3IHTA

Crystal structure of s-adenosyl-l-methionine methyl transferase (yp_165822.1) from silicibacter pomeroyi dss-3 at 1.80 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
b'EQSRLDLFIDRMVSQRACLEHAIAQTAGLSGPVYELGLGNGRTYHHLRQHVQGREIYVFERAVASHPDSTPPEAQLILGDIRETLPATLERFGATASLVHADLGGHNREKNDRFARLISPLIEPHLAQGGLMVSSDRMYFEGLEELPLPPGAVVGRCFIYRRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosyl-L-methionine methyl transferase
publication title Crystal structure of S-adenosyl-L-methionine methyl transferase (YP_165822.1) from SILICIBACTER POMEROYI DSS-3 at 1.80 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Transferase
total genus 47
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12692 Methyltransf_17 S-adenosyl-L-methionine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ihtA00
4MIKA 4XUDA 2ZVJA 5JUWA 3KR0A 2ZTHA 3T7RA 5K09A 4YV0A 2GA9A 1L1EA 3KPUA 4PCAA 3EVDA 5K0CA 4KVZA 5E2BA 1SQFA 5DRYA 5DT2A 4WXHA 3G89A 3AJDA 3DH0A 4GC9A 4A6EA 3GO4A 5IKMA 3GU3A 1KPHA 2VDWA 3Q7EA 2XYRA 2PX8A 3NW9A 3TOSA 3DR5A 2AN4A 3P9NA 3JWGA 3ID6C 4GC5A 2ZFUA 5CUQA 3HCAA 4YUWA 2PXCA 1P39A 4DA4A 5CVVA 1L3BA 2ZIEA 2IGTA 5DTMA 1VL5A 2O05A 3KQQA 4KIGA 5LQUA 3KU1A 1NE2A 1U2ZA 1O9GA 2HR1A 2AOTA 3FTEA 1M6YA 4KDRA 2YX1A 3T7TA 3GCZA 3CJRA 1FP2A 3PFHA 3TFWA 3DMHA 5EG5A 5EMKA 2PT6A 2QRVB 5ICGA 4QQKA 2BM9A 5HIIA 2OZVA 1EJ6A 3DXXA 4PYKA 1SQGA 4PYNA 5K05A 5LQJA 5EIFA 4RVFA 4E31A 3KPJA 4RTSA 1SKMA 3KPWA 5DPMA 5DXJA 5FADA 3V97A 3LKDA 3OU6A 2PGXA 5GOZA 2AN5A 5P8WA 4LWOA 1P1BA 2GAFA 3U81A 1ZQ9A 2ZBPA 3NWEA 3OFJA 4HGYA 3UJ8A 5DM2A 1FP1D 1ZKDA 3HA7A 3C3YA 3KR1A 2G1PA 1KYWA 2BZGA 3MQ2A 1JSXA 3REOA 4OX9Y 1VPTA 5E9QA 3R3HA 1NBHA 4PYJA 1YB2A 4Y2HA 3LDGA 3P8ZA 4ZTBA 4ER0A 5E8RA 1BHJA 3EEOA 2ERCA 3HA3A 3GRRA 3E8SA 1AQIA 3FUVA 1SVUA 3P2KA 2ZWAA 2FK7A 4BP3A 2OYRA 4GOMD 1ZGAA 4O29A 3M6XA 5E8JA 4C4AA 4ER5A 1MHTA 3EVZA 4E30A 1RJEA 2YUIA 3IHTA 5DM1A 5BP7A 3F4KA 4PGGA 4PONA 1YFJA 3I53A 1MJFA 1QYRA 2AOUB 3ANXA 3M4XA 4HH4A 3VC1A 1O54A 3G2OA 3M6VA 2YXEA 2ORED 3KQYA 2AS0A 3DLCA 3KR9A 1RJGA 3BGIA 3ME5A 5EGSA 1ZHFA 1Q0TA 2UYHA 3NVKI 2P35A 3LBFA 1QANA 5E1MA 5EHGA 4RVHA 3DULA 3BKWA 3UFBA 5DX8A 5M5BA 1XCLA 4RX1A 3TKYA 3THSA 2PY6A 3NDIA 4R6WA 5JR3A 3LX6A 2I62A 3G2MA 2JHCA 2OBFA 3FTCA 4EKIA 3KQPA 5EHIA 4RSRA 1UIRA 1R6AA 2XYVA 3EGEA 2PX4A 2JHAA 3OCJA 4Z2YA 5EKUA 4RWZA 3CVOA 3ER8A 3CCFA 1XDSA 3A7EA 2EJUA 4X41A 3LHDA 2PXAA 2GB4A 2UYQA 3RW9A 2C7OA 2AVDA 3VC2A 1WG8A 3KQOA 3GRZA 1G55A 3G2PA 3KKZA 3MERA 5EOVA 4CKCA 1NW6A 3PVCA 4E2WA 1QZZA 2LD4A 2OPBA 2JH9A 4KWCA 4FP9A 3NVMB 4RV9A 3C6KA 4PYOA 3DMGA 5KYGA 3CGGA 3DLIA 4HTFB 3MB5A 4GQBA 5CIYA 2QY6A 1R8YA 4QTUB 2P3QA 2Z6QA 2GLUA 1N7JA 3AXTA 4EMSA 2C7QA 3KQSA 1VLMA 2FRXA 2PX2A 3EGIA 3G7UA 1P91A 3R9XB 5IH3A 2IFTA 2V74B 3DXYA 3GDHA 2B9EA 1DUSA 1VBFA 4OA5A 3HCFA 1VQ1A 3GIWA 4QPNA 4R8RA 1JTFA 3AY0A 2G72A 3FUXA 5HIJA 1RJDA 2ZLBA 4FT4A 5DM4A 2IP2A 4F86A 4YUZA 4OQEA 2YR0A 5CVJA 3PX2A 1SUSA 4R8SA 5FQOA 5FTWA 1KPIA 2BH2A 3JWIA 3KQVA 2OB2A 3IV6A 1D2CA 3BWBA 1X1CA 3FRHA 1VP3A 1FPQA 1KXZA 4X60A 4DQ0A 3G88A 3A25A 1BKYA 4GBED 5K03A 5DRTA 4FSXA 2PLWA 5EMJA 5C1IA 2QYOA 1JG1A 3IYLW 4POOA 4YUYA 3B3GA 3T0IA 3GJYA 5E1OA 3UJ9A 3TLJA 1JG4A 4CXMA 3I58A 2XBMA 2OY0A 3OZRA 1G38A 5C0OE 3B3FA 1EIZA 3HEMA 4G56A 3HNRA 1PJZA 4PYQA 3TM4A 1NT2A 1XVAA 5LQNA 4EKGA 1JG3A 3G8AA 3GXOA 4R6XA 5K0FA 4ISCA 2PWYA 2YXLA 3KR2A 4RTOA 1EG2A 3QV2A 3SM3A 3FTDA 5HILA 3FZGA 2WA1A 3LPMA 4AZWA 3L8DA 4IV0A 3HP7A 4P58A 4RTRA 3EVEA 3JWHA 3MCZA 3SSMA 4AZSA 3EVCA 4E2ZA 3SVZA 1WS6A 3FPGA 1SUIA 1RJFA 4OQDA 1TPYA 2PV0A 3AXSA 3K6RA 2ZSUA 3KPYA 4OBWA 3ER9A 1YZHA 3NDJA 1JQ3A 5CVDA 3BT7A 1R74A 3TKAA 1HNNA 3I9FA 1KPGA 2OB1A 5DTRA 3ELWA 3UJCA 2IH2A 1JTEA 3JWJA 5DX0A 3SR4A 3GRUA 5GP1A 3DTNA 5F2OA 3A27A 3UJBA 3BUSA 3OE4A 2ZZNA 4CKEA 2OXTA 1NBIA 3E05A 3OFKA 1UWVA 2H1RA 4EQZA 4DMGA 4H0NA 5DWQA 2ESRA 1ORIA 3M6UA 4QVKA 4XUEA 4CTKA 3NWBA 5CVEA 2Y1WA 3GRYA 5U4XA 5LQRA 2N47A 1XXLA 3VSEA 5K0NA 2EG5A 1D2GA 4C05A 5HZMA 3ERCA 3MTIA 2EFJA 3MCTA 3EMDA 1JG2A 4GEKA 2ZIFA 4MWZA 3TPZA 3FPHA 4LECA 3DMFA 2E5WA 5FA8A 1I4WA 1XDUA 2YQZA 3A4TA 3CJQA 3EVAA 2AOTB 3HCDA 4AUKA 3MGGA 4PYLA 2IBSA 5EZSA 3BWYA 2HV9A 2QM3A 4M38A 1G8SA 3WSTA 5CCXA 5FQNA 4KIFA 3UWPA 4F85A 3DP7A 4HC4A 2PT9A 1EJ0A 4YMHA 2VDUE 2YVLA 4QDKA 4GF5A 3KHKA 5D1HA 1ORHA 1NW3A 2B78A 3HVIA 1QAOA 2NNWB 3BGVA 3LDUA 3AWIA 2GS9A 2FK8A 5HIKA 3SSNA 3LCCA 3EEYA 3P9CA 5T64A 1X1AA 5GWXA 1AQJA 5DSXA 1YZ3A 5FWAA 3CJTA 4P7KA 5FULA 5FUBA 2A14A 4RTMA 1NV8A 5E9JA 3TRKA 3CBGA 2GH1A 4C06A 4B17A 3MHTA 2V7EA 1VIDA 3P2EA 4KRGA 2O0LA 4LWPA 1T43A 1YFLA 2P8JA 2AZTA 1HMYA 5DTQA 4E2XA 2F8LA 4ER3A 4E32A 4RTPA 2PX5A 1VP9A 1NW7A 1RI1A 3QOXA 2NXEA 2Z6AA 1I1NA 3H2BA 1L3IA 5F2KA 4CKBA 3S68A 4ER7A 3R6TA 2P3LA 5KQRA 1IXKA 3OPNA 4OA8A 5FHRA 1AV6A 4BP1A 4A6DA 2C7PA 3LGAA 3M6WA 4E70A 1IY9A 3PX3A 2PJDA 2KW5A 5EEHA 3PTAA 2ONZA 1QAQA 2NXCA 3HCCA 4RVDA 5KQSA 4BLUA 2I6GA 2AN3A 2DPMA 1FJXA 1XJ5A 3V8VA 2JHPA 1NW5A 3I5UA 3SXJA 5LR6A 3B5IA 3UA3A 3BZBA 4GUAA 4YMGA 3A26A 4PWYA 3KQMA 3LDFA 4QDJA 4K6MA 1QAMA 4PIPA 3G2QA 3IEIA 2QE6A 4U7TB 5GIOE 1XTPA 3ELYA 3G8BA 4PINA 5CD1A 3SX0A 2ZWVA 1YF3A 2CL5A 1KYZA 2BM8A 3GRVA 1KR5A 1UFKA 5EQJB 2DULA 4V0QA 1TW2A 3FPJA 2PKWA 3HVJA 4HG2A 5K0EA 2ZCJA 4DCMA 3EGVA 4Y30A 2ZULA 5GM1A 3RODA 2HWKA 1KHHA 5HEKA 1RI2A 5T6BA 4XUCA 5HIMA 5BXYA 5EPEA 2ZW9A 1JQDA 2Z6UA 3FUWA 3K0BA 4IWNA 2P7HA 5EZQA 5C9ZA 4E33A 3FPFA 4QVGA 3BXOA 2IIPA 2R6ZA 5DLYA 2NXNA 4X1OA 4RTNA 2PWPA 4C03A 3FYCA 2QRVA 1V39A 4CTJA 1NV9A 4IV8A 5KVAA 4RTJA 2PXXA 5E2AA 3THRA 2VP3A 4C08A 2H11A 3LCUA 5CVUA 3UJDA 1R8XA 4ATNA 1Q0SA 3LL7A 5EC8A 3UZUA 4UOEA 2ZBQA 4PCLA 3PT9A 5LSAA 2AOXA 3OZTA 5ERGB 9MHTA 1D2HA 5HFJA 2B25A 2Y1XA 4AZVA 4GOLD 2P7IA 2CMHA 1ZGJA 2FCAA 3FUUA 4RTKA 5MHTA 3PLAE 3P2IA 2NP7A 4BY9E 3UJAA 2WK1A 1JQEA 2P3OA 1XDZA 4P7FA 1VE3A 4XCXA 4R05A 3LSTA 3DUWA 2BR3A 1BOOA 8MHTA 2YXDA 5D1NA 5EVJA 1B42A 1WY7A 3SGLA 1NKVA 2AOWA 2UYOA 3OZSA 5DXAA 4DM3A 4F84A 4PNEA 3MAGA 3OU2A 5GIPE 3M70A 3RIEA 5G02A 3CKKA 2IH4A 1ZG3A 5K8VA 3HVHA 5LQAA 4AZTA 1G60A 1N7IA 2XVAA 5FWDA 1X1DA 2FYTA 5K0BA 2AOUA 2B3TA 3C6MA 2AR0A 1TW3A 2IDJA 4RVGA 4E2YA 3TQSA 3EVFA 4L7VA 2PBFA 2UYCA 1M0EA 2FHPA 4BLWA 5K01A 2B2CA 2FPOA 3EMBA 4GOND 3TM5A 4IKPA 3D2LA 3GGDA 4RYLA 3HCBA 1JR4A 4M7RA 4ER6A 4YV2A 2GPYA 4X63A 3C3PA 3LCVB 5EKXA 5GM2A 4YUXA 3FTFA 1BC5A 5B1SA 3TMAA 7MHTA 2PSSA 1DL5A 4QPPA 2ADMA 4C07A 3MTEA 2XVMA 5KS2A 4DKJA 3BGDA 3GWZA 2I9KA 3NMUF 1SG9A 4FR0A 3R24A 3C0KA 1KP9A 3EVGA 4P7GA 1AF7A 3P9IA 5ICFA 1WXXA 3DXZA 4HSGA 4WVLA 3G5LA 2EX4A 4YV1A 5DSTA 4C04A 2CWWA 4KW7A 2YTZA 2XYQA 3B3JA 3ELUA 5HOQA 1DCTA 3ELDA 3FRIA 3UA4A 3TR6A 2BR5A 3Q87B 2VDVE 5FA5A 4HTFA 5LQCA 3PFGA 2NP6A 2G70A 4DF3A 5K0JA 2O57A 3FUTA 3NTVA 5EEGA 4FSDA 2ONYA 1M6EX 2OKCA 3UJ6A 4RTLA 2EJTA 1H1DA 2ZBRA 4NECA 1P1CA 3HM2A 2NYUA 2ZZKA 3OE5A 3QOWA 2UZ4A 3X0DA 2HTEA 5EMLA 5E1BA 4U7PB 3BWCA 3NJRA 2C7RA 2IBTA 1X1BA 4FS8A 2ZZMA 1YUBA 4M36A 5ICEA 1O9HA 3T7SA 3LBYA 5ICCA 2CMGA 3B89A 4PYIA 2JJQA 3O4FA 4MTLA 4PGHA 2IDKA 2AVNA 4PYMA 4X61A 2HMYB 3FYDA 5E1DA 4YUVA 3CC8A 2CKDA 5BW4A 2P41A 3KQTA 2K4MA 3PS9A 1WXWA 2JH8A 2HNKA 4FT2A 3E23A 4FGZA 4QQNA 5DX1A 3A7DA 4EK9A 1Y8CA 3FPEA 1N2XA 1X19A 1I9GA 1RI5A 1XCJA 3HA5A 5K0LA 1KIAA 1RI4A 1PRYA 4EVIA 4HRAA 5GINE 1L9KA 4P7JA 5DM0A 2BR4A 2G8NA 2O07A 4PIMA 3VYWA 5BW5A 3HCEA 5F2NA 4KDCA 3O31A 3BWMA 4CWAA 4M37A 4DZRA 3HTXA 2P40A 3UBTA 2AOVA 10MHA 1FBNA 2G71A 2VZ9A 4MHTA 1NW8A 3LECA 3HVKA 3E7PA 4QTTB 3EPPA 1OR8A 4AX8A 4V0RA 3GNLA 3UJ7A 5LQKA 4MQ4A 1INLA 3OU7A 2IH5A 2I7CA 2IPXA 4OBXA 5FHQA 2OO3A 1EQAA 3ORHA 2JG3A 3R0QA 3KPVA 3PB3A 3O7WA 1L3CA 3SMQA 2R3SA 5EIWA 3I64A 5H02A 2O06A 3B7PA 4LG1A 3G5TA 5E9WA 5FCDA 3P9KA 1EAMA 1WZNA 3EVBA 3KQWA 5EMMA 1IM8A 4GOOD 2Q41A 4DCGA 5K0GA 3P97A 2NXJA 2WA2A 2ZIGA 4HGZA 5T67A 3SSOA 4BLVA 1JSZA 2P1DA 1RI3A 2VS1A 3M33A 4JXJA 3P71T 1Z3CA 1R18A 3BKXA 4RTQA 2PVCA 3DOUA 2H00A 1F38A 1F3LA 5CM2Z 4FZVA 1G6Q1 1R00A 5CCBA 1G8AA 3LKZA
chains in the Genus database with same CATH superfamily
5COBA 1RRPA 3M4NA 2E9SA 4G65A 3R5HA 5L7YA 5TVGA 5CXXA 3WYDA 3PF8A 2YN4A 3RASA 2P75A 3OZIA 4JHLA 4CKWB 3CSSA 1PW5A 4JGGA 3ZV6A 1NJSA 2PFKA 3BIFA 4NBNA 4OL0A 4F4FA 4JIMA 2XUGA 2QLTA 2FSVA 3VGPA 4JT4A 2CV1A 1Q84A 1SA0A 1XDDA 1RIIA 3Q10A 4M8SA 5CFNA 3ZTWA 2OCBA 5KNBH 4OHFA 3DD5A 2NZXA 4IDGA 4W5WA 3UT6A 1A1VA 5ED0A 1EHCA 4IXWA 4AJ4A 4I8DA 1PTJA 2J33A 3EUFA 2A86A 2AQHA 3QVMA 4M0DA 3X2EA 4A15A 3PHHA 4U8GA 1JXQA 3JX9A 1K86A 4QICA 3EIQA 3MWEB 4KX5A 4OK3A 1FNNA 2BF7A 2BFFA 2NSLA 3IMEA 3FMFA 1XVIA 2IDZA 3IGFA 13PKA 4FGKA 2HR1A 4KIUA 4V3CA 1MQAA 1ZITA 1GT6A 2GM9A 1I2MA 1Y4AE 1MW9X 2FWJA 2N3ZA 4A82A 5AKKA 3VA7A 1XO1A 2F3QA 4I4TA 4QQKA 2IVZA 4LV5B 2IOQA 3WLIA 5D8DA 5HS6A 4DUGD 1PJBA 1AQ6A 3EXG1 3DFZA 2JFUA 3AM3A 1OSNA 1ZONA 2MDTA 1SKMA 3ESZA 2FX3A 2YJZA 3E0XA 2PV7A 4CHTA 1NAIA 1OILA 4FE7A 1CEEA 1KI9A 1GY8A 2GAFA 2QZJA 3EVNA 4DC1A 1OXTA 1ACMA 4Q05A 4MEBA 5LYJB 2XGSA 3EPLA 3OUUA 1MC1A 1ZKDA 4S24A 1F7UA 1KYVA 2Q6OA 3KR1A 4U39A 1LPPA 1I51A 3MQ2A 3VPGA 1A5BB 3V3TA 1IVNA 5G0WA 5KHLB 2YHIA 4G86A 2C82A 3IDQA 1XLTA 3AX6A 3L02A 1PJQA 3DMNA 1WOMA 2HK8A 3LSYA 5ES4B 3H2KA 2XUAA 2VK4A 3F98A 4GU5A 4NZYA 5IYZF 2FG7C 3T3MB 1LSJA 2O2XA 2O8VA 3R3WA 3T9BA 3WFJA 2CNWD 2LKCA 4D4KA 3GP3A 1V7QA 2IW1A 3P19A 1XMQB 3ML1A 3F46A 1FDVA 1O54A 3CPHA 1L4KA 2CVZA 3G2OA 3PICA 4RD4A 3RARA 3WX0A 2AS0A 4KPUB 2O5RA 3GVPA 1DO2A 1ZHFA 1EGQA 4HUQA 3FETA 4RA9A 1GEEA 1T1GA 1SUEA 5L4SA 2AKEA 4QQ8A 1SXJC 3VTAA 2WTBA 1XCLA 2I6SA 1VJCA 1A8HA 3IV7A 2QV7A 4FDVA 4E5VA 5BV1A 1NONA 3IL2A 1UJ6A 2EFHB 2NIPA 3OUZA 2C00A 2FVYA 1ZN9A 1HTBA 2ETXA 1QRTA 2JHAA 3QU5A 4PXSA 2VZEA 4RWZA 2F3PA 2GPTA 5EZ5A 4X94A 2EJUA 2PMCA 1BX3A 1RRVA 4ZQBA 1YWGO 2VP9A 4P3NA 4KWTA 1RMYA 3BA6A 3M9WA 1MV8A 1GLNA 3T5CA 4ITUA 4RS4A 2F1HA 5DI3B 3T9AA 4MYSA 2CXRA 1W0KD 1FLAA 1JFLA 2H06A 3U4GA 1SKYB 4RY8A 3EOAI 4ALIA 1ZZGA 3DLIA 2HWYA 2A0UA 3FJ1A 2XA2A 2YV3A 2R87A 4J49A 4XVRA 3TNDA 4KJZA 2V8BA 4QTUB 4R5HA 3O6VA 3R9KA 3NWOA 1QS0B 4MAFA 1CJKC 5JPIA 3WIOA 2E48A 4Z7QB 3EZGA 2AEEA 3ZOKA 1NM5C 1U9JA 2H3EA 4RS3A 3G7UA 4URXR 5JNUA 1CUSA 2FY8A 2VNHA 3LFUA 1WZUA 2UZAA 3LC0A 4MVJE 4NP6A 3KXLA 3HJCA 3GDHA 3JQRA 1KDPA 4QUIA 4DIFA 3HCFA 1EDEA 2VHXA 2P6PA 1EWKA 3C16C 3W6NA 2HJ9A 5A7HA 2IP2A 4HR7A 4OATA 3WGZA 2WAAA 3AIIA 3PIRA 2NV2B 5EMHA 4EA7A 1QH9A 3ZTTA 4R83A 5BN3A 3DAFA 2Q1UA 4OQ4A 2FW9A 2C9DA 2OAEA 1XRRA 2DKOA 3PU6A 721PA 3RU3A 1HSZA 2GBGA 3MWDB 3DQPA 2GCOA 4R1LA 3UXMA 1H2ZA 1WEKA 1U7DA 2WDPA 3HVUA 5BN5A 3IYLW 4RCZA 2AG5A 4AAYA 2B2NA 2OCKA 2NGRA 4PHGA 2QD3A 3AR9A 1YCGA 4HJXA 1L4EA 4WDRA 2IYZA 2JFVA 3U7QA 2EGHA 2YYZA 3IQGX 4IDDA 2H92A 3PIDA 5BURA 1QVAA 1UPTA 3PQEA 1AQNA 3COVA 4Y7DA 4N76A 1DRUA 3WKCA 5EJ5A 4D8TA 1PHPA 1MPTA 3ASZA 1TQ2A 4B45A 4DS3A 5JO9A 4ZFNA 2GDJA 1QIMA 1OKKA 1QO0D 5B6JA 3AETA 4AKTA 3OTIA 1A2KC 3D64A 3V4PB 2V6IA 1TRHA 3LZDA 2VL7A 4AZSA 1PT7A 5HGXA 1XTJA 1QPGA 3LV8A 4F04A 2C5GA 2DE0X 3CUUA 5LXTA 3LG2A 1ZXXA 3B20A 3T7AA 4ZN6A 1P72A 2XVXA 4RQTA 5H80A 1K8YB 3DF9A 1X42A 3FMOB 2B3DA 4EX6A 3IP6A 4Y67A 4M0UA 1GG5A 3EIEA 3PEUA 1JIJA 3AWDA 5FL7A 4BU0A 1I5RA 1OAOA 2NSJA 3TKAA 2ZUUA 3I9FA 4HDMA 3RGGA 2W11A 1ZMBA 3B6JA 3DOCA 5CT6A 1HRKA 2I7VA 4MYTA 2JLSA 3ENNA 3G0OA 5KNDA 5L6LB 3L5KA 1TUBA 4GI3A 2W37A 3J7AC 4HEA1 1YIDA 2DR3A 3T06B 4D4IA 3SFTA 5K3BA 3HL0A 3N5KA 2I1QA 1BXGB 3J81A 4DMLA 4CKEA 2C1ZA 1AGXA 4DR1B 1J07A 1EFVB 2FX2A 5HWSA 2B2XA 4EFLA 2O8CB 1W93A 1J8YF 1GPKA 4RJKA 2XB4A 1P7VA 1DDOA 1U4OA 3GJ5A 4B47A 2Y1CA 2PGIA 2ZAMA 1QP7A 3LA8A 4GVXA 2FZ4A 4P5EA 2W2KA 3PEWA 1B6SA 1NVGA 4OI4A 3F6YA 3JQCA 3MWFA 1X7ZA 2Q07A 3D7MA 3O7MA 4UW9A 5FPPA 9LDTA 1ODKA 1QTIA 1H2FA 3ZVRA 2C9OA 1OH6A 1DBVO 2C8JA 4D6YA 5IJ9A 1CS0A 3LPDA 4YCJA 5JNRA 2GF2A 3AEKA 2F1KA 3NBQA 1CWUA 1OZFA 3CR7A 4WLNA 1LLFA 4AUKA 4TQUS 4MXDA 1NI4A 1NF8A 5FUQA 5FWXA 2BKLA 4CRWB 1IEVA 2QROA 4JB3A 4KQ9A 2H6EA 2JZOA 3PYMA 2WILA 4CEJA 3M6LA 5ENZA 4XDGA 3A9SA 4ZYYA 1QAOA 2I3ZA 2WFZA 1GZ4A 4QRHA 3TNFA 221PA 3UB3A 3DHNA 3P9CA 3GH3A 2NTVA 1FRFS 1YVEI 4ANFA 1KGSA 4G07A 4JBWA 1W4AA 5CXSA 4MUBA 1E99A 1NV8A 2FMKA 4QHTA 4DYDA 5LZ9A 1TF2A 3H8SA 3BOSA 1ZEJA 1NSTA 4I55B 4DA0A 3UGKA 1VIDA 4DM4A 1J70A 1Y8AA 3HMQA 1PR0A 2TYSB 2FPPB 1QJ4A 1RHUA 2YMMA 4DCSA 2HOQA 2YYSA 2PUDA 2FDRA 4KI0A 2BRUC 2F3SA 4PSCA 1D6SA 2GVZC 5B3AA 4N5MA 3L4EA 4WEOA 1L8OA 1NSFA 1PJ8A 3TIVA 4AROA 5JRJA 3IV9A 5K6RA 2CNBA 4Q02A 3PNPA 2AWNA 3EIOA 4R8KA 1DRVA 3PUJA 1J7JA 1TTHA 4BE9A 3QEBZ 5FOXA 1C8VB 5EI5A 5A4IS 2ZCVA 3D6FA 4IRXA 4OHUA 3UB2A 3RFTA 4WH0A 4ZDIA 4O4HA 4CMEA 3RIYA 2FN9A 3HR4A 5L6MB 3KSRA 1P6UA 4XQ0A 5DNDA 2JHPA 2VJCA 2AT1A 3PV0A 3B1FA 2KPOA 1R8SA 3HXMA 2WKWA 3L6OO 4NCAA 3PZRA 1NVWQ 3EOBI 3QE0A 4K6MA 4X44A 1W1UA 2M2IA 5ALIA 3U7EB 1DQYA 2Z8ZA 4G41A 1S2GA 4ZVNA 1U8CB 1JR3A 1SQ0A 3RVSA 1DEKA 1KR5A 1QGOA 1HEUA 2C54A 4S1VA 1TYBE 4PNHA 2RHJA 3ZQJA 1TW2A 3FPJA 5H68A 1ZVQA 4DCMA 3IMFA 1ESEA 2ACVA 4G23A 5HJ2A 3MTAA 1OFVA 1KHHA 1T4BA 5HEKA 1U1FA 1JKXA 1JLRA 1PGPA 2C20A 3PP8A 1YRQA 4R41A 3REFA 4E5SA 1GPH1 5A4JA 2WD8A 2AF4C 1A5AB 5GJCA 3UHAA 5C9ZA 1ZL0A 2W22A 3H2IA 5I3CA 1EGHA 4PRLA 1DE0A 4BFWA 4ZJYA 3GOHA 4MLZA 4E5YA 2XMSA 1EH5A 4QTZA 1IG3A 4L85A 4ZOBA 2H54A 2F43B 4C08A 5HG0A 3QVOA 5JE8A 3P2MA 3I30X 3ZCXA 4MPDA 1KYXA 3LL7A 3OZWA 1FDTA 2AOXA 2AI3A 3OZTA 4MUIA 1LJUA 3RTDA 4BXOA 2VJNA 4LZNA 4CQMD 3WVNA 3DP9A 2YIDA 5H83A 1WSBA 2QDKA 1WW2A 5LJIA 1Y7TA 1SGWA 2A9JA 3GP8A 1Z0IA 1RHKA 1RWOA 2B7CA 4RESA 3UJAA 4ZGWA 5I8PA 3M34A 2QMYA 4AJOA 3L82B 3V2IA 3AOEA 1GUZA 5IULC 1EP1B 2IS4A 1BOOA 2X0IA 4K2AA 2NXWA 3AJRA 3E9CA 5D1NA 4ZU1X 2HWWA 3SGLA 4X85A 3HRIA 4O4LA 1ATIA 4PQEA 1JDJA 2HCTA 5CDFE 2DETA 1Y5MA 2JI7A 3RI3A 3HA2A 1Z6QA 1U9YA 3L7LA 2PGLA 2P6MA 2G5CA 3HY4A 4YONB 3OCWA 3MMPA 2CLMB 3OICA 4ZAXA 5JJ5A 4IUBS 1B0PA 4NCJA 3WRXA 1S2LA 4UBMA 3UK0A 1O57A 2PO5A 3G8YA 1A71A 2NU7B 3CH5A 2AG8A 1H85A 4PAWA 4QGFA 4GYWA 4BV3A 3ROKA 1J06A 1EWQA 2ZBDA 4HKTA 4OQYA 1H2AS 3OUTA 3ESAA 1JJBA 2A78A 1NDUA 3RE1A 1OYWA 2KYRA 4LHVA 3C5CA 1DFIA 1K2VN 2FEXA 3AONB 3L1KA 4IKPA 3W0LB 2ZB4A 1ZD5A 2Q6KA 4FK8A 5CB6A 4M7RA 2I3DA 2OG1A 1C81A 2LZ0A 3AFIA 3BWXA 3BM5A 1I33A 4WASA 1GGFA 1EPUA 2IV2X 1OYOA 2H57A 4J07A 1OTHA 1NP3A 1BOFA 3I1YA 8ABPA 5KIAA 2CHVA 5BVGA 1IEQA 2IQIA 3RVPA 5DCYA 5F76A 4GRDA 2VPYA 1ZC3A 3L6UA 5KOJA 3K5PA 5KTPA 3AJEA 2X1VA 1GYPA 4WVLA 1U8XX 3FYUB 3FZYA 2HXSA 4UEKA 1NXXA 5DSTA 2XX3A 4BNFA 3I2GA 5E4YA 5JMOA 3FWKA 3ELUA 1JU3A 3KJZA 5CM8B 5EHQA 1W76A 2H1IA 3QKWA 3Q2KA 4E5MA 3ANMA 3V42A 1H0KA 2GXQA 2P91A 4WLOA 5HKLA 5K0JA 3PUKA 5EEGA 5BSMA 1X38A 2GN2A 3DL4A 2I2WA 1SVMA 3HM2A 5CLQA 4YPFA 4IX9A 3FKSA 4LPKA 4AN1A 2ZWOA 2YXBA 2QTHA 1NU8A 4CMBA 2HD4A 2IEBA 1MT3A 1MVLA 1XZIA 2OBYA 3BQMB 4Q3LA 4C2BA 4B3IA 1CSEE 4D4GA 4E4YA 3LQKA 4Z99A 2CVFA 2DUJA 3TQQA 1JI3A 2YCBA 2QTGA 5BPFA 1OF1A 1D2MA 4DLAA 1VG9B 2G9UA 4M21A 3RJ9A 2WJIA 3LT0A 1KOGA 1E5QA 2CYAA 1JEQA 2DQZA 1XCBA 5JTTA 3TEFA 1QIJA 2IU0A 3S27A 4DRZA 4FHCA 4BKUA 2QX7A 2Y76A 3TTUA 5BW4A 3AVQA 3V7NA 1ISSA 2H4XA 1KYIA 1CZRA 2Z0MA 3AY7A 4LBWA 4DANA 4IQFA 4MQLA 1T6YA 3B2NA 2EKDA 1Q1BA 1I9GA 4YJDA 1ICIA 3FX2A 4AICA 4H18A 2QL5A 4KYTA 4GZ3A 3RSOA 5JYCA 3JQEA 1IAQA 3DV2A 3PDWA 4HRAA 4F38A 4DV1B 2WJYA 3PUIA 2IU6A 3FTQA 5C53B 3UWSA 2P90A 3CN9A 1Q77A 3PUWA 3ZE7A 1UKVY 4CWAA 3F8WA 2ZYUX 2V7XA 2VFAA 2WMDA 3AVPA 3T5AA 1IY2A 3GPDG 4RHFA 1MTZA 1EAYA 4WNAB 3OEED 4N40A 1P4HA 2JL1A 4HDNB 4MHTA 5JY1A 1XYVA 3VOTA 4BOYA 3D3QA 1N5RA 1L7BA 4AX8A 4O2AF 3GNLA 4FKBA 4MQ4A 3DLHA 3GDWA 2REQA 1GU7A 1YNOA 4PHHA 3IIIA 3ACDA 3I8SA 3PITA 4ZYZA 4II3A 3R0QA 4TVKA 4TRRA 3W04A 2AXNA 4FC7A 1G59A 1NLZA 1Y6RA 2R3SA 1Z28A 4UAVA 2QMUA 4KWHA 2EAUA 4ZAZA 3P9KA 3TWOA 1WZNA 4C7KA 4DCGA 4DMRA 5DJ5A 3WL5A 3Q0EA 1B3BA 2ZJOA 3ZK8A 3LBHA 4DILA 5AVOA 2P1DA 5LP6B 3KQUA 4X6YA 4EABA 1Z3CA 2HTFA 2MSNA 3O9ZA 3BKXA 4LRXA 4XOUA 3TQHA 3UFXA 2IH5A 2H00A 1GIAA 1V1MA 3MTQA 3O26A 4PX9A 1ADGA 4YT4A 3E3AA 4ENUA 1PAUA 4BFSA 3VSCA 1DGQA 3UWMA 1MOQA 1OLOA 1GPYA 1YZFA 3AV0B 3EIHA 1HG1A 1UPBA 3PTZA 5IAKA 5IC5A 2NUAB 3W8RA 2ZI6A 3R77A 1YK0A 1LI5A 3G13A 4IIEA 4QOSA 3HDHA 3BICA 4KVZA 1SQFA 3FIJA 4G36A 3Q3EA 4U2KA 4WXHA 4AS1A 2XRMA 3IVCA 4HN2A 5D01A 1W30A 4YDSA 3RVBA 3V4FA 3VYRB 3DMTC 1C8BA 1DC3A 3DR5A 4A2WA 2ZSIA 3D6VA 2FEMA 2ZREA 4LOKA 4PIVA 3WLOA 3OI7A 2XEXA 3A6HA 3KYDA 4GVPA 1B8OA 4DQLA 3QPAA 1IUNA 3KQQA 3QWAA 5LDDC 5JHHB 4H08A 3I1JA 1O9GA 4MQMA 2X6TA 4UJ5A 2PGAA 2X76A 4LV6A 4AF8A 4FEGA 4XLLA 3GB9A 3PQ6A 4IIYA 4BBAA 3BHMA 2R6GA 2QTAA 16PKA 1SHUX 1A72A 2NUPA 1XEWX 1J7KA 4GE3A 2FE1A 3LK6A 2QRVB 2G8LA 1ZGZA 1E1CA 1W85B 4XH9B 3J80A 3RS0A 1JG6A 3ICCA 4NV0A 4WFQA 1QQ5A 1DAPA 4BBZA 1UR5A 1NGSA 1XP8A 1I2AA 2Q3BA 3TL2A 3AUFA 3E9YA 4L4SA 2HSGA 1SBHA 4NCNA 2AN5A 3HFSA 2QRHA 1I3NA 3JCZA 3NYIA 3R5TA 3TO5A 4YRNA 1D6NA 1TMKA 1ZJZA 4L8FA 3GFVA 2SICE 2N75A 1REQB 4Q47A 4RADA 3B5JA 4E46A 3DLPX 3SQOA 3AR4A 3ZZ1A 3R7FA 1NWCA 4A0FA 2MJLA 1ZW1A 2PVSA 3HA3A 3V9PA 3RVMA 1AQIA 4YP7A 5DHPA 3TGLA 2PEZA 2CSXA 1N2CA 2C5AA 2IGBA 2YJGA 4D0RA 1HOXA 1R9NA 3EVZA 3ZHBA 2CB0A 1AQUA 4RLFA 1YC2A 2EF1A 2WM8A 3OF3A 4GGOA 3LVFO 1ZC4A 1L7RA 1ZIPA 2VA8A 3KTAB 3ENZA 4AJLA 5C7OO 4DEYA 3RRNA 3NCHA 4XOIA 5DW3A 1AURA 2X15A 3DPUA 1LDGA 3NIGB 1H0SA 4L50A 5CYPA 1M2EA 3E15A 1ZA2A 4BAZA 5HHTA 1FFDA 4LTDA 3V8EA 4D5GA 5G1PA 1JW9B 1MR3F 1HL3A 3QVVA 2EIXA 3DZCA 5EHIA 1P3DA 1UIRA 2NM0A 2QTNA 4OQMA 1CR4A 2VF7A 3LT4A 1C1HA 2NO6A 3B70A 1DAMA 3E9EA 5CJJA 2HA4A 1G64A 1M1NB 4CCAA 4HN9A 4EUEA 3TVDA 1ZR2A 1MZVA 1IBKB 1ULUA 4L2IB 4AQ7A 1FFXB 2EG9A 2JFBA 3D2BA 1AHNA 4M89A 1XTKA 4GPZA 2JFYA 4GWLA 1A27A 3R7NA 4DLLA 5HSGA 5JC1A 4UBLA 3FOWA 3WYFA 3HL4A 5FIUA 1TM2A 5C31A 5KYGA 1Z6AA 2HIGA 2DWCA 3BG5A 3GPBA 3DZDA 4XVQA 1FZTA 2F1OA 2NUTA 4OYRA 1M6VB 5TNXA 2RC5A 3ZD9A 421PA 3KQSA 1AIPA 2ZE8A 1FBTA 2GJAA 1UXGA 2IYLD 1MOZA 1PYGA 3WGJA 3EPJA 4W9RA 3BCUA 3D3WB 4EFNA 3GWGA 1BZYA 2VNIA 5REQA 2ZJAA 4MWSA 1QRDA 5A6SB 4NI5A 4TLMB 5ISMA 2Z6VA 2UYGA 1J99A 1M1YA 2ZE5A 2F17A 1RJDA 3EARA 2UUCB 1XELA 2G28A 1ZH4A 3E4DA 2ONCA 4B3MB 1E0SA 1R5BA 3FI0A 3RYFB 4LZZA 1KPIA 2GILA 3IVMA 2FXVA 4UQPA 1O97C 1VB5A 2WMOB 4S1NA 2WE8A 1SBTA 3QFHA 1POWA 3ZHRA 4Z9XA 2JLAA 4HVTA 3P52A 4QKQA 4ZKDA 1IUKA 3HYTA 2CCJA 3IXMA 3HR8A 1G2IA 3NWPA 2I2CA 3PK0A 4QL3A 5FXMA 1CV2A 2GEFA 4I5FA 5JASA 1ABBA 1EMDA 4CXMA 4OKNA 1NULA 3BXFA 1TDJA 3LXRA 2WW8A 3SQNA 3O4IA 3E58A 3BPSA 4MWEA 4U2CA 3C97A 3L5OA 3C6YA 5C0OE 4C1NA 4L8YA 5KVCA 4XWTA 4P54A 2Y0PA 1W88A 3ONFA 3W4KA 3WYNA 5NLLA 4D3SA 3ANTA 2B36A 3O8QB 2JA1A 1H5UA 3GFGA 5C46F 5I9BA 1B74A 1U3GA 4WBNB 3QV2A 1J0AA 1Q95A 1USUA 2NU9A 1WEHA 3DCYA 4AP6A 2X0KA 3L8DA 3TOZA 5GGYA 2HK9A 4FFBA 5SYAA 1XAGA 4B33A 3LCJA 3RFCA 3FOCA 3HU2A 3SEZA 1TM7E 2HUNA 4UVIA 3CZ4A 3SVZA 5IM4F 3B9QA 3DO5A 5I4IA 4DCPA 3ND5A 1NMYA 1UH5A 3VPXA 2J48A 2WQ6A 4CNBA 1L4YA 1UC5B 5K8UA 3BF8A 4KXYA 2FTKE 4QG7A 3OPYA 4PBTA 4YAEA 1N9ZA 1U7TA 2QB5A 2QF7A 3ETHA 2OFXA 3LM8A 1MNQA 4W99A 1LSSA 3EGWA 4DCCA 3S2UA 3KCNA 3FOZA 1E32A 1JTEA 1XMXA 4QUBA 1IHXA 4WGFA 4TMXA 2IE8A 1XNJA 5I51A 1ZY2A 3I01A 4G2TA 4LOIA 2CHEA 2CYBA 3OO1A 1WLYA 4NKRA 4YMVA 1OB2A 5AVSA 2QQ5A 2D2VA 3MJSA 1N75A 4DBZA 4DMGA 1OTXA 1KS2A 3VBEA 1G8JA 4YP5A 1SA0B 1FLVA 4OQPA 2QYHA 1ZD1A 4EMUA 3HB9A 3L0IB 4L5YA 1KAEA 3IIEA 3HO6A 4LVNA 3EZYA 4XI9A 1GXSA 2FF7A 4FHDA 4JOSA 1VYTA 3V1UA 4DMFA 1QZXA 1Z8DA 3MTIA 3QGMA 4KQEA 5PNTA 5IN4A 3TG2A 4KZPA 1LZKA 2BFFB 3QEJA 1DO8A 2ZBGA 3FPHA 2G88A 3ZZMA 1P1RA 4DXHA 3OF2A 1VJ5A 4YACA 4W4TA 4AFNA 2XXAA 4N3GA 4LEIA 4GWGA 2HRCA 2VBFA 3A1NA 3T3GA 3U0BA 4B43A 1OFGA 4YR9A 2R8RA 1Y98A 2VLBA 2DHRA 2VJKA 4I4TB 5AT1A 3ZCVA 1A9XB 4LYYA 4YMHA 4J0JA 1ZGGA 5TV2A 2QVZX 4DHWA 2GKGA 1Z37A 2HA2A 3UUFA 1KEZA 1LGYA 5BWBA 4TRNA 1E9RA 4G63A 2COEA 4RPGA 4X95A 1SKYE 3TLBA 4R0NA 1EA7A 2XDYA 3QA3E 4DE5A 3F71A 3HV2A 2PMDA 4HMPA 4IJQA 3IQEA 2M98A 2QM8A 4LJAA 1Y1SA 4JV5B 2I4NA 1R3DA 3L7BA 1C29B 2PX0A 3MRVA 2EYQA 3ODGA 4ZT7A 1E1RD 3PFWO 4JB0A 4P5PA 1M7BA 2FWAA 4YWHA 3WJ7A 1NW7A 2YHIB 4RDHA 1L4NA 5EWMA 3GDFA 1CVLA 4UREA 1CNMA 2AQIA 2P4SA 3OPNA 1WMAA 2FWIA 3O93A 4XGIA 2C7PA 3GLFE 1ZVMA 2AH5A 2UXBB 4HS4A 3L49A 4LHZA 5IJWA 2H59A 2J09A 3SKVA 1F5NA 1TMGE 1ZNYA 3PGVA 4TTVA 1PLJA 3OPYI 3V1YA 2I6GA 3BIJA 3KAQA 1XJ5A 5AK6A 3V8VA 3WB1A 5J4KA 4M0CA 2FF5A 4JI1B 4RA9B 4HUQB 4YXWD 1F6BA 1HNXB 2XH8A 1RYMA 3TZ6A 3IAM6 3LDFA 5JVDA 1JPVA 1X8JA 2Q8NA 1QAMA 1G2OA 2AYXA 3GCDA 4LYJA 1W29A 4JR0A 1ZVVA 3GRFA 1NVXQ 4R1MA 4AK9A 4QOEA 3KHTA 1M7GA 2CL5A 1L0BA 1WCIA 4OYYA 4N01A 4DR3B 1TD1A 4W5JA 4DUGA 2WZDA 4XB1A 4C20A 5B57C 4MI9A 5B64A 4ZOLA 1KVQA 3TLGA 4AP9A 2DQYA 3FCEA 4WPGA 3S8MA 4UTVA 2WIGA 5FEMA 1RI2A 3T9DA 1SC4A 5HIMA 4QFDA 2DBRA 3BE6A 4P4LA 1IXSB 4YQFA 5JDIC 1PJ4A 3T6KA 3VU8A 2VP5A 2O1EA 1IFXA 2JFGA 4PC7A 4A8PA 1KYTA 4L9WA 3KK0A 1K6MA 1ONOA 5DLYA 1PFVA 2AK3A 4MPRA 3AKZA 3M6FA 2W4IA 4L0MA 4NG5A 4BQSA 3OQ6A 1D04A 2PXXA 4JDPA 1XEXA 4HWOA 5I5EA 4BX2A 5AFSA 3PT9A 5EP2A 1O3YA 1MEJA 4I3FA 2QVGA 3BWVA 5HTKA 4EFMA 5K3EA 4DDVA 2HGSA 2KLBA 3H65A 4OJQA 3CF4G 1RKVA 3A0RB 3I6MA 4PZYA 5MHTA 1KZ7B 3KOXA 4KR7A 2CNWA 3P32A 1PFUA 1YL5A 2ZE7A 3A6LA 4MIOA 2OXEA 2P3OA 5FBKA 4TWBA 4XCXA 4YRIA 3L0OA 5CX1B 3WHIA 3R6LA 2YHSA 2WKSA 3RFUA 3DUWA 4D0SA 1KGDA 5BN4A 3H5TA 2CXPA 4IXMA 1N4DA 5FBRB 5AKJA 5LZ7A 1P7CA 3WA6A 3GFOA 3NQ41 2QDXA 1DV2A 3W5DA 2G82A 3QE2A 4GQIA 2QRKA 3O4HA 1KE2A 2W5UA 4ALMA 2ZTUA 1G60A 1VXOA 4P4GA 4IZHA 2FKNA 1T1IA 2GCOB 1FP7A 4HXYA 4J4HA 5L7TA 5LA6F 1YD7A 3WK4A 1YSCA 1LNQA 5BN5B 2EERA 3LOPA 4D56A 1GG9A 5ALYA 3BSSA 4UUOA 1PWHA 2QHXA 2O1XA 3U7QB 3UWDA 2WHQA 4JN6B 1Z73A 5B4TA 5DWDA 3A4MA 1DZ3A 1W0KA 4BYMA 4AKGA 3PDHA 5JQGF 1ZK0A 4YUXA 5JSQA 3K9HA 1C9DB 2WTXA 3A1TA 2W2QA 2W2OA 1LK5A 3JSXA 4WERA 3V1NA 5CDGA 4IHQA 3AETB 3B36A 3C1AA 4OK6A 2FSHA 5FOUA 5K3OA 3NMUF 2WJAA 1RHMA 3N59A 4LX8A 4G8BA 5C3MA 2M6KA 3CLRD 4B2PA 1Q91A 2WZCA 3HJRA 3SLRA 2GCEA 1Z5ZA 2QPOA 3GBPA 3U3ZA 5LXTB 2CWWA 1SELA 2GVDC 2QZ9A 2BKEA 3E4CA 4MP6A 1GQYA 2GGSA 4DCUA 1DKUA 1XVLA 3TCNA 5CVTA 1I5EA 4YCLA 3MPOA 1IHYA 2ZATA 4RMJA 3ELBA 1WSWA 4J9VA 2IYQA 4NV3A 4IZIA 4WD3A 1H1LB 4HDMB 1B23P 2GM5A 3JPWA 1M6EX 2OKCA 5IDQA 2EJTA 1J2TA 4RM3A 4MKHA 1Y1TA 3W9YA 5J4HA 1TT5A 5A3QA 1TUBB 3ZH2A 3RRXA 1JXOA 3HB0A 2VYCA 3GUZA 4CKEB 4KLZA 4KBYA 1KA9H 1WPXA 3DEYX 3SLGA 4B7AA 1GO2A 1HTTA 4GLFA 4R3NA 5L3RA 3FTPA 2NZJA 4GPAA 3VXKA 4DGQA 2CNDA 2H1FA 3BJIC 1DFGA 1Z7YA 1T5HX 2H0AA 3O4FA 3OZAA 3R3YA 4FIZA 3IR7A 3QUSA 2CC2A 3S8EA 4DR4B 5A9SA 3RBVA 3NBYC 2PRSA 3BCSA 3I12A 1PI3A 3S0JA 1BGVA 1P6XA 1X7ZB 3A06A 1NZJA 1TO6A 1A69A 2R9VA 2YC2C 1P2DA 4H1TA 1J8VA 1G63A 1KFBB 5AVUA 1FZQA 1QO0A 2VDRB 3A1WA 3QEOA 4EI7A 4TMWA 1R10A 5IJ9B 1CS0B 1NJ2A 5BMOA 4R2HA 4TS3A 1Z3IX 3AEKB 1AUOA 4QGAA 4M46A 1RPNA 4MYUA 5CDYA 4ZI7A 1N6KA 1VDMA 1NI4B 5D3ZA 4LJ7A 1M2OA 1HEYA 2F67A 4FI3F 5FWXB 1XT6A 5JYDA 2FHSA 1GG2A 1UDAA 4TYPA 3GNTA 4WXYB 1RPZA 4CEJB 1VG0B 5KYVA 3ZQKA 1EXNA 2IL1A 5B3LA 1JR6A 3AT1A 1YL7A 1T3SA 3VTFA 2IZOA 3OCUA 3NUGA 3CX4A 3HDQA 4LZPA 1PZHA 4GZ5A 4MDYA 1OR8A 1PFGA 1WLSA 3ROTA 1EJ2A 1Q1NA 1YA8A 1DXHA 3NDPA 1EQAA 3U44B 2Z1NA 4EUSA 1RRGA 1RYBA 2HLPA 3RSGA 4FU0A 4JP1A 1ZNQO 1IM2A 3L6CA 3LWNA 4D5EA 3ADKA 3I01M 5DBIA 4H1HA 4QNMA 4D99A 5IT0A 2BGWA 4DC9A 5CG1A 2JIQA 4YRDA 1D7AA 4GBMA 3R5KA 2V3WA 2WYVA 4NK4A 3OVMA 4Q9LA 3ZQUA 4KIGA 1MB9A 1V5FA 1ITZA 1ZN7A 1P5ZB 1LKZA 4W7HA 4XUDA 4OK5A 1ZD8A 2I4OA 4B0PA 1QQAA 4O4HB 3U4QA 2IEAA 5K09A 3VDNB 3CY6A 3KPUA 4XLTA 2J3QA 3V4RA 3VR6A 5K0CA 1W46A 1XE3A 2QQGA 4Q4AA 1GQOA 5E2BA 4Y1FA 3FMGA 5G1OA 3S2YA 2LBPA 3W3ZB 3F1KA 3EWIA 4NE9A 4RABA 2R7KA 3OY2A 5ULLA 1IYZA 1VA4A 4YDQA 4NZMA 2NU8A 3TSCA 1PK7A 1W5FA 3A6GA 3OP4A 3IQIX 1DXQA 3CZPA 1IONA 2W00A 3NAQA 5HRUA 2OTCA 1XMIA 5JLAA 1U2ZA 2WWRA 4EZIA 2HNBA 4JP3A 2R65A 1GA4A 1QHGA 3CXUA 1KF0A 4P35A 5CPBA 5KC9A 1K4YA 4BATA 1ECPA 1C30B 3WA7A 2HU7A 3OCVA 2QUBA 4OJMX 3VUEA 5L45A 2O3TA 2GAIA 1GVHA 4RVFA 4JFRA 4DTIA 1RPJA 1NFQA 1A7JA 1PVDA 3U3RA 5A5DA 5KZMB 3V1MA 5TPWA 1ID1A 3C3AA 4QVIA 2JHFA 5ILOA 3AY3A 5K4HA 4KQIA 3HZOA 4L95C 4UCWA 2P2ZA 3HA7A 1G5PA 1ULHA 3PUHA 4QWMA 1U8UA 2BZGA 4AY3A 4Z6KA 1GQSA 4CT5A 1AVTA 3C7TA 2VP0A 1XB2A 1XZGA 3TSZA 2FMTA 2E3JA 4O4LB 2FOLA 1F48A 4W8GA 2ERCA 3SBEA 1AQLA 2RI1A 1NZDA 3C7KA 1AKYA 1P5JA 1SVUA 2WU0A 3FUVA 4TMKA 2EQAA 1B6RA 5JNWA 3CE9A 2O19A 3TE7A 4K28A 3PHLA 4C4AA 4DIDA 4F2WA 2B4KA 4PLZA 2VYND 4WFIA 4WRRA 5LMNB 5A02A 2RHCA 2IEGA 2ORED 2WKPA 4EP1A 2JJ1D 4MOWA 5FPSA 2OP0A 3NVKI 1NX9A 3BMCA 3I34X 1NQ5A 4PRKA 3JSAA 5EE1A 1A8IA 3BFPA 4KGVA 2IOFA 2W6QA 4II7A 4BNGA 4IOJA 5M5BA 1VE9A 4J1SA 3TKYA 4WZBA 1RHQA 4Z86A 3KIPA 3COJA 3SS9X 4CF7A 3UCEA 4G25A 1GARA 1JU4A 1GNLA 4CT4B 4RC9A 3MOIA 3U31A 4RMHA 4Z1MD 3ZU2A 2ZI3A 5BVGB 3B6MA 4GXTA 2E87A 2PXAA 5KNDH 5KOJB 4CQMA 5JSUA 1NC1A 4JOBA 1J9GA 1O6GA 1KIMA 5DMXA 4CPDA 3ILXA 3BQ9A 2FSVC 1ZCJA 4B6PA 2H4HA 3E2MA 1MC8A 5IVDA 3JQAD 5HF8A 1UDBA 1TI7A 1UEXC 2ZRKA 2O8FA 1P73A 4FP9A 4MW6A 5FBWB 3PD7A 3K73O 4XX0A 2J9YB 2EKQA 4C6TA 1SXGA 2LKDA 2O2IA 2VKQA 3GUCA 4GOKA 2G9QA 1ORRA 3LYUA 3PPIA 5ALFA 4EHJA 1VPEA 1D1TA 4EI8A 1EFDN 2FRXA 4FJ2A 2EV9A 1QYCA 4BKPA 4ZRDA 1R0YA 1JQAA 1SVLA 2YZ7A 2C2HA 2YJ5A 4M7PA 1J8QA 1VSBA 2UVPA 1SOWA 3KWFA 1PNOA 4BEBA 2FR8A 4Z4CA 5KREA 1S89A 1W5EA 3IBGA 3GD7A 2Q2QA 1BAPA 1K4KA 2VXOA 5ANRB 3V1LA 4DL9A 3K70B 2ZSEA 4C2TA 4ITRC 3FUXA 3IERA 4KEAA 2OP1A 1R4MA 3D7LA 1JEQB 4FQ5A 1R0CA 4QOFA 4HDAA 4GH5A 1U3DA 5CVJA 3U5TA 3VJKA 3W3AD 3UUWA 5HTOA 4C88A 4N9WA 3KQVA 3OC0A 3QLUC 2Q7OE 4Q3BA 5EXPA 1T8UA 5EINA 1E59A 3HSSA 1DAIA 4C3OB 1PKXA 2D5LA 3AQIA 3N2GA 4MVJP 2BKAA 3E70C 1E0JA 3B51X 1TD9A 4N41A 2W98A 3OQJA 5HX7A 1ZI9A 5B36A 3IDZA 2Q29A 3F2VA 2H9YA 3PPVA 4DR2B 1DTSA 4YUYA 4KXWA 3W8DA 1HYBA 1RMTA 4Q9DA 1NQWA 2PUJA 1J20A 1YS1X 3N74A 1NRXA 1P1JA 1W4CA 2JLUA 3F7TA 3KXKA 1R3UA 2GO1A 4L8VA 2DPYA 4MV5A 1W87A 5HGJA 1XYYA 3EXHA 1G8PA 1L7AA 5B2EA 4BWGA 4EBFA 5B2FA 1ETUA 2GAJA 4N8SA 3VHQA 5IK2D 1DAHA 2I6UA 2C4WA 3N6XA 3SBXA 1YZTA 2X8WA 5AW2A 4JI2B 3UNXA 3L05A 5LD2C 3W2EA 1CRWG 1WUIS 4JAVC 2ADFA 3BMNA 1S2DA 3L8YA 2AMYA 3LPMA 4FYJA 4M49A 1NOIA 1HYGA 2XCIA 1UCFA 4KK3A 4E2ZA 4F7WA 3INTA 4PS0A 4K9MA 4KG7A 4JUCA 1LW6E 2BGJA 1YHYA 3E5NA 3DFIA 4YP9A 1I0ZA 1JVBA 1WY5A 2VOEA 1LW7A 2YJ4A 4GM0A 2PV0A 3RYHA 1PD1A 5J9FA 3W6PA 4G1EB 3ZIUA 4JC4A 2CGEA 1SVIA 2G5TA 3ER9A 4PZLA 2V96A 2HO5A 1VL6A 4FFSA 3WLLA 3D8SA 3DNFA 4TL6A 3UFXB 3BMOA 4IRMA 2CN1A 4M22A 3V2UA 4N8EA 1V1MB 4NMHA 1FFEA 4FFPA 3F96A 3OT4A 3T7DA 2RAUA 1DPGA 1D4ZA 3BL6A 2RIRA 3DTNA 4HEQA 3PI6A 1BDMA 3L8MA 4QJ5A 5TMBA 5BNIA 2Q28A 5CH5A 2ZQ5A 2CXTA 4H7KA 1CJCA 5JCZA 5TR9A 4AL4A 4B7XA 4QWWA 4B5KA 1QM5A 3QVLA 1PDVA 1YQQA 5F5LA 2G4LA 2NTEA 4ED9A 1DAOA 3FTFA 3WLFA 1I7SB 4EY4A 5A6VA 3EA0A 2OYSA 3F6BX 1KBQA 3DHEA 4JASB 2OK8A 1XTBA 1SVWA 1WL8A 3OEEA 3BXZA 3KU4A 1JHVA 3AF0A 1TGVA 4TT3D 4DADA 4A6XA 5K8TA 2R6HA 1QB7A 2ZSHA 3V8BA 5FA8A 1D0SA 1XDUA 1X39A 2ASVA 2ZYHA 1FNDA 4ZOCA 4BV9A 3TZLA 2F55A 1CR0A 2YRFA 2NSDA 1K75A 3RS7A 5K4AA 1TA4A 3WSTA 5IWCA 2NUPB 3JWEA 4NYJQ 4E5UA 4B9AA 1A7AA 1E1CB 2LDXA 3QKUA 1K1EA 3ESRA 1NC3A 2XMZA 4KUGA 4O4JA 3BGVA 4GMFA 1QIHA 3I37X 4MS3A 3VAYA 2PSHA 1VI2A 4YJFA 3HKBA 3N5CA 1X2EA 2B99A 1R0ZA 1YZ3A 1HZZC 1BVUA 2GBPA 4HTAA 5JCOA 4QDZA 2FW1A 4JA2A 4JX9A 1IUOA 1D4AA 1WTCA 4P31A 2YJ6A 3U4CA 3M4YA 3QU9A 1HLFA 4PLHA 1M6NA 3D8BA 1YDEA 2V5VA 1M34E 3P26A 1HDZA 1M3SA 2CD9A 4NMMA 3ZZ0A 1MRZA 2DBQA 4BRUA 1EZ4A 5A7GA 4L27A 3TD6A 4E21A 3K8ZA 3ZJYA 2C1XA 1N2CB 4UCFA 7GPBA 3UG6A 1ZA1A 5AJVB 3SZLA 3PTAA 1Q7TA 3O75A 1MENA 3R0ZA 4MMYB 1P7YA 1SRQA 4EKYA 1EX1A 4IDHA 1LPNA 1JZSA 3RRFA 3WRWA 4AJIA 3KKNA 4B2YA 4BUZA 2YIMA 4QARA 5D7NA 5DV9A 5J43A 3O5AA 3NPMA 3G8CA 3A6DA 4WBSA 3F47A 5K0SA 4MWGA 3VZCA 4YCDA 2BL4A 3HUTA 3P5SA 1YF3A 2BM8A 4JA0A 1CR6A 1GCUA 4C0QC 3CB2A 4J94A 1SQSA 5TSDA 5C7YA 1ABEA 1E3LA 1FYWA 2IPLA 2VH1A 3A11A 3HU3A 3S1LA 1VL0A 2AWOA 4ACAA 1H23A 4GNKA 3SLKA 1R8JA 3OTGA 3TQIA 1J2YA 1MJGA 3CH6A 3G5AA 4XJSA 1FDSA 3IJ5A 5GM1A 2HWKA 4TLEA 1OASA 1PVOA 2XOKD 1Y42X 2ZW9A 2BBTA 3OZEA 1QTRA 2IYYA 4M1WA 2TRSB 3RS4A 3MB8A 4IMJB 1UPFA 5C8YF 5KTRA 5LWHA 2VYFA 4I1OA 3VUFA 1CY4A 3DBIA 4ENWA 5BR1A 1PR4A 4JVNA 4MGZR 4RCYA 5CT8A 3ICQB 1ZH8A 3GUVA 3GFFA 3THRA 1KBOA 2NUTB 1AKVA 3UJDA 1WBJB 1R8XA 1CYDA 5BYBA 5CLLA 2P78A 1ZI6A 4MYCA 4ERXA 3PJGA 1JN0A 2GUWA 1EFPA 2D2XA 2D13A 4JJ4A 4KMSA 2O8NA 2OGWA 1UM9A 2LTAA 4ZOEA 3PX7A 1GFIA 5IUKC 2D6FA 3PLAE 1BMTA 1UDWA 2Q6LA 3OTWA 5FAXA 2XB9A 2G25A 3AFMA 3NASA 4P7FA 5E3IA 5REQB 4R05A 3T41A 3IP1A 4BVBA 3FPAA 1P2TA 1M1YB 4ZVKA 2IWRA 3U1VA 4LF9B 1IPEA 2HJRA 2AYZA 3OX3A 3JVUA 4NYJR 4OH1A 3FBGA 1NKVA 4X20A 4MKXA 3OZSA 5DXAA 1PNTA 2OFFA 2PRIA 3OU2A 4RPJA 1IY0A 1HDOA 1A2OA 3KEGA 4OGGA 3ESQA 4W9NA 1YR6A 4BQRA 2FXIA 1TTPB 3II6X 2Y0DA 3KLMX 3QA9A 3QVSA 1G9SA 5JD4A 1CULC 2Y1DA 1FTQA 2VDMB 4G4SP 4ACBA 1C7QA 1N7IA 2IZ7A 2VH2A 3I3OA 2EBHX 2PL1A 3NV9A 3U61B 2YS7A 1VHWA 1KBZA 2NV6A 1CIPA 5CFLA 4RVGA 1L5WA 4KSCA 1CQPA 3EVFA 2PUAA 3KOOA 1PTKA 1DIAA 1N8SA 1LBQA 3QMVA 4N3CA 1IMOA 2B2CA 1DQPA 4BLWA 3S81A 3O9MA 4MGKR 3VDMA 2W93A 4N8DA 4RD3A 1RE0A 3RS3A 5AM0A 2VYVA 1W88B 4QXOA 1U8TA 2X5KO 4PPFA 3RVNA 5DKFA 2H2IA 1HE3A 3JQ9A 2M1XA 3O21A 3PFIA 4HAOA 5GJVC 2QN7A 1OA0A 2V9PA 3ZHSA 4NZZA 3PDUA 2NU9B 2PRJA 4M9ZA 2D5BA 4ID9A 5CLHA 4PSDA 3RNLA 1BDJA 4FFBB 1AF7A 2ZRNA 1ORWA 1J24A 3SU8A 4AF7A 1Z62A 2QYSA 2VXCA 1GRRA 3Q3IA 1NKTA 1E0DA 4UE6A 4WZAA 5G0SA 4RULA 2XZLA 1UKBA 1DCTA 2D1QA 3C7CB 1VLQA 3IAEA 3LUKA 4YRMA 2UUOA 4QFBA 5DB4A 3E9MA 3OPYB 4IBOA 2IUEA 2J3EA 5FA5A 3PFGA 3NHKA 3O0TA 5ALRA 2BJHA 3AL3A 4JU8A 2YZGA 2BTEA 3R20A 2NYUA 2Q5EA 2Z8YA 4PAOA 4DG9A 2V7VA 4U7PB 1MFZA 2WJVA 3EA4A 4O08A 1XQYA 4HPWA 2PUFA 4J8PA 5A4AA 4Q3OA 1FE8A 3LBYA 4WOKA 3FFBA 1QE3A 1GL9B 1IULA 1JMVA 3QE4A 1ZICA 2JJQA 1RWNA 3O3NB 1HG0A 2PWZA 3IR6A 4A5SA 5DYNA 1P1IA 1UXOA 1HPLA 3PEYA 1KSFX 1W6UA 1WKVA 1XRMA 4UFNA 2AJTA 2VPXA 3EBOA 2XJ4A 4AKHA 1GXSB 4MO2A 1YTLA 1DELA 1SBZA 3SOZA 1MC4A 2P69A 3KSBC 2VUTA 3EW7A 3MGBA 3WHLA 4D43A 1FQKA 2IU3A 1QE0A 1ZIOA 4YX9A 5IKEA 5DX1A 3MWYW 3NXSA 5GAJA 3WKAA 5KYYA 1ICEA 4YRSA 2N46A 1NUSA 2D0PB 5FYDA 4DQUA 5BRJA 2XXAB 1VKRA 3VZPA 2B30A 1J5PA 3NFYA 2Y0CA 4LMPA 2YASA 1J8DA 4B4DA 2W2MA 4EUHA 3ROEA 3UPTA 3NDRA 3TCKA 2BY4A 3B1ZA 3BWMA 3QHAA 4IQGA 4ZI5A 3AOGA 3BWEA 1RZRD 2VWHA 1RM0A 3QVXA 5AK5A 1FBNA 1IUPA 3WP0A 2J5XA 1JAHA 1I1HA 3QTTA 4WT7A 1XZLA 4GI1A 2HI0A 2BLNA 1X7XA 1YJAA 3N70A 4LJ6A 3IB6A 1JHMA 2XNJA 4B35A 4EY6A 2J5QA 3DT8A 1PFKA 2DFNA 1LS6A 4H4CA 1Z6ZA 1Y3CE 3MIIA 2D2FA 1K3TA 3GPCA 3H0CA 2X9LA 3B7PA 3OM0A 2VNKA 2GZAA 1OPXA 3LX8A 5EWMB 1G9TA 1GPJA 3D3JA 3RUPA 3AEYA 3SE0A 2NXJA 4MI1A 5T67A 4IDOA 5LBTA 5EJEA 4JQSA 2R751 2GN0A 1EKXA 2Q5JA 3AB8A 4COOA 1BS9A 3GVXA 2BGGA 2XIJA 5ECYA 4MVJF 4BS9A 2XNCA 1LEHA 2J4CA 1VHTA 3EQ8A 2PS0A 1JEJA 2ZVJA 4OJYA 3ZQ4A 3GVCA 3ZXXA 4ZC1A 1DQRA 3ETLA 4NTZA 4QUAA 2G4CA 4UZEA 4ZREA 1CZHA 4PLYA 3S70A 1I14A 4LSGA 4X6LA 4E15A 1T9CA 5JVDB 3U13A 2IHJA 3BD9A 2FZWA 4WY2A 1NI3A 2GT1A 1TT7A 1N8KA 1TYZA 4IXNA 4IEEA 1J8MF 3NBUA 4K26A 1B0ZA 1WCIB 2ZQZA 3P9NA 2C4TA 2JFQA 4GMHA 3SJ7A 3UMBA 2ZFUA 4RIIA 5BRNA 3CS3A 3L6RA 4N5DA 2VHVA 2G4VA 4P92A 4TTIA 3F73A 4WGGA 1H5QA 1NNUA 4ZOLB 3Q0TA 4P1ZA 3TLGB 5AYVA 1VL5A 5H3CA 3PNYA 4S35A 5CXQA 3IURA 3K70C 3NHRA 4D9KA 4CIWA 4KDRA 4CM9A 2BHLA 4U8HA 3B1YA 3T4UA 4V1CI 1B7GO 4WXPA 1JDBC 1EG7A 3AFNA 3DMHA 3TFWA 4EJSA 4OG2A 4W63A 1HI9A 3TAXA 1XEXB 4EMTA 1NUTA 2DX7A 1IWPB 3LLCA 4E31A 3RG2A 5J1TB 5ALMA 3BBPA 1UXIA 3IALA 1KMMA 1RLMA 3C1UA 5LJLA 4MVWA 4WUVA 5LQDA 3C87A 1YACA 3F6CA 4I5EA 2PBRA 3KOZA 1XHFA 3DE7X 1V8OA 4MS1A 3QWIA 2OAQ1 4IMRA 3ZX5A 2I4LA 1UWLA 5MN4A 4H27A 3REOA 2C95A 1SXJD 2C3PA 2OFWA 3AF5A 4OBEA 1E7QA 1FFHA 1NBHA 3D1JA 5BN4B 4YXWA 2AW5A 2SBTA 1PLKA 1NATA 1KRHA 3WBFA 3GRRA 4I4CA 5EA2A 4V0MA 3HXQA 1D6JA 4W8OA 4R68A 1KDOA 2RGNA 3ZUGA 2Q9CA 3CT4A 2M1ZA 3IIKA 3M6XA 1XA3A 5F1YA 3UF0A 3VZRA 2QM7A 3JVDA 2PMEA 2XDQA 3H8VA 2JGNA 5DGXA 1Q44A 2RI0A 2VDJA 1P75A 3I53A 3IDAA 5BSFA 3E61A 4QBIA 2YXEA 4GFDA 1FIUA 2QOEA 1UZMA 4XIJA 4M83A 2HH9A 2WG2A 1CKEA 1HC7A 3E1GA 1O94C 2CXUA 2YNMC 3JATB 3UFBA 4LQ4A 3WHKA 1FFYA 1MJGM 2VHCA 4FYWA 5JAIA 1JHXA 1Y6QA 3U4IA 4CF3A 2BE7A 3QXCA 4FDUA 4BUCA 3RV4A 1HGXA 1GQFA 4TYQA 4OLBA 3LRPA 5DT9A 3CIFA 3UJ3X 5ITVA 1VMKA 1SVNA 4G5SA 4ZZ2A 2HEGA 3UEOA 1WA5A 2B92A 2E82A 3FHLA 3CNQS 1TKAA 2GB4A 2RG1A 1D6MA 3I83A 3FA2A 3QFSA 4TTTS 4YLEA 1E2IA 3KQOA 3QV1A 2AEJA 3ZV4A 4TYNA 4FQ8A 4B75A 1Y3BE 2VPTA 1JQJC 1RVV1 4I08A 3FNHA 4PTLA 4PAGA 5KTYA 3DV0A 3QBEA 4NCHA 3TNYA 2JH9A 4Z8YA 1V71A 4I9UA 3MRXA 2DRIA 3MELA 2ILTA 2C2YA 3BRCA 1PEYA 5JSYA 4CFSA 1ZJJA 5A4FS 4QJBA 5KO2A 1GPWB 2WICA 5U9CA 1QGUA 1OPRA 2PT5A 4MTCA 3DD1A 5FTLA 1Y8ZA 2XMDA 3Q8KA 1USVA 3GJTA 1GYQA 1TT5B 2H8KA 1JI0A 3QTLA 3W2GA 1JA1A 5AHWA 5E7MA 2Q5OA 5K2OA 1PD0A 2WJGA 5SY9A 3EASA 5TGDA 5KYNA 1N5LA 1T1EA 1TF7A 2V74B 4R01A 5FUVA 2B9EA 1I32A 3KZ1E 4LV8B 1GKUB 4F9EA 3V5NA 2XRZA 1VQ1A 3EZFA 3U56A 4F0JA 1EI9A 1LLCA 2H2DA 3O2JA 2ZLBA 4KRXA 3JARA 4QODA 4OQEA 5A9SB 3FCOA 4KAAA 2EW2A 4NVRA 2Z58A 2H5LA 3LT1A 4LJ9A 4B09A 5EJ7A 2PKRA 1XAIA 4TSFA 5CU7A 5KHAA 2OQVA 5TMDA 5ITZA 2RHBA 3GJ7A 5SZHB 1FPQA 4N0MA 1ISPA 2B8WA 2R66A 4JODA 4P2BA 4RJJA 5FBLB 5ICSA 1OYYA 2XTJA 4FOSA 4G4GA 4KN6A 3WIBA 5B4VA 5BRAA 1VSQA 1JR3E 2PLWA 3CZRA 3L1JA 1RM3A 1LSOA 2JEOA 2YQ4A 1ZN8A 3WK6A 4ZI3A 1PDWA 2XCUA 4Q1CA 3T0IA 3TLAA 4B6FA 1AB5A 4DPKA 3O2QB 4ZI7B 4QSMA 1M2OB 4B3DA 1V11A 4GBJA 1AMNA 1F7VA 3BK7A 3UMFA 3E1SA 1KEWA 1IBCA 4G56A 1U9IC 3QJGA 3FVTA 4M4SA 2R84A 2EEPA 4H17A 1UMDA 3T5GA 5BWLA 3C3BA 4R0VA 2EBUA 2PQ2A 2JW5A 3E7FA 2PWYA 1SWWA 3KVVA 4RTOA 1EG2A 3ND6A 1PK9A 1QF7A 2XYGA 3TUZC 1HQCA 2ZI4A 4ESHA 1G8YA 1JU9A 1Z56C 3THYA 3BGOS 3S28A 5KNBD 4YMUA 4ZZ1A 4GPBA 3A3YA 5HRCA 2D7JA 4OQDA 1S2IA 1ZN2A 4ARIA 4K9OA 1OY1A 2Z8YM 3SDZA 2W6JD 1N1EA 3R2JA 2DG2A 2Y2UA 5EUBA 4BMOB 3NDJA 4TYMA 5A4MS 2OC4A 1TYEB 1CJMA 5DLPA 1FXWA 1R74A 3FKQA 2EP7A 2JI9A 1T0JB 3ZDFA 3VKHA 1ENYA 3X2FA 1EJBA 1J5XA 4BO4A 4F60A 3ELWA 4TTRA 2Y66A 4UNRA 4S0XA 2OXRA 2HU2A 3PC8A 3AHHA 4N6GA 3IHKA 2HHCA 3A27A 2RD2A 4FINA 4ABTA 3EE6A 3I9JA 3U4QB 2MYTA 3DEHA 3IBCA 1DEHA 5YASA 2I76A 2D5AA 2G09A 4BAUA 3WLHA 3GLVA 4JK3A 1KOJA 2H1RA 1IBSA 3JTEA 3OLYA 3ZNOA 5ALJA 9GPBA 4Q4AB 4QVKA 1O1YA 1V3UA 3MQFA 5FNVF 2B1GA 3LHIA 4YREA 5EP4A 4M98A 2HT6A 4UM9D 1E3MA 3HP4A 1ADYA 2BFEA 2ZBEA 4GXQA 4QU5A 5GGXA 1LFDB 3I04A 4ZICA 2ET6A 2WJWA 2ZJ6A 3H84A 4IVRA 9LDBA 4N49A 5EHXA 2RHHA 3M5WA 4KQMA 4OF4A 2K7ZA 1JG2A 3DT6A 4GEKA 4N3NA 3PDCA 4OFXA 4D45A 2IBSA 1ZAKA 1MRNA 4K87A 4PYLA 2ROQA 4OXIA 3W1VA 5JALA 2XV1A 1DJNA 1PG0A 1MDFA 2P9BA 1HYQA 1CJUC 3V46A 1AXEA 1Z4NA 3T4EA 3W2HA 1L5MA 2FPXA 1UK7A 2XTAA 3C6ZA 4L4XA 3AI3A 2AXQA 3LDUA 4W1SA 2CUKA 4XVHA 2JCBA 3FR8A 1SEVA 2GX6A 3LCCA 1QUEA 1ADJA 4WOCA 4ZDWA 3R8CA 4PN7A 5JECA 2NTYC 4R69A 4F11A 3N2NA 4IYRA 3CJTA 3GRPA 1YBAA 3H3JA 3PUYA 4QBTA 4XWAA 1NYLA 5FULA 3AHEA 1Z6XA 1KEUA 3MHTA 4CM5A 5TF4A 4CG3A 2EWWA 2W6CX 5IJXA 3STHA 1ISIA 3NX4A 1HMYA 3ABIA 3VSDA 1CFZA 2HU8A 4QBKA 3ZWQA 2FN3A 1KEKA 1WW8A 2NOAA 2PMFA 1EVYA 2R00C 3ST7A 1E3SA 4OHBA 3D6UA 5FL3A 3EIXA 3UGQA 4CKBA 5FOTA 2A5DA 2CLOB 1WVGA 4TV9A 3FOEC 3ZVKA 3PKIA 4A6DA 3DZIA 3KOWA 4XQ9A 3WJ1A 1NPYA 2I2FA 2H1OA 2PJDA 5EEHA 3BEDA 3CFYA 3RGWS 4WA7A 2YIJA 3JPYA 5T4FA 2GESA 4C7BA 2OHXA 1A1SA 2CHQA 1EP2B 2DPMA 4QBGB 2E37A 3KOYA 3OZVA 4F3KA 5LR6A 3BMCB 2FQYA 1PX2A 4PLCA 3LTNC 3V6MA 1SCBA 2P8SA 4NK5A 1LA2A 3O8BA 1A50B 1EDZA 1G20E 2K87A 4QASA 3ISJA 1Z6YA 4WZBB 1EK0A 4ZJPA 1HT3A 2CLLB 2HMUA 3PUVA 5C35A 2YN2A 2QUJA 1K4MA 1N25A 2PSJA 3LMKA 1KJQA 4EZEA 4IIBA 4UXHA 2F48A 2FN8A 4DBVO 5J5VA 4BNUA 3FZEA 2SKDA 3NIFB 5I01A 5JNLA 2ZCJA 3AVOA 1SUCA 4GLJA 5DF1A 3DVRX 4PRZA 3WMGA 4ZAFA 1CB7A 4UNPA 3UUEA 4CQMB 2HF8A 3A6KA 3FAKA 2E1PA 4N12A 1DOAA 2YFQA 3FUWA 5A3JA 1QR2A 2P7HA 3BRSA 4Q9NA 1ODCA 4JJAA 1EQ2A 1UM8A 2OV6A 2IOHA 2O8FB 4TMVA 4RV4A 4XX0B 1BEUB 2ZAOA 3I62A 3H5WA 2CHFA 3UXHA 2F1RA 5FLYA 4CT0A 4FKMA 1UZNA 2XGGA 2NYAA 1DOZA 3HUFA 1XZDA 1GQRA 2VHZA 2YZNA 3H6HA 3WIUA 3I9V1 4B3HA 3F3KA 2DMRA 3FSRA 3D02A 3FF1A 4JP8A 4MAMA 4NCKA 4XD7A 4WN3A 4EAQA 5CB4A 3F7MA 3GFTA 2UVPB 2A3NA 2P7IA 2NUBA 4HATA 2VQSA 2VYNA 4FE3A 2FZCA 1QQ7A 3OT5A 2EZUA 3LSTA 4R84A 1FUUA 4YQZA 4OQLA 2JJ1A 5HJ7A 4E09A 2OR3A 4PNEA 3Q2OA 1Z8NA 2A0YA 4XSGA 4I5GA 3TS1A 4A91A 1TUIA 1U02A 3LHKA 3SBOA 4DAOA 1WUJS 1U81A 1IXYA 3TW8A 5K8VA 2IH4A 3DAGA 1OBOA 3NYQA 3E3MA 5EE9A 1V8ZA 1EA5A 1S8AA 3H7AA 4Z1MA 5K0BA 4WLVA 3EGXA 3C6MA 4R1QA 1N0WA 5F3WB 2OXCA 4E2YA 4JBYA 3ZHYA 1S0UA 1HORA 2FR0A 2DBVO 3DKPA 4UUNA 2HJWA 1T8WA 1QFJA 1W5BA 1XTQA 2IXGA 2OE2A 3M7IA 3T9EA 4RYLA 2N0SA 5TARA 3EXHB 3JQAA 5EP3A 5G4KA 1I4TD 4G9GA 5HOEA 1FNBA 2CT8A 5JAMA 4ARAA 5CFOA 3C3PA 4D9CA 4G8JA 5GM2A 1UKAA 5H7XA 4FNAA 5IAJA 3EFOA 4ZVLA 4H9GA 4F45A 2VJDA 1G18A 1M6WA 1T36A 4HZGA 2B4TO 4S2EA 4MR9B 3VX3A 3AILA 3BMNB 4UFOA 1P8JA 3FPSA 1MX3A 3MMZA 3WS7A 3H2SA 2GHRA 3O91A 2JIMA 4FFMA 5J3JA 3IEXA 3MK31 1AZTA 4TMTA 3Q6IA 1OLXA 1Z18A 2OM2A 4LKRA 3WLRA 2P2YA 3H83A 1YDMA 4BN0A 1G3UA 1K89A 3LVBA 4UMVA 3RYHB 4I6GA 4GMXA 3VR6H 2IWHA 1V26A 3S29A 4UVHA 2DECA 2HY7A 4J2HA 1NQTA 4C6HA 4Y1RA 2E4WA 3F7OA 4HTFA 4YEDA 3I0MA 2G70A 1HFJA 4F9TA 4F9GA 1SQ6A 2R85A 3BMOB 4FMDF 2OO5A 1OC2A 3W3AA 5HK8A 5ALVA 3FWNA 2UZ4A 2R86A 4G5FA 2V7WA 4LN1A 1QOQB 2JGMA 3B1KA 1E3QA 1DAEA 1PZMA 1V25A 1JLKA 2RONA 3PUZA 4UVEA 3I2FA 5TS2A 3GFBA 1HSOA 2R8XA 2I80A 3L1VA 3AHGA 3B2QA 5EUMA 3X1ZA 3KFLA 1CQXA 5JWOA 5SY6A 5BR8B 1Y5RA 2YJNA 2ZJ2A 3KQHA 2B8JA 4LXQA 2R8YA 5FFFA 3L7NA 1AQYA 1T9AA 3UJ7A 1VJDA 4PYMA 4DT1A 2GEJA 3EUWA 3HU5A 3A9TA 4DV7B 1JJAA 4GYYA 2O7VA 3NXKA 2ZDGA 4ZPXA 4YUVA 5BY2A 3FHCB 2IUYA 2O1WA 4CKXA 5IK2A 4KR3A 3ER6A 4DPLA 1PSDA 4ML3A 3E5RA 4CU5A 1TCCA 4HGQA 3I0ZA 5CCEA 1U28A 4X1KA 3BSWA 5ALWA 3QFRA 3A4YA 5HE9A 1PYOA 4Z4EA 3A8TA 2OM6A 4E4RA 1E7RA 2BFDA 4FR5A 3GFPA 2ID4A 4UKDA 2UUPA 3D6TB 3I6QA 3R74A 1SAYA 3F9RA 2Y71A 5IF3A 1Q3KA 3U17A 4TZ0A 2O3JA 2ZWIA 3TMKA 1F6DA 4M37A 2WLTA 1P1HA 4O4JB 4XYEA 1USGA 1V48A 3USZA 1SUFA 2AOVA 4MS3B 4GQAA 2RCNA 4OO3A 1ECFA 4YJFB 3HKBB 1Z0ZA 4PN3A 3L77A 3IXQA 2HA7A 4U2FA 2NO9A 2VHWA 1CFJA 1EVZA 3S7ZA 4O6VA 3TSYA 1GDDA 1DEAA 3IUQA 3NYRA 4F56A 5CTJA 1EVEA 2IPXA 2A7QA 1YT5A 3ZR4B 1AGPA 3SZ3A 3DLTA 1YBMA 4Y2PA 3PB3A 3MRTA 4LDRA 2X9VA 2PL9A 1N0IA 1OZAA 4UC0A 5I7SA 1EX7A 1U1EA 2EDCA 3WGVA 4ZVQA 1L4GA 1A9YA 1OI4A 1ZBDA 3E35A 5KYWB 1QGYA 3NAMA 2IY9A 4E1BA 1FSPA 3S1SA 4KQCA 2Q62A 4HD8A 4URVR 5A06A 3L4JA 3IKVA 3MT0A 3LC2O 2C5HA 2MYPA 2A88A 3K8OE 4Q39A 4O3MA 1HMPA 1P60A 1X1QA 2H7VA 1E7YA 3NHPA 3T7RA 1X7WA 2XUQA 3PNSA 4REOA 4TT3A 5FTKA 1RHRA 1Z2AA 1GZ5A 2Q0HA 3VYSB 3LYLA 4TS1A 1J39A 1T0HB 3AERA 4M0KA 2IYEA 3GGOA 3PR2B 4RMGA 4RKRA 3HACA 3KJFA 1ZIXA 3ASYA 4FDMA 2OHIA 5IKMA 5LZ4A 1K5DA 5FLKA 1O96A 2CXXA 3AP2A 2XYRA 3E22A 1GAWA 5ESXA 3SNHA 4FYVA 3TEMA 3F7NA 4RVSA 3BK1A 1AKRA 1W0CA 1A5SB 3HFGA 4Y2JA 3HCAA 1A8PA 3WSWA 4RK7A 4KZKA 5JHGB 1WQ1R 4PG8A 3VNAA 1IMJA 2P0YA 2YV5A 1AB6A 4HV4A 5LKRA 2Q50A 3U6KA 1QORA 1ZUHA 3LP8A 3FVRA 1YB6A 4NAUA 2ZUDA 4RZ3A 1U5CA 2Y1FA 2WU1A 4HGPA 1AZLA 3G17A 4I8XA 2QX9A 3GCZA 2VSXA 1FP2A 4OB6A 2GN1A 3UIEA 2HWXA 2PT6A 2H1VA 5I7AA 2QVYX 2WWYA 3NCTA 4FOPA 3HR7A 3NT2A 4X90A 3KPJA 4L22A 2DZDA 2E85A 4QJ3A 5HQ3A 2PGXA 5GOZA 4JJIA 4EKDA 2G63A 3VJRA 1EFPB 4A0QA 2ZYAA 1RYDA 2DU8A 4DV5B 1RW4A 2MSKA 4YJGA 5DM2A 3QP9A 3A05A 1CR2A 1IWBB 3LKBA 1JUDA 2LCFA 4J1QA 5ALKA 2J4DA 5KYKA 5LYJF 1W4ZA 1IE3A 2JF0A 3CEHA 3DEJA 1ATZA 2AJDA 3MJVA 1BS2A 4X20B 1QKIA 3OFSA 4TSKA 1T2DA 2FPRA 4IIVA 3EEOA 4MVCA 1P9RA 1DIBA 1P1FA 2UYYA 4OM7A 1G66A 2DUWA 4PZAA 5F1KA 4X97A 3WO1A 2JFPA 3CEPB 2I29A 2ZWAA 3NAGA 4FFNA 4TTQA 3SS7X 4GOMD 5EZ6B 4JVSB 4QLOA 1W19A 1AN9A 1F2VA 2C31A 1Y5NA 3EYWA 1RJEA 1QMPA 5BP7A 1XKTA 1Y8RB 1KY3A 4O5AA 3WGKA 1SK8A 1JQLB 3EAFA 1BQ4A 3EF1A 5K99A 3LTEA 2C84A 2JFHA 4RAQA 5EGSA 3ZCRA 4G0UA 5AUNB 1YU6A 2I55A 1X70A 2RC6A 2XOKA 3MBIA 2IHNA 4RVHA 1WAMA 3D0KA 3WKEA 2BN4A 1GV0A 4R6WA 4QO8A 1Q3TA 4XKJA 3LX6A 2NW6A 4LF7B 2NAFA 4FM9A 2PD4A 1GPDG 4ER0A 5JH7A 2FEOA 1KQFA 2Y8EA 1NPDA 4LDPA 3H17A 3QNMA 4WKGA 3ZK9A 4MQEB 3WGIA 4DAEA 4EO9A 1MHPA 4QPZA 1Z2DA 3X1KA 5IT9A 2WYOA 5JISA 1GL6A 3AJ8A 1PL8A 3MTGA 4X8OA 4X6UA 3KOUA 1KMCA 1XKXA 4GS5A 2WF5A 1E1DA 2HREA 2X9QA 3C74A 3GNQA 4IL5A 4WZAB 1XG5A 5JCJD 1NW6A 4GKJB 3CWQA 4OHWA 1MTOA 2HSEA 3NJ4A 3LRTA 3ZDXB 3OTOB 2FMFA 2WVAA 1I13A 4FJ0A 1ZCZA 2I87A 1LV7A 3UTCA 2IYAA 4ZGGA 1CR1A 3CISA 1Q50A 4H3KB 2QWXA 2Q5CA 1EUDA 2HADA 5HQJA 2P5SA 4GHWA 4QECA 1O97D 2N42A 2OHOA 2MYNA 3AR5A 2ZWMA 1ZLYA 3FNGA 3LP6A 4AN0A 3V80A 1NNEA 4H0CA 4L78A 1P33A 1U5AA 4HYEA 5CHEA 5D86A 1JEDA 5DGDA 2AMJA 5I9TA 1E18A 2J67A 3Q9LA 4PX3A 1L7OA 5THXA 2W2TA 1VPWA 3DWGA 4Q9HA 3T9CA 2J7KA 2WP0A 3D7KA 4LXYA 4OA5A 1YJXA 2C61A 1YQGA 4QPNA 1N6HA 4KFCA 3GJXC 5ALNA 2HLDD 4GP6A 5K7SA 4YUZA 4NC9A 4IDAA 5A3SA 3Q6MA 4OGWA 4RHEA 4GX2A 1OX5A 4YGYA 2QKYA 1U8ZA 4EL5A 4PVDA 3IV6A 3IA2A 1DX9A 4LZAA 3RS2A 4BNVA 1Y1LA 2WLSA 1SKQA 2DVMA 3TIXB 3ZDRA 1OLUA 1WB5A 4DNXA 3O1LA 3E9ZA 5BWCA 2KWIA 5GOTA 5KYYB 3QUCA 1NG9A 3G85A 1KAOA 2JGEA 4L74A 2RHDA 1SUWA 5AP9A 1FMTA 2ZTVA 3D6HA 4KWEA 5HDBB 1MN6A 5AKXA 3H2HA 1ZD4A 4U9IS 5AHRA 4E1VA 4D8VA 3QPVA 3P7MA 1G38A 2RGAA 1ZIDA 2VPWA 4RWEA 3M83A 2X5XA 3GARA 4I7EA 4ZHQA 2FW7A 1P29A 1SKBA 4QDTA 2AJ8A 5IBPA 5IAGA 5ELXA 3DLBA 2WUEA 2GYVA 3EK2A 3WBJA 3HXTA 4KREA 3GJ0A 3H1BA 5F35A 3GXOA 4U5QA 3VYUB 3EFEA 4F91B 5HE8A 5J1SB 4OI0A 1XNGA 2QTVA 4RH3A 4ZYXA 4FFLA 4Q48A