2RAFA

Crystal structure of putative dinucleotide-binding oxidoreductase (np_786167.1) from lactobacillus plantarum at 1.60 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
b'MEITIFGKGNMGQAIGHNFEIAGHEVTYYGSKDQATTLGEIVIMAVPYPALAALAKQYATQLKGKIVVDITNPLNFDTWDDLVVPADSSAAQELQQQLPDSQVLKAFNTTFAATLQSGQVNGKEPTTVLVAGNDDSAKQRFTRALADSPLEVKDAGKLKRARELEAMGFMQMTLAASEQIGWTGGFAVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Dinucleotide-Binding Oxidoreductase
publication title Crystal structure of putative dinucleotide-binding oxidoreductase (NP_786167.1) from Lactobacillus plantarum at 1.60 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Oxidoreductase
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rafA01
1HKUA 1HXHA 2W2KA 4MIOA 4ILKA 4ND2A 4R4JA 5B4UA 2HKIA 3PZRA 3UCEA 3U9LA 1MFPA 3WTBA 5MGBA 3C3XA 4MO2A 4II2A 4MVJE 2JFFA 3MZ0A 4XQ9A 1E5QA 3QV1A 1LDYA 4OO3A 4XR9A 3HHPA 2NTJA 3IMFA 4R1SA 1TVEA 3D3WB 3LT2A 1XWFA 2I76A 3GA0A 1DB3A 4XB1A 3DHEA 4S1VA 3L77A 5B1YA 5HA5A 1N7HA 2X5OA 4Y67A 4FSHA 2VWQA 1HYHA 4IDCA 1JKIA 4WCDA 3PFWO 4A7PA 2O48X 3HE3A 1ML3A 1XSEA 2HSDA 1NXQA 1QP8A 3ZU3A 3C8MA 3H3JA 1T25A 4G65A 3V1UA 2ZYAA 3VH2A 1LDMA 4RORA 3WGHA 3DHYA 3L4SO 1GUZA 3VPGA 5DNAA 3CZRA 3GR6A 3KYDB 4WJZA 4MDHA 2IYPA 2YYYA 3K31A 2J3KA 4I5GA 2UUOA 4M87A 4L73A 1E7SA 3SC4A 1UXJA 2I99A 3O8QB 1ISJA 4U0KA 3Q9NA 1V0JA 4CLXA 1Q0QA 4NK4A 3SXPA 4B4VA 3BIOA 3KLMX 3VVBA 4BNWA 2IDZA 2VN8A 5TC4A 1DC5A 3KO8A 4QXMA 5LC1A 1V3TA 1L7EA 4YRBA 3H8VA 3RUHA 3RFXA 2HDHA 4YQYA 4ZICA 5AVOA 3CEAA 4JGBA 2FZWA 4YXFA 3EW7A 1ZW1A 1VKNA 2Q49A 4XYLA 4QT0A 1I0ZA 1ISIA 1D1TA 3PQFA 4MVJM 2ZB3A 3S1LA 4B4OA 1W4ZA 2P9CA 3SJUA 3ZGYA 5F5LA 3GVIA 1VJ1A 5C7IO 1LQUA 4FGSA 3U4CA 1LRKA 2YV2A 3GN2A 1HYEA 3CZMA 4P22A 2OBNA 2DBVO 4BNGA 4RVDA 4XYEA 2AG8A 3H4VA 3LC7O 4PRLA 2BGLA 4EUEA 1FK8A 5A1TA 2O3QA 4XEHA 1VL8A 1B15A 3D1LA 2GDZA 1X14A 2AHRA 2AQIA 4HKTA 3W6ZA 3BMCA 3HDQA 3PIDA 3ZWVA 5ES3A 2P2SA 4D0SA 4HWKA 2XXJA 5A9SA 1B8VA 3RU7A 4AJOA 5KCZA 3ASVA 2Y0DA 1T2DA 3P19A 2HMSA 4ND5A 4EITA 8ADHA 1WP4A 4BO1A 7ADHA 1BXGA 1YL5A 3VTFA 1X1TA 3EDMA 1G0NA 4FIZA 2W2LD 2VUUA 5IXSA 4RLSA 2YHIA 1KEVA 4Y8VA 4Y9DA 4P4LA 3PYXA 3KRTA 3UCXA 4UUOA 2J5QA 3GNQA 2WYVA 2BHLA 2HQ1A 4GMGA 2DC1A 3RUCA 3ZV3A 2CDAA 4GGPA 5G2OA 2A35A 3G1TA 4RDHA 3BMNB 3PZBA 3JTMA 3W8DA 4OOFA 1ZXLA 4PFJA 2BI8A 5JCJA 2PR2A 5IZCA 4MVJI 4FQ8A 2C82A 2H9IA 1UXHA 4U8GA 4TRNA 3KSUA 3WLEA 1YQDA 1RM0A 3EYWA 3GEGA 3CE6A 3I9LA 4XGNA 1KEUA 1F17A 3BMQA 4IDDA 1C1DB 5TJHA 3ETGA 1HE4A 4WKGA 2GD1O 3FNHA 2UVDA 5F5NA 3ADPA 4IJUA 3LT1A 3H5RA 3I9KA 2Q50A 3IJRA 3R6DA 4EJMA 3BTUA 2P4HX 1VE9A 1AGNA 2VNAA 3CXRA 1I2CA 1LLDA 1DHRA 4XQCA 5AXBA 4CMCA 3QW2A 2X9GA 3E9QA 2YY7A 5AXDA 4IPTA 4PLFA 4WOKA 4D45A 4ND4A 3AFNA 3QWBA 4E21A 2PKRA 4IIUA 4NU5A 1A7KA 1NQOA 2JD2A 4YAGA 4UREA 5TNXA 3NTOA 2X1HA 4LGVA 4MVJG 1YONA 4E2XA 2YQ4A 4L0QA 1IHXA 1LBEA 5TQVA 3RUFA 3WYEA 2OHXA 5IF3A 1W8DA 4BNLA 4EUHA 1YB5A 1I01A 4CV2A 4OKIA 4KWHA 1N7GA 4J9UE 3FCOA 5L7YA 3DFUA 1ZO8A 3AM4A 4J16A 2AQ8A 3H5NA 5G0TA 3ZWOA 4TMFA 2CF5A 3JD0A 1E1KA 2YDXA 1P1RA 3JYPA 1E3WB 2GO1A 3GDOA 3RJ5A 4I8XA 1H93A 3I5MA 5A4DA 4Y98A 4ZD6A 1LLQA 2D2IA 3WX0A 1IB6A 1O6ZA 2AEJA 3C24A 4Q3EA 2PGLA 3WGYA 4LW8A 4M49A 3W4IA 2FWMX 1PX0A 5HBRA 4A0SA 1I36A 1R4MB 4LVUA 3OICA 3LZ6A 4A2CA 3DBLB 4FS3A 1ENPA 3ANMA 1YS4A 4AJNA 4YACA 1NM5A 4WPGA 1MA0A 5KVSA 5H83A 2GNAA 3TF5A 4Q3BA 3JQCA 4J1SA 4E13A 1SZJG 3Q0EA 4BNNA 2P68A 2B35A 3AUSA 4JN6B 1IZ9A 5KVQA 2UDPA 5K0ZA 1H6DA 2B5WA 4AJEA 2BD0A 5DZSA 3K73O 3B70A 1P0FA 2R00C 4GLLA 1UZLA 1A71A 3OSUA 4YJHA 2DAPA 1U2DA 1WMBA 4CPDA 4J49A 5MDHA 4DQUA 5B12A 4M55A 1BVRA 1NFRA 3ZWPA 3PRJA 1GCOA 4TWRA 5IN5A 2HK8A 3DDNA 3MWDB 1Z74A 1ZK2A 3GZ4A 3MOGA 2V6BA 4L4SA 4IS3A 4HY3A 2DVMA 2NU6A 4BGUA 1QYDA 1Y8RA 1YBAA 5IDWA 4CMEC 3MJTA 2PZLA 4ZA2A 3PFFA 2QYSA 3DL2A 3AJRA 2F1KA 3B1FA 2ZQYA 1I3NA 1BXKA 2P9EA 4FCCA 5JAQA 1LDGA 1LRLA 2ZTMA 3QA9A 2HK9A 1VL6A 4J3FA 3RKRA 4CL8A 1GTMA 4LSMA 4TQGA 3UAGA 4D3DA 1R15A 3GK3A 4CLOA 2DTDA 4PLHA 2HCTA 2O3RA 3STHA 2QYTA 3PLNA 3EVNA 1P44A 3K92A 3BXXA 4NJOA 3EGOA 3TSCA 3EHEA 1U2GA 2I9PA 1NQAO 1SC6A 1XELA 5GMOA 3MWEB 1E3EA 3IQDB 4LCJA 4PLVA 4KQXA 3NUGA 3I4FA 3V1YA 4EDFA 4J2HA 4CLDA 1A7AA 1KYQA 3LLVA 3R0IA 5DDIP 1U3VA 1I8TA 1VC2A 4BNMA 3VH4A 4TROA 2JJYA 4YRAA 3ONEA 3VPXA 4BO9A 4WEOA 1YDWA 4DA9A 4E5PA 1LSSA 3U4IA 2CDCA 4J1TA 5F3RA 4AICA 4A73A 4ESOA 3WGGA 4LRSB 4TVOA 4QO8A 1UXIA 4LISA 3VZPA 4ALNA 5IDYA 5KWEA 4D46A 1OC4A 4GWKA 3L4BC 1EZ4A 4J4HA 1Q0LA 3DOOA 4R5MA 3AI2A 4W6ZA 2A92A 4YJFB 3WSVA 1C1XB 2B69A 4ALKA 3OH8A 3VZRA 3VDQA 2BMAA 5JMPA 1Q7CA 2PY6A 2QQ5A 1PQWA 2OZPA 1E92A 5JFOA 2AQKA 5CP8A 1DIRA 3NX4A 4WLOA 4CM6A 5L4LA 1OBFO 1B16A 4I9NA 1X7GA 1DIHA 4Z0PA 1ZKMA 4QEDA 3UFXA 1YBVA 5BNTA 4R1NA 4GX2A 5TLSA 1NNUA 1NWHA 2ZQZA 3KYCA 1U8XX 4IBOA 4J90A 4Q3NA 2OP1A 4B4WA 4GWGA 3OIGA 2HU2A 4R3WA 1XQ6A 1YKFA 1Z73A 3OBBA 4A27A 4E5KA 1EQ2A 4NFSA 4E33A 4NK5A 2P9GA 2C2XA 3NT5A 4UUNA 4FOSA 2I5PO 1DPGA 1OI7A 2W98A 1R4NA 2DPHA 4L4XA 3ICCA 2FOIA 4QFDA 4ZQHA 2EP7A 2OO5A 3BTVA 4NJMA 3RAJA 2Q2WA 4BIIA 4DYVA 2Z1MA 3RASA 1E7QA 1PL8A 2D3TA 4OM8A 3VH1A 3ZNPA 4YT5A 1LEHA 5JO9A 1ISMA 4PGFA 4WCFB 1A9YA 1E6UA 1VSUA 3ROPA 4RPKA 3UVEA 5CHEA 2CNBA 1QYWA 2W8ZA 3OA2A 4PIVA 2NTNA 4D42A 1SEVA 1M76A 3PGXA 1R6DA 5K6AC 2GSDA 5DULA 2BFPA 5CFZA 5DCYA 4IJVA 2RH8A 2OORA 4HFMA 4NR0A 3VPFA 4CMKA 4G81A 3ZV5A 4NBUA 4GSLA 4D3FA 4NFYA 3RC9A 1ZUD1 4M86A 1ADFA 3B1JA 1IPFA 2GZ1A 1VI2A 1ZIDA 5EESA 5IN4A 1X13A 3AUAA 3B20A 4FD3A 3ZWBA 4NFHA 2NUAA 4R1UA 4CV3A 4DVJA 3W6UA 1R16A 3OEYA 3DZKA 5EERA 3DMYA 1JQBA 3C1TA 2Q4BA 2JCYA 4XRGA 2YFQA 1QYCA 4J2OA 3TL3A 3AU9A 3FBGA 1ORRA 3CPSA 3GQVA 1U1IA 1G1AA 2H1SA 3C7DB 1AHHA 5TF4A 2R00A 2ZYDA 3JQ7A 4H3VA 4ZGWA 2O3JA 1WDKA 3KTDA 1U8FO 3GAFA 4CR7A 4E5NA 4CM9D 3EK2A 2G1UA 1JVSA 4KWIA 4AJ1A 1GD1O 3H5AA 4RO0A 2IEDA 4AJ2A 5C3MA 3DBRB 2JFHA 4QX6A 1E77A 5JC8A 4C7KA 2EF1A 2W2KB 3JD3A 2D5CA 1ADBA 1RWBA 2PGDA 1DC3A 2X6TA 4KOAA 4MIEA 1ZMOA 4CMEA 5THQA 4NBWA 2AE1A 3ZNNA 2G5CA 3FI9A 2RCYA 5JS6A 2NADA 4II3A 1D4FA 4R01A 2HMUA 1LC0A 3E8XA 4JP2A 2DM6A 3NT4A 4KUEA 3HG7A 2JFGA 1T26A 2E37A 3DTTA 1PJQA 3WWYA 1UZMA 2NACA 4CMBA 3OM9A 3F4BA 1ZSVA 2IXAA 1HTBA 3D0OA 5I7FA 2GYYA 1LRJA 3ZN2A 5EQFA 3FN4A 3WGOA 4NBVA 1MUUA 4YPOA 1PZEA 1KC3A 1E6EA 1K2WA 3F5QA 1HLPA 3P2OA 2AQHA 2HLPA 2XPCA 1RM4A 1BGVA 2C29D 4IDBA 3T4EA 2UAGA 3AOEC 4RPJA 4WLNA 4IS2A 5T6BA 4ID9A 5T5QA 3RC2A 1LSOA 3GH3A 9LDBA 4IMPA 4RQUA 5ENDA 3MEQA 2HMWA 1TA4A 4UEJA 2VWHA 5JW6A 3I9NA 2RHRA 4F46A 5A5FA 3WXBA 3S55A 4HX5A 3WIDA 4ND3A 1JKJA 1YOVB 5HS6A 5CDUA 1SMKA 4J7XA 1D7OA 3PVZA 5FI5A 3KUXA 4CQMD 4CLRA 3IDSA 3GDGA 3L4BA 3NGLA 1BVUA 1TT7A 4Q9NA 4BNTA 3ENKA 1ISGA 4RF3A 3VPHA 1WXDA 2X22A 4CM5A 1GAEO 1MB4A 2B4QA 3W4KA 4CM7A 1YGYA 2OUIA 1HYGA 1NPTO 3KXDA 1BW9A 1E7MA 1GADO 3IAHA 3GFBA 3ZCXA 2NVWA 3ZWYA 1IHYA 3KBOA 1SAYA 5CPBA 4ND1A 3CTMA 3PHHA 4O1MA 2ILTA 3WLFA 2YV3A 4J91A 3UN1A 3JQGA 2Q4EA 1YL7A 4IQ0A 1NVGA 1P74A 3BHJA 2I65A 5A9SB 3RKUA 4B3HA 1GEGA 4NU6A 1Z75A 3U0BA 4XWYA 4XYMA 2FRDA 2VHZA 1CEQA 3V2HA 2VOJA 3IOYA 3U49A 4FGWA 4YB8A 1PU2A 2OBYA 5CDGA 1TT5B 4YYZA 1BXGB 1UP4A 3QSGA 3ZV6A 1HE5A 1E3LA 3CH6A 3CUKA 1PJ3A 3ONFA 4E5YA 1XIVA 3AK4A 4DLLA 3JQ8A 1R0SA 3MCVA 3ZWAA 3OETA 1VPDA 4CUKA 1CQJA 1MXFA 1B2LA 3DBHA 3QE3A 4OL9A 2QX7A 3I6IA 5EQDA 3SC6A 4ZVVA 1CETA 3FHLA 3QY9A 4YR9A 4LSWA 3QIVA 2X5JO 3OIDA 4BV9A 5K6AA 2C7GA 1WNTA 3K96A 1A9ZA 5TX7A 3K6JA 1C14A 3BMQB 3DWFA 4X54A 2Y1EA 1ZJYA 1E5LA 4DBVO 3AUUA 1IULA 1HDOA 5EL0A 4BO6A 4DBZA 4J0FA 2TMDA 1W73A 1GZ6A 2VZ0A 3P7MA 4E4YA 2O3TA 3PLRA 4QECA 1ZMTA 4FBGA 5GZ1A 1WLYA 2IYOA 2VYVD 2PK3A 1Q7GA 3D5TA 2FN7A 2WMDA 4GAEA 4Z9XA 4U5QA 2Q3EA 4M54A 4OXKA 1DFGA 5B37A 5AXCA 5C7OO 3H9GA 1D1SA 2H5LA 4QFCA 5ITVA 2BH9A 5CPFA 4GL4A 2VQ3A 3DOJA 4IJWA 2X4GA 2FR1A 3ZI0A 2GZ2A 5A3VA 4AG3A 4J4BA 4YBZA 4XIYA 3RJ9A 1OMOA 5DT9A 4PG5A 4PRKA 3NJ4A 2HMVA 3JSAA 3PK0A 5ADHA 1F0YA 3ZHBA 1E6WA 4W99A 2EKPA 1K89A 1BSVA 2PFGA 1WMAA 3VH3A 1M6WA 3PYMA 4YJDA 3P5SA 5TJ9A 2Y1DA 1I3MA 4CMHA 4A03A 3AI1A 1MV8A 3GEDA 4UAGA 1NPDA 2WE8A 4UULA 1H94A 4DGSA 1DLIA 4RCVA 1HWYA 1PZFA 3G3EA 3PI7A 4FDAA 4PG8A 2WYUA 4EUFA 3OFSA 4NDNE 4NBRA 5L40A 1OZAA 1PIWA 3UOGA 3JYLA 1HE2A 1E7RA 5KJ1A 4OAQA 1ZVMA 3ZWMA 4BNVA 4K28A 4M89A 4CQLB 4NZ9A 3NRCA 5KJEA 3TFOA 3ZW8A 2XAAA 4D41A 1PS0A 4NMHA 1NPYA 2IXBA 3WJ7A 1A4IA 3LT4A 1P31A 1Z7EA 1KS9A 2BRUA 5KJCA 5KNLA 5LDGA 1O94A 4CMAA 3WGQA 3AOEA 1PGNA 1I3LA 5COBA 1CYDA 3UHAA 1Q1NA 4IY1A 4DIBA 2O4UX 3WJAA 2Y1OA 2E82A 4BNKA 4I5FA 4BVAA 3BTSA 4PN3A 3LDHA 5TT0A 4MP8A 4B8WA 4TZTA 5H82A 5JAZA 1LLCA 4TSKA 4KDEA 2V6MA 5IXYA 4FW8A 2JAHA 2XF8A 4A10A 2O23A 5JNLA 2JHFA 2PH5A 4BMVA 4J1QA 5T8KC 1LQTA 4A5OA 4BMSA 2PD6A 5ICMA 2E4AA 2LDBA 3DZIA 1E3IA 3RD5A 4P4NA 3VTZA 4B8ZA 3WB9A 1WZIA 4CM4B 3EZLA 1FXSA 3KZVA 3WBFA 4BUCA 4M8SA 4RPGA 4N18A 1WVGA 1HSOA 1QYXA 2GZ3A 3AOGA 2C5EA 3LF1A 2PZKA 3Q11A 4RF4A 2Y1GA 1VSVA 3DOCA 1N92A 3H2ZA 2J5KA 4IQ8A 2EJWA 2FMUA 1T1SA 1HDXA 4OSOA 5JMWA 3HB4X 2CZCA 2DLDA 1E1NA 2G17A 4CLOB 3U62A 3ZWCA 4N5NA 3O4RA 1I5RA 5HRUA 1PGOA 4HNHA 1UDCA 4IDFA 1EUDA 2CVZA 4BQRA 2HRZA 1ZH8A 4RZHA 1GR0A 2YFHA 2DT5A 3BZUA 3ENNA 1D8AA 1UR5A 1PGPA 5JAIA 4BOYA 4IQGA 4GSKA 2CVQA 4JJFA 1NX6A 3JD4A 1U5CA 4LVCA 3PXXA 2HAEA 3ADOA 3QVOA 3E48A 4BMNA 2B0JA 4D3SA 4OJNA 3W8EA 2Y68A 3I83A 3ZW9A 4CMIA 5IAAA 4FFLA 4ZQGA 5GZ6A 3WIEA 5CDTA 1DOHA 3V8BA 2NV6A 5AQ1A 1ADCA 1DRUA 1QV6A 4R41A 3PQEA 1I32A 1R0LA 5LDHA 1PZHA 2YV1A 3COSA 2R2GA 3GG2A 1YB4A 2BI7A 5C7LO 4N54A 4EI2A 3INTA 4EJ0A 2W90A 2D8AA 1EDZA 3RCBA 2VUTA 4UEOA 4AVYA 2J5RA 2X7HA 4MKXA 4JBGA 4GPD1 3CKYA 4B7UA 1QR6A 3A4VA 3P2YA 1N9GA 2AEFA 4RPHA 5DCWA 3TJRA 3PHJA 3F1KA 3H65A 4WUVA 1UJMA 5G4KA 5AXAA 3NT2A 4CUZA 1A27A 2Q45A 3F47A 2AXQA 3H9EO 3GT0A 1X0XA 3HDJA 3FR7A 1BDBA 4RDIA 1WWKA 3QRWA 1JN0A 2IE0A 4M1QA 5JY6A 2PV7A 3IL2A 4KUGA 5A05A 1HRDA 1PJTA 3ABIA 3RC1A 4ALJA 4YT2A 3HZZA 1ISFA 3ZU2A 3PWKA 3TWOA 1ZK1A 4YA6A 2CSUA 1PSDA 5JYDA 3S8MA 2H6EA 3WDSA 4LMPA 2J3IA 4AJJA 4FJ1A 4NNJA 1Z6ZA 5L4SA 1R4NB 3D3EA 4FFPA 1LDEA 1O89A 3D3WA 3TZHA 4O0LA 3RUIA 2DBRA 9LDTA 4FB5A 3PIIA 4N5MA 5G0SA 4Z0TA 1CERA 3TPCA 3QP9A 3BMOA 4CJXA 3VHRA 5IFLA 1HDRA 5JC1A 5FFFA 1HEUA 2HMTA 1GQ2A 3HWRA 1KOLA 3WMXA 1KERA 1CIVA 1DRVA 3C1AA 3QWFA 4L76A 4CM8B 1I2BA 1C0KA 3Q9UA 2EW2A 3E9NA 1OFGA 1YDEA 3VAZA 3KYDA 2ZB7A 3LU1A 2EXXA 3NDRA 3TN7A 1O9BA 4HFJA 4BGIA 5A3JA 3NV9A 3O8QA 4BL5A 2RHCA 3OHSX 3ZWXA 1DSSG 2B36A 2AE2A 2F00A 1ZFNA 1T2FA 2QG4A 3K2EA 3TZCA 3CMMA 3Q2KA 2QW8A 4LK3A 3I23A 1KVTA 2UV8A 3ZHXA 3OA0A 2P5YA 4J0EA 1XHLA 4OQYA 4S3MA 1UZNA 1DLJA 4MINA 3O9ZA 3AY3A 4URFA 3SBOA 3L9XA 3FNGA 1LUAA 1FMCA 2HJRA 4HFRA 4H7PA 3ZWNA 1SEPA 2HJSA 3ZU4A 1WAMA 3FR8A 4CM9A 1YL6A 4JNKA 5A5EA 3JQ7B 2PD4A 2X8LA 5BSFA 4AJLA 4TRMA 2CY0A 1L1FA 4E2ZA 2NNLD 4PG6A 3QVXA 1NTOA 5T8KA 2C5AA 2D0IA 1PJBA 4R69A 3OQ1A 3GMDA 2JD0A 3JYQA 1YQGA 3A06A 4FJ0A 1ZK4A 3MOIA 2EGGA 3L6EA 3GZNA 2Q1WA 3VDRA 3FBTA 1SCUA 3A14A 3G79A 3V1TC 1TEHA 4E2YA 1IPEA 3WNQA 3R3JA 1SOVA 1WZEA 3QWIA 3M2PA 1J5PA 2JKVA 4JBHA 3TQHA 2ZB4A 1ZSYA 3PJGA 2AW5A 5TS3A 3SLKA 1P1HA 4RPLA 3MJEA 5EMHA 3L9WA 4RGBA 2Y93A 1K0UA 1QLHA 2AMFA 3UKOA 1R66A 3WBBA 1GZ3A 4RVSA 5A03A 4ZQEA 1PGJA 4ZRNA 4Y6PA 5COQA 4YTEA 3SX2A 1V6AA 4DPLA 1B14A 1MG0A 1KVUA 3R1IA 3FSRA 3N58A 4JP3A 2QHXA 5TIIA 1LXCA 1AN9A 1H9AA 1I24A 3UF0A 1QV7A 3JQEA 1E1LA 4U7WA 1BRMA 3NTRA 1T2EA 4UVDA 2DFVA 3LLSA 5LCXA 2OFPA 4R16A 3BMNA 3MJVA 1PZGA 4BNHA 3HSKA 2FR0A 1DBVO 2VT3A 3IC5A 2GN4A 4K1LA 1TB4A 3GHHA 4BB5A 2FR8A 4DPKA 3GMSA 5F1KA 4BV8A 3NGXA 3GLQA 4CQMA 1YE3A 2JAPA 2V7PA 2GN8A 3RROA 4BQPA 2PKQO 1UXGA 1Y9EA 3RFTA 3Q1LA 3AUTA 3D64A 3JQAD 4IMRA 4CLRB 4E31A 1T2CA 1P3DA 2XXBA 4NHEA 2GR9A 4QQRA 2I66A 4DQXA 2V6FA 1R12A 1B3RA 3GHYA 1C0IA 3E82A 3DBVO 1GU7A 1EUZA 3EUWA 1YVEI 3OJEA 4TRRA 3HADA 1WPQA 1GZ4A 1ZJZA 1YBMA 2E49A 4PVCA 4DWVA 1BW9B 1KEWA 2EW8A 1RKXA 3RBVA 1EK6A 3JYNA 4D44A 2B5VA 3I1JA 3WYCA 4CR8A 2D59A 3GC6A 3DXFA 2B4TO 3GEMA 1IYZA 5KKCA 3PHGA 4XRRA 3DEYX 3ZV4A 1AXEA 2DBZA 1LJ8A 2RAFA 4DQVA 5CAEA 3LC1O 4RZIA 2FPIA 3OQ6A 3KVOA 1Y8QB 2WTBA 3QWHA 3PEFA 4BO4A 1XG5A 4Z6KA 3R3SA 3UGKA 3MTGA 3OQBA 3GGPA 4J9VA 3E18A 4MVJF 1NR1A 5L3ZA 5DN9A 3OP4A 1MGOA 4TRJA 1U3WA 4JXKA 5A04A 2ZKLA 3GVCA 2X0NA 3TOXA 3FD8A 4ALIA 3ROQA 5B4VA 1V3VA 1QXSA 3TZQA 3F4LA 1X7DA 4B79A 4LCEA 4ZQFA 1V8BA 3JQ8B 3WMWA 2WD7A 3KHUA 2VZ9A 1U7HA 2DTXA 2BELA 3CMCO 4BO0A 4IZHA 1HETA 1R4MA 3PWZA 3MJ4A 1GPDG 3OEWA 4GQAA 1PS9A 1V35A 5CEEA 3FF4A 3BYZA 4WLFA 4HXYA 1Q7BA 3NJ8A 4AJ4A 2O4CA 3LT0A 2ET6A 4XDZA 4RJTA 2VRCD 2R6JA 1DAOA 4WE3A 3DZFA 5G0WA 4GKVA 4K6FA 4R5HA 1H2BA 3I3OA 4IGFA 5I9MA 4CLEA 1UUFA 2QZZA 3VVCA 2O2YA 3UICA 2VYVA 3AY6A 4RVFA 4F6CA 1Q0HA 1B7GO 3NAQA 5ER6A 1MP0A 2EG9A 2PNFA 1XLTA 2GRAA 4PZDA 4B7XA 1XYGA 1Y81A 4MVJP 2O2SA 3GN1A 4KTTE 3HB5X 3V2UA 4J6FA 3C7AA 3PJEA 4KMSA 3TL2A 2FSSA 4BNUA 1N8KA 2OL4A 3EAGA 4J43A 1YWGO 4DIFA 3WS7A 2UYYA 3GPDG 3WSWA 3Q6IA 4WGGA 4L4RA 4ALMA 2VRBA 1B0AA 2DUWA 1DEHA 1GYRA 1I10A 4FR5A 4CODB 2GF2A 1UXKA 4GX5A 2Y05A 1ZEMA 5KVCA 3IP1A 4YT8A 3WQQA 1GYPA 3K5PA 2QIOA 2VTEA 4EBFA 2HK7A 4GI2A 1GQQA 1QORA 3H7AA 3GVHA 4XQEA 3U4HA 1T24A 3OMLA 1LLUA 5I7SA 1ONPA 4OSPA 3UXYA 4KZPA 4PCVA 2PGJA 1U4OA 3ZH2A 1GYQA 1SOWA 2EGHA 3F3SA 5L7WA 5COAA 2D1YA 2I67A 1RJWA 1VKOA 4EEXA 3N74A 2VYND 4NQZA 4P38A 1GY8A 4RVGA 1HLDA 1BWSA 1VJTA 2DUUA 1DFIA 1JDJA 5EIOA 1FJHA 4XX0A 5BNFA 1B26A 4O63O 3JYOA 2FY8A 1BDMA 2Z95A 1LTHR 2EKLA 3JQ6A 3JD2A 3ROKA 1J49A 1CJCA 3I9MA 1FDUA 5DBIA 3JD1A 4O5OA 1HDZA 3JV7A 4XGIA 1ENOA 1KVQA 3ZWWA 1ONNA 1U9JA 4R3NA 2HRBA 4XD2A 4DMMA 4XCVA 5JLAA 1T2AA 3NDIA 4YJFA 1ULUA 3KB6A 1C1XA 5ENVA 1PS8A 1X15A 4B7CA 5JDIC 1FDSA 4PVDA 1LNQA 3S2FA 4MP3A 4MIYA 4U6SA 1M66A 3GG9A 3UW3A 5L9AA 4PLYA 1VRWA 4XA8A 3GPIA 5CDSA 5BNIA 4Y6RA 2WDZA 4WOJA 1SBYA 2OP0A 3DAFA 3OJFA 3BMCB 2WEKA 4IDEA 3KSZO 3DZJA 1F14A 5THKA 1LX6A 3BHIA 1OAAA 1RPNA 3INRA 2Q1UA 5G0VA 4GMFA 1ENYA 3VKUA 2PWZA 1OC2A 3G0OA 1YJQA 1UAGA 1CF2O 2WD8A 4DC0A 6LDHA 3RIHA 3INGA 2BFMA 5IZ4A 1TI7A 3WNVA 4F45A 1HDGO 3ITDA 2YHIB 2YHUA 1T1RA 4YCAA 1EE2A 2PKQP 3M2TA 5FF9A 5BQFA 1DJNA 1X1EA 2NTVA 2ZCVA 3SLGA 2EJVA 1BG6A 4YJGA 1H6BA 2C0CA 3SVTA 2O3SA 1VJ0A 5I8ZA 3ULKA 5KTKA 3ZNQA 1JWAB 5HWSA 2VHXA 4CL3A 1QSGA 5IJZA 3IIEA 4NH4A 3C7CB 3IUPA 2B83A 4NI5A 4XYGA 3WFIA 1YO6A 1E3JA 3KOUA 3QQPA 4YRDA 3RFVA 4CMIB 3FPLA 4JJIA 3OIFA 4ZU3A 3WGTA 3ICPA 3BTOA 5DF1A 4FJ2A 3F1LA 4Q3DA 1DIAA 3H9JA 4O59O 4FFNA 1XKQA 2NLOA 4RV9A 2JL1A 1X7HA 5IDXA 3D7LA 6ADHA 1PJ2A 1PJLA 3H9UA 1B8UA 2GASA 1O8CA 4IM7A 5ILGA 4DUPA 4UVEA 1MLDA 2RIRA 3BHMA 2I3AA 4BS9A 5ICSA 1GDHA 2CFCA 2VWGA 4FPXA 3T7EA 1LU9A 5DCUA 1EDOA 4BGEA 4BO8A 5JYEA 2X5KO 3AWDA 3OJLA 2VT2A 3O26A 5ITWA 3OJ0A 1NWCA 1PJCA 3G17A 1QG6A 4UVIA 1ADGA 4W82A 4HBGA 4RL6A 1M2WA 4D79A 2GUGA 5GZ3A 2W4QA 2B4RO 2RH4A 3RWBA 4A26A 5JO0A 4KTVE 2PTGA 3DHNA 3EY4A 5B4TA 1N1EA 3HJAA 1DC6A 1M6HA 1ISHA 4E3ZA 4G5HA 3QVWA 4KQWA 4OOEA 2D5AA 3SJ7A 4UVHA 1K6JA 2VCYA 1R37A 4BNIA 2FPGA 2X9NA 1KY4A 3FTPA 5A06A 2Y67A 3JQFC 3L6OO 1HE3A 2ZCUA 3FNFA 5KJFA 2C07A 2BLLA 1PQUA 3EVTA 3ASUA 3ZNOA 1P1IA 2GN9A 4BNYA 1T4BA 2Q46A 3DZHA 2D4AA 3FNEA 3T4XA 3UUWA 5BSGA 3BMOB 4OXNA 3A28A 1YJ8A 4YT4A 1NBOA 4KUHA 3GDFA 1SB9A 4CR6A 1JVBA 1GUYA 3I4CA 5BT9A 1H6AA 2B37A 3S2GA 5G4LA 3TZKA 3HQ4O 4MVJH 4U6QA 3ZZNA 3K30A 4BB6A 4FOOA 4PLWA 1KVRA 2A94A 4XIJA 4HUJA 3FWNA 5DOZA 3KYBA 3PDUA 3VPSA 1KETA 2AA3A 2NQ8A 3OF2A 4UVGA 2E48A 3U09A 3GF4A 5T64A 4XJTA 4CM1A 2O50A 4JK3A 5I8WA 2VUSA 3HNPA 2EERA 2YW9A 3WTCA 3TFQA 3RI3A 1P1FA 4H15A 4YJHB 5L95A 4TVBA 4XDYA 3ORFA 3RUAA 1QKIA 3ROMA 4LRTB 4R54A 1A4UA 2AEMA 1RYDA 1YOVA 3D4NA 3Q3CA 4YQZA 4K9DA 3I52A 1U3TA 2CDBA 3M1LA 3NEPX 4N7RA 3RBZA 2CMDA 2Q2QA 4UEKA 1UDAA 4I5DA 4L9RA 4FFOA 1NHWA 1Y8RB 3KM0A 1UP6A 3WGIA 3DAPA 3IKTA 1GL3A 2ZTUA 4IJKA 2Y99A 4E12A 3WR5A 2NU7A 2FHSA 4JQCA 3UH1A 3W8FA 2O7SA 3ETEA 5JDIA 3AFMA 1FDTA 2FPPA 2TMGA 3DFZA 1NYTA 3A1NA 4BO7A 1MX3A 4NIMA 4PG7A 1Y9AA 1E7YA 1JWBB 4E30A 1O95A 2J3JA 5A02A 1FDVA 4FC7A 3GZNB 4E0BA 4IXTA 3GVPA 2RBEA 2GERA 4DLBA 4JCOA 2A4KA 4FFMA 3E9MA 3QWAA 4MVJD 3S2EA 2V6GA 4OQZA 1E1MA 3GGGA 1E7WA 1H2HA 3LC2O 2E6UX 2H63A 4BNFA 1DHTA 2ZTVA 4BNJA 4BNXA 1CWUA 1PR9A 1ARZA 2IZ0A 4O6VA 2OXIA 3F46A 1LDBA 1TT5A 3RU9A 5TT1A 5T67A 2DFDA 3E5RA 4XB2A 1J0XO 4IDAA 5JBIA 4OHUA 2BFOA 3M1AA 2GCGA 4I9UA 1OOEA 1DJQA 1V9LA 4UUMA 1DAPA 2IODA 2NU9A 5KKAA 3DZGA 1GV1A 1N2SA 1U28A 1K6IA 1Y7TA 1HL3A 3ZHYA 1XEAA 2EHDA 4J1NA 5U4QA 4IIVA 4OXYA 1P45A 1NASA 1RYEA 2YUTA 2PZJA 4Z0HO 1KIFA 3AU8A 2VNSA 5L4NA 1G6KA 1LSJA 4R1TA 4CQMB 4XQGA 3JQAA 3QHAA 4NPCA 5CEFA 3F5SA 1XU7A 3IUSA 4TKLA 3RUEA 1E3SA 4DLAA 2NVUA 2J8ZA 3L07A 3RSHA 1NQ5A 4F3YA 3MTJA 5HS4A 2X0JA 3KYCB 4IGEA 4EW6A 1MXHA 5EJ2A 4I5EA 4C4OA 4U0JA 5TSDA 4ALLA 1PTJA 4HNGA 4IZIA 1D3AA 5ER9A 2DBQA 1UAYA 4J7CA 1TLTA 4NBTA 4EZBA 4W9NA 5L7TA 4ZJUA 4JIGA 3ST7A 1B8PA 1IZ0A 1DC4A 4DMLA 4CLHA 2J3HA 1GFSA 3PQDA 3IP3A 1V3UA 5I7VA 4NJMB 3QLJA 2HO5A 4OH1A 3W1VA 3WQRA 3BA1A 1P9LA 4YAIA 3TZ6A 2PLAA 2QZ9A 3T7CA 2EKQA 1P33A 3PJDA 4GVXA 4TKMA 1XQ1A 3JQFA 3E1KA 1GUFA 1JAYA 4R9SA 3NTQA 2V65A 3D5QA 1DXYA 1CDOA 4XKJA 5JPIA 3KEQA 3JQBC 4PG4A 3CINA 1HDYA 3LK7A 3FTNA 1NP3A 4NG5A 1O0SA 1TXGA 2NVBA 1QLJA 1PGQA 1K5HA 3PYLA 3PGJA 4Z9FA 5GY7A 1F06A 1CRWG 5JXWA 1HDCA 2GPTA 1F8FA 4EJ6A 2WD7B 4CQLA 1XCBA 1XGKA 3DR3A 2Z5LA 3PHLA 4E5MA 2WJPA 2LDXA 4EEZA 1A5ZA 3V5NA 4MPDA 3TOZA 5HM8A 2VRCA 4B3JA 2Q2VA 3ANNA 5F1PA 3C85A 4GKBA 4PZCA 1MG5A 2OMEA 3X2EA 3O03A 1GEEA 3O38A 3NKLA 3VC7A 1XU9A 2ZB8A 2QRLA 3DONA 1GV0A 2PH3A 4K6CA 4UUPA 3GY0A 2ZJ1A 4RLHA 3GRKA 5F21A 2IRWA 5H81A 1DIGA 1EFKA 1C0LA 5DP2A 3B6ZA 4GX0A 3WFJA 2CD9A 5A9RA 4WNIA 1SNYA 2FP4A 1K6XA 3HN7A 3H6KA 1VL0A 4Q3CA 1YQXA 3WGZA 2FZEA 2OGUA 2ZJ0A 4YAEA 4BKRA 1M67A 1N1GA 2P5UA 5CDYA 1JTVA 3KEOA 4E32A 1IUKA 4ZN6A 1UH5A 1E0DA 1AE1A 1H9BA 4INAA 1WDLA 3HN2A 4CM4A 4E2WA 4CM3A 4W4TA 1LI4A 2Q99A 3AI3A 5JDCC 3E6AA 2ZATA 1P0CA 1SPXA 4OMUA 4WK6A 1C3VA 1NAHA 2QRJA 4D43A 5TGDA 4AJPA 2ZK7A 3UCFA 4RVHA 1EVIA 1RM5A 5DP1A 1DDOA 1Z7BA 2FSVA 1ZZEA 1IE3A 2IZ1A 3DB2A 3LYLA 4P4GA 2X86A 3RC7A 4YEDA 3HDYA 2G82A 4Z3KA 3JQ9C 3LVFO 1I33A 1YB1A 3K2BA 5HTOA 1MFZA 1ID1A 1NHGA 2AG5A 4RF5A 3RQSA 1NAIA 2Z1NA 1H0KA 5F1OA 2YJZA 1EK5A 2CVOA 4J4TA 4Z3DA 1PL7A 3JQDA 4BKQA 3DAGA 2VHYA 2BFAA 1ZEJA 3DZBA 4L75A 2VYNA 1PWXA 2ZTLA 3IJPA 2Y66A 2C59A 3HFGA 3HFSA 3OJOA 2EP5A 4AL4A 4BKUA 1EBUA 1UDBA 3I9JA 3S2IA 2C2YA 1BTOA 1ZXBA 1P77A 4DL9A 1P1KA 3GNSA 3TRIA 1LC3A 1GPJA 2OOSA 1NFQA 2GLXA 3GGOA 4EGFA 4ROSA 2DQ4A 3CSDA 2WSBA 4TZKA 5JCJD 2Y0EA 4YWJA 5EN4A 4H16A 4BKPA 4CUJA 1C1DA 4W7IA 5JE8A 4C7JA 1BXZA 2JCVA 5BSHA 3WWZA 4WEQA 1PJ4A 1VM6A 2CUKA 2G76A 1Y5RA 3B1KA 4YVFA 1BMDA 3VZSA 1XDWA 3AW9A 3GRPA 1YRLA 5CG2A 5JCXA 4XJSA 4D0RA 4CMJA 1DFHA 1U4SA 2EWMA 3ANLA 2JHGA 5C37A 5ILOA 1L7DA 1N5DA 1F12A 5A9TA 1QMGA 5JAMA 5KOIA 5C5IA 2YQ5A 3GFGA 1F8GA 3VKVA 4DREA 2NU8A 1HT0A 2DPGA 1S6YA 1JAXA 3JQGB 4DIOA 2I3GA 1IY8A 5FYDA 3QJ5A 1B3BA 3PDJA 2C54A 4FN4A 2VHVA 3F9IA 4QO7A 1Y1PA 2NSDA 4WASA 3L0DA 4YAKA 3FRJA 2X58A 1DIBA 4EYEA 4WCFC 5I9LA 1SB8A 1UP7A 2WYWA 4IXWA 1AUPA 2I6TA 1J6UA 4DRYA 3SEFA 4HADA 5FWNA 2IEBA 2X0RA 4Z9YA 4B4UA 2JD1A 1E3WA 3I6QA 3ZHZA 1ZBQA 3PJFA 1SO8A 1EUCA 5CG1A 3GOHA 2WWRA 4XZ3A 4LMRA 4E6PA 4L74A 4DXHA 1JU9A 4YJGB 3DBHB 3DC2A 4QUKA 4QSMA 1I30A 4JBIA 1NVTA 4CM8A 3JQBA 4LN1A 2NQTA 3DBLA 5EPOA 1W0CA 2X23A 5L45A 4RF2A 1Z45A 2VTDA 5L53A 3ZU5A 4WLVA 1HZJA 5IG2A 4WLEA 1AHIA 2VHWA 4HV4A 2BF7A 1ZNQO 1KBZA 1FDWA 4ZHSA 3KV3O 4GLOA 3GNTA 1K3TA 1YXMA 5FEUA 2BGMA 2Q1TA 4I08A 3U4DA 3ITKA 1JLLA 1PQPA 1MC5A 4K26A 5DBGA 4WECA 2BKAA 5BSEA 4I1IA 3W4JA 1HF3A 3DMTC 4BO2A 2PD3A 1NFFA 4AJIA 3WQSB 3LQFA 4ZQBA 3HDHA 2QRKA 3H2SA 4OIMA 4IINA 1MC4A 3PPIA 1ZCJA 4IUYA 3AM5A 5T57A 4XYBA 4AJHA 4BGVA 3OECA 1EVJA 5EINA 3WICA 3IS3A 4JX8A 1Y6JA 1CQIA 4Q3AA 3RBXA 3FWZA 3I9OA 3N7UA 3NYWA 1HZZA 1ZK3A 5I9NA 1HSZA 4W7HA 1PEDA 3GUCA 3ZDFA 1BHSA 2Q1SA 3GVXA 4WNCA 5JY1A 1EEHA 2JCXA 3TNLA 3ONDA 1ONOA 1ULSA 1P1JA 5JDCA 2G0TA 2PA3A 4AFNA 2J6IA 3QVTA 4ZRMA 5BR7A 1M75A 2Y1CA 4WLUA 5U1PA 2X9VA 4DC1A 4QTZA 4FFRA 4Y6SA 4YDRA 2VZ8A 1XA0A 1EMDA 3H3FA 3KSDO 4B3IA 1EFLA 4R68A 3EMKA 1NQTA 4XR4A 4MP6A 3ETDA 3KETA 1LDNA 5AOVA 3JQ9A 3BAZA 1NR7A 1DRWA 2BGKA 3D4OA 4CV1A 1ZK0A 1EVYA 1U3UA 3MJCA 1LA2A 1PR3A 4GX1A 2C7VA 1Q2XA 4YAJA 4FC6A 1KC1A 4GVLA 4ONEA 4GBJA 3F6YA 3WYBA 2HUNA 1EBFA 2IZZA 3DTYA 4JJGA 1IL0A 3NDJA 3RVDA 1J4AA 1R0KA 5DOVA 5K9ZA 1H5QA 3EC7A 3A9WA 4BNZA 4DTIA 1EE9A 1KY5A 2VOEA 3QVSA 5DBFA 1DO8A 1PL6A 1QYVA 4PLPA 1C0PA 2YZ7A 4CMGA 2NWQA 1PJSA 2WE7A 4PLTA 1QRRA 5CEJA 4AJKA 3M6IA 4PLGA 2SCUA 2YDYA 5U9CA 1T4DA 4IDGA 1O5IA 4RQTA 2Y1FA 1A72A 4J7UA 4XGKA 4BKOA 2PZMA 5L51A 1S7CA 4MJLA 1YH3A 3TDKA 1U7TA 5I7EA 3MJSA 3L6DA 4GGOA 4BO5A 2C20A 3C1OA 2P4QA 3AY7A 4JROA 1JA9A 4D7AA 4OYRA 3VZQA 1LSUA 4JLWA 3KLPX 4MOWA 5G0UA 4MVJA 4HFNA 4P8RA 3DQPA 2P91A 2Y0CA 3X2FA 2ZIZA 1I3KA 3G49A 2O7QA 4KP7A 4MKZA 3Q2IA 5JSFA 2EV9A 4N5LA 5KVVA 2ZYGA 4R9RA 5KIAA 3RUDA 1Y8QA 3GUYA 4R51A 3U5TA 1GQYA 3JCZA 4PZEA 2VWPA 4WCFA 4G2NA 2GN6A 2WM3A 3WG9A 1EVZA 3K8ZA 1Y5MA 2O3UA 3GAZA 5FI3A 2POQX 2W2LA 3ON5A 5TRTA 4F6LA 1U5AA 5KJ6A 2DU8A 2X0IA 2XOXA 4PLZA 3V2GA 2A9FA 2DTEA 1GCUA 4PLCA 4ITUA 3AM3A 4MKRA 3EZYA 5IZCC 1WDMA 1EQUA 3D4PA 4RVUA 2NM0A 1PWZA 3PP8A 4GH5A 1G0OA 4OGWA 5J23A 3DO5A 1XR3A 1KVSA 3G1UA 3K9QO 1I2ZA 1JKFA 3HUDA 3PTZA 3PHIA 1FF9A 1AXGA 1KEPA 1N9GB 7MDHA 1WW8A 1RM3A 3WOHA 5IDQA 4DPMA 1VLLA 1ZSNA 2GGSA 5G4KB 1X0VA 4DYDA 1ENZA 3JQAB 3LSYA 4KDFA 4BO3A 3E5MA 1W6UA 3FPCA 2CF6A 3H9QA 5AYVA 3U3XA 1H6CA 3E03A 3LF2A 4I9HA 4W9NC 2EIHA 2NVUB 8LDHA 3IKVA 2EEZA 3DMTA 4L8VA 4OKNA 3PWSA 4Q39A 2DKNA 2UUPA 4HP8A 4CV0A 1IOLA 1Z82A 3CIFA 3DBRA 1JW9B 4BHTA 3VOSA 1NVMB
chains in the Genus database with same CATH superfamily
2W2KA 4R4JA 4JMLA 5B4UA 4ND2A 3PZRA 4KGDA 3UCEA 5JXIA 3DOUA 4GUAA 1B8OA 3OQVA 3C3XA 4MO2A 4M60A 5FO1A 3UK0A 5CB4F 2JFFA 4XQ9A 4NZOA 1E5QA 2MOKA 3JZAA 3KT6A 5J2TA 4BMYA 3I05A 4OO3A 5E9QA 1RRCA 3FA2A 4EPVA 2NTJA 4WRRA 1TVEA 2AL7A 2G07A 3D3WB 1XWFA 2I76A 3EZFA 3GA0A 2NOAA 2NTYC 4S1VA 1FP4A 2MT9A 4WZAE 4A6DA 5HA5A 5IF9A 2HXGA 4XD7A 5J2UA 2N47A 4Y67A 3X1MA 4HDMA 2IJGX 4WCDA 2XNKA 2WVGA 2AV6A 1Y5IA 2HSDA 4MWDA 2PWAA 2XE8A 1LKZA 4P3KA 2VVTA 4NCXA 1T25A 1SFRA 4G65A 3V1UA 1LD3A 2GAJA 3D2CA 4K3VA 3T8YA 1LDMA 5HG0A 1NBIA 4RORA 3ZQ4A 2NSHA 5NULA 3SJAA 3BD6A 1FJ2A 3WRXA 1E5TA 3LDGA 4MDHA 2Z8ZA 4KAAA 4JEMA 1MOQA 4DOMA 1OROA 2J3KA 3IOMA 4ZV4A 2R7KA 3P9ZA 3O8QB 3VMMA 1ISJA 4MK4A 1IEXA 3A32A 4MPTA 3L8GA 4KLRA 3D1JA 5D00A 1Y7PA 1V0JA 1VGRA 2BGNA 4NV1A 4W5WA 1B6GA 4NK4A 4FGUA 3RTCA 5HW0A 2V7WA 2VRNA 3KLMX 2GI4A 3VVBA 4OBBA 2CV0A 2IDZA 1QANA 1NVUQ 1V3TA 1L7EA 3H8VA 1YZKA 1KNQA 1DZ3A 2HDHA 4BLRA 1ZR4A 1NKSA 3HDTA 4JWTA 4A2PA 4QBIA 3JRWA 1WCXA 3A2MA 5AVOA 3D81A 2Y0PA 3CEAA 3DVQX 4JGBA 4C1NA 3WAJA 1UBEA 4N7MA 3M5WA 1Q1QA 3EW7A 4XYLA 3EOZA 4KV9A 2BW0A 1SIBE 4EA6A 1MQSA 4MV6A 4YLEA 2HJWA 4MVJM 3KKKA 5HMMA 3K1TA 2YJ3A 4B4OA 5AJZA 1AF4A 2PIAA 3KOWA 2GZSA 2IXGA 3C3EA 3ZGYA 1AQ6A 3AZPA 1UT5A 4PAGA 5DTEA 5KC8A 3L40A 2D54A 3MPOA 1I1NA 2ZQ5A 5KX5A 2PT9A 2PH7A 3M5CA 1LQUA 4FGSA 1N5MA 3C5HA 5DISB 3GN2A 2P1DA 4LZJA 421PA 1E0JA 1E6MA 3IB6A 1U3FA 2ZBFA 4R9VA 5D3MA 2PRKA 1G21E 3IULA 3K3PA 1X86B 3DYBA 4BNGA 4RVDA 4MX8A 2ZSAA 1I5OA 1P91A 2BHRA 2VR1A 3PR2B 2BKVA 4TGLA 4DC9A 1CNEA 1Z0KA 1P60A 5FUBA 4XEHA 1NF2A 4KI7A 3ZZ1A 2NO0A 3ESQA 4FE3A 4S05A 3D1LA 3OOWA 2ROQA 3RVKA 2AHRA 4C7VA 3HO1A 4HKTA 2ZIVB 3W6ZA 3PIDA 2VAMA 3GCGA 2XSZA 3C8DA 4MITA 3OQMA 1ULHA 5A9SA 2GM9A 1VJ5A 1VMKA 3DUFA 4B85A 1II0A 4OP1A 4UHKA 5DM2A 3I64A 4KR9A 4PBSA 2XCSB 4HDAA 3JATB 5DLYA 1UK9A 2JI8A 3UYLA 1GCAA 1T2DA 3P19A 3ROZA 3V1NA 3WMEA 1RZUA 4ZVPA 1GARA 1NVBA 7ADHA 3SSOA 4MR9A 1BXGA 1HQYE 8ADHA 2FGKA 1QH1A 3C3CA 4RLSA 4R8SA 2GMWA 1G2QA 2QW0X 3LUJA 4JJKA 4R7TA 4QOJA 4JI2B 4RC9A 4Y9DA 2CL0X 4XASA 1KGDA 3QFCA 1RWWA 2NZWA 5E7MA 1PEKE 1ODSA 1R8YA 2YN2A 4GMGA 1AT1A 1Z4IA 1RYZA 3EXFA 1FYFA 4PHGA 3RUCA 1XXHB 4EZIA 3FWHA 3GB9A 4X00A 4DWVA 5LN1A 1Q2UA 3JWIA 2B94A 1ELOA 4R9UC 5I4IA 4RDHA 2R6ZA 3N3AC 4P9NA 3ZQJA 5IWCA 3L1UA 1ZL0A 1EI9A 3W8DA 4V0SA 4OOFA 4PFJA 2ZFUA 3UOAB 4RZSA 2PR2A 3NHKA 1R0BA 1TM1E 4OLFA 1N6KA 2H9IA 4EECA 1HX7A 3KSUA 3SPXA 3GEGA 3KEFA 5DEIA 4PZ0A 3T5AA 1LBTA 1KEUA 2CK3A 1QX3A 2PQMA 3NBMA 2LW7A 4O8ZA 4UTZA 2C5HA 4XSVA 1SKYB 2P69A 2J9RA 1P75A 3Q9LA 1HE4A 2QI9C 1WV1A 3AHHA 1KSFX 2GD1O 3KTAB 3FNHA 4RYLA 3WGLA 1U0HC 1W5FA 2JRLA 4K9RA 3FUCA 5KU7A 1GO2A 3HS3A 4EJMA 1DWQA 2Q9BA 1NMQA 2P4HX 1V3QE 1ECFA 1UFVA 4NQRA 1C30B 2BBTA 1W0JA 2VNAA 5KYUA 1UL1X 4OI0A 3EIHA 1U0SY 3ED1A 4BQFA 1TM7E 3A4YA 1NRWA 2X9GA 3NRJA 2NZXA 2ONZA 3D3JA 5DTQA 2YY7A 4IPTA 1SVWA 3AJDA 1X9IA 2P90A 4D45A 2MR5A 1FA9A 5BN1A 3QWBA 1XTRA 5DHSA 3AGQA 3E05A 1DELA 3KSMA 4AWXA 4NU5A 4HC4A 5KNDA 1NVWQ 1A7KA 3J81A 1AHPA 2CEKA 3IO3A 2QD5A 5TNXA 3HMQA 4CKBB 2O54A 1Z07A 4MVJG 4HH1A 5J59A 1AC5A 2QUKA 1JFLA 2WFMA 1IAVA 1PVVA 2EX0A 3L2OB 3OMWA 4P4TA 4AZVA 3A0RB 4YJKA 3Q7EA 1FE8A 4L0QA 4EO9A 3IUMA 1CXZA 3NYRA 2V6IA 3P5BA 3WSTA 4HWPA 1Q1AA 2Q3HA 3I8SA 3TI7A 1Q57A 3CLUD 4JXZA 3R0XA 3RVPA 2PS1A 3FYUB 4J9UE 4FGZA 2X1VA 2C1ZA 4F11A 4ZDIA 3F3YA 2Y1KA 3DFUA 3IAFA 3AM4A 4H3KB 4CFZA 2WJHA 2B21A 2XCRB 4KE6A 1BC5A 1BWRA 1XMVA 2AF4C 3CRZA 3ZWOA 4TMFA 1MZVA 5FEMA 3FTDA 1P1RA 3LBIA 1N3BA 5EMKA 4YHBA 5LZ5A 2D7DA 3Q41A 4JEUA 2PXAA 3DZDA 1GA6A 4MRMA 4HS4A 2R8XA 4HQ6A 2V7EA 5JS8A 1Z4JA 4EG8A 1A50B 1O6GA 3RARA 1FEZA 1Q0TA 3UWDA 3IDAA 3UAZA 2GCEA 2PGLA 2WU3A 3HYNA 4KRXA 4LW8A 2FWMX 4MVYA 3T1NA 2EU8A 3N0TA 1R4MB 4LVUA 1FVFA 3LGSA 3VU1A 4L9WA 1GZVA 1RS0A 3Q5GA 4JJAA 2P9TA 4ER5A 4QWWA 2G83A 1AY0A 1UBRS 4YACA 4WPGA 1MA0A 5D51S 3BEDA 5H83A 1T29A 3Q5DA 1BGWA 1E3QA 2L19A 2BR3A 1H05A 3JQCA 5CDUA 3M4XA 1SZJG 3Q0EA 1K68A 3CNHA 2EFJA 3BVPA 1N2CE 4L9SA 4F3RA 4NE2A 1FYVA 3OUZA 4X63A 5BUZA 2B5WA 1U9CA 3B82A 5K0ZA 4TQAA 5TEVA 2JIDA 2WWVD 1H9CA 5E95A 4PHFA 2R00C 1V43A 1UZLA 3OSUA 2DAPA 2BMFA 2YJGA 4QDJA 1BMFD 5ECDA 1UWLA 4JHXA 1I4OA 1NUHA 4WOPA 1QIHA 4YAFA 4A0QA 4HZIA 1BVRA 5B12A 3Q5EA 4V1CI 5BR1A 3PRJA 1GCOA 4TWRA 3EXEB 1Q83A 3WB0A 3ZE9A 2B8TA 3N53A 1KI3A 4IJMA 4CKEB 2GAIA 4MAAA 1FYWA 5FPPA 4AX4A 2NU6A 2ZP1A 2F3TA 3ACBA 5HMLA 2A58A 3WL8A 2RBGA 3TQRA 1MT0A 3EWSA 3N7TA 3MJTA 4D97A 1CQIB 3PG5A 1X1QA 2ZBDA 4DJ5X 2XOEA 4JOSA 5EEHA 1NGSA 3VO9A 3B1FA 2ZQYA 1FSSA 4BQSA 1BXKA 1LDGA 3MMPA 4FFDA 4BY9E 4EGCB 3AESA 4C21A 3E15A 1V6SA 1GTMA 3STVA 4CL8A 1V47A 3SE0A 2O2DA 4LHEA 4NWIA 1R15A 1HGXA 1VXOA 2DTDA 2OQRA 2QRQA 1FYDA 2VS1A 3GK3A 3U80A 3UEOA 3A6GA 6NULA 2QYTA 5TDHA 2WPNA 4II7A 5DNUA 3DE7X 1YV9A 2PSHA 3K92A 3BXXA 1NOIA 3THRA 2ZM5A 3PPYA 3LP6A 3EGOA 2ZIGA 5DHUA 4ED9A 2IQ5A 3EHEA 4ZCLA 1U2GA 2VP2A 1NQAO 1OI4A 4IJQA 3SNKA 3F78A 4B48A 5IC5A 1SU4A 4PLVA 3PRKE 1E63A 3NUGA 4KQXA 1JR3E 1MO5A 4J2HA 2Q6OA 3E0XA 4CIVA 4DLTA 1KQFA 3MF4A 2G4LA 4H08A 3LLVA 2YXDA 3R0IA 5DDIP 1T5BA 2RHOA 3NQ41 5DX8A 5KWVA 5LMUB 1TYEB 3GJ6A 2F2TA 4QU8A 4DN6A 3CFYA 4RMGA 3DEFA 3ONEA 4FHCA 3VPXA 1H69A 4WEOA 1FP7A 4DA9A 5KNBH 5ABPA 3NBKA 1PT8A 3SS9X 3ZW7A 5BYKA 2Q62A 2WM2A 2HREA 3O31A 5D85A 2D06A 2IVFA 4J1TA 5E6RA 3U1TA 4ZAVA 3NNNA 3TRJA 5L3VA 3V7YA 1FQOA 2OO7A 4GPZA 4TVOA 2YVLA 5E8JA 2YBDA 5DYGA 5K0CA 1VBMA 4NAHA 1P0QA 4JC0A 5B3JA 2YMMA 1VSBA 1L5HA 4ALNA 5IDYA 3L0YA 1OC4A 4GWKA 2JGKA 2WIDA 3L4BC 4H9GA 3LSTA 4BMXA 5BWBA 4A8PA 2UYHA 1UWCA 1Q0LA 3PI6A 4TXNA 2PS0A 3AI2A 4R5MA 4U7GA 4HHEA 1YHZA 4GMKA 4KLAA 1G7CA 1ZWKA 5FLKA 1GSAA 1HFKA 3ELDA 3FSJX 4M36A 5EY5B 1C1XB 2B69A 3N1UA 4RABA 2X4LA 3VZRA 3VDQA 3R9XA 2BMAA 5JMPA 3UJBA 2FCAA 2OD9A 1SD1A 3KPVA 3SD7A 3DHWC 2Z9BA 3ICOA 4EY4A 2FFHA 2WIKA 2UYGA 5JXGA 2AJCA 2SCUB 4WLOA 3LQRA 1T9ZA 4IHJB 1B16A 4CM6A 2PHZA 1X7GA 5CNJA 1YVRA 5JZSA 1WR8A 3N6VA 4LPKA 3S2YA 2VYQA 3I2YX 5JZ9A 4JKIA 4B47A 5BNTA 1AG9A 2XECA 1E5XA 4F1WA 4Y0NA 1NNUA 2YIVX 4U2KA 2ZQZA 3KYCA 5IM4F 1U8XX 3AJAA 3EX7C 1X7YB 4ZC1A 2H5EA 5ELMA 4GWGA 2QIPA 1SBNE 2HU2A 4E5KA 1EQ2A 2YQZA 1UBFA 3KU4A 5C52B 3H0CA 3FIJA 4O08A 4OPMA 4AZ3A 3H4IA 5MGNA 3DL7A 3GDHA 2C2XA 3UBTA 1FRNA 5KHAA 3UJAA 4FWIB 3GP5A 2I5PO 1ZMRA 2X6QA 4H0NA 4P33A 2GWHA 4L4XA 1D0SA 3QBTA 3AUYA 4EA9A 2I78A 3ZCRA 4DR6B 3IT1A 2W11A 4ZQHA 1KI4A 1GRVA 3KQOA 3QELA 1UWKA 2J46A 3BTVA 1BHO1 4S2UA 5DSTA 3C8HA 1H4TA 1WF3A 1W29A 2V7BA 4Y6QA 3RAJA 4MKHA 1PL8A 1AUVA 2D3TA 3ZNPA 4OXRA 3RC3A 1DKOA 3HBAA 4RACA 1Q95A 5KMGB 5KTRA 1A9YA 1VSUA 3QXCA 5JSKA 3ROPA 1A1SA 5FI0B 4RPKA 5LB4A 2EHJA 4ETIA 3SWWA 3QJYA 1J09A 4RYDA 2QRNA 5AK5A 5DGCA 1RXCA 1QYWA 1YR6A 4H35A 2JEYA 3P32A 3C0KA 3SICE 3WHLA 2HF2A 4HNSA 2H7CA 4D9FA 2IHNA 4ROTA 2NTNA 3ORRA 1SEVA 4PYOA 3THOA 1P29A 1ZD3A 1P2FA 1R6DA 5K6AC 4HLUC 3I6YA 1J06A 5DULA 3V4PB 3LPLA 2K2WA 2I6GA 4KHZA 2HBZA 4IJVA 4ZVTA 2OORA 4HFMA 4NR0A 1C9NA 4JI6B 3S3TA 1Q0SA 4D3FA 5CT9A 2F17A 1ZUD1 3A1SA 1ADFA 1TO6A 1TU4A 4O2AF 7YASA 1RYFA 1ZIDA 5EESA 3WIVA 1U31A 1X13A 1QO9A 4Q7EA 4LJ8A 1AKNA 5DYNA 1TGVA 3B20A 4IH4A 4AMVA 4BP9A 2NUAA 1NJGA 1TTHA 1ESZA 3D9QX 3O83A 3IR5A 4GI7A 4GXTA 1QS0A 4M0FA 4Y1FA 5EIHA 1R16A 3AF6A 2Z3ZA 5IH7A 4B6SA 1L8OA 2Q4BA 3LL4A 3WK7A 3VGJA 3CIOA 3FBGA 1V4NA 4L8FA 5IRCD 1DDIA 1ZMXA 4B09A 1G1AA 3AUXA 4TYPA 1UBTS 3LM8A 5TF4A 2XJ9A 3FPEA 4HAXA 3BKWA 4L5IA 1WDKA 3VNQA 4JSTA 4LRQA 2X77A 1CUXA 1XZFA 2ZVPX 2CLHB 4M0EA 2QRPA 3EMDA 3Q3VA 4KWIA 1LY1A 3BC1A 4KI0A 2LPMA 4TT8A 4DLYA 3O21A 3PNBA 3LCUA 3QLVA 4ZCTA 2JFHA 1DI0A 1E77A 1UDRA 3RS2A 3W79A 4V3CA 4H1UA 1JZSA 2W2KB 3JD3A 5FLYA 3ZE6A 2FN4A 2WT4A 4XPIA 2BH2A 2PGDA 3DO6A 4L5JA 4NNPA 1DC3A 4JLUA 3R40A 2X6TA 3B9RA 4I36A 4LRYA 3PDWA 1CUAA 4NBWA 2AE1A 1XNJA 3BE5A 5THQA 5HIAA 1R50A 2NADA 4BHTA 1L4KA 3EN0A 5J2TB 3TNDA 2ST1A 4OUKX 1ZX1A 3HRHA 1ECGA 1L4BA 4W7SA 3EQ9A 3UO8B 4YUZA 2QJTA 1K2VN 2CXHA 2ZRKA 3NT4A 4PYLA 2WIJA 5DBOA 1QRSA 3HG7A 1FP4B 3K0EA 3DTTA 9MHTA 2B7LA 4UXIA 2JDIA 1PJRA 3SQNA 3BXPA 4D26A 4TV8A 2JJMA 4PHTA 3IVAA 4QU5A 5M34A 1HTBA 5EJIA 5KDOA 1A9OA 1E1RA 1ZGZA 2ZJ6A 4G67A 1SRRA 2QLBA 2GYYA 4TLAA 4UTOA 4V24A 5EQFA 3FN4A 5T6MA 3VC1A 3ZN2A 4YPOA 3UY4A 1PZEA 2Z6VA 4AY5A 1K2WA 3NOXA 2Q7XA 4R7ZA 3AC0A 1M0EA 1AKYA 1U7DA 3PXAA 2AQHA 2HLPA 3JYHA 4P0QB 4L85A 1PK9A 3K9CA 2XPCA 4BMZA 5ALWA 3K0AB 3OZAA 3W77A 2UAGA 1KPHA 4RPJA 3CN7A 3U6KA 4KWCA 4EA8A 3RC2A 4Y7DA 3MFQA 3TBHA 4RPCA 3U16A 3I42A 2N1BA 2NXNA 2OPBA 1NRIA 4IICA 2HMWA 3U3OA 4GMXA 4UEJA 4CIWA 5A4KA 2I1WA 4F46A 4GDMA 5A4FS 3WXBA 5AW3A 5KYYA 4RA6A 3KBBA 5CURA 5HEKA 2J0SA 3F4KA 1K9SA 2ISSD 2OQ2A 2YVAA 1IIRA 5SY4A 3EG5A 4QVGA 3AKYA 5BORA 2ZRGA 4JP5A 4DJFC 4Q1FA 5FI5A 3H9BA 4RKWA 3IDSA 3IEKA 4JVNA 5HQTA 4LF6B 2ADOA 2ZLBA 3ECCA 3ENKA 1RWQA 3GFPA 1TEVA 3IR7A 4BNTA 5BN3A 1ISGA 2WD9A 2RHDA 4NAUA 1SUDA 3FOBA 4HWRA 1GAEO 4DAOA 4A8TA 3O92A 1YRQA 4QGBA 3Q8WA 3P0JA 5I3CA 4RVNA 2ZXEA 3INYA 5C81A 1CZRA 2WAYA 4G0OA 1MQ9A 3U4GA 3PFBA 1T91A 2REXB 2YHSA 1DJPA 2ZRCA 5AVVA 4QGAA 3LMKA 4NCAA 2Q7DA 2Q5IA 1XK6A 3ONWA 2H16A 4HGQA 4AUKA 4DSTA 4U7DA 5B55A 4KO3S 4EATA 3PHHA 1U2EA 2WT8A 2ILTA 4WFJA 3RSZA 3VPDA 5GTDA 4DHWA 3NAZA 4LJ7A 3HXTA 3HVKA 4HSEA 1DTSA 4YR7A 2SECE 3A9VA 2I6XA 1CJUC 5JNSA 2QOEA 1NVKA 2Q6LA 4GSYA 2CBXA 1ISPA 3BHJA 3OPXA 3TK1A 1MX5A 5A0TA 4K1XA 5A9SB 1UFOA 4LVOA 4B3HA 2P4SA 4IKPA 5G53C 5CYOA 1XVAA 5CFOA 3STUA 2MSDB 3GQBA 1HFJA 2XI4A 3RU3A 1DIOB 2CXUA 5FOUA 4YB8A 4ZU1X 3UJHA 2OBYA 3UT5A 4EPTA 2DKOA 1BXGB 3OCXA 1AKMA 1D2AA 1UQRA 1Z2EA 2FMTA 1IM8A 1MNQA 1CRQA 5K0JA 1CLUA 3BB4A 3SQOA 721PA 1HE5A 1SRQA 3K09C 1E3LA 1JYEA 4I55B 4RXUA 3X1JA 3IEVA 4PO8A 2YMLA 4K05A 3KSRA 4JLMA 4P86A 1W87A 3IFSA 2FMKA 1VPDA 2WOOA 1ODJA 3EXFB 3OETA 1CQJA 3OZWA 3QE3A 2CL7X 3DBHA 1W1UA 4IIYA 5EQDA 2I1QA 1OUMA 5EGSA 2GJ9A 3PFGA 3TUZC 1ZD8A 2XJ4A 1EEXB 1U9IA 4FLMA 4LYYA 4N40A 4EHDA 2WUEA 4MW0A 3THYB 1ZOLA 1QGDA 1JFVA 1GZSA 3C3BA 3EF3A 1CB0A 3UT6A 1WF6A 3AQ4A 4I55F 1RMQA 1H3EA 1SWWA 5K2OA 2JGEA 3KB1A 4MW6A 3OEHD 4X7PA 1A9ZA 1CJMA 4RE5A 1VJRA 3RFFA 2RGBA 2IDJA 4Q21A 3FWKA 1I94B 1R6TA 1J8QA 4KO4S 2Y1EA 5CLHA 5AHXA 1APBA 4TM7A 1OIWA 3AUUA 1HDOA 2OE2A 3OF5A 4LRUA 4TZ0A 3H11A 2F67A 1SU8A 1M72A 3VDMA 3IEUA 1QGUA 4TSRA 3ZCSA 4F4DA 2Q5EA 3IP5A 2QMUA 2WTXA 4M0UA 3D4BA 4DWOA 2AX4A 2L42A 1PUXA 1QUEA 5KAPA 3WO0A 2IS4A 2IFTA 5KYUB 4LS3A 5BVGA 3DYVA 2C3MA 3A6FA 1I3CA 3HEAA 1YQEA 1ZN9A 4N0QA 4RIIA 3KLOA 2Q3EA 1OSNA 4OXKA 5K3FA 4MEJA 5F77A 1M10A 5H16A 2H4FA 3AT1A 1JDBC 4AN0A 2ZRAA 4WFIA 1DBSA 3HUEA 4CNBA 5MF6A 2C2HA 3FWPA 1XVUA 4YMGA 3MLEA 4I4CA 1J2EA 1IATA 3ZI0A 3IEPA 1NVEA 3TQQA 1RHUA 4AG3A 1A8SA 2ICAA 4RAOA 2XKJE 3TW0A 2E9SA 4RTLA 1JAHA 1RLIA 2ZRBA 3G2HA 4PRKA 3NJ4A 3IBCA 3ETJA 1WVIA 3P9QA 3O2QB 3ZHBA 1E6WA 2FW0A 3MTAA 2M1ZA 1KYZA 4XDGA 2HRDA 3MCZA 1D7AA 1SGWA 2WAOA 3HWSA 4E7OA 5K3EA 1BFDA 4QGFA 1K7FB 4B71A 3P5SA 4QA9A 4Q05A 3FUXA 4OP3A 5AW0A 3EGVA 1RYHA 3EDOA 1MV8A 4UAGA 1YF3A 2IK8A 1Q22A 2O9JA 4MWTA 4AS2A 1QH0A 1Y3IA 2FX5A 4NZMA 4OA5A 3OM0A 1HWYA 1G5FA 4PG8A 4FDAA 3HJBA 4L16A 4C4AA 1R1DA 2WYUA 3VSEA 1TC2A 1RJDA 4ZVSA 4I3HA 5A6VA 5L40A 4ESEA 3UOGA 3MHPA 4OHBA 3NBZC 2RMKA 3H8JA 3MTBA 4E03A 3EEQA 4Z9BA 2LCIA 3RAFC 2WAXA 4J94A 2GWRA 4OMFG 3MJHA 3P9YA 5FBQB 3ZW8A 1NPYA 4IXNA 3KKQA 4K46A 1N2EA 2Y2UA 1P31A 1Z7EA 2R4UA 4BP1A 5KJCA 3CN9A 3TGPA 1WBDA 2QTAA 1A9TA 2BJHA 2XOKD 4IR7A 5F3WB 3TO5A 3AOEA 2FEAA 3CISA 4JJ4A 2PBRA 3CR7A 3UTCA 1JI0A 1XV5A 2VK8A 4RVCA 1S2GA 4XUGB 3STXA 1YDGA 3WJAA 2Y1OA 2E82A 3SMQA 5F3DA 2ZVDA 4BVAA 1IJKA 3MM4A 4KZKA 2FPUA 5TT0A 2J3DA 4MP8A 3RODA 5H82A 2NMVA 3O3NB 1AV7A 1UKCA 3HYRA 1Q14A 4MHSA 1LLCA 1BMQA 4MUYA 2V6MA 4M0PA 3D0KA 2GEDA 6CHYA 3UJ9A 1TVKB 5JNLA 2O23A 1WU7A 2PX8A 1BCSA 2PH5A 4ZHQF 5ICMA 2ZWPA 5EIFA 2E4AA 5EXDA 3DZIA 2I34A 3FPKA 1A9XA 1QO7A 4P4NA 2HJHA 3VTZA 4CM4B 4L5CA 1BVYF 2OK8A 4G0NA 2PG3A 1NMEA 2NU6B 3LPDA 4FEYA 2AYYA 5IK2A 1R7RA 1SQ6A 4GZ6A 3I2KA 4MAMA 3DH0A 4FT4A 2HSJA 3I2HA 3LF1A 2W48A 1K7XB 2Y1GA 1A8PA 3C41J 1VSVA 4C0SA 3R6GA 4UXHA 1FQKA 2CZGA 4RGVA 3KHKA 1BEUB 4TPKA 2VPIA 2J5KA 4KSBA 1J39A 3TBKA 3DVRX 4S1PA 2H2DA 2Y27A 3FMVA 2MYTA 4O1IA 2CEAA 1K08A 2DLDA 4CLOB 5K7SA 2H9AA 3U62A 1A69A 3NPMA 3K53A 3U81A 5HRUA 2A5DA 3IIMA 4F4UA 3Q8XB 1EUDA 2DWQA 3ACCA 4UQLA 2F4NA 4ZAGA 2LR0A 2HRZA 2ZR8A 4RZHA 2QWXA 4DARA 1P17A 3T7RA 4P3NA 3FCXA 2DT5A 4BB9A 5DGXA 5G1NA 5EJFA 1LK7A 3EH2A 3MG9A 2W5UA 3ZZMA 1P4HA 2FWBA 2LKCA 2OZLB 2QMOA 4RM2A 3SIRA 3NETA 3UB3A 5BW5A 5LDDC 3Q88A 3ZH9B 4LVCA 3B52X 1DQYA 3L8HA 3IMGA 4EJ2A 1GN9A 4WD3A 3E2IA 5J58A 1OLUB 2DERA 2ZUBA 3AP2A 2B0JA 2YXNA 4PX3A 2EFCB 4D3SA 5EEGA 3T5TA 2YXLA 1FTSA 2XCLA 2ZITA 3G85A 4R0MA 3C5CA 5FA6A 3C7TA 4O2BF 3VR1A 2WM8A 3AVOA 4B40A 4P83A 1XU4A 2V9ZA 3JWEA 1G8SA 5HF5A 3SZGA 3ZGZA 4YH1A 3INNA 2V7TA 4LBZA 1XNHA 1V39A 4R41A 2X3YA 3VHXB 2N46A 5LDHA 3COSA 1J0AA 4ZTZB 3DVAB 4JI1B 3B6KA 1YB4A 5CA1A 1VGQA 2ZUFA 4EI2A 4D5EA 1TCUA 4CMAA 5FO0A 2OZVA 1CUGA 1UJ6A 2VUTA 2HSWA 1U65A 2I1LA 2J5RA 2X7HA 3FMFA 2FQYA 3KQSA 4HNAA 3A8TA 4JXJA 4GPTA 5DVZA 4DAEA 4CT5A 5FWXA 5C8XA 2V1XA 3A4VA 3P2YA 3HCDA 3L02A 1LVGA 5DCWA 4B6PA 1G3QA 2VUIB 3EVBA 3AVUA 3O1JC 3UMVA 4FYYA 4KHPB 4I0WB 3MT9A 2Q45A 3CZAA 3DMGA 3W1EA 1X0XA 5BSRA 1QZZA 3AR9A 1WWKA 1JN0A 1HFWA 1V1RA 2IE0A 2WABA 1H1LB 1EESA 2PV7A 4HAUA 5DIFA 3K20A 3AFHA 2M1XA 3WFZA 1EQAA 5CTJA 1N3YA 1IY0A 4HRYA 3W5SA 1O6CA 2GCOB 4YT2A 4KNWA 4UNPA 3ID6C 4L2IA 3W7BA 3HBLA 5LQSA 2OMKA 1ZK1A 4YA6A 4JLDA 1E3MA 1G3MA 3ICWA 1IUNA 2H1VA 1U0RA 2AZDA 4Y2XA 5JYDA 3DT6A 4LMPA 1OXUA 2J3IA 4AJJA 4N3NA 4FJ1A 5C8ZA 3ZQKA 2HDWA 2CNOA 1KI6B 3T5PA 1I2AA 4FFPA 5EJEA 1OAOA 2H1WA 1SK9A 2DBRA 2CJWA 5KNBA 3QELB 1JV2B 1U0GA 4FB5A 3GUZA 2PX4A 4OHYA 2WYOA 4FSXA 16PKA 1E64A 4LHZA 2YKGA 2R0QC 5ALIA 5FFFA 3SFVA 1VDZA 5ITSA 4LBVA 1QCYA 1YTLA 1GQ2A 3HWRA 1FTYA 1CIVA 3OFVA 4M0KA 4U8HA 4L76A 4DM3A 4OMDA 1C0KA 1GG5A 3K35A 2Q3DA 4Y9SA 1YDEA 5IYZA 3HBMA 3K9WA 5JVDA 1KTVA 3PPWA 2GZDA 2AFIA 4F3NA 1AOXA 1QRAA 1QQ5A 3LU1A 4FXPA 1SIUA 1EFUA 3CRNA 1CQWA 4J0DA 3PUHA 1JALA 3F9CA 3NV9A 4YRZA 5A3JA 3O0TA 2OKGA 3GA5A 3SAJA 4HDRA 4BL5A 3LUBA 3A4IA 2VJNA 3AB3A 1ULZA 2W6PA 3EJWA 3LHSA 3TH5A 4D3ZA 1N2JA 4JELA 4Z4IA 1OZHA 4ZZ3A 3HUTA 1T2FA 2JBHA 4WUTA 1AD2A 4MV0A 3CMMA 3Q2KA 5ALTA 4AP5A 5JAUA 1GSIA 3SM9A 4IIFA 4CE6A 1YI1A 4LK3A 2G88A 3I23A 5PNTA 4DWWA 3L1JA 1L4HA 1QVZA 2RAPA 4S0XA 3ZHXA 4O25A 1IJFA 1D0IA 1RRVA 1UKBA 2G28A 4J0EA 4JT4A 4EGJA 2PKCA 1TO2E 3BIJA 1QS0B 5EKXA 4LBWA 5L3RA 4X1YA 3R8CA 4AKGA 4PYQA 1AVTA 3SBOA 3BL8A 2HJRA 1Z5GA 1POXA 1WIWA 2V3CC 2BEVA 3ELYA 3HXLA 4H7PA 1KSGA 2W2TA 3ZWNA 3CZ5A 2HJSA 3ZU4A 3Q8MA 2KWIA 4TL9A 1K8RA 2YMPA 3ZDRA 4CM9A 5BSFA 2PD4A 2X8LA 2QQEA 2UVQA 5EE3A 3ZCUA 5D6NA 4KXNA 4ZO7A 3RS9A 1QAOA 2W2MA 4TRMA 4AJLA 4CHTA 3ER8A 2X42A 1T5DX 5I3ZA 2HUPA 4NL4H 2JI7A 4TYNA 2R6AA 3KQMA 5GADl 2KLHA 3LBFA 3ROFA 2C5AA 3U48A 4LOJA 1PV4A 2ECPA 2FAXA 4FE4A 3W5HA 4YQEA 3OX4A 4CF5A 2G09A 4HAOA 4XPIB 3T5GA 1FFWA 4FZRA 1IN7A 1P7YA 3A06A 1ADJA 2SNIE 1ZK4A 1EJ2A 2IYVA 3MOIA 3L6EA 3MSXA 3EARA 3OWHA 3QNMA 4LE0A 3FBTA 1BOOA 2AN9A 2VSFA 3MBIA 4FVTA 4QG7A 4UBOA 1J9EA 4W6QA 1Y8ZA 4E2YA 2Z6UA 1EHIA 2ECOA 1JEDA 3IKLA 3TVTA 2FG5A 4E2FA 3GLHA 2P3LA 1GQSA 5JNVA 3PXDA 5JSQA 2QUIA 3QWIA 3SDSA 1QM5A 4INPA 1RQNA 4Y2SA 5AK4A 2FUG1 4GE3A 3BRWD 5TS3A 1IXZA 5EMNA 3RYIA 3SLKA 4CBVA 4LG1A 3FAZA 3L9WA 1PDOA 1T2VA 2WK1A 2Y93A 3PT9A 4RGBA 4TV8B 1B6RA 1QLHA 1SU7A 4QQNA 1TQHA 4BP8A 2FOXA 5JHGB 1GZ3A 3AH8A 4NYMQ 2R4TA 4TTSA 4I81A 5LYYA 1KPGA 1IEQA 1V6AA 2UVPA 3MK31 4DPLA 4DIEA 1QP0A 3FSRA 3ZDYB 3CVVA 4IWYA 2O2IA 3GD7A 3TM5A 3LGXA 3UF0A 1VE5A 3FTEA 3AX6A 4GPAA 3JQEA 1ND6A 1KH2A 4IDHA 2WKPA 3MMSA 2D2EA 3CO0S 1M1XB 3T3MB 2D2VA 5LCXA 2P8SA 1R8XA 2V7VA 3ABZA 3OLZA 4H1VA 4QREA 1KAMA 1X80B 5EP3A 5I01A 5MN6A 1DUSA 3PICA 1IVYA 2W42A 2IUSA 3KPUA 2FR0A 4CWAA 2PUDA 2GN4A 3FHOA 2X40A 3NC4A 4K1LA 1U2ZA 1YAHA 2JFZA 5AW6A 3OF3A 4A8JC 2FR8A 2R7NA 4DPKA 5KYYB 2QZ4A 2HIHA 3GJ3A 2Z3WA 3NGXA 5D3KA 1SUAA 2BDTA 4CQMA 4YCBA 3DQQA 4ZTUB 2MMGA 2RHWA 2V7PA 2Y9MB 3WIBA 2PZEA 2B82A 4IG9A 1BQ3A 1T5IA 4BQPA 5DNCA 3AUTA 1KU6A 3ICVA 5ESWA 4C7XA 4FCWA 2RBKA 3SF8A 2GR9A 4QTYA 1JT9A 3HN6A 5AOCA 4GLBA 1AUQA 4IQFA 2IHVA 5HIIA 3QHQA 1UANA 3O7MA 4ND8A 2O1EA 5BN4A 1X6VA 5AW7A 3LK6A 2JI9A 3HBFA 4OHZA 3GLTA 1KAEA 1YNSA 2EZUA 1H8HD 3OOHA 4Q34A 1KEWA 5DM1A 3HYSA 3JYNA 3RBVA 3J7AC 4IKEA 2QSUA 3WYCA 2C2BA 4CTOA 2BSQA 4BXOB 1G5PA 2ORIA 1PT7A 2AFRA 2XV1A 2D59A 3ZGNA 5EJ7A 3E1GA 5ADUS 3GC6A 4PM4A 3QEBZ 2Q0HA 3ZE2B 3PHGA 2YIJA 3D3QA 3JZFA 4N0PA 2OLJA 1BIFA 1N6LA 1WUYA 2RAFA 1P8JA 4LJAA 1M2OB 1TGYA 1GKUB 3HM9A 2WOJA 3VJRA 3X43A 3OQ6A 4K7JA 4JJ8A 2QPLA 1YCGA 3S5JA 3PEFA 1YZLA 4F5DA 3RANA 4BO4A 4Z6KA 1SN7A 2QL9A 1HLGA 1V4BA 3E35A 3K0KA 2X3UA 1TQ8A 2ZRLA 3O95A 1JXAA 3S99A 1L4FA 2RGYA 3GQBB 3E18A 3OTGA 3QW4B 3LPCA 3UG7A 1CFJA 4US2R 1IN1A 1USIA 3VPCA 2JNWA 5DN9A 1LI7A 4IIBA 1V71A 3WYAA 4TRJA 3RADC 1ZI6A 1Y9DA 1U9IC 4FUQA 5MN4A 4ESHA 1USVA 3TOXA 1GU0A 4LOLA 4CKWB 3SZ3A 3FYSA 1VJGA 3KAKA 3TZQA 1XFDA 3PEEA 3LL7A 1XZGA 4F71A 2IELA 2INGX 2ASEA 1V8BA 2MIIA 1XXHE 2COUA 1K06A 3EC2A 1Q17A 2WD7A 3W3ZB 3FCEA 4YMTA 1Q3KA 2VZ9A 4AO7A 2JIZD 1U7HA 2DTXA 1WKCA 3CMCO 4BO0A 2KW5A 4IZHA 1TMOA 4OHFA 3TLGB 3PWZA 1I1QB 4GQAA 1QQTA 3OEWA 1PS9A 1T1EA 1V35A 3FF4A 3T4PA 4BATA 1M6EX 4CCAA 3ZVNA 2ID8A 1OI3A 1Q7BA 3M89A 3LT0A 3CCCA 3ZHTA 1BQ4A 1OIXA 3T0IA 2R6JA 1Q15A 1SKYE 2VRWA 3PNKA 1DAOA 1J8VA 1G19A 2IOHA 1KEEB 3A4LA 3RRBA 4R6WA 3DZFA 4M53A 5EYPB 4BBAA 1TLFA 3D6NB 2OCBA 1RZ3A 2EQ5A 2AG1A 4E5UA 1FSFA 2PTHA 2QJRA 1C4KA 1TZMA 1IY9A 1MDBA 2OHIA 5CNKA 5UKDA 3VVCA 2O2YA 2QN6A 3UICA 5JWRA 3PC4A 4MI3A 3AY6A 4XWTA 4F6CA 4W5QA 3B1YA 1CUHA 2OCXA 4Y3UA 3NAQA 5DHTA 1G8PA 2AJBA 4O29A 1VZ2A 3SEQA 4PZDA 4FW9A 3GROA 2O2SA 5SY6A 3KJFA 3EFOA 5K3FB 4DILA 2L17A 3MWDA 4KMSA 3TL2A 1OH5A 2FI1A 2FSSA 2HYDA 4G84A 4ML3A 4WW0A 3B6EA 3MRTA 4FSDA 5H9WA 3WS7A 5JQGF 3Q7SA 3WSWA 1FFXA 5E2AA 4BRSA 3UTDA 3VVMA 4TT3A 4BJ1A 4DXAA 4C6RA 5C1DA 4WGGA 2VRBA 4QBHA 1DEHA 2BFFA 2CMHA 3B7GA 3DM9B 1Q84A 1Z6YA 4CODB 2GF2A 1ZGJA 3OIVA 1N33B 2QSYA 2RB5A 1UJ2A 1ZEMA 3CKLA 3PDCA 2FDCA 3IUNA 3WQQA 2XNDD 3K5PA 3BWVA 3B9QA 2UZ0A 2P0EA 4GI2A 3GVHA 4IV0A 5JSZA 1W30A 3PQ4A 3L79A 3K5IA 3TSZA 4OSPA 5LL6P 5E1DA 4R1QA 3KUCA 4JBNA 3HM2A 2BSAA 3KWJA 1UBCA 2PGJA 3OCCA 4HQKA 4V1CB 5G41A 4NAVA 4CL0A 5ITZB 3D8RA 1M0WA 4EOGA 2ZS7A 4MQEA 3GIDA 3W2GA 1RJWA 1CY8A 2PUHA 1GHTA 2VYND 4QOFA 4P38A 3I1YA 1MV5A 3UJ6A 1EP2B 3SLRA 1BWSA 1HNXB 1NT2A 4KXXA 2HWUA 2BOVA 3U31A 5JG7A 2BFBA 3I0NA 4XCXA 6YASA 1DFIA 1JDJA 3OT5A 3RBAA 1D9ZA 4LI0A 2HBRA 1R18A 1TCCA 2JAWA 3RREA 2ZBVA 5L3SB 3BQNB 5BNFA 1AURA 4RY8A 5HDQA 2FEWB 1B26A 3P26A 4O63O 4TMWA 1I13A 3KOMA 3F5FA 4AECA 4BWYA 4RFVA 3BFPA 1ZGAA 1LTHR 2IHYA 3LHFA 4I14A 2HCJB 1L8QA 3JD2A 3JQ6A 3ROKA 1ZNZA 1ESCA 2X4DA 1CJCA 5FBLB 1FFYA 3QF4A 5DBIA 4RJKA 1S2OA 1ENOA 1VE7A 1G5RA 3PXCX 2BGTA 4UNNA 1G7RA 2I1VB 2HRBA 4FGLA 4MCIA 1XZCA 4XD2A 1M6VA 4UUQA 5MFPA 2NW6A 3NDIA 1W49A 4YJFA 3TXAA 1ZU4A 5ENVA 1X15A 2FJPA 4FQ7A 1CULC 4B7CA 1AGYA 1BCSB 1TFUA 2WWTA 1FDSA 3LDUA 3QVVA 5EWMB 5SZKB 3PX7A 2ZDGA 3U3JA 2HQRA 1XQWA 1OXKB 4U6SA 3GG9A 3UW3A 1MB3A 3AR6A 1VRWA 3NIFB 4XA8A 3GPIA 1WP9A 3WK4A 1PBTA 4YLGA 3OJFA 2ERXA 3VYSB 4LJLA 4E22A 2QX4A 2FYTA 2OBMA 3ZVLA 1TM5E 2C2GA 1F2TB 1PWHA 3DAYA 3CKKA 3GLKA 4ZPXA 1N0HA 5EJ5A 1PR6A 1OB2A 1W34A 1LPAB 3G0OA 2VDUE 5LQRA 1P7ZA 2GCPA 4DC0A 2NSJA 4G24A 2ZRMA 4G1UC 4P3YA