2A59A

Structure of 6,7-dimethyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 5-nitroso-6-ribitylamino-2,4(1h,3h)-pyrimidinedione
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 50
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a59A00
5IM4A 2B98A 1KZ6A 2VI5A 2O6HA 1DI0A 1EJBA 2C9BA 1KYVA 1ZISA 1C2YA 2OBXA 2JFBA 3MK31 1XN1A 4J07A 1NQWA 1RVV1 2F59A 2C92A 1KZ4A 5IM5A 2B99A 2C9DA 1C41A 2I0FA 4KQ6A 1KZ1A 2C97A 2A58A 1HQKA 1W29A 2A59A 3NQ41 1NQVA 2A57A 1KYYA 1W19A 1KYXA 1NQXA 1KZ9A 2C94A 1NQUA 1T13A
chains in the Genus database with same CATH superfamily
3TTVA 2OLKA 4MIOA 2APJA 2CZQA 2VYCA 1N3YA 4MR7B 4TMZA 5FLYA 2CB0A 5EWJA 1U80A 1IN5A 5BN4A 1ZR4A 1DEKA 3W2IA 1J5EB 3GEEA 1MO6A 4IDBA 1RRGA 4DR1B 1VI5A 2PWBA 2XUQA 3CGGA 2I67A 1P1BA 3D6JA 3JQ7B 1YS7A 1YU6A 2WWRA 3OEWA 4DSNA 4NJEB 4IGKA 2PXCA 3WOVA 4R2HA 1IBCA 2JGAA 4FNAA 2A7QA 4QBKA 4JEUA 2WWIA 2HMUA 3OA2A 4FR0A 1F06A 1JHUA 1KYWA 1M2GA 2HX1A 3G9QA 2JB9A 3PV0A 7AT1A 3FAKA 3JD3A 1YOVA 1E6KA 2V7QA 2AS0A 1N6KA 1YBMA 3L6OO 3WL8A 3BZBA 2NXWA 3CLRC 1MIOA 5BN5B 4BDTA 4CQMD 2QD3A 5D00A 1PO7A 2P2DA 4MB6A 5GMOA 1GPJA 2N46A 3QTBA 2JAHA 1FY2A 3AETB 2Q2OA 2VLIA 1FRNA 2ZP1A 3EXAA 2FZWA 1VE9A 2O7QA 3BRQA 4U02A 2BMEA 1KK0A 2COUA 5KO2A 2DQZA 1BVYF 4TROA 3TKLA 5BUSA 1T5SA 5CT9A 1FQWA 1I1QB 1KJQA 1GGHA 4CEHB 4LZNA 3VH3A 4CFZA 1ADGA 3O8DA 4LDNA 4BMOB 4LFBB 1HDOA 2J32A 3N8KA 5FP0A 1LJ8A 1RAGA 1AH2A 3UBTA 3R40A 1WXEA 1CUIA 3HFRA 4BLUA 1DUIA 5LXTA 4F84A 4PHFA 2C5EA 5E7MA 5DX1A 3AXSA 1ZHFA 4M1YA 1UAAA 3GBVA 1S8NA 4KO4S 4EJSA 2PANA 1L1RA 4JYBA 1I3NA 3WHKA 5A2GA 5EE5B 2WWFA 3OLYA 1H2XA 4ZD6A 1LVUA 2DPXA 2IPLA 3IAEA 4N5DA 2C4KA 4M0CA 4BX3A 2CFTA 1PZEA 2UZIR 4A7PA 1CEEA 2ZLBA 5G2OA 1O3YA 4ZAZA 2Q7DA 2UUCB 1UMDA 1H94A 3HWRA 3ME5A 4PZEA 4YXWD 5AXBA 2H07A 2VEDA 3GMIA 2G4VA 2WLSA 1I2DA 2B99A 1WQ4A 3DFIA 1TKAA 3HA5A 4Q47A 1TVKB 4P83A 3AL0C 5FUMA 5BR1A 1DJOA 1YR8A 2PGXA 1NYQA 4M8SA 1I32A 3U39A 5IT0A 3QG5A 2BEVA 1QQ5A 5HOEA 1WXWA 2GN2A 5K4AA 1G4UR 1V16B 2AI3A 1N9ZA 3AJ8A 4A26A 1U7UA 4O2BB 1U7ZA 1PK8A 2JANA 1UQRA 4CTMA 1O96A 2VH1A 1Q2UA 3L43A 1HG1A 4AKSA 2YJZA 2B35A 3OOEA 4JWTA 5JDIA 4YCDA 1NF3A 2HHAA 1I13A 5E7QA 1U8ZA 1PTKA 5BV2P 3GLHE 1H8EA 4XYGA 1LVHA 3U61B 2QTLA 4RMIA 4ZMBA 5JHGB 1QQBA 1BH2A 1SUEA 4ZAXA 4BGUA 1L8LA 2IPMA 4RM2A 5JSZB 1E1CB 3CW8X 5DHSA 1H2HA 5H3CA 3U7FB 1FDVA 5DTJA 2ZJOA 3MPUA 5DE3A 5HQ3A 5K0ZA 5EUBA 4AVYA 2ZSJA 1KOJA 3IAXA 4NBVA 3ZUPA 4BO7A 4OQPA 1IH8A 3C7AA 4LHSA 4QZVA 1DNPA 5HS4A 1UJBA 1RJDA 2AN1A 2PD6A 1ZNQO 4MSUA 4B3GA 3GAMA 3HRHA 3DW1X 2BBWA 5K0BA 1DDOA 1AX9A 2JFNA 3CX3A 3EG9B 3BCHA 3T7SA 2NV0A 2BEJA 2CV1A 3HO1A 2ACEA 3ZDAA 4GX2A 1JDNA 3HJBA 3FNIA 5AK0A 1NVEA 5JYEA 3COJA 5FH9A 4MVJE 2I2AA 3SGLA 2P9YA 5ALHA 3CY6A 2W22A 5ILQA 3ZDQA 1BS2A 1MG5A 4S1WA 1RRVA 4XGQA 1Q0RA 2FQQA 4TMKA 4K9DA 4ARUA 3CKKA 4ROSA 2A3RA 2F3SA 3NOVA 5HJ7A 1Z6ZA 5E1MA 5JZVA 1MTOA 3RARA 1UBFA 4F3RA 4KLAA 4RZUA 2CLFB 2O3JA 1OWPA 2C8LA 4U3JB 3PQ4A 4FHCA 2ZATA 2YZ2A 2GF9A 1JHVA 3QRWA 3UC5A 5CGQB 4S1VA 3WGMA 5A9TA 1QRTA 4TLMB 1MVOA 1YB4A 2CHVA 4CIAA 1NKTA 4J07A 1KH3A 1KO7A 1IHXA 3BSYA 3CTMA 4NWIA 4QBTA 1LQ2A 2VDKB 1Z4QA 3I61A 3KE8A 1U8UA 4Y9RA 2IBTA 3SS8A 1XO1A 3MSXA 1ORWA 1V3UA 2OCAA 5EIBD 2XCSB 3M3DA 3DKPA 3S8EA 4QXQA 1P7WA 3Q8MA 3D8HA 3R8XA 5G3ZA 2XF2A 1A71A 3DS8A 1XMIA 1NC1A 4F3KA 3D4PA 3W5BA 3R75A 1T4MA 1GHTA 3FWPA 1QHXA 2VBCA 1COWD 4RZ3A 5LOVF 5CM9C 4UCXA 3BMQB 3IVGA 1SB8A 3QLTA 4G0QA 4Q3NA 1TCCA 3T3DA 3WBFA 3A4MA 3KNZA 1OQAA 3T41A 1CYDA 4G0MA 4HGZA 1X1RA 4IQFA 4BNYA 1MGOA 1EA7A 3E3LA 3NP9A 2LXNA 3QIAA 1NYRA 1KEZA 3DTVD 2TRSB 4L28A 4P38A 4E5YA 1J25A 1NUUA 2H1RA 2V55B 3FZQA 3K9CA 4GS5A 4S2UA 4E4RA 2CV2A 1SZCA 3QWBA 5B3JC 4D0GA 5T41A 1K75A 3U80A 5JH7F 4TN5A 3FE2A 4CQLB 3GRAA 2YWEA 4EJMA 4RD4A 3PQ2A 1V6SA 3H2IA 1Z4OA 2WJJA 1U5BA 1Q83A 3GQBB 3QNWA 2GRAA 3N8IA 1M1NA 4KSYA 1LZKA 4ZPJA 3GRVA 2YJNA 3HSKA 1ORVA 5JS8A 1T9DA 5K3AA 1KQPA 3FCCA 1KYQA 2QP3A 2VHUA 5BR4A 5GOTA 4LJSA 4G5QA 4OYLA 2HD4A 5CNJA 3FGPA 1IWBB 5L4NA 1W59A 3DLHA 3RFFA 1LI5A 4PPQA 2ZIUB 1M1YA 5EZ6B 2F48A 3LFTA 4ITRC 1WEKA 3IOMA 1H2WA 3HMQA 2PLWA 3A25A 2QM0A 5FQNA 1G3UA 1P6XA 1S0UA 1E2IA 2ZAGA 3FB4A 1A77A 4H6PA 5HPYB 5HDQA 4LYJA 1PLLA 1CETA 2H0AA 2Z30A 5SZIA 4CBVA 3ANLA 2FMUA 2WWVD 2B1RA 4E2XA 3NMUF 2AVNA 1SCUB 1XTUA 1P91A 1SGWA 4WVFA 2OAEA 3DEYX 4EVIA 4FM9A 1UDBA 2RI6A 5ECYA 4EL0A 4CJXA 1HZJA 4RPGA 1K68A 4EELA 1BTOA 1Z2NX 2H0RA 3UGTA 3R3XA 1HFEL 3HKDA 4DR4B 3RVNA 2B36A 2QTHA 1Z18A 4FE7A 3FKQA 3F4LA 2XCOA 3JVDA 4GI3A 4IKOA 4QDTA 5LP1A 4GKJB 2ODTX 1BXGB 1G1AA 1XYYA 3G2MA 3QF4A 3UICA 3I9NA 3AUYA 3ZH9B 3EEIA 1KEEB 3N0TA 1K3UB 4UOZA 1YS9A 2Q4RA 1DAIA 3VX4A 1O97C 3OEHA 2RK4A 2ZANA 5E0OA 1YL6A 1XVLA 2X7XA 5E9AA 5MHTA 10MHA 2CVZA 4Q3EA 821PA 3TAUA 2FG7C 2R0QC 4BP8A 3NRCA 3ZWXA 1ZVMA 3E2IA 3OKCA 2WE8A 5FNVB 2CLIB 1AS3A 1M0WA 2LRHA 4C5CA 4YRIA 4MWZA 5L4LA 1ZEMA 2XUPA 1TZMA 4WV3A 4DCVA 1M2EA 2D0PB 1PEKE 1S7GA 4F2WA 5J23A 4RTOA 2ZSEA 1L3CA 3AQIA 1KMNA 5FTJA 2SECE 1U0OC 2XVAA 4IV0A 2RHGB 4KO3S 4QOHA 4QTZA 1KHHA 4NOLA 4OQFA 1SKYB 5BNFA 3SOZA 2OFPA 3NUQA 3U1VA 2D5BA 3JQQA 1D4ZA 1JQEA 1Y8AA 2P3SA 2AXPA 3D2CA 5IT4A 2MU1A 4Z0NA 4Z4EA 1N3IA 4FCWA 5KNDH 3ZCUA 5B7GA 4DMCA 3UMVA 2VXYA 1E1QA 2KW5A 1ADFA 3SEAA 5F4ZA 3IPAA 4Y2RA 3QK7A 1H2BA 1AKNA 4I3GA 5DX8A 3PNBA 5B3JA 1G21E 1R50A 1ZXLA 2PMBA 2FF7A 3V9PA 2V7PA 4K9QA 4XSHA 4BAGA 3IQGX 4XJTA 2BT4A 1X9GA 5KNCA 2ATCA 1ENZA 5J40A 3RC7A 3KV3O 5FA6A 5CDTA 1B73A 3IIEA 4OL9A 1DE0A 4Q01A 1M3SA 4ZVKA 6NULA 3QVKA 5KX5B 4RJ2A 3WRXC 3VYVA 2J67A 1BOOA 2WA2A 2WT4A 1E5VA 3QXJA 4IVNA 3OTOB 2VQEB 1RWKA 1A9RA 4JEIA 4JIGA 1EM8A 4UEJA 5AXDA 1KJ8A 1RFGE 3BA1A 4GE0A 4TS4A 4XQGA 2XECA 3ZGXA 1OB5A 4I1VA 1Y7IA 4O3MA 3HCPA 2J9FA 1J2YA 4UMEA 4JR1A 3PRKE 2BBOA 3PCXA 3KB2A 1V8DA 4EO4A 1IWPB 1G7TA 1L5HB 5CH8A 1OJLA 1QVWA 2BE7A 3ID6C 4I81A 1GVHA 4LRUA 4RDXA 2FN3A 2YZMA 1E0JA 4MVJG 1MOQA 1AKVA 3LWNA 1Y1SA 2I2CA 4LNHA 5FBKA 3RIYA 3RSFA 2FZVA 1THMA 2GR9A 2BGJA 3WQSB 4CM8A 4DUPA 1OBVA 1RP7A 4RCVA 3DT6A 1JA1A 1K7XB 1ARZA 1NUSA 4C1NA 2WU4A 3MJ4A 4D45A 5ABPA 2I66A 4H18A 4OX9Y 3ULKA 2PNFA 3G1WA 3DBRA 3KEFA 4W7IA 1YDMA 5AW5A 1DFIA 1W0KD 1R5BA 2GK4A 3DFZA 1NWHA 1BX0A 2Z8ZA 3VH1A 3VPAA 4B80A 1JEQB 2X42A 4TLBA 4WUTA 4DC0A 3P5BA 4NXNB 4BNIA 5JJBA 1OFUA 2FPGA 3O93A 3K2BA 2GUWA 4HADA 3ESCA 5LU9A 2AC7A 1R18A 2GN0A 1PJAA 4EA8A 2CY0A 2CMDA 1KYZA 2GESA 3BBPA 1V1MA 4DLZA 3T3NA 1BDMA 1P0MA 5CM2Z 3VJLA 2CLCX 3GDOA 2FDRA 3FF1A 3NYIA 1KWKA 3LYUA 1NBMD 1NTRA 1LC3A 2F43A 3IESA 2BFOA 2JAWA 1QO7A 2F17A 4MICA 1ES9A 3AB7A 4TYQA 1C9KA 1K9SA 3P45A 1JAXA 3EGDA 3HKEB 1GTG1 3U7GA 3K9GA 4HEQA 4G9BA 4ER0A 1AV7A 2VJOA 1Q6YA 3UFXA 3MOGA 2JLRA 1KRXA 2FRDC 3PFHA 3UJ8A 3UUWA 3L07A 1SVKA 1GL3A 3K73O 1KY3A 2BJVA 1N7JA 2X3FA 4KODA 3VOAA 1EWRA 3CLHA 1DZIA 4EUEA 1PFVA 4IIGA 2Y77A 4Q37A 4PC3A 1FNSA 3I30X 4QLBA 3M2TA 5DLQC 4D96A 2BKXA 1SURA 1VDMA 2JVJA 4I4TB 4DANA 3OIVA 3KOWA 4MYSA 4RVUA 1CUWA 2JAUA 2HU7A 2VPXA 3V3KA 2QX8A 1RHRA 3KAKA 4EY5A 1IQPA 5ILOA 2JFQA 3HBLA 1JQJC 3FVVA 3HJGA 2QR3A 3IODA 1TAQA 2EX0A 2OK8A 4O6VA 4RIGA 2P3OA 4IDFA 4XVUA 4MIKA 4UZSA 3FDFA 1OVMA 1RYMA 4W9NC 1E20A 1K08A 3JYLA 3FYTA 4JI6B 2A84A 2YICA 4FNMA 4Q48A 3RYFA 3K53A 2AFIA 2QTRA 4N7RA 1OLUB 1SRQA 1K7SN 1OKKA 2RGNC 1NXQA 2DP4E 1YUBA 2R8XA 4O2RA 3MQ4A 1RNLA 4V0RA 4Z8YA 1JPJA 1P7PA 3HCOA 1WKCA 2B0JA 5AW6A 1U9IC 1X70A 4LYGA 3JR3A 3QKSA 4MX8A 3FFAA 3LFHA 4DYDA 2VZLA 1SOVA 2G0NA 2C8JA 2C1ZA 2KMLA 1ZBDA 2PO7A 3M33A 5L53A 4KCGA 2JATA 5CLHA 2BJHA 4AJ9A 4FR5A 4DV2B 4JITA 3M4YA 5JPDA 3DP9A 4CL2A 1UBNA 2ZCUA 3MJTA 4JJ6A 5EPOA 5AR1A 3SC6A 1XJQA 2VDMB 3KXLA 4JBWA 3ZDXB 1SKYE 2R1TB 1PT9A 2WIGA 2L19A 3AHDA 3A3NA 2FW8A 5DCYA 4JJFA 4WBNB 4F85A 1ELOA 4LOAA 2IYPA 2OKCA 2BMDA 2C4MA 3WLFA 3E9YA 3KZKA 1EQUA 1C81A 5SZKB 4EX7A 2VDNB 1ODJA 3CE6A 3UJCA 4P4TA 3ZD9A 1E1RD 4OQYA 3ZJVA 3SOPA 1T5OA 2VYVA 4REOA 4XUDA 5CCBA 2LIPA 2Y4NA 4UTXA 4WBSA 1X92A 4B43A 1C3OB 1UDXA 2OHXA 4BKQA 2CKDA 5EHQA 2CXTA 1GJRA 3I2FA 1GKIA 3CX8A 2GZ3A 1JG1A 1C3LA 3L1VA 4ZRDA 3I39X 1W19A 1FUUA 3O8NA 2G72A 1GARA 2XLCA 3SEQA 5KTRA 3KWLA 3QY9A 1ZC4A 2RH4A 3EXEB 3KQPA 4KQGA 4IGFA 1HMPA 1QVZA 2REQB 3JZMA 5ICGA 4JD5A 1BXRA 1RWVA 3TAHA 3AHIA 2V65A 1MC8A 3JZIA 4GVPA 2RBGA 1UKVY 1V7PC 4JXKA 5FBWB 4C0JA 4YCNA 1BFKA 3A4LA 5CDFA 3VYUB 3T9CA 5D5HA 2IOQA 4O29A 1CUHA 1WBJB 3GJZA 4UQLA 3VH4A 5LKRA 2IH2A 4NEQA 2EF1A 1EI9A 1YV9A 1O6BA 1WG8A 3PC3A 1K6EA 3MRSA 5C4GB 3UF0A 4QA9A 4TTJA 4CFYA 3D0OA 2VBFA 1QTQA 2Q0SA 3SICE 4G5SA 2XEXA 2AQIA 1JFRA 1VP9A 2WHEA 2FRDA 1RTTA 2AG8A 1VB3A 2HK9A 2YUTA 2WZDA 3ABIA 3OE1A 3TW4A 3VR6D 1VPWA 2FMXA 3JWGA 3PF9A 1G16A 2ONCA 3LPLA 4ARSA 1BGXT 3IUSA 4X1YA 2RAUA 5D2CA 5LIRA 2CF6A 3FTCA 4PAQA 4CF7A 3DE6X 1ILEA 2Y9PB 2GBCA 3L06A 3O5AA 1T25A 1BKYA 4IFBA 3TB6A 3EH1A 3PNMA 4EVSA 5BVGB 1MIHA 1UT8A 1OBOA 2RHDA 4CMAA 5C1PA 4UD6A 3G0GA 4XE5A 4QQNA 2AHRA 5LLTA 2Y4OA 1R16A 5IF9A 1WSAA 5CYPA 2AFHA 4H31A 4ND7A 2XB8A 4HNAB 5ADHA 2RGNA 4WERA 3E3OA 4AI6A 2NVUA 1PP4A 1Z5NA 2FKAA 5AP9A 3AX6A 1P39A 3GN2A 1FMFA 3BD8A 2PKQO 1KMHA 4EG8A 5ALKA 1O03A 3AP3A 1N2ZA 1A9PA 1REQA 3LHDA 5REQA 4JB8A 4B9EA 4YJDA 5IFKA 4MA0A 3P96A 1Y1TA 4YRDA 2D0DA 3HKBA 5SV2A 3G02A 1I2CA 1LPPA 1H9CA 1NOIA 1YXMA 4OFZA 1OA0A 3OLVA 4XYEA 4YMGA 3RR2A 3SC3A 4OHMA 4U6QA 4CUKA 1M66A 3EQ2A 4XVHA 4C30A 1XZKA 2HI0A 1TADA 2BDEA 2RB5A 5GOZA 2Z1DA 2PGDA 4AMBA 5AW3A 4CGZA 3O74A 1PLKA 1C1DB 1SA0B 2P6PA 3I28A 2JIZA 2AL7A 3FVRA 3RBZA 4MUJA 5AW8A 4AYWA 5C51B 2CD9A 4FEEA 1EE9A 3JTEA 2FSFA 1U8TA 2NW6A 3N2LA 5DGXA 2R751 4R68A 4TTQA 5LDDC 1U99A 3I6QA 1ZL0A 2LBPA 1FP4B 4O4IB 3EMDA 1RKUA 1E3QA 3GVXA 1W5AA 3JD0A 3VR4H 1YBVA 3CU5A 3IHWA 2X6TA 3BEDA 3IBFA 3DCYA 3Q7SA 5KNDD 2HJHA 5GJVC 3MD9A 4C06A 3BOSA 1JV2B 3JTMA 1YZYA 5CNMA 1SG9A 3T3PB 1VL0A 3JAWB 4LSGA 2IYVA 1JKMA 1U6JA 1KMMA 1G8MA 2V96A 2AG5A 3SEZA 2C2BA 2AZTA 2VZEA 4XD2A 4RIHA 3OFND 1FXUA 4QOFA 2XADA 1TAUA 2E55A 1KZ6A 3L7OA 3PQ6A 4I14A 4WJKB 4DMFA 2IS2A 1VMIA 1VMAA 1IHOA 2LR0A 4QDUA 3ZQ6A 2VTDA 4HVTA 4JASB 1SNYA 3IDZA 3OD1A 5B37A 1E9VA 3OEYA 4BNDB 5BYKA 4RA6A 4AQ7A 1ADJA 2QWXA 1QFSA 1RCFA 1MJHA 2V7EA 4KYIB 1DRUA 1VKJA 4PAGA 4RWEA 3F8SA 5LP6F 3C1AA 2VAWA 2QMOA 1IOVA 3FNQA 3KKKA 3SMQA 4RTLA 4Q3KA 2X9VA 5B1YA 5KKNB 4WOKA 1F48A 1KAHA 3KUCA 4EMSA 2O05A 1Y1PA 3EBOA 1YK1A 1AXGA 2FTKE 3RAGA 3RG8A 3C3BA 4FT4A 1F1JA 3NHRA 3OBIA 3C7DB 1SKUA 2BDUA 2HWXA 1Z8HA 2QJTA 3L4BC 3SQLA 1YRLA 1I7LA 1YVUA 2HA7A 2AJ8A 3CC8A 3E82A 4UUBA 1KMIY 1BMTA 2JD1A 4K81B 4PHTA 1FFWA 1MB9A 1EJ6A 3A4NA 3FCYA 3GY0A 2YJ3A 5JE8A 4F1WA 4GECA 4LYYA 4MKZA 1TAHA 4AJJA 1WCYA 2XYVA 3WMEA 3NH6A 4YJ2B 3IULA 4DIUA 1JA0A 4K9KA 3BF7A 4MVJH 5FBHA 1CERA 1GG8A 1KDPA 2DFNA 1XD8A 1DG1G 2YWGA 5CD9A 4X00A 1R1DA 2CJYA 1TA9A 2IZ6A 2O8VA 2RONA 2VF2A 2WD7B 2HBZA 3HEMA 4JY7A 5K3BA 5ALQA 4WXEA 4XVQA 4EHIA 3A2LA 4ILEA 2FF5A 1ZNWA 1U28A 4C2UA 3SM9A 2ATVA 1CUZA 2AN4A 2HMYB 3QWAA 4FK8A 1KY4A 3EXG2 3ZY5A 5K4GA 2ROQA 1OZFA 3E6AA 3IAS1 1GWNA 2WPNA 5DW0A 3A4IA 1GA6A 2NN3C 3NLLA 3GJXC 4RLSA 1PBTA 3D5QA 1VE7A 2IHJA 3FLBA 3GZNA 1JFLA 3LC1O 4E09A 4CDRA 1KBQA 1TCAA 3QXXA 3NGMA 2XSZD 5ESDA 3CUTA 4P0PB 3R74A 4OU4A 3SKYA 4LJ8A 1ZITA 3E35A 1H8HD 1VZ3A 2H48A 3NNSA 4CR8A 3GG2A 4D6XA 5C2JB 3AL3A 1O0BA 2VHTA 1C1YA 4ICIA 2JIMA 3PD0A 4QYIB 3RJZA 2FSSA 3EASA 4LVUA 4QPJC 4E2WA 5IANA 4BTVA 4B7XA 1JYFA 1JA9A 2NO9A 2VCEA 4HQKA 2W8BA 3VFDA 5F7ZA 1H2RS 2ENUA 2QUJA 1CY4A 3IHKA 4WZAB 4MWDA 4PLZA 1C50A 1VSUA 1GGNA 3GWGA 3OMLA 1XJ5A 4JENA 5H7XA 3TDKA 3LH5A 1TVEA 1UEJA 1WLYA 2E6UX 2JIPA 2VSFA 3RS4A 1V39A 1GLVA 2GEJA 3KQYA 4C04A 2BPOA 3E5RA 2EYUA 1Z5OA 2WMYA 3SY8A 2O5CA 3DMTC 1CZKA 2IDZA 5MGBA 1NN5A 1Z28A 1MDBA 1QDEA 4D4LA 5CFLA 1F6DA 1Z4MA 3O7MA 3T5PA 2DMRA 2CNWA 2GZSA 5F7JA 4UMDA 5BSHA 1HYHA 2IIVA 5HM8A 1AMUA 2G7MC 4OQEA 1ZD4A 3NQ41 3X1WA 4BVKA 3SK0A 5T4FA 2C8KA 3S44A 3HVIA 3I76A 1MPXA 1QPGA 3BIFA 3G5LA 4MINA 4G0XA 5DI3B 2UDPA 3I2GA 4URHA 3U7QB 1U2TA 3E3MA 2HK6A 3ZDDA 4P3PA 2QNBA 4DIOA 3KQUA 2VP2A 1UINA 2GJSA 2REXB 4NTZA 5B7NA 2UYHA 2FXVA 2J0EA 1B43A 3LDHA 4WKGA 2P2ZA 1P9OA 2QYSA 4ND3A 3PQEA 4TSKA 1PV1A 2XUDA 3I9FA 5AWFC 2CMHA 1W76A 3TEJA 5CAEA 1EFCA 1R9JA 3BMOA 4WAUA 3LK6A 1XZHA 4MCAA 1IXYA 5IAEA 1MZPA 3BXXA 3TZKA 3V48A 4L7VA 4RPLA 3L4BA 5F78A 4RZHA 3U37A 5EJGA 2WUVA 4BRWA 2QG9A 3DZIA 1P5FA 2L69A 2V5AA 2V59A 2YOHA 4RELA 4O4LF 5FUXA 1R3UA 2EGHA 3HKCA 3K8YA 2A1UA 3GP3A 1CUXA 4FD2A 4R3UC 4X3PA 4BAZA 5SZJA 3R7FA 4AS1A 4WKCA 3K9LA 2XXJA 1VPDA 1P7ZA 4FGZA 3TDMA 2BEUB 4LJ9A 1DIRA 1HKHA 1NT2A 2G9QA 3L8HA 4GLJA 4HFNA 1L5SA 3UMRA 3BXOA 5FWYA 1XVAA 2WB4A 4J1NA 1QH9A 1V47A 3ORSA 1F5SA 3O8OB 4YAWA 3FX2A 4Q9JA 5D3QA 2Q46A 4OJKA 4S1NA 2I6TA 5FIUA 1A9XA 1UXHA 4ME6A 1K3FA 4PQYA 2ERXA 3WX0A 5B1IA 1U7WA 3TXXA 2WKPA 5KOJB 4LZZA 4I1RA 4UU1A 1PGJA 4QFDA 1T15A 3E70C 1EVIA 1T2UA 3SJZA 1F2UA 3D8RA 2IUYA 3N2GB 4PRYA 4P4NA 3T9DA 1BDJA 2Q5LA 4MW5A 5HF5A 5GM1A 1U0EA 1U7XA 1EUDB 3A1DA 1P74A 1W0JA 2PZAA 2QSJA 3KYCA 1K2VN 1CE8A 1OXXK 3B78A 4G97A 1CLEA 2FX3A 2HV9A 2Z9DA 3NVMB 4XGIA 5K1ZA 5KVCA 3EAQA 4FYMA 3ZIAD 1UCFA 3A70A 4KQCA 5CRIA 3D4OA 1N5OX 3WAGA 1V3TA 4U5XA 3GH1A 5BP7A 5AVUA 1PR6A 1DIHA 2HWYA 3IIJA 1UJ4A 2NTVA 5AOBA 2M6LA 3PQ7A 5CIWA 4ZC8A 3HLTA 4QNRA 2JJQA 2OK7A 4IMRA 2WQZA 3F9RA 4CKCB 1JB1A 2P40A 2FR1A 5F23A 4XDYA 1TLFA 3D2AA 4MVJF 1THZA 2VPWA 3OA0A 3N9IA 3ORRA 4RVGA 1LWNA 2FH5B 4FDTA 4BRSA 1W36D 2QUBA 3RS0A 1EZ1A 5CLJA 4YFVA 2ZE6A 4GPD1 3GUCA 1TD9A 3LM8A 3ROZA 3WLHA 1JHXA 5H81A 4YRCA 3AVXA 1EFKA 5KMGB 3OCCA 3HP4A 2D5IA 5M5BA 1CY0A 2CJXA 5CB4B 3DV2A 4BFWA 2NMVA 1H0KA 4X6XA 4TWIA 4YA6A 5TPZA 3TOVA 3QHQA 3C8UA 4UEWA 4QDZA 3VDRA 4A1OA 2SNIE 4GQAA 4EYSA 4LCJA 3Q3VA 2FPPA 5LDHA 1VXOA 2XHZA 4I1UA 5EHXA 4F4HA 5EXDA 1CZUA 1JEAA 3ND6A 4MJ3A 2PV0A 3FXAA 3VOTA 4G01B 1GQRA 1WW3A 3Q8XB 4YN3A 5IARA 4MJLA 3RTCA 4F56A 2GZ1A 3KYBA 1XMXA 4KXXA 4N9QA 4Y1RA 1FYWA 4US0R 4CI9A 2Z3WA 4CG2A 3BFXA 1BYUA 5DBFA 1ZYUA 2YHBA 1DX4A 1ZJ4A 3VO9A 5HIKA 4R6WA 1HLFA 2J3IA 6YASA 3COSA 1ZUHA 2QQGA 3QOFA 1CRLA 1MXFA 2X0NA 2PKEA 3K0CC 1OYYA 5IUKC 4QHSA 4QGSA 4EBBA 2UU9B 4GDFA 3ICQB 3PNPA 1X1CA 1T9ZA 3BMNA 4WZAE 4NRDA 5FR2A 5JMOA 3H5TA 3CNOA 1YUMA 5ULLA 1JHZA 3CF0A 5IM5A 2QMHA 4ITVA 3TZQA 1Q74A 2DETA 1D7AA 2A58A 2C98A 3OIWA 3F1LA 1INLA 3N59A 4K88A 4LC0A 3SSAA 1W85B 1PJ4A 1XK6A 3S70A 4HGNA 2ZS8A 1MB0A 2MMGA 5IVDA 2CFRA 4C22A 4JK3A 4YJ3A 3GPDG 4YPVA 1EUCB 4J0GA 3JWJA 5ALYA 3WYGA 4CV2A 4YDSA 1ZGBA 3JXEA 2IBMA 2NXEA 1NJ2A 3SAJA 4RVDA 3KO8A 4FDUA 1A9QA 2A9OA 2JCXA 2X8AA 4CV3A 1KK1A 1GNVA 4E03A 4JP3A 1EVYA 4G4IA 4QGAA 1A98A 5DXJA 1ZXBA 3A1UA 3FDZB 4ETNA 3RS5A 3BPSA 3TSOA 4ZEWA 3DL4A 2D62A 2YHSA 3KJXA 4J2OA 1NW5A 2FUG1 4WJLA 1OILA 3IOCA 4QTXA 1K89A 2A0WA 2CLLB 3NWBA 4W8GA 1N9GB 1VJ5A 2C95A 4WUVA 2DT8A 2VKTA 2HGZA 1SPBS 3IAHA 4YJHB 3RBXA 1QF9A 2N9UA 4HD8A 4UDNA 3C6KA 2F1IA 3CJQA 1SBCA 4RX1A 1R6VA 1A7UA 2A0KA 4CEIA 5KQGA 2PX3A 3GT0A 2YZKA 5E9JA 4BKPA 1Q1EA 3REQB 4V38A 1P4JA 2P9CA 4FIDA 2XHEA 2NO5A 1H2FA 2VJMB 5TV2A 1XHLA 3QWHA 1VJDA 5CLIA 2FPKA 2VRNA 2KJQA 2N1MA 1SIUA 2X22A 3DLAA 3QKWA 4ED9A 2IYQA 2V0CA 4BMDA 2GCGA 2GLXA 4D1YA 1T9AA 1EAMA 5B1EA 4YMUA 1X7XB 3ED5A 3NKFA 2XBMA 1S7CA 3M70A 1L5RA 3O6VA 3G8BA 4H7IA 5BMVA 3DZHA 1RWPA 1Z07A 4WDRA 1S2NA 2YBEA 4L73A 3AERA 3RUHA 2IHTA 2PFGA 1O57A 4UHCA 2FFQA 3A9RA 3GK3A 1BN7A 2B94A 2C8VA 2QRJA 3KX2A 4L27A 5T7BA 1BHJA 3E15A 4JS0A 1UK9A 5DHQA 4BKOA 2IH4A 3F2IA 3I2YX 4YP0A 4NCBA 3M6LA 4R81A 3WGKA 3TECE 4KHZA 4ZVTA 1U6IA 2FEWB 2HCTA 2QPLA 3QI7A 4AF7A 1HOXA 1ZW6A 3P5SA 1XLUA 2FSVA 4I1SA 4KXNA 4NOKA 1PFKA 2FWNA 2NV6A 3TPFA 3UQZA 1RJFA 2H1OA 4XTRA 2FPUA 3OECA 2HRDA 1ZIDA 2R68A 2GDZA 4YAOA 1JR2A 4HR7A 5JZ9A 3RT1A 5A04A 1KPHA 3G5MA 3K0CA 3DE7X 4N7JA 3IUMA 3GZJA 4KN9S 4PLYA 4CKWB 5B2FA 1PT5A 1IXZA 1F8YA 3T7JA 3UAOA 4EUNA 1NM5C 4NENB 4DKXA 3KFLA 2RKOA 1CUGA 1EGAA 4JOBA 4RENA 4Q05A 5LBUA 3U7JA 1JQAA 2GM9A 3BILA 1VHJA 4RHYA 4I5FA 2HXGA 2IV3A 3V8RA 1CJSA 3FI9A 1F8GA 3KLBA 4P92A 3THSA 5ITZB 3KIPA 4JX9A 3WV5A 5FHRA 5TF4A 2XXAB 3O47A 2A0YA 3FNGA 5GP1A 3HFSA 2WWTA 4QD3A 3HMKA 2IE0A 3BCSA 5JSQA 1ULTA 1XHFA 2I55A 4MQ4A 5EPEA 4ESEA 3IP5A 4C14A 3S81A 2F4VB 5BYBA 2AT1A 1TKBA 2YOFA 5ALMA 5C7OO 1U8AA 2XLBA 3E03A 4ZCIA 4ZCSA 1A4IA 2FGJA 3QU4A 1VSTA 1DUSA 1FOEB 3LXXA 3OTIA 4GD3Q 4PAWA 3H8VA 4I5DA 3HK2A 4F71A 5J5AA 1HYBA 5IG2A 3G9UA 5IYZF 3OBBA 2E4AA 4NPCA 4DV5B 4K28A 2P2GA 2XNSA 3TCKA 4EHHA 3H5OA 16PKA 1BD4A 4INPA 4BQRA 3MGGA 1PLJA 3EBPA 4F5DA 2VA8A 3ZQKA 2D6FA 4MQBA 4DXDA 5I7VA 3KKMA 1ECFA 5IJ0A 4WA7A 2ZJAA 3BXFA 3B1FA 4I7EA 4J94A 2G1AA 3CZ4A 4WY8A 2ZUSA 5CDGA 5JVDA 3ZD7A 2OVFA 4J7UA 1KQFA 3NC0C 1ORHA 4GR5A 2RGAA 1MMFB 4PN3A 4KWIA 3TOZA 4AZWA 1IVYA 2CCJA 3D7KA 2QK4A 2PBZA 4BYMA 1JFSA 4U39A 4CL8A 2J33A 4HNRA 1YSCA 4YAGA 4UHFA 1GRCA 3EAGA 2WUGA 1GM5A 3MTEA 1T34A 2JD0A 1Z0SA 1D9XA 3EGXB 4KYTA 5FO1A 1X2BA 5G53C 1M6HA 3OT1B 4CHTA 4QAJA 2E21A 2FW9A 2CNKA 2JCGA 4GVXA 1UM9B 1LJLA 1EWVA 4NMXB 3MEQA 4MLZA 4PO1A 1JVSA 2XDWA 4HSEA 4KAAA 2C2KA 4MV8A 5A6SB 4B3MB 4XIYA 1NVAA 1OTXA 5A7FA 3V1KA 3FRJA 3H5NA 2MCFA 3S6JA 3V4FA 2JBWA 3ITNA 3VVMA 1H1DA 2C7GA 4HDOB 4HYTA 3TN7A 3K1AA 2PZBA 3OQJA 4KUGA 4IIYA 4NU0A 2GJ8A 1FPQA 4MPPA 1JSXA 1QC5B 1QK3A 3IC5A 4B1FA 3DR3A 1H42A 3QYJA 3TD6A 3RTBA 4OQNA 2C31A 5KHAA 2UYOA 4I08A 2JK1A 3UHPA 4CM1A 1LLCA 5F1PA 1FX0B 3C1OA 3B51X 3SQXA 3Q1LA 1EWQA 4MI1A 4ZQBA 5E6UB 5EJ5A 2KBFA 2C20A 1WW2A 3FOCA 1T5TA 1WSWA 1Z2CA 4KJXA 5EAIA 3T7IA 2FPOA 5BRAA 1RWMA 3VPCA 5K0JA 1X86B 4BEJA 3ANTA 2JJYA 4R2MA 2Q2NA 1LLDA 1U3UA 3DC2A 1ZD2P 2Q29A 2WHYA 2WU3A 4ZODA 1AUPA 1V4BA 3GA5A 3GEDA 1RBZA 1FTQA 1NMXA 2C58A 1H65A 4KO2S 3TL6A 4XYBA 2VHJA 4CDNA 1NM5A 3DNFA 4JUDX 4RJKA 2EFHB 5KEIA 2TECE 1Y5IA 2VR1A 3C3KA 4PXYA 3RAEC 2PUBA 4IHKA 1JI0A 5F7OA 4F4UA 3SIRA 5FPPA 3THWB 1G5IA 4MI9A 2Z6QA 3AFNA 3MTAA 4K9OA 2G28A 2RC6A 1HA3A 1G3IA 1RQPA 2H5JA 2MYNA 1EXMA 1CY1A 2FQYA 1N1GA 3SU8A 4FHEA 4O2LA 2CN1A 4MW7A 4QBHA 5FOVA 4X20A 3HYLA 1S8OA 1UBEA 1ZGHA 2XF8A 3EIOA 3SLGA 1JG7A 3CX6A 3OM9A 3NC1C 1NQTA 3VNBA 2EKQA 4RH0A 3WC4A 1LPBB 1CS0A 3QUCA 4ZIRA 1OREA 4M1QA 4UHHA 4ZP1A 3MQFA 4M86A 5FWXA 4ENTA 4FSDA 1PFWA 3LSTA 3R3HA 1ZSVA 2Z5LA 3KZCA 3CR8A 1LV8A 1YE3A 5DVZA 4F4CA 3KP1A 5JSHA 2QJWA 3WLRA 1Z4NA 2CC2A 5E4TA 5BW6B 2Z6VA 8MHTA 2IZ0A 4P3YA 1A4UA 1LFAA 3L1HA 1IPEA 3DLTA 4RHEA 5ALIA 3QPDA 5H9VA 2GPNA 1USWA 4Y1GA 2EGGA 2DAPA 2YV2A 4EGAA 4CNQA 3I62A 3LWDA 4I0WB 3D6HA 2QN7A 4K40A 3H16A 4ZGGA 5A4MS 3S3TA 3LA6A 4PYOA 1G2OA 3C24A 5DASA 4BX8A 2C5AA 3C98A 1JDBB 4BVEA 5JSKA 4AQDA 4PV7A 3K1TA 1SQGA 4BRZA 4EB6B 3ZD8A 1B76A 2ZYSA 3DV0B 2HN9A 3ABSB 4IIVA 3U48A 1AMOA 3JQAB 2ZQ5A 4IILA 1F3OA 2FUG6 2I1LA 3WHPA 1GUYA 3AONB 5KCZA 3Q72A 3I5UA 4PGAA 4MARA 3W7AA 4ENRA 1DPGA 1Q7GA 2XE4A 2Y1XA 4JSYA 3EQ9A 1WUHS 2ZWMA 2FFHA 4RQUA 3T0FA 5HRCA 3SIWA 3D3JA 2LDXA 1T1GA 3FPKA 1JJ7A 3MWKA 1DBSA 2DCUA 1AKUA 2PQMA 1H3FA 1GQQA 3K8QA 5JJ5A 2A3NA 3II6X 3UHFA 1TKRA 1YCFA 2GHIA 2PKXA 4OD0A 5DSZA 1IZZA 4HKTA 3FM9A 3LCMA 1Z0DA 3HJRA 2VYQA 2PT5A 1E96A 3PGLA 3LWZA 4JLVA 4LJLA 3IAFA 1QF7A 3JAKB 3P97A 4PCLA 3SFVA 3ZZTA 1ZU5A 3ZDYB 3A7DA 1J2UA 4UAUA 4EYQA 3DG9A 2YNMA 1KORA 2MSKA 4XX1A 3A3KA 3IJPA 4K03A 1M10A 2E4VA 2X40A 5C46F 2NZ8A 2BR5A 1R4NB 3FR8A 4J2TA 1UKBA 1ZK1A 4LI0A 2F1RA 3AEYA 2XY4A 2GD0A 3AJDA 3LRTA 3H1BA 4IX1A 3SXUA 4UNNA 4MWSA 3VAZA 5JZSA 1CNEA 1XELA 2QVLA 2ZYAA 1GYQA 4B6JA 5HE8A 3B36A 1H0HA 1VSBA 3EGIA 1UJ6A 5TPWB 1RI3A 3BK1A 3OCJA 4GNKA 3FMVA 4A8JA 1PQYA 4Y2YA 1LPMA 1G4AE 2WMNB 3GNTA 1NP3A 3RLIA 4CG1A 3QE4A 3MNFA 1CZRA 3L7IA 2XTJA 4DMUB 2D3TA 2GGSA 4HY3A 3P9QA 1N8KA 1V6CA 3DMDA 3NGLA 4O4JB 5AJTA 4Z0HO 2EKDA 1EM6A 1T2DA 1XEFA 4G23A 1PZNA 2C2OA 1H0SA 2W6JD 5L45A 1GTL1 3ESDA 3CWCA 2BFDA 3FUXA 5EFOA 1UPCA 2XWPA 4PHHA 3DHVA 3CLUD 5ALOA 3SBEA 1N0HA 4E4TA 2ONYA 2P2NA 2P4SA 1Z68A 1E62A 2H5IA 2QTVB 1X7WA 2YXNA 3GAZA 3N7UA 4OEHA 4AECA 2ZOSA 5IK2D 3S2SA 3E5HA 3ZK9A 3SJCA 2X7HA 4G86A 2O14A 2FK8A 1SWVA 3IV7A 1ZD3A 2SCUB 3ZU5A 4WK0B 3KT3A 3HA3A 4NJMA 4AIIA 2PWPA 2FVYA 3UKJA 3SZUA 3RANA 4I99A 4M8KA 1T5DX 5BQ3A 3CF4G 3EEOA 5FPYA 3KQHA 2A5GA 3NIFB 2FW6A 5BUCA 1UXIA 3IEMA 4R16A 1BOFA 3THRA 3HCAA 3CRW1 4G65A 1JXAA 2DR3A 2J7PD 3LQYA 2ZBVA 4L4RA 1XEAA 1Z37A 4HNTA 2D1RA 1PZFA 2BFBA 3U3XA 5C8DA 4KH1A 4ETMA 4DBZA 5JI3E 2Y1WA 3OG9A 3AIMA 1GPH1 3LE8A 3EXIA 3SDSA 1THTA 4LMAA 3T1OA 4D9HA 5LQDA 4LV8B 1EBBA 2KYRA 1WSBA 3CT4A 3LP5A 1RRFA 3AVUA 1KVUA 3M3PA 121PA 3HXLA 1YNSA 3RC9A 4BFXA 1Y8QA 4EEZA 1RCUA 2CB9A 2IEGA 2K2WA 3MF4A 5DLDA 4LF9B 4U4AA 1J22A 2FR8C 4JV5B 2ZRCA 2AOTA 1SIWA 3TE7A 4X1IA 5K3FA 3SHTA 2VYNA 3GRCA 3DAPA 1R0SA 2PUVA 1DINA 3ONEA 4X7PA 3P2JA 1RXCA 4MW9A 3HB7A 4C4PA 2ZRJA 1GTSA 1LDYA 2WJPA 2H9YA 2VL7A 4DMKA 5B58T 1ZRHA 4Y2VA 4BNLA 2BMVA 1M74A 4KSBA 5HUHA 3N53A 2ORIA 3WFZA 2I03A 3H7AA 2V6FA 2R8YA 3R6LA 3FYHA 1D04A 3ZS8A 1NDQA 3MJSA 4NBTA 3S55A 1CJVC 1NG9A 4P4GA 3UB2A 4JJEA 1D7OA 5IJAA 1VHWA 4LKOA 3E7WA 1FEZA 4GLFA 2I2BA 3EARA 1YACA 1Q7RA 1EFPB 1GG5A 1LS6A 4NESA 1ECGA 2WPDA 1Q11A 3GCWA 1EEXB 1KKLA 2JJ2D 4FZJA 2HPVA 5DNWA 4HRYA 1M6WA 2KI5A 2OVBA 2QPOA 3TTTA 1QU3A 2FEMA 1I4LD 1WL8A 3ZWVA 4EKNB 1S1MA 2AW5A 3DYBA 4NDAA 1W25A 4OMCA 4XB6B 3WO0A 2QLNA 4OLHA 4GWKA 2DUJA 4ZDWA 4DB4A 3MBIA 3KQWA 1OFGA 2QMUA 4DYHA 2ANCA 1CDOA 1G20A 1ZD9A 2XE7A 4FIZA 4ZHQA 5AUOB 2B78A 2W4MA 5TQ2B 3AEKA 3N74A 2VWHA 1SU7A 1NLYA 3P9SA 5KHOC 1TYCA 1Y8CA 3M9XA 3ESRA 1BDBA 4H0CA 5JT1A 5FAKA 5IVPA 2BM0A 2O2SA 1Z6XA 4K9PA 4HWOA 4Q4AB 1Q0HA 5IJXA 4XDZA 1TQ2A 2DXIA 4KIJA 2QGNA 3AXTA 4K5QA 5ARBA 4MI6A 5KYXA 1J6UA 2JKYA 4MWBA 1Z29A 1H4TA 4YT4A 2H1LA 1E18A 3FBTA 1KEUA 3ABZA 1XPJA 4D8XA 2VZ9A 1AKRA 4TL9A 2DUNA 2OORC 3D1LA 2PJDA 2XMDA 1KJ9A 1UAYA 4IDHA 5EHNA 4GQBA 4IIFA 1W96A 3R3SA 3NT2A 2PHZA 1Z4KA 2IHNA 1Q0SA 1I0ZA 2AXNA 4DTCA 1II8A 3B82A 4DHWA 2DQYA 2YASA 1D3AA 2Y2UA 1E64A 3DFUA 3FPCA 3GROA 2ZR7A 1X13A 3LC0A 2DBYA 3NWPA 3W34A 2NYRA 3R3ZA 4PLWA 4V0LA 1EGQA 1ZR2A 1DGQA 3CLSC 3KR2A 4F2DA 3P26A 1T8SA 1TQ8A 3QBDA 2V0NA 4MR9B 3UJHA 2JA1A 3N07A 3Q9LA 2AD5A 3VNQA 1DBQA 4OYRA 3ZW7A 4D25A 2WAMA 1QOPB 1KSFX 2G36A 1ZBQA 4CGYA 4NQZA 3ZHSA 1KPGA 2QM8A 1IMJA 5G0VA 4YRQA 3KZOA 5AW9A 4DNXA 4W1QA 3Q5EA 4NK4A 4RY0A 4C01A 5CCEA 2FZGA 1PZXA 1R8QA 3V4RA 3CR3C 2B61A 3BIWA 5TDHA 2E5LB 3IP7A 5AK4A 1XN1A 3B1ZA 4NFLA 1Y63A 4P08A 4CQLA 1G8PA 2HNBA 4IO1A 3GQVA 4RXMA 3TWOA 1XP5A 3LOUA 1VGRA 3C8DA 2GMWA 3CB2A 3MLEA 2B8JA 2ZYTX 1OXUA 4OSOA 5ADWA 2QBYA 3HYTA 4QFMA 1KJNA 5LJLA 1WAMA 3RHTA 4M0FA 4XJSA 2EGUA 5DO9A 3TOSA 4CDMA 1MVLA 1AV6A 2NU9B 2IYWA 1M8FA 4IWYA 3G8CA 4G41A 1UPFA 2H8KA 4S24A 3GU3A 1EHIA 2GZ2A 2B25A 3BULA 3R0VA 1M33A 1SCIA 3O4JA 2B4YA 3JYNA 1DDGA 2PLRA 2WSBA 2HUPA 1NF9A 2HA4A 3DZKA 4H6XA 3LW7A 3EGVA 2FOXA 1ZGAA 5HUQA 5C8ZA 1Z5VA 1ISJA 3EISA 2QLMA 1TJPB 4FQ5A 4XPIB 5FJJA 1R5JA 1WXXA 2GVZC 3F6SA 3GCGA 1NQWA 2YW2A 4QUBA 3A10A 4Q9AA 4UM8B 2V3VA 3VX3A 3A6DA 1LPOA 1KP3A 4MYRA 2BTQB 1JIKA 1OY1A 3BZWA 1JB9A 3K05A 4OK6A 3AB3A 3WKEA 2AWOA 1AIPA 2NQ2C 1NQOA 2BGKA 4H9GA 2X9NA 4KQIA 3UUGA 3OPVA 3O3NB 2R4QA 1MGPA 3CWQA 4FDVA 5BUQA 2A57A 1U1EA 3JWHA 1GGMA 1U8YA 1KF0A 3O38A 4YJFA 4B5LA 5FNZA 5INTA 2FB9A 1BIFA 1GFWA 2QL7A 4ND5A 2B98A 4XLTA 5JR3A 4LSMA 4HWKA 4I5GA 2WSIA 2ZROA 3JQ6A 4TUYA 1EUQA 2DLCX 1NUTA 2I22A 3DMHA 1FXWA 1PGQA 2JZNA 3GUVA 3EOZA 3E05A 1GGEA 2A88A 4B7UA 4CM8B 2QIOA 5LD2B 2R1UA 5L3QB 1YVRA 4TYMA 4D80A 1G59A 4PFJA 2PH1A 5CEEA 2OWDA 3RVBA 5KIAA 9ABPA 3AQ4A 3M5CA 1S3GA 4GNRA 3A6FA 1UPUA 5DGHA 3VR2D 3DBHA 3OQMA 4KQKA 5EZYF 1ZH6A 1RHUA 2H17A 2PBRA 2O2CA 3A06A 4G56A 1TL7C 4PE5B 4XSGA 3ZHXA 4DGSA 1L5QA 2G76A 2QZPA 2NO4A 4M6WB 3RIMA 3TW8A 5LQMA 3ZCQA 4YR9A 2OORA 3B2EA 3T7AA 1J90A 4RLQA 4XIFA 3JARB 1B26A 2OD2A 4BNKA 3OCVA 1RU3A 3C2QA 4OKNA 5DKFA 5B36A 4J03A 5L7YA 2VNKA 3PLNA 4OSEA 2D13A 1KZGB 2KQUA 2YW9A 2Z3VA 1JH9A 2R6FA 4PLTA 2ILVA 1NNI1 1QHHA 2NZUG 5ALTA 1AC5A 4PLPA 2ZBRA 3CPHA 4YUVA 3V55A 2NTYC 4ABYA 4B46A 3I37X 2HSGA 3F73A 4RHTA 4WESA 4A03A 1M7BA 3U40A 1FSSA 1W4ZA 1D8TA 4MRRA 3E22A 3FKSA 3Q2OA 1BE1A 3UH1A 5BN5A 4YJGA 1X7ZB 1GILA 4BMXA 1GKLA 4FWBA 4QQFA 3MXOA 5KWSA 3A4YA 4YUZA 1OH6A 3PEYA 3NONA 3DE1X 3ZH2A 1DU4A 1M6VB 3WGLA 3CJRA 1B8UA 1WCV1 2QUKA 3KJGA 4BFLA 3EVFA 1GEEA 1S4QA 3HJTA 1JDTA 1R0ZA 4QODA 4RKWA 5JO9A 1E94E 1ZM3A 3ECSA 4EMBA 1SBNE 2COKA 1TA0A 5DBGA 2X13A 1Y3CE 3AR6A 3R2JA 3ER9A 1AGNA 4HLUC 4AD8A 4QELA 2N0SA 1ZGCA 2XQVA 5ECWA 3K9NA 3TJMA 3C6XA 1UDWA 5CX1B 3OSUA 3HPQA 2CBZA 2MSNA 1XE3A 2A1TR 1AVTA 5EXSA 1AM4D 3ASYA 1HLPA 3MGAA 4IJQA 5KWVA 4DILA 2WKRA 4IIJB 4D3SA 4EMUA 4X94A 1U9ZA 2YL2A 2H4ZA 2WV9A 3ZKWA 4FB4A 4YAUA 3KETA 1YQTA 4DM3A 4EPWA 1WE2A 4CG3A 4EZEA 3GHYA 2O07A 1OVGA 1YR9A 3F6EX 3KKOA 4XM2A 3BHJA 3GYBA 5T4EA 4RIFA 4Q1FA 1DQPA 1DQYA 1JL3A 3G2LA 5A3RA 3GDHA 4FXPA 1X14A 1ZMTA 4DLLA 4KJZA 4TV9A 4CLOA 2PTGA 1MORA 3R3JA 5LZ8A 5FEMA 5KYVA 2JFWA 3GUHA 3C5HA 4LNUB 4U6SA 4Q34A 4WZBB 3ZX4A 1QG0A 3L4KA 2GF0A 2GRUA 3VKGA 4WK6A 2NXNA 2WJVA 4GKKB 2GCNA 2YC2C 3UMSA 4S1OA 3WMWA 1K97A 2YWCA 1U3DA 4NX2A 4PYKA 2CK3A 1U3VA 2O1SA 3HCFA 3S8MA 3I8SA 4NV3A 4OV6B 4C7VA 4JVNA 3G1TA 3HDGA 5JFTA 1T1SA 1ORTA 1UFKA 1D2NA 2ZUVA 3CS3A 1PR9A 3HJNA 4D44A 5J2TB 4QNNA 1P1HA 3BQNB 2AKEA 4KEAA 4AX4A 4GGPA 1OV4A 4E5KA 4QOJA 2ZXUA 1JJVA 3DE3X 1NI4A 4KN8A 5F3RA 5B1SA 4OBBA 1SXJC 1H1LA 1P0PA 4UTVA 5BOVA 4DG9A 4RJTA 1VCHA 2O0LA 4F3YA 4NDNE 4CT4B 2OQ2A 1N75A 2ZIAA 3VKWA 4JI0B 2YXEA 2DWPA 2PAFA 4A1FA 3AVVA 4HDKA 1EUYA 1WULS 5FLEX 1FYDA 1RZUA 1VB5A 2I2DA 3IE1A 3QVWA 5TIIA 1V45E 2FPXA 1Q0ZA 3MB8A 2I4MA 3L77A 3NRJA 5DM0A 3LWBA 2DHDA 2IZZA 2ET6A 2E1RA 3CW9A 4MO2A 3UWMA 4BVAA 2VYFA 3ZVKA 1DUVG 3H4TA 5KOHB 3DMNA 1KI3A 3ORQA 5L95A 1ML3A 2YWBA 4Q19A 5FOSA 1SC6A 4XZ3A 1CT9A 1U2DA 4ZYYA 3AI7A 1HL7A 4WCVA 2IPNA 3V7FA 2NSDA 4DLSA 4DV3B 1IIRA 1RADA 1AN0A 1VJCA 3VZSA 5J4YA 2BFFB 3OHMA 3ZGZA 3MJRA 3JALA 4HGOA 4JEMA 5LZ7A 4GI2A 4BE7B 3F9CA 2CEAA 2DFTA 5KC8A 2GN9A 2IIBA 3SQNA 3AFHA 3ZWDA 2R86A 4W9RA 1BMFD 1DKUA 3T94A 4AKIA 1CD5A 4H1TA 3YASA 4NZYA 3VZCA 2FMTA 1RYHA 1TDJA 4MPTA 2JD2A 1U4NA 5BW4A 1Y8RB 4UXJA 3CKMA 3TSCA 2Q3DA 4M21A 1EFRD 5TC4A 2NU8A 4G0UA 4L16A 4KYVA 2Q3LA 3PXBA 4QGFA 2YFQA 3GGJA 2E85A 3KQQA 2BUAA 1GNRA 4CCYA 2XCTB 1KJZA 2MINB 4NULA 4G9GA 2Q2QA 2Q28A 4YJKA 2G4CA 4GO1A 2B8EA 2QRNA 5FUYA 3WP1B 1XTQA 3PE6A 2NU7B 5BSEA 4N0DA 3WKBA 3B7WA 3A2MA 2PXXA 4X6LA 1T6BY 3ZW8A 3BM5A 3HJFA 1DV1A 1F7UA 2OC9A 5D5QA 1AUXA 2ODEA 4BLVA 1EHCA 2P6MA 1E9CA 3AI1A 1Z26A 1UMBB 3A2NA 5LYJB 2HW8A 2O1EA 1XGKA 1US8A 3LT5A 3Q0IA 2O54A 2VA9A 4CCSA 4M3NA 3Q7IA 3EVAA 2O8EB 3U60B 3KLOA 4ZYUA 2OP1A 4PLVA 2Q5HA 1NYTA 3G13A 4JC8A 1N6PA 2KB0A 4WCFC 3A6EA 4EQ6A 4ZYLA 5ICFA 2Q8PA 3KOUA 4PAMA 1FA9A 2NUAB 4A8HA 2QHXA 3QBEA 5A4AA 3RF6A 2XKAA 3W5CA 1JSRA 5L51A 4P0QB 3BT7A 4GUDA 2G1KA 4RSMA 3OZCA 3Q15C 4AZ0B 2XOKA 1ATZA 4FSXA 2QRVB 3PC4A 4GICA 5K20A 1KI6A 4ZHQB 3I9MA 4DXAA 2G4LA 2GK6A 1FS5A 3G6KA 3GOQA 3Q9SA 4HH4A 1L5GB 1KNQA 4RPHA 4Q7QA 2NUPA 4DCJA 1C1XA 1T3ZA 5BV7A 1ZSYA 1A9OA 1L3BA 3RRBA 4XB1A 2HU8A 2V1XA 2XW6A 5EIBC 2EWMA 4CKEA 5AW2A 2YWXA 3IMCA 4Z7QB 5BURA 3I2IA 4KPEC 2JFGA 2PZMA 3JQGA 1JFFB 2HQOA 4PSVA 5IZCC 1XQ9A 3H42B 1LD3A 2VBIA 2EERA 1G8FA 3E1KA 4YGXB 1RQRA 4I6GA 3DMFA 1J8YF 3K5IA 4WZBE 4QICA 4BPRA 2VUHB 2F1OA 4YXWA 4C6RA 4F92B 3FETA 3VNRA 2AR7A 4QYSA 4EFMA 4LOLA 4PLHA 1VG9B 3E2MA 2QT1A 5FPQA 3CPEA 4QUHA 2EFCB 1Y82A 2KSQA 3EUWA 3L0OA 1PKXA 2ZRPA 3HYRA 2DBZA 2ACVA 3VAYA 1LRJA 1XQWA 4YNBA 4FDLA 4WACA 2IC5A 3ADOA 1RIFA 1B3RA 1SUWA 2R48A 3FA2A 1JG4A 3R20A 3DH0A 4KIFA 3OUZA 5EXTA 5B53A 1RM4A 2EXXA 3DQPA 5IAJA 4E33A 3FUWA 4WW0A 1IN7A 3VO8A 5L6LB 1Y4UA 2XZLA 3NAQA 4JI3B 2EQAA 2WFZA 3S29A 5C18A 3IBCA 2C2HA 4N5IX 3T3GA 3U16A 3N8DA 3U9SA 3PKJA 1GTVA 2GILA 1ZNZA 3UN1A 1B41A 2G1PA 1EJ2A 1DTSA 3CH6A 3CVJA 3NR2A 3LGSA 1JXOA 4KGDA 2W70A 1IJEA 5KJCA 1D0VA 4W5HA 3D3NA 2YJGA 1IJKA 2QYTA 2V4ZA 2IIQA 4DIBA 2ZWIA 5IJWA 5TX7A 1SZJG 3F8TA 3B1KA 2ISQA 4M0MA 3EJWA 2BHSA 1Z39A 3BJIC 5DHUA 1OYWA 5ALPA 5L9AA 3BL6A 1DAMA 3UAZA 3RK1A 1TTPB 4X65B 2A0FA 1H8ED 2IS6A 3OY2A 4M98A 4MGKR 1KTIA 3F5FA 1O5TA 4IFTA 4ZK2A 3O1JC 7GPBA 4F93B 3LNTA 1GZ6A 1V26A 3D8NA 2GT1A 5DYTA 3VHXB 1X8LA 3PJRA 2ZUBA 1DCKA 3RYIA 4HRVA 5DNCA 1Z06A 4DV6B 2ODWA 4UE3S 3S2ZA 1OCEA 3M82A 5HF6A 2BTEA 3RS3A 3FNRA 1AA6A 2GEKA 3MINA 4LDPA 3OZDA 3X2EA 5BN1A 2B30A 3WK5A 3WQRA 4WCFA 4PZUA 1U5CA 4BRUA 5JAPA 2CXRA 3HJAA 2ZZKA 3HUTA 5K6RA 1Q17A 4AMGA 3C1UA 1CIJA 1QYVA 2M32A 5SYMA 3WLAA 2FMIA 3CJTA 2GEUA 5JAIA 3FUUA 4P7FA 3QUTA 4CNBA 4MUYA 1WV1A 2PL9A 2ZRMA 3HSYA 2AJDA 1HTBA 3CRVA 1U4SA 2OILA 2C29D 3GJQA 2FQ1A 2A9KA 3O95A 2H2AA 3OPYI 3H5RA 4OHRA 3O0DA 1GQFA 4X8HA 2XAAA 3KQLA 2WC1A 4KRFA 2F6RA 3CLRD 3L8ZA 1W93A 2VP5A 2HU5A 5FR1A 3M4NA 4DDUA 3TPZA 4RHUA 2IXTA 4PCAA 4HXFB 1V8ZA 3MGKA 4JUFA 3DOUA 1R6BX 1RW4A 1WPXA 1QG4A 3JQFC 4B79A 3L0YA 1Z6GA 2ZYGA 4TXLA 4EP1A 1LQTA 2FN4A 3P9YA 2KLBA 3AK4A 3PNSA 3PS9A 2HFKA 3Q9NA 3QPCA 4QECA 5K2OA 3DEHA 3FCXA 4QQKA 1ZLYA 3QSGA 1FSPA 3TNFA 1HURA 1YQ9A 2Q4TA 3ELDA 4FYPA 3CM0A 3MD0A 1WA5A 3VAAA 3VJMA 3A6KA 5M34A 5I48A 2CGEA 2ZJ2A 3DTVA 1NN0A 2X76A 3QQ5A 4HUTA 2I0FA 5DV9A 1WCIA 3SYTA 3MWYW 5GQSA 3TQSA 4B2PA 1YZTA 1Z17A 3LHFA 3EXG1 2QRKA 2NZJA 4ZVMA 3ZC3A 4B7ZA 2BP7B 1O4VA 2H31A 4B8WA 2VDJA 5A5VA 2XGJA 3K7EA 2IT1A 2IPAB 4YQFA 2X77A 3I9V1 1G9XA 4BGIA 1TT7A 1WZEA 3B5EA 1UBSB 2VK4A 4TS3A 3ROTA 2CMGA 1NXVA 1YHZA 3RJ9A 1N0VC 1VSVA 2WK1A 3B1XA 3BL8A 5AHKA 4UDYX 5LA6B 4HDAA 1BMDA 2AN5A 4GOKA 2DBRA 4QIHA 5FFNA 4BX0A 2GEVA 3H18A 4RULA 1G0NA 1OXKB 1Z12A 3LY8A 4R1UA 1NVXQ 4UHEA 4OQXA 5D3MA 3ZXUB 3KPVA 4A3SA 4C6TA 1DIBA 1G64A 4FNGA 4IQ0A 2I7VA 3ABQB 2PGIA 3GFOA 3GIWA 5IJ9B 2M2IA 4DNOA 2C78A 2PZGA 2Q1WA 1STOA 4IJUA 1URPA 4JL8A 4FGWA 4OJQA 3T5CA 4RMNA 5GZ1A 1DXHA 1BHQ1 1EQ2A 1L6IA 1AQIA 2IEBA 2O2ZA 2ZW9A 3AB8A 3KPWA 1L7DA 2OUKA 2XTNA 3CZ5A 3K0HA 3L84A 3PHHA 4LTMA 4OVKA 4FFVA 1PX0A 4UNQA 4OIFA 1B42A 3AY6A 3K2IA 4QUGA 3PITA 3MWEA 3D7RA 4G84A 4DQVA 1EDOA 2C4UA 2I1VB 4I8XA 4K6OA 5CLFA 3AM3A 4QEZA 3O83A 1SMKA 1VCNA 1W5EA 2H2GA 4FMDB 4KLNA 4L72A 4HI0E 4AJLA 5ELXA 1T4BA 1SQSA 4D0LB 3V97A 3GJ3A 1QCDA 4JLKA 4L5YA 4UHBA 2JVKA 4L8FA 4H59A 4OQMA 3F6BX 5E8JA 4EB0A 3OQNA 2ZJ3A 1UXKA 4JBYA 2GPTA 4LZOA 3L7JA 1J2RA 2Q3EA 1GU7A 1CQJB 2HJ9A 1QH8A 5CPFA 2ECOA 4F46A 1SKQA 2AB0A 4GBGA 4R7TA 1NIPA 1NSTA 3NIDB 1ZISA 2ZT8A 1YQUA 3FUCA 4HYYA 3MCZA 4FQ7A 3CRQA 1DCFA 5JNSA 1Y33E 3KCNA 1E1MA 5CVJA 1XKXA 5L6MB 2SKDA 3MAJA 3EMVA 4OA8A 5DP1A 3B1WA 3NYRA 4N76A 1HGXA 3G2KA 3EUEA 4N3AA 4PANA 2G9NA 2OGWA 3WJ2A 4C4XA 1G8KA 3B9PA 1GUZA 3BGOS 1Z5PA 3OM1A 3O91A 1OAOA 3PB3A 1GUBA 3MUFA 4ZU1X 2X4GA 1U94A 3UT5A 5D7BA 4I6JA 1EK0A 1BVHA 4P80A 1R7RA 1Z4LA 4CN8A 2R11A 3PJFA 1SEVA 4MKHA 1QH0A 4UU7A 2WHPA 3EZ6A 1SUFA 4YREA 4B0OA 1OB2A 1MV8A 3U4IA 4MRNA 4I36A 4P31A 3CG4A 1DMRA 1TTQB 1CQZA 2IU3A 4HXEB 3ETEA 4FBLA 3DEKA 4EENA 2QTNA 4I55B 4BMCA 2HT1A 1NZFA 1XQ6A 2OCBA 5BR7A 3D2BA 1DMSA 2F8LA 2WJ3A 4B4KA 1R8XA 3I5AA 3P0EA 3CLVA 3PPVA 3QWIA 2WTAA 4FBMA 4JQZA 1TZCA 4R2XA 5EZ5A 5ALVA 3M4ZA 4F0JA 5C3UA 3P9CA 5IXJA 4EY6A 2PS9A 2PZ8A 3C4VA 1HSZA 1MOZA 2J09A 2YV4A 1H4QA 5LOVA 3TLGB 1SUDA 5B5SA 2V8OA 4CVNA 1XRRA 3PFNA 1RJ9A 3UG7A 3WADA 3C7TA 1J0AA 4C7OA 1GDTA 1RFLA 4BO1A 1ONBA 2GI4A 1E1QD 1E6LA 2QN3A 1RI4A 3H0KA 3ZGOA 4KQFA 4K6KA 4HPXB 4BQQA 4LSZA 1WD7A 3FPHA 1Y5NA 5AIAA 3ZJ5A 3B13B 2ZJ6A 3VTFA 1OU0A 5KYTA 2ZWAA 2E4UA 4NU5A 2NVWA 3BEOA 4ZI7B 4O4HA 3WSWA 9LDTA 3NDJA 5J58A 4BATA 1T0HB 5F9MA 3B6IA 3BJMA 3PYMA 4PTZA 1O5IA 2J9YB 3NI2A 4D3YA 3AFOA 3COVA 4RH3A 1YDWA 3RVKA 3FPGA 5AKJA 2YWHA 3I58A 2D1FA 2PXAA 3EZ2A 4Q82A 4OM7A 3ILVA 5CA1F 5YASA 4I1PA 4Q1BA 2HHHB 4DA9A 5DRTA 1NPTO 3FYUC 5IM4A 4GBMA 1BRTA 2C00A 4QOGA 1KOLA 4F3TA 2OL4A 3ZJ4A 5BYAA 4FHGA 1LEHA 1W0KA 2IXAA 2OFFA 5F9HA 5EOVA 3H2JA 4M9CA 1NVWQ 3U0BA 3DCNA 3HN2A 1NW4A 2EP8A 3B1JA 2F2TA 3MC1A 2GOYA 2QW0X 3R5HA 4HEA6 4LY6A 4Q4LA 2WJ6A 4LRWA 4CR6A 3RADC 2BGGA 3IX7A 1GTJ1 3NHJA 4OM8A 4XEHA 5FQOA 1M2OB 4PYLA 1TO6A 1DAKA 3U1BA 3IBGA 4ZVSA 1F6WA 3GVHA 1C0LA 3ZGLA 1ABBA 1ZI6A 2CSXA 2UXDB 3RLFA 5KREA 1KSGA 1LTKA 2AYXA 4TYPA 4UM7A 2X0FA 5KTSA 4GM1A 3HY4A 1TMGE 1GSIA 1NBMA 4WNYA 3PQ3A 1QPZA 1E98A 3LVFO 4C4SA 5EIWA 4FT2A 1GU0A 4DCPA 1S96A 3ZLTA 1PCXA 1R27A 1Z13A 3Q11A 1GXSB 1PN3A 1MFZA 5AD1A 5BXYA 2RGUA 1E99A 1PHPA 1O97D 4JBXA 5AJXA 4B3HA 4EO9A 5HGXA 5JAUA 1ODSA 2QVBA 3OF5A 3JQDA 5E6RA 5H68A 2R6R1 1WQ3A 1JAZA 4GFDA 4ZARA 5JNWA 2FPMA 4QGGA 4BFYA 3KXKA 5EGSA 1TEHA 3VOSA 4D41A 3VU9A 1UDRA 1ECBA 4YMIA 4EG1A 2R7KA 4ENSA 4IJKA 3WO1A 4NMWA 4V0ME 2IDMA 4FFWA 4FW9A 3OOYA 2WLTA 2OGZA 1R74A 2IP2A 4KV9A 4UC0A 2BFNA 4EWLA 3TNDA 5J2UF 3SX0A 1KR5A 4YDRA 5K8CA 3LNCA 3ROQA 1RM3A 2G9UA 3WYCA 3DMYA 3EA4A 3GVIA 2VXOA 3PNOA 3AG6A 1GAEO 3IE0A 1H6CA 4RVOA 1U63A 2Q6VA 2DKNA 2HXYA 3DDUA 4UATA 2DT5A 2WUDA 4BN4A 4PLGA 4D4HA 4LYAA 5JCXA 4JR2A 1P60A 1P6QA 4ALNA 1F4VA 5UKDA 3V4ZA 4HGQA 2H2IA 1FNDA 2H3EA 4ESHA 3RODA 3USZA 3NPMA 3LC2O 4WLVA 1PSZA 4LRTB 1IL0A 3BE6A 2VT7A 2UXCB 3IQZA 2PUCA 2O3QA 4LWOA 1RHKA 2VF8A 4IIUA 4OUDB 5CCDA 3D8BA 3Q3GE 3TE6A 4J91A 1GV0A 3MA0A 1YNOA 2HU2A 1LVGA 4KDEA 1FP6A 4NLLA 2QZ4A 5JS1A 3OQIA 1OKKD 2YXPX 2Z09A 4KFTA 5KQMA 4GL2A 1VIVA 1RXYA 1YHYA 1OI2A 2FSHA 1DEXA 1YDHA 2O3UA 1Z7EA 2IODA 2ZJ0A 3VKVA 3WGTA 5B3AA 1CUJA 4CIDA 3K6KA 4BV3A 3JS5A 2B5WA 5TVKA 3W77A 2Y6VA 1E1RA 2G06A 2RHTA 2QN1A 3ENQA 4L08A 2FEAA 2X15A 3T4UA 4EG6A 4HDNA 1IOLA 4R83A 2GM5A 3A37A 2NNLD 4IVPA 5C7IO 2UVQA 1LBSA 3K0FB 4KXLA 1QHYA 2PT7A 5K8LA 5AK3A 1G5QA 4BNGA 1SQ5A 4IOKA 2ZRFA 2Z6UA 3TZHA 3IE2A 4IJ6A 1T8PA 4RHCA 3R76A 5IHXA 3INYA 1JJFA 1ZIXA 5A71A 5P21A 2V0GA 4KQ2A 1RM0A 1WMEA 2VXCA 3CV3A 1T9GR 2AA3A 5IHPA 2C7RA 2WF9A 3C97A 1Y3BE 1TTHA 3E8MA 3L8DA 5I01A 3QMVA 5EIHA 1Z2AA 1JUDA 2WJYA 5AUQA 2GK7A 3ZJYA 1JWAB 2W8ZA 3NCTA 1BFDA 4TKUB 5C8VA 4GU5A 4M1TA 4R1OA 5TMEA 1BJTA 1CDZA 3DVLA 4D6PA 5KSWB 1SU8A 2JGMA 4QU8A 5BPHA 4GRDA 3IKTA 1KXZA 1C0IA 4BN0A 2AQHA 3FPAA 2ZIVB 4ILKA 3LHIA 4BVFA 1F9EA 2PQ6A 4TQ9A 1Q1GA 2W2MA 4G1UC 3I9OA 2PJZA 4H1WA 1YFJA 4WOCA 3O1IC 1IK4A 1JKJA 5FWNA 1QV7A 5ETJA 1LDGA 2AEEA 4KX5A 1SH7A 1NVFA 4GM0A 4BJ3A 4ZANA 3BGWA 1RWQA 5HJ2A 4CTKA 4XJXA 2W6CX 5FKJA 3CUEF 4O5OA 4NAHA 4Z7JA 1BEZA 2YN4A 3A1NA 4IMJB 3WLPA 4A5SA 1NVKA 4X60A 4E15A 1KQOA 1E6WA 2QSZA 3IKMB 4JT9A 4G1BA 5CA0B 3GFBA 4L0QA 5BV8A 1J1IA 5IKMA 5I5EA 2VIIA 4IRXA 2A9QA 4OI1A 3LZCA 2W90A 4AG6A 1V9CA 3HQ4O 4NS1A 3GMTA 4QYWA 1SK8A 1CY6A 2GYYA 4IHJB 4X9XA 3P9ZA 4EHAA 1QB8A 2BISA 5AUNB 3G2NA 5KQPA 1DT5A 1I14A 2QE7D 4JBLA 3CA8A 4RF4A 4YUXA 5MGNA 2FV8A 3VI4B 1E7SA 4B75A 1KSHA 4IXDA 4IOJA 4Z4HA 5IVKA 4B45A 4UU8A 5CR9A 1WEHA 3TUZC 2W58A 2ILTA 4NNPA 1HQCA 1ZG3A 2XMRA 2ZJYA 5TT0A 5GJBA 4KI0A 5DFAA 3UTCA 2PWZA 1U2PA 2C04A 3RD5A 3BF8A 1JQBA 1CUSA 2H65A 1D1QA 5LR6A 1P2TA 1GFZA 2IGBA 1AOXA 5FTWA 1AKWA 3C8MA 5H59A 4NHEA 1N1EA 1A9YA 1PE0A 4BZXA 5HUJA 2HO5A 3TG8A 1I9CA 2XNDA 4ZV7A 4RSHA 4C0BA 4L9WA 5IZ4A 4OHBA 1S9HA 4UUOA 3IP8A 5SY4A 4ACBA 4I2NA 1UBKS 1SHKA 4EF6A 1YIOA 4AX8A 3OH8A 5KTMA 4TV8F 4RTJA 2XJ9A 1J8FA 1Z6QA 1QH1B 4EGCB 2FCRA 2Z08A 4YV7A 2Q5CA 4MRVA 5B7PA 4V1CI 2JGFA 1E3WA 2XD9A 3QLVC 5KI6A 2YXLA 2OHHA 3F1KA 2IY8A 2YZGA 3RQSA 3WHLA 5KNDA 3WI7A 3L3BA 1GAWA 2P9JA 3QFSA 1P5RA 4GR4A 4LG1A 2XWBF 4R1NA 1G7CA 4DSOA 3CNNA 4A2WA 2WTMA 1LX6A 4K9RA 3OIYA 2IF0A 4IUDS 1KL7A 2X5JO 4UUAA 2CLHB 3U3MA 2IL1A 3VR5H 2JIZD 4ZEMA 3LPMA 1GFSA 1K0FA 1FRZA 3DWFA 1Y9EA 1R4MA 3FSGD 1XHEA 4FJ2A 5TMPA 3OFNA 3RVQA 3TVTA 4E22A 2QZSA 3OSZA 1JR3A 1WXGA 3NOXA 4L4UA 3PVZA 2GJ9A 4OL0A 1E6MA 1Y1RA 3SWWA 5LC1A 3M1IA 3MJVA 4F9TA 3ZDCA 4W9MC 3NU1A 1SCAA 4UHJA 1JLMA 2FOIA 1CYEA 3LX4A 1T5IA 3BQ9A 5KNBA 1DO8A 3T4XA 4ER5A 3I0ZA 3BGSA 4B0PA 1EFDN 5EE9A 1T26A 2OCDA 2XKKA 5FUBA 3IEKA 4HB3A 3WSTA 2BSXA 1VL6A 3L8EA 2B7CA 2WFLB 5CVDA 4DREA 5B2EA 2IXGA 2QENA 5ALNA 1EVLA 4J0HA 3GUUA 1I1HA 2VDRB 4RO0A 2VHXA 421PA 1CVIA 3C8HA 1A9SA 1XWFA 4R71A 5JBNA 3DAFA 2JBAB 1IUKA 1KFEB 3I5XA 1E1LA 3LYHA 2ID8A 4TT3D 1II0A 3ISVA 4PINA 2O5VA 2QTGA 5CXXA 3E2PA 2P4EA 2XA9A 4Q7JB 3PSAA 3SBXA 3BORA 1SVLA 1O77A 4O1MA 3N86A 1ZM7A 5LP6C 3P94A 3ETDA 1TX4B 2XH8A 3LD9A 1Y6QA 1FW6A 2YV5A 2VK8A 2W2VA 4H3KB 1GSHA 1D2RA 2EARA 1WY5A 2VVTA 2ZB7A 2QZJA 4TLLB 1MHTA 1Y9DA 4PG6A 4A0HA 5EWMA 3V80A 1UWVA 3W1WA 4ETWA 4ZGWA 2QP4A 2CHFA 2QD5A 3ORFA 4BFUA 3PYXA 2IYAA 2XNCA 3RWMB 3ZWWA 3R9IA 1GNLA 4CHGA 2OBFA 4K9LA 4RLFA 3TLCA 3UJNA 3CEJA 2FP4B 3LDGA 4M83A 4OXQA 4PIMA 4GOMD 2QM3A 1CP2A 2B2NA 2DSNA 4K1XA 2IYRA 621PA 2IXEA 3K9HA 3QU9A 4HB4A 2AMLA 5LQUA 2CFCA 4TKMA 1A5BB 3RJ5A 2PA0A 1VM6A 3O4GA 3S99A 2QTBA 4XGNA 1C4XA 1M6NA 1RYEA 1X2EA 1BCSA 1G8YA 1Q5PA 3MCVA 2DR2A 2XSZA 1AD2A 1N3LA 1J21A 3KQNA 3AF3A 4FOSA 2DHRA 5DHPA 4BCDA 3RO7A 2CJWA 4Y18A 1H8HA 4LF8B 7ABPA 1D09A 1M8JA 2P9GA 2PUJA 1LK7A 5JRJA 1EZ4A 4GHWA 5KPJA 4GYYA 4ON9A 3WG9A 4AAYA 3P0FA 3V4SA 1T29A 2BRUA 5KYWA 1LSOA 3B9QA 4FQ8A 3RYHA 3EX7C 6ADHA 4B4WA 3PDWA 2B83A 2GB4A 3ND9A 4ZDKA 1RHJA 2EYQA 3IUPA 1OFIA 3KUKA 1HE5A 4G09A 4Q4DA 1SKBA 3VPXA 1E4EB 4UMFA 5E4JA 5F2KA 1PGPA 3WWEA 4PHCA 1TYAE 3INRA 4NECA 1IQUA 1M2FA 1MRSA 4MWGA 4BFZA 4JCOA 3KAJA 2XVYA 9ATCA 3U6KA 3L4JA 5KYYA 3EYAA 4CM5A 3CZCA 1MX5A 3UAWA 1K9VF 2CL6X 1RLMA 2PWYA 4BASA 5HW0A 1AQLA 4HDMA 4IJMA 5BT9A 3L2OB 4LGYA 3SPXA 3UPDA 4M7RA 1S2MA 4BFSA 1ZA2A 2WW8A 4BBPA 4EW3A 3T6KA 5CJ2A 1YCDA 4EW1A 1KPIA 1SXJB 1V7ZA 4IIJF 3AR7A 4M7OA 1FYEA 3S2EA 4PZAA 1FU8A 1RXWA 4FFBA 3LX6A 5IW8A 3A9UA 3UK0A 1GFIA 3MM4A 2I8LA 4IDDA 4GAEA 5AM3A 2BFCA 2A4KA 3LMKA 1NW6A 2FLWA 5EIXA 3WNZA 5JNVA 3EQZA 2W4IA 3L9XA 4RFSB 3ZU3A 3O31A 2QTZA 3SHOA 1GN9A 1JHDA 2V7UA 5C37A 5CITA 1CEYA 2B3TA 3I72A 5FRDA 2G82A 1LNZA 3C5CA 2CNWD 1S01A 1BVRA 5DWVA 4RV5A 2G5TA 3CNBA 5C8YB 1IBKB 1M2VB 1F0PA 2JHCA 3AM5A 4WKPA 1HNXB 1QYIA 1H23A 1Z0UA 5JXJA 2LP4Y 3PRYA 1NF2A 1ZD8A 3D3QA 1HDIA 1YAHA 2GSDA 4PZPA 1A69A 5JLJA 4BC1A 1I33A 1PR3A 3NALA 3UENA 4X63A 3STYA 1QG6A 2NQTA 3CUVA 3NYWA 3Q5DA 1XZBA 2Q5EA 1PDOA 2ARKA 3I8XA 3W5SA 1G66A 1OBCA 4HFJA 4KLRA 3U9LA 1XQ1A 3H8SA 1O0SA 2DH6A 4FPXA 4DRXB 3THYA 4P4SB 5J2TF 1EHYA 5AXAA 5TXGA 1SD1A 1XA4A 4QUAA 5FPSA 1JMYA 3V1YA 1YT5A 5BQXA 1QIFA 1V5FA 4HTAA 4I2VA 2IYSA 2ZRBA 2XCUA 3RV4A 1U04A 4KYUA 5EMLA 4WXPA 4L75A 4NMMA 4JHXA 3ZW9A 1XJWA 4B87A 3EIQA 2CXQA 1L5ZA 3D3WA 2BMAA 3GT4A 1WOYA 2BW0A 4NYIQ 1J20A 4D3XA 4NP6A 3Q3IA 2C84A 3EXHA 4KQMA 4P54A 4AQYB 4X84A 1MUUA 2G5CA 2ZKLA 3JRWA 1A5ZA 3AUFA 5JATA 1P7VA 2F1KA 2AI1A 2Z8XA 5GV7A 1WDLA 1IHPA 3GX1A 4ER3A 9MHTA 1W88B 1ML4A 2ZUWA 5EWLB 3ZIAA 3KOXA 5TQ0B 3D81A 3T4EA 5K3OA 1ABFA 1XUOA 2GVDC 4JI2B 3NHSA 2FRXA 4MQFA 4BWYA 2NZYA 1CZLA 3I3OA 4IDCA 4UTPA 1EXVA 1XMQB 2JGDB 5FLKA 4YS6A 3QHPA 4KXUA 2GXUA 3M1YA 1WXFA 4RZSA 1OT3A 2WJ4A 4JI8B 1X9IA 2BF7A 3T7DA 1LW6E 2WVHA 1QV9A 2QTWB 4DLNA 3F7TA 5GONA 4J0FA 2WQ7A 3DL7A 2QRGA 5ES4B 1KYYA 1XF9A 3M81A 4HVAA 3QFRA 2HBYA 5FWDA 4ZEVA 1EYZA 1JLLA 3K5WA 2DM6A 2IWRA 1QRRA 1C9YA 2CHEA 3K5HA 5I9MA 2A94A 1QDUA 1XQYA 2O5EA 1QIIA 1ACMA 1QFZA 2DGDA 2CMKA 3JASA 1TAGA 3LRXA 8ABPA 1PJ3A 5IN4A 5IC4A 1BN6A 1SXHA 5EKXA 1SK9A 4W5OA 3BMCA 4F6CA 1KH1A 1P3DA 1SVNA 3ED1A 2IZ7A 3G2HA 1JKXA 3PUHA 5KYUA 4BQNA 2HOQA 1U3GA 1ULAA 3MTIA 3F2VA 3U44B 1LLQA 3QJGA 1UOPA 2Y0PA 2YXBA 2HNAA 1XRSB 1K5DA 3IPLA 4G0YA 4TXJA 4QVKA 4CIXA 1HZZC 3L49A 2Y6UA 3LSYA 4PVDA 4TL6A 3AESA 1KYVA 3F78A 3ACBA 4B6SA 3OFKA 5LYJF 5TPZD 4HDSA 2GM4A 2GH1A 4ALMA 1V1JA 4CKBB 4Z6KA 4GOND 4Q3LA 3S2IA 1ZJWA 1HDYA 5K2MA 3L0IB 6REQB 2JFPA 1YB1A 1PJCA 3TTXA 5DM4A 1EA5A 3HYCA 4MP6A 1P62B 3LPCA 3PNYA 5F5LA 1RLOA 4F6RA 4OFXA 5K0TA 4IHQA 4FYWA 1NONA 2X4IA 3O21A 4L50A 3TGWA 2OA0A 4Q4JA 3A1EA 2FY8A 5CEFA 2VCHA 4LJRA 1GPUA 2ZTMA 1QM5A 3ZY4A 3D43A 2XMQA 3HVJA 1UJMA 2B2XA 1KVRA 1TW3A 4M38A 2Z04A 3CZ9A 2YY5A 3CG0A 3VR4A 3ZD6A 1C9JA 1A97A 1YI8A 4F5YA 4MV4A 3ESAA 1QZXA 3VZRA 4KGVA 2NQ8A 4Z5XA 4A0GA 4REMA 3I34X 4TRJA 4QT4A 1X80B 1S1CA 5SICE 3PD7A 3WLNA 3VR5D 1JIQA 4YMHA 3LCUA 3AJAA 4LOKA 3TSZA 2HSEA 4O4LA 3ZR4B 4E3ZA 2H1SA 3SE7A 2PR2A 5BVHA 1D1PA 5IN5A 3MMXA 4ZVNA 4XRRA 1PD0A 3IEXA 2HUNA 4KNWA 3QKRB 2B8NA 4Y0VA 3MBKA 1R15A 1G2QA 5HCNA 1SY7A 1T9BA 3LBYA 2PX4A 4K3UA 3G17A 4L9AA 2RI0A 4N0MA 2F3RA 4YP5A 1KZHA 4DV1B 1W34A 1O8CA 1PS0A 1KO4A 1QFJA 2ZYRA 1YR6A 3E1SA 3QMWA 4PO9A 3UAGA 6AT1A 5LLDA 3BH6A 2NVBA 4KR3A 2EEPA 1FYXA 3RAJA 2P9TA 3BD7A 3ONDA 2B6NA 1EESA 3ZV6A 4DM4A 1JLRA 3AWDA 5IF3A 2AXEA 1G7SA 2CNDA 4GYWA 1RYFA 4KRYA 3W9YA 4FEAA 1IU9A 1MRZA 2C92A 1N9KA 1NOKA 1Q3TA 4JSRA 4UZEA 3BRWD 3VQTA 2G25A 4FGUA 4ZO7A 3H17A 2VP0A 5MN6A 4EQZA 2W2PA 3CKLA 4WLEA 3V2HA 4CFSA 4GX0A 3EZLA 2GAIA 1GNPA 1QHEA 2QVXX 4N82A 3OHSX 5TMDA 1QS0A 3V8PA 4BNHA 4DJEC 1RC0A 3W5DA 4B32A 3V1TC 2R6DA 3OO1A 1H85A 4H17A 2VWGA 4C0AC 3LZ6A 1QO0D 3ROPA 1XJCA 1HE4A 1KZ7B 2C9BA 1TQHA 2WMDA 4Q1CA 4MVJA 1IUOA 2MOKA 1Z3CA 4RWZA 2F1HA 5K0LA 5JWHA 4JWKA 1JQ5A 3MERA 2G3YA 1VKRA 2JGKA 3FJYA 3KB6A 4CLEA 1MH1A 1TU4A 2WJGA 3MJCA 3BHMA 5BQ5A 4DMGA 3SM3A 2YKGA 2V98A 1YAJA 2EZ4A