2A59A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 5-nitroso-6-ribitylamino-2,4(1h,3h)-pyrimidinedione
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
total genus 50
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a59A00
1KZ6A 1KZ1A 2F59A 2I0FA 2JFBA 2OBXA 1ZISA 2VI5A 2A57A 2C9BA 1EJBA 2A59A 5IM4A 1RVV1 1W19A 1KZ4A 1NQUA 1KYYA 1C41A 1NQWA 1T13A 1NQVA 2C92A 2C94A 4KQ6A 1KYVA 1KYXA 4J07A 2B99A 1KZ9A 2C97A 3NQ41 2B98A 1HQKA 1NQXA 2A58A 1C2YA 2C9DA 3MK31 1W29A 1DI0A 2O6HA 5IM5A 1XN1A
chains in the Genus database with same CATH superfamily
2X19A 1B7GO 2ECPA 1LBHA 1U7XA 2C3YA 2A3RA 3A7EA 1YUBA 3G23A 4OP2A 4BDTA 4CDRA 1BDHA 3A1WA 4P4TA 2YWEA 2XZOA 1N7IA 4S24A 2X5XA 2Y3IA 4JLWA 2FG7C 3WGHA 3RSOA 3B82A 2NTEA 2BFFA 2VF5X 3PIIA 4E13A 3AONB 3GW8A 4XWGA 4NOJA 5EJEA 2P67A 1T9GR 2DWUA 2XDAA 5KNDA 2QZ9A 3GN1A 4K9MA 1UDCA 2GYYA 5H81A 1VI5A 1U2ZA 1GUZA 2JFYA 2C84A 3AFIA 2Z9DA 4PVCA 1JZQA 2J33A 2EQ5A 3OZDA 2NZJA 1YRQA 4KXXA 2XKJE 4PLWA 1RRFA 3IBFA 4WL0A 3RC9A 2OO3A 5JYEA 1SQ6A 3ERCA 2XUQA 4DMCA 2HXYA 1EGVB 5FOUA 2NV2B 2G9NA 2IEDA 4LEIA 3A1EA 4FQ8A 4G67A 3VO2A 1H85A 1WPGA 1VKHA 2VHUA 3PC6A 4F5ZA 1MRSA 2HF7A 3MCVA 2ADOA 2XMGA 3KWJA 4KQIA 4RK0A 3TLXA 2JKYA 3HBMA 5E2IA 4C7XA 3TKLA 2GI4A 1E3JA 1ZJ6A 2GLTA 1SUWA 4NS4A 4Q4HA 4QJIA 4UTNA 1XNRB 1GILA 4MLPA 4EY5A 2XB6A 2PUVA 3OCYA 1W4ZA 4TLEA 3LKZA 3LGSA 2K6GA 2H3EA 3B9BA 3QVKA 1KE1A 2ZPUA 1Y5RA 3AEQA 5IYZA 2JBWA 5L7WA 5LMZA 1Z0AA 2Q5OA 3TBHA 2PWYA 3PV0A 2FFAA 3RLFA 4MS3A 4PPQA 1EUYA 4L1KA 2VAPA 5K20A 1C7ZA 4RH0A 2ACEA 2WUEA 1NE7A 2G08A 5IBRA 2C9ZA 3T9AA 3TQCA 4KSYA 3TI7A 1JSZA 5AYVA 4FJ1A 1OLSB 2ODQA 3GFBA 3C48A 1HT2E 1A2KC 4TTSA 1UCFA 1QE5A 2GAOA 4WBNB 4NJMB 1K4YA 1QBGA 5DH9A 3FKQA 2OHVA 2XUHA 4QICA 4XJXA 3TZHA 4ER3A 1AURA 1SG9A 3QKUA 1T6BY 1ZESA 5JZBA 5K3FB 5E8RA 2P9YA 4X62B 4X63A 4EUFA 3EGVA 3RAJA 2FMUA 4Y9RA 3I2KA 3ZW7A 3TLBA 5C4IA 1MOSA 4X54A 1KETA 5AQEA 3F8TA 2HIAA 3BGIA 1E9BA 1ZC4A 3G1UA 2A1UA 2GN9A 3WA7A 4ROSA 2XDWA 5J9FA 1XLUA 5L3RA 3EWSA 3CNHA 4HDMA 1BN7A 1EZ1A 1JL3A 3JXEA 2C07A 1YS4A 2AEMA 2GCNA 2Y1KA 3DVAA 4D8WA 1CJMA 4BXOB 2DH5A 2P7HA 3DT8A 4PX2A 3WYNA 2R60A 3DEJA 1UP6A 2HJHA 5LUBA 4WY2A 5T4FA 3ZDAA 4LE2A 3T7IA 1WSBA 1EPUA 4M9UA 3E22A 1XROA 1FK8A 1MQSA 2GS9A 2FXVA 4HNHA 1IN8A 3HL4A 2GN1A 4M89A 2AMLA 4DA9A 4BCBA 1JBKA 4HRVA 5H80A 4GT1A 4WDQA 3VYVA 1BC5A 2DCMA 2I03A 1Q21A 3U7FB 2G82A 1PNQA 2HYDA 1H2ZA 2FNAA 2A7QA 2YS7A 4ZDWA 3RIEA 2O8BB 5CLQA 2XWBF 4UDNA 1JKIA 2Z0MA 5T7BA 2BGGA 3MUNA 3PD1A 4KITB 2ZUEA 5A5GA 4A36A 3ABZA 1RI3A 2PKQP 3D7KA 3P2YA 4FHFA 4CUKA 3FVWA 2EZ9A 5K09A 1NLUA 2ZSBA 3HVKA 1DLIA 2OGUA 2P2GA 3O3MB 1OA1A 1PL6A 2ZR0A 2IYPA 4IYJA 1L5GB 3VDMA 2ZITA 4UHKA 5JXWA 1CWUA 3C14C 5GV7A 1FXUA 1V8FA 3LCCA 2ZTSA 4GC9A 1F17A 4NENA 4UDOA 2QVCA 4RK7A 3BT7A 1CU1A 4NVRA 2P4QA 3HUFA 3DLIA 3R5SA 1E2JA 1NGSA 3GJXC 2AWOA 3CZRA 3GA7A 4JGBA 5BUZA 2CL7X 2VQ3A 5HRAA 4IJMA 5F21A 3M5DA 1J5XA 1A7KA 2IF0A 3DMYA 2EBWA 4GWGA 1B3BA 4LVCA 5CVDA 3TIVA 3LVFO 3W6UA 4E31A 4YRBA 5K0ZA 3D0RA 2RGXA 2H3HA 2F3SA 3C3BA 2ZS9A 4C2BA 1PJCA 1RYDA 2VSYA 3O4RA 1T2NA 2Q9UA 3MOSA 2H4HA 4D4IA 3TLZA 3BKXA 1NZDA 2ZKLA 4EY7A 4I8IA 3GG9A 3I37X 1MR3F 2HKIA 4W5HA 4BMSA 3RLIA 4FGSA 4DSOA 3GWZA 3IBGA 3FOAA 4CL2A 1QS0B 1U6KA 4X1KB 5EHNA 4BGVA 3R9WA 3ORSA 3CPSA 5THQA 1RNLA 4FS8A 2ZYTX 4GU5A 3ZCRA 5G1OA 4UQPA 1GQQA 1JUDA 1NXTA 3BE4A 1YR3A 2QVXX 1OYYA 2O8EA 2V58A 3D3JA 1E62A 2D2EA 2H1CA 3QMVA 4RVCA 3CS3A 4RKYA 4BFWA 1EZZA 4KH0A 4FMCB 1QLWA 4U7GA 4I6EA 3K72B 2Q9CA 5GQSA 3K4HA 1WVGA 2SKDA 2JFGA 3BQNB 5AIBA 2FZEA 4HDQB 4IKPA 4Y8VA 3GLGA 1BX3A 2EGHA 1AIPA 4AS2A 5U4QA 4WX2B 2UYGA 4XR4A 2XD9A 2J3LA 4YA6A 1QO0D 2D8MA 4GL4A 4N3CA 3KIPA 4F3KA 1T2UA 1Z8FA 3PJEA 1SBHA 4EHNA 2O54A 4KLCA 4H3HB 3VAYA 2OHIA 3BWEA 4AUNA 5A9SA 3RVNA 1ZOPA 3D7MA 4TSRA 4JC4A 5K4AA 3MM4A 1E2PA 2H11A 3UWDA 4MW6A 1ISHA 1WDMA 2P41A 3N8DA 5BRNA 1TIPA 3CVOA 2D0IA 1CUBA 1KEZA 1ZOIA 4OA8A 4RV5A 1PGPA 3GLQA 1TUEA 4ITUA 1KO8A 4IEFB 1TT5B 2HDHA 1X3SA 2WJHA 1T4CA 5FWNA 1E79A 2NSLA 3OFVA 4PLZA 4RACA 3CZMA 1XP5A 3FPKA 4N6GA 3ZI4A 2RD2A 3HPQA 1ADGA 4OY3A 1E89A 3PRJA 1Z6TA 2BP7A 5AOVA 3VR1A 4MB0A 4Y2YA 3LHFA 4KKXB 4F3YA 1UKZA 5C8YA 1VE5A 3O93A 3U16A 3UF0A 2Y1LA 1DDIA 1E1CA 1XD2A 1U0RA 2V8OA 2VTEA 3DEZA 1IVYA 1AUPA 3CLVA 2H07A 4P5DA 1ANKA 3RKUA 3NNDA 1A98A 3TIGA 1FFYA 1DG9A 1X70A 2I3GA 5MN6A 3E8MA 4UNPA 2ATIA 3DCJA 1J00A 2Y93A 1OWNA 4MQEA 1ECBA 1NPTO 2YMPA 5DHUA 4CM8A 1J2UA 4Y30A 2RBEA 2VUSA 1RQGA 4KNWA 3OEYA 4XM2A 4BRUA 4K28A 3DLBA 3LQYA 4IM7A 3MCAA 1N2GA 1YKFA 5DEOA 1Q2XA 5M3BA 2VI5A 1LS1A 2CMKA 2PMWB 1LI4A 3F9RA 1EFRA 4FPXA 4FYKA 2F8TA 2NV0A 1ZDMA 3HFSA 4YX9A 4TN1A 3RGGA 3QFTA 5J43A 1EEXB 5WRFA 3RJTA 1VE3A 2P9GA 2R66A 2VTDA 4L2IA 1E5LA 4XDZA 1KAGA 1HWYA 2D7CA 2QE7D 4FP9A 3Q7RA 2IYXA 2FRDC 5LA6A 2QHXA 3I12A 2L69A 1T1JA 1T0HB 5THXA 2OYCA 1FTQA 2HBZA 2QZPA 3K2EA 4NZ9A 5GGYA 1DBSA 2WF5A 5J5CA 3TMAA 5HKAA 5J5VA 3FWZA 4RCZA 3RYFB 5ECYA 2XJ4A 3B3FA 4JLDA 1SZPA 4JOSA 3THXA 2NMVA 1KZ7B 5EAIA 5IH3A 2I3BA 2VLBA 1GG5A 5JBNA 2D59A 2JZNA 4PGFA 4IXNA 5AW6A 4CEHA 1H05A 1VYTA 1LBTA 3I2FA 3PXBA 5D87A 4YP9A 1L3BA 5JH7B 1NA5A 3NOXA 2WFMA 4YP0A 5KTOA 1DCTA 3WRWA 4OP1A 2DMRA 4I7EA 1C9DB 5AIAA 1HYBA 7GPBA 1CIPA 2NAFA 1ZRHA 4INOA 4L16A 4MW4A 4UAJA 5UKDA 4H6PA 4LJLA 5BOVA 3NVDA 5K4HA 2ZAIA 1SCUB 4JJZA 3GVCA 3HRKA 1OCEA 3DUWA 3A9SA 4HUQB 1Z0ZA 1W94A 1TZCA 1XTIA 3IKVA 1IWOA 1DHTA 2OILA 2ZATA 2C2WA 4MUBA 3QEOA 4N65A 6CHYA 2BUBA 3OQBA 2PUDA 2VWPA 1P73A 5H4GA 4ZEOA 5CEFA 2Z8YM 1KAMA 5LZ4A 2PNFA 3CINA 2ZAMA 1YMUA 5FNZA 4EITA 1MA0A 5H3HA 3UT6A 1LWNA 3VHXA 2COUA 2JLZA 1ODJA 1U3UA 1J9EA 3KQVA 3P9ZA 3VNQA 4MPTA 4ZIRA 2WYVA 4YDQA 3BFJA 1HZZA 3U3XA 3R75A 1YDMA 3KRTA 4BNDA 1F0KA 1R9NA 3ZS9A 1T3TA 4IV0A 4RZHA 2PMFA 4LMPA 1DX4A 1KERA 4R1QA 2B78A 2C5LA 1DRKA 4U7WA 4PX5A 4C7MA 1QIDA 3KE8A 3OC6A 1Q74A 4YV1A 4Y2VA 3KPVA 2HIMA 3ETEA 4R6WA 2OCGA 4KFCA 4EL0A 3ZIAD 3U5ZB 2X4GA 1B15A 3JASB 1WUYA 1RKVA 4BVGA 2GVZC 1P5RA 1CW2B 3O94A 4IIUA 2OL4A 3GT3A 4KV7A 4ZVKA 4OG2A 1Z06A 1P5ZB 2QM0A 2XMBA 4K9SA 1L1EA 9ABPA 5I8PA 3I23A 2O8FB 1NHWA 1KIMA 3KELA 1EFUA 3KXPA 3O90A 4MVJM 1TEVA 3Q3GE 2PDAA 3RSSA 1AZTA 1I3NA 3AOGA 4BTLA 3WGZA 3I58A 1K08A 1IY0A 2WE7A 1H2EA 4LQCA 4TTVA 4X8LA 3KX2A 1KK0A 2IK8A 3TNLA 5JHHB 1IJFA 4Q7KA 3PU6A 4BU1A 4WGFA 4US0R 5KQPA 5HCNA 2DB3A 2PZ8A 4OLAA 1A5AB 5LA6F 2O4CA 3AEZA 4E5YA 3PNYA 4DLTA 3QPWA 5B36A 5JZ9A 1UF9A 1CEQA 1RAEA 3D8HA 4JLJA 1CS0B 4CT4B 2UU9B 1X80B 2A6PA 2KJQA 4YN3A 1KZHA 1KZ1A 2JGRA 1XN4A 3G2PA 3GX1A 4DDVA 2WD9A 2QMQA 4ZMSA 3CR8A 4A03A 2JC3A 1XPOA 2JJ2D 2WIFA 1HG1A 2FWPA 1JAIA 1X2EA 2XB9A 4AN0A 4Y1RA 1N2ZA 2NTNA 1QIHA 4Z53A 2DP4E 1J0BA 3I6QA 4MHSA 1AHPA 3FCSB 4HS9A 3BFKA 3A4LA 5I47A 4LV8B 3QXXA 4B3IA 2GN4A 5AUQA 4XPIA 5JDIC 2NLOA 5EXSA 2A30A 1ULUA 2JLVA 2P5YA 4UHEA 2JFFA 2B35A 2V1XA 1C30B 4QTYA 4HGOA 4Z3KA 3E7PA 5T64A 1HQCA 5G4KA 1N1DA 1G6Q1 4BFLA 4FYHA 4BLOA 5FBVB 3K0FA 3OJWA 3RVSA 2VOJA 3CPEA 3U4QB 2PSFA 1ZN2A 4HN2A 3V4SA 2QP9X 1GNSA 2RFLA 2Y1WA 4OJTA 2CXOA 1KSGA 3WKDA 1E2EA 1E7MA 4GS5A 4DRXA 4DWVA 2UZ4A 1T0BA 3I8XA 3V42A 2XJ9A 2H1LA 2B1RA 2FZCA 4HDSB 5CVUA 3WMWA 1D07A 5FJJA 3CZQA 4ZOLA 9LDTA 3R3ZA 2E5LB 3AB8A 5BW4A 1JQ3A 2VYVD 4M1EA 3W9UA 2ANBA 2FPUA 3PRHA 4QTZA 3ZE0B 5ITWA 4FNAA 4MUFA 4YRZA 2QQEA 1UWVA 1HEYA 2X77A 2ZUBA 2MSLA 2O50A 1RRGA 3UJBA 4PN3A 2O14A 1GGNA 2BGIA 4ZKDA 1NBOA 2C4UA 3GCDA 5KU7A 1PFQA 2FQWA 3UWMA 1N25A 2RK6A 5IVPA 2P11A 5ELLA 3S44A 3TF5A 3DBLA 1QTQA 3TSWA 4B6JA 3VPHA 621PA 1J25A 4RK1A 1BXRA 3NC0C 4TVSA 3WZMA 4B80A 1THTA 4TTTS 1P80A 1DQZA 3WLQA 1DCFA 1G19A 3KEMA 3AHCA 5KS2A 3T5DA 1I36A 1XQXA 4DR3B 2WAOA 1TM4E 2CUTA 1CPYA 3KQHA 2PVPA 2Y0EA 5HCIA 4CZ2A 2Y1FA 3IDZA 1V0JA 4EJ6A 5GM2A 1DG3A 1OWOA 2YZ2A 3QXJA 4G0NA 2PFSA 5GOTA 3QU2A 5HBRA 4B83A 3Q9LA 4XVCA 5LQNA 3GDHA 1S96A 3BFPA 1YS7A 1KVTA 3U7GA 4B17A 3OAAD 3QPVA 3R20A 1N2BA 4JI5B 3W8RA 3ZHOA 4DC1A 3I9FA 4CF3A 3FG9A 3B1JA 4U6QA 4PYQA 4IIYA 4OU5A 3IT3A 4UXJA 3SS7X 5ALNA 4PNEA 5CFRA 3Q2KA 4LHXA 1UPBA 1SUCA 3AX6A 3FMIA 4Q05A 4D2IA 1JHPA 3C8UA 4I99A 4BN0A 1ETHA 1O95A 3RWOA 5F9MA 2HJWA 4KQFA 1RRVA 2HW8A 5F1KA 5AW0A 3C6BA 2AXEA 4B7UA 1U3FA 2X9GA 5CNJA 2ZI3A 2HZ7A 4JJEA 4LQ4A 2EP5A 3PEFA 3U4MA 1HT0A 1F8GA 1LZLA 1YB4A 3JQAD 4S1PA 2BE9A 1ONNA 4W5WA 2J5XA 3KYBA 1DKNA 5J5AA 2OGWA 3NASA 4BY9E 1GAEO 2CKDA 2WJPA 3EXEA 1I4DD 3GYGA 3JQ9A 3CONA 4LDJA 1U9CA 4FHCA 1V26A 1GN9A 3CRRA 2FDCA 4V0OA 1C29B 3QJYA 4CIBA 2B94A 4Q1BA 5C5IA 3CCCA 3EXIA 4Q9KA 3V4ZA 4BEWA 4F92B 3KZ1E 4CN8A 4I9NA 4B3CA 1L7MA 4EMBA 3EW7A 5FPTA 1FXWF 5IFLA 2R2GA 1EVYA 1UKCA 1XDDA 3I01M 2HDWA 1BCSA 5G1PA 3VI4B 1SVWA 2ZAYA 3DXXA 5FUWA 5LIPA 4WTOA 3LP8A 5F33A 2IHTA 4D9IA 1E9FA 5FI1B 3D3WB 3ZCTA 1R4AA 1BJTA 3Q9UA 4YXFA 4K2AA 5B57C 3KUXA 4WOPA 1HR0B 4NULA 1QV9A 4US1R 4N9WA 1GQRA 3O7MA 4FYVA 3TCXB 1DAHA 3HFJA 2OQRA 4X1YB 3O31A 3NHZA 2FP4B 1T2AA 5SY6A 1ZOSA 1UAAA 5I9NA 3HG7A 1CY2A 4F97A 5IVHA 3EDQA 3TL3A 4AAYA 3NX4A 2WVAA 3AW8A 2VDOB 3HCWA 5IAKA 5BUCA 3L93A 3MTDA 5FTNA 1JJIA 1FJGB 1FFEA 4ZYVA 1T5HX 2BIFA 3PYLA 3W5VA 4R1TA 3NM6B 4UVDA 5B3JC 5HRCA 4H3KB 1ZIXA 4JLUA 3FB1A 3DTVD 1SK8A 4HNVA 3DV0B 3FWHA 3WI7A 6GPBA 1WV0A 1CZHA 4NYIR 3O8QB 5DK6A 4NI5A 4M22A 1L2TA 1GNRA 1I1QB 2RAVA 1UMBB 2VH5R 1V9LA 4J75A 2WPNA 4YWHA 3ZXYA 1BE0A 3WNCA 2NPFA 1CUUA 5DM0A 2EZ4A 3BKWA 4LFBB 3CKLA 4R2MA 3FHTA 1SN7A 3CZ5A 4P3XA 8ATCA 1W4LA 2NM0A 2EATA 4K9LA 4Y6OA 4EFNA 2P6UA 5HTOA 1O8BA 3EDOA 2HADA 1DXOA 4RZUA 4G8CA 5CW1A 2CNKA 3D59A 1HX7A 2PWAA 1IN6A 2Q5LA 3P9QA 4Y6SA 3VNVA 3PWSA 4CR6A 3OZSA 3HXOA 2B3DA 2XCQA 3NYQA 2C5AA 1X7XA 5KYUB 4M1KA 2JEYA 3V2HA 3KR0A 5JU6A 1OH5A 1ECLA 2FLKA 3S29A 4HFNA 4PG5A 4FDUA 1GPYA 2C3UA 2LVBA 2VZ9A 4YJ3A 2WD7A 3IESA 3AF6A 3QE9Y 1WULS 3UKOA 4CM5A 1M2VB 4OAPA 2R65A 2IOFA 3DD1A 4Q9NA 2QLLA 1PTKA 4RD6A 2NP7A 2PGAA 3PICA 1WCYA 4RVSA 3DKKA 2I2AA 2Z6QA 1JZTA 3KV3O 3WLTA 3MMSA 4BGEA 3E6AA 4WCVA 1XEXB 3GWGA 3W2HA 2VYFA 3VZRA 3PITA 3WB0A 4B7ZA 1JG6A 2D1RA 3L2OB 1AHHA 1QVAA 4N5IX 4OJMX 3TX2A 2KLHA 2E21A 1IEVA 4R3UC 3ZLJA 1W35A 3QKTA 1U3GA 2ARKA 2VNHA 3UB2A 4I1PA 2XB8A 4MUYA 1NBEA 1CUSA 1OGYA 2I6TA 2QTRA 3U17A 4A2PA 5A6VA 3G0DA 1KS2A 1QH1A 1U8YA 4MEAA 1Z34A 4QA9A 1Y8RB 2GLXA 4YROA 1B2RA 4ZVPA 2F9LA 5J59A 5JXJA 3IAAA 1GTZA 2DT8A 3FPHA 4DW8A 3N0VA 1ZCJA 3JZAA 3Q12A 4TKUB 2JFBA 1I9CA 4REOA 2GILA 2ZTUA 3RTDA 2PSEA 2XNJA 4D4MA 2VEOA 1DQSA 2VHZA 2VUTA 1RZUA 1C8KA 3MFYA 4Q39A 3U9TA 1NFQA 4H7IA 3CRMA 3NDIA 1VZ2A 3UV6A 2C8KA 2H2AA 3L1JA 3EPKA 4Q1AA 4KVAA 3M6XA 3G17A 4EGFA 2AOUB 1HTBA 5HXAA 4QHYA 4Q6BA 1JAZA 3LKBA 1AXEA 1GGJA 3ILHA 1PFKA 1ZH4A 3K9BA 5TS3A 3GVIA 1QMPA 1VCOA 3O74A 3A2KA 1DFHA 1W34A 2A5JA 3KJIA 3GJ6A 4RIEA 5JSFA 5YASA 5LDHA 3MOIA 4WLOA 3UUFA 4Y1GA 5CBKA 2FE4A 3O3CA 5EMKA 4ANFA 3L41A 1NVXQ 4BV8A 4EHLA 4X8OA 1Z6QA 1JPNA 1K7YA 4YIKA 4TTQA 4C0SA 3NMUF 2V65A 4TWRA 2BKVA 3DB1A 3FZEA 3QEBZ 4HQOA 4JD5A 3PE6A 4B09A 1HNXB 4NWIA 2HJ9A 5KCZA 4WWHA 3ETHA 2FEWB 1BOOA 3ZWPA 4DWJA 4ZDJA 1NN1A 4DUZB 1ZKMA 4KXYA 3V1TC 4E07A 4L6AA 2HLPA 2GOYA 3LECA 3QWHA 1C1XA 5DASA 2ZSHA 5AUOB 1PCXA 2FPIA 3HBAA 4L7VA 4TXHA 5SYMA 3RRYA 1RC1A 3TH5A 1A9PA 2LUOA 3NUGA 1WNTA 3R24A 4R2WA 5I9MA 3SZRA 2QX4A 4OMFG 4AKSA 3F47A 1U4OA 4U7FA 2EKQA 1ODIA 1SNYA 3IB6A 3MWLA 3P9IA 4LK2A 4B3BA 4C6TA 1FC0A 4C7BA 2JLUA 2F1KA 5BYKA 1TJYA 4MUAA 2MWMA 4UW9A 4GAEA 5DRYA 5G4LA 2UVQA 3VDXA 4YMLA 2IS2A 4RHUA 2ZRNA 2D54A 1EWVA 3K0BA 5ICCA 3IVCA 4CCAA 2JG3A 2VP4A 4MR7A 4ZVOA 1BO6A 1I1OA 1RW4A 5FPYA 1CDZA 3NOVA 1EFHA 1EYZA 3GUHA 4Z9BA 1ZRMA 2WV9A 2OXEA 2VDVE 2C92A 4Q1EA 3OHMA 4WSOA 4XM1A 5EVCA 1P8JA 5C3MA 4BVHA 3FKSA 4WLEA 4V0NA 4LOHA 5LWQA 5U9CA 1JEYB 5AKGA 3KPJA 1ZH0A 2I5PO 3B53X 2MCFA 3WNQA 2DT5A 4FEEA 5HF8A 2PUTA 1QQBA 2V3WA 3N2NA 1ZK3A 1M1XB 4M4SA 3TEJA 4FNOA 4OOFA 4OQMA 4U1RA 2OO5C 3SXUB 3U37A 3TLEA 2ZE6A 2P9JA 2H2WA 3JAMA 1LBEA 3D8BA 1GFSA 2A4KA 5EQJB 3KNZA 1OFGA 4HH0A 3ROTA 3KEQA 3MGGA 3H1TA 1AM4D 1N2HA 1OTYA 1XO1A 3NBZC 2H57A 3U81A 3U19A 4Z0TA 1U7HA 3HA5A 5G41A 3P0RA 3Q41A 4OHVA 4TM8A 1GOTA 2GZ2A 2JK1A 3A25A 3AOEA 3OOWA 3ESQA 1C5KA 3OQPA 4MRNA 3Q8WA 2EYQA 1HYHA 2W22A 4O33A 1OX6A 1ZCAA 3AWIA 3VKVA 4OYRA 1ZJYA 2MOKA 2NUPB 3CH6A 4GIBA 2C5HA 3PQ2A 1TCVA 4XIFA 2CLSA 2WJGA 3SXPA 5GJBA 1M66A 2QUKA 3SQXA 4G2NA 1PLLA 2FRDA 4Q7EA 4X71A 5JADA 2X8JB 2WYHA 5IJAA 4M1QA 1EGMB 5DM70 3HB0A 4KBGA 1KPHA 2YCLA 1E9DA 3KSUA 2P78A 3BH7A 3N6RA 3AL0C 3PEYA 3LGAA 4I1OA 1B0PA 1GSAA 4YY3B 3UWKA 1OZHA 4O25A 4KP7A 3QF4B 4LRQA 1W6UA 4TS4A 3RDPA 2PTGA 2WZQA 3RFCA 3N58A 3M2TA 1CFZA 4BKOA 4Z9YA 3BWXA 1EK0A 1HRKA 3I2JA 3OT5A 4ENQA 1Y3BE 4KGVA 3E61A 4FLMA 4JOBA 4OM8A 4AX4A 4FMDB 4CMEA 1PJLA 3PDIB 5ENZA 3L1VA 1SXPA 1GNTA 3QUCA 1C9JA 4AKIA 1R3UA 1KJIA 3UH1A 3G2OA 4BASA 1P1KA 1VGQA 2GZAA 4DKXA 3K31A 1U5BA 4P7GA 3COSA 2W2TA 5FFFA 1QYWA 5KNBH 1ATZA 1FUKA 2CNOA 9ATCA 3DLCA 3ROKA 2VNSA 3AQ4A 4KTVE 3W78A 2JGLA 4YXWD 1XJCA 2XIQA 4G56A 4M76B 1I32A 3H9EO 1CJTC 2AX3A 2HWKA 1GP2A 2GBGA 4PFSA 1B41A 5AM1A 3RKRA 4DR2B 1ZIDA 2LKDA 4HLQB 1QFJA 5K8CA 3NPAA 3PDUA 5GJVC 5I8WA 1OT5A 1I94B 1H2AS 3NTUA 2O5EA 4LVNA 3T34A 1OZAA 4LECA 4H0CA 4ZV9A 2YWBA 2WF8A 3BZBA 4YR9A 1B76A 1Z3IX 2B8NA 1P4HA 1XKLA 1BXKA 3IHTA 3LE8A 3NHWA 5KWJA 2GXAA 1JFFA 2AYZA 3CKYA 3IIIA 2HA5A 3QHPA 5BSHA 1X9GA 1Q84A 4WCFC 5HJ2A 4DLXA 3COVA 2XBMA 3ZC3A 3F5SA 1DC5A 3CKKA 3FRIA 3VMMA 3PKJA 3PVSA 4JXJA 4TMKA 1F5NA 4GYKA 521PA 1P3Y1 4HWTA 2X0DA 4BMDA 1PG0A 1R5OA 4M0LA 2IYOA 1FE8A 1YJ5A 3EH1A 2FVXA 5K9ZA 4TXMA 2PGNA 3A6FA 3ADKA 3QV2A 4OGFA 4U3JA 4B71A 1XZBA 1P0MA 4JHLA 4D41A 4K0KB 4HYEA 3DEFA 5JTUA 1PGQA 2XUAA 5GZ3A 5KEIA 1I5OA 2OOKA 4WZ6A 2HMAA 1JFFB 1L7BA 4N5LA 1NM5A 2SBTA 2D13A 1BOFA 4DMFA 1OLXA 2XUFA 3SSAA 1WZNA 2IS1A 2II6A 1YJBA 1EBUA 1KEEB 3M5PA 3TIXB 1UBSB 3VYTB 2WHYA 3MWEA 1YHYA 4F9GA 5LMCA 1Q7GA 1IIBA 2P9BA 4KXMA 4NX2A 4DCNA 2VTBB 3GLHB 4WNYA 5IJ9A 2L18A 3CY6A 2ZYGA 4FZ5A 1WUTA 3QPDA 2QD3A 3OZBA 1BXZA 4MYRA 1A7UA 3ACBA 2PZAA 1HDIA 5KSPA 5PGMA 4LI3X 3LHDA 2FSFA 2PBLA 3ZH2A 4C78A 2A1UB 2BGMA 2JAQA 3ZY5A 2WHEA 4L8LA 4O2BA 3OJCA 3Q2OA 4BN4A 1ZL0A 1RPTA 2ET6A 3M1AA 1XAIA 1YJCA 3LPMA 2G8LA 4M88A 4OB7A 1OV4A 3BRCA 3W3AD 4B31A 3PX2A 4ARCA 1GCUA 3GMDA 1AUQA 3LOQA 1OD6A 4KO8A 4LW8A 4G4GA 1C0IA 3CNNA 3I9NA 4NFHA 4RD3A 4Q4AB 4ZVVA 1N0UA 1C7QA 3OJEA 4B9EA 3H2KA 4R7ZA 2LNDA 3AKEA 5IULC 4D0NA 4YRAA 4O2AB 5JATA 2Z8XA 3OD5A 4WIAA 1EAMA 1ZW6A 1LW6E 2OV6A 3BH0A 4OHBA 4QBGB 2B8JA 4EABA 4EYOA 1ISIA 1T2VA 1LUAA 4M46A 1ZD2P 5FTJA 2PWPA 3NPMA 2DPXA 5K3BA 2C7PA 1G3IA 1JR2A 2Y9MB 4QEDA 5BOSB 5LOVB 1N6KA 1ZHFA 3EULA 3IIJA 4INPA 4K03A 5ED4A 1DKMA 3F1KA 1REQB 1DDGA 2BKAA 4Y2XA 4QTUB 4ZO4A 1L9XA 2IHZA 4IMRA 4O5OA 1RBQA 3FYSA 1GDDA 5BNFA 2H4FA 1G3UA 1WR8A 2J7PA 1SXJE 4C6TB 2ZS8A 5JWHA 3EC1A 5SZHB 3DBVO 3B1XA 2G17A 3QYAA 1NQVA 3DCNA 4H4CA 3IUQA 1O08A 4PXYA 5H83A 4HX5A 1Q0LA 4K46A 3USES 1CEEA 1P3JA 3VR4D 2JI9A 3H1GA 5ALRA 3R8CA 3U4CA 2CVFA 4V0KA 3RWBA 1J22A 1FQWA 2CSUA 4DZRA 4RMNA 1XDBA 1R8XA 2BPOA 2C98A 4IUCS 4J90A 4MS4B 3BCSA 4C4RA 3EF0A 3TW0A 3L6EA 4EYQA 4DV3B 3GEPA 4V0LA 4B2PA 4JP8A 2I22A 4YQEA 4O6VA 2ZXUA 3AM3A 4DXDA 3Q3IA 1O97C 4G1VA 4JS0A 2AC4A 2XMPA 3KKQA 4JT8A 2OP0A 4EPRA 1G1MA 1ZRSA 1FMJA 2NU8A 2X3YA 3OD1A 1RTTA 4NOKA 3ZX4A 4HNAA 1QH0A 4BUJA 3BHIA 3O47A 3RVOA 2CZCA 4NARA 2D74A 4R8LA 2A0KA 3UMBA 1JJAA 4N1AA 4NHOA 4E7OA 4BNMA 5EEHA 3KB1A 3TQIA 3P20A 3N7AA 2D5CA 4FB4A 1F06A 2OB2A 4JN6B 1M9NA 1BHO1 2VRCD 3GCGA 5D5QA 2R87A 4EX6A 1MH9A 2C03A 1YRLA 2NSYA 5AKLA 3OC0A 4M49A 4O4JB 4FFRA 3L4JA 3LX4A 1KO4A 2Q4RA 2VZ0A 3L8EA 2HF2A 2QJWA 1TF7A 1LQUA 2DQSA 2GZ3A 1TLTA 3KYCB 4XD7D 4RJLA 2VJAA 2RC5A 2UV8A 3TPFA 1SHJA 1VL8A 3TTXA 1VJGA 1GHTA 4JOCA 2P9QA 3A9TA 3GF4A 4PCVA 4AF6A 1KYZA 5K8VA 2A0YA 3VNBA 3A6ZA 4CE6A 4HLCA 4ZOQI 5BQ3A 1TI7A 3RUAA 4EFLA 4UFNA 4L3OA 5EIBD 1A8IA 1LTKA 3H5OA 5DP1A 1PEDA 3DMPA 1ZJZA 2WLSA 1YDGA 4CVNA 3C6XA 5EWJB 1ZGAA 5EXXA 3QITA 3VC1A 1WB9A 2WG0A 2XMZA 1N2EA 1XCBA 4LWPA 4Q3KA 3DW3X 4XYMA 4YMWA 5HVNA 3SQLA 3FFXA 3S2SA 2HSGA 3NKFA 5BW6B 3WWZA 1T15A 1OBOA 4Y2JA 2IXDA 3CG0A 2DKNA 4CYMA 1AQYA 2HLDA 2V6BA 1LNSA 1N0IA 4M87A 4QD3A 2YJ3A 1C2TA 2AK2A 2B1JA 2JD0A 1GTSA 1SR8A 1T1RA 1U2GC 3NIBA 3O9MA 4L5CA 3AJ8A 3WP1B 5JISA 3SX4A 3T3NA 1V3QE 2ADFA 1AJEA 2C5FA 1Z12A 1QNFA 1XZFA 1OWMA 3OTHA 4MDEA 2ZB3A 5I48A 1XZDA 3SIRA 4Q48A 5LP6A 4DEVA 1YR2A 2XCLA 4IFIA 1N2XA 3VJLA 3E9EA 5FUBA 3FPBA 1YQ9A 1YCGA 4LWOA 2QT0A 2J7PD 4RTJA 2EKBA 4H35A 3GPBA 4OLJA 1HLPA 4JKIA 3D5QA 1T26A 3HB9A 2J8ZA 1QQ5A 5CG1A 1U1GA 1GU7A 1GFZA 3F8SA 3JU3A 4MV7A 4B6OA 2ENWA 5FDFA 1E18A 5EFOA 4QM6A 3DT9A 4UZEA 5FUMA 3ADPA 4G3XA 2AFIE 1XWWA 4MX8A 4M8LA 2Y76A 3FA2A 2W70A 3NT2A 1NQ5A 4LC9A 4C0AC 4OYHA 2C94A 2HGSA 1S02A 1CP3A 3EJ6A 4H6WA 3C8HA 5T41A 3OPMA 2P6NA 1NUUA 3MMXA 4ER6A 1QQTA 2CL0X 2P75A 2J0VA 2WJVA 3EAFA 2XGJA 2BDEA 3GQBB 3C0KA 4LG1A 4DB4A 3DZ8A 4A73A 2W2NA 2AW3A 2D2IA 4OFXA 1IHYA 1EWRA 4CKCB 3PC3A 4EJSA 3EUFA 4FLFA 1VSTA 2QYTA 1N5JA 1E9SA 3OLXA 4G4IA 2ZRQA 1MFPA 4GZLA 2ZG6A 4OREX 5CRIA 5FI3A 3JCZA 2F90A 4N8DA 3IPCA 3IC5A 1B6SA 1XZKA 5JSZA 1R8JA 1HY3A 1FP6A 3P0EA 3ROPA 3X44A 4A5SA 4ND8A 2CNDA 1P6QA 1KXZA 3ACDA 3KXDA 3HY6A 1NYRA 2K7ZA 5TARA 1WZIA 1Z07A 2QQ0A 5TXGA 3VVLA 2FR0A 4N18A 4KODA 3GD5A 2AG1A 1P5JA 3PFBA 4BRZA 2CLIB 1YV9A 1XRSB 4PZ9A 1PR6A 2Q5HA 2VEDA 5C7LO 2J4CA 3C85A 1KY4A 4Q3DA 5IN4A 3QIAA 2W2KB 4XD7A 3T4EA 3PI6A 1JG4A 1Y3HA 4HD8A 4BO5A 5EUMA 1OYVA 1MH1A 2QXUA 1L5VA 4HDKA 4DV4B 1UQTA 1W25A 4IOJA 1R4NB 4BP1A 5CLJA 5BURA 3KZMA 3WJAA 1SRQA 1Y8QB 4KX5A 5EIHA 4BATA 4I4TB 4RL4A 1BRMA 4K6CA 4Q3OA 4G0VA 1C9MA 1NW8A 1L7VC 2W8BA 1A7JA 4DWWA 1EA5A 5MN4A 4E4RA 2GJAA 5HMLA 2QV7A 3F3KA 3PWTA 4QELA 4AZ0A 4BE9A 1ZH6A 3OZUA 4UUOA 3V3TA 1KJZA 3CE6A 3OE5A 2ZTVA 4LSGA 4FC7A 1W46A 4RV4A 4HRYA 4Z3DA 5IK2D 3T9EA 4DR1B 3HXQA 5H3LA 1L7RA 2AOXA 3D6AA 3DFUA 5HIJA 4KO3S 4AROA 5CK5A 1S0UA 4J0EA 4FUQA 2GWHA 4LYAA 2FQQA 3OTOB 3THYB 3NVKI 3B85A 5EINA 3S70A 1IZ8A 3C3AA 1NL3A 4F9TA 1X77A 1GLNA 3FDZA 4YASA 3QUAA 3EXAA 1ZVQA 4LISA 4D4LA 2BM1A 5DM1A 1FS5A 3F67A 4RAOA 2Z30A 2RIRA 2WSSA 5K3AA 1YACA 3PCRB 4QLBA 1CDEA 1Y63A 3OE1A 3KL4A 1A8PA 2ZR9A 2FN9A 3MS2A 4PIVA 3PUWA 1DEAA 1BXGA 1U28C 4LZJA 1HDRA 1UM9B 1DKUA 2IUFA 3CIFA 4B4DA 2GBCA 4NICA 3PP8A 1H9CA 3ZY2A 1ULZA 5DHQA 4R31A 4B8YA 1AKYA 1IUPA 2QGNA 5HRUA 3TGPA 4HYYA 1ENOA 3AI2A 1TCCA 4B76A 1QDEA 1RKBA 4CGYA 4E09A 3GRFA 2ORWA 4X61A 2C9OA 3HEAA 2P2SA 1YL5A 2PS9A 3H5IA 4R7TA 2X9QA 4TT8A 5KTSA 3LT0A 4E70A 1QRAA 1FL9A 1G8AA 2QN2A 2Z9BA 1XJ5A 5DMXA 5A9SB 3GH1A 5I9SA 2X0FA 4DJTA 4CMAA 4MRAA 2FEAA 3AF0A 3BCRA 4M9CA 3ZU2A 4BO2A 3EQ8A 4WJZA 1IAQA 4MLCA 3P19A 4BCDA 3Q2IA 4XLZA 1V8BA 4CW7A 4MJXA 4WBSA 4KXQA 3NHKA 1DWUA 4KMRA 4J1TC 4QDZA 2K5UA 4RIGA 3VPFA 1UADA 2V7TA 5ADHA 1FZTA 5CT6A 2Q5IA 1II9A 3QY9A 3PPIA 1UBEA 1EUDA 2GR9A 4W82A 4DBVO 3VNRA 2ZJOA 4U2CA 3GP3A 3ZDQA 2R1TB 1UBRS 1WXFA 2HX1A 3R2JA 4GNRA 4R2KA 2QN3A 3ILVA 3P52A 5FPHA 4E7PA 2QUZA 4Q5IA 5BSRA 2YJTD 1IOWA 3V1KA 2H4XA 3MT9A 4LHWA 1FJHA 5AOBA 3EMVA 4PR3A 4QG7A 5KBYA 4KMOA 1KGSA 1S3IA 3DE7X 3BMOA 3F2IA 2BFBA 3JQAB 3O5AA 4JDPA 3SZLA 4EHIA 1DZIA 1LX6A 2VJOA 1QO7A 2K4MA 3DOCA 4DA6A 4WT7A 3CF0A 5KQGA 5ALLA 1I9GA 1TVKA 3ZVLA 1HFKA 1UK8A 5ALDA 5MFZA 1PV2A 1KXJA 3Q3JB 3I52A 5I7AA 3MTEA 4ZDKA 3JATB 1RCUA 3W2EA 1X8JA 4BLVA 4HPXB 5G02A 3ITEA 2ZLBA 2QRJA 3DM9B 5I4IA 3ZKAA 5ILQA 3DPIA 3EE6A 1TYAE 4UULA 4HX9A 2BMJA 3B70A 4MWDA 4WW0A 4UTVA 2OM6A 3UMRA 5B6PA 2AFHE 1SU4A 3A6GA 1N5LA 2WM2A 5L6MB 1DQNA 2HHCA 4KQCA 1K3UB 3A6HA 2JZOA 1YVEI 2QAGA 5AVTA 4CM9D 5T6BA 1TUBA 2MSCB 5KHLB 3S68A 4KUGA 3BILA 3DNPA 4XYLA 1M0TA 5H70A 3P2KA 5I4BA 2DFNA 3DF9A 2Q45A 3MHPA 3KZKA 1TQDA 1U2GA 2H2DA 4EKIA 4QO8A 3K5IA 1Z2AA 3KD2A 4QQFA 5AM2A 2NZ2A 1SUSA 4ENSA 1ZJWA 3EGEA 2YV5A 1EUCA 1ZNXA 2IXAA 2WSLA 2CJWB 1EB9A 1KA9H 2BELA 3GRPA 3IAHA 5EG5A 4TRRA 5EMMA 4RD0A 5F1PA 1I3MA 2SHKA 2PZFA 2Z2ZA 4P22A 5FT9A 3ZNOA 2WMNB 4BNVA 2AZMA 2ZJ0A 3KEFA 2ODEA 3WRYA 5MDHA 2CN1A 4DUYB 3ZDCA 2HT1A 3E9CA 2VQEB 1MGOA 4F4CA 2VJYA 1C7RA 1PI3A 2CFTA 2V03A 4G81A 2VRNA 5FF9A 3SJBA 4C3OB 2X5KO 1Z56C 3AF3A 1XZPA 4C7KA 1X7ZB 1ESEA 4ETIA 1EU1A 3BE6A 2VYND 1NX9A 2CK3A 2ODPA 4RE5A 1U81A 3VDQA 3HE3A 4UJ3A 2XXAB 5A4AA 3ZEIA 3ZV4A 3WOVA 3EJWA 4HDCA 1JB9A 1TCBA 3QX9A 2JGMA 1ESCA 3CRQA 3NT5A 3QG1A 2XH8A 3RQSA 4KC0A 1ACMA 3AF1A 4MZDA 4D6YA 4HZUB 4AJ9A 3HJTA 5LUAA 1ZCFA 1SB8A 3KR2A 4NYJQ 3RVLA 4ERXA 1KH3A 5DYTA 4I1RA 3B9QA 1SH7A 5FBWB 1LI7A 1HE5A 4BNKA 4PNPA 1FVOA 3Q0TA 1UBGA 5KTYA 1E1MA 3O26A 2R62A 1NC3A 2VHTA 2LCQA 2W2VA 4OBEA 1JTEA 2NQTA 3HDYA 4QU5A 3DG9A 5FBHA 3FH0A 4X45A 3NFRA 3C5EA 2H1SA 1J8DA 3WMRA 4F5DA 4MR8A 1V43A 2QBYB 1DBRA 2XCRB 5IYZF 4KDEA 3KSZO 1U4NA 2Q6IA 4JX9A 3CN9A 4BQFA 1K92A 1KAQA 2YFKA 3KVYA 4MPPA 2A5GA 3TFQA 2K2WA 4K6MA 5K05A 3UT5B 1OZ0A 2FSVC 3HGTA 1GO2A 3A3OA 5CDFA 4RLQA 2Z2XA 4PHTA 2D1QA 4WESA 4TVKA 3UHAA 1M6VA 2GLUA 2WAMA 3EAQA 3NU1A 2ZRCA 1YE3A 4EZEA 1RXWA 1U8EA 5BQXA 3T7DA 2PZBA 2O2DA 1L7QA 5BNIA 5C34B 2FXIA 2CDNA 2OY0A 1V3UA 3IFSA 2DQ4A 3Q3EA 4R68A 2ZU6A 3S6JA 5BW5A 4TYYA 2DERA 3R3SA 2ZGVA 4YP5A 1UXIA 2FZGA 2JLWA 3Q5EA 2WFLA 3NOOA 2XITA 3T3HA 3WLJA 4MW2A 4S2UA 2BONA 2ZSKA 3ZTWA 4C4TA 5CA0F 4DLNA 5L3SA 2Y0PA 1OPRA 4PRYA 3BGSA 2G88A 3L4BC 4EUSA 1KBOA 2C4HA 2ZRPA 5C46F 1PRYA 5FX2A 1I2BA 3NEAA 3WHLA 3GLFA 1I4TD 3LQFA 5BUSA 4MOWA 4O4HF 4RC9A 2YVQA 5EIOA 3KAQA 2HBQA 4QYIB 2HD4A 2HRBA 4KN9S 4CLOA 3PTAA 2GHTA 1LK7A 3ZY6A 1E6EA 1JHOA 1MTOA 1CY0A 3I1IA 3QU7A 4JYBA 4Z99A 3TLGB 1AKEA 4A2CA 4ZJYA 2REXB 2PA0A 1KKMA 1NJFA 3B38A 1A4IA 1AGNA 2GCEA 4NMMA 4R2LA 1OX4A 1XJ0A 4J03A 1VMKA 1CG6A 3U13A 2FEKA 2VHQA 4UU8A 2GCOA 4ZO8A 1WDTA 2IH2A 2F59A 2Z4TA 4PX9A 3CNQS 5LQSA 1MNQA 3TD6A 1AXGA 3FZGA 3FPJA 3KQSA 5KOJB 1DKQA 3QE2A 4KYTA 2NT4A 2QVLA 4MRMB 1GAQA 1I3KA 1OY1A 2GZ1A 4WOKA 2RMKA 3RSQA 4D96A 4DSZA 5AO9A 1Q0RA 4OXRA 2NVUB 2BC9A 1V7PC 3LSTA 1C0LA 3JQ8B 4MQUA 4F4DA 1V95A 3OX3A 2N75A 2GNPA 1C0EA 1CTQA 1RLIA 3DEKA 1N9ZA 1YK0A 2GPBA 2FX2A 1M2KA 1WUIS 3W6NA 1OE0A 1MJFA 2JDIA 4D82A 4UHBA 4ARIA 3KPUA 4F5WA 3VKUA 4RW0A 3AETB 3VDRA 1JDUA 1SKMA 3H0EA 3ZE9A 1PNTA 2C83A 2JI6A 4MVJA 1WCXA 4F85A 2W6ID 5JH7F 1P81A 1S2OA 2UYCA 3ML1A 2B8TA 3GQBA 4DYVA 2G77B 3V97A 3ZCVA 1RHQA 4EELA 1YE8A 2QUJA 4ODIA 3LUJA 2WPDD 3LHSA 4UE2A 3TYXA 4A0RA 2IH4A 1SBYA 4DR7B 3K9GA 5D3QA 3NZEA 3NEJA 5LD2B 3II6X 1X7YB 8LDHA 1Q17A 1QHSA 1V1RB 2XUJA 1V7ZA 3EIFA 4WMLA 1FVHA 4B85A 5B4TA 2JJ2A 2D06A 3H18A 1W36D 4CM3A 2X9VA 1NV8A 4GP9A 1QC5A 1OB5A 1P0FA 2ZSUA 4LGVA 3L6BA 4KQHA 5HE8A 4TMFA 4K2HA 3CRNA 3EGCA 4W1RA 3WDLA 2B36A 5EY5B 3OF2A 4KPUB 4PHCA 3RSLA 4QEZA 4DRXB 4DJEC 2HI0A 3HDHA 2PTHA 5FA8A 2UYYA 2H65A 4FGUA 4RBNA 5FUVA 4BPRA 4BVAA 4QZVA 3R3UA 5TB5A 1G4AE 2F3PA 4W7IA 2GYUA 3D3EA 4AW9A 5DNWA 4IFTA 5LJLA 5BNZA 2Z83A 1FZQA 5HIMA 4BRSA 3HN6A 3HDVA 4Q9DA 5F5LA 4ESHA 1UKBA 2IGBA 2BH2A 3B89A 4ZHQA 1PHRA 1YR1A 1T2DA 2WMDA 3V55A 1XMXA 1RZRA 4WCFA 4RORA 3BWYA 1A95A 2C0PA 2PS1A 2GJ9A 2H7YA 4IIHA 2VAMA 4HF7A 1YRAA 2C4NA 3MYYA 3EARA 1U1EA 4MRVA 4X94A 1D2HA 2R9VA 1Z33A 1T43A 1IMOA 1P8AA 3DWIA 2BR4A 3KLBA 3NKVA 4X6LA 4A8JC 5LFAA 1I1NA 4N5MA 4L9WA 4TKMA 4UASA 5REQB 2BEKA 1UQUA 3W8DA 3STXA 2BEJA 3GNQA 4FR5A 5JPDA 3CUWA 1KSJA 3HKDA 1WP9A 2CKMA 4MJ3A 5GAJA 4Q00A 3SEQA 2B5WA 1EFLA 2PJDA 3CIOA 2NUAA 3GFPA 2GMWA 1RT9A 5DW3A 4IWNA 4JBGA 5TQ2A 2VWGA 1FOEB 2CBGA 5E4JA 4TMTA 4B6GA 4D3YA 3JQFA 1EDEA 2C20A 2JD2A 5GOZA 3D1VA 3GMSA 2J45A 2QMYA 4WH0A 1LPNA 3PNKA 4QPPA 3IVGA 2FPIB 1O9GA 1DWOA 1P60A 4HH3C 1R0SA 3E81A 3KBOA 4XQ0A 5LA6B 5I7FA 5DO9A 3JD2A 3LY7A 4BE4A 1M6YA 5JJKA 2V0CA 2OK8A 3S1LA 2CCJA 4RPJA 5HCUA 4YJDA 1N2IA 2GBLA 2EFHB 1GRCA 1J8FA 1JI3A 1MX9A 4FHGA 4J9UE 3NTLA 4IS2A 5LQKA 4RETA 5KQLA 2BCGY 2ZQYA 1LNZA 3VAZA 1MPTA 3ICEA 1UXHA 1XTZA 3GEIA 4UQLA 3KG2A 5J47A 1E79D 4QTTB 2FN8A 4N5HX 1G7RA 1HLFA 1DOZA 4MR7B 4DDWA 4N0MA 1BMFD 3M9WA 1HOTA 1FS4A 2ZUSA 1J2JA 1VG0B 3RNOA 3VU0A 1P2BA 1XZNA 2APJA 3QWBA 4IO1A 3C6YA 2CXNA 4IHJF 5DNUA 1TGYA 1S1CA 2XNDD 3BGDA 2O07A 3I6BA 3X0DA 1K0FA 2AOUA 3OETA 4MDHA 1KEKA 4O3MA 4FDTA 5TF0A 1F12A 2I1VB 2IL1A 3KLOA 1P2UA 3RFFA 2Y0BA 5CM9C 1L7DA 2GVNA 3MXOA 3R09A 2VJMA 3DP9A 4RFVA 1L5NA 5B1HA 5A3QA 4GRAA 4JIMA 4DN6A 4RKEA 2IP1A 1C9YA 1MN6A 1U0OC 3BJEA 3N8NA 5LZ8A 3T4UA 3WMEA 2J4DA 1MW9X 4DABA 2JJYA 3L6RA 4QVIA 1IULA 4X6UA 1OLUA 1BCSB 2Z5GA 4MUEA 3CF2A 4AICA 3FJOA 1QF6A 1FFHA 1KZYC 2YY7A 3K6JA 4IDGA 1E9CA 1Y8CA 3PRYA 4I8XA 3PHCA 4NE2A 4OX9Y 3AM1A 1RR6A 4WOJA 2V7PA 1AKTA 3O0DA 1FW8A 2HIGA 3SC4A 1ULSA 1JEDA 1UJNA 1X13A 1SCUA 3UT5A 2EW1A 1BHJA 4YAGA 4WEQA 1DE0A 1NHGA 1W52X 3LDHA 4KU4A 5BMOA 4RWEA 1NI4A 2NSDA 1XK6A 4OUKX 1VHWA 1IZ9A 1OJ7A 4OXYA 1KDYA 3QLJA 2LGJA 4D74A 1EVJA 2O7RA 4MGKR 4JT2A 1WZCA 4Q3NA 5AJWA 4ZMBA 1KYWA 4UHCA 1ARZA 3ABOB 3LX6A 4PTLA 1JALA 2MIIA 3NJ4A 4DSTA 2MYTA 5HKOA 3P2IA 4J1NA 2C4MA 2VRBA 4YCSA 1YAJA 5T3YA 1QKJA 4DYDA 4BO3A 1WMFA 3HVUA 1CRQA 3G0BA 2JLQA 3EDCA 1EG7A 1Y4ZA 4GH5A 4B84A 4JDUA 1S1MA 3O83A 4POOA 1TW2A 3WLPA 1ONBA 1W96A 1XRQA 5H02A 1CR6A 1QB8A 2BJHA 2D1FA 1T8YA 4O4IA 3K8ZA 3JYNA 1E2QA 2V0GA 2Q5JA 1D6JA 3EWAA 1R37A 2JCGA 4OF4A 5EJAA 1E3WB 1USKA 3ZU5A 3DBHB 3D2LA 3EXHC 2IZ5A 2QRQA 4U2DA 5DPMA 4MHOA 4QOFA 5ERXA 1PNOA 3DMDA 3IOEA 4Y2PA 2XMDA 5FI5A 3FTNA 1XQ1A 2A7XA 4L72A 1PZXA 2AVNA 3ZK9A 3W5AA 4E5UA 4IZIA 4ML3A 3V7UA 4BMOB 4EJMA 2PT5A 4WZZA 3L7NA 1RAFA 1ADCA 1PWYE 5DGIA 3AJAA 1PF7E 3EZ7A 2AG0A 1KF0A 2P3LA 3M9XA 2XDQA 3WYBA 5B5SA 5KNCD 1ZW1A 3K9CA 2Y1DA 3AY7A 1FFGA 5JBIA 2WD7B 4GL2A 2Z4RA 2B61A 4GI5A 4KBYA 3MRSA 1JE0A 2PH3A 4GX0A 5COBA 4TWZA 4LYDA 2XQGA 3KSMA 1ZUNB 2R1UA 1UQRA 2FW6A 1C14A 5HFNA 4KE7A 3FE2A 5A5EA 2PJUA 2Z6VA 2D5BA 1E5QA 1KQNA 1E3TA 4LXXA 4YP1A 4B82A 2VNJA 1E1NA 2W2LD 3DCIA 3HC7A 1G6OA 3LRTA 2OD2A 1E1KA 5ENDA 1U98A 3K0HA 3GPDG 3PNPA 2IS6A 2TMYA 3OTQA 2JVKA 4GVXA 4GW3A 3EVEA 4JYZA 4JV5B 2Y1CA 1NF9A 2VDQB 2PUGA 4OIFA 1G8HA 2IPLA 3L0IB 2H0AA 3COZA 5KOHA 2XF8A 1T3HA 3WAJA 3SSMA 5LMNB 3N3BC 1Q2UA 3IP9A 3A4TA 4BX8A 1E5VA 4UTRA 5B64A 4CIAA 1XUOA 2DUNA 1E69A 4Y6GB 4BO9A 1P74A 4DV6B 1NF2A 1NVMB 1XYVA 4XQCA 4XFKA 5B1YA 1GAXA 4OPMA 3LUFA 4EHJA 4AYXA 4PPGA 4WBNF 2F9FA 3RVMA 2AFHB 1QM5A 2ZM5A 1CZLA 3WGJA 5AFSA 2P27A 3PHIA 2JLAA 3BSFA 2XCIA 2DUJA 5CCEA 1LCIA 4C0LA 4OL0A 1NBWB 3E82A 4JUBA 1CB7A 1E0DA 1CQWA 1M76A 1QGDA 2GO1A 2LWIA 2M9MA 2MU1A 2OG1A 1JU3A 3NXKA 1SIWA 2QTZA 3MWEB 3PPXA 3QMMA 4NDAA 3E23A 4Z1MD 3FCYA 2H5LA 3OH8A 2J5RA 1UZAA 3L1IA 4G5XA 3PEWA 1D6SA 3M0EA 3EZXA 4KOEC 5FFMA 1L8XA 2X3FA 1CR1A 3LYLA 5DNVA 4LVOA 4HVTA 4R2XA 4X1OA 4DV2B 2Z1MA 1WD7A 1K4KA 5AT1A 2B2XA 1Y4AE 1G60A 2GNOA 2OE2A 3H16A 2B1GA 3F46A 5EI5A 1OIVA 2H48A 1RWXA 3N8KA 4GOOD 4HPWA 4IJWA 4J07A 4XIJA 1MO3A 1SZJG 2QLFA 4FFWA 3WGYA 1EE9A 1XZJA 4M0DA 1DAGA 3Q6NA 2ZUUA 1MRZA 3OFND 1AK1A 4XX0A 5EEGA 5KX5A 1O03A 1T1SA 1WMAA 2I67A 2NTYC 3HWX1 1NXOA 3MT7A 1R66A 4PYOA 3LTNC 1QP0A 1JHXA 4MTLA 1CCWA 1FNSA 1HE2A 3R0VA 4QO7A 4XQGA 2O3QA 3AM4A 4D9FA 4F4FA 1R9JA 1XC7A 3WR5A 5K8TA 4EGCB 3EEBA 2CBXA 1QHEA 2J0UA 2YZKA 4Y2GA 3B6IA 3I76A 4X1IB 5B2EA 2VTBA 4Q01A 1NG9A 5HWSA 3QEJA 1ZITA 5TDHA 1V2HE 4GRDA 4YAJA 2YNMD 3SC2B 4QDXA 4GOND 3TB4A 1Y6ZA 2V6IA 4N8SA 3OQIB 4OKIA 3SVZA 4KSBA 3CR3C 4HWPA 2CZQA 3FMFA 2QBYA 4TLMB 4PE5B 1YIAA 2KW5A 2M1ZA 2Q5FA 1JG7A 2RGGA 3QBDA 4BECA 3NO4A 1PZNA 4HGPA 1E61A 4ZVLA 3VGJA 3W9BA 5JYDA 2VJCA 3L8DA 1D5CA 1OAKA 2HPZA 1Z7YA 1FXSA 2QMHA 2VCHA 3GBPA 3M6LA 3JASA 3GOQA 3S5UA 1ADFA 1BU5A 1TGVA 2HRRA 1Q92A 1W1IA 3CBGA 1OFTA 1P45A 4DMLA 1GDTA 1CZKA 3UK2A 4CIDA 1G5HA 5JNUA 1W8IA 1EWKA 3W6PA 3DEHA 1MFZA 5LQDA 2NO4A 5LNK6 3PC7A 1BSVA 1Z0FA 1GL9B 3B52X 3EA4A 1L4BA 3ZCPA 5JAQA 1RWOA 4DSNA 3EPJA 3GT4A 3G2IA 4IDHA 4KBFA 4U5XA 3TKYA 4Q82A 4YS6A 4CKBA 5FOVA 2F1RA 1DXYA 3FF4A 4C4XA 1EP2B 1FFCA 1K89A 1R6XA 1SBTA 3GN2A 4GMDA 5K03A 3H9QA 3ROEA 3ZXSA 5L53A 3OLVA 1BYIA 1WEKA 3IKMB 1GPJA 3QENA 5DGCA 4GO1A 1APBA 5FBLB 3HJFA 4P31A 2NQ2C 4G8BA 3UWOA 4UEOA 3AERB 3JQ9C 1KVQA 4MUHA 2AZTA 1P9WA 3DAHA 2VHYA 4TSFD 3EFBA 1YOVA 2NO0A 2OESA 2O2YA 2WT9A 4BZQA 5IVKA 3H11A 1G9TA 2G63A 2Q6KA 1KOLA 1CEXA 2ZDGA 1CF2O 4UQOA 2QI9F 3RJ5A 2VATA 1JEOA 4B7AA 2IOQA 3PF8A 4TS9A 2H54A 2WSYB 1UC8A 3HSKA 4KI7A 5H16A 4TMXA 1UKAA 3GA0A 4YJGA 1BMQA 1T5BA 4GLOA 4QYXA 5IK2A 2IYSA 5CB4F 4PLGA 2E48A 5HF5A 4Q19A 4TL7A 1QO9A 3RSFA 3SE0A 3LCVB 4BVEA 3GJSA 5KQMA 4GOXA 4BC0A 4EHBA 1PSWA 2AUMA 1EXVA 1OBCA 5CNIA 4RY0A 2CLMB 4UAVA 5E6SA 1M2FA 4FQ5A 5AD1A 1F2UA 1Y48E 2Q6LA 4L4XA 1SD2A 1E3EA 2JHFA 3A70A 4W5NA 1C0PA 1Y82A 4TYNA 1HEIA 4EEKA 3Q9SA 1QWSA 4K6HA 2VPPA 2FG5A 1Y33E 4ZTBA 4QPCA 5ARBA 3C4JA 3JS5A 2PT7A 3KR9A 4U7HA 4N3BA 1T9GS 4UMFA 2CT8A 4YEDA 1JQDA 1LB1B 1K68A 4MVWA 3PLRA 1V45E 4AS1A 1N6PA 4TTAA 4FE3A 4MKRA 2R6CA 1ORIA 4OHMA 2AN9A 5JBQA 2JLXA 1I7DA 4K8OA 1CIJA 3N74A 1JLSA 2V54A 2Q27A 1K0UA 4NQRA 5B7NA 3J80A 3BEOA 1HFJA 2PZLA 3BMCA 3PQ4A 1UFKA 1HRDA 2CWDA 3DBRA 1W5BA 3KFXA 3G0OA 3NEYA 3OPYA 4I9HA 3GD7A 5JC1A 1OASA 2CMGA 3JV7A 4LBYA 4GM1A 2ZB2A 1RFLA 4RVOA 1R5BA 4BNFA 4XEHA 1D2EA 1SVNA 1OT3A 3OKCA 5EE5B 1V8OA 2NP6A 1JDVA 1PD0A 4RCYA 3RNLA 3GVPA 3RABA 5KDDA 2VT3A 5EE9A 4EHDA 4BX0A 1ZCZA 1P5FA 2JFQA 4DTCA 3ANYB 1PZGA 2DKFA 1DV2A 3DVRX 2NT3A 3HU5A 4F4JA 1I3CA 2Q3FA 1DC8A 1ISFA 4X66B 1U0TA 3MNFA 4NS1A 3R9XB 1T4CB 3O8NA 1LV8A 3ZNPA 2SCUA 3WGUA 2BF4A 2WWFA 4D6XA 3I2HA 5TGDA 1H3FA 1LZKA 1W4RA 4JP2A 1KIAA 4FKZA 3FSGA 3QPBA 4E5MA 2PKYX 2XD4A 2BGWA 5GIPE 1UPXA 4B6FA 3AYXB 3H9GA 3OZTA 3I4LA 1XDGA 1M6HA 4M8KA 4QRDA 1CUJA 2Z8ZA 5FA6A 1OXKB 3FKSD 1AGRA 1IEQA 3SFVA 4FM9A 3DT6A 5HQJA 2V7UA 4GLLA 4JZKA 1IPFA 2YYZA 3FFBA 2XE7A 1UUFA 3H2ZA 1H4SA 1HDYA 3HZZA 1TYBE 2YQZA 4G8DA 2F7SA 4RVHA 1KI6A 4U6NA 2IEYA 1CVLA 5DVZA 4NFLA 3Q7QA 2AI3A 3N0WA 3QJGA 4ECAA 5AVRA 5JDIA 1M8FA 3T12A 5BV0A 3LPCA 2PWZA 3WK5A 1C3JA 1P7PA 1P0PA 2XXAA 3KUKA 3QBEA 3UB4A 3H3FA 8ABPA 3EYAA 4JC5A 3EPHA 4CQMB 2D0DA 3ZCQA 4N39A 1KL7A 5COQA 1NYQA 2JJMA 4PY2A 3VR2A 5K01A 1DIGA 1K6EA 1VLJA 2P5UA 3VKWA 3SPXA 1UP7A 4PF1A 4CKEB 4CL8A 4FZRA 5EJMA 3AHJA 3QMPA 4L5YA 1J90A 4TUYF 3NBFA 2RHTA 3T1NA 4Z4GA 4H15A 4Q37A 1LTHR 1DU4A 1WG8A 1FMTA 1WQ1R 5JNWA 2BTEA 5LLSA 2OQ2A 3K70D 4Z49A 4ZAWA 1R4NA 3QFFA 4JBXA 1U8FO 4CV2A 2HRZA 5BWBA 2QSUA 1GKYA 3BE8A 1Y8QA 3GU3A 5IFKA 1OHHA 2BEVA 4ZTZB 4BKUA 3CJRA 2O7VA 4GE0A 3I28A 1D4OA 1POWA 3E05A 3E8XA 3W1VA 1I6MA 2VA9A 1FNDA 1KZ4A 2B4AA 2OGZA 1VYVA 1Q1EA 1R10A 4RXMA 1T1EA 1L5FA 3GLVA 3HFRA 4IRMA 5CLHA 1NP7A 4CLEA 3OEWA 1QFXA 1UDAA 4E21A 3GJQA 4PC6A 2MJLA 3EXG2 3SJZA 1E7QA 3FPCA 4JYCA 1JFSA 1BE1A 2O48X 1NLFA 4HUJA 4KO1S 1JHZA 4AN4A 1Y0BA 2W6MA 4RIHA 4PTYA 1YVPA 1X87A 1W0CA 1YZHA 3P4UA 5A6SA 3WIVA 5J4LA 3ABRB 4GDFA 3C87A 2H5JA 2N47A 4Q1CA 4AIRA 2WW8A 3IQEA 1VSBA 4GXRA 4WKGA 4C14A 5L95A 2V9PA 2FUCA 3CZ4A 1J4AA 3W4JA 1EZ4A 1P1FA 1P9OA 2L2QA 1P29A 5EHGA 4J91A 1EFDN 2J3HA 1SXJC 2V7QA 3ESDA 2AMYA 2B8EA 2SNIE 3BTSA 4UMEA 3TLCA 4ILKA 3VTAA 1QH9A 4ATNA 4YH1A 3DPUA 2VXCA 3NI2A 3HUTA 3UXEA 4YUXA 3RHZA 1LDEA 2YJZA 5FQOA 2FW9A 4YJ2F 1HMYA 2HUPA 2G80A 3CWQA 1ILWA 2O3RA 1Z83A 3FSGD 1MZPA 1ECGA 1ZO8A 2I4MA 4UU0A 4JJ7A 1EE2A 4RK6A 1VJTA 4BMZA 1RYEA 1CJKC 3DXYA 3WNZA 4RXTA 5BN5A 4U5QA 3TE6A 1ENPA 3B3QA 2OBNA 3ZWNA 2PUJA 5F73A 3T15A 1E1LA 2I2XB 1CQIB 4KR7A 5F2EA 3BB3A 3W1WA 1SA0B 5L4NA 1OTHA 2WRZA 2YX1A 3AHIA 3B7WA 4ZCRA 1A8HA 4PGMA 2FLVA 2Q3BA 4MI1A 1A82A 2WJJA 1NU6A 1W75A 2J9ZB 2GERA 2WTEA 1V71A 4C4AA 4I9UA 5EIXA 2V8BA 1YQTA 1J21A 1Z75A 3MS4A 1P4AA 5T8KA 4C05A 1RKXA 1PR9A 1KMHB 1QB7A 4JLPA 1RZ3A 2PKCA 4MPJA 1QG4A 1DUVG 4P5PA 1AY0A 1Z4LA 3DW1X 4X84A 1VQ1A 3CVUA 4ZXPA 2IRWA 5I7HA 4D8UA 4XWOA 1FX1A 1KRXA 3S81A 1VLHA 3ANNA 4JT9A 1XDZA 3E9ZA 4K3UA 3WE7A 2FWNA 4E1BA 1FUYB 4K9OA 3MSCA 3NT4A 4N3GA 3HYNA 4K9RA 2FETA 5LBIA 3E9YA 4JB0A 5IAAA 2O59A 3AFOA 2H1VA 1ZSYA 4JVLA 5IKMA 3OOEA 4Q4HB 1W7AA 4UBIA 2G5GX 3TW4A 1F3LA 1KJYA 1N2SA 3C3WA 3HY4A 2VSFA 3MN1A 2Q5EA 4IGAA 5MN5A 1Z5UA 4GDMA 2IJGX 1CUCA 2WV7A 2XMCA 2AB0A 2HF8A 2R68A 4Z54A 2DR3A 4JMLA 2P9TA 1V7CA 4MWSA 5AK4A 4AKTA 4DG5A 2EKPA 3KT8A 3S99A 4IKEA 4IDFA 2B2NA 1F8FA 1O89A 3EVGA 3QXHA 3ZOZA 1SUDA 2KSQA 1ZK0A 2YL2A 3ANXA 1FLNA 1JPJA 1UDWA 1AUXA 4H7EA 3WHKA 1L4GA 1OXXK 1PJRA 2FPPA 4QDUA 1CJCA 1KJJA 4LIPD 3RAPR 2HHAA 5DLQC 3HLYA 1QRDA 1V37A 2QJOA 2ZS7A 1M34A 3AR4A 3FNEA 4YAIA 3AEUA 1ELOA 4DYHA 1DFGA 1QVRA 4X8HA 2NO1A 2OZKA 2XNCA 4LF6B 3OEHD 1CUVA 4O4LA 2QTVB 1FLDA 2ZIEA 3T9FA 4BYMA 2O4UX 2YQ4A 4C1BA 2WI8A 5ERYA 3IKTA 4GPEA 2OCYC 2IZ1A 1HTWA 2H5EA 1RJGA 2CJWA 2I4LA 1USWA 2W11A 5L4SA 3NWJA 4DIOA 4HQFA 2IUSA 5EWMB 2B83A 2OCPA 3FMGA 4RSRA 5AI8A 4AECA 5J4HA 5FIUA 2VHJA 2BW0A 3IXMA 1H0RA 1RABA 1XHLA 3DYVA 3MCUA 3UYLA 4BNWA 1DLJA 2NU9A 4JEMA 4Z9AA 4QQKA 3TIIA 4XSVA 1P2GA 1N0WA 4MEJA 4P58A 1CVRA 4MRPA 2BDTA 2BEWB 4OHKA 4CIWA 3NC4A 4UTZA 4L02A 2QG9A 1J0EA 4XI9A 1FNNA 2V6JA 5HILA 3TWOA 1D9XA 2C2OA 3ITDA 2Q3LA 2QQFA 4EPVA 3QQ5A 3VR4H 4WLVA 5BR4A 2G5CA 2YFHA 3HDTA 2JFZA 2CEAA 4B4KA 1OROA 2I9PA 1OFUA 4H7HA 2JVJA 4MQ6A 1WCIB 1AGPA 1YDEA 1ZINA 3ACCA 5GGXA 3UXYA 1THGA 2AE1A 1DIHA 1MD9A 1J0DA 2ECOA 1HDOA 2VAVA 4XFJA 4FU0A 4K40A 1E0SA 3DAYA 4EG8A 3AZOA 2Q0QA 1VCIA 4E14A 2E5WA 2C2HA 1G21E 3MD9A 1EK6A 4H16A 1MHPA 3TRHA 1OAAA 2IPOA 1K5PA 1Y4DE 3TUIC 1GKIA 2J5QA 2QTCA 3I61A 1UDBA 2DQYA 3MB8A 1TADA 2OFOA 2TS1A 4BHTA 2IXGA 2MINA 4GBMA 2X42A 2HDOA 2WA1A 3F9CA 3MINB 1SCKA 4JEUA 4HB2A 8MHTA 3DVSX 3PWKA 2ECFA 1U9ZA 4LOIA 5K3OA 3MTIA 3AJ9A 1JGTA 4DLPA 3VH3A 2ORVA 3RVBA 1S3GA 1QVVA 3F71A 1ZEMA 1L4HA 3LUDA 4XWKA 1EM8B 1G21B 2C0CA 1JSXA 2EGGA 4CIXA 3RBAA 2ODNA 3BZWA 4LNUB 1VB5A 2PLRA 5LP6B 2C82A 2OTCA 3TOSA 3WQQA 4DQ0A 2W5UA 4KQWA 3E35A 2QEQA 1FTGA 2DR0A 1B73A 3LY8A 3QNUA 3K9FC 2PUHA 4DC9A 4CFSA 1D4AA 4KWHA 3R7NA 3CVXA 2ZU0C 3IPRA 4WASA 2PA3A 4TLBA 4ZIRB 3ZHTA 4Z9FA 4DMKA 5C81A 3OLQA 2R6GA 5EZYA 1M5RA 4H1UA 1MC5A 3OFSA 1CJVC 2VDLB 3PQ7A 4C6RA 4FZJA 3CRVA 4FGZA 4D1YA 1E92A 1V35A 2CHEA 1L4LA 1IXRC 1BFKA 1KTIA 2X5NA 3GQVA 1PQPA 4G5GA 1LBQA 4KJXA 3GV0A 3SJAA 5JROA 4OU4A 1RADA 3B8HA 4UUAA 3NJRA 3M6WA 2GK3A 1DBPA 1NUPA 1U11A 1JWAB 1XLVA 2FZ5A 3BWMA 4JEIA 4EG0A 1UM9A 2QM7A 3LUPA 4NJEA 3AESB 2B82A 4YV7A 1LSSA 1A9RA 5AM4A 1LU9A 4RDCA 4G41A 1ABBA 3FMVA 3PXDA 4RE6A 1KDPA 4EEXA 1UL1X 1M1NA 4PPFA 3SHWA 1ISJA 2QQ5A 6REQA 4P36A 3PNMA 4NBSA 2IUUA 4W9NC 4B33A 4FKBA 5CH8A 2AOTB 3PQCA 4FNMA 1NW6A 1Z4MA 2BD0A 4IIFA 1DAPA 4HWKA 4P82A 4X92A 4JI0B 4ZA2A 2BLNA 2IXTA 1YO6A 3DQQA 3EIOA 3GL9A 1FFXA 3GRKA 5BR1A 5DWDA 1SM4A 1A0OA 4YIHA 1CQJB 1ZM3A 4JQYA 5JNSA 1HYGA 2HV9A 3DAGA 4YHBA 3VFDA 4CT5A 2AA3A 2XA1A 2ZT6A 4DCOA 2JHAA 2EQAA 5ESWA 2VQFB 3PUYA 3SQMA 2VF7A 1TF2A 2Z3VA 3H86A 3MQ2A 4WK2B 1YR8A 3H2BA 4N3AA 5FWDA 3T7CA 4CEIA 1JG2A 2A0XA 2QZSA 4C20A 2FU5C 3CVJA 2NSHA 5EP3A 4AZ3B 1M7HA 3FKJA 2EC5A 1HL3A 3NNSA 1XAJA 3ZQUA 2MMCA 1SQSA 3FUCA 1LPBB 2OXIA 3V2IA 3VBEA 1HSZA 3OZCA 1FVFA 2P9HA 1DOAA 3HP1A 1YB2A 3NG1A 2WOJA 4NFYA 4FX5A 4W9NA 2CYCA 4ALNA 2Y1GA 1U6IA 1XVUA 1BNCA 1J42A 1DMSA 3QYFA 3ZGOA 3HJBA 5IS2A 4EO4A 5ADUS 5I5EA 3UMJA 1YQQA 3AFHA 1QHIA 4IJQA 5IF9A 3ASYA 4GGPA 3LNTA 2IH5A 2HSWA 3GC6A 4IJVA 2OYRA 4CCSA 2BGTA 2XRYA 4I5FA 3VV3A 1CS0A 3AR6A 3WGTA 2IEBA 2QD2A 4RH1A 4WZAB 4AT1A 3BXZA 1TKBA 1Y7LA 2IE8A 4O1HA 2JS7A 3HACA 3PR2B 3PEVA 3HB4X 1G3RA 1Z29A 1Z2EA 3IPXA 5CLLA 2D3TA 3TTYA 2JEOA 1IHDA 4L9RA 5BXQC 5DN6D 5KMGB 3B36A 1RAGA 3INTA 3MBIA 3MJSA 1Z47A 2I7VA 3GARA 4YO8A 4CR8A 3FSEA 1NFFA 2R7KA 1DBWA 1KI8A 2C5GA 4OGWA 1Q14A 4AG5A 1D2MA 4CG1A 1AG9A 3PX3A 1ISPA 2IIBA 4PS1A 2GASA 4HLDA 3HHPA 1GVHA 3PENA 3DLAA 2JVIA 1SEPA 4FMDF 3JQQA 3E5MA 3OKPA 4UBJA 1Z13A 4QXOA 1BH2A 2TYSB 2EWWA 4PZDA 2PQ0A 3ZQKA 1NRWA 1QJCA 4HGQA 3BGVA 4AURA 1C81A 1T9HA 1Z88A 1H6CA 1PTJA 2Z9CA 2VQDA 4GGMX 2F00A 3A27A 2RAFA 4BWGA 3V00A 3ZTTA 4OLHA 4HP8A 1GPLA 1U5AA 4MGEA 1K8RA 5I7RA 2OHGA 3GRUA 1J5EB 1E2DA 3RS7A 3DHVA 4N5DA 5E9QA 1I7QB 1INLA 5KIAA 2JIPA 4EGAA 5BV2P 2QM3A 3N3AC 4RU1A 1RLJA 3LYAA 3RFTA 1QH8B 1OFVA 3QOYA 3WRVA 5A0FA 4DQUA 3PDWA 1LPOA 2PKEA 3ZK7A 1DJLA 1SCBA 4GPD1 4YO7A 3WQRA 1RMYA 3RKSA 4KXNA 3DONA 1K86A 1XAHA 1N92A 1M2NA 2RKOA 3LO8A 4CMGA 5A3JA 2A5LA 4NNPA 4UNNA 2NYRA 3ELWA 3GB9A 3QOFA 4AL4A 4L50A 3V34A 3LBAA 3V7FA 3FETA 2WTNA 4MNTA 2NZWA 3OQIA 1NT4A 2WPDA 4UE6A 2DCUA 2IS4A 1SVMA 1R5NA 2G7ZA 4GQIA 5HKKA 2CL6X 2RI0A 1WS6A 2BMDA 2NTVA 1H1TA 3OPNA 4KIJA 3PGA1 4MCAA 5AJYA 1FYDA 5L9AA 2P2CA 2CV0A 2I7XA 1GA4A 5D1HA 1Z2CA 3KHUA 4FT4A 2EZ8A 3FJYA 1AB5A 1T0JB 4IMPA 5EFZA 4EA9A 3R9IA 3TBKA 1VXOA 2Q0SA 1TJNA 1P9NA 1QK4A 4GF5A 1L7PA 2C1EA 2A3NA 2C2ZA 4J1QA 4CKYA 5BV8A 1GQSA 1E32A 4JA2A 3UUEA 4RMJA 4KLRA 4ISBA 4R6XA 5ALVA 4A0GA 1Y9DA 1N0VC 3CLHA 4ND8B 4DCCA 1T4DA 3KEOA 1CRZA 4NMHA 2X7XA 1WPXA 4KHZA 2DYKA 2IBSA 1XL0A 4Q24A 4YJ2A 1DARA 3O4IA 3ROGA 3FYUA 4DDKA 3JALA 2R00C 5K8JB 1IXSB 1VHQA 4LCJA 2IKSA 4NABA 4IVRA 3WL6A 2HMYB 3IQXA 4FHEA 4G0UA 1ZUIA 2I6GA 2XWPA 5HJ7A 1GUFA 2XOKD 4AJ4A 4HUTA 3I53A 1J7JA 1K66A 1R88A 5JS1A 4J0KA 3W04A 2QT9A 1CJUC 4LQDA 3R0XA 4LDZA 5FCDA 3T38A 4UVIA 4ZVTA 1DC6A 2WQZA 3KALA 4KXUA 1Z6YA 4I08A 4KNVA 1PYDA 3E9MA 3AXTA 4YP7A 3LDFA 2FW1A 2G04A 3I5UA 2H1RA 2PUBA 4GLFA 5EIBC 1QDLB 2ZJ2A 4RULA 1DMRA 2C00A 4BNGA 2VF2A 3WLRA 1QIMA 1GCAA 2XKAA 3A8TA 3KB6A 3EMBA 4LE0A 1B8UA 3M3PA 1E96A 1HE4A 3KZXA 5H9VA 4ZVSA 1ZMBA 2RAPA 5BR7A 4BJ1A 4LNAA 5DTRA 3GJ7A 1JF8A 1MJGM 2C2XA 1U7WA 3CEHA 4TT3A 4D43A 5I3ZA 2BAGA 3EEFA 3ZHCA 1RI4A 2B4TO 3G5AA 4Y2SA 1X3LA 4E46A 5JCXA 3T9BA 1QZUA 1G7TA 3C16C 1Q7TA 4F2HA 5TLSA 4KREA 3OU6A 1BTOA 4JSTA 5KOJA 3QTLA 3MLAA 3VR5A 1MTZA 2JJQA 3VR6H 3BCUA 3VYSB 3SEFA 1VCHA 4K9DA 2O8DB 3OJ0A 3WDKA 4AUKA 1OLXB 1YVUA 3SFTA 4C87A 3B48A 4KEAA 2EF1A 4BO1A 1U0LA 2F8MA 3JQ7B 4WXPA 4DBZA 1E63A 4M8NE 1ITZA 3EA5A 3KYJB 4YCBA 3N28A 4PTZA 2GEBA 2JFOA 5B1DA 5KYWA 1HNNA 3E5NA 3HFGA 4MWEA 2ONKA 4Y1RB 1OOEA 1WMSA 2JRLA 3RR2A 2ZYHA 2HK6A 3LP5A 2HAEA 1X92A 3P5SA 4EATA 1EWTA 5CFQA 4WNCA 3TG2A 4PLCA 3O92A 1KWKA 5F7XA 1IG3A 4LOKA 2HK9A 2GB4A 3G0CA 4LPKA 3DO5A 1JFLA 2IEAA 4C06A 1TW3A 1YD7A 1M75A 3I9LA 1WDLA 2VJBA 4A2QA 5HJ5A 4L75A 2I54A 4GI3A 2XQFA 4AWBA 2V74B 1YHZA 3JQ7A 2OAQ1 2QP3A 3BPSA 2VDWB 2VLIA 1VLZA 2F43B 4C2UA 4DSAA 1JIJA 3KXKA 4WINA 5CT9A 4R8MA 3V5NA 3IT1A 3JR3A 4D5EA 2OM2A 2XX3A 3GR6A 4FYWA 3H04A 3QWFA 1QAOA 1RQ2A 5KWSA 3V1NA 5SY4A 3V8QA 3HCFA 3DOIA 1KK1A 3EISA 1ZH8A 4WKPA 4C04A 4DIMA 3T4XA 4E3WA 1GT91 4X3CA 1D2GA 5EKTA 1X15A 2FP3A 2AJCA 3F6YA 1T8PA 1NW4A 2ZIUB 3E9RA 3KPYA 3KVVA 4RHCA 4BGUA 3T61A 2X8AA 4GKBA 1Z6GA 2AKEA 1Q7BA 2MDTA 5U4XA 2IYNA 1CHDA 5K0TA 5MF6A 1VIYA 2VQSA 3M81A 2BMAA 3BMNB 3VBCA 2PHZA 4IYRA 2I6UA 2Q5CA 3JVEA 4UBNA 1BWSA 5HEKA 1EIZA 1G3MA 2CJPA 2V0NA 3BOSA 1NVVQ 3EIQA 4FWIB 4IF4A 4BAUA 4R83A 1PDOA 3LKVA 4G6ZA 5JVDA 4HLNA 1JXOA 2KQUA 5AI5A 3RAFC 1SIBE 4QNNA 4EJ0A 3AR3A 2PR7A 3T1VA 3BD6A 2QRUA 3ADCA 3G8CA 4S12A 5B58T 3W2TA 4WK4B 4W9RA 1XZEA 1PN3A 1PD1A 2XV1A 3H0KA 4I1VA 1BDIA 1KEPA 1UFRA 4OXKA 4R81A 5FTKA 3EOZA 2ZKIA 3QWAA 4BLQA 3TLGA 2OC4A 3T1HB 1N2OA 4DMUB 1KYVA 5FWYB 3KCNA 4PZCA 1OBFO 1T4MA 4H3VA 1QGOA 4OSOA 4BKMA 2IW3A 1P1IA 2QMOA 1HL7A 2P0EA 3QLUA 1K8QA 4D9MA 1F7VA 3T3OA 1GXSB 1PW7A 4XOIA 1SCIA 4F2PA 4FW8A 3ZHUA 4NXNB 2XB2A 1JR3A 2Q4BA 4ZAYA 1NW9B 5DHSA 1CV2A 4KKVA 3AEQB 5K45A 1NMSA 1W5SA 4JJ8A 3EVFA 2B5OA 4UVEA 1XCGB 3H5TA 5C8XA 5C1IA 1YJQA 2D3WA 1HE3A 3HGMA 2Y68A 3LX5A 2PV7A 1UBKS 2NO5A 1DT5A 1EQUA 1GSIA 1G291 2RGDA 2PT9A 3DOEA 3GFTA 4G25A 5I8ZA 4DPKA 2MMGA 3T5TA 2WNHA 4QGSA 3HYRA 5CP8A 1YC5A 5KOHB 5K8IA 5CIWA 4FI3C 2ZREA 3FDZB 4P7JA 2YJ6A 4RD4A 4XW2A 4RTNA 4ZD6A 4EHKA 3FWPA 3GGPA 3M4YA 1GZDA 5BO5A 4A10A 2TMDA 1GARA 5A7HA 2ZBEA 1O95C 4IQ0A 4YAEA 5KYXB 3W5IA 4JXXA 3WMXA 2ZTHA 3FJ1A 5I9BA 1Y9AA 3ZZMA 1JEQA 2YWXA 3AUYA 4M1YA 3ZJYA 4DDMA 1KBZA 1E4YA 1T36B 4Z2YA 2IWHA 4C0HA 3I5AA 4UNRA 3IX7A 4L8GA 3RG8A 1Q83A 3LMKA 3VO1A 1BD4A 2OHXA 4URWR 1XDSA 3CW9A 3OBIA 2BN4A 3UXMA 4E3ZA 1M8GA 4ZZ1A 2D1YA 5LMUB 3U9SA 3NCHA 4AJKA 3IEVA 1P18A 1P1JA 4U02A 2IZOA 3E9QA 4WRRA 1XJWA 3M6MD 2XNDA 5BN1A 5IJZA 1O57A 2R6AA 3QHQA 2OCAA 1Q11A 2VHEA 3DCYA 4ZAVA 3SHVA 3AHEA 4RPLA 3C98A 3B13B 4RZQA 3SS8A 1TEXA 4X60A 3EDYA 3NHLA 1NBMD 4E15A 3GHYA 2EIXA 3SQDA 3G3EA 3CUSA 2R7MA 5BSKA 3PA6A 5EGNA 3DZIA 4DR6B 3PC2A 2QPOA 3UMMA 2GJ8A 3ROQA 4G1FA 3UV3A 2JJ1D 3HI6A 5FKJA 2YIJA 3EGDB 3IUNA 3RW9A 4KAXA 5KNDD 1D7AA 1OXBB 2C3MA 3LHIA 4GR9A 3I6YA 1BD3A 1R6AA 4EA8A 1RC0A 2HRQA 4PYKA 5T57A 1VKRA 1KEVA 1VJCA 4GZ3A 2I66A 3RH0A 4D0LB 1EFPA 3IOYA 1EJ0A 5K2OA 2R6DA 2YZMA 3Q7IA 1E8MA 5JMOA 3VPAA 1XR3A 2AG8A 1BVYF 1J1ZA 4I4NA 1G18A 5I9LA 4JBHA 2G76A 3HVHA 4YC7A 3TLYA 2EVWX 4IPTA 2GPWA 2IPXA 4JLVA 1L3CA 2A14A 4B3FX 2C4VA 1NASA 1T0UA 2O06A 1MVNA 1VFNA 4P3YA 3K2IA 2Y9PB 1QIGA 5ELXA 1PL7A 3UM9A 1JDSA 1AQ6A 3DC7A 4DIKA 3AT1A 1KMHA 1OIXA 2C4KA 4RTRA 5JD3A 3DVAB 5A3VA 1YOVB 4R9VA 5EWLB 3HUUA 4R1PA 1JLRA 2HSDA 3HCDA 1E6LA 1J2TA 1FDSA 1TO2E 1BGWA 1Y3IA 2RB5A 1BS9A 1JDBC 1MIOA 1VGRA 3PSHA 5IP5A 3TTVA 2RHGB 1HUQA <