2RAFA

Crystal structure of putative dinucleotide-binding oxidoreductase (np_786167.1) from lactobacillus plantarum at 1.60 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
MEITIFGKGNMGQAIGHNFEIAGHEVTYYGSKDQATTLGEIVIMAVPYPALAALAKQYATQLKGKIVVDITNPLNFDTWDDLVVPADSSAAQELQQQLPDSQVLKAFNTTFAATLQSGQVNGKEPTTVLVAGNDDSAKQRFTRALADSPLEVKDAGKLKRARELEAMGFMQMTLAASEQIGWTGGFAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative dinucleotide-binding oxidoreductase (NP_786167.1) from Lactobacillus plantarum at 1.60 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Oxidoreductase
molecule keywords Putative Dinucleotide-Binding Oxidoreductase
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rafA01
4NMHA 3PIIA 4B4UA 5A1TA 2ZJ0A 3U5TA 3ADPA 3H5RA 2A94A 4L4XA 1I0ZA 4S1VA 3VH4A 2O2YA 2YY7A 3H6KA 4WPGA 4WGGA 3LLSA 1NR7A 1PZEA 3LZ6A 4I5FA 4NBWA 4GSLA 2DBVO 3ZWBA 3MJVA 1K3TA 1JQBA 2JCXA 2AQIA 3MOGA 1CEQA 2I3AA 2ZB4A 4D3DA 4HFNA 2NU8A 1BDMA 4O1MA 2PGJA 2AHRA 1IB6A 1A4UA 3ETEA 1JTVA 3GVCA 4YJHA 3OA0A 2DBQA 3H4VA 4DTIA 1LLCA 5ILGA 5KVSA 3VVBA 4NU5A 5A5FA 2P5UA 1XQ6A 4BNUA 4DYVA 2DFDA 1YL6A 5EL0A 5DP1A 4WKGA 3DBHA 4JBIA 3TL3A 1NFRA 4ZICA 2ZJ1A 4IDDA 4IINA 2VQ3A 4I5EA 4RJTA 4YRBA 1FDVA 1X14A 4D0SA 5CDTA 1VSVA 3AOEC 4ND1A 5A04A 5DBFA 1WXDA 4E5PA 4LMRA 5B37A 1QYXA 2Y99A 1LQTA 1HE2A 2Y67A 3A4VA 4UVDA 5T67A 3PJEA 3UGKA 2Q49A 4CMEC 3CSDA 4K6CA 3WSWA 4BO6A 1IE3A 2Q1TA 3S55A 3D4NA 2TMGA 1P31A 2V7PA 1KVSA 1EQUA 1YBAA 1RM4A 1A9YA 2V65A 3JD3A 1IOLA 3AW9A 2ZTMA 3FWNA 4N18A 3JYNA 4WJZA 1PJQA 5THQA 1ADGA 4CLRB 4WEOA 3W4KA 4KUHA 2HMVA 4LMPA 1LJ8A 3TZ6A 3AUTA 3ZU4A 1LA2A 1PWXA 4RDIA 1P1FA 1Y7TA 1NQTA 4O6VA 2DC1A 2VHZA 3QV1A 1C3VA 2J3HA 1KOLA 1T2CA 4XKJA 2GN9A 2GZ3A 3OJEA 1HLPA 1P1IA 1X1TA 5AXCA 3U09A 1GEEA 4QECA 1LDBA 3DOOA 2C2XA 4U6SA 5ICSA 3INTA 4RVSA 4A2CA 1DRWA 4PG6A 3RUEA 2G17A 1A27A 2GZ2A 1HE4A 3RKUA 1ADFA 1MP0A 2O4CA 1Z7BA 2VWHA 3R0IA 5JAZA 3ZU5A 4RPHA 5DF1A 2I3GA 3RC1A 2FZEA 3IKTA 3DOCA 3F3SA 3FNHA 1GY8A 1YJ8A 1ZK3A 4NBTA 4D43A 4ZQBA 1U3UA 2P2SA 2Y1EA 4R4JA 3LK7A 3BTUA 5KTKA 5CPFA 3WYCA 4PLPA 3DQPA 4RPKA 2GPTA 5JDCC 4E32A 1IY8A 4I9UA 5ENVA 1M66A 1O89A 1U8XX 4CMHA 1PJBA 4BKPA 3SVTA 1H6AA 5KVCA 4FOOA 1HEUA 4WLNA 5TGDA 2NQ8A 2VYVA 2OL4A 4IGEA 4XEHA 1D7OA 1I24A 3HJAA 3RASA 5JS6A 3LQFA 1LLUA 2IRWA 3IUSA 1Q2XA 1I32A 3DZIA 2IDZA 3EY4A 1W0CA 2SCUA 2Q4EA 3UH1A 5IJZA 3IKVA 4CLXA 1MA0A 3TSCA 1VKOA 1KYQA 3QWHA 3ETGA 1FF9A 3I6QA 3OQ1A 2TMDA 2GASA 5DOZA 1EBFA 3JQAD 1LSOA 3DAPA 3GGGA 2AE1A 5TX7A 3OMLA 1EBUA 1P0CA 1ENPA 2V6BA 2J5QA 4GGPA 4DLLA 1YDWA 3DBHB 5K6AA 4E12A 3F46A 3TL2A 5DBIA 4MVJD 1E3JA 1H2BA 1ULSA 2X8LA 4B3JA 1V3TA 3FPLA 3U4IA 5KVQA 4BHTA 5JNLA 4ZA2A 5BNTA 2B35A 2CF6A 1ZVMA 5I7FA 3H2ZA 4YTEA 1O95A 3ZWYA 3S2GA 3SXPA 1PQUA 2H9IA 2VYNA 4KP7A 2PZLA 3VZRA 5JO0A 2IXAA 3WWYA 5A05A 2ZATA 3PGJA 1EVZA 4MOWA 2OO5A 3QVSA 4JCOA 5G0UA 2BI8A 3HDYA 3IDSA 4NJMA 3EHEA 3RFVA 3BZUA 3V1TC 4G65A 1XYGA 2CVOA 4RVFA 1JAYA 3WTBA 1Z6ZA 5TRTA 3WSVA 5HBRA 3AU9A 1V3UA 4M8SA 1GV1A 3OJLA 1SEVA 2VHVA 4OOEA 3D64A 4LSMA 4XYEA 5I7SA 3VKUA 1NFQA 4CUKA 2JD1A 1UJMA 2O7QA 4PG4A 3RQSA 1DSSG 1I8TA 4E2WA 2NTJA 2GSDA 4H16A 5I9NA 4ZQHA 2I76A 4IIUA 1NM5A 1T2EA 3PYXA 1H93A 1LRKA 1MFPA 4W4TA 1U7TA 3N58A 4KWHA 4MJLA 3WR5A 3EVNA 4J9UE 5IDQA 3T4EA 1EQ2A 4IQ0A 4CLHA 1HSOA 2CVQA 3LT0A 1SBYA 4NNJA 1WPQA 1UXGA 1X15A 2FMUA 2Y1DA 4CV3A 1RYEA 4RVHA 4K26A 1E1NA 5C7LO 1RJWA 3MJCA 5DCWA 4UAGA 3V5NA 4KTVE 1H6BA 5A9RA 2BGMA 3BMOA 1F8FA 4J49A 2X7HA 5K0ZA 5DT9A 2IEDA 2IZ1A 1DAPA 4M89A 3TRIA 3GDFA 1DRVA 2WYWA 5I8WA 3ROQA 4ALNA 3LT4A 3AFMA 3KYCB 2JCVA 3RUIA 1B7GO 3R3SA 2J8ZA 1XU9A 3D4OA 4XYBA 1Z74A 3WIEA 4Y98A 4RPJA 3DMTA 3JQBC 4TRMA 4XX0A 1EDZA 1BHSA 3FRJA 2UUPA 4E30A 1HSZA 2AEJA 2C7VA 2NSDA 1NAIA 3IAHA 4CODB 3TFOA 4FQ8A 1NNUA 4BO9A 3RD5A 4OIMA 4ZN6A 2G76A 4IDCA 4RORA 3QJ5A 3WNQA 4YR9A 1U8FO 1DAOA 2WE7A 1FMCA 3EGOA 3I3OA 5DBGA 5F21A 2X9NA 4CM1A 2WSBA 4RLSA 3CZRA 1E6EA 1E7WA 2PKQO 4J0FA 1ZSVA 3U0BA 4CM4B 4YPOA 5L4LA 4DMLA 3W4IA 1MG5A 3DBRA 3WS7A 3B1FA 1NASA 5C7OO 2VCYA 5L9AA 3DBRB 4JNKA 3DL2A 3U4CA 1HDXA 3SEFA 4KDEA 1V8BA 2BGKA 3GR6A 3WGQA 3JYQA 3INRA 3B1JA 2X0RA 3L6EA 4H7PA 4HWKA 4CV2A 3WBBA 3QW2A 3KXDA 3VPXA 1YBVA 2I99A 5U4QA 1ZW1A 3G1UA 3PLRA 4HFJA 4K28A 3SLGA 5JMWA 5ILOA 1SNYA 5A4DA 3UVEA 5KIAA 2Y1CA 1R4MB 3ZWWA 1F17A 1N5DA 1B3RA 3K9QO 4UUOA 1G0NA 4ND5A 5C5IA 3M2TA 5DOVA 1DC5A 2GF2A 4RO0A 2EKLA 1PS0A 4R54A 1E7YA 3WB9A 1YQGA 4NK4A 5FFFA 5JMPA 1EVIA 4A0SA 1WZEA 1YB4A 1YXMA 2DLDA 4BO2A 4Z6KA 1PZGA 1QR6A 3H9GA 4FFLA 2EIHA 3M2PA 4BOYA 1E3EA 4E0BA 2C54A 4ND3A 2DFVA 4M54A 2VZ8A 1VPDA 4KWIA 4LW8A 1J6UA 3OJOA 1KEVA 1PGOA 2A4KA 3T4XA 1Z75A 3KSZO 3WLFA 1PJ4A 1U3TA 4YT8A 1I30A 3ADOA 3JD2A 2UV8A 3O4RA 4Q9NA 1CYDA 4ZD6A 1U4SA 2UVDA 2X6TA 4H15A 2P9CA 3WMWA 3ZCXA 2GRAA 4ZGWA 4P38A 1F12A 5L53A 1EFKA 1DIAA 4GBJA 1OC4A 1R12A 4J9VA 3OHSX 4J7CA 1QYWA 3F5QA 4BNTA 1GUFA 3S2EA 4ZVVA 2VRCD 5GZ6A 2ZK7A 1LDEA 3ANMA 1GUZA 4FD3A 3ZWVA 3ZNNA 1KC3A 1YKFA 4TKMA 1C1XA 3ENNA 4GL4A 4AJJA 1QYVA 1HTBA 4JJIA 4QSMA 1GZ4A 3LDHA 4WCFA 3QIVA 3JQCA 2EP5A 2HMWA 1YJQA 2Q4BA 4RQUA 1S7CA 3EW7A 2C2YA 4YAKA 5EINA 3E1KA 4OXNA 2VHYA 1KBZA 2PD4A 1TT5A 3BMOB 1K6IA 2DTEA 2PA3A 2AG8A 4GMFA 5F5NA 1M6WA 4EGFA 4FGSA 1DIRA 1H6CA 4FOSA 3VHRA 4AJ2A 4DA9A 1X7GA 5KKAA 4WK6A 1DPGA 3OH8A 2EW8A 1BXZA 1C14A 2I5PO 1SB8A 1B2LA 1R4NA 2AW5A 8ADHA 2B83A 3ZWXA 1D1TA 3TDKA 2FZWA 5BNIA 5CEJA 3AJRA 3CINA 4IQ8A 1D8AA 2CNBA 3ZHZA 1YE3A 5JCXA 4G81A 1HWYA 4UEJA 1QG6A 3KV3O 4RF2A 1F14A 4U8GA 4WE3A 2DAPA 1ULUA 5B4UA 2X5KO 4Y8VA 1M76A 4CM7A 4FJ1A 2BMAA 5DN9A 4E13A 5JYDA 1G0OA 2NU6A 5AYVA 1DLJA 2YV1A 3GVHA 2B0JA 4J4TA 5G4LA 3HSKA 2QIOA 3BTSA 3PEFA 4JBGA 3E9QA 3JQFA 3AOEA 4PLWA 5A3VA 3AK4A 3LC2O 4M1QA 3KYBA 1Q0QA 3ZWPA 1GU7A 4PLYA 5FYDA 5GMOA 1IHXA 2Z1MA 3TOXA 3ENKA 4EZBA 1R0LA 1ZK2A 1T4BA 1ZNQO 3HB5X 1U4OA 3QRWA 3RUDA 1UZLA 4CUZA 3I6IA 4JK3A 1PJCA 2PR2A 5EERA 4EEXA 5CDSA 1I5RA 1LSUA 3PXXA 1DC3A 2X0NA 4C7KA 1HL3A 1V3VA 2BI7A 4AJLA 2WD7A 4CLOB 2R00C 4U6QA 3WNVA 2XAAA 4KQXA 3PHHA 3JYPA 3PIDA 1T4DA 1WNTA 1U5CA 4R5HA 3UF0A 2PD6A 3GPDG 1KVUA 3GGPA 4U5QA 3X2EA 3L0DA 3UOGA 3CMCO 4MKXA 3DZFA 3RCBA 1GV0A 5HA5A 2JHGA 3QY9A 3DB2A 5KJ1A 2ZYAA 3JQ9C 2DKNA 4F3YA 4I5DA 5EN4A 2Q3EA 4R69A 3TWOA 4DIOA 4BNYA 4O0LA 2VUUA 3O38A 1JKJA 1BW9A 1YL5A 1LXCA 3I83A 3JD4A 1KERA 2ILTA 4J1NA 3A1NA 3VKVA 2QG4A 1T2AA 4FW8A 4A26A 3ROPA 4YA6A 3WLEA 1GADO 4P8RA 2GO1A 3U9LA 3H9JA 4ZQEA 4QXMA 1EDOA 3L4BA 1DB3A 4BO3A 5FI5A 3Q9NA 2OHXA 1J5PA 1TI7A 3PVZA 4YJGA 5B4VA 1AUPA 1PS9A 2AQ8A 4XJSA 5KNLA 3IC5A 1PL6A 5G0VA 2RBEA 1SO8A 1P1RA 3PI7A 1SZJG 1AN9A 1XU7A 1N7GA 3RBXA 2VZ9A 3PGXA 2R6JA 4CM8A 5GY7A 4RL6A 2FHSA 2H6EA 3GN2A 5L4SA 2DBRA 2P68A 4DPMA 2WEKA 3NT4A 2B36A 4MVJH 2AG5A 3AUAA 3OIDA 4WCFC 2EW2A 2V6FA 4DIBA 3WJ7A 2EKPA 2O3JA 4B7CA 2NV6A 3UHAA 2O2SA 3JYLA 3PPIA 4LCEA 4R1NA 2ZB8A 4MIYA 2EF1A 5IDWA 3GN1A 4L75A 1HZJA 4RZIA 4W7HA 2FOIA 1E5LA 3T7CA 3GH3A 3JQ6A 3LSYA 3NGXA 2EGHA 4R1SA 4JXKA 3PQDA 3A14A 4FJ2A 5TIIA 2W2KA 1H5QA 4RGBA 3GUCA 3QA9A 4WUVA 2X22A 5BSGA 3HHPA 2PD3A 4AJNA 4YJFA 3WJAA 3P19A 3P5SA 3M1LA 1GAEO 1ZH8A 3TNLA 1NVMB 1H2HA 4CQMD 3GLQA 1ONOA 4IZIA 3E48A 5B1YA 2G5CA 3PHIA 4OKIA 4Z0TA 3TF5A 3NAQA 1PSDA 1HDYA 2AE2A 1BG6A 2YJZA 3I9LA 4D42A 5EJ2A 2WMDA 3K73O 3PQEA 3N74A 3WOHA 4BB6A 4DC0A 1G6KA 1VLLA 1DO8A 1LRJA 1R66A 1C0PA 1MXHA 2WD8A 4IS2A 1E3LA 2Z1NA 1MB4A 3ZNPA 5ITWA 3PFFA 3W8FA 2C5AA 5JO9A 4GKBA 2ZIZA 3ITDA 5IN5A 3BHJA 1ISIA 3NEPX 3MJSA 2AXQA 4XYGA 5DCYA 2O3QA 3FN4A 7ADHA 4R1UA 1EUCA 5JE8A 3GFGA 3ONFA 3JCZA 4W99A 4O59O 2BFPA 3ZWOA 2EHDA 4AVYA 1UP6A 2LDXA 1SOWA 1VJ1A 1ZXBA 1SPXA 4XR9A 2X5JO 3GY0A 3EC7A 4RVGA 1Q1NA 3QVTA 5F3RA 1XCBA 4ONEA 4Z9XA 3WGYA 3NKLA 5I8ZA 4ZQFA 4XR4A 4Y67A 4CJXA 3WX0A 3I23A 4OM8A 1DHRA 4IJWA 1NQOA 2H63A 3I9KA 5ER6A 1LDNA 1NQAO 2B5VA 3SLKA 1NX6A 2A35A 1P33A 2YDXA 3AI1A 3HQ4O 2B4QA 4MPDA 1NFFA 1TA4A 2X9GA 4ZRMA 4S3MA 3S1LA 1ARZA 4DYDA 4MDHA 1ZO8A 2BF7A 4NH4A 1QORA 2QHXA 1WDLA 1R16A 1K6XA 3UUWA 3KO8A 1I33A 1ZSNA 4U7WA 2VHXA 5L45A 2GN4A 3HFGA 3KSDO 3OICA 4GH5A 1J0XO 4CMGA 5JAIA 3K2EA 1JWAB 3GA0A 2HQ1A 1JN0A 5IN4A 1UDBA 4XGIA 4EUFA 1P1KA 2I66A 4CUJA 2C7GA 2PNFA 3KUXA 1Y9AA 3A9WA 1JAXA 4U0KA 4UEKA 3VZSA 5JXWA 2HRBA 4YAJA 1BXKA 2E6UX 2JJYA 1ZK4A 3DDNA 3RC2A 3VH1A 3Q1LA 4WLEA 2Z5LA 4IBOA 1N2SA 1BGVA 2XF8A 4TVBA 3IUPA 1UR5A 1W8DA 3G0OA 2WJPA 3I9OA 3BMCB 4GX1A 1ISGA 2Y1FA 4B8WA 5EQDA 3FD8A 3AI2A 4AJIA 1M67A 3VVCA 4WCDA 3E5RA 5HS4A 4K1LA 1RPNA 3ORFA 5TQVA 3UXYA 1ADCA 2IZ0A 4MP8A 4MVJM 4UVIA 1JU9A 1AXEA 3JV7A 3QWAA 2OFPA 2C07A 1HDZA 4Q3EA 3GEDA 3ITKA 1U2GA 2GGSA 1IL0A 3UW3A 3BMNA 4YEDA 1NWCA 2IYPA 4D79A 3JQ8B 5BT9A 1NAHA 1EUDA 1CQIA 1IPFA 5L40A 3RBVA 3WTCA 4Z9YA 1X0VA 3HZZA 5T64A 1JLLA 3GQVA 3QSGA 8LDHA 3FWZA 3DHYA 2YZ7A 3KEQA 3OJ0A 3QQPA 5B12A 3ZWNA 4BNZA 3KETA 3JQ7A 1QLHA 2QYTA 1N7HA 2WYVA 2B4RO 4D46A 5CG1A 3G17A 4RDHA 5CHEA 1P74A 2AA3A 4I8XA 4ALIA 2QZ9A 4QO8A 2FY8A 5L7YA 1E5QA 5MGBA 4HBGA 3HFSA 2VHWA 5J23A 1E3IA 3D5QA 4GPD1 4TQGA 1ISMA 3ONDA 4CMJA 1YBMA 4G2NA 4YDRA 4U0JA 2EERA 4CL3A 5AXBA 4DC1A 2XOXA 1HE3A 2NVWA 3JYOA 1ZJYA 2GD1O 3JQEA 4CM9D 4OSOA 1XA0A 4F46A 4K6FA 3T7EA 3QVXA 2HK9A 2GR9A 3ZU3A 1O94A 1QLJA 1W6UA 2NQTA 3VDQA 2NU7A 5TC4A 2OP1A 5B4TA 2HO5A 1M75A 3HE3A 2C29D 3OIFA 1MUUA 3IS3A 1LI4A 1EE2A 5BR7A 4XIJA 2HMUA 1KEWA 2O3SA 1O0SA 3D3WB 3NDJA 3I9JA 2D2IA 3L6DA 4MVJI 2Y68A 4BUCA 4IDBA 3CH6A 1NHGA 3BXXA 4OXYA 4E5KA 1B0AA 4BNVA 3UCEA 3HDHA 4DQXA 2CUKA 2PY6A 1IHYA 3GNSA 3EVTA 2B5WA 2DPHA 4L76A 5JDIC 1GPDG 2FWMX 4BO4A 5I7EA 2HRZA 1GR0A 1YS4A 3EZLA 2NU9A 9LDTA 3V1UA 2YQ5A 1E6UA 3LU1A 1E7RA 2O3RA 4RPGA 3AUSA 4N5LA 1HYGA 3ICCA 3IL2A 5CG2A 4EITA 3R6DA 1N8KA 5IZCC 4DLBA 4CQLA 1NQ5A 1N9GB 2E48A 1B8PA 1KS9A 5H83A 4IPTA 4KTTE 4M49A 4ALJA 4I08A 1NTOA 3LF1A 4FFNA 4IY1A 2IODA 5TT1A 2ZYDA 3RJ5A 1ZIDA 4PLCA 5KJEA 4FDAA 2YDYA 2F00A 1PQWA 1RM5A 3FTNA 3GC6A 1CQJA 3IQDB 3NJ8A 1GPJA 3MTGA 1O5IA 2AEMA 3COSA 3KTDA 1DEHA 3F1KA 5A9SA 3ZU2A 4GWKA 2BFAA 4A27A 2WE8A 3UCXA 3BMNB 4CMAA 3B6ZA 4LVCA 1WVGA 4HFMA 1AHIA 3ZWCA 4JROA 3ZHBA 3ZZNA 4CMEA 2OORA 1ISJA 1PGNA 2NTVA 1VM6A 4ND2A 2VNSA 3RKRA 3GG2A 1I3LA 4PCVA 4CPDA 5KJ6A 2OMEA 1CJCA 3DR3A 2YHIA 1LNQA 1V9LA 4B4WA 1U1IA 3OFSA 3BMQA 3I5MA 4TRRA 4CLRA 2ZB7A 3CTMA 4XB2A 2R00A 3EZYA 2W2KB 3G79A 4BGUA 4W6ZA 5T6BA 1MXFA 1Q7CA 1X1EA 4GLLA 3ZNOA 4HP8A 5JPIA 2J3IA 1KVTA 2PGLA 3F5SA 4R1TA 3OQBA 3S2FA 4JGBA 3DC2A 1P45A 3OF2A 3H3FA 3JQ9A 3WG9A 3KRTA 1T25A 1DRUA 3ULKA 4L73A 4J43A 3F4LA 1ZJZA 5CP8A 4J90A 4R3WA 3ZV3A 3A28A 4PZDA 2I9PA 2VYVD 4WLFA 3OEYA 1UXHA 2HK8A 4BIIA 4CM3A 1E3WA 1E92A 3TZKA 5T8KC 4XRRA 1BSVA 5IF3A 1JDJA 3FBGA 2AMFA 3PTZA 2YFQA 3O26A 3H2SA 4JX8A 4NFHA 1SEPA 1TT5B 2BRUA 5L3ZA 2HMSA 4GAEA 2W98A 2YHIB 3DZGA 4NU6A 4HV4A 3R1IA 1PR9A 4TRNA 2O3TA 3MOIA 5FI3A 3OECA 1QP8A 1NR1A 2OGUA 4XA8A 4DGSA 4UUMA 5JSFA 2EJVA 4L0QA 3ROMA 3D0OA 5JCJD 3HB4X 3O03A 1U3WA 3PHLA 1K0UA 2NVUB 5JC8A 2RIRA 3TN7A 4OAQA 3KBOA 2NLOA 3DAGA 4PLFA 3ZN2A 4HX5A 4L9RA 1FDSA 3QLJA 5A02A 9LDBA 1Z73A 3UN1A 4NBUA 1L1FA 4ZQGA 1DHTA 4MVJA 3SX2A 1DC4A 2P4HX 1BRMA 1ZFNA 4G5HA 4NK5A 2JHFA 1Y5RA 3GK3A 3NRCA 1UUFA 4XQEA 1YOVA 2RAFA 1X0XA 1G1AA 3HNPA 3HWRA 4LCJA 4X54A 4Z3KA 1O8CA 1OMOA 2PZJA 1XWFA 4NPCA 3U4DA 3RWBA 3V2UA 5BQFA 4LRSB 1WMBA 3WGGA 4QO7A 4B3IA 4YCAA 3ZDFA 3DAFA 1XELA 1XGKA 3ASVA 3VDRA 5I7VA 3EYWA 2G1UA 1BWSA 3JQDA 4YAEA 1C0IA 2BH9A 1HT0A 4CLOA 3WGHA 4CQLB 4YVFA 1Z45A 1ISFA 3MCVA 4IUYA 4XJTA 1GCOA 3F9IA 4ZHSA 4J4HA 4IJVA 3L4SO 1Z7EA 3VZPA 4J0EA 4IM7A 4YT4A 5CDGA 2FN7A 1SMKA 1TXGA 2E82A 2NUAA 2D4AA 5IAAA 4GVLA 4KMSA 1NVGA 2D1YA 2XXBA 3ZV4A 5JY1A 3KYCA 3M1AA 3PQFA 4ALLA 3I1JA 4CV1A 4I9NA 3TZQA 3VC7A 3PLNA 4AG3A 4RVUA 2EV9A 1NXQA 2W4QA 1VKNA 1DJNA 4PGFA 3KSUA 3WGIA 3S2IA 4MO2A 3ICPA 3GAZA 3AY7A 1UXKA 3JQAA 1LDGA 4E33A 3VH2A 3H9QA 3WBFA 1J49A 1DJQA 4DREA 4TMFA 1PZHA 2HJRA 1YQXA 1QKIA 3JQBA 3K2BA 4J1SA 3ZV5A 5JC1A 4FPXA 3OP4A 1GYQA 4OXKA 5L51A 5TT0A 3RU9A 4IMPA 4AFNA 4FFOA 7MDHA 3EAGA 4IXTA 1DIBA 1A9ZA 3JD0A 4QQRA 2O7SA 2HUNA 4PRLA 4ESOA 1PGPA 1PJ2A 5DNAA 1XG5A 2PGDA 2NTNA 2YUTA 4FIZA 4PZEA 4BNHA 3LF2A 1X7DA 3HDQA 5CFZA 1XR3A 1NWHA 3ZI0A 1Y8QA 2W90A 3CKYA 3H65A 2HSDA 2P9GA 2GN8A 1EVYA 2Y93A 1JVBA 3BTOA 4A73A 3PJFA 2W2LA 4CMIA 5L4NA 4JN6B 3DFZA 4Z0PA 3ZW8A 4FFPA 4MVJP 3CPSA 4JP2A 2IXBA 4MKRA 1N92A 2RH4A 4FBGA 3IP1A 2BD0A 1UP4A 3JQAB 1BTOA 1WLYA 2JAHA 4TKLA 5HM8A 2CDBA 4GGOA 2X4GA 1SCUA 4ND4A 3FNGA 1AGNA 3UAGA 4MVJF 4DLAA 3RBZA 1GUYA 1I10A 2OOSA 2VTEA 2GLXA 1MC4A 4NI5A 4EUHA 1UP7A 1PX0A 2Y05A 1HDCA 3LT1A 1EMDA 5TJ9A 1C1DA 3KLMX 2D5AA 4HXYA 4DBZA 4AJHA 3HDJA 2IEBA 3GF4A 4BNJA 4E2ZA 6LDHA 3W6ZA 1J4AA 1X7HA 4FFRA 3KM0A 1KETA 3DZBA 1EEHA 1B26A 3MZ0A 5A9TA 1NP3A 3SBOA 1RYDA 4FJ0A 4NG5A 1LX6A 5FWNA 4TWRA 3AOGA 1W4ZA 2PK3A 4BMNA 4YBZA 1TLTA 3DZKA 3PWZA 3PRJA 5U1PA 4DMMA 1VC2A 4NR0A 5T8KA 3JQGB 4WOKA 1XEAA 3NT5A 5CEFA 4HNHA 3E82A 5H82A 4E31A 1LLQA 2EXXA 4FS3A 1LRLA 4FC6A 1EK5A 3GFBA 1SC6A 3AU8A 3H7AA 1DXYA 4WCFB 2IYOA 3ABIA 3OIGA 4HUJA 3I9MA 1P1JA 4BVAA 1XKQA 4YRDA 2QYSA 4GVXA 4L4SA 2GYYA 2DTDA 1UAGA 2VRBA 3KHUA 4LRTB 3QWIA 3ZWMA 3JSAA 3HG7A 1PS8A 3AM5A 4BNMA 1CETA 3D4PA 4M86A 4LGVA 5IXYA 3K30A 2Q2QA 1LSSA 1GCUA 2NWQA 4OMUA 2JFFA 2ZB3A 3WXBA 4O63O 5G2OA 5L95A 4BO8A 1JA9A 3QWFA 5HS6A 3Q11A 4IDGA 3ON5A 1R4NB 4CM4A 3L4BC 3GGOA 2D59A 2DUUA 3NTRA 5TSDA 2V6MA 4KZPA 5TJHA 3RUHA 1JWBB 1VL0A 1GD1O 1HDGO 3CE6A 4FGWA 3KZVA 3VPGA 4MINA 4E3ZA 1I01A 2EEZA 1DFIA 1JW9B 4B7XA 3L9XA 1YB1A 1W73A 5IG2A 2NNLD 3DTTA 4EW6A 3GVPA 4NDNE 4BQRA 4AJPA 1Y9EA 3RSHA 2EGGA 3PHGA 5JYEA 4FN4A 1T2DA 4E5YA 4TSKA 1IYZA 1KEUA 3IP3A 4GWGA 2J5KA 1PL7A 4BKRA 3G3EA 3WFJA 1P1HA 1XIVA 3FNEA 1V0JA 3N7UA 1HXHA 3JTMA 4E6PA 1VL8A 1OFGA 3R3JA 5I9MA 4BO5A 1EVJA 2D3TA 1LQUA 1ZK1A 3PJGA 3U62A 1MC5A 1WDMA 4A5OA 3PWSA 3ZV6A 3AUUA 4R68A 2VT3A 2PKQP 4J91A 3GOHA 3Q2IA 4TVOA 2CF5A 3VZQA 1GDHA 5H81A 1GZ3A 5ES3A 1OOEA 1DOHA 3X2FA 5BSFA 4J7UA 2J5RA 4P4GA 4Q39A 4XIYA 4Y9DA 1Q0LA 3E03A 4I5GA 2HCTA 1Y8RB 3DMYA 4R51A 2VOJA 5JDIA 2Z95A 3RJ9A 1JVSA 2AQKA 3CXRA 4LVUA 1ZUD1 1B3BA 1DBVO 2GERA 4BNNA 3GHHA 1ZMTA 5LCXA 1U28A 5KOIA 3WWZA 4YT2A 3EUWA 4XRGA 4P4NA 1VJ0A 4P22A 4BS9A 4OQYA 3KLPX 3TZHA 3C1TA 2PH3A 4E5MA 5AQ1A 3DONA 1IULA 4GQAA 1F8GA 3K92A 3B70A 4NQZA 2LDBA 4Q3BA 4QFDA 1GYRA 4P4LA 4IJUA 4QFCA 3QHAA 4GI2A 2FR8A 5L7TA 3U49A 3GMSA 2J3KA 4XZ3A 1TVEA 3IJRA 3RFXA 4B7UA 2JFGA 4F6LA 5LC1A 1YL7A 4HKTA 3GG9A 1Q7GA 2ZQZA 3PYLA 2CMDA 1YDEA 2IE0A 3KVOA 5F1OA 3GMDA 1YONA 5DP2A 5HRUA 1QYCA 3KYDA 5IDYA 3VPHA 4PG7A 2I6TA 3M6IA 4E4YA 1WZIA 4JLWA 3GDGA 3G1TA 4AJEA 4YJGB 3MJ4A 2EP7A 1R0SA 1WMAA 1KVRA 3WGZA 1JKIA 5A9SB 4Q3NA 4WNCA 5COBA 3AY6A 3BAZA 2CD9A 4EBFA 3MJEA 3DBLB 5KKCA 3B20A 3NTQA 1K6JA 4KOAA 1H6DA 3NJ4A 1H9BA 1QV7A 3K8ZA 4E2YA 2QRJA 5TLSA 4TROA 1YO6A 3BMQB 4ALKA 4PN3A 2BFMA 4FCCA 1AXGA 5A5EA 4QTZA 4XDZA 2GNAA 3RUFA 2FR1A 2IZZA 4Q3AA 1X13A 3C7CB 4FC7A 4BGVA 2O48X 4GKVA 5KJCA 3DFUA 4XYLA 1R37A 1OBFO 1E3SA 1WDKA 1DFGA 4BO7A 4W82A 1R6DA 4R3NA 3E8XA 5FF9A 5BSEA 4DUPA 1K2WA 1HF3A 4CQMB 1ZMOA 5AXAA 4OSPA 4W7IA 1ENYA 3SC6A 4OYRA 3GRKA 3OETA 2C20A 1C0LA 3QE3A 5ENDA 4B3HA 3ANLA 1OC2A 1BDBA 2ZQYA 5FEUA 1I3KA 1U9JA 2JKVA 2VOEA 4CR6A 1ZEMA 1PGQA 2X23A 1CRWG 1T1RA 2OBNA 2HMTA 3ZGYA 4MIOA 1PWZA 1PR3A 2W2LD 5JFOA 5KJFA 1LSJA 1ZSYA 1ZZEA 2D5CA 5T5QA 4LK3A 4ILKA 4LISA 4BO0A 3DHEA 3W1VA 3DEYX 2FPIA 4DPKA 3CZMA 5G4KB 3E5MA 4GMGA 3Q6IA 1PL8A 5JW6A 5THKA 5L7WA 5LDHA 3GEGA 2VUSA 5COQA 4HNGA 4J2HA 3V1YA 4DRYA 1AE1A 4OH1A 3I4CA 3LC7O 3GPIA 1XSEA 2O3UA 1ONNA 4CQMA 2WTBA 3W6UA 4EJ6A 4UVHA 4NFYA 4YYZA 2I67A 4M55A 1L7EA 1RM3A 3E6AA 4YJHB 4BMSA 4EJ0A 1Q0HA 1YWGO 2OZPA 4N5MA 2B37A 2Q1UA 1PEDA 1Y8RA 3KB6A 3H5NA 1MX3A 1PTJA 4MKZA 5DULA 3PK0A 5TNXA 4NJOA 4WLVA 1NHWA 4BNGA 3RAJA 1I3MA 1EUZA 1NYTA 4PVCA 3VTFA 3F1LA 1S6YA 1LUAA 3QVWA 3H9EO 4Y6SA 2P5YA 2FPGA 4FR5A 3TOZA 3CIFA 4PIVA 4UUPA 1HDOA 1AHHA 2W8ZA 3WGTA 5KWEA 1U5AA 2C59A 5A03A 1EFLA 4BNFA 3FR8A 4J6FA 2BFOA 3DZJA 1I36A 2VZ0A 4IXWA 2AQHA 2WM3A 4R9SA 1WW8A 2HAEA 1CWUA 2D8AA 3VAZA 4A7PA 3WQQA 1F0YA 4B4OA 4RVDA 1UAYA 2NADA 2CFCA 1ORRA 3V2GA 5IZCA 1U2DA 5EPOA 3FF4A 5MDHA 4NJMB 5TS3A 1LTHR 3KYDB 3SC4A 4PLGA 3ONEA 3UCFA 1ZXLA 4YAGA 4Z3DA 4JP3A 1QV6A 3S8MA 3PDUA 3OM9A 1HYHA 1NVTA 3F47A 2VT2A 3OSUA 3GZNA 4MVJG 4OKNA 3D3WA 3GT0A 2HK7A 4IMRA 3PFWO 3PHJA 4CV0A 5U9CA 2BKAA 4YB8A 5JAQA 3A06A 5C3MA 4QUKA 4BQPA 1P44A 2HLPA 1ZEJA 2R2GA 3C1OA 2Q1WA 3LLVA 1YOVB 1CDOA 5KCZA 2QRLA 1DLIA 1PGJA 4HADA 1O9BA 1VE9A 4ID9A 4Z0HO 1QSGA 1B8VA 3GVIA 1A7AA 2A92A 2OXIA 2HJSA 3WQSB 4II3A 2FP4A 5JBIA 1VSUA 1HDRA 1H9AA 4INAA 4ZRNA 4JJGA 1A72A 2E37A 4XYMA 1B16A 4LSWA 4XWYA 1CF2O 3WIDA 3WYEA 2RCYA 1L7DA 3P2YA 3H5AA 3TFQA 4BMVA 1T24A 3LT2A 3W8EA 4N54A 3RVDA 1Y8QB 4IQGA 4PLZA 5F1PA 2PKRA 5G4KA 2HKIA 2X1HA 4RF4A 4CR7A 3H9UA 3GVXA 4J1TA 1Y81A 2VTDA 2CY0A 2YV3A 2DQ4A 4BV8A 5I9LA 1GYPA 2FSVA 4FSHA 3GZNB 1E0DA 1FXSA 2DU8A 4BKQA 1OI7A 1BMDA 1YVEI 4J1QA 1WAMA 4B79A 3HUDA 5T57A 4MIEA 4XGNA 1ENZA 1YQDA 4CM5A 4CMCA 1NPYA 3GNTA 1E6WA 3BIOA 3NUGA 2E4AA 3OJFA 2DPGA 5A06A 5ER9A 4D0RA 2CZCA 4R41A 2G82A 2YQ4A 3DO5A 3WYBA 3EK2A 4PLTA 3ST7A 4DXHA 1P77A 2P9EA 3RFTA 1H0KA 1ADBA 5K6AC 3K6JA 1XDWA 3HADA 4BB5A 3FHLA 2DM6A 2RH8A 3GHYA 3NTOA 3TQHA 3ETDA 2EG9A 1I2BA 1V6AA 5CAEA 4D7AA 4AJKA 2RHCA 5CPBA 3HN7A 4JIGA 3PZBA 2DVMA 4PFJA 4AJ4A 1LDMA 4ROSA 4WNIA 4UVGA 1HKUA 3WGOA 4OOFA 3FPCA 3AWDA 5EIOA 3UICA 1K5HA 2QQ5A 3WQRA 1DDOA 1P9LA 1DFHA 1DIHA 2BGLA 2QRKA 3O8QA 2NACA 4HFRA 2RHRA 3UFXA 4DQUA 1BXGA 1DC6A 1E3WB 3HN2A 4IDFA 1U3VA 2PH5A 3E9MA 4AL4A 1TEHA 3E9NA 5AXDA 3CMMA 2H1SA 3NDIA 1MLDA 5C7IO 1E7QA 4YACA 1N9GA 5DCUA 4YT5A 5AOVA 1MV8A 1Y5MA 2VRCA 3Q2KA 4EI2A 4E21A 2V6GA 4GSKA 1PZFA 5TF4A 3FNFA 2VWPA 2DUWA 3MJTA 3QP9A 4QX6A 1BW9B 4L4RA 2OP0A 2X86A 1XQ1A 2PFGA 3DZHA 3GZ4A 4WLUA 3TJRA 5JY6A 5EESA 1HYEA 3GUYA 4PG8A 4A03A 6ADHA 3MEQA 4TZTA 3C1AA 2NM0A 3FCOA 2WD7B 3ROKA 2UYYA 4YAIA 4PLHA 1CERA 3CEAA 4CLDA 4GX5A 4RQTA 1FDUA 3E18A 1PU2A 3RROA 4DPLA 4D3FA 2GDZA 2Y0EA 3NX4A 4PVDA 1DIGA 2ZCVA 1D4FA 2GCGA 4GLOA 2X5OA 3L6OO 2ZTVA 3BHMA 3O8QB 4IDAA 1BXGB 1LLDA 1IUKA 4N5NA 1I2CA 4IGFA 1MFZA 2G0TA 4Z9FA 4R16A 4AJOA 4BGEA 2ZYGA 1E1KA 3BA1A 2FSSA 3WFIA 1EK6A 3MWDB 4OL9A 2PZMA 3STHA 3NGLA 1KY4A 2PLAA 3GEMA 2YFHA 4FFMA 4L74A 3ZH2A 2QX7A 3I52A 2X58A 4NBRA 4WASA 3B1KA 3AY3A 4RF3A 2Q46A 4BKUA 5CEEA 4R9RA 1O6ZA 1I2ZA 2Q99A 3ASUA 4DVJA 1PQPA 1ONPA 1LBEA 1CIVA 1RM0A 3BYZA 3C85A 1B14A 4XD2A 5IDXA 3QWBA 1QRRA 2C82A 1A71A 1YB5A 3SJUA 1F06A 4OO3A 4CL8A 3WMXA 4E5NA 1JKFA 3VOSA 2XXJA 4UREA 4BNWA 3C3XA 1PIWA 2YHUA 2H5LA 2D0IA 2FRDA 4NFSA 1PJSA 4OJNA 1ENOA 1GZ6A 3U3XA 4DWVA 3JQFC 1C1DB 3H3JA 1ISHA 1K89A 1NBOA 2HDHA 2B69A 1T1SA 2B4TO 2UDPA 5HTOA 1R4MA 1IZ0A 4PG5A 1XHLA 3DHNA 4XB1A 4LN1A 4YQZA 4AJ1A 2CDAA 2VNAA 4KUEA 5IZ4A 4Y6PA 4N7RA 2DT5A 5KVVA 2ZKLA 3EDMA 2X9VA 2Q45A 4OHUA 4BKOA 3DWFA 1GEGA 4URFA 3ZW9A 2X0JA 5ADHA 3L07A 2QZZA 1P0FA 1E7MA 3VTZA 1UXIA 1LEHA 5COAA 3RIHA 2YW9A 4D3SA 3PDJA 1FDWA 1FK8A 3RI3A 4UULA 4XQGA 2P91A 2O4UX 5BNFA 3TPCA 2JAPA 2C0CA 4WECA 1E77A 1A7KA 3I9NA 1ZCJA 2C5EA 2JD2A 5ITVA 3WICA 1GL3A 2P4QA 4CR8A 1BVRA 2Q1SA 3LC1O 4JBHA 4W9NA 2YV2A 4D45A 4RCVA 3PWKA 1SOVA 1PJ3A 4B8ZA 3KEOA 3D7LA 3DXFA 4KUGA 5JAMA 2X0IA 4H3VA 5G0TA 3D3EA 5BSHA 2Y1GA 2FPPA 4BNKA 2O50A 4CMKA 3K5PA 1BVUA 4D41A 2VUTA 2NVUA 1KEPA 4ZU3A 3RU7A 3F4BA 1LDYA 1KY5A 1FDTA 1LU9A 1OZAA 3C8MA 1ZKMA 4EEZA 3C7AA 1IZ9A 1UH5A 1YRLA 1ZK0A 2BHLA 3L77A 4JJFA 4KQWA 5GZ3A 1T2FA 2DTXA 2XPCA 3PYMA 1H94A 3PZRA 1E1LA 5CDYA 4EYEA 2NVBA 1E7SA 1C1XB 4L8VA 4FB5A 4ITUA 3FI9A 4YJFB 1QXSA 4IS3A 2BELA 3JD1A 1T26A 4WOJA 4BGIA 3LVFO 1ZBQA 2POQX 4IDEA 1VI2A 3VPSA 1Y6JA 1SAYA 4I9HA 5C37A 4RF5A 3U4HA 4UEOA 3FTPA 4QT0A 1QMGA 1UZMA 4YXFA 5JCJA 4TZKA 1GQ2A 2VYND 4XQCA 3ANNA 5JLAA 3VH3A 1NPDA 2JD0A 1D3AA 1D1SA 4BNIA 3RC9A 4C7JA 4BNLA 4DBVO 2YYYA 2Q2WA 1IPEA 3H8VA 4O5OA 3AI3A 1KVQA 3BMCA 2Q50A 5ICMA 4IIVA 3L9WA 4IZHA 3AM3A 4WEQA 5EQFA 4PZCA 4XDYA 4NZ9A 5G0WA 3V2HA 4R5MA 4AICA 3IIEA 4YJDA 3IMFA 4GX2A 4GX0A 5IXSA 4NHEA 3DBVO 4I1IA 3PP8A 3EMKA 3GRPA 3INGA 3CUKA 1E1MA 2VWGA 4ALMA 4IJKA 2JL1A 1UDAA 4K9DA 4RV9A 3NYWA 1C0KA 3D1LA 5AVOA 5A3JA 2F1KA 1TT7A 3Q3CA 4F6CA 3P2OA 1M2WA 3W4JA 2E49A 4DQVA 4J16A 3RUAA 1R15A 2CSUA 3O9ZA 5DDIP 4Y6RA 3UKOA 3SJ7A 1V35A 2PV7A 3V8BA 4QEDA 1OAAA 3VPFA 2A9FA 3NV9A 3Q0EA 2ET6A 3P7MA 1N1GA 1WWKA 1RWBA 3ZHYA 4HY3A 4CLEA 1HETA 3K31A 3PJDA 3JQ7B 1MG0A 1UZNA 4XCVA 4OQZA 2EKQA 4TRJA 1GQQA 3LYLA 2Y0CA 2ZCUA 1ML3A 1QYDA 2UUOA 1GTMA 2I65A 1XLTA 2PZKA 2GZ1A 4YQYA 4WLOA 1PJLA 4CM6A 4NBVA 4CM8B 3G49A 3JQGA 4EUEA 1B15A 4M87A 4XGKA 2WYUA 1U7HA 3DMTC 4RLHA 4YWJA 2VWQA 1ID1A 4CMBA 1I3NA 4BL5A 3OQ6A 3C7DB 3GNQA 1KIFA 1HZZA 2PTGA 3C24A 3FR7A 3AFNA 3GAFA 3FSRA 5EMHA 5F5LA 4DL9A 5F1KA 4UVEA 5CDUA 5GZ1A 5DZSA 1EZ4A 2ZTLA 5LDGA 3ZWAA 4YRAA 1YGYA 1KC1A 4MP6A 3QVOA 3Q9UA 3TZCA 1SB9A 3F6YA 1P3DA 1LC3A 2UAGA 1A5ZA 3WDSA 2OBYA 2Y1OA 4BNXA 3FBTA 1FJHA 1B8UA 2EJWA 2QW8A 3IJPA 1NPTO 5JDCA 3DTYA 5K9ZA 3D5TA 1HRDA 1VJTA 1YH3A 4J4BA 2GUGA 3AM4A 3KOUA 4J3FA 4E2XA 4C4OA 4II2A 1UDCA 4W9NC 4Q3DA 4RZHA 1A4IA 1RKXA 3MTJA 4EDFA 3OEWA 3RC7A 3DBLA 4D44A 2CVZA 1EE9A 4KDFA 2ZTUA 3I4FA 3K96A 3NDRA 4OGWA 2BLLA 4Q3CA 2PWZA 4F45A 4UUNA 5G0SA 2J3JA 4JQCA 4CMIB 2VN8A 2FR0A 3ZHXA 3RUCA 1PJTA 1TB4A 4MP3A 1R0KA 2HU2A 1GFSA 5HWSA 3ZNQA 2Y66A 2JFHA 4DIFA 4B4VA 5IFLA 4CM9A 2EWMA 1HLDA 1M6HA 1N1EA 4A10A 4BV9A 1GQYA 3BTVA 4J2OA 1Q7BA 3OA2A 2Y0DA 4NIMA 3NT2A 4J7XA 4MVJE 2AEFA 3OBBA 1LC0A 1MGOA 2CDCA 1Y1PA 2J6IA 3JQ8A 3BHIA 4EJMA 3MWEB 3DOJA 2O23A 2WWRA 4BO1A 4PRKA 4ZJUA 1HE5A 1UXJA 2WDZA 2JCYA 3GDOA 2OUIA 4PLVA 4XQ9A 1Z82A 3W8DA 4RPLA 2DBZA 2GN6A 1WP4A 1VL6A 2Q2VA 3IOYA 4R01A 1VRWA
chains in the Genus database with same CATH superfamily
5KQRA 1B4DA 4NMHA 4AF6A 4HN2A 4EL5A 1O97C 1MHPA 2GJAA 3T4PA 2ZJ0A 2Q29A 2W0SA 4D81A 3QI7A 4XUGB 2BL4A 5BVHA 1VL5A 2QRMA 3DWEX 3FJOA 3DV0B 2QAGA 3MB8A 4JEMA 2YY7A 4WPGA 1R9NA 4K1XA 3PC6A 3CW2A 5CTAA 3OKCA 1KAOA 3SE7A 1SUIA 4A6PA 5K05A 3MT0A 4GSLA 1K3TA 1T2VA 1WZUA 1Z0IA 3K53A 2V97A 3T1YB 2I3AA 3FUUA 4FYIA 2YX1A 3E70C 3ENWA 4GXQA 4REMA 4UD6A 1SQ6A 2Z58A 3WLMA 4D0GA 5IT0A 1YZYA 1FNMA 4HFNA 2NU8A 1BDMA 1JPVA 5L3RA 3ZW7A 4Y2HA 1GGVA 3O0DA 2Q4RA 1N6RA 3OA0A 2X42A 2O0JA 1J97A 2HNAA 3LCRA 4R2XA 2GM9A 3H4VA 4YLEA 1LLCA 4JENA 5FNZA 4B71A 4DTIA 3FPEA 5KVSA 4LDQA 4NU5A 1LPNA 1QDLB 2P5UA 3MJFA 5HX7A 1IQRA 5KYXA 1NATA 3LYUA 1JQEA 3GP3A 1PT5A 3HFJA 3HL0A 4ZICA 2VK8A 1COWD 1QH8B 4TYPA 4IINA 1HEIA 3CX6A 5EKXA 1QU2A 5LBIA 4TSFD 5DM4A 3W78A 5CDTA 3EXG1 1YFLA 1CUVA 3WQBA 1A98A 3RQIA 3G5LA 3ZDAA 1FA9A 1MQ9A 1ZCZA 1BXRB 1J09A 2CLOB 3NBKA 4LMRA 5AM0A 3OEED 2VJMA 1LQTA 1X3SA 2Y67A 1U3GA 4U2KA 3M6UA 4KPGA 1E2LA 2DY0A 3C43A 5BV1A 1JHUA 5BOSB 1Q7TA 2XOKD 4H3SA 2X0FA 1U28C 4K6CA 3EVEA 4CN8A 4KWCA 1ZBDA 3D4NA 3L1VA 1QVRA 3D7NA 5IVPA 2V6JA 1UPAA 3ZD6A 1ZITA 2IYVA 1YBAA 3FVRA 1E2MA 1LV8A 2CMHA 2G4CA 4NDAA 4BU1A 4EQ6A 1LWOA 1N3LA 1GNQA 2LR0A 3FWNA 4H7KA 3WOVA 5AVTA 2Y1KA 1PVDA 1U7DA 4WV3A 4RNDB 1Y1SA 4P53A 3PGKA 2EYQA 4HGOA 6PFKA 1U8YA 1JDBB 4JB3A 4ZXFA 1GAJA 2EDCA 4KUHA 4LMPA 1LJ8A 3TZ6A 4QYIA 2IWRA 3AUTA 3QFHA 4LG1A 1CB7A 3KG2A 4AO6A 4JYAB 3DLPX 1IN4A 4PSCA 2H1HA 4MGIR 1NQTA 2H1OA 3CZQA 3ESRA 1C3VA 2J3HA 5B7NA 5JSHA 1AMNA 1V5IA 3I64A 3MJDA 2GN9A 3FOWA 2GZ3A 1FLVA 1HLPA 2ACWA 2R1VA 1OXXK 2O8VA 1GEEA 3U17A 4GYJA 1W4BA 1LDBA 4MQBA 5ICSA 1F7UA 4PXSA 2ZB2A 4IJ6A 3A4LA 2X13A 3M5WA 1VPLA 1J2TA 5DNWA 1IPHA 2G17A 4J29A 1JHMA 1HE4A 3RKUA 4ZOCA 1ADFA 1MP0A 5CDFA 5BOVA 4DMCA 4ZI7F 2X6QA 3IO3A 1TF5A 2GPAA 3ZU5A 5M3BA 5DF1A 3HCEA 3GLGB 1H8ED 1ZC4A 3DOCA 3NI2A 1W1WA 3TTWA 2P2SA 4R4JA 5FEMA 3LK7A 4JA2A 5CPFA 3U0VA 4ZU1X 3RVBA 3ENQA 2B98A 4PLPA 3WYCA 1X42A 1V8DA 3DQPA 5MGNA 1GFWA 3GPBA 3RT1A 1IY8A 1J1UA 1M66A 4MA5A 1U8XX 1PJBA 1Z4QA 3MUNA 2GJSA 2GJ4A 2EX4A 5DWDA 3SVTA 2Q4TA 2GAFA 2OL4A 2P11A 2VYVA 3AG5A 4XEHA 3RASA 2ZAYA 3K9HA 3WRVA 2UU9B 3FNQA 3STXA 2IRWA 4E22A 3IE0A 1Q2XA 4JBNA 3G82C 1GCIA 4LYGA 5EVCA 1USUA 1AK1A 1ND5A 2MSNA 1DDGA 1KYQA 1YVRA 2VP6A 1YCFA 3LP5A 2VP4A 2J5XA 4LNHA 2PS9A 1JQLB 4HL6A 1NY5A 3AEQA 4Q00A 5HFJA 5TR9A 4B74A 1CULC 2TMDA 3GZJA 4TQAA 4RV4A 1OWPA 1T8UA 2OD9A 3P2IA 5T7BA 3DAPA 2AE1A 4CBVA 5C5DA 4M1OA 1EBUA 2J5QA 3FDXA 4F9TA 3FZNA 1R8YA 4BFUA 2FN9A 3TNFA 3F46A 1NY6A 4UBJA 3NO4A 2H2HA 2Z2KA 3CVYA 1GPYA 1ULSA 4TLAA 1EFVA 4B3JA 5BP7A 2BJWA 1CUEA 1V3TA 4NZZA 1SVNA 3P71T 4LJ4A 3VYRB 4BHTA 2PJDA 1BVHA 4YAOA 3UG6A 3IV9A 4QLOA 3RC8A 1KXZA 2NO1A 1ZVMA 2WP0A 4FZJA 4EGSA 4KQEA 3ZI7A 5A4KA 1MORA 1JAHA 3T9BA 2HA7A 3C5CA 3U9SA 3M5PA 1GRNA 3I12A 3FPFA 3S2GA 1PG0A 5HRCA 3H2JA 4HDSA 1TUIA 1TZBA 4HQRA 2VTBA 5JO0A 3FWHA 4OXIA 3K32A 5E4TA 2UYOA 3WWYA 1W88A 3Q72A 4P82A 3ZDQA 5BQXA 3BS4A 1XO1A 4MDFA 2IQ5A 4JCOA 3QVSA 4RTKA 2AMJA 4G0PA 2BI8A 1MRNA 1P7PA 1RAHA 3IDSA 3EHEA 3DTVD 2CFIA 4HEA1 4MMYB 5HBGA 3WXMA 1YFJA 1J5EB 1MZPA 1Z3IX 1H2XA 3NHBA 1YHZA 3WLAA 1A9RA 5ICFA 4RVFA 3UT5B 1XVAA 3EYAA 3Q3EA 1Z6ZA 3DCNA 4Y18A 2CFOA 4R2LA 3JSXA 5CA0A 3AEZA 1DRKA 1SEVA 2WHEA 1KDTA 2OHFA 4JLOA 4O2BB 2OHJA 4LSMA 3TNDA 5I7SA 2FMIA 3LPAA 2G9QA 2O1EA 3JWJA 4UM8B 3VKUA 1FYFA 3L8YA 1KYVA 2JFVA 1UJMA 4PG4A 4HXGA 1L5HB 4IIJF 3VPDA 1M9NA 4E2WA 2JIPA 4IIUA 3UFBA 1NM5A 3DOFA 3PC8A 1QHIA 4V0RA 1T2EA 1H93A 4QBIA 3GLIE 2YWGA 4KLRA 1V1JA 4H59A 3BGVA 4WOPA 4KWHA 2GA9A 1KAMA 4U7JA 4X7PA 5DT2A 5EUCA 4HNTA 2ZUFA 4F96A 5GJBA 4ICIA 2NO5A 1NRWA 4DCSA 3KZXA 2GRUA 2ZRMA 4IQ0A 1NDHA 4MW1A 1W76A 4ZT5A 4BX3A 4NNJA 2GEJA 2XXAB 4QC2A 3OPXA 3IUEA 4CV3A 3ZDEA 5C8VA 5LMNB 1PFWA 4BLWA 3U3RA 1RJWA 3MELA 5LQUA 2ODAA 3V5NA 5IWAB 4KTVE 2B3DA 2OD7A 3T7RA 5A9RA 2I3BA 1A2BA 2D5LA 3MINB 2BGIA 2VQDA 5DT9A 2IZ1A 4KXFB 4TLDA 5SY9A 1IIRA 2WYWA 5I8WA 5AVSA 5J43A 1MNAA 1R3DA 5GPBA 4TOIA 4MYSA 3JRXA 2BBSA 1WS6A 2WTEA 1IIBA 3ESZA 3D4OA 4TWIA 5JNTA 1KZ4A 4MS1A 2Y8EA 3WIEA 1V1MB 4HDCA 4UOEA 3C0KA 4L0DA 4MI9A 1ISPA 1SUWA 2Z3VA 1SBHA 4KV9A 1KJNA 3A31A 4O33A 2G72A 4XD7D 2ZBVA 1RJFA 4G1VA 1TDJA 3FRJA 1BHSA 1T1IA 3SHFA 4D6XA 4E30A 5FRDA 2NSDA 3P9RA 4UBLA 2DYKA 4YREA 2V7BA 1S4MA 5HHTA 1SIOA 4JUFA 3MMZA 3N75A 1NNUA 2ODPA 3RD5A 5I4CA 3A37A 3Q7PA 3OFJA 1IZYA 4RORA 3RRZA 3UUFA 1LJLA 4KMOA 1XFDA 1LF0A 1GL9B 3WNQA 2HDOA 4IX1A 1I3CA 1OGYA 3V4PB 4EMTA 3AR5A 1NE7A 4MR8B 4YP1A 1XTSA 1E2FA 4KYUA 5FI0B 5AM1A 5DBGA 4UBIA 3I32A 5F21A 2C98A 2WSBA 2YRXA 5ELLA 1E2UA 3V4OA 5LQMA 3HCBA 3PKZA 1YSCA 4U3JB 4BCCA 1M5UA 1C7FA 1ZSVA 4XW2A 3MG9A 4A15A 4FIDA 1PFGA 3DBRA 3PEVA 3RNLA 1HGXA 3OKAA 4RQAA 3EOZA 1ECBA 2C1ZA 2VCYA 2FA9A 4IHAA 4Z86A 1OYYA 3EPLA 1USIA 3WGQA 4AXBA 3SEFA 4KDEA 1V8BA 3AETA 3I1YA 3INRA 2QVZX 1A8HA 3EAFA 3L6EA 5KYWB 4QEZA 4JYZA 3KXDA 2NVOA 1LD3A 4FHZA 5IWCA 5ILOA 4J0GA 4R1LA 2LTAA 3GJXC 2R96A 5A4DA 1DG3A 1RCFA 4HVTA 3CZ4A 3T99A 5LLDA 2ANCA 4PR0A 4CCWA 1QTQA 1LJUA 1R0RE 3QE9Y 2XB6A 1F17A 3DC7A 5BURA 5AVQA 4DJ5X 1W581 3K9QO 4XSGA 5ERGB 4UUOA 2AR0A 2AFRA 4ND5A 1R8JA 1RWMA 4RO0A 3RGGA 2EKLA 4LTMA 1CJVC 2W2VA 4BJ3A 4YDHB 4P31A 3VSAA 4DBLE 1Z0FA 2WTAA 1LGYA 1HDEA 2OKCA 1PDVA 4IZOA 4NBSA 2HLDD 4R8KA 5DXAA 4PPNA 4ZI5A 2WU4A 1PBTA 4KE9A 4ZARA 3D81A 4IGAA 4EZEA 1Z38A 4C3UA 2Q21A 4BO2A 4PO3X 1P3JA 2E3JA 1PZGA 1QR6A 3H9GA 3WP0A 5EZSA 1JQ3A 1T2NA 2XNDD 3FYUA 3FTEA 3M2PA 2IUYA 3I0ZA 4BOYA 1E3EA 4E0BA 1GN9A 1YS9A 5BR8B 1WDTA 1NLUA 2BGRA 2ZRDA 2ECPA 1P4JA 2VZ8A 3QFSA 2I7CA 4KW7A 2QQGA 4LW8A 1G8PA 3OJOA 2XZTA 1HFJA 1SKYE 1FW8A 2A4KA 2P2YA 3PR2B 5AW0A 1QH9A 4ZO8A 2IGTA 4ZO9A 1G19A 1V1RA 1TZMA 3WNDA 4Y2QA 7GPBA 3NWPA 3ADOA 5IT9A 1WMDA 3JD2A 3O4RA 2C78A 3AWIA 3W5DA 4HOYA 1SBTA 1U4SA 4NMXB 1E8MA 1YDGA 2AC7A 2X6TA 3GJ0A 3NANA 4H15A 4KQ9A 4L51A 4LBZA 5K8UA 2J6CA 1ORDA 3DHWC 1JPUA 5HPYB 3ZHSA 5L53A 3PE3A 1D2RA 1R12A 3L8ZA 1AMUA 3OHSX 3FYHA 4J7CA 1YRBA 4NH0A 1QYWA 5EZQA 4KMRA 1I2DA 3MRSA 4MW9A 1NVKA 3F5QA 1KZHA 4DR6B 4AS1A 2EJCA 4L4YA 1GLVA 2VRCD 1NQWA 5GZ6A 5A0TA 2FEKA 1LDEA 1QMPA 3DOIA 3FTDA 2W2MA 5K6TA 5EMMA 4R84A 3HHEA 3ZNNA 1ZI9A 2LE0A 1YKFA 2R6CA 3NC0C 4ZYXA 2VXYA 1VB5A 3PEWA 2VPTA 3OQOA 2VSOA 3BREA 1EWVA 3PX3A 1P4HA 4GL4A 1QYVA 4JJIA 3OLYA 3HCAA 4A82A 4WCFA 2ESRA 3HS3A 3G0BA 2Q4BA 2QMQA 4MARA 4DIDA 1S7CA 2GS9A 2I34A 4N0PA 1RRVA 2HADA 5FWYB 5FTWA 1FJXA 3A1UA 1PJAA 1KBZA 4ITRC 3RABA 1K6IA 2DTEA 2GA8A 2AG8A 2V98A 4GMFA 2YCBA 4EGFA 3F7NA 3HPRA 4NYJR 4FHDA 2QUHA 5GADl 4DNXA 1DIRA 2O8CB 1C7IA 4FOSA 4I19A 1X7WB 1VPVA 3GLTA 2I6XA 1X7GA 3VNSA 3ZI4A 3WLIA 1BZYA 1Z17A 5BMVA 5ITZA 3OH8A 4Q7QA 3NTLA 3PE6A 1BXZA 4YUVA 4DV0B 3II6X 3L7YA 1R4NA 1ZRHA 3ND8A 4URUR 3PEUA 1FP1D 4V39A 1D1TA 4KNYA 4KN6A 2EFGA 2ZT7A 4BLPA 4G4GA 4GFDA 1Q0SA 3RVKA 1LFAA 1NR5A 1R0YA 2CNBA 4ZVMA 2WTUA 2AIRA 4TQUS 2XGSA 5ALTA 4Q4DA 4FFBB 4G81A 6CHYA 2ZAGA 3A1EA 3H4IA 4RS4A 5B2FA 3FLEA 1ULUA 5K3OA 3CX4A 3PT9A 4DE5A 4Y8VA 2QLTA 2PIAA 4FJ1A 3R7WA 1NKTA 4YRCA 4TXLA 5DN9A 4E13A 3DZ8A 3JARB 3KZMA 3EIHA 1KTVA 1MRZA 1W2WB 2JVIA 5C4IA 5AYVA 4DCGA 2QOEA 4J4TA 4BDSA 1DBRA 3DDSA 3HSKA 3BTSA 3L0BA 3PEFA 5A3VA 3E9QA 1N2ZA 3TFWA 4YHBA 5FADA 4DN6A 4M1QA 4EVIA 2QTFA 5BV0A 1OH6A 1XZKA 2R48A 4PLYA 2PHZA 3KZOA 3P2JA 4RTPA 2G80A 5CT6A 4MB2A 4RD2A 5FYDA 1F6WA 1IHXA 1X92A 4MX8A 5K3CA 4F1JA 4GDFA 2VSYA 2IBMA 2YWDA 3ENKA 4ZVLA 1JPJA 2FF7A 4D02A 4EZBA 5CYGA 4QBFA 1YCDA 5D7NA 2JIZA 2ZANA 3L7BA 1U4OA 1ZM3A 4N41A 1EM8A 2AZTA 3X1KA 1H1LA 3O91A 1P6XA 3I6IA 5K09A 2V9PA 4EEXA 2MSEB 5CDSA 1DC3A 2A9PA 2FVXA 2MU1A 3CRQA 3KT0A 3OTQA 2WD7A 1HQDA 4EG0A 1RU3A 1SBNE 2XAAA 4X44A 3HXKA 3ML1A 5JV5A 1CR0A 2B1GA 4OMCA 2JF0A 5LBTA 3SX0A 3AV0B 3GGPA 3TW8B 3X2EA 4EY4A 2E18A 4MKXA 3REQB 4IRUB 1WXFA 2EDAA 3RCBA 3RH0A 3VQTA 1K8QA 1ECPA 3MWLA 5J4LA 2VAWA 3DXYA 1A9QA 3DB2A 4O0MA 4KL8S 5HKBA 5JPDA 4F3YA 3G6KA 1C9DB 3N7AA 4RIIA 4ZCQA 4XWGA 3RVSA 5DKFA 5BT8A 1U0NA 2OLJA 2VUUA 2K6GA 3OKFA 1BW9A 5I9NA 1G7SA 3V4ZA 1KERA 5K3BA 1JG7A 2ILTA 4FDUA 4J1NA 2O07A 1T2AA 1DEKA 2Q41A 2MTBA 5AWFC 4NEHB 1HX7A 2QZPA 1OQAA 3R5SA 4HNAA 1SC4A 1LW7A 5EEHA 2F2TA 3WLEA 2ZCJA 1WCIB 2R44A 4G0UA 2PZFA 4C4SA 4N12A 1FRZA 4DWOA 3TSWA 4FSXA 4YCNA 2CL7X 2OHXA 1F8UA 3B1VA 4WESB 3H2HA 1J5PA 1TI7A 3PVZA 4FFWA 4A23A 5FH9A 4XPIA 2WG2A 3LLCA 3EA0A 4YJGA 1WA5A 1YGPA 1DINA 5LXTB 1WUHS 2PVCA 1QQ6A 2XYHA 1SO8A 3RNOA 1C8VB 1SZJG 1W5SA 4PSDA 1N7GA 4NZPA 5J5VA 3RBXA 2VDWA 3PGXA 5ALPA 1QCZA 3ZH9B 4D1YA 3BL6A 4PM4A 2PBRA 5GY7A 2FHSA 3RYCA 5L4SA 4A2WA 4LKOA 3U3OA 2WEKA 4DPMA 3VNVA 3FTQA 1GWNA 5BMVF 3B6KA 2WFAA 2CUNA 1WF3A 5JMTA 3D0QA 1C41A 4MR7A 5DXJA 3FDZA 2IYFA 3CEHA 4AW9A 4DIBA 2WILA 3KKPA 3VO9A 4B7CA 2Y0PA 3ZHVA 4EHBA 1DWPA 3LWDA 4HN9A 4JBLA 3UHAA 1V4VA 1RQRA 4LCEA 2XYVA 3DDUA 3LOPA 4MIYA 2EF1A 5IDWA 2JA1A 1BE1A 1JHXA 4RZIA 4W7HA 2ZR8A 2Z2XA 1JIVA 6ABPA 2DR0A 1R0XA 1NVWQ 3FMVA 3JQ6A 1QHFA 4HPWA 1M5TA 4JX9A 3T7CA 2HH9A 1RC0A 4FT2A 1AKRA 3OTGA 4JY7A 4PINA 4PYKA 3A14A 2PS1A 4KO1S 4TN1A 4MK4A 1ULTA 1GQFA 1VKZA 2Y6VA 3CKLA 1UDWA 2YJ6A 1J21A 2X22A 3AR3A 4NEGA 4U39A 2PD3A 5BSGA 5CDHA 1ZMBA 3SBEA 2XKBA 4YJFA 3P5SA 1GPH1 2GZRA 3DE0X 4R40A 4CIWA 1NVMB 4A91A 4MAAA 1OGJA 1P62B 2IU4A 4MR9B 5EY5B 3GLQA 1NV9A 1ONOA 3GMIA 3RSSA 3ICWA 2G5CA 2IYLD 1IDOA 3PHIA 2W6NA 5B1YA 3P27A 1UCFA 2AW3A 2OVBA 3VOAA 1HDYA 2HU8A 4FFSA 5AKIA 5EWMB 1U1CA 2AE2A 2WZDA 1BG6A 3I9LA 3KPJA 2IV3A 4D42A 4ZCIA 2WMDA 3H0KA 1OA1A 3K73O 3PQEA 2H1CA 1G6KA 5FXMA 4DC0A 2KQUA 1X7ZB 3N2GA 4N0EA 4RU1A 2CCKA 1LRJA 1KH1A 2WD8A 4RY8A 2VDVE 4IS2A 3ZJ4A 4ZYYA 3N5CA 3AQ4A 1R2QA 2X0KA 1HNNA 3C3DA 2ZYTX 1MB4A 2Z8XA 3U3ZA 1IM2A 1JV2B 3ZUGA 5ITWA 2JHAA 5JO9A 1PR5A 3R3HA 1A82A 4AROA 4BUJA 4G0NA 4ZHQA 2QR3A 2BSXA 1OLXA 2H5JA 4WKOA 1LS1A 1PZNA 2GF9A 3COYA 3DP9A 5FBVB 1KTIA 4TZ6A 5HF9A 1FX0B 1M7GA 3AG6A 2AFIE 3FN4A 3AUYA 3U13A 1EUCA 2NXWA 3AHEA 4TWZA 1NI4A 3GFGA 1ZICA 3O4IA 3JCZA 2DPMA 4O59O 2BFPA 1OILA 3QTBA 5DEIA 4AVYA 4GECA 1JA0A 2CNWD 5JANA 5HGXA 1UKAA 2Q5JA 2LDXA 1SOWA 3QVKA 5LNK1 2AMVA 2QG9A 1XX6A 3BSSA 2GAIA 3PVSA 3GY0A 4Y3UA 4XOUA 3WRYC 1KJ9A 4LHZA 5F77A 2IY8A 3HBFA 1DKMA 1XCBA 4GPTA 3NKLA 4MYHA 4ZQFA 2FPKA 4XR4A 1JIXA 3R5XA 1R50A 5I8ZA 4AG6A 1T9BA 4OM8A 1U0BB 1MO6A 5FA8A 4C05A 2Q27A 5ER6A 1LDNA 2VK4A 4HDNB 5C8ZA 1P33A 3HBAA 2YDXA 4ZODA 1PBNA 3GCDA 4BEVA 2B4QA 1F5NA 3IV6A 1TA4A 2IP1A 3PQ5A 1EP3B 1K66A 1NVVR 4MV3A 1TKCA 1ZO8A 3AHJA 4TM7A 5E38A 2QHXA 3PTLA 4DADA 4N47A 4FCTA 1JG6A 4MYRA 3HO8A 3LUPA 3WHLA 4OM7A 3KSDO 3OICA 3HBMA 1OAOC 4CMGA 1XVUA 2D5IA 1QF7A 2FWAA 4GIBA 4X63A 2HQ1A 1JN0A 3DFMA 1PLJA 1VECA 3DMFA 3QH4A 4Q02A 3OT5A 3E2IA 5IN4A 1G6OA 4EUFA 1QIDA 1RHQA 1ZG3A 2I66A 3IPXA 4CUJA 4CKZA 2CB0A 3A32A 3QF4A 4XQ0A 3FNRA 4RTJA 1I1QB 1ZOOA 3HCRA 3KJNA 1RI4A 3LT5A 3ZK9A 5JXWA 3O1HB 2O57A 4YAJA 1BXKA 1G63A 5IVHA 4Q7KA 1IG3A 3W5CA 3B53X 3FPHA 1CRZA 2XE8A 1ORIA 1BGVA 1OT5A 2IU6A 2RHGB 2XF8A 1AKUA 1JIIA 1H2EA 2IXFA 2YXBA 4M46A 5AI0A 1JXOA 2WJPA 4A8JA 4LOHA 2XB2A 3L43A 1I6LA 4P7KA 3MMNA 5DTEA 4ZYVA 1KYXA 1B73A 2R8BA 3UMSA 4HNRA 4ROTA 1T1JA 1M67A 3G1WA 3GXOA 4IIHA 2M32A 4HDNA 3IUYA 1AKTA 3RJZA 3ETNA 4WCDA 3UV6A 4K1LA 1WM1A 2FUKA 3PXCX 3IILA 3V9PA 4FLEA 2AH5A 2IZ0A 3UXYA 5AUNB 3N39C 4DRZA 4E5SA 3LP6A 3E05A 4V24A 3E1GA 1DAHA 5BMOA 4ARIA 1NULA 3BIJA 3GRFA 1BHQ1 2FW7A 3QWAA 4F4FA 1QCCA 1HDZA 4Q3EA 3GEDA 1HH4A 4EZIA 3K20A 1GTVA 2GGSA 1IL0A 2ID8A 3BMNA 2QMZA 2D2VA 5KTRA 1ZUNA 5ANRB 1OTYA 2XRFA 1NAHA 5KWJA 2ECQA 1WE2A 2I7TA 4XI9A 3WLHA 1RLJA 1X0VA 3HZZA 4MV8A 4KVZA 2PU7A 3PSAA 1JLLA 2PRYA 3GQVA 3HY3A 3NYQA 4H4CA 3WL4A 1NDQA 2VYQA 2ZIGA 2CKDA 3DHYA 4C0HA 2X14A 5HIKA 3NH6A 2P3SA 3ZWNA 5B12A 3R7DA 3SWWA 1TM1E 3LLUA 2P1DA 3D8RA 1HC7A 1QLHA 3GCGA 4DYHA 1FQWA 1WLSA 1Y1TA 2F4NA 5J59A 1QV9A 3PEEA 2AA3A 1SOUA 5C4MA 1KJIA 1UMBB 2C3UA 1M2VA 1EUCB 3LI2A 3VPBA 3WK5A 3H2GA 5G1PA 5MGBA 3NWBA 2VHWA 1LPPA 2EC5A 3D5QA 4GPD1 4W7SA 2IV7A 1BGWA 3ONDA 2W6CX 1WXEA 3ITNA 4M9RA 5FOXA 3R8CA 1PZMA 3TD2A 1E2KA 2EERA 1N78A 4ZCTA 1NLMA 1HE3A 4OFXA 4B2PA 1YZVA 2BGJA 2GD1O 3BSWA 1MC1A 4K6FA 4EPXA 4X6YA 3H6HA 3T7EA 3ZOZA 1W34A 4C6RA 4CIAA 3SKXA 1MENA 3SEAA 1DGQA 3ZU3A 3IPLA 3SYTA 1ZUNB 4HMOA 1D6SA 1W6UA 4HD8A 1GGFA 2NQTA 2NU7A 2A7QA 3R0ZA 4M53A 5HCNA 1Q1AA 5MF6A 5B4TA 5JZBA 4OA8A 1NBMD 2A1UB 2AVNA 1M83A 1OBCA 3RODA 2IPLA 2C29D 3NHRA 5H59A 2GHQA 4B31A 4XIJA 2OC4A 3CYFA 1FSFA 2YXPX 3KQTA 3EUFA 5AFSA 5FPHA 4MCIA 3ZHUA 3D3WB 3HACA 4W1SA 2D2IA 4ZMBA 3WA7A 2VJOA 2Y68A 3A6GA 3W5UA 5F5XA 4TVSA 4G0QA 4JKIA 4OXYA 1N8TA 1NSFA 3GD5A 1HKHA 2C5BA 1RVV1 2EGUA 5EVJA 4DQXA 4FGZA 1CX9B 4HNSA 2PY6A 4DW8A 1IHYA 3CVWA 3TTVA 3WYGA 1ZD3A 3MRTA 4LZLA 3GBPA 4JJ8A 4O5AA 4BO4A 5JWHA 5I7EA 2ZI4A 3ZE7A 3EZLA 2H2IA 4LZPA 3OZIA 1HQYE 5CIWA 9LDTA 5J1SB 2YQ5A 1E6UA 2AUTA 2OHIA 4EQ6B 4D26A 3UANA 1NP7A 2O3RA 1XWWA 1S4QA 3AUSA 2ZWAA 5CFPA 2YOFA 3IL2A 1JLKA 1ELOA 3D02A 3Q88A 2OFOA 3R6DA 1N8KA 1TADA 3R4CA 1E2PA 1KS9A 4IIDA 4LJ9A 5H83A 2YINC 4QQFA 1EWKA 4IPTA 1N6LA 2R1UA 2YOHA 1EZZA 1R00A 4JP5A 1NTOA 4K9KA 4FFNA 4ZAZA 2IODA 1Q12A 2OCGA 4NV1A 4BVFA 4FDAA 2YDYA 3NBUA 1H2RS 2F00A 4TMYA 4Y6GB 1PQWA 3GC6A 1TM7E 3G2HA 3IQDB 4KB5A 2CV0A 4I55B 2I3DA 2Y6UA 5AW8A 2AEMA 3KTDA 1XA3A 3C2QA 3QA3E 1XJWA 3UGQA 1B0UA 3HLYA 4QUJA 1JR3E 4W5NA 5JRZA 1JYSA 3KQOA 5GWXA 1VLZA 2WE8A 3UCXA 2QLMA 3E5NA 3BMNB 1VGVA 3K94A 4CMAA 1W4CA 3ZWCA 1AHIA 1OBVA 1G4AE 1DPFA 4JQSA 4XVRA 3H1EA 2XVYA 4BVJA 4JC0A 2OORA 1ZXXA 2NTVA 4B9EA 1VM6A 2VNSA 4X62B 1I3LA 2ISSD 4PCVA 3VR4H 3D0KA 2OMEA 2BFEA 4CTJA 3O8RA 1P0PA 1T5DX 3CSUA 4QRHA 4ARBA 1IN5A 2JVKA 1U1IA 1IQPA 5FTKA 1RPJA 2WAMA 3I5MA 5A6VA 2ZB7A 1WTAA 3HGTA 4XB2A 4LVNA 4CLRA 5FKJA 1G60A 4C78A 2JZNA 4YJKA 3JASA 3SDBA 2B9VA 1G3IA 3TMYA 3N8NA 1DBWA 3VYTB 1D9XA 5JPIA 1Z4OA 2J3IA 3CZAA 3EZFA 2JAOA 1E6KA 1WIWA 2XAUA 4FDMA 2IVZA 2YYSA 2C9CA 3GQBA 3K0HA 1YRAA 1B42A 3DC2A 1HT1E 4UDOA 3G7UA 3S2YA 5C5CA 3MC1A 5K03A 1XQWA 3JQ9A 4LDPA 3F71A 3WG9A 1KJWA 1T25A 4FEYA 1DRUA 4ZOEA 3GLFB 3A6KA 1VMIA 4H31A 4L5BA 4RJ2A 1CG6A 5DTQA 4D97A 1DJOA 2IOQA 4J90A 1FRQA 1KJ8A 3ZV3A 2I9PA 2RI0A 1F6BA 2VYVD 4D4JA 3DGEC 5J4YA 3HKBB 2HDNB 4R2KA 1A77A 2HK8A 4KIJA 3T9FA 2WSYB 3KR9A 4M8NE 1E92A 5T8KC 5AW7A 3DVAB 2ZI3A 4LAFA 2ECFA 4TS9A 5BSKA 2PT7A 2OGWA 4ZTBA 1JSZA 3CURA 4BZXA 1OFUX 4JX8A 1HEYA 4F8EA 1XAHA 5HJ5A 5L3ZA 1L7OA 4MUYA 3HCOA 2YHIB 3DZGA 3IUMA 4NU6A 4FI3C 4XH9B 2PUHA 2DHCA 2DUMA 3BH6A 3GRUA 1BS9A 4XIGS 3SC2A 4QPZA 2R5NA 2ACEA 4DA0A 1CY8A 1HQCA 2O3TA 2R6GA 3OECA 3NV7A 3P0HA 4GZ3A 4BBAA 4D9IA 4RD1A 3SI7A 1NR1A 5JBNA 1W25A 4XA8A 3QKSB 3FPGA 3H5VA 3EDQA 3IBSA 2C57A 2P9QA 2JGDB 1US8A 1C5KA 1G5IA 2CZQA 3D0OA 5EIBD 3NM4A 2C8VA 2YH2A 1ZL2A 2F64A 4G9EA 1K0UA 4Q9LA 3ZUPA 1N0VC 1U2GC 1ST2A 3S28A 1B8OA 4XB6B 1TVKA 1T4CA 3KBOA 3DAGA 4PLFA 3ZN2A 1VG9B 4MV0A 2HPHA 2BFBA 2E5LB 3ND5A 3QLJA 5FL7D 5IC4A 5AKYA 2Q9CA 1X1BA 4H08A 3JARA 3VKGA 1MPTA 2H7XA 1JDVA 4KN5A 1ZH4A 4NBUA 4P3OA 5AKZA 4UAJA 3N0RA 1A9SA 4FDTA 2DKOA 2ZDHA 3SX2A 2J85A 1DC4A 1UBMS 2FJPA 1ZFNA 4G5HA 2A9KA 4TWAA 1GFZA 3I9V1 4S24A 1OASA 2BFCB 4HRYA 3K0FB 3NRCA 3DVRX 4LPKA 3JU3A 5HFNA 2J9RA 1YOVA 1FSGA 2CXHA 2GZAA 4B82A 1O8CA 1OMOA 3USCS 4NPCA 5PGMA 1X77A 3TDNA 2Q4DA 2XMRA 5JARA 1N2CE 4JWTA 2VNIA 2VUIB 3DCJA 4FX2A 2EU8A 4QTYA 2VK1A 2H48A 1WMBA 5E1BA 5DYGA 4ZEWA 3WGGA 1NMZA 4B3IA 1AZSC 3ZDFA 3DAFA 3H1AA 1XGKA 3BK1A 3EYWA 2G1UA 3B2NA 4O8CA 1VE1A 1FTWA 5EMKA 3RVOA 1PSWA 1P1BA 3BX1A 3SXJA 3WGHA 4DIMA 1A9OA 5IHPA 3I2IA 1Z45A 1YULA 2BP7B 3P1JA 5AJUA 3A2KA 2ACKA 2HIGA 1GSIA 2QV0A 3DNMA 3MWFA 4JJ6A 1L5KA 4C30A 2OR3A 1EK0A 4IDPA 2XGMA 1XAIA 4IM7A 4J0EA 4YT4A 1WUJS 5CDGA 3REQA 1TXGA 5IAAA 4ZOQI 1EB9A 4RFSB 1NVGA 2J5BA 1QNLA 3E2MA 3KYCA 3PQFA 4ALLA 5BSWA 1TK9A 2LRHA 3VC7A 3WYAA 2NXNA 2XEDA 3PLNA 1Z35A 1EX9A 3ERCA 3E61A 2AFIB 2ZUBA 2XT6A 1TM2A 1IRXA 3M5CA 2W4QA 4QBGB 4L6CA 1HFKA 1Q1QA 4H7IA 5FOQA 1WXIA 3LECA 3OM1A 2PRJA 4IW3B 3WISA 1YD7A 1KXJA 2E5FA 3WBFA 4DREA 2XBMA 1W5EA 1PZHA 1T0IA 2HJRA 5JC1A 1UBFA 1CDEA 3OM0A 1LZLA 3D6MA 4JAVC 5AJVB 4Q1BA 1B1AA 2DR3A 2X7XA 3WO1A 3ZLTA 3N2EA 3RU9A 3W05A 3EQ9A 4FFOA 5C1BA 3CH7A 1VJRA 3BXGA 3JD0A 3QOWA 2O7SA 1Q1BA 1T9ZA 1KSFX 2QSZA 4PHCA 2W2QA 4AWXA 3NCTA 1Y42X 1PJ2A 2XUPA 4UEQA 5B58C 5BSVA 3VR6A 5AW2A 5DNAA 5AW4A 4PZEA 3SJBA 3T1NA 3LF2A 1HL7A 1BOOA 3VJMA 4HUQB 3SC2B 1NWHA 2VEDA 1DKNA 3NMUF 4CQNA 2QTWB 1Y8AA 3PQ4A 1EJBA 5CW1A 3H0EA 3S6JA 4AMUA 3LGAA 2DZDA 1BRTA 3ZIDA 3U61B 3NDBB 4DLVA 2QY9A 1E2GA 2FFRA 3F7TA 5IJAA 2W2LA 1CDDA 1AZTA 3V3KA 1KIMA 1NXSA 3KC2A 1C7ZA 4C2TA 3V7UA 5BN4A 3KWMA 1MH9A 3KJFA 4P2GA 4XFKA 5ICCA 3N6XA 4N49A 4UBKA 3ZY2A 1N92A 1XMJA 5CT4A 1A4RA 3PA8A 3CQ9A 2Y2UA 2BD0A 4PCUA 4WNAB 3WMFA 1BTOA 1Z12A 2YWCA 3C6XA 4PTZA 4Q6BA 3VBCA 2JAHA 4AXXA 5KNBA 2CDBA 4US0R 1V25A 5LJLA 5HG0A 1FU7A 2L42A 2X4GA 4Q7EA 3AHIA 4RAOA 2QTBA 2YJNA 3ZCSA 2R8OA 3JVUA 3UAGA 4ENPA 1LBQA 2QU8A 3TQFA 3G2IA 3A11A 2XCIA 5DW3A 5CURA 1GUYA 5EGNA 5IYZB 2ROQA 5CVDA 5FULA 1AM4D 3PFBA 3EXIB 1UP7A 3PENA 1SBQA 4DGQA 2BGNA 1PX0A 2Y05A 3FUTA 1HDCA 3PEYA 1T5OA 3LT1A 1C9JA 1T9KA 2PQ2A 3PIRA 5TJ9A 3U7IA 3EH1A 2DHQA 4ME6A 1OCEA 2OQIA 1NU8A 1B0ZA 1NRIA 1Q92A 3QU2A 4BNJA 2VSFA 4F12A 4G5YA 1K1EA 4XUEA 3C6ZA 6LDHA 4BAGA 3RS0A 1F2UA 1X7HA 1UPTA 1VBKA 5L8VA 2FWJA 2G4LA 3SE0A 1KETA 2Q2OA 2PX5A 2PEYA 6REQA 5FPQA 3AF5A 2GPBA 1A1VA 3SBOA 1NP3A 2EP8A 2VP0A 3S1AB 4D74A 1FB5A 1BHO1 5E3JA 5IASA 4FJ0A 4AJ9A 2KB0A 1TKRA 4CRWB 2C9YA 1GTG1 2J7PD 3L6CA 4C7OB 1FRVA 1OX6A 4B3SB 2V0GA 3O9VA 2JC3A 3L79A 3PWZA 4WNYA 1YTLA 4U4AA 2CVPA 2XJ4A 1VC2A 3ICOA 2XMCA 3O3NB 3OEEA 3SSNA 3TQTA 4WOKA 5CEFA 5CR9A 4HNHA 4Z99A 3A3OA 2GVZC 4Q18A 5EQTA 1CVRA 3LDFA 4OHFA 1DI0A 1JXAA 1R4AA 3QKTA 1A8UA 1EK5A 1W35A 5GTDA 2A9RA 4AUKA 1XOIA 4G9GA 1E4EA 2UZ3A 4QG7A 2WV7A 2B2NA 1HNXB 1ST3A 4RIGA 1CP3A 2F59A 1XKQA 3FB4A 4L95C 4O4JA 4TLCA 2FTKE 3X1WA 1W46A 2GYYA 4AX4A 2DTDA 1UAGA 3T1OA 3GDWA 1L5ZA 1TEXA 3CGGA 4BRWA 1CEEA 3IPAA 1TEZA 4C88A 1IZ7A 2OSVA 4IV0A 4EHFA 4BNMA 1CIJA 3D4PA 4G01B 4LGVA 5FYQA 1W4LA 5IXYA 5K8LA 4KQJA 2Q2QA 3GJ7A 4M76B 4OMUA 1AKVA 3PQ7A 3WXBA 4D99A 2H85A 4PNZA 3EWIA 1N6PA 3KPWA 2JLBA 3QZUA 5A7FA 4MW0A 5HOEA 4TLLB 1G7RA 3ON5A 3EBOA 1T0BA 3RSOA 4P4TA 3L4BC 4FYVA 4CM4A 1KK3A 1I4OA 5ECWA 3NTRA 2IT1A 3WK4A 1NSYA 3OTWA 5AVWA 1HDGO 3AYZB 3GRZA 1U0TA 2XZDA 3IT2A 4JJ4A 1BQEA 2QUZA 1LNZA 1L8AA 4WUTA 1GR1A 5C1PA 2J45A 2EFEB 4HB4A 1W73A 1W87A 2BEUB 4JKYA 5EI5A 3GLIB 5A2QA 4PAWA 3C4QA 1CBUA 3GXBA 4BKMA 5JYEA 1VBNA 4OGFA 3B6EA 1YVPA 1A88A 1U5BA 3OFVA 4TSKA 4OQFA 1GPMA 2XLBA 1SZCA 3IP3A 4GWGA 2VXBA 3IRVA 3EGIA 1XCOA 1ZOSA 5IH7A 4YP9A 4L5IA 3ORSA 1P5HA 1XEWX 1U90A 1V0JA 3N7UA 4IHKA 1ZJ5A 2RAVA 4E6PA 1H22A 1JB1A 4QBHA 5ALHA 2IYAA 3RANA 3FX2A 3R3JA 4WCVA 4BO5A 1PL0A 3A1WA 5K0TA 1L0BA 1T6YA 1PEKE 1QVAA 3PJGA 4RZQA 1MAVA 3TX2A 1E2QA 1WDMA 2MIIA 2G36A 3BORA 2Y1WA 3D3QA 4A5OA 3PWSA 2VT3A 4W8HA 3TBHA 4BZPA 2H06A 2IS6A 4J91A 3GOHA 3Q2IA 3R7SA 2CF5A 5G02A 3VZQA 2I8CA 4QVIA 2QBYA 3VSEA 1GZ3A 1KHHA 3AW8A 1YB6A 4QRIA 3X2FA 5BSFA 1S8FA 4OEHA 2XOEA 4XIYA 1JR2A 3EOBI 5HKLA 1XCGB 1YI1A 3FVVA 5KHAA 1Q0LA 3E03A 3R7BA 2IFTA 2HCTA 4HWPA 3UAZA 4FN5A 4N40A 5JCZA 1Y8RB 5ARCA 5C1DA 5JDIA 2B1JA 4PQFA 2XDQA 1OB2A 1GTSA 5FWXA 3Q5DA 2XNHA 3RS3A 2B7CA 3CXRA 1TRHA 5JJLA 2AFHB 1TQ8A 4BNNA 3GHHA 1ZMTA 1GHTA 1IHUA 1Z5NA 1QTIA 1XF1A 1HK7A 4NAHA 4YT2A 4MDEA 4XRGA 5TS2A 1VJ0A 4BS9A 2XUIA 3KV1A 1TPZA 2RGXA 3H1TA 3NTVA 3KLPX 5JNWA 3LKVA 4ZEXA 3OZVA 3C1TA 3PUXA 1U2QA 2WOOA 1IULA 1O6FA 2L2QA 1W44A