIA 2EX4A 2ZSUA 3BWCA 4GOND 4PGHA 4C07A 1I9GA 3FPHA 3T7RA 5ICCA 5GIOE 3BGDA 1G38A 3TM5A 4QVKA 2B78A 3HVKA 4AUKA 3R9XB 2VDUE 3DUWA 5JUWA 5K0GA 3L8DA 1RJGA 3UFBA 2P7HA 3OFJA 4YUZA 3FTEA 3AXSA 3KR1A 3LBFA 2UZ4A 3OE5A 3BT7A 4C04A 7MHTA 2BZGA 5E1MA 1V39A 4IKPA 1SUSA 1PRYA 1JSXA 3OPNA 5M5BA 4O29A 5DM2A 4P7KA 2FPOA 3KQYA 5EMLA 5T67A 1G8AA 4Y2HA 3TR6A 1BOOA 1RI2A 3M70A 4FSDA 1X1AA 4M7RA 3M4XA 2P3LA 1X19A 3EEYA 4PCAA 1NW5A 3ELUA 3DTNA 4AZWA 4K6MA 2E5WA 2GPYA 2V7EA 2VP3A 1RI5A 3M6VA 4MIKA 2O05A 2ERCA 5DT2A 2ONZA 2I9KA 4P7GA 4GUAA 5K0JA 4R6WA 2AR0A 2IBSA 3UJ6A 2HNKA 1G60A 4QQKA 3FRHA 4LECA 4JXJA 3SMQA 3LX6A 1JQEA 5BP7A 3BWYA 3K6RA 3GRYA 4MQ4A 2PXCA 3C3YA 3KQOA 3G2OA 3JWGA 2OXTA 3NW9A 1UFKA 4RYLA 5CD1A 4KIFA 5B1SA 3KU1A 1I1NA 3PX3A 3MB5A 1QYRA 2AOTB 4DZRA 2PX4A 4OQDA 3C0KA 4X61A 4OBWA 1YFLA 2B2CA 4DKJA 1UIRA 3C6MA 5ERGB 4R05A 4CTKA 2BR4A 4BLVA 2CMGA 3EMDA 2AS0A 3AXTA 3G5LA 4ER5A 3HCDA 5CCXA 3PVCA 3V8VA 3MHTA 5EC8A 2O06A 4CKBA 3R6TA 3NJRA 3GGDA 1VLMA 4PYMA 3I9FA 1AQJA 3DOUA 4PONA 2ZW9A 3UJ8A 4RTRA 3GRZA 2OKCA 2NXNA 4RVGA 1ZQ9A 3FTFA 1JQDA 1R8YA 2YXEA 2AN5A 4QDJA 3VC2A 2ZBPA 4MTLA 2P35A 3G2MA 1KIAA 3HP7A 2QY6A 4GBED 4ZTBA 4RVHA 2G70A 3HCFA 3OU2A 5FQNA 4QPNA 3SSMA 3I64A 3SSOA 3G88A 3AJDA 3EGVA 1ZG3A 3KQMA 3LKZA 5HIMA 4EK9A 2ZFUA 4RTJA 3A26A 4GQBA 5HILA 2HTEA 4BLUA 3GWZA 3HCAA 2O07A 3UWPA 3OZSA 4RTLA 4IV0A 5FCDA 5EIFA 3E7PA 2DPMA 4C08A 3DMGA 4HC4A 1JG1A 3G7UA 1NE2A 5E9QA 5CUQA 1VP9A 2PX2A 5U4XA 3LDFA 2PWPA 3C3PA 2GS9A 1XDZA 4DCGA 5LQJA 2AVDA 4RVFA 4G56A 3TRKA 2AOXA 2NNWB 3H2BA 4DF3A 1R18A 3KR0A 3UBTA 5DRTA 3BWMA 3OFKA 3EVCA 1TPYA 1SQGA 2KW5A 3A25A 2IPXA 1I4WA 1KPIA 5FTWA 4E33A 4RVDA 3A7DA 1X1BA 5HFJA 4EKGA 1KHHA 3R0QA 1OR8A 5DSTA 1P1BA 2ZIGA 1JTFA 3ERCA 2WA1A 5D1HA 2FYTA 4ER3A 3GCZA 5K0FA 4GC5A 4DMGA 5IH3A 2PXXA 5K05A 3FUWA 1BHJA 5CVEA 5LQUA 1ZGJA 2NYUA 4PIPA 2IDJA 1G55A 5GM2A 3DXXA 2IIPA 4DCMA 3ANXA 3EGIA 4KWCA 5EHGA 5LSAA 3EPPA 2ZCJA 1INLA 4PNEA 4KIGA 3M6WA 3SXJA 3HA3A 1WZNA 5DTQA 4RTKA 1FPQA 1KYZA 1RI4A 3PFGA 4OA5A 1F38A 1L3CA 1NW8A 1QAMA 4PIMA 3FPEA 3KKZA 1HMYA 2BR3A 3NTVA 3KPVA 4FZVA 3CJQA 2BH2A 2ONYA 5K0CA 3TLJA 4C4AA 2A14A 3KQTA 4LWOA 2ZVJA 4HG2A 4F84A 3QV2A 3TKYA 5BW5A 2GH1A 3BXOA 2IH4A 5E2AA 1HNNA 3JWJA 4Y30A 3VC1A 5LQAA 1NV9A 3ID6C 4FP9A 3E8SA 3MGGA 2Q41A 4DA4A 3B5IA 3EMBA 4A6EA 2V74B 2GB4A 1WXXA 4LWPA 3UJAA 3ER8A 3UA4A 3TM4A 3M33A 4PYJA 4AZSA 3EGEA 5ICFA 3O7WA 3B3FA 5K8VA 1H1DA 3NWBA 1XDSA 2QRVA 2ZWAA 1JTEA 5E8RA 5EOVA 2BR5A 2UYHA 3LCVB 3BKWA 4KDRA 2I62A 4HSGA 5E9WA 2OO3A 4V0RA 4FS8A 2B25A 2YVLA 1RI3A 1G6Q1 2ZBQA 2BM9A 3G8AA 3LSTA 3I58A 4GEKA 4XCXA 5T64A 2B9EA 3GIWA 1DL5A 2OBFA 5HIKA 3O4FA 5K0EA 4E2YA 2CMHA 4GOMD 3FTCA 4P7JA 1QZZA 2PT6A 5GWXA 3UJ7A 5EMKA 3ELYA 2BM8A 4PYQA 2AZTA 2EG5A 4P7FA 5E1OA 2YX1A 1VPTA 4EKIA 3T7TA 1O9GA 4ER6A 1KPGA 2IH2A 4HGYA 2ZULA 4C05A 3M6XA 1FP2A 3DULA 3HA7A 5GIPE 1M6EX 4RWZA 4BP3A 3ME5A 4KW7A 3FYCA 1KPHA 2UYCA 3NVKI 1ZHFA 1M6YA 1FP1D 1NBHA 2WK1A 1N2XA 3CKKA 3EEOA 4B17A 1ZKDA 3GXOA 5K0NA 2Z6UA 3NMUF 1DUSA 5EKXA 4MWZA 2YQZA 1AQIA 3DLCA 3TQSA 1U2ZA 2F8LA 4A6DA 2UYQA 3TOSA 3DR5A 3LDGA 3SX0A 5DM0A 3VSEA 4AZTA 2FRXA 4QTTB 3DXZA 3UJBA 3P2IA 1BKYA 1QAOA 3EVBA 3G2PA 1Y8CA 3FPJA 4PCLA 3SSNA 4ER7A 4M36A 1X1DA 3KPYA 1NBIA 4YV1A 4YUWA 4PGGA 1R6AA 1XJ5A 2I7CA 3HM2A 4GOLD 3GRVA 2ADMA 5EKUA 4EQZA 2P7IA 2IH5A 1P39A 2P41A 2YXDA 3DH0A 3HTXA 3GJYA 4E2WA 2FK8A 3HCEA 3EVDA 4PYOA 5EHIA 3EVGA 2VDWA 3BKXA 5LQRA 2LD4A 4U7TB 3Q7EA 4XUDA 3F4KA 4PYKA 2XVAA 2G8NA 4RTOA 1VE3A 2PXAA 1SKMA 4WXHA 3GO4A 2B3TA 1EIZA 2ZBRA 1XCJA 5FHRA 3PT9A 4YMHA 2H00A 3UJCA 3FUVA 5LQNA 1JG4A 5FWAA 2IDKA 4M37A 5K0LA 4XUEA 5ICEA 3LPMA 3NVMB 5CIYA 1MHTA 3OCJA 4RX1A 1YFJA 5LQCA 2XYQA 2VZ9A 4F85A 3R24A 1P1CA 4R8RA 3IEIA 4NECA 3KPJA 3MAGA 3SM3A 4OBXA 3TFWA 3B89A 4X60A 5GINE 3FPFA 1YZHA 5DRYA 3NWEA 3KPUA 5F2KA 3DMHA 1WXWA 2CL5A 3G89A 2OB2A 2ZIEA 3HVHA 1JG2A 3KQPA 1RJFA 3OU7A 4YUVA 3REOA 3UJ9A 3MCTA 5BW4A 4OX9Y 2ZIFA 4M38A 4FGZA 1Z3CA 3E23A 1RJEA 3T7SA 5ICGA 3P8ZA 2JHPA 5LQKA 2YXLA 3RIEA 5E1BA 2PY6A 3GU3A 1VIDA 4QVGA 3E05A 3ELDA 5E9JA 1WS6A 1YB2A 2EFJA 1AF7A 1PJZA 3A4TA 3K0BA 3ORHA 5FA5A 3SR4A 1KP9A 2N47A 3FYDA 5HEKA 5EEHA 3UA3A 5C9ZA 1YF3A 3HCCA 4MHTA 3Q87B 5C1IA 5K09A 4RTMA 2NXEA 2Z6QA 5EPEA 2AN3A 3MTIA 5EGSA 2ORED 3P97A 4PWYA 2Y1WA 3FUTA 4E70A 1WY7A 1RI1A 3JWIA 4EVIA 2EJUA 4P58A 5E8JA 5EQJB 4HTFA 3LCUA 3P2EA 4F86A 1ZGAA 3PX2A 4KVZA 2HWKA 5HOQA 3IV6A 4RTSA 2VS1A 3MQ2A 3UZUA 2NP6A 3PLAE 2XVMA 1FJXA 4CKCA 3T0IA 2G1PA 3QOWA 5F2OA 4CTJA 3A7EA 2WA2A 5DTMA 4YUXA 4GF5A 2XYRA 2AN4A 3SVZA 4PYNA 3PFHA 1VL5A 4E32A 1DCTA 1XDUA 2PBFA 3LBYA 3BZBA 3FZGA 4IWNA 3DP7A 5FADA 3THSA 4YMGA 3DMFA 4X1OA 3PS9A 1YUBA 5DPMA 2C7RA 4WVLA 3TKAA 3G5TA 5T6BA 4Z2YA 4RTPA 2AOUA 3MTEA 5FQOA 3HA5A 4PINA 5CVVA 5E1DA 1M0EA 2GLUA 1EG2A 3B3GA 4QQNA 2GA9A 5DM4A 4RTNA 4R8SA 4FT2A 2FHPA 3ELWA 2HMYB 3KR9A 3MCZA 1IM8A 2P8JA 2PKWA 3HVJA 3I5UA 1B42A 4FSXA 3P9KA 5CM2Z 1EQAA 3MERA 5IKMA 1RJDA 2QE6A 5KVAA 8MHTA 1L9KA 5DSXA 3OE4A 5C0OE 4E2XA 10MHA 1FBNA 5K01A 2YTZA 2G71A 3G8BA 2IFTA 5CVJA 1EAMA 2OY0A 1EJ0A 3BGIA 4IV8A 5DXJA 2OZVA 2P3QA 2ZZKA 5EMMA 5KYGA 5CCBA 5D1NA 1BC5A 2OYRA 3P9IA 4C06A 1SVUA 3CJTA 4BY9E 2O57A 4FT4A 1JSZA 3LECA 2IP2A 3P2KA 4EMSA 2C7QA 3LKDA 5F2NA 4R6XA 1TW3A 3EVZA 3HVIA 5K03A 1P91A 5LR6A 1YZ3A 5GP1A
chains in the Genus database with same CATH superfamily
3HBFA 3E2PA 1ONBA 5I8PA 1P2FA 2F1RA 4MTCA 3P9SA 4G5QA 2XOKD 3THRA 1LBIA 4QO7A 4PYIA 1TAHA 4RPCA 1IWOA 5ALQA 1IJEA 3K1TA 3WWOA 1NBME 5J40A 5DLPA 2JJQA 1EZZA 3EEQA 1NW6A 5B1EA 1X8JA 1Y7PA 5IT0A 1SOAA 1FUEA 2ZTLA 4OXYA 1QG0A 1HE1C 4AIRA 5DXAA 3V7NA 2GCOB 3ROPA 3U9TA 4MDHA 5KMGB 3K16A 1JKFA 1S8AA 2ZANA 4CIDA 5IZCC 1PEKE 2V97A 4PBSA 1GFWA 3WLRA 4ND2A 1WSAA 1KAHA 4I8IA 5CFOA 2SKCA 5AOBA 4D9IA 3MINB 2CCJA 4CN9A 3CXRA 4JYBA 4Q4CA 4CR8A 1TZMA 3UK6A 1SVKA 3AY6A 2E55A 3GNLA 3CEJA 4ZT7A 3WNCA 2JKVA 2P3SA 2VSFA 2GCIA 1C0IA 2C61A 4K9OA 4BFXA 1W9MA 1GU1A 1U5AA 3EVAA 4CZ2A 2PUVA 1SIOA 1WEHA 3QBTA 4E21A 1XRSB 1ZRHA 2H0RA 2YUTA 3ZU5A 4FEAA 1JBQA 1DKNA 1GT91 4NS4A 1YA8A 5H9VA 4BO6A 4DNPA 2P27A 2RGRA 2EJBA 2OOSA 2J31A 1AV6A 1OYYA 4WH0A 5CA0F 5ULLA 2P3OA 1FFAA 1T0BA 1P5RA 2C2BA 2ZJ7A 3KSRA 4BMPB 4CMJA 3K0FA 4CV2A 3DAFA 2ISSD 4XWKA 4CKZA 5AVVA 1E3DA 5EWJB 4FIZA 3PNOA 3IPCA 5EI5A 3SWWA 1CUYA 1JHZA 4I9HA 3L4BA 4QM6A 1QHHA 3PU6A 3H13A 3DKVA 4C29A 3PTAA 2DJ5A 3QX8A 5D5PA 5FL7A 4DABA 3PB3A 1CX9B 1QF6A 1I7PA 1YJ8A 4HGPA 3IVXA 1PEDA 1T8PA 2XUDA 4YCBA 4J0KA 4EVSA 1Q7TA 1SPXA 1EEHA 1ZJ5A 2XBLA 2NM0A 2ZE8A 3HO8A 4GLOA 3LQ2A 4KITB 2AI2A 2B7LA 3F47A 3A2NA 4GC9A 1TECE 1B3BA 1VG0B 2QRPA 2JIPA 3B6MA 1QHXA 2QR5A 3ND7A 3TRIA 2LIPA 3N5KA 4QJ3A 1UP6A 1N0UA 1CUJA 1FVXA 1KFJB 1T8WA 2Q5QA 2BBWA 2Y0CA 3DOOA 3BBLA 2J85A 3PUXA 2B8TA 1DC4A 1I7LA 1Y1RA 1NSFA 2O1WA 2ZWOA 4ISBA 1TUIA 4REOA 3RWMB 4RKQA 5HJ7A 1TU4A 1NXQA 3AGPA 5EWMB 4DJAA 3E82A 4OU5A 1T6YA 5DX0A 4LQDA 5E0KB 3V5NA 1ZH2A 4YTEA 4WDRA 1XZJA 1TA4A 4KIWA 4QFMA 1T3ZA 2A30A 1W96A 5AW3A 3B78A 3B3AA 1PJRA 4EITA 1HSOA 5FBKA 2NVUA 3GEBA 3GLUA 3BUSA 5IC4A 2IHNA 2H11A 3BN3A 3DE2X 3X0DA 5BPFA 1BO6A 1TYBE 2RSLA 9MHTA 2ZS8A 1NT2A 2C42A 4KQKA 5HIIA 2EX4A 1K8QA 3FNRA 3QUCA 5BMVA 4YXWD 1CEYA 1GZHB 2J33A 5BWCA 4BLPA 2CVOA 2GXAA 5A06A 1YFKA 2CV2A 3IILA 2OHVA 1CZKA 4KXWA 4LF7B 2BFEB 4KLRA 2EBUA 3VDNB 4TMVA 1AN0A 2KHZA 2QN9A 2XQGA 4GYWA 2B83A 1GGFA 2FLWA 4YDRA 5J4LA 1S8NA 3U7QA 3FFAA 2J0UB 1KQGA 3O1JC 4Q4LA 1V9SA 3C5CA 4O29A 2FW1A 5H7XA 5T5QA 2Q4TA 4AP5A 3T38A 1RXEA 4C78A 5HXAA 3WE7A 1R10A 3DTNA 2BUAA 2EFDB 1E61A 2SKEA 4FYKA 4DSNA 4HDQB 4D3DA 4NCAA 1UZLA 3HQ4O 2WWRA 4I36A 3ZUGA 1GAEO 4MKHA 3FKJA 2AC4A 4MUFA 4C2UA 1A0OA 1NX6A 2XWSA 5AT1A 4EPTA 1ZM4A 1QZ3A 5K1ZA 4CLOA 3A9CA 3O8BA 5HCIA 3JATA 1S8OA 2YY5A 1JFRA 3K94A 2CXHA 3KYBA 2NAPA 5AHKA 3DEIA 2Y6VA 3O3MB 1YA4A 4FOTA 3MUEA 1WCIA 4H17A 1QYRA 2XUPA 4N01A 5KU7A 5EPOA 5F77A 3DYBA 1S7CA 4W9NC 3H1FA 4HWGA 4AYTA 4EGCB 4XCVA 4FKZA 3P9XA 1ZZGA 2QIOA 5BV0A 5ERGB 2I6SA 3MS4A 1LRLA 4YNBA 5IJXA 4Y9SA 3EMDA 3ROQA 1FTWA 3FVQA 3T3IA 1XZNA 3IDQA 1NNEA 3H8WA 4CKBA 2BUBA 1GV1A 2HA7A 1SCBA 4TZTA 4TV8A 1JKXA 3I9FA 3P2MA 5IM5A 3ZTTA 1EE1A 3UJ8A 5DHFA 1J00A 3P2YA 1ZQ9A 1Z62A 4GG1A 2IPAB 1BJRE 3L7CA 4BO0A 1MO2A 4MTLA 3QP9A 3OQNA 2EKPA 3DJYA 4AO6A 3I4FA 1B74A 2W4IA 2WF7A 3R7BA 3E3MA 3VHLB 2OV6A 4QJIA 2YC2C 5TJ9A 2I65A 4DCUA 1ODSA 3B5JA 1FS5A 1FYEA 1QFYA 3ANMA 4MKZA 1VA4A 3LXXA 3RF7A 4B81A 5HP4A 3LE8A 3HNOA 4P4SA 1AKWA 2X2OA 4BLUA 3OPQA 4PM4A 1V3QE 4G5XA 4YRFA 4OXIA 4MGIR 1SKQA 4R7TA 4KAFA 1V9CA 1M2KA 3H11B 2CNDA 5F35A 4RIHA 4EHIA 3H0KA 4IKEA 2YNMD 3GJ3A 3DZKA 1M2EA 1UBRS 1H23A 3H5RA 5E9QA 4UCFA 3JYLA 4J1TA 4EJSA 4Z1OA 3E5HA 1XALA 2HDWA 3ZUPA 1NLUA 1USWA 2OGSA 4UNPA 2N9UA 4DF3A 2YQ5A 4HYEA 3UC9A 2ZBGA 3D8SA 1D7OA 2GD0A 1KMHB 3H05A 4QTXA 5G40A 2HA0A 2BP7A 3CTMA 5HKKD 1MEOA 3FI0A 3D5TA 2QT9A 2MYPA 1R0XA 2KWIA 1TPYA 5LBUA 1ZK1A 4YJ3F 4BTVA 4RETA 4ZGBA 4DBLE 4YJ2F 5K4AA 1G3MA 5J5VA 1ZNZA 4PZDA 1MOSA 5LBTA 2ECPA 2A5LA 1NI3A 5I9TA 4YCNA 4PAOA 2AKEA 2Z3VA 2ZB2A 3QVUA 2O20A 4BWGA 1NFQA 3ND6A 1VFNA 4DMGA 2PXXA 4RZIA 5T3YA 5IDWA 5K0FA 1IB6A 5EXEA 3EUWA 1RR6A 2BMJA 2X42A 5JWHA 4IXTA 1P3Y1 5AW7A 1HDRA 2HNBA 1PNQA 3I9NA 3OY7A 5JRDS 1ST2A 1XFDA 3RVJA 2QQEA 4L5JA 1XTKA 2QT1A 5BURA 1AMUA 4F92B 4AG6A 4LOHA 1EVZA 3GGCA 1WZNA 5TQ0B 5KYWB 2GCNA 2PH5A 3COSA 1MD9A 1F8GA 5IWCA 3H1GA 4A6XA 5L51A 3B1JA 1FU8A 1PF7E 2FFRA 5BWMA 1JG7A 1B2RA 3CJQA 4KI7A 4E5YA 1SG0A 1JPUA 4ETWA 3RRXA 4LBVA 3BAZA 2ZI3A 3NFRA 2PKQP 4OFWA 3F8SA 3SZGA 3BQNB 1R4MB 2XSZA 3M3HA 4YXWA 2QBYA 5CNIA 5BW5A 4ND4A 4X0EA 2WWXA 3AVOA 3KOMA 4W5HA 5DHUA 5E6RA 5AHWA 5L8VA 1QE0A 3T0FA 3LBIA 3ID6C 1VPWA 4X65B 2IV3A 5IJ9A 4ZOQI 1I8TA 4ZOLB 3UW1A 3SYMA 3KV1A 4M87A 4NF2A 2AQKA 4UPEA 3WQHA 4EFKA 1V3TA 3FYUB 4XQ9A 4FYWA 3GFFA 3M89A 5ICFA 4D3XA 2VH1A 3ZQUA 3C4VA 2PRYA 5EIHA 4R1NA 2QRVA 4Y2PA 4QAQA 2ZAYA 5K8JB 1NG9A 1FQKA 1V37A 1X7XB 2O2ZA 4RZXA 1W35A 4CPDA 1EFLA 1NVBA 2V9CA 2ZCJA 1TB4A 3D3WA 4O4LF 5K6AC 3KJZA 4Y1RB 4XSGA 4YLGA 3UV7A 4MOWA 3LX8A 3OZ7A 4KE6A 4LRUA 2HJ9A 3S3TA 3GGJA 4R9VA 1GTL1 4XX0A 5K0ZA 5FI5A 4Q3AA 1EK0A 1C3EA 2VPIA 2O2IA 3PEEA 1V48A 1H1TA 3TLBA 2OVBA 1XNRB 5HG0A 3M6XA 4RULA 2GF9A 3D6UA 2QMQA 4D0GA 2FSFA 3AJAA 1VPEA 2PEZA 2PMBA 4NE2A 3THYA 2AKAB 3G9TA 4QBTA 4RD0A 4RL4A 3LMKA 2Q7XA 4FQ7A 3V00A 5THQA 2UYCA 2JI7A 2VJMA 1T6BY 1N2XA 1HFKA 5ALTA 2CDRA 2GUWA 4AKEA 4MV4A 4BGEA 1ZCFA 4ZQCB 3U4GA 2Z6UA 4JBNA 1DUSA 4KLCA 3IAS6 2E49A 3ZWNA 4L0MA 2XNCA 4E88A 2CXRA 1OAKA 3D1LA 3LOUA 1U2DC 1Z28A 1T1JA 1FNMA 2GTPA 2IOFK 1BS2A 2WV7A 4HQFA 4WZ6A 1L5QA 1AX9A 4BNKA 1UZNA 1YB1A 4RF2A 2J4CA 4MH0R 5CG1A 2X5XA 1ZA2A 4E3ZA 2NO5A 3ACCA 2W71A 1XB2A 4YJFA 1HYQA 2GEKA 2QX4A 5GZ6A 4IGAA 1LFAA 5HQ3B 4C4YA 4I1OA 1NPDA 3R74A 1TVKB 4ARBA 5HWSA 3BX1A 1C1XA 3S8YA 4CQNA 3NS7A 2FEXA 3FKSA 4O2LA 1J8DA 2QTNA 1L6RA 3FOEC 1QG2A 4RZSA 1T25A 2HK8A 1FRNA 1WTAA 3GT7A 3MSXA 4W7SA 3HB5X 1QJ4A 2YNMA 2NPOA 5JJBA 3FVTA 3G02A 2LBPA 1V5GA 1WKBA 4BJ3A 2QYTA 1X87A 2JGKA 1UKCA 1J90A 3CO5A 1HE4A 3OSUA 1VKHA 5ECYA 4Q6WA 2QMUA 2O0MA 4P1ZA 1JG4A 4FNAA 5FWAA 4QFBA 4TYWA 1WF3A 4YBRA 2Q99A 4IJMA 3DWFA 3L6OO 4I1RA 4ICIA 4PX5A 4BEWA 2JEZA 2WKQA 3V4LA 3VU9B 5SZKB 3CISA 1KKLA 3F5DA 3OCJA 4ZI3A 1N8NA 4IHJF 1YFJA 521PA 3FMOB 4KP7A 4X62B 5LL6P 4U7DA 1TGVA 1CERA 1SQ0A 2F1HA 4K1XA 3RWBA 5MGNA 2P1ZA 3I9V6 4V0MA 4N18A 4PPNA 2MTBA 2D5AA 3H1AA 3O3NB 3ZDBA 1ZISA 4G0VA 2QS9A 3IQZA 3AM1A 4XE5A 3UEOA 4G65A 4PE5B 2J0VA 5E7QA 4E1VA 3M0EA 1L5VA 5KX5A 3HSSA 2ZBDA 3D0RA 3UF0A 3FB4A 4HBZA 4FNOA 4M88A 1C9YA 1IMOA 4RQTA 3T7SA 4TYPA 3WL5A 1M1XB 2Q4RA 3NO4A 4EX7A 3Q11A 1DAKA 1AUXA 1Z2CA 4JGIA 1M2FA 4JELA 1AF7A 1GR0A 1XCPA 4DM7A 3LC7O 1C50A 1D1PA 1E3JA 1XT6A 4HUJA 3UMVA 4YX9A 4JLSA 4C2BA 2HK9A 1TA9A 1RHKA 4KK3A 4URXR 3FOZA 1YMVA 1US8A 4TYQA 2QRJA 3FUTA 3NWJA 2WG2A 3K0HA 5FORA 2F8MA 4P7BA 4HN2A 5E8JA 1T8SA 4K5QA 4R8MA 4YC7A 1L5LA 4AYWA 5C46F 4UEQA 4J3NA 4DB2A 1PJ2A 3JZAA 1R27A 1XZPA 1CQJB 2Q3LA 3OQVA 2XVMA 4KTVE 3CZ9A 1YXMA 2DAPA 1TRKA 4U7HA 4UDNA 5G0SA 2JGFA 3QOWA 5YASA 4D3ZA 3RAEC 1IZZA 5AJTA 3DFKA 4JLUA 2NSLA 1LA2A 1QKIA 1CRQA 3L8ZA 4ZHQA 1Q7EA 3KL2A 2A59A 3TDMA 1O3YA 1R15A 4Z3KA 1XHEA 2XE4A 1YULA 3KLPX 3QBVA 3RBAA 3BZBA 1PUXA 4BB6A 4WJLA 3DP7A 5CHEA 1AA6A 4ZEMA 4O1HA 2HPZA 2I6TA 1AKQA 4PLYA 2C4MA 5EP4A 5AM1A 3CH6A 1SBTA 4UNQA 4DLVA 4BQRA 2C5AA 1I13A 3DBVO 2Y1LA 5BQXA 2AOUA 2LKDA 4GMGA 1SU8A 1YS9A 2W6ID 2TECE 3S2EA 3W9BA 2FQQA 1JYSA 3U5TA 3B3GA 4I5DA 5ALFA 3UUWA 1U1FA 1XWIA 3GN2A 3I6MA 3HXPA 1T0HB 1IPHA 2BFCB 4IIFA 1RADA 3WZMA 2VA8A 1C1DA 1UDRA 4FHEA 5CM2Z 2XMSA 2ZUWA 1H2RS 1W76A 1HORA 1HLGA 5CK5A 4UNIA 5C0OE 5GVSA 4F5YA 3NM6B 1HYGA 1X70A 2P6RA 4IF4A 4IDFA 4N8SA 4KMRA 1XKLA 1YDGA 1MG5A 2M98A 3QNWA 1KP3A 4CMIB 1N9ZA 4XM0A 5TARA 3DTYA 2YVUA 3DAOA 4QPZA 3EGDB 5FV7A 3G1TA 3CN9A 1QHGA 3HDYA 2QVCA 2QYSA 1V11B 4MCIA 1NM5A 4JI1B 5EERA 5CEEA 1VLVA 3BTSA 5LJIA 3T0GA 3V97A 3ROEA 4X1IB 4HFRA 4YP9A 2LNDA 3D5EA 3WVNA 1H05A 1C7EA 3ISVA 4EB6A 1V4VA 1GNTA 4JP3A 5DBEX 4L5AA 2R00C 5GM1A 5FTMA 2J5XA 1SUEA 1E7RA 2A9OA 4NJEB 2CF6A 3WGIA 1ZVJA 3F4BA 3LJKA 3QLEA 4JCOA 4JLOA 1A3CA 4MVJA 4ZVKA 2YUIA 1NWHA 2O3RA 1FSPA 3D4NA 3KSZO 3CJRA 2WU0A 2ZJ5A 3VDQA 4MAAA 1FDOA 1T5TA 1YVEI 4KWIA 3JAKA 3ZDRA 6ABPA 3QJGA 5J47A 3HY3A 2BGGA 2Q2VA 4UDXX 4QYTA 2JHFA 2WJ6A 4MQMA 4EHFA 4GR5A 4GQAA 1IG3A 1UZMA 2ST1A 5FWYB 1TM1E 3IQIX 5DGDA 1U7UA 4AC9A 3HKEA 3L77A 3WJ1A 3QYJA 4UNSA 4WLUA 2NT4A 1O58A 3PA8A 2R6JA 3AEZA 5C1PA 1IK6A 4A5OA 1JN0A 2PFKA 1VB5A 2W98A 1Q0ZA 2ZWPA 1FJHA 3KKPA 3KDSE 2KMLA 4RY2A 1R9JA 4UCQA 2RHJA 3R44A 5BRNA 5ALVA 1NOKA 1WLSA 1PWZA 4A36A 5KHLB 1WXIA 1J0DA 4CMCA 2P6OA 1WP4A 3AFNA 4ABYA 4Q7QA 1XTZA 1UF9A 1KFBB 2EERA 3V33A 3DOCA 4WXPA 3ER9A 3UKJA 3F78A 4JLBA 1SQFA 3AH8A 1UIMA 1JKIA 4OGWA 2CXUA 1UC5B 1DNPA 4U6NA 2R7LA 2GO1A 3WADA 3E1SA 1C2YA 3RQIA 1CS0B 1EMDA 3PYXA 4R2MA 3T7KA 1VYVA 1ZNQO 3TVYA 1J8FA 4DIOA 1LLUA 2PX8A 2WD7B 3D5QA 4HQRA 2CF5A 2IWRA 3I62A 5DX1A 2V6JA 4IJVA 4ENPA 5CLJA 3CX7A 4Y1GA 3EG9A 2AHRA 3IBCA 3TZLA 4I4TB 1MC4A 1UQUA 2VQEB 1IULA 1J21A 1H4SA 1MXHA 1Q0PA 1HZJA 1T4CA 2RC5A 2ZUCA 4TV9F 4U2CA 4UPDA 2ZS9A 4GICA 4YRPA 4F4UA 1G2IA 5IAAA 3EVNA 1E77A 1XA0A 3A9SA 2D2XA 1LD3A 4XI9A 4BVHA 3DFMA 2IELA 4IP0A 3TGWA 2FDCA 3WTBA 3GUUA 1U98A 3FMFA 1CJSA 3JVUA 3M6UA 1BWPA 5JYEA 1A4IA 1QBKC 3VU3A 4MPJA 4X8HA 3THXA 1A2QA 2NVOA 4CF3A 3IOYA 1GTZA 1J25A 2I54A 2VYVD 1JDUA 1NIJA 1U8CB 3ANYB 3CEMA 4LZPA 5FTKA 4B43A 5JXWA 3WRXA 2JGEA 3Q1LA 5BUCA 3NC4A 5DTRA 3GP5A 3LUJA 3A31A 1HE2A 1BH6A 1HV8A 3EFEA 1KVSA 4N0DA 4O4IB 3I2HA 5B1DA 3ZQ6A 3MM4A 2IITA 1OPRA 4MITA 4N41A 4OLJA 3QXCA 2A78A 2B92A 3OPYI 2E6KA 2W6IA 1U6IA 4HDKA 1OFIA 5DEOA 3LKBA 2GLXA 5KEIA 2A1IA 5BT9A 4OXKA 3VPCA 2B94A 5LP6B 2WIGA 4MJ7A 2HQRA 4B8YA 2GJAA 2XVYA 2DWCA 2B0JA 2CNNA 2DR0A 2ZT8A 3GFPA 4MYCA 3SZMA 3UT0A 4BFUA 2WVHA 5AK0A 4D99A 1M1UA 3LUGA 1XRNA 4BNMA 5GIOE 3TM5A 2A94A 3ZTYA 1PQYA 4ZJZA 3NHYA 3OIYA 1DT5A 1XLTC 1TXGA 1YR8A 3BQMB 1L5GB 1B0UA 3RPEA 2JJ1D 3V48A 5A6VA 3FTEA 1EFUA 1G5RA 3D2AA 1ULBA 1YR2A 2JFOA 5BWBA 1KYXA 2WNHA 4EGJA 2XRMA 5E1MA 5U9CA 1DJPA 1OZHA 3PQDA 2OV4A 4G1VA 4BMZA 4L95C 4R8VA 2D62A 2OSBA 4DRXA 1MO4A 1EGHA 1H42A 2W6OA 1KZ4A 3DGEC 4EP1A 1J2UA 4MDEA 1TTPB 2WWFA 3UCEA 1AHHA 3F6RA 3NHPA 4JIMA 1G8YA 3ZLUA 2QW0X 3OOYA 3CLRD 3KJQA 3LPNA 2IYLD 3EXHC 2PJZA 4K6MA 3ZVRA 4AZWA 2O8DA 1PJ4A 2PH3A 4HLDA 3GZJA 3WLSA 3LXUX 2EWWA 3RYIA 4L7QA 3FBWA 4Q5IA 3WKEA 5BR4A 1RPZA 3EGXB 5J63A 4LJ5A 3AIIA 2ARKA 3A6LA 3SIPA 1DBPA 3K6RA 4XAQA 2OBYA 5F9FA 4CLEA 2JJ2D 4JBLA 3SLKA 1I3CA 1J8YF 4GE3A 4I4IA 3HBAA 1Z2NX 1IG0A 3MB5A 1YOVA 2HQ1A 1OHHD 2IGBA 3CIFA 4FVTA 3H9UA 3LRTA 4WEOA 3WQSB 1N7HA 2Y1GA 4W6QA 2Q1XA 3CPEA 4OP1A 4W1RA 4G36A 4MQFB 4G2TA 4MROA 5PNTA 3C6MA 1PW5A 1O6ZA 4H18A 2FEAA 3BTUA 2QLFA 3F6BX 1ILWA 4G5YA 3ZCVA 3RE1A 3KYIB 3TIXB 1U94A 1UXJA 3WGOA 1OBCA 1PZFA 1AQJA 3DA8A 3NC1C 5LXTA 1YB4A 1B93A 1Q6ZA 4J4BA 4OOEA 3UT5A 3SC4A 4D26A 1DDIA 1ZINA 4LRWA 2V65A 4RHYA 3GLFA 5CGZA 2C77A 3VYWA 1E2FA 1SXJB 4PFJA 5BW8A 4RD6A 4CVNA 1Y3IA 2N42A 1O9BA 2ZDQA 3P27A 5F21A 5FQNA 3I64A 1X74A 5AHRA 3ZHQA 2WLTA 1UMBB 3T7IA 1QR6A 3K73O 1ZG3A 5ALXA 1W85B 2GBLC 2GN9A 2JFQA 2GYWA 4FS3A 3R3ZA 1L5RA 5BSFA 1RCTE 1CEXA 4M46A 4CRWB 1G5IA 4GU5A 1LPBB 2NO9A 4KPYA 2KS6A 1KDOA 4IV0A 1WUIS 1PV4A 3DMGA 3FTPA 4DMMA 2H2IA 2CJPA 3SEQA 1UPBA 3A9RA 4GBGA 4MEBA 3GLGE 1EFAA 1IK4A 1VP9A 3EULA 2BTQB 1QORA 4BMSA 3FVRA 2VF4X 2P4SA 1Z38A 4Q93A 4F2WA 3WYBA 1GPBA 4HP8A 1MORA 3L0ZA 3GEEA 8ADHA 1GNQA 3UBTA 4CUKA 4C0KA 1WM1A 3H16A 2PPVA 4JXZA 3OIUA 1V41E 3K2BA 3ESYA 2V03A 3PUYA 5CYPA 3RB8A 2W2MA 2KW5A 3A25A 3H1PA 4BFTA 3E81A 5JBNA 4KEAA 3A7DA 4AUNA 2VSNA 4ESVA 3FZQA 4P5DA 4CT4B 2RG1A 4D8XA 1K3TA 2ISQA 1CNFA 3P0FA 3LZ6A 4KSBA 4WCDA 3IV9A 5D5QA 4CMEA 1GADO 2WDPA 3EZ6A 3N0TA 2VYVA 3OX3A 2CFSA 2NYUA 4LX8A 1O95D 4HLQB 4X1KA 5DI3B 4CMGA 5JRJA 3ZWYA 1NUAA 3UJPA 1QGED 2JGLA 3NBAA 3S70A 5JWRA 3N6VA 1OLXB 1P8AA 3QU9A 1HLFA 2W6CX 3VVMA 3B1FA 2NT3A 4RTKA 2NZJA 1KYZA 4FWBA 4PIMA 3JTMA 2PUHA 1L3CA 1IJFA 3WGYA 1CJVC 4C3ZA 4DLKA 1CB0A 4IUYA 2WAOA 4DCJA 1EFKA 3L02A 5EIOA 3PVZA 1H2EA 3KSBC 3P5BA 4DV3B 3ZPXA 2B4QA 3NKFA 4HX9A 3PRYA 4DSAA 2EKDA 4LNUB 5KAMA 5HBGA 4KWEA 2F3PA 2GCOA 3MYRA 3PXCX 3Q3GE 1EK6A 3VTKA 1BSVA 1C8KA 3ESBA 2IYYA 2JJ1A 3B5IA 3OQJA 3PIRA 5KNBD 3IP7A 1USGA 1I2ZA 1Z12A 3RVNA 3UJAA 4YAFA 4RY9A 2PT5A 4LJYA 1FE8A 1DDOA 3IAAA 4A8JA 3KSAC 5BV2P 2A3NA 4Y67A 1E64A 2FX5A 1XD8A 1USKA 1QYCA 4HOYA 4NENA 1M75A 3G6WA 1XEAA 4X3PA 3WB1A 1UZUA 4QDXA 1A72A 4TLAA 4Z7NB 1QP7A 4LV8B 3C5VA 4QOFA 4DSOA 2GVZC 3PZRA 3S28A 2Q50A 3CKYA 3KTFA 1ZOIA 1LVUA 2OO3A 4TRNA 4ZAYA 2WHEA 4OIMA 1G4UR 3I58A 3F6CA 3PP8A 3VUEA 2IPLA 2ID7A 1R8SA 3R3JA 5AI5A 3NXKA 3TZKA 2CV0A 1LDGA 3UJ7A 4BQFA 2FSIA 2V8OA 4PYQA 1P44A 5HIAA 3HJFA 2CDBA 5KSYA 1L7VC 3T7TA 2JJ2A 5F7OA 2WSYB 4KQ1A 3JAMA 3L4EA 4UU0A 5CA1B 5KO2A 1MHPA 1USUA 1YBAA 2PANA 3I28A 4GKBA 4LZNA 4WN3A 3ZI4A 3Q8XB 3EFOA 3FCYA 1II0A 3OT1B 5EIAA 2BEKA 1GPKA 2ZIXA 1KPHA 5D3KA 1SNYA 5IYZB 1WABA 4PRZA 4DA7A 1EDBA 2G5PA 2JBHA 3R7WA 3RYTC 3SZUA 3SNHA 3S44A 1ZAYA 1UK6A 4REQB 4E5DA 3RHSA 2XIJA 3ILSA 3R6LA 4FFMA 3FVWA 3L0YA 5HDBB 1CTQA 2VTBB 4JXXA 3WDKA 2OCDA 3BIJA 2VNKA 2FMUA 4KDEA 2B7CA 1LX6A 2NUTB 1YJAA 4GEGA 4Q3EA 4TWBA 3T5DA 3HXOA 1P0PA 2EW2A 2IYOA 2R8BA 2UYQA 4KQXA 5EIBD 3TOSA 1RS0A 4RW0A 4DJTA 4B7CA 4IPTA 1J49A 5FOQA 3TGLA 2VP5A 3KKNA 4L4RA 3O4GA 3DV9A 3ZD9A 2HJGA 3V4RA 4XEHA 5TQJA 5JXIA 1R8JA 1Y8CA 3OZBA 2I87A 1PS8A 1VJ0A 4KKVA 1SPBS 2WIJA 2CDNA 4G5HA 4MMZB 4NTZA 3WLFA 1ILEA 1TKRA 3PD1A 3AL0C 1DPGA 1WTCA 4QJ5A 2HLDD 3TSWA 4I19A 5LUAA 1JU9A 2C4KA 4YHHB 3LSYA 3GV0A 3VYTB 4B3MB 3U7JA 3SLRA 3EVGA 4FBGA 3G2HA 2B5OA 2GZMA 2J9XB 1Y82A 2VQSA 3HJCA 3QU2A 4G1CA 4RH1A 4IVRA 4RIEA 3BCSA 3FHTA 1J2JA 1G20E 3C3BA 3R09A 4BWVA 4RTOA 1ZIOA 4YRAA 2ZUVA 1Z4OA 4D7AA 5LZ8A 1N2ZA 4LXQA 1VYUA 1JJ7A 1N0VC 2G28A 2V5AA 4PZLA 5FHRA 3ZZUA 1GNLA 2G80A 2NTVA 3NYRA 5IC5A 4D44A 4FKBA 5KJCA 3ICCA 2H0AA 1E2LA 2Q9AA 2Y1EA 3I39X 4ZI7A 1MNQA 1NVMB 1D5CA 4U00A 1BA3A 4RGQA 3HVRA 2F3QA 1K6MA 1H0KA 5CIYA 1MHTA 3KQNA 3WB0A 2G7MC 2ZJ4A 1JXOA 1STOA 3R24A 4IGKA 4R8RA 4OVKA 4NZYA 3EIFA 3HGTA 2VUSA 4MGHA 2DHEA 2OCXA 4OBXA 3O8OB 2J0UA 2Y4OA 3P9QA 3TFWA 2HU2A 2XJ9A 5BNFA 1O95A 4DY4A 1KJJA 3FWPA 3GHYA 3IUBA 3SY8A 5F2KA 4WZZA 2IYFA 2ID8A 1PWYE 1PNTA 1P2BA 4TWJA 3AHHA 1T15A 1Q12A 5D00A 3PE6A 4OX9Y 4C5AA 3NOQA 3BXGA 4NU8X 2H29A 4OJMX 1Y48E 2DSNA 1DCMA 2PD4A 3HCRA 1C0EA 2C96A 2IOYA 3RIEA 2CV1A 1E2KA 5SZHB 4HK4A 2QMEA 3E05A 3TBHA 5CCEA 1GAQA 2CD7A 1LK7A 4NAVA 1M5RA 2CD9A 3BE5A 1ZD1A 6ADHA 3UWOA 1KRWA 1Y5MA 1X2BA 4NOLA 4EECA 1RBQA 4WJKB 5CLIA 1UJMA 1Z8DA 1XPRA 4KFUA 5I7SA 1BOFA 3A1WA 3HB9A 1GUBA 4PSKA 4R1QA 4XZ3A 5JZBA 1XD9A 1YQGA 2WT4A 3CRVA 4HS4A 2E4YA 5BNWA 4G0MA 1W52X 1LPMA 4KYUA 2VRCD 2P5SA 4O2AA 3OQOA 1G5QA 1RI1A 1TUGA 2FWMX 3E35A 3JWIA 3MWLA 3O2QB 2Q1SA 2D0PB 2FF5A 3MA0A 3KFXA 3ASYA 2KE5A 4PQRA 4MARA 5DNUA 1CRPA 2VBFA 2PZKA 4EHDA 4RIFA 3IV6A 5GZ1A 4FIDA 5H4GA 3BYZA 5BQOA 4MRSA 4M7WA 4CNQA 5DSXA 5HKAA 2GEJA 1GEGA 4MGYR 4Y9TA 5JI3E 3ENNA 3VQTA 3AJRA 1Z06A 1P9NA 3D8NA 3BK2A 4RYDA 4EMUA 3ILXA 4ARUA 5ADWA 2IYPA 4O4IF 3MJSA 1CP3A 3PFHA 2ZQZA 4OX9B 4GLBA 3NC0C 4OKNA 3RJ5A 5IDYA 3T12A 3H04A 2VF7A 3THWA 1DKLA 4ONEA 4IDQA 1V6CA 3T8YA 3KDAA 1UJ6A 4TRMA 1X92A 3QVGB 5LP6F 1BXZA 3AERB 2Y1FA 1RLTA 3HB0A 4G8DA 4LJ7A 2VP6A 5TQ2A 3BREA 4L0DA 2YOGA 1X6VA 2GZHA 5CW2A 1R16A 2QL7A 3S99A 3MS2A 3ELWA 4MUKA 5HR5A 3TUZC 1NVEA 1VOTA 4A8PA 3TLGB 3I5UA 1OA1A 3JQ9C 1UXGA 2DWUA 2C8KA 4LKRA 3OA0A 3ZW7A 5IKMA 1M1NB 3DDNA 4FMCB 5GGYA 4AKGA 3CPJB 2WB4A 1EGAA 4LYEA 4N7MA 1FBNA 3F3YA 1UOQA 2ET6A 3HYLA 4B7UA 4MA0A 4EAAA 1OIVA 1WD7A 2QTFA 5LYJB 5AO9A 5IAJA 5IU6A 4RTPA 3CWZA 1VIVA 1E5TA 4M0PA 3IL2A 4PLCA 4ZGGA 3DV0A 2JZNA 3VZCA 2O57A 4TTQA 3ZHVA 5BVHB 1RPTA 1RAHA 2R6DA 4OJNA 4KFTA 5JFOA 4F9TA 3QMPA 5F2NA 3OX4A 4EJMA 1Z0SA 4B2IA 4YO7A 3D6TB 1BFKA 1YZ3A 1FQJA 1PR6A 3BL6A 3FTDA 1Y1SA 1I7NA 3WZLA 3UAZA 2XTZA 2E37A 3KT0A 4O3MA 3BXZA 3QVOA 1XLTA 1WCWA 1YONA 2B1IA 2G5GX 2HLDA 2R6AA 2HCFA 3NDJA 4RF3A 5FBRB 2ZQYA 1Q0QA 3ASZA 4P4UA 4BNDB 5B36A 4JP8A 2CKDA 4HYTA 1Z4KA 5DM1A 3NUGA 5TQ0A 2KBEA 2AYYA 2FW9A 3WLEA 1CG6A 1HUQA 1NQTA 4YREA 4DGSA 4QULA 4UAJA 4OQEA 4Q00A 1E1LA 1FMJA 4TROA 2UUAB 4EJFA 5AVXA 4E2ZA 2B6NA 4ZALA 4D79A 2FEOA 3OTOB 5CIWA 2OC9A 3EXHA 4OV6B 4PICA 3WYCA 3SGLA 1PR5A 1Z7WA 3ENQA 4ENUA 1Z4QA 1QQBA 1KI6B 3HXMA 1Z17A 3OFVA 2QG6A 4QXOA 2VDKB 3TSYA 3THOA 2O1XA 2IK8A 2XEDA 2MINB 1XHLA 1AOXA 2P9QA 3N8HA 5DCUA 4WY5A 2X4DA 3WHLA 1UAYA 1KAQA 2VJPA 3UWSA 4D9EA 4ZOLA 2MT9A 2E3JA 4DSTA 4NE7A 2GVDC 3EW7A 3PFNA 4RCVA 3R9XA 2HF2A 3WDMA 2YVQA 4URFA 1REQB 2A9RA 2EJTA 4KR2A 1B6RA 4FINA 3DSRA 3BWEA 2OB1A 4PO1A 3NP9A 1JLKA 1BE8A 2C4HA 2G9UA 2LKCA 3PSAA 5EEGA 3QF4A 1XU9A 1I01A 3SMVA 1GA1A 1RXCA 3HJGA 2F3TA 3L1HA 1P74A 3G9QA 1LZLA 2Q29A 4JX8A 4J7CA 5DU2A 5F73A 3EGCA 4P81A 4ZYTA 2VNHA 3PSHA 3CG0A 4KV7A 2Q4OA 3OQIA 1SGWA 4MAFA 4DLYA 6REQB 4KMMA 4FEYA 3BRWD 2VDVE 2RHWA 1P60A 5SV2A 1Q1EA 1YZTA 1NF3A 2XR1A 5H3CA 2UXCB 3H17A 1GHTA 1ADGA 1CVRA 1O87A 2W6QA 5FRDA 5HCUA 4UOEA 1HG0A 1LC0A 2K4MA 3OHMA 1HK7A 1TM5E 1AUPA 4DR2B 5EHQA 3DLAA 2PZ8A 3B8EA 3EYWA 4LNAA 3CLTD 2JFGA 2X8JB 5DYWA 1Z37A 4BNYA 4BGDA 3Q12A 1IY9A 3GPDG 4M6WA 3VXKA 3LZCA 2AYZA 4MVJE 1WPQA 5HMLA 4GVXA 4F96A 4X94A 2V4MA 4LRSB 1RNLA 4MLZA 5LQSA 3S68A 1T3SA 1RRFA 1H2FA 3LQRA 3OECA 3LY8A 1VZ3A 2YFQA 3KQVA 3KJXA 4AKIA 4XGRA 3B48A 4BP1A 5ARBA 2GN0A 4FUQA 3KUKA 5ERXA 2JH8A 5H80A 1XPUA 1XO1A 3WR5A 3FE2A 3OBBA 5KVQA 3FRIA 2BGMA 2HI0A 3KQSA 4JBYA 4MVJG 4AJIA 3WGVA 2PTGA 2ZB4A 4IVQA 3P9CA 1JDBB 1L4LA 3PENA 1NMEA 3LY5A 1R8XA 1AUVA 3FRJA 3OZTA 4MUIA 5BYBA 5IM4F 1E9AA 1NYQA 4R2WA 5B37A 4D9KA 1UMDA 2QNBA 4YJKA 5FNVF 2VDWB 2HXSA 1G8SA 1L5HB 2ISCA 1PZXA 3KO8A 4BUCA 3K09A 1QLWA 4XGIA 4B85A 3BD9A 1FS4A 4KLAA 4EHLA 1GCOA 2ZRGA 1SN7A 1CV2A 3E5RA 3JX9A 1ULTA 5A1TA 1PUIA 4PGHA 1YB7A 4XOUA 4DQKA 1S2LA 1IEWA 3NKLA 1OI7A 3T7RA 1CUSA 3BGDA 1JIVA 3I34X 4MQ5A 4PSVA 2F6RA 4PLPA 1AKYA 4TUYB 1W0JD 4IJKA 2VBCA 3ZKWB 5AK5A 4B3BA 1T0PA 1XL0A 1FB5A 3AXSA 3NGLA 3PNQA 3WISA 3ZHXA 2YN0A 1JLMA 4D8TA 1E9BA 2BAGA 4WNAB 3R20A 5BRAA 3K2EA 3VU9A 1W34A 1Z15A 2Q8QA 1LB1B 3OPNA 3OLXA 4KN9S 1PZGA 4L3VA 3UAOA 4ROTA 3MK31 4DLZA 1C7RA 1KFEB 2GXSA 3SBXA 3VMFA 4IXMA 4XIGS 4HUTA 3UB3A 4F9FA 3NYIA 5G4KA 5L45A 5IRCD 2CYAA 4CR6A 4ALNA 4IQ8A 1P1JA 2VYCA 2HF8A 5EJEA 2A5GA 2JB9A 3ZI7A 3M6VA 2O05A 4BO1A 1QU3A 3MT9A 2DB3A 4V0KA 4ND8A 4P4GA 1AJEA 1T8TA 4QU9A 2AR9A 4LECA 4U6QA 4U63A 2E21A 3BILA 2P2GA 2XRZA 3GRYA 2QX7A 4MWOA 1XCOA 2D1RA 3FLAA 3EA0A 3V7YA 3KQOA 4JA0A 3K8YA 3M1LA 4N7BA 3NW9A 1KDTA 4RYLA 1GU7A 4TM7A 4X9XA 4C1NA 4V1CI 2PKQO 1VKOA 2O7QA 3R9IA 2I2DA 5AVQA 1RYDA 1FYDA 2GFIA 2GPWA 3OF3A 1GGMA 5PGMA 1MAUA 1PW7A 1G21B 2DUUA 2X1VA 4M1MA 5K2MA 2CLLB 1UIRA 2XWJI 3IJEB 4R05A 4L9AA 3CEHA 4MINA 3ZJ5A 5I4BA 1PR9A 2AS0A 2VDJA 1D2EA 2VT2A 4KN6A 4MX8A 1C8BA 4YS6A 4UM9B 3RFFA 1T5OA 2H85A 2FRDC 1NSTA 2WF9A 2Z30A 5CB4B 1KU6A 1YDFA 2OQ2A 2PZEA 4RHFA 1RZ3A 1UKVY 1EVLA 1V8FA 3HYRA 2P9TA 5FI0B 2JGDB 5KHAA 3TNLA 4Q12A 3P0JA 2PFGA 2XKAA 2DEUA 1GZSA 2UU9B 1ZXBA 4BVKA 1N77A 3WL6A 4EPRA 4R3UC 1P7CA 4MUEA 3T7AA 4Z7JA 1OFGA 3LT5A 5C34B 5LR6A 4BAUA 2FWBA 1KS2A 3I72A 5HF8A 5IJWA 3UMRA 3AHEA 3DWEX 1J23A 3H2ZA 1E9SA 3TR5A 5JROA 4RTJA 3JASB 1W36B 1MFPA 4PFSA 3WY9A 1UT5A 4HR7A 3OEYA 1DKQA 4N9QA 1OWPA 1A8QA 3W5CA 3BRWA 2R5NA 1NZJA 4IHKA 2F7SA 4ZARA 1DXOA 5AM5A 1HDGO 2Q3EA 1YVPA 1Z9BA 2GCGA 3L46A 2IRWA 2GEBA 4DCGA 2JLBA 3RTBA 1P29A 1Z0UA 2DH5A 2H31A 3CZQA 3IPRA 3CCBA 4LY3A 4LY9A 2Q6OA 2FPIB 1GY8A 1JEEA 1F0NA 4RD4A 2Q6KA 5CDTA 2BFCA 3COZA 3RIMA 4BB9A 2W37A 3ITNA 4A23A 2RAFA 3HU2A 1XTQA 3CONA 4M2LA 1PLKA 3K0AB 1JHOA 1OI3A 2QN6A 3G1UA 5HFJA 4EHJA 3VNBA 4DMUB 5DN6D 2G5TA 5E6SB 1M83A 2GA8A 1VLJA 4JQOA 2IHYA 4CETA 4DIDA 3RYCB 4R1TA 1DEOA 5SY4A 4F1JA 1G5FA 4DLSA 5K05A 3VRHA 1LW7A 1EFRD 1JILA 4IMJB 1H2XA 1NXXA 5TEVA 3D3NA 4HNHA 3O8RA 1N78A 5B53A 1L5ZA 1R7RA 4JC8A 1WA5A 3SVTA 4G0OA 5BSWA 1NJ8A 4F45A 3W2TA 2O8FA 3CRNA 5CVTA 3FSJX 3N8GA 1FRFS 3RVMA 3IXMA 2FGJA 1GG9A 1G8JA 1SUWA 2ID9A 5K8UA 1NA5A 1DRUA 1QS0B 1EP9A 3R6DA 3NVDA 2RAVA 3FVVA 4TKLA 1J2YA 4FZVA 4HCJA 3L8GA 4NJEA 4QOIA 2EFCB 4AW9A 2YYZA 4J0QA 5DHQA 5K0CA 4LHSA 5GJVC 1FDRA 1ODLA 1PSWA 2JFZA 3KETA 3MCWA 1GYQA 1P0MA 2CXOA 3QG1A 5JCJA 1XNQB 2RHBA 3PC7A 5EPUA 4AJ9A 2NIPA 1WLYA 3ZY3A 3HRKA 3SYLA 4NPAA 1ZP6A 1W0JA 5L3SB 2YOHA 4Y2UA 2VNAA 2XUKA 1C3VA 1LPSA 2AC7A 2JK0A 3HRIA 2B82A 4H3VA 1J70A 3BXHA 2PKEA 2B4YA 4JUFA 1DC6A 1PE0A 3HDJA 5KDOA 3AIMA 1VCNA 3JYOA 1P2SA 3AW9A 2WI8A 1BVRA 2YXNA 3QH4A 2Z56A 5LD2C 1H9AA 3B13B 2J87A 3STUA 2VYND 4GPBA 4CLHA 2BHNA 1EE9A 4CEJA 3LY7A 3DPSA 3NQ41 1EXVA 3T3EA 3BQ9A 4LW8A 5IBRA 3CR8A 2C4VA 1VMEA 3PQ5A 4NZOA 3Q2IA 4RFSB 3K2IA 4RIIA 1E32A 1S4QA 5LC1A 1OU4A 3L7LA 3TCNA 4CBVA 2CMHA 4TWZA 4TXHA 4HSEA 3PDIB 1FNCA 4UVDA 5D3ZA 1K89A 1NJ1A 2OXCA 1YUMA 3FYHA 5EXXA 5GWXA 2NO7A 4CL8A 1V4BA 1U4SA 1PIWA 1P45A 2WJ3A 1BA2A 3BFKA 3I9MA 3AF4A 3FZNA 1ZXLA 4HGYA 4E51A 1U8UA 2ZULA 5JI2E 4XDGA 3GRKA 1E20A 3BRCA 3DULA 4CEIB 1NMSA 1CS0A 2E7ZA 3FBGA 3LX5A 3PFFA 5H68A 4GMFA 5GIPE 1RWPA 3CNNA 5MF6A 3Q85A 2I4NA 3MTBA 4KJXA 3JD4A 5JCXA 3GPLA 3RABA 1UT6A 5CDUA 1E1RD 2YFYA 4O4JA 4DTIA 4P0QB 2DBVO 5AP9A 2XAAA 4LV5B 3F5MA 4RACA 4FFSA 2W5UA 4TSKA 1JYEA 4CTNA 2Z9DA 4TS1A 3H9BA 3I2YX 1LRKA 1Y9JA 1B0AA 3IAEA 2C9BA 5CAEB 3QEAZ 3DLCA 3B20A 1CUIA 1PFKA 3KNZA 1RVV1 3X1KA 1VKZA 3RLIA 2ES4A 2XTNA 3ESRA 1ZCJA 5REQA 4W5NA 3UHJA 3C8MA 3QG5A 4TVOA 4UQPA 1FDTA 3P2IA 4OYRA 3K30A 2ZM6B 1RKVA 1W48A 2DQSA 3K0EA 5H82A 3OTQA 1J9ZA 4ZU3A 4MXDA 2O3JA 4L9RA 3MYYA 4L8FA 5BSHA 4TLEA 4HLNA 3T1VA 5JXJA 4IDBA 2RKOA 1W4LA 3CVVA 1DBRA 5F5LA 5DI9A 2NU9A 4FR5A 4BV3A 2EXXA 1EZ4A 2JFXA 4ZVNA 3A4LA 5JDIA 1ORDA 4UMVA 3QKTA 4W8OA 3F6YA 2CFOA 5KTOA 2DR3A 3DC7A 4BMVA 4ZKDA 1K5GA 1Z5NA 3I9LA 2OORC 2X19A 2EF1A 3A32A 3PC8A 3REGA 3AIKA 3E1GA 2GRJA 1RAGA 5K4HA 3WGJA 4PHFA 1SOMA 4YXFA 2A3RA 1GILA 4CIVA 3PT9A 1XTVA 4RFVA 3QY0A 4YDQA 1KE2A 4N3AA 1XEXA 2ZJ2A 3SDBA 1HFWA 4XFJA 4WLEA 3CNHA 2HNAA 3NVMB 4RDXA 4H1HA 5K0SA 1GPH1 4HEJA 5DN6A 2WKRA 3TZEA 1LRJA 4D74A 5LQCA 2P5YA 1JDTA 2OHXA 3Q3VA 4LSZA 4D43A 3QENA 1Z6ZA 4YPFA 4M1YA 3QWHA 4I66A 3B1WA 3QLVA 5JIBA 1EFRA 3BA6A 1GKUB 2C2GA 2PO5A 4FKMA 5LZ9A 2I22A 3MSCA 4HDOB 1FF9A 3GOQA 4Q01A 3CT4A 4OI0A 1U02A 1ZW6A 1RJFA 2H7VA 2Y8EA 3PXDA 1N3IA 4TTJA 5H16A 3TNJA 4M38A 3T15A 3C6XA 3ZV7A 5AW0A 2IEIA 1R9GA 2JIBA 3QHPA 4BQNA 1IHOA 1YJ5A 5C3MA 4RSGA 5FULA 4L9WA 3EGXA 3L82B 1YZFA 3K0BA 4YT5A 2FMHA 2ZEJA 3ORRA 4P3PA 5LYYA 4Y6LA 1ZN7A 4O4HA 1F8FA 2GPAA 3DEAA 1ZLYA 2O0KA 3DTVB 3OLVA 4KGXA 3RFUA 1VA5A 2QTLA 4C0WA 2ODTX 2HRRA 4DQUA 2ZUSA 2Y1WA 4LGCA 4US2R 1C0LA 2HDHA 4KL8S 1IHPA 1TYAE 5DBIA 1YHNA 1YOBA 3M9XA 1V7QA 4M9SA 2A0KA 1B7GO 4GO1A 4KU4A 3UV3A 1ZGAA 4QGSA 2HRQA 1U1GA 1WXGA 5LMCA 4L74A 4OB6A 4OEHA 4NCBA 1DJMA 3UICA 2NP6A 2EYUA 1XTTA 2W8BB 3G82C 3OKPA 4NEQA 4D8YA 3RVKA 3O8NA 2Q1YA 3CE6A 2VH2A 2AG6A 4NX2A 4MVYA 4YUXA 4WOBA 5DGIA 1I94B 2AN4A 1F2TB 3LVBA 3UT5B 3LBYA 3ESAA 4I55A 5JCOA 2DETA 4OJTA 2D7DA 4Q4DA 5AM2A 4BKQA 2W90A 4F3KA 2H3EA 5JFGA 4YMGA 3EH2A 2XZTA 2ZYUX 1QF7A 4H7IA 1MEEA 3K05A 2FUCA 1NR7A 4DBVO 1WD5A 2C7RA 4Z2YA 1RM4A 1QTRA 3S4YA 2VJCA 4XGQA 1FSGA 3TQHA 3QBJA 3OZUA 4QHTA 4TUYF 1PKEA 2QX6A 3SAJA 2NWQA 5EQTA 1IHXA 4AYXA 3E9DA 1L4FA 4IIVA 2PWBA 3OZWA 4FSXA 3T5CA 1SR8A 4YT2A 1KJNA 1GL7A 3H3FA 1YVRA 3FNIA 3INYA 3C7TA 1SK9A 2H0QA 3JQGA 1A9SA 4NDNE 5IJ0B 1JHMA 4MKRA 4MGKR 1AK1A 1E1QD 1M67A 3LXMA 2CXNA 4DYHA 4DLUA 5BNTA 4MHOA 3FHOA 2IV7A 2MYTA 1VMIA 1A9PA 2AN9A 2CXXA 2F3RA 5EESA 3Q3JB 5LCXA 5L9AA 4PC3A 1NMYA 1SCUB 2BIFA 2RK4A 4ODIA 3GAFA 4UTNA 2XEXA 1JALA 2Q2NA 4MWCA 5KWEA 5GONB 1I5RA 5DBFA 4N3CA 3LC1O 1EHCA 4KC0A 9GPBA 5KQRA 4HRYA 4FX2A 3ROFA 5AYVA 3TRDA 4CL2A 1NV8A 3ZZ1A 4OHXA 1B0PA 4XJVA 2Z58A 4I50A 4ZMBA 3GBVA 5KHOC 4CKEA 1UPXA 2Z5LA 2O0LA 2Z2XA 4R9SA 3U3KA 2WFZA 4HTFB 3OJFA 5KJ6A 3R4VA 5JSZB 2IU3A 2V4UA 2F9FA 3PK0A 2JLXA 3HBJA 1F6BA 3HBNA 1N36B 1JQ3A 1CCWA 5CB4F 5CX1B 4WKBA 1N6HA 5HS6A 4AURA 4ZQFA 2C82A 2VUTA 3L4JA 2FPLA 1Z4IA 1BXKA 2R6ZA 3QQPA 3UANA 1VB3A 5EJIA 1CUXA 5JSKA 1JG3A 2R1UA 4CQLB 1DKUA 1GPMA 2HPHA 4KXUA 3KE9A 5BOSA 3I0MA 1G9SA 1L5WA 2PXHA 4K2HA 1VE6A 1N5OX 4JX9A 4Q37A 2WWWA 2QF7A 3AOEA 3R76A 3ZZMA 2BY4A 1S2DA 2CJXA 1Z82A 3DE3X 4MV3A 3AR2A 4XGNA 3BWVA 3GNQA 1E0AA 1LFDB 5TS2A 3SJCA 1H66A 1E4OA 3KR2A 2BD0A 2HRZA 2W48A 3KHUA 1XMOB 3KPWA 4EBBA 2OCAA 1Y4AE 3DEKA 1QRUA 3BB3A 2OQRA 2XGJA 1ZMTA 5MFZA 3DLIA 2GCPA 2B1GA 3HU1A 5DLYA 2J9YB 2GETA 5DLQC 3TJRA 4AJOA 4B5KA 4CNBA 2ESRA 5B3JA 5JMWA 1I1HA 2C8JA 3MN1A 3MD9A 1E5XA 2Y1XA 3KKMA 4UVEA 4YJHB 1T8YA 5CA1A 5JAHA 3VPHA 1O0CA 4EUFA 3GLIA 4DJJA 5ANRB 4D4GA 1A9ZA 5CNKA 3M9LA 3VPBA 4NBKA 4GPD1 4RCYA 2ZVDA 1JWBB 2OCIA 1MIOB 3ULKA 1OB2A 5DFAA 2AOTA 2R11A 4EYKA 4P9NA 4ZT2A 3U9SA 5I9LA 1ZMXA 4AZ0A 2YR0A 3LRPA 2IEAA 1PLJA 5JBQA 2NOAA 1UJCA 4M4SA 3SS8A 1NNUA 3ZJVA 1F5SA 3ILVA 1KDYA 1HT3A 2NUTA 4BHTA 1HDEA 1KH2A 4HH4A 3LWDA 4LDNA 5F3WB 5E6UB 1JEJA 1PGNA 1KJ8A 2J5RA 3ASVA 4PAWA 4AP6A 1KTVA 2BZSA 2IY8A 4ARCA 4GX5A 1QGUB 1N7JA 3PNBA 1Y0BA 3MWFA 2PUBA 2E4VA 4K46A 4OAQA 5IJZA 4GLJA 1XF9A 4ZPXA 4B6EA 3RW9A 3M6IA 4BQIA 1WAMA 4EHBA 2HXGA 4EB0A 4L0QA 4DMCA 4MS4B 4NQZA 4CT5A 4GM4A 2VUIB 4LTDA 4DMLA 4B7XA 1AKNA 4ER0A 1F3LA 4QOSA 1D2MA 3FDIA 1W44A 3DE7X 4WAUA 4MS1A 4ZTUB 3C4JA 1GZ6A 4X1YA 3BMQA 1XD2B 2GF2A 4OOFA 1HBJA 3PI6A 4NBTA 4DMFA 1CNMA 1FZQA 2OCPA 3C3CA 2ZSHA 3T1HB 1KJYA 1VHLA 3NHUA 2ZSDA 4L5YA 5K45A 3G0BA 1KVQA 2BGTA 3GDGA 4GUDA 2H1OA 1E1QA 4NE9A 3HFSA 3KZ1E 2FSSA 3R6GA 1W4BA 1JFVA 1MLDA 2BT4A 1N2GA 2FPGA 5FV4A 3HMQA 5FTNA 1V39A 4J7AA 2JJMA 13PKA 3Q3EA 4L5IA 4DZZA 1JPJA 2J8ZA 2WTBA 5BSRA 3I61A 4ZODA 1RI2A 4FSDA 5BN3B 3E0QA 4W9RA 2YHIB 4L3WA 2A84A 2AMFA 3M82A 4IXDA 2PJRA 1N8TA 2XB4A 2W7TA 2ONZA 1D8TA 1H8HD 1L4YA 1NVWQ 1C14A 1W4RA 4JWKA 4L0CA 3EISA 2OA0A 1N1GA 3TLCA 2YV2A 1E6UA 1SQSA 2R1VA 4PFQA 1ODJA 1ZM7A 2R8PA 3LK6A 1ZD2P 1Z6PA 3C3YA 3HL0A 3JALB 4LDAA 1I6MA 4J07A 2WMDA 1UBCA 3OJCA 4GWLA 4ZXPA 5LOVB 1LLQA 4O5AA 4E1BA 3IAUA 3L0IB 1U31A 2J6BA 2VAXA 3VSCA 2HU7A 1F2UB 1F8XA 1FXWA 2YVAA 1EUDB 2B2CA 3LP6A 4GXQA 4X97A 3V34A 1QQTA 2CMGA 2ATCA 2IE8A 3VISA 1JLRA 3BICA 2VNIA 2NADA 2H7YA 1XFAA 2FQ1A 4TMKA 5LKAA 3L7AA 5TMPA 1X1QA 4J2OA 1R4NB 1N0WA 3ZE6A 2DUJA 3KB2A 2IE0A 3IVMA 4WKCA 4AY3A 2JIQA 2V7QD 3V2IA 3PVSA 4W5QA 4RVHA 4IFEA 3W4IA 2HV8A 1RIIA 3IMFA 1SVMA 2C31A 5HIMA 1OPXA 3GFVA 4E7PA 2Z2KA 3E53A 5KJEA 4YAWA 4OSOA 4KYVA 2Q5OA 4QUBA 2I1QA 2R47A 3AEYA 2ECQA 5IC6A 3L2OB 5BVGA 5BOVA 3PUWA 4WBNB 3QPAA 3P32A 4XPIB 3MLEA 1HOTA 5EIFA 2EP8A 4IXWA 3QIAA 4ROSA 3ET5A 4MUNA 2VPTA 3A28A 1RW4A 2VAWA 2D1QA 3NI2A 3O9VA 1MX1A 2R6CA 4FFBB 3ICWA 2PWPA 3VOSA 1XF1A 3PC6A 3ZC3A 5FEUA 3IJ5A 5J2UA 4OFZA 1ZOPA 2CJWB 3HG7A 2IOFA 2EJVA 3TRKA 4F1WA 1ZR4A 4FI3F 3TKLA 4BC0A 4D41A 5JG7A 3BWMA 1N9GB 1H0HA 5D85A 4BASA 3NDBB 2JAHA 4M3NA 3AFIA 1Q74A 2NU6B 1W6UA 3TLGA 2GKSA 2MJLA 1Z8HA 1JS1X 4UMDA 2GZSA 1JR3D 2XF8A 2Z83A 4G26A 2FR0A 4NFYA 2NUAB 4H2DA 5A3JA 4H6VA 5COQA 4D57A 5HX7A 5B2EA 3CLRC 1D1TA 5KVSA 2XW6A 2R4UA 1AN9A 1UFQA 2GHQA 4V2IA 5ALSA 5LYJA 3GCZA 2O5CA 4OHPA 3G0CA 3L1KA 3EIWA 1BRTA 1ZGJA 1NI5A 1FX0A 4TYYA 2OBXA 3E22B 2V55B 3A6HA 2VCEA 4J90A 2ZYGA 1H1LA 1ETHA 4J6EA 4NMMA 4PNEA 3IP9A 3PNLA 2MDTA 2OUIA 2PIAA 4CGYA 1QAMA 2E85A 2W2XA 1C30A 3D4LA 3HS3A 4DMKA 3FN4A 1QQ7A 4S1OA 5F76A 2L2QA 5E3JA 5JTUA 4JOSA 3S2FA 1VSVA 1HI9A 2J9FB 4LGVA 5GPBA 1TE2A 2EZ9A 3NCTA 4P8RA 1OLOA 2CDAA 2ECOA 4H6XA 2NQ8A 4GS5A 4JUAA 4S12A 3IS3A 2YV5A 3FMIA 3N8KA 5E2AA 3PCXA 4KJZA 1WDWB 2QW8A 3G85A 2RGWA 1KORA 5CA0A 2AT1A 4WHMA 4CFYA 1F60A 3MAAC 4YMLA 4UTPA 4JL6A 2DZDA 4QPDA 2RGUA 2VP4A 3JQQA 2GAAA 3IOCA 1GITA 2IYSA 2W6NA 2R7MA 5TS3A 4C89A 4WBSA 4DPKA 1E9FA 1QFXA 3SXUB 4XQCA 2QSZA 2I62A 1KJIA 3BMNB 5E3HA 1XR3A 3IDZA 1G6Q1 1REQA 2BM9A 3Q5GA 4UBNA 5TX7A 2DCUA 4AM8A 1H8HA 4HYQA 4JU9A 3OURA 3JTEA 1XDDA 2D0OB 2XUAA 4R98A 5AI4A 2GNOA 4N7JA 3IQXA 4PZ9A 1W0KD 3RT1A 4TPKA 3ELYA 1XTJA 2BM8A 4NBLA 3DF9A 3GMDA 3WMWA 2EG5A 3SBDA 1MPTA 5L7YA 1W36D 1DJLA 2Q45A 1O9GA 3L5KA 3N8NA 5TSDA 4Z2AA 1K0FA 1A27A 4BFWA 4CF5A 1MX9A 2DWPA 1MAAA 1QFZA 2AZ4A 1SCDA 2Y68A 4BKUA 2HYIC 4DIMA 2WBLC 5ITZA 5JJ5A 1ZHFA 3A1CA 3NVKI 1ISJA 4AD8A 1C4WA 4IYJA 4AAYA 2YN4A 4QPCA 4X7RA 3RFVA 1EHIA 3ZK7A 1UBJS 4TKVA 3W3AD 4EG7A 2D00A 4X20B 5K0NA 1QCCA 4AO8A 2EFEB 3TK1A 2WHQA 2J3MA 2ZBEA 3LYUA 3FD8A 3OT5A 4C7VA 5IS2A 1N4DA 4E22A 1QHYA 1FJGB 3B1ZA 5GONF 3AOGA 3D02A 3LDGA 2XADA 2V7QA 3BB4A 4JBXA 1N6LA 4ZQGA 3NWPA 4AMGA 3DXZA 5A5EA 1JAHA 1FY2A 2FMKA 4BX2A 2JGRA 1QAOA 3AX6A 3RFTA 1IHDA 3TD9A 1EJ2A 2FMXA 3S2UA 5JO0A 4KYIB 3VSBA 3E70C 3PI7A 4URZR 3Q6NA 1N1EA 5CYOA 4B0OA 1DWOA 4KCGA 4EQ6B 2P7IA 4ZAGA 3OOJA 5KC8A 2IX3A 1XP8A 3L1JA 4E4RA 5B6IA 2P41A 4HNGA 2DLCX 3QKSB 4E2WA 2VK2A 1HURA 1OYWA 3EF1A 1XZKA 3HCEA 3OCVA 1P6UA 3RKUA 1VSBA 5FNZA 5LZ2A 4IIJB 2AKYA 3H8SA 2B69A 1N1MA 5I5GA 2VDWA 5JNUA 3EFBA 3W04A 3BB1A 1OYOA 3GA7A 3NPMA 3PITA 3GLHB 2O7RA 2PK3A 2AFHE 2D59A 2EKQA 2PXAA 4MV9A 4L85A 4JITA 4NEHB 5JATA 3UHFA 3KXKA 4NQRA 1RIFA 2IDKA 3FOCA 4PZPA 4MYTA 2AFIB 4IL5A 3FLBA 2EG9A 2H52A 4LK3A 1JR3A 4BXOA 2VCHA 4S1WA 3N0WA 2C8LA 4A0RA 3WGUA 1SXGA 4EHHA 1HNZB 1CZRA 3EIHA 5A0TA 4D5EA 2COUA 3QNUA 2W22A 2BFMA 3UT6A 2BCEA 1JBEA 2QN2A 2G4VA 1IWPB 3STVA 3B89A 4WXEA 1NP3A 3DVQX 1Q2UA 5ALMA 4DEVA 4TXLA 2F1KA 4R1MA 5AUQA 4YONB 3K20A 2COKA 2P2DA 2W93A 4HAUA 1EP3B 2B1QA 3L0BA 2WP8J 3PHGA 4OXRA 4RPGA 3FROA 2OB2A 3QBEA 4YROA 3JQRA 3PHLA 2ZAMA 4RM2A 2JFPA 3VNVA 3D6FA 2G76A 1UPTA 1UWCA 2PZBA 2PAFA 4KDFA 2BEUB 3P8ZA 2WV9A 2YXLA 1BZYA 4G41A 4RGVA 1ID1A 1VIDA 2V45A 4H59A 2WABA 2ZI9A 1SD2A 1WDLA 1P81A 3ELDA 4JQZA 4X44A 3W4JA 3NP7A 3FYDA 1H9CA 2SHKA 5BORA 2ZRBA 4MHTA 1IEVA 4TTAA 1PJ8A 1WOMA 4GPEA 1YC5A 3SF8A 1R0LA 2QRNA 3Q3HA 2DTXA 1JDVA 2PUJA 3FPKA 1XRPA 3AB7A 4HZGA 3OG9A 5TGDA 4Z4EA 2HHHB 4FYMA 4AZ3A 5DISB 3OCZA 2PLAA 2F43A 1MG0A 4H3SA 4RM3A 4AO7A 3HUDA 2XZDA 3PX2A 2D2IA 2I6UA 3M6AA 4N7RA 5IK2A 4NV0A 5IG2A 4TT8A 3MQ2A 1ZIPA 3K8QA 3KKEA 2P9HA 3H2YA 3RU9A 2UUCB 3N53A 2QUKA 1LWNA 2FZEA 2VHQA 3JAWB 3O90A 1Q95A 3TRFA 2UV8A 4QYSA 3GZNA 1SXPA 2WA2A 3IP8A 1N4AA 2CUNA 3RC3A 3UWDA 3AF1A 1SULA 4FMBB 4TLMB 4XKJA 3SVZA 3JQ8B 4E32A 2Q8PA 5BW6B 5FX2A 2V5VA 3AUYA 3PGKA 1G7TA 3B51X 4GRIA 1W59A 4QQFA 5EXSA 4A1FA 1F3OA 3COPA 5AJHA 5I47A 3Q3IA 2PPLA 5GV7A 5G3ZA 4B3FX 2W2TA 1EA7A 4X1OA 4R54A 5AJXA 1QF9A 5AW5A 1T9GR 2EJWA 1NASA 2WZBA 4XWAA 4PZ0A 1T2NA 2F1OA 3MOSA 4IS2A 3PEWA 3ZU6A 1M2VA 3L84A 4GGMX 4MUAA 1MU0A 1ZD3A 2XWBF 1E2EA 1PDVA 4KPUB 4RIGA 3V9AA 3NH6A 5I7HA 1T5DX 5NLLA 4BFSA 1E9VA 1E9CA 1SBHA 1JXAA 1TFRA 3KR9A 3M6MD 3NTRA 1PFWA 1IM8A 4DYDA 3L9XA 1CR4A 2GZDA 4RAOA 1DEHA 1GVNB 1ZXXA 3JQBA 4WESA 2ZR0A 3OMWA 4EF4A 4A1OA 3TZBA 3FYUC 4BWYA 1PD0A 3HHPA 5CVJA 5JOQA 2LCIA 4DW8A 2P3QA 3FLEA 1L4NA 2V3CC 2RJOA 4I9UA 1GUFA 1T91A 1TQ4A 4JDPA 1XPOA 4B3RB 4QSMA 3OZCA 3OX2A 1RQNA 4FT4A 1JSZA 2JARA 5L4LA 1NWCA 2PL9A 2REQA 4KFRA 4UC0A 4AJNA 1KEWA 4F06A 1Z18A 1J5EB 1D3AA 3OD5A 3C3KA 3RYCA 3ETCA 2QUAA 5ILGA 4BNFA 2ZIWB 2HTFA 3AL3A 1G8PA 3HZRA 3DQZA 2DKFA 1GUZA 3IQFA 4U9IS 3S1LA 2BMDA 4URVR 4X5OA 1HDCA 2RH9B 1JHQA 3HKDB 5G1PA 3AHFA 3LFHA 2OEPA 3W6ZA 4B4OA 3OQHA 1CULC 3RTDA 1W5BA 1B16A 3H9QA 2WHRA 3HEAA 4HNAB 4BNZA 1P4RA 4MYSA 1OXXK 2X23A 2D6FA 5JISA 1QS0A 1U28C 1VHQA 4A9AA 3X2EA 3OZRA 2BH9A 1T35A 2BFPA 2NXJA 1OT3A 2Y1KA 3DTVD 4II7A 2PM8A 1G59A 3U7RA 4DG5A 4HEA6 3U09A 1UK9A 2R66A 3DBRB 3MJVA 3FPGA 2OCLA 3TEMA 3SHQA 4NBRA 1A9TA 1JRLA 4EYGA 4KQ9A 1SU6A 2JH9A 1E0JA 3A70A 4L28A 4DQ0A 3R5KA 2D8MA 3CVOA 1R9NA 1XMSA 3MJTA 2DHDA 3CLHA 5CBPB 1EPUA 4GE0A 2WUGA 4J4HA 5FUMA 4ZYUA 1RBZA 3DAPA 3IA7A 1OLSA 4NICA 1WQ4A 2ZRMA 4EY7A 4G23A 1A1VA 1H4VB 5JXGA 4FW8A 3GN1A 3PL5A 4X6UA 1J22A 5C35A 4NHOA 4GMDA 3ZCXA 3DUFB 2YMLA 3AHJA 2UKDA 2ZWVA 5JZMA 4WBNF 3IBFA 5EZSA 8ABPA 1JE1A 3C2QA 1I4EB 1U3DA 1M1YA 4IZHA 3L93A 3QHQA 4YRSA 2A9FA 1G9TA 1NYRA 4Q4AB 2F8SA 4RFSA 3RS5A 4DN6A 3MNFA 1MIHA 3B2EA 2DRIA 3WK7A 5BNIA 2JBAB 4HNUA 5IARA 1MOZA 1V1MB 1QZUA 4JMLA 4MKIA 5HJ2A 3NT2A 3E7DA 3S2IA 1E2UA 2C5LA 3LHDA 1JLSA 1IZ7A 1K1EA 3BGVA 3ONEA 4I7EA 2X0IA 2FMTA 1WMFA 1KRXA 3EAGA 2HO5A 4G6ZA 1E3TA 3COVA 2PWAA 1AGNA 3W2IA 2VBIA 1HA3A 3EXIB 1G0OA 4V38A 4Y2RA 4ZRMA 3ZWOA 3TJMA 1X1CA 2DPHA 3TTXA 5JYBA 3PWSA 5F1KA 3KVOA 4AY2A 2VWGA 4ZN6A 3HACA 3ZWMA 4IIEA 1K88A 2WZCA 4CQMB 2Q3BA 1MDFA 1MT0A 3R7FA 1II9A 1TT5B 4NFLA 5FEMA 2X5NA 4FEEA 5FR2A 3V1YA 5CAEA 3VO8A 3AVQA 3OTIA 1BXRB 3FHCB 4ISCA 2QHXA 2LCFA 3D3JA 5EVJA 2FRVA 4WCFB 2ZTSA 3PQFA 3EVEA 4C14A 4DPMA 4IKOA 3T1YB 3ROMA 4R16A 3TW6A 3FKQA 2P2YA 4QTUB 1WZEA 4YVFA 5B7PA 4Q1AA 5DASA 5AFSA 1SRRA 4N5HX 4R1OA 4ALLA 2E4AA 4MUJA 5LA6A 2P9YA 3IKVA 2VPQA 4MWGA 4EUSA 3TLXA 5B3KA 3W90A 3TZCA 2P9CA 4Z5XA 2AOWA 1XZ8A 4NU6A 1X8XA 3OCXA 1QPGA 1NL3A 1QANA 1MX5A 1UJ4A 5CTAA 2IKSA 3KEMA 3BWCA 3RG8A 1CRLA 4Q02A 1RPNA 2XQJA 3GLSA 3N9IA 1UDWA 3HVKA 1Q3KA 3EUFA 3F8TA 3PRKE 3R7NA 3W6UA 4V1CB 4FUTA 3SPXA 1ZVQA 1QG6A 3DUWA 2AX4A 2O7SA 2XY4A 5AI0A 2IF0A 3I32A 3UFBA 3WDSA 4J9VA 3BORA 3KR1A 4F4IA 1K2WA 2C0PA 3LGXA 3B1YA 4K87A 4PBTA 4RVUA 2IZ6A 4BN4A 2ICAA 2FA9A 2RH8A 4MDYA 4OGKA 5M5BA 3RSCA 3H5LA 5DM2A 3WYFA 2XMBA 1JP7A 4OYLA 1OXBB 2IODA 2RJ3A 1MOPA 3D7LA 1T1RA 3L4KA 5BYJA 3FMVA 2CK3D 3S29A 4PCAA 3SJZA 3OX1A 1CY0A 3OT4A 1JKJB 4MV1A 5BNZA 5C7YA 5KZMB 2Q0SA 3EQZA 2DR2A 1NJSA 5DJ5A 1LBQA 1H2ZA 1M2OB 1HDXA 1PFQA 3G5AA 3OJLA 4YCCA 2CYCA 4TRRA 2BFDB 3QA3E 3EGWA 4G9EA 2IZZA 3FJYA 2GWHA 3U16A 4NJMA 3Q10A 1F4PA 2OCKA 1UQTA 2ZSJA 4NVRA 1I14A 2Q4BA 1SRQA 3VDMA 4HDSA 5H70A 4CM6A 5KOJB 3KU1A 3O03A 4OHVA