4PRZA

Caspase-8 specific unnatural amino acid peptides
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
240
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-8
publication title Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 240
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4przA00
3NR2A 5IANA 5IC4A 4M9RA 4EHHA 4FGUA 1I3OA 4JQZA 2XYPA 4PRYA 2CDRA 2H4YA 4AW9A 2AR9A 3KJNA 2QL5A 3E4CA 3IBFA 3R6GA 4JB8A 4N7JA 4FDLA 4IEFB 3P4UA 2XZDA 3RJMA 4EHLA 2XYHA 4QUBA 4QUJA 4DCJA 1RWKA 3PCXA 2HBRA 4I1RA 2J32A 5JFTA 3D6HA 3D6FA 5IAKA 4QUHA 3H0EA 3R5JA 4QTYA 2NN3C 3R7NA 5IAEA 1RHRA 4HQRA 2CJXA 1BMQA 4JJ7A 5IARA 1K88A 3D6MA 1I51A 2H65A 2J30A 4NOMA 2H54A 4FXOA 1F1JA 4QUDA 3KJFA 1KMCA 1PYOA 3GJQA 3SIPA 4JJEA 1RHJA 3H13A 4N6OA 1RWMA 1M72A 2C2MA 4PS0A 2DKOA 2FP3A 2QLBA 4N6NA 4QUIA 1CVRA 1RHUA 2P2CA 3GJSA 3K7EA 4AWAA 2QL7A 5IC6A 2CNKA 4ZVUA 4PS1A 4QUEA 2XYGA 2CJYA 5IBRA 3V3KA 4ZVPA 3EDQA 2WDPA 3QNWA 2H51A 4N5DA 3R7BA 2XZTA 3P45A 4JJ8A 1NW9B 1RWOA 2FQQA 1I4OA 2FUNB 2QLJA 4AWBA 4ZVSA 2C2KA 3EDRA 3DEIA 2H48A 2QLFA 3IBCA 1SC4A 1RWNA 5I9TA 2Y0BA 1SHJA 2H4WA 4EHKA 1NMSA 4QU5A 4QULA 4NBNA 1NMEA 2J33A 3GJTA 4QU0A 3KJQA 5IAGA 1PAUA 3H11A 1RWWA 3BIJA 4QUAA 5IABA 4LSZA 3S8EA 5IBPA 2HBQA 2CNLA 2H5IA 4NBKA 4EHDA 4NOLA 4NOKA 1IBCA 3SIRA 5H0IA 4N7MA 4DCPA 1ICEA 2H5JA 3UOAB 5LUBA 3PD0A 4JR1A 1SC1A 4JQYA 5IBCA 2J31A 4ZVOA 3V6LA 5LUAA 4QU9A 3H1PA 4D3XA 1QX3A 3R5KA 1SHLA 4N6GA 3R7SA 4IYRA 1SC3A 3OD5A 1QDUA 5IASA 5K20A 1RE1A 2CNOA 5IAJA 3GJRA 1RWXA 4ZVQA 3PD1A 1RWVA 3DEKA 3V55A 1RWPA 1GFWA 2C2OA 4HVAA 4QU8A 4EHNA 1I4EB 4EJFA 1RHQA 4EHFA 3DEHA 5LU8A 3UO8B 4NBLA 4EHAA 3NKFA 5LU9A 1CP3A 4ZVRA 1K86A 4ZVTA 1F9EA 4NOJA 4PRZA 2CNNA 3S70A 4DCOA 3V4LA 1RHKA 1QTNA 3NS7A 4JR2A 4FEAA 3R6LA 4QUGA 3V4OA 4QTXA 1JXQA 2HBZA 2K7ZA 1GQFA 4D3ZA 4D3YA 1RHMA 2C2ZA 2C1EA 3DEJA 3H11B 4HQ0A 4JR0A 5I9BA 3V6MA 4I1PA 1NMQA 2HBYA 2QL9A 2Y1LA 3ITNA
chains in the Genus database with same CATH superfamily
4K8OA 1EFKA 2BC9A 3TL2A 4L4SA 5EEGA 3BRWA 3EWNA 1Y9AA 1C9YA 4UMFA 4IHKA 1SRRA 3LP6A 1JHAA 4YJ2B 1RZRD 2EKZA 3UFXB 1P0FA 3GJ5A 3H5IA 1WNFA 3Q6NA 3O82A 4DDUA 5ICGA 2WUVA 4E0BA 6REQA 4F3NA 4GDFA 1G291 3D1VA 3K9WA 2AJCA 4FDTA 2OL4A 4HLCA 3X1YA 1RQNA 3Q6IA 3ASYA 5AW4A 2FU5C 2Q3BA 1DEXA 2WJVA 3D7SA 1FYEA 3M5WA 2Y71A 5BSTA 4H3HB 1JZSA 1SVWA 4QUKA 2DZDA 4E5YA 3V4ZA 1JQBA 2ZRQA 1KK2A 3EIXA 4QBKA 2RJNA 3TW0A 5IDXA 4YY3B 4N76A 1Z4MA 3DFIA 3QVGB 3DAPA 4LZLA 1PZEA 4WIAA 1Y82A 2CKDA 1BCSA 2YXNA 4CM4A 4TZ6A 1E6LA 1NQVA 1PJ4A 2FR8A 3FTCA 4NK5A 4XW2A 4DA4A 2C7RA 1Q0ZA 2BRUC 5GJWC 4EGFA 1KGDA 2XUHA 2JJ8A 4G24A 1N36B 4IFBA 3PYXA 1BMFA 2Z2YA 3H04A 4PTYA 4LBWA 1BO6A 2FGKA 3DP7A 3HYLA 3IO3A 4NMXB 4BE7B 3PRHA 1XT6A 3EDQA 4YJ2A 1H2AS 1OBVA 2XCIA 5K6TA 3Q9NA 1QHGA 3X1DA 5IZCA 1EP2B 3W8EA 1RYMA 4IF4A 4ZQIA 2GXAA 1KI7A 1XZBA 4IO0A 1C1YA 3EXG2 1BQEA 2B21A 1US8A 3ZI0A 5CB4F 3EAFA 2HMTA 2OA0A 4LHSA 4K6GA 2YRXA 3NHZA 2XVYA 4JHXA 2VDKB 3ZE6A 2OP0A 4R51A 1RLMA 2DUNA 4MPTA 4OF4A 4E46A 4EX6A 4WSOA 3WYCA 3MQ4A 4MMXB 2GD0A 1NVVR 3WRXA 4B2YA 3EEYA 2PBZA 3RKSA 1XB2A 1PG2A 3KOMA 4F1KA 4DMHA 1YS7A 2AXPA 2HA7A 2VP9A 5ICMA 3QVGA 5FD8A 1QWSA 1SFRA 1UC4B 1ZINA 3GBVA 2ZJ7A 1ST3A 1BSVA 2N42A 1E1RD 3KSZO 3H9UA 1W8DA 2KLBA 1EAMA 3FPSA 2GO7A 3ZGOA 5JRJA 5KO2A 1Y6GA 3EBLA 2J5RA 1I4LD 1J8DA 2A9VA 1SCBA 3EY9A 2YZ7A 3MJSA 4N65A 5BYAA 4X63A 2D2EA 1U8ZA 1HFEL 4HOYA 4K6FA 3CCCA 4HUTA 2I1WA 2XDQB 3T3HA 1YQXA 1XTIA 2CFIA 2J9RA 3FPLA 4RH1A 4KXVA 2FUCA 3ULKA 1QOZA 5AK4A 1RZ3A 2QX8A 2ETXA 1UMCB 3KT8A 4GR9A 5AXDA 3U3MA 4C4TA 5JCZA 2C7PA 5IS2A 4DFDA 3DBRA 2ORWA 1DXOA 2A9FA 2BMWA 3DDCA 4S0ZA 4YT5A 1DBIA 1J0AA 4QX6A 1XFAA 2NSJA 1PJ8A 4KLAA 5EUBA 4KGXA 1WXQA 2RK4A 4FI3C 4J0QA 2HK7A 1Z16A 2C3UA 3PUWA 3IUNA 4MULA 5JNRA 3SVLA 4WK0B 4OSEA 2WT9A 5F7OA 2JANA 13PKA 1IN6A 1BEUB 3IKJA 4D4IA 2OENG 4UUAA 5FX2A 4US1R 2ECOA 3OPMA 1VL1A 1PR5A 3ANMA 4Q48A 5JS6A 2VJDA 4X24A 1ZONA 4IKEA 2X2OA 4KVGA 3VZSA 4DABA 4FHFA 3H9JA 4GLBA 4WN3A 3G2KA 3SNKA 3HK2A 1LWOA 1X7ZA 3X2SA 4E5UA 1C9JA 4A8JB 2F7SA 4YJHB 3PCTA 5AKIA 4YMUA 2F9MA 2FETA 3V8MA 1FEZA 2I33A 2B4RO 2BGGA 2HU2A 2XMGA 1E79D 4KYTA 1GN9A 1JW9B 1Y3DE 4UDYX 5CFRA 1J2EA 2G08A 3AHDA 4HUQA 5HZKA 1JBEA 2D4HA 1T9GR 1TEVA 1V4VA 1UMCA 3O8OB 3WG9A 4DNOA 4POOA 2H29A 4WOPA 2NNLD 4H18A 3QJ5A 3JSAA 3OA0A 2ONZA 4PGHA 3ELWA 4PZEA 3IXQA 4RZSA 4OHPA 3DOJA 4D8VA 3K30A 1CZKA 1BHJA 2A5GA 4EZBA 3JXEA 1TIBA 1WMFA 1Q7GA 1AB6A 2R68A 1PDVA 2QUAA 3DGEC 3L9WA 4RPGA 2JLYA 1J4AA 3FTQA 2EZ9A 2P4EA 3H5WA 1QFJA 4N6OA 4B87A 4BPRA 1XZ8A 3VSAA 3KNZA 3WRYC 5LKRA 3D3NA 5C51B 2DG2A 2BSQA 3DMYA 2YBDA 3CH6A 4NECA 1K3FA 3GOQA 4HLDA 3RJ9A 4L72A 5ALRA 3BQMB 3JTMA 3DAYA 5L3QA 3KQUA 5JWHA 3PQ8A 4UHDA 3HJAA 1Z5WA 3NTVA 5MHTA 4KZKA 3UV3A 1KMQA 1P81A 4HZGA 1PYGA 2J8ZA 2O07A 3RIHA 1SQFA 1KARA 3R77A 1NUHA 4BYMA 3FUCA 4I2VA 1URPA 2NU6B 4OGWA 3M81A 1S2MA 3MTIA 2AUNA 3KZVA 4B4DA 3WSVA 1H42A 4JLMA 1Y6RA 4H7JA 2PMFA 3HPRA 2IU6A 2C2WA 1FCJA 3VU8A 4C3UA 5JMWA 3N8DA 2Q27A 4G67A 1EGAA 3ZY5A 3TKAA 4Q3KA 4AY3A 1G63A 1JPJA 1GUYA 3R3HA 3R6WA 4EITA 5K01A 2HYIC 3DZIA 3EPLA 4P1ZA 3E9DA 3ZE0B 1H5QA 2ZYWX 1PL6A 2F59A 2NAFA 3E18A 2EQBA 3PSHA 3T9DA 4ZK6A 1F0PA 1OA0A 3EQ6A 3P26A 4R1TA 3EYAA 4OHOA 4QO7A 3TJRA 4BO2A 1F7UA 5DRTA 3S2GA 2I91A 1VKZA 4HMOA 4CMIB 1I01A 3I2KA 1UBRS 3WNVA 4U2CA 5CDGA 1SC1A 2DPGA 2OZVA 4GZ6A 4FBLA 1WWKA 1B0AA 3DEAA 5REQB 2ID9A 2PFGA 3DMFA 3IBSA 4KEAA 4R81A 1NJGA 3MELA 3ZHQA 1DOHA 1MTOA 3PJFA 5ISMA 2D0PB 3PUXA 3VYRB 1U7WA 3U3OA 1B6GA 2BUCA 5KREA 5LP6F 1JQLB 3D1JA 1DRVA 2O5EA 1B0ZA 4S04A 1JYSA 1A50B 4P6VF 5HIIA 1UJ6A 2NU6A 2P7IA 2QTWB 4TTPA 1XTUA 3KZMA 3HCBA 3NETA 3H8VA 4H6WA 3FJYA 1ISPA 1RKVA 2FX3A 4L95C 4EF6A 4GKVA 4PO3X 3K71B 3PC7A 1KSHA 1YDWA 3GP3A 3T9CA 3I37X 3TKYA 1ZM3A 7AT1A 3ICEA 2VWPA 1A8SA 3FJ1A 2IEAA 4FNGA 5EJEA 5HS4A 4CL8A 4L5AA 4PZZA 4HAVA 2WR8A 1L4YA 1VPTA 4JJAA 4KBFA 2IY9A 1QK3A 3R8CA 3TQHA 4M60A 3CWCA 3I2GA 2F8TA 4R41A 4NZMA 3CB2A 9ABPA 2FPWA 3DAHA 4KUEA 3K15A 4CMIA 2HY7A 4MUHA 4ECAA 3CQ9A 3R0IA 5H82A 1YB2A 2J85A 2QG6A 3A3OA 4QDZA 3VR4D 1N78A 5REQA 3CUWA 4HI0E 2HTEA 2ZAYA 3FTPA 4BFLA 2HL6A 1P3DA 1OXTA 1P44A 2GFHA 3NQ41 4MYHA 3C1AA 1Z8HA 4IWYA 1EESA 2J7KA 4BJ3A 1T6NA 4LDNA 3QFHA 1N75A 4ND1A 4L2IA 3QI7A 3CVVA 5HKKA 3R3SA 1VYUA 2HZBA 2PZEA 3L1KA 4UJ3A 4UNNA 2I71A 1K63A 2V58A 3EE6A 3A9RA 3UAGA 1MB2A 4W9MC 1VIMA 1Z47A 4LYDA 5DGTA 5GPBA 1GNSA 3CPEA 5JC1A 3NBQA 2W2XA 2YICA 3JVEA 3RFCA 3DB1A 3U3KA 2QR2A 1EK1A 4KLRA 1PLJA 1YGPA 1ADFA 2WUEA 3FWPA 1RKQA 3C8DA 3GBSA 2IXDA 4LQLA 4UCFA 5GZ1A 4YQZA 4FMDB 1ZHFA 4B71A 5BNTA 1R5JA 1L7PA 4H59A 5IKOA 2YMQA 3HWSA 2VRWA 4XX1A 5SV2A 2W4QA 4B2PA 3CURA 1UPCA 2IYLD 4FZRA 2BZGA 1NSYA 2PRYA 3M6LA 3P2KA 4HATA 1DFHA 4QSHA 4YJGB 1G8GA 5FUYA 3LT2A 3SOZA 5IZ4A 3S5JA 3A9SA 2FPOA 3RYIA 3D43A 2I6GA 5KCMA 3TL6A 2Y0EA 3F2IA 4IH4A 1E7YA 2XZTA 3KEGA 4YHBA 4A10A 3RYFB 1X70A 3N0VA 3HP4A 2YXEA 4CIAA 2YWRA 3H97A 2VR1A 3P9RA 4UTVA 5HM6A 4GM4A 2XE7A 4MCHA 1GA6A 4JV5B 2XGSA 2PKWA 3ETLA 4BUCA 4WK6A 2ZG6A 3OH8A 3TRIA 4EG6A 3H8SA 4HH1A 1O57A 4N3BA 3R9KA 3K9GA 2VL7A 5AQ1A 2ZEJA 3LX4A 3OJWA 3QXGA 2XUAA 1OLOA 4G23A 3EXHA 4EHDA 2QRKA 1LQ2A 1AUOA 3COWA 4BB6A 2J0UB 3A05A 4LJ8A 4FB4A 1UWVA 2R6JA 3KEMA 3AEUA 3MWLA 1NRIA 4OJTA 4R2MA 5AXAA 3BD8A 4J6FA 4K88A 1BGXT 4JX8A 1PNTA 4TV9B 3U48A 1EWVA 1KI6B 2YQZA 4EYSA 1JFRA 3FW1A 1Q3HA 3AB3A 4PO9A 1R0XA 4UDOA 5E38A 1Y7PA 4Z6KA 4F4HA 4I4NA 3ZD9A 3BWDD 1M8JA 1X8XA 2XV1A 4IGIA 3UJ9A 3MHTA 5JU6A 3RK0A 4YRDA 5KYNA 3VRHA 3NZEA 1Z0IA 4K3VA 4RFLA 2HMWA 2WIDA 3T7KA 3CV3A 1JL3A 2FPLA 4XQ0A 3U5ZB 4G0WA 4HPJB 2VT6A 3KZXA 2C2HA 4LSWA 3JYOA 1QB8A 3NHBA 1F9EA 4TSFD 5DM1A 2Q9CA 1FTYA 1YASA 2VAMA 3DPIA 1IM5A 1NTOA 3LLUA 2Q6LA 4IMPA 5LA6A 3KQWA 3CXRA 1U3GA 3T9BA 4MWDA 1EFUA 1NURA 1Z0JA 2DUMA 2BGRA 4HDNA 4LSGA 4BWYA 2OPHA 4PLYA 1O1YA 3L9XA 4XVHA 1L3BA 4LJ4A 3VPSA 2I0FA 4DA0A 2O5CA 4JB3A 1UBUS 2P41A 1JLLA 1WB4A 3I23A 4RHTA 4C78A 3I39X 3VPDA 1XZHA 4TV9A 1HQDA 5BURA 1CCWA 2YXPX 3I4CA 3KVVA 4LYFA 5A9RA 4RTRA 3OAAD 2RH4A 2IXFA 3E3LA 4M46A 2C2XA 2G8LA 3MGGA 3CRZA 3EULA 4K81B 1C7FA 2B37A 3HMKA 3U7EB 4EK9A 1JHYA 3W1EA 1PBTA 3I0MA 1ODKA 1FP6A 2LDXA 5H81A 3TMAA 5DNYB 1U63A 2H8GA 4MRMB 5D5QA 4HNTA 1ECPA 5J4LA 2XDAA 4GHWA 4PC6A 2PRIA 2YINC 4CIXA 1BEEA 4U2FA 4Q9JA 4TWAA 1NM5A 5DOVA 3VR4H 3BD9A 4NR0A 4PPYA 2ZT8A 5F7ZA 2J30A 2WU0A 1FDVA 1GGEA 2REOA 3EIEA 2GSDA 3TSZA 8ADHA 3FG9A 1ZH2A 2CVZA 3ESXA 4GXTA 4HYEA 1M2VA 5CEEA 4D26A 1SXGA 2QXYA 3BFXA 1X80B 3VPCA 5I9NA 2A92A 2COUA 4HNAB 3WL7A 3UGQA 3UXMA 1YDHA 3V8EA 4M1ZA 3T1QA 4DADA 4HHEA 3KQLA 3DLPX 2DFKB 4H7DA 4N3CA 4FOTA 1E3MA 5KWEA 3EH2A 3KR9A 5E9QA 4KXUA 1NV9A 3JWPA 4PCUA 1PS8A 1BKYA 2FOXA 4RMIA 1OX4A 1XL0A 4HRYA 2OQRA 3UMJA 2O8DB 1JB1A 1RJDA 4G5QA 5C3UA 4Q7MB 1KMIY 1U7HA 5GJCA 2H31A 4U5QA 121PA 4ROSA 3GA7A 2WKWA 2RARA 4JGBA 3PD7A 4M1SA 5FYDA 2B82A 4MYTA 3V1MA 1EAYA 1JHMA 1XDUA 3IPYA 4W8HA 4QQFA 1XMPA 4W7IA 4ZI3A 3CVWA 3LOUA 4LMRA 3MYRA 2EJTA 2FW6A 3F97A 4O2BF 5AW1A 2V5UA 4FR0A 3MQFA 4IXTA 1J42A 4M88A 4EWLA 1U1DA 3W2FA 3AL0C 4WERA 5AD1A 1L9XA 4UBJA 3RSFA 3CGWA 4BX2A 4LDZA 4DV2B 3FYTA 2ZUBA 3R9XB 3B13B 5FUXA 4Z8XA 3GDFA 3DKKA 4QGBA 1P39A 2MR5A 3KU1A 5LA6F 4AXBA 3ABOB 3CZMA 1JHRA 4LUCA 1A2KC 1GUBA 4ZC1A 2PE5A 1SCUA 2GZDA 5K3DA 1GRVA 1PG5A 3DO6A 4ZHQB 4TLLB 1FFWA 2ZJZA 3QLUC 2Q1UA 5F51A 2G8NA 2H0AA 4ZK2A 4B4KA 4N0QA 4QPJC 1PV2A 1GNTA 2XGOA 1TJ4A 4HN9A 3O03A 4RM2A 1LQTA 1IHYA 1FX0A 5I9LA 4EGJA 1XTZA 1A9XB 1L7AA 1NRXA 1P5JA 2HQRA 3FBTA 3IT3A 5KSPA 3WGZA 2FQXA 4AUEA 1E8MA 2C5AA 2C96A 4IIXA 4YPVA 4BLVA 1NUUA 4BMNA 2YIJA 1SOAA 2DWOA 1R74A 3GQVA 5GMOA 4GOXA 1ZL2A 4BMVA 3RGGA 4WL0A 4YCCA 4MJ3A 3A10A 3EPJA 5AKJA 4O3MA 1F9AA 5IH7A 6Q21A 3NIDB 3PGVA 3VNSA 1CJVC 3AP1A 5SYNA 5CITA 3QXHA 1D9XA 2R11A 3ELBA 2CXQA 2RHTA 2J4CA 3Q3IA 5IYZA 1FTGA 1UBHS 4QOFA 2ORED 5EGNA 3R9XA 3VJLA 3U0VA 5E4JA 5TQVA 1FVHA 1A8UA 4RH0A 2JHCA 3RAJA 1RPZA 2W2QA 3E8SA 3K96A 3K9FC 4FT4A 5ES4B 3AB8A 4HB0A 4P8RA 3U16A 1YVRA 3BDAA 1MJFA 2VPZA 4BMYA 1Z4PX 2OB1A 3A6DA 4RBNA 5GV8A 5TT0A 5KYKA 3HV0A 2XZLA 5JPDA 2QY6A 2BGIA 4D9CA 1B16A 3F8WA 5K4GA 4QVIA 1VL5A 1N2ZA 2EV9A 2WF5A 4EGCB 1I10A 4V03A 3UYLA 4TL8A 1EBBA 1T24A 2JFVA 2Y4OA 1FMJA 2D5IA 2MWMA 3KJIA 5JFTA 1UPUA 1TVKB 4J4TA 2GD1O 5CB6A 1VG1A 1RLJA 5BVHA 2JD0A 3LC1O 5DM2A 3JWIA 1G59A 4Q9NA 3OIYA 3RG2A 3UUWA 4YMGA 4JT8A 3WBJA 5JJKA 1IZ0A 1PLKA 1Z4QA 4ITRC 4KO2S 3CT4A 2RGGA 3DBOB 1PWEA 2F55A 1CKEA 2ZJ0A 3F8SA 4WNYA 5TVKA 3K4QA 4JS0A 3ESQA 4MUYA 2I55A 2E1RA 1AQNA 3RJ5A 1NXSA 3PVZA 3UANA 1USIA 3FLMA 1KBZA 2I2BA 4M0DA 4MI9A 4E51A 4Y6SA 1D4AA 2W2NA 2GXSA 2BEJA 2JFBA 2WU1A 1NPTO 1ZGAA 1Q57A 1OVMA 2XQJA 1QVWA 1Y4AE 3P0HA 5ANRB 4MCAA 2IWRA 4H4CA 1M1XB 2V97A 5TS2A 3SXPA 3VR5A 4DXHA 1WOYA 2C2KA 4UNIA 1KEPA 2REQA 1QANA 4I1OA 5IWAB 1K7YA 3QVJA 4FDVA 4PO8A 5LZ4A 1JJ7A 1RW4A 1G55A 1W46A 3LHIA 3O92A 3BXGA 4GR4A 4IMJB 5EAIA 3V2GA 4BIIA 4LI0A 4C5AA 1JIVA 1N32B 3WFZA 3MWEB 4G0PA 1NJ1A 4FGWA 4HLQB 3HR7A 4NBTA 1CEXA 4V39A 5DYIA 3R7FA 2DR2A 1E66A 2UUAB 2GKOA 1JSCA 3BK2A 4MR8B 3QTTA 2IBTA 1CUHA 2JEOA 5JSKA 2C5LA 5KMGB 4BX0A 3L8DA 1LPSA 1CEEA 4NCNA 4WKPA 3AEXA 3V2UA 3H7IA 4EW6A 3OWXA 1BVHA 2X14A 2A9OA 3WC4A 4BGVA 1JR3E 1J2UA 3PXDA 1H3NA 4G5FA 2FNAA 4Q93A 1SHTX 2FPPA 1HQYE 1UWCA 3GRYA 3RSLA 1RXYA 4O4IB 4E32A 4G25A 2PUJA 5H4HA 3ZY3A 1E6EA 2AYXA 2PT5A 3ESAA 2AOUB 2Z8YA 1Z5OA 4M1KA 3NVAA 4URFA 4TLBA 1ISMA 2D1SA 4DMFA 3FD8A 1GA1A 4RLHA 2Q46A 1LB1B 1XTVA 4B7ZA 2KQUA 5IYZF 2O54A 5FKJA 2C4HA 2PSJA 2WAYA 1YJCA 2P35A 3D8SA 3LUDA 2I66A 4PLHA 4AICA 4RGVA 3VYSB 3ZK8A 5IH3A 4B6GA 2F3SA 3JRXA 4LOJA 4HH0A 3PIDA 1N8NA 3MWEA 3GOHA 2ZPTX 3V8NA 5FTKA 3CZQA 3V1TC 4EW3A 4IUDS 1U7TA 3N70A 1ZK2A 1U7DA 1XAIA 4P35A 4Q1DA 4LCBA 4DLRA 4HT3B 1YR8A 2EC5A 3E1SA 4ECEA 1SVSA 4NFYA 4OMCA 2EARA 2VHCA 5HQ3B 3ON5A 5IXYA 4PQYA 4L5CA 1LRJA 5GM2A 3UPUA 2F6RA 2PUHA 4CKWB 5B1SA 4M7OA 2Q2NA 1E1LA 2CJWA 3EIWA 5AKLA 2PUAA 4NATA 1ZSNA 1Q19A 2QL5A 4GLLA 2JBAB 1VDZA 4MB6A 5HJ2A 1ZICA 3MSXA 1X92A 3MQ2A 4EB0A 2ZQYA 2WM9B 1V16A 1UBMS 1CRZA 1YV9A 3UB4A 3T99A 4R7TA 1YOBA 2CHVA 1JB9A 2BEVA 3STUA 1E89A 2AOTB 1SM4A 2AG0A 5BVGB 4HGQA 5U1PA 1C81A 1G4AE 2YXLA 4TQAA 2NUPA 1J5XA 2Z8ZA 4LYYA 4LZAA 3K9NA 5EESA 1NYRA 3SEAA 2UXDB 5CG1A 3T52A 2ZWMA 4RESA 4D43A 1BMQA 3AR3A 1RIFA 1TQ8A 4Z3DA 3ZV4A 5ARBA 2RI1A 1JU3A 1TUBA 3L7AA 2IHYA 5JQGF 1K8ZB 1FNDA 2XB4A 2IQ5A 2QN1A 3IT1A 1IH8A 3W79A 4CDRA 2G76A 2G7MC 3C5WP 1RLIA 2JIPA 5AM2A 4KLCA 1AMUA 5CFZA 4PPFA 5IJAA 3UBTA 1EQ2A 1X3LA 2N0SA 1ZKDA 2G07A 1U3TA 1CZUA 2NLOA 2WHEA 4HZUA 1NSTA 1DKOA 3L07A 4KWCA 4R1PA 4CMGA 5LQNA 2HA4A 4QZVA 5C4GB 1U0HC 2WJYA 1QLWA 4U4AA 4TWRA 4JT4A 2EERA 4ZVSA 4CM7A 2BV3A 4FONA 1QUFA 3BGWA 3CJQA 3O6VA 3ZKWB 5F3DA 4PZUA 2A5DA 2TS1A 4GOND 4IWXA 1EP3B 3N3AC 3KKLA 3U4CA 5KHLB 3HEAA 2QQ5A 5KTKA 2V59A 5EQFA 5BORA 3OE5A 1I5OA 4MQ5A 1D6MA 1X77A 3ACCA 1UBNA 3U3XA 4OH1A 4ADSG 2B8EA 4NYIR 3VC3A 3WK5A 3TR0A 3BICA 1TT5A 2DTXA 3V7FA 2FMKA 1Y4DE 5CH8A 4S05A 4YGYA 3QYAA 1N7GA 4EVRA 3HFJA 3RAGA 2P2GA 2J31A 3AZQA 3GPDG 1ZRSA 2BFEB 4A0QA 2QQGA 3TIFA 3FNEA 3IDZA 1ODSA 4WI1A 3LUCA 1EJ6A 2BM1A 1OFTA 2D3TA 3L4EA 1D7OA 1BHO1 4HX5A 1P2UA 5FBRB 1KSGA 5F5NA 5LYJF 2EW2A 1JZTA 1YBHA 2C5FA 2XOKD 1JT2A 5A05A 5T5QA 1JKFA 1SXJE 2P90A 3MCVA 4YO7A 1TFRA 1QRAA 1D5CA 4PHFA 1LSOA 2PAFA 4ZTUB 3SR0A 2GN4A 3GLIB 2QMHA 4KE6A 4R6WA 5HG0A 2P9TA 3B6JA 1NWHA 4FQ8A 4A8TA 3ZJTA 3VAZA 2ZSUA 3GZNB 1R0SA 2VWGA 4AYTA 4MUFA 4R40A 1A9PA 4H3VA 1BE6A 3AM3A 1SBNE 4D9BA 4W5TA 3KHKA 1ETHA 2AN3A 3S2EA 3HY3A 3VR6A 1IEWA 2K7ZA 1JHXA 1ADCA 4ZHSA 2XVMA 4BXOA 4Y2YA 4IMIB 2W6PA 4GI5A 4GWKA 1ISIA 1Y7LA 1EUDB 2FEPA 2GAAA 2OQVA 4QASA 1XQYA 4F85A 3GF4A 2BFEA 2F43B 2MYPA 1HFKA 3TLEA 1YDMA 5ARDA 1SC6A 3FVWA 4R8SA 2B78A 2BOVA 1QDEA 2P6OA 4B47A 4EJSB 2RHMA 3L7IA 3PPYA 3ZCUA 5C5IA 3UJAA 1DTWA 4QOJA 4NMLA 4ZOLB 2G09A 2BEUA 3JQBC 5T8KA 3ES9A 3KYCA 4MVWA 1C3LA 1ANKA 1M0SA 5IKEA 1KP9A 1UXOA 3OMXA 2IZZA 1VL2A 1YIOA 4PAWA 3STYA 5C9ZA 4N3GA 1Z06A 2VJBA 3AONB 4HN4B 5CVUA 5TQ0A 3UIEA 2WI8A 1XTKA 2YDYA 2AQHA 5IDWA 1DEAA 4YRZA 5I7HA 4KO3S 1E2NA 4PG6A 3UHJA 2V7WA 4A5SA 4I1VA 3I53A 2ZZKA 4Q18A 5GONF 1J39A 4EKEA 3S2SA 3N07A 2NV6A 3TBKA 1XALA 5LQDA 1JVSA 1Z5VA 1KBQA 4AMYA 4KDEA 1QE5A 4UE6A 3Q7QA 2OCDA 2Q5JA 3RC1A 4Y2TA 4ETMA 2I1QA 1YR1A 1Q7EA 2IU3A 3TRHA 4DLUA 5DHUA 3KVOA 4UTXA 5K09A 1CWUA 2Z4RA 1UL1X 3IXLA 1AS2A 2ODAA 3NT5A 3WE7A 4ARZA 1PQ4A 3RARA 5JSUA 3TPZA 2I4OA 1KDVA 4EJSA 5JMPA 3PJDA 1GJRA 2IZ7A 2YQ5A 1QMGA 3GJXC 2Y9PB 1VIAA 2K5UA 3AKYA 3SHFA 1HXHA 3MWFA 2Q2VA 1JPVA 1V8ZA 4TMXA 2EGUA 2EEPA 1ZU5A 3LBYA 3MXOA 4AWXA 4YREA 2PYZA 1C14A 3ROKA 4PAQA 2YHIB 3CWQA 5I51A 3QE0A 3IP1A 3SHQA 2I4IA 1XCJA 1YJ5A 3PZRA 3RS2A 2AMYA 2P91A 4K9PA 4LPKA 5CW2A 1DKLA 1VGVA 1XA0A 3SLGA 3TQFA 1EE9A 4GBED 5JHGB 5DTEA 5ED0A 4O29A 3M1LA 3LNCA 5HMMA 2PUBA 5KOYA 2BFCB 3NP7A 1S7GA 4IP0A 2OO7A 4FLEA 2F64A 3W4KA 4AN1A 4WZBE 1W4BA 4FLFA 2WLSA 4RY0A 1KO5A 3GPLA 3MBKA 3V8VA 4YT2A 1M0EA 2WTBA 2IS1A 3IE2A 3E9CA 3CEPB 1BU8A 1SOWA 1VSTA 3CJRA 4II7A 1U9YA 2ZU0C 4N12A 1F2TA 3EAGA 3C4QA 3WL8A 1U8UA 5DRYA 5FWYB 1R4NA 4HVAA 3WSTA 5GZ6A 4A8JA 4B83A 2ZYIA 2V6MA 3I04A 4M1WA 3R5XA 1H0RA 1B93A 2RJOA 3AUAA 4HF7A 1MOPA 4UXIA 3SWWA 1QR2A 1CUWA 4BMCA 1ZSVA 2CSUA 3WJ7A 4JLOA 1DJMA 5J47A 3S4YA 4BTLA 4DBVO 2JRLA 3U40A 2G5TA 4RJIA 1KZHA 2UYOA 4D3ZA 1GSOA 1V39A 1Z38A 2JL1A 3L7KA 2YHIA 4KQCA 1PGQA 4B3JA 3RHZA 2F4VB 1AKRA 3QVKA 5DKFA 3ZZ1A 1Q1AA 1S1MA 5JNVA 4DV3B 1ZS9A 3U49A 4GBMA 5ICFA 3CUVA 4ZRMA 1Z37A 2FWRA 3D8HA 4QSMA 3ZU5A 5JSZB 2ZLBA 3Q5EA 3L2OB 3PITA 3SC6A 4GBGA 3QFTA 3SHVA 3TZLA 2XUQA 1KVSA 3RVNA 4I36A 4WZBA 3QXJA 3VOAA 4ID3A 4OD0A 5CDUA 5KNDD 5E6SA 4ENVA 1J22A 3N8KA 1HO3A 2V6GA 1QVVA 2PXHA 1MORA 3OZBA 3U4IA 3X1KA 5BSGA 1P1JA 4UQLA 3COYA 2AXEA 1TQ4A 1CDZA 4UAVA 1AKQA 1I3MA 1EHCA 3OUUA 1FTWA 4RD6A 1MGPA 3KHSA 1ZMOA 3S2YA 5C5CA 1UAYA 2FP4B 1X86B 4RFVA 1XNRB 2O8EA 2WIGA 4BRUA 1SZDA 3PTLA 3PL5A 1JHDA 2H85A 4TGLA 4Z4CA 4HWOA 2QM7A 3H9GA 1WO8A 2VC2B 1F51E 2QUIA 3HM9A 4L51A 3BT7A 4WNAB 5BQ3A 2OY0A 4TS9A 4YIKA 2HJSA 4XDHA 1PHRA 2VCYA 1V9SA 4PQEA 1W5SA 1FDUA 3MPOA 1A7UA 4XFJA 2HA6A 4QFDA 3FN4A 3R74A 2VH1A 1TQDA 5LQKA 2VTDA 4OHZA 2O57A 2F1OA 3BWEA 4KR9A 1R7RA 3TX2A 2IP2A 1W6RA 2BTQB 3OOWA 4I5EA 4KE8A 4NAHA 5CUQA 3K6SA 4L07A 5JCJA 2R00A 3KOWA 3PNOA 4CV2A 3DEIA 3C70A 3C45A 3PGXA 1C7EA 5JS7A 3T3NA 3CN7A 6GPBA 3S7ZA 3ZHSA 1VI5A 5P8WA 4CIDA 4BU1A 3OLYA 1FJHA 1T1JA 4ND4A 2ZM6B 1UMDB 1OB5A 1O6GA 1W4CA 2ZSIA 1KPGA 3G82C 3KWLA 3NDRA 4DSTA 5JTUA 3I8XA 2Q6TA 3EGCA 3IEXA 4XFDA 4X93A 5C7IO 4PX5A 2GUWA 4RIFA 3WFJA 3ZHOA 3EZ6A 2OM2A 4DCTA 4DOMA 3OTOB 3RW9A 3HVIA 3GLGB 1U9IC 2RB5A 4TKUA 1TEXA 4H4EA 2ZUSA 2QRJA 3DMDA 4U9UA 1D3AA 4KG7A 3QITA 2GBGA 2IXBA 2Y1EA 2C31A 5FCDA 4BCDA 2QW8A 1E0SA 1U0FA 4OUDA 3A1SA 1X1QA 1VJDA 5CVEA 2DWPA 2L19A 3ISTA 2PQ2A 4H7KA 1IULA 4UQOA 3K5WA 1N5IA 3FBGA 4GGPA 2QJOA 1GG5A 2F48A 4FFWA 1V1MB 3NDIA 4N0MA 4NULA 4UPDA 4AKEA 4A0GA 3UWKA 3MRXA 5AVYA 1BKSB 3THYA 5H59A 1A77A 4X5OA 1YRQA 3I9V1 7MDHA 3I0NA 3D4NA 2O1WA 5CA1A 1Q11A 2CFOA 4AM8A 5CVJA 1ARZA 1CK4A 4X71A 1E94E 4R8VA 5B1DA 1PIWA 4E5VA 3BILA 4R2JA 2OCYC 2B6NA 3LLCA 1JEQB 1PWHA 4KQGA 4A8PA 2G9ZA 4BFSA 1IBLB 1XE3A 3W4JA 2FEMA 3B1WA 2IIBA 4MUMA 1NP7A 5FQNA 3BGDA 2FX5A 4EECA 4FB5A 2RSLA 2UUPA 3CKYA 4OHYA 4PU0A 4R8KA 3RUIA 4ZZIA 1UCFA 2XWJI 3ONEA 5BT8A 2ZYDA 1KIAA 4WRRA 3NMUF 2NQ2C 2FHSA 1NAHA 3URKA 3N8GA 1TU0A 3BE6A 1EK0A 3E3MA 4RKEA 4Y6PA 2CDAA 1AC5A 3IDOA 4U3JB 3C6QA 4YJ3F 2GGSA 3O7WA 3O84A 5KDDA 2VP6A 2QVGA 3HJHA 3R09A 5DISB 3ZX5A 1Q92A 1X13A 3O4HA 4IGFA 2YUTA 1DV2A 3UMYA 3T4UA 5HXAA 4Z9AA 4ZKEA 2EZUA 3RKRA 3AL2A 1KZ1A 3H4VA 4GUAA 1Y6JA 2QJTA 3NVDA 3UWDA 3ZBTA 1K0FA 3BXOA 3ZW8A 2C00A 3P52A 5AM5A 2UUBB 4DRZA 1PTJC 1NJ6A 4JBLA 1MXFA 2AOXA 5BN3A 2QRMA 5DLEA 1U5BA 5F76A 1U9JA 3HJFA 2Q9BA 5EYPA 4AF8A 4DSOA 5GOTA 1L3CA 3B7PA 1XYYA 4FDUA 5BWMA 2AVDA 4MDYA 4AF7A 4XCQA 4OI1A 1TL7C 1JEQA 1T5BA 5PGMA 2CL7X 1LDGA 4G2NA 4A0SA 2ECFA 5KNDH 1P4GA 3SYRA 2XHEA 4EPWA 1AK9A 4KRXA 4NS1A 1D5WA 2AOWA 2JGJA 3T12A 1YXMA 1BJRE 3CZCA 5K51A 2X22A 3EC7A 3UYKA 2QL7A 1YQ9A 2CNKA 5TIIA 2NZ8A 2DX7A 1KR5A 4FFMA 2ZZNA 1B3RA 1PP4A 4J7UA 2VYVD 1B1AA 2R2AA 1FC0A 2YNMA 4LZJA 4Q9HA 5EHGA 5L4NA 3EUAA 4Y2JA 5KJFA 4UTPA 1JJAA 1MEEA 4OLBA 1U0LA 1CZLA 5KYWA 4KE7A 3WQSB 3DHVA 3KJGA 2QR3A 4KQIA 1THTA 2FHPA 3IQZA 3HB1A 5FUMA 1GGHA 1SHJA 1FQKA 1XZIA 4CMEC 2NV0A 3GFOA 4NENB 2WPNA 1E6WA 2GCGA 3OSZA 1QKJA 1H2HA 3F5FA 3Q40A 3HVUA 1F8YA 1XNGA 2CF6A 4FX5A 4M1YA 5SY4A 3TB4A 1J97A 3WGTA 2GCPA 3GY0A 4JJFA 3WMEA 4B6EA 1X1TA 1OAOC 1P9NA 2H5IA 4ZMRA 4B7CA 4BWVA 3I30X 1AOXA 2BFOA 1SOUA 2GJ9A 2ORIA 3EGXA 3CUKA 5JALA 3LZ6A 4ND2A 4G1FA 3TVYA 3W2IA 2PX8A 4CCWA 5CVCA 4ITVA 5L6LB 3HU2A 1PUIA 4DSZA 4YMIA 1JSLA 3MILA 3ZHBA 5AOAA 4LVCA 1RQRA 1DIGA 1X42A 4QELA 3RDPA 2G83A 2Q99A 3RT7A 3TEJA 5M3BA 1VKHA 1PT8A 2O7SA 1QC5B 2Y92A 2ZXEA 4I7EA 4OQYA 5IDQA 1N6PA 1W0JA 3R3YA 4ZRNA 5CXQA 4YJDA 3FY4A 3RC8A 1C7QA 4IJ5A 4OU4A 4IVQA 2CDCA 4MQMA 4C4RA 5K3FB 1X39A 4YRKA 2HMAA 1MX3A 1WEHA 1V7ZA 3I1FA 3ZZTA 5FULA 3EIUA 3QOFA 1EUCA 2NZYA 5GP1A 3AKCA 5J4YA 3LZCA 3H1EA 3NAQA 4ZVKA 3WV5A 1Z25A 4NABA 2IK8A 2HBZA 5TEWA 1PT9A 2JJMA 3V2HA 1EQUA 1VFPA 4JR0A 1CF2O 4M0EA 4R2KA 4IDFA 2HCTA 2H2DA 4F12A 4J0GA 4QXAA 5L3SA 4QXMA 4CDMA 4LC1A 4BLPA 5FWAA 4BFZA 3A3YA 1O4WA 4X1OA 3X1JA 4Y67A 3CG4A 4DLBA 4QXPA 1A9OA 5FEMA 4XJSA 2YWEA 4FP9A 1EE1A 3DXZA 2B4AA 1WW3A 2G40A 2HGSA 1S4QA 4TLMB 4WGGA 1SO8A 1G3UA 4XIYA 3ISVA 2AFHB 2Q9UA 3WLAA 3D6FA 1D1QA 4URZR 4JKOA 621PA 3BE4A 3LZDA 5K3FA 4RGYA 5TQJA 1YAHA 1U31A 2YY6A 3AEZA 1BWSA 3I9KA 4G5XA 4GFDA 1CUAA 3B8HA 3CTMA 3ERCA 3Q6MA 3EJ6A 4B3HA 1QYVA 1HE5A 1QYWA 2QN7A 3FZYA 2NTNA 3E9EA 4TT3D 4AP5A 1KAHA 4Q4AB 3RC3A 1YDEA 4CBVA 1P1RA 2GEKA 4NJOA 1FDIA 4RLQA 4NCAA 1W25A 3ABIA 1MZPA 4CTJA 2HADA 4B8ZA 3EIHA 1YJQA 3MS7A 4O4JF 3FDZA 2VJMB 3W6PA 2EX1A 1NG9A 1Y3IA 3KOOA 1UEXC 1VL8A 5ICEA 1Y98A 4OA8A 3VU3A 2PUTA 5I9SA 4N5DA 1AHHA 2VVTA 3P45A 1ZK3A 3T5TA 1ULBA 2WTEA 4EO9A 1ECCA 1U4NA 1B6SA 3TZCA 2CCGA 2NYVA 4CN9A 4B48A 1T36A 5DULA 3R23A 1CUVA 2G04A 4FOPA 1UXIA 4Z1MA 4IG4A 1OA1A 2AFHA 2NU7B 4X3CA 3TSOA 2OECA 3HGTA 2C8LA 4NBUA 4WUTA 1M7BA 2HF2A 1UBOS 4K9QA 4NY1A 5K6AA 4YPOA 1M2JA 3KFVA 2N1MA 3W5HA 2CB9A 3G2MA 4WDRA 4Y0VA 4XWTA 4DKJA 5JYCA 2GAOA 4KACA 1PJCA 2OEPA 3ZK9A 4UHCA 2RKWA 4BVBA 4A2QA 1JFTA 4MVJE 4JXZA 2WWXA 4GF5A 5DBIA 3BJMA 5JSHA 4GO1A 3K1AB 3KSDO 2XYVA 3NM4A 3QX8A 2VJCA 5B37A 4BLWA 2NTVA 3B2EA 2CVPA 1IOLA 1VP3A 5ALEA 2MSKA 4ZCLA 3FOEC 5CB4A 4YRIA 3RREA 1IBRA 2ZZMA 5BR7A 2E2WA 2FN9A 2DR0A 3G1UA 3HBFA 5MGBA 1RR6A 3EMVA 3DVAA 1YB1A 2BJWA 1TQ2A 5G0WA 3HQ4O 1CY4A 3K0AA 3ZR4B 5LU8A 1X87A 1SIUA 2BFAA 4JBIA 5H3CA 5AIBA 3KSUA 5KYXA 2W2PA 5ILQA 3FH0A 5AI8A 4UHBA 3T7IA 1XP8A 1P6XA 2OO5C 2D7DA 2DPYA 1A2OA 1NHWA 2HUPA 4M83A 3TQSA 4TKVB 4OFXA 4IDOA 1X7YB 3G5MA 3IE0A 2NYRA 3GX1A 5ELMA 3S2IA 2QUJA 3W34A 3ER8A 2CKMA 3DEJA 4QTTB 5AM1A 2IIVA 3NNSA 3SXUA 5KCZA 3I6MA 1N2BA 1XK6A 4M1QA 5AVKA 1RAIA 3HYNA 4KXQA 4PC7A 4YS6A 2HM7A 3EFOB 4OYHA 1U8FO 5JOQA 4KK4A 2F8LA 1MH1A 2WHXA 6ABPA 1JHZA 2XB6A 4RYDA 2R6AA 1G5HA 2KPOA 1W1WA 2P68A 4OGLA 4IZHA 2UAGA 2PR2A 1ZOLA 5L3ZA 2E5WA 4DAOA 4DUGA 4EHIA 2NUTA 2JI7A 1A97A 1A9SA 1GY8A 1PT5A 5IM5A 3ZDRA 2CNDA 4JEHA 4MKIA 1RMTA 1F6WA 4KBGA 4WT7A 3FKSA 1QHHB 3QU5A 4XA8A 4YRCA 2CMDA 2Y0DA 4TPKA 5FBZA 3BMXA 1CP2A 4FMBB 1ZISA 2Q62A 2HMVA 3GVHA 5TPZA 4DCNA 2X1MA 2GEDA 4S1PA 4OQDA 4HFJA 3TXAA 1FP4B 1SXIA 4IHJA 2H65A 3TLMA 1I14A 2ACVA 4IRUB 1QRDA 4KWIA 5JE8A 3PC8A 2W00A 3Q11A 3TLGB 4PYJA 5C18A 4LC0A 2DETA 1WQ3A 4QODA 1PWXA 4D0SA 3BEDA 3D4OA 2VCHA 2JEYA 4JC5A 1OROA 1T6ZA 1BXGB 4F2PA 1HYBA 4QOEA 1BCRB 3G89A 2DFPA 2R8EA 3ZDQA 1ZOPA 1DIBA 1XX6A 3EFOA 5DYWA 2P2SA 4IRXA 3WB0A 1PVOA 3HHEA 4D9MA 2MMGA 1VM6A 4RTNA 1SPBS 2VSFA 1MHTA 3LOQA 2QLJA 2FYTA 3BJRA 2HU5A 3A3NA 4INPA 1I1HA 3CLVA 2IEBA 3BE8A 4HPWA 2PHZA 1HUQA 4ZI7B 2GF0A 4RC9A 2JA2A 2JHFA 3CIOA 4TVBA 4WXEA 5F33A 3SJBA 3V1KA 1XPRA 2G25A 1NW3A 3GLHE 3OZCA 5AM3A 1QHHA 3GXOA 1BYIA 4JENA 2EL7A 5MFPA 2E18A 5IUNC 2I7VA 3ZH2A 1XQ1A 2KBEA 2BP7A 2VTEA 3I5AA 2HXGA 3FGNA 2R44A 2H2AA 2JKYA 3L04A 5JAOA 1RRCA 4I4TF 4C2TA 3REOA 1D2NA 5IT4A 2O7NA 1FP4A 4GI1A 4M76B 1NQWA 3VZQA 4NOKA 2M6KA 3ZU2A 5AW2A 3O8CA 1USGA 5KAMA 5DSXA 3AR9A 5LNK6 3PBKA 3KKQA 4UHFA 2QN3A 3TD6A 1VB5A 1CNMA 5CX1B 5FPHA 3UPDA 1SUEA 5F3WB 5DM70 3TOZA 4ZYWA 1HR0B 4EG4A 1KSFX 3H1PA 4D3XA 1GSHA 2PGLA 4Q6WA 1OHHA 3K0CA 4MQEA 4EATA 3VSCA 3A7DA 3FRJA 1Y3BE 3KWJA 3FDXA 4CYMA 5EUMA 3KJEA 2PJRA 1WZ2A 3IEPA 3KAPA 3AVXA 4CCYA 1PNVA 5K0EA 4C7OB 4OXNA 3NKVA 2BGMA 4Q4DA 3VKGA 4W6ZA 1SKAA 4IV5A 1I13A 2PGNA 2QP4A 3K20A 1KJJA 5JAHA 4N0PA 4Y3UA 2WJIA 2CHQA 2M1XA 1PR4A 3FCOA 3RSGA 4K9OA 5CEJA 2QEQA 4MVJF 2OZLB 2YXDA 3I2JA 2FZ5A 2C94A 1U1CA 1QF9A 2OV8A 4R4JA 1Z2PX 3LW8A 2DY1A 1LDEA 1ZBDA 2WUFA 1SCJA 2IDMA 4DNXA 3HBNA 4A91A 4CPDA 3EVBA 4GPTA 1JPNA 8AT1A 2SCUB 1H93A 1L5WA 3MJ4A 4UTOA 3AUFA 1C4OA 1PCXA 2PGIA 3Q7TA 3PNSA 2WKQA 1E1CA 3V6MA 2FMIA 1IZYA 3TW8A 1I51A 2DTDA 4W4TA 1ISHA 2X86A 2R2GA 3EG9A 3ELDA 2VSYA 3DULA 3ZV6A 4EEXA 3QUQA 3UAXA 3KSBC 1HNXB 3QLVA 4P3XA 3SHWA 1P18A 5CX1A 1YFKA 1ZXXA 2YMMA 3B1YA 3HEBA 1G6HA 2LTAA 1T4CA 2MMCA 3IJ5A 4FDMA 1DPGA 1Z4LA 4KAXA 4EPTA 1EVQA 3IS3A 4RVHA 1UDAA 3ETNA 2O7VA 2A4MA 5JVDB 1K5GA 5KDOA 1YTUA 1DX4A 5T7BA 3O4JA 3BXXA 2BMJA 2QGFA 4NVRA 3A9WA 2WD7A 2HO4A 1ORVA 2PX6A 4XX0A 2NPFA 3TRJA 3WLJA 4L6CA 1WTAA 1JR2A 1WKVA 2A5LA 2XECA 4YH1A 5FOUA 3I61A 2I67A 4FI3F 5AIAA 1SKYE 2VN8A 5KTTA 2JFZA 1WXHA 4M0FA 3AWDA 1H2BA 1U2PA 5J1TB 2I6SA 4WBNF 1NXPA 3A1NA 4H6XA 2RGAA 4Q02A 4NMHA 4A82A 2J5QA 1VXRA 4C87A 4EG8A 1GPNA 2G1AA 2BF4A 1LSJA 2Q0XA 1K75A 3BWXA 4BFXA 3RUCA 5JJIA 3T9AA 1VHLA 2YDXA 4JUBA 2XUOA 4DA6A 3NONA 5AYVA 2FWNA 4E1AA 4JJEA 1ONNA 4INJA 1XDSA 2HRZA 2EATA 3H2YA 3P71T 4NFSA 5AHKA 3L0SA 1DQRA 3DTTA 2NVOA 4TL9A 5H3HA 3KJHA 3VNUA 4RTJA 1QFXA 4CF7A 2XMZA 5EWLA 5FA8A 3IEUA 2BKEA 1M1NB 2J3KA 4O3FA 4CM9A 4D97A 4KYIB 4X00A 5K8IA 4WKOA 4BZZA 4QLBA 1QCYA 4L22A 1Y5IA 4AJ4A 1T26A 4MR7B 3E8MA 2OQIA 3KX2A 3HFGA 5J43A 2ZIXB 4GKKB 3GEIA 1FLAA 4MUNA 2H06A 4OHFA 1AA9A 3OM1A 3NIBA 1PW7A 3HKCB 3B85A 4JKIA 4GPAA 4TTAA 3G2PA 4WTOA 1FP2A 1P4SA 1QORA 4TXHA 4DQKA 3JASB 2YZ2A 3YASA 1OGYA 3CF6R 4BOYA 1SK8A 3F7MA 3DA8A 1OZ0A 1DRWA 3FWZA 4GI3A 4C4YA 5F7XA 2P4SA 1LSUA 2AMLA 5EZYB 4GXRA 3V33A 5SZKB 2BR5A 3ZNQA 2Y77A 4RA9A 3B60A 5CH3A 5FLEX 4HSEA 3AVPA 2FKNA 3DXFA 4IG9A 1W2GA 5EGSA 1D2RA 4PAOA 5K1ZA 2JLBA 3HVJA 3M8KA 2GCOB 4PBSA 1ZIYA 5GWXA 1X9IA 2EW1A 2PVPA 4GEKA 4NEQA 1FS5A 3WISA 4AYXA 1G8AA 1K9VF 1RAFA 3ZLBA 5EMJA 4EFDA 1VP9A 3JQ8A 1RWXA 2B0CA 2CVOA 2NO9A 3DNFA 3E9QA 1Z17A 2AUTA 2IHVA 3LJKA 5G1NA 2JIZD 3FSGA 1KZ7B 1FQOA 4DJFC 1RQPA 1RLTA 3IB6A 4ZOAA 1MQ9A 3DO5A 2SKDA 4XVUA 1NBMD 2I8AA 4PYNA 3AG6A 2ZWIA 4CUJA 2G1KA 4ZVTA 5DYGA 4DYDA 4D9IA 1Z33A 3QPBA 3UMFA 2X8JA 2ZKLA 4DCSA 2O3RA 4JLSA 1WMEA 4J0IA 3VJKA 1L2TA 5D51S 1DZIA 2WSLA 1MGOA 1AH2A 1GEEA 2IA5A 3AETB 3K2BA 3N2KA 2INGX 4P7JA 1T9BA 4F2DA 1VLQA 1Z4OA 4QXOA 1ZR4A 1N0UA 1UMBA 4C88A 4EMTA 4BTVA 5LZ7A 1NVEA 2GA8A 1IY1A 3M1YA 4E5PA 5JFGA 2XTJA 1QTRA 1QRRA 1W2WB 2ZJ3A 5CLHA 5GM1A 3JCZA 1UXJA 4BVAA 4ATNA 3IPAA 1II9A 1Z4JA 3QKUA 4BTEA 1OX6A 1WY7A 3PVSA 1FFXA 4EYQA 3IEIA 2GCOA 2OKGA 4PCAA 3T8YA 3PQCA 3MAAC 3FCCA 4UJ5A 4A5OA 3PR3A 4DV6B 4RTKA 2DY0A 3GLSA 1GL3A 3P0FA 3SD7A 2E4ZA 4DLPA 2ZB4A 2ZWAA 3J7TA 3A27A 4X7PA 1DAIA 3OURA 4UUBA 1BH6A 4ZMSA 721PA 3F9CA 1A8HA 4X20B 4HQNA 3AJRA 4AJEA 4AZTA 3ADPA 2BZ1A 5DMHA 3QVTA 2XUIA 4ND8A 1YR6A 1ORDA 3HBAA 4ZIRA 1NKVA 5ALTA 1KJ9A 4EQ6B 4YAOA 4KVZA 3U7FB 1VJGA 1Z0AA 5JYEA 4PFJA 4Y9SA 1WZUA 2Z5VA 4BBJA 2XYRA 2C2MA 1FYVA 3BB4A 1FNBA 3L43A 2ID8A 4YO8A 1YB4A 2D13A 2JGAA 2Q5OA 4JL6A 2QSUA 3IJPA 3O9MA 4F7WA 4IIFA 3T7CA 5T4EA 3EXG1 2D1YA 5BXYA 3IDAA 4V0ME 2DHEA 5E6UB 4D0LB 5H16A 1RYHA 5ECGC 4AWBA 3B1VA 1XZAA 2O7RA 4OHWA 5IMBA 2GPTA 3PGLA 4RE5A 4CNBA 2Z08A 1N2HA 1U04A 5HUJA 3OM8A 5LB4A 3QJYA 3OQIB 2AJTA 2R6R1 4NU8X 4PHCA 2WJ3A 5TE9A 3RUDA 3RT1A 5HKOA 1NY6A 2CYAA 3UW1A 2P0AA 2V6BA 5I9MA 4DC0A 2VH5R 4OAOA 3CRMA 2OM6A 3GIWA 1SUCA 3KLOA 3KCQA 4EYGA 3BAZA 3RIGA 1KHTA 3BXHA 4LJKA 5PNTA 2EDCA 3T3GA 4O0LA 3K09A 1ZGCA 5H0IA 3RK1A 4OHCA 5IAAA 3QA9A 4RVGA 1VYHA 2JCYA 4EM6A 2A84A 5BRJA 3PQFA 3V34A 2I5PO 3IJRA 4KO1S 1CUBA 4D45A 3OJ0A 2AHOA 3ZXSA 3S99A 2ZUTA 1MAVA 1T1GA 1QX3A 2BF7A 2VPXA 3TLXA 5JY1A 5A4JA 3CZ5A 2WUWE 1WQ1R 3IH5A 3ONVA 1EMDA 5DIFA 3FUUA 1D2AA 4MGIR 1HEYA 3ZXUB 1JRLA 5D8DA 2C84A 3FMPB 4ZQFA 2B7BA 3B20A 3WYFA 2NZUG 1BX3A 4HRVA 1NATA 1YZGA 4MW6A 4I1IA 4EKNB 3DZDA 2XOXA 2VSXA 3SSMA 3B6EA 5KVSA 1PZHA 3ZHXA 1A8IA 5BWBA 4LRQA 5IEBA 4I3GA 1ZLXA 1SQGA 4BRZA 5U9CA 1UFVA 2O50A 1REQB 2R6HA 1ONSA 4Q03A 3CC8A 3SKVA 2ZRAA 3TR6A 3TI9A 1IQRA 5LDHA 3WLLA 1M67A 4UU7A 4I9NA 4RS3A 1QP7A 2JGMA 5C7YA 2Y1LA 5G41A 2PU7A 4V38A 3V46A 1ZD9A 2HXSA 4L9AA 1ZRNA 4NCIA 4ZZ1A 3COVA 1LA2A 4TSKA 1BS9A 4M6WA 4GNKA 5A3JA 4RF2A 1ZVQA 3VOBA 4BNGA 1X8JA 2QU7A 2AR9A 3PFCA 1OU4A 4WH0A 3DWIA 4ACAA 5CBPB 2OZEA 1XLVA 3VDRA 1IM8A 1FDWA 5KAPA 2GNAA 5FNVF 1BYUA 2J3JA 5DI3A 4FSHA 4XUEA 4DDKA 2W6JA 3DMTC 3RS4A 3E9MA 3H1FA 5A03A 2ZGVA 4FJ2A 2G1JA 3NHWA 1U2GA 1N0HA 1R12A 5EE0A 3EF0A 1FIUA 2L2QA 2P9ZA 2A1UA 4HAXA 1OBHA 5C31A 4YQFA 1P80A 2FFQA 1R9JA 3B6ZA 4HEQA 3R3VA 1QXSA 3LQ2A 2Y1DA 1GU0A 1HKUA 2HA2A 2JD1A 2WW8A 4J49A 3R7NA 1IQ0A 4HB4A 3QLUA 4FW9A 1CIPA 5AJVB 1EFDN 2D1FA 5DTQA 2JIOA 4O25A 3DV9A 3M70A 1UEJA 4WV3A 2GFIA 3K0FB 1GD1O 1LBTA 4MVJM 4QBIA 3ZHUA 3R9IA 1IUKA 4DQUA 1QGDA 5BUCA 5D84A 3A25A 1P0MA 2RHDA 4AJ2A 2XQVA 2AEFA 1LS6A 2OWEA 3A9UA 2Z1DA 3JQGA 3LNTA 4GM0A 5CBPA 4ZZ3A 1MB3A 4Y6GB 4XE5A 2B5OA 3N1UA 4ZOCA 2NVWA 1Q12A 4JVLA 5ENDA 1HYEA 3GMTA 5F52A 5EG5A 3THRA 5E6RB 1H8EA 3ZBQA 2C7QA 1KP2A 3WLFA 5MF6A 4QDKA 4R1OA 2E0IA 2OD9A 4BEJA 2HSGA 1LPMA 2E87A 2JI9A 4ER6A 3B3JA 1W34A 3G2NA 4I9HA 3D64A 4P0QB 1ULAA 3JQ7B 1O9GA 1JSXA 2DSTA 3FSEA 3QBJA 1ZG3A 4IOLA 5CMLA 5JS2A 5HP4A 1QTQA 2IJGX 1E6KA 3OPYI 4P36A 4DMMA 2G6BA 2I22A 3L5OA 4R2IA 5HZHA 2ZITA 4D9HA 5ALHA 1P4HA 4UUQA 1HEUA 5AM0A 2CE2X 1H85A 3O75A 4QTZA 2QYTA 1E63A 4B73A 4LKRA 5C80A 4C2BA 2ZI4A 5B3JA 1R5NA 2JH3A 2PZMA 2QYHA 4QICA 1X1EA 4IYRA 1N9GB 4OQLA 1RBYA 3O7MA 1S2IA 1M2OB 3UF0A 2P1ZA 2WSSA 1TMKA 3DBLB 4MVYA 4MWZA 3U9TA 4KITB 3C7DB 1WUKS 3HZZA 2O2HA 4S1OA 4OKSA 5EJFA 2GLTA 1NRWA 5HFJA 2A33A 2HMYB 3QF4B 2XVZA 4NPHA 3AO0B 4NOJA 5KEIA 1OAAA 4IDQA 3QU9A 2B30A 5KYUA 2GXUA 4U00A 4I66A 1E1YA 5DW3A 1N2XA 4BJ1A 4C22A 3WWDA 4QJ3A 1NVVQ 3PHIA 4IV8A 5JS8A 1OFGA 3JQ7A 4QLAA 5JNTA 3QKRB 4B75A 3P2MA 3IAHA 4RUKA 2VF8A 1JIKA 3VC7A 4EFMA 3OLWA 1X3SA 3P9QA 1C7IA 5JAUA 2CLMB 4FMDF 3OEEA 3RGWS 1G8HA 1D6SA 1BAPA 5KPJA 3IALA 1HWYA 1QNFA 3EW7A 1OREA 3ICOA 3NOQA 4NSNA 1KH1A 1Q14A 3DAFA 2N46A 1U7XA 4UXJA 2VAPA 4X7RA 1M2OA 1OZGA 4I81A 1QH1B 3DBLA 3Q4GA 5KSYA 1E64A 3HZRA 1X8KA 4NLLA 1IY2A 1L4MA 2QR5A 1CEYA 4KIJA 2GS9A 1NAIA 3IQDB 3GLQA 2PD6A 3BHIA 4OHXA 5A3RA 3MN1A 3SZUA 5ILGA 1YONA 2A4KA 3GT0A 5EMLA 1IN8A 2YJ5A 2H4JA 2EWVA 3NYIA 2V5VA 4IH9A 4QOIA 1ECLA 3SMVA 1RRMA 1M34B 3IC5A 3RIEA 2NU9B 4QNMA 1NW4A 2W37A 3QKRA 1KH3A 4M22A 1KQPA 4HLNA 4MI1A 5CLIA 5KTMA 4KQJA 4EGSA 3VKWA 1AQ6A 1QK5A 4LFAB 2UZ1B 2Z2IA 4M3NA 2P6RA 4FYHA 4Y1FA 2WHYA 2C3MA 3LPAA 2Z95A 3TE6A 1EBFA 3MTGA 3AHGA 3Q2OA 4OK6A 1W0KA 1LW6E 3W06A 4DR5B 3N05A 5FJJA 2Q45A 3GW8A 3B2QA 4GX2A 4TYPA 2F1IA 3MHPA 3KKEA 3A6EA 3COSA 3A3PA 5B57C 3RYCA 3EFEA 2VATA 4H7EA 3KOUA 3MUEA 1J8QA 2D5AA 4D02A 4DA9A 4ZJUA 4W9NC 3VR2A 1X1SA 3OZSA 1GPAA 3G0BA 3IMFA 3RF6A 3SJCA 3QW4B 4K0KB 5FFNA 2FG7C 4K2AA 3S81A 1J0CA 3IAM6 3IILA 2E21A 2ODQA 1SQ5A 4QQNA 1G20B 3WLSA 2HBQA 1XCPA 3KCNA 2V0NA 4D57A 3SAJA 3TLBA 1TX4B 3M83A 1XRJA 4HWTA 2E6UX 4YRTA 4YR7A 3LVBA 3CHYA 2FQYA 5B4TA 4JHLA 3G1TA 3G2JA 2NTJA 4P4SB 4DUPA 3RFVA 2GF9A 1JE1A 2NU8B 2F17A 4S2UA 4UPVA 3WL4A 2UZ1A 1H0SA 4YLEA 3RUFA 4Y18A 5KX5F 1TM1E 2PUEA 4NYJR 5KNBD 4UARA 3FRHA 1H3EA 1QGYA 1NWCA 4M1OA 1OIXA 1ZP6A 1Q84A 5I8ZA 1TE2A 2FG5A 3BQ9A 4G9BA 1DAEA 1NN1A 3BD7A 2WIBA 1UWKA 2ZRHA 5GIPE 1KORA 1YH3A 2JS7A 3MTJA 4IFEA 4OG2A 4FX2A 1S1CA 3S70A 2BL4A 3MEQA 4TZ0A 5JJLA 4UW9A 1IWOA 3QE4A 1XTPA 3REQA 2YWFA 1AQJA 4RXUA 1Y6FA 3CU5A 1KJWA 5IXSA 3GCGA 1GQFA 1GPDG 1M1YA 2IKSA 1V71A 3D6VA 3LXUX 4C03A 4EJ2A 3RS5A 4B85A 4OHMA 5CDSA 3W78A 1C1XB 2DR3A 5CD1A 1GFZA 1XP5A 3FI9A 1RCTE 1SQ6A 2CDNA 1B8VA 3TNYA 4PVCA 3NBAA 3ZCXA 5LD2B 4HBZA 3CRRA 1EHIA 1J8YF 1UKCA 3A2NA 2JG3A 4KSCA 4KLNA 2J41A 4PGGA 2RGXA 4JLNA 4YNBA 1GGFA 1II0A 5F77A 3WQQA 1T4DA 3B1XA 3KE8A 3ZDXB 4C6HA 3O3OB 3UMCA 2R7MA 2QRHA 2NQ8A 1L3IA 2QIPA 3LBAA 1RRPA 1YJBA 5FF9A 4FLMA 2XVXA 5E7MA 1LRLA 1KFJB 3NC4A 4IXMA 3GIDA 4EEKA 1DCFA 2RC6A 2GWRA 4RCVA 1O97D 4KN8A 2Q5CA 3EMBA 4AKHA 5EWJA 3DD1A 4M98A 2B4KA 2VHJA 1SBYA 1MA0A 1RXCA 1VI2A 1VMKA 4ZYZA 1DKRA 2P2LA 5T6BA 1WG8A 4BLQA 5JAZA 4K26A 2ACWA 4BFTA 1SZJG 2OLEA 1QTIA 3DZCA 4TTQA 4GDMA 4BNIA 3HB4X 2WPDD 3QBVA 4NXMB 1KY4A 4MZXA 1L4NA 1UC9A 3C87A 3PQEA 4IDDA 4XD7A 2PIAA 1HLDA 1L8QA 5TF4A 4NZOA 1L4GA 3R5SA 4IFIA 4S1WA 2CUZA 2G4LA 4NCJA 4OCZA 1GPKA 3EUWA 4BEWA 5IBRA 4N9QA 3E6AA 4UTZA 1HF3A 2NSHA 5JO0A 1EM8B 3CVUA 1OGJA 1RBQA 1XVIA 4YJFB 4X64B 1E1QD 3O94A 4X9XA 2ZP1A 2H2IA 3GUHA 1IE3A 4FZVA 3UENA 2LCQA 5KQLA 3KRTA 4BNFA 2HCRA 5AKYA 5LZ5A 4UOQA 4UVDA 2ATXA 2I6TA 2ZIGA 4Q3OA 3COPA 1W5TA 4XIJA 2I8LA 3T1HB 4DJEC 1EDOA 1O3YA 1PKEA 2RBEA 5ALFA 1UJNA 3TTWA 2VHVA 5DHPA 2XIQA 1WDLA 3G2LA 4B3BA 5CFLA 4DV1B 1BS2A 2P75A 2VPYA 2NYAA 2XJ9A 3QF7A 4B43A 4XB6B 5JT1A 2PH7A 5FA6A 4ZP1A 4HYTA 5DN9A 1ZSYA 2R6CA 1LLDA 1FXSA 3ZUPA 1P19A 2PM8A 3E27A 3LDHA 1A1VA 2HMSA 1WV0A 2X5OA 4RNCA 5CT9A 5GADl 1XNJA 2C58A 3C3CA 3EVZA 2NXNA 4NZZA 3UFBA 1XZQA 1T2VA 3LQ1A 4S35A 3OTQA 4LE2A 3C7TA 4OXKA 4QDTA 4S24A 5FT9A 3JD4A 5KOJB 4ARVA 3KALA 3WP0A 4G5YA 1U02A 5M2QA 1GFWA 1GAWA 1KERA 2IC5A 7REQB 4N18A 2XCSB 3F98A 3MT0A 1J56A 2VDQB 3JQ6A 1P75A 3GAAA 3KYIB 4GZLA 1HNZB 1G21B 1JEYB 4L0CA 2OFXA 3B1FA 3LVFO 1TM4E 1KEWA 5BSWA 3PEUA 1M6WA 1N5LA 4D4HA 3I0ZA 4O8ZA 2I1VB 5CRIA 4DJDC 4XRGA 4B9EA 4P9NA 5KHOC 2ETVA 5KNBH 4XPIA 4JCCA 1CETA 1XWIA 1CD5A 4ZI5A 2Y66A 3SQLA 1N2CE 2ZS8A 3LP8A 3TW4A 5TQ2A 1IIBA 3NDJA 3GYGA 2F8MA 2IITA 3I28A 1SQ0A 3VZDA 1L5LA 1LPPA 2JK1A 5DK6A 4UEWA 2R8YA 4AUKA 4BLSA 4CFYA 3TEFA 3EWIA 1HDOA 3KYDB 3EDYA 1MOZA 1U28C 5KVVA 2CE7A 4Z0TA 5E8JA 4IZ6A 3ZXYA 2QV7A 5CEFA 4TS3A 4WQMA 2YZGA 5JD5A 3D8UA 3D4LA 2YZMA 2KMLA 3FYDA 3UMRA 2F9FA 2WJWA 4G0YA 4EB3A 2UZ3A 2VEDA 1P9OA 5TS3A 3FCEA 3SI7A 3RHSA 4CG1A 4I5IA 5BQOA 4F86A 3MJDA 4LZPA 4Y9DA 2GBFA 2W4MA 4CKBB 3AERA 1E5DA 2IYUA 1XZCA 3PS9A 3VHQA 1XWFA 3UT5A 2X0DA 4R9VA 1XPJA 1DKNA 3BMCA 4QDOA 1PDWA 3DO8A 5AMXA 3VVCA 4OLJA 4LXUA 3WY9A 1CHNA 1S2GA 3ZY6A 4CIWA 3M4NA 5LZ9A 4FBMA 3GLIE 3VAAA 4DS3A 4EJ6A 4DR4B 3AJDA 1M72A 4MVXA 3KB6A 3KK0A 4AI6A 5BUZA 1K6JA 4BRWA 2BW0A 1FMTA 3BMOB 2QE7A 1N2CA 1HLPA 2QIOA 3BBLA 4CN8A 3NWEA 2ASEA 3OIWA 1DEKA 3EC1A 1M8GA 3KYDA 1EXMA 1F3OA 2W6NA 5A6VA 2NM0A 3DDZX 2FZGA 4I9UA 4KWHA 5ITZB 5FNZA 5LD2C 3BCRA 3WLEA 1NW9B 2KI5A 1VE3A 4GICA 5JDIC 4X41A 3AC0A 3ZHRA 3H87A 3KTAB 2Q0SA 4F4DA 1RI3A 2IV7A 4C0BA 3IAS1 1JF8A 1GZ3A 2O2ZA 2RHJA 1XKTA 1Z28A 3BOSA 2JFPA 3OZWA 3CE9A 3SYMA 4BO0A 1PR1A 3CYFA 1SIWA 3QG5A 4QULA 4UZEA 4WECA 5T4HA 2CLHB 1GLVA 2X15A 3BWYA 3CNNA 3IMKA 4IDPA 4MJLA 2MINA 3UB3A 4DL9A 3OICA 4EGAA 3AUYA 4FW8A 4GLOA 2F3PA 3HJRA 1T3HA 1ZWLA 4B3FX 4BNXA 2J3DA 2O5RA 5IVPA 1MHPA 4MKRA 3LX6A 3OY7A 1AG9A 2RGDA 4R0VA 3BWBA 1QIHA 1U2DC 4HC4A 3T4EA 1IXZA 5C1DA 4HWKA 3BMOA 2X7HA 5JO9A 1L1QA 2O3QA 2RCNA 3MPUA 5JXIA 1LK7A 5CHYA 1B8NA 1L7BA 1T8SA 3TM5A 3U7HB 1G9TA 1ZOSA 4JVOA 5K0JA 2C92A 3ZDEA 1EGHA 2D5LA 1J0DA 5CNMA 2MR6A 3S44A 1MEOA 1MIOA 1VCNA 2RI6A 1TVCA 2IUUA 5A2GA 3NT2A 3PWSA 3AGQA 4BNZA 4F6CA 3IUSA 2QRUA 2ICAA 3LE8A 2ZBVA 3WBBA 1HYHA 2UZAA 4CLOA 5THKA 1CLEA 5K7SA 3EH1A 2XTNA 1VTKA 4YB8A 2W6ID 5DN6D 1Q1GA 4QUGA 3ZWPA 3NTUA 3V9AA 5F23A 1SCDA 4XDZA 2G1PA 1GNRA 5FOSA 3I6QA 3C6MA 2JJ1A 1BWRA 1S9DA 5I4IA 1YHZA 2EIXA 4ARAA 2E7ZA 2RAUA 3Q8LA 3EB9A 2AK3A 4R83A 3VPAA 1TTQB 2VYQA 4U7DA 4QFMA 4D5EA 4JJ6A 3W6OA 1QGED 4YV1A 5I6DA 3AESA 2CGEA 3CF0A 4KRGA 5DIZA 3E7PA 3WGQA 1XRPA 3SEQA 3T54A 1UDXA 4AD8A 4DBLC 5JRDS 3JZDA 1A69A 2VYCA 3H2SA 4KODA 3GQBB 4HN2A 1WIWA 2WWWA 4UVIA 4GL2A 2J9XB 3ACBA 4Z1OA 4Z3KA 1POXA 2C9ZA 4WW0A 4KAAA 4L9SA 4JVNA 3DE6X 4QOSA 1Y3AA 1D2EA 4AY2A 4KR2A 4HAOA 4HH3C 4JQCA 4WXHA 3H5AA 1TCAA 1K98A 5DBHX 2BKAA 4R3WA 3D3JA 4UVHA 1JWLA 1SHZA 3DLBA 2PVSA 3V42A 4KYVA 4TX1A 4M87A 1NXTA 1O97C 2EJBA 1PJZA 1KZ9A 3PDHA 1EUYA 3KOZA 2JFWA 5H70A 1W93A 4DVGA 1NBHA 4DJAA 4OLHA 3K0SA 4XKJA 1VMDA 3L0OA 3BIOA 2YV2A 4KYUA 3GEEA 1WPXA 2J4DA 3M6VA 2BTEA 3NFRA 4GVLA 4H6PA 1H69A 2Y4NA 2YKGA 4TWZA 1R8JA 4G1CA 4Y2XA 2YJZA 4PG4A 4LTNA 4RK6A 3VH2A 1KDTA 1T0JB 2AFIB 2WAAA 2YOHA 3ECAA 3E81A 4DLTA 1K6MA 3DNPA 2C42A 2J3IA 2R7NA 4O4LB 5AKKA 4E70A 3PE6A 2ZDQA 5EXXA 3BL6A 1L7RA 2BDUA 4JNKA 4B33A 3AM1A 3GQBA 2DBQA 3H8WA 3DMPA 1U2QA 5K3AA 3UK2A 3GEMA 1N6IA 1ZI6A 4UAGA 2GZ3A 1O4VA 1IEVA 4CL0A 4E33A 4EPXA 5JDCA 5EL0A 2ZUUA 1JYFA 2UU9B 5DCWA 5DT9A 2ZM5A 4OOEA 2XAAA 1TC1A 3RADC 5F73A 3TLZA 2PS1A 5JATA 2D54A 4N1AA 5E7QA 1RJFA 2NPIA 3F6EX 5F2KA 4ZDWA 4BO5A 2OXEA 1OAKA 2BJVA 4O6VA 1UKBA 3K05A 1R8YA 3SDBA 1FU4A 4PNPA 1TNDA 3LK6A 1WD7A 3BMQB 4FMCB 2EKLA 4AO6A 4LMAA 3GPBA 4D79A 1YS2X 5K3OA 1P7VA 1JX6A 3LUGA 3CCBA 2CUNA 1B76A 4DDHA 1GGJA 1V5GA 3FNBA 4PRKA 2ISSD 4OIFA 4XQCA 1G3QA 3ZDFA 1QIKA 3RE1A 2IYNA 3PUHA 4OPMA 3KQVA 4NAVA 2X23A 3AF1A 4PSUA 3T1NA 3HTXA 5LQAA 4JLVA 2QVLA 4XIFA 4D81A 2WV9A 5SY9A 3MOSA 5JXGA 3OOSA 4LSMA 5EMNA 1VMIA 1RABA 1T8PA 1ZRMA 1DARA 1RIIA 2PA0A 3FMOB 3O0TA 3ZWBA 6YASA 3PDWA 3LP5A 3QY9A 4D6PA 1P2VA 2RHRA 3MAJA 2IOHA 5LU9A 4ZVRA 1J07A 4JEIA 3P0JA 4PQGA 1RKBA 2NZ2A 5ERXA 4ZOLF 2AYZA 4RTSA 1G5RA 2FCRA 4W5JA 4MV6A 2ACKA 3WIEA 3L7MA 3Q7IA 2XT0A 3GJYA 2Z83A 4PC3A 4D6YA 4BP3A 2G4VA 2CV1A 3ANLA 3ZZMA 2A88A 4AMZA 1M5TA 2RDMA 3S29A 5JNWA 3OQ6A 5FFMA 1R5OA 2HPAA 3F7NA 1F3LA 3RROA 3TX6A 2VT7A 1AMNA 1CR4A 4JWTA 3H7AA 1E1NA 1SUIA 2Y1FA 3CX3A 1B42A 1UBSB 4KPFC 4Z7JA 3DP9A 1ATZA 1GRQA 3IBFA 4KGZA 2ISQA 2GD2A 1OAOA 1UADA 1V35A 1WCWA 3DH0A 1TGYA 3H2JA 4Q19A 3ZVRA 3GK3A 4GPD1 5HVNA 1Q0TA 4PZYA 2H1LA 3IR5A 1KZYC 2BM8A 1E3QA 4WCFC 3WYDA 4WN9B 2AZTA 4W5HA 3N0WA 2P4HX 3B3AA 3RRXA 3QVUA 1A71A 1N2SA 2OD2A 1Z22A 5F5LA 2X0IA 2PD3A 4M21A 1NXOA 2WT8A 1NXWA 3QELB 3U4MA 4XTCS 1W5FA 3HNPA 1LC0A 4NU5A 4X95A 3LDUA 1QCCA 2QS9A 1B74A 1HQKA 2HSZA 3FLEA 4NL4H 3IFSA 1G7RA 2AN1A 5AOBA 4TYYA 4JODA 3NIFB 3EA0A 3DHNA 1H22A 2ERCA 1NLZA 4NJMA 4TM7A 1TIPA 3VH1A 3B82A 5DCLA 1EX7A 5G0SA 2IYFA 1WCXA 4MYCA 1JKJA 4X97A 3K9CA 1XLUA 1RD4A 3LFTA 3U4QA 3QH4A 2F1RA 4IJVA 1WW8A 4PAGA 4QYIA 4BBZA 4UXHA 4C2UA 4YV7A 1QU2A 4QGSA 3NUZA 1KH2A 3PTZA 5LLTA 2P77A 2I76A 3DKRA 4WY2A 2AIRA 1H0KA 3FA2A 2PQ0A 4LDRA 3SSAA 1NVBA 1OJ7A 1ODTC 2H1VA 2FJPA 4FJ1A 2V6IA 2HF8A 3M6UA 2H1RA 4IY1A 4E1VA 3PC6A 1SVIA 3QSYA 4UU8A 3NBZC 4RORA 4K6CA 1NUTA 1Z8DA 2ECKA 2O2YA 3G17A 5DNUA 1VLHA 3LY9A 1SCNE 1DOAA 1M75A 1BQ4A 1IUNA 2EXXA 3OFJA 5JW6A 1SOMA 1COZA 2B5VA 4P80A 3U5TA 2O2DA 5ES3A 3N6RA 4JLPA 1V1RB 3S1SA 2P69A 4PANA 1F2VA 1CNFA 1UP6A 1HG1A 3OU6A 5G4KB 4FQ5A 1WBBA 4TTIA 3WGMA 3C48A 4ZXFA 1PK8A 3ICCA 4BVHA 1R3UA 1RRKA 2F3UA 4N49A 1WE2A 4HWPA 4R2HA 1I5RA 2ANBA 1Z83A 4RPHA 2FSHA 4K9RA 4YDRA 1XG5A 5E1DA 3O3MB 3C2QA 1VPWA 4BPBA 4G85A 5D1HA 2P11A 2W22A 3HKDA 4E4TA 3C97A 3SC3A 2XSZA 1P1BA 3TZHA 2H08A 4OOFA 2HH9A 3ITEA 4N40A 3HVKA 1DINA 1ZPDA 2ILTA 4J1SA 3T5BA 4BN0A 4M7WA 4TN5A 1JQJC 1G7TA 1NYLA 1XBTA 2WP8J 3B3QA 3RSOA 2PIDA 1NR7A 1N5RA 1GL7A 1TCUA 4MAMA 5ALMA 3NT4A 3WMRA 1OLSB 3HYCA 4I5DA 2DBYA 4XM2A 5KNCD 1MAAA 1G60A 3GA5A 4BKQA 3PUYA 1EXVA 4IXNA 2IYOA 1JDPA 4NYIQ 4HDOB 4PX2A 4HQ0A 1X1DA 2QVXX 3RYHA 1C4WA 1OI7A 4E6PA 1HT0A 4F71A 2P67A 2WWRA 3CLUD 2WWYA 2BHTA 1NBWB 2GDJA 4QRHA 3AF6A 4FGUA 1E3IA 3DTVA 1GLNA 2O4UX 4KDCA 4NCKA 4RHUA 1V7CA 3QPWA 4Q47A 1JTFA 1VE1A 4I3FA 2NMVA 3OUZA 1TU3A 4M89A 1TM5E 3IUPA 4NS4A 1OPRA 3EC2A 4IKOA 3FYHA 1EWYA 2CY0A 1ZGBA 5T57A 1KKMA 1NC1A 5HCUA 1NF9A 3CIFA 4TUYB 1OIVA 5F21A 4CRWB 3NVKI 3U19A 3WNQA 4ERXA 3DBHB 3EGWA 1IWPB 4KVAA 4K0RA 4EEZA 1THMA 3QEOA 2ODBA 3M4XA 3WTBA 1OKKD 2VLIA 4HX9A 1ZH4A 4PCLA 1Z5GA 1JR6A 1J9GA 1MB0A 1Q0PA 2EW8A 3DC2A 3IX7A 1R9GA 3QX7A 4L02A 4OB8A 3HUUA 4C0HA 3D02A 5IN5A 5I45A 5CCXA 2P3LA 3PEWA 4CLXA 3NU1A 2I4LA 2JARA 1GAEO 2JJ2A 2DLCX 1D0SA 1PX2A 1YJ8A 3ZWXA 4U02A 1ZD5A 4JJGA 1P31A 1U0JA 3EZ7A 2WWTA 3BTVA 4RLFA 2JLXA 2QTHA 2WD8A 2XMQA 3RVKA 3SX2A 2C5SA 2OO5A 2ZSKA 2X9QA 4GSKA 1SRQA 1YACA 4M53A 4DANA 1VLMA 4HSGA 5BW5A 4HAUA 2PXAA 3BCUA 1EFCA 2JBWA 2OAEA 1LXCA 1QOQB 3V97A 1F4LA 3U44B 4MV8A 1O5IA 3LSYA 5IF9A 3LO5A 4JJ8A 1CUEA 3JPWA 2XY4A 1IRXA 2ACEA 3TZKA 1KDPA 2VP0A 4OLAA 2ZXUA 1D07A 3HUTA 3T35A 4X1IB 2XUDA 1T34A 5KDLA 3PNLA 2VHEA 4LBZA 3CLRD 4MWEA 5T3UA 2LWIA 3K6RA 3K8OE 3LKVA 5FPPA 2JFGA 1BVRA 2ZVPX 3CX6A 3RANA 5ERGB 4LA4A 4M9XA 4QUAA 1KVRA 4F45A 2XUZA 3AF2A 4YMSA 3FLBA 2LRHA 4EW2A 4EYEA 1EVYA 1FNCA 4N82A 1GVHA 1JXAA 1KYZA 3ROQA 2Z8XA 3C5VA 1R1DA 2G0TA 2N75A 2XD4A 4UE3S 2WU8A 1KVUA 4B3RB 2O0LA 4B79A 2JAWA 5JWOA 3BD6A 1Y8QA 1WVIA 3PHJA 4XYEA 1D1PA 1IHPA 1T1EA 2TMYA 3CW2A 2YJNA 3EVTA 1GPBA 1HSOA 2F3TA 3L8FA 3LT1A 4M55A 3PX2A 2CZCA 4UAJA 1SC3A 5BYBA 3TNDA 1J7JA 4WOCA 5K20A 5DYTA 1FSFA 3WNZA 3JVIA 4ZJYA 4ZVQA 1NF3A 3ZQJA 3PUJA 1L4LA 4LRXA 1H8HA 1G8KA 1Y4SA 3K9HA 3KKKA 3B9PA 1X9HA 3L92A 3QUSA 4LHEA 4M1MA 3ZY2A 1SK9A 3DW3X 4K03A 2F2TA 5EUQB 4FBGA 3WDLA 1HDEA 1PEYA 3OFNA 2FW8A 1E2LA 3WGYA 4N01A 1T9KA 1N57A 2NOAA 2ODEA 2AMVA 1Q0LA 4C05A 3FFXA 4DWVA 1UK8A 4RVSA 1FYDA 4Y2UA 3FUTA 2XYQA 1XELA 4Z8YA 1YIAA 4LN1A 4RAQA 421PA 4AIRA 3SIWA 2H63A 1QV6A 2PGDA 2Z1MA 3H3FA 4CL2A 2I2CA 2ABWA 1KFEB 4WZAB 4IIYA 4MUBA 3QYFA 3ROGA 3SBXA 4QFBA 4JYZA 4MUJA 3IRUA 4F7DA 1OIWA 1SG9A 2Q3LA 2GVZC 1N2IA 2R65A 4I99A 4F1JA 2Y1XA 4M8NE 3AB7A 3Q5DA 2FSFA 4J3JA 2EFDB 5KNCH 4V0LA 3OZIA 2OV4A 5KKNB 3EZGA 3QMPA 3SKXA 4JK3A 4O63O 4F38A 1Z5UA 1XCLA 3CNHA 5JZBA 3LTNC 3N39C 1I36A 4U2KA 3WK4A 4JX9A 1LVHA 1CYDA 1GVNB 2IP4A 4MGKR 3UT0A 1HKHA 1XKLA 3DZJA 2ZCUA 1AZLA 2L18A 1CR1A 4DWJA 4PHGA 1RC1A 1Q1EA 3H0EA 3Q15C 4BVEA 1ZRHA 1PVDA 1Y6QA 2QMQA 4HKTA 2O52A 3DHWC 4KTVE 1JAIA 3V2IA 2QQEA 4DLWA 1WSBA 1Q5PA 2CMFA 1SWWA 2AI1A 3EIFA 3GD5A 3QKSA 2BCEA 1Z3CA 2YWDA 1J25A 2IU0A 4CFSA 4F5WA 2P40A 3LQFA 2GA9A 4JEMA 3UG7A 3ZWNA 3W5BA 4U2EA 4RULA 2O2EA 1TU4A 5K0LA 3KQQA 1KAGA 3GG9A 3UUEA 3VR3D 5CM9C 1ESCA 1XMJA 4F2WA 4XWWA 1GM5A 1ZNQO 4E2WA 3IA2A 1MT3A 3GUUA 1RTTA 4OQEA 2FZLA 3H1AA 2OCXA 5JJ5A 1HYQA 5F3RA 1HETA 1U3FA 2NUBA 4LXHA 5CT8A 4YP9A 3G2HA 3ZGNA 1IPHA 4X61A 2I3BA 4H17A 3VDMA 4PNEA 5T41A 4MP8A 4RF4A 2H1FA 4L1KA 5LXTB 5GY7A 2OCKA 5A4KA 4IVPA 1R0ZA 1OBCA 1PGNA 2VDMB 4D7AA 2D4AA 3G0OA 1S2LA 2ZRFA 4IV0A 3ROTA 2WE7A 3CO5A 2NZWA 1U2TA 3EISA 4CU5A 1Q2XA 4A73A