3IHTA

Crystal structure of s-adenosyl-l-methionine methyl transferase (yp_165822.1) from silicibacter pomeroyi dss-3 at 1.80 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
EQSRLDLFIDRMVSQRACLEHAIAQTAGLSGPVYELGLGNGRTYHHLRQHVQGREIYVFERAVASHPDSTPPEAQLILGDIRETLPATLERFGATASLVHADLGGHNREKNDRFARLISPLIEPHLAQGGLMVSSDRMYFEGLEELPLPPGAVVGRCFIYRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosyl-L-methionine methyl transferase
publication title Crystal structure of S-adenosyl-L-methionine methyl transferase (YP_165822.1) from SILICIBACTER POMEROYI DSS-3 at 1.80 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
total genus 47
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12692 Methyltransf_17 S-adenosyl-L-methionine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ihtA00
1FPQA 3ME5A 3HM2A 4Y30A 4L7VA 2FYTA 1MJFA 3BKWA 5LQRA 3ER9A 1JG3A 2AZTA 2AOTA 3G2OA 5EEGA 4E2YA 1QAMA 1R74A 3QOWA 4H0NA 3CKKA 5E1DA 4DF3A 4YUVA 3LL7A 5K03A 2HR1A 3HNRA 1XJ5A 3BT7A 3M6UA 2PVCA 4KWCA 4G56A 3JWIA 4PINA 5E2AA 3KR0A 3EGVA 5E1MA 2B2CA 2YTZA 5EIFA 4MTLA 2LD4A 5E8RA 3DMFA 3ELYA 4NECA 1U2ZA 4PCAA 4R6WA 3G2QA 3ER8A 3DR5A 5EKUA 1KPGA 1VE3A 2ZWAA 4PYOA 2DULA 2O07A 3SXJA 1BHJA 2QRVA 3EVZA 1P91A 4AUKA 3ANXA 2EJUA 5K0NA 2PKWA 2A14A 5C0OE 3BWBA 4PYJA 2G1PA 1EJ6A 2IPXA 1R8YA 3P71T 3I9FA 5GOZA 2DPMA 1JSXA 3QV2A 3HVIA 4OBXA 4QQNA 1G60A 1JQ3A 1BOOA 3UJBA 5GIOE 1DCTA 3KQPA 2I9KA 4QPNA 3KQTA 5F2KA 3EVCA 4IWNA 3SSNA 3KQYA 2VDUE 1RJFA 2HNKA 3BXOA 1JG2A 2BM8A 1P1CA 1SG9A 1HNNA 2IH4A 4FZVA 1FBNA 2CMHA 3OU6A 4P7JA 1YFJA 4KIFA 1I4WA 4RVGA 4CTKA 4KDRA 5LQJA 3FTCA 3MQ2A 1X1CA 3DMGA 2YXDA 9MHTA 2HWKA 5KVAA 5LQUA 2O05A 5DM2A 3BUSA 4HG2A 3P2EA 2JHCA 1AQJA 3DMHA 3KPWA 3KQOA 2ZBQA 3OU2A 3CBGA 4GEKA 4F84A 4YV1A 1VPTA 2XBMA 3H2BA 3BKXA 3HA3A 5FHQA 1JQDA 3SVZA 4R8SA 10MHA 4F86A 2IDKA 3P8ZA 1M6EX 4DZRA 3FTEA 2AN5A 2HMYB 3E8SA 3LKZA 2ORED 1ZKDA 1QANA 7MHTA 2OZVA 3HCCA 3SSOA 1XCLA 4RX1A 2QM3A 1SUIA 5DXJA 3V97A 1SVUA 5H02A 2PY6A 2UYCA 4C08A 4YUZA 1G38A 1L1EA 1R8XA 3IYLW 4QDKA 4BP3A 2GPYA 1G6Q1 1Y8CA 4OA5A 4E2ZA 3P9CA 4RVHA 4E70A 3K0BA 3DLCA 1RJEA 3FPFA 2VS1A 3P9KA 1AQIA 1P39A 2F8LA 3EGEA 4ER3A 3ERCA 3B7PA 3ELDA 3HVKA 4RWZA 2IFTA 3FPGA 4DCMA 2C7QA 2ZVJA 5DTQA 3RIEA 2H00A 2GLUA 5LQCA 3TM4A 1D2HA 3OPNA 4E32A 3PTAA 3NVKI 2ERCA 2ZLBA 1BC5A 5DTMA 4DA4A 4QTUB 1VBFA 5GP1A 2AOTB 5M5BA 5JUWA 4R05A 5FTWA 3UZUA 4IV0A 3LDUA 5F2OA 2ZWVA 1RI2A 3R24A 1ZQ9A 5KQRA 4FT4A 1KR5A 5FWDA 3T7RA 5BW4A 3UBTA 3GRZA 1QYRA 3UFBA 3NWBA 1NV8A 3T7TA 4HH4A 1PRYA 2ZTHA 5EZQA 3DUWA 3TMAA 2FK8A 3Q7EA 4RTSA 2HTEA 5DRTA 2Z6AA 5KQSA 5FULA 3GU3A 3A27A 2Z6UA 4Y2HA 5EHGA 2QRVB 3MB5A 3I64A 3OE4A 1RJGA 5EMLA 4X41A 1ZGJA 5DPMA 3REOA 5HOQA 3M4XA 4Z2YA 3UWPA 4RTKA 4YUXA 5FUBA 3TQSA 1YF3A 1JQEA 2G8NA 3M33A 3I58A 1IXKA 2ESRA 2JH8A 4ER5A 4RTRA 1AV6A 3UJAA 4PYNA 3SGLA 2O57A 4GUAA 3UA4A 4CKBA 3DTNA 5K0FA 5HFJA 2JHPA 5E9QA 4ER6A 3LDGA 3SSMA 3KHKA 3MERA 3Q87B 4OQEA 4DQ0A 2PX5A 1I9GA 4WVLA 3PX2A 2WA2A 4C04A 3TLJA 2ZBRA 3QOXA 1NW6A 4AZTA 4CKCA 4PCLA 3THRA 2VZ9A 3A26A 1ZGAA 3E7PA 1OR8A 4AZWA 3MHTA 2VDVE 1VP3A 2P35A 1L3CA 5E9WA 2JJQA 4UOEA 4LWOA 3BWCA 2XYQA 4V0RA 1N7IA 2EG5A 2PXCA 5E2BA 1VL5A 2Y1XA 3GGDA 5FQOA 2O06A 3A7EA 1DL5A 2AOWA 5C9ZA 4XUCA 1YFLA 3AY0A 3SX0A 4FT2A 3OFJA 3MCZA 5LSAA 4PGGA 2PX2A 3SMQA 2PV0A 5CCXA 3FPJA 4LECA 5EGSA 3B3GA 2OB2A 1VP9A 3P2KA 3FZGA 3HTXA 3C0KA 3KU1A 1KPHA 1WXWA 2V74B 4PYKA 4QPPA 1DUSA 2PGXA 1IY9A 2UYOA 1NW3A 2YR0A 5CIYA 3EVGA 1H1DA 1WG8A 3EVFA 4MWZA 4C07A 1R18A 2OO3A 1FP1D 3GRUA 5CVEA 1NW8A 5HIMA 2OY0A 1UFKA 2XVAA 2IGTA 3LKDA 2FHPA 3VC2A 4DM3A 2WK1A 3FUUA 4OA8A 1YUBA 3KPVA 4AZSA 3LCVB 2P3LA 2OXTA 4C4AA 1Q0SA 1EQAA 3OFKA 5ICCA 3AWIA 2PWPA 2JH9A 1NKVA 3DXXA 2PXXA 3IV6A 2YXEA 3MAGA 4BLWA 5EC8A 3GO4A 2PX4A 2P40A 3EVAA 3EVDA 3PFGA 3TFWA 3OZTA 5EOVA 2OB1A 2NP6A 5DM1A 5GWXA 4HRAA 1R00A 2O0LA 5CVDA 3PFHA 2IBSA 1QZZA 1R6AA 3PLAE 2YUIA 1KP9A 1NV9A 2I62A 3C3YA 3DOUA 3CC8A 3NDJA 2NNWB 5EMMA 3PS9A 3BWYA 1P1BA 5G02A 4O29A 3GCZA 3M6WA 1SQFA 2AOUA 4EK9A 2NYUA 4PGHA 1NW7A 4GBED 5BXYA 1QAQA 2Q41A 2IIPA 2FRXA 2ZZKA 5U4XA 3P9IA 4GF5A 3HCAA 3LBYA 5E8JA 5K0LA 3M6VA 3MTIA 2P1DA 5E9JA 5FQNA 3GWZA 1KXZA 5BW5A 1JG4A 4XCXA 2YQZA 2PXAA 2EJTA 3EMDA 3OU7A 4GOMD 1WS6A 3HEMA 3BWMA 1HMYA 1ORHA 1V39A 4PYLA 4GC5A 5EG5A 5FA8A 2UZ4A 2IH2A 2JG3A 2JHAA 2NXCA 4RYLA 2OYRA 2ZZMA 4EVIA 2G70A 5FA5A 2E5WA 1YZ3A 4KDCA 2P3OA 5CVUA 4U7TB 4OQDA 3ORHA 1UWVA 3GDHA 1QAOA 3B5IA 2AS0A 5DLYA 2PLWA 5E1OA 2OPBA 2GS9A 3R6TA 2NXEA 1JTFA 2C7RA 1Z3CA 3TKAA 2CKDA 3EEYA 3TPZA 1G8AA 3IHTA 4RTQA 2CL5A 3FUVA 5DX1A 5HIJA 4CTJA 4PYIA 2B25A 5DSTA 4EQZA 1XCJA 4PNEA 3F4KA 2ZCJA 2UYQA 1WY7A 4WXHA 3KPJA 3G7UA 3FTDA 2PSSA 4EKIA 5BP7A 4DMGA 3S68A 3MGGA 4IV8A 1EJ0A 1X19A 2CWWA 5MHTA 2I7CA 3M70A 3G8BA 1X1DA 3BGDA 3G5TA 2ONYA 3LGAA 3SM3A 4P7GA 5F2NA 2FK7A 3DLIA 4M7RA 2GA9A 4EKGA 5P8WA 1NBIA 2AN4A 2CMGA 3JWHA 4HGYA 5K0BA 2YX1A 1D2CA 4GOND 1M6YA 3KKZA 4FGZA 3UJCA 1ORIA 4YUYA 2UYHA 4FSDA 3G2MA 2QYOA 5DXAA 4F85A 4YUWA 2P8JA 2VDWA 3TOSA 4E33A 3PX3A 1VLMA 2ZZNA 3NMUF 5EQJB 2AR0A 2OKCA 2N47A 1N2XA 1SKMA 2IBTA 1X1BA 2Y1WA 3BGVA 5K0GA 1AF7A 1BKYA 1JTEA 3HCDA 3I53A 4BLUA 4RTLA 4PONA 4X1OA 4BY9E 5C1IA 2KW5A 3KR9A 3C6MA 3HCEA 2ZIFA 3LX6A 5CVJA 3UJ8A 5LQKA 5CCBA 2WA1A 1F38A 1XDZA 1FP2A 4C06A 3B3FA 5DRYA 5FWAA 2B9EA 4PYQA 4M38A 4R8RA 4V0QA 3C6KA 3UJDA 5T64A 1NT2A 2GB4A 3M6XA 4EMSA 1XTPA 3GXOA 5CD1A 5IH3A 4DKJA 1G55A 1VQ1A 2ONZA 2NXNA 4ISCA 5K0JA 1EG2A 3C3PA 2AOVA 2QE6A 1EIZA 1KYWA 2XYRA 2VP3A 3FYCA 4QTTB 4XUEA 3TR6A 3L8DA 4ER7A 3FRHA 4KW7A 2YVLA 3FPEA 3KPYA 2AOUB 2ZBPA 2IDJA 5DSXA 1INLA 3NJRA 3MCTA 5B1SA 3GIWA 2PT9A 4X60A 2AVNA 3B89A 2PBFA 3UJ7A 1Q0TA 3FTFA 3G2PA 4PWYA 4HSGA 4XUDA 3SR4A 2PWYA 3OZSA 1NBHA 2XVMA 4GC9A 2IH5A 2I6GA 2XYVA 5CUQA 5EMKA 3O31A 4CXMA 2ZW9A 4KVZA 2HV9A 3HVJA 2B3TA 4FS8A 4GQBA 5ICFA 3G8AA 3WSTA 2BR4A 3LSTA 5E1BA 1NE2A 2QY6A 4LWPA 2PT6A 1T43A 4RVDA 3TRKA 3KQSA 3NWEA 3MTEA 3PVCA 8MHTA 4X61A 3G88A 1EAMA 3FPHA 3I5UA 5KS2A 3CCFA 4E30A 5EIWA 5EEHA 3EGIA 2G71A 2ADMA 4HGZA 4E2XA 3E05A 3R0QA 2C7OA 1NW5A 5EPEA 3EPPA 4E31A 3GRYA 5K01A 3CGGA 2P41A 3ELUA 5FADA 3FYDA 3HCBA 3RW9A 3LDFA 2BZGA 3R9XB 1XXLA 1XVAA 3KPUA 1KPIA 1O9GA 2EFJA 2NP7A 1KYZA 5T67A 2Z6QA 5FCDA 3VC1A 1YZHA 3O4FA 3FUTA 4MHTA 2ZSUA 3LCCA 1JSZA 3A7DA 3ID6C 3OE5A 4PYMA 3V8VA 1SUSA 1TPYA 2ZIGA 3FRIA 4QDJA 5EZSA 1O54A 1ZHFA 3P2IA 4RVFA 3LHDA 5EKXA 5DX0A 5CM2Z 1FJXA 3OZRA 5EMJA 3HA5A 3K6RA 3KQWA 4RV9A 5EHIA 4FP9A 2B78A 4OX9Y 5HIKA 4RTMA 5DM0A 3HCFA 4HTFA 4U7PB 4AZVA 3EVEA 5ICGA 3KQQA 2NXJA 1L3IA 3CJQA 1JR4A 4FSXA 1M0EA 5EVJA 1G8SA 5K0EA 4HC4A 5K09A 3G5LA 3HP7A 3EVBA 4IKPA 2BR3A 4A6EA 5LR6A 3A25A 3FUXA 4M37A 3PB3A 5KYGA 1JG1A 1YB2A 5HILA 5LQAA 1WXXA 3P97A 3CJRA 4CWAA 4C05A 2H1RA 5T6BA 5DTRA 3UJ9A 3CVOA 3GJYA 1D2GA 2BM9A 2P7IA 4M36A 3UJ6A 3X0DA 5ERGB 2P7HA 3KQMA 4CKEA 3HA7A 3E23A 4ATNA 3D2LA 4OBWA 2H11A 3JWGA 5HEKA 3KQVA 2P3QA 4MQ4A 5DT2A 3AXTA 3GRRA 4X63A 3AJDA 3KR2A 1F3LA 4BLVA 1MHTA 1RI5A 3IEIA 1XDUA 4GOLD 4P7KA 2AN3A 3B3JA 2GAFA 5CVVA 4ZTBA 5GIPE 5HZMA 4B17A 2IP2A 4RTOA 2ZFUA 1IM8A 4RSRA 3P9NA 2BH2A 1UIRA 2R6ZA 1B42A 1RI4A 5D1HA 3DH0A 2BR5A 4YMGA 3NTVA 4PIMA 4QVGA 2FPOA 4ER0A 4RTNA 2K4MA 5LQNA 5DM4A 3TM5A 1ZG3A 3EEOA 4P7FA 4POOA 4DCGA 3U81A 2AVDA 3FUWA 5GM1A 3G89A 1RI1A 1XDSA 4QVKA 3DULA 3NW9A 3NVMB 4YV0A 2V7EA 4QQKA 3DXZA 4P58A 5FHRA 2R3SA 1N7JA 2ZULA 3BGIA 1WZNA 3RODA 3CJTA 1RI3A 1VIDA 5HIIA 5DX8A 3LPMA 1PJZA 3DP7A 4GOOD 4MIKA 1KIAA 3R3HA 4YMHA 1L9KA 2FCAA 4E2WA 4R6XA 3T0IA 1O9HA 2GH1A 3AXSA 4YV2A 4A6DA 3NDIA 3UA3A 2EX4A 3HVHA 4RTPA 3JWJA 3LBFA 4FR0A 3O7WA 3GNLA 3GRVA 3LECA 4LG1A 4C03A 3TKYA 2G72A 2OBFA 2PX8A 3VSEA 3OCJA 4AX8A 5K05A 2C7PA 3BZBA 5IKMA 3EMBA 1TW2A 4K6MA 1L3BA 1I1NA 1KHHA 2YXLA 3A4TA 1X1AA 4KIGA 5JR3A 3T7SA 5ICEA 3VYWA 3KR1A 2AOXA 4KRGA 3ELWA 4JXJA 5DWQA 5GINE 3PT9A 4PIPA 1SQGA 5GM2A 5K0CA 3LCUA 1TW3A 5D1NA 3THSA 4BP1A 2ZIEA 4RTJA 2PJDA 5K8VA 1RJDA 4HTFB 3DXYA
chains in the Genus database with same CATH superfamily
3UCEA 3RJ5A 3EIQA 1UINA 1ZONA 3HM2A 5AICA 4C88A 3UOAB 1HDRA 4ND1A 1MD9A 1YRBA 2C42A 1V7PC 2EKLA 2R5NA 3QFFA 1V1RA 1J1UA 4U3JA 4AO8A 4JLPA 4B7ZA 3OKPA 4A8HA 1CUZA 3C74A 4PINA 2GNPA 3OO0A 1TTTA 2ODPA 2FEMA 1ULSA 4IFIA 4O8ZA 4R2HA 3RYIB 3NHWA 1K86A 3TB4A 1LPOA 3M3PA 4S0XA 1G19A 2VAPA 4M7PA 4UCFA 2HYIC 1E7WA 2DULA 4HO1X 4NZMA 4ZYYA 1GEGA 1SVIA 5ANRB 3EBLA 1R50A 4GD3Q 2FR8A 3K9CA 1QQ7A 4QDOA 4WGGA 3V4ZA 5KSOA 1FSPA 3GLHB 4WJKB 1YKSA 1P7CA 4PSVA 1HE4A 3TS1A 2DPMA 2IEZA 4N1AA 1U6IA 5CFQA 1Y9EA 1G60A 1GKYA 1WPGA 4QQNA 1NXXA 3EC2A 4X85A 4DXHA 4K03A 4KGVA 2DTXA 1E1CA 1EWYA 1WRBA 5T5QA 3L1JA 1B8VA 3BXOA 1Q57A 1JG2A 1N5KA 2O2JA 3M9XA 1P1CA 5FFFA 5TE9A 4EFMA 3AVWA 1ZNQO 2PL1A 5AW5A 1KE2A 1QHGA 3CB2A 2BRUA 1M6VB 1KEPA 2FZKA 2UAGA 2QD5A 3AUXA 4D9BA 5JNWA 4W9MC 3C3KA 4F3KA 1CUJA 1AS3A 4QHSA 5LD2C 3WJ2A 1PUXA 3PLRA 3O8DA 1ZGGA 3NEPX 3PYLA 5GGXA 1PQWA 2ROQA 4JP1A 1W8DA 4ZRMA 4ZVLA 3N2ZB 1XQWA 2QZJA 3PNKA 2YV4A 1ZD4A 2ATCA 3C7KA 3OTOB 4CMHA 4H17A 10MHA 4FOPA 2FZWA 3AV3A 1M6EX 2O3TA 4HWSA 3VAZA 3K53A 5EN4A 3TLAA 4DLUA 4DCUA 3CR8A 1A9XB 2RGUA 2BHTA 2G5PA 4KQXA 4MUAA 4EUSA 2IXAA 4MVYA 3L1VA 4AY5A 4JBNA 1OQAA 3MSXA 4I81A 3H1GA 4H16A 1TKRA 4JLUA 4K0KB 4P4TA 1RJ9A 1C2TA 1OFTA 4MV4A 5IEJA 1CUDA 2I99A 1HYQA 5CPBA 1T2CA 4MV1A 5M2QA 1P5ZB 1U3VA 4OLJA 3BSYA 5DKFA 4DZZA 2XUIA 4KR6A 4YDRA 2IFTA 3C3EA 5KTNA 1ACJA 3ICCA 4LXHA 3M83A 1G3UA 3JYPA 2QS9A 2XIJA 2C7VA 2FSUA 4XQ0A 5TQJA 3ACCA 4JI6B 1GJRA 3QZUA 2W2QA 1Q21A 4HNHA 4JQSA 1HDOA 1CR1A 1NRXA 2WIKA 4QELA 1E2UA 3CUEF 1U1EA 2M6KA 1CZOA 1Z6QA 4UATA 3UZUA 1OHHA 4WNYA 5HMLA 4CLHA 3EUAA 2WHXA 4OUDB 4RGBA 4BBAA 8GPBA 3S1LA 3KTOA 5JZMA 4NENB 3R0ZA 2FRDC 3VU1A 4ZPXA 2VH5R 2WY2D 5CEJA 1H1TA 4RF5A 4I6JA 1C8LA 1WW2A 3VX4A 4J0DA 2GCNA 2RARA 4DCVA 3H18A 3FG9A 5I5GA 3K30A 1OAOA 2X2PA 2BELA 4HL6A 2C2ZA 4HAXA 3W7VA 4O5AA 2RBGA 4J4TA 1VKJA 1OX5A 2C2XA 2EX0A 4EKEA 3F9IA 1NQUA 2HNAA 3RBVA 1A8HA 1U1DA 2W8ZA 3NTUA 4KSCA 1FQWA 4OI1A 1WBBA 2E4XA 3EW7A 2IEIA 1BJRE 3PQDA 3AUJB 2Z5VA 4ER6A 3ND8A 1Y9DA 4XM2A 2C29D 5FX2A 3D6JA 4NE9A 5FP0A 1WZ2A 4FM9A 1GU7A 4MJ7A 3QOXA 1BWSA 5K0TA 1DXYA 3G1TA 4S1WA 4EJ6A 2WJ6A 4AKSA 4CFZA 4CG3A 1ZN7A 4GZ3A 2EHDA 3TUJC 1ZS9A 4U7FA 2DHQA 3G3EA 1DC7A 2L17A 2YZKA 3COSA 1R5BA 2WE8A 3LQYA 3HXTA 1BDMA 4QUDA 5AKKA 2EG5A 3F9RA 5E2BA 3SLGA 2VJKA 2XKJE 4C78A 3SF0A 4XDGA 3DNPA 4L5CA 4JT2A 1TYAE 4LXYA 4LNUA 3WNDA 2AE2A 4BGVA 4E03A 1P60A 2A6PA 2WIAA 2FXIA 2AC7A 3K31A 4QGSA 2BGGA 1BWPA 1M83A 3MTDA 5FO0A 2A0FA 3LHKA 1KTIA 3PJGA 2HJSA 3UAZA 4INAA 3JV7A 2XOKA 4BKOA 5J4YA 3ED1A 2CNWA 5ITVA 3LYLA 5B5SA 3KOWA 4IIBA 3T1OA 4DREA 1SC4A 3VO8A 1CLEA 5K6TA 4MCJA 4OB8A 5DI3A 3VBEA 4FYYA 1A98A 1ZXLA 2W6CX 4OPMA 1RMYA 3GVCA 2I3BA 3ZD9A 3OKAA 3NAZA 5AJUA 5CLQA 3PQEA 2PIAA 1XK6A 2JCYA 3FUUA 1YUBA 4OA8A 4XIYA 5GJVC 3QEBZ 1NDUA 5AW1A 4K9DA 1DKMA 4WPGA 3WQBA 2HCTA 1KO1A 1Q0SA 1Q92A 4BJ5A 5I8ZA 1YL5A 7MDHA 1S7CA 3DQPA 4A23A 1ZHOA 4LX0A 4OHMA 1RYMA 1QHHA 3OOJA 3FB1A 1OX6A 3C15C 4NJEB 2WZQA 3JQDA 3NT2A 1ESZA 5HS4A 2P4QA 2HLHA 1JJAA 3OZTA 4L5IA 1XRJA 5DW3A 3UY4A 1P7VA 3OUTA 4B40A 4IDHA 4RXUA 2CEKA 3DAGA 5B12A 1EFVB 3QFHA 2DT8A 5IKXA 1K97A 4L6IA 3QI2A 1AZTA 5CITA 5K8LA 2PUEA 3PLAE 1KAGA 1U2QA 1E5DA 2O0KA 2Q5OA 2Q2OA 4Q3DA 5B64A 4OP3A 3BWYA 3CSSA 2QL9A 1X92A 2AMJA 2PU7A 3SQOA 2XB2A 2WFAA 5ED0A 2WDPA 3MXOA 4LVCA 3TIVA 4B80A 4HEA1 4M98A 4TZ6A 1VL0A 3ZEIA 4AMBA 5A5VA 1VJRA 1H69A 2NVBA 3P9IA 3AR6A 1I4LD 5K0LA 5U4XA 3M6VA 3WICA 3UB2A 2BFWA 3FFBA 3Q85A 1CUIA 5CDGA 2ZYGA 5I8PA 1ECFA 1T29A 1Z16A 1PEYA 2F17A 3MUOA 1AZSC 3DDZX 4RHEA 4Z1OA 3HP1A 3MWYW 4PYLA 1NWHA 4BRSA 4YAIA 4ZVNA 5AXCA 2RK6A 5JSZB 2VQDA 2OO5A 2QT0A 4D2IA 2QV7A 1QQAA 5C8YF 3CRQA 4ALKA 3VDXA 2VJAA 1EBUA 2V3WA 5FB3A 1QAOA 1IOVA 2FZCA 1DEXA 2P3SA 4IOKA 4TT3A 2J4FA 5D85A 1JTFA 2BGWA 2QMUA 4D6PA 4I5FA 4UEJA 5GADl 4IV5A 3JQ8A 1QNLA 3O4GA 4YN3A 4XGRA 3SM9A 4ECEA 1G7RA 2CL5A 3QA3E 2GBLA 3LYUA 1TM4E 1EFAA 4TM8A 2Q3HA 3K9LA 1TF5A 3W9BA 1P4AA 2ECKA 4DA8A 4PPNA 3GBPA 1KHTA 5D8DA 1OYVA 2QD3A 3AINA 3HUFA 1PV4A 1OOEA 2Q0HA 5DYTA 1XJ0A 1KYYA 2WPDA 3K0FA 3QX8A 4J9UE 3PHJA 4M1SA 5JANA 5EQFA 5KTOA 3PD1A 4M87A 4UE3S 4ZODA 4HNAA 4P7GA 3SM3A 2V0GA 4M7RA 5DISB 3ANYB 3FYUB 4INJA 1HNZB 3CNEA 4FEEA 2CW5A 2H5IA 1XZKA 4CF3A 4MQFA 1RM5A 3MBKA 4PLGA 4ZVMA 5DXAA 1UBCA 2PRIA 5LIRA 4DUZB 2WWTA 1WMDA 5CLHA 3TX2A 1N5LA 3NVDA 2BEKA 4PAQA 5EQJB 4LQDA 2HIGA 2R1VB 1LQ2A 4L6AA 3PPIA 1TX4B 3UPUA 4H1TA 4NBRA 5CH8A 2HM7A 1FU8A 1E5QA 2V98A 4L8FA 3B1JA 4HNRA 1QRSA 4CI9A 3DMTC 1E59A 1YOVA 5THQA 5KWSA 4FMPA 4F06A 1H4VB 1FTWA 1PCXA 2R7KA 4I1RA 1FU4A 5AI0A 2WJGA 3RB8A 3KXLA 4X3CA 1T3HA 1X7XA 2FPSA 2AC2A 1ITZA 2YVUA 1Z0FA 2J7PD 2ONZA 3F7OA 1GZHB 3OY7A 2O8VA 3W8FA 3QITA 2DJIA 4ZI7F 2WKQA 1H4QA 1QXSA 2B21A 3K32A 3PC2A 3ACBA 3AILA 2W11A 2WKRA 5CURA 4MPDA 4S1NA 3E27A 2VRNA 3HBJA 1JLHA 1VYHA 4HB3A 3T0FA 4HAWA 1JH8A 5IJXA 3MRXA 5B1SA 4RNDB 4X60A 2GEDA 3GGCA 4Q7MB 3R7BA 2Q9BA 3E58A 2ZE6A 1A96A 4M86A 1N4DA 2HJRA 4Q4HB 1I7PA 2J67A 5FLEX 1L5LA 5IHPA 2C95A 2OBMA 3IBYA 1EFRA 1TVKA 3IAXA 3OUZA 4JLMA 2XBLA 4KNVA 1G16A 4J1SA 5B53A 1VL8A 2VSOA 2OFWA 3CWZA 3OO1A 2OHXA 1XFDA 3C6ZA 3FDFA 4XUGB 1JV2B 4O4JB 2X40A 2O1WA 4CXMA 2QYTA 3S2YA 1AKVA 4MV0A 4GQBA 3MLAA 3S2UA 2ZQ5A 1J9ZA 3INGA 3K2IA 5J5CA 3M89A 5IFLA 2IQ5A 2YKGA 3CRMA 4B81A 3INNA 3BTSA 5E1BA 1GAWA 1O57A 2OR3A 2QY6A 3GEGA 4FYXA 3G0CA 4Q1FA 2AUNA 2EWWA 3MIZA 3H04A 4O2BF 1I0LA 2GEJA 1O7JA 3T3MB 4B3CA 2VCEA 1X13A 2GSDA 3VSAA 4TM7A 4M21A 2O5RA 1IC6A 3P9XA 3ZYZA 4MR7B 5IDQA 1A72A 4FOLA 4D1YA 4EBFA 4BMSA 5JFGA 1E4YA 2IODA 1JKJA 2YWRA 4GM1A 2RH4A 3E3OA 2VHVA 3LDFA 4I1IA 5JJKA 1TCVA 2OBYA 3ZVNA 3TYXA 1H8HA 1K8YB 1R9MA 2EFJA 2Q1SA 1K88A 2PX0A 1UXHA 2W71A 4JK3A 1J9EA 1LXCA 3AUFA 3AR9A 4PZCA 3X2SA 4B73A 1ZRNA 2QUBA 3B1KA 3QKSA 5TXGA 1HE1C 5H80A 3HXQA 1A8IA 1NSFA 3C1UA 4Q3KA 3IEPA 5FT9A 1G9TA 3A7DA 4TUYA 3RJZA 2VTBA 1JEAA 2R0QC 5GJCA 4O0LA 1W44A 2WV7A 4HFNA 3NV9A 1YS6A 3PFFA 4NKRA 2OQRA 3OCWA 1GTL1 5DI9A 5JD5A 4R3UC 3A2LA 4K6GA 5B2ZA 3SF8A 4N48A 1WLYA 2FMHA 1P61B 4GIBA 2RHOA 5DM0A 2C83A 4CMJA 4DEYA 1UMKA 4IMPA 4YJHB 1E99A 2QZ9A 2YC4C 4OB6A 3A4LA 4PG6A 1BDJA 4CLXA 2CLOB 2VWQA 3U31A 1MIHA 3GJ6A 3Q3GE 3DMDA 4YONB 3ZW7A 1PGQA 3VAAA 1Y3CE 2O3SA 3CRNA 4ESHA 1QPBA 4P4SA 2GDJA 2XHZA 2DBYA 3KVRA 1ZM7A 2H1RA 4BQRA 3RVOA 3W4KA 4N47A 3WLSA 2OVFA 1MVOA 3IV9A 1HYEA 1IN4A 4K46A 2P7HA 1DFIA 1Z6YA 1X9GA 1EK5A 4H27A 3E23A 4M9CA 5AI5A 3D2LA 3FYTA 3H1AA 1P3Y1 5AJXA 2KLHA 1HZZA 3A58B 3AYZB 3GARA 4UBKA 1AUVA 1WW8A 2DBQA 4AZ0B 4EOGA 3AVUA 3QVVA 7GPBA 2HGZA 4C4OA 2VNIA 1SCAA 2PKRA 3SNKA 3WZ2A 4F3RA 3EIXA 1JB1A 3FDIA 2AN3A 4ZTBA 3TLEA 1JR6A 5CIQA 2WF5A 1X42A 2HXSA 2R2AA 1POXA 2ZIXA 3ASZA 3TGLA 3IKTA 1H94A 1T10A 5AUPB 3MWEA 1I30A 3WQHA 3OOHA 1UIRA 4B44A 3F0TA 4IFTA 2QG6A 2QU7A 5FH9A 4PIMA 2QAGB 3PC7A 2O2CA 4G0OA 5TGZA 1VIAA 4ALMA 3GUCA 4EKNB 4P7FA 4QUBA 2XTNA 4IINA 1RI1A 1KZ4A 5ECDA 3BOSA 4NDAA 3LJKA 3ORSA 4UQOA 1X70A 3M49A 5IN4A 3L6UA 2JI7A 1DNPA 1J8FA 1PT6A 2RHBA 1RI3A 1NVWQ 1WETA 3MW8A 2AI3A 2RBEA 3HYTA 5HKKD 2J6IA 4RH0A 4MEBA 1GZSA 1PJZA 2DYKA 1CJTC 3U39A 3V2HA 2P6OA 1BE8A 3A9WA 3Q2OA 4WKBA 3NWPA 3IP3A 3OFVA 5LZ8A 3OZGA 4EJ0A 1M8GA 2GH1A 5GJBA 4H77A 2C82A 2GR9A 1W1UA 2QI9F 3O4VA 4XLLA 4LZNA 1H93A 2BEUA 4COKA 3EEBA 3PHGA 4KCGA 4MCAA 3RFXA 1XEXB 5IKMA 1K3FA 2FJUA 4EPRA 3OKFA 4F56A 5LKRA 3AF3A 2JLYA 1ZL0A 2YXLA 3LLCA 3V9PA 1HDXA 4UW9A 3B12A 3JASA 4KIGA 3STHA 1C4XA 3A6GA 1UC4B 4YPFA 2XHEA 5IVDA 2QP9X 4KQJA 3WQSB 1NZFA 1ZK3A 1NAIA 4IY1A 1MFPA 3DA8A 3SEZA 3ME5A 4Y18A 5HBRA 2GFHA 4J6EA 1J8QA 3ER9A 1E20A 1FNBA 4BO3A 3NRBA 2C9ZA 1XD9A 4IICA 3GFOA 3LPAA 3LQ1A 1H2WA 4DF3A 4UOQA 1GXSA 1V6AA 1L7VC 3IB3A 2GKSA 3E1SA 1L5YA 1OFUA 4J3JA 1VPEA 1IQRA 1KI9A 4LOJA 1SKQA 3PCRB 3DMFA 4CN9A 5KYVA 4R6WA 1RAIA 1I4TD 3G2QA 3ZGYA 3GUYA 5ALOA 4E7OA 1OFHA 2AT1A 3ER8A 5EKUA 4BO5A 1EHCA 1NNI1 1S2LA 1VMAA 3X44A 1E9CA 1ZMRA 2O07A 1YFZA 3OZIA 1PE0A 5DHTA 4JLVA 2A2ZA 1FQJA 2DC1A 4ZMBA 1Q0PA 3JVDA 4FR5A 1TEHA 3M1YA 3AJRA 2NVUB 2OA0A 3KOZA 1W76A 3VH1A 2V7VA 3A1VA 4HKTA 4FGUA 4NK4A 3RADC 1WUKS 4KLCA 1Q83A 3ESRA 2PZAA 2Q3MA 4NNPA 2CLLB 5FUMA 2FR0A 2QBYA 2P9EA 2ZYTX 4QYXA 2O8EB 4ILEA 4MVJE 4R9NA 1MBZA 4WACA 5A6SB 2ONJA 3TD9A 2DKOA 5DN6D 3HDTA 3GK3A 5ADHA 3H9GA 3RRYA 2MIIA 2DUMA 2IHZA 1RM3A 1G5HA 1XPUA 2X8WA 1J2TA 2J5KA 1N5OX 1KARA 4E1VA 3VNUA 1T2NA 4PC1A 4UZSA 4N49A 1Z4MA 1NBME 5J2UA 5FPSA 1LZKA 1T6BY 2A7QA 2V4UA 4KKVA 5EWJB 3ZNPA 5JMWA 5M34A 2I0FA 3IPYA 3B1WA 1NW4A 3AF0A 1AU9A 2R4QA 4FFVA 4MKIA 5SV2A 1S2NA 1NHGA 1XAJA 1XUOA 2OVBA 3RBXA 2C4HA 2A33A 1ZAKA 1GIAA 1GN8A 3L7DA 4QNNA 4X62B 2FLKA 3GIDA 3F98A 1N0IA 1P4JA 1QM5A 3H5RA 2QUHA 1JAIA 1HX7A 2J07A 4E2ZA 1G6HA 1POWA 4KFTA 1ABEA 2QZ4A 3W90A 3K0BA 4HBGA 4G1EB 4IDOA 4IS3A 2GYUA 3WGKA 1GUAA 1TECE 4QOGA 3HWRA 4S3MA 4DIDA 4ER3A 3J81k 3ERCA 5B1DA 3HVKA 3T34A 3AF1A 1Z5WA 2WRZA 5DTQA 3C3JA 1GPBA 3L7NA 2GPWA 4DBVO 1USWA 5G0TA 4QEDA 1U8TA 1NOJA 2XDAA 4U8GA 4C5CA 2BP7B 1Y4DE 1G64A 4NMMA 4MDYA 4WN9A 1GARA 3RIYA 3UMSA 5FTWA 2QORA 5C1DA 4AUNA 1I7NA 5FDFA 2JA1A 1SXJB 2FOXA 4WTOA 4IQ8A 1JRLA 4UTZA 5T8KC 1CHDA 3Q7QA 3GRZA 2J3QA 3GWGA 1XMJA 3BB1A 4TYPA 4PG8A 4ZU1X 3JXEA 2J87A 3A9TA 3EA4A 1EP9A 1XRNA 2LVBA 4DWWA 5IP5A 4K6CA 4LPSA 2P68A 1N3YA 4MWOA 5KQSA 1N34B 3GU3A 4E12A 4Y2HA 1AF4A 4X8LA 1W19A 3WKDA 4TVSA 3TEFA 7ABPA 1H0HA 1S89A 2WSSD 2RGBA 5AKJA 3BEDA 2VOEA 5IVKA 3M4XA 3OJ0A 4LDPA 4BFZA 2F3SA 4YUXA 5BQXA 1BGWA 3H99A 3VSBA 5G0WA 5H81A 2D2FA 3I58A 1MB9A 3A3PA 3MT8A 4HWPA 3IODA 2NZXA 1JQAA 4JIGA 3COWA 5K0FA 3N2EA 1ZU5A 2BY4A 1G2QA 3WB1A 1CF2O 1MH1A 3WXBA 5K8JB 2IHTA 1VJDA 3WGQA 5EE1A 1VJ1A 1QQ6A 4WVLA 1R0SA 5K3FA 5CLFA 3ELBA 4BECA 3HVUA 3KVVA 2J6HA 4R98A 1KJYA 3A1NA 2AW3A 5DXFA 2XMPA 5C8YB 3WNBA 3W77A 5EWMA 2D06A 1Q44A 2JBWA 5FPTA 3BMQA 2MOKA 1QB8A 4RD6A 4EECA 4GZLA 3ZZ1A 5MFPA 2GZ3A 3B70A 1CY2A 3G9TA 3S8YA 2RAVA 2NTVA 2O1EA 2O06A 3ESDA 1KFBB 4KPYA 4YMSA 2XCIA 1P1JA 4MA0A 2X7XA 3ZXIA 3MD9A 4H7HA 4WADA 2X6RA 1TO6A 1OAKA 3FPJA 2AXEA 1YL7A 4LECA 4EW6A 1W0JD 4GEGA 4JC8A 1RZ3A 4F6CA 2Q4EA 4F1JA 3NC1C 3GROA 1FTSA 4TWZA 2IXDA 2XA2A 2FZLA 4IVQA 2OV8A 4CCWA 1GNRA 2PQ2A 2FFRA 1K4MA 4BP9A 5LZ4A 1NFQA 2FG6C 2Q9AA 1JXOA 2W43A 3DNFA 1OIXA 4G8DA 1N3BA 3WLHA 1NF8A 3UHJA 3GLGB 1FDVA 3SD7A 2DLDA 3GEPA 1SGWA 1U2PA 1E6EA 1T8SA 1A5AB 4KXQA 1NBMD 3MK31 2X4LA 4FDAA 1NM5A 3REQB 2OXTA 5IYZF 3WBKA 3ENKA 2VP0A 5KOIA 4H9GA 3Q0EA 3IV6A 3RLIA 1N92A 4PXAA 3HCPA 4GAEA 4ARZB 2H4XA 1QPGA 4N3GA 4C22A 4EG1A 3GO4A 5FLKA 2PD6A 3RT9A 5M29A 1NAHA 1QFMA 1ZD1A 4GW3A 4B3IA 3F3YA 4LJ9A 3THOA 2IYSA 1J00A 2O0LA 3U3DA 3E9YA 3WS7A 1VPVA 3GJ3A 1E58A 1SQ0A 1SURA 3D6TB 3G9ZA 3KU4A 3EODA 4FMDF 4G1FA 1T26A 1U7UA 1YASA 2IYUA 1L4HA 3LL4A 2ZYAA 2W2LA 3O2JA 4HLDA 4JT4A 2RHHA 3A6EA 5TQ2A 3TSCA 4ZI7B 1A4IA 5CG1A 4G0UA 2XPCA 4N0EA 2AK2A 5G02A 3ICEA 2BJHA 1BVRA 3OLYA 4FHGA 3JTMA 5B37A 4FDUA 3VU0A 2OXIA 4EO4A 4FMCF 5T6MA 1OC4A 4KUHA 1Y3IA 4I8DA 3IVGA 5E8JA 3MUEA 3LC1O 2O8CB 5JXIA 1ESMA 2P1DA 3OPMA 3DHWC 5JHGB 2SHKA 3MRVA 4FHCA 1HEIA 3USCS 2JCBA 4F2HA 4CR6A 4TYWA 2K7ZA 4J7AA 3WL7A 1QX4A 2H5EA 1GZDA 4MRVA 3RK4A 1FB5A 1V47A 2XYHA 2YVKA 5KWJA 3I4CA 1L5WA 3DCYA 4BX0A 2Z2ZA 4NIMA 1Q0LA 2Q6OA 1L7XA 2GRAA 5L51A 2JPDA 3UOWA 3MYRA 1AOXA 1MN6A 3KUCA 1M67A 1N0WA 3GGGA 3LRPA 3B5IA 1DXQA 4UU8A 1N1DA 1QKKA 1WXIA 4I5IA 2GS9A 2WVJA 1KI8A 3I1FA 4LY6A 1GG2A 1VRWA 3UXEA 4G41A 1XTUA 3TKAA 4GX1A 4Y1RA 4O2BB 3VNQA 3JSAA 2WUVA 4AF8A 3UANA 1OFIA 4QSMA 2B25A 3CKYA 3DLPX 1M34E 4HNVA 4D3ZA 1SCIA 2JW5A 1N0UA 2A88A 1TEXA 3FJOA 1W88B 1Y6GA 2IYQA 3DDUA 1C3VA 3NRCA 1JSLA 1BD3A 1PL8A 3HPQA 5E6SB 1ICEA 1KJJA 1X1DA 2GZHA 3EK2A 4BEBA 4MW1A 1QHIA 5CIWA 5F2NA 3CSUA 2OSVA 2H0AA 1KDZA 4PS1A 5BUZA 4M3NA 4WCFB 2CV1A 4K9OA 2AKEA 1Z33A 1BSVA 4ZRDA 2QA5A 3BCUA 4RHCA 4CNQA 1CT9A 2IZ5A 4L08A 3B7GA 3GRKA 1EGQA 1DV2A 4XA8A 1KXJA 1BTOA 2IIBA 2LZ0A 1HORA 3OOEA 1DIHA 3QYFA 4J0EA 3TRKA 3OLVA 4NE2A 3WL8A 2UVDA 1HT3A 1U6KA 1IN1A 1FUUA 4N4AA 4WOPA 3G2NA 2NO6A 2CD7A 3LVFO 4C7BA 3B1XA 1IJFA 3I53A 1U0RA 1ZEJA 2WKPA 3VZQA 3UK6A 3GLHE 1UBTS 2GUWA 4KUEA 3WISA 4PZ0A 4YP6A 4Y1EA 3I01A 3LUPA 3OETA 4MRMA 3QG1A 4QJ3A 5KDOA 3ZJ4A 3C6KA 1N2IA 2SCUA 4ZC1A 1KC1A 2ODNA 2VP2A 4ISCA 2R1UA 4Q39A 4QBTA 1L5KA 4XWOA 1OFVA 3C3PA 2RAUA 3Q3EA 4IG4A 4WK0B 5JVDA 5LP6F 3ESCA 4IHAA 1WB4A 5LB2A 1BRMA 2GN2A 2WV9A 1EDEA 3F49S 1D6JA 1H42A 1P4SA 5EP4A 3SZGA 2FQ1A 3AETA 3KJFA 4C7VA 3BSSA 1KOFA 2R4UA 4CG1A 2NZ2A 3DE6X 5KYXB 3T5GA 1K68A 1ZRSA 4EARA 5EJGA 4YBZA 2NZWA 4YV7A 4AJKA 5L4NA 4BKPA 3PHHA 1N5JA 4URVR 1A2QA 3C8HA 8OHMA 1TM2A 1T0PA 3UXYA 2N42A 2Z57A 2JD1A 4A2CA 1T2FA 4D5GA 1SC6A 4GRDA 1SCQA 1P81A 1NG1A 3OEHA 5KCMA 3AUSA 3GJ4A 5K6AA 2B3TA 2DBZA 4WOCA 3U7QB 2IPOA 5K0SA 1Q0ZA 4NU6A 2C0CA 4HCJA 3KKMA 4FFBA 3IP1A 3U80A 1NVBA 3WE7A 4A2WA 2GJ4A 4DSOA 3B13B 5JAHA 3TUZC 3KQSA 4JQOA 4GI7A 4L95C 5JPCA 1MX1A 5ED4A 3K5WA 2TMKA 4E30A 2XDWA 3WR5A 4ZFNA 1T2VA 4ABYA 3CV3A 2AUTA 2ADMA 2AXQA 2DR2A 3LFTA 5LZ5A 3QSGA 2WT8A 3KJEA 4O6VA 5DU2A 5JPIA 3VKHA 4P0TA 4LJLA 3BJMA 1A9TA 2RIPA 2I03A 2Q7OE 1PJQA 3HKCA 3LQQA 2I8CA 2MSCB 3IIEA 2QVCA 4RADA 4X1YA 1KPIA 5CDHA 4WLUA 3U3JA 2BI8A 4DLNA 2V03A 3LF1A 4RZQA 1W36B 3LX5A 2WFLA 3EEIA 4R83A 3Q9SA 5JCOA 3LUBA 2BJVA 2AQHA 4JUIA 1YZHA 2FKAA 2NVWA 1Z8DA 4MX8A 5GTDA 1X7WA 1U28A 3GJXC 4OOFA 4IJWA 5IVPA 2EARA 2X0NA 2V0NA 1O54A 1NQAO 4F97A 3QU7A 4KQWA 2FFHA 3ZG6A 3TNLA 1CJUC 3OOYA 1FSSA 3KQWA 1STOA 2GM5A 1NXVA 1KETA 3HZHA 3WYGA 2VJYA 4OX9Y 2ZWPA 1CLUA 3CUWA 3S5UA 2OWEA 2Z8XA 4AZVA 2P0AA 1VKHA 2O0MA 3EVEA 3K09C 1MABB 4DA9A 4MO9A 4FLMA 2ZXEA 1WQ3A 5HTOA 3WDSA 3BA6A 4G09A 3WA7A 1NGSA 1G8SA 1GQFA 1Q0QA 2JJ8A 4IGFA 2R65A 4TS9A 2C59A 2BFFB 5FI1B 3TD2A 5K09A 5TEVA 3R3XA 2PBLA 4EF6A 3T1VA 3SSAA 1TA0A 5HILA 3RGWS 1WXXA 3TZBA 3MCAA 3HJBA 5CLJA 3U19A 2E82A 2XNDA 1U2GA 4FEAA 4YJDA 5DTRA 2Z3WA 4PQFA 5T4FA 4EB0A 5JMOA 1R9NA 2FDRA 4WLVA 4TMFA 2VK4A 4LKOA 4XPIA 8LDHA 1KFJB 1DOZA 4TRJA 4MRAA 2GKGA 4FKZA 2YW9A 3MILA 1GY8A 4F6LA 2TMDA 2VQ3A 3S3TA 3DFZA 4MV8A 3VH3A 4AIRA 5BSEA 4U7DA 4Q16A 4B0PA 3IEIA 2CDAA 2QQFA 3GG9A 2XTAA 3HB5X 2DF8A 5ESRA 4P7KA 3VO9A 3WIDA 3B3JA 4BE9A 2GAFA 1MXFA 1G2PA 1PFKA 3HGQA 3LXXA 2LR0A 3TXYA 5A2GA 2Z5FA 1A9PA 5DNYB 4FYIA 4L8LA 2HJVA 4K86A 4WBNA 3NUZA 2DM6A 4MGEA 4AQ7A 3PZBA 4ZAFA 1A7JA 3ZDRA 4ZCMA 4ROSA 3ZWYA 4NBUA 4TTSA 5C3UA 2ID4A 4QWWA 2OM6A 3KOYA 4MZXA 3F6BX 2A5DA 1P3DA 2QTCA 1SFRA 3CRVA 1WVGA 4QGBA 3ON5A 1Q16A 2UVPB 1UBJS 1YQ9A 5TVKA 1XEWY 3AEQB 4MXDA 1AZWA 4ZCTA 3QKRA 1II8B 2JAOA 6CHYA 1GU0A 4AC9A 1YKFA 1XMSA 1KIAA 1NPTO 3GBSA 3QPWA 1OY1A 1W35A 3F96A 3HKEB 4N54A 3T5PA 4B6GA 1XB2A 3CNLA 4UTXA 2QLNA 3NBZC 2KE5A 3GC6A 1RACA 4ZQGA 5DM70 1QS0A 1M0TA 5A4AA 2CLCX 4U2BA 3HY4A 4NY1A 5F33A 4RFSB 3TKYA 3JVIA 4G5HA 1ULAA 1QHNA 1QHXA 5GV8A 4HDKA 3QWFA 3HSYA 1RTKA 4DABA 5IAOA 5E3IA 2CFOA 4IEIA 4BGIA 4ND6A 2GERA 3ROMA 4PQGA 5L6MB 4L4SA 4KQ6A 4DOMA 2COKA 2WIJA 1NY5A 4PIPA 2VF4X 3DEAA 1PJTA 4ZP1A 1MOPA 5G41A 1IQUA 1H9CA 2J5XA 1CY6A 2C99A 3FWZA 3L7OA 3PC8C 1IL0A 3I0NA 4KWTA 1QFZA 1O6ZA 2PV7A 4EYEA 1QFJA 2BMEA 3NWOA 4TVKA 4CLOB 3MTJA 5KJCA 2C4MA 2WZDA 1GM5A 3BKWA 4LBZA 4PN3A 1QYIA 3SR0A 3ZY2A 5FV4A 5IJ0A 4F7DA 1R74A 3BK1A 1KY3A 4WIAA 2HRDA 3WKBA 1UP4A 4KWCA 3LXMA 4IXMA 3I34X 5E2AA 3KR0A 1J0BA 1NDHA 1QO7A 2HXGA 2GFQA 4YMIA 2Q4TA 4N03A 1TJ5A 1O95A 3S1SA 1TAUA 2Y0BA 3OBIA 1R1DA 1GDTA 1VE3A 5IAEA 4CUJA 4DY6A 5TEWA 2J9XB 5K8IA 4CF4A 4KNWA 4WXEA 4GXTA 4AN4A 4DA0A 2JFXA 1D2NA 4YCSA 3KKNA 2LIPA 2XTZA 2QX9A 1W5FA 4F5EA 2IPXA 3D64A 3KUKA 1C30A 5DYGA 4CEIB 2Q49A 2QMHA 4YQZA 1JQ3A 5FAKA 2JS7A 4Q7EA 3ZNQA 3OQVA 4UHCA 4AQYB 3HG7A 1WMEA 4C0SA 2BM8A 3VU8A 1APBA 1QQBA 1ISGA 4FX2A 4OXXA 1BO6A 1UDRA 4D9HA 5JYEA 2OCDA 4TOIA 3NHYA 4N40A 5LQJA 1TM3E 1TUBB 1PFUA 3L49A 3GMIA 9MHTA 1VI2A 1XQ1A 1JI0A 1M5UA 2XCQA 4FOSA 4IWXA 1CRLA 5LQMA 3TAXA 3QF7A 4KGZA 3KPWA 1ACMA 4ZDJA 2HFKA 4HAIA 4UHKA 3DQQA 3OI7A 1RYFA 4KE7A 5UKDA 3BKXA 1YS7A 4L50A 1DLIA 2VVTA 4PXSA 1F2VA 5IT4A 3LFHA 3R0JA 3CBQA 3AR5A 1N2CB 4GOKA 4DRXB 1EWRA 3ZHCA 1HE3A 1RFLA 3GUUA 2C8KA 2I2BA 3ILXA 1P18A 3COVA 4G26A 4KX5A 5ALXA 4A0GA 1L1EA 2OQVA 2VWPA 4OGGA 1G3RA 2I7TA 3ABOB 3OZWA 3U9SA 2YINC 4K9LA 1JU9A 4Q3CA 3VKUA 1KY4A 2DQKA 2PZEA 3W5UA 3P9KA 3GEDA 3ZWCA 1TO2E 3EGEA 5DBGA 3ICPA 5EP3A 3KCQA 4IHJF 1ZD3A 4DCMA 1T9DA 3D6HA 3VPHA 5CFLA 3K4QA 1QJCA 3K6SA 4AKEA 4FC7A 5IYZB 5I48A 1WKBA 3JQFC 3BICA 2ERCA 3CKLA 1WUJS 1JMKC 5D3QA 1OUMA 2ZQZA 3AVVA 2X0IA 5JWHA 4BQNA 5CDTA 2AOTB 3QWHA 3N74A 2EFGA 1QO0A 3SC6A 3U61B 4B31A 1KS9A 5KSPA 1EUZA 1KU0A 4W5OA 2IUEA 1CEXA 3EIEA 3R24A 4UUAA 4DCTA 5HUQA 5M7EA 1F12A 1QGUA 1QZUA 4JUDX 2JLSA 3KLOA 4KPUB 2BMFA 4FMDB 4K3VA 3L07A 3T12A 3H0CA 4HH4A 2YZ7A 3CB4A 1IH8A 3A06A 1B2LA 3D54D 2B1GA 5JECA 4W5HA 4BGUA 3DBOB 1Y89A 4Q7JB 2HPVA 1ZU4A 2VUUA 2C94A 4KGDA 5KDLA 2DQ4A 2ZJAA 2ICAA 3VOSA 4ZI2A 3E3AA 4X41A 3E03A 3ACDA 1K98A 3I9V1 4P3KA 4RK0A 5HOQA 4FMCB 5DTEA 3TTXA 3TQSA 4R0MA 4ZDIA 4RE5A 1J0EA 1IN5A 1ZHHA 2VWGA 2WHPB 2E3JA 3BFJA 4CL2A 4GX2A 3M33A 3BHIA 4K40A 2PSJA 2OXRA 3PA6A 1C1YA 3C5WP 3ZUPA 1I94B 1JA0A 1C9EA 1U4SA 3ECSA 3O8LA 4NCJA 4H35A 4CKBA 4XVCA 5IZCA 2BPOA 3RYCB 3AVYA 1E3QA 2W5UA 3MF4A 2WILA 1I9GA 1MO6A 2NT3A 4Y6OA 2EL7A 5IT5A 1LVGA 1PLKA 3ASUA 4CU2A 2VCYA 3PJDA 4HATA 1OXKB 4QU0A 4DUPA 1U0EA 2N46A 4DMKA 4ARIA 3NM5A 5FOVA 1PT7A 5KMGB 1SJ9A 5GMOA 4BQIA 1FYXA 2H59A 4CZ2A 1X3SA 4AW9A 1KSHA 1R27A 2ORWA 3GGDA 4XVHA 5FQOA 3SU8A 1EG7A 3IVAA 3QY0A 4NXNB 3CZ9A 4ZCSA 4N5HX 3EG9B 4PSUA 1BGXT 5CH3A 5CP8A 3LHIA 5ESXA 1YFLA 2F1JA 1MLDA 2J3HA 1E1MA 4ZKEA 2QQGA 2D54A 2VP9A 4OUDA 5CA1F 1CPYA 3QJ5A 2QLTA 4R9UC 1NMSA 3OHMA 4BDSA 1GNTA 4Y6PA 5AKHA 3WLLA 3MRSA 2Z4RA 3GX1A 3NHJA 2HR1A 3DL2A 5A4JA 4G0NA 1J7KA 2C4UA 4NENA 5HYVA 2ZYIA 4MUKA 2O59A 4S1PA 1YR1A 2CV0A 1CF4A 1RLUA 4QG3A 4H3KB 3TZHA 4CM1A 3KB1A 1F2UB 4X84A 2O5CA 3OTQA 3SQXA 3ZX4A 3DO6A 1YBFA 2HJHA 1FLVA 1R5NA 1VL1A 3E4CA 4MQEB 4MW7A 3SS7X 4I8XA 3VDRA 4HDSA 4IHQA 1T5OA 3KPVA 3RUFA 5KZMB 2JAXA 2P3LA 3R9IA 1RLIA 3V1LA 3TZLA 2BAGA 2ZRBA 3AWIA 3IUNA 5JW6A 2CJWA 1UJ6A 3WHPA 2JH9A 1R12A 2PXHA 2XECA 1YHZA 1NX9A 3G68A 4HN4B 1OI3A 2W6JA 4BTVA 1W96A 3KB8A 1ORDA 3EVDA 4EZBA 2A9KA 4NZNA 2HY7A 1P9RA 3B20A 1OAAA 5GWXA 1Q1GA 2HWXA 3PEFA 3C8UA 4TL9A 2P0YA 4BBZA 4MARA 1LBIA 4K05A 4C87A 4FFLA 3C1OA 5DBOA 5L3QB 3DGFC 4BL5A 4B8ZA 1CDZA 1SCJA 1E9BA 2QRMA 3MJDA 2O48X 1G5TA 3RH0A 2I62A 1OWPA 1Y8QB 3WB9A 1K7FB 5LP6B 1EFPA 3PNSA 1QK5A 3R3SA 4BX9A 5KB3A 3NALA 4CKYA 3KYCB 1E7RA 5THXA 3T5AA 1H4SA 3ZBTA 5AHOA 1SMKA 3DOEA 3DVLA 4R2LA 2AOUA 3B6ZA 5CRIA 3ZLUA 1XMQB 3KZCA 1MIOA 4MDHA 1Z5OA 3E81A 1XMOB 4YRTA 3U37A 2Q41A 1MDBA 2ZYRA 2Y4NA 2IIPA 3AG5A 3F73A 3D3WA 4LF6B 2RH9B 4MS4B 4R1MA 4BEVA 1OFUX 4BFVA 1Z3IX 2FE4A 4LJYA 2HEIA 1ZR4A 1DSSG 2AXNA 1D2EA 1TA9A 1T1RA 5CXXA 3SKXA 3WL5A 5FA8A 1LCIA 4QPDA 4DHWA 5THKA 4WDQA 4ZOLB 4GVXA 2CBZA 1Z38A 1LGYA 4ND8A 4B87A 1QV6A 3KNZA 3C43A 3R7WB 3VU9B 1MC4A 4IR7A 2RC6A 1TZBA 4ZIRB 2P9BA 4Q3OA 1OA0A 4DR3B 1PUIA 1PZMA 2NN3C 2Q3FA 2PTHA 1NSYA 3I5XA 4MKGA 4K6HA 3FB4A 3V7WA 3HBLA 3VR6D 4BZXA 5AVZA 3N2GA 5LYJA 4HAOA 4QXQA 5A4IS 5KPDA 5LMUB 3SQWA 4IGKA 1JDZA 1E9SA 4ND2A 1DUVG 4PYIA 1AY0A 4WXHA 1HTBA 4R68A 4DLZA 4P3YA 4ZZ1A 1Z5ZA 2HO5A 4F3TA 4Z0PA 5BP7A 3HACA 5AKYA 1OHHD 1QVRA 2Q9UA 2IYTA 3C3AA 3NDRA 3QTTA 4Z99A 2IY9A 3FOEC 1CERA 4CLRA 2ACEA 4JLNA 1KJIA 2BHLA 2R5FA 5CX1A 3SC3A 5JD3A 1Q0RA 3EGOA 1BA3A 4WERA 2EKDA 3VSDA 4V1CA 1BHO1 3AI1A 1ULTA 1U31A 1DTWB 1U7TA 1Z15A 3KKZA 3P9ZA 4IYRA 5KAPA 4PYRA 3VOAA 3RF7A 1I8TA 1DAGA 2JJYA 4YUYA 3EDOA 5DK6A 2UZ0A 2ZIAA 4HVTA 4UCQA 2ZB3A 2GF9A 4TLEA 3ZU6A 1AT1A 1Z4KA 4Y6LA 3RIHA 4UNNA 2NV2B 2P2NA 2R97A 3TJMA 1OB2A 4P22A 2LW7A 3CVWA 4QBIA 2KW5A 4E08A 1LC0A 3OX2A 3W5SA 1XA4A 4K8OA 1H2AS 2A0UA 2G0TA 1ZH4A 3B3FA 4IP0A 5KHOC 5K2OA 4M38A 1YO6A 3LX4A 2HCFA 2H54A 4ODIA 4ACAA 5J5AA 3X1WA 1MKYA 4RYDA 1WLSA 5KI6A 3GXOA 3ABQB 1G55A 1ACLA 2HDNB 4LDZA 4EMUA 5K0JA 3NH6A 5ALSA 3X2EA 2DAPA 2HA5A 2W83A 4KQHA 1DWOA 2PCJA 3DPUA 3ZV4A 1AK1A 2H1FA 5IARA 3PWKA 1LPBB 4MEJA 2YVLA 3TZEA 2FLVA 2J5RA 1K27A 1CCWA 2WF9A 3KQUA 2GAJA 3HDJA 2XLBA 1YZFA 2RD2A 3PA8A 1EXNA 1SVKA 3D7RA 2ALJA 1YSCA 3FGPA 1EDBA 2XGMA 5G53C 2H9AA 3ETNA 1V5WA 2P9GA 3GVHA 4FCCA 3HDQA 4PXYA 3NYRA 4G0WA 1MX9A 1JALA 2H63A 1QVWA 3NM6B 2RC5A 3LWNA 3IH5A 1FFCA 3U0VA 3VTAA 3UV7A 1RKBA 5KWVA 3UQYS 1I6WA 1XEAA 1W6RA 2GZRA 2HKIA 2OC4A 2XYVA 5EMKA 1WXHA 2ZW9A 1CRZA 4GYJA 4OGFA 4Q4JB 4YJ3A 2BDTA 3R09A 2JLQA 4QECA 1QP8A 1SUAA 1Y8AA 3RM3A 3NQ41 2BFDB 3H4TA 1JEJA 4V1CI 2YWXA 5GONF 1F8GA 1HNWB 1W2WB 4LZJA 3TCNA 3X1KA 3GAZA 4G5QA 1H66A 1EAMA 4Y2TA 4G85A 2XX3A 4ZCLA 4GL4A 2OGZA 2VNJA 2XQFA 1NJSA 1W73A 4Q3NA 4TZTA 3COJA 1NW5A 1O4WA 3LF2A 3QWIA 2P41A 1H2EA 1U7HA 4ZQFA 2GKOA 2PKCA 2FPIB 3FW1A 4TLAA 4KFCA 1YRLA 2YYZA 1JXAA 3LZ6A 3Q8LA 3AUYA 3MJSA 5JJLA 4YRPA 4NU5A 4DV1B 2VYNA 4OLHA 3U7EB 4J16C 3SEQA 1A27A 1Z0AA 2IW1A 2A1TR 2IYVA 2JJ2A 1U98A 1HA3A 5KINB 1SXJE 2GPNA 4TXLA 2PUAA 4OHOA 3BMXA 2WT4A 1ESNA 3AEKB 4JJ6A 3OE5A 3UT6A 1V25A 2QM0A 4POAA 1D7AA 1SRRA 2FX2A 4K9MA 4E3ZA 1E2LA 4P35A 4Z7JA 2HU8A 2Z5LA 1I4EB 4XWWA 5EHIA 5K3DA 2GF2A 3ABZA 1TD9A 5C1PA 2IC5A 2AWOA 4L4RA 5DYWA 2PQMA 4TWIA 1GZ3A 1N2BA 2FRVA 3ICWA 4HTFA 3PUKA 4HYTA 4YJFB 4BTLA 3FFTA 1W1IA 4O4JA 5IPFA 1L5NA 1FXWF 5LNK1 4BVAA 1ZN2A 2F67A 4K9QA 3T7JA 5IAKA 2FMTA 1F0PA 2ZEJA 2II6A 2RB5A 1WCXA 3LX8A 4GRAA 1T4BA 1WCIA 2O3RA 3EVBA 3LWZA 3KQNA 1GSIA 3ZZMA 3HKDB 3S44A 1DC8A 3QU4A 1Z63A 2C04A 2C20A 2FLWA 3WGIA 2Z9BA 1J0CA 2X19A 5DNDA 3RGGA 3I73A 5EZYF 4CDNA 1SIBE 2I4TA 1GDHA 2WZCA 1J21A 1T25A 1HYGA 1YMQA 4NS1A 3KT6A 1S1MA 5TMPA 4MQ4A 5DT2A 2ZPUA 4X63A 1F3LA 1KL7A 4QARA 5AHKA 2Q3CA 2YYYA 4FDMA 3QYAA 4C0WA 1BE0A 2AQKA 1I2DA 2EKZA 2DLCX 3P4YA 1NFRA 1XTTA 3QVTA 1U8YA 4OI4A 1EHYA 4WVFA 2ZAMA 2XUAA 1SG6A 2H7VA 3NBQA 4EPVA 3VPAA 4HQLA 1WBDA 2BWJA 3DH0A 3SXUB 2BR5A 2P9YA 4NBKA 4DQVA 3U2QA 1KQOA 1GZ5A 3V8QA 4R2JA 4RQUA 3VJLA 2VNHA 3FUWA 3GF4A 4X1IB 1N7GA 3EY9A 1PG0A 4HSEA 1T4DA 2FSSA 2GT1A 3PEUA 3PIDA 1OI4A 4HWOA 2V7EA 2BZ1A 3UW3A 1VCHA 2D74A 1EK6A 1OD6A 3ZLBA 4DCNA 1KI6A 3NBMA 4W82A 1LLCA 1P7YA 2P9ZA 1Z56C 3Q9NA 3MMSA 4IJMA 1CULC 3O82A 3SZ3A 1N5RA 2RH8A 4LX8A 1QTIA 3I2GA 1L9KA 2GK6A 4MWSA 5CVCA 3N5CA 3RTGA 4YV2A 3Q88A 3NDIA 3O92A 4RTPA 2QZZA 4V39A 2VTEA 5AJTA 1GFZA 4DDTA 1RCTE 3GNLA 4JELA 1VYTA 1E63A 2ZVQX 2F8TA 4R54A 2WQZA 1X8JA 4LRXA 5B36A 1G291 1C0EA 4OAOA 2OENG 1U9IA 2JEYA 2WJWA 2Z1MA 3WYNA 1ZITA 1QDLB 1XHEA 1KK0A 3E8MA 4LOKA 3RHZA 3IQFA 4AZ0A 5ICEA 2B8JA 2VBIA 5A7HA 1BDHA 3ELWA 2FFBA 4L5BA 2K2QB 4ARAA 2O2SA 1EHIA 1E2MA 2OESA 5K0CA 4EFKA 1C41A 4IHJB 4WA7A 1MZVA 2FI1A 2HN9A 2PJDA 4JMPA 7YASA 4DPKA 4CI0B 1EFRD 1A0OA 2PT7A 3ZHOA 2P2CA 2FW0A 3N7AA 3PFKA 3THWA 3BDVA 4R7GA 2D0PB 2G80A 2HK8A 4RJLA 3PEYA 4MVCA 2WR8A 2AG8A 4BO8A 3D6AA 1ZSNA 4EHHA 1DU4A 2BV3A 1AKNA 2TSYB 1XZDA 2FF5A 1A4RA 2RG1A 4PC6A 5I4IA 1RYNA 3HYLA 2O0HA 4RKFA 2XTMA 4KAXA 1HFKA 1TK9A 2PJZA 4JVLA 1U0FA 4TWRA 4MYHA 4BV8A 4I4LA 5EIFA 4MINA 3IP9A 4C2TA 4MQUA 4K87A 4PCAA 4ETNA 2JAPA 2PG3A 2CUKA 5AK3A 3DBIA 2XV1A 1OVMA 1H6DA 2QM8A 1V4BA 3O6VA 3CT4A 4IIEA 4NK5A 4RWEA 4PYOA 4B33A 3KD2A 4M8LA 4K9PA 4DV2B 2R6AA 4C6SA 3GPDG 4YRZA 4R9VA 1XLUA 5I7AA 1LK7A 1RU3A 4PYJA 5J2TA 2WABA 2YVAA 3P32A 1MX3A 1U0GA 1FW6A 1NIPA 1YDMA 3JWPA 2LRHA 1FJHA 2REOA 3I01M 3I8XA 4IWNA 3SC4A 1HYBA 1W7AA 2IXGA 3DD1A 3GA7A 1V9SA 3JY6A 2CJPA 4OYLA 4DMMA 3ZV6A 1XU7A 3G2IA 2CMHA 3MWDB 1KVQA 5JDCC 4JVNA 3DNMA 1J06A 5HKAA 2BBTA 3FLAA 3HI4A 4N65A 1YUNA 4DQKA 4L5YA 1U5AA 3A9SA 4MKRA 1XL0A 1XCMA 4PAMA 1RP7A 4Q37A 1AQJA 1EKXA 4CDMA 1H65A 3DMHA 2VP6A 3LTEA 3ZNNA 4M88A 4UVIA 4AO6A 4MVJM 1EVZA 4D4MA 1OXTA 4Q66C 4TWJA 3VPDA 4E5MA 1JQDA 5ALNA 5LVAA 4N7JA 2AGVA 3HJHA 1PYDA 4WA8A 5CA1B 3NR2A 1MRSA 2QM3A 3K3PA 1RQRA 3O83A 3PGLA 4RX1A 5F5XA 1ZL2A 2OECA 2PUJA 5KTMA 4F0JA 5L45A 4Q9DA 1NVVR 2JANA 2IYLD 1YQEA 4X93A 3ZK7A 3CZRA 2QN1A 3V4VB 1AN0A 1RDFA 1YZYA 2VXOA 1IDN1 2OAGA 1VE6A 2Y1CA 4RW0A 5T41A 4FBLA 4A16A 1P39A 2HO4A 2WSYB 3AESB 4QRHA 4UPVA 4B6FA 4B71A 1RLOA 1D2AA 3WOHA 3TSZA 3BM5A 2I4NA 1G21A 1PZHA 1QCDA 1UXKA 4BMCA 5KVSA 4GGMX 2VYCA 5CPFA 5H70A 2GLUA 3DG9A 3GCXA 1QH0A 1MC5A 3VR0A 4WXPA 3SYLA 1T2UA 4RLFA 2I2AA 3L8EA 1DBWA 3OQ6A 4Q48A 4QTUB 3WBBA 5B7PA 1E3WB 1T8WA 5I4BA 1XPJA 1TMKA 3K0CC 1CRQA 2ODEA 3ESXA 4GOJA 1UBHS 3DW3X 3HDYA 3M82A 5JJBA 1E5XA 1BZYA 2GEBA 13PKA 3T7RA 3C3BA 4G2NA 3TKLA 3ZW9A 1ZRHA 3KHSA 4Q00A 1J0AA 1BVYF 1VA4A 1XQ6A 2O0JA 3GLTA 3RAPR 5KQGA 4MWBA 3A14A 1CIVA 1QIDA 1Y98A 2BEWA 4ZYLA 3IE1A 1RYEA 2YIVX 3MS7A 4FNAA 3ZU2A 1ISMA 5KVQA 2V96A 4C4PA 1E61A 2WVAA 2R5WA 2O5EA 1M72A 3JQBC 3UWPA 1SK9A 4B3JA 4IOLA 3TFOA 2DH6A 1BW9B 3R1IA 3F4LA 4ZAXA 3TDNA 4LRWA 3A32A 3H5AA 5FV7A 1C29B 1YCFA 2JHGA 3HYCA 4GUAA 4JA2A 3UWKA 1Z06A 3O9VA 1XZQA 1HI9A 4X24A 3MERA 1YR8A 3SY8A 4DQ0A 3DLBA 1ZD8A 1U4OA 1NW6A 2Q8PA 5G0VA 4B82A 1GYQA 1P75A 4G4SO 4JI3B 2WC1A 3IO3A 2YZMA 4GLFA 2G06A 4R1NA 3QX9A 3BMNA 2JARA 4ALIA 4IKEA 4QLBA 3HCRA 1VP3A 3M6MD 3GAFA 2ZSAA 2VDLB 5E6UA 4FS3A 2GHQA 4I36A 2WG1A 4FWIB 3VZCA 1B8OA 1ECBA 2R8BA 4UU7A 1AZLA 2ZSJA 4EMTA 2YQ5A 3MTGA 5EE9A 5ADWA 4BC1A 1DL5A 2GXQA 3VPFA 5B3KA 5JI2E 1ZOSA 1SXIA 2G25A 3AY0A 5TV2A 4UNIA 3LUFA 1U0BB 4H1VA 2ZUCA 5BUCA 5LUAA 3SYKA 1YMVA 3HU5A 3I37X 3PRKE 4PYKA 1UBUS 4JB8A 4YRJA 4CODB 4P80A 2ZREA 2WP0A 3LUAA 4ED9A 4MWDA 5JSYA 3NYIA 1WWKA 2OO3A 3VI4B 4KNYA 1FFAA 2CY0A 1GCGA 2E1PA 1S8OA 2Q5JA 5LD2B 2VUTA 1MJHA 1JLLA 2IK8A 2AD1A 3QBEA 3GDWA 4ZHQA 1SK8A 4RK4A 2Q3JA 2MYNA 3ETCA 2ZAYA 1R8SA 1J7JA 1ZBDA 1BXZA 1PQPA 1CB7A 2QT1A 4A2QA 1C7EA 5ICCA 2VYVD 4OYRA 1MG5A 2PWPA 3L7IA 3DXXA 1EX6A 4RJ2A 2FZ5A 2X8BA 2W70A 3IJRA 3LYHA 2XWSA 4JB3A 4QFCA 3T4PA 4ZYXA 1S4QA 2QY9A 3R6DA 4XLZA 4EB8A 3S81A 1YACA 3MXTA 3BB4A 2OCLA 5C8YA 1XT6A 4Q1DA 3T7EA 2JVJA 4R2XA 5CVDA 5J63A 2IS1A 4L9AA 5AKZA 1E2GA 1XQYA 2PS0A 1Y1QA 1QLWA 2D2IA 1R0BA 4NEHB 1RAAA 1ZIYA 2P79A 1Z08A 4PG7A 5JD4A 1XELA 4LJ6A 1J39A 3GT4A 4Q03A 3RFFA 1EK2A 1K89A 4OQPA 2AMVA 2C2MA 1JR3A 5HQTA 1M54A 2NUPB 2XA1A 4PGHA 1NW7A 1GZUA 1N2EA 1JKXA 4NBWA 4CMAA 4MP6A 2ZRKA 5IHXA 1DBRA 3FCCA 4YMWA 2FQWA 2ATIA 2A9JA 4XYEA 4C2UA 4RMGA 2D3WA 5DV9A 2I4IA 3M2PA 1U11A 1SB8A 3I3SR 4TRNA 3IQZA 3HEMA 1K3TA 2UYYA 2C3UA 3VZPA 1CUCA 2JIDA 5EG5A 4UTNA 2JG3A 1EDZA 2NXCA 1DAMA 2R00A 3GLGA 1UQUA 1K6JA 1E8NA 2E5WA 4FZJA 1ZGBA 2V8OA 4GU5A 1WP9A 3CPJB 1U8EA 2DUWA 2F64A 2PKEA 3PUXA 5FWYB 1CUAA 4DFDA 1P5HA 3V34A 9ATCA 4REQA 2E6UX 5DWDA 5TARA 3TJRA 3WADA 4M0PA 5GONB 3SLKA 3IUMA 1F5SA 3WYBA 1UJ4A 5HIJA 1HTWA 2IS4A 4JS0A 1KVRA 3C8DA 5JTTA 2ZBFA 4XTRA 5EJ8A 1JJFA 3AQ4A 4M22A 3DEZA 2ZGVA 4HR7A 5A4MS 1QFSA 3E15A 4KQGA 2HUPA 4EKIA 3ZBQA 4UNSA 1O96B 3R3ZA 4KEAA 1E6MA 3CIOA 4ZXPA 4X0EA 1EJ0A 4B2YA 3N8NA 4MAAA 4OVKA 4DZTA 3DFMA 2PMEA 5K4GA 1RIFA 4TTVA 4P0QB 1Z0DA 3RLFA 5K51A 1B1CA 1OTYA 3BK2A 1XTJA 1V8PA 3F8WA 2ID9A 1DEKA 1IQ0A 4I0WB 4RORA 5KOYA 3AEXA 3A6LA 3EQ8A 4PX2A 3I2FA 4V0SA 5L7YA 4YAGA 5JFOA 4FSDA 1ZAYA 2OCPA 5A5EA 4DDHA 2ZRHA 3QE0A 4K9RA 1M1ZA 3TOSA 1SHTX 1VLMA 3LY7A 4EDHA 4F60A 5C7OO 2O8CA 4MGIR 2P4SA 2WM3A 3ZH9B 4CIBA 2YNMC 3ESBA 2WOOA 3GH1A 3G17A 4CCYB 4ZAYA 3WNQA 5DN9A 3AZQA 2OYSA 1USUA 1M2FA 4R1UA 3ILYA 3LX6A 5C4GB 4W7SA 4XIIA 1JFRA 5K6RA 5EIXA 1EUYA 3B2EA 2A0WA 2X6QA 4QWMA 4WKOA 5DP2A 1G3IA 2HL6A 1YRHA 2QMOA 3HNOA 1DAHA 5T4HA 1IK6A 1MQAA 2WUDA 1UKCA 4D9EA 1YV9A 2DUUA 5G4KA 3KX2A 5F52A 2O54A 4RJJA 5TS2A 4O2BA 3SPXA 3ZJYA 2Z08A 5KOHB 3IR7A 1RWKA 2KPOA 2NZYA 5AO9A 1EBBA 1UEIA 2F3TA 4ER7A 1NVDA 3SDBA 2Z3VA 2CD9A 3GFVA 1PNTA 5EZYB 5KEIA 2G9RA 2P6UA 3NJRA 2COUA 5C34B 2C4VA 2AVNA 3VI3B 2J9GA 3U3XA 1L5VA 3FTFA 5E6SA 1FNDA 4MP3A 4WY2A 1SZCA 3ZKWA 2B6NA 2WMYA 3A6KA 3JYQA 1K2VN 2R25B 3ESZA 1JLKA 3O4RA 3GFSA 1P17A 3E6AA 5DHPA 2WD7B 1EWTA 4WCFA 2I6GA 5BMVF 1JEDA 5AW6A 1NMZA 1N2CE 3KP1A 1DIAA 4WUVA 3K1AA 3AHIA 3AVTA 1XG5A 2I8LA 3PGJA 4ZALA 3UNXA 3WJ7A 4OL9A 1X7GA 1WVMA 2NO5A 3FMFA 2WAYA 4PCVA 1NF3A 3GDGA 4NG5A 5GJWC 1CJBA 1D4ZA 1ZJ5A 3N07A 1TJPB 1USGA 1X7YB 1WAMA 4YRSA 1WZEA 3W5BA 1YE3A 1LJUA 5E7IA 5EIWA 1BG6A 3KAKA 4OMUA 3H5NA 1KEEB 4QXRA 1WEKA 1A50B 2DQSA 1CUYA 3CW2A 2VRBA 4B3SB 1H6CA 3SYNA 2R1ZA 1CVLA 2ZANA 2HADA 3S99A 4UOZA 1JKFA 1SH7A 3OZVA 1O6FA 3R6GA 3ZDYB 1C4WA 2B61A 1SD5A 3NKLA 2A30A 2H92A 1OKKA 3CISA 1AD2A 2W2LD 3F7NA 1VC2A 4WKNA 4KOAA 3AM4A 5A1JA 2X14A 3FUTA 3GT7A 1EDOA 1V9LA 3BXGA 1T3ZA 3N58A 1LZLA 1O58A 3PF9A 1JSZA 4IXNA 2UVQA 2NTEA 1SUSA 5EZSA 1IMJA 4Q3EA 1N5IA 5AHXA 5JNSA 3P2IA 3QVKA 2VDWB 1C2YA 3FSGA 2CXNA 1KSJA 4ZOQI 3HL0A 8ABPA 4LHYA 1QU2A 1GTSA 1SM4A 3HLTA 1AE1A 1FSFA 1HT0A 2YWFA 4B85A 4LHSA 5JH7F 3EXAA 3OA0A 4UEOA 4BO9A 3O8NA 3NI2A 1RKXA 3P0HA 3HCFA 4M1ZA 4NI5A 5F9FA 1WVIA 5ICGA 4INOA 2W93A 4CM9A 3CJQA 2FWNA 3OX4A 2BKEA 4HH0A 4OHZA 3PITA 4L74A 4M1QA 2FGJA 4JR0A 5DHRA 1JHZA 2NUTA 4C3UA 5EE0A 4CV0A 1K5DA 1R9JA 3K8YA 1GPDG 4I9NA 4LHWA 5AUQA 4MQMA 2Z1NA 1JQBA 4C05A 3DOJA 5AKXA 3AHEA 4HN2A 3KBBA 1JIKA 1RPJA 2H4HA 4QL3A 4Z7OB 3HWX1 3UATA 4H7EA 2O2YA 3K70C 2MDTA 5KNCH 4CKWA 3ZIUA 4DR6B 5D5HA 4MWCA 3NDBB 2M9MA 2BEVB 2Z9CA 3AC0A 5IM4A 1SCNE 4K8RB 1TIBA 3U7IA 5JARA 2FB9A 3BWEA 5AW0A 4F3NA 3GLFA 3FPBA 2OFOA 3I39X 3J7TA 4OBEA 1JDVA 4EHAA 3WZMA 2EKBA 2GLTA 3TECE 4E6PA 5HGJA 2XODA 4X92A 5KTPA 4HN9A 4PFQA 3ECCA 3ZHUA 3BPSA 3NHPA 4YMGA 3W6NA 5DGTA 3WK9A 5CCEA 3PXGA 2E1RA 3SZLA 1Y4ZA 3JAWB 1E8MA 1KEVA 1T3GA 5MFZA 3EBPA 1Y9JA 3CF0A 5DNEA 2PZFA 5DBHX 2YMQA 4YECA 4QVKA 5BWLA 1C9DB 4Z86A 2UXBB 1PWXA 3D8HA 2JGAA 3CIFA 1FP6A 3CMCO 5H4GA 4Q9AA 4ZYUA 1GQRA 1MPXA 5A03A 4YWJA 4D9IA 1H2RS 5TPZD 4QBGB 3QKTA 1ATZA 4NYMQ 4HPXB 4V38A 4D44A 1JR2A 4QD3A 3SE7A 4MR8B 4P2GA 3PQ6A 3RVDA 1I7DA 3GD5A 3PXEA 4R0NA 2JATA 4NFLA 3I52A 3GNSA 4L4YA 1CR4A 2HQ1A 3WO0A 4FGJA 4RVCA 1O6GA 5AVKA 2HRQA 2OCYC 1YDWA 2PZLA 1VCNA 2QW8A 3BMOA 1Q7GA 1KHHA 2FSIA 3MT0A 3OBBA 1N9KA 1N6RA 1O4VA 2HRRA 1ETHA 5HCIA 3GLSA 1S8AA 1GVHA 5LMNB 1X74A 4JOQA 5DWQA 4AQDA 1WNTA 1T24A 1P5JA 3RVPA 1MJ5A 4PLWA 3VYVA 2HLPA 4QUKA 2G07A 2XF8A 3JD1A 4Z4EA 4JJ8A 1GTMA 3VA7A 4DWVA 3O8QA 5AKIA 3IMEA 3ZU5A 2ZYSA 1Y4SA 2CF5A 1KEKA 5LQRA 2FR8C 2OO7A 3HEAA 4CEJA 3OEHD 1E60A 1IMOA 2AZTA 1WR8A 2D13A 3H6GA 3A3OA 2V1UA 3JQEA 3L1HA 4N0PA 3FOZA 1UPXA 3U4MA 3P52A 3G8YA 2ZRIA 4ASUA 5BRAA 3HJRA 3TO5A 2H2HA 2H3EA 1Z36A 2WD9A 5DTJA 2BI7A 4RJIA 1RADA 4BV9A 4RMHA 1QYDA 1MJGA 2IITA 2HPAA 2DY1A 2O6LA 2YWEA 4OYYA 3AEQA 4ZCPA 3A28A 2B5OA 4XSGA 3EVZA 2LCQA 4JLKA 2BRUC 1X8LA 1P91A 2XQKA 3H19A 4XOIA 3L6BA 3V6MA 2AF4C 2FEWB 2MSWA 3TRHA 1UAYA 4BNYA 5ITWA 3PE3A 2BZSA 4XASA 4AS1A 3R75A 2ZJ1A 4MUEA 3NZEA 1IN7A 4E88A 1FUEA 1QBKC 3UJBA 4JUCA 3OD1A 1QV7A 2BMVA 5IG2A 4LKRA 1UM8A 4S2EA 2X0FA 3S8MA 1VMKA 1X14A 1CP2A 5AJYA 4ZK2A 4UQLA 1QKJA 3O2NA 4O4LF 1WHSB 2F1IA 2Y3IA 5BNIA 5ARBA 5DTIA 1D4AA 4ZOEA 5HW0A 2GJAA 2VSXA 4U9HS 2QXTA 4FIZA 3AM1A 3LI2A 1LSOA 3IP7A 5AOCA 4HV4A 2Z4SA 2AC4A 2YJ3A 1ZNWA 2WTMA 2VP5A 1EE2A 3JATB 1RD4A 3LT1A 4TLCA 2I1QA 1KDOA 3GVXA 1A5TA 3EIFA 4IMJB 3AUKA 5GOTA 3WMEA 3ZLVA 4CM7A 1TI7A 3AY6A 3JD3A 3PSAA 4XX0B 2EDCA 3HA3A 5F7JA 3HR8A 3GRCA 1N6OA 2VPPA 2V9CA 1LS1A 2Q28A 2WJHA 3H84A 4JJGA 5EMNA 4C14A 3P8ZA 2H17A 4JU8A 3WIBA 1SXGA 3EPRA 3V8EA 2J4CA 2LTAA 1AKQA 1FTGA 1PL0A 1RYHA 1I01A 5DXJA 2GZ2A 1QK3A 3LAWA 4PG5A 3WLTA 5EINA 5BSHA 1ZSVA 5CHEA 4DL9A 3O3MB 3DMPA 3RVJA 4C08A 2XNDD 2QPLA 1ZICA 2F43B 3I9JA 1HOTA 4M0MA 4Y67A 3UHFA 1I80A 1QYXA 4NVRA 4UTVA 1JI3A 4IF6A 6NULA 4RVHA 4TPKA 1GG5A 1JECA 2V1XA 3TAHA 5FPQA 1RJEA 4LTDA 2AZXA 2VS1A 3EJWA 4HDOB 3UMFA 4CQNA 2NW6A 2G4LA 5J5VA 5B4TA 1IY1A 4GRIA 2VK8A 2GFIA 2ZXFA 3FNEA 3EZFA 2JLAA 3FPGA 3RIEA 3V5NA 2WKWA 4CL8A 1IUPA 4Q1AA 3THYA 3CX7A 3SX4A 2GOYA 5CT8A 3BVPA 3B9RA 1OAOC 2FZ4A 1TFRA 3OPNA 2PZBA 3K0HA 4UD6A 2ZLBA 4XOUA 5DE3A 3UMGA 3GLIA 4A0HA 4YCMA 3AY3A 1JHPA 1Y1RA 2UUCB 3JALB 1NLUA 4BAUA 1Y6FA 2X23A 1MVLA 5FI0B 1XRSB 1NNLA 2JASA 4ILKA 4MHOA 4XE5A 5H7XA 5HCNA 3WB2A 5ENVA 3S2GA 1RRFA 5B4VA 2CLKB 1NV8A 2BHSA 2P2ZA 4S24A 5ALGA 4C7JA 2BSAA 2GILA 1L4NA 3UKDA 4N8SA 1TL7C 1GGJA 1KU6A 3FF1A 4NJOA 4BX3A 4DILA 2Z6AA 4FKBA 1N8KA 2DTDA 1MC8A 4MI9A 2CVQA 2QRVB 4PG4A 4QRDA 4BBPA 5EMLA 5JZBA 1PV2A 2Y99A 3TLGB 1WXFA 4IIUA 5H4HA 1U3CA 2AFHE 2QKYA 5F7OA 1F1BA 2WU4A 3QBDA 1KZYC 4JDUA 2PSHA 1GL3A 4MNTA 2QG9A 2B34A 3IPLA 3EAGA 4JITA 3GJZA 4YAJA 4IUDS 5D6OA 3WHLA 4ER5A 3UUFA 3L1KA 4PYNA 3FLBA 3MTBA 4HUQA 3GEEA 3I9MA 4I66A 4JLJA 2XUQA 2YZNA 4FDTA 3MJEA 5HVNA 1VE5A 1U1GA 2UYGA 4BRUA 2IUSA 1T9BA 3E2PA 2P2YA 3W7BA 4CG0A 3RVNA 2PSFA 2VZ9A 2ZPAA 4AKHA 4KR2A 4AZWA 2YJ5A 4D8TA 3ZD7A 4IH4A 3OCVA 1NQVA 1BD4A 1PJ4A 3ZHTA 1NNUA 3V8MA 4PW0A 1KZ6A 1T8RA 1XP5A 4J0KA 1M1XB 2XYQA 5M3BA 3ROEA 2CL6X 4MIYA 3EHEA 4PTZA 4W63A 421PA 4DHEA 4Z7QB 3VUFA 5KNDH 2R8ZA 2CN1A 3BH6A 2JVIA 5HIAA 2RG7A 4WY5A 3FWHA 4ZVPA 4BASA 5JYCA 2Z4TA 5LSAA 2XSZA 3H5VA 1YUMA 5E7JA 1XD2A 4EDFA 1CE8B 1L8XA 4HRVA 1JYFA 4F4DA 3PSHA 4AZ3B 2ZI7A 3H16A 3HSSA 4I1VA 3TINA 2XCUA 1FYVA 2P27A 2H2WA 3CZQA 3PXCX 4UQPA 3IEKA 3T5CA 1DJOA 1PKXA 3BIWA 3LCRA 4R3NA 4XGQA 1SC1A 4FGLA 2IQIA 3L7YA 1FP1D 2CXPA 3LV8A 2DTEA 2QSYA 1D6MA 2EP8A 1O95D 3DZCA 1HPLA 1D5WA 3BAZA 2JA2A 1AO3A 3BIJA 3NEJA 4D8WA 1RXSA 2X0JA 1QDUA 3MG9A 5JAZA 2AN1A 2Z9DA 3P4UA 2G08A 2ZKLA 3U5ZB 4E22A 5LYJB 2C2HA 1I5OA 1JZSA 3AB7A 2REQB 4HF7A 2Q07A 2JCXA 1VB5A 3IUPA 4X45A 4DLPA 2WW8A 2H4FA 4NV0A 3DZBA 3RYCA 3DDNA 2QD4A 1M5TA 1T8TA 4OU5A 4RELA