3IHTA

Crystal structure of s-adenosyl-l-methionine methyl transferase (yp_165822.1) from silicibacter pomeroyi dss-3 at 1.80 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
b'EQSRLDLFIDRMVSQRACLEHAIAQTAGLSGPVYELGLGNGRTYHHLRQHVQGREIYVFERAVASHPDSTPPEAQLILGDIRETLPATLERFGATASLVHADLGGHNREKNDRFARLISPLIEPHLAQGGLMVSSDRMYFEGLEELPLPPGAVVGRCFIYRRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosyl-L-methionine methyl transferase
molecule tags Transferase
source organism Ruegeria pomeroyi dss-3
publication title Crystal structure of S-adenosyl-L-methionine methyl transferase (YP_165822.1) from SILICIBACTER POMEROYI DSS-3 at 1.80 A resolution
rcsb
total genus 47
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12692 Methyltransf_17 S-adenosyl-L-methionine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ihtA00
2CKDA 4MTLA 1RI3A 3PX2A 5FHRA 3DXXA 1SVUA 2UZ4A 3GU3A 2P7IA 3T7SA 4PYJA 5BP7A 2JH9A 3GJYA 3BWYA 5DX0A 3VSEA 1JG2A 3GDHA 3DLIA 5E2AA 2NP7A 1XVAA 4GOOD 2B9EA 1R74A 2EX4A 1ORHA 2XVAA 4P7GA 2P7HA 2DPMA 3L8DA 1JTEA 1TW3A 3G2PA 4PCAA 4RYLA 3UBTA 3EVFA 3BXOA 3FUTA 3VC2A 2JHCA 4OQDA 1R8YA 3S68A 5KS2A 2FHPA 3O7WA 1RJFA 4FP9A 5HZMA 1BKYA 2IIPA 1O9GA 2OKCA 3FRIA 3LDUA 4FS8A 1T43A 2OPBA 5FADA 3TKAA 5E1MA 5H02A 3LX6A 4C4AA 3A7DA 3UJ7A 5LQKA 2HR1A 2O0LA 3AY0A 4C08A 5F2NA 3HVKA 3KPWA 10MHA 2FRXA 3KKZA 2AN4A 1KP9A 2CMGA 1KYZA 2B25A 5G02A 3R6TA 5GM2A 5HIMA 4CKBA 4AZSA 2IH4A 2JJQA 4F84A 1WXWA 2P3QA 1V39A 1VIDA 3UA3A 4ER3A 2NXCA 1YB2A 5EKXA 3DMGA 3SVZA 3TRKA 5K0JA 2YQZA 3SGLA 4AUKA 2PXAA 3EVBA 3UJAA 2FK8A 3GNLA 2IGTA 4CWAA 2EJTA 5HIJA 1KPIA 3NWBA 4RV9A 2R6ZA 5CUQA 2I6GA 4XUEA 2IH2A 3GRVA 1XJ5A 2PXCA 3FYCA 3I58A 5EEGA 4YV0A 3FRHA 2ZIFA 2OB1A 2ZWVA 2B78A 3FTDA 2ZULA 5CM2Z 5FHQA 2Y1WA 2UYQA 3G7UA 3PTAA 3HVJA 4P7KA 3UWPA 3ELWA 5EOVA 1X1AA 1ZG3A 5HFJA 5E1DA 2ZLBA 4G56A 4QQNA 2AOWA 4GF5A 4WVLA 2G70A 1XXLA 1H1DA 4IV8A 2PLWA 1MJFA 1Q0TA 3HNRA 4KDRA 2XVMA 1G55A 1RJDA 3DH0A 3LKDA 5E2BA 3T7RA 2XBMA 4X63A 2PX5A 1JR4A 4U7PB 1PJZA 2GAFA 3AJDA 3REOA 3UFBA 5LQNA 2OYRA 3OCJA 5LR6A 2ZZMA 3A25A 1BC5A 4FZVA 3G2MA 1O54A 3CCFA 4FT2A 5U4XA 1NBIA 1IY9A 5GINE 1ORIA 4AZTA 4C04A 4RTOA 3NDJA 5KQSA 3IEIA 2AOVA 3SR4A 4P7FA 4JXJA 4CKEA 3GIWA 3HM2A 3P2KA 3FPHA 1ZGJA 2VZ9A 3I9FA 5E9JA 3FUWA 3BWBA 1D2HA 3NJRA 4X41A 4ISCA 1KPGA 1KYWA 2N47A 4ER7A 2C7OA 3PLAE 1UIRA 2AR0A 3KQPA 1AQIA 1VP9A 3ER9A 2UYHA 1P1CA 3CBGA 3IYLW 3I53A 2IP2A 4PWYA 1YFJA 5T6BA 3HTXA 3U81A 3B3JA 5KVAA 2NXNA 2O06A 4QQKA 1JG4A 2QM3A 1SQFA 3TQSA 2BR3A 2P3LA 3DXYA 3C6MA 4YMGA 1QAOA 3CKKA 5FQNA 5GIPE 5EPEA 2PX8A 4GOMD 5DTMA 4F86A 3VYWA 3ID6C 3C0KA 1R6AA 5C9ZA 1BOOA 2B3TA 3FPFA 3FUUA 1I9GA 7MHTA 2AOTB 5EMMA 1G38A 4DF3A 4HGZA 4PGGA 4E30A 3LECA 4R8SA 4CTKA 3HCAA 2ONYA 2PWPA 3ANXA 2GS9A 3A7EA 3G8AA 3M6XA 3P9IA 4P58A 4R6WA 1NE2A 5EVJA 3DMFA 4BP1A 5HOQA 3ERCA 1N2XA 4YV2A 2EFJA 3B5IA 3EVGA 3DOUA 2C7RA 3GCZA 3UJ9A 5K05A 4RSRA 5LQAA 1AV6A 4MWZA 1KPHA 3SSOA 3JWGA 3CC8A 3ORHA 2ZZKA 5EZQA 5CVUA 1Y8CA 1JQ3A 2WK1A 5GOZA 3PFHA 2FPOA 5EIFA 2CL5A 4PYQA 4E2WA 5ICEA 4YUWA 1JSXA 4FR0A 2GB4A 4QVKA 2YTZA 1EJ6A 5LQJA 1PRYA 5LSAA 1ZGAA 5CIYA 4M36A 1VQ1A 1JQDA 1RJEA 4OA8A 5DXAA 3T7TA 2FCAA 4EKIA 2IBTA 5E9WA 4NECA 1O9HA 1D2GA 2EG5A 1INLA 1B42A 3DUWA 2PKWA 3ELUA 3NW9A 2P35A 1DUSA 3Q7EA 2ADMA 4P7JA 4QTUB 4YUYA 4DCMA 4BY9E 3P9CA 1EQAA 2YX1A 3BWCA 3DMHA 3LGAA 5FWDA 4PINA 5FULA 3T0IA 3BT7A 4E33A 4RVHA 3MHTA 3UJBA 2F8LA 5E1OA 1AQJA 3K6RA 4EQZA 3TFWA 5CVEA 3TPZA 3KHKA 5EMLA 3FZGA 4IKPA 4HH4A 2IDKA 3THRA 5EEHA 5M5BA 3FUXA 4QVGA 1FBNA 1NW7A 1NW5A 4QDJA 1F38A 4RWZA 3UJ8A 2ZBQA 2OZVA 3B89A 3C3PA 3EVAA 4RVFA 2XYQA 5FTWA 5T64A 1RI1A 2AVNA 3B3FA 4RTKA 5LQUA 2I7CA 5B1SA 2H00A 3A26A 4UOEA 2H11A 5IH3A 3SMQA 2P8JA 5EHGA 5HIKA 4DMGA 3MTIA 1JG3A 2JHAA 5K09A 5EC8A 4Y30A 3DXZA 4X1OA 3HA3A 2ZSUA 2GA9A 2QE6A 2AVDA 2ORED 1BHJA 2IDJA 1XCJA 1I4WA 3B3GA 3HEMA 1EG2A 3DULA 3MERA 4FSXA 3EPPA 1ZKDA 4BLWA 5K0CA 8MHTA 1M6EX 3TM4A 5K01A 1AF7A 2P3OA 3O4FA 2GPYA 4XUDA 5EZSA 1QAQA 2CWWA 5CVDA 3G5TA 3HVHA 4CXMA 5GIOE 3CJRA 5GP1A 3THSA 2Z6UA 1P39A 2FYTA 3R3HA 5E8JA 1SKMA 1KR5A 3MAGA 1F3LA 1NW6A 2AS0A 4KRGA 2I9KA 1DL5A 2HNKA 2PVCA 2BM9A 5DTRA 1HNNA 2QRVB 3FPEA 1SUIA 2AOUB 3KPVA 3MCTA 3NDIA 3KR1A 4FSDA 3RW9A 5DM0A 1FP1D 3NWEA 4GOND 3MB5A 4OX9Y 2AOTA 1QYRA 4R8RA 4BLVA 5DX1A 3BUSA 4XCXA 5HEKA 3M6VA 3V8VA 3BGIA 3FTCA 4CKCA 2VDWA 2ZVJA 1KIAA 3IHTA 1P1BA 4DM3A 4GC5A 3C3YA 1Q0SA 2YVLA 4KDCA 3BGDA 2VDVE 2V74B 4OQEA 5K0EA 5K0FA 5ERGB 1NKVA 1QANA 1IM8A 3SM3A 1D2CA 4RTPA 2QY6A 3EEOA 3ELYA 2ZCJA 2OB2A 3LCCA 3FUVA 1G60A 3A27A 5JR3A 4PGHA 4KIFA 4KW7A 5KYGA 3LCVB 5DWQA 4PNEA 3GO4A 1QZZA 4AZVA 4E31A 5LQCA 3NVKI 3H2BA 4RTJA 3EVDA 4C06A 2Y1XA 3GRUA 4E2ZA 3LDFA 4M38A 2YXLA 2G1PA 3E7PA 3LPMA 4E2XA 1R18A 2NNWB 2WA2A 2IPXA 3EVCA 5T67A 3ER8A 3RODA 4FGZA 3UZUA 3OU6A 2AOUA 3FYDA 3HCDA 4RTLA 3EMDA 1ZHFA 5ICFA 2NP6A 1G8SA 2P41A 5DM4A 2PY6A 3EGVA 2IFTA 2C7QA 2P40A 1QAMA 4V0QA 2NXJA 4RVGA 4OA5A 3ME5A 2VS1A 3OFJA 3KQWA 3SXJA 2H1RA 3OPNA 3FPJA 2HWKA 4H0NA 3VC1A 3E05A 3EVZA 5DSXA 1VLMA 1XTPA 1M6YA 2PSSA 2P1DA 1EIZA 3HA5A 4U7TB 5EGSA 5E9QA 1X19A 4QPPA 4GOLD 2KW5A 3EMBA 4R6XA 1XCLA 1KXZA 1YZ3A 3G88A 1FPQA 2GLUA 3OE4A 5EMKA 5DPMA 1R8XA 1XDUA 2BR5A 2LD4A 3IV6A 3CVOA 5P8WA 3TLJA 3P8ZA 1X1BA 3FPGA 3AXTA 2A14A 5DX8A 3WSTA 5ICCA 2OBFA 2V7EA 5DM2A 2YXEA 4K6MA 3TMAA 5CD1A 3UJ6A 5CCBA 1L3IA 5E8RA 3NMUF 1YUBA 3DP7A 4C03A 5DLYA 2YR0A 4V0RA 4PYNA 5FQOA 4GUAA 5EG5A 2PXXA 3KPJA 4CTJA 2Z6QA 3D2LA 3KQYA 3KR2A 3RIEA 3KQMA 3KR0A 2ZBPA 3DTNA 5FUBA 3BWMA 1VP3A 3P9KA 4A6DA 5LQRA 3KQQA 4PONA 5FWAA 5BXYA 3CJQA 3JWJA 2WA1A 1G6Q1 1N7JA 2VDUE 4GC9A 4ATNA 4F85A 5K0GA 1I1NA 4YUXA 5CCXA 1NT2A 2QRVA 4ER6A 1SUSA 3GRYA 3O31A 3KPUA 3C6KA 2AN3A 2YXDA 3QV2A 3LSTA 1YF3A 3G8BA 3P97A 4BLUA 3HVIA 3G2QA 3KR9A 2PT6A 3FTEA 3KU1A 2G72A 4DQ0A 4PCLA 2OO3A 2ZIGA 2ZW9A 3ELDA 3M6WA 4A6EA 1VPTA 4YUZA 3G2OA 3NVMB 3K0BA 2HTEA 3DLCA 3E23A 1R00A 3X0DA 4EMSA 4Z2YA 4ER5A 2PX4A 4PYIA 2K4MA 4KVZA 3BKWA 1L9KA 3LCUA 4HRAA 4HC4A 4M7RA 3EGIA 1VBFA 3M6UA 4YV1A 5GM1A 1P91A 4EVIA 5IKMA 3AWIA 3CJTA 4XUCA 1JTFA 1FJXA 1WS6A 3HA7A 1X1CA 5D1NA 1YZHA 2O07A 3LDGA 1WZNA 3M70A 2IH5A 4R05A 1JQEA 4PYKA 2E5WA 2PWYA 3LBYA 1M0EA 5HIIA 1TW2A 1MHTA 5CVJA 5BW4A 1L3BA 1WG8A 2ZIEA 4X60A 4KWCA 4L7VA 3A4TA 2JG3A 4MQ4A 3TOSA 5BW5A 1DCTA 3Q87B 2PT9A 3R24A 4C05A 3UJCA 4ER0A 3OU2A 3HCFA 2C7PA 3EEYA 5E1BA 3UJDA 1L3CA 4RTQA 2NXEA 1RI5A 1VE3A 5D1HA 4RTRA 3CGGA 2Z6AA 4RVDA 4Y2HA 3P2IA 1RI2A 3KQVA 4AZWA 4YUVA 5DM1A 3I5UA 2PBFA 5JUWA 3LL7A 2B2CA 4RX1A 1ZQ9A 3OE5A 4GQBA 3QOXA 4PIMA 1SQGA 2Q41A 1VL5A 1NW3A 3HCBA 4LWPA 4C07A 2JHPA 3P9NA 4E70A 4DA4A 1HMYA 5FA8A 3GRZA 5F2KA 2ZBRA 3MCZA 2G8NA 1U2ZA 1WY7A 3HCEA 4PIPA 4RTSA 3SSMA 3DR5A 4EK9A 4FT4A 4POOA 5DSTA 4EKGA 1XDSA 2EJUA 2CMHA 2IBSA 3KQSA 1WXXA 4PYOA 5HILA 2ZZNA 2NYUA 4X61A 1EAMA 4QTTB 1NV9A 4PYMA 5DT2A 4OBWA 4IV0A 4AX8A 2HV9A 3OU7A 3OZSA 3OZTA 5K0NA 3G89A 4QDKA 4IWNA 2YUIA 3EVEA 4HG2A 1SG9A 5GWXA 2HMYB 3MQ2A 1JSZA 1RJGA 3P2EA 1IXKA 3GXOA 5FCDA 3V97A 3I64A 2QYOA 2ZWAA 3TR6A 3HCCA 3R0QA 3PX3A 3M33A 3FTFA 2BZGA 1L1EA 1NV8A 2JH8A 2VP3A 4LWOA 4WXHA 5K8VA 3BKXA 3OFKA 4HSGA 3GGDA 1FP2A 2BM8A 4B17A 2AOXA 4RTNA 5EKUA 3PB3A 5DRTA 2BH2A 3SX0A 4DCGA 4LG1A 2R3SA 2ERCA 3BGVA 3TKYA 4YMHA 3QOWA 3KQOA 2PGXA 1NW8A 4PYLA 5K0LA 1G8AA 2DULA 3GRRA 5K03A 2PV0A 2I62A 1OR8A 4QPNA 5F2OA 5FA5A 4E2YA 2OY0A 4GEKA 4GBED 3OZRA 3P71T 4HTFB 1NBHA 2AN5A 2XYVA 5ICGA 5MHTA 3PT9A 5EQJB 9MHTA 4ZTBA 3B7PA 3HP7A 5KQRA 2UYOA 1UFKA 4E32A 5CVVA 5DTQA 3LHDA 5EIWA 2GH1A 3MTEA 4HTFA 3LBFA 3PVCA 4MHTA 3R9XB 1UWVA 3KQTA 3TM5A 1XDZA 2ESRA 5EHIA 3E8SA 4OBXA 5C1IA 2PJDA 3AXSA 3G5LA 1N7IA 3M4XA 2PX2A 3PFGA 4MIKA 3KPYA 4RTMA 2ONZA 2FK7A 1YFLA 5DRYA 5C0OE 3EGEA 3NTVA 5DXJA 3JWHA 4LECA 3UA4A 2UYCA 3GWZA 4M37A 3BZBA 1Z3CA 3SSNA 4BP3A 1JG1A 4DZRA 2O05A 4HGYA 2G71A 4KIGA 2ZTHA 2AZTA 3PS9A 2BR4A 2XYRA 1X1DA 4O29A 5EMJA 2OXTA 1KHHA 1TPYA 2ZFUA 5K0BA 4DKJA 1RI4A 3MGGA 2O57A 3LKZA 3F4KA 1EJ0A 3JWIA
chains in the Genus database with same CATH superfamily
3ETLA 1IPEA 1VIVA 4K81B 1YCFA 1KK0A 4ME6A 1F12A 4F1WA 1XF1A 2C78A 1XDDA 4C6TB 1NLYA 3FXAA 4RV4A 1ODLA 4DLZA 2ST1A 1EDOA 2FZVA 4Q12A 4DWJA 4ZMRA 4KQCA 1GRRA 3DLIA 3TN7A 4BTLA 4LS3A 1R74A 3O2QB 4L6AA 3LW8A 1CZKA 1HE2A 3EWAA 4B44A 1HNWB 1CQIB 1GFWA 5ESRA 1JTEA 1K4KA 3HU5A 4OK6A 5HCNA 3URMA 5HE8A 1Y5MA 3LT4A 2XMSA 5CIQA 4EJ6A 1BN7A 1WHSB 4PAOA 3STHA 1E69A 2EP7A 1HL7A 4OJNA 1H2HA 2B1IA 1O8CA 3EUWA 3NS7A 1BKYA 1KI7A 2OHGA 2WOJA 4MPRA 4BLSA 4EHKA 4XX0A 4BWYA 4BB6A 1RWPA 3IULA 3LX6A 2SECE 4K9OA 2OR3A 2ZSBA 3IOMA 5KYNA 2GBGA 721PA 3GQBB 4KVFA 5D01A 4LNHA 4GU5A 4PSVA 1KYZA 1MX9A 3V4SA 3KTDA 1XHEA 5KPJA 4Q9JA 4JJ4A 1UPFA 2AXPA 3L7BA 4IGEA 2VAWA 3TBFA 2BFEB 2P2NA 1F8YA 1AO3A 1ZVKA 4TN1A 2H1CA 3QKRA 5JJCA 2H7CA 4IHJA 5LQRA 4ZAVA 4EG7A 4HXGA 5IVKA 1WXIA 3GNLA 4YECA 4L22A 4M1TA 2Z3WA 1P5RA 1JJ7A 2O6LA 2PMBA 2V9CA 2AXNA 3NWBA 2R6ZA 4OJYA 2WIBA 4ZCLA 1Z83A 4US1R 4JBLA 2XOKA 1SA0A 2Y67A 3FRHA 3IQIX 3K1ZA 4CETA 1P4HA 3L5KA 5LLTA 5L7TA 3GLFE 2BFMA 2DUUA 2IU3A 2IOQA 1AU9A 1KNXA 3HVJA 4JYAB 2MSDB 3TLKA 1NLMA 2JFVA 2X3YA 1RLTA 4G4GA 4D44A 2MYTA 4ASUA 3UHPA 1SXJE 2BFPA 2J7KA 2A35A 2FI1A 4QEZA 2QNBA 4WLUA 3L40A 1H1DA 4YFVA 1SOUA 1Q0TA 4M8SA 1QU3A 3SLGA 4OGFA 1SHUX 2E4VA 1NATA 4FKBA 5EJEA 4NBSA 1O57A 3K16A 4PLFA 1UZLA 3V4FA 2H4ZA 2J0UA 2YW2A 1RTTA 5DWVA 4BMVA 2PRZA 1L4FA 3A25A 3O91A 5GJVC 5BXQC 2X6TA 1TEXA 2OBMA 2QTNA 3PIRA 4HJRA 1U5AA 3IP6A 3RC7A 3ADDA 3R1IA 2BBOA 5H83A 1A9YA 3IP9A 2R7MA 2HLNA 5LJLA 3D6MA 5CA0A 3JAMA 3W5AA 2Y05A 2D1YA 3K31A 2R65A 4WV3A 5I9BA 1DX9A 5KYUA 1BE6A 2LKCA 3QSGA 1D2HA 3NFRA 1ACMA 4DLPA 2N47A 4QFBA 3KQPA 4GDMA 4XRGA 3EA5A 5KCZA 3MWLA 1TYDE 2AE1A 1USIA 4PAQA 5DLPA 4G86A 4DQVA 2IYRA 1WE2A 1RC8A 3PEUA 2WIKA 4A9AA 2J1LA 3L7AA 2QMEA 3ZE0B 1MPTA 5ECGC 5LFAA 2PIDA 1XMJA 2XBUA 4PRLA 1LKZA 4KE6A 2JGFA 2GEJA 1OAAA 1FVFA 4WNAA 1VGQA 3RLIA 4A0HA 4D8TA 3E6AA 4DCTA 1T1JA 4QEDA 3HBLA 5H0IA 3BMQA 3ZGYA 4LF4B 4XPIA 4H16A 5FF9A 3DV2A 3ZY5A 4TSRA 4GO1A 2AMFA 3SVLA 2YIDA 4PGGA 1BXZA 1T5LA 5LLDA 2PWPA 4ALKA 2QRLA 2AFHE 2CLMB 2Y1EA 3CS3A 5I7FA 1NWCA 2RBKA 4A1FA 2RH5A 4LSMA 3PCRB 1FUEA 6ABPA 3AUFA 2JANA 1RXWA 1JR2A 1SC9A 1O5IA 4KBYA 5CT8A 2EFJA 1DJOA 2IXBA 2Y0EA 3RT7A 4CHGA 3W5VA 1SXGA 3IHLA 4F3RA 4MKFA 1WXGA 1E3WA 4QUAA 4CN9A 4MKXA 1NMSA 2V96A 2NO9A 4C6HA 3P0RA 4MQEB 5G53C 1CS0A 1U1DA 4U8HA 3U6KA 3Q98A 4OJMX 2CXTA 3KKNA 4UTOA 2D1SA 1UMKA 3PFHA 1V1MB 3QTLA 1P33A 1T5OA 1NVVQ 3KJHA 1VJTA 4JUCA 4OYRA 1AXEA 1C2TA 1EWTA 4PBRA 2GFIA 3DE1X 2AEEA 3ZHVA 1N9GB 1V1JA 2Z2KA 1QOZA 5BSMA 5C18A 1GQOA 1VYTA 3BBPA 1R0XA 4O2BF 1SEVA 3EIXA 1ZOIA 3M5DA 5FOTA 1FTWA 4DQUA 5IYZB 2R8OA 3RBVA 3U4MA 1W0KD 2IPNA 1FSGA 5LMNB 2DFKB 2H85A 1GDDA 4PLPA 4AYWA 4BQIA 4QTUB 5HXAA 1G21E 2GZ3A 3BWCA 4L0DA 4EJFA 1LRKA 4Q7LA 1KMCA 1XJQA 2JFOA 3W4KA 4OKNA 3X44A 3HB4X 2FMFA 3KKEA 3I1IA 3L0ZA 4Q3CA 4RM3A 1SCDA 2P4UA 5IBCA 1AKUA 1MMFB 2CCKA 3D54D 4FNAA 4TS4A 1V5IA 4EEXA 3AIIA 5EEHA 3ZDRA 1E8DA 3CZPA 4OYHA 4HK4A 2C2BA 2VRCA 5AKXA 5FORA 4ENVA 4MPJA 2GBPA 3IP1A 4QUDA 1W0JA 3ZGNA 1V96A 2AGVA 1E6LA 4LDAA 3S3TA 1HDYA 2XUQA 1U3CA 3HDGA 3VHXA 4E21A 2JFGA 2GCGA 4GE0A 1E0KA 1EQ2A 2HPZA 4GXRA 5I7VA 3C5CA 3NKVA 4E5MA 1WZIA 2ZBDA 1QPZA 5HIKA 4W5JA 1ULHA 4ZPJA 4V0MA 3UYLA 1BDMA 4DRXA 2ZAYA 1YE5A 4R2XA 3GYBA 4RFLA 2GEBA 5KTKA 2Q6OA 1TM5E 4WT7A 3WMRA 4DMMA 3EPPA 3RIXA 1BXRA 3X1DA 3GJZA 3ZU3A 4A0SA 3I83A 5AOBA 2NPOA 4OQ4A 4HZGA 3KO8A 3AY7A 2VBIA 3AC0A 3ZU6A 3SZGA 3WWOA 1K4YA 5DYGA 4MVJP 5DYTA 5LJIA 2FFHA 1J7KA 2H7XA 1B26A 3GBSA 4Z3KA 1MBZA 2CUNA 3UV3A 4Q3DA 3IUQA 4KPUB 3ZIUA 3FUCA 4R0NA 2YJ3A 1ZMOA 3IUYA 3OOEA 1VPVA 2QRVB 3GJXC 3EXG1 4FSDA 1RZRA 3TD9A 3O03A 1DC4A 4EG1A 4BB5A 3RRFA 2G9UA 5A4FS 2W6ZA 2VCYA 3NRBA 3H1EA 5EXPA 2QU8A 4DDHA 2JVJA 3F78A 4URWR 1CYDA 2EU8A 2NVBA 1XP8A 2R00A 2XE6A 1QIJA 3U49A 3VPXA 5JDCA 1Q84A 3TZKA 3QHQA 2ALJA 4C14A 5JLJA 2I67A 4J1NA 3EXFB 1L8OA 3HKDB 1JA1A 1PLLA 3ZTTA 4XDHA 1ULSA 3EXAA 2ZJOA 2OT3B 2IZ6A 1E2EA 1C7IA 1IG3A 3SF0A 3PHIA 3UXHA 3LCCA 2J6CA 3PQ5A 2BSAA 3W2TA 2DR2A 1CF9A 2RBEA 3A9TA 4X5OA 1XEXA 1L7NA 2O8CB 1VCMA 3IR6A 1RT9A 3CLUC 5REQA 3SC6A 2WFZA 1QTQA 1G8YA 1BKDR 1USKA 4YMUA 2I4IA 5DF1A 3X1YA 1HEYA 3OLXA 3IUPA 3VKGA 3OTWA 4JELA 5ICFA 5HQTA 4ZI3A 2P41A 1A7AA 1VE9A 4RQBA 4YFYA 1YL6A 5T8KA 1XEWX 3FCUB 3RS7A 1YU9A 4RQAA 1NMXA 2C57A 3RVQA 1RXYA 1XQ9A 2C2MA 3AMVA 3OVMA 2HFJA 4MOWA 1B2RA 5WRFA 4YXWD 2I6XA 5EJ4A 3ZLUA 5JNVA 1ORVA 3EYAA 4OXRA 3MCAA 3FPJA 3A6EA 3JZFA 5K0ZA 4TT8A 3ZZMA 4CR7A 1M6YA 4JSRA 5KYUB 2FN9A 3UT5A 4NY1A 2VF8A 1UODA 1KH2A 3DCNA 3C97A 3PZRA 4XEUA 3V4VB 2XUAA 3EZ7A 4R2KA 1PTKA 1ZSYA 2GPWA 1A4RA 1XNGA 2JGDA 2D00A 2VUSA 3OE4A 3RUIA 4MGZR 3LF2A 3OCVA 1ZN2A 5IARA 3QLVC 1P4AA 3K5WA 4MVJE 3VNSA 1A2OA 1J39A 2LE0A 3H9EO 4KUEA 4QJIA 5CH5A 5E9AA 5P8WA 4CI9A 4MPTA 1IOWA 3IMGA 4GL2A 1SUDA 2J3HA 4JJGA 4Z9BA 2LKDA 2NPIA 4R9SA 4PLHA 2W6IA 3VR5D 3WA6A 4PO3X 3WE7A 4UBOA 2XWQA 5FQOA 3WBFA 1IU9A 1M1NB 1P80A 1W4AA 1E62A 3L8HA 3RIEA 2XNJA 4AYXA 2C98A 4XOUA 3BSWA 1N78A 1RXUA 1DIAA 2NLOA 4OSEA 4IIEA 4PHGA 3SBDA 2UVQA 4INOA 5JHHB 3IPCA 1P1FA 3SFTA 3FBGA 3THXB 5ECYA 2H3EA 2DPLA 2WA1A 1KOLA 3OX4A 4LE2A 1AKVA 2EW2A 5ALGA 1YZYA 5I7WA 3I5AA 1CP3A 4EFNA 5K7SA 1AM4D 1OFHA 1Q95A 2YJGA 5DT9A 5K8UA 3WAGA 1EK0A 1XMIA 4GQAA 1K8ZB 2HU5A 2WWRA 2WHYA 4YGYA 4CW7A 1KQ3A 1ZJ5A 2NW6A 3H5OA 2FPIA 1P9LA 2PT6A 1QVZA 2YHBA 1CU1A 2DLNA 4LVUA 4URYR 2ZIGA 4YJKA 2BFEA 1G0NA 3IO5A 2QR3A 5LKRA 3JYNA 1KZ4A 3OG9A 1SC1A 1R00A 1SELA 4J1SA 1O6ZA 1L7AA 4PYIA 4RPIA 3H3FA 1PFQA 3BKWA 1HKHA 1PKXA 1N1EA 2V7UA 4RYDA 3UATA 1TEZA 2Y1OA 3EWNA 3O8OB 1F8GA 4M3NA 4JV5B 1Z2CA 2PBZA 2QTFA 1W36C 3OFVA 4KAAA 2BRUA 2HCRA 1HFJA 1U8CB 3NHRA 4ZOLA 1XYYA 4XE5A 4LGCA 4NRDA 4ZEWA 1V8ZA 3RK0A 2PH1A 2ZPTX 1XQXA 2W9XA 4PYKA 1LPNA 2E5WA 3FFTA 3GFBA 5F1OA 4B9EA 4BQOA 2FF5A 3OOHA 2DX7A 2ZIEA 3KU4A 1A9XB 3F8SA 5H5JA 5AI8A 5L4NA 5MFPA 4ZU1X 2DHCA 5IDQA 5KTTA 2BPOA 3AEKB 1SU4A 1PR6A 1ZMTA 3V3TA 3EPHA 2Z6VA 3JQEA 1T10A 4HR7A 3KWMA 2BFCB 4YVFA 4MSUA 3N2YA 4B2IA 1RZRD 4O6VA 3U7JA 3D5QA 4F7WA 2Q6VA 1SWVA 4KREA 1S4QA 1VSUA 2P6MA 1NUUA 4EI9A 2GXAA 1WXDA 1E7QA 1P7CA 4J90A 4PLZA 1HDCA 1Q1NA 4K9KA 2YCLA 4QREA 5HDBB 2CHVA 1W87A 2VN8A 4LQLA 4MW0A 4G81A 2FX3A 4YBRA 2JIRA 1A1SA 3IAFA 4I9HA 3UW3A 5ILOA 4WCDA 1YACA 3R8XA 2DMRA 5E2IA 1I94B 4R7TA 2A3NA 3P9NA 4IY1A 4UE3S 4GG1A 4P35A 3GLQA 1P9OA 4OGLA 2WFLA 3LJKA 3RJMA 3DR5A 3CKLA 4TXLA 4V38A 1R7RA 3COZA 1NJSA 4ZD6A 3W04A 3HKEA 1WXXA 3FJOA 3V7UA 1AF4A 2C04A 4CCAA 5AVQA 1EGHA 3UQZA 2A6PA 1T24A 1QO7A 2R96A 3QMWA 4UREA 1NV9A 5EYPB 1SCIA 4UUAA 1T8YA 2FZ4A 3RSOA 5HSGA 1TUGA 5YASA 1UUFA 3KUUA 1WRBA 3E4DA 4U1RA 3TNDA 2QMOA 4MVCA 1XTUA 3GXOA 4RS4A 3V97A 4IQ4A 3ZQUA 1LK7A 4RJIA 1L4BA 1GQYA 5E6UB 3P32A 5EXSA 4NCNA 4M1MA 4YMLA 2Y6VA 2N3ZA 2V54A 3MPUA 1Y1RA 3WR5A 4DT1A 4QRIA 1J0AA 4DJAA 4U6SA 3RUHA 2VP5A 4WXMA 4MLDA 2CKMA 1WUTA 4YCCA 1W88B 2PRJA 4MJ7A 3DLBA 1GCOA 4M9QA 3K5HA 3VJMA 5CA1A 2EGHA 2Y0BA 1O7JA 2I62A 2XSZA 3PUVA 4X54A 5GMOA 5ICMA 4GEKA 5AKIA 3U60B 1GTJ1 2AN5A 3OOWA 3QUSA 3WRYC 2I6UA 4HTAA 3GMSA 4RLFA 4B87A 4KR3A 3UB2A 4LVOA 4FOOA 1UBMS 3FNRA 4AU1A 3KTFA 5D3MB 4QEKA 2PUDA 4ZFNA 3LHDA 3EFEA 1EFLA 1XPJA 3G2NA 3KZ1E 1V11A 3L8ZA 4P8RA 4ND6A 3TRFA 5A5EA 1DXOA 3KQTA 2Q2VA 3I09A 1N6IA 4C22A 3AHCA 2EP5A 3OP1A 1XDZA 4IDGA 3L6EA 5JJ5A 4DR5B 1CQJA 4LKOA 2HMTA 3B78A 4ITVA 3ZCTA 3AXSA 2O1XA 3G5LA 3GX1A 3KKPA 2HXYA 4FGUA 4LBVA 4EHNA 5A3JA 1Y5LA 4DDWA 3G6WA 1QRRA 4FR2A 3WB0A 4MWDA 1DX6A 4Q1FA 1Z5WA 1VXOA 4H7PA 4B3BA 4GYKA 1QRAA 1JKXA 4Y0VA 4BVKA 1BW9B 4G9BA 3FB1A 4HEJA 4WVFA 3W1EA 2FSGA 4TMKA 5C1DA 1NI4B 3ZVKA 5JSZB 4PVCA 2BR4A 1N4AA 3RYIA 3ZHUA 1CUAA 1TO1E 3LAWA 2LIPA 2VPZA 2PKCA 1AX9A 4PRYA 2YMPA 1K75A 2NSLA 2LP4Y 1V7QA 4GYJA 2ZGVA 1NF3A 1S96A 3IHKA 1ILWA 1C3EA 3ONVA 1QLHA 4MUKA 4DMRA 5FPKA 5L7WA 1P5ZB 3W7AA 1Q74A 3V7WA 1JIUA 1ZAKA 5JS2A 3RR2A 3CX8A 2PIAA 3QLEA 2XT9A 5EFOA 3T3EA 1K7FB 3DC7A 1J56A 1TRHA 2PFGA 2QRNA 4ID9A 4N6NA 2Y99A 3EVFA 1WDWB 1I8TA 5BVGA 4CIVA 4OJTA 1AD2A 1F1JA 3X1MA 1J5EB 4RETA 1JU4A 4FUTA 5NULA 1Z7GA 3K9BA 3EXHC 1ESEA 1P0CA 2VDQB 3LC2O 2MSLA 4KPUA 4XAQA 1O2DA 3H11A 2J4DA 3AEZA 4LOKA 2O8EB 2Z8ZA 1WBJB 1G2PA 3WGTA 4J0KA 1JDBB 1WPQA 5AW6A 5TQ0A 1L5FA 1NUTA 4RAOA 3CGWA 2BKUA 3TO5A 1Y7TA 2YASA 5K0SA 3RK1A 2ZDHA 4YDHB 4BWFB 3R8FA 5IVHA 4RDIA 3STWA 3GD7A 3UA3A 3OCUA 1IJBA 2FW7A 3SVZA 2BFFA 3WLMA 3ABQB 4EUHA 5LU9A 4BFLA 4F4FA 1SVSA 3A4VA 3UJAA 2QX8A 4YMIA 3FCXA 3WJ1A 3A6GA 1XPRA 4G5QA 2BN4A 2Z09A 1F2UB 1R2QA 2ZB7A 3CLTC 3DKVA 3GRAA 4E1AA 4EYOA 4ZYVA 4N76A 4OUKX 4K9QA 3T3PB 5JC1A 5LD2C 1TUIA 1YHYA 2CUTA 1SK9A 2B78A 4YO8A 4GMHA 1Y3FE 3ORQA 5AVWA 4QUIA 3BJEA 4C1BA 2P30A 4XX1A 3A1SA 4WK0B 1R6DA 5EOVA 5IBPA 3SWWA 4G56A 1Y7IA 2HBQA 3FMPB 3ULKA 5JXWA 5KOJB 3EGDA 3VMFA 3L7MA 5ARCA 3UIEA 3NRCA 2AWNA 3CXRA 3PIDA 3SR0A 1NPTO 2Z8YA 2Y68A 5CFZA 2C20A 4YHHB 3AFMA 3LT2A 4R2WA 3VC3A 4MKGA 4XB6B 1Z6TA 1JR4A 1PJZA 1LNQA 4HGRA 1ISJA 3NRJA 2OYRA 1WWKA 4G1BA 2WTUA 1KEEB 1Z4KA 1ZESA 4ND8B 1JJBA 1KGSA 1S8NA 2AQIA 2REQA 3CCFA 3EFBA 4QTZA 1YJXA 2J59A 4MV5A 2NQ2C 2ZRDA 3E27A 3WGQA 2FPWA 1KWGA 1QGYA 1MOQA 4KFCA 2CMKA 4KQMA 3HN7A 2ZRIA 1ZGJA 3OJ0A 3SJAA 3ZY6A 4DDTA 3H5NA 4C7JA 1TNDA 5BW6B 1FLAA 3ZQ6A 2GM9A 3H2ZA 3W6ZA 2C7OA 1HXHA 1YFZA 2Z4RA 5TARA 5JISA 3SFVA 4RAQA 3ABIA 2LDBA 3NCTA 3NC1C 4XB1A 1GA6A 1LZLA 4IIGA 1QRSA 2GO7A 1N9ZA 1T91A 3OA2A 3L4KA 4H7DA 1I7DA 3HTXA 4WD3A 5FOQA 2C9MA 3AF5A 2P0YA 3WJ7A 4WN3A 3INYA 1ABFA 4OKSA 4YCNA 4KQ2A 2DAPA 4J0EA 1YBFA 5ALHA 3W2EA 3T3GA 5H9WA 4MUYA 1H9CA 1M74A 3C7KA 2IF0A 2XPCA 3ID6C 3M4NA 4I7EA 4F6RA 1HT3A 4C0JA 5JYCA 1VHDA 2B3TA 1E4EA 1GGNA 1NVUQ 2OM2A 2PR2A 3C7CB 4MDYA 3H65A 2GSDA 3UGJA 2MR6A 3U5ZB 1G38A 4G09A 2R1ZA 3OF2A 3KZKA 4MKRA 5CDYA 5CLGA 2YBDA 3D4LA 4QWMA 3JQDA 1CIVA 4QULA 2H48A 2AA3A 1JU9A 4BMOB 2ZIVB 1JU3A 3LOPA 1YDMA 3QE0A 1HPLA 1VA5A 2WJZB 4LOJA 4BNHA 3IAUA 2VOJA 3C41J 2XOEA 3EZGA 4NBRA 2EIXA 4OI2A 2J4CA 4UHEA 4EY3A 2FP4A 3RF6A 4DBZA 2R6AA 1IUOA 2ZROA 5A5GA 5LWHA 2PVPA 4KXWA 1EP3B 1VYHA 3NP9A 3ORHA 3ENQA 3CVJA 3LYHA 3IVGA 4D5EA 3I2GA 4TUYA 3D7SA 2CNKA 1H2ZA 1G5TA 5BQOA 4W5QA 1M6VA 4PYQA 2W2KA 5IC5A 1MZVA 3QY0A 4U2EA 1BD3A 3F3MA 1E2GA 2Q0SA 3LQ1A 3LT0A 4QVKA 3NEPX 2VXCA 4M1YA 4OQNA 1G3IA 4YLGA 1LDYA 3L7IA 4D02A 3VMMA 3JV7A 2F7SA 3V48A 2AC4A 3QRWA 1KJZA 4QXOA 1O0BA 1TTHA 2QGFA 2W8BA 4KR7A 3NW9A 2ZKLA 4FEEA 3MTAA 1U7ZA 3P9CA 1XV5A 4U2BA 1EQAA 3GJ8A 4AWBA 3HDYA 4K0KB 1XVIA 1C3LA 1NN0A 1XZCA 2I4OA 2YZGA 3JQPA 4RVHA 4ZU6X 4CCSA 2BMDA 4QA9A 4G0ZA 3Q88A 3K6RA 1AQJA 3QBJA 3R6GA 3VKUA 3FZGA 1WSWA 3THRA 1H66A 1Y9ZA 4RGQA 3CUTA 2YZ2A 3Q72A 5CFNA 3C1UA 1W8IA 2ZBQA 3AR3A 3AB8A 1ZWLA 2A59A 3WICA 2O3UA 4I3FA 4ASUD 1L4MA 2CD7A 1UMBB 1RM0A 3ANTA 2AMJA 2OCKA 3KEQA 2A1TS 3FDFA 5D5QA 2QR5A 3DDOA 2JFYA 3E2MA 4OXXA 4JT2A 3DPUA 2PQMA 2DEUA 2EZ8A 1G64A 3MQ4A 1MVOA 4MX8A 3VM6A 2IDJA 1WDKA 4IM7A 5ALQA 4BLWA 1Z4QA 3EXEB 4IQ0A 3DMNA 2REQB 2A1TR 1M6EX 1WP4A 4J29A 4NBVA 3ZK7A 3DOCA 4F4IA 4CEHA 1THZA 3D7MA 4CMIB 1QAQA 4WEOA 4EO7A 4EX7A 3KYDA 4WZAB 1ENPA 5DNVA 2P1RA 4A8JC 4C29A 2GESA 5JH7B 2JPDA 1QZXA 4CRWB 1GP2A 4DCUA 3IUSA 4Q1CA 1U7UA 4UQLA 3GG2A 3DMRA 1WLYA 5TMDA 5C5DA 3WC4A 1Z28A 1AGYA 2BGWA 1Z4NA 2IUYA 3ZHSA 1ADYA 5KNLA 3I4FA 3NTRA 2DKNA 5CDTA 1CQWA 2AOUB 1CQXA 1OROA 1S1MA 2VXBA 3FTNA 4EYQA 2WABA 3BA6A 4I1SA 1FNCA 4L5BA 2O3SA 2VRWA 3H5RA 1IPHA 2C4VA 3NBQA 1ITZA 5BV1A 2VT7A 3FI0A 3LM8A 2OCLA 4NPHA 4N8SA 1N6KA 3HLYA 4OXNA 2Q8PA 2P9ZA 4S0XA 3TRJA 5JZVA 4AW9A 2X2EA 1R88A 4EENA 1YDGA 3UBMA 4HYEA 2JKYA 4OJKA 1OKKA 1X38A 4YJFB 3IVXA 1WMFA 5HQ3A 1ORTA 4Y2QA 3WK8A 1A9PA 3H6HA 5B64A 2ZYUX 1CJMA 1NKVA 3OKAA 4OSPA 3TTUA 1D2CA 3MWFA 4Q1AA 4S1NA 4N65A 2O2SA 3RRBA 4BUJA 1CUUA 2O8FA 4I19A 4R2HA 2YJ5A 4JR1A 5JYBA 1G60A 1KZ9A 3MUNA 2A94A 2O4CA 3LOUA 2JCGA 4KIFA 4QXPA 4ZWNA 4GZ6A 3SJ7A 4ESEA 5EJ6A 1KH1A 1GPLA 3OPYI 4J0QA 4E2ZA 2EKPA 4X6LA 5LZ5A 1DXHA 3D8SA 2FEAA 1TJNA 2FB9A 1BMTA 1NVKA 3G1TA 4P98A 1WSAA 2E82A 1E1YA 3PFFA 4TV8B 2YV5A 4X84A 1IY8A 1F48A 3PGMA 2BCEA 4W9RA 3W3AH 1QDEA 3T41A 1DZIA 2ZT7A 3PWZA 1L4NA 4OL0A 2IFTA 4TKUB 3ZE8A 2C7QA 3NQ41 3IL2A 3G85A 1ADCA 5F4ZA 2F55A 2I9PA 3T54A 3TQTA 1TLLA 2X76A 3H1GA 1SWWA 4R2LA 2FOIA 3OIUA 2XHZA 4Z4FA 3RNLA 4KG7A 1M1YE 4A15A 4U7TB 2FWBA 2VP0A 1OWOA 1OX4B 1YUNA 3DB2A 4EG3A 3HXMA 4GOLD 2BBWA 3W06A 1USUA 3W8DA 1KXZA 1FPQA 1T36B 4IGKA 4NYIQ 4URFA 2QAIA 2G06A 2VJMA 5HOEA 5A4IS 4F97A 4Q3LA 1E2UA 5FR2A 3TLJA 3HJBA 4CKBB 2A14A 1SO8A 3SXUB 3VH1A 1VKJA 1PTJC 3QYAA 2Z9CA 2WUFA 3FYUA 4QOJA 3VZRA 1SB9A 3AKZA 5COQA 2E4ZA 3JPYA 5CD1A 2RHRA 3SHQA 2PWZA 1QG0A 2KJQA 3GUVA 3P2MA 2H1FA 2OC4A 4M21A 2GPAA 3CFYA 2B8JA 3UPDA 4Y6RA 2RGRA 4Y18A 1S02A 2WDPA 1YJCA 2GCOA 5ALNA 3TCKA 4TTIA 3ONFA 1CY2A 1P0MA 4WNAB 1GCGA 4PHTA 5AD1A 3QI7A 5K8CA 4KPYA 5B1DA 4TS1A 4AY4A 4G63A 3P9KA 1DKPA 3IPAA 3KP1A 4I81A 1DC6A 1XCMA 5A0VA 1D8AA 1FFCA 5SZJA 3AL3A 4TLDA 1G6Q1 3EASA 2B94A 5I51A 3DT9A 3MS2A 2CDAA 1ZNZA 1GCUA 2P9JA 1KO7A 3F97A 2YJ6A 1Q57A 2WF7A 3WADA 3EIQA 4ZOAA 1DJQA 2ZATA 1FY2A 5I7RA 4KYVA 2WJJA 1MN6A 2KQUA 4JI4B 1BX3A 1AZSC 1R8QA 1G2IA 1CCWA 3AGPA 5JQGF 5T3UA 3MCWA 4DQ0A 1U94A 1CXZA 1RQ7A 3I23A 2CLIB 3NALA 3WLNA 4Y9DA 1OREA 3MJEA 2F64A 1J8YF 4KUGA 4JXXA 3U61B 4M0FA 1AUOA 3N0TA 3PUJA 3D8RA 5LWQA 5TR9A 9GPBA 3PPXA 1L9KA 3TLGB 1CB7A 1CIPA 1MENA 1HO3A 3H8JA 4I3HA 4H7KA 3LHSA 2VHZA 3LZ6A 3T4PA 2C4MA 3JAKA 1X1CA 3DQPA 3KAQA 3BDVA 1KI6B 3OTGA 4BMSA 2QKYA 3IVMA 2GCEA 1DI0A 1VKZA 1K2WA 4JVMA 3EOZA 1KI9A 1JLMA 2FR1A 2BDEA 3GAAA 3ZE2B 4BN4A 5BW4A 4A23A 1CIJA 1IBRA 2W6JA 4NAHA 2I3ZA 5G1NA 4UTRA 3JQBA 1SXJB 3ER6A 1JKMA 3K1AB 3KXDA 2Q0XA 1KEZA 2VNAA 5GTDA 2VRBA 3B6EA 5AKGA 3I1YA 2K2QB 4PRKA 1ODSA 4C1NA 1J23A 3CR8A 4DUGA 5LP6A 4HAYA 1SIOA 2XZPA 4MAFA 1VE3A 2ECKA 4PX5A 3F5MA 1A9QA 2JASA 3MGBA 2AF3C 2JAHA 4PZAA 2C1ZA 3MT7A 5ALPA 5ED0A 1B2LA 5I7AA 2O7QA 1Z37A 3ESQA 4QLBA 5CLJA 1PJLA 4YRJA 3M9WA 3BA1A 2OZPA 3U4QA 4Q48A 4BVLA 1NXQA 1BVRA 1SZPA 2E2WA 2H08A 4MWSA 1ECLA 3OE5A 5BWCA 2W98A 4B33A 1AUXA 3EISA 3B52X 2X0IA 4Y2JA 3JD0A 4G5SA 3IDSA 2IS6A 2CHUA 3TLAA 1XTZA 2JHPA 3PC7A 4D99A 1VJ0A 1NZFA 3FVVA 3GNTA 5A06A 4CJXA 2BE9A 2OBNA 2VJBA 4KKVA 1HA3A 2ID4A 3CF4A 4L85A 4XD2A 4QDZA 5F5NA 5FEMA 4NMLA 1R4NB 2PPVA 1T3ZA 3D9QX 2J6BA 3NAZA 4PSKA 5FXMA 4CG3A 3Q5EA 1UDWA 1IK6A 4JUDX 1EAMA 3S1LA 3RYFA 1JYEA 1BJTA 4LK3A 4PYMA 4ZIRA 4QYIA 1D8TA 4Z4EA 1QR2A 2IYNA 5EZYB 3A2KA 1OT5A 2AW5A 4BQFA 4N3GA 5LP1A 3MWKA 1TYEB 2HMYB 2XQFA 4OHVA 3T3MB 1OH5A 3QF4A 1YJBA 1KQGA 4OYYA 2PL3A 4D8VA 3DE6X 2PZJA 2GK4A 4KSYA 3I04A 1UKAA 1U8UA 2A4KA 2QY9A 4AXBA 1FUIA 2ECPA 2YVAA 2ZB8A 3GA5A 1MAWA 2A5YB 3BXPA 3BK1A 3DE0X 5LOVF 2RC5A 5THKA 1U2EA 1YI0A 4NZMA 3EMVA 3G9TA 4A8JB 4JUIA 2IKSA 3NHSA 4MLZA 3R44A 4RVNA 4OCZA 4P31A 3H9JA 3WGGA 1OR8A 4XGQA 1M9NA 2OY0A 1H65A 2PU7A 2YV2A 1PJSA 5IAJA 4F4DA 4EA8A 2BMWA 1JMYA 2BTOA 5AJWA 1U8AA 4WQMA 1M34A 3DL4A 4MUFA 4N18A 3PVCA 221PA 1E2HA 1PGNA 2PKQO 3I32A 1QG2A 3RVNA 5CFRA 4G0PA 3CRNA 3RS9A 5C4GB 3E70C 1GT6A 1MD9A 3DTVD 1GL3A 3KZCA 5AHOA 5AXAA 2JIZD 1NQ5A 3GGPA 1QIMA 4GNRA 2VXOA 1H2YA 1N7IA 2WV7A 2OXIA 4XCVA 2XE4A 4DIUA 3W6PA 4E6PA 4M1ZA 3TAXA 3FCOA 4IMPA 4K9LA 2Q4TA 3EGEA 1OYWA 4AFNA 4AO8A 3HHPA 4HNHA 4ZDKA 3GWZA 3JQAB 2FMXA 2ZYDA 4BFYA 5C37A 1EGVB 5BNZA 4DKJA 2DECA 1TPYA 3ICWA 2BDUA 4GPBA 4N5LA 4BJ6A 4HLNA 1DXYA 4XXHA 1KIMA 1WOYA 1P4GA 4C4OA 1U1GA 3QENA 3R5KA 1E5VA 1AMNA 4LSWA 4MTLA 4UNQA 4EFKA 1U5BA 2VBFA 1WCWA 4TV9F 3WMEA 2JHGA 2BEWA 2P7IA 3DOHA 3FFBA 4FI3C 3O4VA 5HZGA 5E38A 2LZ0A 2BMFA 2OZLA 5ALXA 1VLLA 4M55A 2ZJBA 1M6WA 2GHRA 3DF7A 3EXEA 2FLVA 2P7HA 3WB9A 3U13A 1ILEA 1V2GA 3WYCA 4RTLA 3G2PA 3KE8A 5KOIA 1KETA 5CX1A 4F2PA 1Z2AA 1SUAA 5DNYB 1DWQA 5DULA 5EUBA 1CY7A 1FS6A 3DR3A 1YWGO 3GJTA 5EL0A 5IDWA 3TL2A 2QX6A 4Y2GA 4LVCA 5EXDA 4YRPA 3F5QA 3F7NA 3TKAA 5JXGA 2B61A 1DQZA 2Q3DA 2ZSAA 4CM9A 3SHTA 1Z2NX 2J8ZA 3A7DA 3JW8A 3MWDA 3UWOA 3SMVA 1M6VB 2WBLC 2QLLA 1PHPA 3GDGA 4U7FA 2OBBA 2X6QA 2W2LD 4HB2A 5JMTA 2GRAA 4DR7B 3RKSA 1A04A 3RVJA 2D7JA 4FDAA 4RZSA 1G3MA 2C3PA 3D0OA 5L6MB 2EZ4A 4O4LA 4YT5A 3SQNA 4LEIA 1QG6A 3FZQA 4BLPA 1KJ8A 3AI1A 4EDFA 5B5SA 3B12A 3AM3A 2RK4A 4BLQA 3I12A 1M73E 5AQEA 4AY3A 1LCIA 1NYLA 3U1VA 2GA8A 2D54A 2XTJA 4HEHA 3BCSA 3Q4GA 4MP8A 4NU5A 2ACVA 3TUZC 4GX1A 1QH0A 3ZD7A 4BP9A 1P61B 1X6VA 2QB5A 3FTDA 4V0OA 4Q7EA 4FLMA 4X1YB 3AVPA 2OXCA 4PC3A 3M1IA 5CM2Z 1SCQA 5D7NA 4MPDA 5DNAA 3W79A 3UWPA 1SGWA 1FTSA 1PZHA 2J6HA 3C3DA 3K09C 4BFWA 3PYMA 3BD7A 5HWSA 5U9CA 3K70B 3S2IA 3U16A 3IMCA 3G9XA 1J2JA 1MDFA 3BDIA 1U0RA 4L8WB 1N2JA 1YDWA 1PL7A 2A9RA 2PA3A 3ZV7A 4AP9A 2FZLA 1NP7A 4MRRA 3ANNA 1FFBA 1ULBA 3T7RA 3F5FA 5E6SB 3U9LA 3WAJA 2Q1WA 1VECA 2R5FA 2ZK7A 4L50A 4ZPXA 2DFTA 1PWHA 3LVQE 4PANA 2W90A 1ZIOA 2VF7A 4LPSA 3KLNA 1C7FA 3EZ9A 1OI4A 3BD9A 3O4HA 3HY6A 4ZVVA 1OBOA 4FLFA 5BYJA 1PCXA 1Z38A 2E5FA 2VAXA 3NONA 1R6BX 1VL0A 1Y0BA 5BSKA 2HWWA 3R3JA 5AOVA 3REQA 5FO0A 2G9NA 3VHQA 3R5FA 2CLOB 3FPHA 1DUVG 3C7DB 3THOA 4YP5A 3USZA 4NFSA 4YC7A 1V2HE 5L4SA 1W2HA 3TL3A 3U4DA 1KPGA 1R4NA 1KYWA 4ER7A 3ZS9A 4ZYLA 2AR0A 5DTIA 1DWUA 2G5PA 5HKAA 4EVQA 1PYOA 6NULA 2FLKA 1H2XA 2P4EA 2RGWA 3DEKA 4IJ5A 1UH5A 1GXSA 2X0JA 1I7PA 1VFNA 4LUCA 4RV5A 2CLFB 2Q29A 2X1VA 3DVAB 5DCLA 1TOAA 3DMTC 1JZSA 5IMBA 4QUEA 4L4UA 2KPOA 5CJPA 2WFMA 4AO7A 1UBHS 1IOLA 4TKZA 3OE1A 4AG5A 4GOMD 4UULA 2AKAB 4M1WA 1XK6A 1ESNA 4FFRA 2XBMA 3V9PA 2HBRA 1TD1A 3JARA 1F7VA 3H99A 3IJ5A 1M2WA 3U44A 1E7WA 3CMCO 4ZVNA 1RKQA 4OIFA 4AJKA 3BL8A 4MVJG 4Z51A 1FFWA 2KE5A 3HSKA 2BJVA 1Y4UA 4YRCA 2PUHA 3KFVA 1FFGA 3JWGA 3QVTA 4O3FA 5EZQA 5CVUA 2C4HA 1I2AA 4AKHA 1H8ED 4MLCA 1IN5A 1YQUA 4F9TA 2O0JA 1JIKA 4HWTA 2H9IA 3B70A 3CIFA 1VM6A 2YMLA 3ZWPA 4KO8A 1W5FA 1DBSA 1OGYA 2VH2A 4ZI5A 3V1LA 3ZY3A 3ADOA 2PS3A 1N0WA 2AK3A 2BCGY 2E1RA 4XYGA 5HJ2A 3GUCA 1ETHA 2ERXA 3A6LA 3I0MA 4MI1A 2GZAA 3AUAA 2GJSA 4N5DA 4TVBA 3B3AA 4NECA 4OM7A 3ZKWA 4CN8A 2HIAA 4EITA 2Z1DA 1INLA 3H13A 5J63A 4AZWA 2ADMA 4V03A 5A5FA 1QQBA 3QX9A 1SUPA 3U9SA 2YX1A 4R2MA 5FWDA 1ZJJA 4RZHA 2CV1A 1XD2B 3S2YA 4C2UA 1R12A 2ZU0C 1ULUA 4JZKA 4Y98A 2I54A 3R7WA 1EVEA 1CJUC 3MEQA 2W11A 2AJDA 3C3BA 1E2IA 1FF9A 1DG1G 2JJ1D 5K4GA 2PQ2A 1U98A 4H7JA 1X7HA 3PWSA 3I4LA 4Q34A 1F38A 1TZJA 2XDWA 4RM2A 1XTBA 2A5GA 2OZVA 3K1YA 3CY6A 1D09A 1O94A 2WI8A 2ZI5A 3K9HA 5AXCA 3IE1A 2OO5C 1P6QA 1FUUA 2FSIA 4XM2A 3K0KA 3DDCA 4DL9A 3E9CA 4UOEA 1OT3A 2O0MA 1CUZA 1MC8A 1OYOA 3JVEA 4L51A 4MW6A 5IH3A 3BK7A 1D4ZA 2WICA 3MTIA 4GBJA 1K7EB 3OQHA 3RUAA 1V16A 1V6CA 2J3KA 4KTVE 5DBOA 1JEAA 3T5MA 2ORED 2IEZA 2TYSB 4WFIA 2J85A 5B7NA 2TECE 5K0CA 1JJAA 2D5CA 1U7DA 1W73A 2M2IA 2P3OA 2XUZA 1XTIA 1M5TA 1EB8A 2HHLA 3DAHA 3HVHA 5C31A 4V3BA 3THSA 2HN9A 3R3YA 3NZEA 1TM4E 4A5SA 1YE3A 4DIBA 5LR6A 1CF2O 4FJ0A 1ZIYA 2I3BA 3LPDA 4H3SA 2H1IA 3L0CA 3ROFA 3SZOA 5K2MA 2ZBGA 3FTPA 3L46A 1NW6A 2PTGA 2X2FA 4OTZA 1T4BA 1CE8B 3PHGA 3AYXB 3CLRC 1KDYA 4LAFA 4W9NA 3Q3IA 4RHTA 2HPHA 2Q8NA 3Q7PA 3I9V6 2VAMA 3QW4B 1U3UA 3JD4A 4XSHA 1KARA 1Y37A 2VPIA 3DDSA 3IUNA 4OB8A 4LOAA 3ROTA 5CLQA 2N9UA 1HLDA 1OXSC 1HT1E 3MFQA 4FFBA 2QR2A 1JR3D 3BMQB 3FTCA 3A9VA 3VISA 4N5IX 2CVPA 2A88A 4UVEA 2O2CA 3T5DA 5JQGA 1D9ZA 3NANA 4D0RA 2GZMA 2C03A 3HMKA 3I42A 4YJGA 1Y5RA 3DYBA 3EXHB 3OH8A 4EA9A 4F3NA 2Z8YM 1IHOA 3GAZA 2FUNB 5JNRA 2HJHA 3QYFA 4ZEOA 3NGMA 4ZI2A 4MWGA 2FRDA 3D5EA 5JE8A 5C3MA 3IS3A 1XZJA 4D56A 2Q4BA 1ZCJA 4G5XA 3RGWS 1YR8A 2Y1XA 3VFDA 3O93A 1ISFA 1B16A 2G1PA 5KHAA 1S9DA 3LPMA 3F6CA 5JNWA 1BFUA 2AXQA 4NX2A 1CUVA 4QJ4A 3JRXA 3RS2A 3RODA 4Q7JB 4QUHA 1NULA 1BXGA 5K9ZA 1GVNB 2WE8A 2Z43A 3MTGA 4XB2A 2DGDA 2HA2A 4IXDA 1GTZA 2CJWA 4AY6A 5B1IA 2BAGA 1FSZA 2NXJA 3OFJA 2OWDA 2PJZA 5CURA 4ACBA 4HLUA 4E03A 3Q8MA 1QZTA 3F4LA 3T3NA 2P9CA 2YUTA 4MS1B 2HRBA 1UJMA 3CB4A 1LDEA 1BJRE 4HSEA 2VDJA 3SOPA 2PZGA 3LWDA 2I6TA 4DG8A 3OX3A 4MR9B 5T4FA 4DSNA 4B8WA 5C51B 5H7XA 4U6QA 3IVRA 3MRTA 2R66A 3ABSB 4ZHQB 5JPCA 1NXPA 3MGAA 4ID3A 3RJZA 4CKZA 1F14A 3AXTA 4UBKA 1JFRA 3H9UA 4IP0A 4Q4HB 5ESXA 3VDNB 4RJLA 2VSYA 5F35A 4HXYA 2QQFA 1E4EB 1RC1A 5CCBA 1VIAA 2H1HA 3NMUF 1GZVA 3MZ0A 4Q4AB 4OQXA 4R1SA 1FDWA 3L0IB 3QKRB 4GUAA 2DTDA 2ZDGA 3GEEA 3K0FB 4G5RA 3IEMA 4S35A 1OFGA 2WY2D 3PNVA 4EFMA 1IN8A 3PNQA 4K9MA 3F90A 3MVEA 1W30A 3QM1A 3UXEA 3FMOB 1L4HA 1AVTA 1JAHA 4RZ3A 2C59A 3FWKA 3JWJA 4IMRA 4R3WA 4W7HA 1Y9DA 1AKQA 2VK1A 3MWJA 4DBVO 5JIBA 1BGXT 1BCRA 1EX6A 3RG8A 1JDZA 1URPA 1XBTA 3S55A 1B8OA 2HOQA 1DT3A 1VTKA 2OAQ1 1I7NA 2VUHB 1IPFA 4FDUA 3CVYA 4GI7A 4TT3D 1N25A 2CZGA 3GB9A 4I55B 3NT4A 5DHAA 3HVIA 1T5HX 3VV3A 5EZ6B 4JROA 4WIAA 1RM4A 5AI9A 4J49A 1GUDA 1Q0ZA 1V25A 2GT1A 2HTEA 5CPFA 4B3SB 3DLCA 1FS5A 1G21A 5JROA 3AEYA 3OT5A 4Z3DA 1QUFA 4NMWA 3ZCRA 4RDXA 4CU2A 1HSOA 2ZXFA 2PWBA 4Q1DA 5E7QA 3QEAZ 2G1KA 3BXEA 4WCVA 4IPTA 1MABB 3BJIC 3FH0A 2HWYA 5GY7A 1UDBA 3IQGX 3RHSA 3AB7A 2RHBA 4W63A 4NESA 4BU1A 3EZNA 1P60A 4WBNF 2H4HA 2QZZA 1TQHA 1Z2EA 4KVGA 3UKDA 4CPDA 5BQFA 5KINB 3BSFA 4MVJA 3LC7O 5ED4A 1PGOA 2Q99A 3PF9A 4L7VA 2FZ5A 4I08A 4UZSA 3GUZA 1VSBA 3OPYA 1NOIA 1S5PA 2V7GA 3OMWA 5ER6A 1GG2A 2PLRA 4YY3B 4BVGA 5LMUB 4R9UC 5D1HA 1Q1EA 2HA6A 3L01A 5EJFA 3V7FA 3W7BA 4D96A 2RAPA 3NATA 2DHRA 3HCWA 1N34B 3WKEA 1TVEA 4GSKA 1K7CA 5COBA 2VSFA 4ARZA 4WFJA 3BF8A 3ZXIA 2CV0A 3G59A 3H9CA 4YUVA 4LZPA 3FE2A 2TMKA 1CEXA 3L9WA 5CGQB 4EF5A 5FL7D 2FFQA 1CLEA 3KYDB 4FS3A 4WZAA 2B7CA 3NTUA 3L6OO 1GCIA 5FBKA 2NGRA 3MBOA 1XTTA 4DABA 2JVIA 4PQYA 1GZSA 3ZHRA 4C07A 1SCKA 3NIWA 4MR8B 4CMEA 1BJKA 3THWB 4J8PA 1A7UA 5ADHA 1SKYB 2C7GA 1JECA 5HJ7A 3R75A 1NHGA 3DEHA 2G0NA 3C8ZA 3PNYA 5FI5A 3LNTA 1KS2A 5CNJA 1X2BA 3EGCA 1DV1A 4YMWA 5K6AA 1Z5GA 1V1RA 1FFEA 4GP6A 2OUIA 3B9QA 1J8QA 1KYIA 1YRHA 1L4UA 3TOZA 4AKIA 3VPDA 3TSCA 2G8LA 3D3WA 1DJMA 5CRIA 3EVEA 3AERA 4L4RA 1SG9A 4DYHA 2WMNB 2ZQYA 1RQLA 2YOFA 1U0GA 1GZ4A 1FTYA 1MGOA 5NLLA 2AR9A 3KL2A 3BFJA 1EGAA 1SG6A 1T9HA 3M4YA 1DKOA 3G5MA 3IOEA 1PEAA 4XR9A 3SNHA 3FTFA 3U4GA 3ICPA 4HSGA 4GMDA 2D3TA 3ODGA 4LYEA 3A9RA 1JHYA 4L2IA 2OE2A 3U7IA 4O4IB 2GN8A 4WUTA 4Q93A 1NUHA 3BGVA 4QYWA 1H2WA 2EL7A 2XW6A 1XQ1A 1QYIA 4DNOA 1NUQA 2FA9A 1OILA 4NQZA 5LA6B 3GH3A 1NQTA 2CFCA 2CXXA 2HHCA 1SIUA 3OZRA 3KKQA 4X1YA 4ENPA 3CF2A 1TQ6A 4V0KA 4E0BA 4PG8A 5IG2A 3ELBA 2ADOA 4OMUA 3HP7A 4JLOA 1XA3A 1DKRA 4FC6A 2RH8A 1PR0A 3O38A 1SOMA 3OAAA 1U11A 2HI0A 4LTNA 1OB2A 3PJRA 1VRCA 1KMMA 1XWWA 4HTFA 2P91A 3LBFA 1DEAA 4KLZA 4V2IA 2C77A 4OFBA 4R2IA 1HKUA 4KMOA 3C8DA 1LWOA 2R5WA 5FAXA 5EHIA 4IX1A 3AM5A 4PQEA 4E14A 5C7YA 1KY3A 3F49S 1C1HA 2HCBA 1W94A 3H3JA 4B40A 5C4MA 5L45A 2CHGA 2F1IA 3SX4A 3L8GA 2CXSA 1W1UA 1YFKA 4EA7A 5A1TA 5A3RA 3K9LA 3OY7A 1YCHA 1F0NA 2QLMA 1MABA 1MDBA 1V6AA 4KN8A 4L8GA 4QOGA 4U2DA 5DCYA 2PUTA 3I28A 3NIGB 4BJ3A 4BP3A 4YYZA 1NR5A 2ZI4A 2DZDA 1QGDA 2Z2IA 2IKQA 1THTA 2AZTA 3FVTA 5EMJA 3RLFA 1D4OA 5J47A 1SBQA 2BI8A 2ZUTA 3BYZA 1AV7A 1ZZEA 4CBVA 5JD4A 4JY7A 1DBRA 1VBMA 3GFVA 4MJXA 1AJEA 3U48A 3PUXA 4JKOA 4CTMA 3WTBA 1ZM7A 3X1XA 3PX2A 4N9WA 1CNMA 5HF6A 4ND4A 3TWOA 5BN4B 1W44A 5SICE 2KWIA 2QTCA 3VGPA 4OMCA 1M33A 5ICSA 3D3KA 2FPUA 2CBGA 3WLPA 1N2ZA 2W2XA 3WO0A 4D9FA 1THMA 3B7GA 3T3OA 3MTQA 1LS1A 1CQPA 5GJCA 4BOYA 9ATCA 3I0NA 3ISJA 3K72B 4LTMA 1SCAA 4JBIA 4E51A 3A6DA 4YPOA 1QC5B 5CXQA 3SLRA 1BRMA 4M1EA 4MV1A 2XD4A 2I65A 4S12A 3KQKA 3KIPA 1PR1A 4LNUA 2YWXA 3VUFA 4IHQA 4PR3A 1QLWA 1W0CA 4Z8YA 1VG1A 5AIAA 1O5OA 3CX7A 2ONCA 4QLAA 2CVHA 2HUPA 4IHJF 5CX4A 2OKCA 1W35A 2YIMA 3BZUA 3PDHA 1JQLB 3OOJA 1WXQA 4G89A 3LRTA 1XZNA 1R64A 4L7QA 4NL4H 4GOKA 1FDSA 1RRVA 3ORYA 4YAIA 2CMGA 2PLFA 3F96A 1GGEA 3OZBA 2QEQA 1CDEA 3ET5A 2RGEA 3II6X 4D80A 2NNLD 3K73O 3BD8A 1X7ZA 2WUDA 4D6PA 1RTKA 2VUTA 5LM3A 2CXRA 3ITEA 2HZBA 3AWDA 1NVBA 3N8IA 4QBFA 5CT4A 4BATA 1MT0A 1N2SA 3EVBA 1RRPA 1MFPA 3TDNA 2Y1KA 4N1AA 3BRWD 1V5FA 4XIGS 5HIJA 5LZ9A 3U5TA 1AB6A 3DS8A 1CUEA 1T9AA 4OVKA 1IBLB 2ZWVA 5ANRB 2ZM6B 4L16A 1JHOA 1TX4B 2YQ5A 1DELA 1NXTA 3C7TA 1PZXA 1PS9A 2RK6A 4IZIA 1Y3BE 1KGDA 4KH1A 3C1OA 2ECFA 3FA2A 4G36A 3CNQS 2WG0A 2X5OA 4L15A 2CNDA 2REXB 1DZ3A 1MJHA 2YZNA 4QVIA 2WZBA 2CC2A 2RIRA 1TFUA 3LYUA 3OTQA 3S7ZA 3SIRA 3DDNA 2G09A 1J1UA 1NC3A 1G1MA 1Z26A 1MJFA 3WLSA 1C9JA 3QKSB 1JLSA 4M4SA 3PT5A 1JG7A 4EO9A 2BHRA 4C5CA 5JVDA 4OBBA 4I2NA 5B6PA 2QW8A 5AW9A 1DAHA 1JFFB 1M3SA 2O3QA 2ZRAA 4LJKA 4RZXA 3A10A 5CB6A 1N8SA 3FGOA 3IPYA 2NU9A 821PA 1CYEA 5CEEA 1NBIA 1IY9A 3E1KA 3GPLA 1NFFA 3NDJA 4P38A 4Y7CA 5D3ZA 4KN9S 3OZVA 4OQLA 3I9V1 5FAKA 1HYBA 3BRSA 3HJGA 2Y6UA 3PQ6A 1MQSA 4RWEA 4XM0A 4OLBA 1U6IA 5ESWA 1OV6A 4TZ6A 5JAUA 1DHRA 2XUJA 4ZARA 1EFUA 1VLHA 4X41A 3FCAA 3ZD9A 5HKKD 4G67A 5KOHB 2F1RA 1US8B 4P92A 4QXQA 5HMLA 3VR6A 3HCNA 3L8MA 3LUDA 4NU6A 2XXAA 3SBEA 2IP2A 1TZMA 2IDMA 2PM8A 4YX9A 1TF5A 4GL4A 3HGTA 2C9OA 3E3MA 4NK4A 4HS9A 2QM3A 2WVJA 2P9TA 4WKNA 1Y5NA 3N0RA 5C1BA 5F4BA 4BVEA 1QGED 1CE8A 3KHSA 4YYEA 2ZAGA 3IVCA 1E9AA 2NV2B 2QUZA 5IHPA 3K4QA 2V0GA 1R6AA 4FX5A 4NICA 4O4JF 3AI3A 4EQ6A 2V58A 5CDUA 4MQMA 3FW1A 3PC6A 4KMMA 5H82A 3BQ9A 4I50A 3G7SA 2TSYB 3IBSA 5EWJA 3I1JA 3LUGA 3N28A 4A2QA 2ONYA 2GS9A 4KIWA 1GU7A 3WQBA 5JS8A 3JQ7B 4AJPA 5HOQA 1D9XA 3RQSA 1UKVY 1W47A 3DO5A 1ACJA 2JLRA 3SDZA 3M1YA 4WECA 2G4LA 3PA6A 2CE2X 2H59A 3U3KA 2PSEA 3N39C 4BCCA 4X3OA 1SKAA 1Q5PA 5B57C 3R9IA 1WMDA 1XRQA 2B1QA 3ETHA 2IVFA 4IICA 1T2EA 2X0KA 4M53A 5JAOA 5KOYA 1Y8CA 2FVXA 4R1PA 3UWSA 1GUYA 1YS6A 2WK1A 3I8XA 4O2BB 1FRVA 2QL7A 4OPMA 4JI5B 3U7GA 1XKTA 5AIBA 3FD8A 5KWEA 4KV7A 1ECCA 1UPUA 1MC5A 2C84A 4NNPA 4XFKA 1U0OC 4MVJI 1CHNA 2BKVA 3L7YA 1FYFA 3HKDA 4OA8A 2BE7A 4QQRA 1Q7EA 3VDXA 4H6VA 3ESZA 2IEBA 3E9QA 3HQ4O 4HH3C 3ROQA 3ELUA 4E70A 1Z8FA 1H4VB 4M0CA 4HBZA 3U3ZA 3LO8A 3MLBA 5HNKA 3NM5A 2ABWA 3EZFA 3IJRA 4K5QA 5FULA 1WPGA 2J08A 2F1OA 4DE5A 1WEHA 4ZQHA 2ZR9A 3U0BA 3UJBA 4TYYA 4S1TA 4UAVA 1E92A 1YZGA 3F98A 4PSDA 3TFWA 3GJ4A 5CVEA 4U4AA 1GNRA 1XRJA 3RKRA 4S0ZA 4LQDA 1Z34A 2BKLA 2BTQA 1E2KA 3AY3A 1TU0A 3A2MA 3KWLA 3D1LA 2OC9A 3MTDA 1RNLA 4BQRA 2BEWB 2IV2X 2G7ZA 1PW7A 1V3UA 3BGWA 5K3OA 1BXKA 2CXUA 4I9NA 4U6NA 1LSUA 2H2HA 2RH9B 3PGA1 4JP2A 1T9BA 2H0AA 3IAS1 5CJJA 4BKRA 5MN5A 4NE7A 4PLGA 1J9EA 3UJPA 1N9KA 3S5UA 2N75A 1EFAA 4N6OA 4DJJA 1MFZA 2WB2A 1PS0A 3DXZA 1YMUA 3PHJA 2GA9A 4UBIA 2FOLA 2ATEA 3ZCSA 5A9SA 5AVXA 1IUNA 1IZZA 2CNBA 3SZLA 3L1HA 3L1KA 2R751 3TEJA 4LDJA 3O4FA 1GQRA 1XLTA 2PMFA 3EF0A 1OWLA 4CLRA 2UU9B 4KR6A 2DBQA 4GPTA 1KVTA 5TF4A 1W85B 5KTRA 4NLLA 2PYZA 3UWKA 4A3SA 3AKDA 2B2NA 4G23A 4X3PA 1SOWA 4MUXA 5LVAA 1TDJA 1T3SA 3HWSA 4AF8A 1BQEA 2RDMA 4BO1A 3SLKA 1XCPA 1EDBA 1Z75A 2BM9A 2BEUA 1XZ8A 1HNNA 4R1UA 3FNHA 3QF4B 3MCTA 3RRXA 3RW9A 4DRYA 3C5HA 3NIDB 4MKHA 1FP1D 1OBHA 4GOND 4TXMA 1EK5A 3NASA 3EWIA 1QYRA 1A7KA 1XQWA 1YL5A 2B82A 2BZ0A 1GJRA 3FCSB 5TQ0B 4H3KB 3TQCA 2J48A 3BUSA 5F5LA 2JLZA 5LYJA 4RQTA 3U62A 4EHLA 1HRKA 3ZJTA 1G7TA 3OZEA 2B8NA 3R23A 5A4AA 3NDBB 1ONSA 2EBUA 3CTPA 1HV8A 1GA4A 3C4VA 1N5JA 3OEHD 1VJGA 1UFRA 4A8JA 3WNCA 3CVXA 5F21A 3QWHA 1XALA 3WWPA 1KC1A 2IYSA 1WEKA 2ZJ6A 2YKGA 2VDMB 2HSWA 2XCTB 4CIWA 1NF9A 1R3UA 1V47A 3TZBA 4KR9A 1FW6A 4B43A 4QHSA 2OILA 5IF9A 4UEJA 1J70A 1Q92A 4G5HA 4MQLA 4C06A 1EUDB 2ZREA 3IH5A 4X20B 5HKLA 1VGVA 5DM70 2Q50A 2FU5C 2COKA 1IXRC 5JI2E 3WLIA 1NLFA 2JFXA 4ZV9A 1GDTA 2H5LA 4MGEA 4DLXA 5J2TB 1XZGA 1I80A 1M1YB 1QNLA 2X5KO 3B1VA 3B6IA 3D7LA 3FWPA 3IP8A 4Y6SA 4D4GA 2H1WA 4RF4A 2R8ZA 4NYMQ 1U0NA 4C7XA 1MX3A 2I7DA 3SEAA 1M1NA 3BS4A 4Y1FA 1GTG1 4A8TA 1DEXA 2GZ1A 1X39A 1ZUNA 1J90A 2WD9A 2XNKA 1L5MA 2JI9A 2CK3D 3FG9A 3MBKA 2PQ6A 1V9SA 4KSCA 4E15A 5E7JA 3PPIA 1JIVA 2OHFA 1CUDA 1NJ6A 1NLZA 3KDSE 3R5SA 4W9MC 3T7AA 4ALIA 3O3CA 4UXJA 1UBNA 4RS3A 3T0FA 1GPWB 2AD1A 5EQFA 2FG6C 4UUPA 4BYMA 2KW5A 4YJ2A 2I1VB 2OAP1 4EPWA 4ZU3A 1UEIA 1GXSB 1OHHD 4BNMA 3RVOA 4PCUA 3OCXA 1Y3IA 1YZUA 3EG9A 3B1JA 3CVOA 2PX0A 3P8ZA 3Q85A 3EA0A 3MJ4A 4WE3A 1SC3A 5JASA 2QZPA 1R0LA 1KAHA 5AH0A 1DE0A 2ZUCA 4DGQA 3V4RA 1O8BA 4YEDA 4YN3A 3PBKA 1TGYA 4ARIA 1G8HA 4EI8A 2CL0X 1FOEB 2VP2A 4WZBB 4PXYA 4ZQCB 4ZJUA 2PXXA 3KPJA 1WUYA 1LDBA 1JILA 1VE1A 3KJXA 5GVSA 2ASVA 4K8RB 3H5WA 5D87A 5G4KB 3DTNA 2HCFA 1ONPA 1Z0DA 3Q2OA 3CISA 3RVBA 1YVDA 1L8LA 3GUUA 2IJGX 4LYDA 2RHCA 3DYVA 3Q6NA 5ENDA 3PDUA 5CTAA 1EUYA 1UPTA 4FX2A 4H1TA 1IUPA 4TYMA 4IJMA 2CF6A 1F9EA 3WBBA 1E9CA 3KHUA 3VU0A 4CLEA 3R0XA 4V3CA 5F1PA 3LWZA 3OD1A 3SYNA 4YRSA 4DS3A 4E4YA 3QV2A 2G3YA 1AZTA 1FRZA 2IITA 2WU4A 4GLOA 3ZGZA 1JTVA 1N5DA 1OV4A 3BEDA 4HY3A 1VE7A 1G7RA 3DUFA 3IQEA 2NZUG 4GR9A 4LW8A 3G2OA 4QFCA 4P34A 4Q1VA 5JH7F 4WJLA 3V4PB 5IRCD 1ZJYA 4C89A 3BTOA 3K8YA 1Z0JA 1HL3A 3ZY2A 2K4MA 5BOVA 1E6EA 1OTHA 1X9IA 3A8TA 2IELA 2V97A 3G0BA 3KZOA 1UBRS 1UMDB 1HT0A 3QVXA 1NT4A 2IEIA 4R8LA 3T1OA 3MUFA 4F06A 1JQEA 4TMYA 1TLFA 3WQHA 1TMYA 4BNXA 1I0LA 2NZXA 3WHPA 4EJSC 3B1XA 2R6FA 2V6JA 2AF4C 3P27A 2VJKA 4CDMA 1BHO1 4IHKA 1TEVA 3P0FA 4KWCA 5EYPA 7REQB 4DV3B 1SBTA 1W25A 4LJYA 3V1MA 1YS9A 1BH6A 1GOTA 4PNZA 2LNDA 1OLUA 4C05A 3JY6A 1ID8A 1ZM3A 2HO4A 3RS5A 3DFFA 2EZUA 2ZS7A 1JIJA 3IELA 4QTXA 4RJKA 2W70A 1ZO8A 1II9A 1ZCBA 2OCGA 1LSSA 4RH0A 4UBMA 1PI3A 3WISA 4R40A 1BE1A 5D3QA 1ES9A 3RC8A 4XQEA 3RT1A 1M1YA 1YONA 4DRXB 1ABBA 1DQSA 2NTNA 2VNHA 1GRNA 5FIUA 1MO6A 2R84A 1RP1A 3NHBA 3ZU5A 4WY2A 1EWKA 1CRLA 1RAHA 1ZQ9A 1DAPA 2D62A 1XCOA 1DIHA 3QFRA 4GQBA 4NYJQ 3HYRA 1C50A 2QD4A 5EE0A 1OKKD 1FFSA 5IEBA 4IDDA 2GWHA 4A92A 4H35A 1L5NA 1PT9A 2C88A 2WKSA 4M87A 2A7QA 4WESA 5BR1A 4DLRA 2HSEA 1ZK3A 4WZ6A 2XADA 1E63A 1DMRA 5CB8A 2IBSA 3QJGA 2H1SA 3TOXA 4ETIA 2A84A 1LQ2A 2QTRA 4BRZA 4X92A 4ZGWA 1L5HB 4PPFA 1PV4A 3N2NA 1LFAA 4RFVA 3RSLA 4AX8A 2P62A 5SY9A 1NJ8A 3QVGA 4P0PB 4I1OA 3AP1A 4AZ0B 2DHQA 2RG7A 4FDLA 1XT6A 4HUJA 3MG9A 1UT5A 4IWNA 1SUCA 1Z0AA 4LJ6A 1C0IA 1QB8A 2IYOA 1R1DA 3JU3A 1KEUA 3NGLA 4LCJA 4Q7KA 2JBHA 4FIDA 4EP1A 5CJ2A 4F1JA 5L3QB 3H04A 5EWJB 3I3OA 2PMWB 2POQX 1RAAA 1SM4A 1TPZA 3IIJA 4FFBB 4IOJA 1YIDA 5KVQA 3PNLA 2IX3A 5AVYA 1ZCAA 3N5CA 2IXTA 2J9XB 3HXLA 4RTNA 1XRPA 1Z5NA 2C7VA 3TB4A 1M7HA 1P62B 2EL9A 2VHTA 1UZAA 3WL7A 4YALA 3PFWO 5K03A 1FSPA 1PVDA 3SHFA 5JCOC 1KR2A 1VJCA 2HA3A 2ZRGA 3I2JA 1AA9A 2X7HA 3QEJA 4YNBA 1E3LA 4FYPA 4G1EB 3KKKA 4XH9B 5AHRA 4B45A 4AX4A 2UZ0A 3HXPA 3L7DA 2IYZA 3WWYA 1FA9A 5C8YA 4C4ZA 2QZJA 4DBLE 1D5WA 2N42A 3N07A 1KDRA 1MO4A 1P8JA 4BMYA 4PSUA 2EVWX 3O4GA 3VR2D 4ZCTA 2WHPB 2OHHA 2I33A 4A8HA 4Y7DA 2NUPA 1QRTA 1E1DA 3CSUA 1OPXA 2B4KA 2Q1SA 4A16A 2QF7A 1H2FA 2BY4A 3MD9A 4B1FA 4TKVA 4RTMA 3MIIA 3HJFA 2FK7A 1L4KA 3R0JA 1OWNA 2WFAA 4BRSA 3HXTA 4XI9A 1NUAA 1RD4A 4LECA 3UA4A 3PHHA 4P84A 4Q4JB 2WWVD 2E5LB 4PQGA 4DDVA 3A06A 1XI2A 1B7GO 4UBLA 2PH3A 3V42A 4B46A 5E4JA 3FVQA 1LEHA 3WGJA 1Q19A 3FPSA 5GOTA 1HQYE 4ARSA 4DLLA 3SC2A 1Y7LA 4GLLA 3T99A 5AM3A 4WJKB 3RFUA 3S99A 5DBHX 3JWIA 3ZI7A 3IKMB 1OAOA 1RI3A 3B9PA 3MN1A 2EKDA 3AU8A 3L07A 5BQ3A 4F6CA 1E3QA 1W76A 3Q40A 2N1BA 3BIWA 1NUSA 2IZ5A 5IABA 3GT7A 1JG2A 4KFTA 4I50B 4CL2A 1HI9A 3KQHA 5EP4A 4RLQA 2DKOA 3A0RB 4E46A 4H6XA 1NTRA 3SSAA 1ZHOA 3FKJA 4MR8A 1LVUA 2OG1A 5FWXB 2GYYA 3DTTA 3QUQA 3TR0A 4BX0A 3K4HA 4ODIA 3HGQA 4ETNA 1NXXA 2II6A 1YB7A 2FHPA 1K98A 4FFPA 3G02A 1OLXB 2JAXA 2SKEA 4LXXA 4XA8A 5IJXA 4AVYA 4B5KA 5A62A 5CHEA 4MV8A 4MQFA 1GV1A 3DZGA 4WGGA 1IH8A 3NDPA 1XPOA 4WOCA 3OZGA 2H1VA 2OBXA 1JGTA 2CCGA 2Q3HA 4JI6B 5JTTA 3GI1A 4P7BA 5KOHA 3AR9A 3T38A 3QWIA 4DTCA 2ZJAA 3KBOA 4GI3A 4ZT4A 3R6TA 1Z2DA 2I1LA 3PD7A 2M6KA 2WWTA 2X19A 3SQDA 4AY5A 3VPSA 2YJTD 2QUBA 2CLCX 2WKWA 3JQCA 3C3AA 3DMGA 3NHKA 2F2TA 3GEMA 3X2SA 1IXZA 1PK9A 4C20A 1P6XA 621PA 2ZYGA 1B0UA 3VO1A 4PFJA 5I7OA 3PD1A 1CRWG 4BJ1A 3FYCA 3I9MA 1OXTA 2VP9A 2JK0A 3RTCA 2FZEA 4Z53A 5TS3A 3Q41A 4KNWA 3SIWA 2G77B 3TNLA 3W2FA 2UYQA 2FCRA 3TF5A 1I24A 3E3OA 5G1PA 1SQ0A 2ZTLA 1ZG3A 2NU6A 5JAMA 3GUHA 1KBOA 4GW3A 4PBSA 1G8KA 3F74A 3C5EA 4G25A 4KZPA 3RAFC 4H4CA 4LJ4A 4KRXA 1XXLA 4O5AA 1YRWA 2PLWA 2AFHB 2YW9A 1BA3A 1ZK4A 3LKDA 1ZBQA 1TCBA 1GNVA 4HX5A 4ZRMA 4MMYB 1J97A 1FNNA 4X63A 1TRKA 3NPAA 2G63A 4BPBA 2DUWA 1PN3A 2P2LA 2ZZMA 1BXRB 1O54A 1EK1A 2OL4A 3M3HA 3N2GB 3DZCA 4MDHA 3C5WP 1KZ7B 3SYRA 3QOYA 3N05A 4ZYYA 4B3XA 3THXA 4JCOA 4NWIA 3E82A 3KVRA 4BNZA 3HM2A 2R9VA 2A58A 3IJPA 2GYUA 4FDMA 4UM7A 4ZC8A 2XOXA 2C92A 5JH7A 3CRVA 4EM6A 4RPJA 1N6RA 3T9AA 2DWCA 3WLOA 1T5TA 2IEDA 5HR5A 1OC2A 2GXQA 4UMVA 5L7YA 4IFBA 3NOVA 2ID9A 4Q21A 4CF6A 3F9RA 1R9MA 1YE8A 2J3QA 4U7GA 3I3SR 3I53A 4BKUA 5IJWA 4F8EA 5AI4A 4FFMA 4NCJA 1DDGA 1PUXA 2VBGA 3UV6A 1MNAA 3GPDG 3KBBA 4HGQA 3T1QA 5DP1A 1T4GA 3P2JA 4RACA 4I4TA 4RF2A 1MXFA 4YMGA 1LVGA 3BWDD 4OXKA 2PD3A 3CF0A 5HX7A 2PX8A 4FEAA 3OKPA 4QOSA 4TYPA 2QS9A 4X1KA 3FUUA 1I9GA 5AI5A 1QBGA 4N7MA 2ZJ0A 2ZIAA 5EMMA 4FYMA 5EVCA 1PWYE 5CM9C 4ZKEA 1ZD4A 3V8EA 2GJ4A 3QIAA 1YIOA 1N2XA 1D03A 3FNQA 2V4ZA 3HEAA 1QP8A 4RIEA 3R0ZA 1LLUA 5CA1B 3DOUA 3SF8A 2C7RA 4HQKA 3ZW7A 4MCJA 1AV6A 1JHVA 3KEGA 2XE7A 3JPWA 5IC6A 3BFXA 2NTYC 3RREA 5KYWB 1U0SY 1T3LA 4L1KA 5K45A 3BREA 4W8HA 2EKBA 2FPOA 3JWPA 1IFXA 2E89A 5B12A 3CEHA 1YA6A 2ZI9A 4B47A 1OJLA 1ST3A 2XCSB 2GB4A 3U80A 5A04A 2YTZA 4N48A 1ZXLA 4B9AA 4QL3A 3S0JA 1GZ7A 2XGMA 2PX6A 5DASA 3K0AB 3PUIA 4TKVB 2Y3IA 4HATA 4I66A 4O08A 5AVJA 1WMEA 1ZNXA 1ISMA 1VLQA 4J2HA 1M2NA 4M0PA 4DC9A 1VHQA 4J1TA 2RB4A 5CG1A 5KMGA 2HW8A 4BVJA 1RAFA 5KAMA 2PFKA 1ZL0A 1IWOA 1A72A 1VZ2A 3QGMA 3JQ7A 3IHWA 2VG8A 2DERA 1T8UA 4MKIA 4DDMA 4I1IA 1WV0A 2J0QA 1W9HA 4DQLA 3A1FA 4M9SA 1N0IA 2NXWA 2EIHA 1W75A 4ZHQA 2Q1TA 2NTEA 1V8OA 4MV4A 1KS9A 4RXUA 3S27A 3E5HA 3B3FA 4LDPA