3PT5A

Crystal structure of nans
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
320
Chain Sequence
IISPDYYYVLTVAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPSCHFNDIIPLTHCPHDVQDMQSYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALVKNPQNKFLGVCWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNDAPWFCGDTTWYWKENFPHAYEAIYGNYQNNILANIIFVDFQQQGARGLTNAPDEDPDDLSTGYYGSAYRSPENWTTALRSSHFSSAARRGIISDRFVEAILQFWRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NANS (YJHS), A 9-O-acetyl N-acetylneuraminic acid esterase
publication title Structural and enzymatic characterization of NanS (YjhS), a 9-O-Acetyl N-acetylneuraminic acid esterase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli o157:h7 edl933
molecule tags Hydrolase
total genus 124
structure length 320
sequence length 323
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3pt5A00
4RSHA 3SKVA 4JJ6A 4HF7A 2WABA 4M8KA 1U8UA 4DEVA 3HP4A 4S1PA 1ESDA 1FXWF 5B5SA 3PT5A 1V2GA 1YZFA 4K7JA 1K7CA 4H08A 3DT9A 2WAAA 3KVNA 1ESEA 3DT8A 3U37A 1ES9A 2W9XA 1FXWA 3BZWA 4IYJA 2WAOA 3SLRA 2Q0QA 4RW0A 4TX1A 3P94A 1Z8HA 1BWQA 4XVHA 4K3UA 1ESCA 2APJA 4OAOA 1BWPA 2O14A 4K9SA 1JRLA 3RJTA 1WABA 3C1UA 5A4AA 1IVNA 2HSJA 4JKOA 3W7VA 3DC7A 1DEOA 4I8IA 3DCIA 4JJ4A 4Q7QA 4HYQA 5BN1A 1PP4A 4LHSA 4OAPA 4JGGA 4JHLA 4K40A 3MILA 4NRDA 3DT6A 2Q0SA 2VPTA 4Q9AA 5JD3A 1VYHA 5CD9A 1J00A 1VJGA 5HOEA 1BWRA 1DEXA 1ZMBA 4PPYA
chains in the Genus database with same CATH superfamily
1TZJA 5REQB 3WYBA 3FFWA 2RCNA 1C8KA 3A1DA 1QGYA 2J07A 3GUZA 3L43A 2R6JA 3P0EA 2NNLD 3U4IA 1V9LA 4H7EA 4Z1MA 3HGQA 3HFJA 1REQB 2HUPA 1BH2A 5TS3A 4BNZA 1FMCA 1KPIA 4MWDA 3T12A 1IHUA 4U2CA 5AKIA 4C7BA 1U99A 4R9NA 5H68A 5IFLA 1T3GA 2P30A 1W0JD 3P5SA 1LV7A 1KH3A 4FSXA 1AQLA 2RB4A 5DV9A 4MVJD 3UJPA 3ZHVA 4LF7B 2EIHA 2V7BA 4E15A 4LY3A 4CETA 4G84A 4QU0A 1JXQA 3QPDA 3BWEA 2HXYA 3JWIA 1Q16A 4QYXA 1N92A 4EB6B 1PSWA 3MTAA 5ALLA 1G98A 3ENKA 3BSFA 4XQCA 1I7NA 3QBEA 1P44A 1SIUA 2DUWA 3M4NA 1WZCA 1K8YB 2I5PO 4M49A 3GELA 2PNJA 3T95A 3SU8A 2HQ1A 3AJDA 3QP9A 3HB7A 3E1KA 3TPFA 2PIDA 1VHDA 1JQAA 3AV0B 3DTVA 4L22A 4BY9E 2WAOA 4XIJA 4TTSA 3G0HA 3WNCA 3ZLTA 1NJFA 1FS6A 6ADHA 5L9AA 2NQ2C 4JC8A 4FGSA 4ZCPA 1VE3A 1E3EA 1AKVA 1TA9A 1U1EA 2ZUBA 3W34A 1KXJA 5JCJA 2ZTHA 5K0NA 3MT9A 2QTNA 4MDFA 3RAJA 3SS9X 3TZBA 1I1QB 1OVMA 1VFPA 2CZCA 2YY6A 4O33A 3QPAA 5JYDA 3LUAA 1NW5A 3D0QA 1XXHE 1ZOOA 1U9YA 3JWEA 3PEEA 1U9IA 5M7EA 1VDMA 1GU7A 1QQBA 3A4MA 5A5GA 2R1TA 1V9CA 5CLHA 1SHLA 3ABIA 5EPOA 1X80A 1UDXA 4N41A 3EGIA 3KOOA 5P8WA 2H4YA 2Q4EA 3DZDA 4EUSA 5HZKA 3B1JA 4XSGA 5HZMA 4GEKA 1ZA2A 2XITA 3A36A 4KIGA 3O84A 4OP1A 4YRTA 3IR5A 4DIKA 5FLEX 4PAWA 2W00A 5HE8A 1TEVA 3FR8A 3R5XA 2ZIFA 4IDEA 1I3NA 1MDBA 3ITDA 5ITVA 4JUIA 1IXZA 3GLQA 4F4FA 1L1EA 1OKKD 2WPNA 1HNZB 1ULAA 2JBAB 4WHMA 1C0PA 3DTVB 4HQOA 4QTZA 5K0BA 1LS6A 3O3MB 3ZBUA 4PYJA 1GLNA 1OPRA 4E2WA 2GPSA 1OU0A 2A0XA 4LHEA 4LSGA 1AOXA 1CW2B 5BSTA 3ZPXA 1J8MF 1H5QA 4AJLA 2QSUA 4DLZA 3VPCA 2DQKA 5DP2A 1IIBA 1JDBB 1NW4A 2YWFA 1EGAA 4G5HA 3NOQA 1WUIS 5BVHA 2RE8A 4ZZ2A 2WJ3A 4XM2A 1J00A 3LP8A 3D6NB 1JQKA 4XB2A 5J58A 2REOA 4BWVA 5D6OA 2HH9A 1RYDA 4BN0A 2XQKA 2FCRA 1I2DA 3CU5A 3FWHA 3LYAA 3GFBA 3GFPA 4HNAB 3SYNA 1HBJA 2ZJZA 3D4LA 3TRHA 1M8JA 4CR6A 1X80B 4AYTA 4HUQB 5JSFA 5FWXA 2H1FA 2JJ2A 4J6EA 4KMRA 1F3LA 4TXNA 3GG2A 4WBSA 2JLRA 3C7CB 3TNLA 1P62B 2FXVA 2ZIGA 1YO6A 1VHLA 2WK1A 4C2AA 3HLKA 1YL6A 5CIQA 1MQAA 2MT9A 3QWAA 4FFNA 4MMYB 4YRIA 3BB3A 1NUHA 1T6BY 2LP4Y 2EFYA 2NYRA 3QQPA 4BO4A 1CULC 1XU7A 4OK5A 4D8YA 4LJSA 3C7DB 2VDOB 4X63A 4EGQA 3VKGA 1KFKB 3VR0A 3PT5A 3OEYA 4IG4A 3WDMA 4GPTA 4D96A 2PLWA 4H1VA 1NNUA 3HWRA 4IDFA 3NONA 1MAVA 1PEAA 1E9BA 3ZCRA 2Q7OE 3RSFA 1QTNA 4A92A 5I01A 4GP6A 4W8HA 2FFJA 4DNOA 3L9WA 3ZI0A 4U4AA 3RODA 4POOA 1T5DX 2Z56A 4OKNA 5BVHB 4A2WA 1MDFA 2D59A 1G7SA 2WIJA 3CKLA 2ZDGA 2BCJQ 4EHIA 7AT1A 1IXRC 4RGYA 1P1JA 1V7ZA 5HRAA 2AC2A 2Q4DA 4N0QA 1FSSA 2GJ9A 4LTDA 3OE7D 1PE0A 4JEIA 5BR8B 4RW0A 1HF3A 2OCLA 3QXSA 2FN8A 5FWXB 1QDUA 4MWZA 2VAPA 4J7UA 3MWDA 4YDRA 4K81B 1E3LA 2RDMA 4UTVA 1N78A 4AKGA 4HMPA 3UMVA 2ZK7A 2ACWA 2O8BA 3H2IA 1U7HA 2B9EA 3PUKA 1IY8A 3PPIA 3PQ7A 4JOQA 2GN2A 4ML3A 5T3UA 2I9PA 1Y33E 2RHCA 1EINA 1ORWA 3IODA 3DZIA 3IQGX 4H1WA 1HTBA 4EM6A 3AUXA 3O9MA 1UXJA 2N9UA 4FCCA 5CK5A 1GNVA 3KEGA 1CJBA 3E05A 1XA3A 3DAFA 4DV7B 1G55A 1ZIPA 1UJCA 3CS3A 2GJAA 3E15A 3EZXA 3F4BA 4WESB 2C7RA 5J40A 1ZH6A 2Z04A 3E2PA 1U5AA 4NEGA 1NBAA 3OIVA 2IZ6A 1JQLB 1UWCA 2AYYA 2BKEA 2ZT5A 3IT0A 2ZRQA 5LBTA 2CMGA 2IYOA 2FU5C 1TKAA 4M7RA 3CV3A 1O5IA 1Q57A 3AERA 3AR4A 1EVKA 3INYA 2HF8A 2XODA 1AZTA 3JS5A 1XMOB 4DN6A 2V6FA 1ZO8A 4P7KA 1QH9A 1VHQA 2J9YB 5GV7A 5B3LA 1FMLA 2QNBA 2NUBA 5CH8A 5GGXA 3BTSA 2CDRA 1ZINA 2ZTSA 3UENA 5F73A 4AKTA 4XPIA 2D4AA 3GUUA 3SX2A 1D3AA 1B14A 2R4QA 3MWDB 4OO3A 1HSOA 5ERYA 1F17A 1AV7A 4YRDA 3M82A 3NTVA 3HK2A 1A82A 1HQKA 1XQYA 2Y2UA 1EJ0A 3BHNA 3JASA 2E4UA 4HDQB 1ATIA 2CJXA 2G40A 1X1DA 3GRVA 3FIJA 1SKBA 1E5LA 4GE3A 4JBWA 4XR9A 4DGSA 1EWVA 3EC2A 3OPYI 4NBRA 4RFSB 4F84A 1IBLB 4A0FA 3KAPA 2EFGA 3PSHA 5I51A 1RAAA 3Q8LA 5E9JA 1E1QD 3A32A 2Y0BA 3I28A 5JAMA 1AA9A 4U02A 3QE9Y 2QSJA 4Q39A 2FP4B 4ESVA 4MUEA 3RHSA 3RVRA 2ZS9A 1G4UR 4A0HA 4LBZA 4TS4A 3IXMA 1LVGA 2QGFA 2QPLA 5HG0A 4YCLA 1NKVA 1IB0A 3AERB 4L2IA 2YS7A 2DLDA 4TMXA 5DN9A 4DVJA 3HP4A 1YE3A 4WNCA 4BNHA 4LWPA 1XDUA 3AF5A 3CF0A 4NULA 1DT3A 2FUG1 1AGPA 3F3MA 2RK6A 3PPYA 2FCAA 4LWZA 4Z6KA 1PR3A 4XPIB 4PIPA 3G2PA 3PPWA 2WJPA 1GARA 2OV1A 1S02A 1H69A 1VLMA 2BBSA 1WULS 4MHOA 4XIIA 4F4UA 4ZI7A 3RC8A 4WXPA 3BS4A 3CMMA 3WLHA 5ICGA 1BX1A 2YJGA 1CIPA 3IBSA 4JYAB 1SVSA 3I1JA 3MUNA 4GGMX 4M22A 1RE1A 1UCFA 2C98A 3AF2A 2D0PB 5TQ0A 2ZJ1A 2NMVA 4Y3UA 2QUIA 5CURA 1ABBA 4DXHA 4N3BA 3DE3X 5HMLA 1TPZA 2VDMB 1U3UA 1QONA 3D2CA 2EFCB 2PKWA 3DAOA 4N7RA 4NK4A 3VSCA 1E6UA 3FNEA 2F1HA 2IHKA 3GUVA 4RACA 3SK0A 4HFRA 1HEUA 2D62A 1W4CA 2QS9A 3FIUA 1E32A 1PVDA 3NYWA 4KODA 3GNTA 5FWYA 2FN3A 2ONKA 5LD2B 2DB3A 4L2IB 2QAGC 4M86A 1WTAA 7ABPA 4UARA 1FY2A 2GEUA 3KWFA 1KAQA 1CDEA 2FEXA 3VDNB 2VOJA 2I1VB 4F9EA 2DFLA 1T2DA 1IWOA 4DRXA 3N76A 2IEBA 5K8TA 4AX4A 1NR1A 4MAAA 4QOFA 4E46A 4F46A 3WKAA 1E6KA 3MN1A 2ODNA 4MULA 4ZI7B 4GWLA 3RBAA 3AVTA 4PZCA 1X8JA 2WIGA 3O4HA 5H16A 1D2GA 2R8PA 2JCYA 1E6MA 4I5FA 1WL8A 1GUZA 1YI1A 5TQ0B 1MH9A 4OUDA 2IXBA 3PA8A 2UVQA 4DLKA 3H65A 4LRUA 4KYTA 2H92A 3W3ZB 1E9VA 2WHYA 3A4IA 3RSGA 4AZSA 4ZJZA 1VIDA 5C5DA 3IL2A 1XQXA 3AHCA 4P7JA 1J8YF 2OLJA 3KVOA 1P39A 1AQJA 1PFKA 3D54D 1ZITA 2YNMD 1L4GA 4QPNA 1AKYA 3DVRX 3WAJA 2RI6A 3A6HA 2IUSA 3ROFA 4ZAFA 3AFNA 1UBNA 2GN4A 1SPXA 5FWYB 1WB6A 1R6TA 3SJUA 4WZBE 1ZVJA 1X87A 2XOEA 1WWKA 4LFCB 3OF5A 1S96A 2ZTUA 3TZQA 3E23A 3H4VA 1IM2A 1M1XB 1TZBA 5TMPA 2F8MA 1N1EA 4FNAA 2V0NA 3BEDA 2DLNA 1PL6A 2YY7A 4O2BB 5JNUA 2X2OA 4JGBA 4DRXB 3BC1A 2GT1A 1NWHA 2V4ZA 3PCXA 3A26A 2PGXA 4OJQA 3QF7A 4QELA 5HIJA 2QLTA 3CC8A 1JEOA 1YRBA 3BD7A 2YJ3A 3OHMA 4W5JA 8LDHA 1ECGA 3T5TA 1DP4A 4DSOA 3JAKA 2II6A 4KWTA 3QWIA 3TG8A 2B8JA 4DMFA 3SDSA 1AHPA 2EP7A 1AN0A 3PGMA 4OUDB 4C4PA 3PDIA 4NCHA 4JI0B 4JFAA 1PV1A 4KIWA 1XWIA 3AVOA 3DJYA 3CMCO 8OHMA 3P2YA 4WOKA 3MD9A 1CUXA 5C5IA 4JH0A 4AWBA 1C9NA 3V8NA 3T3NA 1TEZA 1BGWA 1S4QA 1W1WA 2XMCA 1KE2A 4IOJA 4G0UA 5JXWA 3TLKA 1J8VA 1X77A 2Q7XA 4UTPA 2QA5A 1NGSA 3K96A 1E9FA 2CDAA 4FQ8A 2GESA 3GY0A 2KS6A 3V6LA 1HY3A 1GUDA 1LRLA 1DRVA 5CDFA 1G8GA 1QH1A 1Z18A 3KR0A 1O87A 2ZQYA 2OHIA 2CVZA 2FFAA 3H9GA 2M6LA 2OPBA 4PSDA 3NEPX 1J70A 3H1BA 3MINA 3ZLJA 5PNTA 1JU4A 1FU4A 2WYVA 3C6XA 3L1HA 4MYRA 1MIOA 3GD5A 2YQZA 4O8CA 5CJPA 2ZJ4A 3TX2A 3UIEA 5KPDA 4Z4GA 4YACA 1PUIA 5SZIA 2ANBA 1EDDA 1K5HA 2OHVA 2X42A 2WA2A 2F17A 5FO0A 2AR0A 2EEPA 1E98A 2ORIA 5KVQA 1I4TD 3WYAA 2KLBA 3Q5GA 1EBFA 3QNMA 4IBOA 2NSLA 1YRHA 4IIVA 1AXEA 2J7PA 2JLBA 3FNIA 1E7WA 1I4LD 4TL6A 2XW6A 4KXNA 3K6SA 3IEVA 2FRDC 1JA9A 3SVLA 1ODTC 5A62A 2ECKA 2NXEA 1H05A 2AW5A 1GXSA 2ZWAA 3PDIB 4W7SA 4KR7A 1PZHA 6LDHA 3DXXA 3VKUA 4XVCA 3DWFA 4PXYA 3ADKA 2GZRA 2IL1A 5DBFA 4KNYA 3VHXA 4AF7A 2JARA 3KXKA 4BMZA 1X8XA 1NW8A 2GF0A 2QJOA 4ZO9A 2JD0A 5JO0A 2CXQA 5BSGA 1ZXBA 1WDMA 3NIWA 2VXBA 3GGPA 5KHAA 2GPWA 3QU2A 2OXFA 3HXLA 1QH1B 3ISVA 2XIJA 3NAGA 2WTXA 5CPBA 2C8KA 2J3EA 3MINB 2ZRBA 4G8JA 4FDUA 2DT5A 4I81A 3ZDCA 1RIFA 4ZRMA 3EPLA 1MIOB 1BE0A 2QUBA 3P8ZA 1Q3HA 3R3SA 4NL4H 4PX3A 3DKVA 3DEJA 1C8BA 1RKXA 4ZVQA 3L7AA 2ISSD 3GLHE 1OWPA 3KS9A 4IXMA 4XW2A 2Z1MA 1K66A 4AJ4A 3P4YA 2WHEA 3K6SB 1RC1A 2JATA 4LSWA 3ZY4A 3AEUA 3F46A 4MV1A 4BKPA 1FTWA 3REFA 3CXRA 3PDWA 1GXSB 4Q7EA 2QRUA 4L5IA 3KPYA 1QH8A 3O31A 4UHHA 2R5NA 2YJ6A 5D3MA 1BKYA 1JKJA 2JANA 3FYDA 3H0EA 5FUYA 5LMUB 3COJA 2C9DA 4EMTA 4EYQA 2IYQA 4MVXA 4MUGA 1QYRA 1Z7EA 2VDPB 1JA0A 3VHXB 3G8CA 1WB9A 1U8EA 2IEGA 2NG1A 4YMLA 4XGRA 1S2LA 3S0JA 2PH5A 3OZBA 5IYZB 1AT1A 2WBLC 4KAJA 5A04A 2E5LB 2G77B 1W0CA 3AP1A 3DZHA 4JHXA 1QYCA 2P40A 3L7CA 2W0MA 4QGAA 4XGIA 1I0IA 3KJFA 1GCIA 4CI0B 5DLQC 1Y81A 1YQUA 2ET6A 3I6ZA 3IOCA 3JARA 5D6NA 2GBLA 4ESHA 1O6ZA 4GW3A 2VUIB 1VYUA 1GGNA 2HZ7A 2WFLA 4UU8A 1M1NA 4FYHA 3S8MA 3W0LB 2QPOA 3DOHA 4YMIA 2G28A 3PICA 1PFGA 2HA6A 2Q1YA 3HJNA 4L6CA 3L7BA 4YP0A 3OZVA 4MI6A 4DYVA 3EXAA 3VDMA 3ANSA 5DFAA 4II2A 2NP6A 3CPEA 5CTJA 1TFUA 1WQ3A 2P11A 3AEUB 1M5RA 4LYFA 1U2ZA 1NJ2A 3CKKA 3GJ0A 3NAMA 2LIPA 2EWWA 2CNWD 3I2GA 3ZGNA 4KK3A 2ODBA 2CXNA 1QH8B 5D3MB 2QN1A 3OEHD 3ZG6A 5B1EA 3X1XA 1JKJB 2A7XA 1HNXB 2VHQA 3FSEA 3QEAZ 1WUTA 3SHTA 4X9XA 1DBVO 5ELMA 3Q85A 3IEMA 2GDJA 3NYRA 3QVTA 4QBIA 1MQSA 4IVQA 1Z34A 1ZQ9A 1YRWA 3INRA 1INLA 1VJ0A 3IKMB 3NJRA 4MV7A 3R4VA 2IV2X 4JNCA 4CTNA 2J5RA 3C14C 1OREA 1E79A 2Z4RA 4WZZA 3P9YA 4Q3CA 2B30A 3DF7A 1WX1A 4JEHA 3FCSB 3L77A 4ZAVA 1Y5RA 2O23A 3F0TA 3K8ZA 1H2RS 5K4HA 3CX4A 1E9SA 1KERA 1Q95A 1U3FA 1K7XB 5AJTA 2JI6A 1GRVA 2JFGA 3H1EA 1SIOA 2WVHA 1E4EA 3KO8A 5FBRB 3JARB 1IOZA 2GLTA 5E2AA 3UW3A 2WFLB 1J97A 1T24A 1J56A 1EVLA 1XAJA 3B1WA 3C3EA 4J2HA 1J25A 2ECFA 4ZDWA 3VU1A 4W6ZA 3CLSC 1ZH8A 1X1CA 2FXIA 1ZN2A 4YVFA 4AJKA 1DTWA 4Z99A 3PC6A 4PYLA 5F9MA 5H70A 3CVWA 1XLWA 1EFRA 1QIMA 1RXYA 2D54A 2P9TA 2YZ2A 5GOTA 1FC0A 1ZC3A 3W7VA 1UL1X 2GAAA 2WM9B 3ZHUA 4F06A 5CA1F 4JI3B 1EG7A 4N82A 5FLYA 1Y4SA 4BLVA 1JLSA 3IKLA 3TTUA 2DBZA 4B80A 5BO5A 1RLJA 4WKBA 2O50A 1XCJA 3SR4A 3PBKA 2VBFA 4HYTA 2XSZD 2Y0EA 5JZBA 4QUJA 3DXZA 1Y5IA 3OQMA 3P27A 4DV0B 3VYRB 4L9AA 1GR0A 5FQOA 3GA0A 4UASA 3KPVA 3R7AA 3FD8A 3PXBA 3DFFA 1OAOA 2OP1A 1Y3HA 3NRCA 4RA6A 4BE4A 5JTTA 1CDZA 3H3JA 3IIIA 4GMKA 1CR0A 3ZTWA 4I7EA 1EWYA 4D9GA 3UJ7A 1T3ZA 1Z8DA 2AH5A 4Z0NA 4D3DA 1E9EA 3FMGA 2O9JA 4CTMA 2OYCA 1E4EB 1BXGA 1IK4A 4EHBA 2X9GA 3JVIA 1ZU5A 5FBQB 5LA6F 3QZUA 1C50A 3CRQA 1KH2A 1CF4A 4RL4A 1OSNA 1KE1A 3TOVA 4J6FA 4OHZA 1QMPA 4KE7A 5MN5A 4HGRA 2Z3VA 1PSDA 3H7IA 2YWRA 1DTWB 3DOJA 4QTUB 5CB0A 4QPDA 1P18A 2ZIVB 3V4ZA 3BEOA 5KJ1A 3S5UA 1OLXA 1TFRA 3OFKA 2GZMA 1U9ZA 2MR5A 3IBTA 2V65A 1E4OA 4CLXA 2FK8A 4BIMA 5F2KA 2B37A 1TO1E 4HPXB 3ELWA 3O1JC 4I2VA 4G2NA 1LDMA 1D04A 3IIJA 5ES3A 4KFUA 2A5GA 1JTFA 1QBGA 5K8VA 2NAFA 3M3PA 4K9OA 4YAEA 1LPBB 3FTNA 3N2YA 4EKDA 3CYFA 4C3ZA 4RWEA 4XVUA 2PRSA 1YTLA 3IP6A 4JXJA 3F5MA 3WA7A 2JFVA 3IQDB 3WZMA 4RA6B 3QMPA 4NATA 3UMGA 1PVVA 3TNFA 2R25B 4F45A 2H1VA 2HR1A 2QLMA 4FE4A 4K6MA 4KXVA 2HRZA 4DJAA 1QU3A 4MQ5A 4ZRDA 1Q17A 4GBJA 3RC3A 1QRSA 1BXGB 4BCBA 4ESEA 4AYXA 3I1FA 2JA1A 2FN7A 1WA5A 1EMDA 5DLDA 4L0QA 1TCBA 3RS4A 4DBVO 2JH9A 3CZQA 3L8EA 1V11B 1IQPA 1JQBA 2XXAA 4Y0AA 3CLVA 3D1LA 3KFLA 3K9FC 2XVYA 2ZBRA 4CDMA 3DEHA 1RQLA 1WF3A 1Q19A 1WQ4A 1CLEA 2C59A 3NETA 5FFFA 5GQSA 1R4ZA 3V1TC 4R8KA 2FZGA 3ZS8A 2AVDA 4GZMA 5IT9A 2Q5LA 4NPAA 4MCJA 4P3YA 1LPMA 1VPLA 3R4CA 5K0GA 1N7JA 3IVCA 4BEVA 3EGEA 4D46A 4Q48A 4DQ0A 3T3HA 1WUKS 4U6QA 1LK0A 2X0NA 2ZREA 3B70A 1MA0A 5CVDA 1DX4A 3WWZA 1IL0A 3C1UA 1W5EA 2JLAA 4TV9A 1EWQA 2YZ7A 4C03A 1NF3A 2ZB8A 4BQSA 2J5XA 2OXIA 2CV1A 3WWCA 4MCAA 1G3RA 3LPNA 2B7CA 3A3YA 5A9SA 2V7VA 3D5QA 5KNDD 3UK0A 2HNAA 3FDFA 1M67A 4BOYA 2V3CC 2A3NA 5HDBB 3WGNA 4JJ4A 3O8DA 9GPBA 4RVFA 1I5EA 2XF2A 5LN1A 4YJ3F 1A71A 4BV3A 4LS3A 1SXHA 4JL6A 2YWDA 3CZ9A 2DPXA 1IULA 1LBEA 4ZVSA 5BV2P 2JGLA 2XXAB 3S3TA 2FTKE 3S2GA 2FEWB 4Z49A 3KJNA 1LC3A 4ERNA 4RLHA 5IJ0A 4F4JA 2PBRA 1GLGA 3FDIA 4EJ0A 1AUXA 2UZ1B 2FUCA 3BXGA 4QOHA 1CUJA 4KXQA 3EEOA 1RJ9A 3IUJA 4I36A 5F76A 2PKCA 4JLSA 1G8HA 4B46A 4ZT2A 1APBA 1KYXA 2EIXA 1PEDA 2IT1A 4Y18A 1I4EB 3DD1A 3O3CA 3PUIA 5FORA 2IEZA 3RU9A 5EIEA 3IAXA 3B9RA 5C37A 1NVKA 3D6UA 3HDGA 4RIFA 3TRFA 5HJ7A 4B9AA 5B7QA 3HVJA 5A0TA 2ONJA 1PFVA 1WXFA 4W5HA 4LRXA 2XUKA 1AMNA 5BN5B 4EG5A 4PPYA 3DE0X 1QV9A 1BMFA 1BTOA 3C5HA 3FN4A 4TV9B 1B23P 3VSDA 1F1BA 1L4HA 2VPZA 4EECA 1P1KA 2V8OA 3HJHA 5A9SB 4UZEA 5K3OA 1PDOA 1E6CA 1XE3A 2ID4A 2WILA 2MSDB 1JVNA 3A2MA 1HX7A 2IYWA 4J29A 5DYYA 2WU0A 3LQ2A 3F7NA 4EI7A 2GJKA 3TCKA 1NYRA 5CX4A 1Y6FA 4Q3DA 2XI4A 2D0DA 4J9UE 4ZARA 1CE8B 4PAOA 1V8OA 4G0OA 1SC1A 3GOQA 3EZ6A 2YXNA 3B1VA 4B7AA 1WO8A 2V7QD 4M36A 1RIIA 1H4SA 4KO8A 4AURA 4BWYA 4G0VA 5EHNA 1Y6QA 4M1OA 1S3IA 2PE5A 4HC4A 3JR7A 4QODA 5IJ0B 2QYTA 2FA9A 3DTTA 5DRYA 3ZGLA 3ZWOA 3HY3A 3M5CA 1AG9A 1II9A 1DMRA 2R751 1YK1A 3PPVA 2OT3B 3LC0A 2NVOA 2VS1A 5DO9A 2IYZA 1G17A 5J2TB 2EHJA 2AJLI 3DT8A 4LEIA 3ROZA 5CFZA 5AVYA 2QVYX 2ADFA 1CY8A 2Q6KA 3PHBE 2IOQA 3QVXA 4FS3A 4PONA 5B36A 1TUGA 3FUWA 1YE5A 2AQHA 2DJ5A 3BE4A 1PWYE 5EXSA 3EXHA 4DWWA 1TD9A 1V1RB 3BZWA 1IC6A 3ND8A 4IDBA 5B4TA 1DWUA 1DCTA 5BQ3A 1J9EA 1TAHA 4J0KA 1E60A 1IBSA 4R84A 2XF8A 1UBRS 3N8NA 1I1HA 1V0JA 3VMFA 3PZRA 4KH1A 4IOKA 4KG7A 5TSDA 2O0LA 3CTMA 5IARA 4YUAA 4TTRA 5JRDS 1BKSB 4R2HA 2WQ6A 2BUBA 3C3MA 4FMDF 4P38A 1N8SA 1J0EA 4B40A 1UMDA 1VG8A 3KBBA 4FXPA 4LY6A 1N0IA 3DV2A 3H11A 3H2YA 1EFHA 3PD0A 5D7BA 4QATA 1V6AA 4CI9A 3ET4A 3NIDB 3MS2A 1Y1TA 3OF2A 3AM5A 5C1OA 5TX7A 3UTDA 1ULTA 3OE1A 4MW9A 2ISCA 4ZYVA 5BSHA 3VOSA 1IHPA 1GGMA 4XOIA 4H16A 3HWWA 1MEOA 5EERA 2JGEA 3EFOB 1PLJA 3GFFA 3TOCA 4LAFA 4DCTA 2BKAA 4Q7QA 5F21A 1MVOA 3M1LA 5H9VA 4JEMA 4URUR 1W36C 3EIHA 1RQ7A 2WSIA 4JIGA 3RFUA 4A1OA 1BWSA 2FJUA 3EXHB 1UP4A 2GNPA 2NACA 3FTCA 3Q3HA 3KT0A 1JTVA 4DA8A 4I2NA 2HCJB 3QPVA 1DZ3A 1H22A 4MKIA 6GPBA 3E5RA 3ZVRA 2EXXA 1QQ5A 2ON6A 3GHHA 3CZPA 1AK1A 3MF4A 1EA5A 5BMVA 2BP7A 2X13A 4G0ZA 1TVCA 3LUJA 1NBEA 3QMVA 2Q50A 2ZU0C 3KE8A 4OQLA 3O4JA 2PSDA 4IDGA 3PNOA 4LN1A 5TPZD 2FEPA 1PJ2A 1XA4A 1EPUA 3B3GA 1GN8A 2B9VA 1UMDB 3CQ9A 4P82A 2JFXA 4Y6SA 5TGTA 2BZGA 3H11B 2SBTA 2WM3A 2A9FA 4IIXA 4CQMA 4G0WA 5BN4A 1MH1A 3BGVA 1M8KA 1XOIA 2ZLBA 3NHSA 1W47A 4JUAA 1SIWA 4J3NA 3H8SA 2BI7A 1G9TA 2KW5A 4ZYXA 3OECA 1MX5A 3KYCA 1KMNA 1YUMA 2CF6A 6AT1A 2DCMA 3T3EA 5DWDA 5ALSA 3G17A 2MSKA 3EXIA 2XUJA 1CUVA 1IPFA 2CNBA 4NQZA 2NAPA 1K7FB 4UMDA 3UWMA 2Q9BA 2C2GA 4H31A 4YRQA 5AK3A 1LDBA 1CF9A 3EDCA 3ZCUA 5A4IS 5I9NA 2ZUFA 2JH8A 1CFJA 1OQAA 3HCAA 1Z38A 2YV4A 5AUQA 1HYBA 1RKUA 3HXPA 3W5DA 1NTRA 4IQ0A 1C3LA 4DCCA 4BFLA 1RKQA 2CLIB 4HAYA 1EJ2A 3OJLA 5K0FA 3KB8A 3EAFA 3Q0EA 4HN2A 2DBYA 3IAHA 2BP7B 4MPDA 4RJIA 5BMVB 5ULLA 1E5XA 3P9CA 2GPYA 2HSDA 1RFLA 3OZIA 4Y2VA 1RHMA 2NV6A 3DLTA 3X2FA 4DR2B 2BFBA 1Y3BE 3HYSA 5BNZA 4JBIA 4FLEA 2HU8A 1PZNA 4MV6A 2P3OA 3G6WA 5T6MA 4EGFA 4M0UA 5H3LA 1EVIA 3EIXA 4QVGA 3CVOA 3WGOA 1VM6A 3KZ1E 4W7IA 4A6DA 4YMVA 4JVSB 5KNCA 1HTTA 4E30A 1B73A 5BYBA 3CUTA 3UKJA 3PGA1 4NAVA 1QCYA 1SHJA 5F2EA 5CDYA 4FI3F 3KYCB 3P9QA 4J75A 2LIVA 5EZYF 2I7DA 3GA7A 3RS5A 4B47A 3C3BA 2BLNA 1KGDA 2OCGA 1I5OA 3EXIB 5IC4A 1IQUA 3SOZA 4AY6A 3NM6B 1NMQA 3BAZA 3IMEA 4KN5A 4ISBA 2GCIA 3I5AA 4KL8S 4MIOA 4B6PA 1EGHA 4ZQIA 2PGJA 1QCDA 1CBUA 5FR1A 1YJBA 3QH4A 4N7MA 5EL0A 3NX4A 5FTMA 3NIFB 3OQHA 3H5NA 3MCVA 4IINA 1YBVA 4GPZA 5IJ9A 4YY3B 3MWKA 3NQ41 4YJGA 3TQQA 1E0AA 1PT8A 3WSWA 2CKMA 3GMTA 5F5LA 4D9KA 3F7TA 4EB8A 5K45A 3CEJA 3ZHXA 1RKVA 4E3ZA 4F9FA 1TUBA 2QG6A 2HA3A 2A9RA 4I9FA 3H8WA 4YB8A 4BQNA 1I3OA 2XTNA 1IG0A 1RZUA 2C2XA 1E2MA 2QP3A 2QN2A 3MTEA 3L0YA 3WWEA 4C0HA 3MHTA 1Q21A 1Q3KA 4LNUA 2E7ZA 1KPHA 4LV5B 4N1AA 4RPIA 1EIWA 4K40A 4ZT6A 5J4KA 1WNFA 1G8FA 4C4OA 1BROA 2XMZA 4KK4A 3ZH2A 4KSYA 2FYTA 3T5DA 1YDMA 5TEWA 2PCLA 1NU6A 2GVZC 2ZBPA 4KQ6A 4QE3A 1Q7CA 4Y2QA 1B8OA 1GT6A 3VHLB 4C7KA 4RQUA 3P4XA 4EWLA 5KVAA 1WPQA 2V6IA 4JELA 1JDVA 2JHFA 2KMLA 2G5TA 1GFZA 4I1IA 5IJ9B 3TBKA 1ULZA 1N6RA 1CR2A 3A0RB 4AXBA 1J2TA 3H5IA 4YRCA 4YJGB 4L27A 4EENA 1SHUX 4QSHA 1CUIA 2MWMA 4RENA 3RJMA 1TE2A 1QPGA 2VF2A 3WMRA 5KB3A 2ZUUA 3R3VA 3AL3A 1OAAA 5FBWB 4FM9A 1FBNA 5CCDA 5KTYA 1Q0PA 2D8MA 2VC2B 3GT4A 4XWGA 1Y1PA 3V80A 2OQIA 2QTZA 2QU7A 5BWOA 1BS1A 1I6WA 1IONA 2YASA 4HEJA 3OX3A 3HCOA 4BS9A 1A7KA 2Q5EA 1GGHA 2FMTA 2FPWA 3P0JA 1HFWA 1M10A 2CLMB 3WLAA 1FYWA 2C83A 2JFZA 1N6NA 5C7OO 1YRLA 2BBWA 2J9XB 4WH0A 1HEYA 3TS1A 2VNIA 1NQUA 3MOIA 3RF6A 1VIVA 3SBEA 3ZZUA 4RPCA 1SOUA 3L04A 1I2AA 3WYEA 3WV4A 4RS3A 3EVEA 2BM1A 3P1JA 3P2IA 2GSDA 3R9IA 4BRSA 3WI7A 4BO9A 4D9BA 5FFNA 4CL2A 4RPLA 3TSAA 4OKSA 4RK4A 3G3EA 4OBWA 4ZOLB 3D9QX 4WL0A 4C0AC 4I5GA 2OBXA 1Y3DE 4P22A 5AJYA 2C2BA 2K7ZA 3RVMA 2XBLA 3SG0A 4EEZA 3KKLA 1YQ9A 4NYMR 2X0JA 1RR6A 1C3VA 1ONBA 2OGTA 4WNYA 1Z0SA 1YB4A 4QWWA 5DGXA 3TQIA 3UFXA 1R9MA 1M7BA 2BUAA 3LRPA 4CM3A 1EB9A 5ADHA 4PZDA 4Z3DA 4L8GA 4OYRA 4FNMA 3HSYA 4JJZA 3Q7PA 4A2CA 2M98A 4EY4A 5HJ5A 1JHOA 1N0UA 1GNQA 2OHGA 4YIHA 3ANMA 1K5DA 3MAGA 4HI0E 4HR7A 4OQFA 4IJQA 4KR0A 1IEWA 3PUXA 1B43A 3K4QA 2YWEA 5A4AA 3UCXA 4ZAWA 2ZRJA 4XXHA 4GBGA 5HPYB 3PTAA 2HO5A 2HU5A 2NPOA 3JYNA 2WINI 3WQBA 1N2SA 3BSSA 4N8EA 2GZ1A 1QE3A 4S24A 2WZBA 3OZUA 5DNYB 4GL2A 2XMRA 3C1TA 4AG6A 4LGYA 1O77A 4R1TA 1YDEA 3WSTA 4ZKDA 3I5XA 3R75A 3Q6MA 3EUEA 1H2ZA 2TECE 3K0FA 5HMMA 1BXZA 2C9ZA 2VQDA 3B8HA 4IRUB 4IHAA 3E03A 4ENRA 1VHJA 3WIVA 2Q5FA 1NZDA 1FUEA 1OBHA 1VMEA 1YZUA 2Q9UA 4PO8A 4ZCTA 1OFUX 1CR6A 2BH9A 4FCVA 1F8GA 2H9IA 3NPAA 3L4SO 5EE5B 3DQQA 3MW8A 1Q1GA 5EQDA 4ZAXA 3GXBA 1MGPA 3LZDA 1GU1A 3UFXB 1UDRA 2WR8A 3KQKA 2QTHA 1LX6A 4FJ0A 4RU1A 4QM6A 5A7HA 5LXTF 3I3OA 3WOVA 1C3OA 1TC2A 1DE0A 1G3UA 3WB9A 2PD6A 2HCTA 2XAAA 2GAJA 2NO0A 3LT5A 2G82A 4R2KA 5TF4A 1XRPA 3DL0A 3KX2A 4URYR 1CZUA 4U6NA 1KZYC 2X8WA 1T5TA 4M0DA 4O5OA 4OEHA 3ZCPA 5KOHA 5IKXA 4KH0A 2MSWA 3HUTA 5F7XA 2FZ5A 1QUEA 5LP6A 2HN9A 2G5GX 1HYEA 2JJ1D 3MCTA 4KQJA 1AX9A 1E2HA 3LPLA 1VLJA 3OOYA 2OV2A 3AKDA 2ZG6A 2X6TA 3DBOB 4DSUA 2ZB7A 2P4UA 4X90A 1NVFA 3M3DA 4YAWA 4Z2YA 3K0FB 1XRRA 4X1YA 2BEWB 2O20A 3HGTA 5HUJA 1BQ4A 1NONA 4BZXA 2KSQA 3HDJA 1PK8A 2O7NA 4LZOA 2VEOA 2CFCA 4GYKA 1J2RA 1W5TA 2EX0A 5KNCH 3ZYCA 4Z7JA 1LLFA 1QO0A 2I29A 2V3WA 2RJ3A 4LHWA 1JYEA 4CN8A 2PTHA 4MV9A 4V3BA 2D3WA 1CUEA 3CF4A 2X4DA 4R41A 3V4FA 3EZNA 2YDXA 1U63A 3ACBA 3DO5A 4MWBA 5AW5A 5BR7A 3PG5A 4CM4A 1Q1QA 1SCKA 1C3OB 1T2CA 5IHXA 1QQ7A 5KYXA 3AF6A 3O26A 1R4NA 4BKOA 3KZVA 4E5PA 5FOSA 1WW8A 1KJJA 3ROPA 1COWA 4TSFA 2E6KA 2ONYA 5JDCA 1EYZA 1K0FA 1T3SA 1UK7A 2IUFA 3DVAA 4IMIB 1POXA 3BE6A 4WK0B 5KOHB 3Q9SA 3AM1A 3A10A 2BLLA 3LT0A 5T41A 5TPWA 2WG1A 3MRSA 1P45A 2DECA 4D3XA 3A1NA 4Q7LA 5LLDA 2JGKA 1BGVA 4U2DA 4OGWA 1AQYA 1P7CA 1DVRA 3B53X 4RTOA 3D6HA 3TE6A 4ENVA 3RTAA 1PK9A 4RHYA 4ZCIA 4UEQA 4ZCQA 3SBOA 2NO5A 1C5KA 3OKCA 3PUJA 4XX1A 5H4HA 3UUFA 3Q1LA 4DM3A 3QX8A 4WTOA 2AFVA 4X1YB 3ODGA 4FZ3A 4G5OA 4Q37A 5BUCA 2J8ZA 4FGLA 1W9MA 4XE5A 3OE5A 4GYWA 1U28A 3ZGZA 3BERA 3H0KA 3BH6A 3K5HA 5JYCA 1VJCA 2J48A 1KBZA 1LJLA 5A4KA 2ZUEA 4CG1A 1RRCA 1TQ2A 1QHNA 1WM1A 5A0VA 2Z2KA 3LFUA 4I5IA 4HB3A 1IU9A 4FJ2A 3Q72A 1I1OA 3FMIA 3RT7A 4DMGA 1XBTA 4IS3A 1C29B 1DUIA 5BNWA 6NULA 2AKEA 4L76A 3DMDA 4ARVA 4GLLA 5JBIA 4DGQA 3FVTA 1SO8A 4TQ9A 4UAVA 2EGHA 4JOSA 4D26A 1FYVA 3UAVA 3O0TA 4U5XA 2ZJFA 4LJYA 5IG2A 1V45E 2A6PA 4JSTA 2QRGA 2C4KA 2F8TA 3A4VA 3R3UA 3GPBA 1L4BA 1ADYA 3DVAB 4ZYZA 1ZY2A 3PS9A 4BVLA 2JAPA 3V55A 1LTKA 1O7JA 4GBMA 5TPWB 1PZFA 3TBFA 5JEEA 1E66A 3SC3A 2ZIEA 3LFTA 2DHQA 1GL3A 2FQXA 3A1SA 4QO8A 4QICA 4JI6B 3RNOA 2NZ8A 2I7CA 1HDEA 3GVPA 2DPLA 3Q9UA 3R7WA 3AH8A 2I67A 1R0XA 1KVSA 1VXOA 1H4TA 1NZJA 4GLFA 2EW2A 3PXEA 4HO1X 2BJHA 3RW9A 3SJAA 2OENG 3DFKA 4RUKA 1ODIA 4K1XA 5AK0A 4BNGA 1I7PA 1V8ZA 3TR0A 3TTVA 2G1KA 5CD1A 1KBOA 2VYQA 1O95D 1OZ0A 2XDAA 3IEKA 1G5QA 2C8JA 3K32A 3H87A 1ZD4A 1XELA 2BRUC 1IEQA 1LZKA 1NW6A 4COKA 1V16B 2NYVA 4GSKA 3R3YA 1P5JA 3NW9A 1JH8A 3K7EA 4MQBA 1M34E 4YCCA 5A7FA 4GZLA 5L3SA 2QPAA 1K5PA 3D1JA 3Q6IA 4KR2A 1P2SA 3GJ4A 4ZP1A 4ZQCB 4ZO7A 2OAP1 1AGXA 4BEJA 4OA5A 4LYEA 4U39A 5TQJA 2GJSA 5I4KA 2QT9A 4J0QA 4GZ6A 2CXUA 2H29A 4MGHA 3FHCB 3FJOA 4H0CA 3OIUA 3C1AA 1O4WA 3ZCVA 1J33A 5KTNA 4BMCA 3MCUA 4G09A 1ZRNA 2JKVA 1RPZA 4O1HA 3LHIA 1ONSA 3BHIA 4YLYA 3PXXA 2JFOA 2D0OB 4GGOA 2GAFA 3GWZA 1MC1A 1YOVA 3IAM6 1KKLA 5IN4A 4MZDA 1KQOA 4FU0A 4BL5A 3QSYA 2PMKA 4ZOBA 2BJWA 1SU8A 4KZKA 5FI1B 5SICE 3WFZA 4NY1A 5KOJA 4JIMA 3A8TA 4MYUA 4RTLA 4FILA 1RAHA 4JBGA 1ZM2A 1ZRMA 3KQWA 3KZCA 3CF6R 1TUIA 5FUVA 2I3BA 3BBPA 2XZTA 4WEQA 1P2TA 2FQYA 5K1ZA 3UV3A 5JNWA 1EWRA 1E1RD 2YN4A 3JR3A 3A25A 5KNCD 4HGQA 1G7CA 2MSCB 3HYNA 4JOCA 4RESA 1PNVA 5FA5A 3R7BA 1M2NA 4CFYA 2DWQA 2G5CA 3G23A 3TLAA 1EBUA 5DBIA 4G4IA 1SG6A 5L3SB 3GFVA 4FBMA 1J9ZA 3NHMA 4LJKA 4OXXA 5DBHX 3TLEA 3L40A 3V4PB 4W9NA 1YVUA 1Z2OX 3DHVA 3LLMA 4B87A 1USIA 4KQGA 1N2EA 1EFCA 3HFSA 1XWFA 3JPWA 1WLSA 3PD7A 4DLNA 3OT4A 2CL7X 4F1WA 2AW3A 1EESA 3KB6A 3U44A 3NBFA 4KAFA 4FDMA 1HLPA 4V2IA 3GJ6A 2WIKA 3AUTA 4LBYA 2I91A 4MI3A 3UA4A 4DQKA 3U5TA 2XMBA 1T1SA 1AK2A 5L3ZA 4TL8A 1YOVB 1QAQA 2FPRA 3O90A 2J0EA 3OO1A 3U4DA 4A0SA 5E8RA 3CNOA 1FSGA 1P7VA 4RF2A 3H9BA 4ARIA 5KOJB 1ACMA 3AR8A 3T1QA 1D2CA 3S2IA 3DO6A 1YJAA 2C84A 2CDBA 3B2EA 4G0NA 5CIWA 3WICA 4XAQA 2ETVA 4BNXA 1EZ1A 1A9OA 1Z62A 4FN4A 4F7WA 2ZE5A 7GPBA 2IS6A 3F6CA 1W36D 5C1DA 4EUKA 1E69A 4GOOD 3PNVA 5A5VA 3ZGYA 2VXCA 3ZV7A 4RTMA 4YWJA 5ICFA 4EITA 1TZCA 4XWOA 2SECE 1WW2A 3CBQA 3QUCA 1GAQA 4K46A 3NDJA 4LNAA 1PJLA 4HNVA 3S99A 4XIYA 3ZHQA 1NMXA 2BKUA 2G3YA 3AUUA 4WT7A 1JIKA 2Q3FA 4ZVNA 4MB0A 1UKZA 4HQFA 5TXGA 1Z4MA 4IUBS 1OT5A 4A4DA 2XA9A 3D3QA 3DXFA 3N7TA 4HP8A 2HY7A 4C7XA 621PA 4K9DA 1C9YA 5HA5A 3F8WA 1IMOA 1SCNE 1ZUWA 2AF4C 1V1MA 3IEPA 1OV6A 3NEAA 3FI9A 3PFBA 3I09A 4GOLD 2X8AA 1UXKA 2IKSA 2K6GA 1ML3A 5B1IA 4XGNA 5UKDA 3ZBPA 3DVLA 3U44B 1XVIA 4IGFA 2FPGA 2B1QA 1NG1A 1EE1A 1VSVA 3VVCA 4KQKA 4NJOA 1KK0A 1BJTA 1ZNXA 1LF0A 5CA0F 2O2IA 4ZVTA 4OBEA 4YJFA 3TAXA 1DDIA 1LDNA 2X76A 3FCXA 4M37A 5AHOA 4GI3A 3VR5A 3WBJA 3ZEAA 1CEEA 5AQ1A 4OM8A 1U7DA 3G0CA 4CEIB 1N6LA 1QJCA 1CFZA 1UWLA 4BVEA 1ZXLA 3K35A 5G0VA 3BKXA 3W6ZA 1NNSA 4L4SA 1WV0A 3I4CA 5B5SA 2JIRA 4RJ2A 3CVJA 4RVNA 2PV7A 3MOGA 5T57A 5I9IA 2CBZA 4WK6A 3SD7A 2FDXA 1SU4A 4DBLC 1ZC4A 3I1IA 3OKAA 3WYGA 1KSJA 1HYQA 2D2EA 3PHJA 2UZAA 1DQPA 4XTCS 4RFLA 2PJUA 3BD9A 4MITA 1T91A 2QW1A 2R60A 2XB8A 3U48A 1JHMA 3SHFA 1XMQB 3R7LA 3DUFA 2GJ8A 4UBIA 1RAGA 4LE1A 1E5TA 5KC9A 2C5EA 2V7UA 3SF8A 3V2GA 3D0KA 2P68A 1Q0QA 1YZHA 5AUPB 1E1CB 2Y4NA 3QLUC 2DWCA 5HF9A 5J2UB 1V1MB 1WHSA 2B2XA 4K88A 3IILA 3P0FA 5GAJA 3IBYA 5F77A 4AJEA 1G59A 1JT2A 4TVKA 1YF3A 2FPGB 2DWOA 1LV8A 3OSUA 3T5PA 3EEYA 2XNDD 3EVNA 2VUHB 4G9GA 1USGA 4ZIRA 2WJYA 2R8XA 3PHIA 4YJFB 2APJA 1GAXA 4QFDA 1UQRA 2Q21A 4MXDA 5EZSA 2WJZB 1OI4A 1MLDA 4J94A 2FWMX 2X41A 1QFZA 4ZQBA 3PLAE 2O6LA 2CE7A 4R8MA 1HL7A 5EYPA 2WT8A 5H7XA 1QGOA 3YASA 4F21A 1FFGA 4YMGA 3EVBA 3RF7A 3TLBA 1Q0SA 4YRGA 4GR9A 4P34A 2ZRPA 4JQYA 1MD9A 4DIDA 3WGZA 2XUZA 2VDUE 2WTBA 3QWFA 2R66A 3LGSA 4UZSA 4BBPA 4G1FA 3LY8A 3A3OA 3JYHA 1RLIA 3AOEA 4G2TA 4MIEA 4UQOA 3RG8A 5EAIA 1VB3A 1MP0A 2YC2C 3K1JA 4P9NA 4DRZA 3OC0A 1NQTA 4YCNA 1RI1A 3DMRA 3LWNA 1WD7A 3ZWNA 1O57A 1N9GA 2YINC 3DUFB 1YJQA 1BDMA 4QUGA 2CL0X 2L2QA 2JFBA 5G0SA 2G9VA 1H4QA 1UPCA 3SF8B 3M4JA 4Q6WA 4H15A 1Q7EA 1XROA 1WTCA 1G5RA 1ORIA 2RIPA 4V24A 1Q7BA 3N0WA 3IP5A 1WHSB 4ZOAA 5DM60 5KYUA 4P7BA 4OK3A 1MAUA 3EQ8A 1NUSA 5DULA 4KQCA 3NC1C 5F64A 1PJQA 4ZC8A 5JE8A 4ISCA 3WL5A 4GBED 1JG3A 3NTXA 1A69A 3EGDA 3CVUA 4Q7KA 1ICIA 4ZIRB 4H4EA 3QVWA 2JS7A 1FS4A 4D5GA 4UNRA 1NVUQ 1CZKA 1AZLA 1IY0A 1TJ5A 5ALRA 4D9NA 4V0QA 2JLYA 4UUNA 3JZAA 3RFTA 2VVTA 3G6KA 4AJOA 2FDRA 1VSQA 3K9LA 3LUCA 4Z1MD 5CD9A 2G71A 3LPCA 1TC1A 2QVLA 3DMNA 3K1TA 4B3TB 3LY9A 4ZTBA 3FVRA 1RRVA 2I6XA 1BX0A 3GBVA 2H4ZA 5ECGC 3WBFA 1CRWG 2C00A 3CSUA 3K70C 3UKDA 4LDAA 2CVFA 1ZVVA 2JHPA 3RK1A 4JB8A 1SD2A 4MYTA 1UBLS 1XRNA 1DC8A 4WFKA 4QYMA 3ZN2A 4IDNA 5J59A 3FCUB 4FT4A 2Q4OA 2R5FA 3NDIA 1ISIA 4I1UA 3HDHA 1NBWB 5EIAA 1N9GB 2PFGA 1BJKA 3E3MA 4LDPA 1TU0A 1R0CA 2IHTA 4FB4A 1XK7A 4GE0A 2AUNA 2HV9A 1E0DA 3LQRA 2WOJA 4KPUA 4NBKA 4EG6A 1T2EA 1E61A 4YS6A 1L9KA 2CHQA 2QZ4A 3PPXA 3KHSA 5KYUB 5ESWA 4BXOB 2QNRA 2CZGA 3WQRA 3W05A 5IM5A 3DTVD 4TT3A 4RIIA 4MMZB 4S2EA 1T8UA 4V03A 4ATNA 4TS3A 2PZAA 4BLRA 3DDWA 1L5MA 1N3IA 2P1ZA 3PWTA 3HKCA 4QOEA 1X9HA 4CM6A 1T35A 4OQNA 5AHWA 2YIDA 4ZU3A 4TLBA 4C20A 5JCJD 2WB2A 2NTJA 3R0JA 1G5HA 3NAQA 5LQAA 4L15A 2HB6A 2K7FA 2BGJA 1D2EA 3TIXB 1HG1A 1TIPA 4G4SO 2VHTA 2ORYA 3B3JA 4FDTA 4BMOB 4K9LA 4GYYA 1PX0A 4JVOA 5DM2A 2WIBA 4QUHA 4AKIA 1RWPA 1R0WA 1J42A 3X1JA 2IVFA 4AT1A 1OCEA 1SUPA 4N39A 5TRTA 1EUZA 3K30A 1XTTA 4JJIA 5FYQA 3ZWDA 4BASA 2FWNA 1C30A 4H1HA 2FQQA 4L07A 5IDYA 5FBVB 1QWSA 2BELA 1FLVA 5L3QA 3VZSA 4GDFA 4PRKA 1Z5NA 4MUXA 4QTXA 3THSA 1DBIA 1U1IA 5DU2A 4WJLA 2W4IA 2FN9A 4YECA 1WAMA 5AKLA 2O48X 3SJCA 3DJFA 4KPUB 2GLUA 1G7TA 1LW6E 2VDVE 1ZHFA 3CNLA 3OX1A 4C0WA 3THWB 3GFRA 3QYFA 1M5TA 2UZ4A 4J76A 4TZ6A 3MHPA 3DAPA 1VYVA 1J2UA 1K1EA 3FPEA 2D7CA 4LBVA 4YP6A 3NBYC 5FDFA 1X14A 2IDMA 4M2LA 2LDXA 5B1DA 1I2MA 3DMTA 2I6SA 3VAZA 3F4KA 3UJ6A 1NYTA 1Q0UA 2VJAA 4TVSA 2GTIA 2OC4A 3W6UA 2I4MA 3L93A 1GTVA 4JT2A 1PZMA 3DHWC 4J1QA 1EK6A 4BWGA 1DC7A 2LBPA 2JG3A 3PQ8A 4NCXA 4RHXA 3AC0A 3BRQA 1GIAA 1XC7A 4OJTA 5JSKA 5T4BA 4UBJA 4L0CA 4EY6A 1UFKA 1SUDA 2BDUA 1VKOA 2OHHA 2OXRA 2WMNB 2YUTA 3QA9A 3GVXA 3NRJA 4IKOA 2BHRA 1CUUA 1YCFA 4LHXA 2RGEA 5C35A 1FP2A 4OU5A 7MHTA 3E3OA 4WA7A 3CGGA 1V95A 4H60A 3WIOA 2JJ2D 4J16C 4JR0A 3ZGOA 4RYLA 4DQUA 1MNQA 4ACAA 1RMYA 2QTVA 5CA1A 2LKDA 4EO9A 5K3SA 1M75A 2A92A 4PNHA 3VR5H 4EBFA 2R00C 2YFKA 3RQSA 1T25A 2PTGA 3BIJA 4E2YA 4NXMB 5IKOA 1CP3A 3WWPA 2Q3JA 4LHYA 4RXUA 5AM1A 1H1DA 4P83A 2QE7A 2X8LA 2C2HA 1SKAA 1BYUA 2Q99A 3AHGA 3T61A 5F7OA 3MT7A 4UM5A 4HAVA 5DLYA 2ZPAA 4LFAB 2I8CA 1NUQA 5IVKA 3QITA 2C0PA 2G80A 1TF2A 2HJHA 2FW7A 4ZWNA 1JT9A 4ZPJA 4XZ3A 1F2UA 1QYDA 2GK6A 4Z4CA 3B2QA 5JCOC 2ZYIA 3IV9A 1AH2A 3PCTA 1N34B 2PZ8A 3EVTA 3HBLA 3PXGA 3VNRA 4ALLA 2J3DA 2W37A 2E4AA 1V37A 4LXXA 2AMYA 3GI1A 4MIKA 2BFEB 4D82A 3F3YA 1LBQA 3FDJA 3VVBA 2XDYA 2BE7A 3A1CA 5LA6A 1JR6A 4Q7MB 1R9JA 3FCCA 4BPRA 2CT8A 2XGJA 1W46A 3ILHA 1AKQA 1QAOA 4YAFA 2O2JA 1F6DA 4KXFB 4XASA 5DIFA 4HNRA 5AICA 2O3SA 5J4HA 1GNPA 5TJ9A 4Z54A 4JUFA 2VJPA 3OY7A 5JUWA 3KALA 1GQOA 1NP6A 3PHHA 5DCYA 3ER6A 1EVQA 1GPDG 4DMKA 5JARA 4OI4A 4P1ZA 5DMXA 4GOJA 2QTVB 2ZRHA 5CA1B 1CUDA 2B1JA 4R83A 3SE7A 2R8ZA 1EUYA 1E4YA 2AG5A 4URZR 3AVYA 4N0MA 1DINA 4Q3KA 1QHSA 4J4BA 1RM4A 2HBZA 1SCBA 3L8HA 3WAGA 2GN0A 2Z5VA 1UEXC 2P2SA 3K71B 4YP7A 1E9AA 3AWIA 2BISA 5JFGA 4NESA 4XA8A 3WDKA 4HTFB 1U3VA 2ZRNA 3FKSA 1LTQA 5BPFA 5I4BA 2OM2A 1YFJA 1R0SA 2VQSA 2BHNA 2GJ4A 4NBLA 1A5SB 4P54A 4WOJA 2DKOA 1F2UB 4Y2RA 4JWKA 4EPXA 5K8JB 4KHPB 2GZ2A 3PC2A 4RS4A 4X1KB 3LQKA 3QFCA 2J3JA 5E9WA 2PFSA 4E5YA 2ZWVA 2XCTB 2FWRA 1MJFA 5LC1A 5FBKA 2VKTA 3RK4A 5KQLA 5DM70 2GM4A 2C5FA 4M9UA 4O4LF 5FCDA 3N2KA 3QFRA 2YFYA 1TGYA 3S40A 1YZVA 5LA6B 3P7MA 4R71A 3O1HB 1GGEA 1H0HA 3BB1A 4Y6RA 3P2JA 4H35A 1U3WA 4XQ0A 2JD2A 1F4VA 1L5FA 4TVBA 1QM5A 4ZQEA 1ISHA 1MJHA 1QLWA 3KL4A 1IHOA 1FJGB 4NDNE 2Y9MB 5KWEA 5AR1A 3F3SA 3Q2OA 1E2DA 1V3VA 2PO7A 1UZLA 3LRXA 4NCBA 2FSPA 2E4VA 2LD4A 3S70A 3AB3A 4NAUA 4K86A 2ZUWA 1L7EA 1Z6YA 2AOTA 1TD1A 3FTDA 3ED1A 3A4TA 1GTRA 5DASA 3ZXYA 4OG2A 2C9BA 3WDSA 3FRIA 1BRMA 2NTNA 2DF8A 3N0TA 4E6PA 3II6X 3B1YA 1PJZA 1I36A 2OGSA 1EIZA 3A4YA 5A7GA 5I4IA 4S12A 3I52A 1TA4A 3MTGA 1Z6TA 3M2TA 1SK8A 2EAUA 2OD7A 5G1OA 2UXDB 3ZKWA 1VYTA 3B7WA 2PX4A 3I12A 4XFKA 5AHXA 2O7SA 3KR1A 3CCFA 3NTUA 4KREA 1PQWA 1XN4A 2YZGA 4OF4A 5JEDA 3KFXA 4FFBB 5CRIA 3G2QA 5JXIA 4LXIA 2WZCA 1X9IA 1GLVA 2A78A 3PHLA 3ZGXA 1SXJA 2XGGA 4RKRA 4YJ3A 1KMHB 2RI0A 4MHTA 5FV4A 3Q3JB 3KELA 2AEFA 4EW1A 1NNI1 4QDOA 3BCSA 3L8CA 4OHBA 4G85A 5L7WA 5C8VA 1IBKB 2PL9A 2NADA 3FGNA 3I73A 1KARA 2COEA 4B9EA 5DTEA 2O7VA 3SZRA 2QOEA 1WP4A 2ZI5A 5IN5A 1Z7GA 5BV0A 4FIDA 4GGPA 5B6IA 5JROA 2ZWOA 2HWKA 1DJNA 2AOTB 4WE3A 3AVWA 1QFXA 4HS9A 3IRUA 3G9QA 1E2FA 2W6JA 2ATXA 1UBFA 2FW1A 3C70A 3O21A 4TQGA 3G2HA 1KIAA 4C7VA 1O94A 3ZDZB 4ZYYA 1UKBA 3H8VA 2ERXA 4I0WB 2A14A 3U4HA 3RAEC 3DUWA 4ITRC 3IQWA 4JA2A 1ZBDA 5DHQA 3UH0A 4WV3A 1ECCA 4EA9A 1I7QB 1PT9A 4DIFA 5H80A 4MEBA 4DZZA 5AVTA 2YXDA 1QPBA 3V4VB 3ZOKA 3ZKWB 1OXMA 2B69A 2JJ8A 3AZOA 1Q0RA 5IBQA 1K6MA 2WP0A 2ZJ2A 3UHAA 1EI9A 4ND6A 3Q3IA 1AMOA 3D7LA 3KCNA 1EDEA 3HCDA 1B6RA 1RABA 2A9VA 1D6SA 1VMIA 2FOIA 1SXJB 4QOJA 4YJ3B 2Z9BA 3SDZA 4GOKA 1TVEA 2G06A 5ER6A 4MUHA 1DELA 3V6MA 2VYCA 4TX1A 5AJVB 3TH5A 5EGNA 3ORFA 4B09A 4KIUA 2WM8A 1FP7A 3CZ5A 3CEHA 1P19A 4ENTA 3UXMA 3SICE 1ZCZA 3SIPA 1GYPA 2C2KA 4BRUA 1LPPA 3EXFA 1YA6A 1W4AA 4I9GA 5CLIA 1SKYE 3ZWXA 3UJCA 4MGIR 3CRW1 1A4UA 3NJ8A 5AKGA 5JU6A 3SBXA 2PKQO 1I0ZA 3VNSA 4CIVA 2G0NA 1KYTA 1E8DA 4JKOA 4AX8A 5DIZA 2DCUA 3UYLA 4KGDA 5SZJA 2JFWA 4OXIA 2QD3A 2A5LA 1W19A 2Y05A 5IVIA 4OOFA 5AVSA 3SYKA 3G2KA 4EFLA 3GX1A 4U7GA 1DBRA 2I2AA 2O5EA 1OW3B 1G41A 3MJVA 3HJGA 5TVKA 2O4CA 4HDOB 2VT6A 4IMRA 1NXVA 5IBRA 3D6JA 1TLTA 1RACA 4EA8A 4MP3A 4YRAA 2OORC 5KAMA 1OR8A 2C57A 3OLQA 4EGAA 1ZVMA 3C3YA 4R51A 3IJRA 1DL5A 2TMKA 1CJTC 1R7RA 2DBRA 1E7SA 1L8QA 5I8ZA 5G3ZA 5A0FA 4LFBB 1UT6A 1KI9A 1U8CB 2GEKA 2I99A 3OUTA 4OHVA 2AXQA 4RMJA 1U4NA 3E2MA 4Y2UA 3ZHTA 2FR8A 2WE7A 2HQBA 3EDYA 4HUTA 2B5VA 3EXFB 3JVUA 3BUSA 3EASA 3L4BC 3G8BA 1XZ8A 5EWJA 1VJGA 1AURA 4B48A 4DS3A 4QLBA 4DJDC 2GPJA 2RHWA 1ZJ6A 1NN5A 1JJFA 1UPAA 1DG1G 3M5WA 3QXXA 3RR2A 5ICMA 1T9DA 2GN1A 1G3IA 1P72A 3WKDA 1UKVY 3WQSB 3AVPA 4A3SA 1SN7A 5DHRA 4B82A 2FW6A 1P1CA 1V6CA 2C3MA 1WDTA 5EA2A 2GO7A 5H0IA 3VSAA 1RRGA 1WHTA 4IPTA 4EYKA 3ZVLA 4AY2A 2O1XA 1NMYA 5EOVA 3QPUA 4M1EA 3TNDA 1XTQA 4B3MB 1YNOA 1D6NA 4IFTA 1HLDA 1BHO1 5FTWA 1KJQA 5AIAA 3HKBB 4MWGA 4FMDB 3D8HA 3CLTC 1EA7A 1VLHA 3OEWA 1O8BA 5KBYA 1RVV1 1P1FA 3F47A 3I8SA 3N58A 3DONA 1D03A 3U3XA 1WY5A 2Z58A 1LSUA 3V8BA 4F60A 2YOFA 2ZVDA 3UUGA 4LVUA 5HP4A 1OXTA 4D0LB 5EQFA 2FVXA 2R6AA 3RS9A 1FJXA 1LSOA 2I4RA 1ZA1A 1FX1A 1TLFA 2FY8A 2G1UA 1KNXA 1UFRA 1YC5A 3ETNA 5AM4A 4A0GA 5KQMA 5LIRA 1Q0TA 2GASA 4CHGA 2ZRIA 2J7PD 5FTJA 4BQPA 2IYNA 4KACA 5K0JA 4R40A 2UDPA 2DG2A 3F97A 3NIBA 1TU4A 3FAZA 3RT1A 4ZVLA 3VISA 4M8SA 1QG6A 3GPLA 5ICEA 4WCFC 5CIYA 4RMNA 2O54A 1CRPA 4BQOA 3NZEA 1UBGA 3HC7A 3PYLA 2A9PA 4P4NA 2C20A 2NXNA 3RLFA 1GTG1 4TLMB 4BMNA 2OV8A 1WHTB 1XTSA 3AFHA 2IHZA 3IAUA 1DAOA 1R1DA 1J0CA 3EUAA 2OO5A 3E9MA 4US1R 3E81A 1QLHA 2M2IA 4RK5A 5FJIA 1JHVA 4Q3BA 1XCLA 1NQXA 2C03A 3TJMA 3WP0A 3HCEA 1FFEA 1LVUA 2QQFA 2ZUCA 1Y9EA 2DY0A 4BO1A 4HJRA 4CW7A 1MT3A 1GN9A 1IUNA 1VE7A 2YYYA 3QOWA 5JZOA 4LY9A 1II8A 1ESZA 3ASZA 3LQYA 2NSYA 4FN5A 4LSZA 3U7JA 3A6PC 2CV0A 2NXCA 3OZXA 5EZYA 3LPMA 3DC7A 3PVSA 3RS0A 4GR4A 1WETA 2WKQA 1VCMA 3EEIA 2ZRAA 2I1QA 3FTQA 2G5PA 3QXGA 5HW0A 3TTSA 4IJ6A 3PLRA 4GMXA 4PQRA 4Q16A 3AESA 1SHKA 2RGBA 2H9AA 2ZB2A 5K20A 3HMKA 3Q1KA 3VNVA 2RH5A 1DX9A 4ENSA 1W4ZA 3WGJA 1P29A 2I03A 2HX1A 3BGWA 3KZNA 1HMPA 3L92A 1NOJA 4NJEA 4NP6A 4RD1A 1XT6A 3IO5A 5KTSA 4OB7A 5BQPA 4IUCS 3GF4A 4IXWA 1BDJA 1TL7C 1Z2PX 4LPKA 4NOKA 3VR6A 5B4VA 2WTNA 3R6LA 3E9EA 5HNKA 1N2IA 3LNCA 3T9EA 3VFDA 1EXNA 2O0JA 2V4UA 3BMXA 3L0ZA 5FUXA 1E89A 4NENA 4C88A 5IPFA 4KPYA 1XTKA 3LA8A 4CM5A 2W2TA 2ODEA 1XZHA 2YCBA 5JC1A 1BO6A 1D2NA 3G7UA 4ABTA 1D07A 4Z9AA 3LD9A 1ZGBA 1N2CA 4FOSA 1ADGA 2HHJA 2PKEA 5LQKA 4UTZA 2IYLD 1TJ4A 4O29A 2DBQA 1II8B 2WTUA 1JB9A 3G1WA 4UHJA 3PUHA 3ML1A 3NUQA 4A23A 1UPBA 3KPWA 1DG3A 4J1SA 4XB6B 5EZYB 5K4GA 1XPRA 4ZT5A 3PUYA 2B94A 3K70D 4U7WA 4RNCA 1MRNA 4J7AA 1GQQA 2X58A 1ONNA 3W8EA 1E1LA 1AU9A 1YQWA 4L57A 3T1TA 3KOXA 3QLTA 3TGWA 3UMRA 4BEWA 1SUEA 4GQIA 5CLQA 5SZKB 2BEVA 1ZFNA 1DOAA 3AESB 3SYMA 5I7VA 2CHGA 4PZYA 1Z2CA 2GDZA 1JEJA 5TE9A 4FHZA 1KQ3A 2Q5JA 3NP9A 3O7MA 1LPSA 3NFYA 5DCLA 3TRIA 13PKA 1QP0A 1Z82A 1DKUA 1UJ2A 1QFSA 4DOMA 1FDWA 2Z98A 5I7OA 5ELXA 1N25A 3TB6A 1ZKMA 1T13A 1NXOA 2VH2A 1Y7PA 2HA4A 4HWKA 1E79D 3S1AA 4E5DA 5C0OE 1MO3A 1KY2A 4NENB 4BNUA 5KSZA 1KO7A 4HFMA 3HVIA 2Y0PA 3AYZB 3ZV4A 1V8PA 4XDZA 3DEZA 3D3KA 3F6EX 4AJ2A 1OF1A 2C3PA 2WHRA 4YHBA 5EE3A 1SGWA 2A1TS 3IBFA 3L6BA 3WGKA 2KWIA 4JAVC 3HM9A 4J0CA 3WYCA 1YHNA 4IR7A 1Q7GA 4IGKA 1QF7A 2GILA 2JFPA 4ON9A 1V43A 3PRYA 1OLUA 1QHHB 3JD4A 2HNKA 2CXRA 2WSMA 3PTLA 3BCUA 2WFAA 3AFGA 4TXJA 3ZW8A 5BQXA 1RI5A 3SZOA 4HFNA 2ILTA 2QY6A 3S2YA 2BEVB 2QM0A 4JFRA 1SD5A 1JRLA 1U3TA 2IF2A 3LP5A 1Q44A 3INTA 5HCNA 4LPSA 3Q8KA 1B42A 1TCCA 2X3FA 4AQYB 3V9PA 4Y9SA 1ABEA 2BDTA 2ID7A 1ZL0A 3OY2A 4W4TA 3H5RA 3HN6A 3IHTA 4KDRA 3ZV6A 4OXQA 4XWYA 5AW4A 2V8BA 3N53A 1VG1A 4YRJA 4OD0A 4EKIA 3B36A 3MFYA 1P4AA 2XH8A 2BSQA 3ZI7A 5JLJA 5I5GA 2WUDA 1T9CA 4NZNA 3NTOA 4H3VA 3S1AB 3H84A 2O5CA 3AZPA 5IULC 1XXHA 2PZKA 1IY2A 2Y27A 4J0GA 1T34A 4DUGD 5ALIA 4AAYA 3ZZMA 2LTAA 4ZZIA 3GEMA 3OE4A 2VSNA 4LYJA 2NT4A 3UG7A 1AMUA 1R5JA 1PGNA 2Y6UA 3MIZA 3VUEA 1EDZA 4C4XA 4NICA 1ZNQO 1E1KA 4HWPA 5AHKA 2SNIE 1N0VC 1G0OA 1VIYA 3C87A 4IOMA 3FHLA 3EWIA 4JLBA 3WMEA 2FUEA 4DJ5X 3C3CA 3PFFA 1POWA 4GVLA 5A2QA 2EKZA 4UU0A 3JAMA 3ROXA 2IYFA 4QG7A 2I7VA 3I04A 1L4EA 1VKRA 4UCXA 3HDYA 1GAWA 4A91A 5KHOC 4QNNA 3LX5A 3THYB 2WKRA 2Q2OA 1IZ7A 3ESRA 4QD3A 1PDVA 1SCJA 5HOEA 4JYZA 4R1QA 2BC9A 1Z07A 5KTRA 3H5VA 1BFDA 2PSHA 3VNUA 2WJAA 3WLQA 4F91B 1V9SA 5IWAB 2P3SA 3EZYA 4RVCA 1TADA 3EISA 1UBMS 1YU6A 3FVVA 3TVDA 4ASUA 1CTQA 3FCOA 3UK1A 3K8YA 3THRA 2H65A 4YMUA 3AJEA 3H04A 5EXDA 1MBZA 4A8JC 4ZI3A 2NZXA 1RHRA 1EFDN 1FA9A 1RU3A 2PKYX 5D7NA 4BB5A 1KEWA 4F4IA 2JHGA 4ID3A 5IKMA 5KI6A 2GF2A 4HMOA 2WU1A 1XXHB 3AY7A 3DBLA 4UEWA 5KDOA 5KSYA 3P32A 3E70C 1Y89A 4TUYF 4R7TA 5IF9A 1BVRA 1RHKA 3JXEA 4FHCA 2VUSA 1D4OA 1MPXA 1WJGA 5B3KA 1U0RA 3B3AA 2WNHA 1VBKA 5FUQA 3GRCA 3ZHBA 4CV0A 3W04A 5JD4A 1T2NA 2D0IA 5LU9A 3F1LA 2DFPA 3LVBA 3N70A 2QG9A 1DC6A 3P0HA 3TNYA 4OH1A 4DIOA 3B52X 4R8VA 3ZDAA 4GQAA 4YQZA 1EU1A 3SSAA 4PSKA 4OP3A 2YDYA 5M04A 2AJ8A 1O9HA 1BVUA 3LU1A 4M9SA 1QIHA 2BGIA 1WS6A 2RHDA 1ENYA 3QVLA 4BRWA 1MEJA 2P9YA 1FP4A 3IVXA 3WLKX 1KOJA 1ZONA 2AJBA 1F8UA 1NVXQ 2BT4A 2X5JO 3VR2A 1CHDA 4OVKA 4IQ4A 4CEJB 3GBPA 4HQKA 1NLYA 1Z12A 1XTVA 5HF5A 1P2VA 4O0MA 4BV9A 3GVIA 3I6IA 4WI1A 5HBRA 2ZPUA 3V1MA 2DU8A 1A7JA 1ESCA 1ZGJA 2OAEA 10MHA 1QDEA 1PFUA 1ZSNA 3MJCA 4DG9A 2ZYVX 2DQYA 2F1KA 1Y80A 2ORVA 5LXTB 3GP5A 3BRCA 1A27A 3MMXA 4R68A 2P1RA 3KQYA 4K5QA 1G18A 2RGGA 1XKTA 1EXMA 2SKEA 3B3QA 3RHFA 4G4JA 4OMCA 3V46A 5ALVA 1PUJA 1GUBA 3D02A 1C4XA 2EGGA 2QI9F 4RQTA 4UTRA 2F4VB 5EWLA 3V4OA 4BVHA 1NMZA 3GBSA 1ZU4A 4YREA 1B8NA 3UJ9A 3HV0A 1H3EA 3WHLA 3A6LA 2GBIA 1WRBA 2BGKA 4QFBA 3AWDA 3LXRA 3BFVA 2PL3A 3JQ7A 2JFNA 1JS1X 4UHCA 5B37A 3C3KA 2Z6AA 2HIGA 3T8YA 3VH2A 2XQJA 3UJBA 3NHLA 1FRZA 5L6MB 2C7GA 3GWGA 1UC8A 1RWQA 3O1LA 5L4NA 3UK6A 2IODA 4IXTA 3QFTA 1FP4B 1I80A 4GEGA 4WKGA 4B4VA 5INTA 2EARA 3R41A 3F98A 3DVQX 4P32A 3I01A 4N48A 2PX0A 2W83A 2XMGA 3WGLA 3DH0A 4L3OA 2E0IA 3RTBA 1JHZA 2QHXA 1SC9A 4GX0A 4PGMA 2DEUA 4FFDA 1V1JA 3PGXA 2MIIA 4UD2A 3SQDA 1BMFD 3A7EA 3K2IA 4QREA 5AH0A 3UG6A 1TYDE 3FOBA 1U2GA 2PWYA 3QIAA 1TVKA 3ZCQA 3CY6A 3KDSE 4Y1FA 2O59A 1QHFA 1QYXA 1QX3A 2XZOA 2DH5A 3NHAA 4F3KA 1EB8A 5IEBA 3WLTA 1GGFA 2WD8A 4QDKA 3F9IA 4IX1A 4UXJA 3ZU6A 1H93A 1RRFA 1P8AA 1MT0A 3GARA 2NZVG 3ZZNA 2I8AA 2CNNA 1ZH4A 3CISA 4ZVVA 5EKDA 1T9AA 1IOVA 3KUCA 4HYYA 3W6OA 1Y8CA 5J23A 2YV5A 4Q93A 3B12A 1I3CA 5JMPA 2JI9A 3FKJA 4HRAA 2I33A 1YJXA 1KGSA 3N75A 4LKOA 2OVBA 1L4YA 4PYKA 4K2AA 2H7YA 1CNEA 5ICCA 2FFRA 3IIKA 2C2MA 4EY3A 2G76A 4L4ZA 4OSOA 1D6MA 3U60B 1B8VA 2ZSJA 1GFSA 1P6QA 8MHTA 4LF9B 2ZIWB 2OBYA 5EJFA 2C8VA 3G5MA 3KLBA 3PUWA 4D9IA 5LU8A 1WCV1 1L5YA 1ZW6A 1SVMA 2H2DA 2Q3DA 3DPIA 4BJHB 4ZDJA 4GDMA 3RRFA 2N46A 1JU9A 3L6OO 1N5MA 3IT2A 1C2YA 1E4VA 3AXSA 5H9WA 5JZ9A 1TVKB 4P2BA 4YQYA 3CO5A 1U6IA 1RJFA 1WV1A 4GLBA 3CUEF 1M0TA 2XKJE 2NTVA 1W44A 4HN4B 5BWNA 5AVWA 3AR3A 1ZW1A 1H6BA 3UAYA 2A59A 5EKTA 3C4VA 1JIQA 1KAMA 1DUVG 1Z9BA 4M38A 2J3QA 2W2QA 3O82A 3GJZA 4LHVA 3JQFA 3A9WA 3QI2A 1PGPA 2ECPA 1PFWA 3W4IA 2WD7A 5H3CA 4MV5A 2Q41A 4KWHA 1V5WA 4Q3OA 3INNA 4HNSA 4E2ZA 5I7WA 3RVJA 2EJWA 3H2KA 5AXBA 1ZUNA 4PNPA 2I9KA 5I9MA 1I5RA 2GTHA 5EMKA 1E2BA 3CPJB 4XM0A 3N9IA 4W99A 2J0QA 1IUKA 3LCMA 1PF7E 4FJ1A 3O8NA 4E5MA 4ZK2A 3LO5A 4TXLA 4MGKR 1T8PA 4AU1A 4HLUA 1Z4LA 1EAYA 2C97A 3IUMA 1JX6A 3VH3A 5KYYA 1WLYA 4XSHA 1JIIA 3MA0A 5L53A 4M6WA 5EE1A 1ARZA 4S1NA 1RZRD 2ZAOA 4UEJA 3HUDA 1EVZA 3GEHA 1BU8A 1H0RA 1K0UA 3JALA 3H75A 1S5PA 1WZIA 4GZ5A 5LMZA 3U7IA 2IZ5A 4X45A 4EQZA 1RAFA 4HAWA 3UHFA 2MOKA 1IAVA 2LVBA 3DLBA 4QNRA 4EHAA 1VPEA 1E6WA 2CCGA 4PC1A 4ABYA 4X3PA 3I76A 3EAQA 2QTTA 2J4FA 5BSKA 2NU6A 2O3TA 2YVUA 4KDEA 3MXTA 1FRNA 4D5EA 2V6BA 1MZPA 4KQEA 3AUSA 1WXGA 3DKRA 3KU1A 4TV8F 3PNSA 1TQ6A 1PJ8A 2HJGA 2WD7B 2CB9A 4CV1A 3R5TA 3U0VA 2PXCA 2YZNA 3JQAA 5A71A 5ADWA 4RJLA 3ORHA 1OWLA 1Z13A 5GZ6A 1MOSA 3BAFA 4MMXB 1ZUNB 5CYPA 4C3OB 4MPJA 1Z2EA 1R0LA 4I19A 1RYZA 2AFHA 2GA8A 3E8MA 4MRAA 4RHEA 3K09A 4KHZA 1KTIA 4DMCA 1Z15A 1PLKA 1F48A 3LP6A 4QDZA 3G79A 5AOCA 3I9NA 3ICOA 3UAOA 3V5NA 1Q22A 1EH5A 2MSNA 3OFVA 4OM7A 4PWYA 3VX4A 2F3PA 5L40A 4D74A 1NASA 2Z8YM 1N3YA 1ZK4A 1GTJ1 1XDBA 1FRQA 2OK8A 3C3PA 4M6WB 3UWSA 3CURA 4BWFB 1PWZA 5HS4A 5EIXA 2IZZA 3FNQA 4WZBA 3JALB 4X7MA 1KH1A 3SAJA 2IFTA 4Q4HA 4RH3A 4XKJA 5ESRA 4QDUA 3EQ2A 2AHRA 1S3SA 1P5ZB 1XPJA 2ZPTX 1VL5A 1QFYA 3OZGA 3PNMA 4LXTA 3TXAA 4B45A 1CNMA 4DEVA 1IBRA 4LCJA 1MB2A 4QYIA 4F8EA 2QU8A 4CKZA 4RDIA 3COSA 3KG2A 1A2KC 1J8DA 1M2EA 1D9XA 2NU6B 3OIYA 2PJDA 3EB9A 3L8YA 3WK4A 3AB8A 2ICAA 5AYVA 4CDNA 1FFBA 1LRKA 2PUHA 3CLTD 4FDAA 4FZ5A 4H17A 5EJ4A 2XXJA 1JIVA 4WJZA 4JI1B 1UM9A 3KXIA 3UYKA 3ZE2B 2HNBA 1A9YA 3GEEA 4X20B 4MLDA 4HNUA 1RXEA 2FLKA 4M7OA 3WC4A 3JQAB 4FE7A 5CA0A 1YFZA 1W48A 3PE6A 3F96A 2Z08A 3KOYA 4JI4B 2OILA 5AESA 1GO2A 1ID8A 4RZXA 3CEMA 3MUFA 3PJGA 3V8MA 1HKHA 4X95A 5HJEA 4KLNA 3CUVA 4J0HA 1NF8A 3N3AC 5J5AA 2Y1KA 4KVAA 1QC5A 4QO7A 1L5RA 1R6DA 1Y42X 4B8WA 4BV8A 3A58B 2P5SA 5YASA 5CB6A 1YFLA 2OQRA 4KTTE 3ZCXA 3LTNC 4FD3A 3CW2A 5MFZA 3IS3A 4WZBB 1W29A 4I8DA 2M9MA 2O8VA 1TMYA 3W79A 4Q4HB 4UNSA 5F1OA 5KSPA 2C7VA 1YS2X 3CJRA 1D4ZA 5DW0A 1PR2A 3OFSA 4KJZA 3QYAA 4TXMA 1FFXA 2E1RA 3WGGA 5JYEA 4GL4A 1XZKA 4UUQA 3FFAA 4QYIB 5K0SA 5LKRA 1N77A 3M6AA 3RS7A 3ICWA 3N8IA 1WABA 4EPYA 3QW4B 3LS2A 5AVKA 3TIIA 3HVUA 5FPHA 4PPNA 3WXMA 1UM9B 2JIDA 4D9CA 2LCIA 2Z5LA 3BMOA 5E7MA 4C6TA 3OPQA 4M7PA 1KR5A 1BMQA 2IYRA 1ZJZA 4K28A 4OV6B 3KOMA 4ZZ3A 3TIVA 4GVXA 2ZI3A 1SBCA 2C9CA 2D06A 3ZQ6A 5BWBA 5C2JB 2QW8A 2QRNA 4XSVA 3SS7X 5HE9A 3FKQA 1TW2A 3BWMA 3HRIA 2Q46A 3TLMA 5DN6A 2XQFA 3MUEA 5BRNA 4AD8A 1B8UA 4QTYA 1KRXA 4S2UA 2PHZA 2IPAB 3E48A 2IIQA 4KPFC 2YXLA 4UBLA 5B3JA 1QC5B 4F5YA 3A1WA 3W5UA 1C0IA 1CZHA 2RJNA 4MS1A 3D6AA 2P5TB 1DWOA 1QIJA 5L7TA 3ONFA 4A16A 2KE5A 5DNAA 4IG9A 3KETA 2DC1A 2H17A 1DI0A 4LGVA 4LJ4A 1ABFA 2HXSA 1RQNA 2IGTA 1BS9A 2E48A 3E5NA 3N2IA 3PHGA 5DNEA 4EF4A 3M6MD 1R27A 3W5CA 1M2GA 1FFXB 3W8FA 2XB9A 3COPA 1KO4A 1H2AS 3FYUC 5HF8A 3IXLA 4WK2B 3RVDA 3WK5A 3U09A 4CL0A 4C2UA 2FNAA 3IIMA 4CV3A 3FYCA 3MSCA 1GYQA 3I04M 4D02A 4ZZ0A 1G16A 2Q27A 3DDSA 3ONDA 1C7QA 4YRBA 3CBGA 3NOVA 5TJHA 5LFAA 3DHYA 4N40A 3VYWA 1RCTE 2PSFA 3LPAA 5BQ5A 5B6JA 4HAOA 4PFJA 3ZWMA 2DULA 2BWJA 2GR9A 1ZMRA 3BMOB 3MJEA 3NHBA 4IEFB 2QM7A 4QDTA 4C6TB 3IPRA 4JYMA 3HN2A 1P6UA 4Y1EA 1OHHA 1RBMA 3LT2A 4QVIA 1LEHA 3HBJA 4A8HA 2VBGA 1M1ZA 1P4SA 2AHOA 3A9CA 4NDZA 1NQAO 4OU4A 4OYHA 3CZMA 5LZ7A 3U4CA 3A6GA 5COBA 4JKIA 4M9ZA 4DNQA 1Y82A 1K9VF 5ALMA 5ESXA 2ZTVA 3FLMA 4GF5A 5FKJA 4HNQA 3MSXA 3CPSA 2A8YA 3VU3A 3QX9A 3H16A 5HIIA 5IZ4A 1NKSA 2G1JA 4W8GA 2AOVA 4MS1B 1TZ2A 1BJRE 3UVEA 2ZXUA 1RWWA 4YJHA 4ZEMA 4NZ9A 3VAAA 1NUAA 1BEUB 3ERCA 4MI9A 3WL6A 3ABQB 4BNFA 2C8LA 4PE5B 5HQ3A 3WRXA 4QGHA 4ZJPA 4KCGA 5BQFA 3OZWA 1RWVA 4TYPA 3C5CA 2F9MA 3VPSA 6REQA 2R4UA 4U7PB 3A1VA 1W0KA 2B2NA 1WVMA 2PMDA 2A35A 3TEFA 5BSFA 5KKCA 2CXPA 1GSIA 5KUTA 2RGRA 1AV6A 1ICEA 2IUTA 1CY0A 1K6IA 4B0OA 2QLNA 1G8KA 2ZE7A 3DMTC 4U2EA 4BTVA 3GLHB 4YRNA 1KEUA 5KYGA 2XCSB 1Y1LA 2C96A 1WUHS 2ZUSA 4CNQA 4EFDA 3PFHA 4J91A 3UC9A 1QG0A 1KJYA 4XVHA 2I2FA 1BHSA 1MKYA 5EXXA 5CVTA 2HHHB 1JEQA 1D2AA 2ACEA 1A9XB 3PC8C 3U7QA 4ARZA 2ZWIA 3FF1A 4QLOA 3W7AA 2AQKA 5HKOA 2VQ3A 4FZJA 1Z0FA 1CRLA 4PFSA 3AMVA 4TL7A 4DLLA 4FYJA 4G5RA 4CKXA 3BB4A 3STVA 3K4HA 3PGKA 3KEQA 2EV9A 3TW4A 5J63A 1LI5A 2AE2A 3EGWA 4G5XA 3DHEA 4PZ0A 4LBWA 4C22A 1T9ZA 1NY5A 5J47A 3E22A 2F4NA 2RHLA 2P2GA 2WJJA 4CCYA 4DNPA 5C7YA 1NVWQ 3ETDA 5HQ3B 1QV7A 5JAOA 3K9NA 4FINA 2AIRA 3SXUA 4F11A 4KRGA 5JPCA 1ZJ4A 6REQB 4HYQA 1X1EA 2NU7A 4CL3A 1X7YA 2PUTA 3R44A 4IM7A 2OO7A 1O6BA 3K0EA 4UJ3A 1MB4A 4XIGS 2HLNA 3GPDG 3PIDA 4OAPA 4J4HA 1CLUA 3ES9A 2QYOA 4NBNA 5FULA 3TZKA 2ZVJA 3EZFA 4AZVA 4B31A 2RGUA 4ODIA 1P1IA 1XCPA 2Z6VA 3ZLBA 4DADA 5KTOA 4D4JA 1UAAA 3FDXA 3G9UA 2BH2A 2VRNA 3ZX5A 1WXDA 3I01M 3JD1A 4GS5A 4E7PA 1JEQB 4F0JA 3MFQA 3FUCA 3MJSA 3PP8A 1UBOS 2K5UA 2NZWA 3ESBA 1ZJJA 2ZBQA 4G01B 3U7QB 4A0QA 1DMSA 2HDNB 4ARZB 2H1OA 1JJBA 3HA7A 3ZE7A 4O2AF 2W2OA 5DX8A 1JLMA 3AB7A 5DM0A 2V1UA 1CEQA 5ES4B 1G6OA 1DIHA 4NKRA 2VQEB 5GONA 1ZUIA 1TO6A 2VCEA 3MWLA 3SYTA 2EBUA 2WKSA 3R6WA 4YTEA 3OKPA 1W5BA 1QO0D 2JAWA 3I6MA 4V39A 4X54A 3FZGA 4CUJA