4PRZA

Caspase-8 specific unnatural amino acid peptides
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
240
Chain Sequence
b'DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-8
publication title Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 240
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4przA00
5IARA 4EHHA 3P45A 1NW9B 2NN3C 4NBNA 3UO8B 5IBPA 1QX3A 2C2KA 3H11B 1RWNA 3PCXA 2QL9A 2CNLA 2CNKA 4JB8A 3V6LA 5IANA 2H4YA 1RWXA 5IBRA 1K86A 1ICEA 3DEJA 4QUEA 3RJMA 1NMEA 1SHLA 4ZVTA 1NMQA 3EDRA 1F1JA 4IEFB 4AW9A 4QUBA 4IYRA 3V55A 1RWVA 4N5DA 4D3ZA 1NMSA 4DCOA 1SC1A 4NOMA 3D6MA 1JXQA 4M9RA 4FGUA 1I4EB 4NOKA 4PS1A 5IAGA 5IC4A 3IBFA 4NBKA 5I9BA 5LU8A 1SC4A 2QL7A 3GJQA 5IBCA 1RHRA 4QU9A 4ZVPA 4EHNA 1I51A 1I4OA 3SIRA 5LUAA 5IABA 4ZVOA 3OD5A 2FP3A 2H51A 3R6GA 2DKOA 4JJ8A 4QU5A 4D3XA 4PS0A 4JQYA 2H48A 1RWWA 4LSZA 4FDLA 2CDRA 1KMCA 2J32A 3R7BA 2QLJA 3P4UA 3NR2A 4QUHA 5IAKA 3QNWA 3DEHA 4QUDA 4EJFA 5LU9A 2J33A 1RWPA 2J31A 1CVRA 1GFWA 1M72A 3H0EA 3KJNA 2XZTA 4QU0A 1CP3A 3NS7A 2J30A 2FUNB 3DEKA 4I1RA 4DCJA 3EDQA 4HQ0A 1QDUA 1RWMA 2QL5A 4ZVRA 2CNNA 1RHKA 3NKFA 4JR1A 3IBCA 4QU8A 1GQFA 2CJXA 3DEIA 2C2OA 4JR2A 4EHLA 4N7JA 2WDPA 4PRZA 5H0IA 2CNOA 4N7MA 3R7NA 4QUGA 5K20A 3S8EA 3D6HA 4QTXA 4QULA 4NOLA 3V3KA 4JQZA 1BMQA 1RWKA 1F9EA 3KJQA 3UOAB 2H54A 1I3OA 3S70A 1RWOA 3BIJA 4HQRA 3R6LA 4ZVQA 4ZVSA 2XZDA 4QUIA 3E4CA 3SIPA 2H4WA 4AWAA 3V4OA 4HVAA 4EHFA 1PYOA 1SHJA 2CJYA 2HBQA 4JR0A 3H11A 4EHDA 4FXOA 2H5JA 5IASA 5JFTA 3PD0A 1RHMA 3R5KA 4PRYA 4N6NA 4N6OA 1QTNA 3H1PA 1IBCA 4D3YA 3ITNA 4N6GA 4I1PA 1RE1A 3H13A 4AWBA 2HBRA 3KJFA 4NOJA 2FQQA 2AR9A 5I9TA 4QUJA 5IC6A 5IAEA 5LUBA 3R7SA 3GJTA 2QLFA 1K88A 4EHAA 2Y0BA 4QUAA 2H5IA 4EHKA 2XYHA 3GJRA 2C2MA 3K7EA 1RHQA 2Y1LA 1PAUA 3R5JA 5IAJA 2QLBA 1RHUA 3PD1A 4DCPA 4QTYA 4ZVUA 3GJSA 4JJ7A 2C1EA 4NBLA 2K7ZA 3V4LA 1SC3A 2C2ZA 4JJEA 1RHJA 2HBZA 4FEAA 2XYGA 3D6FA 2XYPA 3V6MA 2P2CA 2H65A 2HBYA
chains in the Genus database with same CATH superfamily
5AKKA 3GJ5A 3VU9A 4EHHA 1TQ6A 3A8TA 2P2GA 4P4NA 1GU0A 1NXOA 2HMYB 4XGNA 4CWAA 5KNCA 5DBEX 4ZREA 1GPH1 4GOND 1G7CA 1ZGBA 1TRHA 1GWNA 3HL4A 4J1NA 2V7WA 3DXZA 2ZSJA 4UUNA 3WO0A 2D7JA 4AIRA 2AB0A 1XJCA 1Z0UA 3GJYA 1ELOA 2WHYA 1ECPA 1BAPA 1CZNA 1GXSA 1NA5A 1PQPA 1WW8A 4RIIA 3R3WA 3KPVA 4CCYA 1AKQA 2I7DA 3IE2A 4L1KA 3STXA 1RWQA 2OQVA 2XZLA 1M2EA 1PJRA 3H1GA 4OHYA 2C7BA 1GNPA 1LGYA 4CN9A 2F7SA 3LUBA 3PEVA 4TTRA 5CVDA 4L2IA 4WMLA 1IN1A 3ZHBA 2R6FA 4R7ZA 1EUCA 3FYCA 3N5KA 2YMPA 3O73A 3RUDA 3CYFA 1P8JA 3PRJA 1UP4A 2E2WA 4FEEA 2J3JA 3AY3A 4UTXA 4ZANA 6YASA 2W22A 3BD8A 1I33A 1ORRA 3L0YA 1C0IA 4W5QA 3H4MA 1HSOA 3LCUA 4LX8A 4ARUA 4CKWB 3GGPA 1P5HA 3O8DA 4FWIB 1YOVA 3BMOB 5ALUA 5ULLA 3T12A 2ZSAA 5KINB 4LNAA 3AZOA 4WZ6A 1E2NA 1MBZA 4E7OA 4RVNA 1FBTA 3C6KA 1AKTA 2IYUA 2VH2A 3H0EA 5CH3A 3WGNA 3MXOA 5K51A 1AJEA 2ORED 3SS7X 4C06A 1FW8A 5JAQA 1U1GA 5HA5A 4DUYB 3KXLA 2CE7A 2CNNA 3TTYA 3EWSA 5IXJA 3IBCA 3T94A 1ZHHA 3ESAA 1KDPA 3NTVA 3KAPA 2CFIA 5BMVA 2EZ8A 3I1FA 4QFCA 5AXBA 5EHXA 1S96A 1GD1O 1JNXX 1SULA 4RORA 1WMFA 3SJAA 4INOA 3TXXA 3VX4A 4RACA 4NG5A 3S1AA 2MINA 4ALJA 3JQCA 3RWOA 1ZICA 4JZYA 3BIFA 3NT2A 1VTKA 4PEVA 3UC5A 4F8EA 3QVTA 1OTHA 3U17A 1U2GA 3ZQJA 3DZFA 4Z9YA 2I1WA 3ZDDA 3EASA 1SBIA 1ULHA 2FW7A 2J9XB 2PG3A 3B1VA 3EQ6A 3GRKA 4DWOA 4RTOA 4C30A 2CF6A 3ZK8A 2IUFA 5FFNA 3NXKA 3LY9A 4R5MA 1O94A 4UHBA 4QXPA 3QKSA 1I1OA 4R40A 4B4OA 2HU2A 3CURA 3GK3A 2BF7A 4MWGA 2OHHA 5FLXA 3A1SA 3VAZA 3KT6A 2YXBA 2C3YA 4N6OA 4RVCA 2QQGA 3DF7A 2XCQA 5EWMB 2ZZKA 1ZMRA 5THQA 4CM9A 4C7OB 3ENKA 3D4PA 2ZYIA 1GJRA 3SU8A 3X0DA 2GJ8A 2LDBA 1BH2A 3F0TA 4L7VA 2HIGA 1UKBA 1SVUA 1A5ZA 2ZQ5A 3O4IA 5J5VA 3F7TA 2E4UA 4YRNA 4YS6A 1MJGM 4GMKA 5F73A 1E4EA 5HG0A 4PSAA 2ZUUA 2HHCA 4L0CA 4EMTA 4ESVA 3P2OA 1J00A 4TS4A 1T9AA 4AURA 2JEZA 4MV8A 2IX9A 1ZP6A 1NXVA 2ZSHA 3QLTA 3QXCA 3UV3A 5KBYA 2D5CA 4W5NA 3KKNA 2B4QA 3MYYA 1QYVA 1BXGB 3ZZ0A 1AKRA 2YXEA 1RCTE 1ZINA 2Y92A 3I5MA 1ZL2A 1CR4A 1BGVA 2JGLA 1V1JA 3NWPA 1JW9B 4DVJA 2CF5A 3BRSA 3PWKA 4BNVA 1QX3A 1G2QA 1SIWA 2PH1A 3FETA 5BV7A 1NVDA 4NQZA 4XCVA 2EYQA 4X3OA 4AZ0A 4DTIA 2O8CB 3ABQB 4G5RA 2Q41A 1E6CA 2A0KA 3L4KA 3DYIA 1P9WA 4LRUA 3MZ0A 5ITVA 1OZHA 4FI3F 1W34A 1N36B 2J0UA 2WABA 5FOVA 5B4TA 4JGBA 1ECJA 1I3LA 4FYWA 4KR7A 1VE7A 4Z2AA 2W2PA 1KI7A 4NZ9A 4BGDA 3U7IA 4GC9A 1UOPA 3EEQA 4YGXB 4BOYA 1OE0A 1SN7A 3T7JA 1PP4A 4JUFA 4DOMA 4HX5A 1T2UA 4KQFA 3SYMA 2BM8A 1MP0A 3VR4D 1OLSB 1ODLA 3QVGA 3PWZA 5HK9A 4GAEA 2OAGA 3VNSA 2JI7A 4MR8B 4HWOA 4ARBA 4MYCA 5LYJF 2BMDA 3DF9A 1RAHA 4PYLA 4DCVA 2YZKA 2VHCA 4G5GA 5F1YA 1JI0A 5JR3A 1NUQA 1Y0BA 4KUGA 3CXRA 1APBA 5T5QA 3C6XA 3BQ9A 2FA9A 1P1HA 4H7HA 2FPRA 4RVHA 1JYFA 4FFBB 4YBRA 1QIFA 2JFBA 1B6RA 3DEKA 4C2BA 1V6AA 1P3Y1 3I6YA 3L0IB 3N74A 2IEGA 3LIIA 5E4JA 2C4UA 4MWSA 5DGXA 2E21A 2KI5A 1MRSA 3OKFA 3A3KA 3LZCA 1JDPA 4EI7A 2V03A 2JD2A 2HSJA 2QW1A 3MEQA 2QUZA 5ALEA 4K9KA 3SS9X 4QECA 1R74A 1U0JA 1X1SA 2ID7A 3PUWA 3EPHA 3D8SA 4Z86A 3SX4A 5FTMA 1YT5A 2XD4A 3L7NA 3TLYA 1YRQA 3V7NA 1P3JA 3V7YA 3EB9A 2ZB3A 1BOFA 1M2OA 3KLPX 4P4SB 3SF8B 4D0NA 6ABPA 3BORA 3I37X 4BNDB 1FMFA 2I1QA 2BDTA 3BWEA 3COSA 2JG3A 1O5OA 3KHUA 3CNHA 4M54A 5AM5A 2C07A 5J2UB 4D3SA 3A11A 2V55B 1O4VA 3G82C 4XIJA 2VT7A 5IYZA 3RNLA 1COWA 4KGVA 2Z4TA 4TLEA 1NUUA 3QJYA 2W98A 4N0MA 4XRGA 2NQ2C 1Y1KE 3CT4A 4ZXPA 1WQ1R 2G1UA 4WNCA 2EKBA 4JJKA 1WF6A 1E0SA 4RV9A 1M1NB 3MF4A 4OGWA 3KQNA 4QBHA 3V48A 4PCUA 3VR5A 1OC4A 1RHQA 5TQ0B 4PTZA 5JZSA 1T0UA 3U37A 3ELYA 2RIRA 2IZ7A 1N5IA 3BK2A 4E4TA 4JI8B 4L28A 1NP7A 2GRAA 2XB9A 1IG0A 3KAQA 9LDBA 2BONA 2QUKA 2NUTA 4QEZA 5HUHA 2OGWA 4GP6A 2VKTA 4R98A 5AWFC 3FUXA 3OIDA 3TUZC 4NV1A 1NKSA 4Z51A 2NXJA 1ZIXA 3RTAA 3VYSB 2NP7A 5AVKA 3NKVA 3SHQA 2CCGA 4MROA 4L57A 2P7IA 4A5OA 4BECA 2WLSA 4MR7B 2BELA 3H5TA 4GSYA 4Q5IA 2I4RA 4IZHA 5A5FA 2PO5A 3ENNA 3PHBE 1Z2NX 2QR2A 2D54A 1U04A 4G36A 1R6BX 1ZM4A 1GA1A 1G8MA 5K4GA 3I83A 4EHDA 3M6MD 5DYWA 4FT2A 3P0RA 4KDEA 2HRBA 4DUZB 1UJ6A 3AHJA 1HXHA 3GFSA 3UCFA 2GUGA 1X7XA 2B82A 4PWYA 5JDIC 1MVOA 5JRJA 5ED0A 4F71A 4Z54A 2DLCX 1ZK1A 2QD2A 1R6UA 1DJNA 2GPJA 3FYDA 1DDIA 3ISJA 3N8HA 4QWWA 3VYRB 4C29A 2PUEA 2ACEA 1S4MA 4PG7A 1B2RA 3GBVA 4R81A 3WQSB 3AU8A 3OE7A 5ADUS 1SZCA 1H5NA 1XA3A 2HA6A 1XUOA 2EBHX 1SOUA 5CM9C 4YAWA 1UKEA 4XVHA 2DXIA 4JQYA 1N1GA 1SC6A 4QRIA 1EDEA 4LPSA 5LOVF 3HXQA 2OHJA 2C04A 1T5DX 1ES9A 1NW7A 1XKLA 4IVNA 1N2SA 1M2GA 4RZ2A 4KB5A 4DN6A 4I3GA 2V7GA 1R4MB 5SY4A 1E1NA 3SCZA 5J4HA 3GR6A 3A9TA 1ZEMA 2I71A 3CJQA 3BL8A 1KDVA 3TOSA 5B4VA 4QBTA 1NV9A 1DGQA 2P6PA 4F4DA 2VBCA 1E9SA 3JQFC 2Q8QA 2RKBA 1YA6A 3VRHA 1JFVA 3G0GA 3FNQA 3V34A 1R00A 8GPBA 5IKPA 4YCDA 5CJ2A 1QGUB 1JDVA 5FPKA 5A5DA 1V4NA 4LI3X 3EZGA 3VV2A 4TMYA 2VZEA 3ZWDA 3CR3C 2HSGA 3PXCX 1DPFA 3LPNA 4OAOA 4MI1A 1FDTA 3OECA 1ZOIA 2C2WA 1E63A 1Z35A 1XMIA 2RGNA 5K3FB 3ZLJA 4NULA 5FTJA 1H23A 3S1AB 3HCPA 1N1MA 3H99A 2OBFA 3AR3A 1BFKA 1F6DA 1Q3HA 3N8NA 4DNFA 3C15C 1FUEA 4TTAA 4QGFA 1KJ9A 2X5KO 3N86A 1V1RB 1TU3A 1PLLA 4KNVA 5LXTA 5KNLA 5ENDA 4RSGA 2APJA 5C51B 1WMSA 3GRUA 4CF5A 1BROA 3NNNA 5HILA 3R8CA 4EATA 2CWDA 3COPA 3FUUA 1X38A 2P78A 3I01M 4FS8A 4IW3B 4II7A 3BVPA 3PQ6A 4WLOA 3CLSD 3HUEA 4IX1A 3ZGLA 4G84A 4EB6A 2VCYA 5FPYA 2QA5A 4KFUA 2DLNA 5EKTA 4FYXA 4X41A 2VQ6A 2A1TR 2QRGA 3GJTA 5GZ6A 2LZ0A 1YCDA 1N3IA 1SUSA 3QLUA 3TIVA 3UMVA 4JSRA 1KZGB 1EE2A 3T15A 5BR8B 4FE3A 2B8EA 3V1LA 1UXOA 2Y1LA 4E5YA 5IMBA 3LLSA 5DEIA 2IYFA 3D43A 5BRAA 2VHEA 2R25B 2JLQA 2GBGA 1YA8A 2G25A 3DE5X 4B73A 4DLLA 4OIMA 3W2HA 3HCBA 5FA6A 1N5DA 1P4GA 4FILA 5GP1A 4ARAA 1TYAE 1JDNA 1DKPA 2KMLA 3PJDA 5CUQA 1JDTA 3BTOA 4DLVA 1NQXA 4GXQA 4RLQA 1ZCAA 2VSNA 3OKPA 4Y2YA 1YQTA 5L53A 4O4IF 5IP5A 4J0JA 3QE9Y 4LDJA 4DLSA 1RPAA 1E9RA 4DUGA 2HI0A 2LXNA 3AVWA 1QFXA 1DFHA 5ENVA 1P8AA 4FBLA 2EFHB 2JBAB 3C14C 4DF3A 1RP7A 2A0WA 4FT4A 3NPAA 3IUBA 4FKMA 4QUEA 5B30A 8AT1A 5EEGA 1H66A 5EJ5A 5HJ5A 3WGGA 4IWNA 5CHEA 3BFKA 2L0XA 5A6VA 1N2IA 2ZI6A 3ANSA 1PVDA 3PWTA 4PLGA 5SICE 3VAYA 3K6SA 1NXTA 1D6JA 5AVOA 3LT4A 4GHWA 4BKUA 4ZGWA 1NNLA 4JKYA 2CW5A 1EFPB 1DHTA 4MYSA 4WOJA 5JAOA 1RWBA 4I55A 4K6KA 3CZPA 5CXSA 5FUBA 3RRYA 4BUZA 1C9YA 3GRYA 1U28C 1VYHA 1TJYA 1VFNA 2QZSA 3BH6A 4CE6A 5CVTA 2XIQA 1N6LA 2P30A 5FYDA 1NURA 5EXPA 4EGAA 5C31A 2X5NA 2FDCA 1I01A 4OH1A 3G1WA 1TO2E 1JL3A 3U7QB 4D5EA 2A5JA 2XMBA 1SUDA 3MSCA 3R4VA 1ZXBA 1J99A 3IOBA 4P38A 5D3ZA 3T7KA 1UDXA 1JU3A 2YNMA 3E1KA 1C1DB 3G7SA 3NHWA 3AIKA 3OJFA 3W5VA 1CR1A 2FP4A 1G4AE 3CLKA 1U8YA 1BU5A 4CQLB 3HJNA 4Y3UA 2OC4A 5DOVA 2JD1A 1PQWA 1KYWA 5DCYA 4KRYA 4PZAA 5D1HA 2VSFA 4TWIA 4CDGA 4DLPA 2GRJA 1Q77A 2A5DA 2EZ9A 3IEMA 1KR2A 4IDFA 4OQFA 1C7RA 5DN9A 5JQGB 4KSYA 2V0CA 2ZCUA 1RHKA 2GAAA 3O94A 3REFA 2ISCA 3KYBA 4ZYTA 3QV1A 1U7OA 1E2IA 3QEKA 4QATA 1HY3A 2PAAA 4IRMA 1FFSA 4J0FA 3IL2A 5EMKA 1IM8A 3PFFA 2EERA 4BLUA 5JSFA 2VT2A 5I9IA 4E6EA 5AVWA 1CUCA 1VG1A 1KJWA 1ACJA 4QTXA 2JFYA 3ZCXA 1NL3A 3S8MA 2C4KA 2E3JA 3VPBA 1NN1A 3HFSA 3DPSA 4QM7A 5DNUA 3JQQA 1QE0A 3NU1A 3B7GA 2ZWPA 1KERA 1XI2A 1F8UA 3ESYA 1DBWA 4QLAA 4QRHA 4LC1A 1YE5A 5CEJA 1J2JA 2ZAIA 2H4HA 1U1EA 2P9EA 1ULUA 2WHPB 3BAZA 3ME5A 1EK5A 3CSDA 3F6BX 1MB3A 1T1EA 1LDEA 5KNCH 3BQNB 4D6PA 1G6HA 1OX4B 2XYRA 3E7XA 3FIJA 1UDRA 1YVDA 3GHHA 2XRFA 3IQGX 1BEZA 3RIMA 3HP7A 2IBSA 1QZTA 3AFHA 3L93A 4Q93A 4L5BA 3RDPA 4OMDA 2PMEA 4CMGA 1IE3A 1V43A 3M9LA 2VUTA 2WTXA 3O4FA 4MS3A 3PUYA 2NSDA 2QOEA 2Z4RA 1GRQA 3ESQA 3OPYA 4XD7A 3AVXA 3WNDA 4AMZA 4DCNA 2Q4RA 3DVAA 2E55A 3BSWA 1M6EX 3T1QA 1V9SA 2H1LA 4AYTA 3WTBA 4UM7A 1FY2A 3S0JA 2H06A 1FNNA 3Q72A 2D7DA 2ETVA 5BQ5A 4Y6GB 3NGLA 3PQ7A 1IN7A 4MMZB 3JQGB 2VYND 2VK2A 2H1OA 3WDSA 1L8QA 4LJ5A 2C2ZA 1BE8A 4P5DA 3VR2D 1HLFA 5IZCA 4N3CA 4FYHA 3QMWA 4DNPA 5TT0A 4O2BB 3RRXA 1AUPA 2CN1A 4EJSA 3BZWA 3QBJA 3IJEB 4HDMA 5K3AA 2F43A 2OYSA 3QBEA 1E3IA 5J40A 2C0PA 2CD7A 2X0KA 2OV8A 1SZJG 3EEOA 3CH7A 4J4HA 1H1TA 2ZETA 3JYOA 1BZYA 3LBYA 4KFTA 4X1YA 4ENWA 1SVMA 2LWIA 2WKSA 4YMWA 4B6EA 3O0TA 3TKYA 4EL0A 4KITB 1Z4JA 3PCRB 4P4UA 2VQFB 4UBIA 1SBYA 4HCJA 2OBNA 4U0KA 3O5AA 3BOSA 1Q19A 4CHTA 2ZB2A 5C5CA 2L2QA 3OIVA 1S9HA 1BW9A 3C8MA 3PUKA 2CMHA 2C9DA 4DQVA 5I9BA 2CV1A 2DQ4A 4LNUB 2Q9UA 5U9CA 1T0PA 4PAOA 5BV1A 4TYNA 3K5IA 1V8FA 1G2OA 2VPPA 3B5EA 1IVYA 5DYIA 3TDNA 1Q83A 5EQJB 4FYKA 5K6RA 2PE5A 3DH0A 1UXKA 1AGRA 3DKKA 3QUQA 4HYEA 2F4NA 3ZN2A 2P75A 4M8LA 1H2WA 1KC1A 1G2PA 1S3SA 2HU5A 3AUTA 3B38A 4KZKA 2O2YA 5IM4F 2ZI3A 4TV8B 5ALDA 1X1CA 2A5GA 4FFMA 2R00C 4DYVA 3C70A 4H7PA 1Y4AE 4IGFA 4BDTA 4FYYA 3O91A 4LV8B 2J30A 3VPCA 4BBZA 3LF2A 2FPXA 1F5SA 1WZNA 4DR2B 1GRNA 4AP5A 1ZONA 2QQFA 1UBKS 3F6CA 5T6BA 1KZHA 3ZLTA 2WAMA 3MWEB 4IKOA 5HF6A 1RM0A 4EO4A 4F3RA 2RGYA 5HCUA 5I6DA 2XXAA 2Z8ZA 3GNSA 4S2UA 5ES3A 1WPGA 1L5FA 1N7GA 3SHVA 4MQBA 5KOJA 3TCXB 4PIPA 3TW0A 4N01A 4CVNA 4WEQA 5I7HA 4E94A 1GPNA 4B7XA 3CC8A 2YV3A 4KODA 3G2HA 2JVKA 3Q4GA 1LD3A 1MABA 4EJMA 4CBVA 3BGIA 2GI4A 1H1DA 5HRAA 2O3QA 3GY0A 1OXMA 1KKLA 3CFYA 2AQHA 3KK0A 2DGDA 1KY4A 2ATCA 3E58A 1QKKA 3HR4A 3OCYA 4Q05A 5EQFA 2WIFA 3ZU6A 5DLYA 3RANA 1GNTA 1ODJA 1WXWA 4PHGA 4BNUA 5EYPB 2AD1A 4PRYA 1FOEB 4JJZA 1HDXA 2D06A 1L7BA 2Y9MB 2ZJ5A 1SB8A 3CMCO 1Q0TA 4EM6A 5AVSA 4BB9A 2IXEA 3M6XA 4MGIR 3PF8A 1MB0A 4AJOA 2I2XB 1FRZA 4RIHA 4X7PA 3KZKA 3ONWA 2VIIA 4IWYA 4CLDA 1NE7A 3OZAA 1NC1A 2BGLA 1HK7A 2FU5C 2QZ9A 2YHAA 3COWA 4U02A 1MO4A 3OA2A 4BZWA 1YDHA 1XTBA 2QRVA 3G17A 3I64A 3MGKA 3MQ4A 4G9BA 4K9DA 1JLSA 1HYEA 2WU1A 4JJ7A 4XR9A 3A14A 4S04A 2UUCB 1ZVQA 2BP7B 2DQKA 3EXFA 3HUDA 2PXCA 1A88A 1QS0B 3ZQ4A 2IOQA 4FEAA 4DJTA 1BWPA 4IJ6A 4EG0A 3P26A 1D6SA 3PUHA 2VRCA 4Q3KA 4O4JA 3UKDA 2BL4A 3ANYB 1H2RS 3BHJA 2V65A 1GKUB 1K9SA 3K1ZA 2O7NA 3OOWA 4Z4IA 4HP8A 1D4AA 4EPTA 3ER6A 2WJHA 3EIEA 3ZCSA 4B76A 5HMMA 1GPDG 3PPXA 4MPTA 4B3HA 1D8AA 2ZUWA 4FS3A 4LJSA 4MVJM 4GBGA 2LCQA 3PTAA 1SXQA 3DEJA 1WMAA 2DWUA 3VKVA 1UBNA 1P60A 4DLKA 1KDOA 4OH7A 4MZDA 1A8UA 1YJCA 2QPTA 4A27A 3WLQA 3DUWA 1ZZEA 1M73E 4KQWA 3TR6A 2QTVA 3NAGA 1MR3F 4NVRA 2VDPB 1IATA 1DELA 1RZ3A 4QO7A 4LF7B 5DM2A 2HEIA 1ZD5A 2G1JA 3VR3A 1STOA 1R5JA 4QYIA 1I1QB 1YO6A 2I3ZA 2WF8A 4Q3EA 3WGTA 1NR1A 3CHYA 4P3XA 1FZTA 4LA4A 2VYQA 2UYOA 4JDPA 4CLHA 3LPLA 4LK3A 4JJAA 2HPAA 4FDUA 3B1JA 2H7VA 2V1UA 2GLXA 3JQAA 1RPJA 3PC8C 2BCJQ 3HNPA 1JIJA 2FKNA 1XF1A 4WESB 3I05A 4MUHA 1JHOA 4KAXA 3TBFA 1EGQA 2H16A 2J5XA 2P5YA 3GOHA 4XOIA 3DBRB 4CT5A 2UYYA 1WUKS 1US8B 3BF8A 3DBHA 3EGIA 1IOWA 2POCA 2A9VA 2Y0EA 3EGDB 3PGA1 2ZRHA 2IJGX 4H18A 4XE5A 5AKZA 1NKVA 3OHMA 3UM9A 4YT2A 3E8XA 4KZPA 2E89A 1KI8A 3NS7A 2QTBA 4W1RA 3DZJA 5LDGA 1K7CA 3AQ4A 3W77A 3IC5A 4TKVB 3RHZA 5T4FA 3GBSA 1ZRNA 1FK8A 2ZW9A 5ELXA 2ZXEA 3MOSA 5DYGA 1DIAA 4OU4A 4TVBA 3PS9A 1WBJB 4OJQA 3VHXA 4AKIA 3VBCA 1ENZA 3KJHA 5KSPA 3VR5H 4POAA 3QUAA 3O4HA 2DJ5A 3CRQA 3JQRA 3UMJA 1RKBA 2E4VA 5FJJA 2BY4A 3WAKA 1Z75A 2HK9A 3GUCA 2AK2A 3IAS1 1MIOA 1P75A 3BXEA 3LPCA 3K4PA 1JAHA 3AILA 4E4RA 1ONSA 4TQGA 5TLSA 3UXHA 1E2GA 1GQYA 1Q21A 4OFBA 2VJPA 2TECE 2MMGA 2H4WA 2IH5A 2QTWB 3H1FA 4QOGA 2HTEA 2UVQA 4NNJA 2XMRA 4ZCLA 2EGHA 4UEJA 2UV8A 5AHXA 4MGZR 2GWRA 5CU7A 3KZOA 1N0IA 2ZIXA 3QENA 1UKAA 1D4ZA 2RC6A 2AOXA 3VUEA 1SZPA 1TM7E 4GLBA 3W0LB 5B1DA 2X0RA 3O1JC 4OSOA 4KXUA 4OUKX 4PY2A 4QPZA 3G5UA 1PV2A 5IJ0B 4NCBA 1OROA 1ECLA 2GDZA 4MQFB 4EQZA 1UT8A 1FYVA 1JFRA 2IPAB 1LF0A 3PRYA 4DDVA 5AIAA 1N78A 3L04A 4LZAA 1U31A 3D1VA 3SZUA 1WWKA 4JP1A 3QKUA 4X0EA 1SHUX 2RK4A 4MDFA 5LL6P 2XI4A 4HGQA 1T24A 2FSFA 1L9KA 1SHZA 3JZMA 1SVKA 1X9GA 3BWDD 2OO3A 2B5WA 2XWSA 5FPPA 5FFMA 1C8KA 5D51S 4ZVUA 3J7AC 2G6TA 1TL7C 3WE7A 2I9KA 4X90A 1NLYA 3JRNA 3W9UA 3E7PA 3EXIB 5EG5A 1DJQA 1N92A 4NFSA 4MW9A 4XFDA 3CGWA 3PIIA 3KKPA 5E0OA 5A7GA 1M7HA 2A30A 3ROZA 1XRRA 4ZOQI 3BA6A 1M6VA 2JDID 4YONB 3U3OA 4BNXA 1IBMB 1ORWA 5DHQA 4HH1A 3WIDA 1W0JD 4UBLA 3HR7A 4UTVA 5C3UA 1EBFA 3GQBB 5AQEA 3WGOA 4UVDA 4EG1A 3O3OB 5IVHA 3JAKA 4AS2A 3BMQA 1FA9A 1D6NA 1CTQA 2LIPA 3QHQA 3F5DA 3K0AB 3EAGA 3ZHQA 2B0CA 4YALA 3LUPA 2Z83A 3ZI0A 4M7RA 2O5CA 2OZLA 2JRCA 3GEDA 3HXLA 3N2IA 1XX6A 3DMYA 4FCTA 1Z16A 4WJZA 2DHEA 3AP2A 3DAGA 4WQMA 5IDVA 1AF7A 3OJXA 4TZTA 3AVOA 1RLIA 3G2PA 3PIRA 2XDYA 5ADHA 1ZVVA 1ST2A 2DEUA 1VJ0A 3DC2A 1ECBA 1E1RA 3GJ8A 2VS1A 1PR6A 1FJHA 1PFQA 5FP0A 1N5LA 4NMWA 5ITWA 1EWKA 1CEYA 3GFVA 3JARA 1ZI6A 4LQ4A 1EUCB 3UANA 4BEVA 4FDAA 4M83A 1SQ6A 1N8TA 4J03A 4W8HA 2IHZA 2YHIB 5DCWA 5SYAA 1EQAA 3S2IA 2WG2A 4J3JA 4LAFA 4IQGA 2CLMB 1F48A 3L82B 4WACA 4CTNA 2VPXA 4F1WA 1AQJA 1TTTA 2ADOA 2WJIA 5D8DA 1RCUA 5DN6A 1TI7A 4H7IA 3O7MA 4HLDA 1DKMA 2VJCA 3ZD7A 3WMWA 2ECKA 1J8YF 1FFXA 2ANBA 2ZRMA 3H9CA 4MVJF 4P83A 3K5WA 4UBOA 3ZE2B 2B1JA 4MVJI 2HLPA 1QHYA 4N7JA 2JVJA 4NJMB 3TZQA 3PNPA 1Q7EA 1V25A 4RFLA 4H0CA 1XEFA 4I50F 1FX1A 1WF3A 2PL1A 3PHLA 1JQBA 3V46A 2X5XA 1Z6AA 3NH6A 4TL8A 5E1OA 1L3IA 2GBPA 4YRDA 4P93A 5KKCA 1ENPA 1XZEA 3OMWA 5L3SA 3DO8A 1T2EA 1B42A 2QMYA 4G5OA 1EXVA 1Q6ZA 4HAXA 1AB6A 4TL7A 1MKYA 2EC5A 1ZBDA 2F67A 1H8EA 2P6OA 2HO4A 3NB0A 1GSAA 3CN9A 3NAMA 4R4JA 2J48A 5DTRA 1WNFA 3ILYA 1GAQA 3FPAA 5C4IA 5JFTA 2FLKA 2P0AA 3ILHA 1JKJA 3U7GA 2Z5FA 5FI5A 3VTZA 4B6OA 3E70C 4J8PA 2REQA 1FL9A 1B26A 4WLVA 5ELMA 3UT0A 3TUJC 5JDIA 1B76A 2XBLA 3QKSB 1HKUA 4ZO8A 5CH8A 5B1IA 4TYQA 4HYTA 4D44A 4YMGA 4ARVA 2VP4A 4NESA 1DAEA 2GD2A 2CXXA 4KNWA 3NV9A 4Y9TA 1ZGCA 2IIBA 3C6BA 2D0PB 2VZ0A 4MQ4A 4DHWA 3OQNA 1Z6GA 1K9VF 5JH7F 3Q10A 5IDXA 2YJNA 4IICA 3VDNB 5ERYA 3REQA 1SVWA 5JO0A 3CF2A 1ITZA 4HEA1 1QIDA 5EJ9A 1HEUA 1X7ZB 3ZXUB 4LYAA 2PD4A 2F90A 3ZTTA 3H5NA 1TGVA 4FBGA 3FMPB 1J2YA 2WJ6A 2EZTA 3IE0A 5FWXA 4BE9A 1II8A 4ANFA 1M7GA 1NN5A 1PSDA 1XOIA 2R1UA 3O3MB 3FCUB 3RK1A 3AOGA 3ZKAA 3PXUA 1XN1A 1SC9A 1U3FA 1JLLB 5ALNA 3WDKA 3A9UA 4HAIA 2VJQA 3OQBA 4C7BA 3WHPA 2FUKA 1SPBS 3BXHA 4KVFA 3Q3VA 3QYFA 3L8CA 4R83A 3AP3A 4ZI7A 1WV0A 1E4VA 4O2RA 2CK3A 3ZUGA 3ZVLA 1XNHA 1MB4A 4HH0A 5DTJA 4JOBA 4GT1A 3O3NB 3VVCA 4AZ0B 1FMCA 3IOYA 4RZ3A 5CDTA 1LDNA 1S6YA 3FYUC 4EVRA 5DM1A 5FL7A 3CUUA 1O9BA 5DGDA 2R79A 1HT1E 4G0YA 4NYMR 2NU9B 2AXPA 1NMYA 1IEVA 4KJXA 4DUPA 4GBMA 3LC1O 3DKVA 1Z56C 1JTVA 3GJQA 1V4VA 4AF8A 1B43A 5DSZA 2NMVA 5F7ZA 1Z5WA 4ESEA 3WZ2A 3DFIA 2WYIA 4K6MA 4RVOA 1G0NA 3FHOA 1QK4A 5GAJA 1YA4A 1ZM3A 4GVLA 3U6KA 5IJXA 1J7JA 3C3DA 3JYQA 4R7TA 3WWEA 1NWHA 3A6JA 4HUTA 3GFQA 1XHEA 2CNDA 3EISA 5CB6A 1P0FA 1JGTA 1XLVA 4QGHA 4EJFA 5I7RA 5K8CA 1QG6A 2J31A 4TM7A 3ZZ1A 5C8VA 3K70B 2XZTA 4IHJB 4M1MA 1EX1A 2Y67A 3D6JA 4EJ0A 3QVWA 5AM3A 1NPYA 1GNSA 2RGXA 3EIUA 3JR3A 4ZOLA 1VJDA 1Y6QA 1TEHA 4XEHA 4MP8A 4G0PA 4MGEA 3DCJA 3CIFA 2C61A 5TMDA 2QX8A 3DD1A 4CL8A 3WJ2A 1M8KA 2WTUA 4LFAB 3D4LA 2IKSA 2XB6A 3NWBA 3B20A 4HAZA 2I22A 5DKFA 3FRJA 3GGOA 3IUQA 4KJZA 4E5KA 4JXXA 1XYYA 1O6CA 1CP2A 3B7WA 5JWHA 2VUIB 1W25A 3EPJA 3BWBA 3C7AA 1E5TA 1QGDA 1GPMA 1ZNYA 3W8EA 2YJ5A 2YN2A 5E0KB 4QKQA 4I5FA 2JGIA 4U5XA 1GRVA 2NO0A 3AB8A 5EKDA 3GJ6A 3SYTA 5EWLA 2R9VA 3IP7A 4YUVA 4GKJB 1JB9A 1F4PA 2ZKIA 3PENA 4IJWA 4HVAA 1K5GA 3OQHA 4L51A 4QA9A 1P7YA 3TLGA 3WIBA 4ZVKA 4AJNA 4F84A 4EI9A 2L82A 3QXXA 3HVKA 4OHBA 3V1YA 2AXNA 3AHEA 2I3GA 1PHRA 3OEYA 4C89A 3VI3B 4D8YA 1P62B 3U1BA 1QRTA 3GFFA 4TMXA 3X1DA 3L7LA 4CI0B 4DSAA 1HRKA 3FWHA 5AW0A 4C9BA 1XHFA 3Q9NA 4FU0A 5LBIA 4JUIA 4R8LA 1DBSA 3EA5A 4N03A 1HQKA 4NBTA 4S0ZA 5FA8A 2V5VA 4ZVMA 1U28A 4WDQA 3SR0A 3FFBA 4JVLA 2XYHA 4BNJA 4BNMA 2PX4A 3DE0X 1FLDA 1IUPA 1DBIA 1M2HA 3DMNA 2Z5VA 3LY5A 3ETJA 3P8ZA 2G9VA 4L22A 4AUKA 5K6AC 2DULA 2P68A 4IWXA 3NP9A 1JSRA 2F59A 5DISB 2C4HA 2VXYA 4BB0A 4Q7QA 4Q4HA 2J3LA 3AL0C 4MIYA 4R2WA 4LHSA 4E12A 5ILQA 1L5SA 2O3TA 4GR9A 3VI4B 1EFAA 2PFKA 1BDBA 3JS5A 3UA4A 2IY9A 1RJGA 1NQVA 3PEYA 2AF3C 2JK0A 3WOVA 2BV3A 1RD4A 1H2XA 1T4MA 2VAMA 3BICA 1CUEA 3N05A 5D86A 3OLVA 2CNKA 4RQBA 5DHRA 4D42A 4DABA 3BHIA 4MRRA 1DQYA 1LVGA 3GOQA 4BGIA 5JC8A 2HSZA 4EA7A 2C54A 1GQRA 3T7DA 1K27A 3OCWA 3UTDA 2B8WA 1GNQA 1RWVA 3AEXA 1KQFA 4JI2B 1MC1A 3IS3A 3IVCA 2LTAA 1BDJA 2XY4A 3LXUX 4PO9A 5LQUA 5TJHA 2QT1A 3ILXA 3OEHD 4RZSA 5ESXA 1OGJA 3EVAA 5DT9A 4D8WA 2Y66A 1JDZA 4MLCA 1RR6A 2BDUA 3K53A 3THWB 4ND5A 1T10A 3FDXA 3QWBA 3QWAA 1SQ0A 5AKIA 5L6LB 5HNKA 2DB3A 2DT8A 1GG8A 1Q91A 3MMSA 1XP5A 1X3SA 4LCEA 5JCJA 4YA6A 1AN0A 5JS1A 3EVGA 1Z62A 5LR6A 2A67A 2V4ZA 5CEFA 1W36C 3I42A 1FU7A 4K1LA 3E9NA 4ZCMA 5D85A 2ZI7A 2JFGA 3KPWA 3MOIA 3O21A 4GR5A 3RBXA 4DDUA 4XUGB 4E3WA 4C76A 5KTRA 5DWDA 1ILEA 3C39A 1CHNA 3TFQA 4BC0A 1EU1A 3GJZA 3QVJA 3T41A 3DS8A 1XPRA 1NR7A 3VOBA 1JT2A 3DKRA 2O2GA 3NX4A 2FVXA 3NBXX 4AWXA 3T5AA 1I3NA 4Z8YA 3JD3A 5C0OE 1GPBA 4M9QA 4ZDKA 1L7OA 2ZUSA 5KYNA 2I7CA 4B6GA 4L50A 1CW2B 2XAAA 3DEAA 4K6GA 4Y8VA 3VZDA 1QG4A 2BKEA 4ZV4A 3M4NA 1KK2A 1C0KA 2GM5A 3GNLA 4X1IB 4JNCA 2V9CA 4DKXA 5J1SB 1NULA 3U5ZB 1ISHA 1DO8A 1PE0A 1S3FA 1XE3A 4Z6KA 3QTLA 1LS1A 2N9UA 1L5LA 4CRWB 1YQWA 2KE5A 3FNEA 3H42B 4YRQA 5GMOA 5KYTA 2WVAA 3CNLA 1QE3A 1VIAA 4BQOA 3FUWA 3R6LA 5F7XA 2WSBA 2Q1SA 5ECWA 2VAPA 3E4CA 2IQIA 3G9ZA 1Q0ZA 1GUZA 1JX6A 4ISCA 1JMKC 1VJGA 4A0GA 2Z0MA 2ZIGA 3LQYA 4LGYA 2QY6A 5BYAA 1Z29A 3RUHA 1L5MA 4UNPA 2FFJA 2PS0A 4ITVA 4ZOCA 4F7WA 3J81k 4UXIA 2W11A 2XT6A 1AUVA 1WAMA 4YI3A 1DJMA 2QUBA 1HBJA 3TQSA 1Z0ZA 2FPPA 1IN6A 3WK4A 4MUIA 3PEWA 4IIYA 1DG1G 1XVAA 1XZHA 3RTEA 1KDZA 1BDMA 2XGGA 4G56A 1I5EA 5AW3A 2MSDB 4HDOB 2SBTA 1PUXA 2WWGA 3K4HA 3PQ8A 4G8BA 5MDHA 1JEYA 3VSBA 4A26A 4EB6B 3T4XA 1P74A 1Q1EA 3NBAA 3RS4A 3GJSA 3DMFA 1Z4IA 2X8JB 3LO8A 5BSHA 4BFXA 3C6MA 1IXSB 4Z1OA 2HQOA 4I9HA 2FXVA 2IE8A 4NEGA 3O74A 4N7RA 5ALTA 4B85A 3HU1A 1TJ3A 5KKAA 3ZXSA 1BC5A 1RYHA 2D5LA 3RVPA 1OGIA 3D7MA 3LCCA 3QUSA 2RHOA 1BSVA 1PGJA 3BGVA 3MILA 4LJ8A 1PKEA 3P1JA 3FVQA 3RABA 4A3SA 5HKBA 4YCNA 5GJWC 4DGQA 2NV2B 3O8QB 1VYTA 3S68A 5H4HA 2G1PA 3T1NA 2X76A 4I1YA 4MVJP 3PXGA 2OCLA 1IBLB 1RC0A 2G8NA 3K2EA 3VKHA 4RTPA 5J1TB 3AHIA 4KO4S 4KSCA 4M9SA 1DMSA 2Z5LA 1I0ZA 5AM4A 3IV9A 3KPJA 1O9HA 2GHTA 1AMUA 4LWOA 3T5BA 4BQPA 1N2ZA 1FLNA 4ZQBA 4IKPA 2N1MA 1QGED 4KE7A 4ER7A 1E9BA 2WFAA 2J7PA 5D5PA 2XUFA 4H0NA 4XJSA 4RY0A 2PMFA 3BFXA 1U80A 2WT9A 4V1CB 5IJ9B 4N40A 2GFHA 1M8GA 1U8CB 5E2BA 3K6SB 3TG8A 2W4MA 2GJKA 3F4BA 4LMRA 5LUAA 4HJXA 4IFBA 5DRTA 5MFPA 3K9FC 3ZD9A 4I55B 1GILA 3SYLA 2IEBA 3E9YA 3QE4A 4C2TA 3HA3A 1EZZA 1NU8A 1KZ4A 3E5MA 4Y6OA 1QRAA 3FWYA 1PFYA 1Z8NA 4S1NA 5BWCA 2YHSA 3ND7A 1OW3B 1G55A 1Y3BE 2VUUA 4JC0A 3ZWNA 3DQZA 2YS6A 3UNXA 5IVPA 5B7GA 3RFTA 2EBWA 3AUAA 5JZVA 3NCTA 1RQGA 1RZRD 4ND1A 4GR4A 2ZQYA 2RB4A 1T4CA 1L6IA 4QGAA 3QJ5A 4R3NA 2C94A 4CKYA 3HYSA 5M3BA 1G59A 1JQ5A 2O2DA 1IRXA 1R64A 1T25A 4A8PA 1T1IA 3ANTA 4J1TA 2KWIA 2C7RA 1W46A 3GXOA 4QAQA 1J39A 1HDZA 3NYRA 4BP3A 1RABA 3GCZA 1N1DA 2FTKE 3AM3A 1NF8A 2W2KB 1KBQA 3FHCB 4UKDA 3WYGA 4E1BA 4F4UA 2IS2A 4CW7A 3RSGA 1YVEI 1G1MA 1SR8A 1MOZA 3DT9A 3V7UA 4POOA 5IPFA 1H9BA 2GHQA 1NMZA 1W1IA 1QH8B 2JGFA 4ZVNA 4QE3A 1L5HA 4HQRA 4EITA 4PFQA 1BTOA 2ZU6A 3JQ7A 5HRCA 1N0HA 1TQ4A 1BKSB 3JCZA 5E9WA 3BIXA 3JD1A 4F96A 1L4NA 2G06A 2YZMA 3PB3A 4MQ5A 2XOKD 4OMFG 1YQUA 1H93A 3LOPA 2BTQA 1JLHA 2BRUC 4PSCA 3K0KA 2B2XA 4ETNA 2HT1A 4OXIA 3RRFA 5JAPA 3T5CA 4CV1A 3A2LA 3OHPA 5ILGA 3ZQKA 1C9MA 3CVWA 5LQKA 1RMTA 1NFRA 3RIEA 2I66A 2HRRA 1E9FA 1BRMA 3R5FA 4GDFA 1T0IA 5JD5A 3PD7A 1OYWA 1SWVA 3PHCA 1CUSA 3HA5A 4HATA 2YL2A 2CUKA 3PTLA 3GQVA 1W2WB 3PQ3A 4ARSA 3U09A 3EX7C 4D82A 4RJLA 2JKVA 3OETA 4ZFNA 4FD2A 1LC3A 1GL7A 5CVUA 1AO0A 4X66B 2BYTA 1GKYA 3DVAB 1LH0A 5HTOA 3A1WA 4CETA 3K0SA 3OJ0A 1UMKA 3R0XA 4OJNA 3EUEA 3WADA 5A03A 3O4RA 4C4TA 2IHNA 3MLAA 4UM8B 3OVMA 1DJLA 3WWOA 4BO3A 5C46F 2H7YA 4R2JA 1PEAA 4FHFA 1IWOA 2BFBA 4L6IA 2UYHA 3S2EA 4CUZA 5JROA 3H8WA 4AMYA 5AXCA 1BS2A 2FFAA 1VKOA 2I8AA 2ZJ2A 3M4ZA 4HQ6A 2UDPA 4JJFA 4NC9A 4XH9B 4BVFA 4EZEA 7ABPA 3CV3A 1QP8A 2NYAA 1KZ6A 1OAAA 2P79A 2A7XA 1N5MA 2XXBA 4HDMB 2ZSIA 2F43B 2XECA 5T67A 5E9JA 1C81A 2YFQA 2Z2YA 1PBTA 1NQUA 4BRZA 3N8IA 3PCTA 1J8FA 2CBGA 3W9BA 4CIYA 4NOMA 4LYEA 2NUAA 1E64A 4GGOA 4EARA 2JA2A 4U63A 1SRRA 4PS1A 5JZMA 5E38A 5AJHA 1KTVA 3GLQA 4JP3A 5CCDA 3TECE 5J2UF 4DPKA 2TS1A 3VZRA 4M0EA 2AKEA 1XTUA 4HX9A 4MKZA 3CE9A 5JE8A 1I2CA 5K8VA 3JD0A 4GQAA 4PNPA 2JFOA 1MT0A 3KVRA 1YMVA 4EOGA 1V9LA 4J0CA 4NEQA 3NRBA 5TQJA 4NECA 4ETMA 2GN4A 3AONB 2HB6A 4H6WA 1JMVA 1HNWB 2SKDA 3LZ6A 2QY9A 2GNAA 2QJTA 1F38A 3I9V1 1K3UB 3H1EA 3R3UA 1UANA 1U7ZA 2HK8A 1A3CA 1A9RA 3E23A 4MV0A 3AXSA 3D3NA 1EFVA 1KU6A 4FGWA 1FU4A 1Q5PA 1X1EA 3PZBA 1Y1LA 4LJKA 3U19A 2BHSA 4HDSA 1DWQA 4RGVA 3ZX4A 1WDLA 1KXJA 3DAFA 2FOIA 3VFDA 3I6MA 1Z5GA 2FR1A 3F9CA 1RC1A 1X8JA 3I2IA 2IPLA 4IDDA 3V1MA 1YV9A 1HE5A 1FFBA 3ZWQA 3QH4A 1N3BA 3FROA 2HPZA 4Q9DA 3WZLA 2ZYAA 1GADO 2VDLB 3HJRA 4ZDJA 4DMKA 1I5OA 1WXGA 3ZHVA 1G17A 5KQMA 4R7GA 4Q02A 1XZMA 4TLMB 3IHLA 2WVJA 3CWCA 3M3HA 2RAFA 2QT0A 3C8HA 4R0NA 5AJYA 4D8UA 2AFIE 3NM6B 3UCEA 2OUKA 3G2IA 4A03A 4G23A 4YCSA 1YR7A 5C5IA 3TEMA 3RIXA 3SOZA 3ZWYA 2OP1A 1QUFA 1SHJA 2IWRA 2PLAA 3I23A 1MABB 3NLLA 5DCUA 4Z53A 3QU4A 2O2IA 4XLTA 2GFIA 4HVLA 3W3AD 2HW8A 3ER8A 4YREA 2O5EA 1DIBA 3H5AA 1MU0A 1PK8A 4KQJA 3WNVA 1RE1A 1ZI8A 1FFDA 1QTRA 1YSCA 2DPYA 3AESA 4U2EA 4X44A 2R8PA 3RSZA 4LJ7A 1KFKB 3HRIA 3KOMA 4LF9B 1XGKA 2A88A 1YC2A 2FV8A 2GN2A 1M0TA 1UEJA 1KEPA 4P22A 3BT7A 1AUXA 3VOSA 4JYMA 2MSKA 1A9QA 3LWDA 2DP4E 2WYWA 3E15A 3OZWA 3NAQA 4D9BA 5CB0A 2XJ9A 4KI0A 5JDCA 1MVLA 3D2AA 3OG9A 1KY2A 3X2EA 4LRWA 3DUFB 4MK4A 3ELDA 2FZGA 4UE6A 5H7XA 1G1AA 2BGGA 1UBFA 4I6JA 4DEXA 9GPBA 4X45A 1PJSA 4YLGA 3VSAA 2EJVA 2G76A 2PRJA 1O6GA 3NEPX 4HNRA 3WO1A 1ABBA 1E7WA 2NXEA 4QSMA 3QVOA 3RARA 1INLA 1SXJC 4YRFA 3ESXA 4UQPA 3GPIA 1MW8X 4YH1A 3N39C 2DH5A 1HT2E 2FJ0A 1ISSA 1A7KA 2F3QA 3NHSA 1P9NA 1U4OA 3A4YA 4HAUA 4MB6A 4O4JB 2Q2NA 3BRCA 1ONOA 1I4DD 2R11A 4H1HA 1FTQA 1FLVA 3W79A 1BJKA 3IH5A 4YR9A 5CFNA 4U2GA 1T29A 3M7IA 4QUBA 1JAIA 1PG0A 2N75A 1V3QE 5BV2P 2PL5A 4Q1CA 1WY5A 3Q9UA 4B6FA 1SUPA 3CLTD 3UWSA 1F8FA 2OLJA 5C8ZA 3LDHA 2J3IA 3HO8A 1PYDA 2F1JA 3GN2A 2IHJA 3HLYA 2O3JA 1GPWB 2GYWA 3A4LA 4OAPA 1PK9A 2FW1A 4OFZA 3CX7A 3TAUA 4IOMA 4XDHA 3JYPA 5F4BA 1J9GA 3PJEA 1QO0D 3SC2A 1V95A 2ZKLA 3ETCA 4NCXA 4PN3A 3U61B 5B1EA 2IS4A 3JQ9C 5DTEA 1TPYA 2Y4NA 1UWVA 1PTJC 1CV2A 4XGKA 5CIWA 1RQ2A 4PPFA 1QBGA 3GJXC 5D00A 3G8YA 4KFRA 4IG9A 4Z0HO 3B1FA 3HDJA 3U3MA 2GZ1A 4NE2A 4YMIA 5TGZA 1FU8A 4CKXA 4WLEA 1T9HA 1JHAA 1OU0A 1LRLA 2AOTA 3L5OA 1FEZA 1A97A 1K6JA 1I3MA 2AXQA 4F1KA 1NC3A 3LI2A 2FY8A 3WC4A 4CKEA 3NEAA 2PA0A 1JQ3A 2QNBA 3FGZA 2C2XA 1Y6FA 4TYWA 4OHFA 3UGKA 3MGCA 1NW8A 3BFJA 3QYPA 4DMGA 5C8YA 4OAQA 1B00A 3NVKI 2VCEA 4RTRA 4N5LA 3FVTA 1DRWA 2BJWA 1MLDA 4RA6A 2Z30A 4H7EA 4MPPA 1Y9DA 3ETEA 3SC3A 2YQZA 3RS0A 2QRQA 3FCAA 3H86A 1TTHA 3TS1A 4FFOA 2Z6AA 1V0JA 2Q07A 1G8FA 1MIOB 4JN6B 3LU1A 2EZUA 4O08A 4HVCA 1DE0A 4JI1B 1NJ5A 1WM1A 2B9EA 2HZ7A 2PMKA 4GE3A 1ZH6A 4D8XA 3QE2A 3TN7A 2ZZNA 1A82A 3SVZA 1KQPA 2GBFA 4TRRA 1RAEA 2HHHB 3GF4A 2ZJ8A 5CLQA 3O2NA 2GZAA 5EIHA 3EQ7A 4EZBA 3UQYS 3O82A 1CRWG 4B31A 1D3AA 5KVVA 1ZLXA 2CVQA 2QZPA 2Q0HA 2ZSDA 1TZBA 3UJNA 1J0CA 1QUEA 4YASA 1UFVA 5E7JA 1UIRA 1HH4A 5EKXA 2VZ8A 2DT5A 2XUGA 1KH2A 1YZ3A 2W37A 3E7FA 3DTVA 4HNAA 4QJ5A 5LB4A 2FEMA 3F97A 2AN5A 2JAWA 2JASA 2HQSA 3I45A 4BMPB 3RM3A 2A1TS 3CRZA 3IDAA 2FQWA 4DC9A 1FRNA 5F78A 3O8CA 3HKDB 4PBRA 5JQGF 3MMPA 3PQ5A 3RVOA 2ID8A 5CA0F 2G3YA 4MV1A 4YHHB 2RDMA 5C2JB 2QLLA 1FZQA 5B58T 2Q1XA 3FH0A 1SBZA 1F2DA 5FF9A 3QFFA 5JG7A 2VP0A 5K3BA 1M6VB 3FNRA 3GFGA 3QLVA 1Z26A 3UFXB 1XMSA 2DTEA 2C97A 3V4VB 4JLOA 3FNFA 3L0BA 3OFVA 4OLBA 1SK8A 3L8DA 4X61A 2C4MA 2CYAA 1R7RA 3A1NA 3UMGA 2WTMA 4BGVA 2JLAA 4Q9HA 2V7TA 5CDFA 5CT5A 4DRZA 2KS6A 3IDOA 1KWGA 3VTAA 4BVGA 3VH1A 3EXG1 1DFIA 4ZQFA 3AJEA 3FFTA 4ZT2A 2AFRA 2DOKA 3EZLA 5I9LA 3NI2A 5IDYA 2C5SA 3KNZA 3VHQA 1IHYA 5H68A 2H11A 1TX4B 2CV0A 1VHTA 3T1VA 3TJZA 1XBTA 2C59A 5GJCA 5BW8A 2EBUA 3PUZA 7MHTA 2L42A 4JB2A 4ZCPA 4BP8A 1U2ZA 4DYDA 1CJVC 1TCCA 1FDVA 4KIFA 4MITA 2IOHA 4IEEA 4HWTA 4BNIA 2V5AA 3C3XA 3HS3A 4WCFA 4XWYA 3JVVA 4UVHA 1YACA 3E7WA 4B3FX 3U60B 1B4DA 1YQXA 1R3DA 2Z3WA 3FTCA 1CEEA 2XSZD 3R5SA 4N8DA 5C5DA 4F5WA 3F49S 2PQ0A 4B47A 1E2HA 1F12A 3IAXA 1ZJ4A 3UGQA 4PFJA 3ZGZA 3JQBC 2ISQA 2GN0A 3FPJA 1XHLA 5AQ1A 3KQQA 1U4SA 2R44A 3QG5A 4X65B 1A95A 1BNCA 2AEEA 2EEPA 4WXMA 3S8EA 2V4MA 3AR8A 5T8KC 3DD5A 1I30A 4H1TA 4B8WA 1JWLA 4D4MA 3T9BA 2BM0A 3IILA 2QW8A 2Y2UA 5AW5A 3SZGA 4K0KB 2ZM6B 2WVGA 3PQCA 4ZVQA 4G0VA 4KOEC 4MGKR 1NLMA 4LC9A 4YGYA 2NU8A 4MDYA 3I3OA 2W8BB 2UZ3A 1D07A 2W43A 1AGPA 2XHZA 2XJ4A 2ZRNA 4JEIA 2E4YA 4LYHA 1XMQB 2Q3CA 3IIKA 5I4CA 3KU4A 3ABRB 3NDPA 2XZOA 2QG9A 3OT4A 4RPKA 1TM3E 4AMVA 4CT0A 2IRWA 2DHQA 3PF9A 3PNOA 4TT3D 4KBYA 4G9GA 1E99A 4D3YA 5I9NA 3H13A 2H2WA 3IESA 2P1RA 5FFFA 2ZTSA 1IY2A 4YB8A 2PVSA 5IC6A 4ZV9A 3EOAI 3RJZA 2XYQA 1NZDA 3DOCA 4ALNA 1KQGA 1XDUA 2H5IA 2Q4TA 3ZWWA 1CPYA 4TV8F 4UATA 1NVTA 2H1SA 2ANCA 1QC5A 2O9JA 2W6OA 3AHCA 2GJ4A 3BRWD 1R27A 2C00A 1JDUA 1RYZA 2HAEA 4N39A 4DMUB 3AUUA 3ITKA 1T3HA 1WB6A 4JJEA 4DJJA 4NCJA 4DV6B 1GGJA 3M1LA 2JIZA 5DI3B 3WFZA 5HKAA 1N77A 2GPSA 1TAQA 4L0QA 1YVRA 2ASEA 5B6JA 5L7TA 4X6XA 3F4LA 1RAFA 3OPMA 3QFTA 5JI3E 1GQOA 2ACVA 1EWTA 3BWCA 2FG5A 3G5MA 3LGSA 2ZRPA 3U7JA 1WW2A 3GAFA 1XVVA 4Y9SA 3THXA 1OXBB 2HM7A 4WY2A 1FP4A 4HNQA 4PYRA 3DZKA 2QD4A 3JY6A 1CQZA 4JKOA 5E9AA 5F7JA 3OZXA 3LLVA 2AK3A 3EDRA 1AIPA 2AUTA 3GYBA 2C1XA 3NAZA 4I1OA 2YZ2A 4CQJA 1FBNA 1UPTA 1ZC3A 3OMXA 4D3DA 3ED5A 4WX2B 1JQJC 1KYXA 1JAYA 1G5TA 1KMIY 4IDQA 1XEWY 1YDEA 4F4IA 2YJ6A 3INTA 1A4IA 3CUEF 3MC1A 1M10A 3FPKA 4UMEA 3GVPA 4RM3A 1VL0A 3QBTA 3QZUA 4IMIB 3VYUB 3UUGA 5AVRA 2XTMA 3KQUA 3JALB 3CLUD 3JPWA 1Y33E 1Z4KA 5HIJA 2FJUA 2YWFA 1QHFA 4GC5A 4BQIA 1TM4E 3FGNA 1TJNA 4DV3B 2PPVA 3NHKA 2YMLA 1F6WA 3A6DA 3MM4A 3UWDA 4B2YA 4DJ5X 3TE6A 1NFQA 1X19A 1TEZA 4GOKA 1E1YA 4OKNA 4V0ME 4YJ2F 3VYWA 3QNUA 2FMIA 2PUFA 5JAZA 4EVQA 1G3IA 2GYVA 5HW0A 3TQQA 4YXWD 5LYJA 3ETNA 3WLJA 4UOZA 3RBVA 2QSJA 3CU5A 1PGNA 3WV4A 3UHFA 2C7GA 2FRXA 5JUWA 1BXRB 1YI1A 4WZAE 3S2ZA 1NBME 4S1VA 2EFGA 4P86A 1QOPB 1SCNE 2ZWVA 4TMVA 1LV7A 3H9EO 3BS4A 3R23A 2QG4A 4DY4A 4KQCA 4RZXA 3H97A 3ZW9A 2PUTA 1M66A 5JI2E 3SDSA 3BEOA 3UAWA 2QSZA 1GPAA 1ONBA 3S1SA 4HNSA 1JFFB 1N2XA 2AFVA 4FSDA 2GGSA 2ZJ1A 4RKFA 2ZRLA 3OM9A 3AEQA 4LN1A 2FZEA 4H7KA 1T3LA 2Q2OA 5TS3A 1KMQA 4IVPA 1RPTA 3AF4A 5HE8A 3S40A 4B43A 3KOZA 3EXEB 4XYBA 3QX3A 3R0VA 3EQZA 1R37A 2VA8A 5FI1B 1L5QA 2BEVA 4WW0A 3PNMA 3TLGB 4XX0A 4AJ2A 3EGVA 5MGNA 1TB4A 4B6RA 4WIAA 5DK6A 3HQ4O 3ZHTA 5A2GA 3QOXA 2XMQA 4GI3A 4CEJB 1T1JA 1TFRA 3QKRA 2M6LA 3ZHSA 3IUYA 1GR1A 1C29B 2RMKA 2Q3LA 5DBIA 1C9DB 2ZIVB 4GGPA 4YCJA 3AR7A 4P53A 2H5EA 2QVBA 4H1VA 4DSZA 5DCLA 1AQNA 4YJGA 3BD9A 2QAIA 3LV8A 4QOJA 4TMWA 5ALIA 5A05A 1JIXA 1N2GA 2OCIA 4UUQA 3TOCA 4U7DA 2ZTVA 2DBRA 2VFAA 1E2LA 2ENWA 4RGYA 5KTOA 4OKSA 3WLTA 4B3BA 2JC3A 1GGNA 2VATA 1DB3A 1ZGJA 4LISA 3KQMA 4OHOA 4YPVA 3LOUA 3L6CA 1R0YA 3WB2A 3KCNA 1UBHS 2PCJA 3DDWA 4WT7A 3WRXC 3JQPA 2PHZA 4QL3A 1OH6A 3L77A 2FSVC 2IW1A 2AG0A 1VLHA 1Z7YA 1YNSA 1NVEA 1OY1A 5DGIA 1IQUA 3A6GA 2P9HA 3DOFA 3NHMA 3KWFA 3PFBA 1IPFA 4EFLA 1WVMA 1BIFA 1SUCA 2IIVA 2W90A 3I5XA 1E96A 1ZK2A 1U3UA 2F9MA 3CRVA 4JI7B 3WY9A 1KY3A 2HQ1A 2UUOA 4ZHQF 1HNZB 5LP1A 4K40A 3BFPA 5JCOC 1SVLA 3GA5A 1X6VA 1PTKA 1YFJA 1JJ7A 1XLWA 2ODWA 2HV9A 3BN3A 4MS4A 4EHNA 4W5RA 1I4OA 3LFTA 3ACBA 1YZQA 3BB3A 5JC1A 4DR4B 4RYLA 3FVRA 5H02A 1M2FA 5IUNC 4UBMA 1KARA 1N7HA 1XCBA 2A94A 2OBBA 3PDUA 1GL9B 4MQMA 4URZR 2CV2A 4AY2A 4ER6A 3UGTA 2UYGA 1MGPA 4IDBA 4DREA 2LD4A 4Y6SA 2Q3HA 4AP6A 4YIHA 2C3UA 3JWHA 4TS1A 4QSHA 2HZBA 1F7UA 2GD0A 3E35A 4JP2A 1KSJA 3HU2A 4PG5A 2V6IA 3NHBA 3SS8A 5LOVA 3IJ5A 5I4BA 2OGSA 4CZ2A 2WILA 5ICGA 4PNHA 5KNBD 3H9JA 5CB4B 4XPZA 2Y93A 4OI2A 1UP6A 4BVKA 3OTOB 4IV0A 5JEEA 4QDKA 5FUVA 1C7IA 1MCZA 1NBIA 2GEDA 2ZP1A 1SHKA 3HACA 4IIXA 3T9CA 4PHTA 2DBZA 2ICAA 5CGQB 3UK1A 5FULA 4QULA 4WH0A 1DRJA 1JALA 1RLUA 4PXYA 5DIFA 3K72B 1JQAA 1TQ2A 4WHMA 3G8DA 4I4TF 4Q9IA 1M76A 3OJEA 2YXPX 2CXOA 4OQLA 4DC0A 4J1SA 4JGIA 1XNRB 1Y89A 3TWOA 1JSZA 2P5UA 3RUAA 3OCCA 5BSKA 1QRDA 3LFUA 3G79A 3IAFA 4DGSA 4Q4JA 3QWHA 1JDSA 2CSUA 2GCGA 2GM9A 2XUPA 3U4GA 1A9YA 2NM0A 1E9AA 1AS3A 1L7MA 4B2IA 4PCAA 2RIPA 2B94A 2XQIA 1Y6JA 3EN0A 1FJGB 2DUNA 1R50A 1IDOA 5EJ6A 1C30B 3I6BA 3T9EA 3IP6A 3E2IA 3PGLA 3TAXA 5LSAA 3ZNOA 3NONA 1A8HA 3SZOA 2HCJB 5CFRA 4R1OA 3DPUA 4HMOA 5F23A 1PAUA 4XB6B 1XF9A 3NVDA 3A9CA 5KZMB 4N41A 4IGKA 4HFMA 1Y3HA 4RJKA 3U3ZA 1DP4A 2IS6A 2P9BA 5K2MA 4JY7A 3R3YA 2H6EA 2XUQA 5DHSA 4YJ3B 1JEQA 1XWIA 3DOEA 3KCQA 4R5HA 1JEYB 1LTQA 1RZUA 3K16A 2G28A 2W71A 3PXAA 1FQKA 1ZIYA 3THRA 2WSMA 3IEUA 4LJ9A 1ZITA 2HK6A 1NR5A 4LHXA 1BXKA 3DJFA 4ZIRB 1GUFA 2PSJA 4ZO7A 2W2XA 3WIEA 1M34E 2R1VA 2P4HX 1XYVA 4YIKA 5JS6A 1RWNA 3PLRA 4C4RA 2CNLA 4KBGA 1HLGA 1XDZA 4QG3A 5M5BA 3TZCA 3PFIA 4Z4QA 1PKXA 1RQXA 1YS6A 4B7AA 4IQ8A 3T5MA 1TU0A 2WV9A 3JTMA 3KLMX 5F2KA 5H80A 4O4IA 3SDZA 4ZU1X 3WRWA 5FWAA 5D7BA 1VHJA 1G20A 2G4CA 1U5CA 5BYKA 4UMFA 2X4DA 3ODGA 2CDBA 2NTJA 2B3TA 2WZDA 1PG2A 4I99A 4NL4H 5CM8B 1U7XA 3BIOA 3STTA 5ICEA 3PGMA 1UMCA 4R8VA 1XD9A 4M7PA 4PQYA 4EF4A 4CLRA 5JWRA 1QQAA 2C4TA 2D2XA 4HPWA 1ODSA 4ZMBA 4JLUA 1T9BA 3GEEA 5GVRA 3R6GA 2BFFB 5EKUA 1WKCA 3IIEA 3L1IA 4D3XA 4YRGA 3OTIA 1EP9A 2H48A 4IGIA 3SMQA 2XAUA 4X84A 3E9ZA 1I14A 4P58A 3CLVA 2O7VA 2PZBA 1R0KA 3EZ2A 2PYDA 2KBEA 5BV0A 1TXGA 1YU6A 4ENPA 1OBVA 4LXQA 2J33A 1RWPA 2GAIA 2BR4A 2YDXA 4KXXA 1KJZA 4BQRA 3WQBA 4Q9JA 3C5VA 3OA0A 4Y6QA 3V3TA 5HE9A 4Q15A 5H81A 3E61A 1F60A 1WCYA 3I0MA 1DKOA 1LC0A 3IQIX 1QFMA 1A8PA 1VMDA 1P9OA 2IYXA 3EZ9A 3STVA 3IQHX 2OFXA 3DEIA 4MSUA 4EDFA 1MQAA 3CPSA 4FR5A 1U7PA 2VG8A 4RF5A 2HIMA 4KQEA 4U6QA 1E66A 3EQ9A 5EE9A 2B0JA 2ILTA 4U2DA 4DJAA 1YFLA 1JEDA 1Z0IA 4YDQA 1UFKA 3C24A 3KJQA 5ANRB 2HU8A 4XVRA 1W88A 5BXYA 2ODPA 1PK7A 4BLRA 4QQKA 1G6KA 3G0DA 1PS8A 1PZFA 3NUGA 2C3OA 1R4NB 3M33A 4B35A 4DLWA 1OFUA 1YDGA 1B0AA 1V96A 3LDGA 2B8NA 4GPTA 4RC9A 4TGLA 5EWJB 3AG6A 3TQTA 5HM8A 3BWXA 3L43A 1IPEA 1L5HB 4XGQA 3VUFA 1PWHA 1X87A 3JQ7B 3OU2A 4BO4A 4F9EA 1DV1A 4MO9A 3RC8A 1NXXA 2E4ZA 5JJCA 4AKGA 2O54A 1U0HC 2JCVA 5EIWA 2P1DA 2OO5C 1TYBE 3K5HA 1SQ5A 4CT4B 5I4IA 3DOUA 3RLFA 3ZS9A 2Q6LA 2BTQB 2NVUA 1YGYA 2YDYA 5EIFA 4GL2A 3BWYA 4E0BA 1ZD4A 2R6HA 3BGDA 3EZ7A 3IIJA 4BU0A 4G5HA 3VH3A 2AUMA 3DCNA 3MS4A 3R5JA 5BQFA 1HDEA 4P92A 1OBHA 1TT5A 2P8SA 3C3PA 3OMLA 4MWDA 4KLRA 3SX2A 3A4NA 3DKPA 4D96A 3K9BA 1SELA 4YTEA 1MW9X 2UZ4A 4HDKB 3EIFA 5HS6A 2H52A 4DDHA 4EQ6B 1B0PA 2Y0CA 3AX6A 6CHYA 1CBUA 3H8VA 1YRBA 2QVXX 4R2LA 3DQQA 3N7TA 3WXMA 5EXXA 2JGMA 1VKRA 2JEYA 3K0CC 3UUWA 3TR5A 3HXOA 4X94A 3VPXA 1CQJA 3GFPA 3RIHA 4ND2A 1Z0AA 4O1IA 4FSHA 4LDRA 3WGYA 1X1BA 3W8DA 4KQ9A 4CJXA 2HWWA 5JYDA 4LZLA 1Q15A 1SBCA 1V5IA 2BFBB 3UH1A 5B4UA 1NUAA 1O95A 1OXVA 3D81A 4RIGA 3AR4A 2XB4A 5I3CA 3UICA 4BN5A 2C29D 4XDZA 5AW8A 1YXMA 1WPRA 2J6HA 1LVUA 3NHFA 3PA6A 1VXOA 1BHJA 3P9SA 4ID3A 1Z08A 4P0TA 3DE2X 1ISFA 5DO9A 4MHTA 2FPKA 4F4JA 3GLHE 1BE6A 2VHJA 4G4SO 4MKGA 4EEXA 4TYPA 5TPWB 1HT0A 4E6PA 3QEBZ 3PX7A 5EMMA 1E2MA 5KX5B 1FFYA 1HWYA 1GGFA 1KZ1A 2JF0A 4X71A 3H2BA 3MHPA 2JFPA 3TVYA 4K3UA 3KYCA 3DEHA 3IEKA 5BQOA 3TINA 3WNQA 2ZXUA 4TMFA 2BGTA 4K2AA 4LUCA 4A8JA 1RKUA 3TMYA 4HNHA 3M1YA 1YD7A 3D3WA 4NNOA 1IJBA 2OQIA 2W4IA 1Z8HA 3OZCA 3VJKA 2IDMA 3V2HA 2FZCA 3HHPA 4JBWA 4BFYA 4PTYA 4B4WA 2LVBA 3VV3A 3X3HA 4G37A 1C1XA 1EFVB 1YUNA 1L6RA 3AUYA 2HREA 3K6KA 2BAGA 2WD9A 5EIBD 4UEWA 2O2XA 4F56A 4UE3S 3ORHA 3T7EA 4AN1A 1W48A 4M6WA 1FJXA 3GRFA 5TPZD 5JLJA 5LP6F 4W5TA 2R2AA 2X19A 4FMCF 1MH9A 4O4HB 3ELBA 4QBFA 3SE0A 4RMGA 3GDOA 4DYHA 4TL9A 5CFZA 4JU8A 4PONA 3IP1A 4KX5A 3NBMA 4DCUA 1ZUWA 3E9MA 3LF1A 1K8XB 4MRMA 1QXSA 5CDGA 4AT1A 1M1ZA 4EYGA 3P27A 1NRIA 1NN0A 1XMXA 1XQYA 1DX9A 2WTEA 5BWOA 1ZNZA 221PA 2PMBA 1Z5UA 4ZCRA 3ZIDA 5CFMA 3SWWA 4N82A 1ESMA 4YCLA 2VDWA 1QV7A 4RW0A 3R8XA 1DEXA 3DHWC 3LRPA 1NJGA 2JFFA 2NTVA 3ILSA 5ARCA 3WBKA 2PA3A 3OLQA 2XWJI 4B8YA 5JADA 3HCDA 2DUJA 3IUNA 4QUJA 2PH3A 2PJDA 4JVMA 1CRZA 5AOCA 2WNHA 1NDUA 5G1OA 2C5EA 2Y1CA 3RG2A 2B35A 1DLJA 2LIVA 4ZO4A 3AESB 3NDIA 5K3CA 1NE2A 1KETA 1CQIA 2GCOA 3T5GA 4RTQA 1DTSA 3HKCA 1IK4A 2EL9A 1M6YA 3GROA 3GEBA 4RFSA 2D59A 2B4KA 4H4CA 3SDBA 2FMKA 3BIWA 3IRUA 4KPUA 4EUKA 4OKIA 1B15A 3TW4A 4OY3A 5JAMA 4UQOA 1L4UA 2XF2A 4Z0PA 1S02A 3TI7A 3CVYA 3FD8A 5MGBA 4O8ZA 3CLUC 1EQUA 2PBRA 3V4PB 5FOQA 2XYVA 4PC3A 3NW9A 5HGJA 5ALYA 1AQLA 4CYMA 3A36A 3H16A 1OFTA 2C88A 5B6IA 4NP6A 2Q1TA 3JQBA 1ICEA 3MINB 1BHO1 2EDCA 4QTZA 5DM4A 4IDNA 3AWDA 3N2ZB 4LDQA 4LYYA 3P97A 1R10A 4MQEA 1TVMA 1TVCA 2EATA 1Z17A 1T2DA 3PU6A 1J0EA 2D5IA 2IPOA 1K1EA 1YJQA 2WPDD 3CMMA 5CYOA 4UHJA 1O03A 2AI1A 4ZN6A 4GZ5A 4E07A 2W0MA 3M4XA 3ORQA 3QX8A 3OE1A 4I81A 4E22A 4MCAA 4AJEA 6REQA 2M32A 3ILVA 1QDLB 1BEEA 2AJ8A 5TE9A 1BE1A 3OHSX 1PUIA 2QK4A 3I76A 1R15A 4PC6A 4E09A 3QEAZ 1HUQA 4YUYA 3UF0A 5A4DA 4M98A 4KR6A 4LMAA 1ZSVA 4XIGS 3USZA 4EH1A 4LXHA 1WCXA 3LM8A 3S5JA 4OSPA 2AJBA 1O87A 2X1MA 4MVYA 1U2EA 2JAHA 1JR3D 4YK7A 4BLSA 3WXBA 2XMSA 4LKRA 3GB9A 1ZISA 2E82A 1DC3A 5ALJA 3W4KA 2I54A 2BLLA 1M2VB 3DQPA 3T38A 3FGOA 2XNCA 3GZ4A 3LPMA 1CUVA 3P9IA 1X7DA 4KN8A 3UAXA 3ZVRA 1IFXA 2X3UA 4ZVRA 4RXMA 3C1OA 3OQIA 1JQEA 2BGIA 3ZCTA 3PC3A 5A62A 2H8KA 2BKUA 1E1QA 3HA7A 1XMOB 4D25A 1ID8A 1EQ2A 3M81A 3LX8A 3DNFA 2O2JA 5ICFA 4IDHA 5H83A 4WBNB 3QPCA 5K4AA 1W4RA 1W6RA 2C57A 2F1HA 4MV6A 4OYYA 1TLFA 4PHHA 1N6KA 7GPBA 4BLVA 2QPAA 5LWHA 1IB6A 4GD3Q 1OD6A 3V42A 2J5KA 4J2HA 3Q5DA 1B1AA 2JH3A 4ND8A 4PLCA 4X7MA 4DIFA 5EKSA 4L6CA 4F97A 3WK6A 1EESA 3CUWA 4RNCA 4LXYA 1NAIA 2AW5A 5C8YB 2YWDA 1R6DA 3CR7A 3HI6A 1CERA 4JBGA 2WIKA 4DEVA 2JLWA 1JR2A 2GVZC 1E3EA 1IHUA 2DLDA 3Q0IA 3WOHA 2FMTA 1QH1A 3L7YA 3O90A 4M3NA 3TM5A 1YTUA 4N6NA 1GSOA 5B1HA 2VYCA 2WK1A 3D7SA 5EE3A 1J70A 3MCVA 3ITNA 3V7WA 4QHSA 3PL5A 3PNSA 2QDKA 5FTWA 4Y67A 4ZCSA 4UMVA 3C4QA 1CLEA 1H8HA 1H2HA 2EARA 2QUJA 3IHKA 4FC6A 3TTVA 4AIIA 4C21A 2QEQA 2RD2A 4MR9A 1VC2A 3O8OA 4Q7MB 3GMDA 1XLTC 3H2IA 3PDIA 4DLYA 1CDZA 1W85B 4G2NA 4PLHA 3F3MA 4QJ4A 2WU8A 5FBLB 3VZBA 4F6LA 1G2IA 3L7BA 3I1IA 3T7CA 4KPEC 3F3KA 1FCJA 2C5GA 5AK0A 5L4SA 1NTOA 3DPIA 2QBYA 5EN4A 1ZCJA 3GGGA 1F0KA 1Y34E 3M8KA 1GFIA 4Q37A 4QNMA 5FBQB 3T1YB 2IYYA 2V58A 1DJPA 1PZXA 3F9IA 3DTVB 3EHDA 5SZIA 1K63A 2YUIA 2I4LA 2P6UA 1TQDA 1Z2AA 4P4TA 1VPTA 2G70A 5FWYB 5JWOA 4WA7A 2IYAA 1NHWA 3CS3A 2PX2A 1OX6A 2Z43A 1USGA 5BO5A 1SD2A 3TE7A 2EG9A 5L8VA 1XC7A 3GLFA 1LI5A 1XCJA 2R8OA 3TRDA 1K97A 3RK4A 1PFUA 5KAMA 2WIAA 4R2KA 3KQVA 2G82A 2OT3B 4DLAA 1O6FA 1E3QA 3A1DA 2WAXA 4JLDA 2OZEA 4KQ2A 1BDIA 1WD7A 5I8ZA 3V1KA 5BSMA 4AB1A 2Y68A 3NTUA 5CK5A 1AURA 5AR1A 2A5LA 1VHWA 2PUVA 1ZD1A 2OTCA 2D2FA 2PKEA 2RHMA 4IAOA 1QZXA 1DTEA 3HBLA 3ZCPA 2BFAA 2QAGA 2WT4A 4LCJA 3O0DA 3O9MA 2H7CA 2IYEA 3N59A 1ZSYA 4M53A 4PYOA 3ER9A 4Y2XA 1UR5A 1UZUA 3UJCA 1OZ0A 4U2FA 2VWHA 4MINA 3KQHA 2W8ZA 3PJRA 3ZU2A 1RWWA 3S4YA 1R1DA 3EVZA 4PAWA 5G0SA 4M1EA 1NVWQ 3RSOA 1LTHR 3LCMA 4ID9A 4QD3A 1NYTA 3EY4A 3K4QA 5EOVA 1L1RA 2YR0A 3VPHA 2WINI 1VIYA 4OSEA 1GDHA 5LA6F 4DM4A 5A9SB 4DDMA 1VCMA 3KJGA 3IB6A 4JASB 4LVOA 2ZYHA 5A3SA 2NZUG 5KNCD 3INNA 2A84A 3SKVA 1JDBB 1KEVA 4AN4A 1I2DA 3HBJA 2WA1A 4TL6A 1FDOA 4FJ2A 1IY8A 4REOA 4COOA 3BJZA 1VA5A 1IMJA 3ICVA 4DLNA 3M6WA 1SA0A 2CLKB 1V3TA 2I1VB 1QV9A 2FUEA 3F2IA 1RYBA 5IFKA 5CPBA 3DR3A 4CU2A 4PO8A 5KYUB 1ZW1A 4GZ6A 3D02A 4LE1A 1OYOA 3F6EX 4YDHB 1VP3A 2B98A 4IOKA 4KLZA 3OFKA 4MVJA 4AG6A 3U16A 1K0UA 3HGQA 1HDRA 3TI9A 1EX7A 2CC2A 2XB2A 4R8SA 1B6TA 1WZIA 2PLWA 1R8XA 4TKUB 5DBGA 3BE8A 4JBNA 5LZ8A 6NULA 5ED4A 4NJOA 2OK7A 2N1BA 2R62A 4BEWA 1ZS9A 1A0OA 4G4GA 4FM9A 1RQ7A 2HSWA 4D8VA 3MCUA 5KSZA 1GUAA 1O97D 4B4DA 4KFCA 4X1OA 4DMCA 4L3VA 5FBWB 1MAVA 5HYVA 1SOVA 1CR0A 5LQNA 2EP8A 2LBPA 3ET5A 2C8VA 4ZT6A 3RHFA 3E03A 1EB9A 2PJZA 1A9PA 3FSGA 4C5BA 3H4TA 1E8DA 1QH0A 2QN6A 2ZRFA 3GRCA 4MI9A 1MV5A 5E6UA 1NU6A 4ZDWA 5HQJA 3QUTA 3VH4A 3DTTA 4H2DA 5HBGA 3GDGA 2Q5FA 2QXTA 3MUOA 4YP0A 1ZD8A 2YTZA 3SKYA 1C4WA 1RVDA 1GGHA 4B3CA 3TL2A 1EWYA 1NNSA 1AXEA 1G5PA 1KK0A 4ZALA 4E88A 2RH5A 3A6HA 5JH7A 1EFDN 1YU9A 2ONZA 1GV1A 2G07A 2RH4A 1IXRC 1PLJA 1L8XA 1TA9A 3DCYA 1TIBA 2WJVA 2JJ2D 3QX9A 2OSBA 2VQEB 4ZJPA 1DDGA 1ADYA 1MFZA 5CNIA 1GU7A 3L7KA 5EEHA 3H11B 3DMDA 1YS9A 5EP4A 3DEFA 5KOHA 4H7JA 2BN4A 2F1RA 1O94D 4GOOD 1NMEA 3D0RA 2PANA 4JA0A 5SV2A 4C4OA 4W5WA 1U11A 3KOXA 4AY5A 4CG3A 1F8XA 4ICIA 3LUDA 4HTFA 2J9FB 1S2LA 3H83A 2GF9A 2QTAA 4CM9D 3QPWA 3RR2A 4TTQA 2P4QA 1Z06A 4R6XA 3NANA 5IC4A 2D4HA 2XADA 3MBKA 2JFUA 2OM6A 5L7WA 2HMUA 2R2GA 2ZT8A 4HQFA 3D3JA 3E8MA 1SXHA 3MRVA 2CJPA 1N4AA 3DVRX 5DGHA 3V32A 4UPEA 1NASA 5DI9A 5IT4A 5K0GA 1WEKA 3INRA 2GSDA 3OC6A 1AUQA 3K8ZA 3NNSA 2PWYA 1X7WA 1DG9A 2QP3A 2CDRA 2OXCA 2Q0XA 5CVVA 2FUCA 1OXTA 3WLLA 2YV2A 3W5BA 4FSXA 5EHIA 5DIZA 4CTJA 2GN9A 4WK4B 3C43A 1XJ0A 2E1PA 2JLSA 3HVUA 3KLNA 1UK8A 3COZA 4NYIQ 4WASA 3ZPXA 1TA0A 5AKGA 1LEHA 2XHEA 4IS2A 3UCXA 3FZYA 1RXVA 1JEOA 2GBIA 5JXGA 2PX6A 1GU1A 2WMYA 5JARA 4LDPA 3I3SR 3SC6A 1TM2A 3FDZA 1Y80A 1KA9H 2Q27A 4G1BA 5JLAA 5EERA 5D6NA 3SZLA 1CVIA 3GAMA 3WLIA 3GT3A 2VF4X 4IL5A 3PFKA 3GPDG 4A6EA 1OH7A 4G9EA 1F9EA 3RBZA 2MWMA 2Y1WA 4TKLA 1Z33A 1MEJA 2LPMA 3NHUA 1O96A 5J3JA 4RJIA 3QMPA 4WXEA 3RRZA 4AY4A 1QGAA 1JT9A 4HDNB 4ZOEA 2O0KA 2RARA 2VPZA 2X0FA 5K0EA 2R6CA 4TYMA 4LE2A 1J7KA 2QRKA 1U02A 4UFNA 4Z7JA 1RJEA 2JGKA 4XSGA 1PYOA 4PQEA 2C84A 2Q9BA 4RIFA 1WCIA 5LZ4A 4XVQA 1P6UA 1ZH2A 1DOZA 3SXUA 3E2MA 4JWKA 5EJ2A 1RXYA 2PKQO 3LBIA 3FVWA 3AEQB 3IBTA 1TVKA 1PR4A 2IUSA 3MJ4A 3QYJA 1SKBA 1E5XA 1Y3FE 2TMDA 4MRPA 1R0LA 3SJZA 5CBKA 1A1VA 5TQ2A 1UKVY 3AIOA 2VHUA 1D7OA 4QYMA 4U7HA 1CDOA 1FP6A 5KDDA 3S28A 3HFJA 1HQDA 1NP3A 1ZOOA 1JSLA 2BFMA 3K1AB 4G1FA 1DUIA 4RS4A 5IU6A 3ZGOA 2BEVB 4MJLA 5A5VA 1Y42X 5HTKA 4XX1A 4CM8B 3PBKA 4G8DA 3BL5A 3EWNA 3ZDFA 2BFPA 3R44A 1UUFA 1YBHA 2X7HA 3HTXA 2P0YA 3JRXA 4FVTA 1WSAA 3WX0A 3RKSA 1VFPA 2G0AA 1F14A 3GLIA 3H1BA 3SIWA 3X1XA 4TTVA 2H3EA 2HC9A 5TDHA 4KLNA 2CY0A 2VP6A 4CEIB 4V0KA 1I7NA 5HWSA 2JLRA 3F7OA 3GZNA 2XPCA 2UKDA 5FYQA 4C5CA 1U4NA 5EQTA 1R9NA 3C3YA 3CBQA 3DHYA 3ZLBA 2HA7A 1GCAA 3RCBA 3WNCA 5ECYA 2AR0A 4IOJA 5CRIA 1ZVKA 5FORA 5HIKA 5HS4A 3EMVA 2W6JA 2FWJA 3KQLA 1QVAA 3A6PC 4U1RA 4Q4LA 3RKUA 1OAOC 1Z4QA 3SHWA 3EPLA 2ZROA 3IO5A 5GJVC 1P91A 1YUBA 1MJHA 3L49A 4IUYA 4MWBA 1DKLA 2IYQA 2KX7A 4GI2A 1QAQA 3CH4B 2PXAA 3UG6A 5KTNA 4L07A 5F3WB 4QICA 4BKMA 1A50B 3P0IA 5LBUA 1E2EA 4NYIR 5DT2A 4HWPA 4AJHA 3DLBA 2FSSA 2IOFK 5DK4A 2W70A 4MULA 2BPOA 3VR5D 1KJNA 1SOMA 5IVDA 4WKNA 1Q0UA 2IYLD 3FB4A 3LQ4A 4D6XA 2A6PA 2GILA 4RK5A 4WZBE 3PLNA 2J45A 3HXPA 4Q3OA 2FW8A 2VOEA 2ENUA 2YXDA 4PS0A 5DPMA 3P2MA 3Q8WA 1I7SB 5GGXA 4S35A 2YWGA 4I1VA 3IAM6 4MS4B 1W76A 4FFLA 4XPIB 5BT9A 1YL7A 1LS6A 1Y7PA 2HGSA 2V5UA 2WWTA 4ZVVA 5TX7A 2B1GA 4AL4A 5GZ1A 3THYA 4IX9A 1CZOA 3K3PA 3KD3A 3L4SO 1YQ9A 3QEOA 1OQAA 1TUGA 2GK7A 1ZQ1A 2XCIA 1VE6A 3D2LA 1AQUA 1JKMA 3DL0A 3EBPA 1TZMA 4WZZA 5EI5A 3LUGA 3ZV3A 4BNTA 4CIDA 3DDCA 3N0XA 1A27A 1U1DA 2HJWA 3KUDA 3MD0A 5FL3A 1LFAA 5J58A 3JQ6A 1IUOA 1ZPDA 4V24A 1LQ2A 3ABSB 1QJ4A 1K7SN 2G5TA 4PGGA 5TVGA 4X3CA 4HGPA 5DGCA 2G7ZA 2AA3A 1GZ5A 1GVHA