3PT5A

Crystal structure of nans
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
320
Chain Sequence
IISPDYYYVLTVAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPSCHFNDIIPLTHCPHDVQDMQSYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALVKNPQNKFLGVCWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNDAPWFCGDTTWYWKENFPHAYEAIYGNYQNNILANIIFVDFQQQGARGLTNAPDEDPDDLSTGYYGSAYRSPENWTTALRSSHFSSAARRGIISDRFVEAILQFWRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NANS (YJHS), A 9-O-acetyl N-acetylneuraminic acid esterase
publication title Structural and enzymatic characterization of NanS (YjhS), a 9-O-Acetyl N-acetylneuraminic acid esterase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli o157:h7 edl933
total genus 124
structure length 320
sequence length 323
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3pt5A00
5B5SA 1BWPA 5CD9A 4LHSA 4JHLA 1JRLA 1PP4A 4RSHA 1J00A 1VJGA 3DCIA 4OAOA 1V2GA 4JJ4A 1U8UA 3DT9A 2Q0QA 4S1PA 4JJ6A 5A4AA 4K9SA 3HP4A 3P94A 4K3UA 4DEVA 4HF7A 4RW0A 1VYHA 4JGGA 3RJTA 1YZFA 4Q9AA 1BWRA 3SLRA 1DEOA 4I8IA 3SKVA 1FXWA 5JD3A 1ZMBA 3C1UA 3BZWA 2WAOA 1ES9A 1IVNA 1ESEA 5HOEA 4H08A 4XVHA 3W7VA 2WAAA 4TX1A 3DT6A 1BWQA 5BN1A 1ESCA 2Q0SA 1WABA 4PPYA 3KVNA 3PT5A 1DEXA 3MILA 4Q7QA 3DT8A 4K7JA 2HSJA 1ESDA 2VPTA 4HYQA 4K40A 2O14A 1FXWF 3DC7A 1K7CA 2APJA 4JKOA 4M8KA 1Z8HA 2W9XA 4IYJA 2WABA 3U37A 4OAPA 4NRDA
chains in the Genus database with same CATH superfamily
3KXLA 5KOIA 4CKWB 2OLJA 3GFGA 5F2OA 3WHPA 1PZNA 2IS1A 1TU0A 1PQWA 5AM4A 4AWBA 4KQ1A 1RAGA 2ERCA 1MW9X 2VF5X 3D6HA 4KPUB 4U4AA 4C29A 1UBKS 3SDZA 3QEMB 4Z1MA 4L3VA 1VL2A 2EXXA 4ODIA 3WFZA 4CW7A 3P8ZA 5BYKA 2LBPA 2A84A 1PWYE 2V6FA 2Q3MA 3DZJA 3FKSA 3VMFA 5C81A 3ZQJA 3W4KA 4QUAA 3FMVA 2B94A 3DE0X 3VVBA 5JSZA 2KS6A 1PG5A 1DWOA 2YWDA 1KDRA 3GAMA 3FGOA 3OC6A 4ID9A 3QI2A 4NE9A 4D3XA 3R2JA 1NDQA 1F3LA 1MAHA 4HH3C 3PRYA 4IHJA 2YIDA 4XWGA 5JBIA 2FFHA 3F5FA 2DFVA 4NS1A 5SYMA 1SC6A 3OIDA 1Q0ZA 1BJTA 2P2DA 4HMQA 4KW7A 2B34A 3OPVA 5KAMA 1A5BB 2XB2A 1VKRA 4WXPA 4ZOQI 1K5GA 1ZVVA 3R5HA 1ZJ4A 3OEED 4HUJA 2JPDA 2JANA 1VFNA 3C14C 3FG9A 4BZZA 3PWSA 1JKJB 2PSSA 2VDJA 3ZXIA 4DDMA 4TXJA 3EF3A 2ADMA 2D59A 1REQA 2C98A 2JCSA 5ITVA 3PFKA 1XP5A 2CVHA 4B6JA 1PG2A 3E7FA 4RMIA 3TAXA 1TM3E 3TLXA 5AFSA 3ER9A 1ZAYA 1SOWA 4K3UA 2OGWA 4OB8A 1AZTA 3I0MA 2Z09A 2EDCA 3PTLA 5F51A 3WQSB 2QYHA 3VYUB 4YYEA 4B3CA 4ZCTA 3KQNA 1XJQA 3EN0A 2HQRA 5EHQA 1LWNA 1A9RA 2ZXFA 1J90A 4NJEB 3JQ8A 4R9UC 3SX4A 2FW7A 3KZXA 5GADl 1ML4A 1I6KA 3ADCA 3OE5A 2QJWA 1NR1A 2QTFA 1AUQA 1PEKE 1W87A 4JENA 5DNDA 2FN4A 3WNZA 3CPHA 5E6UB 1B4DA 2BHTA 4DBLE 5BYAA 2PGOA 2A5LA 3ECSA 2VXBA 1U2GA 3FNIA 1QE0A 2CJWA 1DE0A 1QR2A 1YV9A 4YCDA 1KE2A 2CK3D 4IMJB 1YKSA 2VNIA 4DT1B 2I80A 3JVUA 1COZA 1ZJYA 2HU8A 3T0GA 1C0IA 3A05A 4DS3A 1FX1A 2JLRA 2JJ1D 4V0OA 2QPAA 5A5VA 5JZOA 3WLOA 2FMKA 3EXHC 3H3FA 4L51A 5CCXA 4RLQA 1RI2A 3A06A 4KLAA 3RIEA 2XA9A 3SIXA 5AIBA 4MQLA 5IJWA 5K09A 1K8ZB 4NPHA 3LXUX 3BRSA 1L5OA 4C9BA 4L0CA 1JSXA 3EWSA 1IB6A 4Q16A 1CXZA 2O2XA 2Q4EA 2C4WA 5JAPA 2AN1A 4AC9A 4IDDA 4ND2A 4DLPA 3T5GA 1TCCA 3BFKA 4JNKA 4DIDA 2O2IA 4RFLA 1G20E 5FHQA 1NXQA 1ZS9A 1K7EB 1Q1BA 1YRQA 2NV0A 2R6CA 2ESRA 3DTTA 3LDAA 4PHHA 4RESA 2FMTA 3HDGA 4FYYA 5A3VA 4MRRA 4ZOLF 3C3BA 4RMJA 5CB6A 3NDBB 3ZS9A 5I5EA 5KYXA 1S9DA 2BFOA 4G8JA 2ZIWB 4Q00A 1BFUA 3AZQA 2D06A 4XIJA 1DQZA 2Z8YA 3FFAA 4TL6A 2R85A 1SQGA 3A3NA 4OXIA 3CEAA 4US0R 3TH5A 4AB1A 1FBTA 1SBCA 3X3HA 4YUWA 1K63A 4LQ4A 3PDIA 2BELA 2O20A 3PZBA 2NUAB 3FWYA 2H17A 5EKUA 4MDHA 1U7XA 5IG2A 1MB2A 4ZYZA 1EUCA 3EG5A 5C34B 2PT5A 2H59A 3K35A 1VL0A 3RANA 2YXNA 4F06A 5JVDA 1WUKS 1ZWKA 1YGPA 4CM8B 4KR9A 3FUTA 2ZRDA 2V4ZA 2AW3A 5BNZA 1E1CA 1UC4B 1BDHA 3KP1A 2ZWVA 4RAQA 5SY9A 4FCCA 1OAKA 3GARA 5ELMA 2JATA 1ULSA 1WHTA 4JB3A 4A8HA 5C5IA 1PRYA 3AYZB 3PIRA 4UM5A 4X91A 3FYUC 1SKAA 2GARA 5DHRA 5G4KA 4C0XA 1V3VA 3FB4A 1ZN9A 4NXMB 2PBZA 1AUOA 3N2NA 1V4VA 1THGA 1P44A 1XRJA 1X92A 4LWPA 4Y1RB 4YDSA 1ZGHA 1LZLA 2HPAA 3L82B 4I4IA 1GTJ1 4GU5A 4P4GA 4DBZA 4F3YA 3A2NA 1JEYB 1TT7A 3HXPA 3HVRA 1ODIA 2DM6A 1OLSB 3WDMA 3QWBA 2EQ5A 2NYRA 4NR0A 4MWEA 5E4YA 3U7QA 2CF5A 1ANKA 3HZHA 3Q7SA 1Q1AA 2GCOB 3GRUA 5DGIA 4AUNA 1HDRA 4LGYA 5EQTA 4EG7A 4YRQA 1CUSA 2QPLA 3F3MA 3KKZA 3Q98A 4I1UA 3VXKA 5GINE 3THXA 3RAPR 3COWA 3EQ9A 5KX5F 3S8MA 3WWZA 4XOIA 3B78A 2Q9CA 1A5TA 1Y81A 1CY1A 2PBLA 3HGTA 2XMBA 5EFZA 2ZI3A 1KA9H 3B7WA 5AI5A 4YA6A 3SC6A 2GM4A 4MRSA 3TD9A 4JGIA 4BB6A 4BAGA 8OHMA 2P9GA 4PHTA 3N6VA 5BN4A 4AKGA 1WY5A 1I4TD 4RK4A 2C2WA 2ZDHA 1T0PA 3RAFC 3E48A 1U9ZA 1TIKA 2PFGA 1K4YA 3SYLA 1TF5A 4YR9A 4H08A 4C6HA 1MB9A 1Y1SA 2BM9A 2ZVDA 4NF2A 3FIJA 4GOMD 4LZZA 4XVHA 5DF1A 3TLKA 4FEYA 1VE7A 3TYXA 4OKIA 1E9CA 1N2HA 3BQ9A 1GYRA 4RVSA 5H3LA 3X43A 1T36A 1PZMA 3JALB 3SR4A 1VCMA 4Q9JA 2D1QA 5BVHB 4JR1A 3GN1A 3TG8A 5IK2A 2SECE 1M33A 5IMBA 3B9PA 1VLMA 3ZGOA 4B44A 3O38A 3FMIA 1SM4A 1CZNA 3NOOA 3T1HB 5CJPA 3L7YA 4ALJA 5FOUA 2PZAA 1X87A 3H17A 3QFCA 3FPSA 4JUCA 3RUEA 4L8FA 4WY2A 1FDUA 1N8SA 3EZXA 2X41A 5F21A 3CEPB 4FQ8A 3DMPA 3B7GA 3GRAA 2HDOA 4KK3A 1H9CA 4D74A 1HT3A 2C1ZA 2CWWA 2AVNA 2DFLA 3K72B 3ENNA 2GD1O 3NT5A 1VLZA 4J3FA 4TROA 4AYWA 4BMPB 1YDEA 1SJ9A 3RD5A 2NP6A 1U0BB 3CEJA 3DZDA 1XDBA 1Y3FE 2IPXA 3N05A 5BT8A 3C5HA 3RYTC 3GPIA 2DBZA 5ESWA 2P67A 2H8GA 2UU9B 3TD6A 4HNVA 3NU1A 1YO6A 2HF7A 1YQUA 2ZITA 4D3ZA 2JGKA 4D4JA 1XMIA 1JAHA 4IRXA 2AOUA 3K32A 5FV4A 2DQKA 1NY5A 1QHHB 1R66A 2JFYA 1Z5GA 1U2GC 4YRJA 3UJAA 1H66A 3AZOA 1A69A 2C7BA 5CNIA 4OAOA 1FFBA 5LCXA 3ZDEA 4PLZA 1PYGA 1Z2DA 1ZD5A 2XYQA 1MT0A 1NMXA 1UAGA 1AX9A 2RI1A 3BPSA 3I23A 5T3YA 3PEWA 1ZNXA 2TS1A 1SEPA 1UBUS 3A9RA 4QYTA 4EG4A 2OBXA 3Q12A 4FDVA 3GEBA 5DASA 3FBWA 3H1BA 3SSOA 4U2CA 5I9TA 5LQMA 1ZK0A 1L8LA 3CMCO 4E5VA 2GYWA 1DHRA 2JH9A 1ZOSA 1GQQA 4UPDA 1CRLA 2ZBDA 3VVLA 5K3CA 5LUAA 2Y0EA 5TGDA 1RCTE 4PNHA 2P2ZA 1NI4B 1DO2A 4IQFA 1VB3A 4QQKA 5EE9A 1PLLA 5CIWA 1KY2A 2G67A 1KHTA 4O5AA 1ISJA 1EUQA 3KK0A 4ZYUA 3MWLA 2P5SA 4V0KA 1QCDA 2ADOA 3OQMA 3B20A 3BULA 1I9CA 2VT6A 5KNDH 4IIGA 2AG6A 1HKUA 2UXBB 2PXCA 1TOAA 4XCQA 3E82A 3ADBA 1TK3A 4YJGA 1HDGO 1VCHA 4TQ9A 3WNBA 2OBBA 5DHSA 3D3WA 4RA9A 4NTZA 2EGUA 2AZXA 3ZD8A 5A9SA 3ENQA 2EJUA 3NR2A 1T5HX 4F3TA 1P2FA 2NYUA 3I9MA 1JLMA 3WKDA 5E2AA 5L40A 3DXYA 2ORED 2ZI5A 5C1BA 1X7GA 4M8SA 4P0PB 5EUCA 1VG9B 4GRAA 5LZ4A 3GFQA 3USCS 3ROZA 3TRKA 3UY4A 2QNRA 3SGLA 1YZUA 3C97A 2H1SA 4PTYA 3RLIA 3KJGA 3VNRA 3WO0A 3K2BA 2Y8EA 3SF8B 1U90A 3T3EA 2HOQA 2H1VA 4BQSA 1YF3A 2C7PA 3O90A 4WOKA 5CT8A 1NHWA 3OF5A 3BBPA 1QIGA 5DNUA 2HIGA 2J41A 1YQDA 4RJ2A 1UAAA 2E2WA 5FYQA 1L5HA 1WEKA 3OZCA 4HR7A 3OZVA 3S2FA 3G2HA 4NYJQ 2X0DA 1LGYA 4CLEA 1IQPA 1P1CA 2ZJ8A 3GLTA 4LRWA 1D5WA 2HSGA 1RHQA 4X20B 2DBVO 1NBMD 5LFAA 1MN6A 1G5HA 1Z0IA 2H0AA 3NYQA 3Q6IA 5FJIA 3WOHA 4F1KA 4W8OA 1VXOA 1Q83A 5C2JB 1I94B 2A2ZA 1ECPA 2GN0A 4HYYA 3RQSA 5EIXA 1U0JA 2WJHA 4GLFA 5JCJD 3D54D 1Y3CE 3GWZA 4C0BA 5AW6A 1SCQA 2WYHA 1QV6A 4RPLA 4UEWA 3TLEA 4FYWA 5BV2P 2SICE 3LT2A 4J7CA 4H4DA 1N77A 1ADYA 3PDCA 3D0RA 1N75A 4JOQA 3AB3A 3MPOA 2L17A 2H2IA 4WJLA 2SHKA 3CNHA 5AKKA 4DDWA 5F78A 1SQFA 3E2IA 4QU5A 1Q2XA 3C3PA 4QU9A 4IYJA 3ZCUA 4FOTA 4BS9A 4I1PA 3AR2A 1E5LA 1YK1A 3DR3A 3DUFB 3AILA 3OM8A 4JBNA 3ZQ6A 4B73A 1J9EA 3G8AA 3LKDA 4X85A 3FF4A 3LGAA 2PWPA 2I99A 4B46A 4G0WA 2FZWA 4M1KA 4IDCA 4KN6A 2BMAA 3PGXA 4ARSA 1IBKB 2B8TA 2WU0A 1WUTA 1GKLA 4B2PA 2R7MA 4RHTA 4MVJD 1IN7A 4PZLA 1V1MB 1IBLB 5TY0A 5FA5A 1CUJA 4YQFA 9LDTA 4ZOLB 4ZT7A 1KI4A 4G41A 4LOAA 5J2UA 4RJIA 1V1RA 3DXFA 2PSJA 4Q4HA 4UJ5A 2X22A 5BRAA 5FWNA 3VAAA 1XEAA 1WRBA 4FEAA 5FF9A 1YFJA 1E94E 4MLPA 1HZJA 1TX4B 1ZIDA 4M7WA 5JC8A 1MBZA 2E89A 4HPXB 4PX5A 3VH4A 5CU7A 4B9EA 4H1WA 3TVDA 1AT1A 3GLRA 3RTDA 4ZCLA 5HE8A 2H7XA 1XE3A 2AYYA 2OM6A 1XQXA 2AFIB 3SLKA 3H2HA 3TJRA 4AJ2A 1E9EA 4OMDA 1R4MB 3JAWB 2R2AA 1P1IA 1NVEA 3O74A 1D1QA 4QGFA 4MAFA 1S5PA 2VK4A 2WILA 1TJ5A 3ADOA 3EBLA 3JV7A 1NVDA 2E1PA 3P9SA 4GM0A 3LH5A 5LMCA 4LJKA 4D6PA 3K1JA 2J3IA 2Y0PA 1QGAA 2WKPA 1Q57A 1YZNA 5LQJA 3ZZ1A 2YRWA 3JAMA 3OT4A 1EGHA 2VOJA 5JO9A 2IUUA 2B7CA 1TYAE 1VP9A 1LBSA 3HZRA 4NCNA 5I3ZA 4RCYA 4YP7A 1MIOA 4DCUA 4D3FA 1YKFA 4ZTBA 2UVPB 2I6FA 1YIAA 2NVBA 3U6BA 3E22B 1K89A 2IE8A 2N75A 2WWRA 2G5GX 1IPFA 3HKEA 1KFCB 1Z0KA 1YB1A 3O1IC 4QG3A 3LWNA 2XDQA 1CNMA 3PK0A 3NBMA 2AC4A 1MA0A 4BNYA 1E6KA 4AZVA 4KO4S 1XU9A 1DJNA 1I7NA 2DQ4A 3MJCA 4ITUA 1K3TA 1RE0A 2HDNB 2VN8A 1MDFA 2NZVG 2BI7A 2X9LA 4ZI7B 4G5XA 4G9EA 2GA9A 3VR5A 4ZXPA 4TV8A 1E1KA 2VLBA 4XJTA 4J3JA 3P9CA 1ESCA 3IEIA 2PO5A 2FGKA 1SBYA 2ZBFA 3TOCA 3WLKX 4CQMD 5JBNA 1X13A 3KUXA 1MX5A 4N5DA 4NE7A 4UM9D 1FFAA 4YT8A 1ZQ9A 3LVFO 1XELA 3RIHA 2NZ8A 1QRSA 2G6BA 6REQA 1JQ3A 1Z2AA 5B1YA 1UBCA 1BFKA 4ME6A 2XE7A 3CLSC 3D4BA 3O94A 1K88A 4N03A 4JEIA 3DQQA 2AKYA 4HDSA 1VZ3A 3BEOA 3DOCA 2VZ9A 1KAEA 3MD0A 4ZU6X 2AX4A 2YYAA 4I5DA 4LWQA 4H6VA 5SY4A 1Z22A 1E2MA 2XMDA 3KJQA 3ONDA 4OFBA 1LBIA 4COOA 2O8DB 2NOAA 1NE2A 1XVIA 1G8YA 1T29A 2O6LA 1M1YA 1FDRA 2HA2A 5DNCA 1J2TA 4WUTA 4KXMA 1RXEA 2QN9A 5CNJA 3T5BA 4GL4A 4EG0A 2GXAA 2GZMA 4L2IB 2EJVA 1MQSA 3ZY4A 2QF7A 2QPOA 4GKAA 4D0RA 2O6HA 2IY9A 2RIPA 1U2SA 3QVTA 4NZNA 2GJ9A 1L5FA 3H6GA 1H3NA 3EWIA 1IM5A 6ADHA 2IXDA 5C0OE 2WOJA 5F77A 4D6XA 2O2DA 4H16A 1QHSA 1JU4A 2CN1A 3D8SA 4DYDA 3IOEA 2IPMA 3O9MA 3ISJA 4RM3A 3ST7A 4HRAA 2GN1A 3EFEA 1S96A 3ND5A 2Z1NA 4IVRA 5ICGA 5H16A 5D8DA 1GUBA 1KVUA 2FXIA 2O7SA 2J32A 4CLDA 1RWBA 1GZDA 3A4NA 3BB4A 2FUKA 2QXTA 3GGCA 3AR8A 3KOWA 3GIWA 3M2PA 3NHFA 1VSUA 4RIIA 4KKVA 5A7HA 2P6NA 4RZUA 1YDMA 3U9SA 4RL6A 3V00A 5FOSA 1GCIA 3P9IA 2O07A 3GBSA 3RUFA 3TTUA 1OB2A 1LSJA 1FLVA 3PHCA 4B48A 3ESYA 3ANNA 3GLGB 2PSHA 4G01B 4AP5A 2VP9A 4HH0A 4U2BA 1KDOA 3JWGA 4GKVA 5TPWA 2H2FA 3F5SA 2L18A 2CLCX 3C3JA 3R5SA 1XMQB 3MGGA 4J4TA 4M8IA 3HV0A 2VT7A 3GDWA 5T6MA 5BSWA 5JI3E 1QB7A 3RJMA 3THYB 3ZI0A 2CBZA 1GQYA 2EFYA 3MJDA 4ZEXA 1OWNA 2ADFA 5FYDA 3OOJA 1U65A 2YRXA 3AHFA 3NIWA 1DIAA 3MYYA 3TL6A 4AKSA 3KQYA 4EQZA 1SNYA 4NZPA 4KZKA 5AHXA 2IV7A 2WAYA 4Z2YA 1DQRA 3QUAA 4WNCA 1GTL1 2BD0A 2F43A 2XQGA 3C43A 3R7NA 2X0RA 2HFKA 4FFBA 4F5DA 2IDZA 1YDHA 5J3JA 3R9XA 3EDCA 5DHUA 1V8PA 1NMEA 1YI8A 2Y68A 1EUDA 1GRVA 2KM1A 2YBDA 3LVBA 3ROGA 1AO0A 3E27A 3PFGA 2Q2QA 3FIUA 1JPJA 1RPTA 4D8XA 5F4BA 3GH3A 4K81B 2OENG 2X8AA 1U7TA 1WSDA 1XJ0A 3W2FA 3HBFA 4AO6A 4BMCA 1JH8A 1GKYA 1HL7A 2HX1A 3VTKA 3WGOA 1HPLA 2QR3A 2OKGA 1PR2A 3KU1A 1H93A 3B6IA 4HX5A 5TIIA 4ZIRB 2V97A 2M32A 5L3RA 2X9VA 2PZMA 2RK6A 3IQXA 3QPBA 1MW8X 4RD6A 4RDXA 3MJSA 5G2OA 3W06A 1Y6JA 1I5RA 3L4BA 5MN5A 2JKVA 4N4AA 4ZK6A 5EXDA 1GA1A 1KPGA 1MVNA 2FP3A 3ESDA 4JBXA 2I54A 4EVRA 1RYEA 4CCYB 2HJVA 4PLTA 4DYVA 2PUGA 1M0SA 2WU4A 1UANA 4JC8A 4Z7JA 3U09A 1PUIA 4I3GA 4N1AA 1XU7A 5A3QA 3NUZA 4AF8A 3NUQA 2EEZA 3L7MA 3MZ0A 2IOHA 3FNEA 3KPVA 3TKYA 4BX8A 3K9LA 5T4HA 5MFPA 1YVPA 1NYRA 3QKSB 5EESA 1IM2A 4KLRA 4QHYA 1LW7A 2P30A 1XCGB 3JQFC 4V24A 2I22A 4YC7A 4EL0A 2EWWA 2FSVA 3FFXA 8GPBA 1WQ1R 3EXG1 2BUCA 3A1DA 3FX2A 4FONA 1M5TA 2LGJA 2R2GA 2PD6A 3JWIA 4L8WB 4X1KB 2Y93A 3VJMA 4KQKA 1O97D 5EXSA 3QNMA 1I3CA 2ECFA 2HZBA 1ZU4A 4URFA 1DGQA 1AKUA 2X0KA 5HMMA 4M22A 3NXKA 1PP4A 2J09A 3WOVA 1GFZA 4HNUA 2D2EA 3DNPA 4MO2A 4UMFA 2JARA 3B51X 4LDPA 2J0EA 2QVYX 5DBGA 4YAGA 1U28C 3OCZA 1CR0A 3DWEX 3M6AA 1GNSA 2FUNB 1VL1A 2IVFA 1ZUWA 4HPJB 2COUA 4D4IA 2NUBA 4EI8A 5CD1A 1R6VA 5CITA 2FDCA 2QMUA 3FTEA 1EFAA 3IUJA 2GK4A 1JDBC 7MDHA 4CM1A 3IO3A 4OXQA 1IDN1 2ZKIA 2C97A 4PSVA 5LQNA 4US2R 2X2PA 5FFFA 2YTZA 3AL2A 1U8TA 3LY9A 1GZ5A 5BO5A 4AROA 2DHQA 3HYTA 4I9NA 4LV6A 1X9IA 4Q47A 2X8LA 4PTLA 3GEGA 5CB0A 1J97A 2CZGA 3K6JA 4JLVA 4R0NA 3SSNA 4UZFA 9GPBA 3G7NA 4DJDC 4XX0A 5CPBA 4IJQA 5JWHA 4B3HA 3WL3A 1PFQA 3ON5A 3CJRA 1WX1A 4DQKA 2VLIA 5D85A 4XD7D 1A8SA 4BLQA 3ZJ4A 1SG0A 2DUMA 5HUHA 2EG9A 3N07A 3GN2A 4HEA6 1ORHA 2Z04A 1A8UA 1A27A 1MNQA 3HRHA 3G68A 3TAUA 5LM3A 4FFPA 3CONA 3AY3A 1DKMA 1ZMRA 1MPTA 4TS4A 2A0XA 4OO3A 4U1RA 3FOCA 3WQQA 4HF7A 4KFSA 3QVLA 5AM5A 5KSZA 4EHKA 3A31A 4NBUA 5TQVA 3CLHA 5LXTF 1VSTA 3C7TA 2QRVB 4KAXA 3EWAA 4BGEA 5LU9A 3LY8A 2FQYA 1S3IA 2I5PO 2YDYA 4W82A 3R76A 1OILA 1QM5A 3OIVA 1PT5A 3GPBA 2ZROA 4RTKA 1EE1A 1DX6A 1FRNA 2P2GA 3Q1LA 3EZNA 4TXNA 1A04A 2HV9A 2WAOA 4RO0A 4TQAA 3ZW7A 1ZR2A 1F06A 2CB9A 1OI3A 3PCTA 1KU0A 4PO3X 1AH2A 1BQEA 1H1TA 1IQ0A 1UK9A 2IEGA 3DE2X 3HE3A 2IYZA 1QVWA 4IDAA 2CXXA 1KI6B 2R7KA 4W7HA 1Z6YA 2QQGA 3U7IA 2BFFB 1HQKA 1XUOA 2HJGA 2I66A 2WNSA 2HMVA 5HZKA 1A9PA 4BJ5A 3HWX1 1G16A 1NW5A 2X9QA 4ZCPA 2CSXA 3D8HA 2W90A 1MQAA 3DEIA 3R3YA 1EWTA 3HVJA 4A5SA 2H9AA 4GIBA 3ZYZA 2NAFA 1ZK3A 4RETA 2X4LA 4M0LA 1JFTA 2NXEA 2FZCA 2W6OA 1JDUA 1A8HA 1O6GA 2YJTD 3AYXB 3WQHA 4D44A 2X7HA 1NQWA 2FR0A 3FSRA 2J0UB 5L51A 4C08A 5F3DA 4QUHA 3ZX5A 2J67A 4G0QA 4JKOA 5EE5B 3SJ7A 4Y9UA 3ICEA 2J3MA 5CX1B 2Y05A 1JT2A 2AQHA 2QQ5A 4X8MA 4EK9A 5IVHA 4NNOA 1T5IA 1CR6A 2YRFA 4LMRA 3VYRB 2PD4A 4DPLA 1YFKA 1WCXA 4B3GA 4PINA 2PCJA 1MUUA 2ZR8A 1JFFA 2J9YB 1BGVA 3U4HA 4JT4A 1FDSA 2GS9A 3DDZX 4P82A 4YQEA 2Q7OE 4EBFA 1KJIA 2Z95A 3N2GB 4J7XA 1H2RS 3EGCA 5EZYA 5BPHA 4PCUA 1L4BA 4DA8A 1VDZA 1FYEA 5DSTA 4AWXA 4EGFA 1F7UA 3RM3A 1IM8A 3GFOA 1U2ZA 5B3AA 2XCRB 1CQXA 1XTVA 1O0SA 2AEJA 2IDJA 1Q7RA 2JIBA 4MQFA 1DMSA 4CR6A 2UYCA 1XT6A 1PDOA 1T8YA 2FPIA 2I2CA 4CVNA 2XRZA 1KWKA 2X15A 1PJ4A 1PS9A 3OMLA 2NIPA 2FWRA 2BFBB 4MYCA 2W98A 1JALA 3MINB 3MMPA 4H2DA 4LYHA 4IF6A 4BO9A 3KTAB 3FSGA 1B2LA 1NKSA 2BKVA 3AETA 3OM9A 5HF5A 1KJWA 4LJ6A 1KO7A 2E87A 2GPNA 3OD1A 4DM4A 4DJEC 4MWBA 4ZQHA 3L4BC 4A23A 1GNLA 3BICA 4ZXFA 3CGGA 1II8A 3B6KA 2BPOA 3SMVA 3FA2A 1NW3A 1GPYA 2VJAA 3PXAA 2I2WA 4IOKA 4E2FA 1YR7A 5DGCA 1MGPA 1XLVA 3EIQA 3V6MA 1R5BA 4MUEA 4HXFB 5DO9A 1V8ZA 3KQQA 4UARA 3MA0A 4BBJA 5HFAA 1OC4A 2WVGA 5C51B 3OPYI 1SHKA 5CMLA 1P9LA 3GYGA 3R3VA 5B30A 2XZTA 3UPTA 3OPYB 1JDSA 4P7FA 1Z5ZA 4QG7A 2UYOA 4P7KA 2N9UA 3FVTA 4Y2HA 1EJ0A 2EQBA 3KAKA 4ZZ2A 2YW2A 2IW1A 4G81A 4P58A 5DBHX 2H1CA 2FSVC 2VKTA 3QRWA 2L42A 4KE7A 4PXSA 1Q7EA 2E4XA 3ROPA 2XV1A 4YJKA 3AZPA 4M3NA 3KHUA 4I2NA 3R4VA 3UHOA 1L5NA 1X7DA 3GJZA 3VTAA 1DAEA 2W2TA 5TEWA 1Q74A 3FZQA 3HK2A 4NU6A 4Y6OA 1QGUB 4YROA 3ZCRA 4Q4JB 1KYIA 3T99A 2AK2A 3K5HA 3VO2A 3WGQA 2PD3A 1DQSA 1J5XA 3L9WA 3H2JA 2FG7C 3OO0A 4RGYA 4XVRA 1MB3A 4XFDA 5BRJA 4LGMA 4NABA 5KHLB 3ROFA 4RA6A 1UBFA 1ISMA 1T34A 3B3JA 4QDXA 4LF7B 2FEPA 3RGWS 4DSNA 2Q8PA 4F8JA 5EMMA 5AVOA 1DQYA 4LDZA 4MDEA 2B61A 1KP9A 3O4VA 2DKOA 1B1AA 1J2EA 221PA 2C78A 3OP1A 4CN9A 1ZZGA 3BVPA 4LC1A 4AJEA 1UBTS 5DM4A 2MSDB 2KMLA 4ON9A 1NI3A 3PFHA 1GVNB 1TF2A 2WHQA 4JNCA 3PC3A 1YFZA 5FTMA 3M1IA 5CLFA 4KIWA 1M2OB 3WBBA 1NSTA 3TLGA 2WFAA 1HE1C 1ZP6A 3EIEA 4U7FA 4URVR 4QUEA 2XTZA 3E81A 3H2IA 2H1IA 3B53X 3PC8C 4OU4A 3T9AA 1LLCA 3WLPA 2IH4A 3LF2A 4F4FA 2FWPA 5L3QB 3FBTA 1Y33E 1QIIA 3I8SA 5MN6A 2W2LD 4RANA 5K3SA 2JK0A 4EPRA 4ZOAA 2OV2A 5TNXA 4LOLA 2XYHA 4FFVA 1ZM9A 5AKGA 4YI3A 4DMFA 5CDHA 3SQXA 1T6ZA 1K2WA 2HLDD 4FTWA 4X7MA 3HFSA 3K1AA 3UANA 1MRZA 3LOUA 5JTTA 1YJ8A 1Z07A 5D1NA 4QJ4A 1FBNA 1YWGO 1KZ1A 3F6SA 3CCBA 5FPQA 2BKEA 1VKOA 2BDEA 3H86A 1WXIA 2VEDA 2ZEJA 4PN3A 5EHZA 3B9QA 3BKXA 3OZTA 4XD2A 2X1MA 1SIBE 3NP9A 4BL5A 5A9RA 1KKLA 3DFKA 3EW7A 4LYYA 1JEQA 1IIRA 1OFUX 3U0BA 3CM0A 1TD1A 2NQ8A 2N46A 2ZJ0A 1CJKC 5J2TF 4DF3A 3QG5A 1PT8A 4IDPA 2B4AA 4PS0A 1N34B 2K7ZA 2DX7A 3UMGA 3QYJA 1AQIA 5DB4A 4A6XA 5COBA 3WGMA 5SYNA 4KL8S 1MEJA 4CKXA 1EH5A 1UR5A 4BATA 3GEIA 2HCFA 1TGYA 2XIJA 3DJFA 1UF9A 5L8VA 1NM5A 1FIUA 5GZ6A 4DLAA 4MR9B 2CNDA 1JPVA 2A3NA 2WC1A 5CJ2A 3RYHB 4GBMA 1VLVA 4F8YA 3IHTA 1RM4A 1W4CA 2VP4A 3OIFA 4Y30A 2I8AA 4OD0A 5FLXA 5JNVA 3VNVA 1BXRB 2VQDA 4UU0A 2IZ1A 2K87A 5IMSA 4GKKB 3TZBA 2XXJA 3UGKA 3L05A 1W0KA 2BFCA 2J9FB 3DEHA 1GGKA 1OUMA 2VCEA 5EIEA 5BMVF 3MEQA 1DDIA 5KTMA 1F2VA 4M86A 1Q1ZA 1M7GA 3UYLA 1P4JA 1UBGA 2PM8A 5TMEA 5IDXA 1Y9AA 1AMNA 1DU4A 4N0MA 2Q2OA 1HEYA 1KK2A 3KSZO 2QB5A 3SSAA 3MJFA 4MR7A 3ROXA 1OX4A 1E89A 1P39A 4HDCA 3NVAA 4AZTA 1KMIY 2JCVA 4M4SA 2RHHA 5FP0A 1FRQA 3CU5A 3I6BA 3N5CA 1WXFA 3C1UA 3L01A 4U6NA 5BNTA 4MA4A 5CB4F 2OZEA 2OO5A 3D8TA 1HSOA 1L7MA 1QVAA 3BGVA 3BZWA 3KIPA 3RV4A 5LP6F 1M66A 3H65A 5L6LB 4RFSB 1YNSA 1I7SB 4Y7CA 4BQEA 3I76A 3IJRA 1J8VA 1SVNA 1N5DA 5LXTB 3AM3A 4WK4B 1YZKA 2BZSA 3WQRA 4C06A 5KQGA 2ZE8A 1U7OA 2XCQA 3O91A 4XJXA 5FLEX 1MJ5A 3UGJA 4NBVA 3PKIA 1QP7A 4JVNA 5J4HA 5HFNA 1ZUHA 1LFDB 2HLHA 2Q4BA 3FFTA 2QL7A 1B8VA 1PWXA 3RVDA 1ZU5A 4DGSA 1U4NA 4WFIA 2C8JA 4FQ7A 4PX3A 4ARZA 3W04A 2QK4A 1ABEA 1KZGB 1M8FA 4MW2A 4WZBB 4CM9A 4C4YA 2OHOA 4MUAA 4PNZA 2RH8A 2IOYA 2I55A 5K0LA 1JIKA 3PJFA 5A5DA 2C1XA 5EAIA 2J08A 2IYQA 1VE6A 3HWRA 3ZDQA 2WJIA 2ZRFA 2O05A 3BJRA 3A3KA 3ESAA 5FKJA 4X5OA 4ZYYA 3PXCX 3Q8LA 4IVPA 1QFSA 2H2DA 1RKUA 1C8VB 4YP9A 3H18A 4GWGA 4IUCS 3RYFB 5IANA 3FOZA 4TT3D 4DR6B 2R68A 1ULBA 3MB8A 2G8LA 4R9VA 3GJXC 1X80A 4Z49A 1AZWA 4ZGWA 3NC1C 2IKSA 2RGEA 3TJZA 4M7PA 1NVUQ 4NRDA 3FUVA 1X8JA 5EXPA 4E11A 3K94A 1GCOA 5HVNA 1VBKA 3FYCA 3V3TA 4JYZA 3VV3A 1PVVA 1F1BA 2EW8A 4K88A 3FCSB 1UFRA 1RTTA 2GFQA 3K53A 3P26A 3MCWA 1FVOA 4W5RA 2YJZA 3R6WA 1GZ6A 3UM9A 4LZOA 1LDEA 1FDTA 4BGVA 1YBFA 3C6MA 4N8DA 3NVKI 1RAFA 3C6XA 2PA0A 5H0IA 2JLCA 3AVPA 3CVJA 3HBNA 4N40A 5DM2A 3DE1X 3TRJA 1RJFA 2Y6UA 3V42A 2D5CA 1JYSA 4UNIA 1QG2A 3TNDA 1X1DA 3AJEA 3MUOA 1UP4A 3EEYA 4WKGA 1Y5MA 4Q1FA 5AWFC 3UENA 3HR8A 1NATA 2W2OA 1RABA 2PFSA 3CLRD 4CU2A 4BPRA 3KBOA 4BCDA 3QVMA 1FP2A 1MORA 3PQFA 3PCRB 4QHTA 5E8JA 4IINA 2HWXA 3TWOA 3AOEA 5BRNA 3CWCA 3QVJA 4GXTA 1WUIS 3FJYA 2AQIA 4LCJA 4QTTB 3CJQA 3R44A 5GP1A 4YIKA 5G0TA 4JI8B 2BMFA 3NKVA 2C5AA 1N1EA 3M9LA 3FOBA 3DKPA 4OCZA 3RS2A 1B74A 1Z9BA 3UQYS 4DQXA 3P0HA 2M6SA 1ZUIA 3I53A 3T7TA 3EPJA 1J5EB 2Y1DA 3A32A 3GRCA 4L5YA 1KJ8A 1GPAA 1PJBA 3F46A 3TFWA 3IMEA 1W36B 1BA3A 3D6TB 5HRAA 2FZ5A 2ZIFA 1GTRA 1Z06A 5SYAA 4QXAA 2QNIA 3B3AA 1LI5A 3VHXB 3JQGA 4UHCA 4MPRA 4ZP1A 5FAXA 4C14A 4CHGA 3AF3A 1POXA 4S0XA 721PA 1HLGA 1RXSA 1SULA 1U2PA 2UUOA 3BMCA 3H1GA 1OXBB 2H1OA 5JD3A 1TPYA 3M70A 4Q7JB 4IGIA 4B7XA 2Z3WA 3DZHA 1ISHA 5HA5A 2ZRKA 3GNLA 1E8DA 5DNAA 4OHXA 3UB2A 4H1TA 3ASYA 4EYQA 1QAMA 4ZC8A 3INGA 4PAQA 4IQ4A 2X7JA 2X58A 4DQLA 1I80A 2A57A 3ET4A 4QOGA 1UC5B 5CT9A 1S3FA 2XD9A 1QNLA 3KPUA 3T3PB 4ZO7A 3T41A 5DIFA 4YLEA 4BUZA 3VKGA 3LX6A 4PGHA 3MT0A 4YHHB 1J8QA 1QO0A 1GZ3A 2P3QA 2ZCUA 3GRFA 3KJZA 4GP7A 4TYYA 4OXNA 4LSZA 3K05A 4HJXA 2G3YA 3AF1A 1N0IA 1NM5C 2K6GA 4PZAA 1N5MA 4EFDA 1ULUA 4ZGBA 2Z58A 3GAAA 2IX3A 1H2BA 4G89A 4G1BA 4RCVA 3ZUGA 1XP8A 1D6SA 3LLUA 2A1UA 4MV4A 4R0VA 4E31A 5H4GA 3RF6A 4NCJA 3HU3A 2B5VA 3ZDXB 1VE3A 2V9CA 4K6MA 4G25A 4UJ3A 1QG0A 5A7GA 4B4OA 3BGIA 4ND5A 2C2XA 2MINA 3PUHA 2GK6A 2YZ7A 4LK3A 3RRYA 4YXWA 3OQOA 3FTCA 2C4TA 2CLOB 2QG6A 5KYNA 3MJEA 4Q9IA 1E2JA 2FVYA 1M54A 1PTKA 2C82A 1E4EA 1R0ZA 2XCLA 3IILA 1S1MA 4FM9A 5IAKA 2Q8NA 3HCAA 4FX5A 1PR3A 2E5FA 5DT9A 2OXFA 4MB6A 1SZPA 3WV4A 5KNBA 4NCAA 3A6PC 2VDWA 2DP4E 5CA1A 4AECA 3E7PA 1ZH8A 4INOA 2QT0A 2OO5C 2AI2A 1S7GA 5D7BA 2QIPA 2WG2A 5A3RA 1A9YA 3HMKA 4HWSA 4KWHA 1ZJZA 3SEQA 5A3JA 1GAEO 2Q4DA 1CZRA 3QFTA 4CIXA 4AKHA 4QEZA 3LBFA 5IUKC 2A5DA 1YR1A 3TUZC 1CY4A 3G9UA 3MWJA 2OCIA 1XRSB 4Q1CA 2XWSA 2ZIEA 3UWMA 3N7UA 1PWEA 1WCIA 4MGEA 4WL0A 4NEHB 2GPSA 1W93A 2IZ5A 3MXOA 3ZK8A 4MCAA 5M3BA 2Q0HA 4KODA 1IN4A 3NEPX 2QM3A 1CQPA 3TQQA 3DDNA 3JWEA 3ZHQA 2G72A 3ULKA 1YCGA 3LO8A 1V7CA 4GKBA 1XWFA 4E5NA 2C2MA 4K3VA 4KYUA 3PUIA 3GMIA 2ZETA 4OHUA 4B4KA 1ODLA 3AKDA 5C80A 1NV9A 2ICAA 3NS7A 4QYIA 5U1PA 1NLMA 4ILKA 4GZ3A 3WNVA 5REQB 2IK8A 4OEHA 2PYIA 1NLUA 1DSSG 3WLIA 2VRCA 2AZ4A 4TKVB 2BE7A 4I81A 2X4GA 5ABPA 3H8JA 2VOEA 1RW4A 3GJSA 1N8TA 1T35A 2HJRA 3L6EA 2ZQ5A 5KTOA 1J22A 1XRLA 1YZTA 1XKXA 3LWBA 2F67A 1XTKA 3FYUB 1PW7A 3A0UA 3SN6A 3GZNA 4BAUA 2P11A 3SAJA 1SQ6A 2JHAA 3LUGA 2VJQA 4F38A 3DEAA 1EKXA 4IG4A 3RYIB 5AK0A 4CR7A 3PQ3A 1ZISA 2BFNA 3ZKAA 2EVWX 2J4DA 1SUFA 1BH6A 1R2QA 3EXEB 5L3SB 1U5AA 3COYA 4BV3A 2CXQA 3WLMA 3QOXA 2VHTA 5J63A 1I24A 4JI3B 1G3QA 5C7LO 3DBLA 2FTKE 2ODPA 3BE6A 4WE3A 5FPKA 3WK8A 3TNJA 1JH9A 3AOEC 2PX3A 3NYIA 3V33A 4JUAA 3NKFA 2JCXA 4RHUA 5EINA 1HDCA 1HXHA 4OV6B 5FRDA 5ERXA 3ANMA 3SKXA 3FPFA 1WWKA 3AIKA 3G5UA 3JD4A 3UMBA 4MKFA 1W49A 5LLDA 4XVCA 5KQLA 3DMNA 4ENSA 2FSIA 1DTWA 2VBCA 2C5GA 2CKMA 2ZRJA 3F0TA 1GG2A 5F12A 3IUSA 1LK0A 5A5EA 3CFYA 5I9NA 3SOPA 4ECAA 4P83A 1ULAA 5JQGF 1XZMA 3QK7A 4X64B 1QTQA 2BEVA 5CH5A 5TR9A 2QUBA 5JSZB 1NVBA 3VQTA 4UNPA 1SHLA 2WDZA 3TIIA 1WULS 2FW6A 3DE5X 3LCJA 1B76A 4H7IA 4DCOA 1KL7A 3SE7A 4PTZA 3E4DA 4IHJB 3DZGA 3KHTA 4H7FA 3V8RA 2IOQA 3L06A 5B1DA 3BD6A 1DXHA 3QJGA 2ZIUB 4WBSA 5G02A 1RPZA 4GW3A 1P91A 1C7ZA 1MJGM 4NAUA 4ZAYA 2NU9A 4DV2B 3I30X 3PR2B 1LBEA 1MRSA 2XCSB 1TCAA 4ZHQF 1BHJA 1FTSA 3L3BA 2VHUA 4EENA 2WU1A 2XB9A 3LX4A 2HZ7A 4JBWA 2BT4A 3HG7A 3OZDA 2IODA 1RQGA 1REQB 3QSGA 1D2AA 3Q72A 2BM8A 3BDIA 3UJBA 3PNLA 1NIJA 1QU3A 3NUGA 3LUBA 4DV5B 2HT1A 1NLYA 2XEXA 3JQAD 1B6SA 3WIDA 1VCIA 4WV3A 3ZBTA 1OFGA 2AG0A 3NBFA 4XGNA 2QT1A 4JI1B 4FCWA 2R6ZA 3ETEA 5JJBA 2Y1FA 3O7MA 1EI9A 4K2AA 3THWA 4BLVA 2AJBA 2BMJA 4WHMA 1RXIA 3VUFA 4M0MA 2HSDA 3JQ8B 4Y2PA 5DHPA 5ALPA 5EVCA 2WWVD 3S7TA 1E3SA 2WKWA 2CCJA 16PKA 3CURA 4RWEA 5ALDA 2RE8A 4MAMA 1N33B 1LPPA 2PNFA 3P4UA 3QWIA 4N5MA 4F8EA 2OWDA 1RDFA 4HQFA 4RZQA 4Z4CA 1A4UA 2HJHA 1X6VA 3IIEA 2HU5A 1GGEA 3ZE6A 3NHRA 1F8XA 5DYWA 4BQNA 3CF2A 3OEEA 2CJWB 1H05A 2VPXA 4W6QA 4CMJA 2GAAA 4E3WA 3VX3A 5BSGA 4LF8B 4P9NA 5CTAA 4R8KA 1L3CA 1U7DA 5JC1A 4INZA 5KYKA 2H6EA 1NVVR 1SC3A 2VCYA 3O9ZA 2RHTA 3UAGA 5EG5A 2CFTA 2QX8A 2OBLA 3C48A 4IR7A 1DCTA 1TU4A 2O3QA 5BV0A 3NT2A 4P53A 3D0KA 5KYYA 2BBWA 4PWZA 2V3WA 2H0RA 1J2UA 3DDUA 3X1DA 3MJ4A 4A6PA 1TTTA 5JS1A 1GFSA 1PW5A 3L0ZA 1QGDA 4HZIA 3O4GA 5CNMA 4CR8A 1FYWA 3DHVA 1HDXA 1DCKA 1NBME 2DQZA 3KKLA 3OCUA 4RF4A 4DIUA 4DG5A 4EHBA 1CNFA 1SPBS 3PT9A 4OQXA 3SM9A 1F12A 1T9KA 3D1JA 3R24A 1DADA 1VHWA 1L7OA 1CIPA 1ZO8A 1EMDA 2V9PA 5B53A 3KR2A 1PF7E 1IC6A 4JJZA 2IITA 2LCFA 4N39A 4P4SA 5FDFA 1AGXA 1VLLA 2CK3A 2RBKA 3ME5A 1XHLA 2GYVA 3OTGA 1NXPA 2B1QA 4FI3C 5KYXB 1XDUA 2CMHA 5EJ6A 1FRFS 4CG1A 3DW3X 3K16A 1ZN7A 2W6NA 2BFAA 3DH0A 3CKMA 1B0PA 3ZHZA 1OZ0A 2JJ1A 3JQCA 4E5MA 2PMWB 3ELYA 2G9NA 1N2SA 3PDIB 1MPXA 3I5AA 3TSOA 4QU0A 2IYSA 4QSMA 3RIGA 4DWJA 5LQKA 1AGYA 1UXJA 4FHFA 4TTIA 2DPHA 3X1KA 1EUCB 4H27A 1P18A 4EHHA 3CYFA 5JNLA 2GD2A 1EX7A 4KFRA 4WLOA 3U7EB 1RPJA 5JVDB 1EP3B 5CB8A 1WCYA 2NN3C 4L3OA 4PFJA 1GAJA 5ECYA 3RJ9A 1EVJA 4K6GA 1H2XA 3EPHA 4HB3A 3AVQA 5BWLA 4DSTA 3I04A 1NOKA 5ALUA 2DF8A 2C2GA 1WHTB 3ADKA 1Z6TA 4KE8A 5TPZD 4DLVA 4YAUA 2O59A 5G4KB 3NC4A 1Y3IA 5FOTA 4RSGA 1P1FA 3O92A 4J43A 5GJBA 1CU1A 2ALJA 1ZVQA 3CSUA 3NGXA 3PEFA 2CNOA 1DOHA 4WIAA 3UCEA 3ZCSA 1AGNA 1CUBA 1SG9A 1NLZA 3OT1A 1R8JA 2NUTA 4M38A 2PV7A 1G0NA 4IUDS 1VHLA 2QD4A 2OPBA 2C9ZA 3U7QB 3FWHA 3L2OB 2MDTA 3HKCA 2Y2VA 4LDRA 3AY7A 1CVLA 4N5IX 5IT5A 4NBRA 2G0AA 3CRNA 4WEQA 3F7TA 3THXB 3DLHA 5TQJA 4AJIA 3BB1A 1HQYE 3KYBA 3X1WA 4EX6A 1GL3A 3TZQA 1FUKA 2ECQA 4QPPA 5JISA 2F55A 4PLYA 3TQCA 2Q2VA 5AJXA 5JY6A 2VZLA 2EKZA 4ZICA 5AVYA 3M5DA 4K9NA 1Z2EA 3SZUA 2CL7X 3LBNA 5CGZA 5FADA 1I3KA 5BN4B 1Z38A 5ICMA 1Q77A 1OU4A 2LV8A 4P35A 1ESMA 1N2OA 1G2OA 1S2DA 2BHSA 2P3SA 1HTTA 3DMHA 3HJBA 3QPAA 4RK0A 4CL3A 5KVAA 4N8SA 2FPXA 3D7RA 4BEVA 4X24A 5KAPA 4MVJP 5FEMA 4D6YA 1FUUA 4LRTB 3KB6A 5K8JB 3MIIA 2LW7A 1CP3A 4KC0A 4CIAA 4OXKA 2HF8A 1NQVA 2HJSA 2P6RA 3ZJ5A 3AW8A 1BA2A 1C0LA 1LK7A 2DWQA 2WPNA 2P1DA 3I3SR 1OA0A 4MW7A 1B1CA 4RORA 4YEDA 1P17A 2UZAA 3UWPA 4F9TA 1T36B 4K0RA 4JZYA 5DBOA 3RVRA 4W5NA 2RK4A 3H2KA 1R6XA 4I55F 1W581 3P2YA 4UBMA 5KC8A 4AQYB 1GPNA 1I51A 4LYAA 4R9SA 1KNXA 4UEJA 4X7BA 3D1LA 4WBXC 2AD1A 3ZY2A 4I08A 3ZCVA 4G0NA 3IBFA 4R9NA 3QXHA 5EXXA 1Q0UA 1NJ8A 3D8UA 1DZIA 1ORWA 4UD2A 3UIEA 4WINA 3H19A 3SG0A 3WDKA 1DI0A 1YL6A 2ABWA 4XLZA 3B70A 1P73A 1NYLA 3DVRX 3QYPA 1HNNA 2WWWA 1A7AA 3OY2A 1T91A 3QHAA 1ADJA 3GPDG 3LU1A 4AJ4A 2D2VA 4HCJA 1V9SA 2F90A 4LRSB 4RPGA 3D3QA 5CCDA 3E5HA 1RKVA 1TQHA 3GZTB 3HYNA 4L95C 4Q4CA 5H9WA 1G7CA 1DHTA 2W6JD 1WXWA 5JROA 1CRPA 3TINA 4E94A 4QYWA 1Q0RA 3NLLA 2AOUB 2AYZA 2WHEA 4CMIA 2GB4A 3LZCA 4EB3A 3NDPA 2OD7A 5GAJA 4R8VA 2IY7A 4WSOA 4BGDA 3ODPA 3OUUA 1ZCAA 2V7WA 2WJWA 1N0HA 3ILHA 1MLDA 5FQNA 4ADSG 5HWSA 3WGNA 1UDBA 4DCMA 1UMCA 4MKGA 4C30A 2W58A 3LDGA 1GAXA 1Q92A 5CYPA 1T3GA 1UQUA 3ELDA 4DLUA 1BU5A 2JLAA 3EGEA 4REQA 2IIPA 3V7UA 1UMDA 5WRFA 1YASA 1QIDA 3AP1A 4NY1A 3SX0A 1GNPA 1WBJB 3D8BA 2A14A 4YUXA 2FOIA 2H5JA 1A9QA 3MPUA 4CCWA 5L6MB 2JFQA 2GPBA 2NTVA 3IPRA 1MO5A 4IUBS 4WOBA 1BN7A 1WCV1 3WJ2A 3JZDA 3VBEA 4MRVA 4IZHA 3GMTA 4I1IA 4J0IA 3SYRA 2J33A 3WMFA 1V2GA 1FRZA 3IUEA 4YRBA 3U13A 4G8DA 3EY4A 1VGVA 2XSZD 2PQ2A 4IMIB 3T1OA 1E9BA 4DMHA 1P2DA 3FYTA 4CN8A 4YJGB 3KSDO 3A6FA 1YGYA 3RSFA 3D3WB 4RA9B 3F47A 4CV0A 1SURA 3EIFA 1FPQA 4DMLA 4DXHA 1WXEA 2IE0A 2CW5A 4EEZA 1S01A 5JYEA 1YAJA 4ZKDA 5A9SB 2J4FA 2GJKA 2ISQA 1QDEA 2Z83A 2FZ4A 1II0A 2GZ2A 4OM8A 4HVCA 2BJHA 3RBZA 4TMFA 1VYUA 2C5HA 3HB5X 5HJ7A 4GP6A 1F9EA 5JFOA 4C5AA 2PXAA 3G0DA 4GZMA 5AKJA 5JH7F 1JNYA 2DWUA 3FMOB 2E0IA 4HL6A 1ZK4A 4X7RA 3K3PA 5D84A 4P2BA 4MW4A 2IU4A 4H3HB 2IYYA 2VJBA 1IXYA 1WKCA 4G5RA 4N41A 4RH0A 2BUBA 3SEZA 1L5HB 1NKVA 2R8EA 3JY6A 5AJYA 1CQZA 2D7DA 4CEIA 3DAYA 5KYTA 2GMWA 2F1IA 2POQX 4YJHA 3C6ZA 2A33A 2RAPA 3SKVA 4C7MA 4LKRA 2WWYA 1TA9A 4V0MA 2I1WA 4QYMA 1W4RA 2GDZA 4HNRA 4ETNA 1OFTA 3TQHA 4C04A 4C7OA 5BW4A 2YOHA 4HAZA 4RZIA 2Y2UA 1U04A 1IVNA 2XWPA 4MWSA 4MLDA 3NW9A 4MUJA 4AK9A 2YFYA 2VHJA 7MHTA 4B85A 4Q1BA 1VIVA 5E4JA 1KI3A 3LVQE 3TZHA 1M83A 1T9HA 4GGOA 1U0GA 1R5JA 2CYBA 3I32A 5JFTA 1NRJB 2O1WA 4OP1A 4AVYA 3FOEC 4Y0AA 1TZCA 2AGVA 2WU8A 2WYWA 4FFMA 3JATA 1SUEA 3NFRA 1FJ2A 4NC9A 3ZVLA 1UADA 5FWYB 3VH1A 1PL0A 5DGXA 2QJTA 1EX6A 3NT4A 1WNTA 4ZO4A 3KWLA 5JATA 4X62B 2QU7A 1KAMA 3L0BA 2ZWPA 1B7GO 1AHNA 3AEQA 4IW3B 4JQCA 2F00A 3MC1A 3JX9A 4ZZ1A 2NU8A 5HM6A 2MYTA 3RH0A 3W3AH 4RKYA 3DAFA 2FWNA 4WASA 1RWKA 3TLJA 2PXXA 2GBLA 3HDYA 4GBJA 1WP4A 2HU2A 1Q84A 1TRKA 1Y8RA 3BSWA 1NBMA 3OM1A 3PXUA 3TTTA 2EKQA 3ETNA 5JNTA 4J16C 1L8XA 1ZIXA 4S1NA 1MP0A 1ACLA 3T12A 2VUIB 4IQ0A 5ICCA 4NULA 2BFEA 5P8WA 3NATA 1FMFA 1U2DA 1Z4LA 3B5EA 5J2UB 2FE1A 1V1RB 4Q4HB 5ELLA 5JCJA 1OLXA 2HO4A 3AM1A 5GJCA 1QVRA 1PX2A 3NHZA 4AJ1A 4YGYA 1G5IA 3D7NA 2F17A 3C5WP 1ODSA 3IUQA 4ZQGA 5EIHA 1B0UA 3GLFE 3WK7A 4W63A 1CQWA 1E5VA 2H52A 2I91A 1KDYA 2B98A 3NHYA 1P77A 2N3ZA 3WJ7A 4D4HA 3URMA 1E0DA 2GJ4A 5BYJA 3EOBI 3GCDA 3H1PA 2QTNA 1WTAA 1SCKA 1D8AA 4PGGA 3FZGA 4IS2A 3M4XA 3QZUA 4EKGA 2RHMA 1XF9A 1SRRA 1M6VA 2HV8A 1EE2A 2IYPA 1R0SA 1AQNA 3K9NA 4U39A 2O8CA 3IE2A 1V25A 2HU7A 1GG5A 3FAKA 3I83A 2E9SA 2YXBA 4MVJA 1T13A 1KTVA 1NW9B 1B16A 3RVOA 1R0WA 2IHTA 2HWUA 1FEZA 3TRDA 2BIFA 4CIVA 4J4BA 2PUFA 3K2IA 4WKNA 4DCCA 1J7KA 3UW1A 2FCRA 1WXXA 3QU9A 2BGTA 5JSYA 1BS2A 4BQQA 1MIOB 4ISCA 4UCXA 5HF6A 2XRMA 3L1JA 3D6AA 2CJYA 4W99A 2QE7D 3ENKA 1NT2A 3BE5A 1RYNA 1RZ3A 1BMFD 3L7JA 3OM0A 3RT9A 5B64A 1SGWA 2XQKA 3HKEB 1FRVA 2HPHA 3STXA 4Q18A 4D42A 2XDQB 1CZOA 2JD1A 4K9SA 4GFDA 3DCJA 4O3MA 2FEWB 3U80A 4BV8A 5JEEA 1SUAA 1QLHA 3SLGA 5EERA 2Q1YA 2QHXA 1GUAA 3GMDA 3NVDA 4XAQA 4YUVA 1ADCA 4TWZA 1JDBB 4IOLA 4TV8B 5IUJC 1J39A 4OHBA 4R6WA 3ZGNA 3C7DB 3MWDA 4QLAA 1U3WA 4MGKR 3I6QA 8LDHA 1HWYA 2BKLA 3N6XA 1LI7A 1Z8DA 2JHCA 3UHFA 3E9NA 3GFBA 2CEAA 3KLOA 4XPZA 3SZ3A 1LCIA 1R16A 3HH8A 3VX4A 3K70D 1ZW1A 1W59A 6REQB 3ND7A 5EN4A 3MTJA 3V4VB 3ABIA 2CHGA 3QA3E 4HDSB 2IYEA 1RFGE 1Z73A 4G84A 1NRXA 2FMIA 2QUZA 1FLAA 4FZVA 3RF7A 2Q27A 1YBHA 4E3ZA 1PVOA 1RPAA 3BILA 4BX2A 3A04A 3BA1A 2P91A 2V7BA 1SBZA 3NBAA 3NTUA 4M0DA 5DLDA 3WQBA 1M1YB 3ZI4A 1VI5A 3AVWA 3SHWA 3OF2A 2IL1A 2OMKA 3OQJA 3SX2A 1TMGE 2YNMA 1THMA 2QQEA 1HY3A 3BHIA 4Q7LA 3ENWA 3KOZA 5EIOA 4C6TA 4KPGA 2V6JA 1Y0BA 2W70A 2CFOA 1WB4A 2R5FA 1JHRA 1SPXA 4U00A 1NVWQ 1SCUA 2MSKA 2WSSD 1Q1QA 4TLDA 5KJ1A 2NZ2A 1C3XA 2W2VA 3ANTA 1XXHA 2GTIA 2A9JA 1IWBB 4HDRA 4L85A 1TEVA 2MSCB 1XPRA 3TQFA 4CQMA 1E6EA 3E9QA 1IN5A 3T1TA 1WLYA 5FR1A 4EG3A 4L3WA 3F3YA 1LUAA 2C9CA 1TMKA 1OXKB 3VO8A 4GX0A 2LUOA 4XGKA 2XNSA 4AZ0A 1MAUA 5HYVA 4ALNA 3AV3A 3MS4A 1TYDE 3TX2A 4LQLA 1U0TA 3FDZA 3DD5A 3E7DA 4L4XA 1BMQA 2W93A 4PFKA 5DP2A 3V7WA 3W5BA 2AXNA 2WB2A 5JNRA 5KBYA 1YA6A 1DEHA 4PAWA 4PVCA 5LMUB 1K2VN 1PV1A 1TB4A 2HXGA 2OCPA 3O31A 2VHQA 3GD7A 4DUGD 1XDZA 2BEWA 4DADA 1U4SA 4IIFA 4A0GA 4IHAA 4B7ZA 2ZOSA 4BX9A 2PLRA 3MGKA 1L5WA 3BCUA 3D31A 3FR8A 1YCHA 2XYGA 4B2YA 1QK4A 1IBMB 2EIXA 1ZL0A 2QVCA 5TPWB 3UV3A 4QGSA 2CDBA 4QPNA 1M74A 4U0KA 5IABA 2P7IA 3HB4X 1EJ6A 1GOTA 3IAXA 3U3KA 2TMDA 2I62A 4E51A 1HFEL 2QRQA 1TNDA 3KEQA 5JTUA 1C80A 5ERYA 4H0CA 4RPKA 5AI8A 1IOLA 2WTNA 3HCRA 4G0ZA 2FEXA 4EYOA 3JPYA 4C2TA 2GVDC 2EJWA 2J6CA 3GLHA 4HXGA 5EQFA 4NBTA 2Q0XA 3UAZA 5F3WB 2CDAA 3T7IA 5BSEA 4U9UA 4GBED 4EKDA 4DXAA 4MGHA 3QLEA 2AD5A 1M2NA 3NBKA 3Q15C 5HCUA 2F43B 2GO7A 4PIVA 2KLBA 5BY2A 1MZPA 1JMYA 3IAUA 3PF8A 3KJNA 4FFBB 1FLNA 5AKEA 3R3JA 1E5TA 1IPEA 1ECFA 4LE0A 5DXFA 3R9XB 3U9LA 1MAWA 1O6FA 1EUDB 2DFNA 2GBLC 2I3DA 3GJTA 4MV0A 5DPMA 3KYCA 3GT0A 3QKUA 1XKTA 5JWRA 4GMKA 3F1LA 2PX6A 1ZH2A 2B21A 5BOVA 5B36A 4OMUA 2XJ4A 1RRMA 4JVOA 2QTHA 3LW7A 1KY4A 1ZOLA 2ZJ7A 4BN0A 4EX7A 1ZOPA 2CY0A 3O3NB 2WU3A 1Y7TA 5E9AA 5EZ6B 4ZVRA 3DMRA 3MWFA 2I2XB 4NCIA 4S1TA 3UH0A 4B47A 3K9FC 3JZFA 5FLKA 4FYVA 4M1TA 4QATA 4XUDA 1A7UA 4LFBB 3HM2A 4WLFA 4YRNA 3G0HA 5A5FA 1LNQA 3H8VA 2NZUG 2FZKA 2R66A 5DM70 1XZCA 4MWDA 5A6VA 1EAMA 2Z98A 1OXVA 2ETXA 1TEXA 3E23A 4MWTA 3WLQA 5CFMA 3KVOA 4AO8A 1DELA 1RWXA 2POCA 5LQSA 1R00A 4UNSA 3RVNA 5FCDA 1BQ4A 1EQUA 1NZJA 2NXWA 3TTSA 2OFPA 4B1FA 4Z86A 5DX8A 3LOQA 1BO6A 1E98A 4R2KA 4QVIA 3D43A 4UNQA 4AJLA 2CDCA 2VJKA 3LKZA 2QN1A 1IHYA 1DBPA 1X3SA 3V80A 3OCYA 1OGJA 2FFJA 3KQPA 1F0YA 1N7IA 4X45A 3DL0A 3N59A 4NPCA 3DAOA 3IUBA 2J8ZA 2PSEA 2VYFA 3IEKA 4DR2B 5FPHA 1KEUA 1T3LA 2IFTA 2PRYA 5LZ2A 3ZX4A 3PEYA 1LX7A 4JKYA 1GGJA 3D6UA 4B6RA 3I5YA 3WISA 1HF3A 1SCNE 2HF2A 4UUBA 3CE9A 5LSAA 2DHRA 3X1YA 1MABA 1VBNA 3KQVA 3LRPA 4PSKA 4BZQA 2C7QA 3HCBA 1F20A 4HK4A 4OGKA 1JILA 4AJOA 1FUEA 2A6PA 4QOIA 2BKUA 5D51S 5H81A 3F3SA 3LLMA 4JJAA 1JIXA 3GXOA 3HJHA 4NZYA 2ZR7A 4KE9A 1E5DA 4W4TA 3FB1A 4WI1A 3X2EA 1N9ZA 1TKAA 3G7SA 2I03A 4O4JA 3GJYA 3TIFA 4D8YA 2I29A 5LOVA 4QM7A 1IEQA 2IYTA 3F74A 3TX6A 3ZE2B 3OUTA 4XJVA 1RLIA 1QG4A 3MTEA 3G9QA 4I9GA 2NVOA 4UOQA 3RSOA 3F73A 5HHTA 2Y92A 1Y1LA 2Y1KA 5C4IA 3LK7A 4YRTA 4LOHA 3P9QA 3K15A 4L4RA 2CYCA 4KACA 5HCIA 3V9PA 2WG0A 2B8JA 2OV8A 3H0KA 2UYHA 3ZZNA 1WMBA 4QVGA 3R0JA 2BI4A 4XX0B 5G0WA 1GZ4A 1EFUA 3PJGA 1NA5A 5AOAA 3A14A 4U7PB 5TRTA 2OHIA 4ZPJA 3RR2A 3UUEA 3L7IA 4QUBA 3W7BA 1ND6A 2Q07A 2WF6A 1DS6A 1MXFA 2QTTA 3AWDA 1O0BA 4M53A 3HCCA 1JIIA 3U7FB 1IRIA 4LZLA 2FX5A 4ZZ0A 2N0SA 3FETA 1E1DA 4KQWA 3O4RA 1I13A 3E35A 4DUPA 2FF5A 4NEGA 4X60A 1BGXT 1L7PA 4F91B 2YCLA 1RQRA 4II3A 4CFZA 3C6QA 1G1AA 4REMA 4EAAA 1W36D 2ETVA 2GAFA 1N36B 1LBQA 2QN7A 2AF3C 5A02A 1UZAA 1FY2A 5KC9A 2F48A 1JSCA 3O2SB 4HV4A 1ZM2A 2VT2A 5HILA 2V7GA 4V0QA 3K96A 3K71B 1MD9A 3VU8A 3T3IA 2BSXA 2K4MA 2DFDA 2X2OA 3V4SA 4KZPA 5KOYA 3K0SA 2PKXA 4KR6A 4G56A 4QQRA 1C7FA 4BVKA 2CMFA 4RQTA 4XD7A 3F4KA 1R5NA 2ZYTX 4ZVSA 4C0SA 4C7JA 1CY7A 2QD3A 4XZ3A 3UICA 4BNXA 3D59A 3VR4H 4JJIA 3HY4A 5TT0A 2YBEA 3PLAE 4YJ2F 1DIHA 2WJGA 1QPGA 1P7YA 2YASA 4ESOA 1UMKA 3WR5A 1BVYF 1VIAA 2BZ0A 3DLTA 3PC6A 4MEBA 1E2NA 1E3QA 2JVIA 4BP9A 1G64A 3OJEA 1E3MA 4Y2SA 2HUPA 2CJPA 2RH5A 4ZRNA 4I4LA 2XRFA 2FMHA 4Q4DA 3OECA 3BFJA 4FP9A 3DSRA 3MS7A 5FX2A 1R1DA 3ENZA 1X94A 3D7LA 3OD5A 4KE6A 1C4OA 4M0CA 4F4DA 2YMLA 3KUDA 1SKUA 1L8QA 4F9GA 4PWYA 4YR7A 4EJ2A 3W2TA 4GKJB 2IU0A 1WSBA 2VTVA 1AVTA 2Z2YA 3D6FA 3GJ3A 3G2JA 1IY2A 1U9IA 3HGQA 1GGVA 3I2YX 1R18A 5EVJA 2GTHA 2PMEA 3L18A 1JFFB 3CCFA 3G1WA 3MTBA 4BZWA 4YMVA 5KWIA 1F2UA 4B9AA 3TFQA 5KIAA 3OFKA 2ECKA 4NDNE 4F12A 5EZYB 3RVPA 1VMIA 2X3UA 4E1VA 2WYIA 3ZKWA 4FS3A 1RLTA 1PQYA 1JR3D 1DEXA 1E3LA 5ENVA 2HUNA 3D3NA 3OQBA 4NP6A 5EP1A 4O63O 5BN5A 4DPMA 3PDUA 2WT4A 2HM7A 1WPRA 4KGXA 1QRAA 2D5AA 4MQFB 4DSAA 2REBA 4Q3NA 3ASUA 4ITRC 1E20A 3QW4B 1G7TA 2FPIB 4LTDA 5JAQA 3L8ZA 1H2ZA 3CO5A 4MRNA 4K0KB 1U1FA 1JDVA 3AR3A 1VECA 1W8DA 3CBGA 4DCGA 4PGFA 5NULA 1DV2A 2J5RA 3TSAA 5CHYA 5DYYA 3KQTA 4B5LA 4QGHA 4Q01A 5CFZA 4BXOA 1NMZA 4HTFA 3AETB 2YN2A 3EC7A 3NM4A 5EE1A 1XBTA 3LHSA 4FKZA 4IKPA 1OYVA 4ZANA 4EA6A 5K8VA 1TM7E 2KB0A 4DVJA 1UJ5A 2EG5A 2UYQA 1RRCA 5CURA 3F49S 1II8B 3OZGA 3PXEA 1L5VA 4Q03A 1Y3HA 4ALKA 4CF6A 1AQYA 1RHRA 4FXOA 5AIAA 1L7NA 2YICA 2OOKA 1X7ZA 5LBUA 2NU7A 3T6KA 5BV8A 2JHFA 2EHJA 4ZD6A 2FFBA 4N49A 4GXRA 4P4TA 4C7BA 1YFLA 1SZCA 2NUPA 1QGYA 3Q3VA 3B89A 1WW3A 3QX3A 1DEKA 1A2KC 1P61B 1NNUA 3OPQA 3ZGZA 1Q3TA 4G37A 5LQUA 4FBGA 3VV2A 2FG5A 1RRKA 3O2JA 2DHDA 3U16A 4GLBA 2DRIA 2WDPA 5I48A 2QUJA 1VKJA 2C9OA 2IZOA 2BEKA 2YZNA 4MI1A 5ENDA 3PPXA 3MTAA 2VBGA 3Q3IA 2FEMA 1UZLA 2V54A 3FWKA 2C2HA 2R1UA 3L8YA 4AO7A 4GWLA 5IKPA 4A8PA 2J48A 3MUEA 2WUGA 5BUZA 5IXJA 1NR7A 3D9QX 4Q7KA 3TE6A 1HYGA 4JP1A 1J21A 2QTRA 1S8NA 3KLNA 2EZ9A 3RI3A 3OLQA 4Q15A 4H17A 1EWYA 2Q1TA 1B93A 4W1PA 1U31A 1QX3A 2QGZA 3T35A 1CD5A 1Z0AA 4RA6B 4MVWA 1N6RA 1H5NA 3H4MA 3IEUA 3S2SA 2QP9X 2B8EA 3Q8MA 3LT0A 2Y1CA 1BZYA 4G4SO 3SCZA 4EB8A 2X5NA 3HNRA 5IVDA 4BJ1A 2FJUA 3SDSA 4K6FA 3AERA 2ZBRA 1CULC 4I8IA 2IGTA 3L9XA 2XCIA 10MHA 1W76A 2EKPA 3ORRA 4X44A 1M6NA 4O1IA 4DDTA 3M82A 2I65A 1RWQA 1HR0B 4LZPA 1ISFA 4O2BA 1Z17A 1AF4A 1SXJD 4CL2A 4NYMQ 3FUWA 1O97C 3TLGB 3F8WA 4HGOA 5KYWB 3MG9A 3FFBA 1S2NA 1VSBA 4G09A 2OV6A 3U6KA 2QMYA 1VHDA 1F6DA 2WAAA 1LBTA 1P2VA 1LK5A 1T5TA 2J7KA 4HUQB 3ORQA 5G1NA 1N4AA 2P5TB 3KXDA 3SP1A 1SXPA 4L73A 1FDVA 4LBWA 4EW2A 1TZJA 3SFVA 1WUHS 3GL9A 3RPEA 3VDMA 4BJHB 3E9DA 4G5OA 4POOA 2ERYA 1Y7IA 5FUMA 3K1AB 1T3SA 3IQEA 1I8TA 3DB1A 2XY4A 1GIAA 4HYEA 1ZI9A 4BMXA 2X5XA 4HN2A 4ENUA 2F3QA 2PE5A 4MSUA 1QMGA 2FPLA 2QAGA 5DLEA 2ZFUA 3MILA 5JPCA 1EXDA 1QTNA 1AKNA 1T26A 1T24A 2JS7A 3GLUA 3OJOA 4X65B 1JEQB 1RVV1 3DLPX 1RZRD 4ITVA 2CSUA 3PHJA 4FI3F 5LQDA 1ZRSA 3WYCA 1QYIA 3FTNA 3NKLA 3F78A 1R9JA 3A9TA 2Q9AA 3IA2A 4DKJA 4WZZA 2YINC 4IMPA 2BGLA 2X8WA 3R6LA 3I8OA 3CRVA 3I6MA 1GL6A 3K8YA 3C3DA 3I6ZA 3LGXA 1E18A 4JQOA 5I01A 3WLTA 1FK8A 4C07A 1U8EA 3FY4A 2W2LA 1NBIA 2R47A 1H2FA 1YR2A 4NDAA 3LUKA 4F46A 3AKZA 1J49A 4NDZA 4IDHA 1YTLA 2ZKLA 3N76A 4IJ6A 1PJZA 4CG0A 2ACKA 4ZAZA 2VF7A 2XUDA 1L4GA 2VJOA 3NTVA 5CIYA 1WETA 1IE3A 2BFWA 5K7SA 5AVXA 3Q2KA 1E9SA 2NTNA 2O7NA 3T9EA 1ACJA 5HTKA 4RMGA 1WOMA 3ZQUA 1NOIA 1SCDA 2BH9A 1ADFA 3JQ9A 1R50A 3T3MB 4B83A 3EVAA 2VHWA 1YOVA 2WP0A 4M9UA 4AP6A 4ARVA 2WWTA 4UOEA 5EQDA 1UFOA 2FDXA 3BK7A 3KZMA 5DOZA 5C8YA 2N42A 3INNA 1U9IC 2PQ0A 1FQKA 3ZU6A 2OVFA 1G291 2EFGA 3H83A 4B74A 1G6OA 3O75A 2MSLA 3O84A 3RUPA 4IXDA 5FPYA 1NAIA 2EKDA 3AUKA 2HTEA 2ZYWX 3PLNA 1OX4B 2L69A 2YJ3A 4MR7B 4YJ3F 5FH9A 1NQAO 1PS8A 3BF8A 1G5RA 3LX8A 3BFPA 1SUCA 1K7SN 2R8RA 5JD6A 1LTKA 1M1NA 1PR1A 2V6GA 3FWPA 4DILA 2ZRIA 2HREA 5KOJA 1N2IA 4YV0A 1D4OA 2Y1LA 3AP2A 3EVFA 3UG7A 1AXGA 5EJAA 2QZ9A 4HWGA 2IF2A 2XNCA 2PQMA 2GVNA 3DF7A 3GYBA 1CJTC 2EATA 4IZOA 4MULA 1M0EA 3LXXA 3TR0A 4U8GA 3WRVA 2NO6A 2FR8A 2W22A 4UMDA 7ADHA 2V0GA 3FRJA 1QKKA 3HPRA 4CFSA 3R9WA 2I1VB 4KTTE 1A96A 4FCTA 5KHAA 3B2QA 1ZDMA 5K6AA 1I2BA 1OHHD 3BN3A 4TSFA 4Y2XA 1GNRA 4XARA 5A71A 3VI4B 6CHYA 2G1KA 4RLSA 4CPDA 4BV9A 4X90A 3CR3C 4ARZB 1B3BA 3E3LA 4H1UA 1C9YA 3G2OA 4BTEA 3WBKA 1KEVA 1AKEA 1OTHA 4JT8A 3TZEA 1N7HA 3LL4A 3DCYA 3WGHA 4B6QA 1NFFA 1PDVA 4DJAA 2RSLA 2GPTA 1U2RA 4KQGA 2P5YA 4OHPA 5GONA 4QUIA 4G4GA 3Q3EA 4UAUA 1XJ5A 3BAFA 1R8XA 2ZJOA 1O6ZA 2LIVA 3GT3A 3OZWA 2M6KA 5IU6A 1VE9A 1R6DA 2PA3A 4HAIA 1TLTA 1Y7HA 1Y9JA 2BF7A 2J5QA 2GBFA 3H7AA 4HNSA 1X80B 2JGMA 2WM9B 1ND5A 2OXRA 4LUCA 2QPTA 2Z08A 4DIOA 4R5HA 4S2UA 4CYMA 5DJ5A 3NV7A 4EA9A 4OY3A 1SQ0A 1CY6A 1TVMA 3L1UA 3OJFA 4OP2A 1SU7A 5AUQA 4ENPA 3Q6MA 4GMHA 2PCLA 1YVRA 1H2AS 3OTQA 1Y9EA 4QEDA 4ZDWA 3I9FA 3NXSA 1F0PA 1KSHA 4BNUA 2N47A 4BKQA 4X93A 1E69A 5KNCD 4BLSA 2Q6IA 4KMMA 2H11A 2VPTA 5PGMA 2O1EA 5FUXA 1YOBA 3VVMA 4B3DA 4LYDA 1SVKA 2V55B 3IUNA 3A8TA 4FFSA 3RRMA 3ZXUB 1IVSA 4Z8YA 3VO1A 3GDOA 5DTJA 4Z3KA 3UGQA 4P7BA 3U7RA 4LHXA 2Q29A 3T52A 2NLOA 1E6WA 4CL0A 3JTEA 5K8UA 4LJ7A 3ZTYA 1M8PA 3LYUA 2AFIE 3SY8A 1HNZB 5JJLA 1YRLA 4TT3A 2WFZA 3TRHA 1ZGCA 2XYPA 1Q44A 3UC5A 1ZVMA 5AKXA 4RTMA 2XTAA 2FRDA 4EFLA 2VKQA 1KO5A 2AI3A 1JHYA 2EHDA 2ZAMA 3AR5A 2XXAA 1GT6A 3U40A 5DNEA 1JQJC 3NBYC 4MUKA 5ES4B 2XE6A 3ABSB 2Q45A 3WXMA 1K0FA 1K8XB 2H2WA 4GPBA 4EB6A 3KR9A 1KQFA 1U1GA 4PLVA 5DE3A 1H5QA 5DFAA 4ALIA 2NO4A 4DTIA 1TAGA 1Z37A 4UASA 1ZIPA 1G2IA 3M33A 1OY1A 3IMCA 5EHIA 4D9NA 2MHCA 3H1AA 2OYRA 3C16C 2VNAA 1R9NA 3TTXA 1NJ5A 3B38A 2D5LA 1QZXA 2G70A 2R79A 4IIDA 4NCHA 2QGFA 3JQGB 2Z57A 4NE2A 1AHPA 1R88A 4OB6A 1L8OA 1T1EA 2DJ5A 2PWZA 3BMCB 3E3OA 4MYHA 2QAGC 2F3PA 4O4LF 4P81A 2R97A 4RKWA 5AM3A 3H2BA 1JIJA 3QBJA 3U44A 4OX9B 1X42A 1PL6A 1NN1A 3WVNA 1CUFA 4MX8A 1O03A 4Z6KA 3Q8KA 1H9BA 2JLYA 1NUUA 4AXXA 4BPBA 4B0OA 3GRVA 1E60A 3I92A 2ZJ5A 3FNGA 4LTNA 3HP4A 1DKPA 3H87A 4XYMA 1U1EA 4I1OA 1IN6A 3UV7A 2DWCA 4HH1A 3HMQA 4BLPA 4I50A 5JAHA 3T34A 2P4EA 1IXZA 2L82A 4KQ9A 4K86A 1JA1A 1VJ5A 3OSUA 2GRAA 4N82A 2VP2A 1GNQA 1TA4A 1YA8A 2CKDA 4YECA 3PXGA 2BFMA 3NASA 1TQ6A 2FX3A 3Q7EA 1P8AA 1UUFA 4IXWA 2H9YA 3EASA 3EY9A 1R9MA 3R77A 3QUCA 4UDOA 4XB2A 4DFDA 4TLCA 4UUMA 1FXWA 1KK3A 3B1ZA 3H2YA 3K2QA 3QP9A 5JNUA 4B32A 3HXOA 1JSRA 2ZS9A 2A1UB 5AM0A 2I4NA 2G71A 4C4OA 4DLYA 4Q1AA 1GTMA 1IK6A 1RMYA 1IG3A 1VJ1A 2UZ3A 3M6FA 2ZZNA 1CY2A 3B1KA 1CNEA 3N8IA 1KI2A 4RJKA 1BMDA 2MINB 4BKRA 2AYXA 1L7AA 3H5AA 3O93A 4EDFA 5JCZA 1CF4A 3FW1A 2XLCA 1XMOB 1W2HA 2FZGA 2JVJA 1Q1EA 3FUXA 1FLDA 4PLFA 2G8NA 2FB9A 1E4EB 3JYQA 3FI0A 5BUCA 4IIUA 1GQFA 1FFCA 4NVRA 1NC1A 4PSUA 4YBRA 3EA0A 3NV9A 1G8MA 1R15A 1OBVA 3LD9A 4CT4B 4YIHA 1JKXA 3R8CA 2YC4C 3LJKA 2OM2A 2VDWB 2BGNA 5FOXA 3KVNA 5CA1B 1AE1A 2JFFA 5CT4A 5LZ8A 1G21A 1HE4A 2GBPA 2XRYA 3K8ZA 4HMOA 4JSRA 4NMMA 4MV1A 1S8FA 3SMQA 3ND6A 4JP5A 4QOJA 1NXSA 2AR0A 4G2TA 3ZH9B 3BHJA 1ZKDA 4DJTA 1M1UA 4G2NA 2DR0A 2XTJA 1KAGA 1N5OX 2HDWA 3UMSA 4H18A 1WCIB 1T6XA 5K6AC 1SU6A 2QI9C 2GDJA 4AJPA 2ZANA 2A59A 4BKPA 3E7XA 4DA7A 3A6ZA 1OGYA 2PLFA 2A86A 2O8FA 1H0KA 5MDHA 1GCGA 1JVBA 2BEJA 2OECA 2XF2A 2QU8A 1L5ZA 1W1UA 4M1SA 4S24A 2VPZA 4QTYA 1QTIA 3GLGE 1X1QA 4HWRA 1F48A 1H6CA 1Z88A 1Z25A 2EIHA 2XZPA 5K03A 3J81A 4FFRA 3N8DA 1LPAB 3TECE 3BIWA 4ENRA 5KTYA 3AOGA 4QYIB 4Y3UA 4HNTA 2BH2A 2QT9A 1IHPA 4GX2A 4H7DA 3A9SA 1H0HA 3QLUA 3WSWA 2DHEA 4KK4A 3SIWA 3DP7A 2FOXA 3LHDA 5EZSA 1GEGA 2IT1A 4B17A 5IFKA 2GILA 1OH5A 3G02A 4ZK2A 1F14A 3GNTA 3GPCA 4G5QA 4HH4A 4J1NA 4L4ZA 4YUAA 5FT9A 2AOWA 2OUKA 3L4KA 5JD4A 4F84A 5L45A 1FPMA 3CMMA 4DR5B 1HBJA 2VPYA 3WRYA 2XUGA 4AW9A 2V65A 2OCGA 4IVQA 1ZVJA 4JU8A 3GZNB 1I0ZA 2ZTHA 3M8KA 3TMKA 1P1JA 3LG2A 5EJ5A 1AKRA 3AUXA 4EGCB 4MK4A 3U2QA 5LJLA 3ZLVA 3GFTA 1QUEA 5JS2A 1CY8A 4IS3A 2WB4A 1N6IA 4BE9A 3OOWA 3ANXA 1GU7A 2VTEA 4UU7A 2DR3A 3ML1A 3NCTA 4HX2A 5LBTA 4O4HA 4FW9A 5FJJA 2PMBA 1WU8A 2VSOA 1G8AA 2OORA 2VK8A 4JBYA 1O87A 1YR6A 4DMGA 3DBLB 1RI4A 1HC7A 5HIMA 1L3IA 5CFQA 4C7VA 2PH1A 2EGHA 3KOMA 1OYYA 2FRDC 2CFSA 1T8TA 2P7HA 2W8BA 3QVXA 4MR8A 4U63A 3RW9A 3VZDA 2QL5A 1TE2A 4WNAA 4TV9A 3DBIA 5K2MA 1LSSA 2WNIA 3PJRA 4LJ9A 4Q3LA 3OQPA 1U02A 4LRQA 1PZEA 2G28A 1N7GA 4R1MA 4OJYA 5KREA 1DTWB 2Z6AA 3ZD6A 2M1ZA 4BVFA 3H9CA 2G63A 5B1IA 4ZQFA 3LV8A 3I9KA 3F71A 4G07A 1CYDA 1EZ4A 2BEVB 1GPMA 3HXKA 1NJGA 2NZYA 3M5PA 5DZSA 4LHZA 3H5RA 3P32A 1RRFA 1JX6A 1ORIA 3O82A 2VDPB 1RQ2A 5HIKA 2X5KO 1WVMA 4CG3A 2B8NA 1KR5A 3QENA 3A3YA 4JLMA 3RHFA 3I2KA 3ZWXA 2JRCA 1FF9A 5GMOA 5ECWA 1XL1A 2OO3A 4OUKX 3JQ7B 3LNTA 2EYQA 4HQOA 1ZH0A 2P6PA 2YYSA 3KQWA 3ESXA 2NU9B 1AMOA 1DT3A 2CLLB 4AT1A 5C8ZA 4F5WA 3S2GA 4EIWA 5J58A 5CVJA 1A5AB 2PANA 2ZXEA 1WDMA 2C7GA 5FBQB 1L9XA 1U94A 5I3CA 3L8HA 4GMDA 4ZALA 3JQRA 1S3SA 2VAWA 4DMCA 3A0RB 4TXHA 1U81A 2X0NA 4MW5A 1ETUA 5F5XA 5TJHA 3CN7A 4JITA 5LLTA 2PGJA 2Y0DA 4ZI3A 1TLFA 4V0RA 1ISIA 1DUSA 2ZSJA 3RFFA 5CD9A 1B0ZA 1AU9A 3THWB 3PS9A 4I5EA 1ZEMA 5FBHA 1O08A 2G09A 2O52A 3X0DA 1XA3A 3L1HA 1KO4A 1EFPA 4JAVC 1HUQA 1AM4D 4JFAA 1R0CA 2NG1A 5HIIA 2Z4TA 2ZQZA 1A3CA 2C84A 2MYUA 3UMCA 5J1SB 3WMWA 1NUTA 3RVSA 4D8VA 1AG9A 1KS2A 1KR2A 1QE5A 4MUIA 3AFHA 3WSTA 3DEYX 4KR3A 1QCYA 2Z5LA 4UTXA 2HQOA 2JFGA 4AI6A 4ZYXA 3A4TA 3T3OA 4FT4A 5B3JA 1GLGA 1T9DA 3WICA 1E2QA 2J7PD 3KVYA 3L6BA 2WSLA 4H7PA 1E8NA 1FE8A 3THOA 1PX0A 3H6HA 3ZV7A 3JQAA 4Q3CA 4WXEA 1C9EA 4TVKA 2JLZA 1EVLA 1JQKA 4OSEA 5B4UA 1XLUA 3ERCA 5KYYB 1NSYA 1RLMA 1AIPA 3VM6A 1WPGA 3AU8A 1UT8A 4DLZA 4JHXA 3KYDA 5GZ1A 4M2LA 5D3QA 4M7OA 1PJ8A 1C1DA 2EU8A 1K7XB 1UJMA 3LHKA 1N1GA 5CX4A 4JU9A 1RJ9A 3GG2A 3ACBA 4AMBA 3BWEA 3O1LA 5JXGA 3M81A 2ZP1A 1E7WA 1W75A 2AKEA 2G5CA 5EKXA 2WF7A 4PZ0A 4OYHA 2Q6KA 2P5UA 4PR0A 3B9RA 4JJGA 4P4SB 2DQSA 4QAJA 1XZJA 2A5GA 5JAUA 2Z2XA 1V3QE 1XRQA 3AFNA 4X6YA 4KWIA 2VH2A 3TCKA 2D7JA 4CDRA 3QVWA 3SDBA 2YXPX 2CMDA 3AEKA 2ZAOA 3L7OA 5ENZA 1JT9A 4G86A 3NPMA 5BW8A 3PTAA 1YZVA 4EMUA 2D1FA 3ZS8A 4P92A 4B45A 1FU4A 2H4XA 1O4WA 3DBHA 1PYOA 4UXIA 4WVLA 1XG5A 5TLSA 3ABRB 3QLUC 4I14A 1T1SA 2R4UA 3QFRA 1L8AA 3QVSA 2PKYX 4AY2A 1NBAA 4HRXA 3DTYA 5TF0A 3I2HA 2D6FA 1I6MA 2PPLA 3K20A 1YXMA 1Z4OA 2I6UA 4E07A 4D9FA 4ZGGA 4L5AA 3R7WA 4EECA 3NQ41 2DFTA 2B9VA 4U3JA 1T4DA 2QTAA 3YASA 5SY6A 4RTPA 3EDQA 3ROQA 5KCZA 4QT0A 1Z15A 3AGQA 3K2EA 2Q46A 1HG0A 3KTOA 5HKAA 2QVGA 2CNBA 3LIPA 5TGZA 2WJJA 4NV0A 1NVVQ 3DO5A 2PWBA 1XLTA 2VPQA 1E2HA 1KQ3A 2WZCA 3P7MA 3CPJB 3OT1B 1G18A 2NUTB 5F35A 2O0JA 4G26A 4OIFA 1SQ5A 4BNDA