4PRZA

Caspase-8 specific unnatural amino acid peptides
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
240
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-8
publication title Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 240
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4przA00
1RWNA 3NR2A 5LUAA 2NN3C 2QLFA 5IAJA 3S70A 3DEKA 1QX3A 4JJEA 4JR2A 4ZVTA 3IBFA 3V4OA 3DEIA 3OD5A 4QUBA 4HQ0A 4FDLA 4QUEA 4ZVPA 1ICEA 2XZDA 2C2ZA 2Y1LA 4NBLA 4DCJA 2HBRA 2CNLA 2QLBA 2CNNA 3H0EA 2Y0BA 1K88A 2K7ZA 3GJSA 3R7BA 4QU9A 3IBCA 4N7MA 3EDRA 1KMCA 4NOJA 1K86A 3V4LA 2XYPA 3GJRA 4NOKA 1RHKA 3V6MA 1I3OA 4JR0A 1PYOA 4QUJA 1SC1A 3KJQA 1CP3A 3UO8B 2P2CA 4NBNA 1NMQA 1NW9B 3H11A 4N6NA 1RHUA 2H4YA 3R5JA 4ZVUA 2H48A 4PRZA 4ZVOA 2QLJA 2H5JA 2CNOA 3V6LA 4D3ZA 5K20A 1I4EB 5LU8A 2H51A 1RWWA 4EHHA 1F9EA 2H54A 4QULA 1SC3A 3KJFA 3PD0A 1RWVA 2DKOA 1M72A 1QDUA 4QU0A 3R5KA 4JJ7A 4EHKA 1RWXA 2C2KA 1QTNA 2H4WA 4QU5A 4QU8A 3D6HA 4NBKA 3PCXA 1SHJA 3NKFA 4JJ8A 4HVAA 4NOLA 1SC4A 3QNWA 4M9RA 1RWOA 4FXOA 1CVRA 1NMSA 4EHNA 4EHDA 3PD1A 5LU9A 4QUIA 5IC6A 2FP3A 2H5IA 3D6MA 5H0IA 1I4OA 1RWMA 4ZVSA 2QL9A 3E4CA 4QTYA 1RHMA 4EHLA 3GJQA 3BIJA 2XYHA 2QL5A 1GFWA 2C2MA 2HBQA 1IBCA 2FQQA 4QTXA 4ZVQA 3SIRA 5IBRA 4EHAA 3D6FA 4N6OA 4EJFA 3S8EA 5JFTA 2CJXA 5IBCA 5IAKA 3R7SA 3V3KA 1F1JA 2XYGA 3R6GA 4FEAA 5IC4A 3NS7A 1GQFA 4N6GA 4QUAA 3RJMA 4AWAA 2CNKA 2J32A 4D3XA 1I51A 2J31A 2HBZA 4QUGA 3R6LA 4N5DA 2C1EA 2WDPA 4JB8A 2HBYA 3UOAB 3ITNA 2CDRA 5IBPA 3V55A 2C2OA 3SIPA 4DCOA 3DEJA 5IASA 4I1RA 2CJYA 2AR9A 4IEFB 2J33A 5LUBA 4NOMA 3H11B 4JR1A 4PRYA 1JXQA 4ZVRA 3R7NA 3P45A 3KJNA 3H1PA 1NMEA 4I1PA 3P4UA 4N7JA 1RWPA 5IARA 4EHFA 4LSZA 1RHRA 2J30A 4D3YA 1BMQA 1RWKA 1RE1A 3H13A 2QL7A 2FUNB 2XZTA 4HQRA 4JQYA 2H65A 1RHQA 5I9TA 4QUHA 5IABA 3DEHA 4JQZA 5IANA 3K7EA 4AWBA 1RHJA 4FGUA 4PS0A 3GJTA 1SHLA 5IAEA 3EDQA 4PS1A 5I9BA 4DCPA 4QUDA 5IAGA 4AW9A 4IYRA 1PAUA
chains in the Genus database with same CATH superfamily
1XOIA 3Q3IA 3ZTWA 2O0MA 3GLHE 1OLOA 3ZWVA 2V7UA 2X0KA 1VP9A 1G5PA 2VUUA 3TSYA 1LJLA 5JZ9A 3CHYA 3CF4G 1ZNXA 5TEVA 3X1KA 1UPUA 1UIRA 2G0AA 2JAOA 4FMPA 2Y1CA 1BFDA 4G1MB 1W94A 5LM3A 4O2BF 1FX0A 1JR3A 4Q82A 5FHRA 5BMVB 5JY1A 3OIYA 1MB9A 3L43A 3BGVA 4RZ2A 3VPDA 1M2FA 2C3YA 4PANA 3WLMA 2VT3A 3TR5A 4QBKA 2WT8A 4BRUA 3S2FA 2VWHA 4GOND 4GMGA 4BLQA 1V5WA 1J8DA 2GYVA 3EAQA 2P5YA 2V5AA 2IBMA 4GWGA 4KXUA 5I9SA 1E0KA 3A58B 3I5AA 3F97A 3FMGA 4FFSA 1HOTA 3OJ0A 5DLYA 3FCCA 5J4KA 1ATZA 4FFWA 1RP7A 4Z1MA 3VPAA 1WZEA 4G0XA 3UJPA 1E9AA 2X5XA 5K0SA 2FH5B 2YDYA 4RUKA 2CXOA 2RJNA 2MSCB 4JBXA 4OJMX 5AIBA 4KUEA 1FMTA 1JHVA 2FX2A 3R5KA 3R9WA 4IVNA 3LP8A 4H6WA 4NCJA 1SG9A 1WV0A 2WHEA 3AL3A 1TZKA 2YY6A 4F4CA 3JYHA 3PQCA 2FPIA 3FROA 1KQNA 1QZXA 1YTLA 1LPNA 2C8KA 2QZJA 1HLGA 3A9SA 2WR8A 3ILXA 4NBWA 4JYAB 4BNKA 2QRZA 4IDPA 1FQWA 3K0KA 1RLUA 1WY7A 2V7XA 1ZCAA 3S2YA 1IPEA 1SD1A 3UVEA 5L4LA 4AQ7A 3O4FA 3DF9A 2K4MA 4IWNA 3FFBA 3SXPA 4CT5A 1L1RA 4EPVA 3NDBB 3FVVA 4MIOA 2GN1A 1DC3A 3KWJA 4PG7A 2NO1A 3C7TA 4YAUA 5HKBA 3R0ZA 2ZYWX 4ZRMA 1OTYA 4OL9A 1VKHA 3NDPA 3TTXA 5AKKA 4B4KA 1KL7A 1RQ7A 1Y5LA 3K1YA 3BMQA 3AOEA 3W04A 2CD9A 3COPA 4UOEA 5H02A 4HTAA 1HK7A 5FD8A 1BJTA 1ZM4A 4YR9A 4RMHA 2C99A 3W2IA 3ZJVA 2JVKA 2RB5A 2YZKA 3C1OA 1RXYA 3DE0X 2HHJA 1H5QA 2JJQA 3OZ7A 1WNFA 4M0DA 4BO8A 4IQ4A 2JKYA 2RC5A 3HGMA 2JHCA 4XM0A 3V2GA 3EA0A 4RGVA 1OFVA 5EHQA 1FTWA 2DWUA 2QKYA 2CJYA 2XQFA 4Q02A 3U80A 3D2BA 1AHHA 3PLNA 3TG8A 5L95A 4QIHA 4B2IA 2WQ7A 5DLPA 2EFDB 2V98A 4LV5B 1VJDA 1UZNA 2DPHA 4G4SO 5AK0A 5AM5A 4A16A 4B71A 3PICA 3KVRA 3P4UA 4G97A 1USWA 1D2NA 2XCSB 1CRZA 2Q8NA 4KQJA 5AUOB 3TM4A 2FZ5A 5FWYB 2OXFA 3PFHA 2E1PA 3VAAA 2WVJA 2DTEA 2UYGA 4BMPB 4WY2A 5KWJA 4ZANA 5AXAA 4PWYA 4HYQA 2NO7A 1C14A 5HCNA 3ROPA 5BW8A 4P32A 1NVBA 1XDUA 5KTRA 4C7OB 4PYIA 2FEKA 3A7DA 5CIQA 4BE4A 1C3VA 4INJA 3EPHA 1D7AA 1LVUA 1QJ4A 4MKXA 1U7TA 1X2BA 5LDGA 3VV2A 5C5CA 1V5FA 4KYTA 2YN4A 3BQMB 2ZB4A 2Q5HA 1UBFA 3MFQA 1GJRA 1D2HA 1X8LA 2ZXEA 2JGRA 3IPYA 3LPLA 4ZOBA 1II9A 3TYXA 4ENTA 2FMHA 2C9MA 4CI9A 1WBDA 3T3EA 3ZWMA 1NW6A 1NPTO 5MDHA 3U09A 4RSMA 1R0ZA 1VRCA 3JQFC 4H1UA 5ABPA 3GL9A 3I5UA 4DMGA 4OXYA 4TZTA 3KZKA 1NP7A 3SMVA 1V47A 2VHEA 3HP7A 3LZDA 4OQLA 5F2KA 2CHVA 2Q07A 3MQ4A 4PHCA 4YCNA 1L5RA 4Q37A 4U5XA 2ANCA 1NZFA 1P80A 1Q1BA 3NIDB 3TRJA 2LKCA 5K6RA 3TG2A 4F97A 1GM5A 521PA 4GS5A 4CNQA 3STWA 3RROA 1OA1A 3A3PA 1A9YA 4PYMA 4FLEA 1C81A 1NR7A 2ZUUA 4IINA 5GJCA 2Z6VA 1U4OA 4WK6A 1J1IA 3ULKA 1P0FA 1OFUX 3FKSD 2ZYAA 1UKBA 2XMBA 3I01M 4NS4A 1A9OA 1X1AA 2NSDA 3B6IA 4C22A 1ISIA 1MJGM 4MW0A 1A72A 2N47A 4G8BA 3T9FA 3N87A 3PQ6A 2QRVB 5EESA 3C1AA 2BH2A 3OWOA 2BZ0A 3D6HA 4EW1A 4O4JA 4DOMA 4NL4H 3NG1A 1P6XA 4MI1A 4RVUA 5AVXA 2I9KA 1Z5UA 3ABIA 4RWZA 2CXNA 4IJ5A 3ELDA 2QUHA 1W0CA 3PFIA 4HDMB 4X6LA 2I6GA 4QYTA 1OILA 1Y81A 3E5HA 4LXIA 4FFVA 4UHJA 2VYND 2P9ZA 1LSUA 3IVXA 1W59A 4P84A 1B8VA 4IWYA 5IDXA 3PLAE 1RM0A 2ABWA 1M8PA 4IVRA 4CLRB 3FWYA 4LRXA 1GQOA 1UQRA 1D7OA 3E58A 1K7EB 1P7CA 4OKIA 4QL3A 4ABYA 1H8EA 2G0TA 3MRTA 1I7PA 2UVPA 5BPHA 5BUSA 2NP7A 1CHDA 3ANSA 3K05A 1XZAA 4D0SA 1E63A 3HSKA 4UNNA 3KWLA 4ILKA 4ACBA 2Q4RA 3V4ZA 1W6RA 2IF2A 5CYPA 3TS1A 1GR1A 3BERA 1KAGA 3AO0B 4ZFNA 2OZLB 2GETA 3V2HA 1YOVA 1UXJA 3RYCA 4ZYLA 1K9SA 3GRAA 3TB4A 3MGBA 1EGHA 1RAAA 4IDGA 4RS4A 5CBPA 1O5TA 2M1XA 3TTTA 3GR6A 1E7RA 1KPIA 3A6EA 4M1EA 4NF2A 2WKPA 2HTEA 2YQ5A 3IAXA 2IKQA 1I2MA 3FYUB 1K8QA 4G2NA 1AUQA 2JJMA 5BQOA 2JFHA 3DCNA 4IEFB 2R6CA 2CUTA 121PA 3TSZA 4F06A 4HZIA 2GBLA 2EFHB 4WD3A 2XE4A 2EJTA 3T7CA 2NWQA 3RG8A 3RF6A 1NBAA 1EDOA 1O5OA 4UVDA 1X3LA 3BL5A 4DMHA 3ETNA 1G4HA 3FBGA 1PT5A 5KQLA 3W5HA 1NFQA 4HEHA 1ES9A 4MWOA 1DWUA 4IDQA 2AHRA 3T4UA 4N76A 3VR6D 3BN3A 1JG7A 4DNQA 4XOUA 2OYCA 2XQKA 4HAZA 3CNLA 3BFPA 2ADMA 2BWJA 1ZVQA 1RXVA 1ID1A 3GRUA 4G2TA 4MGZR 3M33A 1Z4PX 2GHQA 1G3IA 2UZAA 3ZW8A 5EUBA 1SCJA 1XKTA 1NTRA 4IJQA 3TQHA 1XZHA 1MOZA 1W36D 1YJCA 2ZJ4A 4GKAA 2FN3A 1FOEB 1EDEA 4DMRA 3H5LA 4OH1A 3PQEA 3OD5A 4OB6A 1VG1A 4L76A 4W1SA 4BVHA 2NO4A 1YZQA 2NV0A 2Q1UA 1RQPA 4W9NC 3I45A 4UTPA 1I7LA 1P9RA 1T8SA 1R8XA 2W5UA 4I55A 4DS3A 2HRCA 5KYNA 3OLVA 3LECA 2V74B 2IWRA 4HLUC 3CB2A 3ZX4A 5EWMB 4K8RB 2J41A 1DBRA 2A84A 4IUYA 4Q7MB 2ZSEA 2WUWE 3P2YA 4LRYA 2G71A 3ZE6A 3H9EO 4H3SA 1XCMA 3WLSA 4DJEC 3I37X 4KQKA 1FCJA 2CZCA 3AYZB 1WUYA 3RSOA 1EK5A 3CZ5A 4NX2A 1K66A 1IWOA 1UF9A 4OEHA 3L84A 3B7PA 1AN9A 1V7PC 3COSA 4G37A 4KAAA 5H3LA 1TGYA 3FPEA 1JFLA 3FUVA 4B47A 3SJAA 3VVLA 2O2DA 2OXCA 2PZBA 3OZWA 5FV7A 1P4GA 1L7MA 4ZREA 1DUVG 5FOTA 5KMGB 2JAWA 3B6MA 1QIEA 1V8OA 2W2KA 2O7SA 1X86B 5EAIA 1G5IA 5CLLA 1AQUA 4KMRA 4TSKA 1O6BA 4Y0NA 3INTA 3PQ7A 4EVRA 4N18A 3AEXA 3FHTA 1A88A 1YC2A 4B73A 1CULC 2GF9A 1VL8A 4IJMA 4P34A 1XZLA 3R3WA 5HUJA 2WD7B 1ATIA 1FA9A 5DM2A 2HC9A 1JILA 3FN4A 3OCZA 3W5VA 3ER8A 3D6FA 2R7KA 4NICA 3DFUA 5D5PA 2BHSA 2HF9A 3JQ8B 5EKXA 3PEFA 3WIVA 5LZ5A 4KRGA 3ZD8A 1ONPA 5LFAA 2JLZA 1NM5A 4RHYA 1TVKB 1J5EB 1FUIA 1EDBA 1N2BA 5EJ8A 2Q41A 4DR4B 2Q3DA 2KPOA 3ND9A 4XX1A 3LNCA 4J07A 2XOEA 1QYDA 2HBZA 2BMDA 4WFQA 3RT1A 1ZNWA 5B1HA 4A0SA 4OLAA 3QLUC 1JXOA 4U7GA 2V6GA 1ONNA 1QVRA 4EB8A 3KG2A 2FR0A 1PRYA 3C98A 1YJQA 1CF9A 1GO2A 3L8GA 3SQMA 5B1YA 2CCGA 5T5QA 3A4YA 4LTNA 5C7LO 3UMBA 1COWD 1WSWA 2IE0A 3IAS6 1H85A 4AN4A 1UWVA 1DUSA 4UCFA 2X1VA 3AFGA 3PEUA 1GAWA 4JCCA 5ENVA 2UDPA 2XIQA 3N0VA 3FSEA 4YRPA 1DHTA 3VX4A 5AD1A 4RO0A 4XGNA 4U2GA 4BYGA 1KC3A 1NAIA 4XGKA 5F64A 3K73O 2H65A 3ZWAA 3EXEB 1CY7A 5LYJB 3KQOA 2QTVB 1YD7A 1P6QA 3N75A 4PC3A 2ZOSA 4HDMA 2PL3A 4HUQB 1B14A 5A5VA 3COYA 4MVJI 5L51A 4X1KA 2H7VA 2BV3A 2PCJA 2J9RA 2ZUDA 5IJAA 3NTOA 4D5GA 4Y1GA 1XQ1A 2AN1A 1ELOA 4KXLA 1RIIA 3WHIA 1D4OA 2GCOA 3T9CA 1C5KA 1LX7A 4WECA 1KYVA 2JEZA 5EQTA 1SOAA 3KZOA 4JYMA 4EJSB 5LXTF 2X3UA 4CEIB 5TPZA 2P2LA 1PJAA 4KC0A 2HMWA 3EFHA 3UT5B 1BE6A 8ABPA 4MVJM 2C4MA 2I4IA 3EZXA 4WKCA 2P4QA 4FCWA 1KDVA 4ND3A 5C35A 5IXSA 1X8KA 1XU9A 2O6LA 4CF3A 2DETA 1L5KA 3SYRA 2CXRA 3QVXA 3U3DA 3EGEA 1JEAA 1PK8A 4WZAA 1Q7GA 4D26A 3GEEA 2QRMA 1E1YA 3A1EA 1LCIA 1IY9A 1UPAA 2GARA 2H57A 4WZBE 2IOFA 3ZCVA 3FYUA 1RI4A 1UM8A 3E84A 2Y05A 2G4VA 2HUNA 2GVNA 4RAQA 3EZ7A 1XYGA 3AG5A 3SHQA 3C3JA 5SY4A 3IHLA 4TUYF 3SI7A 2XBUA 3SR3A 5B4VA 5I9NA 1KQFA 2CNOA 1B6GA 1V1MB 4BBPA 4DZRA 1LTKA 3R8CA 3T4PA 2OHVA 4QTZA 5JJ5A 1I5RA 1M33A 2Y1XA 3GEHA 3QLJA 4K6MA 2XUDA 2HT6A 3NHSA 1UBNA 3ZDQA 5CX1B 5ALOA 4DANA 2R3SA 2QW8A 3RUEA 4A92A 4ARZB 5KJEA 3I0NA 1KDZA 2R4TA 4OLBA 2FCRA 1QHXA 4X24A 3TZHA 1XGKA 1LU9A 4LYEA 1YIDA 4FCTA 3ETGA 5L53A 3JASB 3WBKA 1U99A 2QVBA 1B93A 3E9NA 5IC6A 3GVIA 4R3UC 5IJZA 1YFKA 3T3PB 3AU9A 3IIKA 2NU9A 4V0KA 2NVBA 3A1DA 2Z8ZA 3GJQA 4EHLA 1JFTA 4HXEB 3HFRA 2CV0A 4QDXA 4EDFA 1KY5A 3FCXA 2UZ0A 3PNBA 2C5AA 4H0CA 4D4LA 1Y6GA 3QTBA 3QVGB 1B74A 3NDJA 1QCDA 1YDEA 2BKAA 2OSBA 3SJZA 4DIKA 1A95A 3IKTA 3AEQB 4FGKA 4NCBA 2P78A 2A9PA 1PJLA 1USKA 2PXCA 1RAEA 4G5RA 2YHBA 5FR1A 4WOJA 1KYXA 5A05A 1DKLA 1R0CA 2C20A 3LI2A 2I03A 2B1JA 3GRYA 4NJEA 2VQDA 4QUGA 4ZHQB 2E2WA 2O1XA 1F6DA 2HWXA 1B6RA 2IT1A 2XCUA 3Q1KA 5ADVA 3AHHA 3I1JA 1JL3A 3QXXA 2FZ4A 5G41A 5HDBB 3IAHA 4YREA 4Z4HA 5C5IA 1MC5A 4R1TA 1LC3A 2WF5A 4OG2A 1ODCA 4CKEA 1RJEA 2GKSA 1SOVA 5T6BA 3AJ9A 1O4WA 1WX1A 5DRYA 3ERCA 4LDNA 1R3DA 4D8XA 4NYMR 4G1UC 3W06A 1V35A 3S7ZA 1BH6A 4C0WA 2B5VA 1FU7A 1XT6A 2DULA 1VBKA 4S24A 1NR5A 2C7GA 1Y3AA 1ST3A 4G24A 3V4VB 3D64A 1SA0A 3GWGA 1AURA 1NOKA 4F45A 4N3BA 1ENYA 4FGZA 3G0IA 4TZ0A 1PVDA 4Q15A 2QX9A 1S8FA 3NLLA 1Y98A 2INGX 3Q3CA 3T12A 1ZCBA 4QPCA 2WD7A 4LGVA 2W48A 1YJ8A 1PT7A 3PRKE 1G2OA 1QH8B 1Q0PA 1WEKA 1GCGA 2IJGX 2QQ0A 3MM4A 4Y3UA 3VNBA 3NATA 3SZLA 5L3SB 4EJ0A 4DQLA 1H0SA 1MBZA 4Z7NB 2AJTA 1WTCA 3A3NA 4HAWA 3JQ8A 3LCVB 4MGIR 2O8VA 2R6GA 2JFQA 2WU4A 3E9YA 4ZVPA 5IN4A 4DV6B 2QSZA 4OFBA 2DWOA 2D74A 4YI3A 2WIJA 1PYDA 3UB3A 3FJ1A 5JSFA 1M76A 3S29A 2ZWOA 1CIPA 1NKSA 2XMPA 2OE2A 3EA5A 1DEKA 4TKMA 4XRRA 1W36B 4RF2A 5K0NA 1ZEMA 2ODWA 2N0SA 4CV1A 3QE4A 2R6HA 4NXNB 4EB6A 2PJZA 2GN2A 3I6ZA 2PGJA 1AQLA 1N9GB 3ASYA 3CGGA 3RRFA 3ANNA 3DKIA 4V1CB 4P5DA 5IVHA 3C24A 3KAKA 1J8VA 1FUUA 4FS3A 4LJ5A 5BR8B 3RODA 4DEYA 2WHQA 3ROEA 4JITA 3RM3A 2GAOA 3FOAA 8LDHA 2QLMA 2B20A 3HACA 1ACJA 3EXEA 2EJBA 2ONKA 4EYSA 1QH9A 4DGQA 2GI4A 5LQCA 2FWJA 4GMFA 4MX8A 4Y7CA 1Z45A 3NKFA 3HXKA 13PKA 4MIYA 5C37A 2HA6A 2P4EA 1ZN2A 2GZSA 4OQPA 4QGAA 4YJKA 5HUHA 3SPXA 4JBGA 5K3CA 5A71A 1S2MA 5A3RA 5EJ5A 1XZJA 3WLKX 2H5IA 3DV2A 1GPAA 4TL7A 1K4KA 4YGXB 1L6IA 3HQ4O 3WK6A 2ZR7A 2X2OA 3QKRB 4BRWA 2YVAA 4GGMX 5DNAA 3UCFA 2BM1A 3KWFA 2E49A 1U8TA 1DDIA 1RWBA 1QF9A 2EEPA 3AZQA 3CPJB 1FZQA 2G36A 3FTPA 5FO1A 3SIRA 3S1AA 1VHJA 2G25A 3PEVA 2A86A 1R66A 3IQFA 1JTEA 3LW7A 1XDBA 1AKQA 5JATA 2D5CA 1FDOA 3WSVA 1B8OA 3UMSA 2A0UA 1W52X 2JIBA 3M2PA 4BS9A 2QTRA 3I2HA 3PBKA 1M1YB 2BR5A 5BVGB 1KRXA 2XB2A 4EJSC 3PVSA 5KYTA 3THXA 3C5VA 3S4YA 2WDPA 2ZUSA 2D3WA 2XYQA 2IIVA 1UBLS 2WT9A 3SEQA 2ZREA 3UGTA 2PGDA 5J2TA 4K7JA 2J3HA 4LCEA 3CZMA 4DCMA 2ODEA 3PDUA 1M1NB 3KKLA 4GMXA 3WO0A 2XZLA 1H6CA 1T2EA 3I6MA 2X1LA 3DAPA 3ZJ5A 1R8SA 1U0BB 1U7WA 2QTNA 4YRAA 2QAIA 2A78A 3QY9A 3UJNA 1N32B 4M89A 1HQCA 1OMOA 4B8ZA 3HRKA 1BMTA 1XVIA 2C5FA 1XF1A 3CWCA 3ICCA 3DWIA 3FKSA 3LKZA 2R5WA 1DE0A 1RHQA 1N0VC 1DDOA 3HB9A 1X9GA 2VJQA 4E5KA 3WRWA 1DJNA 1ISGA 2IYSA 2B4TO 1I6LA 3HTXA 3I64A 4TRJA 3MWEA 3E3OA 4IJVA 5GM1A 1BA2A 1CP2A 4J91A 3G2IA 4QUDA 2YN2A 4KWEA 1HOXA 2LW7A 3IHTA 4LQ4A 4Q4HA 1I3KA 5E7QA 5TXGA 3V1YA 4DFDA 1N2SA 3IEPA 1YASA 1XEFA 3G5AA 5AJHA 3J81A 2UUBB 3DLHA 2VATA 2PFSA 4ECAA 3AF0A 1U3TA 2EZ8A 2TMGA 3IAS1 4DHWA 2XB6A 4OHZA 1ADBA 1NBOA 2D2XA 2EV9A 3OPVA 2FGKA 3OOHA 3E9ZA 2DTDA 4PZ0A 1LC0A 1MRNA 3ESDA 3HMQA 4JN6B 4J76A 4W7HA 5HJ5A 5HQ3B 2IX9A 1JQBA 1V3QE 4ILEA 4HBGA 5GONA 3CE9A 3E9MA 3ZZ1A 1LK7A 4NMXB 3OP1A 3CUVA 4FLFA 1W2WB 4NAHA 5F2EA 2P6RA 1AGNA 3DQPA 4DJFC 3K70C 4GE0A 1UPBA 4K87A 3SYKA 1O8BA 2J4CA 2VDPB 2VF8A 3C70A 1WP9A 2DOKA 3EBLA 4QHYA 3R7WA 3TVDA 4G5YA 2IHZA 4HC4A 2I1LA 1QOZA 2UKDA 1GU0A 3ZLVA 2J3LA 1CNEA 2H54A 3G6KA 3GIDA 1UJCA 2DKFA 4K86A 2J6CA 4MQBA 1NKVA 3BE6A 4EI2A 1M72A 1E62A 1NQTA 4X45A 4Q1AA 1KJWA 3EGDB 3HLKA 2RBKA 3BAFA 2ZBQA 3HDVA 3C85A 1TMGE 5CW1A 4S3MA 3AJDA 3I2KA 3HKBB 2RK4A 5IC5A 3CVWA 3T3OA 4UKDA 2WICA 3O82A 3L04A 4AZ3B 1OZFA 4OHFA 4MCJA 1SULA 3WLFA 3S7TA 1QH8A 2JI4A 4GBED 3MC1A 5JCJD 3WB1A 4MWZA 4JJZA 4PAOA 5ELLA 2P5SA 2Z5LA 1F38A 1A0OA 2JLRA 3H04A 4RYLA 1J0XO 3DFFA 1V8ZA 3CH4B 4MH0R 3HNPA 1LBHA 3DR3A 3LRTA 2WHRA 2SCUB 5FNVB 4A1OA 2BHNA 1JJIA 4HKTA 4P86A 4UAGA 2QHXA 4BQRA 1WMEA 2Z56A 4LNAA 2VNHA 2JCVA 4FWIB 2X5JO 1GZDA 4ZIRA 1E4VA 4QUAA 2JF0A 4QYMA 3VVMA 1RWQA 1E9EA 2XUGA 1T9ZA 2QYHA 2Z09A 3AVPA 3JQ7B 3KZXA 3N2LA 5GOTA 3EGIA 1HURA 2VYVA 4S35A 2A94A 3NW9A 5KNDD 4D9IA 2PYDA 4MOWA 1OBHA 1B8NA 2E6KA 1UJ4A 2YYAA 2BBOA 2GKOA 3DLTA 3PPXA 4V1CA 3AJRA 4LEIA 2EFYA 5J5CA 1FXWA 1Y3BE 3WHPA 1V43A 3P5BA 2FJUA 4ZC1A 4U9HS 1C2TA 2XNKA 3CIOA 3I01A 2C29D 3LUJA 2BJHA 2RCNA 3AI2A 1E6KA 3WC4A 1IHOA 2CL7X 1PL7A 1T43A 2UUPA 4RGBA 1W36C 1ID8A 3L79A 1MJGA 3BFKA 3OSUA 4I1SA 1AOXA 2Y3IA 4BB5A 4YY3B 4OX9B 4P38A 5I3ZA 4NG5A 2ZAGA 1XZ8A 1F6BA 3H3XA 4FYHA 1RU3A 4RD3A 3AF1A 2ZVJA 4UCQA 5D8DA 3JAKA 1ZKMA 1FFBA 3EVDA 4RE6A 4AWBA 1DIRA 5GZ6A 2HQ1A 3QPWA 1Q0QA 2ZJ1A 2VJLA 5SY9A 2H29A 1JLHA 2O20A 2ETVA 3M9XA 3CZPA 2IYRA 2VHJA 3FE2A 3W79A 3RAGA 3EGCA 2XZOA 3GVCA 2C1ZA 4ZZ2A 2JGDB 2XTJA 1DX6A 1J09A 4F1KA 1DWPA 4DY6A 2QNRA 3A28A 2I2FA 1I9CA 2CJWB 3U1TA 4C0KA 2AYYA 3J7TA 3DP7A 3JQGB 5HJ7A 2WZBA 3ADOA 5HMMA 5DGDA 2VH5R 3P9XA 1DX9A 2YJZA 4IIVA 3T7RA 3BRCA 2G76A 3INNA 3AETB 4HFNA 1E1DA 5ECGC 1C3XA 3RW9A 1KEPA 3HFGA 4A8TA 3JD1A 3DW1X 3JWEA 4M55A 1E8NA 5BO5A 4NNOA 1ZSYA 3USES 3M5CA 1NBME 3AGQA 4X7RA 2R6FA 1DAOA 2J5KA 3LPMA 4B8WA 3G8AA 3NHMA 3W5CA 4DIEA 2P9FA 3AI1A 1B1AA 1O2DA 5JNTA 1F0YA 4HQKA 3B7GA 2XMCA 3EXHC 4UTZA 3SF8B 1MEEA 4JT2A 1T0HB 1YZYA 2PZEA 1F9EA 2IWHA 1PWXA 3I9KA 4B84A 4R40A 1U1CA 5A4AA 4NV3A 4CCSA 3RVPA 4KR6A 2FDRA 5CG1A 1PGPA 3ROXA 4BLOA 4J6FA 4MP8A 2D06A 2RI6A 3U5ZB 1O0BA 5D3MB 1J0AA 1U2RA 3LDFA 2B1IA 3EUWA 2AA3A 4FN5A 2GD6A 4G0MA 4MEAA 4ZQEA 5DWVA 3LQRA 4CMIA 1W2HA 5H0IA 2GPTA 2BW0A 2RG7A 1ONBA 4KLRA 3O2JA 4FEYA 4PC1A 2IOYA 4LC1A 3TW4A 5K3OA 4LJRA 3QVUA 3D4NA 4QFBA 3JXEA 4D81A 1EFTA 1J90A 1EJ6A 1Z5PA 4EKGA 4M21A 4PO9A 2I1VB 3P0EA 5A4DA 2F6RA 1VSBA 4HGZA 4KXWA 5EN4A 1MO3A 5JI2E 4Z8XA 2CBZA 2FMKA 2XUJA 1WDWB 3OCYA 4LWPA 5I4KA 1DZ3A 1DXQA 3EAGA 4KYVA 5CITA 4YBRA 1NF3A 2WTXA 3KFLA 4LK3A 2IYOA 4LIPD 1KMQA 2K5UA 4IDCA 4WJZA 2DF8A 4Y67A 1BHO1 5TMEA 2Q7DA 2E4ZA 2G04A 4BC1A 5CVJA 3UMMA 3ROQA 3BRQA 4WVFA 3EPKA 5JJLA 4MJLA 4URHA 1FNMA 2OLEA 3HP1A 2WTBA 3LVQE 4DLSA 3DEJA 3GAMA 4XQ0A 5ERXA 3FOCA 3WGMA 5CDGA 1B0UA 5CM8B 4XYEA 1TQDA 1YL7A 5TQ2A 2VG8A 4N9QA 1U7XA 4LHEA 5KYVA 2WI8A 4F6LA 3EGDA 1FFXA 1FTQA 3AG6A 1JI3A 2AEJA 3LBNA 3OHMA 3QUSA 3DT6A 3NGLA 4NAVA 5IKOA 3U9TA 1GWNA 2IZ1A 3OEYA 3ZCXA 1E9DA 3HKBA 4A5SA 2C3OA 4QWMA 4F04A 3U17A 3LOPA 2CDAA 4FWTA 1T1SA 4AZ3A 3HSSA 3UCEA 1Z4OA 3ENNA 4YRLA 1FFHA 1XMOB 4BP1A 1I32A 2NVUA 1OZHA 5CD1A 4TV8B 3L7MA 2WWGA 3D54D 4QXOA 1NJSA 2AT1A 3V1MA 4LOLA 2GB4A 4YBZA 3D1VA 3M2TA 3VISA 1WXFA 2IHTA 3CLUD 2JAQA 3HBAA 4ZYWA 4E07A 4MEJA 4EGCB 4TT3D 5KWVA 5REQB 2G1JA 4AS1A 4JR2A 1KY3A 1K63A 3PHGA 2PLNA 3KLOA 1YQQA 5AO9A 2ZRLA 1VXOA 1TU3A 3QMMA 4RMGA 2XCLA 2I78A 3OESA 4XD7D 2WWTA 4QJ3A 4JVOA 2R8EA 3DE6X 1P3Y1 5D84A 2HBRA 4LAFA 1O4VA 4HT3B 5AMXA 2VEOA 1N2GA 4EARA 4Q05A 4RFSB 4P3KA 3MMSA 3V5NA 4WDQA 1IHUA 4ZT5A 3KOZA 4BPBA 3PR3A 1MUUA 3LSYA 1IMJA 5BNFA 3PWTA 5J5AA 1RRMA 1ESEA 2YDXA 1JDJA 1XMJA 4BFXA 5A4KA 1YE3A 3PD7A 5DP1A 1IBLB 1G21B 4NZOA 4RQBA 1DCMA 2RKOA 2VTKA 4RETA 2IEIA 1FTYA 3RVJA 3V80A 2JGFA 1LI4A 1NMXA 4YPOA 4P0PB 1N3BA 4KQ2A 3HYCA 1TYAE 1UBTS 1ZD4A 3LQ1A 2OFPA 3IBGA 4P7KA 4EL5A 3T1TA 1ZGZA 5HG0A 2RGEA 3QBVA 4NTZA 4RK7A 5HGJA 2O14A 3OX4A 4UM8B 1UJBA 2FSPA 2NYUA 3IVGA 4O08A 3QJYA 1GSHA 5JT1A 3BCSA 1N7JA 2GCIA 3GFRA 4P92A 3AV0B 5BSMA 5BV7A 1B23P 3WWDA 1LWNA 1DKRA 1IC6A 1E96A 4H3VA 1JE0A 1YMUA 2VTBB 2IY9A 3O3MB 3PC8A 3TXYA 5K8JB 2W2MA 1Q7BA 2YY7A 2JGDA 3T5GA 3TINA 5KX5B 4S05A 1NC1A 5KYUB 1QYWA 4O63O 3ZWKA 1XBTA 2A33A 2VPWA 2CJWA 2CF5A 3TEFA 5KQSA 1M3SA 3ANLA 1UKVY 1YS2X 3C3MA 2QX6A 3E4DA 3W4JA 2FG7C 4JP8A 3G1WA 4RH0A 1C4WA 4OGFA 3Q4GA 2W9XA 5FTJA 3OT1B 4MVJA 4BKUA 3AETA 2UZIR 4MW2A 1PTJC 2AC4A 4J0IA 3R74A 2X8JA 4X71A 3IL2A 3EB9A 4Z1OA 1KYIA 2QA5A 3KLMX 3FUUA 3R41A 3ZTTA 2CNKA 4A0HA 5JMWA 1T24A 4LF4B 2TECE 3ZWPA 3O8QA 5ADHA 1DBWA 1BXRB 1KFJB 1NV9A 2ZYIA 3MWLA 4QSMA 1LZLA 3WICA 4F5ZA 3SF8A 5IEBA 1SCIA 3CINA 1D2CA 3RDPA 1FL9A 1XX6A 2J33A 4NKRA 3CA8A 1T10A 1DAPA 3IOBA 5JVDB 4R1UA 3RWMB 4F7DA 2NVWA 1PWEA 3ZLUA 3SD7A 1JXMA 1OBCA 4F2GA 1AKNA 3I6IA 4IO1A 3OUZA 3STYA 3THOA 1OI7A 4AM8A 1KEWA 1GTJ1 2X15A 5HFJA 2FMUA 3HP4A 1TZBA 3ZD6A 4GBJA 3NYQA 3AEKA 3KVVA 3DBLB 3FKJA 2IUSA 1MQ9A 1R27A 1JEQB 5MF6A 2ILVA 3EDMA 4I8IA 5IANA 3TTWA 1LJUA 2H1WA 5TLSA 3D6NB 4W63A 2VP9A 2OO5A 3BB4A 1XDDA 3DTVD 2OB1A 4G5XA 4LJLA 3ZDZB 2V4ZA 1JDNA 3F46A 3M6WA 4E6PA 3X1DA 3COJA 4G0NA 2QI9C 3UT0A 1PL6A 2VJMB 2B82A 3U61B 2BBWA 1CSEE 2WUVA 1SVMA 2ES4A 4KX5A 2O3JA 2H1RA 1RXUA 3PGMA 3ID6C 5EE5B 3MWDA 4P3NA 4FYWA 5CAEB 1PJ2A 4D6PA 2PA0A 5L3VA 3MILA 5DHRA 3OQNA 1URPA 1ZCJA 3QF4A 3CX4A 4RKEA 5FJJA 5L3RA 3D3JA 4F4UA 5DNCA 4BNTA 1C7FA 3G5LA 1FZTA 2WHYA 4AZVA 2AQKA 2CL0X 4IG4A 3RI3A 2VK2A 1U4NA 4IMJB 1KYWA 4HAIA 3ZV3A 4UD6A 4IZOA 4F4FA 1IN8A 2BGRA 2XLCA 1ZFNA 4H15A 1RVDA 1L5ZA 2I2BA 3FA2A 1JG1A 2ODBA 3L7YA 1KU0A 1N9ZA 2ZBVA 3ENQA 5CA0F 1J06A 1PCXA 2QJFA 3LC0A 1MJHA 5AHRA 4A10A 5LWQA 1CT9A 1C9NA 1WV1A 3OZFA 1CE8B 2Z1DA 4FONA 1U7UA 2RB4A 3V33A 3ZIAD 1JR6A 3GZTB 3HJTA 4EG6A 3LBIA 3KL2A 3AEYA 3F7NA 1RRVA 2HLDA 1GL3A 1EX7A 1SUIA 2O5RA 4KV9A 4NS1A 1E2KA 5ED0A 4DC1A 1VCIA 4FOSA 4N7BA 1K2WA 4D8YA 1XR3A 3QELB 4J7CA 4HWGA 2XUHA 3FFWA 4OUDB 1UMDA 4P58A 1QGDA 1QK4A 1GKYA 5ALGA 2C7RA 2OVBA 1O08A 1XEXA 3H4MA 3G2KA 3DPSA 4L8YA 5DBHX 3VTZA 3K0SA 4N7RA 5HUQA 1R4MA 4RHFA 3M4JA 4FXOA 3T4XA 2CK3D 2YUTA 4DLYA 5LU9A 1T5HX 1OGIA 1R5JA 2YWGA 1C8KA 4Q9IA 1ZSNA 1BMFD 1I4OA 1KQOA 1TTQB 1U1FA 3AR3A 3M9WA 3Q8XB 2VT2A 1LPAB 1CEEA 3FSJX 5ISMA 1FP7A 4XFDA 1B73A 3B2NA 4BWVA 1AG9A 2H16A 2VA8A 5DLQC 2AJLI 1EQ2A 3S2UA 3SZ3A 4P4TA 4JKOA 3RQSA 5A7HA 4R8KA 4C4ZA 1ZQ1A 2WRZA 5J47A 2PUDA 3HCNA 1B16A 2G40A 2HRBA 4CL2A 2H85A 3PPYA 1HLFA 2ZXUA 1O0CA 3WGKA 4NBTA 5KWSA 4L50A 1A4UA 4B7XA 1OV6A 1MKYA 3E8MA 2XWQA 2E85A 1WZUA 1CW2B 4AJPA 4EG8A 5KNBD 3ENVA 3GARA 4M1ZA 2ONZA 3SHTA 4US2R 5FKJA 1T6ZA 1M2OB 1OTHA 3VMMA 3ZGYA 1TYBE 2Z83A 4HEQA 3RSGA 1TM5E 3OLQA 4MPDA 1Y8AA 2Q0QA 1PJ4A 4OQYA 4E3WA 2PUEA 1M2JA 2DPYA 2AUNA 1E59A 4P81A 1PSWA 2HPVA 4ZCRA 1ZIYA 2Y0PA 4G0VA 4AULA 4K9PA 4O1HA 1TL7C 3C7AA 3CWZA 2COEA 2P7IA 5LB4A 4YP0A 2YUIA 4F60A 5BW4A 1CIJA 4GWLA 3ADDA 1GGNA 2GBGA 2HA2A 3L0DA 3PG5A 4LYGA 4ND1A 5KREA 2CLCX 1F2VA 2XZTA 4JBWA 2VJCA 3PUYA 2V4UA 1JJFA 1K8RA 2IUTA 4G4SP 5AVJA 4DLPA 2VTBA 5FHQA 1T4BA 2QUAA 4F5DA 1VECA 1M0EA 2G6TA 1T9BA 5KYUA 4O59O 4FFMA 4AMBA 1OFHA 4FJ2A 4OQEA 5D5HA 1XL1A 2HV8A 4ENPA 3DAOA 2AZMA 3GLHA 5DYYA 5P21A 5LUAA 4WXMA 5JECA 1PJ3A 4C3ZA 2ZLBA 2FMIA 1MQ8B 2VAXA 3DJFA 5I9MA 2WP8J 3TW8A 5JQGF 3BJZA 3LT2A 4KW7A 1UM9B 3FNBA 5JCJA 2PX6A 3AVUA 2N46A 2GT1A 3H1FA 5E3JA 4D74A 2DBYA 3K0HA 4U2BA 5I5GA 5AQ1A 4EITA 5FA5A 2VWPA 4LQLA 4A8JB 2FZVA 4FHGA 2CMGA 2I4MA 1IAQA 1XCLA 2UXCB 1GG8A 2H1SA 1J2JA 4FW8A 3CF2A 1V6AA 5CLJA 3EOAI 2WD8A 4AN0A 2A9VA 3GJ5A 1KIFA 1RHUA 5JVDA 2X6RA 2XGMA 2E6UX 3OZEA 1G2QA 4CTJA 4EG4A 1ANKA 4C30A 2ZRGA 5IZCA 1OIWA 4P8RA 5ESDA 5K8IA 2XXAB 3W1WA 2GXUA 4V38A 5KNDA 3S40A 4C76A 2I9PA 4BNNA 3QLTA 4EUSA 2OGUA 3FWHA 2OMKA 1NPYA 2O8EA 1SUAA 1U1EA 1YVUA 2FZKA 1RWVA 3EIUA 4Q1FA 5DN9A 4ZI5A 1ABBA 4L72A 1XPOA 1R10A 1UFOA 2JKVA 3C39A 1KAEA 3FPJA 3KLPX 4WHMA 4AMZA 2QQEA 1PYGA 3UQZA 4LFCB 2QMYA 1J99A 3V7UA 1G5HA 1Z2PX 4U39A 5T6MA 3OZAA 1XJWA 4HXFB 2BM8A 1L4FA 2ZYGA 1PDWA 2I87A 2I4RA 4GXRA 3Q2IA 1FK8A 2YFYA 3W7VA 4YJFA 5CAEA 3FGNA 1YDMA 1QP4A 3C1UA 4KQHA 4MQ6A 1EQUA 2BN4A 4NP6A 4NC9A 2ZIUB 3G85A 3G2JA 2I5PO 3B3QA 2G83A 3H2YA 5IBRA 3IV6A 2W58A 4XJTA 2NZWA 1IJEA 1G7RA 3GX1A 3OQIB 3TFQA 4AUEA 4BHTA 4EJFA 2IX3A 1XHEA 3FCYA 3WQBA 3I52A 3AWIA 3NGMA 2DY0A 4QYSA 4BLSA 1GAEO 4ZMRA 3TGPA 2HW8A 1X42A 2OAEA 3BMNB 1SCKA 4AY3A 1D2RA 3L1IA 5KSYA 4OIFA 4DUGD 3IYLW 3P19A 4ZEOA 1RYZA 5JWHA 3QEAZ 1IDOA 4KE6A 2OB2A 5U4QA 1JKJA 3CSUA 5FBVB 4YAEA 3LH5A 2C4WA 4XX0B 4QPPA 3T94A 3K09C 1JW9B 1N6OA 2FPRA 1NN5A 5A7GA 3JVUA 4E15A 3TSAA 5J4VA 1C0IA 4GH5A 4TLAA 3WMFA 4RV4A 3S44A 1XQVA 2I29A 5ALJA 4TWIA 1NU8A 5CB0A 1A69A 1VCNA 4FYPA 3O21A 2CN1A 3KTAB 2DE0X 3O8OA 4UTOA 3TL6A 2VJOA 4B0PA 2XV1A 1YS4A 3BB1A 3FPSA 1ZR4A 5IG2A 3NHAA 3KKQA 4Q9DA 2HH9A 4RD0A 5KVSA 2GF0A 4C88A 1GZVA 2EIXA 2VT7A 3FVRA 4F9FA 2JK1A 4PS0A 2YYZA 3QU4A 2Q9AA 4G0UA 2QMQA 3HYRA 2GEVA 4M1QA 1TK2A 1Y7PA 3D4OA 2X7HA 5EIAA 3T3HA 3INGA 3V6LA 3VNQA 4ETWA 5BN4A 2R1ZA 3C6XA 4H6VA 3OQ1A 3GCZA 3K31A 4M8IA 2VC2B 3D8UA 4RK0A 3CKYA 3E5NA 4OHOA 2QMOA 4UREA 4EF5A 1N6KA 4JI4B 5DBGA 3IO5A 4PLFA 1EFPA 5H9WA 5GMOA 2EP7A 2PM8A 3OLWA 3VYRB 1O94C 2F8TA 3WGHA 1YS7A 2JRLA 3DOEA 3DTVB 4ZD6A 4I4TF 5JADA 2VAWA 2VYCA 1WPQA 2DY1A 1U5AA 1VPDA 1P1JA 2IK8A 2OC9A 4XM1A 5B53A 2NU8B 5K3FA 2F1RA 1M2OA 1T4CB 2ONJA 4R71A 4HXGA 2COKA 1X39A 4PLGA 1GNTA 2C61A 4KNWA 4L6IA 1J8YF 4WADA 1L5NA 3O5AA 2QN3A 1FYXA 1ZRMA 2P8JA 4WLFA 1NWCA 5HKLA 4AJOA 3VTAA 5M04A 4QEKA 1UBEA 1DL5A 3DAYA 2E82A 4GPIB 4RDCA 4RIFA 2QT9A 3LUCA 2IU6A 4ZTUB 1OH7A 1PHRA 4WUTA 2EQ5A 2GCNA 3SK0A 4HMQA 4D8WA 1KI9A 2MYPA 3W90A 1HKUA 4ALMA 4XWGA 4ARBA 1GKKA 1UKZA 2C2BA 4JLVA 4ZEXA 5A4JA 4QBFA 2V3WA 2WU8A 1W4BA 4MHOA 1AMNA 4NXMB 2BSQA 2C2KA 3MWYW 3TNFA 2WINI 4IGFA 4C3VA 4LOHA 1P2FA 2NU7B 4HDKA 4P82A 4EMSA 1J7JA 3OBIA 4BX3A 2HF8A 3OE7A 4DJJA 3N0XA 3U7HB 4K03A 4L7VA 4O4LF 5JNWA 3LK7A 2YX1A 3ZHCA 1N25A 3GDHA 4BNVA 3ECCA 1AO0A 1W35A 1H4TA 1ZJ5A 4IICA 2WNIA 2O23A 2YXDA 3UPUA 4J8PA 1A82A 1JFFA 3RJ9A 5C9ZA 1GFWA 1UM9A 4OJKA 1AQYA 1JWAB 3BILA 3IT3A 3OPMA 4MVJG 5KKCA 4EZEA 3HH8A 1WCV1 4BX8A 1CZHA 2QM7A 4Q47A 5ENDA 3UOGA 5FP0A 3GA0A 4D46A 3U26A 1GGEA 1XEAA 3OURA 4AF7A 5AUNB 3EFOB 1G17A 5DYIA 2VDKB 1LJ8A 1CUUA 4TT3A 1WDKA 5FPYA 4XTRA 1P60A 3WYCA 1LI5A 1RQNA 1QIHA 2HPHA 2VUSA 3BEDA 3LLMA 4YVFA 3DE5X 3D5EA 3T6KA 4L15A 5IMBA 1S8NA 1OX4B 1MEOA 1R7RA 2EFGA 1AA9A 1U0HC 1P77A 2I8AA 2PIDA 1T9KA 2Q3MA 3BGIA 3DEAA 3G6WA 1CJUC 4R1MA 5DMXA 5T41A 5G02A 1OROA 3G2PA 1HV8A 2VTVA 4REQB 2WFLB 4IUBS 1RT9A 2XNCA 3JQQA 3NDIA 4KK4A 1FFSA 1R6UA 3H11B 4FYYA 4NQZA 4A8JC 2Z4SA 2BP7B 2HQBA 1GY8A 3SP1A 1UBJS 4XDYA 3KS9A 2X2PA 4X8HA 5EKUA 2ZIFA 1D6NA 4A1FA 2D1SA 2IYFA 3NAZA 1QYIA 1FFYA 5NULA 3PEWA 4FOOA 4LC9A 3V8BA 2P1RA 3ZHBA 5I7FA 4DV2B 4X6XA 4KE7A 3U3XA 4CIDA 3K7EA 3S2EA 4PR3A 2PUCA 3WYEA 4WY8A 1R6AA 1L9XA 1YE5A 2PVPA 5A2QA 5JNRA 1W1UA 2H4XA 1G3MA 3ZW9A 3IJPA 5IJ0B 3H8WA 4YAGA 2XB8A 2PNFA 3EH1A 3QLVC 3W8RA 3L7CA 1TT5B 4U63A 1L9KA 5THXA 4EHIA 1K6IA 1N36B 1EUCA 1GUZA 2F1HA 1MZVA 3WLHA 1GPLA 3KUCA 2Y77A 1Z56C 2JD2A 1ZJWA 2GN8A 3B2QA 1BVYF 3OQIA 1H5NA 1MABB 5AKHA 5JH7F 1ZGGA 4UNRA 2OV1A 4JC0A 1LLQA 1YFZA 4P4LA 3G1UA 4DGSA 4HNRA 4B1FA 2BTEA 1ICEA 1ULHA 3BMNA 3HU3A 2GS9A 1RI5A 1ZOOA 3MD0A 4MW6A 4ND8A 5IT5A 2GDZA 1DQPA 4YRRA 2PJDA 4LOJA 4DDHA 1TIPA 2C5HA 3PLRA 3M4NA 1O6ZA 1GQ2A 2OQIA 1TO1E 2B4RO 2H2WA 2R5FA 2A9OA 4M8NE 5B1IA 1PJCA 3HRIA 1LW7A 4LYFA 1YNSA 4G36A 4PGHA 4XX0A 1YU6A 2QP9X 3BWXA 2Q7OE 3V9PA 1JA1A 5ITVA 5LOVF 1NW9B 4BKOA 4P98A 2JS7A 1LBQA 1MTOA 3WLEA 2VXCA 1IWPB 2ZSUA 3TIXB 1T9CA 4BPRA 1Z3IX 1KEUA 4DEXA 1TLFA 1Y3DE 3DZKA 2BZ1A 1SD2A 2WZCA 3KJIA 4YCCA 1MDBA 4R7ZA 5SYMA 2XQJA 5F77A 1QRSA 1II8A 1OWOA 5C1IA 1JECA 3WRVA 3ZIDA 2XBLA 1Y5MA 1P8AA 2O3SA 3OWHA 3RK1A 1LPPA 1QJCA 3JTMA 5LPNA 4LJ9A 3I5XA 4HDAA 1PLKA 1K98A 4DSAA 4WKOA 4I9FA 4DCNA 4HK4A 3O6VA 1YB7A 3U6BA 2REOA 1SM4A 1SKYB 4F2PA 1MNAA 1ISRA 1G6OA 3D6MA 4OJTA 3QA3E 4KPFC 1LS6A 2PAFA 3FNGA 5KTYA 1FUYB 1MFPA 5JD4A 1H2RS 1A9XB 3F6EX 4IH1A 3BULA 5JZBA 4F6RB 3AK4A 2WYUA 4RPLA 2X0RA 2N1BA 1DPFA 3P96A 4O0LA 2QF7A 5TR9A 4MTLA 5FPKA 1SPBS 1F4LA 1ND6A 2QU7A 3RHSA 1T4CA 3KDAA 2IP4A 4QEDA 2J3DA 4J4HA 4I5EA 4RL4A 5DWQA 1C8LA 4JKYA 4PGGA 4OIMA 1SC6A 1XA4A 1E9FA 3C6BA 3Q7IA 3VSAA 3L9WA 4FHCA 1NVVR 1DTWB 4HP8A 1SCUB 1Y9ZA 4XYMA 4U1RA 3S8YA 1Z34A 5L45A 1JDVA 3LUPA 1W8IA 4PTYA 2W98A 4UARA 2XT6A 5EHNA 4GXTA 1ULUA 3KVOA 2CXUA 1XHLA 2V03A 1S0UA 5KHLB 4I8XA 5AVYA 2XY4A 2B7LA 3NONA 2CMKA 1JNYA 2RHDA 4NQRA 3PGVA 4QLOA 5KO2A 3ZY5A 1DP4A 1W4LA 2ZTUA 3QQPA 2V7QD 4BO4A 4GRIA 1NRJB 3DXYA 4YK7A 2RH5A 2C0PA 3SN6A 4RIGA 1JZSA 1DIAA 4YRGA 1RP1A 2ERYA 3F9IA 1M6VB 4FFNA 4JJKA 3IELA 2PZGA 4ARUA 2V97A 1KS9A 1Z2NX 3LUGA 4XWOA 5L9AA 5C8XA 4RKFA 4MW9A 4DNPA 2M9MA 3FNRA 1I4LD 1I1OA 1L5GB 4NU0A 1ODFA 4AZWA 5DYTA 2BSAA 1M66A 2QDKA 4C07A 5LLTA 1VGVA 1V37A 3SSOA 1YJBA 4JUCA 2VNSA 4TTRA 4G5SA 4WTOA 1ZD3A 3MJEA 1QE5A 4LE2A 5JAZA 4QQFA 1Z2OX 1QMPA 1WVGA 1XZGA 3INYA 2CK3A 1X92A 4BVBA 1QDEA 2FWBA 3PC4A 1AQIA 5CLQA 2NP6A 2WYOA 3L40A 3OO1A 3I53A 3GFSA 5SZJA 3F5DA 1C0PA 3FUWA 3PXDA 4QICA 2A9FA 1Q50A 2RKWA 1P5FA 4HJRA 5FBWB 3SJCA 4GLLA 4FYVA 4MQMA 1JHZA 5F2OA 4WZBA 1HQKA 2DRIA 2WV9A 3LNTA 4JOBA 4G5FA 1MC1A 1GUBA 2DWCA 4IMPA 3TLEA 1WW8A 2R48A 1JN0A 1JR4A 3R76A 3DFMA 1ZHFA 3G2OA 3W8NA 2QT1A 1MEJA 1L5SA 1CP3A 2TRSB 1NBWB 1NXWA 4HNAB 1ZESA 1V96A 1WCWA 5DI9A 3H11A 1U3VA 3N7UA 4GYWA 3W9YA 2YOFA 3MK31 4WN9B 2BP7A 4G5HA 2R85A 5DP2A 3ZI0A 2A1IA 1U28A 3GLRA 5AKXA 5BWLA 5KNBA 3MYRA 4YHHB 1YA8A 4N12A 2AUMA 2YCBA 3CEMA 1H2YA 2J6BA 2HXGA 4L0MA 4EHHA 2D8AA 1OAOC 3MUEA 2J3MA 2A2ZA 3DDOA 4PLVA 3SHWA 1QQ5A 4GGOA 3DO5A 3VOBA 3L9XA 2GK4A 4CG0A 2FQYA 3D2LA 4E21A 4IV8A 1U0OC 2B61A 1DQYA 1Y4UA 3IR7A 3Q11A 4BCBA 4ZHSA 3SIWA 5DYWA 3FSGA 3DS8A 3DYVA 1Z0KA 3F74A 4A36A 1OZ0A 2WJ6A 3QNWA 4P7BA 3AP2A 1C3OA 1R3UA 3DDNA 1JG2A 3PUWA 1DOZA 2OT3B 3WA7A 4UFPA 1H1TA 3KBOA 5A04A 1G60A 3DHNA 4Y2UA 2FV8A 4MZXA 1MABA 4X20A 2JLSA 5EUQB 3WGYA 3VH3A 1HBJA 4R2MA 3LP6A 3QX3A 1N0HA 3HLTA 1SUPA 4YONB 5C52B 4HX2A 3IQWA 3PHLA 5A3JA 2QG9A 2PKQP 4WVLA 3ES9A 2X9QA 2OM2A 3P27A 3S8EA 2I80A 4R2IA 2A1UA 3I83A 4EO4A 1NUTA 2FVYA 3V8NA 3SOZA 1FDSA 2IIQA 5FBKA 1HYGA 2ZR9A 3OM1A 3UK0A 3R8FA 3LT4A 2EBHX 3ZVKA 1WU8A 2OGWA 3LLUA 3CR3C 5KTPA 2OYSA 4PCLA 4L74A 4Q9HA 3L6EA 4DILA 2YQZA 4IW3B 3DXFA 2OV4A 3E7WA 1MOQA 4PX3A 4V03A 5LLDA 3KAJA 3OEED 1FXUA 2AR9A 1H1LA 3GRZA 4GM4A 4NOMA 1EXDA 3RVKA 1QIMA 2A8YA 3GHYA 4GP9A 5IYZF 2QV7A 3IEMA 2Q3HA 4JLMA 5KTNA 4M38A 2WM3A 3TLAA 3W4KA 5JEDA 1PFKA 4M1KA 4MUEA 4LBVA 1SWVA 4RQTA 4UMFA 4NE7A 5A5EA 3ZDDA 4MMYB 1AGYA 1RE1A 4JQYA 5EEHA 1R5BA 4LWZA 5HFNA 4C20A 4C0XA 2C9CA 1D1PA 2AGVA 3RIYA 5H16A 3QOYA 1RHJA 4K6FA 4D6YA 1ZXBA 1XAGA 4KR3A 1FFCA 1U1GA 2D2EA 2AEMA 2JKZA 1X7GA 3MUOA 3L8FA 1K0FA 3O26A 1JQAA 5CB4F 2GR9A 3O7WA 3DCYA 2X0JA 1Z7YA 1KXZA 1Z17A 1E6WA 1Z9BA 2YZMA 3CEHA 1TIBA 5DASA 1TO6A 5KYXA 5LU8A 3IH5A 1M2WA 2QTTA 1GN9A 5JLJA 4CDMA 4YCSA 2R11A 3QZUA 1FRFS 2PFKA 1HH4A 2EYUA 2OBNA 4MVJH 4KSBA 4DRYA 4W9RA 2YWDA 3AF3A 1VPWA 2ZTMA 1F17A 2A57A 1P1RA 4WCFB 4AS3A 3QBTA 1UQTA 1KMCA 3GP8A 1K86A 3M1IA 4RDXA 2IFTA 4NOKA 3S81A 4MB0A 3BYZA 4S1WA 2BFFB 3RRXA 2PKCA 5ILQA 3HK2A 4M54A 1UQUA 3G0HA 4QJIA 2BUCA 5C1PA 3GGPA 1KJQA 3FDFA 1DMSA 1RQ2A 4GICA 1VLQA 4UDNA 3VM6A 4YASA 4EQ6A 3WX0A 1NE2A 1ZU5A 1APBA 1IDN1 5H70A 5JYCA 3GBSA 4KQXA 4QRDA 1TT7A 4UU0A 4Y2TA 3D8BA 2YJ3A 1R6BX 1TLTA 4HEJA 5FUVA 1G6Q1 3H99A 3KYDA 1JIQA 4RLSA 1GFIA 2ZTLA 1Q15A 4CRWB 5IJ9B 2HGSA 1I01A 2C92A 4N8SA 3O90A 3DBOB 2Y1KA 1O77A 2CJFA 3TL2A 4DQUA 1C1YA 1ZW1A 1XQ9A 2NTVA 3GLFE 2ONYA 5BQFA 1V8FA 1KSJA 2VJKA 1WMSA 3T0IA 4MR9B 2LDXA 2ECOA 2RGCA 4MRSA 3UHJA 3CZ4A 4ZV7A 1OWNA 4A03A 5IFKA 3GJ4A 1TECE 2B3TA 3BMOA 1Y34E 4Y9TA 1DJMA 3GUHA 4N0PA 3FLEA 2ZI5A 2C31A 1K5DA 3FPHA 4UEKA 4RZHA 2BFAA 2JZCA 3W2GA 1WVIA 2V9ZA 1YJAA 2XX3A 1HE1C 1IBRA 3C14C 4YWHA 3S28A 1FYVA 4ZJZA 1IBCA 2BFNA 2DPGA 2FX3A 4XGIA 3R9KA 3N8HA 2ONCA 5DX1A 2GD1O 1GNQA 3I39X 5IAKA 3R7SA 2GPJA 1XYVA 1AXGA 2H9AA 1YB2A 4EY8A 2QZSA 3FYSA 3HPRA 3I76A 3MBIA 5KEIA 3OCCA 1XD2B 4GX2A 3GEGA 3SYNA 1TZCA 1MC8A 3NPAA 4J3JA 2EATA 3FJYA 3HO6A 4LJ4A 5GJVC 1NUSA 4RD2A 2A6PA 2XMZA 3PHBE 3IQHX 5FEMA 1X19A 3DR5A 5WRFA 1JLSA 1M74A 1DMRA 4LOAA 2V7GA 2W43A 1JHRA 5CB8A 4D1YA 4NDZA 1AZSC 1GA6A 1SCNE 2QD3A 4UNPA 3VH2A 2VOEA 4M46A 5H3HA 2QK4A 3IPLA 5LUBA 3RBVA 4O4IB 1YCHA 5EA2A 1Y6JA 4RAOA 3UIEA 4EO9A 1KMIY 4NCKA 3NBXX 1N5MA 4G0QA 3IMGA 1W73A 5IARA 4U7WA 4I3HA 1QG6A 3WHKA 1EZZA 2R0QC 3BK2A 2P3QA 1L5OA 1JBKA 1OJLA 1E9SA 2XOKD 3DM9B 3OQJA 4GEKA 4D9CA 4E2FA 3AEUA 2QMZA 3CSDA 4AKHA 1L7NA 1NW8A 3ZH9B 1UPTA 3E82A 4DBVO 1BROA 2HHLA 4HNHA 2HHCA 4MA5A 5EJEA 1HKHA 1BOOA 2OXTA 2GPWA 5BSWA 1F20A 2OORA 4PPFA 1UXKA 1ZI6A 2IDKA 3PXUA 5I9BA 4IKEA 4CM8A 3LUKA 3UTCA 1Y82A 1VG8A 1FNCA 3P52A 3L6BA 4O2RA 3B8HA 3OC6A 1A8HA 3C43A 5ALVA 4D80A 2P7HA 2G67A 1GZSA 2J6IA 3KXDA 1RYHA 1PNVA 4XR4A 4B35A 4MQ5A 5C8YB 2HSEA 3ZGNA 4H27A 1NQAO 4DDVA 3KQNA 2PJRA 1CETA 3LDGA 2RAFA 3FTNA 4FFBA 1ISJA 2ORYA 2KWIA 4BUJA 3M3HA 1XIVA 2C2ZA 3K92A 3BQNB 4G56A 4A82A 5BSGA 1IZ7A 1P9WA 5IDWA 4KNYA 3OA2A 1SXHA 4M53A 2Q27A 4D41A 2ETXA 5KI6A 5KUTA 1QZUA 3CLSC 3IQEA 3CUYA 3BPSA 5C8YF 2DLNA 4OUKX 3EGVA 5JD5A 1T6XA 2QEQA 4MPRA 4ZODA 1DRKA 1NYLA 4IF4A 4OTZA 2Z2ZA 4J1NA 3G59A 1SUDA 2ENWA 5ER9A 5EIOA 5H80A 5K8UA 2XDQA 1UDAA 3KVNA 4FPXA 5ICSA 1GYRA 3DE7X 3Q8KA 1SUEA 3ILHA 1FP2A 4N01A 4UBLA 4BJ5A 5KQGA 3EUEA 3HN6A 1XLVA 2AMYA 1S3FA 4A8PA 1RBYA 3BA6A 4BKQA 1P7ZA 5JNLA 1DBIA 4F12A 1NASA 3Q88A 1RWXA 1M34B 2RFLA 4FZ5A 4Q19A 2GVZC 3P9RA 621PA 2V9PA 3UKOA 3AFHA 3WFZA 1CRPA 1T8RA 4M4SA 4WNAB 3WRYC 3ROFA 3WXMA 4PAGA 1AGPA 4P7FA 3VDRA 5KYWA 3E9EA 3AGPA 4D56A 2R79A 1ISFA 2Y6VA 1GPBA 1KZ6A 1C3LA 1E7QA 3ZBQA 3EISA 3FPBA 2J3JA 3OPYB 721PA 4EJ2A 1Z8DA 1E3IA 3MAGA 2Z4TA 3VUFA 5BXQC 1OAAA 1QHYA 3AIOA 4M9QA 4LS3A 3EA4A 3W7BA 4EFMA 1U7OA 2QL5A 4PQRA 2F90A 1L8QA 3C7DB 3JQ9C 1FVXA 5AI9A 2X40A 1DQNA 3IDQA 1J0DA 4GNRA 1TXGA 2WVGA 2X42A 4Q3DA 3TRHA 3SC2A 3QE9Y 4PQGA 4L8WB 5J40A 3VR0A 2BFFA 3G7UA 3RRYA 2BMAA 4G1EB 1BGXT 4ESEA 1SMKA 1W0KD 2E7ZA 2RHCA 3B1YA 1XZPA 4FYJA 3ZS8A 3L7NA 2C9YA 2W2OA 1EE1A 2PSDA 2E4XA 3A2LA 1WS6A 1L8LA 3KDPA 3L7AA 3MGCA 1CLUA 1IJBA 1QFYA 3RF7A 4EHJA 2XEXA 1XLTA 1X1RA 3FZGA 4N65A 4EH1A 4ABTA 1THGA 1J0EA 2P9QA 2PXAA 4WCFC 1RQGA 4WLNA 3OETA 4FT4A 4I1IA 2ZRIA 3SJUA 1DRWA 1RD4A 2AQIA 3M3PA 4K26A 2CVHA 5I01A 5KNDH 1F4VA 2E9SA 2HUPA 3HXTA 3TBHA 1SU4A 1TM1E 1YQDA 2FXIA 3DEYX 3ZU5A 3GT4A 5EYPA 4YMGA 1ZVMA 1NIJA 2FUNB 2QL7A 4QARA 5LXTA 1GZUA 4GM0A 5ALEA 1LRJA 5GJBA 4KFTA 1KJNA 4MR9A 4HGYA 5DTRA 5FOWA 1VHLA 4AN1A 2WSIA 3GMTA 4WBNF 2N42A 3R20A 4C7XA 1I7QB 2KQUA 2Y92A 5K09A 2PWPA 2O57A 5FJIA 4H4EA 2NO6A 3ETJA 3IO3A 4DPKA 3E35A 2D2VA 3MD9A 5KAMA 3G7NA 4KDFA 1Q74A 5CH5A 2AZ4A 3QX7A 2MSNA 3S8MA 2JBHA 3CRVA 5LSAA 3LRPA 4UE2A 2XUAA 3BIWA 4N5LA 2B3DA 3RARA 2GTPA 2G80A 3TLJA 1I2ZA 2CFTA 1MGPA 4Q7QA 3KD3A 2XECA 3PFFA 1QK5A 1Y8ZA 1GRCA 2JARA 3PQFA 4TUYA 2FZGA 2Y4OA 1PX2A 3RVLA 2PT5A 3AONB 1P1FA 1Y9AA 1A2KC 2Y76A 1VI2A 4NULA 1A76A 2I3ZA 3FBTA 5I5EA 3ZLTA 4I1YA 5DGXA 2OZPA 4BZZA 2ZUVA 1NBMA 4IHJB 5AM1A 2AF3C 2C7PA 5ALTA 2WE8A 4FE4A 1E32A 1K7CA 2W6PA 4TKUB 1WO8A 4FW9A 2M6SA 5E95A 3D1JA 5JAMA 3ACCA 4DLZA 1E4YA 2VSFA 1Z68A 4MWSA 1NI5A 4C4TA 5G0WA 1FLDA 5DM1A 4LZPA 4CLHA 5JBNA 4RHTA 1W19A 2R68A 3RUPA 4E5SA 4BMSA 1QQ7A 3U60B 4LBZA 3TECE 2M2IA 1KFCB 2HPZA 1FYEA 1IHDA 4U5QA 3GGDA 3UC9A 2ERXA 1QTIA 1VI6A 4HPWA 3QXJA 3HBLA 5T3UA 2D7JA 4R5HA 1D6MA 1YGPA 1ESZA 1HDEA 4WT7A 1JLRA 4JROA 1QB7A 4JUIA 1U6IA 2ZEJA 2XJ4A 5DF1A 3ZZTA 2WMYA 1IATA 2PX4A 3OP4A 1QGED 5F1OA 4KREA 1S9HA 3FB1A 5HJEA 1YI8A 2IITA 4DLAA 2QDXA 1JA0A 4WCDA 3IP1A 1KHHA 2VP3A 3I05A 1ZBQA 4RF3A 5B55A 5LNK6 4Y1RB 4RS3A 1R0SA 1CHNA 2HD4A 5CFLA 2PZLA 1YS6A 3DOIA 4KRXA 2J3KA 1L3CA 4WUVA 2PU5A 7YASA 3TVYA 2CXPA 2PH1A 5L7YA 2B7BA 1H0HA 4BO2A 2VQ3A 5TVKA 5JXHA 2O8CA 3KEGA 2EWVA 4PG8A 4O0MA 4YAFA 3EY9A 3N28A 1E58A 3OOJA 4X1YA 4JXZA 2R7MA 2RJOA 1PJBA 5BNZA 5ADUS 3ITDA 4ZGBA 1CB7A 1P0MA 2CSUA 4KKXB 4Q4AB 1AXEA 1OX6A 1R5OA 2ESRA 3CX7A 5AM0A 2KW5A 1QH1B 2X7XA 4GOJA 1XVLA 5A9SB 2PH3A 3LBHA 4IGAA 1OXVA 1E2QA 4KO4S 2ID8A 1KS2A 3DNFA 1S89A 3Q8MA 3Q0IA 3TE6A 5CG2A 4KGXA 3GCXA 3ZXUB 9LDBA 2F8LA 4P0QB 1KAHA 1O1YA 2QJTA 2CGEA 3M6XA 1T5BA 1C7EA 1M34A 1N1EA 1HMPA 3WJ7A 1T3ZA 3WP0A 2IYPA 1E5QA 5FO0A 2ZPTX 4UCXA 4DR3B 3CS3A 2JJ2D 3DWGA 5HK9A 2ZXFA 3HSYA 5AXDA 3M34A 3ODGA 1DARA 4QJBA 1NN3A 3DHYA 2IHKA 4C0BA 5INTA 3O8NA 3CQ9A 2WWWA 1E1CA 4HN4B 4WV3A 2AN9A 3I12A 3NUZA 1G9SA 3CRRA 5DU2A 4BMNA 4D0LB 3JQ6A 1JLLB 3FOBA 1Z5WA 3NYIA 4KQCA 3R24A 3T1HB 3UAZA 4Q4LA 1VKZA 4MI9A 1F3OA 4BQSA 2X2EA 3KAQA 1DWQA 4HGOA 1EK0A 4W1QA 2OO3A 4KQWA 3U4GA 1PNRA 1BDJA 1J39A 2EF0A 3WLTA 4AP5A 4DLTA 1GNRA 2R6DA 1NYRA 3BD9A 1ICIA 3AERB 4JT8A 2HDNB 4U9IS 5F4ZA 4X97A 5JZVA 3RJTA 4PONA 4WK0B 3WJAA 1MJFA 221PA 1TK9A 4MUKA 5GIPE 4KLNA 3D3WB 2I7XA 3LFTA 4KTVE 2HLPA 1DRJA 3EHEA 3F4BA 2AOTB 2Q21A 4FLMA 4CEJA 1XMPA 3GPDG 4OFWA 4BJ1A 2HJGA 2PZ8A 3U3JA 4MLCA 3QQ5A 2VDVE 1U9JA 3QIVA 3HDHA 3A6DA 2G5TA 1MB4A 4AMUA 4F8JA 4QXQA 1P2TA 3PZBA 1QQAA 4WOKA 3TNDA 4R01A 1DI0A 2FPKA 3IB3A 4LZNA 1ZOPA 1KZ4A 2G82A 2OESA 4RMIA 4KR2A 1PK9A 5G1OA 3PI7A 3OEEA 1HSZA 3TMKA 4A5OA 3C4JA 5AVWA 4OM8A 3GH3A 3HCPA 1QHSA 3QOWA 1DFIA 3BBPA 5SV2A 3FGOA 3UH1A 3F7OA 5CVDA 4G65A 2A5FA 1CRQA 3KQPA 3UJDA 1ZM9A 1SVSA 1K2VN 3SHFA 1HG1A 3KYCB 1YRAA 4M9UA 1IG3A 1WTAA 1LTQA 3L2OB 4H7JA 1QP7A 1AS3A 3TPFA 4ZAWA 5KOHA 2WSLA 1AZLA 1DADA 1JAZA 2WSSD 3BK7A 4GSYA 4RJJA 5BRNA 3ZXSA 4DY4A 5L4NA 2GD0A 1E2DA 1S4MA 3NM5A 3QMWA 4YP5A 4H1HA 4N3GA 5BR4A 1CQPA 2G5PA 4YCDA 4FI3F 4JSTA 4IIJF 4DR5B 4DEVA 1HL3A 2NVOA 3WI7A 3MOSA 1GRQA 3ACDA 4FOTA 1GZ4A 4PTLA 3U19A 3EXHA 2EKLA 4IF6A 5I7RA 2C42A 1JG6A 4X94A 5BN3A 2NG1A 1ZNZA 4FINA 5IULC 2WV7A 2H2FA 1T5DX 4QNRA 1XELA 3F2IA 3W0LB 3HG7A 1V9CA 4R54A 5HCIA 2XWBF 3I23A 1DELA 3TD9A 2P27A 2GZMA 4NAUA 1Z26A 4UHBA 4BATA 2NSJA 2HA4A 4HNUA 4IJ6A 4ESVA 1Y6FA 1E3MA 3BE5A 2QMUA 2XE7A 3LQYA 4ARSA 1GL6A 3HA3A 3H9CA 4KODA 4PHGA 3EIHA 2VDRB 1OXTA 4UXJA 1T9GR 3YASA 1TUEA 4FU0A 4XW2A 2ZBUA 2VZEA 3A6HA 4YI5A 5F9FA 1CPYA 3FMIA 5BWOA 1WCIA 3HA5A 4CLOB 3GFBA 1FLAA 1G98A 3IEUA 5TQJA 2YW9A 3TIGA 3BD7A 4KE8A 3NIFB 3G88A 4UFNA 3OH8A 5BXYA 4FHFA 1G8PA 3OIGA 4ZO8A 7ABPA 5IH3A 4PICA 1ZL0A 5EZYB 4TLCA 1W5TA 2FG6C 3ZZUA 4CHGA 5CNKA 4EKDA 1Q1NA 1OZAA 3TN7A 1N6NA 3H4IA 1JHDA 1XJ5A 2OXRA 4YRTA 1AHPA 5IJ0A 3O0DA 4QUBA 1Z06A 3WLJA 4X1IB 2OYRA 2P2SA 3R3VA 1X7WA 5CT4A 3LFUA 3ISVA 3NHZA 4ENVA 1OV4A 5J58A 2G28A 3E8SA 1XRLA 4Q4AA 1AHIA 4EG0A 2JGKA 5ALKA 4KV7A 1FDWA 3ML1A 4DDUA 1HE8B 5AJVB 3ZYCA 1KAOA 2EW2A 2PRKA 2WNHA 1KZ1A 3EEBA 4ZQHA 2F2TA 4HDCA 2GFIA 2ZRAA 3V8QA 2P6OA 2CD7A 4IH9A 1G2IA 1RZUA 1Y6QA 2B78A 2J7PA 3C3YA 3HM2A 4B7UA 1FVOA 2PMKA 3DZIA 3VZDA 5IVDA 1A2QA 1QYXA 2RHMA 1QIKA 3H19A 3VSBA 4ZWNA 4UDXX 2ISSD 4LUCA 4W7SA 4RH1A 4BE9A 5IM5A 4MDFA 3UJ8A 3HJHA 1C4KA 5IK2D 1D07A 1KNQA 3DMNA 2ZDHA 1HLDA 3HUFA 1E4OA 3AR6A 3IEIA 4B2YA 1ECJA 2RAUA 3CX8A 1P81A 1EM6A 1GZHB 4QHSA 1BS1A 1BS2A 2QAGB 4OOEA 3VR4D 4AG5A 1OREA 1I6KA 1VLJA 3PPIA 5GPBA 2GAJA 4M60A 1E1QA 3BOSA 1OJ7A 1OUMA 2J09A 3TIFA 1LUAA 4S0ZA 3C7CB 1MP0A 1EVYA 1U8EA 3DKRA 5FLXA 3ZBTA 3AT1A 2KLHA 1KNXA 1PJQA 3LKDA 2XYHA 2EOAA 2X41A 4YRMA 2GBPA 1RFGE 5FL7D 3ZE2B 2A67A 1NW7A 3PWSA 3VKWA 1HTWA 1SU6A 1XI2A 2IYAA 2XLBA 3DW3X 3JR7A 4EFKA 1Z2CA 3IJRA 3BSYA 1QGZA 4BCDA 1VPLA 1X0VA 1BU8A 2PQ6A 3A1TA 4KAJA 2IYYA 2QVZX 2VK4A 2W7TA 3N8KA 4UMDA 5JXGA 3STTA 3WGIA 1NQWA 1QB8A 1PFGA 4M0PA 1Z4KA 4WBSA 1D09A 4MIKA 1J7KA 1SD5A 1E66A 1XVAA 2C8JA 2OQ2A 1MV5A 1OE0A 2EJWA 4IEEA 4YIHA 5K0BA 1WULS 4FVTA 2O8FB 1FS4A 3FPLA 1Q16A 3FIUA 1ZH8A 4R2LA 2GZ3A 5FA6A 2CYAA 4BXOB 3N86A 3SIPA 4Z7QB 3LQKA 3X1JA 4BFYA 4B6EA 5JAIA 1CG6A 1IUNA 4DTIA 5LMNB 1DJOA 3THWB 4JY7A 2GTIA 3D8RA 1U63A 5LNK1 4YFYA 5KNBH 2QORA 3K15A 3ER6A 1QCCA 4FIZA 4LHYA 4LY6A 2NZVG 5DGIA 1ORHA 1EEXB 4LWQA 1EJ2A 5M34A 2FMXA 2P3LA 3IA2A 1G18A 2A0FA 3D6JA 1Z73A 3M89A 3A4NA 3G0CA 5BP7A 1WZNA 1CR0A 2MWMA 1XCOA 1XUOA 2H92A 2HU5A 2L0XA 2YHIB 3DDUA 4H2DA 3VX3A 3BIFA 3QEBZ 3DTTA 1T9GS 1GGJA 2Z9DA 4ZALA 4F4DA 4WZ6A 4GPZA 1IPFA 4M0KA 1NG9A 3UHPA 3GGCA 1WJGA 4Q1EA 1BDMA 1DIGA 3BGOS 3D2AA 1ODIA 5GZ1A 4YMTA 1HG0A 3E61A 3ZWCA 5K6AA 4PGMA 2ZRBA 4TYYA 2LVBA 2P79A 4GYJA 3ZHTA 5KYYA 2G1PA 1M2HA 2FRDC 2DM6A 3PXCX 5DI3B 5EXTA 5LB2A 2Y2UA 2Q7XA 1Y1KE 1Q1AA 2FAXA 4LGCA 3DMGA 5A0TA 2VP2A 1T3LA 3NWBA 3Q7PA 1WXGA 3HR8A 5HE9A 3EDRA 1KSGA 2VYQA 3DTYA 2Q3CA 1OAKA 4BQFA 5J3JA 1BX3A 3OZGA 2IRWA 2ATCA 4B85A 1DXOA 3LLVA 5FOUA 2VPIA 3AYXB 3LYAA 3GG9A 1IZ8A 2H2HA 5DXFA 4L4SA 3WGQA 1GILA 4DMKA 4C7KA 5GJWC 1L5MA 4DPLA 3OU6A 2W6ID 1FQKA 4XVQA 3ST7A 2ODPA 1LQTA 2CL5A 2FK7A 5HE8A 1QVVA 4N54A 4KXNA 2H2GA 1SOUA 2X0IA 1G8HA 1QSGA 1RRPA 2IC5A 1DHRA 4WLOA 5LQNA 3N8GA 4YCMA 1Z6GA 3RIXA 4KI0A 1Y48E 1HDIA 2GNOA 1IULA 3PA6A 5B57C 2FKNA 4BWYA 3AEZA 1Y3HA 4N5MA 3UYKA 5BOSA 3BWYA 2OQVA 5EZYA 1MX9A 16PKA 1N2CB 1YK1A 3N2GA 1A5AB 1UADA 3QF7A 4NPAA 1PR6A 1QHGA 1KH1A 2C57A 4EHDA 5AK5A 5AVUA 5LWHA 1QQBA 1N9KA 2FUKA 4BMCA 4DJ5X 2P2DA 1ST2A 3ENZA 2I71A 5B3JA 3ICQB 3N9IA 4RF5A 4YR7A 4RTSA 2MSLA 5ALNA 1NVUQ 4UEWA 5CX4A 7REQB 3EDYA 4ZTZB 4M9ZA 4UU1A 3LBYA 3GVXA 1HNWB 5DT2A 1Q91A 4KU4A 5ICGA 2B2NA 2FRVA 1NXTA 5LDDC 2CDNA 2WUFA 1J22A 3QFTA 4A15A 4RPKA 3Q1LA 4XE5A 5AKIA 4UEQA 4XDGA 4E09A 1AH2A 2RK3A 3EFEA 4BE7B 1BKSB 2P35A 1GRNA 3PR1A 1JDZA 3ZC3A 4Z7OB 1RJ9B 3QI7A 4C08A 2PUVA 2H5EA 3QWAA 2GFHA 2I66A 1V4NA 2W2TA 3DDZX 4IQ8A 4NJMB 5EC8A 4C6RA 4EAQA 5KSOA 1J20A 2A92A 3T9DA 1U3DA 1Z0IA 4QXAA 4UVGA 4XKJA 5B6IA 1SQ6A 2ECQA 2I7DA 3UUFA 3EZFA 3OE5A 4MUYA 2XE6A 2Z0MA 3V1LA 4I5GA 5C7YA 1YBFA 2QROA 4HAOA 3AX6A 3HVUA 3RFXA 3RTBA 3U3MA 3FF1A 4D96A 2VDMB 1O7JA 1CUAA 1WB4A 2AHOA 4PYLA 4UE3S 2HMUA 1EFVB 4YQZA 3SXUB 3VU9A 3HC7A 1WPXA 1V16B 1DO8A 2BEUA 1WDTA 1ZC3A 1ECCA 3USCS 5JOQA 5C3UA 5KTSA 3TKYA 1MHPA 1WLYA 4KLAA 1TGVA 4X7MA 4WX2B 2EQAA 3A1WA 6LDHA 2QAGA 3L7IA 2HTFA 2JANA 5FBLB 2X5OA 5HGXA 4WBXC 1FEZA 2QRGA 1GQSA 3ECSA 4MQEB 5EUCA 4B2PA 3MHPA 5CIWA 3RC1A 4CKBA 2L42A 1D2AA 2X9NA 4GDFA 1SHLA 3NXSA 1INLA 3E1SA 3PDJA 5EZSA 3PNVA 4YRDA 1VDMA 1NVWQ 3EXIB 4GMHA 1ULSA 5GAJA 3K20A 3U4MA 1FC0A 1WMBA 1IZZA 1XRQA 4K40A 3ZV5A 3KTDA 1DKQA 3MMPA 4AJHA 4UVEA 4EY6A 4PO8A 3LJKA 5KDLA 4ZCIA 3KUKA 4ZU1X 1VM6A 1TF2A 2IEDA 2QN9A 2R1TB 4ZQCB 3GPBA 2HPAA 4PRKA 1HDXA 1JAHA 3KKNA 1TW3A 1NV8A 2V3VA 3GJSA 5T4HA 1FU4A 4KP7A 4BMVA 5IAAA 4Z7JA 4TTAA 4BXOA 4PSCA 2VS1A 2JH3A 3NNNA 4ZCPA 2YKGA 2NPFA 3D7SA 5JFGA 3ORSA 1EWKA 4LQDA 3ZDRA 4OBWA 5BYKA 3KAPA 1L5YA 1NLUA 3NKVA 1WD7A 2I3BA 5E4JA 3SX2A 1KF0A 4OU4A 4MUJA 3H9QA 4OATA 2BBSA 4RZ3A 3ABRB 4BBAA 5KNLA 5JXWA 4F2WA 3SICE 5HHTA 4LJ6A 1X1QA 2OG2A 3JD0A 4UHHA 2MIIA 3EULA 4CGZA 4E1VA 4D9KA 1RAFA 1T9AA 4PYNA 1RJFA 1YZFA 3OPQA 1RQXA 4WKGA 4AD8A 2VA9A 2V45A 2XKBA 1QV6A 2YHIA 3OMXA 1KPGA 1W4AA 3AR5A 1GHTA 4R8MA 1NN1A 1VL5A 3RTAA 1KOFA 2R1VB 3TSOA 4DV0B 1SIBE 4TYWA 2COUA 3DOOA 3M3DA 4P80A 1WE2A 1RXIA 5G1PA 4AUMA 2IIPA 2O8BA 2BFDA 3SSAA 1YZNA 2VNAA 3L8YA 6GPBA 3F73A 2YJ4A 2ZAOA 4U6QA 3I5YA 5H83A 1QDLB 2FGJA 2DFTA 5E0OA 4J0QA 3TQIA 3L0OA 2JJ2A 3FI9A 5DX8A 3RFFA 2FP4B 1N6LA 4KUGA 3TBFA 1N6RA 4FE7A 4X91A 2AF4C 5IT0A 4EFDA 4LXGA 1Y8QB 4KQ1A 3RUHA 1D1QA 1AIPA 2DBRA 2V6BA 1NI3A 2ID7A 1ZONA 1GTG1 4RVDA 1U04A 4E5UA 4MKHA 4AZ0A 1WNTA 2HY7A 2AD1A 4H1VA 2BEJA 3LMKA 4UUQA 4Z0TA 3M6AA 1BOFA 2VJAA 4NEQA 2P2ZA 3BC1A 3TH5A 2ZKLA 1AGRA 2OWEA 2QVYX 3A06A 4J0HA 4R2XA 1JDUA 1Z0JA 3F7TA 3LGSA 4MMXB 2ODQA 1E98A 2R00C 3G02A 3IDAA 4QOFA 4KR9A 4WAUA 5KPDA 3A9UA 4RVOA 1HDGO 1ZUNA 2C5SA 5FFFA 5IBQA 2N75A 1SVKA 2B99A 2LRHA 1SNYA 2IY8A 3MJDA 1ZSVA 3Q9UA 2VQFB 2C9BA 2RGWA 4NI5A 3AESB 4NLLA 3WGZA 5AVQA 2V8BA 2BVNA 2O3TA 4L08A 3R7NA 3O2SB 3AKZA 2DQYA 4A2CA 4OI1A 4W1PA 1JQJC 1X3SA 1QNLA 5D7BA 3U37A 3PFGA 1QO9A 3LQ2A 4ZXFA 5HA5A 5FTNA 1PF7E 4O29A 1N2CA 1TQ2A 1AC5A 2X4IA 2FWRA 3WK9A 3SQOA 5AVRA 4HN9A 1C9DB 4RE5A 1MENA 2DFLA 1V45E 5HPYB 2VPXA 4XWTA 5IN5A 1ULZA 7REQA 1SCBA 3I9V6 5H1YA 3KK0A 4QODA 3OJLA 1QAMA 1OOEA 3EIFA 1CUHA 2NAFA 2IYTA 3V8MA 3WAKA 4B3CA 1SKUA 2YR0A 4E31A 5H8WA 1DU4A 1UDXA 4II2A 1IU9A 5BPFA 2HT1A 4HDRB 4W5QA 4XB6B 5CA0A 2WILA 4ZI7F 1POXA 3LT5A 5E0KB 4W5HA 2C3UA 2PUGA 2NXNA 2PZMA 4UZFA 4GXQA 3CT4A 2PMWB 2HU7A 5K0ZA 4PSVA 5AHKA 2GM3A 3H4VA 1BFUA 2XXBA 3BD6A 2BEWA 3L8EA 2W4QA 2QZ9A 1A98A 3L7BA 4DNXA 3DAHA 3A9CA 2VZ0A 4PAMA 4YQYA 5K6TA 4B43A 4II7A 2W6CX 5M7EA 3ZJUA 1GT6A 4OHUA 2QM0A 1JZTA 1SCAA 3L7OA 3AIIA 5HF6A 5AJTA 1WQ1R 1Z62A 4OVKA 4FMBB 4HL6A 2JGMA 3BJIC 1RPNA 3UATA 2BFPA 2BFEB 4G01B 2QN8A 3KZCA 4EPYA 2QBYB 2H51A 4IXNA 3R9XB 2QENA 4MVYA 4YB8A 3OJEA 5I6DA 2RH4A 2PK3A 3QOFA 1OHHA 1V6CA 2X8LA 4MV4A 3ZY6A 1RVV1 5E9AA 1DS6A 4PZ9A 5JRZA 2CWWA 4O3FA 2WJAA 2ZE8A 3MA0A 4I36A 4TPKA 5H9VA 3SEFA 4BZXA 3IE0A 4ENQA 1I3MA