3PT5A

Crystal structure of nans
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
320
Chain Sequence
IISPDYYYVLTVAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPSCHFNDIIPLTHCPHDVQDMQSYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALVKNPQNKFLGVCWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNDAPWFCGDTTWYWKENFPHAYEAIYGNYQNNILANIIFVDFQQQGARGLTNAPDEDPDDLSTGYYGSAYRSPENWTTALRSSHFSSAARRGIISDRFVEAILQFWRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of NanS (YjhS), a 9-O-Acetyl N-acetylneuraminic acid esterase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli o157:h7 edl933
molecule tags Hydrolase
molecule keywords NANS (YJHS), A 9-O-acetyl N-acetylneuraminic acid esterase
total genus 124
structure length 320
sequence length 323
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3pt5A00
2VPTA 5HOEA 4PPYA 3P94A 1ES9A 3DT6A 4OAPA 2Q0QA 2WAAA 4Q7QA 1BWRA 1V2GA 4K9SA 1VJGA 1K7CA 5BN1A 3DC7A 4H08A 4K7JA 1BWQA 2O14A 2APJA 4K40A 3W7VA 1ESDA 3SKVA 5CD9A 4JHLA 1JRLA 4XVHA 2WAOA 4JJ4A 1WABA 1DEXA 2W9XA 4NRDA 4JGGA 4IYJA 1U8UA 3KVNA 4Q9AA 3MILA 1J00A 3U37A 1IVNA 2WABA 5A4AA 4K3UA 4OAOA 4RSHA 4DEVA 2HSJA 3C1UA 1PP4A 1FXWA 3SLRA 5JD3A 4LHSA 1YZFA 1ESCA 4JJ6A 4HF7A 2Q0SA 1FXWF 3DT8A 3RJTA 4M8KA 1VYHA 1DEOA 3DCIA 3BZWA 3HP4A 4S1PA 4TX1A 3DT9A 3PT5A 1BWPA 1ZMBA 4RW0A 4HYQA 5B5SA 4I8IA 4JKOA 1ESEA 1Z8HA
chains in the Genus database with same CATH superfamily
3P27A 1MD9A 1POWA 3ELUA 4QBHA 4UDXX 3ENVA 2QENA 4JEHA 3W5VA 3RTDA 1NVVQ 3F8TA 1QF9A 1E2EA 2CE2X 4S2UA 6AT1A 1JZQA 1LK7A 1RVV1 2R7AA 2GXAA 4DLYA 4DA7A 1DI0A 3H13A 3M1LA 4S3MA 4EECA 3D7LA 3UENA 2H7YA 2AMFA 3EZYA 3QVOA 1EX9A 1CF4A 3EULA 1G6Q1 1NXXA 1QQ6A 2I8LA 1CUHA 2EKLA 1CE8A 4TWBA 5K1ZA 4W9MC 4UBKA 3WI7A 1L5ZA 4RMJA 5EWMA 2AR9A 2O2ZA 4GWLA 3JS5A 1NNLA 4QJBA 4OVKA 3AESA 4BQQA 1Q0QA 3AIMA 1YNOA 3F7MA 2BM1A 1JSCA 4DA6A 1KAHA 4P58A 3UCFA 1EEHA 5PGMA 4F5YA 2R7MA 5EZ5A 3ZR4B 1ZEJA 2FSVC 2N47A 4D97A 3U39A 5F9HA 1KH3A 3JYHA 3PJRA 3LBHA 2FUG1 4NBSA 2H63A 4LAFA 1RHQA 4UDYX 1WOYA 2OZLB 3PQ2A 1N6RA 3K4QA 4M6WB 4MARA 4MRNA 2A5JA 4MKGA 4BTEA 3PP8A 4GPAA 3R24A 4L75A 2WPDD 3AJ8A 2XTMA 3TAUA 1D6JA 2IEBA 2PK3A 4RSRA 5B36A 3PJFA 1SKYB 1MTOA 1XAJA 4F4HA 4MPJA 2OCGA 1VYUA 3FUCA 4OQLA 2PSEA 3RSOA 1D1PA 4DY6A 4YR7A 3PYLA 4WNYA 2IY8A 3NTQA 3WIEA 3H3XA 1JG2A 5ECWA 2FR8A 2H2IA 3OZSA 5K20A 1W5EA 3AOEC 1C9EA 3SBEA 4ZU6X 5AUQA 2I6QA 3ZHYA 1QHHA 1OLUB 3JQ8B 1EVQA 3I45A 4K88A 4ZMBA 5AJYA 2JLZA 4LBVA 1M6NA 1QE3A 1SD5A 1VCOA 2G9RA 4ND1A 1G5PA 1T6NA 3H9CA 1XMJA 5CLGA 3KR0A 2A57A 4I2VA 3PD0A 4JB0A 4WBNF 1ZAYA 3IPXA 2PXHA 3P0FA 4H7PA 4Y3UA 1E3WA 3F49S 3V9PA 1RFGE 4TWZA 5AJVB 2BBSA 5DTEA 2IUYA 4DDVA 3I62A 1VGRA 4K0RA 3MTIA 3GA0A 3VPSA 2NXWA 1IM2A 4MWZA 3RRYA 1KNQA 4PV7A 3EQ7A 3RVQA 3VJMA 3EFHA 3SQDA 2AN1A 4MV5A 3UKOA 2I7VA 5FO0A 2IYPA 5BSTA 2A7QA 2PSFA 1G8JA 2X2PA 4JJ6A 3K8OE 4ND3A 4WH0A 3AIIA 5J2TA 1PK8A 4YN3A 1JLKA 3EXFA 1WF3A 1RD4A 1T9GS 1VMIA 3NC0C 5JNUA 4Z1OA 3BFVA 4V3CA 2AQKA 4NCNA 1YHNA 4DV0B 2DTDA 1F38A 1DQSA 1WXWA 1SG9A 4KJXA 4PVDA 1ZK3A 1N34B 2DR2A 1V7QA 3L1KA 3GCXA 4DIOA 2EL9A 1DG9A 4ON9A 1DC4A 5J3JA 1ODTC 5DRTA 4B4OA 4JENA 3EC1A 1GQRA 2O3RA 3NBFA 3LL4A 1WSAA 3GLRA 2R7LA 1IZYA 4ZTBA 3AHHA 5B7NA 2YCLA 2VSQA 4OHCA 1G8KA 5AK4A 2BKUA 3ZDAA 4KGVA 4RJ2A 1UXGA 3QXCA 5C7YA 2C9BA 1XAGA 1QP8A 2CL5A 2GJSA 3VM6A 5JZMA 1J2TA 1GEEA 1MP0A 2WWXA 1Y1TA 1RJEA 4DNFA 2IODA 3CN9A 5JRDS 2YHIB 4URZR 1NM5C 1I32A 3AO0B 3H5AA 4XKJA 3UHPA 1YRLA 2CWWA 2WSMA 4JP1A 5IUKC 1HO3A 4GI2A 3B6KA 2VLBA 3LT0A 3ZWPA 4EHBA 2ZB4A 1XXHE 1A1SA 3OMXA 1ID8A 4EX7A 1XQYA 1IZZA 1NY5A 5IUJC 3C7DB 4LDPA 2ASVA 4HAWA 1S8OA 3IC5A 2GTIA 4Q4LA 2J5KA 2VWQA 4AIIA 2FLWA 3GD5A 5E8JA 4AW9A 3OCVA 1R0WA 5D8DA 2GTHA 3GC6A 2CD9A 1CUZA 2DCUA 4P7FA 1R4NB 3CB4A 4G0XA 5BV7A 5J2UF 1YQEA 2GD1O 3IMFA 2OFOA 1H2YA 4NEGA 5HQ3A 5L53A 4J6FA 3X1DA 4P33A 5IH7A 1NMZA 2FPGB 2GM5A 3RWOA 2RJOA 5LIPA 5EXSA 1KK2A 1XAHA 1XJCA 5BPHA 4LXGA 3PI6A 1E9DA 4NJEB 5BYAA 4JA0A 2D3WA 4CCYB 1XVIA 2WW8A 3K16A 4RXUA 4FMCF 1E1DA 2ABWA 4MKRA 1Y48E 3QVWA 1KMHA 4F2DA 4KVAA 4ERNA 5LKRA 5HTOA 2A9QA 1UMBB 2M6SA 4MS1B 1IOWA 2A9FA 1VI2A 3CUYA 4PRKA 1VA4A 2HEGA 3BN3A 1RXIA 2E5LB 2RHLA 1RQ2A 1ZGJA 3WHPA 3RTBA 1T4CA 4BUCA 2M6RA 3DD5A 3IGFA 5DSTA 1WZ2A 4BP3A 2F55A 4QGAA 3VPFA 3S1SA 4REQA 2GD2A 4UASA 3V2GA 4UTVA 1FFXB 1FBNA 2P2DA 1X1TA 5AW4A 3G7UA 5BW4A 4N48A 1JHQA 2GNPA 4B5LA 1LK5A 4P54A 4JT8A 4UUMA 2RCYA 4CCWA 4MVJA 4DA9A 4E1VA 2CHEA 1U2SA 1MB0A 3QLEA 1RWBA 1DS6A 1Z4MA 4QECA 1V4VA 2X6TA 4YJFA 3OF5A 4JYCA 1G2OA 3WMXA 3HN7A 2BGIA 4G8JA 1KYXA 2E5WA 3AW9A 4NP6A 3I01M 3K0CA 5HMLA 4BU0A 2WOJA 3EIEA 3TF5A 1DUVG 1JFVA 4MDFA 2OOSA 4HMPA 5IWAB 3TB6A 5JATA 3ERCA 2J0SA 3LVQE 1YR1A 3PUZA 4X84A 3SEZA 2UAGA 2QAGC 3V2UA 1KQPA 4Q4CA 1S2GA 3BZWA 3KQTA 4WKOA 3PDHA 5LDDC 2DEUA 3UJ9A 2FOIA 4YNBA 3L1JA 3W2EA 5DNDA 3II6X 4XE5A 4P4SB 2XDYA 1LUAA 3TSWA 4EY4A 5BSWA 1KEEA 2OORC 2GEDA 2BR5A 1YJCA 2B4AA 1PR6A 3G68A 4OHZA 3HWWA 3BJIC 4KMMA 1PR2A 2FXVA 1N2HA 1Y6JA 4YJDA 3QI7A 4GVPA 5JAQA 1WB4A 5ALYA 5DX1A 3M3DA 4E33A 5JMWA 1FBTA 1P5JA 2NPFA 3C4JA 5KU1A 1FSZA 1ZD4A 3QXSA 4NYIR 1X1AA 3CMCO 3ROQA 1ZI6A 1NT2A 2GARA 3FZQA 3HSKA 1ENZA 3B1FA 1G8SA 1R15A 2R1ZA 4BPBA 3KB2A 1RM0A 3SU8A 2IGTA 1Z83A 1XCPA 2ZAGA 3E61A 3GAFA 1PQYA 4CLXA 4Q4DA 1Q0HA 1W9HA 2L0XA 4E32A 2I76A 4X1IB 2OAEA 2EBFX 2YWJA 1B41A 4RHEA 4KXFB 4G37A 3FYTA 3PNMA 2OUIA 2C94A 1LZKA 4R2KA 1PRYA 4NBTA 4OUKX 3RARA 4BVHA 4ZZ3A 5AVXA 1OCEA 3HHPA 5C1IA 5EJAA 5KNLA 1RPNA 2GPWA 3AZQA 4KEAA 6Q21A 3ESYA 1XWWA 4PS0A 5HIKA 2X9NA 4CPDA 3LWDA 3O8BA 4DJAA 4YI5A 3ENZA 3FYSA 2IXDA 4U7HA 1I24A 3IESA 2C99A 5JANA 5KNCD 2MR5A 1E9RA 1BE1A 4RFLA 5NLLA 1P9RA 1TYDE 1TTTA 4LXUA 1RQRA 4FUTA 3P0JA 4ZFNA 2YN4A 1T8TA 3VR4A 4K9RA 1KJNA 1RR6A 1IY2A 1MJHA 3B6MA 1LU9A 2IZ0A 3HA2A 3BJRA 3I6IA 1E60A 2VO1A 4RA6B 3UT6A 1RSZA 4BLUA 2G40A 2YIJA 3TKYA 5K6AC 3T3OA 3K70C 4LHXA 1T4GA 1E77A 1XVVA 1YA8A 1MRSA 3OM1A 4WZZA 1NX6A 2Y05A 3MELA 2IDKA 3O3OB 3OOEA 4QXMA 4RSHA 4ZEXA 4FP9A 4GSLA 2WT8A 3VOBA 4P3YA 4EGCB 4MV7A 1LBTA 2XB4A 5EQJB 2GPNA 4NBNA 4D56A 3KUUA 4BN0A 4I1VA 4ZVMA 1DO2A 3UA4A 2IYZA 1AZTA 2TMDA 3LCMA 1TFRA 4PYQA 2XF8A 3RUPA 3KTOA 2WD8A 2XT9A 2WM3A 5LPNA 4ZRMA 4K9DA 4UFOA 4DMMA 1KO7A 1V5IA 1OILA 2UYHA 1OAOA 2P4SA 3H3FA 4ZANA 5F1PA 3ROGA 1SU7A 2N3ZA 1JLLA 2B7LA 4HLUA 5D01A 3PC7A 1N78A 2MHCA 2WKWA 4JH0A 2DHCA 2FEAA 4M7WA 1RC8A 2H4HA 5JC1A 4N8EA 4LFBB 3AUAA 4EFNA 4MR7B 3FDJA 4QRDA 4Z53A 2OKCA 1AA6A 2B61A 2HT6A 3SGLA 2BL4A 3O9ZA 4CJXA 5D5HA 4RORA 3F6YA 3GLSA 4MRAA 1TZKA 1IOLA 4QELA 2O9JA 4WN9A 4ZAGA 4QQRA 4P4LA 4MW1A 1PTKA 4OQZA 5C34B 1X80A 2WFLB 3JYQA 1R6UA 2PZEA 1B2LA 3NOOA 4JJAA 4ZGBA 1NSYA 3NNDA 5DXJA 2D5AA 3I6QA 4ZV4A 1N0IA 4QULA 1CR6A 3LUJA 5A7HA 1ESEA 1B7GO 5BXQC 3L7NA 3LV8A 1CDZA 2HSDA 3JRNA 4RACA 3NANA 3AETA 4P0QB 2DWOA 4QIHA 1V11B 4RABA 2IPLA 3KS9A 4UHDA 1WDWB 3UUFA 3AFIA 2XYGA 5EE9A 1DBIA 1Q1NA 4OAQA 1AG9A 4EHDA 3OLYA 1QHIA 5JMTA 2VDOB 1FDVA 4CM1A 1C0PA 4E5UA 2V55B 5HA5A 2I1WA 3SKYA 2DPXA 3D6FA 1E94E 1SAYA 3D8SA 1ISSA 3BZUA 3L0DA 4XTRA 4TWRA 3X0DA 3F96A 3EDCA 5I5GA 3TGPA 3U44B 4PRLA 1USGA 1FVFA 4F72A 3ABIA 4FNMA 1E9BA 4IXWA 4PG6A 4QE3A 3KZXA 4LZZA 3CJTA 2XMGA 3GAMA 1GITA 4LMRA 2B35A 1IQRA 2GHTA 4ZQCB 4BLQA 1T35A 2XAUA 1J21A 1VHDA 3K5IA 3ETHA 3FA2A 3CLUD 2H4ZA 3AY3A 1FNCA 3PA6A 4M88A 1FUIA 3ADKA 1Z0KA 1V8ZA 4CM5A 1D2AA 3RAEC 1KEZA 1R2QA 1JDPA 4X92A 2RAPA 5F2EA 3S2UA 3U48A 1WMBA 3UJNA 4QJ4A 1JQAA 4MMZB 1PDVA 2NVWA 2D5CA 1NBEA 4PANA 3NT5A 4QPNA 5A6SB 1SHZA 4LGVA 1Z73A 1N2CB 1PKEA 1YZUA 3B1KA 3NKFA 3OBIA 4I19A 4KPUA 4N12A 4WLNA 4GXNA 1T3TA 1U8AA 4FWBA 1XZEA 3RFTA 2XB9A 1EUZA 4JI8B 4CLHA 4AXBA 4FYVA 4NJMB 4NYMQ 4L5CA 3T99A 3GJ7A 1FDSA 1FUKA 4OYRA 3MIIA 2AG1A 3WIOA 4A03A 3WLQA 3B78A 4UE2A 3TIGA 3UAGA 2CJXA 5KOHA 2ZRHA 2ZRPA 2O59A 4IF6A 4IPTA 2PZKA 4QNMA 3ZVRA 3NQ41 3HU5A 1RFLA 1SUPA 4AO8A 2I7TA 2XUHA 4YQEA 3K1JA 2IDJA 3N6XA 2XZDA 1QMGA 4C6RA 2CDBA 3Q7RA 3C1UA 3ORSA 4J49A 4IILA 4JV5B 5LB2A 5DIZA 4X44A 4D8WA 1U7XA 4MQ4A 3WL6A 3CNNA 2OHGA 3S6JA 1KARA 2OGSA 1CUSA 2DT8A 4IIJB 1AO0A 4CM4A 4MQBA 5IT0A 1YDFA 1ISPA 3K2QA 4D6YA 4JB2A 1DAKA 4KXQA 1QCCA 1DJPA 5CIQA 5CVTA 2EV9A 3LQYA 4MS3A 1W0JD 3V8VA 3P19A 1YZYA 4IQ4A 1ECPA 1YKGA 2P9ZA 4R1SA 2GRJA 1F14A 3D3EA 1ZGCA 2DPGA 4LE1A 4J0QA 1VLLA 3UJDA 1G8YA 1H5QA 1RABA 3HNOA 2IV7A 5U1PA 2JGDA 3ESBA 3FI0A 4JBHA 5DHPA 1U2GC 4IH1A 1I3KA 3PHIA 1MRNA 5F1KA 3ZE2B 2HHJA 3FI9A 3ZNPA 4DUGD 5J1TB 1UPXA 2DMRA 2C9YA 1N6HA 2VP9A 3HP4A 4RFVA 3F97A 1AZSC 5TPWA 1UPTA 2CLCX 3FVWA 3PXDA 3GEGA 3VZRA 2BLNA 5E3JA 1SC6A 4R0NA 4BKQA 3PHJA 4FWTA 3Q5EA 2ZIXB 3RB8A 5K4AA 2PH1A 3OJCA 3B1YA 3A3KA 3I83A 4RZUA 1ZFNA 3TXAA 1VJDA 1SC9A 5GGXA 5M3BA 1I0IA 1BXRA 1H4TA 3WLEA 1BMFA 2XRYA 2JAHA 4WK2B 3E2PA 4LY9A 1Q57A 2C0CA 3O8LA 4QGHA 3QA3E 4HPJB 2G04A 1LNQA 2IY9A 3A8TA 2QAIA 3NTXA 1L5KA 2QP4A 1CPYA 3JQCA 3ICQB 4F3NA 4KYTA 1BE0A 1P5ZB 4NATA 3SK0A 3N86A 4IGFA 3FPLA 1NC3A 3D8HA 2ZRDA 1RRFA 2WIKA 3W5CA 4Q7EA 4BP9A 1V6CA 2BUCA 1O9BA 4O4JB 5BUCA 1I4TD 1FNDA 4N3AA 5E8RA 1OTHA 1NOJA 3WAKA 5CT6A 3WLPA 4B7UA 4OREX 4B3FX 1P33A 3W5DA 1LSSA 3DH0A 3FUWA 3I30X 2CF5A 4LY3A 5CHYA 3BDVA 3WK7A 4DG8A 3NBAA 3GLHE 5GQSA 4KRFA 4L74A 4EYKA 4XCXA 4KQHA 2NU6B 3EGEA 1Y4SA 4GLFA 8ABPA 3TDMA 2VJPA 1F1JA 3TQCA 2J3KA 1UJ6A 3W7VA 4DAEA 2QU8A 5LP6A 2IC5A 2YYAA 3ZE7A 2ARKA 2I6UA 4MIEA 4P22A 3IQZA 1XIVA 4Q3EA 3WGHA 3TQFA 4YASA 1X80B 2X14A 2ZIUB 2GN1A 3IIEA 1ESNA 4F1WA 3AJEA 3ER8A 2PD3A 2ACEA 5K05A 1E58A 1UBRS 4JJ4A 4B82A 2FEPA 4HS4A 3E1SA 1ZJ4A 5GONB 4BO8A 5I7WA 5EXEA 1LPPA 3X1KA 5JISA 2MSLA 5LQDA 1VJTA 2MWMA 1OAKA 3PGLA 1U3WA 1XQXA 4JGGA 3JV7A 4MVJH 1ZJ6A 3PG5A 5E4TA 2H11A 4GP6A 2FKAA 1NP6A 2JANA 2RK4A 4YCDA 2GXUA 2YUIA 3BDAA 4YQFA 5IJWA 5EHQA 4NZMA 1P19A 1QYXA 2B3DA 1U28C 4HAUA 2PFGA 2RG1A 4FCVA 3QM1A 1R5BA 3VYUB 1S7GA 2Y2UA 1KJ9A 1SVMA 2YMMA 1WPQA 1ZNWA 4ZARA 3SZMA 5BN5B 1S01A 1FNSA 1XDDA 5CJ2A 5G1OA 2P9FA 3BF7A 5E9QA 3HACA 3OG9A 4I8XA 1P73A 1NLMA 1QVWA 1CERA 1HF3A 4IF4A 4GP9A 4RTQA 3IOYA 1ZYUA 4TL8A 5CA1A 5A71A 5I7VA 1ZHHA 1PQUA 4EL0A 3SLRA 5JSZB 3QOYA 2F62A 4MHOA 1YCGA 3DBHA 3MQ4A 4MYTA 1KETA 3E22B 1B8VA 2HYDA 3GJ3A 1KERA 3LOPA 4OXRA 4DZRA 3F6SA 4FDVA 4Q93A 4RVGA 1ZJYA 4NCKA 3A14A 3OMLA 3CVUA 2IX9A 1HV8A 2ECQA 2IZ6A 2RFLA 2PVPA 4ISCA 1N6NA 4WW0A 4YJGA 4HJRA 1U7TA 2VF8A 3VNQA 5B3AA 5KHOC 3VMFA 4EGSA 1EFDN 4RDCA 1NQWA 1P2FA 3GPBA 2GUWA 4LY0A 5JW6A 2BGGA 3AYZB 2BFCB 1UKYA 4KPYA 5IHXA 1ORDA 3QV1A 3CUUA 4FBGA 4D5GA 3PL5A 2PMBA 5YASA 4LEIA 1D0VA 1YRAA 3RSZA 1GCAA 1OYVA 4BNVA 3S5JA 1M7GA 4NECA 1BGVA 5CEEA 1WCXA 2OBLA 4G0UA 2IOHA 1ZS9A 3RSGA 4MR9A 3U5ZB 2WWGA 1NV9A 3OUZA 3LPCA 2V5AA 4MLPA 3DL2A 4QPJC 2AOUB 1EA5A 2H06A 3SICE 4J0EA 3LKVA 3D4BA 3OZVA 4B6JA 1OV4A 1RT9A 2J48A 2VPXA 2ODWA 1YUNA 2NQTA 3FG9A 2RAUA 2CYBA 5K3FA 4ASUD 1X9GA 1AD2A 1Z15A 3VZPA 3RRXA 5LOVF 2IHNA 3DBIA 1ZUHA 2EX4A 4KR2A 4MLCA 2R2AA 3A3OA 5LDHA 1ZIOA 1I2CA 1I10A 1PL0A 3CLTC 4LSZA 3IFSA 4ZVPA 1WPGA 1KI1A 2JGNA 4TL6A 1Q3KA 4UHBA 1GGJA 4MS3B 1OBVA 2ETVA 2WYWA 1RAIA 3BXHA 3TBKA 4FHGA 3SS7X 2BEKA 4G8DA 3QNUA 2PX4A 2BH9A 4JGIA 2ZJ5A 1IHYA 3NDJA 2NO4A 4UATA 1NT4A 2PJDA 3EUFA 3F74A 4ZVTA 3RREA 3RT1A 4DGSA 4Z51A 3NBZC 5JT1A 5T41A 4II2A 3HADA 1J8QA 3U1TA 5CD9A 4HDRA 4RWEA 5CH5A 4BZXA 1U0GA 3VHXB 2B5WA 1KFJB 2FMIA 1Y5IA 3NTUA 3ZY4A 2C2OA 3L4JA 4MUXA 3IOCA 1V3UA 4RJIA 1VG8A 2VDJA 5DYNA 1FJHA 1PBTA 3I9JA 3U1BA 2JFPA 2ZP1A 3ZWVA 2ZRAA 4Q6BA 3T06B 5KNCH 3MD0A 2Q8NA 1NURA 1KZ7B 1H6DA 3H04A 2D7CA 3NG1A 2CV0A 4JUBA 2E5FA 5E6SB 4F11A 3OIWA 1UBUS 1BE6A 2WT9A 2MT9A 3ZY6A 2FFJA 1I5EA 3I2JA 3L7MA 5G4KB 3QEBZ 1WY7A 1N6PA 3O82A 3K9QO 4IM7A 1MLDA 3BICA 5LLTA 1D7AA 1NBOA 2GVDC 2ZM5A 4MI9A 2W4QA 2A4KA 3D0QA 3I1FA 1R16A 4IDDA 1EUCB 1STOA 3ICOA 2BOVA 4YRLA 3TIVA 4EA8A 1N5IA 1RKXA 1UK6A 1Z88A 3EFBA 5LOVA 1O94A 2PL5A 3N59A 4TV8B 2Z3VA 2O8DA 3KDAA 4FHZA 1KI3A 1GKIA 2JGMA 1IK6A 1U0TA 3IBCA 4R2HA 4V03A 1RPJA 2X77A 3EB9A 3R7DA 1PK9A 5TS3A 4CGYA 4IJMA 4MJXA 3ICWA 1I1QB 1I80A 3QA9A 4EG0A 1XKQA 2FVYA 3CUTA 5D3MB 1XG5A 5FOUA 4C4AA 3KJGA 1F8FA 2XUAA 4RBNA 2ONJA 2PGNA 2N1MA 1IZ7A 3OPXA 1KAEA 3QYJA 1NI5A 2Q0SA 4ZI7B 2ES4A 3UMFA 4DQDA 3KCQA 1W76A 3DE0X 3MGGA 4X24A 3VPAA 2O3SA 1EK5A 2HH9A 2OHHA 2M6KA 4EG4A 1FMJA 1BGXT 3ZE9A 1XE3A 4GICA 4L8GA 3LCUA 5DWQA 2F8LA 3N2GB 1TYBE 1IBCA 1J5EB 3I1JA 4N54A 5FBLB 3EG9A 3MWLA 3GLHA 4QU8A 1SMKA 3O92A 4FTWA 4NDNE 1QB7A 5JO0A 1CRLA 1QGZA 1DBRA 2Q3DA 2VP2A 1TT7A 3MAJA 4JLOA 4DCGA 9ABPA 2QD2A 2C07A 3B2NA 2PCLA 1TRKA 4OQPA 4XPIA 3EHDA 4DRXA 5K3FB 5GP1A 4HNUA 2EFGA 2PBZA 1CK4A 1YDHA 1B6GA 1TM2A 2CMFA 2J9ZB 4C4YA 1T2FA 4YI3A 2BAGA 2AG6A 4OL9A 3ZGOA 1V1RA 3FKQA 3QKTA 3SC4A 2W48A 1XA4A 3DA8A 1U9JA 1QTNA 4URHA 2XW6A 2HF7A 1QH0A 1H8ED 1W49A 2VDLB 3OAAD 4HPXB 4INZA 1V1JA 3HDHA 1VKJA 4GGMX 1PFWA 4G1VA 4DPMA 2ZU0C 3AVVA 4X90A 5CMLA 1KOGA 1FLAA 2R8ZA 1K3UB 3JQ7A 1DE0A 4HDNA 2CV2A 2G67A 3S2EA 3U09A 1IFXA 4TMVA 3BYZA 5FLXA 2B36A 4KN6A 3VU9A 3ZHBA 3DCYA 3OFKA 4KFRA 1WSDA 4Q05A 1XD9A 1R8XA 4TGLA 2WD7A 5C8XA 4ZVNA 3W9UA 1AU9A 1Z47A 1CLUA 1DUIA 2ZGVA 3AVPA 3H4TA 3NEYA 4IICA 4XB6B 2ZUDA 1MPTA 2EP7A 1XELA 4C2AA 1RYFA 4BB5A 1TKCA 2FZLA 1USUA 2Q2VA 5MHTA 1NVTA 3K6RA 1O95D 3D4OA 1E1QA 4CWAA 4RTLA 4BQIA 1APBA 3NDRA 1C0LA 2BF4A 5FB3A 1RJGA 5AI4A 2ATEA 2JGIA 3BGSA 3G1TA 4EZBA 3TO5A 1L8LA 3BX1A 4ARVA 4E22A 4XM2A 5H5JA 5JR3A 1MABA 3NEAA 4WLOA 4G5HA 1LI7A 5FI3A 1ORIA 2OB1A 2XMCA 1T3SA 1WVIA 3FCAA 1ENPA 3LZDA 3PCXA 5CTAA 1JG7A 1OXXK 2D0DA 3Q5DA 4YQZA 5HF6A 1K97A 1NP7A 3JD3A 3KSRA 4CG3A 5LP6F 1ATIA 3EA4A 4IIHA 1BVUA 1K0FA 2W6JD 5FO1A 3TX6A 5K3EA 1DSSG 2ZRMA 5FNVB 3OLWA 5DBIA 5IZCA 1TVCA 3NX4A 5FBVB 1EZ1A 5JQWA 1XCBA 2AN3A 4DMGA 1VZ3A 1B26A 2I4RA 3V00A 3TMKA 5C1DA 2I7XA 2QEQA 2Y0EA 4REMA 1T2AA 3BQMB 4Y8VA 3P0IA 3DS8A 5KPJA 3C74A 4KFUA 3MINB 4ZOEA 3LW8A 1SXPA 3VSCA 1CUVA 3AL2A 3MTJA 3QNMA 5KCZA 1R8YA 1EA7A 3Q8WA 1YZQA 3EFOA 3PTAA 2EW1A 3RTGA 4P4GA 3CNHA 5FWDA 1BYIA 2J46A 5GY7A 2C8LA 1NFQA 2IA5A 3HKDB 3N2NA 1ZGZA 3RTEA 4J16A 3F7TA 2HTEA 3AT1A 5AKXA 2GM3A 2HWXA 4HN4B 3WGYA 4ZO9A 4Z9BA 3T7SA 3BHJA 2FCAA 4K1XA 3OOSA 1JVNA 1QP4A 5HRCA 4MAFA 1GILA 4FOSA 3EFOB 4PLHA 5DO9A 2I4OA 3RC3A 4MTLA 3A4YA 3PITA 4JLWA 1L5RA 3HCOA 3FFXA 3KKZA 5B3JC 2IHZA 4XJSA 1AHIA 3QX8A 6CHYA 4JIMA 2Q3HA 4PGGA 5LA6A 2JA2A 1U2EA 4MUHA 4B4UA 3A4VA 2OESA 6YASA 1BWPA 4KKXB 3CY6A 4J03A 4M6WA 4IDFA 4WNIA 5P21A 2M98A 1WW2A 3BH7A 4EKNB 5KTOA 5KYGA 1P6XA 2JCBA 1SU4A 2OBNA 3L9XA 4QDOA 2VA8A 3ZI4A 5AW1A 1Z0SA 2H2FA 2JFWA 1UC4B 2W7TA 3ABQB 4XARA 1XMQB 1L8XA 1ZXXA 3LM8A 5E2BA 3IX7A 2RHWA 3SJ7A 2SCUB 3OIUA 3E7DA 3IVCA 4BC1A 4LRTB 4ENQA 3CEMA 3G6KA 2F3PA 4DIKA 2QX4A 3C1OA 4A73A 2C20A 2QZPA 3ELYA 4LWZA 3IODA 3HKCA 3ZNOA 4Z4EA 2AL7A 4HFMA 3WMGA 1N2JA 2C4WA 2RIPA 4FNGA 4WI1A 3HCDA 4G0PA 4Q19A 3DV9A 1NLZA 2E85A 3NORA 4YRSA 5IW8A 3RBVA 1OFTA 3OZEA 4HUQA 3ZWBA 4YX9A 5B3KA 3A4NA 4MPDA 3MOGA 4MV6A 2VATA 4QPPA 3TD9A 4DWJA 4IGKA 4PG8A 3E9DA 3P1JA 4EHIA 4PBTA 1UFRA 4WKBA 3UT5A 1MZPA 3DONA 3KK0A 3Q3JB 3T5AA 1GN8A 2Q6VA 2R6DA 5K51A 4BKOA 4ZDIA 2AN5A 4CR6A 2Y67A 4I8DA 3QJYA 1JSXA 3IP6A 5IC5A 1BFKA 4DREA 1AKTA 4RTPA 4OJTA 4MWGA 3DD1A 3UZUA 4A26A 4JJIA 2O8BA 3UO8B 2Q6LA 4U9IS 4AECA 4B44A 2Q49A 2O1SA 1KZHA 2AS0A 3OLZA 4G5XA 2HSGA 3DW3X 2CXUA 2P2SA 3WV4A 2VHQA 1H9AA 2BP7B 3ANMA 1SWVA 2CLDX 3LL7A 3TPFA 3F3YA 2JBAA 2QN7A 2PXXA 2Y1XA 3BE6A 3G2PA 3IT3A 3QXGA 2GVZC 2F8MA 4HWOA 4IJKA 3UKDA 4BNZA 5AUOB 5D51S 1NMSA 2I0FA 4B85A 5A6VA 4DCNA 3I37X 4HAVA 3L84A 3U37A 2JIQA 1GZ3A 3CUWA 3JATB 1JKXA 1WHSA 2B0JA 3OWHA 2P1ZA 1ZLXA 4JP3A 3V4LA 1K4YA 4XDYA 3ZWYA 4IFIA 3GL9A 2R6JA 2YZ2A 1FDTA 2A5LA 4K6CA 1ZK0A 3H2ZA 1N57A 2PWYA 4ZA2A 1NVBA 5FQOA 3HKDA 2IUFA 2VSFA 5JQGF 3QKSB 3Q9LA 4GOXA 2BFBB 2GXSA 3MS2A 3OZIA 4HNAA 3DWFA 4GMFA 2Q0XA 4NL4H 4G5FA 5LYYA 1KAOA 1RLMA 1A8SA 1H05A 3CF4G 3MS7A 4M1ZA 4UTZA 2EWWA 3C1AA 4PX3A 3U7QA 4BZPA 3QK7A 3BMNA 2E0IA 4F9TA 4BB6A 5JNVA 1AKVA 3IP7A 1X7HA 4MRMB 1L7MA 1JQDA 3IRUA 4N4AA 2CLIB 2F3TA 3FVRA 4KO1S 1PN3A 4IOLA 1UOEA 4XGQA 4B17A 4Z1MA 5HCUA 4NLLA 2H57A 1Z0UA 2P65A 1F6BA 2ON6A 3FDZB 4Y9DA 1ULZA 5DHFA 4DLVA 3TD6A 1THMA 3L46A 2WJJA 2ZAIA 5EZYA 1DBSA 3E3NA 3TEJA 3IMKA 1XZBA 5I4CA 2DQZA 1L5FA 3HY4A 4YT5A 1S02A 1O97D 3L77A 4RKEA 2B1JA 2D8MA 3B6JA 3ZE6A 3LZCA 1XAIA 1ITZA 2GD6A 2D1QA 3X2SA 1V0JA 3R5XA 5KQRA 2BTEA 4UUPA 1JAIA 1Z35A 3TVDA 2G0TA 4JUIA 1WP9A 1Z34A 4YJHA 1Z13A 3DDSA 4YAKA 4G67A 5J2UB 1IB0A 4XVUA 1GM5A 1P8JA 2ADOA 2EEZA 2XOXA 4HMQA 2WB2A 4A0FA 5CB4A 1TF2A 2VPTA 1YS1X 4J1TC 1V25A 5FPHA 1EJ0A 2QF7A 1P4GA 2YJZA 3KKEA 4YP6A 1XT6A 3RUEA 4DW8A 1JLHA 3VYSB 3B53X 4Q7QA 1QZXA 1KS9A 2WZBA 3IOMA 4I1RA 5T8KC 1KZGB 2XNCA 3MCTA 4WSOA 3TCNA 3V32A 2JFVA 1XCJA 5DE3A 3WP0A 3KTAA 4ZU1X 3T8YA 4AY5A 1CNEA 1PR5A 1Q74A 2NG1A 1F12A 4ZVOA 2EW2A 2IZOA 3GLFE 2OXRA 3C8DA 2E1RA 3AR5A 4WL0A 1HTWA 2C9ZA 3MAGA 3TPZA 4KBYA 2O2SA 3KRTA 1XRLA 3KE9A 2WIGA 4AY3A 1DC8A 1D3AA 2H59A 2LUOA 3NWBA 3JR7A 1LLDA 2PYDA 4G09A 3A1CA 4KLRA 4AJ9A 4CCYA 2J6HA 4H77A 4JGBA 3KZKA 4JVSB 2P6MA 3SBXA 4B43A 3G59A 1L7OA 1NJ6A 4BATA 2PJZA 4PXAA 1LTQA 3CW9A 2NU8A 1WZNA 5BV8A 3MUEA 4OGWA 3WFJA 5IM4F 4AP6A 3S8YA 4ZK6A 4MMYB 5JALA 1QX3A 2W2XA 4EAQA 1KH2A 1QPBA 2FZCA 3NYIA 4BYGA 3ZQJA 1ZGHA 4Y9SA 3ZCTA 1GL7A 1SXJE 5DBHX 4DF3A 3H4MA 5FADA 5CURA 1FJ2A 1XLUA 2QM7A 2XVXA 1VLMA 5CDHA 1IHOA 4UU1A 3SY8A 5EWLA 3S4YA 4AJNA 5JNLA 3FHCB 3GUVA 5KYVA 1VJ1A 4FGWA 2ZBEA 5KWJA 1ZOIA 3ZHVA 3Q3HA 4O2LA 2JJYA 5KTRA 1MOZA 3QVJA 5L51A 1JP7A 3TIFA 1OIXA 2VWPA 2O7VA 4WAUA 5THKA 4D7AA 2RC5A 3I6YA 2DPLA 5IBPA 4CEHB 2JB9A 3VKWA 4XEUA 1SBTA 2AEEA 3IUEA 4NONA 3KQUA 4M0EA 1GHTA 2IPOA 3RFVA 2HHCA 2W93A 4R2LA 3BTOA 4NNJA 4G0WA 4KBFA 1XTKA 3LBFA 1U81A 3GFPA 4W5HA 4KU4A 4C04A 3PEWA 4UQOA 4BMVA 2H2HA 1C7ZA 1EHCA 2W6ID 3PWTA 2FHSA 1WCWA 4TZTA 2CZCA 3R7WA 4CYMA 1YOVA 2IS2A 1I6MA 1K2VN 2P67A 2R4TA 2QW8A 4FWIB 4YR9A 4O2BF 4TTVA 1M7BA 5EOVA 4US0R 4IRXA 1U4SA 3R5SA 4KQXA 3KVOA 4UCQA 1HFWA 2AKAB 3WGGA 3ZHTA 4KAFA 2SKCA 3OLVA 4DM3A 1AF4A 1MJ5A 2G8LA 2GN8A 3C6ZA 1XTIA 1HG1A 3AG5A 5IM4A 3OF3A 1FFWA 4U6SA 4X5OA 3MIZA 2OLEA 3FMOB 1RXUA 4KI7A 1SKAA 1RWOA 3E8XA 4TTJA 2VP6A 2FPMA 1PZNA 3I9V6 5TMDA 3HKBA 2NZ8A 3AJDA 1FNNA 1QGDA 1ZZGA 2IXGA 3RIGA 1U4NA 3TNFA 1ZGAA 4MQEA 1E92A 1V5GA 1WWKA 4JLDA 1T9GR 1IJBA 5COQA 3D59A 5DOVA 4N9QA 2EVWX 3GARA 1AKEA 1NVMB 1PZFA 2AOVA 2B20A 1Q7GA 3GDOA 4MB6A 4CHTA 5JAMA 4LV8B 1EFPB 1LJLA 1W0KD 3IT1A 4FKMA 4KK4A 1FUUA 4KQWA 4BGUA 5JS7A 3W8FA 1FYEA 1P9WA 3I2FA 4HOYA 4YV2A 2XWJI 1OWOA 2HGSA 1PGOA 2YRXA 2XLBA 3B7WA 3GJQA 3IUSA 3JQAB 1ZJJA 5EQFA 3VYRB 2Z2XA 3PUYA 4A0HA 2BDUA 2V54A 3JYOA 4H7KA 5LUAA 3TW6A 4RKRA 2Y0CA 3BD7A 3UGQA 3RIHA 1ZG3A 1J09A 3E9EA 3UQYS 3P96A 2VXCA 4RNCA 1HE8B 3IPAA 2H1CA 3EVTA 1D6NA 2IF2A 1TAUA 3OT1B 4IGEA 5E1MA 4LHEA 2HMUA 3GRKA 3RAJA 3ZOZA 5JU6A 2A6PA 2IU4A 1N2BA 2IYOA 4FD3A 4O2BA 4R3WA 4XJVA 1HBJA 4WFQA 1D6SA 1JEOA 4Y6LA 4YJ3F 1Z29A 5DEIA 1PWXA 3NJRA 4Q1CA 3UW3A 4YRBA 5L6LB 1K6XA 2X40A 3PCRB 4RVFA 3D7RA 1TVMA 1TYEB 1QONA 1U2DA 3TLZA 3NDIA 1NJ5A 3EPLA 5H0IA 5I7EA 5GJBA 3GUYA 2EHDA 3QZUA 4PRYA 1I7PA 1EUQA 1VYVA 1RI2A 2QR3A 3L8MA 3WX0A 1I0LA 3H0CA 1PWZA 1RWMA 2WD7B 4G0QA 4OUDB 4B4VA 4D8VA 3JZMA 1ULHA 4D9NA 2V6BA 2G08A 1UODA 2XPCA 2CNWA 1H2ZA 3PXBA 1R6AA 3DJYA 3L6RA 4CEHA 3I64A 2CXQA 5ECDA 2OYCA 2A8YA 3CCFA 2Z2KA 3S2GA 5I01A 2PT7A 1BYUA 2KE5A 3A6JA 1TJ3A 3NHWA 4RPHA 2XY4A 2AUTA 1UJ4A 3GN2A 1QVAA 1XOIA 4EJFA 1T9ZA 2GHRA 4KBGA 3HZHA 1NVAA 3FOEC 4Z9AA 2FPUA 2WYUA 4JOQA 3F0TA 2OBXA 1TLFA 4Y2SA 4CHGA 3IDZA 4EA7A 4LRUA 1DKNA 3PVCA 5JD5A 4JAVC 4JMLA 4OP2A 4ZJZA 2I65A 3ANLA 1SZPA 4A6EA 5FUXA 2FMTA 3FSGA 2HHAA 3QELA 4LHSA 4KDEA 5EMKA 3OE5A 5F78A 2JJQA 3MZ0A 3GGPA 1HYBA 3MSXA 2IS6A 2DBRA 2K6GA 3ASYA 4O4LA 1XZIA 3LQ4A 2ZJ0A 3CLSD 2OV1A 1E6MA 3FTEA 5IC6A 3OFVA 5JNWA 3K0AB 3UPTA 3FNBA 2OFPA 1V8PA 4IVPA 4P3OA 2A9KA 2CXXA 4WA7A 1XX6A 3IUJA 3AVTA 4HGZA 2A88A 4C2TA 4X60A 3BBLA 4CTMA 2BHSA 2CF6A 1IZ0A 1E20A 1PR4A 1AGNA 5G4LA 5IKEA 4CI9A 1II8B 1RE1A 2XT6A 2AQ8A 1IQUA 3I04A 3A28A 2L69A 3DE5X 4KWIA 4DV1B 2NO9A 2TYSB 3DM9B 2ZCVA 2RK6A 3M34A 1WMEA 4FYWA 4K6GA 3M49A 1KDOA 4OXNA 4M87A 5EHGA 4IIFA 1DXHA 1O94D 2PGLA 4B74A 4G01B 3AG6A 4AJHA 3MD9A 1FW8A 4WBNA 1L6RA 2RGEA 3N3BC 3N8GA 5F5NA 1C9NA 3UPDA 2C4VA 3RLIA 1O9GA 2YY6A 2FMUA 3JVEA 2G0NA 1WXQA 1KVTA 3GHYA 5FLKA 4GRIA 4GOJA 5HFAA 3DOJA 3GYGA 5K8UA 1KGSA 1FE8A 1QZ3A 3LC0A 3N05A 4GMXA 3UMRA 2R6GA 4MAMA 3GRUA 1PJSA 4G5OA 3GRZA 4BMCA 4U6NA 5HXAA 3CF4A 3KIPA 3IAS6 4URWR 4XGIA 1KSFX 5EFOA 1TADA 4YYEA 1MN6A 1U5BB 2HCJB 4RK0A 1J7JA 2GRUA 2XA1A 3D0KA 4ALJA 4CUKA 2X8AA 4EG7A 5BSKA 2INGX 1O97C 3GDWA 4BDTA 4JXKA 4BOYA 3PR1A 4AX8A 1VLHA 2O0JA 2Y1OA 4JT9A 4KV7A 3OZBA 2C3PA 2ZDHA 2AVNA 4LY6A 4NBVA 5BRNA 5CR9A 1ZM2A 3SQMA 1YCDA 3CPSA 4LGYA 1QHSA 1Z5OA 3W1VA 3GJYA 4PTYA 4IMRA 1TM7E 3MERA 4IDCA 5FPPA 4PGFA 5DTJA 4C4OA 1P1BA 2QRLA 4AMZA 2VAMA 2ZSKA 1IBKB 3O8CA 1PT5A 1D7OA 1U8YA 1UC9A 1T36A 2BJHA 2JGFA 4BVAA 2IS1A 4V1CA 3IPYA 3IQHX 4C7BA 3QE2A 2G1JA 4MVCA 3MTDA 3UXHA 4UTRA 1JDTA 1QFYA 4CMHA 3B5IA 1GNPA 1UFKA 2PQ6A 3HSSA 3RT9A 3D43A 4ENRA 3CQ9A 2QTAA 5JPIA 1KS2A 3E7FA 3FOWA 1KY3A 2F17A 4FOPA 2PV0A 5B58C 1RLJA 1MOQA 3TM5A 4A8JC 2P8SA 4UBNA 4LF8B 1PTJC 5ITVA 5G0WA 1WZCA 2A1UB 1IXKA 1WL8A 4ZT3A 5T6MA 4P3KA 1FFHA 1UC5B 1Y8QA 2BEVB 5AK5A 4OHMA 3UAXA 3CBGA 4F7DA 2CFIA 4FFLA 1NYRA 2JFNA 4K3UA 2EF1A 2ZAOA 5GJWC 2QNBA 2ZQYA 1U6JA 4FGLA 2RGXA 3VAZA 4MUGA 1PJAA 3VJLA 4AKTA 3QEOA 2Q3LA 5I3ZA 3TVTA 4YP0A 4RWZA 4CVNA 5KO2A 4F9EA 4KAAA 4P38A 4YFYA 3SBDA 2YFHA 3SQWA 1VE5A 3CN7A 4WLFA 1QU3A 3P4UA 1A5ZA 3CYFA 2Q5QA 3PPYA 4I14A 2IYTA 4J7UA 4FQ8A 4KGXA 2BP7A 3FKSA 1M8FA 1IBRA 4M1OA 3DDWA 3VHRA 5SY4A 3TCXB 3E5NA 1Z62A 3FAZA 5FORA 3K9FC 4XOIA 1DCFA 1AQUA 3DM5A 4RZ2A 4QHYA 1OZ0A 2C00A 2V59A 1FXWF 3AONB 1Q6ZA 1L9KA 3Q2IA 2WUEA 1J2YA 3AERA 4ND4A 4PHHA 1GWNA 2RGCA 3JD2A 2HA4A 4YUYA 4YO7A 1ABFA 1H22A 3LY7A 3TTXA 1H8EA 3OAAA 1F2UB 1G60A 1T5OA 2FY8A 3BBPA 4Q4AB 1VKZA 1VE1A 1T24A 3ESZA 4YUAA 4D9HA 3FZGA 3HYRA 3OE7A 3VBCA 2HUNA 3A37A 2CUTA 2JLSA 3AEYA 3X2EA 3FKSD 4ZQHA 3CRRA 1SURA 4EYQA 3AU8A 1XRPA 2YC2C 3E9CA 2Q2OA 3L6EA 1H3NA 3NBMA 4G4IA 2OAGA 1D0SA 1Z7EA 3VAAA 4DHEA 2FEKA 3WZMA 3BXPA 2F9MA 3I01A 3VKUA 2Z04A 5HF9A 3AI7A 5BN3A 4OA5A 4QWMA 1E3WB 1DV1A 2QLTA 4CKWA 4B7ZA 1QZUA 1HOXA 5CLFA 3DOEA 5CK4A 4POOA 3OQIB 5KTTA 1OLSA 1G9TA 5CDFE 3RSCA 5BQ5A 4JKYA 2Q7XA 1UBLS 4LYAA 4D79A 4QBKA 5C8ZA 2XUDA 3ETCA 2XCRB 4E5NA 5BSUA 1SVKA 2CDAA 1FP7A 3AZOA 3MJVA 3AY0A 1SUAA 1OOEA 4XXHA 4HI0E 4DCUA 3QELB 4N0DA 4J0HA 2NUAA 3JATA 1Q83A 3ZCVA 4Z3OA 3O47A 4X3CA 1BMQA 2O2GA 2W37A 1HWYA 1PFQA 3IVRA 5IAEA 2C7QA 3CH6A 3L8ZA 5FPQA 4FZVA 4PONA 1FSGA 3JQ9A 3LLMA 4QL3A 4AP9A 4DHWA 1OA1A 1WM1A 4LV5B 5KQPA 5EWJB 2JBAB 3AVWA 3WGMA 3LNCA 3NUZA 3ZIAA 2VC2B 2IFTA 5I45A 2QV0A 3QMMA 4CQMB 1BKSB 1PL8A 3EN0A 3KO8A 5CU7A 2J7PA 3T1OA 3RFFA 4MS4A 4C43A 2GAAA 3IJPA 1Y1PA 3GGSA 1XNGA 1FUYB 2ZWOA 2Q3EA 4KIUA 3WLAA 3ZTYA 5FUWA 1CFJA 4GBMA 5L3QA 1XU7A 5I7RA 3PRYA 1MRZA 4LTMA 5JMPA 1TUBB 4CDNA 1Z5ZA 2NZXA 2WMNB 3QHAA 1MVLA 3U3OA 3UANA 2C77A 1QANA 1VG0B 4YT2A 3WRYC 1RKUA 1DAMA 3VV2A 5JCOC 3ADCA 3ZKWB 2Q9AA 4KIGA 4NU8X 1UK8A 2DKFA 4H31A 2R0QC 3DKRA 1KXJA 2IP1A 2SECE 4QOGA 1GZ5A 3EXG1 4MV1A 1GARA 4IMPA 1DEHA 1DG3A 2IEYA 5H59A 3IUNA 3VZSA 4G5YA 1T26A 1CVRA 4I2NA 5ILQA 1N5OX 4H4EA 1KMIY 1H93A 3F5SA 4HBZA 4W9RA 3IO3A 4FZJA 2H1FA 3GBVA 2ZTHA 3HXLA 2BMEA 2G07A 1J1UA 3Q6MA 4B6QA 3F73A 4JVOA 3WL3A 2VUTA 4N82A 2D3TA 3CR3C 2JFHA 2NV6A 5TJHA 3NATA 4IXDA 5DB4A 4ZWNA 1OLSB 4MVJF 1Z2OX 4HB3A 3WLNA 1V37A 3A6LA 4Z9YA 4YT4A 1JHAA 4H3KB 1QH1A 2GWHA 1RM5A 4KOEC 5A03A 1QG2A 1P72A 1TT5A 1ZRHA 2CBXA 1AS2A 3X44A 3BKXA 3IJ5A 1E0KA 4P4TA 2ZBPA 3HJHA 4O3FA 4CLOA 4ZVSA 3U3RA 3WIVA 3U3MA 1Q20A 3RW9A 3X1ZA 1NQOA 2R3SA 4JP5A 3H5TA 2VIIA 2R8PA 3F3MA 3KL2A 3R5TA 5ICEA 2A94A 2V45A 3C15C 5KNBA 5JTTA 4I3GA 3WOHA 4JN6B 4KQGA 1C1HA 3RRBA 1GQQA 2KMLA 2IOYA 5LDGA 3ASUA 2XJ4A 2IPAB 4MQEB 2VNIA 3VH2A 1JIUA 4IDNA 2P4HX 3COJA 3QVTA 2V4MA 3GJ6A 3I6BA 1IEWA 3MRTA 3OPNA 5JOQA 2OORA 3ACBA 1NYLA 3B8EA 3OCYA 4KQ1A 5A4JA 4ARZB 1UDXA 1C7QA 1ZNYA 4L16A 4TV8F 1FMFA 5KJFA 2QZ9A 13PKA 4IIJA 1WY5A 5DBOA 4AMUA 3CLTD 4B0OA 4QZVA 1OYWA 2R6FA 1JT9A 2QGNA 1IJFA 3HBJA 2X0FA 5FTMA 1P81A 3VNAA 3TI9A 1H0SA 5C31A 3B2EA 3L0BA 3DL4A 2GF0A 1U0SY 2HLPA 1UBSB 2YXPX 2FPRA 4JCOA 2GMWA 5EP3A 2MYPA 2QDXA 1NATA 4G5SA 2BD0A 3GCDA 4JWKA 3G8BA 3RWBA 3AKZA 3W4KA 4TLBA 1SUEA 3MWEA 1Y6FA 2DG2A 5SYAA 4ZALA 4P35A 2CLSA 4ZP1A 3LXMA 3H9GA 2PR7A 4N0QA 2J5BA 5TIIA 3FYUA 1NVWQ 2PL1A 2PX6A 3KDPA 3BXOA 4X1KB 4BLOA 4CMEA 2FFHA 3TLGA 1BVRA 4JKIA 1JFRA 5DCLA 5FL3A 3HRKA 5JJKA 4PIMA 1EVYA 3B38A 5BSFA 4KI0A 1R27A 4PC6A 4WBXC 2JFFA 1TA0A 1V9LA 2CB0A 2NTEA 3ABRB 3ET5A 3WL4A 2IEGA 4OFZA 2N1BA 4G5RA 4MXDA 1PLLA 1RP7A 4Z4GA 3UG7A 4X97A 4CDGA 2XTJA 3TR5A 3I92A 3O8NA 3UB2A 4EF4A 5A9TA 4FN4A 4NE2A 2I3DA 3L43A 3NXSA 3R6WA 5CDTA 2QT9A 4G1UC 5J59A 4EG8A 2O1WA 4D43A 2ID7A 3UJPA 4L6CA 1K7FB 4NPHA 4A0SA 4H60A 1SXHA 3R0IA 1C41A 1KEWA 1YI8A 2IYXA 4F96A 3OESA 1RADA 1EWRA 3CNEA 4TRJA 4KYVA 1XN1A 1R64A 3TTUA 4FC6A 3MWJA 2ADFA 1A4IA 2VRCA 2YDXA 4LX8A 1ODFA 1G5FA 4TV9F 4YREA 5BT9A 3N0RA 3DDZX 1YBFA 5K4GA 1FJGB 1QPZA 3PNQA 2ZANA 4UEOA 3ZWKA 3H84A 5E7QA 5LU9A 3AP3A 2A78A 3O03A 1OXKB 4E6PA 1I4OA 5JD3A 2FVXA 2J0EA 3QKIA 4WACA 3VNUA 1ZHOA 2UYQA 1MVNA 1CZKA 3S0JA 1J7KA 2R87A 5IK2D 3U7FB 1ZR2A 1W6RA 2NYUA 2XDQA 4QOIA 3L2OB 1UAGA 2GBFA 3THRA 4LUCA 3TQHA 3ZE0B 5KSYA 3PLAE 1GQFA 1P0PA 1S3GA 4IG4A 4J07A 1J8VA 3V42A 2ASEA 4AMVA 5I7HA 5LQCA 3BG5A 2C0QA 4KSBA 2ZSJA 1TAHA 2WD9A 1U8FO 2DBVO 3B3AA 4LBWA 4JXJA 1UM8A 2Q3MA 5COBA 2ZBUA 3W7BA 2LXNA 1IHPA 1NI4A 3ZKAA 4OHUA 4TTSA 4AG6A 4G8BA 1IN4A 4WPGA 3GY0A 1JJBA 4QU0A 5CYPA 3ESCA 4QFCA 4WADA 3DT9A 1OFIA 3OUTA 3SF8B 3CINA 1X7XA 4DNOA 3QWBA 1JLSA 3CO0S 5FWYB 4MUAA 5COAA 3CVYA 1I3OA 3R9XA 4DTIA 1YGYA 1E7YA 3GFRA 1NYQA 3JX9A 3QVGA 4KKVA 1M2EA 2W2KA 1KOFA 5LZ9A 5A02A 3WOVA 3L8CA 3NKVA 4TQ9A 2D13A 3OSUA 1XRMA 5K3SA 3RTCA 1UAAA 4M83A 1LVHA 5I9NA 1DX4A 4FFDA 3JQBC 5K0JA 4G0VA 3EGDA 3BGIA 3AW8A 1X8KA 2OGTA 2ZQ5A 3SDBA 2FPOA 1Z6ZA 1GXSA 2IE8A 1YFKA 3OJWA 1E3MA 1I1HA 5CXUA 4XEHA 3ADDA 1OZHA 3JW8A 1IATA 2EZ4A 4UXJA 5AHRA 2X86A 2CT8A 2WQ6A 3N0WA 1K3FA 3V34A 4XFKA 3BB1A 2X22A 3BXFA 1I30A 3M6AA 4L72A 1TQ4A 1K27A 4G97A 1W0JA 4C0AC 4GRAA 5LBUA 3M3PA 4WKPA 5AVKA 1O95C 3UJ7A 5JO9A 1U9ZA 3TL6A 4IIUA 2KX7A 4K7JA 4L6IA 2XRMA 1RU3A 1OWMA 1ETUA 3U4DA 3EGXB 4Z9FA 5FUQA 1M76A 2HJHA 3MSCA 4DSTA 5C52B 5K0EA 2LGJA 1B3RA 1UWCA 1ESDA 1SKMA 2PLWA 4BCBA 2JA1A 3MRVA 3SG0A 4EB6B 2W2OA 1YZGA 3DWGA 1NE2A 3ORYA 1QK4A 3KOOA 3U61B 2AJ8A 4QOJA 2G0AA 2C9OA 4G9GA 2ZPUA 2CVFA 4CQLA 3AY6A 3GP3A 1NRWA 3P9SA 5AM0A 3VR3D 3PQFA 2GAJA 3LGXA 3R7LA 3K5HA 4KQJA 3GLIB 4XPZA 2UU9B 1AZWA 1IRIA 2WWRA 3VC2A 5CIWA 1WABA 1G5QA 1F20A 2WJIA 1K5HA 4JK3A 4KE6A 4XGKA 2P79A 3JARB 5DBFA 3PX7A 4KRYA 3TYXA 1ESZA 2Q9BA 2HQOA 3A27A 3WLMA 5HJ7A 3UYKA 1CQJB 4WDQA 1U9IA 4EZIA 3NAGA 1J00A 3WYFA 1PX2A 1A4RA 1NVUQ 3I9V1 3LRXA 4C7MA 4IG9A 5D87A 3FZYA 5BWMA 2XB6A 1YB6A 4CT0A 5JCJD 3SAJA 2QQGA 1FS5A 5EXTA 5LIRA 1T36B 2QLJA 3CF2A 3SWWA 3GLGA 2Q1TA 4QTYA 2GQ0A 4FS8A 4C7KA 3JARA 1M2NA 3ZK9A 4DEVA 1I1NA 1VMAA 3ZWQA 4YCAA 5CFLA 1HNWB 1CQIA 1ZC3A 1GRCA 2H31A 2D7JA 3JSXA 1XNJA 5C8DA 4Y7DA 4QUEA 1CB7A 3ZI7A 4R2MA 4CT5A 4XTCS 4DSAA 2BEWB 4TSKA 1U3UA 1SA0A 3LXRA 3FCUB 3KYCB 2VXOA 4JB8A 3IXQA 3QG5A 1P1RA 3CR7A 4XR4A 2LNDA 4C2BA 4CDMA 1N6KA 5DCUA 3T7KA 1NDHA 1YR7A 2VOJA 2CFCA 5FPKA 4B73A 2XNDA 2AE2A 2CC2A 2FWBA 2P30A 5SV2A 4DLKA 2XOKD 3UUGA 3W2HA 1TJYA 1XXLA 3C0KA 2OXIA 1GFSA 1RKQA 3C16C 3OT1A 4W5TA 4TS1A 2XR1A 4EEXA 5BYKA 3F46A 1E62A 3FUVA 5IDXA 1JTEA 2GOYA 4S0XA 5JASA 4I9GA 4US1R 4BZWA 4DA4A 3E0QA 3V48A 1AOXA 4MHTA 2PQMA 5EZYB 3HVKA 3KQPA 2RHMA 3SSMA 3ZIDA 4FLMA 2BKVA 4YMGA 1D07A 3DXXA 1KYQA 4IRMA 2GBIA 2J9RA 5K0FA 5D00A 1BVYF 2WUGA 4BZQA 1S9DA 1Z0ZA 1XRQA 2C3UA 3ZLJA 3QUCA 4BN4A 1R18A 4PWZA 3RQSA 4B8YA 3SKXA 3ZBQA 4LF6B 2AG0A 3D0RA 3EQ8A 4PHFA 1GKKA 3AINA 1UP7A 5AW6A 5EUBA 5LZ7A 2GK3A 1SCUA 2WKSA 1PDWA 2CJWA 4RHYA 4PIPA 1E4VA 3DTYA 2XAAA 3HKEB 1EZ4A 1WMAA 1F0PA 4BO2A 1W30A 3BIXA 1OBFO 5KTPA 4A1FA 5LQKA 5AKLA 1ZUNA 3PJGA 3CUEF 5DHAA 1U9IC 3NWPA 4UD2A 2YZNA 4QYTA 4ZO6A 5T4BA 2W00A 1TXGA 2DULA 2GGSA 2XKJE 1S8AA 4FEEA 4RJJA 1U94A 2V74B 3AR4A 3ZGYA 1CUUA 4RVSA 3E81A 1U0HC 3MGAA 3KM0A 1QIIA 3EBOA 1F0NA 1TI7A 3DUFA 4PSKA 1YS7A 2B69A 2IZZA 1S8NA 1XZAA 4XPIB 1GAXA 3TECE 3MRXA 4HNGA 2VKQA 4M9QA 5K0BA 3J81A 2AJTA 3LOUA 1Z12A 1UBNA 4N1AA 2QXYA 2JHGA 3ED5A 2NV2B 2GO7A 2LVBA 2PPVA 3NASA 2I3AA 3OZFA 4UVHA 2ODQA 1OY1A 4PX2A 4AO6A 4C4ZA 1R3UA 1T6ZA 3FB1A 2GPAA 3S70A 4PC3A 1I9GA 3BOSA 4NIMA 4RANA 3FB4A 3KAQA 3HJAA 4JQCA 3FGPA 2WIJA 4FILA 1L4BA 2XECA 3LYUA 4EPWA 1E9CA 3PT9A 2P7HA 2PUJA 2DWUA 3OA2A 2DQ4A 2VJAA 3U4IA 2WJ6A 3VR4D 3ZC3A 1KI6B 1E9VA 4PAGA 3AGQA 3HU3A 2FRVA 4CGZA 3DJFA 3WK5A 1BE8A 2VK2A 3SMQA 4U7TB 1VP9A 1XKTA 4RQUA 1T4MA 1RPTA 2O7RA 3ESQA 3LJKA 5BQOA 1B0AA 2RHGB 5FJIA 4YAFA 4TKVA 4YDRA 3VVBA 4GQBA 4TWIA 4NOJA 4IV8A 3SYRA 1NZFA 1GCUA 1SZDA 2AEJA 2P3LA 2BBOA 4DUZB 3D4PA 3Q1KA 1QVRA 4NCBA 1CJKC 5G0VA 1DP4A 4IDHA 3DE3X 4Y2HA 3KAPA 1DC3A 2B5OA 2WVHA 3R7BA 3HE3A 3P0HA 2IXBA 4Y1FA 4YP5A 3R76A 4UBLA 5AOCA 1MW9X 3OMWA 2J4DA 1MB2A 1RM4A 2D0IA 2HA7A 3GGOA 1UDWA 3HNPA 3IMGA 2PMKA 3WGNA 3BORA 3KETA 5DTRA 5G4KA 3KQYA 3ETGA 4OJYA 1KWKA 2WEKA 3H0EA 5IVIA 3SYTA 3VYTB 3REFA 5ALTA 5SZJA 1YB2A 3EBLA 4J43A 4RK1A 4RM2A 2JG3A 1SHTX 2H5EA 4I55A 3GNQA 4JS0A 4PQEA 5DHTA 4C4TA 4OPMA 3OZWA 3BK7A 3ND9A 3FD8A 4RTMA 2Z9BA 4L22A 2OO5A 2ZK7A 1WKBA 3OTIA 1EM8A 2NUAB 5T4FA 1EVKA 1BNCA 3MF4A 5KVQA 4BWVA 4DLRA 4B3RB 2BKXA 3R2JA 1XBTA 1UZMA 4NEQA 3WLIA 3BF8A 1HT3A 5CXSA 4F12A 2CBZA 2WU3A 3EIWA 4A15A 2UDPA 3UXMA 3VV3A 1YVRA 3AI1A 3AU9A 2IPXA 3JZFA 4X1YB 1FU4A 4MKHA 4NC9A 3FYCA 1GFIA 1OJLA 1SC4A 2HLDA 4KR6A 3FZEA 1HR0B 2DBYA 3IELA 2XE7A 2WPDA 2PUHA 1EXMA 1RBMA 5KKAA 1Q0TA 4L9RA 1XK6A 1NI4B 1GSOA 3CONA 4EELA 1U63A 2Y99A 1XZNA 1P77A 4I50B 3MWDB 4GE3A 3IS3A 2ZB2A 5ANRB 2GZRA 5LZ4A 4AZ3A 3MJRA 1NTOA 2C0PA 3N8DA 2A2ZA 3ZLTA 2AMYA 1ND5A 3NRCA 1KSHA 1Z8DA 4ZGWA 3I0ZA 4LPKA 1JTVA 3IE1A 3WKDA 3JQGA 4D80A 2EP5A 2DKNA 3EISA 4LRWA 4EFDA 1E64A 4Z7JA 4K9QA 1EVJA 2PGAA 2BHLA 3CCBA 3GXBA 3CT6A 1AGXA 4JJGA 1NMQA 1P31A 3A6KA 5AT1A 2SNIE 3MBKA 2QTVB 2LE0A 2QJOA 2H9YA 3MXTA 2EG9A 1XTJA 5HPYB 2PZGA 4MDEA 5BUZA 2O2JA 1RWNA 3V1KA 3AH8A 4Y2JA 3CF0A 3CZMA 2DB3A 3EY4A 2ZR8A 1NPDA 2ZSDA 3W2FA 4FM9A 1E2LA 1WCV1 3DFUA 4HGPA 1QH1B 2CKDA 4ZV7A 2YL2A 3GOHA 4DR7B 2Z98A 2H4FA 4JLBA 4L8VA 4QXQA 4RTNA 3AP1A 4FR2A 4P3NA 1FP4A 2R2GA 1GUZA 2ZJ4A 2O52A 2ERCA 3FW1A 5FOSA 2ZDGA 2HCTA 2YHIA 4DMLA 1SQFA 1T3LA 3B89A 3VC1A 2FDRA 3IURA 3SHTA 5A2QA 1Z9BA 4XYEA 1MAVA 3T5GA 1ZD1A 1YZTA 3VSBA 1FFAA 4Q3CA 3V6MA 2FU5C 1JIXA 2EZ8A 4GR5A 1RZ3A 4NU6A 2ZZKA 4X41A 1D4FA 4FYYA 4AJLA 3NOQA 5HZMA 2O3TA 3OKFA 4G23A 4ZO4A 4IUBS 1NZDA 1P7WA 2P9BA 5DGIA 3FFWA 3IUBA 4HGOA 1MCZA 2FZ5A 3MWKA 2QRVB 3L7CA 2YWGA 4K9OA 4KPEC 4N7MA 1NONA 3HVJA 3SJZA 1E1RA 3LIIA 4Q3NA 2K5UA 3IA2A 3C3MA 3PIRA 3TMAA 4RIIA 4R9RA 3V1LA 3KQNA 5BQFA 4L08A 2BFDA 2WF6A 4LBZA 1C3OA 1JMVA 2BE7A 2G9QA 2P9YA 2Q1XA 4PO9A 1V16B 2QR5A 1DAPA 3M81A 3DMTA 3DNFA 4GWGA 4BQRA 2HBZA 2DX7A 2EU8A 4HTFA 5AXBA 3NNSA 4LDZA 3RASA 3HCPA 2CHUA 2HMSA 1E3TA 3LBYA 4JELA 3U4GA 5BWCA 5JH7A 1GAEO 2R65A 4X6YA 3E9MA 2BKLA 2ZI6A 2EFEB 3I1YA 2Z09A 1ISIA 3IERA 1QORA 3LQKA 2Q27A 3OJXA 2OECA 1UWKA 4F3TA 3K0AA 3ZD6A 3IQIX 2HAEA 4L2IB 3RAFC 1XL1A 4JLUA 3X1JA 2ZLBA 2ZCUA 2HIGA 5MN5A 1TJPB 2Y76A 3QPWA 3LY9A 1RC1A 1W5BA 3HR8A 4RE5A 3ZYZA 1YONA 3WGZA 1FK8A 4EI7A 3CCCA 1DJLA 5GM1A 5BPFA 2B3TA 3QY9A 4WBNB 2D62A 1E3SA 2R1TB 4YRRA 2JF0A 2XA2A 3D5QA 3LK7A 1ZVKA 4Q5IA 4DL9A 3K31A 1XEWY 1T9KA 1TAQA 3TTWA 4D3XA 4HUQB 1K68A 3QOWA 2EBWA 4TZKA 4O4IB 1EKXA 1H2EA 4V0OA 2PXCA 3FCYA 3EDQA 2I2CA 4K9PA 4FE4A 1Y3AA 1ZMRA 4PLWA 1JHOA 2VTBB 1MBZA 1TIKA 5CT4A 1G59A 4X7BA 1HFJA 4U9UA 4UHEA 5I4BA 3TDNA 2Z8XA 2W6MA 3ND6A 4KQ2A 4TQGA 3UC9A 1OD6A 3N70A 1NQXA 3O7WA 4RY9A 2GN4A 1BD3A 3IIJA 4IMJB 5EIXA 3I2KA 1SUDA 2M32A 3FCSB 3DWEX 5HP4A 2DUNA 2VWHA 3DBVO 1SKBA 2XVAA 4F7WA 3Q72A 1JWAB 3GA7A 1XKLA 3JVIA 4CKWB 4GGPA 5F73A 1OX5A 3NEPX 1H5UA 1ULBA 4WCVA 1J39A 3KXDA 1SD2A 2ORIA 2VNJA 3HGMA 1N2SA 1VLVA 5C4GB 4BNLA 1D04A 4KE8A 2CN1A 2FPWA 4QAJA 2PN1A 4FUQA 4JL5A 4WUVA 3KHUA 3TTVA 1FNBA 2XRZA 3IEUA 3C6KA 3REQA 3ZTWA 4D74A 3EPHA 3OCUA 3PLNA 3KHKA 1E3DA 3EG5A 4DCTA 2D2FA 3VR2D 2E4ZA 1H42A 2EIXA 4HQNA 2G5CA 4UZEA 1XLTC 2OTCA 3GCZA 4BE9A 1R66A 5H68A 1S3IA 1ZCJA 1WSWA 1DIGA 4GG1A 4EY8A 3NNNA 2WQZA 2WWTA 4ETIA 2FRDA 2V03A 1PGPA 2HV8A 3MMNA 1HYQA 1JS1X 3MT9A 4YVFA 4Z7OB 4EM6A 4B3GA 1AB5A 2RHRA 2WABA 1JBEA 1XEAA 3ZUPA 5FYDA 5C37A 7REQB 3C48A 1HEUA 3MT0A 4BMZA 2XYQA 2FR8C 3LVBA 2CHQA 1GZVA 1R0YA 3GELA 1N92A 2NXJA 4MQLA 4UNPA 5FBWB 5EJ5A 3FWPA 1E3JA 2PKXA 3U7IA 1GA1A 4OQEA 2BM0A 4LPSA 5EGNA 4IFEA 4AN4A 5AKYA 1J25A 1YI0A 2FUEA 1N77A 3RYFA 3UH0A 3DPSA 5FD8A 5JADA 1PNQA 4BFVA 1P18A 4IFBA 4YJKA 4YCLA 5CG2A 4S1NA 4HWRA 4LWPA 1XRJA 2O19A 4HNHA 4ZO8A 3IAUA 5CNKA 2FPPA 3RK1A 5I47A 4KLZA 2AFRA 1EU1A 2BTQA 3BSFA 3HJUA 3R75A 4KSCA 5AI0A 4BFTA 4EG3A 3ECCA 3JXEA 4RD2A 1S96A 2BFFA 1KYTA 2GYWA 1MX9A 2PU5A 1DHRA 3DMGA 3GLUA 3K5PA 4QFMA 4B71A 5E3HA 5AW7A 1GNVA 1BHJA 3OQVA 5CBKA 5J47A 5DYWA 4DLXA 2ZIGA 1O5IA 3HH8A 1IY0A 3AM4A 3ELDA 3CNOA 1YQUA 2VP3A 3EYWA 3L79A 2ZT7A 3TW8A 4A0QA 2PZ8A 5BWNA 4C2UA 2WHXA 1JECA 1PLKA 1ZL0A 3WL5A 3KYCA 4AQYB 5GJVC 3KB6A 5L6MB 1IZ8A 3WLJA 2QM0A 3AVOA 3THYB 3DZGA 4QGSA 2AOTB 1DINA 2XVMA 3L0IB 1G5TA 3L7IA 1I3LA 2BJWA 4HVTA 4O4IA 4RO0A 1UXJA 2B82A 1QHNA 3KPWA 4UVIA 1J1IA 5JQGB 4W1QA 4KR3A 4INOA 4IJ5A 3BEOA 1GNLA 1VGQA 1BN7A 1XQ6A 2JHAA 4TYPA 5A4FS 1I3NA 3O8RA 1DG1G 3JWPA 4GU5A 3HQ4O 2HFJA 2L82A 1EFCA 2Y92A 3HY6A 3KKNA 3OE7D 4JBLA 1EB9A 4G56A 5LJIA 2AOTA 2QN3A 2IF0A 2JRLA 3EOAI 5DPMA 5A4IS 4ZI2A 4GI1A 3W6NA 5KQSA 1O5OA 2BGMA 2RB4A 5HKKD 2WILA 4HDOB 2GYUA 4LZWA 4V24A 1KAMA 1TECE 2W70A 1BW9A 1Q0ZA 3TPCA 3FNGA 1PWEA 5LWHA 3L7KA 5CVCA 1M5TA 5A9SA 5LP1A 1GP2A 1U11A 2BSAA 5CITA 2VP5A 1NG1A 3GT4A 4BPRA 2Y27A 2B30A 1YBVA 3FTCA 3VU1A 1TYZA 4DJFC 4BJ6A 3CVOA 3K2EA 3EASA 1JQKA 1MR3F 1Z7YA 1XNRB 2PRKA 3ZEAA 3EWAA 5L95A 1U9CA 4JUAA 1V8DA 2ZW9A 1C8LA 1Y4AE 2BPOA 5EIOA 1A9SA 2H18A 2NYRA 4H1TA 4L78A 4JHLA 3DVSX 1P4HA 2YS7A 1Q7EA 4II3A 3KQMA 5EERA 1UDAA 1ZAKA 3LS2A 5GJCA 1BU5A 1OH7A 3DDHA 3U4MA 4NPCA 2R6AA 1UR5A 2XWQA 3L6DA 4EUEA 3L06A 4HVAA 1YQTA 4EK9A 1PJ2A 2CCJA 3JWIA 5E9JA 3F5MA 3SSNA 1GYQA 1PZMA 2RC6A 1BKYA 3CZCA 5IG2A 4RTKA 4I7EA 3WA6A 4WEOA 1FSFA 4HQLA 4PYJA 2J0QA 1M2FA 4QTXA 3ZW8A 2HA2A 5KSZA 4I9HA 4B2LA 2YWRA 3K1AA 2BH2A 2DJ5A 1HLDA 3BB4A 1M5UA 4L50A 3QIVA 2XMBA 1PHPA 5C0OE 3T7JA 2JHFA 4CBVA 2FK7A 4KIJA 3T34A 4JA2A 4M1WA 2BHRA 5KYYB 3K0BA 2I4MA 3V80A 1EP2B 4ND5A 5CX4A 3QW4B 4OLFA 4EPRA 3DVLA 4EARA 1ARZA 1RYDA 3K0CC 2AT1A 5E1OA 2Y1KA 5D3QA 1CJVC 3LOQA 2QOEA 3GEHA 2QQ5A 2X5NA 4WK0B 4P80A 4B3JA 4M9ZA 3T5MA 4DV4B 3V4RA 1C81A 2EAUA 3S2IA 3GUCA 4XJXA 4MW2A 3WWEA 2Q5JA 4IFTA 4FIDA 3ZU6A 3IAAA 5BORA 4OHPA 5CA0B 3IKJA 1DKLA 5LZ2A 1N7JA 2Z1MA 2Q1UA 3QBEA 4XQ0A 521PA 4P84A 2FZWA 3NGXA 4C1BA 4KR7A 1AV7A 2VDRB 1U3TA 2P8JA 3E9NA 2GEFA 4MP8A 5T8KA 3QVMA 1TCVA 2ZTMA 4AURA 1LTHR 4S1PA 1WETA 5BSEA 4INPA 1WCIB 4OGLA 4BUZA 4E5PA 3H87A 2PL3A 1DKMA 2YOGA 4PR3A 1P8AA 2RBKA 4E03A 1BOFA 4HUTA 2J9GA 5L45A 5K0NA 1UBGA 5T3YA 3VU3A 3NAZA 1VIVA 3ZDYB 1Z8HA 3T9EA 3U7HB 2ZYHA 1G4AE 5JNTA 2UZ3A 3CLHA 2NSJA 3H1TA 4QD3A 2I71A 1GVHA 4JT4A 4LFAB 3EIFA 3H0KA 2QX8A 5DXFA 3M6WA 4BGIA 4KIFA 1Y3FE 2D06A 1DQPA 1W5FA 2W2MA 1BW9B 4G0YA 2YV2A 1SXJB 3DQZA 4IJWA 4IH4A 3RBZA 4K9LA 4HQ6A 1WU8A 4ZODA 5FNVF 2PS9A 4MGEA 2YXLA 2ZITA 1ECCA 5H9VA 4OOFA 1Q7BA 4OQMA 1K2WA 4C08A 5IJ9B 2K2WA 3OQPA 3BKWA 2H29A 1VJGA 4HQKA 4J0JA 3FLBA 4MTCA 2CE7A 4HQ0A 2DHEA 2GA8A 4Z4IA 5DVZA 2AFIB 1KA9H 4ZAWA 3RKUA 2OM6A 1SVSA 4IHAA 3DTVA 2IOQA 2RGGA 2AW3A 3LO8A 5EVCA 2QN1A 3WNVA 4C6HA 1L3BA 2ZI9A 1ZOLA 3A9WA 1MNAA 3CEAA 3GG9A 5IJXA 5KOJA 5AR1A 3KUCA 1PR3A 3NC1C 2VYNA 4ZI3A 1AK9A 4EDFA 2BMVA 1JHPA 2GPBA 1EUCA 1S2OA 2CWDA 1RI5A 3OD1A 3EZFA 4PG5A 5JSKA 3E22A 5K0CA 1BQEA 1LX6A 1NJ2A 2HQBA 2HIAA 2VT3A 3NT4A 3Q8KA 4Y67A 5EMJA 5F12A 1P3JA 1U1IA 4PYLA 5EUQB 3TW8B 2DLNA 2YNMC 2ZVQX 4A2CA 4CTOA 5JPDA 1JHXA 4JQSA 4IOKA 2DH5A 2FKNA 1Q1BA 4PQRA 4Q4JB 4YV1A 1USKA 3H5OA 2O0HA 3IT2A 2H2DA 1M2VB 3O2JA 4IKOA 5AIAA 1F06A 1HE5A 1XTTA 1XU4A 3C6MA 4G41A 4OB8A 3LBIA 4NAUA 1G8AA 4UMEA 3RVKA 2RHHA 1FYWA 4PBSA 1JA1A 1EP3B 2WJGA 1E2JA 4MCJA 5LVAA 5BMVF 1M1NA 3GK3A 2HC9A 1T5TA 1YULA 1RLOA 1WQ3A 2QW0X 3FX2A 3M4JA 4LC0A 2VCYA 4LX0A 4MO2A 4RMGA 3R7NA 3PUHA 4Q9HA 1FDOA 3UH1A 5C3MA 3K70B 2W2PA 4WOBA 1FDRA 4YMTA 3RAGA 3ILXA 4LCEA 4V2IA 2G82A 4N9WA 2JRCA 3CA8A 1M8KA 3KKQA 1LSUA 5CG1A 3CIOA 3MVEA 3WJ7A 3ZDRA 1GTJ1 5HNKA 2JEYA 1O3YA 5IAAA 2AE1A 3PQ3A 5DYIA 5DP2A 3WWPA 4JIGA 4G9BA 1U8EA 3FBTA 4BTVA 3HDQA 1YZFA 3BE4A 3GEDA 4MW9A 4NS4A 4HRAA 2JFZA 3KE8A 4N7BA 4O1IA 1MB3A 3I72A 1QYRA 1Z06A 3ODGA 2Q2WA 4XD2A 4EZEA 3TEMA 3A6ZA 1JJVA 1TUGA 4TMKA 4XX0B 4K8OA 1EJ6A 2VT7A 5CW2A 2VNAA 2VTEA 4LI0A 4YACA 2HB6A 3EVZA 4DCMA 4WXMA 2IV3A 1DEOA 4TSFA 4EAAA 3RUCA 3TFQA 1BXGA 3TMYA 1EJ2A 3GW8A 1E0JA 2RJ3A 1HE2A 1ZSYA 2HRRA 1XDZA 3KWMA 1YHZA 2FE4A 1TVKA 1XZHA 1Y3HA 4M3NA 3NYRA 3WSVA 3BDIA 1E1YA 3EXEB 4LYHA 1QYIA 1ZMBA 3DNMA 3UN1A 3PWZA 2HNKA 2H4YA 4CKBA 1AMOA 3EPPA 2X3YA 3VC7A 4AN1A 5CLJA 1SVLA 3G0DA 3G7SA 1TCBA 2J6BA 2Y68A 2AZXA 4P82A 4C5BA 2ZWAA 2BEUB 5AVYA 4KH1A 2VHJA 4MJ7A 4TTQA 4WHMA 4BNIA 1OAOC 6GPBA 4DLWA 4RPCA 5BOSB 3T95A 4IEFB 4YGYA 1U8CB 1YQDA 1NV8A 1Z5VA 121PA 2JHCA 2OL4A 1USIA 5F7JA 3LTNC 3TX2A 3RRNA 3AR9A 2W4IA 4F1JA 1U3DA 3Q1LA 4DIDA 1RBYA 2XIJA 2V0NA 4BFYA 1ID1A 1SB9A 4AFNA 1Y7LA 2LZ0A 4F4CA 4QBIA 5JSFA 5DF1A 1QNFA 3BSYA 4P31A 3I8XA 4U7WA 2VPQA 5DLPA 5D3MA 3CNLA 5BY2A 1AS0A 3PHGA 5C7LO 1LQUA 5JY1A 1L5QA 2A0UA 1AH2A 2XD9A 4PZYA 1K75A 1H1DA 1XK7A 4NU0A 1F7UA 3O8OB 3TLBA 3CX6A 3L1VA 1HSZA 3BL5A 3ANYB 3IE2A 4AQ7A 1OWNA 2IT1A 4I1UA 4RH1A 5DBEX 1A2KC 1Q15A 4QM6A 1V4NA 3SR0A 3SF0A 2YWHA 4QBGB 4A0GA 5IMSA 3BH6A 3S40A 3SX2A 4G36A 4BGVA 1F8UA 3WYGA 4RZHA 2IEDA 4V0RA 1T2VA 1QAMA 4V39A 4FT4A 1U1FA 1QV7A 1ZM4A 3IRVA 4C0SA 1RRCA 3G5AA 2OV3A 1VL6A 2EJBA 2MMGA 3HZRA 4FQ5A 5JAOA 4EB8A 3BS4A 4ILKA 3ZWNA 5KVCA 3THXA 2BKAA 2R4QA 4L4ZA 4C4XA 1N2IA 3MWGA 5A4MS 3K1TA 1L7BA 2X7JA 4BN5A 4A36A 1EUDA 2XTAA 1QIDA 2GKOA 5DN6A 3EXAA 4RZSA 3OE1A 2VF4X 4FZ3A 4OBXA 1EWKA 4QASA 4HO1X 1YKFA 4ZEWA 1JPNA 5EZSA 3LQ1A 1LFDB 3RSHA 2FPGA 2QYHA 1JEAA 1DIHA 1N5RA 1QFJA 1Y63A 1YJQA 3INNA 2IIVA 3KJFA 4M9CA 4N01A 4BX9A 5KDOA 3IL2A 5ISMA 4Y1GA 2JLVA 1X13A 2B1GA 2ZRKA 4ZI7A 1E5QA 1M6HA 2GCNA 4O8ZA 3V7YA 4D9KA 5K8JB 1VKRA 4QSMA 3E7WA 1YH3A 3JQ7B 3QEMB 4LZNA 2W22A 1XA3A 2EKQA 4N65A 3ANXA 3QPAA 5FR1A 3E6AA 4A2PA 1ZJWA 3UQZA 3VR6D 3M6LA 2OB2A 4M8LA 5EE0A 5F77A 3W6ZA 1R8SA 3HK2A 5E38A 4OXIA 1GAQA 2VYND 4AJ1A 2V7EA 1N2GA 2R86A 1IN7A 3B6EA 4HS9A 5JG7A 1YAJA 1U5AA 3A58B 4QREA 5KTSA 3ISTA 4DQVA 3W5AA 2ZRBA 1T9BA 1RAHA 1SN7A 4YLGA 4ZYZA 3VJKA 5KVSA 2H54A 3GZNB 3VKFA 1VPEA 3GLVA 5EEGA 4PX5A 5B2ZA 1KDPA 1NY6A 1CIJA 2PT9A 2D00A 2ZYVX 3FDZA 4LNUA 4DANA 5IJAA 3R3HA 1G42A 1Z17A 1IHDA 5LMZA 3D81A 3W3AA 4Q82A 4KFTA 7ABPA 1HQDA 1YJ5A 2V7UA 4FEGA 4EEKA 5EUCA 1E9SA 2RCNA 4LXYA 1T6YA 3FNIA 3H5LA 1JG6A 4F86A 4E31A 4YMHA 1TDJA 1XA0A 5JLAA 4C7XA 1GV0A 2X76A 2H17A 3FPHA 5CEFA 4RD6A 2XVZA 4LMPA 1J56A 1O77A 3I42A 2WTNA 2HWKA 4O4HF 4IIBA 1QTQA 5E4YA 3KOZA 3AZPA 3KYDA 2IHJA 5KJCA 5ES4B 3RRZA 4PFJA 3D8BA 4IX1A 2XCTB 2HQ1A 3M3HA 5L4LA 1XPRA 1LVUA 2I91A 4TYWA 1MA0A 1ZIYA 1N8KA 2YDYA 4TRMA 3THSA 1YC2A 1P9LA 4XQ9A 4YAWA 5FI1B 3W1WA 1UMCA 1UJ5A 1N1DA 2R68A 5JHHB 3FGZA 1I1OA 1KSJA 2DWPA 4HTAA 2BFMA 4HNRA 3HGQA 1CZHA 2JLYA 2HUPA 3WK6A 1MC4A 4DJDC 3GEBA 4LC9A 1KQNA 2W6QA 3SC2A 1UFQA 5LWQA 1M66A 4ALKA 2WYOA 1DKUA 5LLSA 1RZRA 5JNRA 2NZWA 3VKVA 4AROA 2YQ5A 3FJOA 1Z6GA 4PZ9A 2PPLA 5FPYA 4FT2A 5KYTA 3OLXA 5CDYA 2RGUA 3LUAA 1ZM3A 2PX3A 1LC3A 1KEPA 3B9QA 3FFTA 3OX3A 2C1EA 1XMPA 4AKEA 1GKUB 4Z0NA 1NW7A 4BVKA 5B12A 2PUBA 3DBLA 3INRA 2PSJA 1E63A 1HDIA 3AVYA 4MGYR 1JAZA 3AK4A 3BPSA 2FSHA 3UV7A 3FRIA 1M2KA 1FRNA 2I2WA 3DKPA 1UPAA 2JAXA 4QJIA 2W5UA 1P91A 2HJGA 1JPVA 3IBYA 5T3UA 5BMVA 2JZCA 1G8PA 3F9RA 3ENKA 3NB0A 3PC3A 4QYIB 5E0OA 1LDNA 5GV7A 1X8JA 5D86A 4YRAA 1C3LA 2DY1A 2OZLA 1I51A 3JD4A 3IIKA 4HH0A 3S55A 4RTSA 4U2DA 1TK3A 2JI4A 3PGJA 3KSBC 2NO6A 2IHUA 1JLLB 3GVIA 3MYYA 1CT9A 1ISFA 4GXTA 1NC1A 1YVEI 4YROA 1AKWA 8AT1A 5U4QA 1COWD 2JAPA 3BWXA 3I0NA 2P4QA 2PMCA 3ZGLA 4DT1B 2JJ1D 3E8MA 2HO5A 1W25A 2EIHA 3AXSA 3ISVA 2QP3A 2CVHA 2VQDA 3AUUA 4IW3B 4I1PA 1SPXA 1F8XA 4BIIA 2P4EA 4L5YA 4WKGA 4HGQA 1XTBA 5BR7A 2E7ZA 3A2KA 1UOOA 3CG0A 3DHNA 2UZAA 2GK7A 1M2GA 3L8FA 5CK5A 5TVKA 2BGTA 1MGPA 2HFKA 2X8LA 4NYJQ 4B79A 3ICEA 3LQQA 3I39X 1Q3TA 4WIAA 2HSEA 3W3ZB 3BXZA 4KR0A 2NUPB 4M7OA 4Y6GB 1QF7A 4LZPA 4RPIA 1NKVA 3KKLA 2ZTLA 5IVPA 3VUFA 1V39A 1VRCA 4QKQA 1U90A 1QK5A 3T3GA 1RQ7A 2X8JA 1PFUA 5ALWA 1ST3A 3TJRA 1L5MA 2ESRA 4DCCA 4OH1A 4GR4A 1V35A 2VAPA 2BJVA 1X74A 1GQSA 1JAYA 2JFXA 1PWYE 2LRHA 1OAAA 3TZBA 1M3SA 4FDUA 2WSSA 4KTVE 1LKZA 1GLVA 8ADHA 1HDXA 3O90A 3Q3IA 4NZ9A 3V4PB 4A8TA 2FV8A 1A7UA 3EDMA 4MV3A 2PZAA 3PQ6A 2DKOA 2HXGA 1N6LA 3UMJA 2IYQA 4ENTA 2I4NA 3KUDA 3N87A 4RLSA 3PLRA 2X0DA 4MRVA 1E6LA 5LD2B 4EVQA 2A33A