2RAFA

Crystal structure of putative dinucleotide-binding oxidoreductase (np_786167.1) from lactobacillus plantarum at 1.60 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
MEITIFGKGNMGQAIGHNFEIAGHEVTYYGSKDQATTLGEIVIMAVPYPALAALAKQYATQLKGKIVVDITNPLNFDTWDDLVVPADSSAAQELQQQLPDSQVLKAFNTTFAATLQSGQVNGKEPTTVLVAGNDDSAKQRFTRALADSPLEVKDAGKLKRARELEAMGFMQMTLAASEQIGWTGGFAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative dinucleotide-binding oxidoreductase (NP_786167.1) from Lactobacillus plantarum at 1.60 A resolution
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Oxidoreductase
molecule keywords Putative Dinucleotide-Binding Oxidoreductase
total genus 60
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rafA01
4K28A 5DF1A 4B4VA 1MV8A 2BFAA 1NQ5A 4TSKA 4YJGA 4FCCA 3CMMA 1DSSG 4JIGA 4O63O 4J0EA 5DBGA 5ILOA 2B0JA 2Q46A 4Q3BA 4Y8VA 4YEDA 3H7AA 2DTXA 1T2EA 1EVZA 2F1KA 3E18A 4B7XA 3I9LA 4XQEA 4ALLA 3ZU2A 3AUUA 4LISA 1DRVA 1GR0A 2JD0A 5BQFA 5C7IO 3AM4A 2D0IA 3WGZA 2FZWA 4NFYA 5L7YA 2NLOA 2YQ5A 1N8KA 2QIOA 2HMWA 3ADOA 3FBGA 3I83A 4IZHA 4ROSA 1YB5A 2WD8A 4NBUA 2EW8A 4IXWA 5F1KA 2ZYDA 2JCYA 4I8XA 1H6BA 1N9GB 4DUPA 4PLFA 4DQUA 2C7GA 1LSOA 1XG5A 1ISGA 1Y9EA 5ER9A 4FOOA 4FFOA 3R3JA 3RQSA 2D8AA 2BF7A 3HZZA 5ITVA 3K96A 5DBIA 1F0YA 4IUYA 1I32A 4BKPA 3EVNA 4RQTA 2FN7A 1VPDA 2I6TA 4IMRA 1ONPA 3BXXA 1A27A 3FR7A 3EW7A 2RIRA 1YVEI 2GN6A 5JFOA 1XGKA 4FC6A 4AJJA 1DC4A 4CLOA 1BGVA 1XQ1A 4EUFA 1MGOA 3GF4A 2AG8A 3E8XA 1IL0A 1IB6A 1ZUD1 5TS3A 3ZZNA 2VT3A 1V3TA 3CH6A 1O5IA 1OAAA 1JDJA 3P19A 3H6KA 3ZHZA 2AMFA 4PGFA 3H3JA 4F3YA 2Z5LA 3R1IA 4PLPA 3GVHA 2NVUA 3VTFA 3AY6A 3LT1A 4IDEA 1NQTA 1GPDG 1JN0A 4BNXA 5B4TA 4XJTA 1DAOA 4CQMB 4PVDA 3RKUA 4JX8A 1E6WA 1JVSA 2DPGA 4YTEA 3RUEA 4IBOA 1NAHA 2FMUA 3DO5A 3DQPA 5CDGA 3GGGA 2VZ8A 4TKMA 3ABIA 3PPIA 1HKUA 3FPLA 1YBVA 1LI4A 1YGYA 2AEMA 3IMFA 1B8PA 2HAEA 2NWQA 4CV2A 4EZBA 4CV0A 5HS4A 5GZ6A 3K9QO 3QWAA 2UUPA 1C0KA 4BV8A 4BVAA 1GY8A 1A7KA 4W7IA 5JAIA 1HLPA 2JJYA 1K3TA 1XA0A 2DBRA 4KDEA 3S2IA 1P74A 1VKNA 3OM9A 4MVJI 3C1OA 1QLHA 4RVGA 4D79A 1XDWA 4J1QA 3GVXA 2FSVA 3P2OA 4MJLA 3RROA 1IHYA 1GZ4A 3WGOA 4CQMA 5A03A 4B3HA 4NMHA 3I52A 3OIGA 4LVCA 3I9OA 5ER6A 1OOEA 2PH5A 3JYPA 2O4CA 2ZTVA 1WDMA 3EZLA 1DIRA 1VM6A 3PFFA 3ZI0A 4BO8A 2ZB7A 4N7RA 3WTBA 1HRDA 3GDFA 1BRMA 3RIHA 2YV3A 1QLJA 3LLSA 4PZDA 4OM8A 3ZV3A 3LU1A 4ESOA 2EIHA 2VRCD 2YHIA 3CEAA 2YUTA 1MB4A 2C54A 3CSDA 3DB2A 4YJGB 4R9RA 2J5QA 3NRCA 5AOVA 2I99A 3H2ZA 1V3VA 2DC1A 3RASA 1ULUA 5A1TA 3JQBA 2RHCA 5KNLA 1MXFA 1VRWA 3K92A 3HG7A 3Q11A 5I9NA 3GN1A 5DOZA 3H9JA 3ORFA 3PWKA 9LDBA 3RUDA 5I7FA 3KSDO 3L9WA 2CMDA 4ZQEA 1V9LA 1SEVA 3NYWA 1Q0LA 1TT7A 2JAHA 1H93A 3C24A 5COAA 3UFXA 2JFHA 3JYOA 3BYZA 3FNEA 3PHGA 1JQBA 2O2YA 3ANMA 1YB4A 2DLDA 2JD2A 5AXDA 5G0SA 2BMAA 5FEUA 3NTRA 1U3UA 4P4GA 4R1NA 3ZV4A 1I33A 1VKOA 3K5PA 2DM6A 3FD8A 4DL9A 4DRYA 2W98A 3PJEA 4Q3NA 1Y8RA 3HADA 4HY3A 4J2OA 5I9MA 4C7KA 4GGOA 4IGEA 5ADHA 1PS8A 1PJBA 2Q4BA 3HQ4O 4KQWA 2YV1A 3MJTA 3JQFC 4UUOA 4D0RA 2G82A 1HYHA 1MX3A 4J3FA 2B69A 4TQGA 4W99A 4WLNA 3V1UA 2DBVO 3KSZO 3GDOA 3PGJA 4M54A 2Y1DA 2PKQP 4LRSB 4UUPA 5JC1A 1PGQA 2VYVA 1V3UA 1TT5B 4R3WA 3VPHA 2GERA 3KLMX 4A7PA 1KETA 5JO9A 1I3MA 1NBOA 2EV9A 4M8SA 3JD0A 1S7CA 1NP3A 1UZLA 4WNIA 4CQLB 2X8LA 3KLPX 2DTDA 3CIFA 4E6PA 5HTOA 5TC4A 4AJPA 1VJTA 3I4FA 1KY4A 4DMMA 5JPIA 3VTZA 4CM5A 1HZJA 2FR8A 3PZBA 1SNYA 4D43A 2Y0EA 1EVIA 4MP8A 5JMPA 3BMCB 3H65A 2DVMA 3ZW8A 1JLLA 4BKOA 3ZN2A 1PGJA 1UUFA 3KZVA 3JQGB 1X14A 3WGYA 3HUDA 2BKAA 3OIFA 4HUJA 2DBZA 4JLWA 4XYGA 3SC6A 4A73A 1N1GA 4RF2A 1F12A 3ZU4A 1QYWA 2ZTLA 4L4XA 1AHIA 1Z73A 4DIBA 3PZRA 3TDKA 5TJ9A 2HJRA 2X23A 1XU9A 4IJUA 3RFVA 1MUUA 3E9QA 3JYQA 2X4GA 3IP3A 5KOIA 1KBZA 1N1EA 4OOFA 2AW5A 3GAZA 3LC7O 3D0OA 3KYDB 5BSHA 2CY0A 4H15A 1ZJZA 3ZWOA 4D3FA 4Y67A 1EDOA 3IP1A 3RBZA 1JKFA 4XA8A 5BR7A 4QEDA 4GMGA 4YPOA 3N58A 4L4SA 2BFOA 2EW2A 4W4TA 3NTQA 4NJOA 4XQ9A 3LF2A 3OEWA 3OP4A 4BNJA 1QKIA 2YQ4A 2GPTA 3LYLA 1YONA 3UHAA 3WR5A 3GHHA 3DZFA 3RC9A 8ADHA 1EBUA 4EBFA 5A9SB 1X0VA 1YDEA 4LN1A 1OI7A 3OHSX 2BELA 1T2FA 5DT9A 1OZAA 5IN4A 3M2TA 3S55A 4XB2A 4BO3A 1E1NA 2EERA 3H9GA 5G4LA 5U1PA 5GZ1A 4TZKA 2OGUA 2X22A 4Y6RA 4PN3A 2Q1TA 1E6UA 1QV6A 4Z0HO 3AM5A 1O89A 3NGLA 2DFDA 3I9NA 3UCFA 1L7EA 3NAQA 2C2YA 4IDFA 4DQVA 3CZRA 4PLHA 1PGNA 3E03A 1GPJA 3D3WA 3RBVA 2RH8A 4DPMA 4XR4A 1CQJA 4E30A 2ZYGA 5DOVA 4WEQA 4HKTA 1YRLA 2CF6A 4XX0A 1EMDA 1ZK0A 3OA2A 3KYDA 3HSKA 3CXRA 4FSHA 2FR0A 1A4IA 1N5DA 1VJ0A 2J5KA 2WEKA 4DLBA 3IQDB 1GQYA 2FY8A 3C7AA 4WLVA 4RCVA 3H8VA 5IAAA 3O4RA 2AEJA 1P45A 4FFMA 1Q0HA 1Z7BA 2D1YA 2Q4EA 2GNAA 4JBGA 1UDCA 3WIEA 2D2IA 2WMDA 3FF4A 3MOIA 4EEXA 2H9IA 5KIAA 1FDUA 4OJNA 3BTSA 3OEYA 3SVTA 3D1LA 2R6JA 1ID1A 2X7HA 3LT2A 3ZW9A 4BNVA 2W2LA 2VRCA 2I3AA 4MIEA 4U8GA 1KEVA 3I3OA 1SCUA 1HE5A 1AXGA 1E3LA 1ULSA 2GRAA 4E2XA 3DBHA 5EQDA 5F1PA 2NSDA 4QFCA 2QRLA 3JQ8A 1Y81A 4R5HA 2X58A 4YRBA 3PWZA 3VPSA 2ZIZA 4XB1A 1ISIA 2AEFA 3D3EA 4PFJA 3LLVA 5A9RA 1O6ZA 1N7HA 3W8FA 1ZMTA 3AU8A 3L9XA 4I5FA 4CUKA 5ICSA 4FGSA 3GPIA 1HSOA 4FDAA 4RPLA 1NWCA 1C1DB 3NJ8A 4JQCA 3TZ6A 5KJ1A 4BUCA 3OJLA 3GA0A 1Y1PA 3HDYA 3AOEC 5B12A 3GDGA 1PJLA 3B70A 5T5QA 3OJEA 4HFJA 2ZATA 1NXQA 1C0LA 5FF9A 3SXPA 3I23A 2VOJA 3BTVA 4G81A 2FWMX 1RPNA 4WEOA 1SB9A 5K9ZA 1LSJA 4L8VA 1YOVA 4FN4A 2X9GA 5G0WA 2IXAA 2VQ3A 5CP8A 2DT5A 2J8ZA 4FJ2A 4IQ0A 2HDHA 2NADA 2ZQZA 4BO5A 2X0NA 1E1LA 3E48A 1I2CA 4OH1A 4BNNA 4B3IA 4DREA 3NDJA 4H7PA 1P1KA 4GPD1 3RFTA 3U4HA 4YJHB 3O9ZA 2W4QA 1E3JA 2YY7A 3HDJA 3A9WA 1ZFNA 5KVVA 3EYWA 1RJWA 2Y1EA 3BAZA 4DC1A 1GV0A 1YL6A 5CPFA 4BGUA 1NAIA 3ZV6A 3I9KA 3QW2A 4GQAA 3DAPA 4HP8A 4E31A 1E1KA 1KEUA 5EJ2A 1NPYA 2PY6A 2BRUA 1ZNQO 2Y1CA 4RLSA 1GADO 3OETA 2GD1O 3ROQA 1O0SA 1ISMA 3DBLB 2ZTUA 3GG9A 4BKUA 3EMKA 2BGLA 3R0IA 3HWRA 3T4XA 2H63A 1TVEA 2Q1UA 5EINA 1D7OA 5JNLA 2IEDA 1O9BA 3T7CA 1AXEA 1E7WA 1C1XA 1H5QA 1QG6A 1WLYA 4TRJA 3PK0A 1NFRA 3NUGA 2BFPA 1F8FA 4DTIA 3U62A 5KJEA 1DJNA 4J1SA 5KVQA 3NGXA 1LRJA 1T4BA 1F8GA 2G5CA 1BXKA 1PR9A 2O3JA 3SJUA 1BWSA 3PJDA 3JQ6A 2ZJ0A 4XIJA 3FSRA 4U6QA 1D8AA 4UUMA 1HDRA 1VJ1A 3DAFA 1CERA 3JD4A 1CDOA 3GMSA 3RC7A 1KYQA 2LDXA 5JYDA 1I3KA 3SX2A 3S2GA 2PGDA 3GVPA 3W6UA 1ZKMA 4RVHA 2CVQA 3DZKA 3Q2KA 1Q7BA 4MKZA 4OKNA 3ZGYA 4YT8A 2FOIA 1ZH8A 4KP7A 1LC0A 3NJ4A 3L6EA 4WCFC 2VYNA 1YS4A 4RL6A 4ILKA 1LTHR 4DC0A 4PG6A 3KV3O 3AY7A 4CUZA 1Q0QA 2UDPA 3QQPA 4WJZA 4J7XA 4DYVA 1QORA 2QRKA 1ADBA 3TOXA 3GMDA 4CMAA 3L6OO 2D4AA 4JGBA 3JCZA 2FPGA 2O3UA 1YOVB 4OAQA 1EBFA 4LSMA 5L7WA 3GGOA 3WMXA 1Z82A 3B1JA 1EE2A 1R0KA 1XIVA 3LDHA 4UUNA 3RFXA 3KYBA 3TF5A 1GUFA 1O95A 3JQ7B 3QA9A 2Q3EA 1PJ4A 1F17A 3L4BC 4A26A 4U0JA 1EZ4A 1G6KA 3K8ZA 5MDHA 1EQUA 2XPCA 4BMVA 4OO3A 5KKCA 1I2BA 1M6HA 2PZKA 4L74A 3FTPA 4RGBA 5A5EA 1P0CA 4BNTA 1J6UA 1ENZA 3H5RA 3VZRA 4CMBA 4CR7A 4RV9A 1DB3A 4CM4A 3INRA 5C3MA 1DFIA 5F3RA 5AQ1A 3GVCA 1U3WA 3W4IA 1LNQA 2CDBA 4IINA 3HDQA 2AE2A 3FWZA 1ZEMA 2H6EA 3KTDA 4NPCA 3P7MA 2Y05A 3GEDA 1LLDA 1X13A 4XYLA 3F4LA 1NHWA 2YYYA 4WCDA 5BSEA 1U3VA 3TZKA 1PJ3A 4YWJA 1IY8A 3S1LA 1E5LA 3AY3A 5CHEA 5A3VA 2B4RO 1E7MA 3GH3A 1OFGA 4MDHA 1K2WA 4WCFB 2CF5A 2EF1A 2VOEA 2BFMA 4P4NA 3MJCA 1GZ3A 1WVGA 1F06A 3U0BA 4J9UE 3P2YA 4HWKA 1MXHA 4BNFA 1FK8A 3DR3A 4TWRA 1Q7CA 4K6CA 4MINA 3OQ6A 4WLUA 3HNPA 3IJPA 3N74A 2C07A 3M1LA 2YFQA 2QW8A 2P68A 2EGGA 5T8KC 4AVYA 4WLOA 5AVOA 2F00A 3BTUA 1XELA 4Y6PA 3D5TA 1RYEA 2CDCA 4FOSA 4FR5A 1XEAA 4YAKA 3BMNA 4ITUA 1J49A 3U49A 3QVXA 3VPGA 2D59A 2Y1GA 5HM8A 4FQ8A 4CM4B 1A4UA 1ZXBA 2QHXA 4U0KA 4M55A 3RC2A 1C1XB 1ONOA 2Y1FA 1LDEA 3QVSA 3R3SA 2PK3A 3GUYA 3JQAD 5A05A 3ZHXA 3ASUA 1X1EA 4QT0A 3BMQA 1P0FA 4ALMA 4GWGA 4FFNA 2E49A 3TFOA 3DTTA 1FF9A 4YB8A 1KY5A 4FS3A 2C82A 4IIUA 3JQ7A 2Q50A 3RU9A 2Z95A 1DIGA 4XDZA 1CETA 3ZNOA 4CM8B 2PV7A 4YJDA 1B26A 1BG6A 4UREA 5COQA 1ZSYA 1BDMA 3D4NA 1U8FO 2I65A 3IL2A 1KEWA 1DC6A 1LLQA 1TI7A 1Z7EA 5CDSA 2QZ9A 4RVDA 2VNAA 5JCJA 3TZQA 3WWYA 1J5PA 3JQFA 1E3SA 2OZPA 4X54A 1G1AA 4CMKA 4YR9A 1Y7TA 3H9UA 5AYVA 1QMGA 3OJFA 1KC1A 3JD3A 3L0DA 4ONEA 3RUFA 5A06A 5L95A 1R66A 2W8ZA 4MVJP 2Y1OA 5DN9A 3ZV5A 5G0UA 3UXYA 1GYQA 4QX6A 4XIYA 5BT9A 1Q1NA 4D44A 1I3NA 1PWXA 4ALJA 4DLLA 4BIIA 1WAMA 2EWMA 4CUJA 4Q3EA 2NU6A 5IFLA 5IDXA 5MGBA 1T2AA 4O5OA 4UEJA 3QVOA 2ZKLA 3ENNA 1PJSA 2Q49A 2NU8A 1ZK4A 1NHGA 2QRJA 1HE3A 3HB4X 1T4DA 3PGXA 2CVOA 4DXHA 3DWFA 4OQYA 4CR6A 3IS3A 1KVQA 2Q1SA 4L73A 1E1MA 4PG7A 3TRIA 4DBZA 2G0TA 4TVOA 1PS9A 2QYSA 1ZSVA 3O8QA 3Q0EA 2VWHA 1EVJA 1HL3A 1ZVMA 4GL4A 4BGIA 5TJHA 4IXTA 4WLEA 2VHZA 1HWYA 1ADCA 1V0JA 1Q7GA 2HMSA 4PG5A 3GC6A 3PYMA 1ZSNA 4CR8A 1TXGA 4IJWA 1NR1A 2B4TO 4J4BA 4YT4A 3M2PA 1E0DA 3WSWA 1LSUA 1WPQA 3ICCA 3BMCA 2ZK7A 4I9UA 4S1VA 4WCFA 2IZ1A 4QTZA 4AJNA 4CM7A 1GU7A 2DUWA 3QRWA 4RPHA 1YL5A 2VNSA 2Y0CA 3GFBA 2Q2VA 3CUKA 2A94A 4PZCA 4RPKA 3HFSA 4YJFB 4YAEA 3WYEA 3MEQA 3FBTA 4CQLA 2HUNA 2Z1MA 1NVTA 2X1HA 3COSA 3PHLA 1NASA 4PLTA 5GMOA 5CDTA 4AJKA 4NU5A 1CWUA 3HDHA 3WNVA 3DZBA 2PTGA 1G0OA 3PJFA 4CLHA 1KS9A 4JBIA 4L75A 3L4SO 3VKVA 4EYEA 1P1HA 4J16A 9LDTA 3ROPA 1BW9B 1E6EA 3VPFA 3OFSA 1E3EA 2AQ8A 3GG2A 4YRDA 5FI5A 1P31A 1YQDA 3BZUA 1A9ZA 3PHJA 4PLYA 4QO7A 3RWBA 4B8ZA 2PD3A 3DOCA 5LC1A 3D5QA 4IDAA 3IC5A 3FHLA 1ZO8A 4ZQGA 1UP4A 2JD1A 2O4UX 3BTOA 1ZW1A 2P4HX 3VH3A 4YACA 1BMDA 3MTGA 4A03A 5LDGA 5FWNA 3HE3A 4PVCA 5L7TA 2HU2A 2BI8A 2V65A 1OBFO 4EUEA 4TROA 4BO9A 3L6DA 3IAHA 1CJCA 1UDBA 2FPIA 1FMCA 3VOSA 1R16A 3DMYA 3T7EA 1NPTO 1DHRA 3E9NA 3HJAA 4BV9A 2FRDA 5TX7A 1UXHA 4BL5A 1J4AA 3H3FA 3KETA 4ND5A 5HA5A 4TRMA 3SJ7A 4R9SA 1HT0A 4FFLA 2AHRA 4O59O 4XYEA 1BW9A 3LK7A 4PIVA 4E13A 4TVBA 1KVSA 1EVYA 5TNXA 5KVCA 2P9CA 1GTMA 2PKRA 4E2ZA 2B5WA 3DMTC 3C8MA 4B7CA 1NWHA 1ZXLA 5EPOA 4DLAA 1ADGA 2FPPA 2XAAA 3K30A 1Y8QA 1YB1A 4Q39A 2P91A 5IF3A 4BQRA 1A9YA 4D3DA 1LC3A 3DHEA 2JHFA 4A27A 2A35A 3INGA 3VZSA 4YXFA 5T67A 5TQVA 4GX5A 3PYLA 1GQQA 1NFQA 1V8BA 4CODB 1MP0A 1RYDA 4MPDA 4XQCA 2IE0A 1ISFA 2X0IA 4LVUA 5JAQA 4JJIA 3U9LA 5A3JA 1I01A 4CMGA 3OQ1A 5L4SA 5JSFA 5JY1A 4F46A 1DO8A 3STHA 4MVJE 2HRZA 3C1AA 1LDMA 2GUGA 5LDHA 4QO8A 4TKLA 4BMSA 1ENPA 2OMEA 2NACA 2P9GA 2NNLD 4OOEA 1PU2A 1EK6A 2YZ7A 1AHHA 3FI9A 3ONEA 2Y93A 3QY9A 2VHVA 3ANLA 1I2ZA 4XGNA 5FFFA 1GZ6A 4M89A 1NR7A 2YDYA 2HSDA 2X6TA 3NT4A 1SAYA 3E9MA 2CZCA 1K5HA 4GI2A 1E77A 3DOJA 2J3HA 3W1VA 2AA3A 1H0KA 3RCBA 3ZU5A 1IOLA 1LDNA 2C5EA 2FP4A 3IUSA 2D3TA 2XF8A 4Z9YA 4CV3A 4NBRA 4NBWA 5K6AA 1JAYA 1HTBA 4WGGA 4BO1A 3W6ZA 4JP3A 3ZHYA 3S2EA 2UUOA 3F4BA 1U28A 3KM0A 3WGQA 3ZWCA 4LK3A 3LT0A 4JNKA 3ETGA 1DEHA 5JS6A 3ITKA 3PRJA 3TQHA 1VL8A 3V2HA 2NQ8A 3AOEA 1ZCJA 2VUSA 4JP2A 4N18A 3DBRA 4NBVA 1KC3A 3SBOA 5I9LA 5ENDA 3V1YA 3SLKA 2UVDA 2WE8A 4KUEA 2YW9A 2O50A 4PLWA 3JYLA 5F1OA 1JKJA 4HFNA 3C7CB 2R00A 4K9DA 3QWFA 4EJ0A 5JXWA 3JQBC 1PGPA 1DFGA 2CNBA 2VUTA 1H9AA 1SEPA 1ONNA 4R1SA 1L7DA 2PWZA 2POQX 3EY4A 3MCVA 2AQIA 1GD1O 5L53A 2P5UA 2C29D 4ND4A 1GUYA 1OMOA 4AICA 4G5HA 3QWBA 3ZWXA 3NTOA 4ZICA 1QRRA 3ETDA 2PLAA 5DP2A 4PLGA 4HV4A 4Z3DA 3H9EO 4W7HA 4NFHA 1CEQA 1A71A 3E1KA 5TF4A 2V7PA 1GEGA 1QYDA 1PJ2A 3G17A 1K6XA 3PFWO 4IDCA 1TA4A 3IKVA 3QVWA 4D7AA 5G4KB 1CIVA 3OSUA 5IXYA 4FW8A 4XYMA 1BHSA 2IYOA 3KOUA 1HE2A 1ARZA 1YBMA 4FJ1A 1SO8A 2HLPA 3GZNA 3ULKA 4YAIA 3CZMA 4MVJM 2BGKA 1HEUA 2YHIB 1RM3A 3NT2A 2Z1NA 2OXIA 2JCXA 3I4CA 1BXGA 3L77A 3D4OA 3QLJA 3GZNB 3G0OA 4B8WA 5HWSA 1W4ZA 4W82A 4QUKA 5EESA 2NVBA 1C14A 4AL4A 2IZZA 1XSEA 2GASA 1QYCA 1TLTA 1VLLA 2GZ3A 2QZZA 3I5MA 1NVGA 1Y6JA 1V6AA 3Q1LA 1LQUA 3KYCB 1IPFA 4E33A 4PRLA 4D42A 3HB5X 3U5TA 5C5IA 4R4JA 2UV8A 5FI3A 2H1SA 1L1FA 4P4LA 1CRWG 3MWDB 3KXDA 4IIVA 4AJLA 3GZ4A 1RM4A 3NKLA 1D1TA 3ITDA 1ML3A 1U2DA 3WGTA 2DTEA 4QXMA 2XXBA 5JBIA 2Q1WA 4B79A 3E5MA 5JE8A 4QSMA 4YA6A 1GAEO 3NDIA 3U09A 1DRWA 4NIMA 5JMWA 4OKIA 2EXXA 1NNUA 1DIAA 2V6MA 3Q9UA 3BMOA 2P4QA 1B0AA 3AI1A 1I30A 1QSGA 1PZHA 2BLLA 3GLQA 1YQXA 4GVXA 3ZNNA 2C7VA 3ADPA 7ADHA 3NX4A 3OMLA 1EE9A 1Z6ZA 3E5RA 4RLHA 4LCEA 4KDFA 2WE7A 4A0SA 4I9NA 3JD1A 2EKLA 3NEPX 3DMTA 3M6IA 1B3RA 4LMPA 2WYVA 3RJ9A 1D1SA 5CEFA 1DIHA 4IZIA 4OSPA 4YVFA 4BOYA 1T25A 4J43A 3INTA 1VL6A 2GF2A 4GMFA 1XR3A 2O3TA 4YDRA 4CJXA 2PGJA 3UCXA 1N2SA 2I3GA 4EI2A 5L45A 2NQTA 2P9EA 2DQ4A 2CDAA 5DZSA 4RDHA 3PVZA 5B4VA 3JQ9A 4R5MA 2TMGA 2HQ1A 3ETEA 3D4PA 2CFCA 1Y9AA 4C4OA 5EQFA 1LU9A 3TSCA 4AJHA 1Z45A 2AE1A 3PHHA 1GV1A 2VTDA 3DOOA 4GKBA 3UW3A 1K6IA 4DMLA 1ENYA 3L4BA 4U5QA 4D0SA 1B16A 4J4TA 3FWNA 4N54A 1PL8A 1GQ2A 3F1LA 2NUAA 4GGPA 5C7OO 1GCOA 5EIOA 5JW6A 1SBYA 4KUHA 1E5QA 2CUKA 4II3A 2PKQO 4UVHA 3OECA 4IPTA 4WOJA 1X15A 2NV6A 3BIOA 3FNHA 1AUPA 5A9TA 1MG0A 4HX5A 5U9CA 3I9JA 1D3AA 5A04A 1EEHA 2HK8A 2GN8A 3ASVA 4WK6A 2C2XA 4BQPA 3F47A 4GX1A 4KOAA 4GLOA 1LXCA 3VZQA 2WD7B 2D5CA 3KEOA 2W2LD 2YV2A 4GLLA 5TSDA 3CE6A 1WZIA 3I9MA 1FDSA 5B4UA 2DAPA 3F1KA 4YAJA 4IDDA 1DFHA 2HMVA 2YHUA 1U2GA 1WP4A 2WD7A 3DC2A 4AJ4A 4F6CA 2JL1A 3RAJA 3Q2IA 2NM0A 5IXSA 3S2FA 4RZIA 5L4LA 3G1TA 4NG5A 2A9FA 4B7UA 1QV7A 3PLNA 4L4RA 1TB4A 4CM6A 2YFHA 5ITWA 2AQKA 3PLRA 3U4CA 1GDHA 1E7RA 3K2EA 3MOGA 3AK4A 2PZLA 1IZ0A 3QWIA 1OC2A 2OP0A 4NK5A 1XU7A 4IY1A 4RVFA 3UH1A 2ZCVA 2OUIA 2VYVD 3VHRA 2YDXA 3MJ4A 4JJGA 4GX0A 4CL8A 2E82A 3IOYA 3WYBA 4CM3A 1IULA 4R01A 2VUUA 1R0LA 3F9IA 4NBTA 4TZTA 4MKRA 5COBA 4ZJUA 1HLDA 2NVUB 5L3ZA 2JAPA 1PQPA 5G4KA 4B4WA 3GNSA 5IZ4A 4CM1A 2GZ1A 2VWQA 5THQA 2VT2A 5KTKA 3LSYA 1XKQA 3WGIA 1T2CA 1SZJG 1WW8A 3GHYA 4ZD6A 3ICPA 3EHEA 4NJMA 2VZ0A 1HETA 4OMUA 4MVJH 2BD0A 1UZMA 4CLOB 3AUSA 3IJRA 2E37A 4L9RA 3TZHA 2G76A 4NK4A 4N5NA 4Z6KA 3PIDA 1N9GA 3K2BA 3RBXA 3WNQA 1NTOA 1PSDA 5C7LO 1KIFA 2UYYA 4XD2A 1DPGA 1H6CA 1WDLA 3G49A 4DQXA 4R1TA 3UN1A 2ZB8A 2GR9A 4J90A 1EK5A 2O7QA 3NV9A 3FRJA 4M1QA 3UGKA 3GRKA 4R69A 4A10A 1M6WA 1PZFA 1VL0A 1T24A 5EERA 4EITA 3GN2A 1N92A 1P9LA 1DIBA 4EJ6A 5JDIA 3BHIA 1NFFA 4LCJA 1JAXA 4BNMA 2J6IA 1H9BA 4AJ2A 1SOVA 4OXYA 1JWAB 4DBVO 4BKRA 4OXNA 4Y6SA 1HDXA 3X2FA 1ZK1A 2XXJA 2ZQYA 3HHPA 3WWZA 2IEBA 5J23A 4AJEA 4OHUA 1NPDA 1X0XA 1DC3A 3P5SA 4Y98A 3WB9A 1PL7A 3JQ8B 4HNHA 3GFGA 5DBFA 1ZIDA 2PFGA 5I7VA 2PA3A 2WDZA 1U5CA 1XYGA 3OA0A 4E5KA 4XQGA 4J7UA 4RF4A 3PWSA 4B4OA 3UVEA 4PCVA 4HFMA 4BO0A 4MOWA 5GZ3A 1X1TA 4ND1A 4Q3DA 2GDZA 5JC8A 4I5EA 4N5LA 3JV7A 1LDYA 1EDZA 3ZNQA 4B4UA 5HBRA 1Z74A 2QX7A 5IZCA 3LC1O 2JCVA 3KEQA 3CKYA 4NQZA 3TOZA 3Q3CA 3W8DA 2X9VA 3ZWVA 1B15A 2NVWA 4WE3A 1Y8RB 5DCWA 3WGGA 4JN6B 2NTNA 4CV1A 3WQSB 5L9AA 1LSSA 5HRUA 3R6DA 3PQEA 1E7QA 1M66A 1SOWA 3VH4A 1R37A 1AN9A 3KUXA 4KTTE 1MG5A 4NZ9A 4GSLA 3G1UA 4I08A 5K6AC 1EUDA 1P3DA 3GAFA 1UAGA 2WYWA 4XZ3A 1MFPA 2Q45A 4NR0A 4O0LA 3FPCA 3WJAA 3G3EA 4CQMD 4NFSA 4UVGA 2NU7A 2DPHA 3C85A 2O2SA 1ZEJA 3RVDA 3TL3A 3TFQA 1FDTA 1MFZA 4BB6A 1O94A 1HDOA 4GBJA 5JDCC 2IRWA 1W6UA 3B6ZA 3HFGA 3H5AA 4BO7A 1E92A 3DBRB 2EGHA 4IS2A 4RQUA 3PHIA 3GR6A 1I5RA 1K89A 4BO4A 2G17A 1X7GA 3WXBA 5A9SA 4ZHSA 2WSBA 3BHJA 3WLFA 1LLCA 4ND2A 1HYGA 4KWHA 3RJ5A 3RKRA 1YQGA 4R51A 3WX0A 2GYYA 2OO5A 3TN7A 1QXSA 4AJOA 5L51A 5BNFA 2VYND 3IDSA 3A1NA 3M1AA 1PJQA 2X5OA 5KVSA 2IYPA 4RORA 5H82A 1XQ6A 3VKUA 4L76A 1NQAO 1I3LA 2EJWA 2FSSA 1ORRA 1WZEA 2I9PA 3CINA 3G79A 4BMNA 2ZCUA 4LSWA 4KUGA 5CEEA 4CMEC 3QJ5A 4WUVA 3DONA 3SEFA 3GPDG 5CG1A 4JCOA 1I8TA 4K26A 3FCOA 3PDJA 4TRRA 5H83A 4Y9DA 3WIDA 1BSVA 4M49A 4Z0TA 1Y5MA 1U8XX 4JJFA 1BVUA 5CEJA 1GYRA 1PGOA 4XJSA 1DDOA 4ND3A 1H94A 4GAEA 4RVSA 3DTYA 1UDAA 4EEZA 1OC4A 1DHTA 4WLFA 3JQGA 1LDBA 4E3ZA 1XHLA 1A5ZA 3RC1A 4RF3A 1VE9A 2DFVA 3PTZA 4UVEA 2B36A 3KYCA 3DZHA 2O3SA 1PIWA 4E2YA 4WNCA 5ICMA 1QP8A 1VSVA 3EDMA 3O03A 2QG4A 1BXZA 3CPSA 1GFSA 1NX6A 4I5GA 1LBEA 4ALKA 4BGVA 2EG9A 1CF2O 4NDNE 4FBGA 4ZA2A 3WBFA 2UAGA 1IPEA 4PG8A 2VWGA 5I8ZA 4BNHA 1H6DA 2ET6A 3UF0A 1JA9A 1TT5A 5KCZA 1XWFA 3K73O 3GNQA 4Q3AA 4FFPA 2B83A 3ANNA 4RZHA 3AW9A 3WS7A 4F6LA 3AM3A 4FGWA 4P22A 4S3MA 3WGHA 1HF3A 4ID9A 3FNGA 4ZGWA 1RWBA 1ZK3A 2Y0DA 5C37A 5IN5A 3VZPA 4CL3A 5KKAA 4FB5A 1A7AA 2J3KA 3JQEA 1FJHA 1EUCA 1M76A 2NU9A 1MC4A 1T26A 3DEYX 4FPXA 2VN8A 5AXAA 5T8KA 3H4VA 5IDWA 4W6ZA 1R4NA 3UICA 2AXQA 1T1SA 1LX6A 4RVUA 4CM9D 3QV1A 2WWRA 2C0CA 2B37A 2RCYA 1SC6A 1U7HA 5AXBA 5T6BA 3UUWA 1B3BA 2GN4A 8LDHA 4NU6A 1HDGO 3V5NA 2PH3A 4I5DA 4YBZA 1NM5A 3QE3A 1KERA 3GRPA 1GEEA 2JFGA 3JTMA 4OYRA 2RAFA 4A2CA 2Y66A 2Y99A 4BNZA 2Y68A 1ZJYA 4BNIA 2PNFA 4E0BA 1IYZA 4MVJG 5BNTA 3V2GA 2GSDA 4YT5A 4CMCA 3Q9NA 1PQWA 4M87A 3OQBA 1PTJA 1E3IA 3ROMA 2PD4A 3KBOA 3RUIA 2VCYA 4J2HA 5T57A 4J4HA 4CMIA 3AUTA 1BXGB 2GLXA 4PLVA 5JY6A 3WFIA 1K6JA 1WWKA 1CQIA 6LDHA 1M75A 2HK7A 5A02A 4JXKA 3T4EA 2HMUA 2W2KB 1KVTA 1H2BA 3Q6IA 3FN4A 2A92A 4XGKA 1NQOA 4CMHA 3VPXA 3WBBA 1YH3A 4BNGA 4DIFA 5DNAA 2IXBA 2IODA 3GT0A 3ZWAA 3RUCA 1UAYA 5JO0A 3U4IA 4OL9A 4HNGA 3QP9A 3PQDA 5HS6A 3UCEA 3DZIA 3D64A 4IS3A 5TRTA 1YDWA 2D5AA 1MLDA 3BMNB 1FDVA 2ZB4A 3AWDA 4GSKA 3WOHA 5I7SA 4DVJA 4OSOA 1W8DA 4CMJA 1IUKA 3BA1A 1P1JA 1SPXA 4IQGA 4XDYA 4I9HA 3B20A 4NH4A 2BHLA 2WM3A 4LGVA 2P2SA 5TGDA 1XLTA 5JDCA 1PZGA 1P1FA 1F14A 3ZWYA 3PYXA 3TJRA 4DPKA 2P5YA 4P38A 1G0NA 1Y8QB 1A72A 2AQHA 2JHGA 3EAGA 3OICA 1I36A 3TNLA 4D3SA 4C7JA 1UP6A 3AI3A 2X5KO 4CLXA 1ZMOA 2BI7A 1E7SA 1R15A 5H81A 1W0CA 3E6AA 1SB8A 2RBEA 4R3NA 1LRLA 1P33A 2GGSA 3ONDA 4MIYA 4UVIA 4G2NA 3F6YA 4RPGA 4XRRA 4DGSA 1R4MA 1VC2A 2EKQA 4J0FA 4UVDA 5JCXA 3V2UA 1VI2A 1B2LA 4K6FA 3GVIA 1IZ9A 2O7SA 1QYVA 3EZYA 1T2DA 3OBBA 4HBGA 4B3JA 3ZDFA 3B1KA 3QVTA 2Y67A 5IDYA 5F21A 1JKIA 3DBVO 3K6JA 2HMTA 3WSVA 5KJFA 4MVJA 3PI7A 4RO0A 4YT2A 2OHXA 3JQ9C 4GWKA 4YQZA 4R16A 5JYEA 2Q2WA 1PZEA 5AXCA 4II2A 4LMRA 1R4NB 1RM0A 4PZEA 4YQYA 2VHXA 3A14A 3TZCA 4CPDA 3WQQA 4IMPA 3UKOA 1B7GO 2X86A 3ROKA 7MDHA 5IJZA 4FC7A 4FIZA 4DWVA 4QECA 4CLRA 3JYNA 1ISHA 1ISJA 2CD9A 3MZ0A 2TMDA 5JDIC 1YWGO 1MA0A 4WKGA 3SLGA 3BMOB 3O38A 3V1TC 1U7TA 2VHWA 4ZRNA 3ONFA 1WXDA 2HRBA 2J3JA 3JQAB 5IDQA 3DZGA 4UEOA 1C0PA 1KOLA 1IHXA 5EL0A 3ST7A 3RI3A 2GN9A 4JROA 4CM9A 2EEZA 1WMAA 4MP3A 1BDBA 4UEKA 1GCUA 3A06A 5TIIA 4J91A 4EGFA 4BKQA 5CAEA 2QQ5A 3LT4A 4RF5A 1Y5RA 5G2OA 1PWZA 1PX0A 3PDUA 3FR8A 4UAGA 4IGFA 5BSGA 3WMWA 3DZJA 1JW9B 2FHSA 2R2GA 3AFMA 3DXFA 2O3RA 3ZHBA 3DHYA 3PP8A 4XYBA 3KB6A 3VDRA 3TWOA 1B8VA 2OFPA 1LUAA 4ZN6A 1J0XO 2E6UX 2J3IA 2RH4A 2VHYA 4E2WA 1R6DA 4D46A 3MWEB 3AU9A 2I66A 4NI5A 2E48A 3LF1A 3H2SA 3VVBA 2WYUA 1T1RA 4P8RA 5IZCC 4ALIA 3ZH2A 3TL2A 1UXKA 4FD3A 3MJVA 4ZQFA 4CLDA 1Q2XA 4YJFA 1EFLA 3W8EA 5CDYA 1DXYA 1RKXA 3B1FA 4R1UA 2IDZA 1X7DA 4K1LA 2GO1A 4WECA 2DKNA 2XOXA 5CPBA 1TEHA 1S6YA 2DBQA 5K0ZA 1AGNA 1LJ8A 2HO5A 4J1NA 5GY7A 5B1YA 3HN7A 4Z9XA 4MVJF 2H5LA 3VH2A 1SMKA 2GCGA 3C7DB 4GKVA 5KWEA 2O48X 2ZJ1A 3GOHA 3TPCA 2ZTMA 2VWPA 4WOKA 1RM5A 3D3WB 5EN4A 3GUCA 1EUZA 4U7WA 4IDGA 3RD5A 1C0IA 2A4KA 5DULA 1PL6A 1YXMA 2V6GA 2C5AA 4E21A 3DDNA 4OIMA 3VH1A 1DLIA 6ADHA 4MIOA 2OOSA 3O8QB 1HE4A 2HKIA 2W90A 2JFFA 5U4QA 2CVZA 1I24A 2OP1A 1U9JA 5DCYA 4E4YA 5JLAA 4XEHA 3AFNA 5EMHA 1P1IA 1E3WB 3OIDA 4W9NA 3K31A 1DC5A 4Z9FA 1KVRA 4IM7A 4E12A 2B4QA 1I10A 1E3WA 4I1IA 3RU7A 1H6AA 3KHUA 5CDUA 3IUPA 1EQ2A 3I1JA 3ZCXA 2EJVA 2X9NA 3JD2A 3VAZA 3MTJA 1WNTA 2Q99A 4Z0PA 2OL4A 4WPGA 3N7UA 3EVTA 3ZU3A 4YYZA 1PEDA 1LQTA 1UXJA 1R4MB 4INAA 1R0SA 3LQFA 1C3VA 3EK2A 4RJTA 3WQRA 3IIEA 4PLZA 3W4JA 5ENVA 4HADA 3GGPA 1DOHA 3RUAA 1CYDA 2PZJA 5CG2A 4GH5A 4H16A 4EDFA 4ZRMA 3OH8A 3ENKA 4FFRA 4MP6A 4DIOA 2BGMA 4J7CA 2WTBA 4O6VA 5JAMA 4E32A 2O23A 4Q3CA 3ZWMA 2J5RA 3WLEA 1H2HA 1R12A 4EUHA 1DBVO 3BMQB 3DL2A 2R00C 1PJCA 1UXIA 3PXXA 2OBNA 4UULA 4W9NC 3RSHA 1JU9A 1PR3A 1B8UA 3WFJA 4LW8A 3JSAA 3DBLA 5CFZA 1BTOA 1VSUA 3S8MA 4Z3KA 3MJSA 4HXYA 4HFRA 3F5SA 4BO2A 1EFKA 1NVMB 1WMBA 2AG5A 2DUUA 3DFZA 1U3TA 4NNJA 4IDBA 4XRGA 3GY0A 1HZZA 4J9VA 3AOGA 3DBHB 2BH9A 3F3SA 3GEGA 3H5NA 3UAGA 3FTNA 4MVJD 1HXHA 1ENOA 1YJQA 1UP7A 5DP1A 4BNUA 1HDYA 3JQCA 2IZ0A 4KWIA 3W4KA 4ZU3A 2NTJA 3QHAA 1FXSA 4J1TA 2V6FA 2I76A 1D4FA 3ON5A 2PGLA 5L4NA 4BNKA 3JQDA 5T64A 2VTEA 3A4VA 2G1UA 2WJPA 3AJRA 1I0ZA 4E5MA 3F46A 1UR5A 1QR6A 3A28A 3D7LA 3OF2A 3IKTA 5DDIP 3JQAA 4XKJA 3GQVA 1ZBQA 3LVFO 5G0VA 5F5LA 3WDSA 1GUZA 3WICA 4CM8A 2B5VA 2V6BA 4YJHA 1ZK2A 3L07A 2QYTA 3CMCO 4CLRB 5TT0A 3C1TA 5ILGA 2B35A 1IE3A 4DYDA 4IQ8A 1DLJA 3QSGA 1ZZEA 5L40A 3PEFA 1BVRA 1LA2A 3F5QA 3WJ7A 1PJTA 4KZPA 4QFDA 5A4DA 1YBAA 3NDRA 4R68A 1ADFA 2O3QA 4BS9A 1B14A 3UOGA 5G0TA 4YRAA 2EKPA 2OBYA 4WASA 4MO2A 4J6FA 3VC7A 2C59A 1Z75A 2ZYAA 1PQUA 1XCBA 3CTMA 2I5PO 4OGWA 4E5NA 3WTCA 3ZWBA 4BNYA 1GL3A 1LEHA 2PD6A 1LDGA 1E7YA 1P77A 1YE3A 1YO6A 4PLCA 2FR1A 1FDWA 4ALNA 4JBHA 1HYEA 2DU8A 1NYTA 4F45A 2EP5A 4DA9A 4GX2A 1O8CA 2YJZA 1DAPA 3I6QA 4LRTB 4AJ1A 5THKA 5IG2A 3EGOA 4AG3A 4R54A 4L0QA 4JK3A 4OQZA 4H3VA 4RDIA 4XCVA 3V8BA 3OJOA 1U5AA 4CMEA 1HDCA 3VVCA 4OXKA 1JVBA 4A5OA 3E82A 1WDKA 3QWHA 3ZNPA 3PJGA 2OORA 5BNIA 5TT1A 3O26A 4BNLA 1DJQA 3ZWPA 1QYXA 3QIVA 3MJEA 3X2EA 3FNFA 1AE1A 3EUWA 3U3XA 3AUAA 4RPJA 5B37A 1N7GA 2HJSA 4J49A 3NT5A 5BSFA 4BGEA 1UH5A 3U4DA 4AJIA 4BB5A 1GYPA 4CLEA 4QQRA 3EC7A 2LDBA 4PG4A 3SC4A 3KSUA 3C3XA 3WYCA 3PIIA 1JTVA 4KMSA 4CMIB 1V35A 2X0RA 3RUHA 4FJ0A 4M86A 3KO8A 3DHNA 3H9QA 5FYDA 2ILTA 1U4SA 2SCUA 2HCTA 2NTVA 3GEMA 5TLSA 1W73A 1M2WA 5DCUA 3OJ0A 3BHMA 4U6SA 2W2KA 4ZQHA 5F5NA 5LCXA 3ZWNA 2RHRA 4YCAA 4EW6A 1U1IA 4KQXA 4BNWA 1M67A 1HSZA 1YL7A 1P44A 3DFUA 4MKXA 3KVOA 4URFA 1X7HA 4N5MA 1PS0A 1DRUA 2E4AA 2FZEA 4Q9NA 5A5FA 4KTVE 2EHDA 1HDZA 4IJVA 2EP7A 3ZWWA 4XWYA 2X0JA 3GNTA 3I6IA 4E5PA 3GK3A 3LZ6A 1MC5A 4TMFA 5KJCA 4XR9A 4R41A 2PZMA 4YAGA 4D41A 1JWBB 5I8WA 3WG9A 1P1RA 1UZNA 2CSUA 4DPLA 4D45A 1LRKA 1KEPA 4IJKA 3VDQA 4PRKA 3DAGA 4ZVVA 4AFNA 1KVUA 1C1DA 4XGIA 4O1MA 4ZQBA 2C20A 4GVLA 3PQFA 1UJMA 2Q2QA 4NHEA 2HK9A 4EJMA 2ZB3A 3KRTA 4TRNA 2X5JO 1YKFA 4BHTA 2JKVA 4NJMB 4G65A 2PR2A 3HN2A 5KJ6A 4E5YA 1K0UA 2VRBA 1YJ8A 2GZ2A 3LC2O 5JAZA 5JCJD 5I7EA 2VZ9A 4BO6A 1LLUA 3AI2A 1U4OA 2I67A 1UXGA 5ES3A
chains in the Genus database with same CATH superfamily
5C1OA 2H1WA 3VBEA 1ZCFA 1ZU4A 1W5BA 2HJVA 2MDTA 5G40A 1M1YE 4TSKA 4F8YA 5HQ3A 3WAGA 3O2NA 2WKWA 5HK9A 3O8LA 2W43A 4JIGA 1V16B 3P2MA 2XNKA 4O63O 3KWFA 4R1LA 3OPYI 4RY0A 5EHXA 2FN9A 4FILA 4IIJB 3NKVA 2B0JA 2Q46A 2ZUUA 4YEDA 1Z7GA 5EFOA 2C61A 2DTXA 1DAFA 3WIUA 3FFAA 2RONA 2E5LB 1BVHA 1THMA 1G63A 4PM4A 3RLIA 4B7XA 5JH7B 1EAMA 4ALLA 2QNBA 3D43A 3D7KA 1IM2A 3DT8A 3HI4A 5CK5A 3EDCA 1EP2B 3KLNA 3D3JA 3IALA 1DRVA 1GR0A 2YJTD 5BQFA 4RVNA 1C7EA 3RFFA 1LLFA 3U9TA 1NC3A 1NW4A 2FZWA 1GCIA 3V2IA 3TKYA 3NHZA 5JAPA 1F0NA 2Q3MA 1E6CA 3FBGA 4Q7EA 3L82B 4ZVNA 4UE2A 1U2PA 3F3KA 4ROSA 4K9NA 1G3QA 2I8AA 4BFZA 5F1KA 3X1WA 1DV2A 2E9SA 5HJ7A 5AVVA 3HV0A 2FEKA 4QNRA 4N41A 5KYUB 2XMRA 1VA4A 3EF0A 3OZBA 3Q7SA 3Q6MA 4BZWA 1WEHA 1K6EA 3FKSA 4MV1A 1ISGA 3BG5A 3GFTA 3GUVA 3R3JA 4AG5A 2EBUA 4EUSA 1DJLA 4C6TB 2RI1A 3MA0A 2BF7A 1NJ1A 4OATA 4AD8A 3GU3A 4AS2A 3FA2A 4XSGA 5ITVA 3OZGA 2JLWA 3FMFA 4RUKA 3MB8A 4IUYA 3N3BC 4KV9A 3UJBA 1V7ZA 2ABWA 2HV9A 5LM3A 1QH1B 3MM4A 2I6TA 1XLWA 3EGWA 4EUKA 2XVZA 1M8GA 1XPOA 3FR7A 4FFSA 3SD7A 4EA9A 1SBCA 3RRNA 2ODNA 4CDRA 3HBLA 1Q95A 3ZIDA 5IKEA 2AFHB 2O6LA 3CT6A 1VHQA 1CJUC 1JIKA 4G09A 1JRLA 4FC6A 1DC4A 1BGVA 1XRRA 3KTAA 4LC0A 4YREA 1MGOA 2X4IA 3E8XA 3WO0A 5AKJA 1IB6A 1ZUD1 4C0QC 1X2BA 2WPNA 2VT3A 3IDQA 2YZ2A 1MO5A 3JAKB 5K3AA 4DMGA 1OAAA 3TGPA 3D7SA 1DQPA 3A2MA 1G20A 2VDLB 3I58A 3H6KA 5JG7A 2B7LA 3W7BA 4ZT4A 3ZHZA 4Z54A 5LOVA 3CLTC 2A7QA 3H3JA 4DSAA 3B5JA 5DGTA 2NVUA 3VTFA 1QUFA 1SOAA 4UBLA 3W0LB 3ZYCA 2ZUEA 1MH1A 1KMCA 1MX1A 2AX4A 1KSJA 4HGYA 1RYMA 2ADOA 5H5JA 2FPMA 2HM7A 1QJ4A 2QUHA 4JJ4A 4BVGA 1UBTS 1IHDA 2DPGA 4IG4A 1XU4A 4CE6A 3VU9A 2NOAA 4UOZA 4IBOA 4OBXA 3A7EA 4DDUA 1XX6A 1W47A 2OBLA 1QZUA 1NVFA 2W6ID 3DEAA 4NJEB 3SM3A 4BFYA 5CDGA 2C57A 3ABIA 2BZ1A 4ENWA 1K86A 2QV0A 1HKUA 2IEAA 4ZVOA 1QO0D 2HAEA 3K1TA 4Y2RA 4AKEA 2BJHA 2AV6A 2WA1A 5KB3A 1N5JA 1SXQA 4IQFA 4Q4JB 4BV8A 5FPHA 4G1EB 1BX0A 4G1MB 2XXAA 1S5PA 3H05A 3LCRA 2WFLB 1K3TA 1XA0A 3JQRA 3CISA 3LPCA 4G41A 4KDEA 2HT1A 2BGGA 1CP2A 4NMMA 5LNK6 4Q00A 1NSYA 1FTQA 3BXHA 1DX6A 1EFCA 4PCAA 2QX8A 4BECA 4MWGA 5IAKA 1HZZC 3UOAB 3P2OA 4OREX 3V3TA 4LZLA 3WGOA 5AICA 3WIOA 5A03A 1SXJD 3MFQA 4NMHA 5E1DA 4E2FA 2B2CA 3GRCA 5ER6A 1RMQA 4LXGA 4B2LA 2PH5A 1HT1E 1ZA1A 1VZ2A 2WF8A 3O0TA 1Q50A 2B9VA 2HHAA 4NYMQ 2AOUA 2V59A 3ZZMA 1B6GA 4JLAA 4N7RA 4BO8A 4CKBB 4IILA 3DD5A 5KWIA 3HJFA 3R9XB 1NVKA 2COKA 1VHDA 3NWJA 3U7GA 1R2QA 4JL5A 3LU1A 1YVUA 4P7KA 3AUKA 1I4DD 1JUDA 2VRCD 1UM9B 4G3XA 1GRCA 3NVMB 3G59A 1NU8A 4B34A 4JSYA 2C54A 4RHEA 3CSDA 4G5XA 2R6FA 2J5QA 2QR3A 3W05A 5AOVA 3W2GA 1W9HA 3HABA 2IOQA 4ENTA 3E8SA 2DC1A 3O8BA 5LL6P 2HBZA 4R05A 4WXMA 2LGJA 1AMUA 3M9LA 3SC2B 3K92A 4IJMA 3HG7A 5FDFA 2QI9F 4MS1A 5G1OA 3QXCA 3QPAA 4CL2A 1AGRA 1Z08A 3GN1A 4LJ7A 3OURA 4G1VA 4BFUA 4LV6A 1UWVA 1JYSA 4LGMA 2LCIA 5B6PA 3A04A 1I94B 4O29A 3KSDO 3L9WA 2ZIEA 1ZL0A 1V9LA 1SEVA 1HGXA 5HM6A 2O6HA 2JAHA 3V8EA 1NY6A 2N47A 4H4DA 4XH9B 3AXSA 4O4JA 3BDAA 2JJ2D 3BYZA 4G0ZA 2NZWA 1JQBA 2V0NA 5E38A 5CIQA 5IBRA 2JD2A 1U3UA 2I0FA 5F33A 1K7SN 2Z58A 4IHJA 4ER6A 2O52A 4RJIA 2HA6A 3K5PA 2DM6A 2BY4A 4URWR 2NUTB 4DL9A 5U4XA 1KEEA 2N0SA 1D8TA 1B1CA 3HCOA 2OV6A 3PJEA 2Q2OA 2V58A 2F9LA 4HY3A 5I9MA 3V4SA 4IGEA 2MTBA 2VBIA 4MCIA 4C7KA 1Z4PX 1PNTA 2Q4BA 1L4GA 4H0CA 1VKZA 2VPPA 2HA0A 2J5XA 2YV1A 3WGVA 4S1TA 1QRUA 1TD9A 5KUTA 1QP4A 1RI1A 1WF6A 4NCIA 4JLMA 5IJ9A 1JDUA 1DADA 3V1UA 1CKEA 2AI1A 3KQUA 2DBVO 2CLLB 3KSZO 5ICGA 4M54A 1XQVA 2WTEA 1U0SY 4QQNA 1O96B 3OX4A 2I4MA 3CE9A 4HB0A 4OJKA 1RXWA 1V3UA 4A7PA 1JXQA 4GYWA 3IAUA 3WP0A 1KETA 1I3MA 5AFSA 4I5IA 4TXJA 1ZHHA 1UBCA 3PQ6A 3FMIA 4LAFA 4GMDA 2DTDA 1OXMA 4E6PA 4JJ8A 4AG6A 1XJ5A 3OMWA 3FZYA 3I4FA 3LY8A 5CB4B 2WSMA 5JWRA 1YVRA 5JPIA 3PG5A 3VTZA 3DOIA 1BFUA 1I6LA 4CM5A 4DMMA 5EJ6A 1N8TA 2FR8A 2FUG6 3MTDA 3OJWA 4ROTA 2GVNA 1EVIA 2Y0EA 1YIOA 1E0KA 1SK9A 4K8OA 4MAAA 4MP8A 4QDTA 5SZKB 3SYNA 4NCXA 4WQMA 1DTSA 4COOA 2W6ZA 1XL1A 4HJXA 1RLIA 2VNIA 3L7MA 4HUQB 2ZFUA 1MQ9A 3HUDA 1UQRA 2BKAA 3IGFA 4F21A 2DBZA 3LY5A 1FS5A 3CX3A 4INZA 3IE1A 1RC8A 2XVYA 1HDIA 1RYHA 1Z5OA 3PUYA 2J6CA 5LMUB 1NJ5A 3S70A 3CLUC 5FWYA 2WJJA 3KT0A 3RRMA 1YUMA 3TZBA 2YCBA 4NAHA 4FB4A 1AHIA 4G23A 2ZUTA 4BNDB 5TJ9A 1RQXA 5EIEA 1QTNA 5JSZB 2XQJA 4IJUA 3RFVA 1MUUA 3UMCA 1ID8A 1UKZA 3RTEA 4TTQA 3TJMA 2ECKA 3VNUA 1GSHA 5FUBA 3OY2A 4Y9SA 3WLSA 4RFLA 5KOIA 2JW5A 4O8CA 1TIKA 4U7PB 8ABPA 2CY0A 2OZLB 5B7NA 3HK2A 2FH5B 3O8NA 1ODTC 4O0MA 1TLFA 2B1QA 3KUKA 4FMCB 4OK5A 1U6JA 3PQ8A 4Y67A 1MQAA 3RBZA 2Q6LA 1JKFA 1QB7A 4QEDA 3EVEA 1WXGA 4B33A 5BV0A 2BFOA 1AKNA 1EX7A 9ATCA 2Y1LA 2YTZA 1H2RS 4NJOA 4XQ9A 1YA4A 3OEWA 4D8XA 2ZBFA 1QKIA 4FQ7A 4LTNA 3QYJA 3PPWA 1RZRA 2GPTA 2IH4A 2AN3A 1USWA 1KH2A 4JB2A 4X0EA 1QCZA 5JD6A 4IOLA 3SI7A 3UHAA 4CDMA 4QPJC 1WQ4A 3PLAE 1AQLA 1TVMA 3WSTA 5IEJA 1NT4A 4LRYA 3ZY2A 2SCUB 3K9WA 4EBFA 2R8OA 4UAJA 4O02B 4EY8A 1KOJA 1Z5VA 4RSHA 2ZB2A 1QHHB 3EXHA 3P9RA 1O77A 1T2FA 2WIDA 5DT9A 5IN4A 2HQOA 1B43A 4G0PA 3LQ2A 4ND8B 4RVOA 3UJNA 1E1NA 1L3IA 1NV9A 2X19A 3H9GA 1IIBA 3T9CA 4Q12A 4GLBA 1SRQA 3WO1A 3EGVA 1U3FA 2EJCA 3LP8A 5TMBA 3BIFA 4PN3A 4C2TA 2ZR7A 2DXIA 1SIUA 1XXLA 1S01A 3MMPA 3EUFA 1O89A 2FGJA 4E14A 5KSOA 4HNQA 2OXTA 5LP6C 3RSOA 5BMOA 3EFHA 1T5BA 3PX3A 3LQQA 2HTFA 4LCBA 5THXA 1IMJA 1CUYA 4L85A 4GP6A 3W7VA 2QJOA 5KWJA 1GGJA 1TE2A 4EQ6B 1NGSA 2RH8A 3TCNA 3V7FA 4RQBA 1CQJA 4E30A 5DOVA 4DLNA 1QZZA 1SCIA 4ZK2A 5C4MA 1YRLA 2FTKE 3M8KA 1EMDA 1ZK0A 3BGVA 3TNJA 2AMJA 1K27A 4FSHA 2YJGA 1CEEA 2ZT7A 3L8HA 1PQYA 1NF9A 1N5DA 2AZMA 2FR0A 5JBQA 1VJ0A 2J5KA 2IC5A 2OCDA 2WEKA 3VI3B 2FY8A 4GLFA 4RCVA 4ARSA 4AQDA 3CFYA 3GRUA 5IAAA 2J0SA 2QLTA 1WB9A 2C84A 1TZKA 2VAPA 1JXMA 1Q0HA 1FX0B 1Z7BA 2GNAA 1ZJ6A 2VHJA 3A0UA 2IBMA 3O1LA 3SN6A 2F62A 4BNDA 4YV2A 2P6OA 1C9DB 3R9XA 2JAQA 2BM1A 5JPCA 5E7IA 4CF3A 4U3JA 3L7LA 3C6BA 3G82C 1FDUA 4X3OA 4X91A 1F7VA 3BUSA 1SXHA 2L17A 4B81A 3D1LA 2R6JA 4LFCB 3EJ6A 1MOZA 3LPMA 3IR5A 2VRCA 2I3AA 2NP6A 3Q3GE 2EAUA 4U8GA 4MHTA 2ID8A 1KU6A 1KY3A 2I87A 4K5QA 4U02A 1V8ZA 5D3MA 3TSOA 5I4IA 4HVCA 2VDVE 4IF6A 4MR9A 4ZCMA 1XAHA 5ADUS 2IHYA 2J9ZB 5EQDA 1MB3A 3BC1A 3DFIA 4YRDA 5LZ9A 3K16A 3KZOA 3KZCA 3RUPA 5IVIA 3P9QA 3CWQA 2QQFA 2W2QA 2RH9B 2BUBA 3O4GA 4NYMR 4F2HA 3FSGA 2FMKA 2ZSHA 2ZWAA 1UBMS 5DYWA 4FFWA 1JU4A 4NULA 3L84A 5A9RA 3COYA 4V0OA 3VR4A 1N7HA 2HPHA 3IQZA 3IXMA 1CVLA 2WM9B 4PO8A 2X5XA 4TLLB 3W8FA 2PSSA 1AF7A 1R7RA 1Y6ZA 1W4BA 4X1YA 3UJHA 1ZVVA 4RDCA 3E7XA 3HCDA 4IJ6A 4PBSA 4TYNA 4L08A 5FR1A 2IYSA 3URKA 2XH8A 3G5LA 2CJXA 4BUCA 1E3DA 4XPZA 4TS4A 2MR6A 1Y1PA 4DIDA 2QMZA 4Y7CA 3AOEC 5EXTA 2VPXA 4U9UA 5FAKA 4WH0A 3AUYA 2ZIFA 4CBVA 2YY5A 5JD5A 4MYRA 1D6SA 1W0KD 3CBQA 3GQBB 2AFRA 4AN0A 3I23A 2VOJA 4DMCA 1TGYA 3EMDA 5KSZA 1RPNA 4WEOA 2GEFA 1SB9A 3ELBA 5JISA 2B8EA 3R7AA 1VHLA 5AKGA 4BLPA 1YOVA 1TM5E 4FN4A 4BBJA 2C1XA 2C78A 2WWXA 2ZE5A 2QY9A 3QOXA 1LPPA 3FXAA 3QVVA 5F7OA 2JLZA 4ARBA 4BO5A 3E48A 4KQ6A 4ZFNA 3MXOA 2ZRGA 2VQDA 1ZR4A 3OZUA 1KRXA 3I45A 1AMNA 1LWNA 4DREA 2D54A 3B13B 4J0DA 2ODEA 4K87A 3NDJA 4OAOA 1P1KA 1Z5WA 1C7ZA 4PGHA 2FR8C 1L8QA 4YJHB 5TS2A 3WIVA 2QTFA 2QRGA 2YY7A 3DEHA 2PL3A 3DT9A 4J3NA 2ORVA 4IMIB 3EYWA 1RJWA 1YJ5A 2J31A 2Q8NA 1IZ8A 3RU2A 5A4KA 1JBQA 2R1TB 3BAZA 3PF9A 4CU2A 1GV0A 3ONVA 3PEUA 3T7KA 1JJIA 1YL6A 1X1SA 4BGUA 4NZZA 1E8MA 3QW2A 2EVWX 1I14A 2ZT5A 3PHCA 3R4CA 1EXWA 1JJBA 5DB4A 1V71A 2BRUA 1ZNQO 4NXNB 2O8CB 4RLSA 2ETXA 2XNCA 3OETA 4LHXA 5REQB 1V25A 3X1KA 4CM7A 1COZA 4DV2B 2AJCA 3MBIA 1HM5A 3BEDA 3GG9A 1MNQA 1R18A 2ZJ6A 3CWZA 4XCXA 3R0IA 2QVYX 1NBIA 1JDZA 3AP2A 3HWRA 4GOLD 4ZAZA 3VYRB 3MHTA 4PCUA 2H63A 2Q1UA 3QEMA 5BQ3A 1W5AA 1I7SB 1D7OA 2EKDA 5KYTA 1TO1E 3OM1A 3ACBA 2IEDA 5JNLA 5EE9A 2Q07A 4QVGA 1O9BA 3T7CA 3MRXA 1E7WA 1QTIA 2D00A 2YYAA 3TKAA 4QM6A 1H5QA 1WLYA 2GS9A 4RLQA 3PK0A 2R96A 3FPSA 4DEVA 1THZA 3ZHCA 5K3SA 4PCLA 3NUGA 4DTIA 4YYEA 4Q1DA 3ZQUA 3HTXA 1H3FA 1PKEA 4LNUB 4PYNA 4F97A 4RTQA 2VIIA 1A96A 2YJ6A 1J09A 2XGMA 2YASA 1ULZA 1BJRE 4LJ4A 1BWSA 3B1YA 4GUAA 3BWCA 3KELA 3HKDB 3JQ6A 3CJQA 1ODFA 3KBBA 3HCCA 1ZPDA 3UHFA 1GKYA 5B7PA 3FB1A 4N3NA 4U6QA 2AR0A 1UEXC 2YX1A 3CB2A 3KR1A 3ODGA 1R74A 2X40A 1CERA 2BSAA 1X2EA 4REQB 5DYTA 5JADA 3GMSA 2XWQA 4KDRA 4IG9A 3HO6A 1KYQA 2JRLA 3EVGA 3H86A 3KC2A 1YS2X 3OU7A 4LHSA 3GJZA 4XM1A 1YK0A 5DEIA 3HKBA 8MHTA 4AP9A 1MAHA 4R1PA 5LD2C 2B2NA 1EAYA 2GHQA 3GGJA 1VIDA 2W0MA 4NBLA 1QS0A 2W2NA 2YINC 4YQFA 4U2FA 1U0GA 5JZBA 4G0UA 2VJBA 3NWBA 1Z07A 4N9WA 4MKZA 1VRVA 3ICVA 3NGMA 3HA7A 4BMPB 5IPFA 4JOQA 5CX4A 2C3UA 4KO4S 3NJ4A 4BWFB 4RY9A 3WYDA 3L6EA 2VYNA 4HSGA 3O8CA 3L4EA 5IXJA 3LXUX 3TTYA 1I4EB 4V0RA 4DC0A 1E1YA 3JWPA 2ONJA 4BDSA 2B99A 4O4LA 1PZNA 4WJZA 3PQCA 4J7XA 5IAGA 4BEJA 1QORA 1H0SA 1ADBA 2QRKA 2ZDGA 3DL0A 4EF5A 3GLFB 1XRNA 3L6OO 1QK3A 3QE4A 2QUAA 3GA5A 3JCZA 3AIKA 2FPGA 2JFZA 2O3UA 1YOVB 2B8WA 2Y6UA 1EBFA 3K2QA 3KXPA 3MRTA 1ZOPA 3BDVA 3NI2A 1F60A 3JR3A 4GR4A 2O8NA 3WKDA 4JOBA 2H4JA 2W5UA 1WZCA 1Z9BA 1QGED 1QIGA 3DL7A 3TF5A 2Y2UA 4CG2A 4OP1A 2NUPA 1ZX1A 3IKLA 4D9KA 4GZMA 2XQKA 1ECGA 3K4QA 1Z68A 5TR9A 4D0GA 3ELYA 2WPDA 2XPCA 3W9BA 2OHIA 4BMVA 1JHRA 2A0FA 1UPCA 3W2IA 5KKCA 3L4JA 4DB4A 4PYIA 5F12A 1J6UA 3H5RA 3R3UA 3TUIC 4Q47A 1G38A 2J41A 4FGLA 4J0HA 2AH5A 4PPYA 3OFKA 3VZRA 3ZEAA 2FOXA 2ARKA 1BIFA 4CM4A 3HWWA 4ZDWA 5C3MA 1T1IA 1PHPA 3TRJA 1KTIA 4RH3A 3G23A 2IUFA 4NPCA 4Q0MA 4NYJQ 2GBIA 1DPFA 5GZ1A 2BFWA 3G0IA 1XZLA 3F4LA 3G13A 5JNSA 2FV8A 1PJ3A 3LBYA 3NBXX 4KHZA 4I0WB 4YWJA 4F86A 2GXAA 4IWXA 1RSZA 5CK4A 3WRXC 5CHEA 1AM4D 3T95A 3CCFA 1W6RA 1MNAA 4X1KA 4KQHA 4PQGA 2VOEA 3LVBA 3SYLA 4YV0A 5E4FA 5MFZA 2BFMA 5JS8A 2XZDA 1YK1A 1YZNA 1F06A 4RGYA 5L6LB 4QDXA 1S8AA 3IEMA 4LHWA 1UPXA 4OBBA 1FK8A 2EG5A 3QPCA 2PS0A 1CNMA 3DR3A 1AS3A 3V1MA 1QB8A 4BC1A 1R5JA 3C70A 4K6CA 4RD3A 1JAZA 1N0UA 1GCAA 1TK3A 3HNPA 3HWSA 4J03A 2J9YB 3N0WA 1LNSA 2QW8A 4R2LA 3V8RA 2P68A 2Q3CA 4NEQA 4YRJA 1IVNA 1J22A 4WLOA 3S1SA 3A4IA 1OILA 1CB7A 1XP8A 4DV3B 1A77A 3T34A 1RYEA 4FR5A 4FOSA 4U1RA 1XEAA 3OE7D 3BMNA 2R6AA 4NZMA 4IVRA 1GNTA 3QVXA 2ZJ4A 4LZAA 5CGQB 1VIAA 2XRFA 3M6FA 5J4VA 2UVPA 1BMFD 4FK8A 1P9OA 5BWNA 1BKDR 3G02A 2Y1FA 4PTLA 4UHJA 4EGQA 4EG3A 3GUYA 3P0FA 3JQAD 1UC4B 4MQEA 3EF1A 4QT0A 2HOQA 2XUKA 1FX1A 4D96A 2B6NA 4GWGA 4FFNA 3HUFA 4G0NA 3A3YA 3TFOA 4LF4B 4L02A 1FF9A 3D02A 3UGQA 2O8BB 4NOMA 1Z0JA 4PFKA 3JQ7A 1O5TA 3FZQA 1OXKB 3FIUA 3RU9A 1DIGA 1XTJA 3V4PB 3ZNOA 4GXRA 2EEPA 1OWLA 3A7DA 4HHEA 2C3PA 4OU4A 3THSA 3KQOA 1MPXA 3MIZA 4I6EA 3HSSA 2I65A 4KPUA 4AROA 2UUCB 1C3JA 1Z7EA 2P6PA 1L3BA 3F5DA 2JGAA 4ZZIA 1DV1A 4XFJA 3V8VA 3N07A 3RS4A 1KY2A 2VUHB 1G1AA 2A9QA 5FB3A 4CMKA 3AP1A 4PN7A 1JSLA 2P2ZA 3FETA 3K5WA 3H9UA 5AYVA 3TQQA 1NJGA 4A3SA 3ZHVA 5B55A 1FFWA 1AB5A 1KC1A 1ZC3A 3MBKA 3VKWA 5A06A 3WNBA 1FCJA 4LVNA 5AVRA 1QKKA 1TADA 2Y1OA 4UQPA 3H5LA 2F43A 5DN9A 4XIYA 2H08A 3L1KA 5G0UA 3UXYA 3ZV5A 1I3NA 5H9WA 3INYA 4ALJA 4BIIA 5HKOA 2O8BA 2BEWA 5HVNA 2NU6A 4XWAA 3BE6A 5IFLA 4RWZA 5INTA 1W96A 2V8OA 5MGBA 4R9UC 4LNAA 4OMFG 1RPZA 2X5NA 3ENNA 1SVOA 4MEAA 2PTHA 4F3TA 1ZK4A 4ZU6X 3FHJA 3BQ9A 3V46A 2XWJI 4RPIA 1T4DA 2XCOA 1SBIA 1CSEE 2WHQA 1Q12A 1YIAA 3F9CA 3LDFA 3ZV7A 2IXGA 1A3CA 5DLPA 2MWMA 1Z83A 4PNHA 1QNLA 3IS3A 2Q1SA 4PQEA 4MUYA 1SVUA 2ZYIA 2AFHE 4TVOA 5AM1A 4CVNA 2KM1A 1ZSVA 1QC5A 3FZEA 4KE7A 3WL7A 3Q0EA 1KF0A 2JJQA 4K6KA 2QP9X 4YECA 3Q6NA 3MAGA 2O8EA 4BGIA 3QLTA 2IYFA 4PSVA 5LZ5A 4DUGD 1HQYE 4A23A 1N5IA 5I4BA 4MWEA 3KR9A 3S40A 1WUHS 2Q5LA 1NKVA 5FADA 1EVKA 2HMSA 3BEOA 3FDIA 4X1IA 4P98A 5F73A 5H3LA 3SQMA 5EHQA 3MTQA 1ZSNA 1TZ2A 3RFCA 4YP6A 4CR8A 1NR1A 1IQ0A 2CLOB 1UT8A 2JFBA 1K92A 1P5RA 1A5SB 2FRXA 3BJRA 1AS0A 1UINA 2C8JA 2I71A 4US0R 3WSWA 1WPQA 1ZRNA 2ZJ5A 1TJ5A 4IV5A 3DWIA 4I9GA 3DC7A 4WCFA 2IZ1A 5CA0A 3VGJA 1I9GA 1XNRB 1GU7A 3OM0A 4LMAA 1TKCA 2NU8B 2A88A 4NMLA 4GXNA 2N1BA 4XM2A 1JLKA 3U37A 3X1ZA 4Z3OA 1BX3A 2VNSA 3BIJA 3GFBA 3ZU6A 2IS6A 2BISA 2BEWB 4EHIA 1Q6ZA 4RPKA 4A6EA 5GADl 4E22A 1KMNA 5PGMA 1TCBA 2Z1MA 4M8NE 2X1HA 4DA7A 1NASA 3DVLA 2VDJA 2BEUA 4KBFA 3G88A 5GMOA 1DBIA 1K4MA 3CNBA 1HOXA 3ZH9B 4Z49A 5CDTA 1L5ZA 4UM9D 1KE2A 4CDNA 4X20B 4AJKA 2FETA 4MKHA 1CWUA 1O96A 3HDHA 4OVKA 3WNVA 1XJWA 5AJWA 4F1KA 2PTGA 3ZHUA 2P3OA 2Q0QA 3EOAI 3PJFA 3L4SO 3GLRA 2J4CA 3KQVA 1P1HA 4EELA 1Z3IX 2ST1A 3SQXA 1E6EA 1ZYUA 5FTLA 5DNCA 2J6BA 4I8DA 3GG2A 2OR3A 2SHKA 1WBBA 3ESBA 1FW8A 3CR8A 4QO7A 3WLPA 4GI1A 4RETA 2EARA 3AR4A 3GUZA 2BR4A 3DOCA 3L6RA 5LC1A 1W34A 1DZIA 1Z17A 2AUTA 4ZI5A 4L9SA 4G5FA 4R8SA 5CR9A 1RQNA 2VDNB 2CWDA 1FUKA 2AZ4A 3FHLA 4XX1A 4ZQGA 2FMFA 1Z36A 1UP4A 1FTWA 2O4UX 2E4WA 5TGZA 2ETVA 1YS7A 1Z5UA 4KLRA 1SVWA 4ZREA 2JLUA 3MTGA 4A03A 1W8IA 2G9UA 2OHVA 4EF4A 2GJ8A 3OOYA 4O2LA 2B2XA 1Q6YA 1PL0A 4HOYA 5EWMB 3JAWA 1U8AA 1J42A 3QFRA 1VCIA 2V65A 3SGLA 4B8YA 1OBFO 1K8XB 2SICE 4JLUA 2V0GA 3L4KA 3DNFA 3ESAA 2QPLA 3QVLA 4G9GA 4BO9A 1ZNYA 4LXIA 4C2BA 4HMOA 4Q16A 2P0AA 2RJNA 2W6IA 2Y4NA 4PPGA 1UDBA 1U2RA 4AZTA 2BLNA 1T3TA 1QQAA 3I6YA 1NUQA 2J09A 3VOSA 3QF4A 4OUKX 3UJ9A 4C87A 4EABA 1NPTO 1SRRA 2V6JA 3ACDA 1M8FA 2AG1A 1J39A 2FRDA 1SIBE 1NURA 1Y4ZA 2VAVA 3GEIA 3KETA 4ND5A 4P9NA 2DETA 2JJ1A 3PA8A 4HGZA 4CWAA 3TI7A 3T5BA 4FDVA 3EG5A 4YJ3F 2XUOA 1UWLA 4LA4A 4XTCS 2NO1A 2X8JA 5IC6A 1BW9A 5EJAA 4E13A 2R86A 4RFVA 3IAS6 1IY0A 5D6OA 5JTTA 4E2ZA 2HNBA 1JGTA 2BVNA 4DA6A 4N6OA 3DMTC 2KLBA 3UKJA 1X9HA 4H0NA 4B7CA 2G77B 3H99A 4W6QA 5DV9A 3RS0A 3Q3JB 4G5RA 2WMYA 4UHCA 5CYOA 1URPA 2OCYC 5EPOA 2WM2A 5FT9A 4P3KA 4PAWA 4QFMA 1RRMA 2J0UA 3K30A 2XAAA 2XTMA 4FU0A 4ITRC 5LZ7A 4JYBA 2QTHA 4BQRA 4D3DA 1PG5A 1LC3A 2CYAA 1HQCA 3DHEA 5GQSA 1Z56C 3INGA 1EM8A 5ALJA 5T67A 2PQ0A 5TQVA 5J47A 3PYLA 4JLBA 3B1WA 1LB1B 1PV4A 1MP0A 1CDDA 2I54A 2NTYC 5ERXA 1D09A 3EZ2A 4KE9A 5A3JA 4OUDA 1POXA 2Z2YA 3DL4A 4EL5A 4QTUB 1DO8A 3R3HA 4KLNA 4MVJE 3STHA 4B9AA 8GPBA 1V7CA 3C1AA 1LDMA 4P82A 1Q1QA 1CJKC 1Z7YA 2ZSKA 2RKWA 1ENPA 1QFSA 4HWTA 3WAJA 3II6X 2VRNA 4Q7LA 5EY5B 3WISA 1PU2A 3SNKA 4H4CA 3DYIA 3KOOA 3MGGA 4DLRA 3CVVA 3EWIA 1YR6A 3N8KA 3EXG1 4XGNA 3AR7A 3GJYA 1I6WA 4M89A 5DRYA 3UMYA 2HSDA 2NPOA 4HB3A 1M34B 4YP9A 2JBAA 2IOFA 3UWPA 2CZCA 5FFMA 3LUBA 3ZDDA 2CXRA 2JIQA 3NBMA 5BP7A 5SZIA 5BPHA 4R1OA 4GI2A 1Z2PX 1E77A 4JUCA 3OWOA 1ESMA 2BI4A 2H1HA 3DOJA 3O1HB 3QEJA 1N6NA 2CZGA 5AJXA 1XDGA 2I1LA 3LTNC 2I4LA 1F3OA 1FQWA 4ISBA 1A9PA 2C5EA 1CZHA 2FP4A 3T5PA 2ORED 3E84A 1EFDN 4Z9YA 1W76A 3A4YA 4NBRA 4NBWA 2AYYA 2EATA 3A6KA 4LXUA 4CV3A 1V26A 3D8HA 4BLSA 1MB2A 2RGXA 3T7JA 2UUOA 3F4BA 3U1VA 3ZWCA 1SGWA 5EZ5A 3H19A 1U7PA 3TEJA 2NZJA 3PVSA 2HFJA 2HU5A 4JNKA 1DEHA 2AFHA 3LMKA 3PRJA 3OVMA 4EY4A 5TEVA 4PC1A 4R0NA 1EVEA 1EUDB 4L5CA 5KHAA 4CHGA 2HRCA 3DBRA 4NBVA 4G2TA 4DEXA 3MWGA 3CU5A 3U7JA 4F3KA 3HVUA 5FOQA 3J81k 4G0XA 1S7GA 2W00A 3AEYA 3EZXA 3UB3A 2AG0A 3JYLA 4PLWA 4FT4A 4LGYA 3WGKA 3LP5A 3V33A 3G8AA 3EDRA 4REQA 5DNWA 3KT6A 1UFVA 4FONA 1DQZA 2PWZA 4GP9A 4PGGA 4TMWA 1IJKA 2OFOA 3FLAA 1LVGA 4RENA 3AXTA 3PTLA 1PFKA 2RGRA 1MN6A 2WV7A 2C29D 1GUYA 4MGHA 4P0PB 1PRYA 4ZICA 1QAQA 1QRRA 3ETDA 1C1HA 2CFSA 4HWRA 2P67A 5FLKA 2IPNA 4PLGA 4HV4A 3GZJA 3FUWA 1TLLA 1V1RA 5CM9C 4AZ3A 5AM5A 4HDRB 5TF4A 3H75A 3I1FA 3IBCA 4JA2A 4PZ9A 3OTGA 1HURA 3ADBA 2XA2A 2DT8A 3U7QB 1SD2A 2FPXA 2LV8A 5G4KB 5ALEA 4Q82A 1CZNA 1FSZA 1PT8A 3OOJA 4FW8A 4XYMA 3V4VB 5IXYA 2QTGA 2CMHA 2IYOA 1Y98A 3DDWA 3DCNA 3CLSD 3OBIA 3IULA 3OZRA 4FDTA 4FJ1A 2Q27A 3MAJA 1J8FA 4B75A 4KGDA 3ILYA 2ZVQX 1HEUA 1RAHA 4ZT3A 3JU3A 2P77A 2JCXA 4DNXA 2CFOA 2FQWA 5BUCA 3TBFA 4Q9AA 4O3FA 2FEXA 3G0OA 2Q7DA 2QLJA 1G2OA 2Q29A 2XADA 4B8WA 2R97A 4RJJA 5HWSA 3I8XA 1P61B 2VHUA 4QUKA 1C14A 5EESA 1FEZA 4BP9A 3M9XA 5A4FS 4ESEA 5JASA 4PWZA 2HSGA 2GASA 2QZZA 4UBMA 4V2UA 5GV7A 2IK8A 3DDCA 2H0RA 4MS4B 3G0CA 2O0HA 3HB5X 1CLUA 1JWLA 3KU4A 1WVIA 2QAJA 2AG6A 3HZOA 4R4JA 5FI3A 2AFIE 3T52A 1RADA 3W8RA 4IFEA 6AT1A 2LE0A 1CRWG 3MWDB 2WIKA 3KXDA 3R77A 1G2PA 2A57A 2J9FA 3VNAA 4EWLA 4RE6A 2JLRA 4XPIA 1ZONA 2HIMA 2Z2JA 2QT0A 4O2BB 4QXMA 2XXBA 4PHFA 2B7CA 3AKZA 1QPZA 1T3SA 4B79A 4IRUB 4IHQA 3E5MA 5CM2Z 2GPBA 2F1HA 1NN3A 3K1AB 4QSMA 5JE8A 1PDWA 2TECE 3NDIA 4ON9A 3VPBA 4NIMA 4D3XA 4JAVC 1ZIYA 3QBTA 1C8KA 5AW0A 1NNUA 5JMWA 4LXXA 2ZE8A 4DFDA 1BU5A 1NOKA 3JPWA 3F6EX 4F8JA 3DKRA 2IHKA 3AI1A 3DOFA 3MTAA 3VX3A 1I30A 1NXSA 2XD4A 4D74A 1NYLA 1R3UA 3LQ1A 3MILA 3GLQA 3OT1A 3DLBA 1SVMA 1MVNA 1MPTA 3DA8A 3E23A 2ZE7A 1Z6ZA 4W5JA 2E1RA 1EESA 1JH8A 2G9ZA 2YHSA 3B3FA 1HFEL 1SXJB 2MSKA 3OI7A 3UOWA 5KQGA 2QM7A 4LYYA 3DMTA 4GO1A 4LMPA 2CV0A 3RJ9A 1DIHA 1P18A 3BBLA 3LVQE 4OSPA 5FHQA 4MHOA 5SZJA 3SNHA 3TEMA 5YASA 5F9HA 5B6IA 3R6TA 3NTVA 2OBFA 1JDPA 1H5UA 2O3TA 2PGJA 4ENSA 5L45A 2NQTA 2NUAB 4ZYYA 3ZGOA 2UZ0A 2JJ8A 1XAJA 2P9EA 2DQ4A 2CDAA 3CUTA 3OFNA 4IH9A 3AEUA 3LQYA 2E1PA 5HJEA 2CBZA 4ZGGA 3GI1A 1JEAA 2Y3IA 1WQ1R 4U7DA 1YB7A 2XQFA 1Y9AA 4C4OA 4F6LA 2CLDX 4FKBA 3OEHA 3BK2A 2Q5HA 2HYDA 2WZBA 3TSCA 5MN6A 1IM5A 3FPGA 4QSHA 4JV5B 3CG0A 3PHHA 1O94C 1U2DC 4A1OA 3DOOA 5B3AA 1LK7A 1JB9A 1V8DA 3H4TA 2C9OA 4FYVA 4U5QA 3SSOA 1R00A 4LOIA 3Q3VA 4JGGA 1NDHA 4ZYLA 5BR4A 4J4TA 5BN1A 3RJTA 3DFMA 4ZCSA 3IUMA 4FGUA 5LKAA 1GQ2A 1JEQB 2XGOA 3F1LA 3RVBA 4B7AA 4QUJA 2DFLA 1GCOA 1SBYA 3M5WA 3OPYA 4G86A 4JEMA 2CUKA 3HA5A 3PC8A 3OECA 2BEKA 3CLVA 4IPTA 5B2ZA 1M6VA 5J5CA 3T4UA 5BVHB 5KAMA 2JVIA 3ENVA 3LA8A 1MG0A 1IUNA 3C3JA 4HX5A 2ZPUA 1D3AA 4TL8A 3N8IA 4AUNA 1N2GA 1W88B 2KBFA 2YXEA 1Y1TA 1ZMBA 1IHOA 1J8QA 1KO1A 1YVDA 2PMFA 5AVSA 1LXCA 1UANA 1RI5A 4TM8A 1TCVA 2PJUA 1KJJA 2D5CA 3F78A 1HNZB 4JEIA 2Q7XA 3K8YA 5K3OA 4D57A 5CT4A 2DG2A 4M6WA 4YAJA 3ASYA 3TQRA 5K20A 4B3SB 1DFHA 3DTNA 3L7DA 2WD7A 3P94A 1LH0A 4FGZA 4WKOA 1KI6B 4GEGA 3KQQA 1LF5A 3ZIAA 2NM0A 3USCS 3HB7A 3I34X 1UBGA 4RZIA 5KOYA 1G55A 1N6IA 2AD5A 2GH1A 2XOKD 4V24A 4B7UA 4M2LA 1JFRA 1YJBA 2CK3D 3HI6A 1QV7A 2VSXA 3KJZA 4HLCA 2IPXA 1OV4A 4N3BA 3GRZA 4H59A 3L7NA 2B4KA 2OPBA 3B51X 2PUEA 4RKFA 2D0PB 1D1QA 3BFKA 5B2EA 2UYCA 3MOGA 1MAUA 4GRDA 5F9MA 1OC2A 2OP0A 4NK5A 4IY1A 4RVFA 4TL6A 2QAGA 3RVOA 4EZEA 3EEQA 4N48A 3RDPA 2P9HA 4H18A 4JLPA 4JJGA 4CL8A 2FN3A 4W1PA 4M1MA 4Y9RA 2C4NA 5EIAA 1IULA 4TZTA 5IULC 2VYCA 4MV6A 2HF9A 1QE5A 5BWCA 3I2YX 1JEYB 4GI3A 2ZDHA 4CM1A 5KTKA 2VT2A 4DADA 1G4AE 1TVKA 5BRAA 2WFAA 4JU8A 1VYTA 1XNQB 3T54A 2AI2A 2YCLA 3HLYA 5DM0A 4ZD6A 5CVUA 4HNUA 3QG1A 4NJMA 3IHWA 4C6SA 2I1VB 3QHQA 3AUSA 1BO6A 4F9GA 4V0ME 2E37A 4L9RA 3C4VA 1JA0A 1UBOS 1K7YA 1KZYC 1AKWA 3NTXA 1OVGA 2JFXA 3H84A 2G5GX 4MKFA 1JXAA 1AF4A 1M1UA 2V4UA 4UQOA 2HEIA 1FSPA 4RK4A 5DXFA 4ZAVA 3CVYA 1PSDA 1Z2OX 2I7TA 4EHLA 1DG3A 2I29A 1F5NA 4TM7A 3ILHA 2FRDC 3INNA 4I4TF 1WDLA 1Z37A 2WABA 3AHFA 2QN2A 3GRYA 3IA7A 2XBUA 2C03A 4C78A 4DQXA 4Y0VA 4UM9B 4WZZA 1P91A 2OCPA 3FJYA 3NV9A 3UGKA 1G6Q1 5AESA 3GD7A 3S7ZA 1AKEA 4K03A 3A6HA 4KO8A 4R69A 3UFBA 4QOEA 1USUA 1F4LA 2GJ4A 1VL0A 4DR7B 5CVTA 5EERA 1N2JA 1XLUA 2RIPA 1LJLA 4OM7A 4CKCA 4HDKA 1MF7A 4EITA 1IK6A 3AZPA 1TO6A 1WXFA 1K7EB 1I5EA 3I8OA 4EJ6A 1VPWA 2G1PA 3BHIA 5FWYB 1JA1A 4OK6A 2WAOA 2IW1A 5EG5A 3ZXIA 1C9NA 1JAXA 3L8CA 1OGYA 4BNMA 2J6IA 1H9BA 2BHSA 4OXYA 4YPVA 2DPLA 3FSJX 1LBHA 4Y6SA 4BKRA 1HDXA 2XXJA 3ESDA 3OIWA 4FDMA 4GS5A 1YQWA 3TLAA 3EH1A 1SCKA 2FX3A 2J3QA 1YZGA 3OOWA 3IVCA 4HJRA 4M0FA 4P7GA 1NVDA 4Q4DA 5CB4A 1U5CA 3OA0A 3ZIUA 3RC8A 1IXRC 2QTRA 3EVFA 3JASB 4KRXA 4XQGA 4YMTA 1GTRA 1ZUNA 4LV5B 2DWUA 3PWSA 3Q15C 5DPMA 4B4OA 2O7RA 4DTCA 2Q3HA 2MCFA 1E2JA 3HSYA 5LUAA 4GF5A 4MOWA 2ZAOA 4DCSA 2BT4A 5ALYA 2OYCA 5A0TA 2AMLA 2GDZA 3FG9A 3FKSD 2H29A 3CVOA 4AP6A 1YJCA 4MS3A 2WD9A