4PRZA

Caspase-8 specific unnatural amino acid peptides
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
240
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-8
publication title Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 240
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4przA00
2CNOA 2H54A 5LUAA 4HQ0A 2CDRA 4EHNA 3EDQA 3KJFA 1QTNA 3IBCA 2XYPA 3R6LA 1RWXA 1RWOA 4NBKA 3PD1A 3UOAB 4IEFB 4I1PA 1GFWA 2FP3A 3P4UA 4N6GA 3R7BA 4EHDA 4EHFA 3RJMA 3S8EA 3GJTA 3H11A 3S70A 3V4OA 5LU9A 1NMEA 3H13A 1K86A 2CNKA 3V55A 1QX3A 1KMCA 3BIJA 1F9EA 1NW9B 1RWNA 4PS0A 3V4LA 3R5KA 3V6MA 4QU8A 2HBRA 5IBPA 4QTYA 2FUNB 3H0EA 2HBZA 3OD5A 4PRYA 4PRZA 1SC1A 2XZDA 2DKOA 1RHKA 3D6MA 5IANA 2H4YA 1I3OA 4JJ8A 3R6GA 3NKFA 2CJXA 3ITNA 3V6LA 1RHQA 1NMSA 2NN3C 2Y0BA 2QLBA 4NBNA 2C1EA 4QUAA 4N7JA 2H5JA 1SC3A 4JR2A 4QU0A 2QL5A 3KJQA 4AW9A 3PCXA 2XZTA 2C2OA 2J31A 2CNLA 1GQFA 1CVRA 4PS1A 2J30A 2CNNA 3E4CA 4AWAA 3DEKA 1SHLA 4EJFA 3R7SA 4QULA 1RHUA 5IARA 4QUHA 4ZVUA 4JQYA 4NOLA 3KJNA 1SC4A 3EDRA 4ZVRA 4N5DA 1JXQA 3H1PA 3PD0A 5I9TA 3SIPA 1RWKA 3GJQA 4QTXA 4ZVOA 2C2ZA 2QL9A 1ICEA 4FGUA 1I4EB 1RWVA 2XYHA 5IASA 4HVAA 5IC4A 5IBRA 4QUBA 1PYOA 4QUDA 1RWWA 3P45A 4I1RA 4EHKA 4FXOA 1RHMA 5I9BA 4ZVPA 4QUJA 1SHJA 2WDPA 4M9RA 2AR9A 2H51A 4JQZA 4LSZA 1F1JA 1QDUA 4HQRA 1RHJA 4QUEA 4ZVSA 5K20A 4ZVTA 2CJYA 2QLJA 4NBLA 3QNWA 5IBCA 4NOMA 4D3XA 2QL7A 3NS7A 5IAJA 4N6OA 2C2KA 3H11B 3D6FA 1RWMA 5IC6A 2C2MA 3SIRA 3V3KA 1M72A 4FEAA 2H65A 3DEHA 1RE1A 4JR0A 4NOKA 2XYGA 1PAUA 1NMQA 4DCJA 4NOJA 1BMQA 2Y1LA 1I4OA 4QU5A 3DEIA 3UO8B 4D3YA 2HBYA 1CP3A 4QUIA 4EHAA 1K88A 4JJEA 5IABA 4JJ7A 4EHLA 2FQQA 4QU9A 5IAKA 5LU8A 3DEJA 4N7MA 2J32A 2P2CA 3R5JA 5LUBA 4EHHA 1RHRA 4ZVQA 2H48A 2H4WA 3GJSA 4AWBA 3D6HA 2K7ZA 4QUGA 5JFTA 5IAEA 3NR2A 2J33A 2QLFA 2H5IA 3K7EA 5H0IA 4DCPA 1I51A 1IBCA 4JR1A 5IAGA 4DCOA 4D3ZA 3GJRA 2HBQA 4IYRA 3R7NA 4FDLA 1RWPA 3IBFA 4JB8A 4N6NA
chains in the Genus database with same CATH superfamily
3LPAA 1ULTA 1VA4A 3CM0A 1UJMA 2FJ0A 4RAOA 4RO0A 4JGGA 4P6VF 1X8JA 3SD7A 4NCNA 1T9DA 4HGPA 1ZM4A 2O0MA 3ANXA 1DZIA 1P4JA 3REFA 3WDMA 3JD3A 2V7GA 4E7PA 5KHLB 1KPIA 1N6KA 3ER8A 6ABPA 4PAGA 4EHFA 4RY0A 2GAAA 4QPJC 1LRLA 3AVWA 1PR9A 4O4JB 1VBNA 1GKIA 4H4DA 3TTSA 1HRDA 3HA7A 2FRVA 3PXGA 5L6MB 3TFOA 1R9GA 4G36A 4QNNA 5JD3A 4U7FA 2G63A 2QHXA 3D3NA 3R3XA 4PRYA 4LVOA 3BC1A 4YACA 1FE8A 1XR3A 2HV9A 3A10A 4NH0A 4K9MA 4NWIA 3L0PA 4WZAA 3RRZA 1KEEB 3CKLA 4MWDA 2LCIA 2FEXA 3IIIA 1ZNZA 4PHCA 2F7SA 4O2AF 4X97A 3UWKA 1HX7A 4B71A 5CDYA 2Q07A 3NHWA 4FEEA 3VVCA 4YRTA 1CR6A 1AZSC 1Y9ZA 1F5SA 2AC2A 5FUBA 2PKYX 4BNKA 3WLIA 4LF8B 1OJ7A 1RQXA 2AIRA 1S1CA 4MCAA 2EFGA 4QOIA 1T4DA 2Z6UA 3ZCQA 1VB5A 2OHOA 3FUWA 3CINA 1T6ZA 1VM6A 2GRAA 5ES4B 4KQMA 3T7AA 3HU3A 2H9IA 1RJDA 4ZO4A 2LV8A 3HNOA 5ILGA 4NDNE 1I14A 1R10A 5A05A 3E4DA 1OLXB 3OQMA 1T3TA 1Z9BA 5JOQA 1Y81A 3QXHA 1PZNA 1HEIA 1TI7A 1GZ5A 1FFXB 1SKMA 1ZIOA 2ZJ6A 4QDUA 5EXSA 1ZK2A 3FMOB 1M2VB 4YCDA 4PQFA 4QECA 1POXA 3DHYA 3HCDA 3FUTA 4XGKA 2AMYA 4M38A 3F6BX 1O4VA 1K8YB 5CK5A 2K2QB 2NTJA 1IXSB 3CS3A 3E7WA 3VO1A 1SQSA 4HB3A 3HC7A 4ZC8A 4B6QA 4DW8A 1D07A 1NA5A 2QTWB 3WYNA 4DG8A 2PKRA 2Q0HA 4UUMA 4A03A 2R47A 1QG2A 2W43A 4TV8B 2X2EA 2OVBA 2FE1A 3O74A 3IOYA 1KHHA 3SXJA 3GZNB 5ALWA 3I9OA 3WNBA 5CFLA 3GRFA 3ZDRA 3I9FA 1YU9A 3TZBA 5JU6A 3KSZO 3A06A 2YIMA 2IUUA 1HDGO 3C1UA 1M2HA 2HPVA 1ADYA 4KQ1A 1ZK1A 2PMWB 5IAKA 4F38A 2RK4A 3GG2A 4JZYA 3CX3A 3M0EA 3P0HA 5I7WA 3ER6A 3GEPA 3NR2A 1KDYA 4A5OA 4B44A 3OPVA 2D8AA 4OLJA 1NFRA 3KWMA 3WNCA 2ZJYA 3QI2A 2IZ0A 3QLEA 3OA0A 2BE9A 3U40A 2HJHA 4OGWA 4W1SA 1P1CA 4S0ZA 3ODPA 4KR2A 3E7DA 1WZNA 3R6WA 2Y9MB 3V7FA 4RTLA 1Z6XA 2J5QA 4MLPA 2CLIB 5DIZA 3DBHB 4KQWA 1PEKE 3EE6A 2ASVA 3PGMA 4LTMA 1KQ3A 1QNFA 3Q3IA 1JILA 4H3SA 3U7GA 3BH6A 2JLUA 3PQ2A 4ILEA 1SK8A 5E6RB 3ISTA 1CQWA 2ATVA 1MD9A 4MHTA 1DIRA 1UJNA 3SU8A 1TJ4A 1TMKA 3ZDZB 2R84A 3OE4A 4MS3B 1CR4A 4AK9A 3FUVA 1G55A 4RZHA 4DDTA 1YVDA 1PX2A 3ZWAA 3L6BA 4JKIA 4TKVB 3E53A 4EPWA 5I47A 1QIDA 4FMDF 2C5BA 3F7TA 3JQQA 1PLJA 2GD6A 1NJGA 4G8JA 4O2LA 4TQ9A 4BC0A 2AX4A 2IZ1A 3SLKA 3AYXB 4IGAA 1DCMA 5A7HA 3H9CA 4I6EA 1JBQA 9ATCA 1XKTA 4KXMA 5KTYA 3GLIB 3KYBA 3W6NA 2XE4A 1D03A 1CY2A 1M9NA 3KVOA 4RK4A 1N78A 1XD2A 1QF6A 1VYHA 3MJEA 4DMUB 2GHTA 1TZCA 2UZ0A 3MFYA 2DR0A 4MDEA 4WA8A 1F3LA 1R8SA 4GH5A 4N7BA 2Z04A 4UOQA 4JT9A 4EUFA 2FMTA 1R18A 2NXWA 4L5YA 3I39X 3AOEC 3IHKA 4LCJA 4MYHA 4FGJA 1SCQA 1ANKA 3X3HA 1GGJA 1I94B 5I01A 4LK3A 1IULA 3N3AC 5A6SB 4YT2A 4ZEMA 1SHLA 2IDKA 3KVVA 3M33A 1YKSA 3MCWA 3CA8A 4OHPA 3WZLA 3DE4X 3OU6A 5C0OE 2VHTA 4LDRA 1OR8A 3KQSA 1O08A 3IDOA 3RC9A 2P5SA 3V1UA 4DJ5X 2D1SA 4KG7A 3H87A 1PWEA 3LFUA 4W6QA 1BRTA 5GJCA 4PCAA 2FOXA 3DWGA 2ROQA 2V98A 3PPWA 3TCXB 1UWLA 1X13A 4NU0A 4R2LA 3UXYA 4CM4B 3IOMA 4HDQB 3TRJA 1WPGA 1QOPB 1HRKA 1XLUA 2BI7A 3DXYA 3ILVA 1NXXA 3UWOA 1KMHB 3X43A 4EG6A 2Q0SA 1BMFD 3PQEA 1HR0B 2C61A 3QHPA 2XVMA 3BGVA 4MVJE 4JP3A 2QM7A 1L7PA 1YS1X 3QNWA 4HDRB 3W9YA 3UY4A 1ZJYA 2XGJA 1A8HA 1MB0A 4G23A 1J42A 1LTKA 4K28A 1IPEA 3AKDA 3T5PA 2JZNA 2DFDA 3NHAA 3RYTC 1H9CA 1HH4A 3DXZA 1NVDA 5IC6A 1JTVA 5ICCA 4I4TA 1TQ6A 1WBDA 3WLFA 4OU5A 3ZW9A 2CL5A 3C1OA 1EFTA 4R8KA 3JRXA 1US8B 1LKZA 3FOEC 5IJAA 1U4SA 2G04A 3OPYI 4E03A 3I3OA 2GYUA 5IJ0A 5KYYA 3GLFA 1S2OA 3K73O 1G2IA 3NVAA 1E69A 4F4CA 5TQ2A 3D3EA 5L3QB 5B36A 2QTAA 5JS1A 3L49A 2IT1A 1IPFA 5HIIA 4BJ6A 1EUDA 5ALSA 4IIDA 4KVFA 3WWYA 2VDJA 4F8EA 5ETJA 1XZGA 4RENA 3WO0A 3W34A 4UM5A 4C3UA 2W6IA 5C1BA 3EDOA 5IM4A 2P0AA 1ADJA 2J9GA 1U1FA 2JI4A 4Z9FA 4Q05A 5HFNA 1BXGA 2CJWB 1UBJS 3C87A 1VIYA 1XP8A 3PKJA 3VU9B 2JKVA 5E4FA 2Q2NA 1K7SN 1UT6A 5ER6A 3FYUB 4TN5A 2CYAA 1V8BA 1VCNA 4DLZA 1IHUA 1K2VN 3ZWMA 1PZEA 1U8YA 2P27A 2RHLA 2V97A 2XUIA 3OY2A 3LQKA 3CPJB 2Q7XA 4II3A 3URKA 4M0UA 2WSMA 4CDNA 1A2BA 3K1ZA 2HLDD 4CM9A 3S99A 3PJRA 3UPTA 5KPJA 5F1KA 4JT4A 4BB9A 6YASA 3T61A 4DV3B 5IZCC 3EUEA 4YAJA 2VDUE 1F8FA 1GYRA 4OGKA 2L19A 2J6CA 4E6EA 3SM3A 3ZWPA 3REQA 1IQUA 5KOHA 1Z2PX 1PFWA 3I9V6 3PV0A 3AY7A 3QG1A 3U4DA 4BQPA 3FDFA 3LKVA 1NZFA 2HRQA 2FQYA 2IEYA 3RF6A 5JS2A 5JJLA 2BCJQ 3H6KA 4PQEA 2ZBPA 1GU1A 5CNIA 2ADFA 1JDBB 2PA3A 2WV9A 1LBEA 4H6PA 5T41A 1DEOA 5J40A 3WGGA 5CEFA 4U2GA 1Q7BA 4I3HA 2DUJA 2HCTA 1FZTA 4NBTA 4ROSA 5HUHA 4CV0A 3WGZA 4RCVA 2HU5A 3RW9A 2HGSA 3QH4A 4R2MA 3LUHA 5JXHA 3P2EA 4P82A 1XF9A 1RTTA 2BEJA 1EM6A 4GPZA 1VLQA 5IU6A 1AGXA 4MWEA 4NTZA 3H6GA 4CR6A 5CYFA 4C3ZA 3BSSA 4EW2A 1EBBA 3LZCA 4NMWA 3R7FA 4DCSA 1OILA 3VUEA 2ZRIA 1MTZA 4FFDA 2QTLA 4CF7A 2EW8A 1FA9A 1K7FB 4N3BA 2JCVA 4TLEA 3L1UA 3GVPA 4RTJA 5B55A 1UZMA 2ZUVA 2COKA 1CY4A 3SWWA 2CL6X 2D3WA 1GEGA 3E9CA 5DYGA 5LL6P 4PNZA 4XR4A 4Y6OA 2RAUA 1QVZA 1YQ9A 2VZ9A 3JX9A 1YAJA 3WJAA 4A8JC 3X2SA 2QRLA 3JXEA 2O50A 3U9SA 1HE5A 4JLBA 1GARA 3DJFA 2ZIFA 4N5LA 4X3OA 1TIBA 4BEBA 4TWAA 1M5UA 5ALGA 5BWLA 1KQFA 3T4PA 3FGNA 3TLEA 2ZBUA 2ZKIA 3G2PA 4YEDA 1PFQA 2V9ZA 3TFWA 1IMJA 4X6XA 4M9QA 3LNTA 1QOZA 4R3UC 4XM2A 3TJZA 2O48X 3VR2A 4BNUA 4EG3A 1I4LD 4L15A 5HJ5A 2W58A 2YINC 1U81A 3WIUA 5F1OA 5HZMA 1J22A 4JU9A 2J9ZB 1X9IA 2A9JA 2FHPA 3D7RA 5C8YA 1M72A 4CR8A 3P1JA 4NOKA 4WCFC 2DU8A 4MKHA 3OCVA 1OV6A 2BDEA 2QORA 3IDFA 4I55A 4MW4A 4DT1B 3ENQA 3A1TA 4ETMA 2PKQP 1GU7A 2DE0X 3LCMA 2E89A 3AP1A 4F4IA 2ZIAA 2Y4OA 3DNPA 4FGLA 4U7JA 4NC9A 3W6UA 5DRTA 3CUYA 1SOMA 3WLSA 1G6OA 2WKPA 4CE6A 2AK2A 2Q3LA 4AMUA 1WZIA 3C3WA 2AF3C 4HXGA 2G80A 5CYGA 1XPRA 2ZDQA 2P9YA 3AHHA 3QJYA 4EMSA 1Z3CA 3OWXA 4QHTA 5A1TA 2I66A 1G5IA 1JDPA 1TOAA 2AG6A 4PYLA 4WJLA 1J0DA 1HFJA 5JNTA 2GZHA 1GGVA 1QFZA 3IR5A 3TOCA 1XVTA 5BOSA 1U63A 1SQ0A 2DJIA 5JROA 3KLMX 4YRJA 3NRJA 1N7IA 3C15C 1CNFA 1M2OB 1W6RA 2VTEA 3H6HA 1ODFA 4TKMA 2X1LA 2ZK7A 4EHDA 2YJZA 4WKCA 1EFRD 4KU4A 3WP1B 4N0DA 2I22A 2IGBA 4XFJA 3KV3O 2FZKA 2IDZA 3A1NA 2DPLA 2LUOA 1BQEA 2H4HA 4ZVNA 3V4OA 3W2IA 3DV0B 2NYUA 1Z6YA 2PVPA 1SZPA 5HF8A 1JMKC 2FUEA 2ZRMA 3HJUA 1UJBA 1ZRNA 4OJYA 3A05A 1YR2A 2OHJA 3CNNA 3GVCA 4RFSA 1T8PA 3O03A 1I7LA 1GILA 1QF9A 3K9LA 2WD7B 3KZVA 4P3YA 1FJ2A 1E7WA 1QFXA 2IDMA 2JGDB 5I3ZA 2R9VA 3SHTA 1T2NA 3NT2A 3P5SA 2LBPA 3LUJA 3T7JA 2O8VA 4O1IA 1LSUA 3KXDA 2R5NA 3H7AA 5F5XA 2EFJA 2HPZA 3KLPX 2HC9A 1AU9A 3AF3A 5DLYA 1QR6A 1GG9A 5AKEA 4W9RA 3VTAA 4PG4A 2ILTA 2JGMA 4TZKA 1QONA 4G07A 2XNDD 2QGZA 3ON5A 1MAWA 4JLPA 2NYVA 2VP6A 3L46A 5JJ5A 2C9MA 2NV6A 3BXHA 1A4IA 1H4TA 4IJMA 2Z1MA 4Z9BA 2ZCVA 2PKEA 1GV1A 3K5HA 3PT9A 3OTIA 4YMVA 2QRVB 1H3EA 1Q1AA 1PNVA 1RFGE 2ONKA 3PHIA 2W00A 5AW5A 4CM8B 1VGVA 2A59A 4FMDB 4XYMA 3QVSA 4MJLA 5KTKA 3CSSA 3LQQA 4EMUA 4R40A 3HZOA 3CUEF 4MS1A 5JJKA 1Z0AA 2Z8YM 1N5RA 3EZXA 3W7BA 5K0TA 5ES3A 1AF7A 1JT2A 3RSSA 5K0NA 3HB9A 2JNWA 4NJMB 1EESA 4KWEA 1U04A 2FWAA 3HVKA 2D8MA 3W2FA 1E4YA 4CL3A 4EHKA 4XX0A 3TW8B 3DFUA 4P22A 2EG5A 3Q0IA 3AEUB 4BFSA 1T4CB 3RHTA 2GLTA 5J4LA 1POWA 3BREA 4G37A 3USZA 3GYBA 3H99A 1ZWKA 2CZCA 2JJ1A 4G1MB 3EWIA 4UULA 1HQCA 2JGEA 1ZHHA 4LGVA 2JD0A 1S8NA 2D7CA 3RUEA 4FX5A 4EI9A 3RFXA 4B32A 1MU0A 1FY2A 1G64A 1ZXBA 2DFKB 5F2OA 3AUKA 4J1TA 3B2QA 1KXJA 2YYZA 1X7WB 2YV3A 5FI1B 1W25A 3WADA 1XPOA 3T9FA 1ENPA 2V6IA 1R6DA 4CV1A 5K4GA 1E2BA 4EG7A 2E9SA 3I28A 3IAUA 3FGPA 1YRBA 1PFUA 4LRSB 2GZ1A 3LC0A 2WT8A 1YXMA 4U39A 4Y1FA 4E5MA 2FOIA 5A4KA 3C5CA 1MX3A 3LOUA 3M4YA 2CN1A 2G36A 4WNYA 3HLYA 4NCXA 1F2VA 1XNHA 3NGXA 3Q10A 3EMVA 1U5CA 4GSLA 1P1BA 3K7EA 4WVFA 3S0JA 5J5VA 1Y3FE 3HXKA 5F78A 3TR5A 4FDLA 1OFIA 5BQ5A 1JHVA 1RLJA 2ARKA 4WFIA 2JHPA 4A82A 1NL3A 1E5LA 2X7JA 2ZYGA 3FWNA 3IX7A 4E2XA 5H8WA 5DBEX 4E33A 4ZZ2A 1ZCJA 4Y2QA 5JH7B 1ACMA 3LQ1A 1X19A 5A5VA 5AIBA 3PWSA 2RB5A 2ST1A 3UIEA 1DFGA 3EXG2 1RRKA 1AC5A 5F4BA 3RT9A 2WV7A 3FPCA 3GUZA 3P32A 5JPCA 2HDNB 5CBPB 2J0QA 1BS1A 2A5YB 4GLBA 5BO5A 5HCNA 5HDQA 2IPMA 4P7BA 3FB4A 3B5EA 1R6BX 4A3SA 1RAAA 3GRVA 4RELA 1KI1A 3DCNA 4NARA 4ALIA 2D5LA 3BZUA 3IJEB 3L7CA 1L5YA 2F43A 2QGNA 2I1QA 1M0TA 2A9VA 3DULA 4LDAA 2C98A 5A71A 4XWKA 1JJVA 1GGNA 5SY9A 2CJXA 3C48A 1UMKA 4UUNA 1ZNXA 4WXYB 1O6BA 1OVGA 2Z83A 3RFFA 4EW3A 4Z3OA 3D8HA 1SZCA 4MQLA 4OBBA 1ISGA 2NT3A 5B3JA 5HHTA 2C59A 4IGFA 2IQIA 1GPAA 4PLFA 3LBIA 1KJJA 3SNKA 4EECA 2VHQA 2WSLA 3HFJA 1K8XB 5DM1A 3N8HA 4UEKA 2O57A 4DCVA 2X0KA 3HEAA 1KY3A 2GO1A 3JZIA 1FVXA 4JZKA 1RQGA 3ETCA 4HDKB 1ZBDA 2RKWA 4ZVRA 2LPMA 4LJ9A 1NBHA 1MJGA 3X1XA 5EHIA 1KPHA 5U1PA 2OWEA 5FBHA 4S1WA 2PL1A 5L53A 2P4UA 2YASA 3VSAA 5TMPA 1BVHA 3HN6A 3OCCA 2BMDA 1AOXA 4O4JA 5JIBA 1OU0A 1W36B 1RBZA 3BRSA 3SZRA 4ZN6A 5GVSA 3ZY6A 3B7PA 2FVXA 1SOWA 4KVAA 3WJ2A 2QVYX 2KJQA 3KR9A 1X7ZB 3UCXA 1RRCA 1A9TA 2FZCA 5BSTA 4RPIA 3ZHZA 2O3JA 3OQBA 1YA8A 1FQKA 2RGUA 1DWOA 3VTFA 3FKJA 3GARA 5DSTA 1QRTA 4DQ0A 1KEEA 2POQX 3TQQA 3VC2A 2PUGA 2QEQA 1E8NA 4A15A 5B3KA 1V7CA 2W2OA 3TG2A 1HE2A 1EVIA 2JDIA 2WNHA 2XTZA 2XZPA 1L5KA 5JZMA 5GADl 3EQ6A 5SYMA 3UHPA 2VS1A 4GG1A 3FHJA 5AIAA 1E2FA 2K2WA 1VKNA 5EWMB 3MELA 4XIFA 1BS9A 2IK8A 2CEKA 5T4EA 3TB6A 2FYTA 1F17A 1Y9JA 2HBYA 2D4HA 1T5IA 3JQAD 3O21A 4RNDB 1OBCA 4L8YA 3ZDEA 5LYJF 3I1YA 3RRFA 4PO1A 2OAGA 1XZLA 4EQZA 5LDHA 1OGYA 1GL6A 1TKBA 3CHYA 4FINA 1OX6A 1OLXA 3D6HA 4YUZA 1H1LB 3M3DA 4BKUA 4LZZA 4CHGA 5CFOA 1ADFA 3G17A 4EG8A 2JLSA 3OM0A 1Y6FA 3KOUA 4HPJB 3IAFA 2G8NA 3GLKA 1UZAA 1FFXA 1F6DA 4ZALA 3BWDD 4R84A 1CUCA 2DSNA 4OXQA 4TTQA 3QOXA 2QT1A 2XWBF 1CEYA 1QIJA 4KH1A 1XQYA 1XKQA 1M2VA 1SM4A 1H23A 5LUAA 3BHNA 4DMCA 4JAVC 5IPFA 3NH6A 3O7WA 2X6QA 4FKZA 4QX6A 3Q7PA 1QORA 1CVLA 2AN1A 1DOHA 4DAOA 2GAIA 3QA9A 1X8KA 1BKYA 1KYQA 2GJKA 1SCNE 2KM1A 3G1UA 1JDJA 4U00A 1Q1GA 1ND6A 2E1RA 3GJTA 2WHEA 1O5TA 1U9IA 3HDQA 3P2KA 4YY3B 1YFLA 1IHYA 1NI4B 2A0KA 4TV8A 5BVHB 2JAHA 1CY0A 1KVUA 4NYIR 5CA1F 1JSZA 3X1WA 5K3BA 2YJ4A 4FWBA 1CZUA 5K0ZA 5CP8A 3GZNA 4HWSA 2GD2A 5DISB 5KYVA 3PXDA 4ND5A 1SULA 3PTLA 4D0SA 4QQ8A 4FFOA 4ZT5A 4Y2JA 3AR6A 2NZXA 1MQSA 5DZSA 1U7HA 1EINA 3EPRA 3NKFA 3SBEA 2WWGA 1RLUA 2VPQA 2ZT5A 1RABA 3SVZA 3P9XA 1ZVVA 1U99A 2W90A 3MK31 4J2HA 1SVWA 3CZCA 4B45A 2I2AA 2H2AA 2QJRA 3K05A 1ONOA 3HSSA 4NBNA 3EWNA 3AHIA 5MDHA 1DCTA 3H8JA 2GNPA 1CDOA 1PK8A 1QTRA 1W35A 3SFVA 4E4RA 2E6KA 4FN4A 5IH3A 1SUCA 5IC5A 1M8FA 1SC9A 2C4HA 2CNWD 3MT8A 5IULC 3NM6B 2VEDA 4EI7A 1A8PA 1XELA 3EIOA 4QBIA 3WGNA 3TB4A 5LBUA 4DMRA 5IF9A 5L3VA 3DXFA 2EWMA 1W59A 2DJ5A 3AG5A 4FYYA 4ENWA 3DBHA 3D5TA 1EGAA 2O3QA 5AHKA 4TYYA 6ADHA 1A0OA 3TTXA 1KZ7B 1OKKA 2ZIXB 4DRXB 1N5DA 1G5PA 4C0JA 3UQZA 3ZCRA 5E6RA 4D44A 1Y7IA 2YJ6A 4FYPA 2QSUA 4DEYA 5C3MA 4OI0A 2R2GA 4H1VA 2COEA 4MS3A 5C80A 2OD7A 1B6SA 2JAUA 4RVGA 2IEZA 3H5RA 3ITKA 3QWFA 4AZ3B 3TRHA 4DLXA 2ZE8A 2EU8A 3LLCA 5ESDA 3FFAA 5BW6B 2IV3A 4TKVA 2ISQA 5BWBA 3CPEA 4ZKDA 1UJCA 1AS2A 4ATNA 3PNPA 3F78A 4LRWA 3FH0A 3VPFA 5BY2A 3WZ2A 3HH8A 2DFTA 1D2AA 2PD3A 5JCJA 4JT8A 4F4UA 4N6OA 3P26A 1XAJA 1ZW1A 2XUJA 3I1IA 5FL7A 1UQTA 3B6ZA 4ON9A 3U4AA 4YRGA 2X22A 3KX2A 3S1AB 2NVBA 5DHFA 3UN1A 1VDZA 1AGPA 2H5LA 1U0BB 3DM9B 1DUIA 3NHPA 4HRXA 4GXTA 4BP3A 5FOVA 4RTMA 4ZYTA 4JBLA 4S1PA 4YJKA 3RNOA 2YTZA 3CN9A 1QNLA 1IY0A 2PUHA 3C5HA 3I2GA 4K9OA 4LOHA 4UHDA 1TRHA 5JO0A 1JFTA 2EKLA 5E2IA 3A6PC 1NXOA 5A6SA 3H9UA 3FWHA 4KNVA 4IJUA 5F7OA 3A4IA 2XCLA 2VT3A 3TQCA 3DZBA 4URVR 4R69A 4AIIA 4IZHA 3BB3A 4JGBA 2QR2A 2M6LA 1XQXA 4AM8A 4QJ4A 2I76A 1EH5A 2GN8A 3EF3A 4ZMRA 3S2SA 2Q3FA 5I7OA 4UHFA 1OGIA 3ZZUA 1Y1RA 5ALZA 3G13A 3V8VA 1M7GA 4Q7KA 3QA3E 5ELMA 1ONNA 3DZ8A 3WLRA 4A0HA 1KEVA 3SZUA 4BNIA 4PZEA 4CM4A 5AI4A 3QV1A 4PCUA 3W1WA 1KMHA 1QTIA 2GEDA 4X9XA 3PNLA 5B4TA 3A2KA 1CPYA 3NVKI 5DGHA 1K92A 2WU1A 1M6NA 3L7IA 3P4UA 4IJKA 2JFGA 4HDRA 4RK5A 2OHFA 3SCZA 2GVNA 1EFLA 3N7TA 3WICA 1Y0BA 1C81A 4KKXB 4F4JA 3J81k 5TC4A 2D0OB 5LB2A 4CL2A 4XDGA 4XEHA 2OCBA 2Q21A 3N0TA 3HCCA 3SKXA 3T5MA 3HWX1 4AKTA 4OQMA 2HMTA 1KMCA 1QBKC 2C3YA 3N2KB 2P3LA 4NEGA 4ZTUB 3KLOA 3VYTB 4IUYA 3E82A 3AVPA 1D1PA 3WWPA 1US8A 3KTOA 1TAHA 4ISCA 1JSXA 4MRMB 2BIFA 1VSBA 1ZNWA 4GOOD 1DX4A 3NHYA 5AJWA 4NABA 1EFAA 4M7PA 1JALA 1PHRA 4UBNA 2UZ4A 4BIMA 1I5RA 3CVYA 3T3GA 2D62A 3KEQA 4BNJA 1Q21A 4MV8A 3ZD6A 2WJWA 2RHRA 4RV5A 3VSCA 3QYJA 2QL5A 1NKVA 3PUIA 4DV7B 4YPFA 2IHUA 4RD2A 1NJ1A 2CJWA 3VU9A 5SY4A 1TGYA 3DV9A 4OX9B 1CRZA 1IUPA 4JP5A 4RHYA 4QBGB 1Q0UA 3FYUA 3AZPA 2JFZA 3ZNPA 3IPCA 1N1GA 2Y67A 2HEGA 3OE1A 1F8UA 2J3IA 4QSMA 4I1YA 2VT6A 5A04A 3CE6A 2B20A 3ZHXA 2CVFA 5K8CA 4GPBA 1YHNA 2IXAA 3S2FA 1DEKA 4AKEA 4C7KA 1BFUA 1H8ED 2OK8A 1KSHA 3PK0A 1GPH1 2J3EA 4MO2A 4EFKA 1Z4OA 5A6VA 1MPXA 2HXSA 3BMOB 4ZQBA 3QU7A 3MTQA 1W8DA 5J4KA 5FNVF 1G8YA 1J2EA 1NN1A 1UM9B 2JJ2A 3H18A 1Q12A 1P5HA 4U63A 3QPWA 2JZOA 4GOLD 1EK2A 1XDBA 4P7GA 4FU0A 3B85A 1MMFB 5JNRA 1N6OA 2C2KA 3FPEA 1HXHA 1OYOA 1UFOA 3UWSA 1C7JA 1E4EB 1RE0A 3FRHA 1RWBA 4O5OA 4RVOA 1RKUA 4M0LA 1C9DB 1YI8A 1TZMA 2R1ZA 3D0QA 3R40A 4JI5B 3TEJA 2FXVA 2X3UA 4DNQA 4Z4GA 1T9KA 3W04A 1LJLA 1ABFA 1CJKC 4D9IA 5T4FA 2FTKE 3VR3D 3DEIA 2WF5A 3Q9LA 3BE4A 4NE7A 5LR6A 2OCIA 3SX2A 1JPJA 4BQNA 2CCKA 1U2TA 3V8RA 4B1FA 1KHTA 5C2JB 3TQRA 4RS4A 1RIIA 5T6BA 1SXIA 2EC5A 3N53A 4BBAA 2JFBA 3L0CA 3I45A 2IUTA 3HJFA 2PQ0A 1P5JA 2YCBA 2WWWA 2DF8A 1GN9A 3KDPA 2BFEB 3GRKA 4K2AA 1XLVA 1J20A 3LX4A 3CF0A 1YR3A 4O4HF 3D6JA 2YVAA 5HYVA 3VU3A 1H94A 4CG2A 1M6VB 3RVPA 4KUEA 4NNPA 1TECE 4DIMA 4DXAA 4D56A 4EUSA 4YN3A 3AETB 2RB4A 5E7JA 3RU9A 3AVUA 1XK6A 4DSUA 3NWPA 1J21A 1E79A 1RYNA 2FEAA 2VYFA 1Y7TA 3VPDA 1M75A 1RWOA 1B8NA 2F48A 2WUEA 1SPBS 3JV7A 2H8GA 2QTVB 3A1UA 5HDBB 1R12A 3FKSD 2DHRA 5LYJB 2XGOA 1K5HA 2J9YB 3DMYA 3RUDA 5F3RA 2XWSA 4FLEA 5AJYA 3RIEA 3G0BA 1E1NA 1KQPA 1N3IA 2J3KA 4BN5A 3JQFA 4GBED 3AHDA 3LQ2A 2OILA 5JJIA 1VL5A 3JQ8B 2IPOA 4WGFA 3TZKA 1NQTA 2EHJA 3BXOA 3WQBA 4IIHA 4PHGA 4CEIB 4I50F 3CJTA 4LMPA 3AR7A 1OXXK 2EX4A 3V6MA 4DT1A 5A2GA 1R8XA 3RUCA 1EVZA 4U1RA 1YQUA 4GBGA 5LOVF 3N8DA 3W5UA 4K86A 3GPBA 4C5BA 1JDNA 1GVNB 3DD5A 3ZXIA 2XOEA 1RHQA 4FHFA 4XH9B 1GQOA 3F7NA 4E5UA 2Q5CA 1SKQA 4KH0A 1ZHOA 1Z47A 3SICE 1LVGA 2H7XA 4Y2UA 5B7GA 3AG6A 4KWHA 4RETA 3VHXB 4MX8A 3AK4A 3O9MA 4G56A 1IY8A 1XCOA 4ZXPA 2Z5VA 2OP0A 1Z6AA 2WB2A 4BRWA 1EQAA 5CA1B 1M2OA 3NHSA 1T4MA 2WAYA 2G70A 3EDRA 1WUHS 2YWHA 1PV1A 4I5FA 1LA2A 2FPSA 3IUNA 3AI7A 5I9MA 1TK2A 1OAAA 3MWKA 1ZIXA 3BM5A 3FETA 3PF8A 4NAUA 1IZ7A 3O0TA 1P33A 4HT3B 5LD2B 3DV0A 1Z2CA 2NU7B 3AB7A 1JH9A 2OHIA 4MYTA 4DY6A 2O0KA 4G1EB 4QUJA 4Z8XA 5JFGA 2RKBA 4I3FA 3F7OA 4IHJF 1N7JA 3HLKA 1GYPA 1Z83A 2BGTA 2WD7A 1PNQA 1E3WB 2OT3B 3OBIA 3KFXA 2JGDA 4E46A 4COOA 1BDIA 3QE2A 2PD6A 3IPYA 1NVMB 3QU5A 1A50B 4O6VA 3K0AB 2Z43A 2J7PA 1ADCA 3D8TA 3RFTA 3RSZA 5FH9A 2IHVA 5SZJA 4BX9A 4RGQA 1G3MA 4XSGA 4NMMA 4UE2A 4GQBA 4MVJF 1WP4A 4RACA 4D8VA 3W3AA 3F1KA 3CLSC 2V9PA 2PQMA 4LHSA 4P7JA 1AHIA 1UPCA 2ZWAA 2EG9A 2FF7A 1IJFA 2PZFA 3JW8A 4Z9YA 4MUMA 2HIMA 4J1TC 4J1QA 1OF1A 2HKIA 2QL6A 2WILA 2CVHA 2QRVA 3NJ8A 1XQWA 4BO5A 2H48A 4CM8A 1CULC 3STHA 3U7HB 2RHOA 1WLYA 1FYEA 2WWXA 3FOCA 5H0IA 4YAFA 5BUSA 2WWYA 2ZCJA 5D86A 3MCUA 4DCOA 3HI6A 1FOEB 2QZ4A 3HCBA 5HS6A 5A3VA 4NJMA 1KQGA 1SO8A 1QFSA 1LNZA 1JDTA 3IBFA 2H11A 1U2GA 4MRNA 2PZAA 4X62B 3SPXA 3TW8A 4JVNA 3T35A 4F9EA 3AR3A 2QN2A 3AEUA 3SJZA 1T4CA 2HQBA 5CDGA 2B4AA 1GR0A 2C3OA 3H1TA 3K9WA 4DBZA 1U0LA 4CU5A 1EFHA 1KYIA 3VDRA 1P0FA 1YCGA 1Y63A 3AVTA 3GJXC 4ZCRA 2AJLI 3BS4A 4OK5A 3LWNA 1B00A 3U9LA 2EP5A 2A0YA 3ONFA 1NIJA 3OLVA 4YQZA 3AJDA 2PM8A 3VXKA 2DQZA 2JH3A 4G5QA 5EP3A 2EKPA 4BMCA 1QCZA 2AH5A 4Q0MA 4UTRA 5H9WA 2OENG 3GQVA 4M1OA 1CQJB 1K6JA 1T2EA 3UEOA 4ZZ0A 3QQPA 4C87A 2JLZA 2PH5A 2R85A 3V5NA 2ZB7A 1X7WA 3F2IA 5GIOE 4A4DA 2Q3DA 4ARCA 2NVOA 4B3DA 5BV1A 1KY4A 5IWAB 1G3RA 2VIIA 2MINB 3KRTA 4IDGA 4JLVA 4X1OA 5HF5A 4A23A 4ZICA 3QSYA 1O94A 1V71A 2WY2D 4FNGA 4QXOA 2O59A 3RTGA 4TKUB 1IE3A 2Q1XA 2WVAA 2YDYA 3E7XA 4L3WA 2GBPA 4TKZA 3ZVNA 3HEBA 3E6AA 3SMQA 4LJRA 1RC0A 2R68A 4M22A 3CMCO 3CW9A 4JP8A 5B3JC 2JI7A 3FNHA 3VAYA 4YDHB 1NTRA 1Z8DA 4LZLA 3IFSA 4F3KA 3TXYA 3FHTA 3RVDA 2BL4A 3IPAA 3WMGA 1Z2EA 2ATEA 5EQDA 1C4OA 1ZN7A 3KJNA 4F6CA 3PNQA 3S2EA 5JH7A 3AU8A 3CBQA 1S1MA 1TAGA 3MTDA 4EY5A 1DLIA 2DULA 3PD0A 5B7QA 4RM2A 2REQB 4MVJG 4YJFB 4EJ6A 1XMQB 1N32B 5CBPA 4R9VA 1E7QA 4H2DA 5IBRA 2QJOA 4KB5A 4R6WA 4XWYA 3ZIAA 2RONA 2X2OA 3EASA 5IKOA 3USCS 1L3IA 3VUFA 1AN0A 2XX3A 1GZSA 3EOAI 4ND1A 4H7JA 5GV8A 3T6KA 1G4UR 1MB4A 3BFKA 3OM1A 4EEKA 4YCMA 2EXXA 4JC5A 4EARA 5MF6A 1N7GA 4V1CB 1BWSA 4H3VA 2HQ1A 2JFUA 1E63A 1OBOA 4ENPA 4JK3A 3W6ZA 1D8TA 1C0IA 1QVWA 5KJFA 1O6FA 5JRDS 3BCHA 1ZY2A 1XDSA 2FAXA 2BHTA 1P1IA 3DTVB 1PAUA 2CUZA 1BROA 4Y6SA 1SXJE 4NR0A 3U16A 1W48A 2EF1A 4MUHA 4LTNA 1I4TD 4QOFA 4BQFA 1QYRA 4M98A 2O8FB 4IOLA 4MO9A 3AKEA 3A4YA 3ERCA 4DLLA 2ZWIA 5F77A 5B4UA 2QE7D 3UPDA 4EX6A 3KKNA 5JY6A 4HDKA 1RBMA 1TL7C 2QDXA 2H4WA 5AYVA 1Z7WA 5LPNA 4NPAA 5T67A 2ET6A 1VSUA 3T0GA 2HCRA 4R0VA 3U6BA 3GLIE 4LI0A 4ZDIA 1LS6A 2HBQA 5B2FA 3N1UA 1JF8A 2BV3A 2VK2A 4HAUA 5IANA 4MZXA 2JBWA 4LJ6A 2P9ZA 1H85A 3DB2A 3NWBA 4F5ZA 1WSBA 1MX9A 1PR3A 3K35A 4FE3A 4M2LA 4BX8A 1TAQA 1X7ZA 1FPQA 1VSVA 3IP5A 1SCKA 4Q7JB 1J7KA 5DO9A 1S3IA 3R44A 2C7BA 4O25A 3JWIA 3CUWA 5EKTA 4DJFC 1PVVA 4MGIR 2BH2A 5TQJA 1KEWA 4HXEB 5CCBA 3DTNA 1V3VA 4OYHA 4JL8A 3QELB 4JHXA 4E5NA 3LQYA 4P3NA 3V1KA 1Z68A 3REOA 2AFHE 3CG0A 3DVLA 4U5XA 3V00A 1T0HB 4LXUA 1EX7A 4PX3A 2N0SA 2XHEA 3CB2A 5CEJA 1U9IC 1NONA 1R0ZA 3OCYA 4OM8A 3S1LA 3SMVA 4NICA 3ZY4A 1C7FA 3WKCA 1Z0KA 4O4HB 3PGKA 4M87A 2EFDB 4HEA6 4PSVA 3L4SO 1DKNA 5KJ1A 3UJ6A 5LMNB 3WHPA 3DWIA 2JAWA 3GLRA 1H1LA 1LJUA 1M2KA 5BV8A 4GI3A 5CFMA 1DB3A 3FCYA 3QVXA 2TECE 1K3TA 3QX3A 3U17A 3C6MA 1NLYA 1ST3A 1QE5A 2R8EA 4IP0A 3GGGA 3IUQA 3OFNA 3QP9A 4G97A 5E3IA 2ODNA 4JQYA 4EJ2A 3FSJX 2AEEA 1GZDA 4I50B 4D9CA 5JPIA 1KOLA 1W8IA 2C1XA 2ZR8A 1OQAA 1IJKA 3TH5A 3WLPA 4BNLA 3S8YA 1G3UA 4G2NA 3KTAB 2FFBA 1SU7A 3BXFA 5LOVB 2QL9A 5HF6A 3IILA 4EW6A 5CDSA 4Q3OA 1MABB 2WFLB 1I6LA 4YRMA 1AA6A 1NI4A 2HY7A 4K1XA 5B1EA 1RJWA 1JU4A 3AF5A 4II7A 1QYIA 3HNRA 3TRFA 1AX9A 4OXYA 3NATA 1N2XA 2C0CA 1PQUA 3OLWA 4YK7A 2I4MA 3IA7A 5BSUA 3OZDA 4OI2A 4OMCA 3QLVC 1D2RA 4FIDA 1XVUA 5DNAA 5LB4A 4CKXA 3MWDB 4J2OA 3ACBA 3BXEA 4IRMA 2JK0A 5KNDA 2X4LA 4BLQA 4MB2A 5KKAA 2RGYA 1VJ5A 3GFQA 2RJNA 1XVIA 3H4TA 4XUDA 1ZN2A 2IHYA 3NEPX 3P20A 4J94A 4MR9B 4RANA 4RKWA 4RY9A 4D3SA 3B12A 3AW9A 3CNQS 4JJ7A 3WP0A 4PSAA 4P0PB 4EITA 4D1YA 1EPUA 1G7SA 1E6MA 2I0FA 1YZGA 1CRQA 2LCFA 3CLUD 5JLJA 4KDFA 3VBCA 3DFKA 4LNUB 5G0SA 3AFGA 3E9YA 4Q21A 3V80A 2NUBA 4XFKA 4IHJB 4YAWA 5A4DA 4D3DA 2ZIXA 3F98A 4DE5A 4DRXA 2XMBA 5CT8A 4Z0HO 5AESA 5B4VA 2VP9A 1QHHB 1Y3IA 5FULA 3LVBA 3M6LA 2P3QA 2PLRA 4YJDA 4PQYA 1TM7E 3KSRA 2NSJA 4LWPA 1SG9A 4R8LA 2OBBA 3K96A 4XB1A 3FE2A 3PE3A 1KOJA 3AL2A 4AZ3A 1FUIA 5T5QA 4IDAA 1TF2A 1XZHA 2O14A 2A0XA 5TARA 3ICOA 5DJ5A 5DB4A 2B0CA 2F3SA 4B8YA 1N1DA 3UAVA 5JYCA 5LFAA 2ATIA 2XF2A 3DB1A 3IT1A 1V5WA 4KV9A 5AUOB 1N1MA 2HF2A 4D0NA 1ZL0A 1XTRA 2GMWA 2PT9A 1Z45A 5KNBA 2DX7A 2VT7A 4Y2SA 3S1AA 2I1VB 1WUIS 4HZUB 2FPUA 4AZ0B 1MJGM 2OGSA 2HAEA 2WU4A 1B8PA 2ZJ4A 3GQBB 1YKGA 4URWR 1JR3D 4X95A 5CGZA 3UOGA 2QRUA 4RX1A 2WD8A 1I1NA 4G1UC 2JCSA 4ZQGA 2P6RA 4H17A 5HM6A 4TT3D 4AO7A 3ADPA 1K4YA 4D3FA 2VA8A 2C95A 3P94A 4H59A 3ASYA 3G2NA 3WGOA 3RR2A 1O95A 1G9TA 1IEWA 1RYFA 3I4FA 2ZJAA 4HNHA 5FADA 4YP7A 3RWMB 3ZZMA 3HCFA 4CRWB 3PLRA 5EE9A 2CHVA 4J07A 1DEAA 2HSWA 3WK5A 4US0R 4HYTA 4EABA 2FGKA 2ZB8A 4EGAA 1FLDA 4LE1A 4EQ6B 2Q6LA 4N9QA 2DECA 2I4IA 2QRKA 1QAOA 3MTGA 5AOVA 3VC1A 4I14A 4OYYA 2PMBA 3FAZA 4R0NA 3RI3A 3A11A 4Z4CA 2O3RA 1YHZA 2JFNA 1NNSA 2WF6A 2TYSB 2XNSA 2ZR7A 4FLMA 4QTTB 3RVRA 2Z4SA 3I1FA 2C5GA 1L2TA 2VF8A 2XOKA 3CMMA 3FYUC 4MVJP 4UEQA 1VHWA 1I5EA 4OHOA 3RT7A 2RSLA 4DZZA 2OSBA 2YY7A 1UEXC 2VZLA 2P67A 3MIIA 1AKNA 4L0QA 3AM5A 1IDN1 2GCIA 3N2KA 1U1CA 4S2EA 1LEHA 3GZJA 4LV8B 5AI8A 4A8PA 4W7IA 3COSA 2WMNB 3LECA 5BSGA 4R7GA 3UKJA 4CHTA 5JLAA 3PYMA 5EIAA 3K0KA 1L4HA 4Z9AA 3RUPA 2WG2A 3LV8A 5TX7A 4MRMA 1D0VA 2PRZA 1I3KA 1JG3A 1YGYA 2ONCA 2PUTA 3STYA 1R0BA 1G7TA 3FOWA 2HJRA 4AY2A 3TRKA 2WTEA 1FUYB 1RWMA 5AVRA 5J4VA 3NC1C 3DVRX 1JDBC 2H65A 1V11B 4DSNA 4Z4FA 2HCBA 3NM4A 1VCOA 5ALMA 3ETLA 3THSA 1NMQA 1PTKA 1SVKA 5K3FB 3AR5A 4AYWA 3UO8B 1BN7A 2Q4BA 4IDDA 4O2BF 1JJBA 2ZWVA 4XQCA 5ADHA 2YIVX 3GRRA 1NXSA 1X1AA 3COJA 3ZLUA 3IV9A 1UOPA 4ZTZB 1GZ7A 1H0RA 1Z5UA 3B2NA 4XCXA 1KE2A 2NP7A 3KPVA 2OV4A 4J0CA 1FFDA 4FYIA 2XF8A 3A25A 2FPIB 4B75A 4EBFA 2Z09A 3GYGA 3I62A 3VHRA 4MW5A 2Y1FA 1Z0IA 1EK1A 1FL9A 221PA 3OJCA 2PSDA 4MI1A 1FW6A 1QGAA 1RYBA 3ZE7A 5FOSA 2Q1YA 3T3NA 2HSJA 3G0CA 1ZOLA 3NYWA 2QD5A 3BMOA 3T4EA 1G16A 1XXLA 2E37A 4G86A 4MQ4A 5CH3A 1KE1A 2HWUA 3A36A 4MUEA 5AXBA 3VZQA 1UM9A 3EB9A 3RKUA 2HRRA 1P2DA 2CXTA 2JASA 1MRNA 2Y1DA 3KZOA 3SFZA 2BGGA 4WESB 3AOGA 5CM9C 1NUUA 4PYOA 3BMNB 5M3BA 3BICA 1IAQA 2Z2XA 4ZAZA 3IR7A 1FFAA 3D3QA 2B35A 4TSFD 1H5NA 5FLYA 4ZARA 5AVTA 2HQSA 4G9BA 2HB6A 2AK3A 2I8AA 1RLIA 3O38A 1E4EA 4UQOA 3ZW8A 1GL3A 3EBPA 1CNEA 1MTOA 3SYNA 3ZY3A 2ZVPX 4AICA 2J4DA 2OAEA 5AM2A 5JSHA 5MN5A 2AQKA 2KI5A 1TB4A 1FNSA 2O7RA 2W37A 3AFMA 3N58A 4B4UA 2ZYHA 4QNRA 4I9FA 1T2CA 2CXOA 4XXHA 4HLUA 3LBYA 3AO0B 3PC7A 3JQFC 5EJAA 1DHRA 2IXDA 3RU2A 1CZHA 1CD5A 3W1EA 4YT4A 2PFSA 2XZDA 4HMOA 4GPEA 1I2BA 3LGSA 2BH9A 1ZH4A 4XUCA 5BWCA 5CG2A 3V1NA 2CLEB 2LXNA 1A5AB 3K71B 2DLDA 2P3OA 3R5HA 1YMVA 5ALVA 4LBYA 1XHLA 1IN8A 4ZQCB 4DN6A 2Y77A 3S55A 1ESCA 2IYEA 3HADA 1E60A 2BFEA 2C9OA 2OCPA 4ESEA 4BKOA 4PZUA 2DR3A 1W52X 1L3BA 4K6HA 2YXLA 1Z36A 2D7JA 3MT0A 4XM0A 4F06A 1M6VA 1AKUA 4LJ5A 2H7VA 4DV0B 3AF1A 5LC1A 4IDOA 2IZOA 1JJAA 3AETA 1LU9A 1G6Q1 2EIXA 4AAYA 1RC8A 3BQNB 6Q21A 3LL4A 1OTXA 3PFCA 1Y6QA 3IEUA 3PQCA 3OEED 2H7YA 4KMOA 1SC4A 3TSAA 5T7BA 2COUA 3ESZA 1D2MA 1L4KA 1B0PA 2QTVA 4XJTA 2RH5A 3AEXA 3K2EA 5LYJA 6AT1A 1HOTA 1VLVA 1K7CA 2O6HA 3BZBA 3QJGA 2GKOA 4GMKA 3BIOA 2OYSA 4GVLA 4K9SA 2O07A 2Z5FA 1L4LA 3EF0A 4KQGA 4Y3UA 2O5EA 5T8KA 1IC6A 1DBVO 4ECAA 1ZRHA 3I01A 2J87A 2E5WA 3HGQA 2JHGA 1Z25A 1GUDA 1WB6A 1RHMA 2AZTA 2QAGB 3JQ8A 4IH9A 4TLBA 4X45A 1F5NA 3FWYA 4CEIA 2GB4A 1FP6A 1WQ1R 4MV6A 1OFGA 5DHUA 4ZI3A 2FFQA 5FUMA 2PTHA 3N2NA 4C29A 3FWZA 4JA2A 5C31A 5LJIA 2VDRB 4GGOA 2FPXA 3DMFA 1D2HA 3TVTA 4ACAA 1LI5A 3EZLA 4WY2A 5BN3B 3R41A 1ECFA 5C1DA 5JISA 1GPLA 1Z22A 4OIMA 1G7RA 3VI3B 4EB3A 1V8PA 2JANA 4QARA 3VPBA 4RQAA 5KYXB 2AXPA 2ERCA 2PIAA 3HCWA 4N5HX 4C7BA 2EZ4A 2EGUA 5D3ZA 2G0TA 2PU5A 3GEEA 4GXQA 3OFKA 1C0PA 4AJ2A 1GUBA 3LU1A 3VHXA 3WLTA 1BMFA 2UUOA 3LXUX 4QU9A 4U0KA 5KJEA 5MFZA 3D7KA 2BF7A 2G76A 2JLRA 1ZM9A 3G9TA 1ULAA 4GU5A 1BMTA 3INYA 5FF9A 4LDZA 5CA1A 2HJ9A 1AB6A 2PA0A 3VPCA 4GBJA 3F5FA 3IPLA 3L06A 2ZZNA 2W2MA 4CT0A 2I3GA 1LW6E 1R16A 2HXYA 4CMIB 4FI3F 3QEKA 3PGVA 2B8NA 3GBPA 4I5EA 2W6PA 1B1CA 4PYQA 1XYGA 5DX8A 5BQFA 4C76A 1YZKA 1A2QA 3IDSA 1CJMA 2NU7A 4G8CA 3NX4A 2AOXA 2ZRCA 3L1JA 3OTGA 2X9NA 4QEKA 4IJQA 5BWOA 1JAYA 1T91A 1FP2A 1UC9A 4J16A 4ZU1X 5K0LA 3DDCA 1S2GA 3GMSA 1BMDA 3D3WA 1CEEA 2DR2A 1U2GC 5KSZA 1PLLA 3GI1A 4IEFB 1RRPA 3B8HA 1E3WA 2WZCA 3C6BA 4MEAA 1HA3A 3A6HA 3TX6A 1QYWA 4RMJA 3SF0A 2WFAA 3I3SR 2GEJA 1TYDE 4BXOA 3K0AA 4FKMA 4X00A 2PZLA 5E1BA 1QFYA 4FCCA 5ANRB 3IVCA 1HZJA 1EE1A 2OV1A 4MI9A 3BE6A 1F9EA 3NGMA 3ZHTA 1I9CA 1L5RA 4CLRB 1VPEA 2CFTA 2XUPA 3MF4A 4UM7A 2JVIA 5A3QA 2P5YA 1UMCB 1E64A 5K3DA 2WVJA 4DGSA 1SBHA 2MSNA 3L7KA 1C0KA 3OD5A 1BE1A 3TQOA 1J9EA 1A5BB 1KI4A 3KZXA 1KEPA 5GY7A 1RHKA 1KK3A 5H70A 1NJ5A 2WFMA 1ZFNA 4XLZA 3GOQA 3PWTA 3TNLA 1G38A 2ZIUB 5FR2A 4IF4A 5ITSA 4PWYA 3HR7A 2CHQA 5ALDA 1Q6ZA 2BONA 1JR4A 1DWPA 2D1FA 2H5JA 1UT8A 3OQVA 721PA 1Q5PA 1SD2A 2I2WA 3BMXA 3C0KA 3K30A 4NZPA 1ATZA 4HNSA 3STVA 2G0AA 4LZAA 1RPTA 4FDAA 2VKTA 3QG5A 1PT7A 4BO9A 1LPPA 4K6FA 1MNAA 3L6RA 3QOFA 3OPYB 1ZC4A 3CN7A 4OHWA 5G1PA 4ZYZA 2WM9B 3ZQ4A 3JD4A 1AQNA 3WNQA 4Y2GA 1NVTA 3CVXA 4EK9A 1JIVA 3K0EA 5C5IA 1NJFA 1X7XB 4BMNA 3UHJA 5EKXA 1VJGA 2CXHA 4GVPA 4Y0NA 2CDNA 3DOIA 3SYMA 1L8LA 1MFPA 2WHPB 3QW4B 1AS0A 1QKJA 4X44A 5JS7A 3UK6A 1FJGB 4H27A 1L7BA 1THZA 4FPXA 4QELA 3RUIA 3SQLA 1CQJA 1E1MA 4FUTA 1SK9A 4B40A 2ZAMA 4UC0A 1Y82A 1TUGA 1P91A 1NZJA 4TRRA 2BY4A 2JGLA 5DM60 4JNCA 3PEVA 2MINA 4TVOA 5CM8B 3IR6A 2P2GA 3HY3A 4GO1A 1QH0A 2M2IA 2ZUUA 3BVPA 3OPXA 4XUEA 5FT9A 1CUDA 2JLXA 1SBIA 4IS3A 3U7QB 2I6UA 4RBNA 4TKUA 2RGNC 2GPAA 1AQJA 4IHQA 3CUTA 5KWEA 2Y6VA 1VGRA 2JJQA 1GU0A 4W5TA 4LVCA 3IOBA 4LWOA 4RHCA 1T0UA 2C5LA 1COWA 4MGKR 4PFQA 2A92A 1OW3B 2QUJA 3OE7A 5TJHA 2VWGA 2VZ8A 1I1QB 4X7PA 1UOQA 3RFUA 4G09A 3C7KA 2W2LD 4AX4A 5L6LB 3WYDA 2X9VA 3Q7QA 3UJHA 2Q4TA 5A4IS 3IEMA 1VCHA 1FZQA 1RKVA 4WIAA 4EVRA 4KYVA 2RGRA 4G84A 3UT5B 2WTMA 1VL2A 4YJGB 1SVUA 2VWPA 4KO3S 4D5EA 3KFLA 4BMDA 3A9UA 2B0JA 4Q9LA 1FXWA 2WYUA 3ESRA 5CYPA 1WHSB 5A4MS 1GSIA 3PSHA 3A1VA 4O08A 1JNYA 1JR2A 5P8WA 2REQA 2F2TA 3BXZA 4YJFA 3LA8A 2WHYA 4W8OA 4Y2TA 2Q28A 3PDCA 3OEHD 2BOVA 2YOHA 1Z07A 3PJGA 1ICIA 4QRIA 3V9PA 1N2CE 1O5OA 3F3KA 5F5LA 3BXGA 1W36C 1RU3A 2QM3A 4HP8A 1Q0QA 3NQ41 2D06A 3PQFA 3R7AA 1RXSA 4QG3A 2HHJA 4V1CA 3CO5A 5KTTA 2HMUA 3LW8A 1S7CA 4ZODA 4M8NE 4C7XA 3HEMA 3EEFA 5E8JA 5E9JA 4Z3DA 2G77B 4CG3A 4FW9A 4JYBA 1L8QA 1WM1A 1NMEA 1W0KA 3LYUA 2ODQA 4C30A 4CTJA 3AQIA 5G3YA 1NXQA 3HMKA 1NU8A 4MQMA 3KJXA 3DTVA 4OHZA 4EG1A 4HUQB 2VDQB 2Z4TA 4RF3A 5T3YA 1TT7A 4Q4LA 4M9SA 2WSSD 2AS0A 3DH0A 1YQEA 2H2IA 2IIBA 4M1SA 2A2ZA 1PE0A 4RF4A 1L1QA 2WIKA 4BFZA 5K0JA 1IXYA 5FIUA 1NE2A 1IXRC 1U8AA 2EERA 3IQXA 1PO7A 3LUDA 5AW6A 1EGQA 2A7XA 3I9JA 4X24A 3WO1A 3P27A 1ZISA 4A16A 3FX2A 3RS3A 1LBIA 3CZAA 2I78A 1BGXT 3H1FA 3GFGA 1EQUA 4AN4A 5C53B 3Q8LA 3C3DA 1JXMA 5KOYA 1KL7A 1WKCA 1ZLXA 5ADVA 2YJTD 4BJ5A 3TF5A 5TJ9A 1YACA 3SE0A 4WOBA 1PT9A 1I01A 4CQMB 2J30A 3DKKA 2WG1A 4ZOAA 5JVDF 3GVXA 3GH1A 4CW7A 1BOOA 1NQAO 3ASVA 4KO1S 4TS3A 2F4NA 3HTXA 2ZG6A 2YWRA 3OLXA 5CG1A 1V9LA 1K0FA 3QKWA 1JXAA 5IVDA 1K7XB 5KQPA 1Y89A 1A1SA 3HN2A 2VK1A 1Q1EA 5AJVB 3WIOA 2OQVA 4ZC1A 1VL1A 1SIBE 3TCKA 2I99A 2JARA 3B1XA 4GF5A 4NZYA 4DM7A 3Q5DA 2H16A 3VKVA 2H17A 1A4RA 3QELA 2QYSA 4OK3A 4YYZA 2JS7A 1N0UA 4KR6A 2XNDA 5BV2P 3BJEA 1IUOA 5J9FA 2ZPUA 3NTQA 4CF6A 1XKLA 2Z1DA 1YK1A 2CF6A 3HU2A 3MPUA 2JGNA 2J3QA 1PKEA 3FPSA 4H18A 4MPPA 1L4BA 4FDVA 4O4HA 5LQNA 3RS9A 3IULA 1DINA 1FNDA 1DXHA 2QQFA 1YJ8A 5IT0A 2E4XA 2WAOA 4U2FA 4FOPA 1VE5A 3V3KA 2C5HA 1IWOA 4DEVA 5C5DA 3OIFA 4JYZA 1RACA 3O3NB 4UE6A 1FLVA 2WLSA 3NW9A 1CC1S 2QVLA 3LT2A 4ZWNA 3RIHA 3DL4A 1PJ4A 4U2CA 3GFRA 1MJNA 4HB0A 3TKAA 4B87A 1EZ1A 5GJBA 3RU3A 1NASA 1UBTS 4K7JA 4U9UA 4BTLA 3GGPA 5BMVF 1ZGCA 1AT1A 1V5IA 2FEPA 3T7RA 2SKEA 4INZA 3T06B 4I50A 5JZOA 4FZ5A 3RG8A 1N2JA 4DKJA 5TVGA 4FGKA 2A33A 1YI0A 2XH8A 4FQ5A 5D7NA 3KTAA 4UQPA 1P2GA 4B3GA 3PC2A 4JUCA 5LOVA 3IP3A 4AJHA 2G07A 2P3SA 1WXDA 3GJ4A 1MABA 2WFLA 1Z6PA 3CVOA 4GWKA 3CX6A 2WJAA 1DVRA 1SH7A 4JP2A 3ZYZA 4E1AA 9LDTA 3GO4A 1ZUHA 1WHTB 3CX8A 1RYZA 1J99A 5K3CA 2YVKA 4Q1BA 4EYGA 1CUHA 4P7FA 3LS2A 2Y1CA 2YN4A 4GE0A 5JPDA 1U4OA 1W4AA 1GYQA 2HTFA 4F4DA 4X8OA 1KZYC 2C7PA 1JE1A 2A1IA 4EGJA 4NFHA 1NW4A 2A94A 2CW5A 3NBAA 2QK4A 1F4PA 1KJYA 1UL1X 3OLZA 3MWDA 1LI4A 1Q2XA 4R5MA 1TMGE 2F1KA 3ZUGA 4Q15A 4C01A 2XT9A 2HIAA 3NTRA 1KTIA 5LZ9A 2DTXA 3BIJA 3MUFA 2PGXA 4TLDA 3UAGA 4EBBA 3AUTA 3F8SA 2Q4RA 4Y2RA 3N2EA 5EYPB 4WGGA 4GI2A 2GK4A 3W5BA 3W8RA 2ZZKA 4HG2A 1V3TA 4O8ZA 3B3AA 4MR9A 2O7VA 1KO7A 4AJ4A 1X42A 5JDCA 2E4UA 3GA7A 4LJYA 1XTSA 1H4QA 2ZRNA 4ABTA 1IVYA 5REQB 1GIAA 2KBEA 3A9RA 1VE6A 1X92A 4DJEC 3H9GA 4FIZA 5CNJA 1DG9A 4F86A 3PNYA 2ZRFA 2CXRA 4IHJA 1ZYUA 4N82A 3ZVRA 1Z5OA 4F3RA 5ALXA 2E48A 1UFQA 4JFAA 1NKTA 1CUEA 1QHHA 1UJ4A 1V8ZA 4GSYA 4AECA 2LIPA 1CHNA 3KXKA 4DARA 1CVRA 1F0YA 4BNHA 4L8GA 5ERYA 3QVMA 4ZI5A 1FU7A 3CURA 3VYVA 5HM8A 3MOSA 1XHEA 1Q7GA 2F1OA 1GSHA 2PLAA 2PT5A 4MVJA 1DZ3A 1ONBA 4LYAA 5HZKA 4YQEA 4MMYB 1YTLA 4JQSA 2J3MA 3KPWA 3RWBA 1XLTA 2PMEA 1RZ3A 2C9BA 2OQ2A 5TSDA 1YVPA 4QJBA 3SIPA 2H1FA 3CUSA 3WB2A 4B3HA 3F3SA 2YWXA 2NO7A 3GP5A 1BWQA 1TZKA 1DTSA 4OQNA 4QG7A 5FUYA 4IIXA 3BRQA 1XIVA 3DAHA 1ZMXA 4UVGA 1U7WA 3W5CA 3ILSA 4HZUA 2C88A 4OJNA 4JN6B 1PFYA 1BW9B 2CMDA 1RNLA 1U1EA 2FUG6 4RQTA 5F9HA 2QF7A 3GQBA 4JQZA 3D2LA 3Q6MA 1FRZA 5KVCA 1V5GA 4QYXA 5TPWB 4PGMA 2G09A 1KI9A 4AKIA 4Z51A 1SURA 2UYYA 1DELA 3H5LA 4Y0AA 5A3RA 5JJCA 3H11B 3FVRA 4BMXA 1L5GB 3WOHA 2HQRA 4HN4B 1AZTA 2V65A 3FBGA 3TS1A 4BMVA 4KAJA 3EA5A 4JJZA 4R2XA 4GMFA 1S8FA 4BVHA 1FTSA 3USES 5AD1A 3PQ6A 4C7MA 4CN9A 3DPIA 3ABIA 3PHJA 5K3SA 1RDFA 4EQ6A 3L0DA 5C8VA 1GDHA 4QL3A 4N03A 2FFAA 3T1NA 2X13A 3Q7IA 2B98A 1L5FA 3ESBA 1QUEA 5K5EA 1L5SA 3TLAA 3EC7A 3INGA 4GOND 4J4BA 4S04A 2ZJ8A 3HKCB 1OIXA 1MT0A 5DIFA 1II9A 1Q1BA 1P4RA 1TLFA 4INPA 4TMZA 3SEFA 1AGNA 3IT2A 2VNHA 4MIEA 4P92A 1ARZA 4PG7A 4HWPA 1F38A 1NOJA 4RMNA 5NULA 4YAGA 3UFBA 5J4YA 2NSYA 4H4CA 1VFPA 2WKQA 2ZRLA 1ILWA 2XBUA 4IWXA 1H5UA 4AT1A 5AKJA 2B4QA 1G1AA 2OORA 5E4YA 5A5DA 1UDRA 2BTQB 3CH6A 5BSFA 1GAXA 3SBOA 3E84A 3H84A 1DC6A 4CTOA 3UM9A 3S8EA 3R8XA 1I80A 4F3TA 1Z4IA 3MILA 4MQ6A 5JZBA 1IQRA 2R6HA 3B51X 2NLOA 2ZSHA 4IW3B 2VP3A 3H2KA 1Y8CA 4OHVA 4MEJA 3OCUA 3DPUA 3N7UA 5JCOA 1V11A 5ILOA 1P6UA 2DUWA 2YICA 4LGMA 3L0SA 2PUDA 2Q2QA 3LZ6A 1DBPA 2Y2VA 5K3FA 5E6UB 4F8JA 1UWCA 1XQ9A 3QMVA 4ZA2A 2I4NA 1TD9A 3FCAA 3FHCB 4HOYA 4B6FA 5CLFA 4RLFA 2UYOA 2XQIA 5LBTA 1T5SA 4HLUC 2FPIA 5HK9A 1U11A 1RQNA 3P9NA 1XPUA 3HB1A 1KJWA 1V2GA 1GZ6A 2YNMD 4UFOA 1WOYA 4CLOB 3G2LA 4CI9A 2Q3EA 3RRJA 3DE7X 3QU2A 5GGYA 4A1OA 3IIJA 3KQUA 3Q3JB 4IILA 2CNLA 1EE2A 3I09A 3PHLA 4BTVA 1SMKA 2NVWA 2CE7A 3LLVA 4KNYA 4LPSA 1P0PA 1PNTA 3TQIA 1H3FA 3V4VB 4F2WA 2ZBGA 4HADA 3HXMA 1V4NA 4URXR 3FNQA 4WESA 4GZ5A 2PGJA 2ZB2A 3ABSB 1PG5A 1W0JA 3BMNA 3BCSA 4G26A 4KFTA 4U2DA 3RFVA 3HCEA 2P68A 4AZVA 1TT5B 2BGLA 2BEUB 2OG1A 2XDAA 2IYTA 2HRCA 3ZXSA 1UKEA 1MXFA 1S9DA 2QJFA 4OHFA 3X1YA 5BW5A 1LQTA 1DOZA 2EKBA 3RODA 4F6RB 4LBZA 2ETVA 1TE2A 4O8CA 5J2UF 1DCKA 2GJ4A 2H51A 1EXNA 3Q8WA 1SCUB 4Y1RB 5HVNA 2MSEB 2FSSA 2IZ5A 4GGMX 3C5VA 4R5HA 5CVCA 2J45A 2PX3A 4GC5A 1C5KA 1W93A 3ANYB 4EKNB 3GDGA 1LTQA 1XCLA 2MIIA 1Z74A 1TQ2A 4E1BA 4BMSA 1LPSA 3M1IA 3ND7A 4ED9A 4C2UA 1DMRA 1QMPA 4KIFA 1PGJA 3OJOA 4UUQA 1JEQB 2R11A 3MHPA 1YO6A 2JPDA 3KDAA 1UC4B 4K9PA 4R7ZA 4AP5A 4M6WB 1YQTA 4FONA 2J0EA 2YVQA 4MIKA 4WACA 3M3PA 3RK0A 3NAZA 3ZHQA 5IABA 3DP7A 4ZOQI 3O4HA 2DUNA 3OF5A 3OUUA 1UDBA 1GEEA 2IGTA 3DCIA 5I9IA 1CV2A 1JTFA 5A7GA 1E9AA 4G6ZA 1V16B 5EJ2A 1H2AS 4D6PA 4QWMA 1UC8A 1T29A 3CJQA 4LOAA 1AQIA 1XX6A 2JGFA 4OJTA 4QDTA 4UHJA 5AJXA 2FEMA 2XCIA 1Q7EA 3BGDA 4KPFC 3ZQUA 1SJ9A 4ZMSA 1I51A 4YXWA 5LN1A 4YUAA 2QN3A 2BR4A 2NXNA 1NOIA 1PJTA 3UXMA 1NSTA 2OXIA 4Z0PA 1NAHA 1FLAA 4JYMA 4AMZA 3OZGA 1Q19A 2XV1A 3CR8A 3V4PB 2QAGA 4EA9A 5BNZA 5JI2E 4YJ3B 2YFKA 5ELLA 3WFZA 5LD2C 3OP1A 4C4AA 4FQ7A 2M6KA 3FCSB 3I72A 1KU6A 4EUNA 4ARIA 3NDRA 2QTMA 2ADOA 3PG5A 1OFUA 1MH1A 4AL4A 1EXWA 1KARA 2B94A 1RQPA 3C1TA 1Y3BE 1KU0A 2ZRGA 5C7LO 2F17A 2ZKLA 1P80A 1DQPA 3WRWA 3WRVA 5BMVB 1NNUA 5E3HA 5BN3A 2WU0A 1WVGA 3FZNA 2A4KA 1K86A 1PGPA 4JLKA 5ALLA 3G5LA 1DTEA 1Y33E 3KBOA 3K72B 2GNAA 4QODA 4RQUA 3LBAA 5KTSA 1QHGA 3PR1A 1VL6A 2GAOA 1K8QA 4RMHA 4FC7A 1E5DA 4JSRA 1XD8A 5IHXA 1A5TA 4NENA 5ERXA 3TRDA 5HP4A 5TDHA 3B1YA 3RVBA 1F8XA 1ADGA 1G5HA 5JDIA 4UNPA 2TRSB 5LZ4A 2R8YA 1WPXA 3ZV3A 3S2UA 2OUKA 2VHUA 3OZBA 3I5UA 3RF7A 4EO4A 4POOA 3IAM6 2UZIR 3R0QA 4OQXA 4NNOA 4CMIA 5HKKA 2XUGA 3R9IA 2BUCA 4Q82A 4ARZB 2XZOA 4V3CA 3E23A 4BUCA 3SDBA 2ZT6A 4YO8A 3MXOA 5BPFA 1HDRA 1PV4A 3RV3A 1JNXX 3CPHA 1R9JA 3ZCSA 1HDCA 1YIAA 2Z2JA 3K9BA 2Q2OA 3MBKA 1T34A 5JG7A 2O5CA 1Z0SA 2XDWA 3P9KA 4KGVA 4L95C 3H2SA 4XWWA 4FOTA 4TZ0A 3STWA 1D6NA 2KE5A 3W7AA 2UV8A 1HLDA 4RZ2A 5BPHA 3AUSA 2DFVA 4GMGA 1SHKA 2F9FA 1IN5A 4WZBE 5F2KA 4CLRA 1OUMA 5KCMA 3V2IA 5KO2A 2YV2A 1KFCB 3AQ4A 1UMCA 4OB8A 2O8FA 1RHJA 2BM0A 2WAXA 4RXMA 4OQQA 3WE7A 1FFSA 1MQ9A 1S5PA 4C4RA 5K0EA 1TEZA 1MQ8B 3ACCA 2FU5C 5JSYA 3RSQA 5HTOA 4E2FA 4LECA 2E4ZA 2QD3A 4XOIA 3RD5A 1DWQA 2DQSA 5KDDA 4CI0B 3JD0A 4K6GA 4ENVA 4FEAA 4MKXA 3R0IA 8ATCA 5A5GA 2IWHA 5EAIA 4ER6A 3CNLA 4YP1A 4GL2A 1Q1ZA 4DJDC 2JCBA 3UAWA 4CCAA 2D54A 3ZNQA 2ODEA 2CXUA 3OPYA 2AXEA 4RH0A 3T5BA 3GFPA 2GEKA 3JZFA 4PZ9A 5AVJA 5FUWA 2JLCA 4BE9A 4C88A 1KFJB 3JZMA 2AWOA 2FPOA 4IDPA 1ATIA 1OREA 2PSSA 3FRIA 2ZETA 5BNFA 3DP9A 4ERXA 1X7XA 4B6RA 1EFCA 4HZIA 4Y1EA 2B8WA 5JWRA 4ENQA 3PC3A 3PQ5A 1YUNA 2XA2A 4L76A 5EQJB 3M4ZA 2WHPA 1XCBA 4TZTA 1QDLB 1G17A 1CUZA 2O1WA 2JCXA 3D7MA 3ZD8A 5F73A 1N0IA 2NP6A 2R4QA 5CPFA 4HN2A 4EIWA 1ZD1A 5HK8A 4RKEA 1VJ0A 4JDPA 4WY8A 3U81A 3V34A 3QE9Y 2IE8A 1BRMA 5ITWA 3PC8A 1IBMB 4FBLA 2Q2VA 3K8QA 4YREA 1YKFA 5CNKA 2JC3A 4MYSA 5EHZA 3GCWA 4OUKX 5B1YA 3PX2A 3WI7A 4EDFA 4URYR 4E3ZA 1VHJA 2WHRA 1UBGA 2PL5A 5T3UA 1RAIA 3BHMA 4W5HA 3RQIA 2C2WA 4A0GA 3U7QA 1EVJA 3B53X 3C45A 2HHHB 1SXJB 3PLNA 3N6VA 1SU6A 3TEFA 4WOJA 2OYCA 3LWZA 3PXBA 4QFDA 4HQOA 1WBBA 3L8EA 2H00A 4LEIA 4NBSA 4NEQA 4HUJA 4FB5A 3GR6A 1SC1A 4L51A 4X41A 3HY4A 1TAUA 4MVWA 4WXRA 2VTDA 3I01M 5ALTA 4C43A 1WV0A 1ZIPA 3TD9A 3UT5A 4YJGA 2CHFA 4MK4A 1Z4MA 1AIPA 2Y93A 4HLCA 2I1WA 6GPBA 1VJTA 2VSYA 4JR2A 2G4CA 4Q24A 3UJBA 1WHSA 3IE2A 5EFZA 3PUXA 1CY6A 1O5IA 2P8SA 1SOVA 3BN3A 5DOVA 5FJJA 5L4SA 5FTMA 1XWFA 4GWLA 4RESA 3V7WA 5JSFA 3QGMA 2HDWA 5E7IA 3HWSA 1ZA2A 2ZIWB 1J8DA 4WX2B 2VKQA 4LX8A 1LGYA 2ATXA 1LPOA 2R97A 1U7UA 2IJGX 4QJ5A 4XX1A 4U2KA 2WYOA 3GAFA 2JF0A 3FBTA 4R9SA 5DNEA 3EZ6A 3EVCA 4HATA 4DQUA 4TS4A 4EMTA 2HDHA 2PXCA 4NESA 4AKHA 4HFRA 4BEWA 2HHCA 3K6RA 4MW1A 4UVDA 3GJQA 3SS8A 4EKYA 4YJ2F 2WWIA 1V8OA 5ICFA 2XYRA 1T4BA 3ABRB 1JX6A 4FYHA 3SYKA 3WAJA 1MZVA 3I2IA 4JLAA 1QVRA 1HLPA 3IT0A 2OV6A 2OBLA 4I1RA 4GWGA 2CE2X 3S6JA 5LQAA 3GMTA 4ZRDA 3B8EA 4JX9A 4HUQA 3TIXB 1M2JA 3NG1A 4UZSA 1YFJA 1TKRA 3RVJA 4IJVA 1DFIA 4L7VA 3U09A 4PM4A 4YMUA 4DUYB 2ERYA 4G25A 4J90A 3I0NA 4E11A 3QPCA 3UW3A 2RHCA 2WB4A 3OO1A 4M1TA 1PZGA 4CF4A 1ZZEA 4EVIA 3FI9A 3DNMA 3PUYA 1FRVA 2BM9A 3BULA 4MA5A 3AMVA 2IYPA 1JLHA 1XSEA 3I61A 2GYVA 2XCRB 1WLSA 1B93A 2R7KA 2ZJ7A 3OLCX 2NZ2A 3OMWA 4RJ2A 1J00A 4FGWA 4CQMA 4EZIA 2AT1A 1JIJA 1XDDA 3KUXA 1R00A 4I9UA 1GGFA 1XG5A 2P9CA 1BJKA 3C70A 3G89A 4YH1A 5I5GA 2IZ7A 3WGUA 2RH8A 5EHNA 4M9ZA 1RHRA 1QIKA 3KQHA 1ES9A 2VK4A 1EM8B 3KEMA 5F3DA 1WAMA 2PN1A 1G19A 2EQ5A 4QEDA 5AVYA 3JZAA 4MHSA 1HT2E 1QYVA 2I55A 1L1RA 4PBSA 5D01A 3H5TA 5EP2A 2BLNA 2XNHA 4Y9TA 2PWZA 4JQCA 5C7OO 2XADA 3G6KA 4HAOA 3PTAA 5EA2A 1LV8A 1F60A 3M6MD 4KMMA 2CDRA 2OBFA 4DSAA 1C29B 2Z1NA 3E9EA 5TPZD 1MLDA 4W5QA 1U6IA 4YBZA 1FUKA 4GGPA 2AOWA 3EH2A 3KAKA 6REQB 3PPVA 4TL6A 3ETGA 2I2DA 3C43A 2AJ8A 4EKGA 5DN9A 1DOAA 2FW6A 4R05A 1XKXA 2FG5A 2PFGA 1YTUA 2IU4A 1IG0A 4EAQA 3ZZTA 1EUYA 2WIBA 2PJRA 1PSDA 1J8FA 1GRCA 2YXBA 4NDZA 4B4VA 4BUZA 1NW8A 1U90A 3GRYA 1PD0A 2ZIGA 3HP7A 4FDTA 2GAFA 1C8BA 4P4GA 3OQPA 4KO8A 2IV2X 1CQPA 3PHGA 3W4IA 1F0NA 4M86A 5HIJA 3O1IC 4NAHA 4MGYR 1C3LA 2GK7A 3CT6A 2BEWB 1D5CA 1TGVA 2B2NA 4P8RA 1L4NA 3ET4A 2R7NA 4BVBA 4ENSA 2AUTA 1KR2A 2W6ZA 3R1IA 1XTKA 5JDCC 1ZOPA 3A1CA 3LXMA 1V7ZA 3L8FA 4PN7A 5BQXA 2GF2A 2JGJA 1J25A 4OA8A 5CITA 3I30X 5KTPA 4ZAGA 5E8RA 5BN5B 4LJ4A 4UOZA 5KHOC 3OQIA 3AI2A 4PC3A 3QY0A 2QNBA 5CVTA 2FY8A 3ZGYA 1UOOA 2NNWB 1T3LA 4YB8A 5EKDA 4PTZA 2RGEA 1WHTA 4RTRA 2WM8A 5E2AA 5LP6B 1E9VA 3CB4A 5DM4A 2W6ID 1DDIA 3GNLA 3QWHA 3MHTA 1JG6A 3KL2A 4S12A 1X1BA 2X0JA 4QPPA 3IIMA 4IZIA 3S44A 3A3KA 3H3FA 5I9TA 4DUGA 1NFFA 1XTIA 4JUAA 3KB6A 2X77A 2EKQA 1NQ5A 4RORA 2WI8A 4AMGA 1UKBA 1XLTC 2B8TA 2VYVD 3BBPA 4I3GA 3WTBA 1W46A 2HQOA 1WTAA 3ENKA 1TK9A 3FZGA 3LC2O 3OY7A 5EQTA 2DAPA 2YYAA 4ZKEA 5EYPA 3W2GA 4GM0A 3TDNA 3KYJB 3I58A 4TRJA 4MQBA 5FLKA 4CM9D 4FM9A 2NM0A 2GTIA 2GXSA 1VIMA 3CZ4A 2OCDA 1LNQA 2J08A 4G65A 4TYPA 3W78A 1O87A 2QL7A 4D80A 3OTWA 5CLHA 4A27A 4OJKA 5MHTA 4V0SA 5REQA 4KQ9A 2JD2A 1Z4PX 4PFSA 3MS4A 3E05A 3JASB 3O84A 2FG7C 2ZLBA 3HFGA 4HB2A 4F2GA 5LIRA 4LF6B 1RE1A 1Z2NX 1SHTX 1MC8A 2CV1A 1C9NA 2IXTA 1T10A 4NIMA 3NBKA 4L9WA 5M2QA 1JN0A 4KX3A 5LZ7A 5JUWA 3FR8A 2PZEA 4GI7A 4BFCA 3DG9A 3G59A 4LHVA 3DMRA 3ETDA 4X84A 5AO9A 1TVCA 2FR8A 4GVXA 2QMZA 4C08A 2QVXX 2VUSA 5HOQA 1FDRA 4E5DA 2QLLA 3FUUA 1CQIB 1SC6A 5IAEA 2QLFA 2XQFA 2GM5A 1W73A 2GPSA 4MV5A 2PXXA 3PPXA 1O0SA 4ZTBA 6LDHA 4ZPXA 4I5GA 3FZYA 1EGVB 2NIPA 1UAGA 3NWEA 1HT1E 1XUOA 2R8ZA 2WF8A 3H4IA 3W8EA 3F4BA 1RXCA 1WETA 2H1SA 4I36A 4P93A 4RADA 5EMKA 3LBHA 2OE2A 4MW9A 2NT4A 1BW9A 4L22A 5EI5A 3M49A 2CHGA 3BCRA 3MXTA 4MP6A 2ALJA 4NS4A 4BVLA 1E32A 4B4WA 4JENA 4NYIQ 2ONYA 4Q6WA 2VC2B 3E15A 4Q12A 1CUVA 5TPWA 2JJYA 1G98A 3D2BA 3G5UA 1C9EA 3JYHA 4HTAA 4IKPA 2GAJA 4W7SA 2OORC 4WEOA 4BEVA 2FX5A 4BV9A 3H11A 2QT9A 2Y2UA 3ZVLA 1XMOB 4R81A 1L4EA 2GH1A 4EHBA 2NNLD 4QRDA 1M6YA 5FTNA 1WMAA 4GYYA 3V2GA 1IHPA 1T9BA 4A8HA 5BSEA 2OECA 1BDHA 2AEMA 2JL1A 4GEGA 1L5LA 4NLLA 1PJSA 3P9RA 3VR2D 1KDVA 1JDZA 2ZBDA 1KKUA 1LLUA 7MHTA 1ZKDA 4BUJA 3NIDB 3OT5A 2WJPA 1XBTA 3QX7A 1SCDA 1SUBA 3R5TA 1EWTA 4L07A 2WP0A 5T4BA 5K8UA 1IB6A 1EP1B 4KIJA 2JFXA 4E5VA 2IUSA 1X0VA 3BMQB 3GOHA 2P9JA 3T1YB 2FOLA 3AR8A 3JVUA 4HO1X 4MA0A 3EG5A 1JW9B 3HKCA 4MOWA 4BLPA 5BWNA 4TYWA 2XIQA 1YDHA 1EK0A 2GO7A 2P30A 1FK8A 3ROFA 3T8YA 3UMBA 2GI4A 2B5VA 1JZTA 3C97A 4FR0A 4G4SO 2OZVA 1BE0A 4A6EA 1N6LA 2BWJA 3QXJA 1KGSA 1EWVA 1Z29A 2X76A 1U3FA 3BXPA 3DDOA 4KYUA 4RD3A 2W93A 5CPBA 5KDLA 1H6DA 1P8AA 1EDDA 4E70A 5A0VA 3ND9A 3LO5A 2BTQA 2UYQA 2YFQA 4WCVA 6PFKA 4BGDA 2C07A 3G2HA 5D51S 3ND6A 4JQOA 3VZDA 3OZWA 4GDFA 4XRRA 3GD5A 1Q20A 1ZI8A 2VRBA 3P9PA 1NXVA 3TVDA 4EYEA 1JU9A 4PO9A 3GAZA 4N0MA 1F1BA 1WXWA 3R9WA 1USKA 1OMOA 1XRQA 2HSEA 1CUSA 2KHZA 2XT6A 3BE8A 1R6TA 1Y3CE 3NFYA 3QKRB 4JVLA 4NXMB 1QG0A 3VJKA 4HNTA 2FPKA 1H66A 4BO7A 4RCYA 1SRRA 3G88A 4DLKA 1IFXA 3VO2A 4QOSA 4J76A 1U2SA 3ANMA 1E6KA 3D8BA 3EUWA 3NB0A 4HJXA 4M1EA 5E6UA 2NMVA 1N5KA 3KQWA 4FSDA 3B60A 4C4YA 3EZFA 3MA0A 4HMQA 1VI5A 1DXQA 1SR8A 3OOHA 1X3LA 2R60A 3KPUA 2NU9B 1OROA 1XWIA 2XAAA 1N2GA 2EZ8A 4M1YA 4PSCA 1CUFA 3OIUA 3IKMB 4B31A 4CLOA 1WKVA 1SVNA 3K4QA 4BFVA 4UDOA 4UCXA 2PPVA 3HB4X 3O2SB 4BPBA 1ZCFA 4NVRA 1SN7A 3L7LA 4YJ2B 1C3VA 1YS4A 1Y5MA 2ZSJA 3EAQA 4QE3A 1ILEA 4MQFB 1F51E 3CLRC 3EQ9A 3W2HA 1ZH6A 1UXJA 4RVNA 3C8DA 3ABZA 4YFVA 4J0EA 1K27A 3E3AA 4U4AA 3O5AA 4B73A 3JARB 5BQOA 2CZGA 4CIAA 4GE3A 4U3JA 2VDPB 3I5MA 4OQZA 3KU4A 1A9ZA 2OQIA 4YWJA 4Q7MB 1GTL1 2E21A 2GF9A 2X0DA 3SR3A 2F67A 4LDQA 1X8XA 3A28A 1VPWA 5DN6A 4KXYA 1NM5A 1TT5A 1Z73A 2BEUA 4IHAA 4TVBA 2O0LA 3NUQA 4HWOA 4HAWA 1W75A 4NV3A 1MA3A 2JGRA 4XD7A 5HZGA 1I36A 1ZUIA 4TTRA 3AUAA 4U6QA 3O9VA 3IBCA 5L7WA 2CLOB 3OLQA 3SYLA 1SCUA 3GCDA 4Y1RA 3KYDB 4EGCB 1K6EA 5HJ2A 2QAGC 3INRA 1GLNA 4JDUA 2AZDA 4RABA 1T35A 1USUA 1LBHA 3BWBA 4TTPA 4UHKA 5DKFA 3MGBA 3LP5A 4MDYA 5LYYA 5DHSA 3K5WA 3P71T 4MVJM 4ESVA 4MINA 1VI2A 1I2MA 3DVSX 3G6WA 4TMVA 2JJ1D 3C85A 1JEQA 3M4NA 4M1QA 3U3DA 5FA5A 5U4XA 4M6WA 5K05A 5ED4A 2QZZA 2WMOB 4KDRA 3L0BA 4KYIB 4MWZA 4HNUA 16PKA 3CLSD 2OC4A 1E96A 2VWHA 2YHIB 4LBWA 3CVWA 1G5RA 2B82A 1Y9DA 3CKKA 2XKKA 5LMUB 2D59A 3ELUA 3G9ZA 1V5FA 4GI1A 4LAFA 3ZOKA 5THQA 1L5NA 2ID9A 1TTHA 1G5QA 1V16A 1R27A 1ZJWA 2GPYA 3EIUA 1PP4A 4N0EA 2VNSA 1JV2B 3E18A 2JIDA 2JVKA 3AILA 2ON6A 4UBJA 2VJBA 3PX7A 2IUYA 3KZMA 3PICA 4J29A 1NBWB 2G5GX 1F8YA