2A59A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 5-nitroso-6-ribitylamino-2,4(1h,3h)-pyrimidinedione
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 50
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a59A00
1KZ1A 1HQKA 2JFBA 1W29A 2A59A 2F59A 1RVV1 4J07A 3MK31 2OBXA 1C2YA 1DI0A 1NQWA 2VI5A 2C9DA 2C94A 1KZ4A 1NQXA 1KYXA 2B99A 1ZISA 5IM5A 1T13A 2I0FA 2C9BA 1NQVA 4KQ6A 1XN1A 1W19A 1KZ6A 1KYYA 2O6HA 5IM4A 2A57A 1KYVA 2C97A 2B98A 3NQ41 1NQUA 2A58A 1EJBA 1C41A 2C92A 1KZ9A
chains in the Genus database with same CATH superfamily
4DAOA 1FMLA 4D44A 2FGJA 1XPJA 1R4NA 2JNWA 4MIYA 2FVXA 4CV3A 2QT1A 3KD2A 5T4BA 2DERA 4GMKA 4UATA 4AW9A 3ZWPA 3CF4A 3GRPA 3U2QA 3H5IA 2LBPA 3DL7A 2TMKA 1COWD 3DZ8A 4MW7A 5AKXA 2BUCA 4YWHA 5JD3A 1C9NA 2IHKA 4D5GA 2KYRA 2ZP1A 1QOQB 3LW7A 1RQNA 4OYLA 5KHOC 2VKQA 4YI3A 1QCDA 1H05A 1ZXXA 2JA1A 2JIZD 3L0DA 1GG9A 1BHQ1 5GPBA 1GL9B 1KH3A 1NMXA 2EJUA 3F47A 4MS1A 5DM4A 4BBZA 5BWBA 3JCZA 3NUQA 2W8ZA 4LIPD 1YASA 1LPAB 2Z56A 4J2HA 5JC1A 2WHRA 2I7VA 2C4HA 2LW7A 2ZRHA 1R0YA 3I9V1 3KEFA 5DYIA 3N0VA 5HTOA 2Z1DA 1IULA 1XAJA 5AKLA 5EUCA 1RHMA 5ENDA 2SCUA 1VPVA 3KLOA 2HNBA 2O54A 1IBSA 3A6ZA 5A4JA 3N3AC 2VJNA 1U8AA 3Q7EA 3UGTA 2JVJA 3VO9A 1JQLB 4IOLA 3R0QA 3S1AB 2MINB 1E6UA 2Y1WA 3DAFA 4EP1A 5LP6F 2FUG1 5HZMA 4GPD1 1M7GA 2QR5A 4XGIA 2VHUA 2HY7A 3K2EA 1ENZA 1Z88A 3HXPA 2B25A 4L72A 3NHBA 4L5BA 5B4UA 1N8TA 2BEUA 1PLKA 2KS6A 4DUZB 1Q7EA 2LUOA 2PZEA 3Q7SA 2WJ6A 3KQHA 1LLDA 2E87A 2QD2A 4CFYA 2OBFA 1TUIA 4LKRA 1EHIA 3V4SA 2PJZA 2CXHA 3A58B 5DGDA 1B8UA 1TU0A 2PLNA 5ER9A 3ZNPA 3KJGA 5GJBA 1W88B 3H3XA 1T0IA 5D51S 2R4UA 3GJYA 4ZEMA 1D1QA 4NYMQ 1THGA 4M83A 4CF7A 1U1IA 1DRKA 3RTCA 4KPGA 1ISMA 1E18A 3CC8A 4F85A 4BMZA 3D8UA 3M82A 1AE1A 3CRZA 4XPIA 3PKJA 4AMBA 2AKAB 2VHXA 4S12A 2AFHA 3AQIA 1V95A 4LX0A 3MWYW 4HB2A 4V02A 2XCLA 4K3VA 3IAM6 4GOMD 3WHIA 1RQ2A 3BSWA 2W6NA 1NG1A 3P9PA 1U3FA 3CRRA 4HKTA 1FQWA 2ZSDA 3JYHA 2AX3A 3EA5A 4CTJA 4ARCA 4Q24A 4U2EA 1LJLA 1Q2XA 2GX6A 4WV3A 4ONEA 4R3WA 2ZRDA 4JDPA 1GRCA 3MCUA 4RFSA 3U62A 4GSKA 5IHXA 4MWGA 2J07A 4KV9A 3OZXA 1BMTA 3LXMA 3NGMA 2PNJA 3T7RA 3R7WA 1CB0A 4ENTA 3LHKA 4TTVA 4HC4A 1EFLA 1RTKA 1EEXB 4FE3A 2ASEA 5EAIA 4NMLA 1AH2A 7AT1A 1P72A 4ISBA 3H9GA 1TPZA 5A0TA 3HRKA 3ZY6A 4L8VA 1ZHOA 1D6MA 3KU4A 4GZLA 3A3KA 2RHJA 1R4MB 4OQDA 2FU5C 3KOYA 1R9MA 4K2HA 5HWSA 1U28A 1RLMA 3GLFE 4TYNA 2EP7A 1O94C 3AETA 3MTJA 4GRIA 3UK2A 2O20A 3MWGA 4NXMB 3CVUA 5T4FA 4S24A 1DKNA 1RYYA 4B6SA 1Z5UA 3A6KA 1Q1BA 1CV2A 2CD9A 2WWTA 3L0BA 3MPOA 3BMNB 4OHPA 5F4BA 4AO7A 5I3CA 5BR8B 2ZBGA 1NWHA 1N6HA 3I6IA 4V3CA 3ZCUA 2A86A 4BGUA 1OMOA 3TM4A 2QX9A 3OQIB 3GGOA 4I6EA 4UUNA 4Y6OA 1D2AA 4PBSA 2N47A 5LZ5A 4JYAB 2DVMA 2XKBA 1BC5A 1PSZA 2A1UB 3G8DA 3L7KA 4FZJA 5HJ2A 4YRPA 5IEJA 1L9XA 2WU3A 1E62A 4JQSA 2B0JA 2W0SA 1JHQA 2FVYA 4QFDA 4TQ9A 4G0XA 4KHZA 4CMAA 2BGWA 5A9TA 4PFSA 1NW6A 3D8SA 4ZOAA 3PR3A 1HDCA 4FMDB 1P4SA 3HB9A 3JQ8B 5EY5B 1UK7A 4E6PA 3H04A 3CJQA 1JX6A 3JZFA 2E89A 3UYLA 2MSDB 2FRDC 1U7PA 2OHGA 1FEZA 1UQUA 2V4ZA 2BFAA 3LFHA 5AO9A 2O6LA 3KYIB 2VJBA 1CRZA 2YW9A 3E9DA 1QRUA 5AW7A 4BASA 4BP1A 3WIVA 3OLQA 5EFOA 4HNVA 1K5GA 1C8LA 2R7MA 5AKJA 1KAGA 1YVRA 3D02A 4M4SA 1F2TA 4DIKA 4D4IA 4ZRDA 2R8PA 4R2LA 5GAJA 3UGKA 4AZ3B 2AOXA 2YWFA 3SHTA 4LWOA 5BRNA 2ZDGA 2C54A 1QXSA 3HJGA 2FEWB 4LSMA 3ZE1B 1YCFA 2ZQ5A 2JBWA 3W3AH 4OFBA 2PAFA 2QJRA 3U7FB 3OICA 1U8FO 1TJPB 1U0TA 4URUR 4GMXA 3PI7A 4KWCA 5DMXA 2H1HA 3K0SA 3VU1A 1EGHA 4N65A 5IX8A 1TQ2A 3LUAA 3LUJA 4X97A 4NZPA 4KBGA 3RUEA 4B34A 4DOMA 4DDVA 1ZGBA 3HBJA 2V9ZA 4RVSA 5HG0A 4WJZA 4Z9YA 2XXAB 1DAEA 4RTKA 3AK4A 4B31A 1CZKA 1FDVA 2EP8A 1DI0A 3EY4A 3KDPA 5TF0A 3KQQA 2A30A 2AZTA 1GPDG 2R86A 3C6QA 4JP3A 4PGMA 5EHIA 4DPMA 2O8DA 4F56A 1V96A 1U8XX 2GWRA 5CH5A 1GUBA 3BJRA 4OGFA 2H5LA 4ZC8A 3PJGA 1PT7A 1D8AA 2I1QA 1AHHA 1L5FA 2PLRA 2IYWA 3D3EA 3DD5A 4BUJA 4ABTA 2AIRA 4B7AA 2C5SA 3N7TA 2I7TA 1U1FA 3ESCA 1SVMA 4J29A 4EYGA 4JMLA 2YHSA 2G06A 1QTQA 4EF5A 3WRWA 1SKYE 3EW7A 2FJ0A 2G8LA 4R7TA 2XNDA 1SHLA 1DU4A 4ZV9A 1MQAA 2JEYA 2QS9A 3TZEA 3I6ZA 3FYSA 4B76A 3AKZA 1CHNA 3BBPA 2XCRB 3HNOA 4QO7A 2Q5HA 1KVSA 4FNMA 1PEYA 1ZFNA 3TPZA 4A1OA 4C0BA 1SA0A 4HZUB 1KMQA 1K8YB 2PQ0A 3TXYA 1IN5A 1PDWA 2YQ4A 4WOJA 4RVDA 3STTA 3TNDA 4AWXA 1ULBA 1KVTA 2AZ4A 1WUHS 2HYDA 2JFQA 3INGA 4ZQIA 2OHIA 4JNKA 4QM7A 4QUIA 1CULC 5DASA 1GXSB 1U0BB 3I1YA 3ZBUA 1T1SA 1XZBA 4BLQA 4EYOA 2OLEA 3P71T 1YQ9A 2F2TA 2X5OA 3KS9A 3D2BA 2E1PA 2NNWB 4M1ZA 1JKFA 4UVIA 4DV0B 3LOPA 3PPWA 3FFTA 1G6KA 3ZEIA 3CIOA 2R25B 1XZ8A 3WYBA 4BKQA 1JBEA 3KXDA 2QVGA 2RHMA 1GUAA 4R8VA 5GMOA 4HWRA 3IO3A 4TT3A 3GDWA 1CF2O 1XDGA 4I4CA 4P7KA 5KJCA 3H2HA 1A98A 3QF4A 4DFDA 4E7PA 2HQOA 4BLPA 2O05A 1EX1A 3OPQA 3NUGA 1LUAA 1A4IA 1SCQA 3C16C 1E79D 5B12A 3WZLA 2I55A 2TSYB 3QY9A 2E82A 3L6CA 4QLBA 2AK2A 1X74A 3C8UA 2I2FA 3IAHA 1J8YF 1UQTA 1K4YA 1P73A 3ZKWA 3T5AA 1GPYA 1PT6A 4P3OA 1GLVA 1TVEA 1SCUA 2WQZA 3KQMA 3IR5A 4XX1A 1JR3D 4XZ3A 3L9XA 3TTYA 3VNQA 5FBHA 1HYHA 1EWRA 1KMHB 1J0BA 3M8KA 3WNQA 1UXHA 4RGQA 1ZMXA 4N49A 4UREA 1GUFA 4HGZA 3FHTA 2R8ZA 4C0HA 1SRQA 2Q4EA 4WCFC 5FI0B 2WLSA 2W5UA 3SZLA 4MUJA 1AMOA 4EO7A 1MIOA 5DHPA 3SYTA 3NGXA 5LOVF 5ALOA 1DO8A 1VA4A 3TOSA 3A2LA 2ZBPA 5J59A 3THSA 4ERXA 5LFAA 1E2JA 3UEOA 4AROA 2RIRA 2QYSA 2EJCA 4FDMA 4WL0A 3WGKA 3FDFA 4OHCA 3QXXA 4H7DA 2P62A 4AJ1A 4CMCA 3Q8LA 2V7EA 3NWEA 3ZLBA 5DYNA 2CLHB 1H1TA 1DUIA 1Q22A 2ZQZA 3IHLA 3NTRA 1F6WA 2JHAA 2VWPA 1FNSA 3D8HA 1YF3A 3JARB 1ZQ1A 2L2QA 4KE6A 3OMXA 1GQSA 4QEKA 1WV0A 2WF6A 1YTUA 3ROTA 1RXSA 1FYXA 5CVJA 1OHHA 1L3CA 1B0PA 1M9NA 3DTTA 5DSTA 3ZXYA 4Y6PA 3TQOA 3HLTA 4CM9D 3BD8A 5C5EA 5IARA 2HF8A 4KQ6A 3WB2A 1QG2A 1JW9B 3O4HA 1QAOA 2IYXA 3OKAA 5FX2A 5AQEA 1JR6A 1BN7A 1CUJA 1GKUB 2RHGB 5B58T 1DPFA 3LX6A 4KX3A 3PTLA 4WXPA 4CF3A 1VIDA 3TOVA 3H6GA 5A71A 2XWPA 3RIGA 3PWTA 3LXRA 4FFOA 2YWXA 4UUMA 4AZWA 4DCMA 1Y4DE 2IVFA 4CM1A 4TYYA 3BSSA 3UJHA 5HZHA 4TN5A 5E4JA 2PL5A 3E84A 4DNQA 2CMFA 2DH5A 3IHWA 4HN4B 1TYZA 4QQ8A 4R16A 2E5LB 5IK2D 4OU5A 2C4NA 2VUSA 4YRQA 5IH3A 4BMPB 1MBZA 5EI5A 2PUDA 2WJYA 4CM8A 5E7JA 4PC1A 4NU5A 4D9CA 4DVGA 1BWPA 1XDBA 1YR7A 1POXA 5DBHX 3JYNA 2VUTA 4EDFA 1PGNA 4G86A 2GPYA 1J8FA 1M75A 5IP5A 4RQAA 2UYGA 2V98A 1KIFA 1M2WA 2CC2A 3AEZA 3KSMA 4K6CA 2HEIA 1CVIA 4UTRA 2ZT6A 3A9SA 3W6ZA 4LHSA 1VP9A 3R40A 1KEKA 4XI9A 2DLNA 3D3QA 1EINA 1WKBA 3F6EX 3H11A 4M0FA 4HNQA 5FUVA 5HMMA 3U40A 3O5AA 2BELA 2C59A 4KDFA 3EQ2A 3QPDA 4RFSB 5DRYA 1CIJA 1FYVA 1G6HA 1BMFA 1H2YA 1LWNA 4MAMA 5E2IA 5CDGA 6CHYA 3FMIA 1FBNA 3BG5A 1G7RA 2CCJA 2PMWB 4NQRA 2QYTA 1W4AA 3OQVA 2EBUA 1WY5A 4L9WA 1HETA 3NHZA 1VP3A 4RKFA 1IDOA 1TQDA 4AUMA 3C3WA 3ZPXA 4ZZ3A 2ZETA 4F3CA 1KNQA 3LU1A 1Q92A 2K2WA 2R00C 1A7JA 1X19A 2A6PA 4AP9A 4B1FA 2P9FA 1P1BA 1BX0A 3LY5A 4IGKA 4PYQA 4GR4A 2W2XA 2J0VA 2ZS8A 3SFVA 4MVCA 1ZR4A 3TOZA 3DBRB 1H2BA 1RIFA 4AICA 3F1KA 4DJAA 2R1VA 2ECFA 3ODPA 4LOHA 1D4OA 5CJJA 2RGCA 3HV2A 1TMGE 1ZMTA 2G4VA 2F9MA 4MW5A 4KO2S 5CT9A 5KVVA 4PAWA 3PTAA 2C2KA 3L6DA 3PYMA 1Z17A 1UJBA 4UEQA 2VDWA 1NP7A 2BY4A 2Q7XA 4W9RA 1T6ZA 1PT8A 4G09A 1E99A 4GGOA 7YASA 1CNFA 2Y92A 9LDBA 5F23A 4DJJA 5DHFA 3P2YA 1SBQA 3GCGA 5EVCA 3BE5A 2H16A 4R8MA 2UU9B 3EMKA 5SYAA 3LK7A 2FXIA 3UB4A 1RE0A 3GL9A 3DTVD 4O3FA 3RM3A 1PUJA 4YJ2A 1ZXLA 3E1GA 4R1SA 2Q62A 1A9XB 1UEXC 1SBCA 2C2BA 4L1KA 1X1BA 4OPMA 3UMGA 2QE6A 1RC8A 2J85A 3GEEA 2AJCA 3N8IA 2J0UB 3N05A 2CJWA 3W2HA 3DV2A 2W6QA 4P3NA 5CR9A 2ZR7A 1QFJA 5CM8B 1FTSA 2D0DA 1F2TB 1E96A 4JBIA 5J40A 3V48A 4PHCA 1SVIA 3ZQ6A 4AFNA 2QTTA 4EHNA 3Q3CA 3KAJA 4WBNA 4R0VA 1M1XB 4QSMA 2DPMA 3PKIA 4JD5A 2Q6LA 2XSZD 3BHMA 4IYJA 4JI7B 5CJ2A 1WR8A 4NJEA 3I1IA 5FTWA 5L95A 3AL0C 1QP7A 2PYZA 1GZSA 1NYLA 5AI0A 3DDHA 2BLLA 2R6AA 3AXTA 3VH3A 3CBQA 4E09A 4XJXA 4LCJA 2CNBA 2HNKA 4PZUA 5FA5A 3VU8A 4CV1A 1LZKA 5LYYA 3FIJA 4YX9A 2AI3A 3WS7A 3ZHOA 1OWOA 2HRDA 4NL4H 5KWVA 2VS1A 3KOZA 10MHA 2E9SA 3TX6A 4ASUD 3PZRA 4G1VA 2Y1GA 2GKOA 4KWHA 4DJFC 3OCUA 1VC2A 3TS1A 2F4VB 3IHTA 4OMUA 5IAAA 2XKKA 2A5JA 2NUTA 1WCWA 1NW4A 3EQ8A 3T41A 1GL3A 1RLTA 2L0XA 4RZSA 5EP1A 2O8DB 1H69A 4TM8A 1B8OA 2WDPA 3B1FA 4AKEA 2QXUA 4E4RA 2HQRA 2WTNA 1G20A 1QQTA 1N5MA 2J5KA 3KTAA 1P8JA 4GPEA 3FPGA 2VZ8A 4XJVA 4F38A 4F3KA 5EUBA 3F90A 1J20A 3AT1A 2I4MA 2VYQA 4UBIA 3U61B 2HJHA 2OZVA 3ZHTA 2HJWA 2O4UX 5DT9A 2PS0A 3NP9A 3ZGOA 5KNDD 1WF6A 3C14C 3ZGZA 1C3JA 4IY1A 3T9FA 2C58A 3BE4A 3WIUA 4A3SA 2ZVJA 3URKA 4PO8A 4X00A 4BN4A 3WAKA 1NTOA 4KREA 1ULTA 3HYCA 2HR1A 3KYJB 1AURA 1I2DA 3GGDA 5KOJA 4MXDA 5A4MS 5JBIA 2VRBA 3CCCA 3R3SA 2B6NA 4HNAA 5K8IA 1A4UA 4UUPA 4DXHA 2J5XA 1ZI8A 1HFKA 3F49S 3EH2A 3ISVA 1GTJ1 3EMDA 3HFSA 4XD7D 3NOOA 1Y4SA 4J16A 1S3GA 1YA4A 2EW8A 5I8PA 2ZAMA 4XXHA 4QJIA 2JIZA 1P77A 1ORWA 2LZ0A 3A1UA 1RQ7A 4O4HA 4PG4A 1Y42X 2XWSA 4K8RB 3MTAA 1C30B 2G4LA 2IHUA 4LVOA 2FSUA 3B12A 4NCNA 2CLLB 1MN6A 2QUJA 4EEXA 2WZCA 3OQNA 3ZWKA 3AXSA 2QUAA 1LNZA 3L8FA 4MV6A 1W75A 3AZOA 3AKEA 5ALGA 1KS2A 3CPHA 1GAJA 3MMXA 2R5WA 2XXBA 4AXBA 4EMUA 5BYJA 2CUTA 2QL6A 4MHOA 3T5BA 5HK9A 3T7SA 4QOEA 1EBUA 1C9EA 4KGXA 2IZOA 1QZXA 1YB6A 4IOKA 4BTLA 3C3CA 2KHZA 4RORA 4RY0A 3HPQA 1E9BA 3AEXA 3LBAA 1ISPA 2WA2A 1GGKA 4KYVA 4U39A 4YLEA 1CY1A 1OB5A 1EUYA 4I3FA 4YP5A 2OAEA 4HMQA 4G1BA 1BVHA 2JAOA 3MJCA 3ZH2A 4CU5A 3LGXA 4DM7A 3OJEA 1OZFA 2P9ZA 3RRFA 3TB6A 3U3DA 2VYVD 3JVUA 2AX4A 4ND8B 3IJPA 4PXSA 4WNYA 2WWRA 4R5MA 1CHDA 4JX8A 2MSWA 2CDBA 2RB5A 4F6CA 5LKAA 3IVMA 4DEYA 1U2QA 2AOTA 3DE3X 4MGKR 3R44A 4X7RA 1OBVA 2W2QA 3TAUA 3L93A 2QF7A 4WSOA 4OQMA 1NGSA 4FD2A 1RQGA 3UFBA 4CG1A 4YXWD 4O0MA 1MIOB 4WLOA 4IQFA 4E15A 2AFIE 4HAIA 4KIJA 4X0EA 3T5GA 1NQOA 3KKLA 5JCPA 2AEEA 4PPNA 1ZUIA 2WW8A 4RF5A 3FFAA 3ONNA 1CQJA 1W0CA 4YCLA 4RK5A 3HRIA 1E3TA 1XZIA 4FVTA 4QGHA 1LBEA 3CZ5A 2XTMA 1UPCA 4AUEA 3EFEA 2PSEA 1HFEL 3IEMA 2UKDA 2BFBA 2ATCA 5B6PA 4EHKA 2PZMA 4RLSA 3R6WA 3GVPA 2VYCA 1EUZA 2LNDA 5HHTA 1AKRA 3CE9A 3GC6A 3R6DA 1H85A 1PS8A 3HJNA 3S2UA 4XIFA 5HUHA 3ZE8A 3UKJA 1Y8QA 3GA0A 4E7OA 2IXGA 1PN3A 4CG2A 5H82A 1U7HA 4E21A 1N2GA 4PSVA 4NULA 4W6QA 3TD6A 5I48A 3G59A 3QXJA 1EGQA 1DC3A 4D9FA 1K75A 2QN7A 4Z2AA 2A9PA 2KW5A 3V9AA 1K27A 2OQIA 4IZIA 1M6HA 1GPAA 5CDUA 2RGEA 3G82C 4DMFA 1S5PA 4NWIA 1W0JA 2PM8A 2EF0A 1C0IA 3C2QA 4C4PA 3RNLA 1LTQA 2IW1A 1U7WA 1TM1E 4M54A 1P0MA 2DR0A 3EYAA 2GPAA 1GEEA 2NUPA 2HDOA 5TEWA 3UYKA 5BWOA 3S2FA 2WF5A 3C41J 1MJFA 3LMKA 1II0A 2DU8A 2IX9A 1ZZEA 4MKIA 4Q9DA 1K0FA 4XGRA 3HQ4O 3F7TA 2YMQA 5ARBA 3O4JA 4J1NA 3KG2A 1KAQA 1YMVA 1XSEA 3H9UA 4KK4A 4PQFA 2FZWA 1X7DA 1C4WA 1NNUA 3JU3A 2JJ1D 4LYYA 5I7OA 3A2MA 1IIRA 2OWDA 2PVPA 2IXFA 3G17A 3N39C 4GW3A 4QASA 1QHHA 4IP0A 4XUCA 1I1OA 4B8ZA 4E51A 1U3VA 2C83A 3PQDA 4GU5A 4D56A 1ACMA 1VBFA 2I03A 1JDTA 1EWVA 4AKSA 5M7EA 1U4OA 1D2MA 1Y6ZA 1L5MA 3AUJB 3H11B 1TADA 4RIEA 1KSGA 4V1CI 3UC5A 1CBUA 3H9CA 5CXQA 1E2FA 9LDTA 3ZU2A 4DLNA 5T64A 1HEUA 1EHYA 1PDOA 4FFPA 5A2GA 4ND2A 1O03A 1T43A 2AXEA 3EAQA 1FYWA 4CLHA 4JBXA 1QHXA 1Q0UA 1WXWA 2JFVA 3C4QA 3LLUA 2XRZA 4Q1VA 4R2JA 3EMVA 5C3UA 1Z4NA 2E4VA 1MVOA 1WXHA 2C1EA 3BYZA 3C4VA 2J4FA 2WZQA 5JASA 2W6JA 1LV7A 3GW8A 1ZHFA 1R4ZA 2WVAA 2X6TA 4G5SA 4QUKA 4AM8A 3RRNA 3WKCA 1W4RA 3NEAA 1DX6A 4KN6A 3HB4X 2VDMB 4CUZA 2XY4A 2QN6A 2XOEA 3AU9A 1OYOA 2FDCA 3JW8A 3LQQA 2R1VB 4V39A 4XUEA 4C7XA 4N7BA 3NASA 1KJQA 5KJFA 3VOBA 4GOKA 4NV3A 2COKA 5EE5B 2MSNA 2CHFA 4IHKA 1XRSB 3JR7A 4M8LA 4UEOA 2BW0A 4YAOA 2AT1A 2TS1A 2QSYA 2VDWB 2Z1NA 3OT1A 5I9IA 1H9BA 4MPRA 2YZ2A 2QTVA 5LBUA 5BN1A 2R5FA 1IUKA 1BH6A 5TV2A 2O8VA 3ESYA 2QY9A 4IF4A 4AKTA 1Z0IA 2QNRA 2QZ9A 3CUYA 3PHBE 4DUPA 4ETIA 3A9WA 1K9SA 1RVV1 3LKDA 4BGIA 4CHTA 2FMTA 4PSCA 1OCEA 1D9ZA 2W37A 4YJ2B 3UB2A 2R1TA 1YR3A 3ECAA 4HYYA 4LDRA 4BZXA 2P5UA 2JIBA 1EGMB 2UZ1A 2ZGVA 4KFCA 2ZE7A 2HB6A 3B38A 1YZ3A 1ZH6A 1W94A 2O23A 4GOND 2VTKA 5J4VA 1CKEA 1VJ5A 2P6UA 3VTFA 4AS3A 1EBFA 1T29A 1WUIS 3G85A 4DLSA 2F9LA 3P2KA 2PJUA 1C3VA 4ZOLA 2D8MA 2YASA 4ZYXA 4EPTA 4QUAA 2V54A 5B58C 4GVPA 2XA9A 3CF6R 4Y6SA 4AJPA 2B36A 2HLDA 4KHPB 2VHJA 1JFLA 4NJEB 4BO5A 3C1TA 1MGOA 1USGA 3KZXA 3PKZA 1YMQA 1LF0A 2WWVD 1SQ6A 1G63A 1XD9A 1ZCJA 2DWPA 5CB4F 5JAHA 1H9CA 4ZHSA 1A04A 1K7XB 3F3YA 1G8GA 2W2PA 1LPNA 4KLNA 1M2OA 4RPJA 1RPNA 1PWXA 1JDJA 2I9PA 4TTPA 4F2WA 1OAOA 2WKPA 3UMMA 1VXOA 4M1TA 3OCXA 2GJKA 1JJBA 4EHJA 3CLRC 1DWPA 1KDVA 2GKGA 4HEHA 1E5VA 4P22A 4QXAA 4TSFA 1D5CA 4ALLA 1HQCA 4GDMA 1CK4A 1XF1A 1YB4A 4U7GA 4GGMX 1UJ4A 5IDWA 5EEHA 3VKUA 4WEQA 3NV7A 3TFOA 3E70C 3PSHA 2HN9A 2AQIA 2FZLA 2GS9A 4I1PA 1OPXA 1WCV1 3M5WA 3EVNA 4ZCRA 1C9KA 3QUCA 5JAZA 3KTAB 3COYA 3UC9A 1MC4A 3EUWA 1B74A 4G8BA 4JUBA 4UPDA 2B83A 3RT1A 3T9CA 2PX6A 3WGMA 1D4FA 2VP5A 4JDUA 3BORA 2ZSHA 1T15A 2QHXA 2EWVA 1E79A 4A0HA 2Q1TA 4KMOA 2E55A 1C1YA 5JE8A 4YUZA 3VR6D 2CE2X 2PU7A 4D8TA 4ZA2A 5EKDA 5KKCA 4EH1A 1J39A 1GT6A 1HK7A 2WJVA 4TV9A 3UANA 3OM0A 4BX8A 3EOBI 3MWFA 1YC2A 2JAWA 2PKQP 2W4QA 4FOOA 1ONNA 4CZ2A 3T7AA 1Z4MA 2B6HA 1Z22A 1CJUC 5AJXA 2RAFA 1P7VA 4OJTA 1Y3AA 3BD9A 1Z0AA 2XMBA 1LLUA 1GG5A 2FWMX 5ALJA 3EDOA 5KTPA 3OHMA 3I1JA 3SQOA 2QQEA 4YIKA 3HXMA 4Y9TA 5DM0A 3BE8A 2ZCVA 1BHO1 5G4KA 1U4NA 2MTBA 1H2EA 3TRFA 3DNPA 4K9DA 2VSNA 3ZDRA 4ABYA 5ESWA 3O8DA 3W9YA 5DGXA 4MQ5A 1ZNQO 2CYAA 3N8GA 2PE5A 4MPJA 5LZ4A 4FOPA 2OK7A 3FVQA 1AC5A 3ZW9A 5JADA 1XQXA 4OOEA 4W9NA 1LBSA 1YQWA 3D4OA 4D0RA 4CL3A 4J16C 3L4BC 3IPRA 5K6AA 2OV8A 4MVXA 4UFOA 4U2FA 5AKKA 1TT7A 4UEWA 1MA3A 4JOBA 5AK4A 4GNRA 3KR2A 4ZVSA 3VSDA 3U7HB 4P0PB 3UJAA 5A04A 1S2IA 3A10A 3PQ8A 2A3NA 4IYRA 2WJGA 3KIPA 3V8QA 5J58A 1OFUX 4DR3B 1H3EA 2J0EA 1X15A 1SIWA 1VG0B 2OCLA 1AQ6A 3B1KA 4FR0A 5DLYA 1G7SA 4CM9A 3LW8A 1KOJA 2I4OA 2B5OA 3DM9B 5P21A 5KNBD 3PJEA 2O8CA 1V35A 1J25A 1UR5A 4KMMA 4BN5A 4Z4GA 1XLUA 4URFA 2OB2A 4IMJB 1G55A 4BFCA 1T36B 1LPSA 2GK7A 1Y3IA 5L7TA 3CLSC 1ZITA 2HLHA 3RS7A 3ZU5A 2R6GA 2DRIA 3PRYA 1XVTA 1XQ6A 5DEIA 4RVCA 2AR0A 1KK2A 3H3FA 1DIHA 5GY7A 1LSOA 4C5CA 1DAOA 3ND9A 2P2CA 1YVEI 1GZ5A 1V2GA 2AOTB 3DH0A 3KOUA 5LJLA 4UNPA 4NYJR 5H3HA 2C00A 3L3BA 1EWKA 4OSEA 3S1SA 3RSOA 3DG9A 4K6MA 4M1OA 4GBED 3EPHA 5F77A 1OF1A 2BMWA 3K20A 1P1JA 2BP7B 4PRKA 3V2GA 3DW3X 3H5WA 5KSPA 3V3TA 1R15A 1CUSA 2NTJA 3AL3A 2CK3A 3OD5A 4MR8A 5ALKA 2OHHA 1W73A 3D7RA 5C1PA 5C1OA 3KQUA 2CXOA 3DE6X 1YQXA 1TQ8A 2XD4A 5J63A 1J56A 4JUCA 4DNPA 4JROA 3W8EA 4A27A 5BYAA 1QF7A 2JCXA 2CNLA 2ZUVA 2OO5A 1FMCA 1P0IA 4I1OA 4RMJA 2OM6A 3TJRA 4GYYA 5I47A 1ZM3A 3AYZB 5LMCA 1QF6A 4YQYA 1VQ1A 1XI2A 2G6TA 1QANA 1Y8QB 1F2VA 2OBMA 3A3YA 3BXPA 4C4ZA 1ODIA 2OO7A 3LYUA 3IVXA 2H54A 4NONA 4R9VA 1DINA 2LGJA 3RTEA 2FMKA 5EMJA 1QAMA 3T95A 1KAEA 2VPYA 2PZAA 1U5AA 2BKLA 1QB7A 2GHTA 1CRQA 4NFHA 3WADA 2IYTA 3PYXA 4MMYB 3A32A 3JAKA 3KYCB 4IOJA 4KKXB 4N0DA 2RH4A 6REQA 1HL3A 1PGOA 1JWAB 3AM1A 3GT4A 1RRVA 5JG7A 3ZCQA 3WL5A 3P9QA 4N48A 4KTTE 3ZU6A 4NECA 5B2FA 3OBIA 4Z8YA 1W1IA 3G88A 3LL4A 4ZO4A 4HCJA 1CJMA 5DYGA 4X61A 3TBFA 4AYXA 2AXQA 3LZ6A 1VDZA 3KT6A 3OZWA 2QUKA 2GTHA 4ALJA 5KU1A 4MO9A 4D82A 2JLVA 3OX4A 5AMXA 4N8SA 4V2IA 4CHGA 4S0XA 5JCJD 1Y5RA 3AESA 3AW8A 1BOFA 2I66A 5TQ0B 4BQPA 1W6RA 1SZCA 1E3SA 3DFIA 3NHWA 3DMGA 4R2WA 3AF2A 1XX6A 1I9CA 5BSGA 2A7QA 2IYZA 2X1VA 1QHHB 5AW8A 3ZZTA 4EG0A 1PX0A 2CKMA 4LFCB 1JG2A 2DTEA 4PANA 4D9EA 5DNUA 2ZIGA 1E6MA 1S7CA 2ZROA 4L5IA 5BVGA 3B1XA 5TRTA 1E66A 2AG0A 2QG6A 3OAAD 4ZU3A 4JV5B 4AKIA 3VVMA 2IXAA 4HDSA 2H57A 3OEHD 2QAGC 4XDZA 1E69A 3LYHA 1T5DX 2IV3A 4TTSA 3SQMA 5HP4A 1JNYA 2WA1A 1I0IA 3H5VA 1FQKA 3PEWA 1HYQA 3IVGA 1OIVA 1EAYA 2XKAA 3IJ5A 4I1SA 3QXCA 1CWUA 3L7LA 1SUAA 9GPBA 3L84A 3D6MA 3V8EA 5L4NA 2FPOA 2BM9A 3AI1A 4EZBA 5ADVA 2XSZA 5CX1B 3GG2A 5ENZA 1APBA 2NXWA 3TD9A 1XROA 4U6NA 4ZT7A 2QB5A 4WY2A 2QSZA 4DA9A 1RXUA 5KQSA 2KI5A 4I1RA 4QXOA 3ZNQA 1JTEA 1T0BA 3GDFA 4GOJA 4MGHA 4BVLA 4CLDA 2ZE6A 1BCRB 2H2HA 2X2OA 3PNVA 1JU9A 4MLZA 2ZTVA 1JDZA 4ER3A 5HZGA 3NFYA 4F6LA 1OUMA 3PEEA 1HDOA 3GZJA 2GAJA 2VPZA 1VFNA 3H16A 4WZZA 1BE1A 2FWNA 2ZSIA 3NTLA 2REQA 1RM0A 4R3UC 2GN4A 1KMIY 4QYMA 4CE6A 4ESEA 2DY1A 2AN5A 2O2ZA 4E70A 1SOWA 4JC0A 4I9NA 1UBGA 5DULA 3WKBA 5EUMA 1JPJA 1NQ5A 4ZV4A 1N2SA 3IEXA 3PQFA 3NOVA 2WFZA 4B74A 1YBMA 2R1TB 3FSGD 4BKRA 4UOEA 3U4QB 2O8EA 5LDDC 2UZ1B 2BGKA 2BI8A 2VATA 4V0QA 4JWKA 4I50A 3NLLA 1OTXA 1TCUA 5REQB 3NS7A 4G07A 4NDNE 4TMKA 5CDFA 3V4VB 4D0GA 4X6XA 1K8RA 4IFEA 1T5SA 5JARA 1KO5A 4MS4B 3GT0A 4P7FA 3ZE0B 2O2GA 4L02A 3FN4A 1XWFA 1J0CA 2RJNA 3QMPA 5I7WA 1UBKS 3MJRA 3UAGA 1UXGA 3HLYA 1K8ZB 1H5NA 2JDID 4QATA 3QEOA 2PUWA 2Q45A 2VPIA 3H13A 3H2ZA 3UMJA 3X2EA 3NTVA 4FC6A 1PFWA 3SHFA 2J3MA 1D4AA 1OXVA 1NFRA 2GQ0A 3F96A 3LG2A 1JR2A 3AWDA 3QVXA 4Q6WA 1LXCA 3RVRA 3KJHA 3HJAA 4C4AA 3DEYX 1BE0A 3CV3A 2VCEA 5DWVA 5HKLA 2X0FA 3EASA 2FPLA 3A9VA 4JP1A 3O1LA 5CP8A 1FYEA 1X8JA 2BHSA 4G4IA 3K0HA 4ZO8A 2FDRA 3KV1A 1UM9B 3VZBA 4K05A 4DDUA 3QWHA 4XIYA 3A26A 5E1MA 4EUNA 1QO9A 3AUAA 1FNMA 1SU6A 1WA5A 3GMIA 3TQCA 3WHLA 4JJAA 2BFMA 4FD3A 1PQ4A 2VDOB 2AG8A 1B42A 3CURA 3FF1A 1N4DA 1Q3KA 2IYNA 3HZHA 1CZLA 1JKJA 2NVUA 3B7WA 5LD2B 3KFVA 4UNQA 4LWQA 3G8YA 4B0PA 5MF6A 2I9KA 3FOBA 3H9QA 3V4ZA 2BEJA 3A3OA 4POOA 3NDJA 1PZFA 1Z4OA 1SNYA 3QEMB 2A1TS 5CTAA 3SJZA 4ARBA 3ZHUA 1XMXA 1XXLA 2VH1A 3HP4A 4YUXA 1JH9A 3TMYA 1G59A 5HKKA 4QVIA 2NXNA 1KP3A 4S1OA 1FS4A 5ICSA 2PJDA 4JLMA 5DGHA 3CUEF 4V0SA 1B4DA 1DBPA 1IL0A 4IFBA 4LK3A 3M3DA 4EEZA 4OHUA 3IUNA 4ER7A 5CBPB 5J2UF 1DMSA 1B00A 2LV8A 3OLVA 1ZVQA 4Y1RA 2ACWA 3EUFA 5CA0F 1Z18A 1V7ZA 1ZRHA 2ZSEA 4YV1A 3Q8KA 2BJVA 2APJA 2HF9A 1B6RA 5PNTA 2WF7A 1DT3A 3KOOA 4LN1A 1UDBA 3TW4A 1HFJA 1AKNA 1U6JA 1NULA 2OM2A 4MVJI 1S89A 2LCQA 5K6TA 3G23A 4RM3A 2FV8A 2MSEB 5TIIA 2XUDA 1Y63A 3IAS6 4BQEA 5JAPA 1OZAA 4MI6A 1NBOA 1DHTA 4RSMA 5G4KB 2CXRA 3AEQB 2ZB8A 1KO4A 1UT6A 5G02A 3ITDA 1NPYA 3MVEA 4WLVA 2KE5A 1PNTA 2QMQA 2WJ4A 3V33A 3NAGA 4L7QA 4N5DA 4M8IA 1J49A 3S2GA 5FPKA 3GEGA 3B7GA 5CK4A 1JTFA 3M4YA 5HGXA 5KMGA 1Z2OX 1GNTA 1YS1X 3W06A 1XMIA 5K3DA 4WK6A 1SXQA 4QYIA 4JEMA 3BH0A 2BBWA 2JFOA 2GEKA 4EGCB 4OJYA 1V8ZA 1T0JB 4G4SO 1AUOA 2D2VA 1KERA 2AOUA 3PJFA 4MDFA 2DFVA 1EX9A 2C5AA 3O84A 4W9NC 3UHAA 3QLUA 3FHJA 4QOHA 3H75A 3QF7A 1CUHA 1RWQA 3H8JA 1BKDR 4K26A 4EECA 3IPLA 3I28A 4BO4A 1W8DA 3UAWA 5K6AC 5CTJA 1E3EA 4U5QA 1R5OA 4O1MA 1H3NA 1WCXA 4V03A 3E6AA 4KLAA 5H70A 1FQJA 2ZIXA 5PGMA 1KJ9A 1W581 1M2HA 2VK4A 1QVAA 2VOJA 3GJTA 3QXSA 3UG6A 4MYSA 1XALA 3TCNA 2XIJA 3C5HA 4BAGA 4BLOA 3NHUA 2IOFK 5AI5A 1P1HA 4DYHA 1KEZA 1NM5C 1P3Y1 2CZGA 3KPUA 4LXQA 1H2RS 2NV0A 3GZTB 4UASA 1RP7A 2R4QA 1LKZA 4W7SA 1PJ2A 1UMCA 1PD0A 3GP8A 4TUYA 3FWYA 2H7CA 3OPXA 5DDIP 1CDZA 2VJCA 3BHJA 3WLRA 3EHDA 2H29A 4CN8A 3JASB 4QYWA 5AWFC 5KSOA 4ZQCB 1N33B 1X80A 2C78A 3NTXA 4HPWA 3HM2A 1CY0A 4H16A 1QX4A 1T1JA 5HRCA 2XAUA 4M60A 5CAEA 4BX2A 2FMXA 1CNEA 2O1XA 5HCUA 1QGYA 3N8DA 1BMDA 1NVFA 1EJ6A 1T8SA 2ZS9A 3F4BA 3O2NA 4RVNA 4V3BA 5L7YA 4CEHB 1T6YA 2IDZA 2XLBA 1H3FA 5EZYB 2C92A 3HY4A 5CVDA 1A9YA 2PSHA 1Y1KE 2GFHA 3M6MD 2VQ3A 3R0XA 3RUDA 1L6RA 2PUVA 1FVHA 3GY0A 4H60A 2GKSA 1L7VC 1PS0A 3PI6A 4LJYA 3VZRA 4YQZA 1QJ4A 4L95C 3BZWA 4Y2TA 4JMPA 2DUMA 8OHMA 1EK0A 1NMYA 1E9SA 1X6VA 2VWGA 4F06A 3ISJA 6REQB 1NUSA 5FTLA 1P4RA 2F8SA 1IZYA 1FUUA 1EP1B 1NBAA 2GLTA 2YW2A 1L8QA 1Q0QA 1T6NA 1QIIA 3UFXA 5F7XA 2CVFA 3EQZA 2B98A 1R6DA 3PX7A 3KSDO 5JCOC 2FAXA 3ND8A 1NJ6A 2BKAA 1HQKA 4A26A 2FSVA 3OX2A 3NDRA 2JAHA 4PG7A 2RE8A 1GPBA 1RIIA 2HWWA 4TZ0A 3AESB 3I8OA 3HJUA 4K7JA 3RRJA 4NBRA 4QPNA 1P5FA 2JK0A 4DIEA 3Q5DA 5DNAA 4I5DA 2OV4A 1JQEA 3UCEA 2IEGA 3CG4A 3FOFC 3A4MA 4FFDA 3KXIA 3QUAA 2Q29A 1GL7A 4LZWA 3TF5A 3CY6A 2H63A 2HSEA 3O95A 4LVUA 3CJTA 2V7GA 3LL7A 3SK0A 2JGKA 4RFVA 3OC6A 1CRPA 1JDBC 3D6JA 4M86A 4MRRA 4B40A 4HDSB 3DSRA 5AUNB 1CEQA 2H1CA 3RRBA 2HWUA 3LUKA 7MDHA 1HDIA 1LPMA 4ENUA 1EDBA 4FYJA 2JGFA 4OYHA 1NVAA 2W90A 1WZEA 2XUJA 1FLDA 1Z62A 4G67A 4HQFA 1RE1A 1LI7A 4R9RA 3D54D 3SI7A 2XUIA 4CM4A 3H1EA 2R6R1 4FFBA 5LL6P 1G4UR 2AFRA 3RNOA 3TLXA 4LJKA 4MPPA 1CD5A 1SPXA 2ACVA 2C8KA 2H1FA 4K40A 4CCAA 1ORTA 3H0KA 2CLEB 2WMDA 5KI6A 3CLRD 1M0EA 4IIFA 1F5NA 2ZT5A 4QFMA 4BP9A 4P3PA 4GDFA 2JHFA 1CF4A 4DMUB 1NNLA 2GASA 2L69A 2BM1A 2ZJ6A 1EBBA 1HM5A 3NZEA 2PGIA 4QOSA 3W9SA 5EJAA 2FSSA 3IQDB 4EUEA 2I3BA 4CR6A 2JATA 1LLQA 2B8WA 2A9OA 4H0FA 5ARDA 3RV3A 3W5HA 2NSLA 1M2JA 2WTBA 3N87A 4BZWA 4DG8A 4F96A 4BQRA 3G0HA 2EKQA 3N7AA 4D7AA 3DWEX 4JS0A 2BWJA 1B2LA 4X95A 4D8YA 1NVWQ 1ZD9A 4IS2A 4I0WB 2UXBB 1YRQA 2GAAA 2ARKA 3MGBA 1AA9A 1ML4A 1NRWA 4P0TA 4TROA 4UTZA 3ZI0A 5K09A 1YMUA 5LJIA 3A04A 3PDIB 4XDYA 1IN4A 1N3LA 3GPCA 5CLLA 3ZGNA 4F71A 2HI0A 3H1GA 2RI0A 4X62B 2P0YA 1ETUA 1A76A 1QLHA 1UC5B 1RRGA 1WDWB 3QE9Y 3BEOA 4I50B 4KR6A 1XLVA 4DIUA 3M4ZA 3AWIA 1ZOSA 3LUDA 4GLOA 1UBMS 3IIEA 5A9RA 1E3QA 1R0ZA 2DPLA 2BEWB 2KSQA 3KCQA 3QQ5A 4A0RA 4KNYA 2PX0A 3IIIA 5H4HA 4XA8A 5IF9A 2ZPAA 3TSYA 3A1TA 3NHJA 4YEDA 3U6BA 3A4NA 1PV1A 2ZJ8A 3CWZA 1M76A 3FOZA 1VG9B 1G7TA 3G0CA 5A4AA 5ERYA 1IOLA 4JKYA 4ND1A 3IBCA 1ZPDA 4IDHA 3K2IA 3W8NA 4PAOA 4OGWA 4C22A 4EGAA 3FIUA 2JI9A 1HV8A 4J4BA 4ZRNA 3C6ZA 4RABA 1K3FA 4CM3A 3O0DA 4IZ6A 4WY8A 3RWOA 4TGLA 1DWQA 4OIFA 5AHOA 5DSZA 4E4TA 1XTSA 5F35A 3S27A 4JHXA 3O03A 3I6MA 2JW5A 5TGDA 1J1UA 3LT0A 1CYDA 2V9CA 3VX3A 1JPUA 5D3MB 2H2WA 2XYVA 1EVZA 2R8RA 4GL4A 4BLWA 2CHGA 2I2CA 3IE0A 5HFNA 3IAS1 5IW8A 2P78A 1NAIA 3SJAA 2B3DA 4RETA 4DLXA 3HUEA 1H0KA 1SXJD 4PYJA 1NDQA 3CLTC 3SDZA 1JKJB 3JSXA 3ETGA 1KR2A 3F6BX 4Q3CA 2NVUB 4O5OA 3LKVA 1VHTA 1RBYA 1XTQA 3IPYA 2XGOA 3NJ8A 3INTA 3CLSD 2PYIA 4ZQBA 4JB3A 4NBSA 3WG9A 1Q74A 1NF3A 3C48A 3L05A 3IKLA 1XYVA 3L0YA 4IZHA 4JOSA 5B64A 2OCPA 4FTWA 1ZONA 4U2GA 5F4ZA 1X13A 4ZXPA 1KQGA 1W7AA 2VHEA 1M1UA 3JX9A 2PKYX 1EFVA 4NCXA 4AS2A 4CI0B 1JS1X 1SKUA 2CDCA 4FCCA 4HNGA 2H1WA 4RHUA 1UPAA 4JL6A 4Q1EA 5E9JA 5B7QA 5D5PA 5SZHB 2RKWA 1GR1A 3AJAA 4A16A 4G97A 5MN5A 1E32A 1FOEB 3AUTA 3TR5A 4HFNA 1KNXA 4IMIB 5AVZA 3KXKA 4RADA 1CR1A 3B52X 1OX4A 3CKKA 3V4OA 3B2EA 1VE9A 4U9UA 5AK6A 4ZI5A 2ZZMA 4TVOA 5DTMA 3L7NA 3GWZA 5H3CA 3R7AA 1HLFA 1G8PA 4MUNA 2WJ3A 5LIPA 1L7BA 2XXJA 1LPPA 1GN8A 1DAMA 2P91A 1P45A 1LK5A 1ZD3A 4MQLA 3K5PA 1I3MA 1GYPA 1Y3DE 4FI3F 1MB2A 3KB2A 1E2HA 4EATA 3C5CA 5DISB 3UWDA 5CDHA 3H2SA 2UXCB 1JQBA 4ZIRA 1HPLA 1YZUA 3HVIA 1Y4AE 2A0KA 4YMVA 2PWZA 1RRFA 4P36A 4P83A 3FYUA 3UGJA 3F0TA 1NP3A 4K9SA 1XJCA 3RKSA 4G0VA 2VHWA 1NU8A 2QN8A 2I2WA 4EG6A 3ZD9A 3TIIA 4X8LA 1VIVA 1KZ7B 2A5LA 5TPZA 3MXTA 2Z58A 2RHWA 2C3OA 4LMBA 4YCJA 2WWWA 4S2EA 4CDMA 2Y2UA 1UODA 5LLDA 4I81A 2A4KA 3O4IA 1QK4A 1E94E 1L3IA 2HIMA 4H1HA 1V16B 1DJNA 4EB3A 5AW4A 1L7XA 3U7QA 3BH7A 2Q49A 4XOIA 5I4CA 4CKWA 1UXKA 4F21A 4IUBS 4DDWA 3QRWA 4B3GA 1RRKA 1JXOA 3OUZA 5DHRA 5LWQA 1MU0A 4GYWA 1ZDMA 1HNZB 3SEAA 2XVMA 2F59A 2OL4A 2R3SA 3QOYA 5BR7A 5KQGA 5L3SB 1AHNA 1N2CE 1OY1A 2OCAA 2X8JB 2PCJA 2P40A 3P97A 3PJDA 3FF4A 3V1KA 4TUYB 1XPUA 1OGIA 2AVDA 2K2QB 2BN4A 2WUFA 4DQKA 2Z6AA 1GRNA 2ZUCA 1PZHA 2ATVA 2L82A 5JCJA 4KE8A 3CH7A 3LOUA 2EGHA 1IXSB 1X80B 5KYYB 3PFFA 1X7XA 3VUEA 1EMDA 1VBMA 4IDQA 2OUKA 4KQWA 1OH7A 4I9GA 1FL9A 4HBGA 1IXYA 4Y1FA 3V32A 4NESA 2EQAA 3FPJA 1N2HA 5LDGA 1XHEA 2VK1A 4KC0A 1GKKA 3J81k 4OMCA 2EZ9A 3LY8A 4NNPA 5DBEX 3W3ZB 3OI7A 1YOVA 2XH8A 1F38A 2A0XA 3IUMA 4PRZA 1CR2A 1YO6A 4REOA 1G21E 1CF9A 1GZDA 1ST2A 1WL8A 3ICWA 4HYEA 5D00A 4A0GA 4EIWA 2XD9A 3TFWA 1EI9A 3O8RA 2AA3A 1YACA 2IYAA 3U44A 3RFCA 4E46A 2PT5A 3OIUA 3JQBA 5D85A 2HMTA 1PEDA 2A0WA 3HYLA 1ZW1A 1IPFA 2RGUA 1SVNA 3ZS8A 2NU9A 3QU4A 2C9YA 1A5ZA 2F1OA 1ZGZA 2ZR8A 1QHGA 3DO5A 1E5DA 3EG5A 4FR5A 4XUDA 4XEUA 5JV5A 4X1IA 3NVAA 1CUEA 2H4FA 2ZTUA 4XR9A 3AUYA 4XTRA 4EKYA 5C7IO 5GZ1A 4AP5A 4YUAA 5HIIA 2PUCA 2GB4A 2JJYA 3SE0A 4AJ9A 1QX3A 5IJ0A 1C50A 1JWBB 3HR4A 5B36A 4LOJA 3DPUA 3BA1A 1TRHA 1JDNA 2Q5LA 5G1OA 2VSYA 2GHRA 2H52A 4JIMA 5IC6A 2QP4A 3RC3A 3SC2B 4FM9A 1EVIA 2OC4A 3HDTA 4FYPA 4Z1MD 2N0SA 1IB0A 4NVRA 3WV5A 1HXHA 5BUCA 2Q3HA 3GJ8A 1RHQA 3P9SA 1RNLA 1THMA 3K0KA 2C9BA 1LI5A 2K4MA 4K3UA 1RHUA 4H31A 4DGSA 4TV8F 1ONPA 4XCVA 1RAAA 1TK2A 4TTRA 5CMLA 3ZLUA 4JT4A 2NOAA 4A4DA 5IU6A 4TN1A 2FHPA 1AUQA 3QNUA 1A2KC 2QRHA 3EC2A 2QVBA 4TKUB 5DHSA 2VJQA 2VF4X 2B0CA 3ADOA 4HLQB 4H27A 5B53A 3O6VA 3FLMA 3QVUA 4RCVA 2PGDA 3DLBA 1V3TA 4Z2YA 2IYEA 4IIVA 5KX5B 1VYVA 3AVOA 3TZBA 1R74A 1C2YA 3OCZA 1VE3A 3FYHA 1L5SA 4EBBA 5EIBD 2YHAA 3JWEA 4FFBB 4MB6A 5T8KA 2IJGX 4FGZA 4ZVOA 3S2YA 5JY6A 3HCNA 4DDTA 5MN6A 3PC4A 1XZPA 2SKDA 1OLUA 1T9GR 3RC1A 4ATNA 3PNKA 2JFPA 5EOVA 5AKYA 1RXWA 4EYEA 3LSYA 2LTAA 1Y81A 4E3WA 4KUEA 2YJ3A 3AIMA 2WIGA 3IBGA 3C6XA 2G63A 3F78A 1SHZA 1WQ1R 1PL6A 3JPWA 4JLVA 5DCYA 5DKFA 3WHPA 5HF9A 2DR2A 3HKCA 4DV7B 1S02A 3QELA 3UT6A 4OHRA 1A5BB 3FB4A 1O6CA 2FUEA 4GBGA 5I7RA 3QITA 3HJFA 3ECCA 4IBOA 1ZH0A 2O07A 1AK9A 3KJIA 4MYUA 1BS9A 1AKQA 1PQPA 3NXKA 1B14A 1P39A 4ZCSA 3H1TA 5J5CA 1Z74A 5LXTF 3INNA 2O8BB 1L8OA 4MJ3A 3RB8A 4R84A 1IOZA 1L4EA 3B82A 2Q0XA 1U0JA 4Z7OB 3PXGA 1JLLA 3VJMA 1F6BA 4TS9A 5JS6A 2WSSD 1RCTE 3R3JA 2ZUTA 3BCSA 3QU9A 4EA6A 1N77A 1U8UA 2WV7A 5FUYA 4IIUA 1C1XB 3NQ41 1KK1A 2WHXA 4G0WA 2PA3A 4OQFA 1Z83A 3QUQA 3ST7A 3O9ZA 4FUTA 5KX5F 1AG9A 3MWEB 4GSYA 4E22A 5BOSA 4TMVA 2Q6TA 4RLFA 4RJTA 1IOVA 4TXHA 2QORA 3L7YA 1NYTA 1FU4A 2G88A 2PMCA 1J0DA 1ZIOA 3DO8A 5AW9A 4LY9A 3VC1A 1IN8A 4XDGA 5EVJA 1KYZA 3QLVC 1PNQA 4UMDA 4UQPA 5AK5A 4F9GA 1Y5LA 3ZVNA 3WDKA 1QPGA 4YRCA 1E1CB 5MGBA 2G83A 1YU9A 2FK8A 5CCEA 3V1TC 4AN1A 1A9OA 4LHZA 5E6UB 1XYGA 2ZE8A 4EL5A 1BJTA 1KAOA 4EGFA 2IOQA 5K3BA 1KPHA 5FBLB 3PXCX 2I5PO 2BFWA 3CUKA 4ZZ0A 1U99A 4EY4A 5LQAA 3GGSA 1TUEA 2BR5A 1T4CA 2PX3A 5BN5A 1M8KA 1V4NA 2V5VA 1HWYA 3V46A 1G66A 3RVNA 3PU6A 4L2IA 2PH3A 1XWWA 2BCGY 2VP6A 3GFVA 3GFPA 1H8ED 4D57A 1KY3A 3FYCA 4LSWA 3C6BA 5EE1A 4ZGGA 1HH4A 2O7RA 1R6VA 3PGKA 5LDHA 2RBGA 1JG4A 3K1YA 4INOA 5GQSA 1GPNA 1YA8A 4HQKA 4E6EA 2C3YA 1F2UA 3VO1A 3NDPA 4A03A 3DFMA 1W36D 2HFKA 3KOMA 4H9GA 4DCUA 2PRYA 3RS0A 5JZ9A 1OW3B 3O31A 4DLUA 3BWBA 3HL4A 2MWMA 3FNHA 1I3OA 4DB4A 3RUAA 4JLBA 4MWCA 5EWJA 2DMRA 1JN0A 1JL3A 1KMMA 1BU8A 1GOTA 2JGLA 4CLRB 2V3CC 3G0DA 4HNUA 1NLZA 1ZAKA 1OX4B 1E3DA 2IL1A 5B57C 4BAUA 5HNKA 3AJDA 1KI3A 4HI0E 3LT2A 1T1RA 2HMUA 1CZNA 4IIJB 4ZARA 1ZMBA 4NV0A 5TS2A 3RFUA 4F9FA 3UNXA 1Z29A 3LK6A 4Q4LA 5ESXA 5IZ4A 3OOEA 1VYHA 4O6VA 1RD4A 5DTEA 8ABPA 1P4JA 4RHEA 3VTAA 5ED4A 1C41A 1OB2A 3D8TA 1T1GA 1EFUA 4RK1A 1L5KA 1Q17A 3PEUA 4Y2UA 1IAVA 5BPFA 2NQ2C 2ZUBA 3DXXA 5EHNA 4DPKA 5KTNA 4IRUB 1M34E 1U6KA 1FU7A 4PG8A 4BU1A 4ZIRB 1M5UA 3EN0A 3SHOA 4QT0A 2HPAA 3JRWA 1ICEA 4XR4A 4NBVA 4XM1A 4IUYA 2P2ZA 4Q3EA 3FYUB 3RH0A 4D2IA 1E20A 1REQA 1TX4B 5JISA 1IJEA 3VA7A 3L4JA 3V8PA 2ATEA 4E32A 5IXYA 4DR5B 4HUQB 3VMFA 1AS2A 4ZTUB 2C0QA 2YS7A 4FN5A 4QNRA 1I2MA 1AIPA 4REMA 1TXGA 5KU7A 4D4GA 1I5RA 2EX1A 4BVHA 1S2LA 2IELA 4I5GA 2W70A 3SKXA 4UPEA 1EAMA 3PNSA 3GUZA 2LDXA 4BB0A 5KJ6A 2ORWA 1OFUA 3K05A 1ZU5A 2Z1MA 1Y9AA 3ESAA 4G6ZA 5D7NA 1Z2NX 5COBA 4GI3A 1W52X 2XCIA 3OJCA 1XDWA 4M9QA 5AVWA 2IBSA 2HCBA 3CONA 4QD3A 4Z9XA 4IDEA 2J3DA 4FIDA 4BMCA 2CJPA 3RS3A 2YCBA 4CG3A 5K8JB 4L0CA 1WMEA 4OQNA 1H66A 5BXQC 2V7UA 3WR5A 4NABA 3NPAA 1YR6A 4ZU6X 4X45A 1J2TA 1AKWA 1PT5A 2E49A 1P18A 2HSGA 3FRJA 4RSRA 3MZ0A 5JTUA 2ZUDA 1PR0A 4C20A 3M4NA 2C2HA 3PNOA 2HWXA 1P4HA 1DEAA 3K8ZA 4L5JA 4K9RA 2G0TA 4J1SA 4OXIA 1I4OA 2AF3C 3ENKA 2O3TA 4KIGA 2DJIA 2IHBA 4TWRA 1KZHA 3SBDA 5KWIA 2BGTA 2X58A 3AF4A 2X8AA 4QARA 1LX7A 2XNSA 3IV6A 3ILXA 2OBLA 2WU0A 1N2IA 1NYQA 3ZNOA 2GEUA 5K3OA 2IPOA 3HSKA 2KMLA 2X4GA 1N4AA 1OWMA 1DQPA 1VJRA 3QP9A 4MI3A 1YOVB 4GKKB 5K8UA 3OVMA 4V0NA 1ZK0A 1N9GB 1PZGA 2ALJA 2Z5GA 3DFFA 4HDCA 4M9XA 4TVSA 2M9MA 4R7ZA 1NI3A 4D42A 2JIMA 1WE2A 1ZWKA 1ZJYA 1AQLA 2G9RA 3GDHA 4LJ7A 2HK9A 1E8MA 2I1LA 4A6XA 3ZVRA 1HE1C 1UBCA 5ALVA 3RROA 1YFLA 3IMKA 3ZGLA 2BFFB 4KQ9A 5DLDA 1IOWA 3GLHA 3AHDA 4TRMA 3W0LB 2HLNA 3I0NA 1ZICA 4UBJA 1U9JA 3QYAA 3TMAA 3JQBC 5IBQA 1O9BA 3W1WA 4OUDA 5EWLB 3M6XA 5MDHA 1DCFA 2XMGA 1YRBA 4WVFA 5AXBA 2O7VA 1SIUA 2HHLA 5IJ0B 3CPSA 3WGJA 1BEZA 3RK1A 4ZDIA 4BNFA 2CJXA 4B17A 1PL7A 1RLUA 1AB6A 3AV0B 3L1UA 2ES4A 3O1JC 4P34A 5A4DA 5ALQA 5AI6A 1CU1A 3IUJA 5HQJA 4DHWA 4TOIA 3LZCA 1Z0UA 4YQEA 1YRYE 3EEYA 3SEZA 3N2GA 4FFLA 2VNKA 1CPYA 1LY1A 1VYTA 1NXVA 3VR5D 3HY3A 5C0OE 3LX5A 5ANRB 4F8YA 3D6UA 2RK6A 1UINA 2ZW9A 3CQ9A 1Z36A 4D0LB 3W5SA 1E9FA 1VL2A 1M6NA 4NQZA 4EI7A 2EOAA 4KQ1A 3W05A 1JIXA 4WY5A 2GZDA 2HYIC 1SXIA 3LBYA 3BHNA 4YJDA 1VE5A 4U7HA 4A0FA 1HOTA 3AJ9A 1SXPA 2ZWAA 2WVHA 3VRHA 4UQOA 5D8DA 5EUQB 2WICA 4R1PA 3TR0A 2DPHA 3E5MA 1HBJA 2ECKA 2PFSA 3JQAD 4MEBA 1D4ZA 4QRHA 5G3ZA 5TY0A 3ER8A 3EB9A 3FLEA 4EI8A 1SY7A 3THWB 3T3OA 3G2IA 2R8XA 4CMBA 2BDUA 4BNYA 5JLJA 5IVKA 3KKNA 3MAGA 3BDVA 1FY2A 1KO7A 2Q6IA 4PICA 5EJEA 2G17A 1NUQA 1SMKA 2Q3CA 1IXRC 2WILA 2VSQA 5IVIA 3DEAA 5T8KC 4BYMA 1U5BA 2XMCA 4QT4A 4KR9A 1A71A 3M2PA 4HWTA 4PSUA 3CO5A 3IRUA 4WXYB 5AVOA 2Z95A 3BL8A 3QELB 1OAKA 5C5DA 3Q88A 4CEJA 4MIOA 1SD1A 5AUQA 3AFGA 3IQFA 3L1JA 2R751 16PKA 1G8JA 5JS2A 1F9AA 1KBOA 2BFOA 3I30X 4GP7A 4Y2XA 4EHBA 3I2HA 3VNVA 1EGAA 1YQQA 4X5OA 3DMNA 3ZIAA 5C18A 2B4AA 3EGXB 2I0FA 3EVBA 3RODA 2XA1A 3DKVA 3WK7A 5BMVF 2RHLA 3QVLA 5CXUA 1RLIA 1Z75A 5HRAA 4CWAA 1JLLB 3KZ1E 3WY9A 1RYNA 4D3DA 3MJEA 5JYDA 4PQEA 1E0KA 2QMZA 5DXAA 1M2VA 2GJSA 4KPUA 1TLTA 4LVNA 4D96A 4DREA 1PKXA 1DC4A 4PBRA 4QHSA 4BXOA 1NT4A 3M3PA 4INAA 5KNDH 5JAOA 2JFNA 1CFJA 4HWPA 4MQFA 3H2IA 1Z0JA 1B23P 2EF1A 1TU4A 4C06A 2J9FB 2BEVA 1ZCFA 5JSZA 4YRKA 2C3MA 2I7XA 3CVJA 4PNHA 4RC9A 3VH4A 4ZCMA 5DHAA 3EQ7A 1PGQA 1K1EA 2QAJA 1M8GA 2FMIA 3DYBA 5ECDA 3C3AA 4W5RA 4WZAB 2XECA 1HT1E 3I8SA 2YY7A 3A0RB 2QRMA 4P7BA 1PEKE 3BWMA 3OM8A 4ZCTA 1ISRA 4ETNA 2C1XA 2NZJA 4MUGA 4MSUA 5E1OA 5EMMA 4IHAA 5I7AA 3LPNA 2N42A 3ER6A 2C4VA 3FTNA 2HT1A 3U4AA 3ZX5A 1ZGCA 1JVBA 1EDEA 1X3SA 5K8LA 4PW0A 1QGED 1VE7A 4BVGA 3AM5A 2NWQA 4MX8A 5JNSA 3EVCA 3QUTA 3KL2A 2QTWB 1DXYA 2ZLBA 3DVAA 2OC9A 5G0UA 1JAXA 2FSFA 5G0VA 1H93A 1ZRNA 2YUTA 5BN5B 1W46A 1O6ZA 4KRYA 4D4LA 2K7FA 1IAQA 4P5DA 2ZU0C 4L2IB 1JRLA 2DT8A 2NW6A 3R3UA 1KJJA 3CWCA 3DZKA 3DWFA 2CFRA 3L8DA 4YP6A 1OYWA 1WO8A 1B8VA 3Q2IA 3GFQA 3DT6A 3SP1A 1WZUA 4M8KA 5CNKA 5DPMA 4MVYA 1SGWA 1LB1B 3VX4A 4BNJA 4L8LA 2ODWA 1F2UB 2H3EA 2WKWA 4MV5A 4AY6A 1TMKA 3UJ6A 5HF8A 1BYIA 2BKUA 4U6QA 5I7FA 2PVSA 7ADHA 1JB9A 3IOYA 1R0CA 3ABSB 3PRHA 4NAVA 5LBIA 4EVIA 2BUBA 3QVJA 3SU8A 3U3OA 4XD2A 2C7OA 1N3IA 3JVEA 2HWKA 1DKRA 1UBHS 1K06A 1R5BA 3H8WA 3PQ4A 3D8BA 2C94A 3LBHA 3T54A 4CQMA 2FN8A 2OGSA 2GBPA 3U4IA 2GM3A 1VHJA 4L5AA 4LZNA 2XQJA 5LA6F 3OF5A 5BVHA 3TRIA 2ZVDA 2F3RA 4RXUA 3U4CA 1S8AA 2RCNA 2B20A 4PWZA 5SY6A 4ES6A 3OZVA 4EQZA 2NP7A 2WEKA 2D5LA 4IILA 1X8XA 4MRMA 4OHVA 5AM2A 4TLBA 1AKMA 3NVKI 3LLSA 2H9IA 4EFLA 3H5RA 3K1AA 4L4RA 2G0NA 1GZ3A 3PGLA 1O8BA 1IHUA 4CNQA 2LXNA 5NULA 1D1PA 4QZVA 1XZMA 2HU8A 5ICGA 1TO2E 1TUGA 2AZMA 3BWDD 1M73E 4KQFA 1ZM2A 4OGLA 4G5QA 4EGSA 1A9PA 4RHFA 1WHTA 1E77A 3FAKA 4MR7B 5A0FA 1P1IA 3SYNA 4DTCA 1KYWA 1IBRA 1UXOA 2YJNA 3KUCA 3KTOA 2X1MA 2FPXA 1XZDA 1Q19A 3KVRA 4ZO7A 5JNUA 1V4BA 2PX2A 2ZYDA 1KSFX 3KQPA 3RJ9A 1Q7TA 2XNKA 5K8VA 2CUNA 3VKWA 3D4NA 3DCNA 3SZUA 1LD3A 3LECA 1J06A 4A6EA 4UAVA 1AF4A 3MS4A 1RYMA 3Q1LA 3D7NA 4TWZA 3LWDA 1TO1E 3P9CA 3JPYA 1G8FA 1XU9A 4FB4A 1PUIA 3Q3HA 4TYQA 4R9NA 4DY4A 3K0EA 4Z9FA 4NBLA 1NVEA 1JG7A 3TJZA 2JLAA 3O38A 1W29A 2FWPA 4FYMA 2W7TA 1MX9A 3GARA 2XADA 5H0IA 2O5EA 3ICCA 4D99A 1H65A 3LQ1A 2CXNA 3OTGA 3MCWA 1TCVA 3MNFA 4PZAA 4HK4A 1J09A 1W2WB 3E8MA 4MV4A 3W5IA 4KCGA 1S8FA 4WNIA 3DE1X 1JEYA 1NHGA 3GD7A 4CIXA 4CMEA 4LBYA 3IP8A 1TYEB 2VHVA 2F3QA 1FUEA 3UQZA 3M34A 2NG1A 1N5LA 3U31A 5BV2P 3WVNA 4X90A 2ZEJA 4KITB 5A7GA 1ZGHA 2AMVA 2VXBA 2WSBA 4RJKA 3LM8A 2PANA 2O52A 1X14A 1D2CA 1NBWB 3BCHA 4R8SA 3SS7X 3T52A 3GK3A 2YL2A 5CA1F 4YT2A 5GP1A 3K5WA 4BDTA 1R8XA 1QWOA 2HHAA 2JFFA 3BXFA 1QYCA 1WCYA 4MTCA 1R8QA 4MWOA 4DL9A 4KQJA 5FO0A 4EYSA 3O2SB 4IDAA 5G41A 4EM6A 1BSVA 5I9MA 3RR2A 1B16A 2W11A 3K8OE 2PRIA 4OQEA 1TL7C 3GEDA 1UL1X 2IOHA 1BAPA 4NX2A 1M1YA 4YPFA 1ML3A 3MTIA 3GJ6A 2FLVA 2VLBA 2P9HA 3L92A 5GV8A 1TMYA 6AT1A 4OSPA 3S1LA 3NC4A 3EGDA 5EPEA 4MS3A 3QVKA 5H9WA 2X23A 3ND5A 3WK6A 2OAQ1 4E5DA 5ITSA 4ACAA 4GNKA 3RSSA 4EJSC 5IH7A 5TMPA 1X94A 3E8XA 4R81A 3M6FA 3NOQA 4QUHA 5M04A 5I8WA 2PZBA 3M9XA 1TVMA 2CXUA 2O48X 1IMJA 2RSLA 5KYUA 3DMDA 3GLHB 5FWYA 1M33A 4OFXA 4P2GA 4LI0A 3D3NA 2VT7A 3Q9LA 3DP9A 2IH4A 1SD5A 1YNSA 4DBZA 1W5SA 4OUDB 2OP1A 3FWKA 5AD1A 1BVYF 3GRYA 1IHDA 5FTJA 1IMOA 5DCLA 5DGTA 3R3YA 4G4GA 4YMHA 2P27A 2WRZA 1PR2A 2RHCA 2WIKA 4BBAA 3KVYA 5DT2A 2OMEA 3RLIA 5DNEA 1NPTO 4D9KA 3IA2A 1E2DA 4R2KA 3PDWA 2Z0MA 2RH5A 1ZMRA 1IYZA 1Z4KA 3ENVA 2AQ8A 2IU4A 3R2JA 1PWEA 2PZ8A 5LMNB 1L5OA 1G98A 2NNLD 2W2TA 2HBRA 1YRWA 2YOFA 5EXXA 4ZVUA 4C04A 3K70C 1AGNA 1JECA 1NY5A 4JI8B 4NS1A 5E4TA 5IXSA 3MWLA 2QOEA 4DZTA 3IMEA 1DOZA 2DGDA 4CLOA 3HM9A 1RYFA 2G7MC 2Q4OA 2WSSA 3PP8A 2PBLA 5M3BA 1P80A 4JN6B 4Q00A 3LTEA 1JSRA 4JLKA 3TLZA 1Z12A 3OHSX 3TTSA 5L3QB 4NCAA 4LCBA 4BLSA 3FBGA 1N0WA 1U0FA 2RFLA 3LPCA 5BSWA 3SIXA 5A3SA 3PICA 2E21A 3HBFA 5AVRA 3FFWA 3FSEA 4IJMA 1W85A 1U8YA 3C3DA 1ILEA 1KVUA 4DYVA 1QQ5A 5K0JA 1I30A 3SSNA 5A1JA 1WBDA 2Q5OA 3KWFA 1ECCA 4MR9A 1R27A 3T6KA 1I14A 2QJWA 1L5VA 4KEAA 4X20A 3UMYA 1N6KA 2AW3A 2ZDHA 3QFRA 4G85A 4YJ3F 3OQOA 4W4TA 4P6VF 3RBZA 1L5RA 1C80A 1T9HA 3Q7TA 5BUZA 3PFIA 5HJEA 1RFLA 2AXPA 2H7XA 4LWPA 2GETA 1J8DA 3GUVA 3O8BA 3IQXA 3P2MA 2IYQA 1I4EB 4LGVA 1UIRA 1LCIA 1U5BB 2CMGA 1N6NA 2QDXA 3GJ4A 4Q9AA 3KLMX 3P9RA 4IZOA 5JBQA 2GF0A 2VT6A 5JFGA 3LCUA 4UU1A 1BVUA 1U2SA 1E1QD 1WBJB 3LPLA 4WTOA 3VPFA 3GLIA 2P69A 3IX7A 3F7NA 1TVCA 5ADWA 5ADUS 2HPVA 5JLAA 4ZCQA 4YMSA 3D81A 1YL7A 1ZK1A 2P4QA 2DSNA 3L0IB 5IMBA 1Y7LA 2HU5A 3ZUGA 1OFIA 5BNWA 4KPEC 1P61B 4HPJB 1SXJB 3CPEA 2JC3A 1ZO8A 3QFFA 4AKHA 3B5JA 3K1JA 4OG2A 2CFTA 4EUHA 1YZKA 4TKLA 4D8XA 2BTEA 1K63A 5EKTA 1OH5A 3VYWA 1M2VB 3A70A 2XDQB 1O9GA 3GRAA 3JQDA 3UA3A 3T3PB 1RI4A 1CDDA 3MK31 1VL5A 2YBEA 4BXOB 3CSSA 4TZ6A 3G68A 3M4XA 2HEGA 2PO5A 4H3VA 2IH2A 3UV6A 3WIEA 1P5JA 4HVTA 1Q1QA 3GCDA 2XZPA 1E0JA 5KC9A 3GPLA 1GWNA 2HFJA 5I5EA 2JFWA 2XT6A 4ZQHA 3SNHA 3Q3IA 1LTHR 3ULKA 1X7YA 3UJ7A 2DCMA 3NYIA 3PE3A 4B9AA 4XM2A 3FH0A 4CG0A 1W5AA 3VZCA 1HO3A 5LNK6 5EIBC 4N7MA 1U6IA 3DBOB 3WIBA 4EY6A 4RPLA 4ZI7A 4INZA 3W6PA 1NUAA 2IZ6A 3WWZA 2AHRA 3DEJA 4ZOEA 3Q1KA 4ALMA 3TRJA 4EY7A 1V4VA 3UJNA 3THOA 2JK1A 2X5JO 3V2UA 3GN1A 1G9SA 4BEBA 4GPTA 4ZQEA 1JDUA 1XQ1A 1FJXA 5AKZA 5FR2A 3OFND 3SJBA 3LA6A 1US8B 2QVYX 1PQYA 1BQEA 5EQFA 3T3DA 3WLTA 2Y68A 4WXEA 3WYCA 5GZ3A 1W44A 4QGAA 2FQYA 4S35A 5BR1A 5AJUA 1E5XA 4FNOA 1F2DA 3BC1A 1QLJA 1JHVA 3RT9A 4TWIA 4P54A 5AM4A 3SAJA 1J0EA 4GX5A 1Z6AA 5KOHA 4KQKA 5JO9A 4G0YA 1Q1EA 1ZJ5A 3LC1O 2O0JA 2PN1A 5DFAA 3WQSB 3AY3A 1DS6A 1O5IA 1ODCA 1QM5A 4A23A 3ZZ1A 1YZYA 3EEQA 2HRQA 1XMVA 4O4JA 3NONA 1FRNA 5JXJA 2RAVA 5B3KA 5F7OA 2ETVA 1MJNA 2WWXA 2YVUA 3ZQ4A 3C8MA 3D6HA 3HWWA 2IXEA 2ODBA 3K15A 4LZZA 4YONB 2R8OA 3SEQA 4NFLA 1E9AA 1O0BA 1BX1A 3VYSB 3HKEA 1XKQA 5BW4A 1ADFA 4XFJA 2QTZA 4NCHA 1Z8NA 3UJ8A 4C5AA 3F67A 4CQMB 4DMLA 5F3RA 1DDOA 1WULS 5EJMA 2JASA 3DZIA 3EPRA 1D0SA 5AW3A 3S2SA 5BVHB 5HF5A 1EDZA 2PHZA 4D4HA 2B61A 3D7SA 1MCZA 4H7JA 4LC9A 1YUBA 1GEGA 4RTRA 4O2LA 4MRMB 2Q1YA 3MUFA 3ZCVA 5KWEA 4R1LA 3AI3A 2CJYA 1TAHA 1QE3A 2PMEA 3A3PA 4NPCA 3LPAA 1IY2A 1JILA 2XUGA 5EZQA 1FRFS 4YRDA 3LC7O 4PO1A 5FOWA 2QZSA 2WAYA 1KDRA 3GVIA 3N70A 4PLGA 5B1DA 1TZMA 2IF0A 2DP4E 2YVLA 5B37A 2IUUA 1WHTB 2CLMB 5DNWA 4QTTB 3LA8A 1RXYA 3VVBA 1RHRA 4A2QA 1Q77A 3LKBA 4E14A 2JLBA 1NY6A 5J9FA 4G41A 4QGFA 4E94A 3QJ5A 3TMKA 3R6TA 2W2VA 3KD3A 3O91A 1NKSA 4LX8A 4MJXA 1VLZA 2PQMA 3EVZA 4UUAA 2ZCJA 1E7MA 1FE8A 1FZTA 3M5DA 3WMXA 3D3KA 4BZZA 2ZI4A 1I5EA 4GI5A 1NQUA 1XEAA 1A27A 3IQZA 4B43A 1T6XA 4UMEA 2NSHA 3ZY3A 5JD5A 1M6WA 3PHGA 3L9WA 5EJIA 3F98A 2BJWA 2Q9CA 1PSDA 3MEQA 4REQB 2B1RA 3O90A 5T4HA 3C3XA 5FV7A 1UC4B 3GLTA 3DEHA 1E0DA 2X4LA 5G2OA 3OQPA 4UTVA 1G41A 4CIDA 3FHCB 2PZJA 1LBTA 4ZI2A 1NUHA 4LYHA 3QI2A 2WVGA 4BNVA 2HT6A 2QRQA 3PC7A 2XBLA 4XFDA 5D1HA 3K8QA 4KLCA 1EXWA 1MUUA 2Q4RA 2ZULA 3E35A 2GBCA 3R1IA 2OPBA 3VZDA 4RYDA 4GPAA 5DCUA 5A03A 3IQIX 1S8NA 1Z3CA 3EZXA 4Q3KA 4DLYA 1DFGA 4JVOA 2A4MA 5FB3A 1VCNA 3T94A 2H8GA 3W04A 2ORIA 2A5DA 1KL7A 1YB2A 2XDAA 3KZNA 4QHYA 5JR3A 1L5WA 4D0NA 3GFBA 1J9EA 2GERA 1WB9A 4FLMA 4DV2B 3RRMA 4F91B 4GFDA 4CIAA 5E0KB 3GRKA 3OZIA 5HCNA 2BBTA 3JXEA 5KUTA 1N5IA 4XSVA 5BURA 3IUPA 3NM6B 1XL0A 4KSCA 4G25A 4HLDA 4LJSA 1T9DA 3B7PA 2FOIA 2LE0A 1M1YB 2WJPA 2ZYRA 4IJWA 4CW7A 4DJTA 4IIXA 5JJ5A 1DJMA 1LFAA 3D4PA 2H9AA 2RHRA 2H2DA 1I4WA 3DMTC 3EGDB 3GEHA 4MS3B 2CNWD 2P1ZA 5FBRB 3TKLA 4ARZA 3BIOA 4D4JA 3EZGA 1QKJA 1ZUD1 2XJ9A 1W30A 4OFWA 4TYPA 2GCNA 4P4LA 1OH8A 3WFIA 1F9EA 1E3MA 3A4YA 4WPGA 4AY5A 1XIVA 3ONFA 4W8HA 3W90A 1P3DA 2ECPA 2H59A 3B6MA 3EIOA 1RMYA 3MJ4A 4O2AB 5AJZA 3DAGA 2XF8A 5KYUB 2II6A 2DPXA 1YNOA 1ZIYA 1U4SA 4HFMA 1QH8A 2H48A 2DOKA 1T2AA 1CIVA 1M2FA 1XZJA 1H8HA 2GPTA 4PO9A 4Y2QA 1MEEA 1R0BA 2PQ6A 1CUBA 1GITA 1YHZA 2JFHA 3KDSE 1CR6A 1S2DA 1Y3BE 4I2NA 4XVRA 1U7ZA 2A0FA 3EQ9A 2D4HA 4FDTA 1SCBA 5HILA 1V1JA 1PBTA 3VDRA 3WLFA 3BMCB 4EJ2A 3EEOA 3N0RA 1P19A 3WGLA 5HR5A 2X9LA 4BV9A 2R4TA 3VAAA 2ZXFA 3FA2A 3UOWA 3QH4A 1VL1A 4H7PA 3S44A 1A8SA 3CN9A 2G9ZA 2PV0A 1ZIPA 3Q8WA 1RBMA 1JQ5A 4MWEA 2A94A 3WNVA 4DM3A 4X60A 1E4VA 4Y30A 2NTVA 5EJGA 2IYOA 2QYHA 5I7EA 4YMGA 3G0IA 2P8SA 4H35A 5DP1A 1F7VA 2JEZA 4HNSA 2ODTX 1F6DA 4TWJA 1YKSA 1ZD5A 2OCGA 3I9MA 4HHEA 3MB8A 1A8UA 1XC7A 5D01A 2O8FB 2FSPA 4W7HA 1XPRA 4AZTA 3RUFA 3NV9A 3P45A 5LQDA 1EX6A 3QBDA 1W85B 5E4FA 4YRNA 2D1FA 1I32A 4IUCS 3MMNA 4MV0A 4PFQA 3IUYA 2VSOA 4LY6A 3SF0A 3UAXA 1E3JA 2G40A 4O2AF 3WSWA 4MR9B 3E58A 1V6SA 1S2GA 3HEMA 1RAEA 2IITA 5F1KA 3QIAA 3U7RA 5FRDA 1ST3A 1SUPA 3LNCA 1XZQA 1V7QA 3N1UA 3QLEA 1Q0ZA 3ROKA 4OHZA 4WZBA 4FS3A 5F73A 4ZVLA 2QX6A 1T5OA 3GIWA 1K97A 2VCHA 5K5EA 4MKZA 4OLBA 2EJTA 1BFKA 1ZIXA 1KAHA 4YAWA 3SNKA 5MGNA 5BV0A 2C3PA 2PAAA 2AUTA 2VZLA 3EIFA 5LNK1 3GLIB 1OU4A 1ZH8A 2JHPA 3O2QB 2F1RA 3UJDA 1TJ5A 3K6JA 3L82B 4ROTA 2IS1A 2RGAA 2R1UA 4JBLA 1GKLA 4Q9IA 3F46A 4LBZA 4MQMA 5JALA 5FPTA 2IS2A 2MSCB 1P2BA 2WP0A 4UDXX 1TJ3A 3JWPA 4CMIA 2P3LA 3DVQX 3JQCA 4G0MA 1T2CA 4UXHA 3K9QO 2P65A 3THRA 4C76A 3TEJA 3ZWBA 2GZ3A 5AVUA 3W2EA 4ESHA 1PL0A 2OBBA 3NATA 4NCBA 1GRRA 1XXHA 4X1KA 4XSHA 5IM5A 3A28A 4TV9F 4G1FA 4F8EA 4JXJA 3FZEA 1SOAA 3P20A 3HVRA 2OZLB 2VAMA 2ZBEA 4ZWNA 2ZBFA 3P2JA 4A6DA 2A9JA 1T8TA 2EATA 2ZTMA 3EGEA 4W1PA 1R0LA 2TECE 3JD0A 4O33A 5BQOA 4YMUA 2AHOA 2D8AA 2ODAA 4TQUS 3WLPA 1XJWA 3EWSA 4OATA 4QJ3A 3LE8A 3L41A 1AY0A 1PQUA 4ZAFA 2JH8A 1CS0A 3OP4A 1D09A 1EDDA 3V1LA 5JWOA 3BA6A 1HSOA 4GWLA 4YQFA 4MUEA 2JBAB 1L5NA 4PEVA 3AEKA 1RMTA 5HOEA 3DCIA 4PAGA 1YJAA 3IEIA 1U0RA 5CG2A 1JIKA 3QE0A 4P35A 1YZNA 2YFKA 3VHLB 1KETA 3NR2A 3ONWA 2H06A 2UXDB 1KP9A 1IBCA 1KIMA 2RGNA 3FGPA 3V4FA 3ZZ0A 1QCCA 3FBWA 4NEGA 4B3BA 4E5NA 3C3BA 1I7QB 1TZCA 5FDFA 5KOHB 1SFRA 5BW6B 1SC9A 4CF6A 5MFZA 1W8IA 4IHJB 2ID8A 3KQNA 3TQTA 2DECA 4F6RA 4ZOQI 5DGIA 1KMNA 1RVDA 3D0OA 2QTLA 5EEGA 3P0HA 4PG5A 1UF9A 3KALA 2ADFA 2REBA 2C9ZA 5FUXA 4Y2JA 4N6OA 3T7TA 4DIFA 4PLFA 4MRNA 1J5XA 2MOKA 2VWQA 1Q57A 2GZRA 2OXIA 1DTWA 2YXDA 2HDHA 4LZPA 1FTWA 1K9VF 5G0WA 1JXMA 1EXVA 4GM0A 2VJAA 4MGZR 3TINA 1H2HA 2NADA 4UJ5A 3TZLA 1HQYE 1JP7A 4LOKA 1GILA 2Q7OE 1KRHA 3DA8A 3A0UA 3HFJA 4LHVA 1QPBA 2NN3C 1G16A 4FYVA 3P8ZA 1GT91 3WLEA 5DTQA 3ZV7A 2JARA 4WXRA 4QDZA 4KXXA 3MJHA 4EY5A 3WYFA 1LFDB 1MX3A 2ZUWA 2VSFA 3GLFB 4K81B 1ZK3A 3A7EA 3OZEA 3QKUA 1PRYA 1UFRA 3ROPA 3ZK8A 4RKEA 5C9ZA 5T7BA 3B6JA 1IEVA 1ZHHA 3OJWA 1HNXB 3JQFA 4Q3NA 1WX1A 3WX0A 4ENPA 1DE0A 3OSUA 2NZYA 1CT9A 2YWRA 3NBFA 4G2TA 2ET6A 4BO8A 2C88A 3GEIA 5AVSA 2B4QA 1LBIA 3BFPA 1DAIA 3DB1A 4ZKEA 4RTOA 3RHFA 3D6VA 1QIJA 4IHJF 4HDNB 2R60A 4AULA 2OA0A 1FFAA 2BCEA 4FGUA 3NW9A 4CQJA 1NP6A 4Z0PA 5CLQA 5JH7A 3DOUA 1B8NA 1OAAA 2HXSA 2QU7A 3OX3A 3GPBA 3RYHB 3ZWVA 4DCVA 3L7JA 4Y0NA 1WPXA 4OO3A 5EIFA 3SZ3A 1K68A 2ID4A 3NBKA 3EARA 3ENZA 3IUEA 4M9CA 2QSUA 5EQTA 2VQSA 1FW8A 1H6BA 1Z68A 4ITVA 5TPWA 1IBKB 3AP1A 4MW2A 2X4IA 3IPXA 3KKEA 4KO8A 1ZN7A 1K6IA 1MHTA 1F06A 4TKVA 4QJ5A 3U13A 1BGWA 3FUXA 1D2HA 1GQOA 1K6MA 2OY0A 2BHRA 1I2CA 2LPMA 2M1ZA 1BWQA 4PE5B 2IDMA 4YACA 2OSVA 1U9ZA 2RH9B 3RVMA 5BUQA 2GK6A 3IELA 3COPA 3H9EO 4UXIA 3V7YA 3E9ZA 3ETEA 1W87A 4JASB 2WHPB 4YA6A 4OI0A 2Z8XA 3NPMA 5IJWA 3IIMA 4JB8A 1GAQA 4HDRA 4RPCA 3NFRA 1JPVA 4FT2A 2X40A 5IRCD 3WQBA 1JHDA 1ZLYA 2XB6A 3TLGA 4GF5A 3COVA 2VP2A 4KVZA 4NLLA 4OMFG 4RA9A 3ZV5A 1I1HA 2B9VA 3BCUA 3MQFA 1SXHA 2AD5A 2AFHE 2JJMA 1QQ7A 2ZYGA 3OFKA 5C4GB 4XWWA 4PYOA 3EZ6A 2QLFA 4NU6A 3MUEA 5JSYA 3TD2A 4QLOA 4RK6A 1WD7A 4I4TB 2HHCA 2AQKA 1VGRA 3D6NB 4XLTA 1KFCB 5C7YA 5F1OA 2CDNA 3DBHA 3L1HA 1GTL1 4EVRA 3R0ZA 1N7HA 1JEAA 3RAJA 5CCBA 1OWLA 4JYMA 1ZBDA 3JD4A 4HAZA 1Z37A 1FFGA 3D0QA 2ZI6A 3OIWA 3PK0A 3IUQA 3JQAB 1J2JA 4ZZIA 1FZQA 2QVXX 5H81A 3NBXX 3GNSA 3E5RA 3RIXA 2WFMA 3F9IA 3AMVA 4ICIA 3REFA 2GLUA 2IXDA 3QQPA 3VJLA 3URMA 4B80A