4ICIA

Crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
NSKILVAYFSATGTTARAAEKLGAAVGGDLYPIAPAQPYTSADLDWNNKRSRSSVEMNDPKMRPAIKSKKENIGTYDVVFIGYPIWWDLAPRIINTFIEGHSLKGKTVVPFATSGGSSIGNSATVLKKTYPDLNWKEGRLLNRTDEKAIRAWLDVIAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative flavoprotein (BACEGG_01620) from Bacteroides eggerthii DSM 20697 at 1.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Flavoprotein
molecule keywords Putative flavoprotein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iciA00
2F1OA 4J8PA 4GI5A 4YAUA 1T0IA 1CZNA 5F12A 4H6PA 4FGKA 5FA6A 4LAFA 2MWMA 2OHIA 1AKVA 4D02A 2Z98A 2KQUA 2W5UA 1WSWA 1YKGA 1T5BA 3R6WA 4Y9RA 2FZ5A 4XDGA 3UXHA 3QE2A 3P0RA 2QMYA 3GAMA 4ZVKA 3UXEA 5LLDA 1FLDA 1I1OA 3O2NA 5LBTA 3O73A 3HA2A 3W77A 4PU0A 1AKUA 1ZWLA 2GSWA 3K20A 4Y7CA 3OJWA 5EA2A 3W78A 3NFRA 1E5DA 3HLYA 1AKWA 1FX1A 3F2VA 4LA4A 5F51A 2M6SA 3TE7A 5EMNA 1XT6A 1YCHA 2HPVA 1CZRA 3KAPA 2BZSA 2KLBA 3FJOA 3GFQA 3N3AC 5EAIA 3ESZA 2B3DA 4YAWA 4N65A 2QX8A 4LTNA 3FW1A 4QOIA 1AZLA 1YCGA 2FLVA 1FLVA 2X2PA 2Z9CA 4M0CA 1JA0A 1YOBA 2V5UA 4BMOB 1J9EA 1H69A 2V9CA 1OBVA 1AKRA 2QX6A 3K1YA 4OXXA 2OHHA 5FX2A 3B6IA 1D04A 1TIKA 1YCFA 3OX3A 5A4KA 3QFRA 4ICIA 1DX9A 1FTGA 2Z9BA 1SQSA 1FUEA 1QRDA 4FX2A 1FLNA 4N9QA 1AMOA 3OJXA 1QHEA 3NHSA 1C7FA 1RLIA 3HR4A 1CZKA 2N1MA 3LT5A 1J9ZA 1AG9A 1FLAA 1X77A 2MTBA 2QX4A 4NLLA 4U7GA 1C7EA 4C76A 3GFSA 1OFVA 2Z9DA 1XI2A 3B6MA 4LTMA 3W7AA 1H66A 4QOFA 4CETA 3N39C 1B1CA 1ZWKA 1BU5A 3S2YA 2BF4A 3SVLA 4R81A 4LTDA 4U7HA 3ESYA 4ESEA 2Q62A 2R97A 3L9WA 1XYYA 3N3BC 5LMCA 2HNAA 2QX9A 2X2OA 3NHPA 2XODA 3ESXA 4FGJA 5NULA 4GQIA 4YAOA 3FNIA 2HNBA 3TEMA 5LJIA 2ARKA 1TLLA 3F6RA 4HS4A 1CZOA 4QOGA 1AKTA 2XOEA 1ZX1A 4GR9A 5FUQA 3OX2A 1JA1A 3U7IA 2ZKIA 4NULA 3F6SA 3NLLA 3RPEA 5B3KA 1CZHA 1FVXA 5LVAA 3EDOA 5B3LA 2D5IA 3QFCA 1YRHA 5BUCA 1WSBA 4ZVLA 1J9GA 1NNI1 3NHJA 3NHWA 3NHYA 3OWXA 4DIKA 1AHNA 4C14A 4C0WA 5JROA 1AKQA 3D7NA 2FOXA 4HEQA 3NHUA 4YQEA 2AMJA 2QMZA 2FDXA 3FVWA 3B6JA 4QOEA 1V4BA 1KBQA 2MT9A 3ES9A 4PTZA 4FGLA 1SG0A 2FVXA 4XDHA 1XYVA 5LBUA 1D03A 5NLLA 5ULLA 4C0XA 1OBOA 1BVYF 3EYWA 3B6KA 1DXQA 3OVMA 2FX2A 4YALA 2V5VA 1RCFA 2R96A 3JSXA 4H2DA 3KLBA 5LJLA 4QOHA 4ZVMA 1J8QA 3OX1A 2FCRA 2MOKA 2WC1A 4CF6A 2A5LA 3OWHA 4U7FA 2QR2A 3ZHOA 4F8YA 4PTYA 1RLJA 5TGZA 2M6RA 4BMPB 4DY4A 4Y9UA 3GFRA 3F90A 1VMEA 4S24A 2FAXA 4QODA 1RTTA 5F4BA 1D4AA 2QWXA 3FX2A 1DXOA 1CZUA 2BN4A 3NHKA 2FZVA 3TZBA 3G5MA 3NHLA 1KBOA 3NHFA 3KEGA 3L9XA 2BPOA 1CZLA 1QR2A 1F4PA 2BMVA 3NHRA 1YDGA 4N82A 4QOJA 4ZVNA 3U7RA 3KAQA 3W79A 2OYSA 2RG1A 6NULA 2Q9UA 1QBGA 3LCMA 2OHJA 4YAFA 1GG5A 4DILA
chains in the Genus database with same CATH superfamily
3HCRA 2PAFA 4ZQCB 3AEZA 4X91A 2QD2A 4UVHA 4ZYVA 4K28A 1NQVA 3ZV6A 1A5ZA 3FOEC 1KDVA 2PNJA 4JR1A 3GGOA 2VOJA 2XWQA 1XN4A 4Q7JB 4BB6A 3VSEA 2AWNA 1DRUA 5F1YA 3MSCA 5MN6A 4W1RA 1CUXA 4IDDA 4ZZ1A 1L4YA 4IDQA 1M2HA 4DWOA 1A9QA 2X13A 5ALWA 4P3XA 3AMVA 4DUGD 1PGJA 1JLLB 1TT5A 2NZUG 4GXRA 5G3YA 2BM1A 3GLHA 4BDSA 1JIVA 1SPXA 3EXAA 3SDZA 2EEPA 1L4KA 3P19A 5GADl 2OSVA 1TJYA 2WEKA 5AVSA 1M6WA 2BUCA 4S35A 5AI4A 2RE8A 4OXNA 2QT9A 2LBPA 2PS3A 3B53X 3ANTA 1U8ZA 3B51X 2V9CA 4R5HA 1NOIA 5AJUA 2R7AA 4FSDA 2WFLB 4QYXA 1DT3A 1RE1A 3DPUA 1LTKA 4Y6QA 4AJ4A 4BJ6A 1OF1A 2CFCA 5KQPA 3BRCA 2QVYX 3QIVA 1W0JA 2QV0A 4KSBA 1JR3D 3VJLA 2VSOA 3VX3A 1GTJ1 4P08A 2GWHA 2WUVA 3CU5A 1CSEE 3V2GA 5EHZA 3DXFA 2PO5A 2RDMA 3D6HA 3B9QA 4K9OA 1J0AA 5FJJA 3RIHA 2QE7D 3OFSA 4KO4S 3ULKA 2B35A 1EFRD 1N1GA 1NF9A 3MFQA 1R88A 2O5VA 4H7IA 3ZD8A 3V1YA 2XB9A 1SKBA 4CIXA 2OD9A 3RYFA 1OVGA 4L78A 2CDNA 1LBIA 3GGGA 4J6FA 2DRIA 3DZGA 4KVFA 2ILTA 4IIUA 4PE5B 2GH1A 4TKUA 5ALUA 2VBIA 4D5EA 1RCTE 3F6PA 3ZV3A 2JJ1D 3VC7A 4LOJA 2C4NA 3D1VA 1HX7A 2LDXA 4DDKA 4JBXA 3LUGA 3IUNA 4R2LA 5B55A 1HG0A 3M4YA 5JXGA 4QGBA 1FC0A 2F9FA 2NV2B 4RGBA 4FB4A 2A84A 3K0CA 4Q01A 1O89A 2GBLA 5JROA 4YQEA 1HG1A 2FOXA 3OLYA 4X3PA 1Y80A 4DNQA 4JJ8A 2WJ3A 3G0GA 1FF9A 4ZT2A 5LBUA 1IN1A 3O1HB 3LAWA 4HDKA 4FMPA 2BRUC 1J49A 1X1TA 2WOOA 3LGXA 1C0PA 4L6IA 4BLVA 2TMDA 2WD7B 1EZ4A 1YOVA 3SYNA 2CXSA 2JVJA 1A76A 3IAHA 2AQKA 4TZTA 4ZZIA 5TEVA 4H60A 5BOVA 4YRDA 1EGHA 3EZ2A 3OE1A 3KU4A 2CUNA 2D1FA 1XROA 2HMVA 5AVXA 3W6ZA 1NMYA 3KLOA 3RJ9A 4OHMA 1AQIA 3ANXA 3HBFA 5FOXA 1RYMA 2H2GA 3P26A 4Z3KA 4LF7B 3R20A 4KXYA 4RHUA 2CZCA 3I23A 2PM8A 2X14A 2PK3A 4G5RA 2QYSA 3AEKA 4LJAA 3WGHA 1TYZA 1VPLA 2NWQA 1OASA 2YS6A 2UYHA 4YAIA 4CTJA 5JTTA 3BF8A 2O8VA 3LO5A 5K4GA 1TGVA 1YZQA 1J8YF 4B47A 1OLUB 2FWBA 4DADA 1F1BA 4EY3A 2F43B 2R7LA 4H3HB 1U7HA 1M34B 1Q7TA 1UKYA 2XDQB 4U6QA 3TB6A 3JQ8A 4WN3A 1KEWA 3AINA 5GZ1A 2H4JA 5B12A 4AJHA 5K3DA 3FPSA 1OFTA 2VR1A 1U2ZA 3IGFA 3OQVA 4XRRA 1HETA 3FZEA 1IBMB 2VHTA 3M34A 2EJTA 2QLFA 4G01B 1UFKA 5CM8B 1GDTA 4UHDA 1RJ9A 1U1GA 5G1PA 4IIHA 3ZBTA 4JKYA 1KQNA 4KO1S 4ZMBA 1QPGA 5B58C 1CRZA 4JOCA 3OMLA 4WK2B 4XA8A 1IBKB 2V8OA 2XT0A 1M0EA 1IY8A 3C6MA 1GZUA 2QZZA 2FRVA 4NRDA 1OBVA 2J33A 5DE3A 3B1FA 4L4RA 1G0NA 1OU0A 5AXBA 1K97A 1G20A 2AC4A 1P72A 1CHDA 1E1RA 1JU9A 1Q91A 1QH1A 2JGEA 3HKDB 3IMCA 1P61B 2HLHA 1PYDA 3VOTA 4BIMA 4HNRA 3PQ5A 1CDOA 4TZ0A 2ZQZA 4XLLA 1SO8A 4JSYA 3LUHA 1EYZA 1M1YE 1M66A 3VKWA 3QE4A 2JA1A 2IEIA 3G8BA 4L07A 1CTQA 2V8BA 3GZNA 5BV1A 3T1YB 1GTRA 2P68A 2E87A 2A4MA 4JVNA 4QUIA 4R8VA 4KQ2A 4DR7B 5KJFA 5ELMA 2Q1SA 5AK3A 3H1BA 1A2QA 2ISCA 2AG5A 3FSJX 1CDDA 4B09A 1XO1A 2G9ZA 1V5EA 3CZCA 3OPVA 5D5HA 3SAJA 2V7UA 6AT1A 2W6OA 1ZNQO 2EOAA 2YJGA 3DBRA 1G9XA 3I9OA 3N58A 4WSOA 1F9EA 3OX2A 3ZY3A 2G1JA 2JGMA 1KI7A 1RYBA 2L2QA 2P1ZA 5IM4A 4LF8B 1L3IA 3O8DA 5HFJA 1TMYA 3H17A 2GASA 3EIQA 1M6VB 4FYKA 4B4VA 4EAAA 3OZSA 1V7ZA 2P6RA 2HSZA 1Z34A 2RH9B 2XCIA 4FD3A 3HVRA 1JPVA 1XZCA 4FCWA 4E33A 1YHNA 4DIMA 3MAJA 5BPHA 4B6OA 1LV8A 1NASA 1SA0B 1MIOA 2HQSA 2C1ZA 3ASZA 4IDGA 3QMPA 1Z73A 3FOAA 4J91A 5ARBA 1JHXA 3T1QA 4NMHA 2WJZB 4RL6A 4UNSA 5B3JA 2GF2A 3AHDA 2EWWA 3C5EA 4I1OA 3WHPA 4BO2A 1I94B 2B5OA 3KAKA 3L01A 2IH5A 4LGMA 3I5YA 3QKSA 1J00A 3FCAA 2VNHA 2ZZMA 1IB6A 1REQA 3MSXA 1A7UA 4RVOA 3X1KA 4JI7B 1L4GA 2C03A 2CMKA 3EXFA 1KEUA 1JVSA 3EVTA 3B9PA 2IV7A 3X0DA 2H63A 3AKZA 5JNLA 1KZHA 2AC2A 3SZUA 1B76A 3VSAA 1PT8A 5FWXA 3SVTA 1OE0A 4HGZA 1A71A 5ELLA 4UPEA 3WK5A 3GGCA 4NV3A 2JAXA 3H8SA 4R1QA 5GTDA 4R6XA 3A6DA 4U9IS 3HM9A 1AK9A 3LP8A 4HX5A 2PX8A 4X7RA 3ANYB 4QYIA 2DYKA 5BNFA 3R0XA 1RC8A 3PTLA 2V7GA 1PNQA 4BGIA 3AVXA 1JZQA 1PE0A 1EFTA 3AR4A 3FHTA 3A6FA 3PWTA 2LDBA 5EIFA 5IFLA 2O8BB 2P6MA 4DT1B 1GPDG 1E8NA 1UBKS 1ZGGA 2IHZA 2WAXA 3A6KA 3HFRA 4HAYA 4DV5B 2O48X 3QE2A 5AICA 3ZZ1A 4NF2A 5LQCA 3KKNA 4HRXA 5B7PA 4JJZA 4OLAA 2HT1A 4Y9TA 1GGMA 3WWYA 4EQ6B 5EL0A 1FMTA 1T0JB 3CUYA 4IFEA 4IXNA 1PUJA 5EZQA 3L7DA 4YBZA 2C92A 1U9IA 4FOOA 2JPDA 3FKSA 2JCBA 4ALLA 2H4YA 4DSUA 4EO7A 3TIIA 1BHO1 3OU7A 1DIHA 1RT9A 3PEEA 3PEVA 1RKQA 2CCJA 3FM9A 4JWKA 5AO9A 3B3JA 4DVJA 3U6BA 1IVSA 1V8DA 5ENVA 3WIBA 5IW8A 2O23A 3LPMA 3FWHA 4YAJA 4M9ZA 3U1TA 4FFWA 1KFCB 1T9CA 4G8DA 1W5FA 4IRUB 3TMAA 4YP1A 3U80A 1YCFA 5CDFA 3DLHA 3QJ5A 3CF2A 3NCHA 1F60A 4UOZA 2HZ7A 1UAYA 4UVEA 1JEJA 1YS7A 2WU4A 5IUKC 3KE9A 4K8RB 4OHVA 2WV7A 3ETLA 3I0MA 4NJMA 1BXKA 1NN0A 4MINA 3RVLA 1IVNA 3CCFA 4R2HA 1YASA 4QJBA 5JS1A 4AO8A 3O4HA 3PIDA 4KHZA 3GH1A 4PQEA 3PLNA 3UG7A 1YGPA 3OE7A 1JHZA 3VA7A 5EE1A 1A50B 2PR2A 1P2BA 2XWJI 1TO1E 1ZM9A 2IPLA 2QW1A 2Y1DA 3M3HA 5ARCA 1E9SA 2JF0A 3IHTA 2WKPA 3QX9A 4PSUA 2WAOA 4H7DA 4B3IA 2C2BA 3ZE1B 4E15A 1TM4E 3GAZA 1T9AA 3LUDA 4IGKA 4GX2A 2F67A 3E27A 4AL4A 1HEIA 1H3NA 2JIMA 3R44A 3LD9A 5EWMB 1MJHA 1TYCA 3IDZA 4AKEA 1A7KA 1D0SA 2C98A 2D5IA 2YV2A 4H7EA 4MMZB 4WLFA 2OO3A 5DOVA 4ZVLA 1KDZA 1Z62A 3P5BA 3BSYA 1FMJA 1VRWA 1RCUA 1L7AA 1TZCA 1XRLA 4XYEA 1R00A 4JC0A 1RPTA 5DHAA 4BCCA 2O3TA 4FB5A 4W5TA 3MJEA 4MDHA 3FFAA 5THKA 1LSUA 3UC5A 1HURA 1V47A 4U00A 1T13A 1KQOA 1CIPA 4WUVA 5CGQB 2JCVA 1JBEA 3OVMA 2I29A 1XU9A 4INPA 4EHJA 2F62A 2IXFA 1KJQA 3VR0A 1UOOA 2J6CA 1M3SA 1U2RA 5ICSA 1NRXA 3GJZA 1RLJA 4FP9A 4FXOA 4RCYA 4TL6A 4BTEA 3G5TA 3MGAA 3OM9A 3KHSA 3THYA 1ZUD1 1GU1A 3TI9A 1OXUA 2VDVE 2XGSA 3NRBA 1K6EA 3MMPA 2G09A 3P2OA 3UWSA 2ZB2A 4KWCA 2HU8A 3RSLA 1JQAA 2PX4A 4JR2A 7GPBA 4GPTA 4MV6A 1W85B 3LKDA 4D4HA 2ZRIA 5EJ8A 3B2QA 1BVUA 1R10A 3DMFA 3CE9A 1L5KA 3UK1A 4E13A 5CG1A 3IB3A 3EWIA 4RDXA 4TV8F 1A8PA 3BWYA 3E7DA 2EC5A 1YACA 3K9HA 4QVGA 5IWAB 1VPWA 3GMIA 3IDSA 4XCXA 4AI6A 5HF5A 1C8LA 1K7EB 1RWPA 3PSAA 4WK0B 2CBXA 4D45A 4XDGA 5CLIA 3JQDA 2C04A 3L1VA 5K03A 1H8EA 3CF6R 4FJ2A 4DCTA 4KU4A 3GBVA 1EX6A 2V74B 3I34X 3FSRA 3OZCA 3WGVA 1TU4A 2HDNB 3DL0A 2P3QA 1K4KA 3PNLA 2FTKE 1Q7BA 1G8JA 2EU8A 4MVCA 5CA0F 4MKFA 3FDFA 5CDFE 5F3WB 2BZSA 5AOBA 5A5FA 3SSAA 1XVAA 1Q3HA 1TYEB 2J08A 1Q95A 2W6CX 2Y05A 3Q7IA 3QJGA 3LF2A 3OLVA 4L8GA 4DRYA 5AJZA 1NQWA 2P2LA 3PNBA 3MMXA 4KITB 1EX9A 5DGIA 5B5SA 5ITWA 3A3KA 2P65A 4RW0A 2ZB3A 1KE1A 4BL5A 2EZ4A 2DT8A 2WF6A 2W98A 5DIZA 3FDIA 5G41A 4ZOQI 1UK7A 3SM3A 2J9FB 3IBTA 2B7LA 2XUZA 3BWVA 3OZRA 1H2ZA 3F7OA 3V8QA 5HZKA 3D9QX 2H1CA 2FQQA 3MMNA 5F78A 1VKJA 1QHGA 4JB3A 5IDVA 5BSKA 3P27A 5CT4A 1VYTA 4R1OA 5GV7A 1Q0RA 2W11A 3EQ8A 4Q9DA 2Z58A 2BUBA 4YRMA 5LUAA 2WNHA 4AVYA 2C7QA 5ESDA 4EUFA 2MYTA 2R7KA 4MB0A 2WRZA 1E2KA 2CWDA 2CJPA 5FOSA 1RJFA 4COOA 1G6HA 2W22A 1BGWA 1B1AA 2CK3A 4RPCA 4KDFA 1ZZEA 1JQBA 1RRKA 4V2UA 3SC2A 2Q3FA 4BAGA 1S4QA 3JRWA 4MR7B 2PJUA 1NULA 2B25A 2V7BA 4MV4A 1FUKA 2JIDA 3N70A 2LRHA 4MV7A 4YMUA 4YMTA 2H51A 3B6JA 1GFSA 4LK3A 1QYDA 4YCBA 3WB9A 1KAHA 3CWCA 4JQCA 4X20A 4B73A 4M89A 3WFIA 4DQ0A 3FPKA 3MQ2A 1Z5OA 2QRPA 2CUTA 2XJ4A 1EG2A 5DM1A 5K0BA 4QQKA 2ODNA 2X41A 3QI2A 4Y1RB 4OG2A 3WAGA 1RZRD 1X39A 4YRPA 4JBWA 1BMFA 1A7JA 1LLQA 1MORA 3BF7A 2VJNA 5TNXA 4F2DA 1W49A 3L5KA 3QKRB 1SCUB 1JTFA 4Z4CA 1YFLA 3WLJA 1S5PA 2XE6A 4A6DA 1J21A 4HSGA 3C8HA 5KVQA 3DQPA 1ZBQA 2OCKA 3IP7A 3SKXA 3X1MA 3HXKA 3ZLTA 4BWFB 3RC9A 4TYNA 2DCUA 3RSFA 1WTAA 1KU0A 2YXLA 3G0DA 3GJ3A 3IE0A 3KPUA 1SXJD 3GNLA 4MWTA 4X3OA 4Z3OA 1JLLA 1VL2A 2YRFA 2BIFA 3H04A 1YL7A 4RZSA 4C4TA 3OF2A 1Q2UA 3BBPA 4L5JA 1L5FA 4GT1A 3TE6A 2FUG6 2BEWB 3DAFA 4Q03A 2D8AA 4NKRA 3KKMA 2Y27A 4JT9A 4EZBA 5TF4A 4CLRA 3IAM6 4YN3A 2LCFA 5IS2A 3H9CA 2EHJA 5DW0A 2ERYA 4E1VA 4GLLA 4P8RA 3DDCA 3KJNA 2JH9A 2ZUFA 1Y63A 3L0CA 5KQSA 1L1FA 4FE4A 3A37A 2C3UA 2PX2A 3MERA 2JLUA 4EUSA 1WP9A 3BJEA 3K6KA 1IPHA 1NA5A 3LVFO 4KQEA 3LRPA 3RC1A 3QUBA 2MSDB 5EAIA 4Z7NB 1AKNA 4M9QA 3LU1A 2WTUA 1IBRA 3CS3A 4R9VA 4JBNA 3IO5A 3L18A 1E6UA 3PA8A 2V45A 1KYWA 1NOJA 1JSRA 4M0CA 4NJEB 4OHOA 4PX2A 1VPTA 3IOEA 3JU3A 3UMYA 2XKJE 3PUVA 2JKYA 4B3SB 4PIVA 3D3WA 3L8DA 1GTVA 3T1TA 2ORIA 3FOZA 3FA2A 1SHLA 2HEIA 2Y66A 3DGFC 2ZJFA 4P4LA 2PZAA 4ZQFA 2UZ3A 2O2CA 3D4IA 1V37A 4PV7A 5LDDC 1A69A 3ZGOA 2XUJA 2A92A 3E9YA 3LM8A 2P0EA 1KVUA 3VNSA 3PEYA 3C5CA 3F8TA 4WECA 1RPAA 1XQXA 2FW9A 1J09A 1X9HA 3OETA 1AHIA 1ZNXA 2J9RA 4KJZA 5EERA 3SYTA 4D82A 4F2GA 1UIMA 3KXLA 5FWXB 3QE0A 2CXPA 4I1SA 1ZD9A 3B9RA 3DDNA 4JK3A 3MCWA 3AF3A 3H9UA 4Q4CA 4IICA 1EIWA 1X15A 2NZ2A 3FH0A 3IX7A 8LDHA 2AWOA 2HADA 2VK1A 1QBKC 4DM4A 7ADHA 1IHXA 4D42A 1MNQA 1UDWA 4S1PA 1T1JA 2Q9CA 3ZNNA 3N6XA 2AMYA 5BNWA 5EOVA 1XTVA 4YAGA 4G1VA 4MWBA 2PRZA 5K3AA 4UXHA 1G42A 1GRNA 4ZQHA 5LZ2A 1V6AA 4ZODA 4PHCA 1I9CA 4LOLA 4TUYB 1A9SA 4BFYA 3WBBA 1JKFA 3IAS1 3F97A 2Q4OA 3FOCA 2PL1A 1GZ7A 1O2DA 1SU8A 2BMDA 2CMFA 3PFKA 4WEQA 4CJXA 1F06A 4AUNA 3IODA 1V4BA 4HUTA 1E9EA 2JJ2A 2MT9A 1ZM4A 3C7CB 3N0RA 1U6JA 4HGRA 1LDEA 5FBHA 1Z3IX 4ZVTA 1M7HA 2ZJ6A 3AESB 3U48A 4EBFA 2A33A 2RHCA 3B85A 1SZJG 1U80A 2C9YA 2FX2A 4CM8A 3B7PA 4KG7A 3MZ0A 4EGQA 3KPVA 3EF0A 4U39A 3T4PA 5ALXA 4F0JA 3EIHA 4M9XA 1JDBC 1Y1KE 3KYIB 2XPCA 1QHHA 3S1AB 1DEOA 2ET6A 1G9SA 3EA4A 2BFDA 1D2MA 3PB3A 3A6GA 3T35A 4WERA 4YRNA 3EXEB 2H1VA 3DF7A 2CLSA 3QVSA 3TW6A 2WUGA 1KAQA 1R6AA 3DLTA 1QANA 1Y8QA 1UK8A 2D54A 1DKNA 2B4YA 1SC9A 2BH9A 3I09A 4LXQA 5CVUA 4FDUA 2RB4A 2ZRPA 4JBGA 3PGMA 4R83A 2RHTA 5E6SB 3NAMA 2R5FA 4KFRA 1ZH2A 3DJFA 1I7LA 3LHFA 4FVTA 1YL5A 3WTBA 4IDHA 2GZ1A 2IKSA 5EZSA 1UXJA 4G97A 3BA1A 3G8YA 3OJCA 4J4HA 2O2YA 4Z0HO 3V4LA 3BQMB 4YJ3B 3DEYX 1JEYA 2PEYA 5HIKA 3A1CA 1KI6A 1T91A 1WDLA 3MGGA 5SYNA 3SYLA 2X7HA 5B4TA 3V3TA 5ALLA 5E7MA 4W8GA 1L7OA 1PL8A 3BWMA 1TT5B 5KHAA 2RGRA 3C45A 4BYMA 4XASA 1I3LA 2A0FA 1X2BA 3HHEA 3AOEA 3VSBA 4QDJA 3R7AA 3X43A 4RTPA 2ZZNA 5G0VA 1E4VA 3ML1A 4IJ5A 3K6SB 3E9CA 1CEQA 5KINB 1MRZA 1M6NA 2WZDA 4C5AA 5M34A 2FUNB 4ZVQA 5EI5A 3IDFA 4E5MA 1BS2A 4B4DA 2AZMA 2R79A 3MRSA 3ESZA 2WWTA 4AMYA 3WDLA 2YNMA 1KY5A 1U5BB 4HTFA 4TLMB 4DMMA 4TVKA 5ITZB 1C7QA 2V9PA 3MS4A 5EGSA 3V1TC 1N2HA 3S2GA 2DLCX 3DAHA 3AWDA 1BC5A 4R01A 3WB1A 1SEVA 3OE4A 2BMJA 1XTTA 2PSFA 1HYHA 1XE3A 3OQPA 4JJEA 4OK6A 2QGFA 5JQGB 3LZ6A 3CLUC 2ZAOA 2HIMA 3KWMA 3QLTA 1L9KA 1AMOA 3ET5A 1BDIA 4Q3BA 4ZK6A 1SVIA 1MR3F 5KPJA 2BSAA 1GTZA 2OP1A 3G0CA 4HO1X 4EKEA 2G07A 5IX8A 3R8FA 3KZOA 1UBEA 1KRHA 3QOYA 3B7WA 3KD3A 4A91A 3TAHA 4FW8A 2E4VA 3AZOA 1ZOLA 2P35A 4RF3A 5TXGA 1PQWA 4Q66C 5CVTA 4TMFA 3OQ1A 7MHTA 3CN9A 4HQNA 4YCDA 1N32B 4YRBA 3WDMA 8GPBA 2PV0A 5JH7F 1PGQA 3SSOA 5AVJA 3NWJA 1VRVA 1I3CA 5DTMA 4PC6A 2JLYA 4MRMA 1O94A 1ODJA 4UTRA 4HADA 1GQRA 2Z2KA 4JJ4A 1R5JA 1GFIA 4D57A 2WA1A 1DPGA 4B45A 5I7WA 2ZKIA 4D74A 4PEVA 3FNQA 1FVXA 2FPWA 1G63A 2Q3HA 5ALGA 4YPVA 2HKIA 1BCRA 2H8GA 1ZISA 2ZUWA 3N59A 4RD0A 6GPBA 3L7JA 2RGNC 3MS7A 1N78A 4PXYA 3PSHA 4F9GA 5DM70 3IERA 1WZUA 1ZUNB 2OTCA 3HNRA 4HQFA 4JHXA 2JGDB 4MOWA 1JRLA 1KEVA 5F77A 5FA8A 2ZAYA 2IYOA 2V55B 5AUNB 3N2ZB 4G1BA 4QREA 3NWEA 2W93A 5E0OA 3UOWA 4KQFA 3HS3A 3HUDA 2WJGA 2R60A 1K9SA 3OOEA 1EEHA 3TO5A 1RLOA 5G0SA 2C54A 3OZTA 1FX0B 2PX3A 2VTKA 5DBGA 3UXYA 3L05A 3T1VA 2FMTA 4UVIA 3H4TA 3C85A 3OC0A 1ORVA 1KPGA 5TR9A 1F4PA 2K87A 1ABFA 4FZRA 4F4HA 1ECPA 3DOIA 1B3BA 1ONSA 1A8UA 4QIHA 4HDMA 1UMBA 1XJQA 4L50A 4JEUA 4YAFA 4E6PA 4FDTA 3R9WA 4LDQA 5C1IA 4ZMSA 3RD5A 2NLOA 2H0AA 1Z6PA 5JMPA 1R7RA 4MPPA 2OB2A 3KKEA 4BLTA 4OP1A 2DU8A 2XMBA 4I4TB 1R2QA 3KB8A 4S2UA 4FNAA 4JNKA 5BO5A 2PZ8A 2JGKA 4TTTS 1E2NA 1T3ZA 1BYUA 5JS7A 3V00A 1KQGA 3UN1A 4BV3A 1RWWA 4GBGA 2A5FA 3EE6A 1IONA 3O4JA 3A4YA 4M1TA 4ZOEA 4CM7A 3A0UA 3AUTA 3EWSA 3O9MA 2DJIA 5TF0A 5HP4A 1GM5A 4DHWA 2IP1A 2FH5B 5TS3A 1RE0A 5HMMA 4YCNA 1JIIA 3NFRA 3ZHVA 1NP3A 4J1NA 4PX5A 3R5KA 3ITDA 1DXYA 4TTSA 5EJ4A 1P0QA 2FMUA 3PFIA 4MKGA 2PH7A 4Q0MA 3FBWA 4QLAA 4EMBA 1WZ2A 4NEQA 1XWIA 2X0FA 4LY9A 2BE7A 4CIDA 4MUXA 2JVIA 2PZJA 3VPDA 5DNUA 1ORDA 5U4QA 2ETXA 2YWRA 4KN8A 1WUYA 3JD4A 4Q7LA 4DMUB 2HR1A 4GYKA 3HXQA 1P9LA 4LV8B 3OEEA 1T35A 2V7VA 3CH7A 2CN1A 4DJEC 3WO1A 1GA1A 3M70A 3R2JA 3ED1A 3IXMA 3ICEA 3B1VA 3EB9A 4M60A 4G8CA 1C0KA 3ME5A 3O5AA 5JHGB 5IMBA 3ER9A 4TTRA 2HLNA 3HBLA 1WLSA 2G4CA 1DSSG 4JUCA 1B8VA 1AT1A 5E4FA 1WA5A 1P18A 1WHSB 4OB6A 1EFUA 2HCFA 2QRJA 2SKCA 3R4CA 3REQB 3B2NA 4A3SA 4EEKA 1M0SA 5AQEA 1M5RA 2XGJA 4MVXA 3KTAB 1JYEA 1ZSYA 1BYIA 2RBEA 1E3JA 3ZIDA 1PK9A 1MA0A 3PE6A 2P4QA 3H5VA 3NM5A 4BNHA 3L7CA 1D7OA 1HKUA 2W0MA 2ZSEA 4CG3A 2C82A 5J2UF 4TL9A 2FMIA 3TJMA 2EP7A 2GAIA 1EE2A 3E18A 4KKVA 2C8JA 3T7EA 3EBLA 3T95A 4EFMA 2BFAA 3QLEA 2EJWA 2DTXA 2ODEA 3H2ZA 4KQGA 3KZCA 1X0XA 1W4RA 1WMBA 4XWAA 3MN1A 2VP3A 1I2DA 5AH0A 5LMNB 1D2GA 1KWKA 1MNAA 1TAUA 2HNKA 3NW9A 1T8PA 4PY2A 4B3BA 1V3UA 5EP4A 2AMJA 2VN8A 3WHIA 1QYCA 4A5SA 3KUXA 2JEYA 4S1NA 3FUCA 3MQFA 1LU9A 1YB6A 3GAAA 4B6RA 4E94A 2N42A 5EHIA 4FC7A 3RUIA 2XF2A 4DUGA 4HDNB 4B34A 4OGGA 3FNBA 1ZK2A 5CIQA 4IP0A 5BSEA 1E9BA 3GT7A 1SC3A 4XCVA 4LE1A 3DYVA 4W7IA 2YFKA 3SD7A 5B6JA 5SV2A 5LZ9A 3SJBA 1TNDA 1Y37A 3ICVA 4D1YA 1PT5A 3ENZA 4YVFA 3L6EA 3ET4A 3R6TA 2Z2XA 1AGXA 2VWPA 3AEQB 4PC1A 3VV2A 4B3FX 3D4OA 5ESXA 5HHTA 1XLTA 3SJUA 4XVHA 5T3UA 1U0RA 3BT7A 2CF6A 4X84A 5H3CA 1EP2B 4JA0A 4ZGGA 2IS1A 4QXRA 2IY9A 4D8XA 4B8WA 1ZC4A 3PXGA 4C20A 1E62A 2YZ7A 1FCJA 1ZIOA 2JHFA 4MGHA 1T4CA 4US1R 2OCIA 3NBXX 3RU9A 2ZTLA 4F6CA 1O6BA 1Z8NA 2ZULA 4RA6A 3W8FA 2XZLA 3H18A 4WZBA 2PWAA 4YR9A 1IWOA 3QFFA 4GL2A 1P7PA 1KL7A 1ZA2A 2GEVA 1GTMA 3AETB 4HWOA 4MYTA 4Y6PA 2KB0A 4ZAXA 4YGYA 2BBWA 3C6BA 1QGZA 3MBOA 1ZW6A 5MHTA 2VPYA 4CVNA 2LNDA 2EG5A 3D5EA 1JJIA 2B4AA 4LXXA 3FDXA 1JIUA 5HIMA 1R9GA 2A57A 4R7ZA 2XXJA 4LKRA 4EI2A 3EG9A 3NMUF 4RE6A 2L0XA 1MZPA 4MVYA 4RJ2A 1ULBA 4B7ZA 1WNTA 3L8GA 2VJDA 2W6PA 3A14A 1XZMA 4YMSA 4HVAA 3RYIB 3SE0A 4Y8VA 1UJBA 4CQJA 3WAJA 2ZIUB 2ZJ3A 1KGSA 1N5RA 4NATA 5T4HA 3ZU6A 5IASA 1UMDA 3H8WA 4EA7A 3TGWA 4Z6KA 3HL0A 4TRMA 4C0SA 2GD2A 3MLEA 3TOSA 4W82A 3ZWXA 4BZZA 1YWGO 1C1YA 4X9XA 3ZY6A 2ENUA 3BFPA 3TLYA 3DBHB 2PYZA 3E58A 1TIKA 1KQ3A 1CUZA 3EZNA 3TZHA 1YIOA 2ZIVB 3L02A 4EARA 3ER8A 5EHGA 1T2CA 1KA9H 3R74A 4RSHA 4YASA 4N0QA 2BBOA 1QXSA 3U3MA 5BRAA 3QG5A 4BC1A 2Y9MB 5AVKA 2AS0A 4LXUA 4D9JA 3S29A 4MIYA 3BG5A 2JK0A 2HPZA 3ZKAA 3PFBA 1UK6A 4BRSA 2E3JA 3GRPA 3QA9A 4POAA 1DT5A 5EE3A 4WFJA 2XKBA 2H3HA 3A9VA 1P9WA 3KOYA 2R8ZA 4M0DA 5F2NA 2BGUA 3E9MA 3D8SA 1JJ7A 3ELWA 4N3NA 2QTMA 3HGTA 4D2IA 1YZVA 1MJFA 1XLWA 2IYSA 3HKDA 3LCUA 4NP6A 2JRLA 4XH9B 4AKIA 3AJDA 4WLNA 5A05A 1IG3A 2VHQA 3JD3A 5AJYA 1XMIA 4ID9A 2COKA 1NJ2A 1L5YA 1ILWA 1SD1A 2K5UA 2O0HA 4JL6A 5FNVB 4HAUA 3C14C 1SHZA 4ZYLA 2RHBA 2Z1DA 3DMTA 2ZXUA 1EVZA 1T3LA 3HHPA 4JVSB 1KIFA 1C14A 3ABOB 3Q1KA 3DLCA 2JI6A 3GUVA 4BP1A 3DT6A 4HEA6 2PJRA 5HNKA 3REGA 2UVQA 1GZVA 3USES 2O06A 3K2IA 5EINA 2N46A 1MC1A 2JVKA 4DEXA 2YFQA 3HACA 4MULA 5BOSA 5AW8A 1DWQA 2PSJA 3LLUA 3EPHA 1NW6A 5K8CA 3PUXA 4K2HA 4NU8X 4PS0A 3OOWA 2H2WA 1U3CA 2B4KA 3ZCUA 2ZWOA 4JEIA 3WK7A 1Q0SA 4GLOA 2FA9A 4JH0A 1YAHA 3T7AA 3ICPA 1TZBA 2YWXA 3KTDA 1E5LA 3F90A 4GKKB 1VMEA 1XDUA 4ZT7A 5FJIA 4DXAA 2HJSA 1XCBA 2CK3D 3CSDA 3H8JA 3Q8LA 4OFXA 4MK4A 1Z36A 3G5MA 1AUVA 4L7QA 4AM8A 4A9AA 4ARAA 4CMEA 1AKEA 3PYMA 4XVUA 1VJ5A 4FNMA 1BHQ1 4YMGA 1DMSA 4JXZA 3M89A 1TEVA 1CJUC 5G4LA 2C2GA 3M83A 1PG2A 4BLQA 2WWWA 3Q7EA 5B2EA 1ODSA 4ILKA 5IULC 1UBRS 3CV3A 4I4NA 4IUCS 1IY9A 3W1VA 4AFNA 5BMVF 1K0UA 1DAPA 2WPNA 3O3OB 4NBKA 5AW6A 2HHAA 3BWEA 2GGSA 1L7BA 1WULS 3KOMA 3R3JA 3RGWS 1IMOA 1OX5A 16PKA 2MSKA 3O3NB 4G0YA 4J49A 4KACA 2MINB 4BN4A 2AHRA 4QUAA 4ZIRB 4G0WA 2BTOA 1IRXA 3LUFA 5F21A 1EUCB 1N7JA 2E0IA 4DC9A 4G0PA 4ENUA 2XB4A 1PZEA 1ZNZA 3KJZA 1E7MA 3TXAA 2Q0HA 4FYXA 2G17A 2IE0A 2BT4A 1K68A 1QIFA 3EZGA 5EHXA 3UTDA 1L8QA 3AY7A 1Y7LA 3TRHA 2JHAA 1ZNYA 2FHSA 5AK4A 2OZVA 4OYLA 2VWGA 4D0LB 4EB6B 4NSNA 4FU0A 4EF5A 4Q7MB 2H7VA 3HKCB 1BG6A 4G56A 1KZ9A 2LIVA 3SYRA 1XRSB 1Y6FA 5DTIA 1J99A 5J4KA 3QF7A 4I7EA 3R7FA 3UCFA 4CM6A 1WDWB 2C2XA 2H1WA 5BNTA 1TJ3A 4CTNA 3N86A 4R1SA 5HGXA 4NLLA 1JZSA 3D6UA 2E5LB 4YUXA 3GUHA 4BGEA 2A7QA 5LIRA 4L15A 3BD6A 3L79A 1PR5A 1FSPA 4PSDA 1KRWA 1NKSA 4JQOA 3E70C 5CTJA 4H4DA 2MMCA 4WY8A 3CWQA 4K9KA 4HWPA 1Y48E 1R8SA 1P4RA 1L7DA 3CCBA 1R0ZA 1PTJC 3LBAA 4TM8A 1XYYA 2J0QA 3B8EA 1AS3A 3ZNQA 5NULA 4EH1A 1YC5A 4BWGA 5HYVA 5MDHA 4GQAA 4RTJA 4LRXA 3I53A 3IMGA 4URFA 2Z4RA 3GLIA 3P9QA 5CT9A 4I5EA 2IX3A 2ILVA 2C7GA 1BEUB 5IFKA 2P77A 4M6WB 5EWJA 1YB1A 2O8DB 1JH9A 3RS4A 5B3KA 4UHKA 3BJIC 1IZZA 1X6VA 4QTXA 4AJNA 3W05A 3C43A 3E5RA 3Q8WA 3MTGA 4QDOA 4XD2A 2CYBA 5CNJA 5CYFA 4J4TA 3L6DA 2JFPA 1E64A 2Q99A 2HYDA 1E7QA 1VB5A 3F8SA 3FPFA 4X8HA 1V16A 2OCBA 4A8JA 3ROKA 4OI1A 1P9RA 1RI1A 1SVMA 2V3WA 3T9AA 2YYSA 3N8HA 4JIGA 2JW5A 4GI2A 2PT6A 1YHZA 1AU9A 4CN9A 3AJRA 3HFJA 3RTBA 4C87A 1SB8A 1GZDA 5TMEA 1PWEA 1MEOA 1T34A 1VYHA 1M6HA 3EEYA 5EPUA 3H11A 3RJZA 2WWFA 5ADVA 1J2JA 5IBRA 3CX3A 4BNIA 1JV2B 2P8SA 4TGLA 6PFKA 4EG6A 2GJ4A 3A06A 3IIMA 5HILA 1JAXA 5AUPB 3D1LA 3HZZA 4X66B 2AI1A 1BS1A 3AZPA 3QXXA 4MJ3A 5FT9A 3AP1A 1HE3A 2R6AA 2DCMA 1NV9A 1ZD4A 2I3ZA 3CN7A 1VBMA 4XFKA 4C89A 1ENOA 1DARA 1KMHB 2OOSA 3EXG2 3I6MA 3KDPA 4UFOA 5GGYA 4HDSB 1H2XA 3C41J 3JQBC 3UJHA 2VHUA 4DG5A 2A1UB 3K9WA 3NJ4A 4LMRA 1KYQA 4MV1A 1CY8A 4I2NA 4LXYA 5FFMA 4C43A 1KYXA 2GEJA 1M6YA 3DV0A 3AR2A 3I8OA 4YTEA 4JZKA 1JQKA 3UAYA 4O4LB 4URVR 1RJEA 4QEDA 1X9IA 4K9PA 1JNYA 5DNDA 2D6FA 4JC5A 3U4AA 4MI1A 4GAEA 3BEDA 5A9SA 3FLBA 1X86B 3VR2A 2BISA 1L5OA 5HDBB 4ZT6A 3E23A 3DEZA 3N07A 2RCYA 3MMZA 1SY7A 1WTCA 1Q0HA 2UZ4A 3Q7PA 3RTGA 9LDTA 5JQGA 4YPOA 5FLKA 1K3FA 1U81A 2H17A 1AKWA 2PUVA 2GBCA 4JX8A 3M6LA 4L8WB 1YBMA 4BU1A 4L9RA 4AZVA 3O95A 1FU8A 2EJCA 4HPXB 2P9GA 1WOMA 2PZLA 5D3QA 1T6ZA 3M82A 4QU9A 3DVLA 5FYQA 3EPJA 4DR1B 4X92A 2AW5A 3IILA 4ZGBA 4HNVA 3KCQA 2BHRA 2BP7A 5JE8A 4HN4B 3ACCA 4BBAA 5CFLA 2FF7A 3COSA 3GYGA 1W30A 1FP7A 1M72A 3PYLA 3ZG6A 1F4LA 3DWGA 3AUSA 2FEPA 1X7YA 5BW8A 1CNMA 1AF4A 2ASVA 3A0RB 4F3RA 4N9QA 1SCIA 2AN1A 3SF0A 1HFEL 3SF8B 2RARA 4UOEA 5J5AA 1U0BB 5D01A 4C76A 5BSVA 3ESDA 3DJYA 4FJ0A 4MWEA 3UWPA 3LUJA 1JF8A 1ZOPA 4UHBA 2IEYA 3E9EA 4QSHA 1YIDA 3ZHTA 3IXQA 1VIAA 1AQ6A 4MWSA 1QH8B 4GW3A 3VR5D 2D8MA 2A88A 5BNZA 5KVCA 1OY1A 1I6WA 2QRVB 2XF8A 4IIEA 4FGWA 3QOXA 2QK4A 4TTVA 1MF7A 2RGCA 3KHKA 4BEWA 3GZ4A 3SZLA 3TD2A 3E3LA 1V8BA 2JAHA 4KUEA 1NL3A 1R0CA 1TLLA 4WNYA 3WOHA 4C0JA 2BFNA 4Y2GA 2W2NA 5TSDA 1M1YB 3NT5A 1KO4A 2OVFA 4FHEA 4IIBA 4LOHA 3ZHUA 4RTSA 3A26A 4DR2B 1POWA 4TLDA 5EYPA 2GXSA 2GUGA 1U99A 3BBLA 2QN1A 2O0JA 3O90A 3W6NA 3U7FB 4XM1A 1XAHA 1HT3A 2IHTA 4ZCIA 2B2XA 1VCHA 2ODAA 2EQ5A 1H65A 1XKQA 2ZETA 3FETA 3PX2A 1QHHB 4EB3A 2IZ1A 5HOEA 1X8XA 2D2VA 2H54A 5EFZA 1T2UA 3ENVA 3OF5A 1SFRA 2EFEB 4TTPA 2QGNA 1BWRA 2FZCA 1RM4A 1I4WA 3D7LA 3EG9B 3F6BX 4HH1A 4RX1A 1II8B 1NFQA 3WYDA 2OSBA 1YR2A 2YWBA 3ST7A 2PT9A 2Z5FA 5EIHA 4KSCA 1XYGA 4U4AA 4JB0A 4LXHA 4N3GA 5GGXA 1XMVA 4LZWA 4R7TA 5CX4A 3T4UA 1D4ZA 1JQEA 2J0UA 1N8NA 5H9WA 1GGJA 2HWUA 3SZRA 3DHWC 3D3EA 4KBFA 1CY7A 1E2FA 1OUMA 1URPA 2P5YA 1VXOA 2HEGA 2R7MA 3F3KA 4R8SA 2JIZD 3FX2A 2IYWA 2HF2A 3R8XA 1E79A 1EIZA 2BDUA 3ABSB 3TAXA 1DKRA 5CB4F 3UZUA 3C6KA 3UJBA 1HA3A 2AXNA 4LQ4A 5ESRA 1RMYA 4UREA 2X6QA 1LWOA 2EFHB 3BSWA 1QQ7A 2BUAA 3JTMA 3IOBA 1ZVMA 4QBFA 4ZEWA 2EBUA 2OHFA 4JQSA 1HQDA 3T7JA 3DV9A 3T1OA 5IVKA 5GWXA 1QPBA 3UGJA 1DAKA 4DGSA 3BJRA 1YKGA 2RAUA 2FZ5A 5KI6A 1YE5A 2HU5A 3EVCA 4QICA 4MPRA 1DTWA 1YQXA 4WY2A 1PFVA 3CPJB 3LECA 1GSOA 4TZ6A 4KEAA 4GUDA 4HDOB 5HCIA 2G9QA 4AZ0A 1OZAA 3H7IA 3DLIA 3AFNA 1UPFA 3NIFB 4MR8A 3KVVA 1ORHA 2Q6LA 4Y30A 1G20E 1TW3A 3LDGA 1AK2A 2XZPA 1A4RA 2P3SA 1ZD2P 3L6CA 4RZXA 1Q77A 2HU7A 5AK5A 2NMVA 3ASYA 4YXWA 2C5HA 3ROEA 3GBSA 1B0PA 1JLKA 4M1SA 4Q3EA 4RFLA 1JFRA 3U9LA 4CCYA 1NKVA 3VTZA 3FYUA 5E2IA 3T5TA 4K9SA 4RJJA 3ZHSA 2Y1CA 3GNTA 3O1LA 3PC8A 4KQ6A 4ND3A 4DMHA 2G7ZA 3ITEA 1FPQA 1Y5IA 3K09A 5LOVF 1WSAA 3UY4A 3WGOA 4C3VA 5IAGA 2OG2A 3VHLB 5KNDH 4ZCLA 4EG4A 1EG7A 1E2LA 3E1SA 3JARB 2VLBA 3QVLA 1L4NA 3OPNA 2IDKA 1BRTA 4I6GA 4LJKA 4QFMA 3HJHA 4QJ5A 2WFZA 4WAUA 4ZOLA 2UVDA 2E6KA 2VNKA 3RABA 3PUKA 4HPWA 3FAKA 2Z4SA 3N0XA 3MWGA 1ECFA 1OIXA 2RGUA 1M2NA 1XDGA 2DQ4A 4PGAA 5EY5B 5F64A 1TF5A 4OIMA 5LD2B 1LK5A 4R8MA 4AKTA 1HTTA 3MRVA 4L8LA 2QQEA 4MYSA 4DJTA 5C52B 4A0FA 2UYGA 1FFDA 1XZJA 4PHHA 3BULA 2JGDA 2R7NA 2ZTMA 4GSLA 2OQRA 5FYDA 1B8UA 3HB4X 5A7FA 4LSZA 3C6XA 3OZ7A 3RM3A 3UAGA 4UJ3A 1DOHA 2EKQA 2BSXA 2GHTA 3QVXA 1C9EA 3T5MA 1I4DD 1CQWA 2C97A 1CJCA 2N47A 2H2IA 4PZ0A 4WFIA 1KY2A 2VSNA 4K7JA 1VECA 5DPMA 1L6RA 3H9BA 1EDBA 1WABA 2R1ZA 4ZQGA 1SCUA 3MTBA 4AD8A 3ZTTA 1HQCA 3NGXA 2OFPA 2QENA 3BCSA 1B2RA 2YZNA 5BRJA 2DPYA 2AV6A 5EZYA 2OAGA 3I9V1 1TQ6A 5JG7A 1SXPA 1NVFA 3CKYA 2PSHA 4LWZA 2QM7A 2V4UA 4FGUA 1GCOA 5A6SB 3RSCA 3GVHA 5AIBA 4CXMA 1FS4A 4MMYB 5H5JA 1QLJA 1YNOA 3EAQA 4FTWA 3PWKA 4Q3LA 3VVLA 1QGAA 2B94A 3H11B 3OPMA 1T5HX 1M2FA 4DJ5X 2DSNA 2VIIA 3GZTB 3AVQA 3LW7A 4DWWA 4D4IA 4KUGA 4GSKA 1ACMA 3H9EO 2I7VA 2Z43A 2D3TA 3OQBA 1D6SA 3U81A 1EWVA 1E89A 1WUTA 3ZE8A 4ZOAA 5CX1A 4D9BA 3L9XA 4G5XA 1UKCA 1NVDA 1B6SA 4MWOA 2L19A 1II0A 1K92A 5BMOA 5LQDA 2J48A 4RPIA 3PIIA 2PBZA 4D43A 1IQRA 1NVVQ 4HWRA 5J23A 4C06A 1RS0A 2NAFA 1SBYA 3CY6A 1OI4A 2XLCA 4A2QA 2ZVPX 4JUAA 2W58A 2H2AA 2AT1A 4JLPA 3ZZTA 4AS3A 3CONA 1QV7A 5FTLA 1BQ4A 1FYDA 2G0AA 3TTYA 1G2QA 4P9NA 3A6PC 2K2QB 3G89A 1Y7IA 3O0TA 1FQOA 1F2TA 3JWJA 4G1EB 4F38A 1VB3A 2F48A 3DD1A 3LPCA 4Y7CA 3FFTA 5HTKA 1VPDA 2ONCA 1P1KA 1HK7A 1FX1A 1PR0A 1K6XA 4URWR 3Q2KA 4R3UC 1JFFA 3G17A 2YZKA 3I6BA 4TYQA 2HY7A 3NFYA 5KNBA 1UWVA 1ESNA 3C0KA 5BP7A 1PJTA 5CB6A 4O2AF 3PHIA 5JS8A 4QKQA 4D4LA 3T5AA 5JD5A 3RF7A 5H3LA 5C8YB 1U6KA 1J2RA 3CRRA 1MG0A 3L8YA 5J59A 5T6BA 4AZ0B 2PVPA 4L0QA 2JA2A 2FW0A 2PEZA 2ZI5A 4DLTA 2GRUA 4JMPA 5I8WA 1NPDA 2H7CA 1HE1C 4YRJA 5LQNA 1FSGA 1EM6A 3DMDA 3O38A 1Z68A 3MC1A 1DAHA 1PVDA 3GDHA 5I3CA 4WT7A 3FTCA 1JYFA 3W8RA 1JUDA 4WTOA 1UZUA 3DF9A 1ULHA 2H7YA 2ZRQA 5TJ9A 1XMXA 1HE2A 3A4TA 5JECA 1DC6A 1C3OA 1N2SA 3DLAA 4LMBA 2GBIA 2LPMA 3DCJA 3L9WA 4D4KA 2FPGB 2L17A 3QIAA 1SBNE 4JUBA 1CY1A 1HZZC 2WHPB 2XVYA 3EUEA 3ZY5A 3VI4B 3GWGA 3F96A 1PG0A 2YMLA 4GPD1 5FOWA 3KKOA 4C2AA 2IHKA 4G8BA 4LV5B 4Z9XA 1S6YA 4IPTA 4BFUA 4UTVA 2J1LA 4O8ZA 1LX6A 1VFNA 2Y99A 4G9EA 4GZ3A 4WJZA 3RAFC 1NVAA 1F0PA 1R0BA 1WM1A 1I30A 1TFUA 1SZPA 2ENWA 4LNAA 4DYHA 3LTNC 4WMLA 1GUBA 4LBZA 1JHRA 1CVLA 1DAMA 3A4NA 3M6MD 4UBNA 4S04A 3EEBA 4BMNA 1IYZA 5ULLA 2LCIA 3P9CA 3KTFA 4Y6RA 3WIDA 2PQ6A 2EIHA 3DMPA 4LY0A 4JSRA 2OQIA 1GGVA 3BFJA 4MKIA 4PFSA 5GPBA 4C6HA 2ZBPA 4F45A 1G3MA 2II6A 4JLUA 1J39A 4NOJA 3UKJA 3OTIA 3VDXA 3JSAA 1PJAA 3O9VA 3EXIA 5F9FA 1KC1A 2HLDA 1P4AA 1PLKA 2XIQA 1D4AA 3MWEA 3KQUA 3R6DA 1MJGA 4KO3S 4ZRNA 1GPKA 3FCOA 8ADHA 2XMSA 1MX5A 3EIUA 1JMVA 4EQ6A 2F1RA 4B3RB 2DF8A 1JWAB 3O8BA 1CD5A 1W52X 2JAUA 4RABA 1OKKD 4WXPA 5HTOA 1FUYB 2PUGA 1KF0A 3KEOA 1PZXA 2HOQA 3S3TA 4FR5A 1KI1A 1V9LA 2PD6A 3LUKA 3QE9Y 9MHTA 4BN5A 2HK6A 1BHSA 1MU0A 1DJLA 1Y7TA 3NTOA 1BOFA 3I9FA 4AMZA 3SC6A 4FYJA 4DIBA 2E2WA 1TZKA 4H27A 3PZRA 3SZGA 5JT1A 5K0EA 4P3YA 3LSYA 2B6NA 2YICA 4UM7A 4BUCA 2JI8A 1ZAYA 3UBTA 3EG5A 2QAGB 3HCEA 5KOJB 4OF4A 4CKCA 4E0BA 1JHPA 1Z6GA 4KRYA 4AF6A 3H2YA 2ZRGA 3D64A 3EFBA 4F6RB 4OM7A 5ANRB 3FTQA 5ERGB 3URKA 4E22A 5L40A 1Y9ZA 3UWOA 4AJPA 3HPQA 4LNHA 1FBNA 4NU5A 5CDHA 1KZ1A 4EG7A 1XV5A 4QOIA 1DEHA 3HXOA 1Y3DE 3RVRA 3GPBA 5C8DA 3PQFA 2VPIA 4EMSA 2P2CA 1GNVA 4KLRA 4L5CA 4MQ5A 3DOJA 2I66A 1MQ9A 4TQ9A 5JXIA 5EKUA 5D00A 1AZSC 1DDOA 3WL4A 2RJOA 4EMUA 2WF7A 2QI9F 4PPGA 4KXXA 4PIMA 2JI4A 4OUDA 3SZMA 3GLUA 5AVYA 4O4JB 4I9GA 1XZEA 4WBNF 1ODIA 3CPHA 2DBRA 1IZ0A 1R9JA 1XEWX 3K96A 4TS3A 2I7TA 3R41A 5DM0A 4DKXA 4X71A 4KR6A 2JD2A 2UKDA 1GUFA 4JYAB 1IZYA 5TPWB 1U94A 3SVLA 5EXXA 2NU7B 4KWHA 4H15A 4IIDA 4KPUB 4MW0A 4RC9A 5TIIA 5I5EA 2A0XA 2QTLA 2GTHA 3HLKA 3DXXA 4BGDA 4L16A 4TSFD 4M1WA 1ZUIA 3LLSA 1XA3A 3LQRA 4UEOA 3L4SO 2JD1A 4A23A 1Z6ZA 3L7NA 4BKOA 1UP6A 3CVWA 4II3A 1WCXA 1P1IA 3K70C 4XOUA 1CR0A 1XWFA 2VEOA 2XNHA 3A6HA 3M81A 4A2PA 4AY3A 3F73A 2BCEA 4TYWA 3DEIA 2Q1YA 4FMBB 4PAGA 3MCZA 3EY4A 3T3NA 1BMTA 4B8YA 1O9BA 4TUYA 1N7GA 3DFMA 1ONOA 4RFVA 1H22A 4ARZB 5C8ZA 4R9RA 2IZ5A 4Q3OA 4ES6A 1ZD1A 4ZAYA 3ETJA 3DWEX 2QDKA 2H5LA 1EZ1A 2IITA 3T7IA 1KNQA 4CF3A 3T3DA 3CPSA 1PD1A 5EXEA 1O4VA 3NTUA 4EI7A 4Z7JA 3BXOA 4PZCA 2HFJA 3FWZA 2FR1A 3EDCA 4XM0A 4G1MB 4YRRA 4E5KA 5JYEA 4JCOA 3UMFA 2R96A 1SUBA 4GBJA 5AVWA 3CMCO 4E5DA 4NH0A 1IAVA 3MHTA 4CLXA 4JGIA 1WMDA 2R87A 1LS6A 3A05A 4CQLA 2M6RA 2QPAA 4AF7A 6LDHA 3LRXA 1FP2A 3DO6A 1AQUA 2O7VA 1PNVA 3SR0A 3GN2A 3RV4A 4XVCA 5K8VA 4QPNA 5HJ2A 2D06A 2ZJOA 3DZKA 1X1DA 3MCTA 1CETA 3PXAA 1XD8A 4ENPA 4KDEA 4HNTA 3WGYA 1E66A 2OC9A 3ZVMA 2AR9A 5FBKA 4CLDA 1SVWA 2Y67A 3NDRA 1JFSA 4Q4LA 5KYNA 1CZNA 2XNSA 4XUEA 4B7AA 3LNCA 4I5FA 1K08A 3MGKA 1Q0LA 4M9CA 4MIKA 2BFFB 2A1TR 1D2AA 1P33A 4AKGA 1BQ3A 4KIGA 2WYUA 4LHVA 1JJBA 3EGEA 1WMEA 5K1ZA 3JRXA 1KMCA 1C3LA 1PN3A 1M8FA 2BMAA 3VR4D 2BY4A 1U0HC 3U7GA 5BVHA 2VH2A 5I7VA 1FY2A 3GLGB 4OXIA 2R00C 1QQ6A 3UAZA 4MGYR 1JVNA 1XZAA 4IXWA 3CKMA 4PGHA 4F5YA 3RU3A 2ECKA 3H1FA 3MYRA 4D5GA 1GT6A 3A58B 1P74A 1U8UA 3H5IA 3TBHA 4G07A 5K6TA 3MF4A 2C2WA 4F1JA 1Y6QA 4RV5A 3F47A 4UNIA 2WM2A 5K8TA 2D1SA 3DZJA 1H2FA 5FTJA 5G4KA 1NUUA 1Z0SA 1RYHA 5IT4A 2DC1A 4DZRA 1O3YA 4KE9A 3WV4A 5KQLA 1UKBA 3AL0C 4US2R 3N7UA 4QG3A 2Y1XA 3U16A 3C4VA 3OJ0A 5CX1B 1P0FA 2L82A 3U3JA 4DMKA 1B43A 4O59O 4QJ4A 5I3ZA 3TPZA 3UB3A 1L1RA 3U7QB 4KIFA 3PVZA 2D2FA 2NO4A 4IDOA 3BL8A 3NB0A 3PNYA 4YACA 1Q3KA 4GWLA 1I0LA 4XR9A 4AXBA 1QK5A 1OFVA 4RVCA 5KREA 5IVHA 4KLZA 3PEWA 2F43A 2J3IA 2ZSBA 3I64A 3WWPA 5CB0A 2RGNA 4C6TB 2JDID 1QV9A 4F9EA 1OX4B 4WQMA 5HCUA 3LK6A 4TSFA 1NY5A 3MJCA 4FCTA 2V1UA 1KGDA 1Z18A 2YUTA 1M8KA 1JEDA 1TB4A 4S0ZA 3T5GA 4FBMA 3TLBA 4QNMA 1T8WA 4OI4A 4D4MA 3TJZA 1PX2A 1BMFD 1QTNA 1R9MA 1SIOA 1DMRA 2R68A 3W90A 1USIA 1DBSA 2P1DA 3AI1A 3ZWWA 2XDYA 1YRLA 3OP1A 3OOYA 1V4VA 1RVV1 2C4KA 4Q5IA 4XDYA 1YRHA 1YI0A 3ABIA 3TNJA 1GPH1 1VMKA 1Y4DE 3URMA 1AGNA 5MGBA 4B75A 5BSWA 3C8ZA 3WJAA 2MHCA 1G55A 3LQ1A 4UTNA 3T5CA 1WKCA 2X4LA 5TS2A 4Q12A 3TK1A 3HSKA 3WWDA 7REQA 1PJZA 2PLNA 4JYMA 1UZMA 4ZHQB 2SECE 1NBEA 1N6LA 2JBWA 3KUUA 2IW1A 1KOGA 2X86A 2HSWA 2O0LA 1PJCA 4J1QA 1EQ2A 2ISQA 3KSDO 4TKLA 3FMOB 3QLUC 6REQA 1GT91 3I8SA 3QLJA 3C4QA 2YMMA 3CLSD 5ALOA 4D3SA 3THWB 3MPUA 3SQLA 3WGQA 4N8SA 3HKCA 1SVUA 1U7XA 3AETA 3GFRA 2BZ0A 3HYLA 3P4YA 3FDZB 2FAXA 2I5PO 4OJNA 2IOFA 2F3QA 3P8ZA 4BLUA 3QEBZ 1U7UA 3GRKA 3TTSA 1UBOS 3KVOA 2UDPA 4WNAA 2OILA 1G8HA 5JYBA 5IKEA 4UM9B 1QR2A 2FHPA 3VJRA 4EB8A 1S2OA 2OV6A 3F6CA 4MQFA 1B6RA 4U2CA 4MZDA 3BMQA 3O03A 2HA3A 3UK6A 1Y6JA 2JIRA 1ZGAA 2FB9A 1N0IA 5IABA 5EHNA 1S89A 3EHEA 5CNMA 2VJLA 5E7QA 1R8YA 2QRZA 3B5JA 1VGQA 4HN9A 3UH0A 5CEJA 4CIBA 5I51A 2C0CA 1UZNA 1WCIA 2JLWA 2RH5A 3RUDA 4B32A 3CYFA 2H1OA 2VBFA 5LLSA 4I99A 4OXQA 1C3JA 1Z15A 2HDHA 2AEJA 1M67A 2ZQ5A 2O20A 4D6YA 3WKAA 1WKBA 4A2CA 5LLDA 5E1MA 2HJWA 1M74A 1KS9A 4W63A 1E3WB 1LZKA 4XR4A 3W77A 4YIHA 2OO5C 1ZN2A 2AKYA 4DL9A 1YHYA 3K20A 2IPMA 3TZCA 1BSVA 1G9TA 1QLHA 3B1YA 3SS9X 4DA9A 3U17A 3ZUGA 5KTKA 1HXHA 4C3UA 4C4YA 3GRVA 4O0LA 4YRKA 3R23A 4MMXB 4ZHQF 3WGIA 1TQHA 2Y71A 3T9FA 4KLCA 4O25A 5AXCA 4MWZA 3FZYA 1WO8A 4AZSA 4RSRA 3PL1A 1HV8A 2AG8A 1DTWB 3O7MA 1DFHA 4IZ6A 4KZKA 5C81A 1OW3B 3CGGA 5TQVA 3JQCA 1VL0A 5MGNA 1TFRA 3I2IA 1MOQA 3ZDDA 3B48A 4MCAA 4GOMD 4MXDA 1U9IC 2BEJA 1ZSNA 1OB2A 4ND2A 4EFNA 3G13A 5BOSB 5LQJA 4QBIA 4YNBA 5GONA 5A1TA 3OQHA 1G7SA 1OIVA 1A9PA 2VRBA 4H1VA 1J5EB 3NCTA 3EJ6A 2I91A 1B23P 3LPAA 1ZH4A 1X7GA 3BREA 2ZCVA 3K73O 1P5FA 2VFAA 4NAHA 3T34A 1V8PA 5FQNA 4MTCA 1RXVA 1NXSA 1YR1A 1DQPA 4B7UA 4NCAA 1PWZA 2W71A 4WOBA 2VZLA 4F6RA 4FFNA 2XGOA 2NYVA 2ZYGA 4PLHA 1XEWY 2A3RA 4J0QA 1Z4JA 3D3QA 2D7CA 1Q5PA 4CR8A 2IU6A 1A04A 2GBGA 3JYNA 1Y4ZA 3OOJA 3V8EA 5HZHA 2FX3A 1R12A 1DBRA 5JH7B 2PGJA 4MUBA 3HDJA 1UT5A 2I65A 2VKQA 2VUSA 3HJCA 3KXIA 4S12A 4KBGA 1J5XA 4L27A 1TPZA 2JAOA 3RFFA 4YUZA 1WXGA 1SUAA 4WCFA 4PO8A 1OREA 2VK2A 1HT2E 4DR3B 1QIGA 5C1OA 3RASA 1UM9B 3TVYA 1XLVA 1L5ZA 3AB3A 4X90A 1MX3A 3RHFA 3LX8A 2VDRB 2YASA 2YWCA 3GI1A 3FVQA 4HATA 2WQ7A 1RAHA 1WUHS 4FWBA 3LDUA 4WZZA 2C8VA 1FFXB 4ARCA 2YHIA 2XRYA 4RADA 2N9UA 3VH3A 4AS2A 4BFTA 4EA8A 4F7DA 1U63A 2FP4A 1NMSA 1XZ8A 2CMDA 2OM6A 4XLTA 2RFLA 1Y89A 3FGNA 4FMDF 2I3GA 2ZW9A 4RHXA 4F21A 1Z22A 1DCMA 1DO2A 3HI4A 3TLEA 4YJGA 1QE0A 5JAHA 3O7WA 3OE7D 4EHBA 2IYLD 4ZKEA 3R7SA 3PNMA 4ZOLF 2ZTUA 4U7TB 1W19A 4PZUA 4AUKA 3AGQA 4LJ9A 4BQQA 4OI0A 1LPNA 4YJFB 4CDGA 4MUNA 4GKAA 3HP7A 3UFXB 1ZM7A 5DFAA 4C4AA 1FX0A 4Q1EA 2IU4A 2WLSA 2WF9A 2H07A 3CJRA 4CDNA 5KWVA 3S55A 1UFVA 1Q14A 1PO7A 2QRKA 1SURA 1MA3A 5ADHA 4G1FA 3UUGA 1R4MA 2G6BA 2QEQA 4NY1A 3VTFA 2J5XA 4F3CA 4URUR 1PV4A 2K4MA 4G81A 1YF3A 4PX3A 3A1NA 1RKXA 4GX1A 1WVGA 2YMPA 4X61A 5JZVA 1UZAA 1QHSA 1I7DA 1F8FA 1E1QD 3VTKA 1T8SA 3WJ2A 4BP8A 2ZQYA 1ISFA 4ZGWA 3ZD6A 3G79A 5IXSA 3N75A 1W88A 2GZDA 3FJOA 3EIFA 5JVDB 3TXYA 3VZCA 4C5CA 4MPJA 1FLVA 2VJOA 4LMPA 2YDYA 1LI4A 5JZBA 1JXMA 1VLHA 3SX2A 2WSMA 2QX6A 4TMZA 4HV4A 5K6RA 3WMFA 3QBDA 1N6PA 1T2VA 3ORYA 2XVZA 3MTJA 4ZYUA 1GRVA 4ER5A 4Z7QB 2XBUA 3EA0A 3O8NA 1BH2A 3QU5A 2QMUA 4M88A 1ISMA 3WZMA 4BLPA 5CD9A 3RVSA 1DELA 1T2DA 3PUJA 1LDNA 2FI1A 5HRUA 3P9ZA 1C7JA 1T6NA 3MD0A 3O2SB 4FYIA 4UU1A 1CQIA 4B6QA 4BVGA 2J6IA 4WEOA 2A14A 1N2IA 5IAJA 1RQ7A 4LXIA 4QFBA 2JEOA 1SIWA 1YI1A 3U4QB 1HR0B 3AM4A 5TDHA 3W7AA 1KXJA 3I9KA 1N5KA 1XL1A 2RGWA 5CJ2A 3VAYA 4F93B 1Z5NA 2GD1O 3RS2A 3KHUA 2Q62A 1B8OA 1YQGA 2WPDA 2DY1A 4CMBA 2J8ZA 2BGWA 4QRHA 4A0GA 1SC6A 2EF1A 1Z37A 1KWGA 4ITRC 3X1JA 3ETEA 3UIEA 4XUCA 4M0UA 3NBMA 4HFRA 2JLZA 5BXYA 4EGSA 5BN3A 2GJKA 3P20A 4Q7QA 5FNZA 3HYTA 5KHLB 3OQNA 1FDIA 1O57A 3EQZA 3OWXA 1VKRA 4YJ3F 2YZ2A 3L0PA 4G1CA 3PDHA 1CRPA 2J9ZB 3IAS6 4WH0A 2CLEB 2WHRA 3AF1A 2F1IA 5DEIA 4DSNA 2JFNA 5EEHA 2AR7A 4E5UA 1QTQA 3OEED 3EIOA 4IRXA 4P35A 5C0OE 2QG9A 2VNIA 2VT2A 1Z0IA 4LCBA 2XJ9A 4ARBA 4CPDA 1N1MA 5IZ4A 3AKYA 5KWJA 5JAQA 1PL0A 3MS2A 3I39X 2MSEB 3GA7A 2WBLC 3IQHX 3QKTA 5ALEA 2BHNA 3KAJA 5AM5A 1NLMA 3N1UA 3BB3A 3LC2O 4ZU1X 5ALKA 4OREX 1UT6A 4HKTA 1KFJB 1SAYA 4JBLA 1UMCA 3GEGA 3T3EA 2PXXA 4I4TA 5DLEA 3KPYA 1WUJS 3IUMA 3L84A 4DBVO 2XRZA 2G5GX 1TYAE 3FPGA 2GFHA 3TPFA 1CUCA 1NLUA 1Z4OA 2XLBA 4GOND 5KKCA 2Q5LA 2YIDA 5CB4B 2DFTA 4I50F 1BRMA 3PE4A 3G5UA 521PA 4TWZA 2ZAMA 1LLCA 5T41A 3I5XA 5AP9A 2RI6A 2Z5LA 1OVMA 4LBYA 5EG5A 1XALA 5TPZD 1CE8B 2PTHA 4EJSA 2F8SA 3TUZC 1W4LA 3KT8A 5EKXA 1PR2A 3IQGX 4G5SA 3EASA 4FFBA 4B5KA 5FL7D 2HMTA 4S05A 1XZIA 3LZDA 3VU9B 2PUJA 4PFKA 4KSYA 4CMEC 4IIXA 2QLJA 3KSZO 4L28A 2HF9A 1A77A 2G70A 3WWOA 3DDUA 2X9LA 4KQJA 3U31A 1YQUA 3A6JA 2ID8A 3F5QA 4YC7A 4ZMRA 3QKIA 4BO4A 3BSFA 4PQRA 2M6SA 4IHJF 1FNCA 2R8YA 4WDQA 4UNNA 4OQDA 1QHYA 2SICE 3Q5EA 1SPBS 4BP9A 4TSKA 4FD2A 2YHUA 4LSWA 1WWKA 1YRQA 1KFBB 1C1HA 1S3SA 1PQUA 1AKRA 2Q41A 1DG9A 2QD3A 3HY4A 3I37X 3HSYA 1BJTA 1WVMA 3K1YA 3OTGA 1JI3A 2Q9BA 5ALIA 1VIMA 2QNBA 1Z28A 1G19A 1V45E 2YV5A 4H1UA 1TAHA 1NQXA 1N9GA 3U2QA 4D80A 4JXXA 2A0WA 3NYQA 1XIVA 4V0MA 1JDUA 4TWIA 4XYGA 1ADYA 3WK9A 2IDMA 4BX2A 5JDCA 1MDFA 2HA4A 3GLKA 1ZEJA 4EYGA 3KD2A 3UWDA 3OM0A 1KVQA 2A2ZA 4BCBA 1ODCA 1YXMA 2X3UA 2GPTA 3INRA 4P2GA 1S02A 1UF9A 4ZO9A 5TJHA 3PDIB 1OH7A 2VQSA 5IBPA 4BKPA 1JQ5A 4X5OA 4V1CA 3O75A 3QENA 5EMKA 5IG2A 4F72A 1CLEA 2C5LA 4J3FA 1EXMA 1C29B 2QJWA 2NAPA 2QMQA 2WMDA 3CEPB 4MRMB 2JCSA 1X74A 4LEIA 1QDUA 3TD6A 3I5AA 3R9IA 2G40A 2HBQA 1OYVA 4ACAA 5B3LA 4BFXA 4D7AA 3R4VA 1N6RA 1BMQA 1ZINA 2IBMA 3HXTA 3Q2OA 4HQOA 4UBLA 5L4LA 4EJ2A 3O94A 5ALZA 2WIGA 2WIBA 4N3BA 2FFHA 4V39A 1T0UA 3ZLUA 3NYIA 3O8OA 4C14A 4YCCA 4BXOA 1YQEA 2GVNA 3D7NA 4E2YA 4DJFC 2OVBA 3CR3C 3EVGA 1CKEA 2QMZA 1DC3A 1GUDA 4P53A 5CFNA 5KSYA 3NAZA 4B35A 3COPA 3RUAA 3LV8A 2WM8A 3ZD9A 3U9TA 3FIUA 3GJ8A 3TW0A 5DLYA 4EKYA 2WTEA 1B8PA 1QGDA 3O0DA 4FE3A 3HCPA 1E7YA 4LDJA 5E95A 3TMYA 4CFZA 3ZHCA 1HE5A 2C4MA 1IM2A 1HDOA 5A03A 3IT2A 2PE5A 1O7JA 3HJBA 1XVVA 5BWMA 2C9ZA 2HMWA 3IS3A 5DM2A 3V2HA 3OLQA 2J46A 4RHEA 3WMGA 1BN7A 3OT5A 1N2GA 1UOPA 1ZZGA 1G7CA 2WIDA 2Y1GA 3Q7QA 4J7XA 3VKVA 5BMVB 5KS2A 2IYTA 4OUKX 1GY8A 2PH5A 5REQB 4PSAA 4YGXB 1GYQA 3ENWA 1D2EA 4L1KA 1LPAB 1NXXA 1XQ1A 1Z88A 3KEGA 2CXNA 4HX2A 3CIOA 4ZVPA 2JAPA 2ZK7A 3H1GA 1HO3A 1N1EA 1GKYA 1J1UA 2NT3A 2RH4A 5FTMA 5PNTA 3TQOA 3TNDA 4YV7A 2QW0X 3PUIA 3TH5A 1MC5A 4NICA 5I7OA 2IELA 2IPAB 4W5NA 1VP9A 1ZYUA 3T54A 4DB2A 1W36D 1GG9A 4DQKA 1T0IA 2HCJB 4HH0A 2RGBA 2O8FA 3W3AD 1YUBA 3EPRA 2MWMA 3STTA 3RIMA 4IKOA 3WLOA 3K53A 1V1RB 4P82A 3RIYA 3S5JA 4LCEA 1QAQA 1Z2DA 4YCJA 3SICE 1XR3A 4ZICA 4TXMA 2ACKA 2VWQA 1T8TA 1AUXA 2VT3A 3HYNA 4KR0A 4MI6A 3NONA 4TQUS 2OFFA 4G41A 1Q3TA 1Y42X 1Q11A 3RUFA 1Z8HA 1JSXA 2R1VB 2XTAA 3E22A 4RH3A 1U0NA 4HF7A 4ARIA 1VCNA 5DT2A 3U4DA 1OSNA 3QI7A 3F6EX 3AILA 1A8SA 1Y3CE 1TM2A 4FYWA 3WDSA 4MYCA 4RSGA 5C8VA 1XDWA 2FUKA 3GCGA 2DHQA 1HTBA 3IH5A 4QU8A 1NRWA 2JANA 4BX0A 3AH8A 3KZ1E 1JA0A 1K7CA 3R5TA 5SZJA 3RS3A 3HBMA 3U13A 4PNZA 1F5NA 1SUEA 1FOEB 1K3UB 2NUTB 4CKEA 4E88A 2FDRA 4HWTA 3RK1A 3TL3A 1EXDA 2VWHA 1QIJA 5CK5A 1AGRA 2J32A 1H85A 2X5XA 4HXGA 5A3SA 4JLKA 4RO0A 3KQQA 3CO5A 4LJYA 4WLVA 1WQ3A 4AAYA 1YB4A 4NESA 5AM1A 5SZHB 1T2NA 4FOTA 1HYGA 2H85A 3BTUA 3JQEA 1UXGA 1Z4MA 3FSEA 4FI3C 4LYYA 4EGAA 4J2HA 4YDQA 3R77A 1HQYE 2VDWB 2E48A 1DIGA 3V2IA 1NVVR 1Q20A 2BONA 4CV3A 4BZQA 3QOWA 3VTAA 4JL5A 1JIXA 4BO7A 2BM9A 4O4LA 5F98A 2PFSA 4J43A 3GEPA 4WGGA 2VK8A 4D81A 1T8UA 2XUFA 3JAKA 1L8LA 1SRRA 3Q3EA 1E5XA 1R3DA 3C3XA 2HBRA 1RZRA 3AY6A 3E9QA 4Z0TA 4CLEA 3AF5A 2WV9A 3QBJA 3ZDXB 2HZBA 3WLAA 4TKZA 1E9DA 1I6KA 2QVXX 2ONZA 3EY9A 1XG5A 2VS1A 3PP8A 4GP6A 4PWZA 3SNKA 5IDXA 2IY8A 5JRJA 3MOSA 2G25A 3L1JA 4NBVA 5G1NA 4CL3A 1YMQA 2QVGA 1UT8A 4QBKA 5HEKA 1BKSB 2D1RA 4P31A 1C9KA 1G7TA 4JXJA 1OX4A 3BVPA 2I9PA 4M8NE 3SWWA 3QEMA 3DW3X 3NQ41 1N6IA 1T15A 4MARA 4OLBA 3LXRA 1S9DA 2CNOA 2E55A 2ZFUA 3SK0A 3W1WA 3WYEA 5TLSA 2XMGA 2HC9A 3KT6A 5EHQA 4HD8A 1IXSB 3LQKA 1PJ2A 1IIRA 3Q5GA 3F9CA 3AL2A 3HN2A 4MA4A 1XYVA 2JDIA 2NNWB 4D96A 1CUYA 1YNSA 2V59A 1OBFO 2HJHA 2OK8A 3B89A 2EGGA 3OESA 4G37A 4IH9A 4M0PA 2YYZA 5CAEA 4FX5A 1I0IA 2B4RO 2OKGA 2WU0A 2YY7A 3PBKA 3ROQA 3SU8A 1N77A 1U2SA 3E5HA 3FNFA 3Q9NA 3TIXB 4CMJA 4FZVA 4LDPA 4ALKA 1KYYA 1T25A 4WVLA 5TGZA 4L5YA 4Y9UA 1AV6A 3BSSA 1ZPDA 4ZVRA 2EL7A 3BQNB 3L46A 1P1FA 1EUDA 4XWWA 1U7TA 1B41A 1NSYA 2CXTA 2QM8A 3N2KB 5IZCC 4JB2A 3HA3A 3DHNA 4W4TA 3VR6A 1VIVA 2FJ0A 4EG8A 4PANA 3V97A 3MT0A 4DA0A 3LFHA 2WWGA 5E1BA 3PCTA 1PFQA 3OQIA 1P80A 3R0ZA 5A2QA 3W2GA 2V03A 1E3MA 4FFDA 4BNNA 2F1OA 2GX6A 4RULA 1NJ8A 4AWBA 1JJAA 2GETA 2PWPA 3NO4A 4B81A 3K0FA 1T2FA 3MCAA 5IVDA 3DNMA 1L7PA 3QQ5A 1FYEA 4G3XA 3GUZA 5DVZA 2AOUB 1XDZA 1T9ZA 4OBBA 4GPEA 3U9SA 3RAEC 5CT6A 5KTNA 2CB0A 1YU9A 4O3FA 2GCGA 1PWYE 2WIJA 3AYXB 2HCBA 3IEMA 1Q0TA 1CU1A 4QDKA 4S1WA 3FMPB 2ZJZA 3HABA 4LI0A 5GVSA 4I6JA 1QNLA 1YL6A 3EQ6A 1ZJJA 3GL9A 2Q3MA 1D4FA 3P9IA 3RVPA 4MNTA 3UMBA 2ZCJA 3A9UA 4Q7EA 1LPPA 3VSDA 1CUVA 1C4KA 2FEOA 3S0JA 3TCNA 1CERA 4WBNA 2CYAA 3STXA 5C35A 1YR3A 4HAXA 3DR3A 4CQLB 5B6PA 1X42A 3QHQA 4GOKA 1US8B 2Y77A 4Q4DA 3HC7A 8ABPA 1NURA 2JLQA 3PFNA 1TRHA 3U4HA 5AW9A 1JA9A 4ZC1A 1T1RA 3HY6A 5C1DA 3FPCA 4KGDA 4HTAA 4W1PA 5JSHA 3CLTD 4PFJA 4G85A 1YZTA 2UV8A 3KT0A 1NONA 2QXYA 2BGTA 2QIPA 2RSLA 3L0SA 3ZZNA 1JTVA 1XXHE 4CM1A 4D3YA 1RQ2A 2X2FA 1V4NA 2FWAA 4BRZA 4E4TA 1BU5A 2G9NA 3BHIA 2X8BA 3ESYA 4J1SA 5A5EA 1CP3A 1GL7A 3RI3A 4ZI7F 4PCAA 1EUDB 1M8PA 1FP4A 4GP7A 2AI3A 3BFVA 1FIUA 1NNEA 1EGQA 4PZYA 2C3PA 2O2ZA 1OZHA 2WNIA 4YJGB 4BX9A 4DCGA 5F4ZA 5FP0A 3BWBA 3VYRB 1KI8A 3LS2A 3Q8KA 1INLA 5KTSA 2WSSA 4NULA 1WKVA 2KS6A 5K0NA 2CL5A 1UH5A 5IJ0A 1YJCA 4YJFA 2F3SA 1VZ3A 2EGHA 3HNPA 3K2BA 5JAOA 2XWPA 5AI9A 4GZLA 3G8DA 1NI4B 3ENKA 3VKGA 1PWXA 1WPQA 4FEGA 1I2AA 3GCXA 3WK4A 5ENDA 1USVA 2CJXA 4R51A 4HEA1 2B99A 1RLMA 2H9YA 4BKUA 5G02A 4QBTA 3SBXA 3TOVA 1CIVA 3JD2A 2DWOA 4DLLA 1P19A 3AK4A 3CVJA 1AGYA 3EWAA 2HDWA 5BN4A 3T7TA 3W0LB 4AY5A 1NYRA 1TEZA 4RUKA 1XC7A 1F0YA 1BJKA 4JJ7A 4NV1A 2Z8YM 4B76A 4JENA 2PLFA 3W04A 1FYFA 1V3VA 4YJHA 3LIIA 1TKRA 1HNWB 1NVTA 3ORHA 5THQA 1G1MA 3BCUA 2FWRA 2PYIA 3G0IA 4OAOA 4OKSA 4U2GA 2GRAA 4ONEA 1NVXQ 3HCDA 4PNHA 1MAUA 5IJAA 1Z6XA 2WP0A 3MT8A 3C8DA 4QOJA 1G4AE 3ZYZA 2CFRA 3INTA 5KC8A 5FV7A 1QFYA 1T3GA 3W7VA 2JRCA 3H13A 2XE8A 2ZRJA 2PLWA 1BWQA 1ULUA 1D2NA 3ZIAA 4KDCA 5JO0A 3BE4A 3U7QA 1KE2A 1N0WA 3IQZA 4KFSA 1VKOA 3E8SA 2PMDA 5WRFA 3FUWA 4QHYA 3O8LA 3ZVNA 4YEDA 1ZONA 3U39A 5AM3A 1QJ4A 1KK0A 2B4TO 1Y9AA 4FUQA 5DISB 1KETA 1HKHA 5HG0A 4Z8XA 1DV1A 1NLFA 1ODLA 1ZAKA 3P0RA 3GAMA 4PG4A 4Z1MD 4B4UA 3CG0A 1P31A 1V8ZA 3PTAA 2RIPA 3UPDA 3JAWB 4R2JA 4LF4B 1JWLA 2XMRA 4OYRA 2H1HA 1E5DA 2XOKD 2XTNA 3I3OA 3IBYA 3ONWA 3TL2A 4QXOA 4JI6B 3PPWA 1PKEA 1MPTA 4IEEA 2D0DA 3N3AC 3WXMA 4Q3AA 2B3DA 3UGTA 4E14A 3THSA 3MWEB 4Z4GA 4IVNA 2M32A 3SIRA 3KKLA 4OHYA 1W75A 1TMGE 2MU1A 4OI2A 3HQ4O 3ZBUA 4KPUA 2ZUUA 3JWIA 2O2GA 4RHTA 5ILOA 1L7VC 1JBKA 3PG5A 1I7NA 5IMSA 4NPHA 1EWRA 1MB0A 3L4BC 4W9NC 2PKXA 5I9BA 5K51A 3ZGXA 3HVKA 4EATA 4KLAA 2HLDD 4QDTA 2JL1A 2NTYC 1TZ2A 4PONA 2C2KA 5ALSA 4CMAA 2BJWA 4L8YA 1YZHA 4CT5A 4LRTB 1H1TA 4UHCA 2QTGA 3IJRA 1ZR4A 5TY0A 2Z2ZA 4KH1A 2PQMA 5DP2A 1RMQA 4DLZA 2CXQA 2NU9B 1W5TA 3ZDQA 1F38A 2YMQA 3MBIA 3Q7SA 3ZPXA 3OE5A 3ZBPA 1AY0A 4XB6B 3ZCXA 4EY4A 3T38A 2W37A 5FF9A 3A4MA 3G2HA 5AW2A 3ZX5A 1O6ZA 4CHGA 4MEBA 3E9DA 3EXEA 4M37A 1AKYA 4QO8A 4X60A 3RTEA 3YASA 5IHPA 1HFKA 2IW3A 4UATA 2XCUA 4AG3A 4QXQA 4QLBA 2F3UA 4CTMA 1RWKA 4DYVA 4MUEA 4NS4A 3STHA 1TECE 1WB4A 4BJ3A 4MX8A 5DHUA 3G5AA 5CYOA 3F49S 2KM1A 1IEXA 1XK7A 4DV0B 4U1RA 1HMPA 2BGJA 4NVRA 3BXFA 4RYLA 4DIUA 3RBZA 1XZKA 1JQ3A 3IAXA 3TOZA 3LH5A 4ENWA 3DFIA 1AKQA 4NHEA 2X1MA 4HLUC 5KYGA 3DKKA 1U2PA 2PUEA 3RANA 4PTZA 5JS6A 1UZLA 3HR8A 3AEXA 4NJMB 3RRNA 3CPEA 1DXQA 4KVAA 4AP6A 4JN6B 1K6IA 3LBHA 1A8QA 2V5VA 1PFGA 1R4NB 3MTQA 4RCZA 5COQA 3WVNA 4QOHA 3CW9A 3CM0A 1EBUA 3HJNA 5FPQA 2CUZA 3G9TA 1QNFA 3JZDA 2JGFA 2OPBA 4N03A 3L1HA 2IXDA 3IV9A 2AN9A 4XJXA 1YRBA 1ZCZA 4URHA 4REQA 2MR6A 3B12A 2BEUB 2PKQO 1YMUA 2PJZA 3DL4A 3K2QA 3WGZA 5CBKA 4CW7A 1AB5A 3PXBA 2C3MA 4E21A 2APJA 1GPNA 3ADPA 4I14A 1DI0A 1Z0KA 2OHJA 2GJAA 2C2HA 4M1EA 3K5IA 3L43A 3UCXA 3FUXA 3Q3HA 2R5NA 4FSXA 4W1QA 4D79A 4UE6A 2QKYA 1T36B 1FTYA 1E94E 2O07A 3P2KA 1ZBDA 4E11A 4DABA 4ZJYA 4BJ5A 5LQKA 1OPXA 2R47A 2FY8A 2OYRA 3ZH9B 3R6WA 3D6VA 1NFRA 1I7PA 1ZK0A 3ZEIA 1N92A 1RFLA 3WOVA 2WWXA 2G7MC 2DFNA 4RY0A 2CHGA 5DGXA 5JALA 5B4UA 3A3YA 3GX1A 2CFOA 2J9XB 4DPMA 5JHHB 1U0OC 3T7RA 1GNSA 3A1TA 3HA2A 1M2WA 2WHXA 4OEHA 1X1SA 1DOAA 4AU1A 4Q05A 1GGKA 4YDRA 5FWDA 2V6IA 3KIPA 2DHDA 3OH8A 2GAAA 3PK0A 4NZYA 1NR1A 5DXJA 4ALIA 4M0MA 3TNLA 3TWOA 1TTQB 2GLTA 3TUIC 4PO3X 4X1IB