2A59A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 5-nitroso-6-ribitylamino-2,4(1h,3h)-pyrimidinedione
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
molecule tags Transferase
source organism Schizosaccharomyces pombe
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
total genus 50
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a59A00
1ZISA 1HQKA 1NQWA 4J07A 1C2YA 1KZ6A 2F59A 1W19A 1RVV1 5IM4A 1KYVA 2I0FA 3MK31 2JFBA 2A57A 2C94A 3NQ41 1KZ4A 2A59A 2C92A 1NQVA 2C9DA 1T13A 1KYXA 2O6HA 4KQ6A 1DI0A 1XN1A 2B98A 2C97A 2OBXA 1W29A 1NQXA 2B99A 1KZ1A 1EJBA 2A58A 5IM5A 1NQUA 2VI5A 1C41A 2C9BA 1KZ9A 1KYYA
chains in the Genus database with same CATH superfamily
1K66A 2JIMA 3D2LA 3GJSA 4NARA 5I7WA 2HHLA 3H19A 1R4NA 3THRA 2OD7A 3ZE7A 2NSYA 1QH9A 2AYXA 1L1QA 2O2CA 3BRQA 3H9BA 1EXVA 5KO2A 2QX8A 3HL0A 4G41A 3HUTA 1DWOA 4O29A 4L08A 1CR4A 1QORA 2PCLA 4A8JB 2PT6A 3NO4A 3E48A 2IODA 3G2PA 5EN4A 5T41A 4KVFA 2WA1A 1KO8A 3JAKB 2AJLI 2A5FA 5GOTA 2GLUA 2PAFA 3HJAA 3MFYA 4IVQA 1GLVA 1ND5A 4ZT3A 2X2PA 4WUVA 5JROA 1OFHA 3GX1A 3AEKA 1S3IA 1QGAA 3I01A 4DIOA 1BN7A 5F98A 1X7YA 1MEOA 2X5KO 4YLEA 4BL5A 3ZDQA 3C16C 4Q3BA 1Q12A 1VJ1A 5K0JA 2QRUA 3GGGA 2C4WA 2OBFA 4I81A 5E6SB 3AR9A 4ZAVA 3WQRA 5CD1A 5LLSA 3QBJA 4JI2B 1O4VA 3KAKA 2AKEA 3DQPA 1VM6A 1T3ZA 2FR8A 3ZWWA 3DGEC 3GJZA 2I4NA 4EGAA 1JSCA 3SFVA 4GBMA 1BQ4A 2CZGA 4B0PA 1KYXA 2IYFA 4MNTA 6GPBA 5AW6A 1U80A 1YB4A 3O73A 4YUAA 1KRWA 2WG0A 1RM3A 2P6UA 4GECA 3FWZA 1I5EA 3DMGA 1V2HE 5FOVA 1M34A 2GRUA 2Z8XA 2OUIA 5T64A 3W9UA 4BKMA 4BXOA 1V3UA 3A0RB 3OBBA 1FU8A 4OATA 2P9ZA 5K0CA 3WBFA 1EPUA 4ZCLA 5K0TA 2VN8A 3G85A 2ANBA 2PIDA 1JQ3A 4NYIQ 2GD6A 4YMTA 4KNWA 2PXHA 1SVOA 2AW3A 3CCFA 1YI8A 5FTNA 1WD5A 1T2DA 1XRRA 2WYWA 3AF3A 2RCYA 3L7MA 4KYTA 4CCWA 1G64A 3N9IA 2AK2A 5HCUA 5A9RA 1GNSA 2ADMA 2CVQA 2G1KA 4QLAA 1WULS 3V8VA 5K0ZA 4JL5A 4TSFA 4XA8A 1CE8B 2NUBA 1T0JB 2GN4A 4NTZA 4AIIA 2AK3A 4ZQCB 2G9NA 4F2DA 3NT2A 4KR0A 1Q0UA 1XZHA 2YVUA 2Q4TA 4CQMD 1L1RA 1XYVA 3MWYW 4BCCA 5KX5B 3NBZC 1M6WA 3REGA 1E1MA 4CQLB 4UREA 5F4ZA 4A6EA 3WAGA 5EAIA 4BO5A 4KE7A 5AFSA 1O77A 3NHSA 1C7FA 4UVDA 4EHNA 1ORTA 1RTTA 1Y5RA 2FH5B 5B6IA 3ZWNA 3DYVA 3QELB 2V6FA 4FSDA 2RHLA 4Q15A 2WKWA 4BO9A 3DUWA 4L16A 1MB4A 5CW1A 1VI2A 2RH8A 1NW3A 2G4VA 3CRMA 3WQSB 4ZVOA 2ZSJA 5EHXA 4BFLA 2IH5A 5ADHA 3N2IA 2JI6A 2ZQ5A 4Q3AA 1RC0A 4WZAE 1SH7A 5IT4A 1FJXA 2PBZA 3I2HA 2KSQA 5HIJA 1YQGA 3KVYA 4FYWA 3OD1A 4NPCA 3UG7A 3VOTA 4LG1A 3PFGA 2D2XA 1PR4A 5AXAA 1JR3D 2OAEA 3RF6A 1H0SA 1QJCA 5H02A 1JDBC 5JXGA 3WRXA 1R15A 3KQVA 3A58B 4E5KA 5DYTA 2J3LA 1PK7A 1C7EA 2H2FA 3PC8C 4CMKA 1ZRSA 3NZEA 5JNSA 1WCV1 1YO6A 1OT3A 1V9SA 4G5QA 1KU0A 3N0VA 1I5RA 1GPNA 3HJNA 3LCJA 4AMUA 1QZTA 2VJLA 4IV8A 2IU0A 3SBDA 3VAZA 5LCXA 5BV0A 3R3JA 1ZIYA 2JJ2A 1RJDA 4TTIA 1KEZA 5ELLA 3MK31 3W5IA 4BX3A 4B3IA 4WBNF 4L4YA 5FOUA 3U7JA 1DCKA 2GARA 2WEKA 5FBKA 1QVZA 4J94A 2ODPA 4ETIA 2YFKA 3R0QA 5AUQA 3GEIA 2AI3A 4L8FA 2OGWA 1G6Q1 4QXPA 1EIZA 1Q83A 2JGDB 3KYCB 4RQTA 2HTEA 3QJGA 4M7RA 4MQEB 1KMHA 2NZJA 3KU4A 4IS2A 3I5XA 4RC9A 1QLWA 3RIXA 5DWDA 4MMYB 4JB3A 4R7GA 4NBUA 5D8DA 2CVHA 3F90A 4C76A 1FW6A 1EWYA 2ATVA 3EVBA 2HQRA 3TMAA 2CJWA 5AESA 3K0FB 4CDRA 3GEGA 3QF4B 1KYIA 4CTJA 5IAGA 4NU6A 4WINA 4K6HA 4O4LA 3EVGA 1KPGA 1JT9A 1RQXA 4DXHA 1YK0A 4LCEA 3FOFC 5A7GA 3U3XA 4MH0R 4DA9A 2P68A 3ABSB 1UMCA 2AG0A 1VKOA 1W25A 2TMGA 1D0SA 1OKKA 1Q19A 4FN5A 4GD3Q 2F9MA 1RRKA 2HLDA 4LJKA 1RLJA 1XWFA 3PUWA 4J16C 3I5AA 3MGBA 1UFOA 4K9PA 5GGXA 1EWRA 4DHEA 4JU8A 2AHRA 2PUJA 4LZLA 3I04M 3AVWA 2AVDA 3GIWA 1A8SA 1W9MA 2LTAA 2ORYA 3CBGA 3SS9X 1SKUA 4BLRA 3A7DA 1P2GA 1XTZA 3LXUX 3VTAA 4DLVA 1XTVA 1DQYA 1MBZA 1JAZA 1P3DA 4YJHB 5HQJA 2P35A 2IOQA 4GKAA 1L9XA 4IQ4A 3Q12A 1NN0A 1TK3A 4YQEA 5TGTA 5I48A 5ITZA 2D1RA 2K4MA 5CPBA 4HGZA 4KBGA 1UXOA 4HL6A 4OKSA 3D7SA 4GOND 4Q9IA 2GF9A 1U9IC 3OZGA 3ZHTA 1EP2B 3KDSE 2H59A 2R79A 5ILQA 4NS1A 3X1MA 4BNWA 4G23A 4AUMA 3G0IA 3RS2A 4FQ7A 3X3HA 4FC7A 1DWPA 4FGZA 4WNIA 3IP5A 1DRUA 4D0RA 5F5XA 1RACA 4KK4A 1HKHA 3SF8A 2P9TA 2I55A 1BIFA 4GX1A 3F5QA 3AJRA 3EVZA 2VS1A 1Z56C 5J2UB 5TT1A 4B6OA 5C9ZA 5L3VA 3T4EA 1XJCA 3UAWA 4MVJE 1N2CA 1TQ4A 2QG6A 2ZUCA 1EYZA 1U99A 1T8TA 2I2BA 4DCNA 3JZMA 3THYA 1JA9A 3FZEA 1CIPA 4NMMA 4YHHB 2YN4A 3P97A 1KIAA 1FVFA 2YXNA 5KNCH 4CEJB 2ZAYA 1WKCA 1X19A 1YI1A 2OP0A 3H65A 2X7JA 1MR3F 3QKSA 4R8RA 2YZKA 1BE6A 1MJGM 2C82A 5BWLA 3H7AA 3H99A 5G4KA 1EJBA 2HIGA 3BB3A 1G6HA 3ZU5A 3B53X 4R84A 4COOA 1NONA 5IAAA 3EEIA 1FJGB 2A2ZA 3WHLA 3ORFA 5JCJD 1NVWQ 3N2NA 4ILEA 4KXFB 1LBIA 5AW5A 1QIMA 4DTIA 3ZCPA 4WN9B 1L5RA 1R4MB 3D2AA 3RJZA 1KK1A 3ZDZB 2B8NA 4P4GA 1QO0D 4OQQA 1FSSA 3U3DA 3W77A 3LBFA 1GFIA 3FB1A 3M8KA 3CZ5A 3OJXA 4EQZA 3HCBA 1NG9A 3GQBB 4B43A 5C7YA 4LJ7A 5B7GA 3REQB 2XKJE 4XQ9A 1VYTA 4AF8A 4EJSC 1VQ1A 1PBNA 3KZKA 2BEUA 4C5BA 1A7AA 1OR8A 3FGPA 5J9FA 2HMVA 5D7BA 1RCFA 5DW0A 3HN2A 1ADGA 4HAWA 4K2AA 5EIBD 2X0EA 5AUPB 2IPMA 4LBVA 1XD8A 1F5SA 2KQUA 2BR5A 2X0KA 2IKQA 1WM1A 4CQMB 5T3UA 2NN3C 3CNEA 2QPAA 4R1UA 1SFRA 5SV2A 1F4VA 3V9AA 2I1VB 4BQEA 3FPHA 1RLMA 1CE8A 5C3MA 1NMXA 2FV8A 2R7MA 2ZSEA 3Q3IA 4JJ6A 4S35A 5E2AA 4BN4A 3Q0IA 3RC9A 3L1HA 5C7IO 1NC1A 2FEOA 2BZ0A 5FYDA 4OHOA 1KOLA 1QQ7A 1FP4B 1SA0A 1YACA 2PKQP 3WYEA 5CFOA 1GTRA 2XBMA 2ZI4A 4ZZ2A 4UULA 4B79A 3N2GA 2VDRB 1Q91A 4D4KA 1FPMA 3FNRA 4UBNA 4J16A 4U2GA 1E9DA 1R8QA 2B78A 1MU0A 1Z6YA 2W83A 3SU8A 2NSJA 4EFMA 3K6JA 1TDJA 2WABA 4IIJF 4PSUA 4S24A 1RYEA 3I6MA 1H42A 2CK3A 4POOA 3VZCA 4BBAA 2BDUA 2WVJA 1UWLA 2Q28A 3ENNA 4L7QA 4MQEA 3HMKA 3IEPA 2PTGA 2Y9PB 1F2UB 3QE4A 5KDLA 3G8CA 4XYEA 1Z17A 1BKDR 2YMQA 1AZWA 1JKJB 1VG9B 1WDWB 2H4FA 3KV1A 1A8IA 3B3QA 4RVFA 5IJAA 4MVJH 2R11A 1DC6A 3H04A 2VSNA 3TL3A 2I34A 3N07A 5JXHA 1W9HA 2PJUA 1HLGA 3BULA 3PC6A 4OSPA 1GPDG 1Y1PA 2NYVA 4N1AA 2Y0EA 1VP9A 4PAMA 4J7CA 2QXUA 3ESXA 4BKOA 4DG5A 1CJTC 2H16A 3G7UA 3HZOA 4LECA 2OV2A 3D59A 4NS4A 4X90A 4A03A 1F6DA 3OKAA 2OV6A 2ZRQA 4BLWA 3KZ1E 4Q0MA 4DLWA 1A4IA 4FQ5A 3LYAA 1QDUA 4FNAA 1P4JA 4RCVA 5GJBA 5UKDA 1Y1KE 4OFWA 3SYNA 3T4UA 3TLZA 3PDHA 4FDUA 1PDWA 2VDLB 1W36C 2PR2A 1HEYA 1CQPA 1NOKA 5J63A 5JVDB 5I8ZA 1OIXA 3JAWB 1K3UB 1O5OA 1ZL0A 4OM8A 5AQ1A 5LDHA 3BXZA 4S3MA 4TT3D 2WNHA 1CT9A 3HNPA 5CIQA 2QLNA 1U63A 1MAAA 1R6TA 3GDGA 1P7CA 3I9MA 3QPAA 4U7JA 3D7LA 3LXMA 1NBAA 3ZIAA 2JIRA 4JEUA 3I0MA 3THWB 1Z2DA 4NY1A 4CLOB 1XRQA 1U8EA 1M1YA 1LDBA 1HTBA 1WABA 4RKFA 5L51A 1I6KA 1IQPA 3L7CA 2WLSA 4WN9A 3E2IA 4R54A 4BNKA 2WNIA 3I1IA 3OECA 2Q49A 2UZAA 3FPCA 3RBXA 5IH7A 3ZKWB 4HWSA 3RSFA 2VP9A 2XA9A 5IWCA 4ZPJA 1JNXX 1QYRA 2PVCA 3LGXA 5F7OA 2C4TA 4IIJA 3ZY6A 2O50A 4I5IA 1R8XA 4LVOA 3KBOA 3DLBA 3E27A 5HQ3B 4EJSA 4TUYF 1Z7EA 3LUAA 1U7WA 1Z4NA 2O8VA 5HFNA 4NAVA 1H66A 5JV5A 1QDLB 4YLGA 1JJBA 2WOJA 1H2WA 1BMFA 3OPYA 3VZRA 1RKXA 3L7IA 2V7GA 3IVMA 4AP6A 1YRQA 1C1DB 3HU5A 3P71T 4MKIA 4FYPA 5EJ4A 4OXXA 3JYHA 3C7CB 1MC5A 4GP9A 1XCBA 2ZBRA 2PYZA 2ZJ0A 3GFBA 3KQOA 5KOJA 3FROA 2GXAA 1WP9A 4MVXA 2HA6A 3EG9A 5TE9A 1ONPA 1C1YA 1DQRA 1R4AA 3F4KA 2FZEA 4JI0B 2PKWA 3D3WB 2VG8A 1SQGA 3LKZA 3ZG6A 4RANA 4BNDA 1J9ZA 1BW9B 1SC4A 1W5FA 3TIXB 3ZJ4A 3VPGA 2ZR0A 5HIKA 2VAMA 3HI6A 5DI3A 2I8CA 2D3TA 3JQFA 4CF5A 1I4LD 2PNJA 4EHAA 5JCPA 1E92A 4H6XA 5CLGA 1PYDA 1N5RA 4Z4CA 1V5IA 4LCJA 1EVYA 1R4NB 1KNXA 1SUBA 1Y3AA 3K9QO 4NF2A 3LQRA 1CFJA 1BHO1 3LT5A 1BE0A 1Y1QA 1FW8A 3JD2A 1TCVA 1UM8A 4PPNA 2OFXA 1O6CA 3LVQE 4DJTA 4UNIA 2H6EA 2REOA 2JFVA 3MQ2A 4JBGA 4I9FA 4Y1GA 1BTOA 3LVBA 3M1LA 4LC9A 3QOYA 1T9HA 3U7QA 5CEJA 4I4CA 1E6EA 5B2FA 2C7PA 2X42A 1R27A 1QHGA 4URUR 5KVAA 1IEQA 2XGSA 4YAEA 2OQRA 3T3DA 4BLPA 1JJIA 2NU7A 5L45A 3OCCA 1KJZA 3L6BA 2UVPA 3PFNA 2EFYA 3QPCA 3BD7A 1A3CA 1WCYA 4LF6B 2B61A 3EXEA 3EXFB 1I13A 3AEQA 4F7WA 1XPUA 4YMGA 4OAPA 4DIDA 3L0ZA 1N5JA 1OX5A 1XZDA 4KN9S 5J2TA 4QLOA 4IDGA 2VH2A 2X7XA 5CGZA 5AKLA 1KK2A 4RDIA 2DKNA 4ZRMA 4W5RA 2RHRA 3G0CA 3ECSA 3IX7A 4E46A 4JYBA 1M34B 2QMEA 4E7OA 2YJGA 1T2EA 2P7HA 1D03A 1DT3A 5CB6A 4BXOB 4DY6A 4WK0B 3BHJA 1GRNA 1H94A 2A3NA 3KEGA 4KN6A 4XJXA 4BO3A 1ABEA 2PX0A 2WJPA 3JASB 3V34A 1GPH1 1XVIA 5CU7A 4JI3B 1WXQA 3R0ZA 3Q7PA 4OHXA 4L76A 3FDIA 2W22A 1G8FA 2ONKA 1XZAA 4NATA 3G02A 5E7IA 3UKJA 1ZN2A 3U4QA 1QTRA 3DVRX 2EHDA 3AIKA 4LOLA 1MORA 4JC4A 1YZNA 1BEZA 1QM5A 4GMDA 1MAVA 4HEA1 1MJ5A 1WCIA 2CHFA 3BRWA 5JJIA 1S2NA 2FEAA 4J0FA 4XLZA 3M4ZA 4LDAA 5HDQA 3FIUA 3T1NA 3CW8X 3INNA 4IH1A 2V7WA 4LXHA 4M9CA 2ZIWB 3OUTA 4FGUA 1UPUA 1EP9A 1SJ9A 1GL9B 3JAWA 4RPIA 5EQTA 4HDKA 4KB5A 1Z08A 3N0XA 3ZHUA 4I1PA 4JASB 3EPLA 4FZ5A 4U9IS 3DQQA 2F8TA 4IG9A 1FSGA 3RU2A 3RTAA 2WG2A 3K2EA 3TJMA 2BMFA 3TVTA 1BWQA 2A1TR 1PLLA 2BGWA 1N9ZA 2E5FA 3HCRA 4EA7A 1XRNA 5B3JA 2VYCA 4DUGA 1M6NA 2EARA 3EYAA 1QF9A 2RKOA 3G9XA 3ZEIA 3UPUA 5KQMA 3I73A 4H7DA 1H6DA 4IRXA 4ZI2A 5F23A 1B15A 3FWYA 1ZIDA 4UM8B 4J9VA 1Z6XA 3WG9A 2W00A 1QZ3A 1KZ9A 1XL1A 5FB3A 4A3SA 4CKCB 1ORRA 1BCSB 3ZV6A 3HTXA 4DKXA 4BRSA 4XAQA 5HWSA 2GAOA 1NN5A 3QV2A 1JG4A 4TWBA 2GOYA 3EFEA 2UUBB 1FQOA 3SSMA 4IZHA 4K6KA 1G21A 3O3MB 4WERA 2PKCA 2XYRA 3VX3A 3EMKA 5B2EA 5HR5A 1HFEL 2ZAGA 2I29A 4ZCPA 4G0ZA 1K3FA 1NURA 1U8CB 3JTEA 4AJOA 9ABPA 4GMFA 1PDOA 4M0MA 4HNUA 1GG5A 3NIBA 2OK8A 4EYKA 1KBZA 2R2GA 2EBUA 4RTSA 4HYQA 1CJSA 2BLLA 4PHHA 5IANA 2QRPA 2CD9A 3DEHA 3TOZA 1L7QA 4ND7A 3BQ9A 4KBFA 1A9RA 4W5QA 2QZZA 2FR8C 2W8ZA 2VRWA 2ZI5A 4ENQA 2NO9A 2NQ8A 4BMDA 5DBFA 1D09A 1N5IA 2M1ZA 1VE9A 3AF6A 3OZSA 1L0BA 3ESZA 1UZUA 4JELA 3SLKA 4JLDA 5CEFA 4RPKA 3JYQA 1ENOA 1UMBA 2FW0A 3TNLA 1CFZA 1AKEA 3RJ5A 1E7MA 3FY4A 3LUFA 3WHIA 4IHAA 3TLJA 5K8IA 4WFQA 3DZHA 3MAAC 3SAJA 3GLKA 2Q5CA 1D9ZA 3NG1A 3TUIC 2Q4EA 1WA5A 4MKHA 3KKQA 4FZ3A 4QUDA 4JZKA 4MHOA 5JMOA 2DFPA 1Y3HA 2EAUA 2XTAA 3AW8A 4MIYA 4A82A 2I22A 1PS9A 2FA9A 2RI6A 3B85A 2J0VA 2HRCA 2HQBA 4FPXA 1KF0A 2D0PB 3P9XA 4YALA 1JDZA 1ZD2P 3LCMA 5LZ8A 2B25A 5BUZA 2AN9A 1OH8A 1NVKA 4OSOA 1Z74A 4ZHQA 3IR6A 4ZYLA 4QOGA 4RBNA 3ADPA 5JWHA 3ILHA 1P4SA 4FIZA 1LX7A 5KJFA 4BO2A 4HLDA 1Y3CE 4XFJA 3GRPA 1BXRB 2JGMA 5I9BA 4EL0A 5IYZA 3DPSA 2UVPB 5IG2A 2WP8J 5CJ2A 2C5LA 2X6TA 3PXCX 2PT9A 3K35A 2VWGA 2C00A 4I55A 4MSUA 4QWMA 1Y33E 1W76A 3OIDA 1QPZA 4Q47A 2Q8PA 2ZATA 4ZV7A 3WLRA 3PI7A 1QYVA 3PFWO 4JLOA 1AKRA 4DNOA 1ZGGA 1OFVA 2Z3ZA 3L0CA 2YZNA 2P2DA 2EIXA 4JUIA 5TX7A 3C8UA 3OQMA 1SBNE 4DYDA 1DSSG 1RTKA 3QVWA 3PHLA 1LSUA 3JQAD 4AMZA 1P0PA 3K16A 4E09A 1CUIA 5JNTA 2CLHB 3EFHA 1BVRA 3NANA 4EW3A 4X0EA 2Z8ZA 3KOUA 5EFOA 2B2CA 1FDRA 5DHUA 5U1PA 5ADWA 3NAZA 4Z1MA 2LVBA 2YJ4A 5IBRA 1TQ2A 3PC8A 2FU5C 1WD7A 1QJ4A 3M9LA 5AW8A 3F9CA 1NPTO 1XLWA 3WA6A 1JR3A 1MNAA 3B6JA 3OPYI 4BU0A 3S6JA 1DDIA 2GZMA 1Y7LA 4WY2A 1Y4AE 4Q7JB 1HRKA 4UXHA 1ZUHA 3HUEA 2R48A 3N7AA 4Z2YA 3O92A 3RROA 1VMEA 4BBPA 4X92A 1HM5A 1ZJWA 5DGDA 1MC1A 2FSVC 5E3IA 2BHNA 2Q62A 4XE5A 1JDVA 4M0LA 3X44A 2AR0A 1IOZA 5LR6A 2RHBA 4A0FA 3TTXA 3QOFA 3IAM1 4C4YA 3AUFA 3C45A 1LVHA 3LVFO 4KJZA 4JI6B 2ZYIA 5EZYB 5BMVB 4TTQA 1K9VF 1UDBA 3JQGA 4PU0A 3HPQA 2VSFA 4FVTA 3O4JA 4I8XA 1F20A 5IH3A 2D2IA 4QTYA 3I1YA 1GVNB 1RLOA 4ZRNA 5AKHA 2QYOA 5MHTA 4N8SA 1A5SB 5CP8A 1L5MA 2ZBGA 2QL5A 3H5WA 4H6PA 3WDLA 4BFZA 1GU0A 2ZIEA 2CNKA 2OG1A 3AI3A 1RWPA 1YE3A 3MUEA 3Q5DA 4MS4B 4ADSG 5IAOA 4KR2A 2W2LA 4D8XA 4WBNA 4FB5A 5LWHA 1R6UA 5K0FA 3RS7A 2ZRKA 2A0XA 2Q6KA 3I72A 3ZE9A 3HCPA 2XLCA 4LQLA 2H8GA 1M74A 3UUGA 1G4HA 1I9GA 2AH5A 5F12A 2BY4A 4QASA 5DLYA 3WJ7A 3IE1A 1U0GA 3V8QA 2UZ0A 2VF2A 5JLAA 2C7BA 2IOFA 4UHCA 1GNVA 4C3UA 1T9AA 3CLTD 5CCXA 4W9MC 4Y9RA 3AR6A 2WSIA 2QGZA 5EJFA 2R6R1 3LQKA 3IMEA 4G1EB 4QGBA 1FQWA 4BQOA 5IXJA 2JIZD 4PCLA 5EPUA 1MAHA 4KPUA 3CLUC 1AZLA 1XA0A 2VBCA 1LEHA 4RVNA 1CTQA 3A6EA 2Q5JA 5D3MB 4ZQFA 2JW5A 1GG2A 4YBRA 3LPDA 2CT8A 2V65A 1IWPB 5ESDA 1SULA 2BFDA 3G17A 4ZZIA 1E1LA 1UR5A 1LD3A 2O8DB 4NPHA 1VECA 2IUSA 2G0NA 1U7XA 1XE3A 3P9RA 1J09A 4GMGA 3LX5A 1AKNA 2OORA 2PZ8A 3TQTA 4TKVA 1MOPA 4W7SA 1BCSA 2Q07A 2ZYVX 2VEOA 5I9TA 4MUAA 4ITUA 4CMBA 2FN7A 4WA8A 5JZVA 3Q3CA 4YJKA 2RB5A 4K5QA 2BHLA 5IMBA 5I7OA 2Q99A 1QC5A 4GLLA 3VR6A 3ETLA 4BB5A 4UDOA 1RD4A 5JAIA 4Z4EA 1XDSA 1DG1G 3DXFA 2WJHA 1F8FA 1XRSB 3R6WA 2JIZA 3F7TA 4O63O 4Y1EA 2WAYA 3ANLA 4CMCA 3WZLA 2HDWA 2MYNA 4RWEA 3V2IA 3W4IA 3P0IA 4GFDA 4P7FA 4OLHA 4DR4B 1IJKA 4KYIB 4UFPA 3WRVA 2GEKA 4LRWA 5CB0A 1Q74A 3B1VA 1Z4KA 3T6KA 4A1OA 2IZZA 2YYZA 3AG5A 1T91A 3DMTA 1EQUA 2V4MA 3BKXA 4FX2A 2R7LA 4G0VA 3DZIA 4PBTA 2JEOA 3BL5A 1IY9A 4MS1A 3T95A 1Z0SA 1BJRE 2AXQA 6ADHA 1YB6A 5CVUA 5EE9A 5HUQA 3WSVA 4FBMA 4GBJA 4JMLA 1EBFA 1I6LA 3NUQA 3KE9A 2M9MA 4RXUA 5EFZA 3OLCX 1NKVA 1OQAA 1COWD 1PX0A 4B2LA 2XWSA 1Q1EA 4FR0A 2ONJA 1QE3A 3VJMA 3D6NB 1JSZA 4GM0A 3S70A 1D2CA 1TUBA 3E5MA 4HRYA 3CE6A 2GHIA 1V37A 3SIWA 3EPRA 2ZB8A 1XF9A 3ADKA 1M6HA 4D2IA 2G5GX 4B7CA 1SUAA 2BV3A 1MF7A 2EL9A 2OO5C 3FOCA 3IPAA 3JSXA 4WKGA 5CVDA 4B6EA 1PWZA 2JFGA 4YUVA 3HHEA 1ECFA 3FRIA 1HFWA 4PCUA 4ALKA 1M72A 1CYDA 1FFAA 3EMBA 4QTXA 4IJQA 4IQ0A 2CV2A 5TR9A 1TYZA 1BD4A 2B30A 3FDFA 4HAUA 2FFRA 3ZWCA 2UKDA 2DGDA 4Q37A 2V7PA 4YJ2F 3TSCA 4EX7A 4I14A 4OJMX 5BYAA 1SBQA 1PI3A 1OT5A 1VPDA 3AB8A 3QVKA 2G1UA 4HFMA 3WVNA 1RQGA 3RREA 2VL7A 1T6YA 1C8VB 4B4VA 2RHTA 2EGHA 4OUDB 4AWAA 3QFSA 3JYNA 3KXIA 4QNMA 1SBCA 1LZKA 4CUZA 3NHLA 4KAJA 1N6KA 5DNUA 2I8AA 2AEFA 4QICA 1G3IA 5HTOA 3Q88A 1Q0SA 2C78A 1U3UA 4L95C 2NPOA 4HGQA 5FKJA 1U9IA 3TRIA 3HVJA 1UH5A 3O93A 5K8UA 3A3NA 4MPJA 3IP3A 5HCIA 5FORA 2OXIA 3D7KA 1MA3A 3ZV4A 2FSFA 3IOEA 4PPFA 4CDGA 5L95A 1A9XA 4GYWA 3KWMA 4BFTA 3MHTA 2WPNA 2PMKA 1VFNA 1UDWA 5G0TA 3DZKA 3UAGA 5IBQA 3V46A 5H8WA 1KC1A 2NU6B 3A9WA 1XKTA 2W6QA 5TRTA 3U1VA 5JS2A 4TX1A 5A7FA 4PLPA 3NDJA 4M3NA 2J41A 4AKTA 4YMIA 4ZYXA 4ZVUA 2FR0A 1DT5A 3NP9A 1VPWA 3PS9A 1HSZA 1Z6PA 4GZ5A 1VA4A 4D82A 1RHKA 5K4GA 3G5TA 4DR7B 3SR0A 3KKEA 1P1HA 3F78A 1DBSA 1ST3A 4FD2A 2BFEB 4JP8A 4ZGWA 4L5IA 2V8BA 4CG0A 1PLJA 1QDEA 2VBIA 1T8WA 1TW2A 2XT6A 3ZIUA 5BQ3A 1OX4B 4BU1A 1KI6B 3EHEA 2GRAA 3L84A 2XDYA 4HO1X 1U2EA 3GLQA 4N54A 2O2HA 4KMRA 4U0JA 5DW3A 4BGIA 4DEXA 3G9ZA 2CXXA 2AG1A 4K40A 4IL5A 4MINA 5AW2A 1KI7A 1FTNA 2XIQA 4NBNA 2VQSA 4RW0A 5AVKA 3SF0A 1IZ0A 1OBOA 3E9NA 4KRYA 5COQA 3DMTC 1JHQA 3QHPA 5BXYA 1JQDA 1V5EA 3IIMA 3NOVA 4GRDA 3P9ZA 3FHLA 3EXAA 3RTDA 3C70A 5M29A 5TEVA 1EG2A 1ML4A 3CXUA 3L06A 3R3WA 2WTUA 1SUCA 2CNWA 3TINA 2HCRA 3B36A 3BWEA 2DQKA 1ZVMA 2CUTA 1JU4A 4AF7A 4BVHA 1J07A 3U60B 3BHIA 4TSRA 1XEXB 2ERYA 3FYCA 3COPA 1YGPA 2D4AA 2C1EA 1XRJA 5L6LB 2XWBF 4KXNA 1QK3A 4K9OA 3N2KB 9LDTA 5IKEA 4IZ6A 5CDHA 2VRCA 3L6CA 3W9BA 4EFLA 3STVA 3HYTA 1SXPA 4CHGA 3FAKA 1M1ZA 2Q6OA 4O2BB 1OU4A 1SU6A 1YQQA 5LQCA 2BCGY 4LGVA 8OHMA 3U4MA 2EYQA 3HKCA 1RWNA 1M7BA 2C4MA 3GLVA 3KTDA 1L5NA 3FF1A 4PFJA 2MYUA 2QVLA 3KFLA 1N2SA 2MCFA 1KKUA 2N1BA 1F3LA 4M1OA 2BWJA 3CURA 4NYIR 4RQBA 5FBVB 1U2GA 1EFAA 5JFGA 1JIQA 2JZCA 4CIAA 1GYRA 2Q3EA 4DDKA 1IXKA 5TB5A 2OXTA 4YYZA 1XZBA 2DQZA 3FDZB 3KB1A 4UBIA 4R01A 4JHLA 3RSHA 1SVWA 1YI0A 2O8NA 2OM2A 1ZI9A 3QNWA 2Q5FA 1CUYA 1E2UA 2BBTA 1ENPA 3GW8A 4L75A 1NIPA 4O2AA 2IS2A 3ONVA 2KPOA 2Q1TA 1USGA 3S40A 4AECA 5FX2A 4WZBE 4NAHA 4CDNA 2LGJA 4UD2A 1F0KA 2K7FA 1ZNQO 4WH0A 4D96A 2O3RA 3H5AA 1KMNA 1GSHA 1F2TB 1OXUA 3NC1C 4YQYA 3KTAB 3NHWA 1XKQA 4LWQA 5LQNA 4Y1RB 4L5YA 4KDFA 2HJVA 2HSJA 1P4HA 2FPLA 1WE2A 2P3SA 3FFWA 4D3YA 4NCAA 1X9IA 4K3VA 4C0SA 4K2HA 2J85A 3PLNA 5J5AA 2FX2A 2OGUA 5SY9A 4UAJA 3S1AA 2ESRA 3PICA 4E30A 1ESZA 4E70A 4WGFA 5JC1A 2ZTUA 4M1ZA 1NUHA 2ORIA 3EZ9A 5L6MB 2BGIA 4HPXB 4IEFB 3CEHA 4NECA 4RQAA 1M1YE 3F3SA 1VKZA 5AJTA 4EPRA 3IL2A 2RGCA 2XZLA 3R2JA 1TOAA 4F3RA 1Z25A 3A10A 3CONA 1ESDA 3TI7A 2CY0A 2JZOA 2JVKA 3JXEA 2X0JA 3QI2A 4XYMA 1KY2A 1E5XA 3NHJA 4BLVA 1RI1A 1UPAA 4HFJA 2DPHA 5AWFC 5SYNA 3T94A 4XX0A 1EFDN 4GI1A 3ZH2A 3T52A 1QRDA 1PS0A 1PT9A 4GWLA 3C24A 1GQ2A 5JSUA 3HN6A 3WX0A 3G59A 3IE2A 4DV7B 4V2IA 3RVDA 3BXOA 5TDHA 2AQHA 4G8JA 3FLBA 4QU5A 2Z6AA 2IYEA 3CW2A 4XUCA 4H60A 2Z83A 5ED0A 4LDJA 4I55F 1J8VA 1E94E 2PBRA 2VYQA 1UXGA 1CP3A 4P34A 4LXUA 5IDXA 4EG6A 5K20A 4I8DA 2EQ5A 2IE0A 3ZS8A 2IP1A 3DLAA 1G3RA 1E58A 3TZHA 1GUDA 1RXSA 1C3OA 1PK9A 3A06A 5DP2A 4CKWA 1UMDB 3OF5A 4FMCF 4HEJA 2RGBA 5CNMA 5JSYA 1DX6A 2O7RA 3GFRA 4N8EA 4WLFA 1E9SA 2WJIA 3OBIA 5EXPA 1AKMA 4Z3OA 2J4FA 3AHJA 4P3KA 4XLTA 1T36A 2YWXA 5G40A 4DCJA 3Q9SA 1RHRA 5JAUA 3H0KA 2KLBA 2RDMA 4XTRA 1P3Y1 2XRMA 2AOWA 3KP1A 1H23A 4YUZA 1VSVA 4R51A 1QIJA 1X92A 2VAWA 1LBTA 3GMIA 5DRYA 5B3JC 3IKJA 1HE3A 3DD5A 3TSOA 1OYWA 3IDQA 2OUKA 1Z6TA 2QTZA 2ZTLA 4M9ZA 3SXUB 4E51A 4OI0A 3INYA 1JHRA 2G4CA 1NJ6A 3LUCA 2OBYA 3UA4A 3ZI4A 4NZPA 2AEJA 1TT5A 2WJAA 3VNUA 4GP6A 2P5YA 2ZYDA 4HN4B 1KS9A 2FXVA 2EIHA 5F2OA 1FXWF 4E31A 1VCHA 2C20A 4D98A 5C32A 1RPNA 1L4BA 2LCFA 2QJTA 3MLAA 4DLSA 2I1LA 2BELA 2ZVPX 1UDRA 2XVAA 4WMLA 5DHFA 5LOVB 2BHSA 4DEVA 1VJ0A 2ZEJA 2V6JA 1ID8A 1SK9A 3ZIDA 1SKMA 1EX6A 3KZCA 1QU3A 2P7IA 3HU1A 2C2WA 1JIVA 2OILA 5IVIA 2PUVA 4DLXA 3LX8A 1J23A 3WYCA 3OEED 5BSKA 2EQBA 3HBLA 4B3CA 3EXHA 3F6CA 4X1YB 3MG9A 5DHTA 4ZI7B 1U0HC 1XVAA 2QU8A 4YT5A 2Z6UA 2CSXA 4UAUA 3QEMB 1G21E 4KUHA 4J6FA 2P9HA 4O2BA 4R1LA 3UUWA 3R20A 3WNQA 2R8XA 1RRGA 3R4CA 2AR9A 2PL5A 4DNQA 4QOIA 4JIGA 3TZQA 1NVAA 3K4QA 1KWGA 2CXSA 2WAAA 2ZS9A 3UH0A 1H9BA 2Q7OE 1E2PA 1H1LA 1VXOA 2I8LA 3DBIA 4XOIA 4Y8VA 4YCAA 4J0DA 2F4VB 3PTLA 1T6XA 4HQ0A 3C8DA 2RGRA 2E89A 3A1TA 3OZTA 1O4WA 3UQYS 3M6UA 3LFTA 1HDIA 3OZIA 5H16A 3LUDA 2ILTA 1P2DA 2PKXA 4QGHA 1RIIA 1DEXA 3PUZA 2FKNA 4RXTA 1R0CA 4UDNA 4UHBA 3DT9A 5G02A 3VR1A 3AEZA 3CEJA 4DUPA 5DI3B 1Y6GA 2BFWA 1JLHA 2VZ8A 1U81A 1KVRA 3FNIA 3V7UA 3E5NA 2JHCA 4DRXB 3BQMB 1CZLA 1U3VA 1JQLB 4KSBA 3LL4A 5IVHA 4WZBA 1RKVA 5JZOA 2FUEA 1BKYA 1Z7YA 4QQ8A 5CJJA 4F1WA 1UPXA 1X1QA 1IH8A 1C4WA 3H1BA 1NUUA 3MXOA 5CYGA 1KORA 4NZOA 1I14A 2W6NA 5I3CA 4JUAA 1LB1B 2R6GA 4W63A 121PA 2Z8YA 1SHZA 1IY8A 4QO8A 5H83A 2D00A 5NLLA 5JECA 3H13A 5JANA 3O1IC 1C3OB 4PQFA 5IVDA 4Y6PA 4IAOA 1L7BA 4D41A 1Q1NA 5KTPA 3VR4A 1YHYA 4II7A 1IK6A 4RHFA 5KYXA 2FWPA 2RK6A 5JCJA 4K88A 2QG9A 4M8LA 3KALA 4LI0A 5ED4A 4FEAA 4DCPA 2P79A 2ZIUB 2PT7A 3E61A 5CLIA 5IFKA 4AS1A 4W8HA 3FUVA 4AS2A 5KOHA 4D5GA 2OB2A 1E1QD 3PDUA 3PWZA 1WSBA 4A8PA 5A71A 4D0LB 3LYLA 1VL5A 5TJHA 1K6EA 1PFVA 4UEJA 1C2YA 2AQIA 3P9QA 4OMCA 4RTNA 1OI2A 2WU3A 5EOVA 3KVRA 3W5VA 3ZZMA 2NTEA 1KKMA 3NBXX 5KTSA 1XC7A 5JR3A 2DETA 3M70A 1WZUA 1TIBA 2FJ0A 1XRPA 4TLDA 1OI4A 4Y2PA 5GM1A 3M5CA 3WLQA 4C14A 5AJZA 3B5EA 4CQLA 4GGPA 2Q27A 1IZ7A 1Z0AA 2ZJ2A 2RKWA 2JLBA 5DNAA 4B81A 2XMCA 4TVKA 2PZFA 4HZUA 5KHLB 1EBBA 3GIDA 1IRIA 1PNTA 3IAS1 1W85B 1KPHA 1GKLA 3KJZA 1JKFA 1V4BA 2CFIA 5EVJA 3EDCA 4M1WA 2ZB7A 2HUNA 2Y0BA 4EB0A 4S1VA 1OLUA 1YQTA 3B9QA 1CDOA 5TQ0A 3BT7A 3KFXA 1KAOA 4KUGA 4O3MA 5EKDA 1N2EA 3L46A 4M55A 3L7BA 4MWGA 2V9CA 3EMVA 5E3HA 5LUBA 1H93A 3VHXA 4HNTA 3WRYA 2ZJYA 4CLEA 3HDVA 1X3LA 1BW9A 1SVMA 3WQHA 4MQUA 3WYAA 4E5DA 2X1VA 2Y1OA 3NBYC 1SNYA 2DHEA 1WBDA 5D5HA 4CL2A 3M82A 1D4AA 2PDAA 3WZ2A 5JJLA 3V97A 2RG1A 4A0QA 1OC4A 3SJAA 1E1RA 4D74A 1P2TA 2XD4A 1KE1A 1OH5A 4IM7A 1INLA 2Y1LA 3MJSA 4I50F 1J0AA 4AM8A 5EPOA 1CY6A 1I7SB 5CFQA 3HDYA 4JODA 3Q7RA 3UW3A 4J1SA 5HW0A 3ZNOA 5KPDA 3UCFA 2CF6A 1FFSA 2ECKA 3GFVA 1RJEA 2I62A 2PJDA 3MPOA 4TLAA 3SC2B 3DZCA 4D8UA 3D8RA 2VNSA 3HR8A 4N7JA 4RABA 1HDOA 2Q4RA 1GDDA 1W5TA 2NACA 1XP5A 2YUTA 3GJXC 3HYCA 4G8DA 4ZOCA 7AT1A 3TKLA 4J7AA 3KO8A 3WLPA 1ZCZA 1I7PA 3QJYA 2O5CA 3K0CA 3A4VA 2A5LA 1ZM9A 1SOWA 2GAFA 3GA5A 3OFSA 2XXAB 1YJ5A 2F62A 2NZWA 4NWIA 2C7GA 3HDHA 2F6RA 1OOEA 2WJ4A 3U31A 4PSAA 1NOJA 4U2FA 4HXYA 3WLEA 3M9XA 1KDYA 2QOEA 3ZI7A 4AXBA 1W59A 3O4VA 4PNEA 4Z4FA 3OJFA 5BURA 1KR5A 3NM4A 1L5VA 4HWKA 3PCTA 1HEUA 1E3LA 3OTGA 4FMDF 1IG0A 4IIXA 3FLEA 1X74A 1CEEA 3MRSA 4YCCA 3EIWA 4PYNA 2REXB 4UDYX 1EB9A 4GF5A 1BQ3A 2C2BA 2LPMA 2GDJA 1E3SA 2QAJA 5IZCA 3O94A 1Y7PA 2RBGA 4W9NA 3H6KA 3RVSA 1XP8A 5JSHA 3ZVNA 3VX4A 1C7RA 1XDGA 1YS9A 5B55A 1YJCA 4B76A 1ZQ1A 1PCXA 4GI7A 1ODIA 4MYDA 3A9UA 3GDWA 3MUOA 3NCTA 3VYWA 4N7BA 4LYAA 1T5BA 2Z95A 4F2WA 1QH1A 3OCXA 5CRIA 1KQPA 2RIRA 3LPNA 1FSPA 1G7TA 3H5VA 3IOCA 2OO3A 2ZIZA 4QSHA 3RUIA 5KQSA 1XG5A 4CG3A 4HCJA 5A3QA 3KSRA 1FFBA 4PPYA 5LD2B 2GBPA 2UVQA 4UZFA 3D0OA 3HWRA 5ILOA 4WLUA 1UKEA 3HVRA 8ADHA 3ADOA 3AM5A 3CF0A 4X93A 4XVQA 3R7WA 2CYAA 4EEZA 1P1JA 3ZHZA 4RTKA 3EQ7A 5D5QA 3EZLA 2N0SA 8LDHA 4XASA 3EWSA 3KQWA 5M34A 3IALA 1NSFA 1VIAA 4QC2A 1A5AB 2HSWA 1J2JA 3DOOA 4GWKA 4ND5A 5BUCA 1AF4A 4ARVA 4L4SA 2KLHA 1W44A 3QJ5A 1PVVA 4LAFA 2A7XA 2MSWA 1GJRA 1STOA 3A1EA 3E8MA 4ZTZB 5LXTB 2IXBA 4Q93A 3T3IA 5DCUA 1KK3A 3SF8B 4TWJA 2GD2A 1NMZA 3F97A 4GW3A 1U7OA 3L1KA 4P35A 3AF0A 5F7ZA 5KNBD 4IJ6A 5EJAA 2JAUA 3FR7A 4AZ3B 3FYHA 3SYKA 3ZZ0A 2VJYA 2YQ5A 4EGCB 3WRYC 2LD4A 2H1IA 3BMXA 3LIIA 1UCFA 5AI0A 4DR1B 1XTSA 1M2GA 4G9EA 4NEGA 3H0CA 2XZTA 3QK7A 3T0GA 1IN7A 1RJ9A 1L4UA 3WGTA 3ZDBA 3BEOA 3ROQA 3MJHA 1Y82A 2CJFA 2W90A 3L4SO 2Y2VA 5FD8A 4BO7A 4QU9A 4K05A 3ZYCA 4HN2A 3KIPA 1DC8A 1OX6A 2F1OA 1Z4MA 3BMQB 3I0ZA 1I4EB 4FMBB 4J0EA 3CNOA 3RH0A 3U9SA 4BVJA 4ECAA 3E3MA 1WZIA 1G9XA 1EZ4A 1I4TD 3K1YA 3FZYA 1LPSA 3LL7A 4R9VA 4P32A 1U9CA 3ENVA 4IYJA 3G2QA 4L4UA 4DC0A 1DBIA 5FV4A 2DUJA 5FTJA 2GM4A 3EISA 3GMSA 1D4FA 2PEYA 1W4BA 5DCLA 1IM8A 2FCAA 3AU8A 1UZAA 1MO2A 3GELA 5CXSA 5E0OA 3OZDA 5KAMA 3JWGA 3WYFA 2X3UA 4UMEA 4MV5A 1YC5A 5HHTA 2X1LA 3TLCA 3KWLA 5BN5A 4G8CA 2AVNA 2VJMA 1Z0UA 2X4LA 4OQ4A 3IDFA 3CINA 1LFAA 1WXIA 2CLMB 3AESB 4IIBA 4U5XA 3C85A 2FEPA 1H8ED 2YHSA 5D84A 4RPJA 3OMLA 1E3TA 4YCSA 1W46A 4U8GA 1KWKA 4X1IA 1HRDA 2JB9A 2C2OA 3SBEA 4PCVA 4DJFC 1DDOA 4F9TA 1QQTA 1GPUA 2BOVA 2B4YA 2XOXA 3C39A 4PAQA 3MRVA 2GTIA 1IONA 4OG2A 1I9CA 1QYCA 2E0IA 1JLLB 3NHBA 3B1YA 5AOVA 1E1YA 1OW3B 4ZVSA 5FUMA 2G28A 4KMOA 3JALB 1KYYA 2QDKA 4L57A 5JSKA 1XALA 4ZCRA 4EW2A 1J25A 4JT8A 4M60A 4AG3A 2VKTA 2IT1A 4CM5A 1IU9A 4EO9A 4RTPA 1PG0A 4N5LA 4OJYA 3SWWA 3DEJA 4RFLA 3UK6A 2J32A 5KTTA 3S1AB 3SJUA 4YHBA 4QXOA 3KLPX 5BNZA 1EFRD 1TCAA 1BU5A 1VJTA 1WUKS 4EARA 2FUNB 1DRVA 1PEKE 1XLVA 2WV9A 1CEQA 1G8PA 1Y5IA 3LDHA 5ALQA 3X1ZA 1IQ0A 4FT2A 2C2MA 2Y67A 3BUSA 4LQCA 5AW9A 3ZXIA 1WEKA 1QV9A 1HLDA 1PTKA 3EC1A 4Y9DA 3SSOA 4EG1A 3ND6A 1IVSA 2DR2A 2XCOA 3ZY5A 1UPBA 1XDWA 2FUCA 5LMNB 3T1YB 1ZONA 2CFCA 4TYWA 2CNOA 1EM6A 2QDXA 2YWFA 1OXBB 4K0RA 5AKYA 1D2AA 3CX4A 5BP7A 5J4YA 5LLTA 5F9HA 1USUA 1QIGA 2NVUA 3GCWA 3U3KA 1WIWA 1Y6ZA 3GFTA 1WF6A 5AJYA 1UWKA 2A33A 4MW7A 3I9V6 3L6UA 5C80A 3A37A 4HVLA 1CQJB 2SCUB 1DWUA 3RI3A 4H0NA 5J4VA 1U0OC 1L8AA 2I2CA 4O1MA 4TL7A 4PFQA 3QFRA 4QVKA 2KHZA 4MW0A 1QKIA 5T4BA 3DUFA 1NUQA 4WXEA 3OI7A 4QUBA 4EJ6A 2ZJ6A 1MQ9A 2AXNA 2P0YA 1GCOA 4RV4A 3AP2A 4NCNA 2X4IA 2DE0X 3I09A 2OO5A 2OSBA 4RAOA 2B82A 3KQUA 3K92A 1BGXT 4UU0A 4YRLA 1EWQA 1QVVA 1QTNA 2MMCA 3OOJA 5KQGA 3QFHA 2J3QA 1B76A 2YUIA 1H0KA 1V1JA 3N0RA 3KCNA 4ILKA 2OKGA 4Y0AA 2J08A 3U1TA 1SVNA 1WKBA 4NHEA 1PFGA 4ZDKA 4WKNA 1S2GA 1Y98A 3RJTA 3V1MA 1EE9A 1I1OA 2ZBDA 3QFFA 4HY3A 4MWEA 1ZHFA 4BAUA 3D4NA 5LZ9A 4ZHQF 4AQYB 4AJ4A 2AOXA 3CB2A 5H4GA 2CVZA 5EWLA 5HPYB 5LDDC 3U3JA 4QOJA 4QEZA 1V35A 3ICCA 1CB0A 5AUOB 3UFXB 1IEXA 1TUIA 3O2SB 4I7EA 1IWBB 1ARZA 1F2VA 4QRDA 3WYNA 4AY2A 1OZHA 1QRUA 1NX6A 5BQ5A 1WDTA 2ERCA 4R1MA 2J4DA 4WFKA 2XI4A 1E0SA 4ZKDA 5A03A 2QRZA 3LM8A 3D64A 4OJKA 4QJIA 1OZAA 3QSGA 1Q3HA 3H2KA 3EPKA 5TSDA 1U1IA 3VOSA 5DTMA 3Q7EA 2DH6A 4UZEA 4OQYA 4D0SA 4W5OA 1WQ3A 1C9DB 2JK0A 1NVBA 4QTZA 4EFNA 5IWAB 4RD4A 3TRHA 4QBTA 1XMIA 1QO9A 1JLLA 2G1JA 3OVMA 4NE2A 1ABFA 3ZK9A 1PQPA 4BMZA 2KE5A 4M1EA 1LRLA 1MZVA 1VJ5A 4MGKR 4P3XA 1O0BA 2EJTA 3N8GA 1UPTA 3QEMA 3VSCA 4GKBA 1E4VA 1I30A 1LSOA 3CTMA 3DBRB 3ICVA 3AM1A 1EESA 4KV7A 3PFFA 4AQ7A 2VAPA 4W8GA 3K4PA 4XGKA 2QVBA 4OHKA 3EFOB 4YACA 1EP3B 3HDGA 1JR2A 4AX8A 4KQ1A 2GJ9A 3NRJA 1VB3A 4N6NA 1QGUA 1XRLA 2EC5A 4FS8A 4EAAA 3DLCA 4JQOA 3V4SA 2DM6A 4A26A 1TT7A 1NFQA 1VMAA 1KFKB 2A7QA 2XLBA 4G07A 3T3GA 2NADA 5BPFA 4PRZA 3MTAA 5AKIA 2YXDA 4YRRA 2J9GA 4KOAA 1PYOA 1OBVA 3DEIA 2FPOA 5L3ZA 5BSGA 1RLUA 1RBYA 1YJ8A 4MVWA 4RK7A 3TAUA 4JNCA 1MO4A 5DYYA 4P3YA 1XD2B 4TM8A 4DMKA 3MXTA 2YKGA 1Y6RA 3LKVA 2V58A 4GGMX 1VLVA 3VZSA 3ZWOA 4DW8A 4GC5A 2Q4OA 4YCBA 1XQYA 2W4IA 3L6OO 5ECDA 1NV8A 4EUNA 1N6RA 4H7KA 4LJ9A 1BDHA 5IK2D 2QLJA 3R7NA 3VI3B 4NV3A 4NDNE 2V6IA 5I01A 4C0JA 4TL6A 3AEQB 4NQRA 3CNBA 3DDHA 2BRUC 2CJWB 4WNCA 4UE6A 5B53A 3ZYZA 3K72B 1RSZA 1WHTB 3RWOA 3TB4A 1NL3A 3RK4A 2OR3A 3M6WA 4MYCA 5ALTA 2BPOA 1P91A 2AR7A 2C0QA 3U17A 3U7IA 3H4IA 5CFNA 3ESAA 4MCAA 2NU8B 1ONSA 2B34A 2ACVA 4HAZA 3RABA 4CI0B 5IJ0A 5KTMA 3MERA 1XI2A 3AR8A 1Z16A 3DAFA 3AOEC 1EHIA 4U2KA 1IMOA 2FVYA 2RGNC 2IWRA 2PM8A 5LP1A 2H1CA 1MRNA 2CDNA 2A4KA 1D2GA 1H6BA 1POXA 1Z8HA 2MSLA 2YJZA 1DO8A 1KDPA 2H1RA 3AIMA 3CUKA 1R0YA 1XUOA 3GEPA 4F5YA 5BWCA 4NU5A 3PEUA 4YRFA 4OX9Y 1MPXA 1QGED 5T67A 5AHXA 4ARSA 4BJHB 4H35A 3KQHA 1YZHA 4UTOA 1QKJA 2OWDA 3AZPA 3JR3A 3ZCSA 3SSNA 2XUGA 1MN6A 5BW4A 3LPAA 2LKCA 5A4IS 1RZRD 3ABOB 3PQFA 3D43A 4MVCA 3B3AA 3H18A 4BVLA 1IMJA 4EMBA 1JMVA 2XYHA 3B70A 2CNNA 2XD9A 3BL6A 4KIJA 4DA8A 3QOXA 3NRBA 3RODA 1R8YA 4DCVA 2VR1A 2UYHA 1T2VA 3VSBA 1T0IA 5HM8A 5U9CA 4ERNA 1GZ4A 3ZKAA 3S1LA 2E4UA 2W37A 3I01M 2QM0A 4NFSA 3GLHB 5ALGA 3HUFA 5FL3A 5LB2A 4D26A 2BHTA 4FFPA 3REQA 5MFZA 1ZHOA 1M2VA 2GCNA 4U2EA 1WU8A 5H68A 3PRKE 1G4AE 3QFCA 4JGBA 4US1R 4W1PA 4TYQA 3FR8A 3JWHA 3CUSA 5FBZA 1NZFA 2OCLA 2QPTA 2WJVA 1NUPA 4BNNA 5EE1A 2QUHA 4NBSA 4OX9B 5G0VA 1B0UA 4CUKA 3RANA 3ADBA 1M5TA 1SUSA 4DBLE 3PBKA 2RI0A 1AGNA 3G79A 4RM3A 5FXMA 3T9BA 1KVQA 1HPLA 1J9EA 1P5HA 1QIFA 3NHZA 4N0QA 4L07A 4F4HA 1FXWA 3KQMA 1L5WA 2P11A 3UV7A 1SOAA 4IQGA 4RHTA 1DX9A 3QPBA 3TQFA 2HGZA 4JKIA 4DUZB 5LQAA 1ISFA 4PZZA 1ORWA 1FLDA 2Z6VA 3V1YA 4ZYZA 2O3JA 4NZYA 1K7YA 1ZQ9A 1T4CB 1IFXA 3BB1A 3ICPA 4QIHA 5DHPA 4P2GA 1OJ7A 4BQNA 4LNUA 4MB6A 3RM3A 1IZYA 4AN1A 2JLVA 2ZWMA 3L5KA 1JFSA 2RGWA 2BGMA 2I4MA 4B45A 4OGKA 5GY7A 4BWVA 4M0KA 2PWZA 2XW6A 2G70A 2HIMA 1TEVA 2GAJA 2JA2A 3I6IA 4HX9A 3BTVA 4YJ2A 4NV1A 1PR0A 1TJ4A 2V7VA 1RYHA 1NGSA 4HDSB 4KGXA 3BD6A 4L0CA 5HDBB 4MV9A 2BT4A 2C83A 3MCWA 3DBRA 4RV9A 4DREA 2UU9B 3FFBA 1GU7A 1KQNA 4KFCA 4Q4AB 4ARCA 1JRLA 3COVA 1NZDA 4BKUA 3U44A 4YASA 4ZEWA 2JCYA 2XE7A 5EJ2A 1RWWA 4YAKA 1L5FA 4C03A 2R85A 1EJ6A 3NOOA 3ZTYA 3WLHA 1FP4A 1SA0B 4B6FA 1RQPA 4PYQA 3CR8A 4U3JB 2BFEA 1XNGA 4X64B 2BBWA 2GUGA 1SXGA 4Z9XA 1VMIA 4NP6A 3NGXA 4WX2B 4BFCA 2VA8A 1VYHA 1J06A 2V6GA 3T0IA 1QGDA 2ATXA 1EDBA 1V95A 4NABA 1TL7C 2VP4A 3PNOA 3EZGA 5K5EA 5DP1A 1K75A 3FUUA 1SQFA 5I5GA 2Z1MA 4ON9A 5FPSA 4CEHB 2HDNB 4H18A 3TSZA 4TN5A 2POCA 3LT1A 1K06A 2IH4A 2F1RA 2AUNA 1DJNA 1DZIA 4CLOA 3W3ZB 2B5OA 1T13A 3IPLA 2CVOA 1DQNA 2NZYA 2B21A 2ZFUA 1LQTA 4CRWB 1HQCA 1N8SA 1GFWA 2PRKA 3R74A 3VKHA 5L9AA 1B16A 5CURA 3WQBA 1RXCA 4H4DA 4JI5B 2KW5A 4X84A 2BAGA 5I47A 1C0EA 2X8AA 4PC7A 4DBLC 2ZIXA 3FPLA 2PUBA 2PZKA 1GZ3A 5DCWA 5FA8A 2WUFA 2YYAA 3NWEA 4KQXA 2H54A 3H1PA 2JBAB 4TVSA 3NLLA 1NV9A 8ATCA 4UEQA 3UCXA 2V9ZA 4XSVA 3AB3A 2YW9A 1HT0A 1DPFA 3FA2A 2J45A 3QKSB 1EVLA 4JOBA 5DMXA 3CJRA 3INRA 5L3RA 3G5MA 1KI9A 4US2R 2AOTA 4JVMA 2CLLB 2RONA 4XGRA 1X9HA 2Y68A 2DUWA 1XU9A 2IYXA 3B48A 3CNHA 4URZR 2C61A 1U0SY 1C30A 2CLSA 3N58A 4H7EA 4HUQA 4JBNA 1CULC 4XI9A 2ZRJA 3TJZA 1RXWA 5C18A 4RVGA 1C8KA 1GRCA 4ID3A 5TARA 4XVUA 3Q6NA 1V26A 3L8GA 1H3EA 5CK5A 4JROA 1N2OA 1J2TA 1DQZA 3EEOA 2BGUA 3AETB 2R60A 2WWRA 1ZA2A 3HWX1 1ZISA 3PA8A 1ESNA 4BNUA 4O8CA 4CODB 4TM7A 3ECAA 1U7DA 3OZCA 1DAEA 4OAOA 1LPOA 1N0VC 3W5UA 4F2GA 4XSHA 4AIRA 2X0DA 4FLFA 3GVIA 4C0XA 4Q3EA 3U9TA 2ZROA 3L0DA 1VOTA 4R2HA 1NDQA 1A88A 1YQDA 3DWEX 3KSZO 2IZ6A 3NW9A 4YMSA 1Z4IA 3NASA 4X66B 2WICA 5CW2A 2P9EA 1FFXB 2H4ZA 2J48A 1JSRA 3CZRA 4FZJA 4JIMA 1YAJA 3FPSA 4CKEA 4UDXX 4TS4A 2AF4C 1DPGA 2VZLA 1DXHA 3QXSA 1UF9A 4W9NC 1U2SA 5AIAA 5JXWA 2IS1A 2XE6A 3LF2A 2W4QA 2HCJB 3OUUA 2TS1A 3HB9A 1KMQA 1Y8AA 1ZESA 3H3FA 3O91A 4JBLA 4UFOA 221PA 2Y0PA 4LNHA 2ZIVB 4BNTA 5A62A 1JYEA 5HZGA 4DANA 3DZJA 4TKLA 3TQHA 2JAWA 1HLPA 1R3DA 2UZIR 3HB7A 4CR8A 2HLHA 4AKIA 4MRAA 4BVKA 3GGDA 2QP3A 1V47A 3D3EA 1WB6A 1EE2A 4LHYA 2ID8A 3IRVA 3M3PA 1DAPA 2PANA 1XAIA 3FIJA 2G3YA 1T6BY 1MTOA 3E9DA 1YRBA 5IP5A 1U0FA 1SU4A 1ZOOA 4MR9A 1Y80A 4YROA 4ZO8A 4MTCA 3EX7C 1YVPA 1SCDA 3D31A 3AJ8A 2CWWA 2Y3IA 1DTWA 2DBZA 2BISA 1NPYA 2BSXA 2C5SA 2F3QA 1BC5A 2II6A 1W19A 4FWBA 2XMZA 3C3AA 3ET5A 1Z8FA 2ZETA 5HBRA 2VYVD 4E08A 2WNSA 5KTKA 1G98A 2IA5A 2ZSHA 2ZITA 3I2GA 3AJ9A 3EG5A 1IJBA 2R96A 2J5XA 4OA5A 2WKQA 4IHJB 4BP1A 3JQ8A 5BOSA 2ONZA 4H0FA 4RLQA 2CMDA 2ID9A 4ND3A 3U4QB 2VPIA 2XKAA 4DC1A 2XQVA 5DHQA 4FKMA 1KJJA 4TPKA 1RLTA 4Q01A 4ER0A 2ZU6A 3KOYA 1G5TA 2D8MA 1E5LA 1GT6A 1JPVA 4KVGA 3KSMA 4EX6A 2LUOA 2O3UA 3E4CA 3QKTA 2I76A 1X7HA 2QT1A 5JSZB 2VC2B 4NIMA 4OMFG 4C0BA 4C7VA 3HJBA 1I5OA 1N2BA 2FSHA 3KT6A 1VLHA 1DXQA 4IDOA 1O3YA 3R9KA 3ZQUA 3P4XA 3HYLA 1ZN9A 3K5PA 5DKFA 5GONF 4B34A 2DFTA 3K70B 4UM5A 1UADA 3K8ZA 2IV7A 4HQNA 2A0UA 2FDCA 3DMNA 3KPYA 2QN1A 3RSOA 3FCCA 4GH5A 3IODA 4OLFA 1AB6A 1W49A 2X2FA 5KQPA 3VDRA 3SQWA 3KJFA 4CXMA 1GXSB 2Y6VA 4AZ0A 3TQIA 4MS3A 4WLEA 5CH5A 4JQYA 5HBGA 3ERCA 3ZV5A 4L8LA 4A2CA 1CUSA 4V0RA 2XWPA 4C6RA 4DJEC 3JWPA 5CG2A 4CKCA 1CUWA 3VH3A 3AV0B 1JV2B 1IEWA 1NF9A 1V8OA 2IPXA 3MBOA 1BN6A 1T3LA 2PSFA 1UBJS 2F3UA 4TL8A 1CHDA 2HFJA 3TAXA 3G82C 2ONCA 5TQ2A 3P0FA 2MMGA 1EQAA 2XGOA 4Y2UA 3SIXA 4U3JA 2G4LA 3ZOKA 5CFZA 4PYOA 3PK0A 2P5UA 3DL4A 4XIGS 1BJKA 1ZC4A 2Y0DA 4DA6A 1UXKA 1WKVA 4PO3X 3D8BA 1C9NA 1C7QA 3I37X 4FKBA 3TE6A 3MMPA 1P0QA 4R83A 1V5GA 5EERA 4MGHA 1IULA 2DCUA 3W8FA 5EJEA 1EEXB 3QXXA 3I23A 3MM4A 1Q84A 2IPOA 2J9XB 1WUJS 1NJSA 4Q3NA 2O7QA 1D04A 3LHFA 4L9AA 1AHNA 5DM4A 5KOIA 1NI4B 3DLTA 4FCWA 1AB5A 4FGJA 1H5QA 1AQLA 3R44A 1JIKA 4JYMA 4QJ4A 3FMPB 5GIPE 1VRWA 4K9KA 3PXBA 5KOYA 2V55B 2VUHB 3IQGX 3SOPA 5REQA 4D25A 4HTFB 1BMQA 4WESA 5F52A 1OC2A 1O94C 1VE3A 1Z4PX 2JFBA 4EHHA 5C81A 3TECE 3LS2A 2CXQA 1CY4A 2FVXA 5DXJA 3AUXA 4P4UA 1RP1A 1O87A 1WXFA 3C4JA 2BE9A 4CN8A 1SEVA 2N46A 3T5PA 2B9EA 1X86B 1RAAA 1K86A 4ENUA 1EUQA 3D5EA 4ZVTA 3QWIA 2EFGA 1MX3A 3GCDA 4ARAA 3KEQA 4P92A 4UUPA 4C4ZA 4RZIA 4AMGA 1RQ2A 3O9VA 3FGZA 4XQCA 3MBIA 1EE1A 4CG1A 1X2BA 1CS0A 2J6BA 4OVKA 5BQXA 1I7LA 5EQDA 3AEYA 3PQ3A 1LRJA 4I1UA 1WW3A 4I1YA 1TRHA 3IS3A 1CDDA 1O5TA 2ZCUA 1HFKA 1VE1A 2H7YA 4RDXA 1S2IA 2IEBA 4EMUA 4YXWD 1JPJA 4ABYA 1CF9A 3OIYA 3S81A 1YONA 2A5YB 4UHHA 1CJVC 4E0BA 3EXEB 2XSZD 3FUWA 3VGPA 1QCYA 4G84A 1E1CB 2I99A 4ISCA 3WGUA 5LYJB 3A1SA 4BP3A 4I1VA 1Y5MA 1GV1A 1I6MA 4AI6A 2VPZA 3H5OA 4FZVA 5A7HA 1G60A 1HFJA 3PDCA 4JJAA 4EVSA 5JSQA 1C81A 4FGWA 4X9XA 2W2PA 1PZGA 2CUNA 4B7UA 2PGJA 4QBGB 2GYYA 3M6XA 3QPVA 2FPRA 1GA1A 1CWUA 2Q9CA 3ANMA 4OHMA 5EUBA 2JCBA 1L8XA 1HDXA 2WAOA 4P86A 2Q3BA 3R23A 3U7FB 4DCMA 3T3OA 3LQ1A 3HB1A 3WWCA 4LE2A 4Z8XA 3IAFA 3SM3A 1JJAA 2AZDA 4C29A 2JFPA 1JHDA 3KJGA 3V4PB 4YDQA 5MFPA 1LLCA 5K4HA 4N48A 1RHUA 2H9AA 1GUZA 1YK1A 4PX5A 3T7EA 4B3MB 4YXWA 1WCWA 4FBLA 3E70C 4INOA 3LHDA 4B80A 4DWOA 3W04A 4NCBA 3ASZA 1JWLA 2O48X 3P4UA 2IUFA 1PZHA 3F2IA 1P2SA 4HZUB 3VMMA 2PXCA 3TE7A 5DGHA 3OLXA 4P3NA 2WOOA 5IABA 3A2NA 2D62A 1FYXA 2A14A 5K8LA 3NDBB 5IHPA 3EGOA 1F9AA 4J43A 1CZUA 3MF4A 5FTLA 2ZSDA 5HM6A 4V1CB 1K8XB 3EQ8A 4TLMB 4B6QA 4B3HA 3LRPA 2O0HA 2X3YA 4R3UC 3GFFA 2VXBA 1T5LA 2IPAB 3DNMA 2HZBA 2IUEA 3HYRA 3PNLA 4FFRA 2X14A 4J2OA 1LTHR 4NMHA 4BCBA 4BTEA 1S8NA 5IMSA 2UUAB 1Z29A 4Z49A 2OC4A 3ZIAD 2FG7C 1DKLA 2ZAIA 2MSDB 3H9UA 1PUJA 1XZNA 4JUBA 4LTNA 4XIFA 4KPYA 2DFVA 1OE0A 1T2AA 4UCXA 4WSOA 3W9YA 3C3YA 2XEXA 4HBZA 3OLZA 4WFJA 1A9OA 2WUVA 3C3KA 4GRIA 4W1RA 4RYLA 4MUKA 5HKKA 4BLTA 3SXJA 1FTYA 1T1RA 1VL0A 4KMSA 2VCYA 4XR9A 5KREA 4M1YA 2O2EA 5I9NA 1AKYA 2PWPA 3T3MB 3GJ3A 4IZOA 1P17A 5A6SA 1N0HA 4PAGA 2C7RA 1T24A 2PH3A 3E23A 2XVXA 4ZTUB 5JMPA 2D7CA 3OMWA 1W48A 3VJLA 3ZDCA 2PUHA 2H29A 3PNQA 3WKDA 3RUPA 4D9FA 4IIGA 2PGNA 5DVZA 3CVOA 4RNDB 4ENWA 5H7XA 1GPMA 1ZOIA 1UOQA 1SQ6A 3C0KA 2RGXA 4JYCA 4QDUA 4X60A 3UUFA 2AS0A 3VTKA 1O95C 1TQ8A 4HGRA 3DC2A 1Q1GA 5ILGA 5AKEA 4KRXA 1X0XA 3F8TA 4GXQA 5BN3B 3WV4A 3T9CA 1WXHA 1LW7A 2NNLD 4K1LA 4X7RA 2G08A 3RUEA 4AJ2A 2HL6A 2R84A 3JVDA 4M1QA 4TS3A 5AH0A 4LF9B 1QU2A 4PYJA 4B33A 5EEGA 2XUDA 2D1FA 2PG3A 2X5OA 3SQOA 1NE7A 4W7IA 3TXYA 4RHUA 1AXGA 1S7GA 2VZ0A 1O95D 2XUIA 2NYAA 2XNSA 4YUXA 5EE0A 1JXOA 4ANFA 3FYUB 1IJFA 3TTSA 3C6YA 1V0JA 1LA2A 1X8LA 2ALJA 3E7WA 4D9JA 2GPYA 1X80A 3O3NB 2OZEA 2IY7A 1PZEA 3G0DA 4K8RB 4KIWA 4Q3CA 4BNFA 5INTA 2ORWA 4QQRA 3SVZA 2V74B 4IVPA 3UYKA 3VTFA 1UZMA 2OCKA 4IV0A 2HXSA 3GV0A 3HVUA 2QRLA 2DUUA 4ND8A 1ADFA 2Y9MB 4HMOA 4IWXA 4MGEA 3HFRA 5JNVA 2IHNA 4AU1A 3FHTA 1ELOA 5JW6A 3HM9A 1KMMA 2Y1EA 1HETA 1SBZA 1V2GA 2FQWA 3AKYA 3KPWA 3QWAA 4HWRA 4ZC1A 1E62A 1E7SA 1GRQA 3IUPA 3QLUA 3R7WB 5HKKD 2GPAA 4KC0A 5TGDA 4HVCA 4YEDA 1X7YB 3R9IA 3RG2A 2BGRA 2BEJA 4RA9A 4B75A 1F9EA 2Q9BA 4DJJA 2AJDA 2WU8A 3DULA 4ZDIA 2LE0A 2ZUTA 1JFTA 3G2JA 3HXTA 3CH4B 5ITWA 2ANCA 2R8PA 3IIKA 3JWJA 3L40A 4G5XA 1GU1A 1AU9A 1ZNYA 3ESYA 3HKDA 1YZUA 2WF6A 3OG9A 2UXCB 3GOHA 3TLAA 2JFHA 1YWGO 4HGYA 5DOZA 4YGXB 3UOWA 5KYGA 3EZYA 4F4JA 1X1EA 4EPVA 3RFCA 3KT3A 3ACDA 3SC4A 4NBLA 1CUGA 2VO1A 2RG7A 4BX9A 3L0IB 4ZK2A 4ZVQA 2WU1A 5TPZD 4POAA 2HJSA 5ICFA 4X94A 3INGA 4TMFA 2OCIA 1OLSA 1SKBA 3BEDA 5M04A 1N3BA 1R0XA 3DAYA 1DELA 5JEDA 3LSYA 3LAWA 4O0MA 3ZGYA 3OQNA 3K9FC 4K9SA 1UKAA 1TPZA 2Q41A 4MYSA 4Q3DA 2IEIA 3AB7A 3CH6A 1YU6A 2WSSA 4QAJA 2VTEA 1QB8A 2DTDA 2XTMA 4UNQA 5FBQB 4KR6A 3R8FA 3LVRE 3HABA 3QUCA 1BRMA 1NM5A 1DGQA 3AONB 5AHWA 4XSGA 3QUAA 4R9NA 4WJLA 1JALA 2R1TA 5K3FA 2AFIB 3U7EB 1SBIA 1XR3A 3E3OA 4BRUA 1N8TA 1RWMA 3GVCA 3HE3A 4IWNA 4CF6A 5JALA 3AP1A 1YZ3A 3H83A 3KHTA 3NDPA 3PCRB 4H08A 3DWIA 4PQYA 3SIRA 4EB3A 2Z9BA 2VTKA 4QPCA 2QTRA 4V3CA 3GH3A 1KTIA 4IG4A 2GASA 2WF7A 3DTVD 3ZD9A 3IJEB 4YP1A 4HDKB 2EV9A 5LQRA 2F1KA 1H05A 1Q7EA 3PXEA 4LGCA 5CITA 2PMFA 2W6PA 3I2KA 5JH7F 3HVKA 3E5RA 4B8WA 4ZIRB 2O8EA 5U4QA 3RS5A 1AK1A 1HX7A 1FP2A 5A5DA 3CLRD 4BGDA 4RD0A 4KX3A 3K6SB 1P5ZB 3F1KA 1UMCB 1Y8CA 3KZNA 1V3TA 3OZ7A 1T9BA 2WHEA 4LSWA 2DF8A 2DFNA 2KJQA 1ZK1A 1MABB 4G2TA 2D1SA 5ALEA 3SQXA 2FK7A 1ISJA 4F8EA 1GEEA 2BR4A 3BWXA 1YR8A 3KUCA 3EEBA 3EZXA 3NPMA 2JPDA 2WM9B 4I5GA 5DK6A 3W2HA 3ZD8A 4ZKEA 4Z54A 3IKTA 5F3WB 1U7UA 1U2ZA 1GLGA 1H2YA 4MQFB 2Y66A 4P38A 3OEWA 5K6AC 3L1IA 1YZVA 2ZYUX 5EINA 3ND5A 1DNPA 3UWDA 1TKCA 4JP2A 2HHJA 3C74A 1PGPA 4LV5B 5GIOE 3G6KA 2WFZA 1WXDA 4ZT7A 3LHKA 2NNWB 4CM7A 1O97C 5D1NA 4B4DA 5EQJB 5A0VA 1G3MA 5AJXA 1ISGA 2A0KA 2R7KA 4ZU3A 1RFGE 2FLKA 2Z58A 5GJCA 3RSLA 5IJZA 1VKRA 4LSZA 4JC5A 3SNKA 3KUXA 4HS4A 4O2BF 1X13A 3DT8A 1Z45A 3GCZA 5DNWA 3IOBA 2H18A 2FSIA 3QMMA 3E1KA 5IM4A 4ESOA 3LT0A 4RJLA 1O97D 3C6KA 3M6FA 3AR5A 4G0MA 3NB0A 4LYYA 4UM9B 2UAGA 1RXYA 3P27A 1MCZA 1A27A 3SDSA 4CLHA 4R0VA 3ZHXA 2Y1GA 2POQX 3HSSA 4O4HB 4Q00A 5ANRB 3H3JA 4CHTA 2Q50A 2OYSA 2W8BB 4HEQA 4QEDA 5B4VA 4Z4IA 3U62A 4DDHA 10MHA 4ND8B 4QXMA 4RACA 4YMWA 2P9QA 4RWZA 3F6EX 1HNNA 1CY1A 4ENSA 1R50A 3QKRA 4S1OA 2V9PA 1EGAA 3GUCA 1MGOA 5DLEA 4C7JA 4G36A 5GZ6A 5LL6P 2ET6A 3ILXA 4J0KA 4NMWA 2JGJA 1WW2A 1PNVA 4FB4A 2OCPA 2NXJA 4GI5A 4GZLA 4OD0A 5DN6D 1B8NA 1Q2XA 1PL0A 3DXXA 1PUIA 1Y3DE 1YAHA 4PTLA 4HDMA 4AKGA 1J2YA 1FSZA 1KJYA 2VPTA 3VO8A 3GLUA 3JQ6A 3KUDA 1Y6JA 1M8PA 3PEFA 1PNRA 4JKYA 3VU1A 1VZ3A 2AKYA 1Q95A 1WR8A 4QD3A 3LBYA 4XH9B 3GLGA 4PCAA 5EP1A 4LY0A 1NM5C 1PJ8A 3R5SA 4R2IA 1KAQA 4S04A 3DL7A 3WQQA 1B93A 2R6FA 3NTXA 3L1VA 4PZLA 3OTWA 3HKEA 4OH7A 4ESVA 2VLIA 2YASA 4TV8B 4E12A 5FWYB 3BGWA 2E37A 3RNLA 5AO9A 1G38A 4PG8A 1XOIA 4Y6SA 1Z82A 1TUBB 3CRW1 3OOWA 1KDRA 2WJ3A 2CJXA 5CTJA 2HHHB 2XZPA 4RH3A 2HYIC 4A2PA 3VVMA 3LWNA 1Z8DA 1ZCFA 4BNLA 5DN6A 1ZNZA 4DMCA 1GNLA 4UBMA 3WO0A 4B6JA 3ICQB 2O8CB 3R5HA 5A06A 2C4KA 5JXIA 4RULA 2P3OA 2P6MA 4D9HA 5IEJA 1UJ6A 2O3TA 5HS4A 3MJRA 1XZMA 2OXCA 3W2TA 3RBAA 5FPHA 5F51A 3OICA 1P31A 3P45A 5FNZA 3IC5A 4E14A 5F7XA 3NPAA 1XAGA 3VSDA 5A5GA 1JDPA 3V7FA 1APBA 2A0FA 1P7ZA 4P7BA 1L7EA 1J0BA 3QX7A 2PH7A 4L6AA 1C9EA 3E9QA 3CR7A 1GN9A 5JC8A 1X3SA 4I6GA 3LNTA 3VC3A 1JLRA 4DY4A 5T6MA 2OM6A 5FFMA 1T35A 2FFHA 3QGMA 1DU4A 3EOAI 5GGYA 2GO1A 3WGGA 2B7BA 4URWR 4X7PA 3UJDA 1O0SA 3FVWA 3SGLA 2ZS7A 2OCGA 4QJ3A 1H8HA 2EBHX 4G09A 4TXNA 2B0JA 3SHVA 3CA8A 3WISA 4R98A 1GPJA 3GT3A 1U1FA 1D2NA 4R1TA 2ZBEA 4DLLA 4GKVA 3WK9A 1C7ZA 1ULTA 1QV7A 1ZI6A 3AUJB 3ED5A 2JAPA 4M8KA 4ZALA 3UJ8A 1DRKA 2QPLA 5G1OA 1UAAA 4M0PA 1THTA 1DEKA 1ZSYA 2O2XA 3QRWA 3MCVA 3TRDA 3EVCA 4U02A 1X39A 3C48A 4A8HA 3ND9A 3HDTA 1XGKA 3S27A 2M32A 2R8EA 4BAGA 3SEAA 2B3TA 2O07A 2VATA 2VT3A 5TQVA 1N7JA 1TIKA 2DQYA 4EMSA 3RS8A 4GP7A 2EEZA 2VXCA 1TVMA 1QLJA 4QUIA 2XADA 3M49A 4FOOA 1G55A 2OGTA 2OLJA 3AY7A 3EULA 3GLSA 2ZS8A 3GVXA 3PJFA 2XMBA 1L4LA 3NYWA 3Q0TA 2JJ1D 4YI5A 1G18A 5CFRA 1E7QA 2BM9A 4PG6A 4DWVA 2P62A 2QQEA 2XJ9A 1K7XB 5T57A 2VWHA 1E6MA 2IEGA 3CEMA 2CXNA 1J33A 3EXG2 4P22A 4OK3A 2FRDA 4QDJA 4UQPA 5LYJA 5EJ8A 3KPUA 3CG0A 4FSXA 5JIBA 3IMGA 3TW0A 4D9GA 2X86A 4L02A 2O8FB 2GN2A 4RZ3A 4QHYA 1A9YA 4TRJA 4Q34A 3PHGA 1AUVA 4QXAA 3BHMA 3ZGNA 4PFSA 3BD9A 3A6DA 1F1JA 5ARDA 4KGVA 4AZVA 1LBEA 3LK7A 1EXNA 1MG0A 4GVXA 1RE1A 4IOMA 3TQQA 3VH1A 4QJBA 5GZ3A 3I9NA 1CEYA 2VQ3A 3JQGB 3F5SA 3WWDA 1V11B 3PT9A 2I33A 2P30A 3W1EA 4YFVA 3D7NA 4GMXA 5PNTA 4LSMA 1R6VA 5IARA 5JBQA 1T5OA 3N2YA 4BUCA 3DLPX 4AG5A 4RHCA 3MTJA 5EQFA 2PGAA 2PPLA 2R1UA 4IXDA 1T1SA 3R5TA 4ZEXA 1DV1A 4PGAA 1M0SA 1XTKA 2L18A 2P2CA 1GKKA 1HUQA 2FQ1A 1ONBA 5E1MA 3WK8A 3ZW7A 1XWWA 3X1DA 3D6VA 1ZICA 4Y9TA 3JQDA 4JK3A 4ZQGA 3RRXA 3T5CA 2WBLC 2XB2A 3AU9A 3NU1A 4LXIA 4TMZA 1JT2A 5ECGC 4QM6A 1IN6A 1P9WA 3E5HA 2EJUA 3Q9NA 2IWHA 3O8DA 5HTKA 3QG1A 3ZX4A 1RS0A 3K1ZA 4HX5A 1CS4C 1NQVA 3KLOA 5BNIA 2GN6A 4GI2A 4QAQA 5TF4A 1K5HA 3GBVA 1ULSA 1I1NA 3LP8A 4JGGA 4OLJA 3GLGE 4RH0A 5SY6A 4IDHA 1QH0A 4X1OA 4C7BA 7REQA 1SUDA 2QUIA 1IHPA 2G07A 2I7DA 1NNLA 2JGDA 1W581 3FBGA 3FDZA 3KYCA 4KXXA 4MAMA 1D2MA 1GR1A 3D8TA 5H3CA 3DH0A 5BSEA 4RTLA 3TGPA 4TMXA 1KEVA 4LE1A 4DLKA 2R1VB 3BBPA 2BW0A 4OBXA 3UMGA 1ZXBA 1NOIA 3IQDB 4LWZA 1RJFA 5LZ7A 5HCNA 3VPXA 3R24A 3NIWA 5KJEA 4WN3A 5K2MA 1BDIA 4B4WA 4D56A 3RFFA 3WC4A 1O57A 4JOCA 4OAQA 3SJBA 3EW7A 4BYMA 1E2GA 4LSGA 5ALWA 5MN6A 1O96B 1YUNA 2DC1A 3K0AB 1IDOA 3BFXA 4GSYA 4QXQA 2VBGA 5GVRA 4CNBA 4N8DA 4F7DA 4RENA 2WPDA 2Q3MA 2WYVA 4MP3A 3ZI0A 4N76A 3WWOA 1J24A 4X3PA 4PZEA 2VUTA 5AKKA 4EDFA 3KTFA 3WJ1A 3H5LA 2M6SA 2V6BA 2WC1A 2HSGA 4NR0A 5LYJF 4LW8A 4B3FX 4YX9A 4ZGGA 4MRPA 4U0KA 4WKOA 4QNNA 3UK2A 3WYBA 4X97A 2FW1A 1Q0TA 1W30A 4ALJA 3OOHA 1A9PA 3LX4A 3UOGA 3MTQA 1Z13A 1JMKC 3ORYA 621PA 1EVEA 1VI6A 1S2DA 4PONA 4EB8A 1CB7A 1VCIA 1F7UA 1JX6A 4PVDA 1A5ZA 1JL3A 3QE2A 1P60A 5J40A 1XXLA 2HMAA 3QYFA 5EKXA 4B1FA 1W0CA 2JHGA 4PZUA 1C29B 1CIVA 3WAKA 1AGRA 5F3RA 3GLRA 4BKPA 2KI5A 3WAJA 2IOFK 5CUQA 2XE8A 5KZMB 1JEAA 1LQ2A 4KE9A 1U9YA 3V00A 5JDCC 2AG5A 2FK8A 1EZ1A 3SVTA 4MVJP 2ECQA 4IIUA 1JAXA 5JAMA 4MGIR 2WWVD 5CM2Z 2L0XA 3GBSA 4GM1A 3A7EA 5DASA 1RCTE 4DWWA 3K0SA 3QVTA 2I7CA 4LPSA 1NBWB 1WDKA 1TJ3A 1Z75A 1ZY2A 2GD0A 3GJ5A 5E6UA 5FI5A 2NGRA 4FEGA 5AM4A 3E2MA 3OC6A 5E95A 3GPDG 1ECCA 3FNQA 3M3HA 1Y4SA 3AQ4A 4UVEA 1UQTA 1E6WA 1NQTA 2I87A 1Z4JA 3BBLA 2AOTB 5I8WA 1RWBA 2GN1A 1V8PA 3AR7A 4C07A 4E5PA 1F6WA 2QN9A 3A6JA 3A6GA 4X8HA 3N8HA 1G19A 4PWZA 3TTTA 4ASUD 5B64A 3W5DA 3EUWA 1Z0DA 5CD9A 1ZSNA 4LRQA 4N0EA 2QSZA 4MI9A 4GQAA 1WZEA 3RARA 2Q46A 3UAYA 4ZOLA 1ESCA 4QYIB 4EITA 1TYCA 4LYDA 3OIFA 2MIIA 2P91A 3BTOA 1U94A 4IILA 4RHEA 5KJ1A 1PFUA 2FMHA 5J2TB 3OQ1A 4QDTA 4X54A 3THYB 4OI2A 1TC1A 3E7PA 3Q85A 2AIRA 4FE3A 2I4LA 4YJDA 1Q1ZA 1BZYA 1TYDE 1NXPA 2XBLA 5B1DA 3T1HB 2Z2IA 4HAYA 3NFYA 3PV0A 2PCJA 4N7RA 3EGEA 1U7PA 1D2EA 1KMIY 1ZIOA 2XCUA 4QQNA 1T10A 2NUPA 3GPBA 3OIVA 2XUQA 2EXXA 1QCZA 3H5IA 3HZHA 4L8WB 1QPBA 2W98A 1GQRA 1YKSA 2OCYC 4IMRA 3H84A 1GQFA 2H5LA 1A69A 1FVXA 1MIHA 5J43A 4XEHA 2FSPA 3UGTA 3CRZA 3COSA 2CXHA 3PUYA 1NJ5A 2QUZA 1L1FA 3F74A 3S44A 2PS3A 1H4QA 3UWPA 1GGMA 3BIWA 2BM0A 1D4ZA 4MVYA 4NKRA 1D1SA 1W2GA 3KKZA 1VLZA 2GILA 3RUHA 3GYBA 3DV9A 2JIDA 3DLHA 1M1XB 2WVGA 1U1EA 3IB6A 3KHSA 1JI3A 3T5GA 4KAAA 5BSFA 4C0KA 3K1AB 2WJJA 2Q4DA 4HB2A 4EQ6A 1Y9ZA 2ZPAA 1B42A 1T9GS 3F0TA 1IAVA 1QHXA 2PD6A 3MNFA 1QFYA 3GDOA 1U5BB 3P96A 4YLYA 5K99A 1II8A 5CXUA 4URXR 1JHZA 2OL4A 2QAGB 3DDOA 3P20A 1C1DA 3PGXA 1QP4A 4E22A 3NUGA 4MR7A 5H3LA 2V1UA 4Y2VA 3IELA 5EGNA 3R8XA 2Q5HA 2CLKB 4QELA 4R05A 1LV8A 4BB9A 4EJMA 5JZSA 3A05A 2AN4A 1WL8A 2XTNA 4H31A 4BIMA 4C88A 2UZ4A 4GT1A 1B6TA 1ZPDA 3EJ6A 4KK3A 4PS0A 3RSZA 2W0MA 1K7CA 1NF3A 3LCCA 2YZ2A 3CKKA 2ZRIA 4BNHA 3OPMA 1KFBB 2W93A 1L3IA 1S2LA 2Z6QA 3Q3VA 4H0CA 1CF4A 2LIPA 1R3UA 3IEKA 1QGOA 4WDQA 2VJOA 4F93B 3HJTA 3I62A 2X9NA 2OKCA 3Q11A 4KQ9A 4JJ7A 1OYVA 1EHYA 1PT5A 3DMPA 3IDOA 3M4NA 3NWOA 1Z4OA 2XUZA 3P32A 4R1QA 4EOGA 3LP5A 4N3AA 4RVDA 1SVUA 4IO1A 1U9JA 2MJLA 2RAPA 2DFDA 4I66A 1W96A 2PZAA 3GXBA 4BAZA 4EYQA 1FY2A 1KGSA 3OCJA 3F6BX 1TCBA 3LWBA 5IAKA 3SX2A 4BFVA 5ITVA 2JH9A 4Z9FA 4PSCA 2R6ZA 4ZREA 3DKVA 4NDZA 1D6MA 1E77A 1MOZA 1CETA 1Q15A 3LFUA 5E9WA 3HKCB 3PX3A 3RG8A 1T9GR 5A5EA 2IEDA 3PR3A 3CVWA 3M6VA 4D9MA 1DARA 3C6QA 1XEFA 4KSYA 3SP1A 2ZE6A