2RAFA

Crystal structure of putative dinucleotide-binding oxidoreductase (np_786167.1) from lactobacillus plantarum at 1.60 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
MEITIFGKGNMGQAIGHNFEIAGHEVTYYGSKDQATTLGEIVIMAVPYPALAALAKQYATQLKGKIVVDITNPLNFDTWDDLVVPADSSAAQELQQQLPDSQVLKAFNTTFAATLQSGQVNGKEPTTVLVAGNDDSAKQRFTRALADSPLEVKDAGKLKRARELEAMGFMQMTLAASEQIGWTGGFAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Dinucleotide-Binding Oxidoreductase
publication title Crystal structure of putative dinucleotide-binding oxidoreductase (NP_786167.1) from Lactobacillus plantarum at 1.60 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Oxidoreductase
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rafA01
1W4ZA 2X9VA 2X0NA 3JV7A 1LC0A 1ADGA 2PZKA 3DOJA 2VHWA 3COSA 5DT9A 3TJRA 1DB3A 3JQ9C 3L4BC 4CV0A 2J6IA 4RF4A 2VNSA 3RAJA 3AY6A 4PLGA 4DBVO 3PXXA 2NTNA 1SEVA 3H9GA 1HSOA 2VWHA 3R1IA 4J9UE 4A2CA 1Z74A 2NTVA 2RHCA 3KYCA 1KOLA 3GNSA 5A1TA 3A06A 3VH2A 4J16A 2GLXA 5BQFA 2BI8A 1ID1A 2NWQA 5JC8A 1OZAA 3MWEB 1VC2A 1DDOA 3B20A 1R0LA 3AJRA 1YB4A 3FNFA 3FF4A 4INAA 3UKOA 1SB8A 4LVCA 3F4BA 3H2SA 4J4BA 4R01A 3W6UA 1PWZA 4CMCA 1KIFA 5FI3A 5I8WA 5T64A 5CP8A 3ANMA 1I3NA 1KVUA 3DTTA 3PWSA 4L0QA 3MJVA 1JKJA 1QMGA 2DPGA 4KOAA 4WNCA 4EJ6A 4PCVA 1KBZA 4XJSA 4GGOA 2Q2WA 1ZK3A 4E2ZA 2QX7A 1Z7EA 4RDHA 4DPKA 4PZDA 2Z1NA 3U62A 3HUDA 4FFNA 4HV4A 5K6AC 1E6UA 1JWBB 3GUYA 3RWBA 4E5MA 5L40A 1M6HA 1P1HA 1YDEA 2XF8A 4ND1A 1GZ3A 3NV9A 4CLRB 2GZ3A 1PQWA 1O0SA 2DAPA 3G17A 3FTPA 2YV3A 3OEYA 4MIEA 1IZ9A 1R15A 3NGLA 1MXHA 3FPLA 3D3WA 4KZPA 4W82A 1QYWA 1SBYA 4UUNA 2ZB7A 3H3JA 3HQ4O 4OKNA 4Z0PA 5KKCA 3UICA 3H9JA 1GCOA 2BFAA 2B69A 2Y93A 4XEHA 3RVDA 4G81A 1C1XA 2UUOA 1A4IA 3QLJA 3SJ7A 5JYDA 3RI3A 2NU9A 4K9DA 4FB5A 4O1MA 4MIOA 4OQZA 4I08A 1F0YA 3IL2A 2HU2A 1NTOA 1DOHA 4JBHA 4W6ZA 2BF7A 3E82A 3FPCA 3GNTA 4E2WA 4NBUA 4WASA 1UZLA 3JQ7A 1PJLA 1P1KA 4RV9A 2XXJA 4OSOA 4W4TA 3SC4A 4TVBA 4ND3A 4J43A 2VUSA 2PZLA 3PP8A 3LF1A 3WXBA 4E32A 4RL6A 3UHAA 3BHIA 1M6WA 3VPGA 4UUPA 3AUAA 2CF5A 2GN8A 1V6AA 2DBZA 4M54A 1PIWA 5CDTA 4PIVA 3I4FA 2DPHA 1M76A 3NDRA 4CJXA 1EVZA 4CUKA 5EL0A 4UULA 3VOSA 8LDHA 3VKVA 3P2YA 3WX0A 1IOLA 4GQAA 1YJQA 1C0KA 2HDHA 1PZGA 4BKOA 4YT5A 4BMSA 4JGBA 4CV3A 3WFIA 2RCYA 3ZWYA 3P2OA 5TQVA 3ZU2A 4BQRA 4CM4B 1T25A 4HFRA 4BIIA 1NQTA 1WVGA 2HRBA 1DPGA 3HFSA 5JPIA 3AI2A 2FZEA 2LDBA 1YWGO 1WMAA 2PGJA 4MVJH 3RU9A 4P8RA 4FCCA 4GBJA 5F1PA 1EK6A 3NT4A 5AXCA 3S8MA 4TRJA 3F1LA 1Y5RA 4IUYA 4Q3CA 1EBFA 1ZK4A 2W2LD 4QFDA 3OIGA 3WSVA 5L4SA 1YQGA 2Q2VA 4B3HA 4CLXA 1SB9A 3K73O 2I65A 1E7YA 2X22A 4YRDA 3I4CA 2FZWA 3E1KA 5IFLA 2X5KO 4BKPA 1RPNA 1SPXA 4IJKA 5L4LA 4L74A 5KVSA 2DT5A 2VRBA 3DXFA 1Y8RB 1PZEA 1GUZA 1NWCA 1CWUA 3DTYA 4I9HA 3I3OA 2PA3A 2PKRA 3NDIA 4WPGA 5L51A 3ZH2A 4P4LA 2Q49A 1UDAA 3SXPA 1E6EA 4BHTA 2NNLD 3JYLA 2JKVA 3PZBA 3DAPA 4O0LA 3Q3CA 1K6JA 2G0TA 4HFJA 3V5NA 5CDYA 1E3LA 1Y8QB 3T7CA 4D0RA 3IOYA 3L0DA 3RUFA 3IUPA 4YT2A 4EZBA 3JYNA 2I67A 4W9NA 5I7EA 4M55A 1E3WA 1I10A 1VSUA 5AXAA 3DZBA 1YGYA 1ZNQO 2Y0DA 3MJCA 2BFPA 4O6VA 3VZSA 4N5MA 1B8PA 1PGNA 3D4OA 4ALIA 4EUHA 1MG5A 1LDYA 3HDQA 3KB6A 4BKRA 4CMEC 1DC3A 3GEGA 1IZ0A 1BW9B 3N58A 2GR9A 2F00A 3C85A 1MC4A 1C0LA 2DC1A 3NGXA 2EW2A 3CH6A 4ZRNA 5FYDA 1TI7A 3WQRA 3ICCA 1YL5A 2X9NA 2BMAA 1F8FA 1UJMA 4KWHA 5EN4A 2JD0A 3EK2A 4IQGA 4MKXA 4F6CA 1MX3A 2YHIB 1E1MA 1I8TA 1K0UA 3F1KA 3OA2A 2GN4A 3PK0A 3GPDG 3VH4A 4GSLA 2W2LA 4MJLA 5TSDA 4Q39A 2OGUA 3N74A 1JVBA 1N7GA 5TT1A 1PJ2A 4HADA 2YQ5A 4GMGA 3DHNA 1OC4A 1GV1A 3WGOA 4JJFA 4CL8A 4J2HA 4BV9A 4JN6B 1QKIA 4IDAA 4MVJI 5BSEA 2FPPA 1LLCA 3WR5A 5B37A 3PIIA 3WGIA 1Z75A 2ZQZA 3GY0A 1NP3A 4FQ8A 3ON5A 1D1TA 5IXYA 2I9PA 4IPTA 3KUXA 5G4KB 2VTDA 1ADBA 4YJGB 4OQYA 5DOZA 3QHAA 4JJIA 1H9BA 1EZ4A 3Q9NA 5I9MA 1Q0LA 3GMDA 4LGVA 1JU9A 3S2EA 3WTBA 1U28A 2TMDA 4NBWA 4ND4A 1B8VA 1PJ4A 1KS9A 2O4UX 1EUCA 4FGSA 4MP8A 5MGBA 1ZCJA 1XCBA 4GX0A 3WS7A 4XQ9A 2GERA 4HBGA 5L7WA 5HWSA 2B4RO 4W99A 1XKQA 1DIHA 2NU6A 3ZU5A 1A7KA 2IEDA 3RJ9A 4PLWA 3B1KA 3KTDA 3EVTA 3NEPX 3PWZA 1QG6A 2QYTA 3M1LA 4R1NA 1KETA 4E5NA 3CMCO 2J5KA 3L77A 5KJ1A 4U8GA 1TEHA 2G76A 4RVDA 5T8KC 3PYXA 1HE3A 2PV7A 5IZCC 3EC7A 4W7HA 1XHLA 4WGGA 1ZK0A 1LDBA 1QORA 3BZUA 3EMKA 1I3KA 2HMUA 1RM5A 4NBTA 2FR1A 5I7FA 1ORRA 2E48A 4J7UA 2CDCA 1ZXLA 3CSDA 3GZNB 3NDJA 1GZ6A 4P38A 2QHXA 2FSVA 4GMFA 3Q9UA 1NQOA 3SLKA 1E1LA 2PZJA 5A9SB 3PWKA 3BTUA 4LMPA 1QYXA 3EHEA 2NSDA 1YOVA 3DMTC 2FSSA 4EUEA 1EDZA 4YACA 3WBFA 4CLEA 4E2YA 1AUPA 1GD1O 2GGSA 4LRSB 2A35A 1N9GA 1QXSA 3WMWA 3SVTA 1A9YA 2AQ8A 1EMDA 2JL1A 2Q1TA 1LDGA 1DRVA 1I5RA 3D3EA 4FOOA 4UEOA 5EJ2A 3R6DA 1KEPA 5G0TA 1BMDA 1DAPA 3QWAA 2PY6A 4MKRA 2Q50A 1I30A 1N1EA 1ISIA 1BRMA 4D3SA 4DYDA 4EGFA 2PD4A 3G0OA 1U4OA 2CSUA 4D7AA 1SOVA 4YAJA 5IAAA 2YFHA 1G0OA 4YAGA 1KVTA 2DFVA 2EP7A 1BDBA 1ZXBA 4I5DA 3GDGA 3DBLA 5JDIC 2DBRA 4NBVA 5JW6A 4WEQA 1EQ2A 3PZRA 4OOEA 2GASA 3PHLA 2VWPA 3DBRA 3GF4A 1RM3A 2B37A 4AJIA 3CZRA 1O8CA 2HLPA 2YUTA 4NI5A 1V8BA 1HDOA 3ONDA 3AM5A 4FC6A 1C0IA 4RF2A 1T26A 5ER6A 5I9NA 4B8WA 1U1IA 1Y81A 4MVJP 5CDUA 5HM8A 1WNTA 7MDHA 1U3TA 3SLGA 5JFOA 4LISA 1HLPA 2D8AA 1E1KA 3GEMA 4YDRA 4J4HA 3I9LA 4KUGA 3KRTA 3F6YA 1LRLA 3C1AA 5JYEA 5JBIA 1MA0A 4QO7A 2EJVA 1U3UA 3NAQA 1V35A 1Y1PA 1NNUA 1LTHR 2P4HX 2AEMA 5DBGA 3U9LA 1I2BA 1SZJG 3O26A 3PLRA 3S2GA 1TT7A 3OQBA 3ROPA 3Q0EA 1ZEMA 3H5NA 3HN7A 4PGFA 2J3JA 2ZYDA 3JYOA 4XGNA 2GZ2A 2FWMX 3RBZA 4BO0A 4L9RA 4YJHB 1DHRA 5FF9A 3LT4A 3PYLA 2C20A 3LU1A 3JD3A 3ZN2A 2HK7A 7ADHA 3K2BA 3ENKA 2ILTA 3FWNA 1C14A 1XELA 4J1SA 3HZZA 1DJQA 4R1SA 4I9NA 1ZJZA 4A5OA 1PS8A 3EW7A 1EDOA 3OQ1A 1T2AA 1T2CA 4CUJA 2X4GA 5T5QA 5A4DA 3GA0A 4OHUA 1U3VA 2BHLA 1TA4A 2A92A 3PGXA 1R6DA 3ROMA 3TZHA 1MLDA 5G0SA 1KERA 4J7XA 1P1JA 3GNQA 3LQFA 5F5NA 2YHUA 4OKIA 1IY8A 3GZ4A 4DPMA 2VHZA 1WMBA 4TWRA 3O38A 4L4RA 3PYMA 4AJ4A 1DC4A 4BO9A 4PG6A 4K26A 1UZNA 4OSPA 3WBBA 2HAEA 4DC0A 3E18A 5KVVA 5B4UA 3BMCB 1BTOA 1NR1A 1YDWA 2PGLA 2EKQA 2JHGA 2CY0A 3WGTA 4B7UA 3JQDA 1W0CA 1YXMA 4MVJD 1HYGA 2NVUA 3WLFA 4EEXA 3KLMX 4MPDA 2X86A 5GMOA 1PGOA 3ANLA 4CMHA 3PQDA 1N8KA 2PKQO 2V6GA 4DWVA 4M87A 4NG5A 3EZLA 2EEZA 4U5QA 3ANNA 5L4NA 1YB1A 2O23A 1T4BA 3RQSA 3D0OA 4R1TA 1PU2A 1K2WA 2FP4A 3RC7A 4IQ0A 1GFSA 3FI9A 1RYEA 2JFHA 4RF5A 5ITWA 2VWQA 4RVHA 2OO5A 5ENVA 1DEHA 1E7QA 4Z9YA 4KUEA 2DTDA 2X0JA 3K96A 1GUYA 1VJ0A 3JSAA 2Q4EA 5EPOA 2B4QA 3WLEA 5LC1A 1GQYA 2C7VA 4J0FA 5ITVA 3GPIA 3KLPX 3NJ8A 3K5PA 4CM9A 4AJEA 1CYDA 1Y9EA 1ZEJA 1E7MA 3SJUA 4LMRA 4DQXA 1PEDA 1YBMA 3FD8A 2W2KA 4AL4A 3VTZA 2DBQA 1OBFO 2Q4BA 1HKUA 3OF2A 4IS2A 3L07A 3L6DA 3WGYA 1QLJA 2VUUA 1GZ4A 3N7UA 4PFJA 4XGKA 1PJSA 1MFPA 3NYWA 3DQPA 3HB5X 2O3JA 1ZK1A 4GGPA 2BFMA 5G0UA 2W4QA 2GPTA 3BTOA 3VDRA 4NJMB 4BNTA 4C7JA 3B6ZA 3UXYA 1ZIDA 4ZN6A 3CEAA 4B4VA 3U49A 2DFDA 4J9VA 2V6FA 1HYHA 4TZKA 2JFFA 3TQHA 4JXKA 4R41A 1K89A 3WWYA 2OZPA 3JTMA 3A14A 2Q46A 1GTMA 5G2OA 3ZWBA 3P19A 3W8FA 5EQDA 4H16A 3LC2O 4HUJA 2NVBA 3BMQB 2W98A 3UCFA 1WPQA 1JDJA 2Y1DA 3FN4A 2X0RA 1VJ1A 4CM1A 5COQA 2HMVA 3CKYA 5TX7A 3W1VA 1DAOA 3DMYA 2YDYA 2P9EA 4YJDA 3BIOA 4UUMA 1BXGA 3OM9A 2BFOA 3WYCA 1DRUA 5JY6A 2X0IA 1UAYA 3GQVA 4QEDA 4XQEA 5COBA 2AG8A 3W4IA 4DC1A 1DJNA 4QECA 4TQGA 4DBZA 1UR5A 5DN9A 5J23A 1HZJA 4PRKA 4ZQEA 1Q2XA 2O3SA 4IS3A 3MJSA 2X5OA 1ARZA 3SBOA 5H83A 3GRKA 5TC4A 1EK5A 2GDZA 1LDMA 4MVJM 1KEUA 1GDHA 3H6KA 4J3FA 1L7EA 2Q3EA 1TT5B 3AI3A 5JXWA 4YYZA 1TB4A 2D0IA 1R4NB 5JDCA 3OEWA 4EI2A 1XQ1A 4Y9DA 4BNWA 4GH5A 4R69A 4FC7A 3E9NA 5DBFA 1P0CA 3ZHBA 2VZ9A 3ZWCA 2YJZA 5FI5A 1NASA 4E5PA 4BO8A 4F46A 2VYNA 2O3RA 3DZIA 5JSFA 3QA9A 2DKNA 4MP6A 4RLHA 3KYDB 1NXQA 1PJQA 4G5HA 4L73A 5C7OO 3LK7A 4GKBA 4IINA 3EDMA 2I3GA 1LXCA 4ZD6A 3ZV6A 1KVSA 1EVJA 1SCUA 2PTGA 4OMUA 4ALNA 3AFMA 4HFMA 2Y1FA 1HE4A 3PI7A 1VI2A 1VRWA 1UDCA 1QYDA 3GOHA 3LYLA 4TSKA 5EMHA 1GPDG 4CODB 4W9NC 2IYOA 4DUPA 5C7IO 2O3QA 3EGOA 5JE8A 5C7LO 4IBOA 2EF1A 2NACA 3QWFA 1ZMTA 4QO8A 3V2GA 3VC7A 5JO0A 2EKLA 1LSSA 4U0KA 2VYVD 2HK8A 3ZV4A 3PJGA 3D7LA 1VLLA 3RFXA 5C37A 1ZJYA 4BNZA 4UAGA 4UVGA 3PHJA 4PG7A 4PLFA 2Y68A 4K28A 4YPOA 4IJVA 4YRAA 3UUWA 3VPSA 4RF3A 4XYMA 4D42A 3AM3A 5JCJD 1YRLA 1R0SA 1WWKA 5TRTA 3JQFA 4P4GA 2BLLA 1GR0A 1PS0A 3NUGA 1X7GA 1AN9A 5DOVA 3QVSA 3QP9A 3VPHA 4CLOA 3DAFA 4J1NA 1RWBA 4XCVA 3ULKA 5BNTA 2AEJA 2Q1SA 1T1SA 2FRDA 4DIOA 2WD7B 3RUDA 4R68A 2CD9A 4E4YA 4CMAA 2G1UA 4XB1A 2R00C 4B7CA 2WDZA 2QIOA 4BNMA 3QWIA 3RC1A 4DYVA 1JTVA 2FPGA 1S6YA 3KOUA 4J2OA 5BSHA 3UF0A 1Z45A 4D3FA 4LW8A 4G65A 1XEAA 3LC1O 4PZCA 1P0FA 3TOZA 4E5YA 2H5LA 2UV8A 2VCYA 3GVXA 3PVZA 1BVRA 3I9JA 4DIFA 3DZGA 1CERA 3PGJA 3RUHA 4BOYA 4E13A 2ZQYA 5CFZA 4AJJA 3PEFA 2AXQA 2NU7A 5AXBA 1MXFA 3ROKA 3VVCA 2C07A 1T2DA 3OFSA 1ULSA 5IXSA 2WYVA 4DGSA 3O8QA 1B8UA 4B4WA 3WYBA 1UAGA 3O4RA 5EINA 3AUSA 3MJ4A 3AK4A 3FNHA 1I3LA 4II3A 1A5ZA 5JCJA 3U4HA 2QW8A 1U7HA 4Z0TA 1YO6A 4R5HA 3WYEA 2AW5A 1HYEA 3BMOB 1N5DA 2GN9A 4NFSA 1M67A 1HE5A 2TMGA 3LT0A 4IGEA 4AJ1A 5KNLA 4IQ8A 1GUFA 4FR5A 4KQWA 2Y1CA 1N92A 4BNYA 4C4OA 1E1NA 5L53A 2C5EA 4XQGA 1E7RA 5I7VA 3DBVO 1O9BA 1B2LA 4D0SA 4MVJG 4B4OA 2YYYA 1K3TA 3NX4A 4JP2A 4RZIA 3V8BA 4Z0HO 3I9MA 2WE8A 4I9UA 4WOJA 3AFNA 5JCXA 3C24A 2B35A 1YVEI 1LLDA 4CPDA 4PG5A 1HETA 5DDIP 4B4UA 5GZ3A 3ZWOA 2Y67A 5T6BA 1V9LA 3D64A 3H8VA 4S1VA 5TT0A 1NHWA 2NUAA 2H9IA 2Q45A 1R12A 4ITUA 1UP4A 2DQ4A 1MC5A 5JLAA 1I3MA 5EERA 3WGQA 4E31A 3DDNA 3TFOA 4A73A 2UDPA 3TFQA 3WJAA 4ND2A 4RCVA 4XYGA 4XQCA 3OMLA 1EUDA 2V65A 2V6BA 1X15A 4BO2A 5KJ6A 1NR7A 1Y7TA 3WG9A 3IDSA 3ZV5A 3ZWXA 3AUUA 5G0VA 4ZQBA 2IZZA 4M8SA 1N2SA 4WOKA 1YKFA 3IAHA 5AOVA 3OHSX 3UAGA 4A27A 1LLUA 3PIDA 5HS4A 5BNFA 4J90A 4RVFA 1QP8A 4NIMA 4Q3BA 2ZJ0A 1C3VA 4CLRA 4OXNA 3RUAA 2VQ3A 1EQUA 3GN1A 4JROA 4ALLA 2QG4A 3JQ6A 1IPFA 3I1JA 1JKFA 1PL7A 4RQTA 3QIVA 4BNHA 2EJWA 2X58A 2BD0A 3GN2A 2DLDA 2B83A 1KVRA 3FNEA 3G1UA 5F21A 4CLDA 4NPCA 4BS9A 4CQLB 3DZKA 1QRRA 3JQ9A 1V3UA 1HLDA 4LRTB 1NAHA 4JJGA 5HS6A 1DIBA 4WLUA 1E6WA 4EITA 3ASUA 5HBRA 4GAEA 4DVJA 5TF4A 4OOFA 1BG6A 4NH4A 4CQMB 4Q3NA 5B4TA 1PJ3A 4J91A 1A72A 1SEPA 3F46A 1ZSYA 1KEVA 1XSEA 4XD2A 3B1JA 2B4TO 4XR9A 4FBGA 5FWNA 3HDJA 1DO8A 2GNAA 1GEGA 1TVEA 1H9AA 4K6CA 3GGOA 3ONEA 4P22A 4X54A 2A4KA 3C7AA 4U6SA 4W7IA 3PTZA 4CMIB 1NBOA 2X23A 3FHLA 3JYPA 2I76A 2P5YA 1PSDA 3DFUA 3V2HA 2YV1A 1JKIA 4PVDA 1ADFA 3JD2A 4NK4A 2Y1OA 2PKQP 4CM4A 4A26A 5LDHA 1LC3A 1ZMOA 1K6XA 4UEJA 4D46A 4E12A 5IZ4A 4YAEA 2OOSA 3ZZNA 4BGIA 3DBHB 2P9CA 2WWRA 3OQ6A 3PQEA 3ZWAA 4RVSA 4FJ1A 1XA0A 4TRNA 4CQMD 1LU9A 4RPJA 2QYSA 2FMUA 4NU6A 5DCUA 3LC7O 3OIDA 2QRKA 3L9WA 4L4SA 1C1DB 4A0SA 4D41A 5HTOA 2VWGA 1H2BA 2I3AA 2ZTLA 2B5VA 2AA3A 1NM5A 2XPCA 3RKRA 2JJYA 4J0EA 4YTEA 2VRCD 1ULUA 3VPXA 2Y99A 3JD4A 4NDNE 4EDFA 3X2FA 2ZKLA 1ZK2A 3CE6A 3C3XA 2O2SA 3OICA 3RIHA 3PPIA 3F4LA 4YJFB 4Y6PA 3GVCA 1P1RA 4FDAA 1Y8RA 1ZBQA 5CEFA 2BGLA 4GX2A 1KC3A 1P3DA 3F5SA 1CQIA 4KMSA 2DTXA 4PLZA 1ENYA 3CXRA 2GO1A 2PZMA 3I9OA 3BHMA 4J1TA 1TXGA 1YBAA 1Y8QA 1QYVA 4ALKA 3A28A 2JCVA 3MJEA 1DXYA 4XKJA 2W8ZA 1YONA 2WTBA 4M1QA 4BO1A 1MB4A 1HTBA 5GZ6A 2OBYA 1LNQA 1I0ZA 3K31A 3R3SA 4ZRMA 2HJSA 1GV0A 1D7OA 4HXYA 1PS9A 3D4NA 2HKIA 2ZATA 4BGVA 3A9WA 1BW9A 3MOGA 2GUGA 2AQKA 1DBVO 1PJBA 3UOGA 1FDUA 4D3DA 2JCYA 3D1LA 5AQ1A 2GYYA 1GYPA 1H93A 3QY9A 2Z5LA 1ISMA 5ADHA 5KTKA 2EP5A 2RAFA 2D5CA 4IZIA 2C5AA 2YHIA 3O9ZA 3RD5A 1VKOA 5B4VA 3IKTA 2C2XA 1QR6A 1ZZEA 3Q6IA 3FTNA 1GL3A 4XDZA 1VPDA 3JQ8B 4NFYA 4XR4A 1Q1NA 4TRMA 3MOIA 1HDRA 3KYBA 5DZSA 4R9SA 3SEFA 3WNVA 3PHGA 1HDXA 1GQQA 3MTGA 3I9NA 1X1EA 5F1OA 2GZ1A 4R3WA 4BO3A 1DFIA 5TJHA 4YAKA 1Q7CA 1OC2A 3NTRA 4DIBA 5ICMA 3PJDA 4I5FA 2GSDA 3H65A 4XZ3A 4WK6A 4Y67A 1Q7BA 1VKNA 5A02A 1X7HA 1XQ6A 5JMWA 4RGBA 1ML3A 1Q0HA 2WEKA 1JAXA 4DMMA 2J8ZA 3DOOA 3ZWVA 5G4KA 2JD1A 4QSMA 4YJGA 2J5RA 3IS3A 1DIRA 1UXIA 1XDWA 1W73A 3JD0A 4R54A 3WGGA 4XDYA 3RROA 3BMNB 4BNFA 1IL0A 1DFGA 1U7TA 1U5AA 4FFRA 2EERA 1E0DA 2RHRA 1AHHA 3CINA 3KXDA 4F6LA 3JYQA 3AOEC 4I1IA 3DOCA 1P31A 4L8VA 3KV3O 1LSOA 2WD8A 4AJLA 1KC1A 4N5NA 4WECA 1UXJA 4FN4A 1UP6A 2ZB3A 2YQ4A 1GY8A 4CMEA 3EY4A 3ZNPA 4DXHA 3U5TA 2JFGA 4NU5A 1OOEA 3MTJA 4YB8A 2B0JA 5MDHA 2BGKA 2CUKA 5H81A 5L7TA 2VUTA 4GVLA 2WMDA 1XG5A 2CF6A 4B79A 3IC5A 3I5MA 4D79A 1LSUA 1ISFA 1XIVA 1FK8A 3H4VA 3ZHZA 3F47A 4WLVA 5B12A 4HY3A 3ZNQA 1B26A 4OGWA 1UXKA 4ZA2A 4WLOA 4N7RA 1K5HA 4CM6A 4ZJUA 1R4MB 1QV6A 3PHIA 3LDHA 3F3SA 4CV2A 4ZHSA 4WCFC 3OJEA 3KEQA 3GZNA 1V3TA 4KUHA 3DZHA 2NU8A 1EBUA 2DTEA 3KBOA 1IULA 1JW9B 3GVPA 2JD2A 3WGHA 2IZ0A 1GQ2A 1SO8A 3GFBA 3GFGA 4BNGA 2GD1O 3DFZA 4J49A 5JDCC 4CM8B 4E2XA 1ISHA 3GDOA 1UUFA 2HO5A 5A9SA 1I36A 1L7DA 5TLSA 4PLPA 2DUWA 2G5CA 1A71A 3INGA 1R16A 3LLVA 5FFFA 1F17A 1UH5A 2EV9A 3F5QA 2PH5A 3AM4A 1RYDA 1E77A 3RFVA 4U7WA 5EIOA 4E21A 4RVUA 4BMVA 1YBVA 1GAEO 3I6QA 1EUZA 1ZSNA 5IG2A 5BSFA 3UFXA 5JNLA 1H0KA 1LRJA 2EGHA 5GY7A 3VHRA 3KEOA 3M2PA 2DBVO 1UXGA 4RLSA 1P1IA 2ZB8A 1ZVMA 1F12A 3GGPA 1IPEA 2IE0A 2ZCUA 4PZEA 1Z82A 3AU8A 1D3AA 1P33A 3LF2A 3OIFA 4IM7A 5KJCA 4CMBA 3GDFA 3WSWA 2IXAA 4IXWA 3U4CA 4ZU3A 1IE3A 3Q1LA 1LX6A 3VAZA 2R2GA 3RFTA 1LBEA 1E3SA 2C82A 1CRWG 4AJKA 4EEZA 3ONFA 3NTQA 3M2TA 3IP1A 3TZ6A 5A3JA 1X1TA 1EFKA 5T8KA 2Y66A 2PWZA 5IZCA 3BMNA 5COAA 4UREA 4CM3A 2HQ1A 1L1FA 2P4QA 1CDOA 1HDZA 2NQ8A 1NPTO 3FBTA 4IJWA 1PX0A 3OJFA 1GU7A 4WCFB 1WAMA 4L4XA 1F06A 1IHXA 1X13A 3GC6A 2GF2A 4OO3A 1NVTA 4XWYA 2ZB4A 3JQAB 4EW6A 2O3UA 1PQPA 4LVUA 3CMMA 4GWKA 1HSZA 2YDXA 1KY5A 3ADPA 2PGDA 1VL8A 2Z95A 5ER9A 1NX6A 1EVYA 4FJ2A 5ES3A 4FSHA 3KSDO 4PVCA 3GR6A 1B3RA 1ZH8A 2C7GA 2F1KA 4MVJF 2O4CA 3T4XA 5KVQA 5KOIA 3HE3A 1U9JA 2OXIA 5ILGA 1T1RA 4IDGA 4YJHA 4Z3DA 2IXBA 4IMPA 5CPFA 4ZQFA 3IUSA 4GPD1 1VJTA 1EVIA 3LZ6A 3ZNNA 5A5FA 1XR3A 5JC1A 1KYQA 3VTFA 2PR2A 3GEDA 5IDYA 3LLSA 1XGKA 1GPJA 2CMDA 1RJWA 1P77A 2OBNA 3KYCB 4J1QA 3EYWA 2AHRA 5CG1A 1WP4A 4E3ZA 3JQAD 2BELA 4MVJA 4CM5A 1YQDA 4D45A 1BXKA 1PZFA 1VL0A 3SC6A 2JCXA 5KWEA 3INTA 4YVFA 3C7DB 5JDIA 5I8ZA 3E9QA 1F14A 4HFNA 4YT4A 1D8AA 3DZFA 1OMOA 3IJRA 3HJAA 2I5PO 5IF3A 2H1SA 1X14A 3NJ4A 1ZO8A 3ZNOA 1B14A 1CJCA 3G79A 4NBRA 2ZTVA 3PFFA 2IODA 5CEJA 2I6TA 2D4AA 3PRJA 4TKLA 6ADHA 2VHYA 3TDKA 2Q1UA 3BMCA 2PLAA 1P45A 4BKUA 3E48A 4E0BA 1HF3A 3OJOA 3PHHA 4KTTE 2VZ0A 2I99A 3ORFA 5K9ZA 1U2GA 4CMGA 1LQTA 3M6IA 4OXKA 4WLFA 2E6UX 4IDEA 5DULA 4YQYA 4MVJE 2HSDA 3ZI0A 4UVHA 4A7PA 4NHEA 2W90A 2FR8A 3HN2A 3I9KA 3D3WB 4JCOA 4NQZA 3KETA 3AUTA 3ZWNA 2QZ9A 1GYQA 9LDTA 2FHSA 3TZCA 4ALMA 4BVAA 3S55A 4RQUA 1C1XB 4OH1A 4YR9A 1R37A 4BNIA 4JNKA 5T67A 3QQPA 4EJMA 3NKLA 1FDSA 1JWAB 3MZ0A 5DF1A 3KSZO 3RC2A 5CDSA 1NPDA 3DAGA 2O2YA 1ISJA 3KHUA 1Z6ZA 4QXMA 4EJ0A 4JLWA 4DL9A 1VL6A 1OFGA 2EXXA 1GEEA 1PQUA 1Y6JA 1NPYA 3JQ7B 4HWKA 4NNJA 4BB5A 4RVGA 4ZQHA 4YA6A 2H63A 4YBZA 5GZ1A 4J7CA 4FFMA 4TRRA 2X6TA 4BNXA 1MG0A 1VE9A 2OHXA 4PLVA 1EEHA 3I6IA 2FN7A 1H2HA 3PJFA 1LSJA 3GUCA 1KEWA 4LSWA 4GI2A 4FS3A 5L95A 3GLQA 1B0AA 2UYYA 3S2FA 3QVOA 3QWBA 3HWRA 4PG8A 2O50A 3R0IA 4FFLA 1ENPA 2X7HA 4E33A 2CVOA 4UVIA 2OFPA 1X0XA 1I2CA 1QLHA 3RCBA 4BUCA 4NJMA 5THQA 1M75A 1EFLA 1G1AA 2B5WA 3KO8A 3WGZA 5BT9A 4EYEA 1KY4A 1NQ5A 2CDAA 4PRLA 4J4TA 3B70A 4H15A 4Q3DA 1C0PA 1UXHA 1FDVA 4KDEA 4UEKA 2V6MA 1ONNA 2ZCVA 2J3HA 1P9LA 1OAAA 3ROQA 2Y0CA 4JQCA 3BMQA 3WQSB 8ADHA 3KSUA 4K6FA 4F45A 3KVOA 1WZEA 3RUEA 3BXXA 1CEQA 4GVXA 4BNVA 1DLJA 3A1NA 3VZRA 3EZYA 3I23A 3ASVA 3BHJA 4E5KA 1BHSA 3QVTA 3IJPA 4LSMA 4CMJA 2PD3A 4PLCA 1YL6A 2Y1GA 1U4SA 1AGNA 3ZWPA 3AOGA 1HDCA 4OXYA 2IRWA 4WNIA 1O5IA 1FXSA 2UUPA 3CTMA 4WEOA 1PTJA 2NLOA 5HA5A 1BDMA 1HRDA 5U1PA 1HDGO 1PGQA 4WCDA 4PN3A 4H7PA 2EGGA 2D5AA 5L7YA 4FPXA 1J0XO 5JY1A 3C1OA 1VM6A 3CZMA 3EVNA 4YCAA 3WNQA 1UP7A 1XU9A 4WLNA 1K6IA 2C59A 4L75A 2ZJ1A 4IZHA 4II2A 4ROSA 3VDQA 3ENNA 3E5RA 3IIEA 2IEBA 1H6DA 1BXZA 1SAYA 1WZIA 2CNBA 5FEUA 1TT5A 3FR7A 3OP4A 1E3WB 3H9QA 1XWFA 5JO9A 3ZWMA 2NTJA 1R4NA 4I5GA 5L45A 1MUUA 5TIIA 1JA9A 3DWFA 4BO6A 5JMPA 1XLTA 3K92A 4YEDA 4MP3A 5HRUA 2VYVA 2YY7A 5CHEA 2VHXA 5IDQA 4BNUA 1ENZA 5ILOA 4IJUA 1DFHA 4R4JA 4XYBA 3TF5A 3ZHXA 4DREA 3EAGA 4Q9NA 4XJTA 4GKVA 2UVDA 1FMCA 1DC5A 1NFQA 1FJHA 1PL6A 3KYDA 4WUVA 3RUCA 1W8DA 2WYUA 2VN8A 2QQ5A 4RZHA 3ZWWA 3HG7A 1G6KA 3KM0A 1PGPA 5LDGA 2CFCA 3GAZA 1WDMA 4ZICA 3HNPA 4ND5A 4YT8A 3HDHA 3HDYA 3EUWA 2RBEA 4FJ0A 4DQVA 3PDJA 4GLLA 1NVMB 3UW3A 2RH4A 3L6OO 4BNNA 4B3JA 2LDXA 1Y5MA 4R51A 2EG9A 1O6ZA 4AJHA 4Y6SA 5KKAA 1ISGA 3OH8A 3UCEA 2FPIA 4FOSA 1O89A 5L9AA 2QRLA 4JX8A 1T24A 2AG5A 4Z9XA 3VKUA 4KDFA 4Y6RA 1RM0A 4IDFA 1QSGA 3HSKA 4JIGA 4A10A 5A9RA 4BGUA 1D4FA 2EHDA 1P74A 1U8FO 3O03A 4PLTA 3G49A 4IDDA 2P91A 3ETGA 2WM3A 2XAAA 4F3YA 2XOXA 1SMKA 4AVYA 4R5MA 3WDSA 2O48X 4TROA 3AI1A 5C5IA 5H82A 2JAHA 3JQBA 3MEQA 3E9MA 3ZCXA 2PD6A 3H9UA 3DONA 3U4DA 3GMSA 4RPGA 1RM4A 3IMFA 1BVUA 3ST7A 3H3FA 2WD7A 1LDNA 4OIMA 1MP0A 1HWYA 3AU9A 4XRRA 1PWXA 4CM7A 5AYVA 3GVHA 3BAZA 1ZKMA 3L6EA 1PR3A 3UN1A 3ICPA 5IDWA 3RU7A 1YE3A 4LK3A 4HP8A 1FDWA 2J3KA 2C54A 4FIZA 1V0JA 4ZGWA 4U0JA 2C2YA 2FOIA 2P5UA 4HNGA 1H6AA 4IMRA 3WICA 3INRA 3ITKA 1YS4A 1PZHA 5CEEA 1E7SA 1WDLA 3E6AA 1E92A 3DB2A 2XXBA 4RO0A 4IIUA 3TZQA 3IKVA 2PNFA 3L4BA 4TKMA 4YRBA 1Q7GA 3VPFA 2OP0A 3Q2KA 4FGWA 4OJNA 3DO5A 5TNXA 3WJ7A 1JVSA 1M66A 4CR6A 5BNIA 2FY8A 4NZ9A 3AW9A 1E5QA 1MV8A 1T4DA 2GRAA 1U3WA 1IHYA 1I32A 3OBBA 3B1FA 4PG4A 3MWDB 4IDCA 4ID9A 1YJ8A 5A5EA 4N5LA 1W6UA 2IYPA 4B8ZA 2AEFA 1YOVB 2EW8A 1I33A 2NQTA 3BYZA 2EIHA 2ZTMA 3HADA 4GLOA 1CIVA 3ZU3A 1B15A 1HEUA 3DL2A 3LT2A 3D5QA 4DLLA 5KJFA 2X5JO 1N9GB 3BMOA 4IIVA 5F1KA 2ZYGA 3WOHA 4NK5A 5EESA 3TPCA 1R66A 2CVZA 1B3BA 2X9GA 1DLIA 4QFCA 3S2IA 4QX6A 4MOWA 3LSYA 2DU8A 4XX0A 2WJPA 4KTVE 3ITDA 5K6AA 2V7PA 2JHFA 3C1TA 3QWHA 2NADA 2VOEA 3CPSA 3DR3A 4UUOA 2YFQA 3ZHYA 3H7AA 4YAIA 4TMFA 2R00A 2FR0A 4YXFA 5KCZA 2UAGA 4DA9A 1E5LA 3TL2A 1E3IA 4P4NA 3IQDB 2BKAA 1UZMA 4RJTA 4FFPA 3WIEA 4Z6KA 4BNJA 5B1YA 2ZIZA 2D2IA 3CIFA 3DHEA 3DBLB 4L76A 4GL4A 5KJEA 2P9GA 2O7QA 2J3IA 2VT3A 4BV8A 4B3IA 3RC9A 3QVXA 4RDIA 3UVEA 2Q99A 3DBRB 3RJ5A 3F9IA 3HB4X 1QYCA 5IDXA 4CR8A 4Y8VA 4Q3EA 2X1HA 2C0CA 5A04A 2O7SA 3JCZA 4BNKA 2O3TA 5DP1A 5JAQA 1H6CA 4RORA 5C3MA 3W6ZA 4K1LA 1A4UA 2Y0EA 1GCUA 4RPLA 5ENDA 3ZW9A 2Y1EA 1JN0A 4Q3AA 3ZW8A 5DNAA 1LEHA 3FRJA 1NAIA 4HX5A 5BSGA 2ZYAA 2G17A 1YH3A 3JD1A 2VT2A 1FF9A 5THKA 1M2WA 2PH3A 2ZK7A 3HHPA 3PDUA 3ZGYA 3H5RA 4XA8A 3U4IA 4JBIA 2AQHA 1IUKA 4CQLA 1ONOA 3GG2A 3ZDFA 4WKGA 3R3JA 2BH9A 3DZJA 4M89A 5TS3A 5JS6A 3U0BA 3JQGB 2H6EA 2D3TA 1LRKA 5CPBA 2E37A 2E49A 4D44A 3SX2A 2X8LA 2Z1MA 1J6UA 3RASA 5DP2A 3T4EA 4BB6A 3ZV3A 1YQXA 3VVBA 3JQCA 4CQMA 5KVCA 4IDBA 1RKXA 3FBGA 4BO7A 2Q1WA 3LVFO 1DRWA 1GADO 2VTEA 1EE2A 3RBXA 1SC6A 4KWIA 4ALJA 2B36A 2A9FA 4NFHA 4OL9A 3STHA 2VRCA 1TLTA 2AQIA 2I66A 2OORA 4N54A 4HKTA 2DVMA 3W4KA 4CMIA 1S7CA 1J49A 5ICSA 2D1YA 2P2SA 1BWSA 3NT2A 1WLYA 5BR7A 3TWOA 1ZUD1 4GSKA 3WQQA 1U2DA 4FW8A 1AHIA 3GRPA 4O59O 3A4VA 5L3ZA 3DHYA 3NRCA 5IN4A 4AJPA 3V1UA 3TZKA 2AMFA 4HNHA 3DBHA 3ABIA 4JK3A 2CDBA 1E3JA 2R6JA 3OETA 4YWJA 4DQUA 5KIAA 1XYGA 2WE7A 4E6PA 1X7DA 3QW2A 1F8GA 3M1AA 4UVEA 1C1DA 3P7MA 5AVOA 4AJ2A 2OP1A 2NVUB 2CZCA 9LDBA 2QRJA 5DCYA 3TSCA 2HRZA 3H5AA 3FNGA 3P5SA 1Z7BA 4URFA 1U8XX 1B7GO 4CL3A 1HZZA 1J4AA 3RKUA 5DCWA 2IZ1A 4YJFA 3TN7A 2D59A 3BTVA 3GH3A 1LI4A 3FSRA 2ET6A 5A03A 1YL7A 4XIYA 1FDTA 1O94A 2WSBA 3FWZA 2HMSA 4MKZA 4GX1A 6LDHA 2GN6A 2E82A 3I83A 4CV1A 4E30A 4XB2A 4DMLA 4ESOA 2PFGA 4C7KA 1E7WA 2BI7A 1JAYA 3H9EO 5CG2A 4PLHA 4BO4A 1D1SA 1A9ZA 4AFNA 1NVGA 4OM8A 3AY3A 3ETDA 3OJLA 3S1LA 4RPHA 1ZW1A 3DC2A 1Y9AA 4I5EA 5DBIA 1ENOA 4O63O 3RUIA 3QRWA 5TGDA 1N7HA 5TJ9A 2W2KB 4H3VA 3GVIA 3VH3A 3NTOA 1IYZA 3W4JA 1HE2A 4M86A 4CLHA 3JQGA 5U4QA 3ADOA 5JAIA 4NR0A 3D4PA 5I9LA 5IN5A 1NFRA 1LUAA 2J5QA 4XGIA 3RSHA 4O5OA 2POQX 2VOJA 2HUNA 1P44A 3G1TA 3JQ8A 4BO5A 4CR7A 1PJCA 4G2NA 3L9XA 1HDYA 3C7CB 5K0ZA 1N1GA 1AXGA 2NM0A 2NV6A 3TL3A 1LQUA 4AICA 2SCUA 3K6JA 4DRYA 4CM9D 5F3RA 3Q2IA 3VZQA 1O95A 3LT1A 4LN1A 5JAZA 4WJZA 3AWDA 3ZU4A 4GX5A 5JAMA 2RIRA 2IDZA 2EWMA 2VHVA 1YB5A 1H6BA 3CUKA 3PLNA 1CQJA 1EE9A 4TVOA 3E5MA 3HFGA 3IP3A 1NWHA 1BXGB 4DTIA 2YW9A 5A05A 3DEYX 3E03A 4CUZA 1ZFNA 1GYRA 4EUFA 1HL3A 4XRGA 3JQEA 5CDGA 3K2EA 3JQFC 2JAPA 1HXHA 3K9QO 2C29D 4KP7A 3QSGA 3BTSA 4BKQA 1T2FA 4UVDA 1BSVA 3UH1A 3BA1A 3U09A 2E4AA 4WLEA 3MJTA 4FFOA 1CETA 4ZQGA 4ZVVA 2WYWA 1R0KA 1J5PA 4PLYA 2OUIA 5F5LA 4BGEA 3D5TA 4IY1A 1I01A 2YV2A 3E8XA 2G82A 2DM6A 4LCJA 2AE2A 4XIJA 3DMTA 4GWGA 1ONPA 3GK3A 2GCGA 4QT0A 1PR9A 2HMWA 4ONEA 4S3MA 4LCEA 4KQXA 3WB9A 3QVWA 2BRUA 3GAFA 3W8DA 3RBVA 4J6FA 2RH8A 1R4MA 4FD3A 3V1YA 2PK3A 1P1FA 5G0WA 2NVWA 3QJ5A 5U9CA 1Q0QA 2Y05A 3I52A 3GHYA 4WE3A 1I2ZA 3U3XA 5AXDA 1VSVA 2AE1A 1LJ8A 1CF2O 4Z3KA 2VNAA 1LDEA 1Z73A 4CM8A 1ADCA 3VZPA 3UGKA 1PL8A 1DC6A 4Z9FA 5T57A 1MGOA 1WXDA 4M49A 4QTZA 4R1UA 1NQAO 2OMEA 3PQFA 4QUKA 3GGGA 3UCXA 5I7SA 1NYTA 1H5QA 1KVQA 4I8XA 4AG3A 5A3VA 3ETEA 3G3EA 4AJOA 3QE3A 2VYND 1PGJA 3FR8A 4DPLA 1JQBA 4NMHA 1I24A 3OSUA 1A27A 4B7XA 4XYLA 2VZ8A 1B16A 1BGVA 1NHGA 2QZZA 3TNLA 4BNLA 3WTCA 3AY7A 4JP3A 3FCOA 1AE1A 3MCVA 4XYEA 1QV7A 2HMTA 4RPKA 4AJNA 1U5CA 2HJRA 3K30A 2CVQA 4CLOB 4A03A 3V1TC 4R3NA 3AOEA 4MIYA 2ZTUA 1JLLA 3GHHA 1V3VA 2DUUA 3K8ZA 4ILKA 2HCTA 3H2ZA 3X2EA 3OJ0A 2P68A 3V2UA 3VH1A 4MINA 4OAQA 2A94A 5A9TA 3OA0A 5G4LA 4BQPA 1SNYA 2EKPA 1A7AA 3C8MA 4DLAA 4OYRA 1DSSG 3QV1A 4MO2A 5A06A 1WW8A 4R9RA 5EQFA 3W8EA 3WIDA 1XU7A 1DIAA 3GG9A 1IB6A 1MFZA 2BGMA 1ZSVA 4BL5A 5IJZA 1X0VA 3KZVA 1PJTA 2HK9A 2OL4A 2YZ7A 3L4SO 1DHTA 1SOWA 4JBGA 1AXEA 1G0NA 3JQBC 4WCFA 4DLBA 3GT0A 4R16A 3PJEA 1T2EA 4U6QA 3WWZA 4D43A 3WMXA 4MDHA 3PFWO 4TZTA 1HT0A 1UDBA 3JQAA 4N18A 4YQZA 1NFFA 1H94A 5CAEA 1DIGA 2Q2QA 3WFJA 3NT5A 1WDKA 3Q11A 1LA2A 4EBFA 1E3EA 4Y98A 1OI7A 4IGFA 5LCXA 3TOXA 4IXTA 3T7EA 3TRIA 3O8QB 4BMNA 1LLQA 4CMKA 3OECA 4QQRA 4NJOA
chains in the Genus database with same CATH superfamily
3R3UA 3N9IA 2X9VA 2XA1A 4INPA 4LE0A 2W48A 3BWYA 3HC7A 1V9SA 4OHWA 3TKAA 3U40A 4RD0A 1HL7A 4L51A 4X63A 3COSA 4DG5A 3TJRA 1DB3A 1XNHA 3FDFA 2FX3A 3JQ9C 4A8HA 3KLOA 2EQAA 2J6IA 2Q8NA 1U7ZA 2XDWA 3PGA1 2DH5A 1KI3A 2FW7A 4M9XA 1MAUA 1TKBA 1OIWA 4RHEA 3JAMA 2QLMA 4KFUA 2XCOA 3AY6A 4HUQB 2HMYB 1U0GA 2NTNA 3M0EA 4EZEA 3H9GA 1SKBA 4JWTA 1KK3A 4DDUA 1Z74A 3MMXA 4ZDKA 1RPTA 3LQ1A 5REQA 2ZUSA 4BLPA 4BWFB 3TR5A 3AXSA 3VC1A 2GLXA 1HNXB 2BI8A 1CVRA 2ZBUA 5ITZB 2NWQA 2GCNA 2J7KA 2AMYA 2P8SA 2PZBA 2ZXFA 3WL7A 4ENTA 2MSLA 1R0LA 2ILVA 1K5PA 5MN4A 1PR1A 1FFXB 2Q3HA 3AYXB 3DLAA 4NPHA 4Q3OA 4BMOB 3FJOA 4J4BA 1D4AA 5J63A 3SCZA 1Q1GA 3MIZA 3V7FA 1KIFA 3A11A 3A32A 5I8WA 3UAWA 1W4AA 1SVSA 1M5UA 1AD2A 2HXSA 2F3UA 2VSYA 3CA8A 4L0QA 3MWJA 3SJBA 3HLKA 4OJQA 1JKJA 3QX9A 1MTZA 5FCDA 2YW2A 1S1CA 4XJSA 2Q2WA 3PSHA 3HWSA 3HS3A 2A67A 5IK2A 1OCEA 2QX7A 1EUDB 1Z7EA 4Q00A 4GWLA 2OSBA 2DHDA 3VO1A 3CF0A 1QTRA 1JWBB 4DHWA 4E5MA 2DFLA 4B5LA 5L40A 1P1HA 1FBNA 2DF8A 1YDEA 1JEAA 2XF8A 1EP3B 4AAYA 3ONWA 4G9BA 5JASA 2X19A 4LE1A 4G5FA 2MDTA 4UBKA 3T3EA 2V7WA 3OTWA 4KQ2A 5CXUA 1O0SA 2DAPA 3LXUX 3SP1A 4B3MB 1EA7A 4Q7EA 4MIEA 2F3TA 4EB3A 4RY8A 1URPA 3FPLA 1JIXA 3HNRA 2NSLA 1QYWA 1SBYA 4TMKA 2HMAA 5EE9A 1NM5C 4OKNA 4Z0PA 4MUGA 1JR2A 3UICA 2OQIA 3HVRA 4L72A 2PBFA 3WKCA 1QVVA 3RVDA 1C1XA 1PUIA 4D81A 3GLGA 4EQ6B 3QLJA 1KXZA 2XE7A 4MRPA 5KNDD 2O8FA 1HYBA 1X9HA 2RSLA 3KSAC 5FWYB 4O1MA 1QBKC 4URUR 3FMFA 4ZMSA 3IL2A 2HU2A 1NTOA 1VDZA 4BQFA 4D9CA 4A5SA 4B3GA 3KPUA 4KGDA 2IQIA 3E82A 3FPCA 3U7IA 1GTG1 1HOXA 1LI5A 1UK6A 1W48A 3JQ7A 3RIEA 5KVAA 5LMNB 3HMKA 4QREA 4W4TA 2I7XA 3KKMA 3M7IA 1HQYE 2RHOA 2AF4C 1VIMA 3IAUA 1WUTA 4IKPA 4JLBA 1VRCA 2BGRA 4LJ9A 3A3PA 3PP8A 4QELA 3LF1A 4XVUA 4UHHA 3UHAA 2OHIA 3BHIA 3CEMA 2Z6AA 2QP4A 1WULS 3GFTA 4N0PA 2C2OA 3AUAA 4RV5A 3NHAA 2OKCA 5DLDA 1P61B 4M54A 1PIWA 5CM2Z 4PIVA 3VKWA 2J6BA 1MAAA 2ZYUX 5CDTA 3KZXA 2DPHA 7MHTA 3NDRA 1DUVG 4CJXA 4KX3A 4EHAA 2VQ6A 5PGMA 3DFFA 2ZZNA 2QU8A 3Q3VA 2AUTA 4JVLA 4L6IA 1X7YA 2CYAA 3LDFA 3FB4A 1LFAA 4ZTUB 1MW8X 4XH9B 2HDHA 3O7WA 4JLDA 5YASA 4PQRA 1NMZA 3SF0A 3VVMA 2EX4A 3Q12A 2J0QA 3P2OA 4F6RB 2YXBA 2LXNA 4AJNA 4HDMB 3CE9A 4ZT5A 1JEOA 1DPGA 2G7ZA 1T4GA 4RTQA 5CLQA 3CTPA 2YTZA 2LDBA 1U99A 1YWGO 1ABEA 3W9YA 4P8RA 4FCCA 2XT0A 4F5WA 1SVIA 3IIMA 1EK6A 3NP9A 1I0LA 2HCBA 2NSJA 3ENZA 3ILHA 5AXCA 4TRJA 3F1LA 4B6EA 4EL0A 1F5NA 2IU6A 4CCYB 5IF9A 1XVAA 3D8SA 1Z26A 4Z2AA 1EBFA 3TLGB 4JJ4A 3OIGA 3WSVA 3VDNB 4B3HA 3R7AA 4UBOA 1G59A 5IABA 1U2TA 3K73O 4CIBA 5MN5A 2BR4A 1CUFA 4BQOA 3KTFA 3HCFA 3E1KA 4KYTA 3ZJUA 5IFLA 2P6MA 5KWVA 5IARA 1VA4A 2RKWA 4HH1A 4BXOA 1RPNA 4IJKA 4YAWA 5L4LA 2Q62A 2XRZA 2QI9F 3K2IA 2IP2A 2F2TA 3L1UA 1CUCA 5DM1A 1BX3A 3UJCA 5KNDA 5LQNA 4W5RA 4ESVA 4WZAB 1E66A 1WL8A 1GUZA 1L9XA 5I45A 4JHXA 4JR0A 1CS4C 5HCNA 1U2DC 4X7PA 2MTBA 5I5GA 1IBKB 4Z4FA 4TL7A 4P4LA 1TLLA 1P2GA 2Q49A 4F4HA 1UDAA 5EIHA 3LWDA 1ZUWA 5A1JA 3E23A 4RJKA 5ISMA 1Y33E 2JKVA 2VQSA 1EXDA 3PZBA 3I3SR 5AKIA 4FP9A 4ZPXA 4C2AA 2HLHA 3V1KA 1JHRA 3VV3A 4KZKA 3KOOA 1A76A 3QLVC 1DAFA 3RIGA 1E3LA 3T7CA 3BH7A 4P5EA 4Q12A 4RM2A 3RUFA 2XYRA 3IUPA 4QBIA 5E4JA 4ZI7F 1RWMA 2C31A 2I67A 4KRYA 5I7EA 3EFEA 4M55A 4LZWA 4FM9A 3GAMA 1YGYA 3ENWA 4LKRA 1NUAA 1Z5PA 3EF3A 1KNXA 4YRQA 5ED4A 1B4DA 3VNAA 1MG5A 1LDYA 3HDQA 3ESAA 5HEKA 1W49A 3SYTA 1E0AA 1DTWA 4U9IS 5HE8A 2QN2A 2PUWA 4DM3A 2UZ1B 4XGRA 1QDLB 2WJ6A 2YWRA 4UNQA 2GPNA 5EJMA 2L19A 1EHCA 2BFFB 1OI4A 1GQOA 2QLFA 3ACDA 4HG2A 3WQRA 4MUBA 3U81A 3V80A 3RRJA 2QTVB 2FTKE 2JD0A 3EK2A 4ZI7A 1X77A 1E1MA 3DWGA 3FZNA 1K0UA 2GM9A 3VX3A 3VH4A 4KXWA 2M98A 3PQ2A 1Y4SA 3SBEA 5M04A 1NTRA 5E7IA 1TIPA 4X24A 3DZCA 3L7DA 1UMKA 2M32A 3NNNA 4G9EA 4HEJA 4DT1B 1YVDA 3U7FB 2GA8A 4IUDS 5EMNA 2YQ5A 3BE5A 4TPKA 1OXXK 2EL9A 5E3HA 4UTNA 1ECJA 1XEFA 1CPYA 2CW5A 3HB7A 3WGOA 1GZVA 4J2HA 5KYXA 5KHOC 3PD7A 2C1XA 5HQ3B 4BP8A 4UU7A 4MVJI 4DR2B 1FS6A 3UNXA 2FPPA 2PXXA 1KEZA 1OKKA 5B37A 3IR7A 5CH3A 2P6OA 2ZQZA 3EVFA 1PF7E 4REQA 2ZYSA 1YZGA 4HJRA 4BMYA 5G4KB 2IE8A 2VTDA 4EX6A 3EZ7A 2OHVA 3OU6A 4MH0R 1CLUA 4JJIA 1GZHB 3V2IA 2D7CA 1EZ4A 1Z4PX 1J09A 2IEZA 3NBMA 4UZFA 5KWIA 2EFYA 1ESCA 3WTBA 5DSXA 2FOXA 2TMDA 5JQGF 3HL4A 3UUGA 1OJ7A 3N0XA 5JXIA 3LC0A 1B8VA 5I6DA 4L2IA 3AF0A 1E4OA 3ZVLA 2DUMA 3C6YA 1EUCA 2ATVA 5C1OA 2W4MA 3WS7A 2UXBB 2NSHA 2ZUBA 5KSZA 1KEEB 2D3WA 3K0CA 2J0UB 2NO0A 2FXVA 3FWYA 4WSOA 5L7WA 3EC1A 4W99A 1NW4A 2R65A 2P6RA 2H4HA 2LIVA 1YVRA 4X1YB 1ONBA 1DIHA 3ZWQA 1JYEA 3ZU5A 2CKDA 4S05A 2IEDA 5CH5A 1A0OA 3CRQA 2IU3A 3T3PB 1TYCA 3EVTA 2QTLA 4KH1A 4L22A 4CVNA 1JDTA 2ZRDA 1EPUA 3EH2A 1I51A 1QG6A 3PWZA 3WLLA 3M1LA 2P30A 1HDIA 4L07A 3RYFB 4E5NA 1M33A 3H97A 1J0AA 4KHPB 4J0GA 1A82A 2YXLA 1TEHA 2PUVA 2QQFA 4FMBB 5TVGA 3FWKA 4P81A 2B1RA 4RVOA 4TWZA 5ECWA 4W7HA 4WGGA 5JI3E 4BAZA 3VJRA 1QORA 1QFMA 4EGQA 2HMUA 4MVXA 3UHPA 4ACBA 2I1LA 4QICA 5HOEA 3KQKA 5K5EA 3CSDA 3CLTC 2EW1A 4DZZA 4P38A 2QHXA 4CG3A 1YZQA 4FUTA 4BX8A 4FOPA 2V54A 1P2BA 3E1GA 3IPCA 1EH5A 3K70B 4KO2S 5LXTF 3T0IA 1E1LA 3ESRA 3L0SA 4D2IA 1Z4QA 3R0ZA 1TZ2A 2CCGA 4IIGA 3L02A 2PM8A 5A5GA 1QYXA 1TADA 4J0CA 1CJMA 1Y9ZA 5E9AA 3TBKA 4D9EA 4LZOA 2WWYA 1Z06A 4AMGA 2NSDA 1L4FA 3F6RA 4FXOA 3NPAA 2EOAA 4NU0A 3D31A 2CHEA 3GIWA 4CTJA 4EUEA 4QG3A 3WBFA 721PA 3IQEA 5I9SA 4Z4EA 1TCUA 1AUPA 3R5XA 4YDHB 5SYNA 5AVUA 7ABPA 1R1DA 4L02A 4MPJA 4G24A 3L4KA 1LDGA 2Q1TA 1IEXA 2B0CA 2CHVA 3D3EA 4G8BA 4KWEA 1Z0IA 4D1YA 1AKTA 3C3WA 3UFXB 5KINB 3IEXA 1UEIA 3MF4A 3W90A 3FZYA 3GLKA 2PY6A 5JS1A 3BA6A 1BHQ1 1WZNA 3OOEA 5LP1A 3AQ4A 2Q50A 1L5MA 5LXTA 3VFDA 3C16C 4UW9A 2OAQ1 3WNZA 2BMDA 4MKFA 1V16A 3CKLA 1VBMA 3FI0A 4AP5A 1T8TA 4D3SA 3G0OA 4MW0A 2BEJA 3KOXA 4FKMA 5C35A 1FPQA 2ZP1A 4EB0A 1ZHFA 1V8ZA 2J1LA 5IAAA 1NLYA 1VYVA 2WUVA 2IHBA 1G0OA 3B3FA 3H4IA 4P31A 4ZU6X 2ATCA 1LPMA 2ZJZA 5C2JB 1QZUA 2WUDA 1U9ZA 1XAJA 4REMA 4P9NA 3S6JA 4NCAA 2PGAA 3BL6A 1KDPA 1NN1A 1O9HA 1K5DA 1BDBA 1XF9A 3IVRA 3PEEA 5DNCA 3G0GA 5JDIC 1R0BA 1TVKB 3H13A 4WEQA 1YZFA 4MDYA 3SHQA 3AIMA 1CULC 4RUKA 1D9ZA 4DNPA 2QE6A 2FFQA 3EZXA 3PZRA 3A36A 4D96A 3GF4A 3DD1A 3ZTWA 1RM3A 2PUFA 1QVZA 1DAEA 1TTHA 3CWQA 4L3WA 1I7PA 1TJPB 1Y6RA 2B37A 1FLDA 5FWDA 2HLPA 2YUTA 2BUAA 1IOWA 3TOSA 1HDOA 2FWNA 1C0IA 5DGTA 4RF2A 3X1XA 3O3CA 2OUKA 3WLSA 4MVJP 1Y81A 1CZHA 4Z5XA 1WNTA 3HCRA 3AR7A 3RTBA 3U37A 1SHZA 2C61A 1HLPA 2D8AA 2ZAOA 5FPSA 1E1KA 1G64A 2EBHX 2J41A 3GT4A 3TIFA 4V1CB 1QRDA 1RRMA 2WMOB 3I9LA 4LNUA 3L8FA 3W1EA 3OQVA 3ZXSA 3AKZA 4HAVA 3V4ZA 5GJVC 2QDXA 2EKBA 5JBIA 1U11A 1MA0A 2BFNA 1RRGA 3JRNA 4PXYA 4YMIA 2WVAA 1RKUA 1MQSA 4BLQA 3NAQA 4CGZA 4Q4AA 4NLLA 2J9FB 4R8SA 4MUIA 5DBGA 2I2AA 1KA9H 3UH0A 3HKDB 2WJYA 4DF3A 3UB4A 5JMTA 3B1WA 1KDOA 3BHNA 2R47A 2XB9A 2TMKA 4FR0A 1RWPA 1Q0RA 2CXUA 3AVQA 2B8NA 4PGFA 3ROEA 4PXSA 2IOHA 4XQ0A 4DCPA 4XGNA 3V1MA 1I14A 2GZ2A 3FZQA 1LPAB 2PE5A 4BO0A 4L9RA 1E2NA 5BUSA 1EFDN 1GGJA 1GZSA 2ZAYA 2Q6VA 3LT4A 3LU1A 4KQEA 3ML1A 1U31A 1NMXA 1T6YA 4LZAA 1T8SA 3IQHX 4YALA 3V7YA 4XAQA 1Y3BE 3ECCA 2O52A 2HO4A 4QUDA 3VR6H 5KQSA 1PWYE 3KCNA 3O2QB 4R9NA 4KPFC 5ECGC 3ZDQA 1IN4A 3OESA 3CKKA 3INNA 4HS4A 3TDNA 4A5OA 1ST2A 4I8IA 2VPTA 3OQ1A 4LYEA 5EFZA 1T2CA 4BEWA 2AJDA 2UYCA 2X4GA 2B34A 5T5QA 2J46A 2H16A 3GA0A 5A4DA 1OXUA 1JFLA 5CGZA 2BHLA 1V2GA 1SC9A 3F49S 4R2IA 4RLFA 5HZHA 3VYRB 4C0KA 1R6DA 4F4JA 4M83A 4ZAVA 4F9TA 4J7XA 3EVAA 1MMFB 3KZMA 2CXPA 3H99A 2A6PA 3HNOA 3X1ZA 3LX4A 2XVAA 2AN4A 5B3AA 2YHUA 4OKIA 4X62B 1RWXA 1WMBA 2ZSIA 3CNHA 3IE2A 3NCHA 2OM2A 4IHKA 1A77A 2HNKA 1ADJA 1V5GA 4LMAA 3L7OA 4WX2B 2GBCA 3VM6A 4AJ4A 2YHAA 4BRSA 1J9GA 2EWWA 1WPGA 1UZNA 2IZ7A 1JG3A 2WOOA 1Z15A 3GDWA 1P4GA 2BEUB 3QKUA 4OSPA 3DE7X 1MD9A 2GVZC 4AM8A 1GU0A 3BMCB 1FYEA 1BTOA 1NR1A 4ZC8A 1XD2B 2ZYHA 1PYOA 4WDQA 5JPCA 4B7UA 4JH0A 2CY0A 4JVMA 1W0CA 1BOFA 3GJQA 4OXRA 4MVJD 1A50B 2ISQA 2JZNA 3WLFA 4U3JB 5I4CA 5IVPA 5KTSA 2CLOB 4MPDA 3ZZTA 3O8CA 4QODA 3PQDA 2UXCB 3A7EA 4KAXA 5FUQA 4UUAA 4DWVA 3QNUA 3HA7A 3EZLA 2EEZA 3JZDA 4M87A 2B4KA 4U5QA 3HXOA 2O23A 3D0OA 4R1TA 4FT4A 4RD6A 5T4BA 4XTRA 4ID3A 4CKCA 4G4GA 3MCWA 1V6SA 4LXHA 4O25A 4G5GA 4QUHA 4QU8A 4XASA 1VRVA 5HTKA 1T5IA 4NMWA 3G1WA 1NVWQ 1NVAA 2ZRLA 1UEXC 4RVHA 2OO5A 1K63A 3A1VA 1VJ0A 3RV4A 3ETHA 4UNNA 1GILA 3TD6A 3I6ZA 3QOWA 4EIWA 1N2CB 5LC1A 3IEMA 3SZGA 5AHRA 1NJ6A 5ITVA 1HE1C 3C8HA 2UZAA 3EIFA 1N5KA 3LH5A 2ERCA 4AJEA 4DOMA 1CYDA 1T10A 3AKEA 1Y9EA 2RAPA 1RMYA 4X94A 2PAAA 2AK2A 3QNWA 1QH1B 1KRWA 1RXWA 5F9HA 1JIIA 4TZ0A 4HZUB 4NC9A 1TUBB 1MEJA 1QWOA 2EJBA 4U7DA 2CBGA 3OKPA 1HGXA 1OBFO 2Q4BA 4HS9A 4H17A 3STWA 1RNLA 1EIWA 3WGYA 4EHBA 4MTLA 4XGKA 2KX7A 4URZR 4DSAA 3NYWA 3DQPA 4UUQA 2HJGA 3R9WA 1WQ3A 1L7MA 2FQ1A 2HADA 3BTOA 3PKIA 1KSJA 4P54A 2IX3A 1ZKDA 1E1CB 4GOMD 2DWPA 3SJAA 2IOYA 4MGZR 2CNLA 3KJXA 1KZYC 2ZZMA 2PEZA 3LO8A 1WKCA 2JFFA 2H4WA 2XZDA 4H1TA 3WLQA 4H4DA 3T12A 4R41A 1K89A 3FOEC 3L7MA 3P19A 2GT1A 1L4GA 3AFOA 1GSAA 2F3PA 5EQDA 3LC2O 4HUJA 3H11B 3EFOB 1SC4A 3FN4A 2Y1DA 4FFDA 2X0RA 1ZD8A 5F35A 3X1YA 1UPFA 2HMVA 3CKYA 3TK1A 1IATA 2EDCA 1FUEA 3EE6A 5C8YB 1QVWA 2VYFA 4TMWA 5K09A 3JWGA 3BIOA 1X7WB 1TECE 4C6RA 1KP3A 4KC0A 2RH9B 1Z3CA 4BQIA 1NRIA 3ZQJA 3D6NB 4YUVA 4U7PB 1DBIA 2JZOA 4RAQA 2JBAA 3NBUA 3WYCA 2M1ZA 4CF6A 5JSQA 4MR8A 4XQEA 1XMQB 4QEDA 1VI5A 1U3CA 2I4MA 3RR2A 4ETIA 2HC9A 4AMUA 1LVHA 4C6SA 1UINA 4DBZA 1C9MA 2DHQA 2VF5X 1TQ6A 1HZJA 2OGSA 3WMEA 4YMLA 4PRKA 3C6KA 3A6GA 1KBOA 1SRRA 2X5OA 4QLOA 3UK6A 2Y1WA 3L6RA 2UUBB 1G2IA 2VXYA 5TC4A 2QVYX 3BGIA 1YS6A 4MR7A 1L7XA 3SE7A 1P9RA 2QGZA 3UAZA 2ODAA 3OE5A 1GDHA 2GZMA 5B2FA 4HAYA 4F9FA 3H6KA 3UMMA 1L7EA 1YRQA 3DT8A 1TT5B 4H7EA 1T1IA 5JOQA 3BCHA 5JXWA 1JDPA 1S3FA 1R4NB 4R9VA 5JDCA 3R5HA 5J1TB 4B31A 4GL2A 2I6XA 4Y9DA 4G0VA 4FC7A 1H65A 3T5BA 3E9NA 1KFBB 1P0CA 5LQKA 3ZWCA 2YJZA 2ZJFA 3IAM1 4Y18A 3E4CA 1THZA 3DZIA 3FHJA 2DKNA 2JVIA 2FUG6 1CUEA 1FJXA 1K4YA 1L5RA 1NXQA 1PJQA 3CO0S 2IZOA 4G5HA 2B9EA 1KAOA 3EUEA 4L73A 4ME6A 3QFCA 4MUFA 3LK7A 4JS0A 4L8YA 1N3IA 1R9JA 3EDMA 4IINA 5EJFA 3B7WA 4DV5B 2I3GA 3L8DA 4LYHA 3OQPA 1MH1A 1XLUA 3ZV6A 4AY4A 3HP4A 4Y9TA 5FWAA 3G89A 1HR0B 1ZD9A 3C7TA 4ALNA 3AFMA 4HFMA 5DM60 2Y1FA 4P84A 4GMHA 1VI2A 1Z6TA 2OZEA 2JEZA 1DU4A 2W2XA 3CRMA 3G88A 3G9XA 3LPNA 3LYLA 4WY5A 1UC9A 3N2KB 3SKVA 4AO6A 1S2DA 5C7IO 2O3QA 3CFYA 1AM4D 1IM2A 4H1UA 3TPFA 1T3TA 2NACA 3IQIX 3QWFA 4QO8A 2ZUWA 3V2GA 3EHDA 1NC1A 1TF5A 3SOPA 16PKA 2EKLA 3KLBA 3B9RA 4JL6A 1C30B 3QE0A 3ZV4A 5CB4F 4BPBA 1VLLA 5HFNA 2C9CA 4QGBA 2QTZA 3THWA 3PHJA 4EDHA 5K3FB 1Y82A 2Y68A 3AKYA 1AZTA 1ODSA 4IJVA 4DA0A 4YPOA 4DXAA 3DKPA 1XMOB 3LW8A 2Q3FA 5JJIA 2WYIA 5E2IA 3QVGA 5LDDC 3AM3A 2QSUA 4ZGGA 1R0SA 2Y2UA 1WLSA 1NUHA 2OXRA 1ZUNB 2MOKA 3JQFA 3VR2A 1QU3A 3W5UA 5BUQA 4HMOA 3BGDA 4DEVA 1QIDA 1NR5A 2OHHA 4KBGA 5AUQA 3E9RA 2FA9A 3QP9A 4K9LA 2HYIC 4K0KB 2MYPA 1DX4A 3PPWA 1RWBA 4XCVA 3ULKA 3IAFA 3P32A 4P53A 1NVBA 3UMYA 4NZNA 3MCTA 1AHPA 2WD7B 1UBMS 3ZHUA 1DBPA 5I5EA 3SQXA 3W9UA 3BC1A 5C53B 2J7PA 4A16A 4ZQCB 2WSIA 4KV9A 4C0LA 4DMKA 1CUUA 1Q1AA 1UBKS 5FPTA 1OLUA 4JLVA 2E89A 4M88A 1QCDA 2IS6A 4J2OA 2W6OA 5BSHA 2WM8A 3JATB 3HCCA 3AVVA 4D5GA 1USKA 5TY0A 1GIAA 3TCXB 3FWPA 4CF7A 3F78A 3LC1O 1KO8A 2AOTB 1HKHA 1KO4A 5KQMA 3U56A 3TOZA 3RK0A 2H5LA 1SXJE 3VJKA 4E5YA 1QRAA 4MEBA 3UBMA 1N2HA 1BVRA 2PSJA 5AKHA 3ZCTA 5TVKA 2PXHA 2ASEA 2BT4A 3QU7A 3LX8A 1S4MA 1SBNE 4F92B 3I9JA 1IK6A 2NAPA 2NVOA 2XVXA 5EZ6B 1NKTA 2CFSA 3DZGA 5F12A 5MF6A 4J0JA 1ANKA 2WK1A 1JQ3A 4M9ZA 4E13A 2HSWA 1WXGA 2WWWA 3GI1A 1BKYA 2VEDA 1JEJA 4QPNA 4DIMA 3PEFA 1XX6A 1NQXA 3R9XA 3HR7A 3ZVNA 2FPOA 3Q6NA 3HU5A 2WJZB 4UTRA 3B36A 2DR2A 5IXSA 1N34B 4LX0A 4E3WA 5DXJA 1SR8A 3E7PA 4COOA 1SUWA 1FNNA 3A9CA 3BVPA 2P2ZA 4OXQA 5DNDA 4WJLA 4EG5A 3GQBB 3LTNC 1Z7YA 1Z63A 2H3EA 3DYBA 4LHZA 5BSVA 5FWXB 3I8XA 3TTWA 1LPBB 2AW5A 2XQVA 4C4XA 1M2FA 1N5DA 1UMCA 2GN9A 3BMOB 4NFSA 5FUXA 2H1OA 1MZPA 3AEXA 4WW0A 5UKDA 2EVWX 3I1YA 4FR5A 1TZCA 4UZEA 5SYAA 1E1NA 5L53A 5EJ8A 5JAPA 2YR0A 3DMRA 4PAWA 1OH6A 1XMPA 4DRZA 1RAGA 5FO0A 4FDVA 1BWQA 1L8OA 4HJXA 2OPHA 3REFA 4HXGA 4Y2JA 4X3PA 1SIBE 4MVJG 1ULAA 2CK3A 3P9XA 1XP5A 4RXMA 4MNTA 1K3TA 3NX4A 1N1MA 2OBXA 4ZALA 5M3BA 2IS1A 1J8VA 2BJVA 1WY5A 3QZUA 1E4VA 4Z0HO 1FMFA 4OI0A 2WE8A 3DKIA 3HVJA 3AFNA 4HHEA 5JCXA 2O8CB 1HC7A 4PAQA 4WTOA 1LLDA 3EAFA 1IXZA 3OEED 2HW8A 1JLKA 2Y67A 1XV5A 2Z4SA 5E7MA 1RQ2A 3H8VA 5KOYA 1NHWA 2ZUEA 2NUAA 1HOTA 4AY3A 1G38A 2L17A 1UP4A 3LWNA 4ACAA 4YI5A 1XJQA 2VNHA 4HB3A 3T3HA 4RYDA 2FV8A 3WJAA 1X3LA 1Z2PX 2MWMA 3OIUA 3IALA 4N8DA 4NZZA 4EVSA 4ND2A 2QP3A 1HUQA 2C99A 4HRYA 4RCVA 3SBDA 4RHYA 1U7UA 2Q3DA 4XYGA 3OMLA 2V65A 5E1OA 4JUBA 4NZOA 4Y0NA 2LR0A 1BU8A 2JI9A 1U8UA 3CW8X 2HJ9A 5AOVA 4YCNA 1L7AA 2AJTA 4A27A 5HS4A 3FVVA 2P40A 4LDJA 2EJUA 1T1GA 5C32A 2PT6A 2CHUA 2FI1A 3P9PA 2GZDA 3HKEA 4ARZB 1I7NA 3F6CA 4YPFA 4ALLA 4CWAA 2QG4A 1V5WA 5LZ5A 1P2DA 3IPRA 3TR6A 1I5OA 1K8YB 3PDIA 4IDNA 4F4FA 3BWXA 3IEKA 5AVYA 2FMFA 5AVRA 3D2AA 3NW9A 3O8BA 3P9KA 2BV3A 1X1SA 1KVRA 4CLDA 4L95C 3K9GA 4BS9A 4WKPA 1RYBA 4CQLB 1W88A 2V5VA 2YJNA 3I37X 4RY9A 1UJ2A 1RCFA 2OO7A 3JQ9A 3WLRA 4FKBA 1NAHA 1P7CA 1RQGA 1Z8FA 4YUAA 3GLVA 4XVCA 2ZJ4A 1BVYF 4GU5A 1MJGA 5HS6A 3NRJA 1E6WA 3UMCA 4FMPA 2VSNA 5TF4A 4JSTA 3IRUA 5DX8A 2YXPX 3ZK7A 1BG6A 1W35A 2FFBA 4V0KA 4CQMB 3KDSE 4C01A 4ETMA 1QLWA 3IUEA 4Q3NA 3TI9A 3K6SA 1PJ3A 5A5VA 4QTUB 2IIQA 5CCBA 1W0KA 1M34B 1EWKA 1XZBA 3M5DA 1GKLA 3OEEA 2GPJA 4QXPA 3ZGLA 1FP2A 3M82A 3SZ3A 1Q83A 5C8ZA 3OJXA 3EDOA 4JHLA 3B1JA 4AN1A 5IUJC 2JGDB 2EP8A 2NTYC 2A1UA 4HDAA 3PGMA 4PYLA 3DP7A 221PA 2F1OA 3GGOA 4RNCA 2NYUA 2FQWA 1JPJA 4TVKA 2QGNA 1WB6A 1C4XA 4WESA 3R9KA 3W06A 4W7IA 4CMIB 2X23A 4QQKA 1GGVA 2V7VA 4HN4B 5JANA 4XWTA 3V2HA 3O31A 5C31A 1ADFA 2V59A 1GXSA 1VMEA 2PKQP 3JD2A 4NK4A 4CM4A 4DCGA 4DY4A 4ARVA 3QXHA 3O3NB 4KU4A 3ZDZB 3BWEA 1AG9A 4EPTA 1ZMOA 1K6XA 4RA9B 1XRJA 2I6QA 4J0KA 4YAOA 3F90A 1VGQA 3DBHB 4ZXPA 2WHPB 1RJGA 2QA5A 3OQ6A 3PQEA 3F0TA 1LU9A 4EUKA 1QG2A 1EWYA 3UMSA 1GU1A 1H3NA 2WTXA 3IUYA 2R11A 4FZJA 3W6PA 3TLMA 4TV8F 3ZE9A 4ON9A 2ZW9A 4ROTA 2ZTLA 4QFBA 1ND5A 1MORA 3VOBA 1T13A 1NM5A 4J0EA 2O20A 3B2NA 1YI8A 5ALXA 1C5KA 4DIEA 2ZSFA 4B48A 1DJOA 3DDHA 3X2FA 1ZK2A 3CE6A 3WK6A 2BFCA 4F5EA 3PPIA 1XVIA 4Y6PA 1Y8RA 3P9ZA 1BE6A 2C3PA 2I4RA 5EMKA 5GM1A 1IJEA 2ODPA 1ETUA 1GZUA 1X19A 3D2LA 3QNMA 4GOND 3B5JA 2PNJA 1CLEA 2Q6TA 2C2ZA 2YWFA 3F5SA 3SEZA 3DW3X 3TF5A 3C3DA 2B2CA 2DTXA 2RK6A 2QUZA 4TV8A 4ZKEA 1XTQA 2P8JA 1DARA 1NY6A 2JIPA 2QXUA 2PZMA 3BHMA 1N8TA 3OT5A 1TXGA 1UFVA 1Y8QA 3KK0A 4HMPA 1U65A 2ZRJA 1DXYA 1T9DA 2W8ZA 4XKJA 1U1FA 3I5XA 1ILWA 1Z5UA 3BKWA 4UAUA 3KQQA 2W71A 5GZ6A 4F56A 2OBYA 5DIFA 4QYMA 3G8CA 3W9BA 1A2QA 3UPUA 1LNQA 1SC1A 1I0ZA 3CWCA 1YJBA 2DQSA 3NOVA 2BHRA 1ZVVA 3K31A 4ZRMA 3PUKA 4QNMA 1YQEA 3SMQA 4HXYA 2JB9A 4JJ7A 4N1AA 1ZN7A 3A9WA 3P97A 1PJBA 1AQJA 1UK8A 3QMVA 1TF2A 1B93A 2BW0A 1P91A 3EFBA 3IV6A 1I1OA 1H93A 5KNBD 1QX4A 4EA9A 5LKRA 1ISMA 4QUGA 4J76A 4UQOA 5ADHA 1KS2A 1F4PA 2A5GA 4TTJA 1EB9A 4I9FA 2EZ8A 4KIWA 2D5CA 4MV9A 1TRHA 1NT2A 4IZIA 3WJ1A 5IC5A 4DLYA 2YHIA 3F71A 4KMRA 4DQDA 2C2XA 3AZQA 2PA0A 1GL3A 5EPUA 2RMKA 1JEYB 4H1VA 4PFQA 4KW7A 4KXUA 5FV4A 4JVSB 4DQKA 1T2NA 2IPMA 4TRMA 3G5MA 3MOIA 4R1MA 1O0CA 1HDRA 2C5LA 1VJDA 1RTTA 1BCRA 3Q72A 2XECA 3WNVA 3PHGA 2XBLA 1GQQA 4Y7DA 3FKSD 5F1OA 2GZ1A 4R3WA 1T3LA 5ALQA 4BO3A 1D09A 1XQYA 1JTEA 1OC2A 5ICMA 3DAHA 3ZTTA 2YMLA 2IW1A 1CUDA 1GCAA 5A6VA 5JMWA 4RTRA 1X7HA 5LUBA 1ML3A 4RC9A 2QLBA 4JI0B 5CVJA 2GLTA 1Q0HA 4DMMA 1TKCA 3HU2A 2V3CC 2J8ZA 2R0QC 3ZWVA 3I12A 1FRFS 2CB9A 1XN4A 3ES9A 3CLHA 3MAAC 1OFTA 4Q19A 5CURA 4RK4A 3FTCA 2PAFA 4JYBA 3RSQA 4CU5A 4KI0A 2P2GA 4TKVA 4XDYA 3OTOB 3BMNB 1K5GA 3AGQA 4EP1A 1IL0A 3C74A 1DFGA 1A1SA 4FFRA 4IG9A 4PHTA 5EMLA 1YFKA 2J87A 1E0DA 2P4EA 2CL6X 2Z09A 3QXCA 5H16A 2ZS9A 4UTPA 5BY2A 1G8MA 2WNSA 4D3ZA 3IXMA 3R44A 1GLNA 1RWKA 1P31A 3DOCA 3WK7A 3ZDDA 3NANA 3HKBA 4WECA 4AK9A 4FN4A 1UP6A 1QDEA 2R6HA 1FLAA 3ZX4A 3H2IA 3MUFA 3P2KA 4RGVA 4H9GA 4DSOA 1T34A 4Q1FA 1EBBA 4DXHA 1ZI9A 1UF9A 4RK5A 3UK1A 4B0OA 4BN0A 1OXKB 3L0BA 1RPZA 5CT4A 2M6LA 1XZDA 2BGKA 1XMIA 2CUKA 3LQ2A 5KNBA 2F9MA 3I5UA 1H2RS 2PKWA 5F98A 1V11B 1DMRA 2VXBA 4KN8A 1KZ1A 4M1EA 1OLSA 5J5VA 3U80A 1AGRA 1XG5A 2CF6A 4IGIA 3I5MA 3U1TA 2JI7A 1LSUA 1E2PA 1FK8A 1H4TA 2OCLA 4IYRA 3H4VA 4UMFA 4W1RA 4AZ0A 2JVKA 5JD4A 2IUYA 3CVXA 4LC0A 4M1OA 2VRWA 1XVTA 4HY3A 4RVNA 1B26A 2Q1XA 4O4JB 4OGWA 4ZA2A 3ZNQA 2AC2A 2GTPA 2EQ5A 2JFYA 4N7RA 4WLOA 4YDSA 4BE4A 4D9HA 3ZDBA 1P39A 4JL8A 4QASA 4NTZA 4X65B 4ZHSA 2KLBA 5AHXA 3C3YA 3GZNA 3MB8A 2BE7A 3NOOA 5KC9A 2R5FA 3S68A 1EBUA 2DTEA 1RWOA 2FNAA 3KBOA 2OQRA 3CLTD 3G7SA 3EGWA 2JD2A 4K2HA 4YRCA 4F2GA 2CXXA 5BN3B 3AY0A 5LIPA 1XJWA 5HOQA 3KPYA 3CRRA 4Q7QA 4C4AA 2IYYA 3F8WA 4E2XA 3GDOA 3QLUA 1E62A 4JBNA 4OJYA 4NYJR 3RRZA 1I36A 1L7DA 2UYOA 5TLSA 2DUWA 2HQRA 3AFIA 1A71A 1R16A 5HF9A 1XDDA 4JB2A 3WRXA 4KI7A 4MLZA 4BCDA 2VAPA 2AKEA 1UH5A 1W76A 1VI6A 5HBGA 3AM4A 3JARB 2F8MA 2AZXA 2GCOB 4RDXA 4V0QA 2BMFA 2GM3A 3CH7A 5NLLA 2JIZD 4RVUA 5CBPA 1YBVA 4FINA 1ZSNA 4C3ZA 5EZYA 3IQFA 2AK3A 2XZLA 2EGHA 4XI9A 1G3QA 2MSNA 2VJBA 3ZD6A 2C5GA 3STXA 3NBYC 2CVHA 1PFVA 1O6BA 3EEFA 1OAKA 4MRAA 3GGPA 5EEGA 4G56A 5IAGA 1Z5VA 2W0MA 2ZAMA 2BF4A 1JLLB 3P2IA 3V1LA 3UC5A 2HJVA 2JLQA 1KNQA 3W5VA 2FCRA 4D56A 4MV5A 4EMTA 1U02A 3AFHA 3LF2A 4X8MA 3BX1A 2OCIA 3BSWA 3LW7A 3WSWA 4XWOA 2QTGA 1MC8A 1OW3B 2GCPA 4J16C 2AJLI 3T5CA 3ZEAA 1IE3A 3QLTA 3Q9SA 4DNOA 1S9DA 3TQRA 3RFTA 1BE0A 1LBEA 1Q1ZA 4S1TA 1I5EA 3N86A 3FPHA 5ALEA 2C82A 1CRWG 2OTCA 5GVRA 4C05A 2LCQA 1HLFA 4JENA 4NICA 3M2TA 5JD6A 3FOAA 4HLNA 4QVKA 4Q7JB 1SQ0A 2IYSA 1X1TA 2Z08A 1KQ3A 3CURA 3LV8A 3VX4A 5JJ5A 4OMDA 1P7PA 2Y66A 4W5TA 2PWZA 5JXHA 4QE3A 4N76A 1FXWA 3KB2A 1OPXA 4ZEWA 5IKOA 1FMTA 2XMGA 3F3KA 2IEIA 1ULTA 3B6KA 4AO8A 5JHHB 2P2NA 3GB9A 1CDOA 2H2HA 1HDZA 2NQ8A 4TLBA 5KTPA 3SEAA 3FBTA 1KEEA 3S4YA 5ECDA 2QN9A 2OCKA 3FLMA 4BFWA 3DFIA 4WCFB 1WAMA 2HF7A 2XQIA 4L4XA 5C5EA 5DISB 2WWXA 1QQ6A 1IQ0A 3L7CA 4OO3A 3K4HA 4K81B 1ZHHA 3JQAB 5ED0A 2PWPA 1WB5A 2Y6VA 5IANA 4DKXA 1PQPA 5CAEB 2PWBA 1NSYA 3CMMA 1A95A 2DY1A 2DFKB 4LVUA 1KY5A 1QJ4A 3N2YA 1I3OA 2Z95A 4W1QA 3U7HB 2AXNA 3FIJA 3PDCA 4KN6A 2H2AA 3A37A 5DTJA 3ZLTA 4BBZA 4FSHA 1Y4AE 4LDZA 2JLBA 3FDXA 2EJTA 3V46A 4F72A 5DEOA 4BRUA 2NP6A 2GTIA 4AYWA 1B3RA 1ZMRA 2Q29A 2JIZA 2AR9A 1SUIA 2QAJA 2C7GA 4AROA 3I9V1 1AQIA 2XITA 4QWWA 1OH8A 1JU4A 3T4XA 4KXVA 5KOIA 4BAGA 4K6HA 1A9SA 5C51B 3EWIA 2L82A 4N7BA 4Z3DA 1V2HE 1FTGA 1FTYA 4IMPA 5CPFA 4RENA 2GRUA 3MT7A 2I4NA 1HX7A 3ZS8A 1EVIA 1NI5A 5AJHA 3ZNNA 1XR3A 4CNQA 3UYLA 5BSWA 1TU3A 2C3MA 3LLSA 3SSOA 1GPJA 2CMDA 1CBUA 1UT5A 2ZR9A 1KPHA 1OZHA 3T9EA 5CLHA 1UPAA 3D3QA 4CM5A 1YD7A 4F3TA 2DR3A 1Q6YA 2CNKA 3PU6A 5DI3A 2OV8A 3KEMA 4L5IA 2CL7X 5T6MA 3V4VB 5A6SA 4XLLA 4PTLA 4PYJA 3PCRB 1F51E 5H5JA 3AGPA 4A0HA 2QL6A 5JDIA 5KWEA 2WHYA 1EINA 3E9QA 4LGYA 3BD8A 3VC2A 4TVSA 1ODCA 2QDKA 3IJRA 3TG2A 2I5PO 2X8WA 5HK8A 1R18A 1YFJA 2XW6A 2V9ZA 5F2KA 3GLFE 5IJ9A 3NHZA 3KZ1E 5DGHA 1CE8A 3SIWA 3WL4A 1CJCA 1OWMA 3G79A 4MYRA 4NBRA 2YYAA 3W8NA 4RTKA 3M1IA 1FFAA 1VXOA 3P5BA 5ALTA 2E4XA 2PL9A 4TKLA 2JLSA 4U2KA 2WU1A 4OI1A 6ADHA 4DV2B 3VYTB 1XMVA 1E3MA 1PD0A 4B2YA 3OCCA 1HBJA 4BKUA 4MUNA 5CB4B 1HF3A 1WHSA 2BCJQ 4LV6A 4Z7QB 3PHHA 3ICQB 2FKNA 4BEVA 3PUYA 1ZCAA 2VP2A 4CN9A 2ZRHA 4DUYB 3PXDA 2R4UA 3V8EA 3BB4A 3AC0A 4N01A 4OFXA 1TUEA 5BO5A 1HNZB 2G8NA 2JJ1A 3HWX1 2HSDA 1DKMA 3OZIA 1WF3A 4RJJA 3DTVB 4NV3A 4NHEA 2I7VA 3R7NA 2FR8A 3MS4A 4P7BA 4V2UA 5EWLB 2GPSA 1I9GA