4ICIA

Crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
NSKILVAYFSATGTTARAAEKLGAAVGGDLYPIAPAQPYTSADLDWNNKRSRSSVEMNDPKMRPAIKSKKENIGTYDVVFIGYPIWWDLAPRIINTFIEGHSLKGKTVVPFATSGGSSIGNSATVLKKTYPDLNWKEGRLLNRTDEKAIRAWLDVIAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative flavoprotein (BACEGG_01620) from Bacteroides eggerthii DSM 20697 at 1.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Flavoprotein
molecule keywords Putative flavoprotein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iciA00
3KEGA 4N65A 3NHWA 5FUQA 4N82A 1J9ZA 1AHNA 1CZNA 3B6MA 4U7HA 1ZX1A 2XOEA 3KAQA 3F90A 3NHYA 3FVWA 4PU0A 3QFRA 2FLVA 3U7IA 4J8PA 4U7FA 5F51A 2OHHA 4GQIA 4N9QA 3B6JA 1QRDA 1RLJA 2QX8A 3W79A 1OFVA 2Q9UA 4QOGA 4DY4A 1XYYA 5LJIA 2OHIA 3KAPA 2X2OA 4H2DA 2WC1A 3KLBA 4ICIA 1FUEA 1FLAA 2BMVA 1ZWKA 3HR4A 3JSXA 2M6RA 3NHUA 3NHRA 4OXXA 3OJXA 4QODA 4Y7CA 5EAIA 3W78A 4DILA 1C7FA 3B6KA 4R81A 1AMOA 3W77A 3G5MA 1XYVA 1VMEA 3LCMA 3QFCA 4FGLA 3ZHOA 4BMOB 3EYWA 1AKQA 4ZVMA 3GFRA 1RTTA 1WSBA 1KBOA 1T5BA 4LA4A 2MT9A 5EA2A 5LBUA 1JA0A 1OBVA 1H66A 2QX9A 1QHEA 2V9CA 3ESXA 3OX2A 3NHFA 3R6WA 4FGJA 2M6SA 4F8YA 2MOKA 1J8QA 2N1MA 3OWXA 3U7RA 2ARKA 3OVMA 5LVAA 1E5DA 5TGZA 4HS4A 1QR2A 4YAUA 4FX2A 4XDHA 3L9WA 5B3KA 5BUCA 3GAMA 3N3BC 1YKGA 1RCFA 3LT5A 3N3AC 4Y9RA 1DXOA 5FA6A 3S2YA 3QE2A 3O2NA 4NLLA 5LLDA 2FX2A 1AZLA 4NULA 1AKWA 4ZVKA 1C7EA 1D03A 1ZWLA 2Z9CA 1AKTA 3FW1A 4GR9A 4Y9UA 2MTBA 3ES9A 3OJWA 1H69A 1RLIA 4CF6A 2QMYA 2RG1A 4FGKA 4QOJA 1FTGA 2QX4A 5A4KA 1TLLA 3ESZA 5NLLA 1JA1A 3NHLA 4C14A 4U7GA 2GSWA 2OYSA 4HEQA 2FAXA 2Z9BA 3B6IA 1FLVA 1CZHA 3NHJA 5F12A 2BZSA 2FCRA 2R96A 3GFSA 1CZKA 3O73A 1OBOA 3TZBA 4DIKA 4LAFA 2QWXA 1AKVA 1V4BA 3NHPA 1AKRA 2ZKIA 1FLDA 2FZ5A 3P0RA 4CETA 2B3DA 2FZVA 2Z98A 3SVLA 2MWMA 3EDOA 3FX2A 2HNBA 2V5VA 3D7NA 4ESEA 1J9GA 3UXEA 5LJLA 1XI2A 4YAWA 5NULA 1BU5A 1X77A 2HNAA 3L9XA 2HPVA 4H6PA 4QOIA 4C0WA 3W7AA 1BVYF 3GFQA 1FVXA 1SG0A 1YCGA 5LMCA 4C76A 3TE7A 3OWHA 2D5IA 4S24A 4XDGA 2KLBA 2XODA 3HLYA 1GG5A 1YOBA 3NHKA 4ZVLA 3UXHA 1J9EA 3ESYA 3F6SA 1KBQA 5FX2A 1YCHA 1TIKA 2OHJA 1B1CA 3F6RA 3OX3A 1FX1A 4M0CA 4PTYA 1DXQA 3NFRA 1CZLA 2AMJA 3FNIA 3HA2A 1SQSA 2QR2A 1AG9A 2R97A 2Q62A 2KQUA 2F1OA 4YAOA 1WSWA 3NLLA 3RPEA 3K1YA 1CZRA 4YQEA 2QMZA 1XT6A 3FJOA 6NULA 4QOFA 2BN4A 3OX1A 4PTZA 2X2PA 1YRHA 4GI5A 4LTMA 4QOHA 2BF4A 4C0XA 1I1OA 3N39C 1CZOA 1FLNA 2W5UA 5F4BA 2FVXA 3F2VA 3K20A 2BPOA 4ZVNA 4QOEA 1CZUA 2FOXA 1T0IA 3NHSA 4LTNA 3TEMA 2A5LA 1DX9A 2QX6A 2Z9DA 1YCFA 4YAFA 1F4PA 1D04A 4D02A 1QBGA 1NNI1 2V5UA 5ULLA 5EMNA 5B3LA 4YALA 4BMPB 5LBTA 5JROA 2FDXA 1AKUA 4LTDA 1YDGA 1D4AA
chains in the Genus database with same CATH superfamily
2YXBA 1Y4SA 3CIOA 1HMYA 3A4TA 3NM6B 5ECYA 1X13A 5E6SA 3B1JA 1MENA 1NN5A 3H7IA 2HJSA 2COEA 1KEUA 1Q57A 5A4JA 1KAGA 1NYRA 1TYZA 4FGZA 5BUQA 3NHAA 2V6FA 2OHHA 3UM9A 2WLSA 1E9VA 3UHAA 1S2MA 4CF7A 1JQEA 1P29A 3DOUA 3OJ0A 4W5WA 1DWUA 3C8DA 2VAMA 4UZEA 2AG6A 2BI8A 2MSCB 4R9SA 3U4GA 3E05A 2GHTA 5E8JA 1XSEA 4XGNA 1JGTA 1P7YA 3HUUA 2BGWA 5AQ1A 3THWB 5TV2A 3U3ZA 1YFKA 2FQ1A 3ZU3A 4RULA 3C74A 3N76A 5B1HA 1EHIA 3HACA 2DR0A 3CFYA 4BDSA 2IXAA 5LOVB 5GADl 1MB2A 2EBHX 2QV0A 2Y4NA 3T7RA 4NCJA 3LIPA 1C8BA 1XXLA 1V9LA 3JX9A 4J0GA 2R1ZA 3NAQA 2HD4A 1M73E 1F0NA 1M0TA 3JVDA 1S4MA 2W6OA 1Y8RB 4KRYA 3TQIA 3RIHA 4ADSG 4BQRA 4CM9A 5JZBA 1NDUA 4GRIA 1NU8A 1K5GA 2VJDA 4DLSA 1OZAA 3L93A 5ADWA 3VR4A 4G5HA 2MSEB 5FF9A 3T06B 3K6KA 1A5ZA 4BKPA 2Y1WA 1ZZEA 3K2EA 3V8BA 1NVAA 2BC9A 4LVNA 3A6LA 1THGA 3NHLA 4LJAA 5D7BA 5DEIA 4L85A 2I55A 2PTGA 3G2MA 1MW8X 1I6MA 4KI0A 2C54A 4BBJA 4D8UA 2NZYA 4QICA 4FMDF 1P2GA 1MJFA 1L4KA 1XQ1A 4JP8A 1GNTA 2UYCA 1BJRE 2VH2A 4KHPB 3DWIA 2PZAA 3KT3A 4X1KB 5KU7A 1H05A 1QG2A 2PH7A 1A9PA 3FVRA 3MJHA 4IMPA 5KVVA 3SIPA 3DP9A 3UMJA 4MYUA 2JHCA 4Q12A 3D1LA 1J8VA 4HRVA 2OG2A 4LSMA 1TPYA 4H3VA 1X0VA 4W5HA 3ZVNA 3M4NA 1EESA 1MC1A 1JIJA 1VFNA 4LZOA 2ZB8A 3G0CA 3RD5A 5K8UA 2XW6A 2PUFA 1SD5A 5GM2A 3BVPA 4IJWA 2PZGA 2Y0DA 1Y0BA 1FNCA 2UZ0A 4B6JA 3L7JA 4FS3A 1JUDA 3WICA 4ZAZA 3Q8KA 2B4AA 4BCDA 4LCBA 2L19A 2WTAA 1UPFA 3G88A 1HG1A 2HIHA 2C2MA 1ODSA 1E2QA 1P7PA 2ZJ0A 3L7BA 4KDCA 1Z5NA 4N5NA 4RLFA 4RANA 4WN9A 1L5YA 4CG0A 3DPIA 1FW8A 1R9JA 2A0FA 3OQMA 4X90A 3SQDA 4Z4IA 1FCJA 4F85A 2FKNA 3LSTA 3LY8A 4QFBA 4U2KA 1P6QA 2JB9A 13PKA 4X6LA 5CAEA 4BVKA 3GROA 4RPGA 2F4VB 3MCTA 2H0RA 4Q9LA 1NQXA 2C58A 3L4BC 5EXXA 3WOVA 4BQNA 1E9AA 4YLYA 5G53C 3V80A 4OUDA 3VR6A 4RVDA 1PLLA 5DGIA 4I55F 4RFLA 4RC9A 5CB6A 1SB9A 4ARAA 2FSSA 3L7MA 1SOVA 1DOHA 3MYRA 1YQDA 1RAIA 2H7XA 2QRLA 3WGKA 4KW7A 1SVWA 4E4RA 5B2FA 1GDTA 3BDVA 3ETHA 5F5LA 4TV9A 1OILA 3D3EA 1NP3A 2W93A 4WLUA 1O5IA 4IZIA 2FG7C 2J41A 3GN1A 3TJZA 4C6RA 2HT6A 3FJYA 4I2NA 3UV3A 1HYHA 1OYVA 1PDVA 1H9BA 4GLBA 2WC1A 4FDMA 2RHOA 1ZWKA 4TROA 1SVIA 4WZAB 4YJHA 2GNPA 3IEKA 3GGPA 1VSQA 2FN4A 2P69A 5CX1A 4ASUD 3W05A 1VIYA 4YI3A 4M1SA 5LYJA 5BR8B 4TZKA 2ZSFA 4YI5A 5G0TA 4CMHA 4F97A 4II2A 1PP4A 5IAAA 3IL2A 3L6EA 1KEWA 3ZTWA 1CIJA 4EG1A 3O8CA 3E5HA 4D97A 4KQWA 2BAGA 3BZUA 1H1TA 3OZDA 1JHPA 5E2BA 3QPUA 2ARKA 2V4UA 1I3OA 2OB1A 4HN4B 3MN1A 4F7DA 4NBNA 1AUXA 4O2BA 1A2BA 1KVQA 4EO4A 4UEQA 1H2AS 2HA6A 4LSWA 5FPPA 1KMCA 1A5AB 3HWSA 2IE0A 1PO7A 1QWSA 5CXQA 5AW1A 3M34A 1BXZA 4XIGS 3WK6A 1R6TA 2JCBA 1SOMA 2V9PA 3JVIA 3QJGA 3CLTC 4ISBA 3A2MA 3OOJA 4PFJA 4PW0A 2XCRB 3PQ2A 4NCXA 2W2MA 5TQVA 2P30A 1CUGA 5K99A 2ERCA 1W0JD 1RXYA 4AUKA 3CW8X 3K6SA 4MKXA 1MABA 1YRWA 3CX4A 4KBYA 2QYHA 4GPAA 4ITRC 4BE7B 5GINE 1ZS9A 5EYPA 1J0DA 1FDIA 5DH9A 3L0BA 1C9NA 4IMJB 3FMFA 4F8EA 2GHIA 2YFYA 1UJ6A 3RSOA 1UJ5A 1Q1GA 2WFLA 4P54A 3AL0C 4WXEA 1AKVA 3VDMA 3K16A 2DUMA 5MFZA 3DTVD 3KALA 4G41A 1N2ZA 3SC6A 4JXXA 4FGWA 3CB2A 5DXFA 3I9LA 1ISSA 2YYYA 4BBZA 3VA7A 1Q0TA 1W48A 2P9JA 3K35A 2JBHA 2PEYA 1V16B 2FSVA 5J4YA 2HGSA 2JL1A 5BOVA 3A05A 4HV4A 5BQFA 2WAMA 4B5KA 1G2OA 3EG5A 1IWOA 1UPAA 3E03A 3O84A 2HBQA 1CJCA 4O59O 3CZ9A 4D5EA 4EW1A 1E1RD 3W8RA 1D7OA 3CZ5A 4RU1A 2IY8A 2MINB 5IUJC 5KVCA 3U44B 1QGAA 1UM8A 3M6MD 4L7QA 4HAIA 2AN9A 4A8TA 1I33A 2PKQO 4QHYA 1XZNA 4HVCA 4KFCA 4KRFA 1Q1AA 2BV3A 2QN7A 3B9PA 1V3UA 1L1QA 3U4IA 3I01A 4HAZA 2CXSA 4R8RA 3TD6A 5IYZA 3I12A 3CWQA 3C3CA 1C29B 2IEGA 3EDRA 1YZ3A 4H3SA 2Q7DA 3V4ZA 4JJZA 2GXAA 4M2LA 1MIOB 1XZQA 221PA 2PUTA 3IC5A 3SZRA 4D8YA 3PX7A 4A23A 1KHHA 1E60A 2NSJA 2WIKA 1BS9A 1YACA 1YRQA 4JLWA 3L1UA 3BQ9A 2YWDA 2WV9A 2ZATA 2DOKA 3AFNA 3ZE9A 4B6GA 5F1PA 2XADA 5SY4A 5I7OA 1LNSA 1V71A 1GVNB 3QOFA 4UD6A 5A6SB 1XTTA 5TS2A 3ZUPA 4AY5A 3K73O 1WXQA 1YIAA 5ENZA 4MAFA 3B3FA 1GPMA 2QG4A 3BBPA 3CCFA 5C32A 2B6NA 2PGJA 3W79A 4ETNA 2P0EA 2A88A 2FSHA 3A9VA 3DWFA 3LY9A 3R8CA 2Q29A 3O31A 3O1HB 1T4CA 4ZYWA 3T7AA 1ZYUA 2QTVA 3B70A 2X0DA 3ZY3A 1BOFA 4Y0NA 4S04A 1FEZA 3SKXA 4GUAA 1U8TA 1P0QA 3IS3A 3Q7EA 4WOJA 2W6JA 1T8SA 2WMNB 3IALA 2CL7X 1RRMA 1HDZA 2PNFA 1L1FA 3M0EA 4BLUA 3K31A 2IYAA 1SXJB 4Z4FA 2C00A 2O7QA 1MB4A 1RWPA 2HU8A 3G23A 4PZ9A 4NDAA 1Y3CE 1Q7CA 2COKA 2WJAA 3ZWDA 4C2BA 1L4YA 1BDMA 2O1EA 4BXOB 2FU5C 3EA5A 4HSGA 4IEEA 3ZN2A 4PAWA 4XEHA 5JAQA 4FI3F 4ZOAA 1P7CA 2XZOA 1CLUA 3TQTA 1WXXA 4BNYA 3CLHA 4JYBA 4I4TA 1E2JA 3ESAA 4QZVA 1T6XA 1J00A 1LC3A 4TVKA 3K9LA 3Q9NA 2HMAA 4OXRA 1CT9A 3A9TA 4O4HF 4NQZA 1KYVA 4GVXA 4AWAA 1E6LA 3A6JA 1O5TA 1OAOA 1JMVA 4I0WB 4OFXA 4MAAA 3RYTC 4DYVA 1G38A 1V5GA 2Q3DA 3I05A 4KVFA 2XTNA 2QAIA 2PZFA 3GNTA 3A6ZA 5KC9A 1DQSA 3U13A 3U3JA 1TJNA 4BZXA 1D2AA 3RHTA 2IEAA 3IODA 4UPVA 5CB0A 3ILYA 2R60A 3NDPA 2NO5A 1WG8A 3WADA 3VVCA 4J9UE 4TLCA 1T2FA 3ZV7A 4JI2B 2O8FA 2XUZA 4LJLA 3GA7A 4H7FA 5IJ0A 4PS1A 3LL4A 4UOZA 4YUWA 4HBZA 4ZQBA 2ZB2A 4IOJA 2GI4A 3DLAA 5ALZA 3ZYCA 3LVRE 3A1SA 5FNVF 1N57A 2G9NA 4PIPA 4WBSA 3H65A 2C61A 4AKTA 1I0LA 4RDXA 2X58A 4MGZR 4GU5A 3WO1A 4N8DA 1OY1A 2H48A 4YYEA 4BX3A 2LIVA 5GIPE 2OC9A 2EARA 3UMSA 4WK2B 1Q7TA 4C4ZA 2AOUB 4OGLA 1BD3A 3STUA 3DBVO 3EPJA 3S44A 4YWJA 4Q1BA 4B71A 1P1RA 4GIBA 2OM6A 2YCLA 3PEWA 5AR1A 2ZIEA 2QXUA 4UU1A 1U6JA 1IEVA 2X5OA 3AUTA 5AM5A 3BXFA 2OCXA 3LKDA 1LK0A 2ZYWX 4JEIA 3WLRA 3HZZA 1O6ZA 1YONA 2ZTVA 3DGEC 4EYQA 4TQ9A 1HC7A 2X23A 3M83A 1D4AA 4PXAA 4RJTA 1NW9B 1GIAA 5L8VA 5E1MA 3MWYW 2PZMA 3E3MA 3CLUC 1UK7A 3CX7A 4U7HA 4I3GA 3RUCA 2BE9A 1G3MA 1M72A 3AR3A 3SNKA 1NT4A 1C0EA 5K0NA 3TLMA 4Q4LA 1ADBA 1UKVY 4JEMA 2GF0A 2QT9A 4RJKA 4S1OA 2PM8A 4PZUA 1JG2A 1VA4A 3DVSX 4FE7A 3PXGA 1XTQA 3L0SA 4MHSA 1PYDA 1CR1A 3N2LA 2E37A 2HXGA 3CRVA 4PHGA 3C3KA 4OATA 2BEVA 1ISGA 4BP9A 4N48A 2RE8A 4RVCA 3OT5A 2O2GA 2YZ2A 4JUDX 3RUEA 1L7EA 3KZNA 1AKQA 3PXAA 1Z08A 3EVEA 4P5EA 3CVXA 4ZTUB 4L5JA 1TNDA 4GE0A 2G08A 2G09A 4D9HA 1H6BA 3CR3C 5BPHA 3FOAA 4INOA 4X3CA 5IVDA 1RWMA 1F7VA 1RKQA 1P91A 1NYTA 3GL9A 4LMRA 5SZIA 4QU8A 3I62A 1UPBA 5GJBA 3E8XA 2FPMA 2JJ1A 4NZZA 4HAXA 5BSHA 1K9VF 3A6EA 4IUCS 2ACVA 4OI0A 5C46F 3R5JA 1GWNA 1JJBA 4GD3Q 4HC4A 3HCWA 4HDNA 4PBSA 1P1CA 3ET4A 5AHWA 1XNQB 1TAUA 3GJ4A 2Z9CA 2AHRA 2GS9A 2OQIA 4M98A 2WG2A 1Y8CA 3B5IA 4MTLA 3JVUA 1EZ4A 3DDHA 4JP1A 3WLNA 2FJ0A 2YV1A 4OJKA 3MGCA 4KOEC 1NW8A 3ZDXB 1WNFA 3HR7A 4B84A 4IXTA 5C1BA 2AKEA 2OCDA 5LXTA 1J21A 2GEFA 3LTNC 2JLYA 2J46A 2PMKA 4GM1A 2GTPA 1I2MA 2BONA 4ERNA 4CL3A 1Y6QA 1G7RA 1QIEA 2H8KA 3ZQ4A 4MWEA 1V2HE 1AMUA 2JFQA 4YUXA 2IBSA 5I6DA 4Y6SA 4R2IA 1Z4PX 3GRKA 4U7JA 4QTYA 5K8CA 2A3RA 2Z04A 3FTPA 3OSUA 5AKXA 3E7FA 4C0QC 3I5UA 4O08A 1Q77A 1TT5B 1JW9B 3M5DA 3QBTA 2Q1YA 1ZVMA 1UJ2A 5EYPB 1DAIA 3G2NA 5LQCA 3IT1A 1FRVA 3W7AA 1HV8A 1EUZA 3A32A 4ZJPA 5CDGA 4F92B 3OEHD 4TSFD 4JOSA 4ZGGA 1EP3B 2YIMA 4PZCA 3S8EA 3FCOA 4BLOA 3K09A 1BX3A 3HVJA 2XKJE 4NPHA 1D9XA 1W5TA 1CJKC 5GVSA 1AA9A 1IDN1 1QVAA 4CFSA 1F51E 2ZYIA 1NLFA 1IZ7A 2IHJA 2H2AA 2OZKA 4JENA 2D5BA 3DT8A 1B8NA 1RS0A 4JS0A 4NFHA 4D82A 3SC3A 2FK8A 4UULA 4E21A 1QBKC 4MHTA 3EZ9A 3IQEA 1VOTA 1ULBA 1XRNA 4MS3A 1AGXA 2B30A 1N1DA 5KQRA 2W6MA 4EVSA 5I4BA 1HQYE 3FROA 4R1MA 4D4KA 4XOUA 3SYKA 2ZRHA 5ALIA 4JU8A 1YTUA 2H4YA 1TC1A 1Q0LA 2NX2A 1C9DB 1THZA 1VECA 3BJRA 3TLKA 4WVLA 1ACMA 2P9FA 3WB2A 1O1YA 4IFTA 3JQCA 2O2HA 3W9BA 1XJ5A 4E2WA 1E4YA 1IZ8A 2FRDC 4M9QA 3NOVA 4FFBA 1KPHA 3GVCA 3F6YA 5C7LO 3GOQA 2EKPA 2PWPA 1Z6PA 3AFGA 1TDJA 2ZRKA 4ROTA 1SWVA 4KXYA 1NM5C 1OWLA 4Y1RA 5DNWA 3D02A 3EE6A 1K4KA 2OZPA 3H1BA 4RD1A 2LUOA 1WZEA 2JGNA 3EG9B 3IPRA 4XGQA 2ZIFA 2YIVX 4HS9A 4RV9A 4CM8A 2DHCA 5EXSA 2J3QA 4R2MA 2Q3BA 4E5PA 1HE5A 1UBNA 3I2HA 4M7PA 1P9RA 1G6HA 5JZVA 4B3MB 2KX7A 3EF1A 3HDVA 4C43A 4IH4A 2WJ6A 2ASEA 1U98A 1JH8A 2ZJ4A 3KB8A 3ICCA 3F49S 3M70A 4G1VA 4LVCA 2P7HA 1Z47A 3H99A 3UPTA 4ETIA 3P94A 3LKBA 1PWYE 4MVJA 4YP5A 1X70A 2QVXX 3H0CA 3GMTA 4JUIA 4OHBA 2D0OB 2PRZA 4DLBA 1QUEA 1SQ6A 4C6TB 1F48A 1GPDG 2OPBA 3UWMA 1GN9A 1YDMA 3UKOA 3A6DA 1I2DA 3A1WA 3PQ6A 4HFJA 3VU9A 3BILA 5DKFA 1QVRA 3ZQUA 2EZTA 4RF2A 5I9MA 5A05A 1IUOA 3RT1A 2IS4A 4DARA 1RQLA 2B8TA 1TZBA 4Y7DA 1CJVC 2UZ4A 4L5YA 3X43A 3VC2A 1I94B 1R16A 3HCBA 1RYEA 2W71A 3I9V1 3JD1A 3MT0A 1L5RA 1K6XA 5B37A 1PDOA 1Z4IA 4YGXB 3RTEA 4BLPA 1Z2NX 4E5DA 5A9SB 5HMLA 5IG2A 3U80A 3WMRA 5HKBA 2NW6A 1LLFA 1SBHA 4M54A 3DBOB 2JKYA 2LE0A 3BRSA 2VPQA 3WBBA 2P5YA 5DN9A 4O2AB 3WLKX 1ZVKA 4R9NA 4CR6A 4P4LA 2PUJA 3A3KA 3FWPA 4RKQA 3ZU2A 4F1JA 2VNIA 3RVRA 4JL5A 3EASA 1K7SN 3TO5A 2ZIAA 5AJZA 3ZDBA 1HLGA 3NHMA 2CLLB 3QNMA 4C01A 1OX6A 1V47A 3PUIA 4Q48A 1C7JA 2D7JA 2QJWA 1JG6A 1KF0A 2RHDA 3FX2A 1C3EA 1OFGA 4XCVA 1TB4A 2H4JA 3ESDA 3GMDA 4PX5A 5FL7A 4DCJA 4HD8A 2QR5A 2ECFA 2VJLA 4NBSA 2LCFA 1DBIA 2QVGA 4RS4A 4LJ9A 1Y3HA 1XFAA 2GN9A 3BHIA 3Q3VA 4L0QA 3L0OA 2LP4Y 3K9CA 4KXWA 1VCNA 2YYSA 2YIJA 5F35A 1CJTC 5EINA 4E5SA 1F60A 1AN0A 2Q9AA 5DNEA 5LQNA 1YA8A 4JFAA 1SUIA 4D2IA 4WZZA 5JTUA 1VPWA 4NTZA 2AR7A 4ZC8A 4AULA 2W42A 2W2LA 4WASA 2HHLA 1WSWA 4IKPA 3MCZA 1F6BA 3TMKA 3T41A 1BE8A 1BXRA 4MUEA 6NULA 2L82A 3BMNA 4XUDA 5JZOA 2QU8A 2NU8A 5KSYA 3ZH9B 4TLAA 3GT0A 1UDWA 2ZYVX 1YHZA 4U9HS 5JH7F 1U5BA 3MJCA 2DHDA 3T1NA 2ZK7A 3U3KA 1OR8A 1PGOA 3PGLA 4NENA 4QYXA 2PRIA 2VCYA 4FCWA 2PTHA 3CN9A 1WF3A 3I4LA 4RKWA 1I5RA 2A5LA 1VHLA 3BGDA 2P9TA 3OJFA 5AI8A 3L8HA 3R09A 4N5LA 2PH3A 3R44A 4FYMA 3RYCA 2JAWA 3O8BA 4Z7QB 1R4AA 3GFGA 2I6QA 4XM0A 4MA0A 1R9MA 1ZNXA 3L1JA 1G20A 1FF9A 5TQ2A 3V00A 1GD1O 2ECQA 2P78A 3EAGA 3OECA 4PZDA 1JFFB 1MVOA 4OB8A 1JDTA 1UFRA 2WJHA 1GZVA 3O4GA 2K2WA 1W34A 2KLHA 3G49A 4KWEA 2IV7A 4KPUB 3EIWA 5IX8A 1G2QA 3NRJA 1QF6A 2JLXA 4GX1A 1H2FA 1XZFA 2PX5A 2PT5A 3MMPA 2VJQA 3A1TA 2JDID 5AK0A 1E59A 2PYZA 2JGAA 2O5EA 3TLEA 3AZPA 2HCTA 2Y2UA 3C5VA 4JA2A 3CW9A 3SBOA 1ZH6A 3P20A 4YEDA 5SYNA 4C4SA 4ZVMA 2YC2C 2RHLA 4GLLA 1KBOA 2QY9A 4Z3KA 1D1SA 3R6WA 3PGVA 3ROXA 4UKDA 3PKZA 1IBMB 4EY4A 4JJKA 2P6MA 3KUKA 5TARA 4RD0A 1JDZA 3X1YA 4BNDB 2ASVA 2WYIA 2OHOA 4BFYA 2W2QA 1ISHA 3QX3A 1QCZA 2VWHA 3LT5A 4NXMB 3NPMA 3QEAZ 2JASA 4FSXA 4BNWA 4KO8A 4JB0A 4A82A 3K9HA 4CI9A 1NUPA 1NUSA 2BHLA 1R6VA 2D8MA 5B7NA 3PPYA 4RIEA 1R6AA 3VFDA 2G9UA 4L74A 1TYDE 1ZN9A 3AHGA 1H9AA 4RY8A 4TTIA 1P3Y1 3EZYA 4F9GA 1VE9A 3BH0A 1SIWA 4OQMA 4QEZA 5SY9A 4ENTA 1W0KD 3HL4A 4IXNA 4JI7B 4DUYB 2FZ4A 3CJTA 1T25A 3PHHA 4KQKA 4RK4A 3PEEA 3CNEA 4TZTA 2OV1A 1J2UA 4FBLA 4HLDA 2A6PA 2ALJA 1Q0QA 3HXMA 1M33A 2OCBA 2VCEA 1KVUA 3V8RA 5H3LA 5CM2Z 1XF1A 2C78A 4DG5A 5ITZB 3PDCA 2VQSA 3N1UA 4OFBA 3WDLA 4NDNE 1P80A 4OHOA 2QE6A 2ZTSA 3IIMA 4G1EB 5I8WA 5IASA 2B2NA 2LKCA 3A70A 4LJ6A 5JQGA 1AKYA 3AYXB 3NXKA 4QECA 1A8IA 1P61B 2XYGA 3KEFA 2C7OA 4C76A 2ZKLA 4N7MA 2FPWA 4UDOA 1RABA 1XGKA 2WTUA 3TKLA 1L4BA 3G2PA 5HG0A 1OFIA 3C6ZA 2VDNB 4FGUA 2CE2X 1K8RA 1VE1A 4G86A 4HDMB 1PJTA 2C0PA 4QUKA 4R7TA 4A10A 4BKUA 2O4CA 5CLJA 1FBTA 2HDWA 1KMHA 4DCCA 4UM8B 1VB3A 2M2IA 3L4KA 3IELA 1DUVG 3NIBA 4KR2A 4L9RA 4C7VA 3FGNA 5JLJA 2O3SA 4DLTA 2RGNC 3V1KA 1QK3A 1UC4B 2CVZA 1A9QA 1N2EA 1ZIYA 2FFJA 3LA8A 2ZXUA 1J23A 1NN3A 1ESZA 1LPPA 5HWSA 1SHUX 2X7JA 1E1QD 3BF8A 2ECKA 3GBPA 3MOIA 2EATA 2Q2NA 1TGVA 2QN2A 2VJAA 3DE3X 4N0DA 4JI3B 1IEXA 2G72A 4K5QA 4GT1A 2PWAA 2VKTA 5JROA 4D4MA 5L3VA 5A0TA 2JIZD 4JC4A 4GF5A 4ACBA 1Z6XA 3ERCA 4PG4A 3N7TA 1NR1A 4P4TA 4ERXA 4YXFA 1CY2A 3VMFA 1K7FB 4ZEXA 3V7YA 4ENPA 1RIIA 1H4VB 1DWPA 3B1FA 1QHHA 5AOAA 4EGSA 3TR0A 1J6UA 4D0GA 1NIPA 2IOHA 4BYGA 4MZDA 1EQ2A 4PCVA 1XCPA 4XLZA 4GP7A 1PQUA 1OI3A 1QYDA 1VKRA 5KU1A 2PS9A 1H85A 1YI0A 2X0JA 2NSYA 3G1TA 2HLDD 3NTQA 3W78A 3G5TA 1NVMB 2BKVA 1NVUQ 5AK6A 1P5RA 1MR3F 4BO6A 1JKFA 3A3YA 1XDSA 1VCIA 4NH4A 1JBEA 5JR3A 2QX9A 4DMHA 4EQ6B 5AJVB 1J20A 3E3NA 3GPDG 4YV7A 1TLFA 4A4DA 4OSEA 1M10A 2JRCA 2C88A 5K20A 5EJ2A 1MNQA 2OV8A 3CRQA 4HFRA 2IUSA 1TU3A 4NZ9A 4Q3DA 4R3NA 4A0QA 4FOSA 4DCUA 4UBJA 4GYWA 1V8PA 5D2CA 3PEYA 4F9EA 4ZO8A 1QCDA 1XRPA 4BMSA 3L4SO 1DJPA 4CPDA 3BZBA 4YK7A 3PDJA 3N87A 2AN5A 2E0IA 2P3QA 3DDSA 1DEXA 1P0MA 3F1KA 3RVNA 2ZZNA 1F4VA 5JCJD 1R3UA 1JFLA 3GLQA 3HYCA 3TI9A 5EZSA 4HLQB 2P9ZA 5HSGA 3EISA 3OSZA 4IMIB 4ZAWA 1DO0A 1XRJA 2WJ4A 4JCOA 5FUVA 2ONJA 4LY0A 5CCBA 1XK7A 4ZO9A 3V2GA 1IN6A 2BFMA 3KYBA 2YV5A 3SLRA 1KXJA 1FDRA 3OCUA 3TSZA 5KWSA 5B53A 4EKNB 4FHZA 1STOA 1C30A 1IPFA 5JY1A 3ZWBA 4GL2A 3ODGA 1FFAA 1MOSA 3GAFA 4BPBA 1SQ0A 2PKRA 4CMJA 3RRJA 4FONA 3AUJB 3W5BA 1X1QA 2LKDA 3EXFB 4MRVA 5TRTA 4QOIA 3BWYA 1KNQA 3MS2A 2X5KO 1TQ2A 1XUOA 1WCYA 2F00A 2PSDA 4GR4A 1NJ6A 3WLOA 4KV7A 5KKNB 1JJIA 2AKAB 1MB0A 3F46A 3E22A 3B38A 4FIZA 1PEKE 4EHNA 3FPLA 3KSDO 1XJ0A 2XVXA 4FDAA 1HMPA 1O95A 4MIYA 2W43A 4NOKA 4ZXFA 3T12A 1U7ZA 4M0CA 3E0QA 3ND5A 4G09A 1NU6A 3E2MA 3TIVA 3K0HA 3QJ5A 3ILSA 3ZVRA 3FUTA 4M36A 1UPCA 1SJ9A 5DYGA 2ZBVA 1V35A 5FL3A 1QLJA 5I7EA 4KE9A 2VTKA 2FGKA 2VHWA 3FUUA 4RELA 5TE9A 4ALKA 2YC4C 4LRTB 5FDFA 1JG1A 1GL3A 4TLBA 3AIMA 2BR3A 2QAGB 1ULSA 5FWXA 5DCUA 3W6UA 1JFFA 4C03A 5L7TA 3QKSA 1WD5A 5AVUA 1WPXA 4X3OA 2I7VA 4YBZA 5THKA 4NCKA 3ESRA 4D02A 2VFAA 1LPAB 4OHWA 3KO8A 2A0XA 1A9XB 3U3RA 3ZWMA 4ZODA 1M66A 4QNNA 1QAOA 2HIAA 2J1LA 3H16A 3C70A 4R05A 1NATA 1S8OA 1QKIA 3R5KA 5C7OO 1CRWG 1F0KA 3PYLA 4JIGA 1KFBB 5EESA 2ONYA 5EE0A 1E2HA 3OBIA 3FUCA 3RS0A 1B0UA 5EEGA 3WL4A 2EWVA 3BDAA 3C6XA 4NENB 5J63A 4G4IA 3JQ9A 1P1KA 3KJIA 4V1CI 1PDWA 1R3DA 3DM9B 1O94A 3ZU4A 4BEBA 5JALA 4M6WA 4DLNA 2L18A 2YVQA 2JEOA 4TMFA 4ZJZA 2FE4A 4MUGA 2NN3C 4NBLA 1JKMA 2V65A 3FCCA 1KR2A 2Q1XA 3QXJA 4FUQA 2ZRNA 4DHEA 3U26A 4IUBS 1DIHA 5KX5F 3VKFA 1L9KA 2QD3A 5AMXA 3RC2A 3D0RA 5LB2A 2BI4A 3GVHA 1VRVA 1IU9A 3ZCTA 5IWAB 2W8BA 5DLEA 1P4AA 2X0EA 1DQPA 1G64A 3AY0A 2UU9B 3THYA 1DGQA 1OH5A 4FFLA 5CVVA 5E3HA 1XNGA 4JC5A 3SLGA 1MZVA 1GNVA 3EXHA 3DOJA 2I3ZA 4RJJA 2NPOA 5E1BA 3D8HA 1TTPB 4QRHA 4OLFA 3ZCXA 4F46A 4ACAA 1Y37A 1CQIB 1WHTA 3JD3A 4MPTA 1IN5A 1U7DA 2CLSA 4Y9RA 5GV8A 4HDCA 1SKAA 2CNBA 4OHFA 1XL0A 2FUKA 2PN1A 3REQB 3U4DA 4EI7A 1KYXA 3AVQA 4L8LA 1SXJC 5I9LA 4DIKA 1KMIY 1C2TA 1HURA 2CMGA 3GBVA 1XJCA 4E5KA 2OUKA 2VDLB 2X7HA 3LPCA 1AQ6A 2G5GX 3G3EA 3WLQA 1FTSA 3IKMB 5JV5A 2ZWMA 2Q1SA 3M4XA 3O82A 2VP6A 2QSZA 1MT0A 5DTJA 1N5JA 3L0IB 2C31A 2QT0A 2YJ6A 4ZQCB 2PJDA 3BE4A 4K2AA 3V4SA 5FPSA 1NZDA 4DIMA 3Q7SA 4FSHA 4YJKA 3QV1A 4IVNA 1U2ZA 4OMDA 2P8SA 3PCTA 4QYIB 3NCHA 4U2CA 5AVWA 3U4HA 2GAAA 4UXIA 2CVPA 4MA5A 1KDZA 1W4AA 4MI6A 1SH7A 1OAKA 1T1EA 4I1VA 3BIXA 4OU5A 4MAMA 4OAOA 5IUKC 3PIDA 2REQA 4CDMA 5M04A 1R5JA 4NJMB 2VRWA 4AZTA 2E5FA 5I7AA 3S2ZA 3SHQA 4KP7A 1UBUS 3NVKI 1YS1X 4G1UC 4JLSA 1WPQA 4IGFA 3LPAA 5HCIA 1PVDA 2ZW9A 3ZEIA 4Z4GA 1CDDA 4ZALA 4MQBA 4MS1B 4YT4A 3NYRA 5MFPA 2DULA 1MW9X 2YVAA 2JFXA 5T6MA 3EGEA 1K0FA 1MC4A 2GARA 1UR5A 1JXAA 1RM3A 1W44A 1XQWA 4BEWA 2VDRB 2EJBA 4G23A 4YT2A 4OI4A 4NYJQ 1JDUA 4RCVA 1O3YA 4QOFA 2Z4RA 1T9GR 4AZWA 2JAXA 1W2WB 3KUUA 5IK2A 3T7DA 2ZYGA 3SDSA 4D7AA 4CIWA 3G0HA 1D8TA 3NTVA 3COZA 1HZZA 2PR7A 3LKZA 3NM5A 4IAOA 3SR3A 3RADC 3KUDA 1M83A 4JYAB 3OJCA 2Q6IA 1FNBA 4XYBA 1AZWA 4QWWA 5K9ZA 2CLEB 2C5LA 1B3BA 3D1JA 4MVXA 1PX2A 1BH6A 1M1YA 5GWXA 2WF5A 3H1FA 4KU4A 1E58A 3DL2A 1U0BB 1EBBA 3LM8A 4RD2A 5I9SA 2H07A 3I9OA 4H1HA 1BEUB 4UEOA 2NZXA 3D7MA 4WXPA 3FAKA 4QATA 2BBWA 3TL3A 1DVRA 4ITVA 2ZTUA 1TO1E 1RLTA 1WUJS 3PNSA 4HLNA 3IXLA 4RJLA 1BN7A 1TUGA 4UHBA 5E4JA 2CVFA 3H2GA 1E63A 1PJ2A 4EJ0A 1A5BB 3CCCA 1JPJA 2ZDHA 3LP8A 1Z35A 4MV3A 3KU1A 2VEOA 4WUTA 4C0KA 1G8YA 2LW7A 1GU7A 2W6ZA 5KZMB 4X1YA 2J9FA 5TPZD 5IBPA 4RGQA 1N6OA 1XRLA 2HCFA 1P9OA 1Y3AA 2B7LA 1M2KA 2OMKA 2WIJA 2B2CA 3UMCA 3TLXA 4UDXX 3PNOA 4QIHA 1G5TA 1XEXB 3UT5A 4TT3D 3HFGA 5IHPA 4EUEA 3THXB 3IKJA 2C29D 3CKKA 5DVZA 3E58A 2R5NA 4RTLA 1QUFA 1PFUA 1HF3A 1T9DA 2GXUA 1QQTA 4HAYA 3S55A 1GNQA 4RNDB 1NW7A 1Q21A 1FP1D 2PRSA 4ZEOA 1RYHA 3MWGA 4ATNA 2H5EA 3UNXA 1L5QA 1U7WA 2VXCA 3WLMA 4ZDIA 1KQPA 2ZUVA 2JCYA 6REQB 1MC5A 2GT1A 1T1GA 4LW8A 1YRLA 1R0RE 4NFSA 2YXEA 4PBRA 4CEJA 3DKPA 3G68A 2VJNA 3P8ZA 1NVGA 1Q1QA 3SK0A 2P7IA 3T3GA 3A1EA 4P4GA 3AILA 1L3IA 2P91A 3JQQA 4WLOA 1LTQA 2X9GA 3DPUA 3ZQKA 5ICEA 1RBYA 3IUNA 5DW3A 3PR3A 4FM9A 4A1FA 4OJTA 1SGWA 2ATEA 3ICWA 2WM2A 3ETCA 3HVHA 1AUOA 1YQTA 2YICA 3E81A 2I8CA 4URFA 1TCBA 1QPGA 2B4RO 1CUWA 4WZBA 3UOWA 2WM9B 5HRCA 2GA8A 2R44A 4QG7A 1MOQA 1UM9B 3GIDA 4FDUA 1EHYA 2I7XA 2OBLA 1NPTO 2R84A 1X8XA 3VH2A 5HTKA 2Z1NA 3DULA 1Y7TA 3KT6A 2QRHA 1H3FA 3NANA 1RWQA 4ZAGA 4IF4A 4EARA 4KITB 5JWOA 2ZYDA 4G1MB 1BFDA 2FKAA 4CN8A 1VE6A 1X9HA 3KM0A 1EJ6A 1PTJA 3KQSA 4DNXA 3UMFA 3X1DA 4S05A 4AZ3B 4P5PA 4LY6A 4R83A 1JAXA 2B8WA 1KO1A 3BCHA 1S3SA 2I3DA 4HN9A 2TS1A 2W83A 1HLPA 3CLSD 3JRWA 3URKA 4EI8A 2DEUA 3MHTA 5IVIA 3V9AA 4JKOA 1E3JA 3EZGA 3VKWA 3RREA 1S96A 3DWGA 5DISB 4EBFA 1ZVQA 1L5NA 3C8UA 3FJ1A 4Q3OA 5CVJA 5TXGA 1B8VA 1MTZA 4D43A 1UKBA 4AMBA 4J4TA 1DFIA 2WTXA 3JYQA 1OTHA 3DAOA 4QVIA 3ISJA 2GF2A 2VK4A 5KYUB 4DDUA 5J1SB 1AC5A 3BN3A 4KAXA 3LUPA 1ZK4A 2I2WA 1ZUNA 3IULA 4MPDA 4U5QA 2HWXA 4H6XA 2XT6A 4PGHA 4KSBA 4TTAA 5EJMA 1ZVJA 4AYXA 3L4EA 1UT6A 3IESA 1GFSA 4B3FX 2J5BA 1E3SA 3FVQA 4RDCA 4HUQA 5KQPA 1AKUA 1FXSA 2H9IA 2F55A 3WGVA 3I8OA 3IJRA 2WWVD 4N65A 2ZI7A 4DQVA 1NUUA 1A9SA 3O8LA 5F2NA 1FYWA 4I50A 4KQEA 4BNHA 3UC5A 1P2VA 3L0PA 1Z73A 4PSVA 3VNSA 1QE0A 1OBHA 1JLSA 2GN8A 2PPLA 3L49A 4FD2A 4G63A 1Y4ZA 4ECEA 5F23A 3O7MA 4HEHA 1CHNA 1KYZA 1XTRA 3I0NA 1E5LA 3DVAA 3SZMA 3BFXA 1NAHA 3KAPA 1JIQA 2ZZKA 3OZAA 2O2CA 4LE0A 4Y2QA 5H3CA 3ZXYA 1YR7A 3FNHA 4C6SA 3VZSA 4GPBA 4IQGA 4AC9A 1DX6A 3O26A 4CT5A 2ZYRA 3DL0A 4ZIRA 3I6YA 3HU5A 4BGIA 2BFBA 1ULUA 4WY8A 3GUUA 2J3IA 5EA2A 4TSRA 2PUEA 4D25A 3OEEA 4YN3A 2FW7A 4L4RA 1R10A 4JVLA 1PZMA 4YV1A 3OPMA 2MOKA 5H7XA 4ETWA 5CT4A 3P32A 3TFOA 2YOHA 5FULA 3ISTA 2XZPA 2H65A 4X61A 4F2HA 1OLOA 1XZHA 1IZZA 4IINA 4IF6A 3A04A 1CFZA 3VPXA 3LJKA 1BHQ1 2D2XA 3HCNA 3ZZTA 4M7OA 3O75A 1Q1EA 4GLJA 2FW9A 1Z2AA 5IANA 1PEYA 2P6UA 3TVTA 1AKTA 3AF6A 1LPNA 3WFIA 1A71A 2VL7A 1QV6A 1O54A 3CEPB 1VA5A 3DJFA 3OJWA 4HGZA 4NJEB 3S4YA 3W3ZB 2NP6A 1W88B 4MDHA 5HFJA 4QOJA 2BY4A 2X6QA 4NG5A 3WV4A 2R8YA 4WV3A 4LYFA 3AF4A 3BUSA 1BKSB 3I6BA 2Z2YA 1FLVA 1BD4A 3U7QA 4II7A 4DNFA 5BV1A 3H97A 4ZI7B 3F9CA 4RZ3A 5FHQA 2C4TA 1WHSA 4AMZA 3FHCB 4RTOA 3P2OA 5BYJA 3AIOA 4JB2A 1SXHA 2DQKA 4DG9A 1VP3A 5KTRA 4QQKA 3DM5A 4JJGA 3G79A 4M86A 4DB4A 1F2DA 2AZDA 5JNWA 4NMLA 5FLXA 2OCPA 2ZT5A 1KPIA 3K0FB 3L8YA 5BN3B 4TL8A 1ID1A 3F5FA 8ADHA 4DMMA 5F4ZA 1TADA 3KOXA 5HOEA 5JHHB 1ZJYA 3IE2A 3IVMA 5IJ9B 1XDUA 3QRWA 3DB2A 4GOJA 4XASA 2EP5A 2JHGA 2ZAGA 4C7OA 2B1RA 4DNPA 1BWQA 3LOUA 5FX2A 2C59A 4CU5A 1SXGA 4MGKR 1PZGA 2QLFA 3HKEB 2AMJA 4OG2A 3F7OA 3SHOA 3CX3A 4BHTA 2OAQ1 1JFRA 1SVUA 4XVQA 1TF7A 3LPNA 5G4KB 1SVLA 1E4VA 3VZRA 2F2TA 3NI2A 4MV9A 3DMFA 3VHRA 3OX1A 1SUAA 4F38A 5JNSA 1HEYA 1XFDA 2WAAA 1NP7A 1LFDB 1DB3A 3DA8A 3DH0A 4XGRA 1V25A 3P9CA 5ELLA 3JRNA 3ZWOA 4GC5A 1C1HA 1ND5A 3KKMA 4D56A 4DMFA 4O1HA 2ATVA 1J5PA 4IMRA 5FB3A 1T3GA 1R0YA 2OYRA 4M1ZA 1EP1B 3AP2A 4F71A 1COWD 4BP3A 3MTJA 2XCIA 2AG8A 2JCVA 3B1KA 3QP9A 3QVGA 1XZ8A 1NI4A 2QM7A 3H4VA 2VXYA 3MWLA 4MKFA 4UQPA 1TO6A 3TTTA 3ZCQA 2G8LA 3OZWA 3IQHX 4KK4A 5I7RA 3LDAA 4O5OA 2WVAA 3ULKA 4F2GA 2CHEA 3FZEA 3ONWA 3JSAA 2CXHA 5F76A 3QIAA 4U7FA 1K8QA 3GMIA 2J3LA 1QHGA 1N1MA 1VSVA 2QSJA 4L4SA 5I5EA 4X66B 3GJQA 1RZUA 4MRMB 4TLLB 4X71A 2X22A 4GEKA 2OHVA 1OTXA 3CWZA 1QTNA 4CF3A 2RGCA 3ZTYA 4BMVA 3SXJA 5MDHA 2IXDA 5IRCD 2V7XA 5J23A 3O74A 4JT2A 5CDUA 2QRKA 2BFFA 3QFCA 1AXEA 5DK6A 3ET5A 2JJMA 3D4NA 2YHBA 5A9SA 3ESXA 2CJWB 1V45E 3LT4A 3N8HA 4YRZA 1TTTA 4J49A 5KYXA 3IHLA 3L0ZA 3ZZNA 4Q4AB 5CJJA 4DJ5X 1E66A 4UNSA 3OE7D 3REFA 2FW6A 1KETA 1LVHA 1PFVA 2HMWA 3V8EA 4A26A 4UEJA 4GMGA 4FYKA 4D4HA 3RRXA 2IK8A 4WT7A 1XNRB 1JMKC 4PGAA 1Q84A 3OURA 3F5QA 5FBVB 1O94C 1K6IA 1R0CA 1N0VC 2VNSA 3K92A 3DBRA 2GFIA 1KZ9A 1CCWA 2BEUA 2C20A 4G37A 3RM3A 1O77A 3CKYA 4LDZA 3S28A 1RJ9A 2FF7A 2QN3A 4A27A 4R1PA 1M2OA 1N34B 4Z9FA 3RJ9A 2XVAA 4RTQA 3I92A 5AVRA 1II8A 2I8LA 4YXWA 3W2HA 2GZDA 1QQAA 1GYPA 3QLJA 8ABPA 1Y48E 1MOPA 3Q8XB 4ID3A 3TTWA 3WE7A 4ALJA 4C05A 2EG9A 3KLOA 4EYEA 4ARVA 5C8VA 3WMXA 4Z0HO 2BFOA 1CUCA 2F6RA 3G82C 1HK7A 1PYGA 2A5JA 2ILVA 4WXHA 3VZBA 3M1AA 4WCFC 1GTZA 4YRMA 4IICA 4TWZA 3CWCA 2QMOA 4CUJA 5J58A 2CUKA 3ND7A 2ONKA 4FDVA 5DCLA 2IWHA 4CQNA 9ABPA 2FPLA 3N5KA 1JDPA 3B9QA 3WK9A 2CBXA 3ANSA 2QZ4A 1EKXA 4CGYA 3EB9A 4PVCA 4F21A 1W1UA 2OQVA 3ZKWB 1VL8A 1J9EA 4REQA 4CF5A 1HZZC 4FR5A 3J81A 2ZRJA 5KNLA 1NNLA 2ZYTX 3DEJA 3P0IA 4MLZA 4WBNA 8ATCA 3X1KA 5HX7A 5LOVA 1ZPDA 3RS8A 4KRGA 4CNQA 5ES4B 1P1JA 1M5TA 2UXCB 2O50A 4XYMA 2ET6A 2KE5A 3AQIA 4AKIA 4GRAA 4WN3A 2J4DA 1SUEA 1OBCA 4MI1A 4QL3A 4D8WA 2CKDA 2HA0A 4V24A 4UMDA 3H84A 3WS7A 1XZCA 2UZIR 4RVHA 1AOXA 1EFLA 4PPQA 4L8FA 1Z4OA 1A82A 1Q7BA 1UK6A 1WDMA 2WWTA 3LTEA 1RQNA 1TJ5A 3FAZA 2VF7A 1GRRA 3K30A 5FFNA 2XTAA 3DW1X 3P2EA 4JVOA 4ZPJA 5BRAA 2GVNA 2Q4RA 3WMFA 2IEYA 3IQWA 3RUAA 1S8NA 2OBYA 5ENDA 7MDHA 1LX6A 4N5MA 4IXDA 5BYBA 5KHOC 3WAJA 3QKRA 4YJGB 4HWGA 2AFIA 1OIXA 1LSUA 4UASA 3UK6A 4OJNA 3DEIA 3O38A 3M6IA 3ZGXA 1U8YA 1FTQA 1T2AA 3LW8A 4A8JB 6ADHA 2ZI5A 3IBGA 3OHSX 1X7XA 4D9FA 2K7FA 1IWBB 3AP1A 4MW9A 2YKGA 2BEVB 1N3LA 1XZGA 2IYYA 4W1PA 4HI0E 4BCCA 4DR7B 1A4UA 5LXTB 4UHJA 4B3JA 4QODA 1JG3A 3L7NA 2DY0A 2WPDD 1RHUA 4NBUA 3CEMA 3RSHA 4AX8A 2FETA 1DO8A 4UUMA 3NBAA 5LZ9A 3LY7A 2QVZX 3KZKA 3WYFA 3K8YA 1C3OB 1E2FA 1NJGA 1OBVA 2L2QA 3NBFA 2H1CA 4IDAA 4IQ0A 4L3WA 3R7BA 5IHXA 4FFWA 4V0QA 4ENWA 5BMOA 3AERA 1OA1A 1SBQA 4HEA1 5HFNA 4EG6A 5TDHA 4ZVVA 1EE9A 4YR7A 1OWNA 5FBWB 3GJXC 2B5VA 2XRMA 3T5BA 1GITA 4YIKA 3VNVA 2HU7A 4GRDA 1U02A 4OI1A 2AQKA 5JBQA 3HZHA 1J25A 3RVQA 5BYKA 4BNVA 3D6AA 1IY8A 1R4MA 2P2SA 4Q1EA 5FOSA 3ZU6A 1SU7A 3VUEA 4WLNA 1TMKA 1SFRA 5D87A 4F6RB 3MUEA 5BV0A 3GHHA 3PNVA 3K8OE 2J9ZB 1X7XB 2VK1A 2XOKD 1NUHA 3O4HA 3C4VA 3H17A 5EE3A 2VSQA 1JA1A 3BK7A 3DZ8A 3G0DA 3RK1A 1XJWA 1ELOA 3O03A 4FJ2A 5E9QA 4TXMA 1GCUA 2JFVA 4JB8A 1XPRA 1QGUA 1H9CA 1C1XB 3GDGA 1WULS 2QU7A 2ZSDA 5THXA 1LVGA 5KKCA 2R1TB 3NTRA 1VMIA 4UVGA 1P8JA 3QUCA 4KXQA 3TZBA 4DLYA 3I5XA 1REQA 4UTPA 5AOCA 2VR1A 1FFXB 3JQ8A 4L6AA 3UTCA 4YJ2A 2RFLA 1PQ4A 4FCTA 4XRGA 4DPKA 3HVIA 4I1UA 2I6GA 4CQMA 2X76A 2YH2A 4D8VA 5TPZA 3ORHA 1PNQA 1WCIB 3TSOA 4IBOA 3CUUA 4J03A 1D2GA 2AI2A 3DBLB 4DA8A 1FRQA 2GPAA 4RXUA 3IIJA 4NYJR 3EWNA 4ZT6A 5TPWA 2V3WA 1P9WA 2P6OA 2RSLA 3AC0A 4XDYA 2FDRA 2KLBA 2SKDA 4H31A 4PCAA 4LYAA 2VEDA 2RHMA 1IN7A 5T64A 4Y30A 4HNQA 5D5PA 5C37A 2OD9A 3EDQA 3VKUA 1CZLA 1EK2A 4KBFA 3U7JA 2XAUA 1W36B 4BYMA 1DIGA 1HETA 2JIBA 2VYND 2ZWIA 4YHBA 3SEZA 1Z17A 4MJ7A 4B45A 1KXZA 2CK3D 5FV7A 3RC3A 1UOEA 3G0IA 5C7IO 3RANA 4DLUA 1O6GA 3SEFA 3DLBA 5BN5A 2Q6KA 5DWVA 2IITA 4KR6A 2W2KA 2VZLA 1NW6A 1NNSA 3ROFA 3G8BA 1NIJA 3PLRA 2I9KA 2X4GA 3H8JA 2PVPA 3E0XA 4HWOA 4BV8A 3DOOA 4XTRA 2QNBA 1IM8A 3IT3A 2IP4A 3MS4A 5CCEA 4RY9A 5BN4B 2I3GA 2PRKA 1EGVB 3GELA 1FYEA 2PIAA 5IZ4A 4X92A 5HHTA 1NBIA 5F1OA 4BFZA 4P3XA 2WD8A 3IKLA 5ALJA 2EV9A 2WUFA 2BISA 1W5BA 3U6BA 4F93B 1SXJA 5LM3A 1Y7PA 5KJEA 4DAEA 4OA5A 5JD5A 2IBTA 2RC5A 1KI7A 4D4LA 4YUYA 2CT8A 3TKAA 3MOGA 5FTKA 5JSKA 4R2JA 4PVDA 4I19A 1E1KA 4DF3A 2UYQA 4DY4A 1YVPA 3ICQB 3BYZA 4Y7CA 1FNMA 3K9WA 1G8GA 1Y5LA 1GADO 3BORA 5JSHA 4KDEA 2BSXA 2D13A 5L4NA 1TZMA 4HB3A 3EBPA 2XYPA 2V8BA 4DKXA 4NV3A 3UBMA 4QU9A 4F8YA 2JLSA 3KYCA 1QP0A 1E4OA 2RGAA 3ZS8A 1ZOIA 3W2TA 1T9ZA 2I29A 3OLZA 3OQ6A 5HJ7A 1KP9A 2Z08A 4M0DA 5FUXA 2FPKA 2G06A 4MDYA 5KNBD 1EBUA 3OP1A 3QE0A 2RARA 2F4NA 4KLRA 4IDPA 4FEEA 3EPRA 3O4IA 2AK3A 2ORED 3ZQ6A 4QFMA 4DA6A 2PUDA 3SM3A 1E79A 4KMOA 3UB2A 2GVDC 2BCJQ 1VGVA 1OLXA 4IUDS 1EAYA 4J2OA 1KK1A 3WWEA 3HB0A 2NXJA 1ENOA 1JECA 2QX4A 3EIFA 2PGNA 2QG9A 3K1TA 4PIMA 4U7GA 5TSDA 3X0DA 4E07A 3OBBA 3MTQA 3H9UA 3O3CA 4L0DA 5D5HA 1CZHA 2FW1A 1JVBA 1X87A 4KOAA 1SU4A 4PPNA 2OPHA 2ZUDA 3FVTA 5EIOA 3W1WA 5T8KA 1MQAA 3LUFA 3PI7A 3C45A 1J90A 1UBGA 4J3NA 1P9NA 4NFYA 5LDGA 2C5GA 3HP7A 3TZEA 1RPNA 3G7UA 4WZAE 3JYNA 1AUPA 3HI6A 1QB8A 3EFOB 1TVKA 4OKIA 1DCMA 1QMGA 4KC0A 1E2LA 3Q3HA 3NTXA 1WXEA 1HO3A 5ILOA 2G5TA 4LZAA 3SEQA 3N74A 1L8QA 5BSGA 3BXXA 1YR8A 3SEAA 4EEZA 2GCGA 2C2OA 1UPXA 3GNSA 2HYDA 3LZCA 3R3UA 4CTNA 5CIQA 3SHVA 2R6R1 3LHDA 4CKCA 4KGXA 5BQ3A 5L4SA 1W4RA 3HKBB 2JLBA 4FEAA 2XMDA 4G24A 4HSEA 1J70A 4TWRA 4WNAB 1Y5RA 5ESDA 2BUCA 2F67A 4OM7A 3RIMA 2PA3A 3UENA 4EG5A 2P41A 2I2BA 3GN2A 3GLVA 1AG9A 4RKYA 1G8SA 4QDJA 4OTZA 1TL7C 2GQ0A 3UGJA 3EPKA 1PYOA 1H0HA 5JMWA 1PZFA 4Y1GA 2IW3A 3LRPA 1R6XA 3DFMA 1YZUA 3BH7A 4XX0B 1NQTA 3CMCO 4Q1DA 2QRJA 3LCUA 3EGXB 1RJEA 4HNTA 1V43A 4Z99A 5HIKA 2Y76A 3DS8A 4P93A 4UE2A 2J67A 1W5FA 2Z9DA 3UC9A 3MS7A 1JS1X 4EGJA 5EJ6A 4XRRA 2X1VA 3DQQA 5EGNA 4E7OA 1N9KA 3AY7A 3T52A 4CLDA 3H18A 4KVAA 4Y2PA 4EKGA 1JKIA 3G9TA 2FLWA 2HB6A 2JIMA 4BLTA 4DMCA 1NPYA 2ZLBA 4F86A 5KOHB 3N75A 1UOOA 3P26A 4EFMA 2A1TR 3WFZA 2QD2A 2XJ9A 5JNLA 1MO2A 4LRWA 3LDGA 3T9DA 1XDDA 1DADA 3VGJA 3JRXA 3OAAD 5JZ9A 1W88A 2A84A 2ZU0C 2QRVB 3A7EA 2R00C 3IAM1 4LNAA 4NC9A 4L51A 4AF6A 2CN1A 4FMDB 4V0ME 4DE5A 2F9LA 3LK7A 2A30A 4J0EA 4DILA 4O1MA 4RYLA 1WMFA 5UKDA 1WDWB 1QTRA 4XXHA 3H5NA 1MP0A 3RWBA 1W4BA 5BWLA 3AQ4A 4ARSA 3HBNA 2PX0A 3T1QA 1QRUA 3OQPA 3AEQA 1W0JA 1M1NA 2QMUA 4BFVA 4R1OA 3VR5D 3U09A 1B42A 2FMTA 2Y67A 3USCS 1FX0B 1VZ2A 2RGWA 4U00A 3S2SA 5D3ZA 5EHXA 1QCYA 2N1MA 2NPFA 1AZSC 2LCIA 2GYYA 2JFFA 2VJYA 5DCWA 1RCUA 4BO3A 1PKXA 2D54A 2NZVG 1IATA 1PWHA 1Z5ZA 9LDBA 5JS6A 1UP4A 2EW1A 4XDHA 1I3KA 3OIYA 3SMQA 5DDIP 1QZUA 1B26A 4MCAA 1PR4A 3ZDEA 3PQ5A 1KZ6A 2ZRIA 3KQMA 4A8JC 3UMMA 4CHTA 3P4XA 5J47A 5ALLA 3C14C 3VPGA 3F7NA 4KAFA 4IIGA 3V1UA 2ONCA 1X3SA 4JUBA 4IV0A 1ZD1A 4RA6B 1SIBE 4V2UA 3VJMA 3WIDA 1K4MA 4M0KA 4XSGA 1PT9A 1K8XB 3LL7A 4BMXA 1B6GA 4B3HA 1KMQA 1QOPB 4IIEA 3DTYA 4CLRA 3ND6A 1MAWA 2DETA 3MERA 4YFYA 2AV6A 4O4JF 3RUPA 1QP7A 5KMGB 3U5TA 2CV1A 2O3UA 1EAMA 4ZRMA 1VI2A 2X42A 2VC2B 1ZMTA 3HPQA 1PNRA 3M6LA 4QBHA 4G9BA 1US8A 2WHPA 3KT8A 4RFSB 1WKVA 1X7GA 4ZVPA 3PUVA 5FI1B 5FOXA 5KYWA 4I5EA 2HIGA 2DFPA 3GJSA 1V5WA 2Y0BA 3VDRA 3T9BA 1LA2A 1NN0A 2F8MA 3VC1A 1EM8A 2QUBA 1GCGA 3FPKA 4YRCA 5I3ZA 1NQWA 1REQB 1X1SA 2JK0A 3CISA 3PRKE 4RPLA 1AX9A 4B3XA 5GZ1A 4RVNA 3CINA 3THXA 1GEEA 3JQ7B 4MV4A 5BWNA 4DV7B 5EP3A 1N6NA 1M2FA 3AZOA 3SIRA 3R3ZA 3ROGA 5DYWA 1A95A 3GUYA 1XZAA 4HF7A 4UEKA 4HATA 4CLOB 1QYVA 1I7SB 2OCIA 2H1HA 4E94A 4FMBB 1CZRA 4FYPA 5TGTA 2O8BA 2CNWD 3AFOA 1IVYA 2HK9A 2YS7A 5GONB 5JZMA 1PFWA 2H3EA 3H2IA 3RE1A 3V7NA 4EB8A 3BB1A 5AVQA 1P7WA 1V3TA 5KDOA 2AEJA 1G8MA 3L8EA 4MLPA 5KTOA 4YRPA 4HPXB 4Q01A 5F7XA 1YZYA 5D3MB 1CF2O 1QKKA 5HXAA 2FOXA 1JHOA 2J9YB 3HJRA 1ZEJA 2E55A 3TTYA 3MCAA 2XUFA 3G9QA 1XZBA 4GC9A 4XJTA 3ZHXA 1M6YA 4RK6A 5CVUA 3CNHA 4N3AA 4OK5A 3RS4A 3AUFA 3LQ1A 2I76A 3T1VA 4LQLA 4HKTA 1J06A 3ELDA 4PY2A 4TLDA 4E2FA 2FW0A 3OJOA 1SHKA 2ZR9A 2VYNA 1FOEB 3VTKA 5U9CA 1RHRA 2D1YA 2OHXA 2J8ZA 3PCXA 1H2EA 1RAGA 4OQZA 2D2IA 1GXSB 1UWVA 4R1TA 2RHGB 4FOOA 2HA4A 3Q8WA 4Q4CA 5AXDA 1DJOA 3L1VA 4RV5A 5T4EA 3TKYA 1GTVA 2NAFA 4Q4HA 4KQXA 1DT3A 3W77A 3CHYA 3LF2A 2P1RA 3EMDA 4K26A 4R81A 5A5VA 1G3RA 2W6QA 2AFHE 2MYPA 2X6RA 4Q3NA 3HCOA 5L95A 1JHQA 1D5WA 1M7GA 5A3QA 2P4HX 3B1YA 3B7PA 3FZNA 1N0UA 2IIPA 3PXCX 1J0AA 1AGYA 3S81A 4B9AA 5JT1A 1J24A 1UQRA 3UW3A 1H8HA 5J4KA 5G0VA 2YVLA 4JR2A 1ZUWA 4Z7NB 1T43A 3WWOA 3MTIA 2X7XA 1RAFA 2KW5A 1L4GA 2HQBA 3FWYA 3VOBA 1VIVA 3H1AA 1C7RA 5EIEA 4NULA 2RGNA 1E4EB 4MITA 1AKWA 4BB9A 4IWYA 1DIOB 1GPKA 3C41J 4Q02A 1E6CA 2QYTA 3HADA 1VLJA 3IYLW 3FI0A 1DRVA 2SBTA 3V1NA 4X8HA 1FS5A 5LMUB 1I01A 1GPLA 4HB0A 1SCJA 1XK6A 3GO4A 4EMUA 1NMYA 1YRYE 3NUGA 4JLKA 1SUSA 4XQEA 1X39A 3R23A 4HEQA 3TK1A 4MPRA 4RZSA 4OD0A 2VUTA 3CNQS 4IZ6A 3GZNA 4P4SB 2WD7A 2IHUA 3U7HB 1XPUA 3BD7A 4U0JA 1TUEA 4YPVA 3WJ1A 2EX0A 2X9LA 4F3RA 1XTPA 1Y5NA 1D09A 2B20A 4DA7A 1O6CA 1F2UB 1T2CA 3U61B 2R8RA 3HCRA 1T8WA 2XQGA 1DSSG 4L9AA 2J6CA 1DC6A 1IHOA 1WXHA 4M7RA 5I8ZA 5ISMA 4M8LA 2RGGA 3H6HA 1EQUA 3CKLA 4H6PA 4MINA 4YDQA 2JW5A 4KKXB 5IDXA 2SKCA 3CZ4A 1C8KA 1T2NA 1UBHS 2B1QA 3CRZA 3GC6A 3LYAA 4MOWA 4OQQA 4YP1A 3UHFA 1Q1NA 2KHZA 2VAWA 3OG9A 1E2BA 4YRBA 4FJ0A 1TUBB 3SZUA 5I01A 2IFTA 2D5IA 1FPMA 1ZHOA 5M29A 1V0JA 4FX5A 3WXMA 3WZMA 2EGHA 3QVTA 5D86A 3ZEAA 2GBCA 3B13B 3Q5DA 4IW3B 4C78A 4ZEWA 3Q12A 4CTMA 1H65A 2BEUB 3E7PA 3QTBA 2XXJA 3USES 4PLHA 4S1NA 1JNXX 2EZ9A 2OK8A 2J3EA 1G9TA 1FA9A 3FCXA 1C4KA 1RJ9B 2ORIA 3NC1C 3PC3A 4KCGA 1G17A 4KNVA 4Y2XA 4ZT4A 3T7KA 4PAQA 5KHAA 1JR3D 1XQ6A 4DB2A 1KJIA 1EFAA 4BNZA 2OQRA 3SIWA 2P6PA 5CIWA 1RDFA 2G9RA 3RW9A 1X3LA 3I9MA 3RRFA 2BM1A 1UZMA 3G2JA 4TV9B 4YQZA 2GCPA 1XTKA 1I7PA 3GGGA 5A3JA 5JYEA 1B23P 3BFKA 3GEPA 4OO3A 2N1BA 4HRXA 1PTKA 1RHQA 6AT1A 2YZ7A 3MOSA 4L1KA 3MQ2A 4CLRB 1U7HA 3N59A 1UAGA 4XSHA 1HT2E 1QDLB 5AI5A 4C06A 5IAKA 3TBKA 3QH4A 3T3MB 1XLWA 1GPNA 4Y9DA 3G9ZA 3IQGX 2F1RA 5FTJA 2B7BA 4ROSA 3WGJA 1PQYA 4J8PA 1UAAA 1ZOOA 4I5DA 2LZ0A 3JR7A 4D92A 1RW4A 4R84A 3WNVA 3GLHB 2O20A 4H2DA 3PL5A 1YE3A 3HR4A 1TU4A 3AHEA 2WF7A 5KNCD 1WQ4A 3IP5A 5IJ9A 3KPYA 4L4ZA 3RO7A 1XYVA 1RFLA 4HQOA 4G9EA 1CUJA 1VBFA 1BWSA 4WZBE 4H0NA 4M0LA 2GJSA 3IUJA 4IOLA 3RVPA 3OJEA 5FADA 3N6RA 5K2MA 3W2FA 1FBNA 3PNMA 2WM8A 1B4DA 1WIWA 3LHKA 1TEVA 2ZAYA 4F84A 2H1OA 2VSFA 3N28A 4TKMA 1Q7GA 2O23A 4TWIA 2UUBB 4Y2YA 1AMNA 2FHPA 3C6KA 3BTUA 1IDOA 2RAUA 4WDQA 4F6RA 1T1SA 2UUPA 3KDPA 5AM0A 3GLIE 1MRSA 1B1AA 4D9JA 1KWGA 3A58B 3G89A 2YXDA 3B3QA 5HIAA 4FHFA 4M6WB 2PBZA 4QGGA 1WBDA 2XYRA 3ECCA 3ND9A 3PQDA 4KO4S 3VSBA 4RZXA 4BNTA 4RTSA 2GSWA 1QU3A 5FBLB 1QYCA 1UBKS 4IRXA 3MGGA 5JQGB 4MW5A 3A8TA 5BN3A 3DMYA 1N6PA 3SYLA 1KSJA 1AD2A 3F97A 3IUSA 3NWPA 2BJWA 2HLNA 4CQLA 2QWXA 2P3OA 3LPDA 1PJRA 1NUQA 5H3HA 4AIIA 4G25A 3MJTA 4RK5A 4PZEA 3K0BA 1A27A 1NTOA 5KYKA 1LNQA 3DTVB 1IEWA 3K94A 3IXQA 3D6FA 4J7CA 4Q0MA 1TT5A 5I9IA 1MO3A 4DQLA 3P1JA 1T2EA 4AECA 1YI8A 2QYOA 5DXJA 1ZL0A 2B99A 3O95A 5KQMA 2DFDA 5H8WA 1KP2A 1M5UA 4EQ6A 3U4MA 3O91A 1GEGA 1P6XA 2G88A 3E9ZA 4L02A 3BICA 4HDRB 1ORWA 2YV3A 3GFBA 3VNRA 1MEOA 1A1VA 3P5SA 5P8WA 2ODTX 3WLIA 4B6RA 1MX5A 3FYTA 3QTLA 2WWIA 4RVGA 4PR0A 5LN1A 3KYDA 4M1KA 1NQOA 3BE5A 4MDFA 1B0ZA 1G16A 3HE3A 4M49A 4W8GA 2F62A 1F3OA 3NASA 3H9BA 3UZUA 4JROA 4UHKA 4NFLA 4CIXA 2B83A 3SS7X 1SB8A 3UG7A 4F8JA 4PG8A 3LUBA 3QBJA 4MW1A 3M81A 3UFXB 2FP4A 2X1HA 2GUWA 2H6EA 3GEEA 3MJFA 1U2DA 2A14A 4JLPA 3TTXA 1RXVA 3L0DA 3IIEA 4AKEA 2C2HA 4FZJA 4WKBA 4YWHA 1ZY2A 1GSOA 2J0VA 3M2TA 3WO0A 1GUFA 2FAXA 4YP9A 3ON5A 5LR6A 3O5AA 1BMQA 2ZSEA 3IMCA 4YAJA 5BN1A 1UEIA 3NYQA 4EIWA 3D6VA 3HKDB 3ITDA 1OFUA 2O0JA 3C3JA 1BHSA 2XTJA 1A8UA 1DXYA 3ENNA 3EEBA 5DGCA 5SV2A 4ZV7A 3GJYA 2V6GA 3QMMA 5FT9A 1FU4A 2RI1A 4Z1MD 2I2XB 4XX0A 4ZICA 2PSJA 3TLZA 4LX0A 2HR1A 2DGDA 2WZQA 4D0RA 4KIGA 1E1CA 2QP4A 3JALB 4J4BA 3GFVA 4JP3A 3KQVA 4CKEB 1T5HX 2BM9A 1J0BA 5DF1A 1HLFA 2AUTA 3PR2B 5KVAA 4N47A 3R0IA 3PBKA 1EU1A 2UVPB 3F96A 4HVTA 4EKEA 2QROA 3Q10A 1OU4A 2CMHA 2AUNA 2R4UA 1NL3A 4M7WA 3O4FA 3PHCA 4JL8A 2QOEA 4R68A 1W1WA 3H5IA 1H4QA 2RHTA 2CMDA 3ABRB 1EG7A 4B75A 5BOSA 4R2WA 3CNLA 2C03A 3DMTA 1MB9A 1OE0A 3PUHA 4DC1A 1PV1A 1NXXA 4QUIA 5FWNA 2CYBA 1EX7A 1TT7A 3ZLUA 2D7CA 3AJ8A 3RWOA 1CFJA 4W63A 3UCFA 2AFRA 3NEAA 4IG9A 4TV8B 3VX4A 5K6TA 1WV1A 3PICA 5H59A 2O59A 4CMEA 1GG9A 2ZGVA 4L08A 3GARA 1P5FA 3KR1A 4HQFA 3OHPA 4LK2A 3GLSA 4QULA 2X2FA 1W6RA 3TNFA 4UOEA 2RG1A 1GPUA 1W9HA 3L7KA 5JD4A 2WTEA 3TBFA 3E5MA 3M6XA 5EMMA 3GA5A 4BUCA 3KVVA 3NOOA 2Z8YM 3AHIA 3KTOA 4IO0A 2R6DA 5H68A 2I78A 2GCIA 3ZI7A 5JY6A 1G8AA 1CS0B 3DE0X 1X9IA 4GGPA 2ZJ7A 1E7QA 3HVUA 3AJRA 3MWDA 3INTA 2A7XA 2C8VA 1USWA 2CF6A 2GPYA 2QAGC 1JHMA 2Y9PB 4LVOA 1B6RA 2V7UA 1E1MA 1F3LA 1KQ3A 4GEGA 1EPUA 2P1ZA 1VZ3A 4JLAA 4RGVA 1W2HA 3IMGA 2IYRA 4QGBA 4B4KA 5CDYA 3L82B 2V96A 4QM7A 1KA9H 3I4FA 5ADUS 2A86A 2RH9B 3ZJ5A 5CFOA 1JDNA 4BB5A 4E2XA 1ZGBA 3GFQA 1XZEA 1O97D 2FWRA 4OB7A 4EP1A 5JIBA 3IVAA 1PK8A 2RHCA 4JLMA 4OV6B 3DZDA 5LXTF 2Z30A 3S1LA 3ZZUA 2EGGA 3TOCA 4V0RA 3LQ4A 1FFDA 2EW2A 3ZV3A 2HRRA 5K3SA 1HNNA 1X80A 5L3SB 5K0FA 1S7CA 5LP6F 4ZVQA 4KNWA 4Z5XA 3HA3A 4WK0B 2K4MA 2LVBA 1O94D 5EJFA 2QXTA 4MRPA 5EE5B 3D31A 4Y1FA 4MQMA 1XDBA 4ZAFA 2Y1CA 3SZ3A 1PK9A 2GFQA 4K6FA 3OEWA 4NAUA 1IOWA 1PIWA 1T6ZA 3AH8A 3AVPA 4JGBA 4WUVA 4NU0A 3IPLA 3C1OA 4IXMA 1A8PA 3GD7A 4GPZA 4TTJA 5KTYA 1GJRA 1RP7A 1CUFA 3FBWA 3GGSA 2OO7A 3QPCA 3KSZO 4QOSA 4M89A 5T8KC 5CK4A 5LUBA 3VV3A 2M6KA 3UXMA 2Q3MA 5K01A 4OHYA 3UTDA 2QL9A 5AIAA 5B3LA 4OX9Y 4QPPA 3B82A 3VJRA 1V6CA 3LE8A 4OUDB 2ADMA 3HEMA 2AOWA 2DERA 5C4IA 2BT4A 1ZA1A 1IC6A 2QKYA 2GR9A 1Q0HA 2O4UX 4IIUA 3ZGOA 3QELA 2G5PA 2JD0A 3I2JA 5L53A 3H83A 1ZD9A 3L3BA 3PX2A 4DC9A 5HK9A 3R3WA 2CV2A 2ENWA 1RYNA 3HUEA 4O0MA 5TMPA 1CIPA 2OHGA 4IOMA 1KYTA 3WWCA 2ODQA 3ZY2A 4IKOA 1ZN2A 3L79A 1YF3A 2WYWA 3CH6A 1SRRA 2H9AA 2Y1GA 3EZNA 3VR6D 1QF7A 2FPUA 3WGZA 1P7ZA 2QGFA 3QSYA 2AEFA 4LV8B 3KSRA 4EHDA 4QUGA 4B79A 5DHTA 3PXEA 2Q0XA 3VHQA 5LZ8A 3AW9A 3N2IA 2JLVA 4OHPA 2CDAA 1G2IA 4RQUA 1ISFA 1J99A 2WEKA 4OAQA 3TXYA 3VUFA 5INTA 4QDKA 4PINA 2IH2A 1M0EA 1R12A 5BR7A 1QORA 2D3TA 2R751 5IC6A 4Q9JA 4X7PA 2YY5A 1AIPA 1K6EA 1ZKDA 4EMSA 4JBXA 1C8VB 1FYVA 1L4EA 2JIRA 3O3NB 2MCFA 2NTJA 4JBIA 3SBEA 4IFIA 3UK2A 1IN4A 1V4NA 2CWWA 4DPMA 4QASA 1T4GA 2G9VA 4UBMA 3SCZA 2HMYB 2FPXA 3ONFA 3DZBA 3FNRA 4PQYA 4EO7A 2C9CA 3EOBI 1ZH0A 5CNKA 4GUDA 4Q19A 2OYSA 2QTMA 3N6VA 3CNOA 4BV2A 5C7YA 4U6SA 1L4HA 3CH5A 1G3QA 4PZLA 4L78A 1RADA 5K4AA 3IMFA 5KQGA 1GCAA 1PJZA 4IILA 1UBFA 3DR5A 1Y1SA 1BDIA 3SSNA 4GBED 1GDHA 4QELA 3RQIA 4PO3X 5EMKA 3AO0B 4ZVRA 1M1XB 1OU0A 3PRYA 1U5AA 5A9RA 2C2KA 2VHTA 3PZBA 1QAQA 5JDIA 3ZDQA 3G02A 2OV3A 2XHZA 5IT0A 5IPFA 2AJTA 1L7RA 4Q16A 1MAVA 2ZEJA 1U28A 6REQA 1ZCAA 1UKEA 4M1EA 4HNAA 3S5UA 1MJHA 2AL7A 2Q3LA 5HBRA 5C1IA 5IUNC 1JEQA 2JAPA 3A9WA 1FUUA 2W6ID 3SR0A 2RB5A 3E9MA 1WZCA 5BUZA 1JEQB 4PC3A 3B20A 4LXUA 2OFWA 1ORVA 3F6RA 4RMIA 4GDFA 3FPAA 4I4TF 4GS5A 3DTTA 4DWJA 1JWAB 2I65A 1M8KA 3LHSA 4B74A 1PBNA 3B9BA 3GQVA 1KP3A 1MABB 2CVOA 2D1TA 4D6PA 4WWHA 3E9DA 4EG7A 1C4OA 2BBTA 2AZ4A 4YMHA 5AFSA 3CT4A 3FYSA 1HYGA 1R64A 2I6TA 5ALGA 4BLQA 3QXCA 4S35A 1P1HA 2P62A 3L0YA 3T9CA 1CZOA 1EWVA 1PR6A 3FGPA 4J43A 3ZY5A 3ROQA 2QLNA 2DM6A 2ZITA 3GGOA 3AU8A 2QS9A 2OZVA 4G4SO 4GAEA 2A9OA 1A2OA 1DZIA 3FDXA 1ST2A 3PD1A 2O2DA 2YHIA 4FFPA 4HGQA 4UNPA 3THOA 1KWKA 1N5OX 3VC3A 4D0SA 4J94A 1P19A 4GMDA 2O1SA 1OYYA 2A0YA 3FY4A 1NJ1A 2L42A 2R7NA 1E6EA 4HAOA 4I5FA 1U9YA 1A2KC 2BFAA 1MIHA 5BN5B 3DP7A 2Q50A 1E3IA 3WRXA 2YRFA 5JWRA 2PANA 4O4HB 1TYEB 2OBXA 3UHJA 1U80A 1R0ZA 3A7DA 3Q9UA 1L5GB 2EDCA 3FCUB 3Q85A 1UWLA 3FFTA 4J9VA 1XLVA 1JLRA 3C3PA 2H54A 4WVFA 4LF7B 3T0FA 1ZC3A 5DWDA 3UPDA 3IVRA 1NPDA 2ZG6A 3MSCA 2P27A 1DPGA 1G18A 4JXKA 3IMEA 1EEXB 1ORRA 4P32A 3AKEA 4RK7A 4L57A 3N8GA 4FFRA 4RWEA 1NKVA 4BBPA 3U7FB 4ZOQI 3ZK7A 2X8BA 3IP1A 1VHJA 5DO9A 4NCBA 5EN4A 4CMIA 4KFSA 2I6SA 2G4VA 3MIZA 1FNNA 5T4FA 3TQRA 1Y7HA 2GD1O 5TPWB 4H7EA 1DKPA 1U4OA 3EYWA 3GR6A 2IODA 4H7PA 5BNTA 1JXQA 3WTBA 2EKQA 2JJ8A 3LU1A 2VT3A 3G0GA 3ER8A 2F43A 4WERA 5LQJA 5FOVA 7GPBA 2WJWA 4HAUA 5JPDA 3HXQA 1JPVA 2WT4A 2QEQA 1S3IA 2XY4A 3KOMA 4IVPA 1YR9A 3GPIA 4WK4B 5BORA 3V1MA 3EGOA 5ALYA 2V4ZA 3MPUA 4C9BA 3IDSA 4DT1B 4E3WA 1PR5A 4HNUA 1ZO8A 3H11A 5LQDA 1XCLA 1M75A 1BGWA 1E4EA 1PNOA 2Q1WA 3F8SA 4R0NA 1NI5A 2I71A 2G9QA 5DLPA 5CAEB 3CSUA 4HB2A 5C3MA 2IT1A 1G41A 2XNDD 5JJCA 1AQUA 4BAGA 1E7SA 1D6NA 2IW1A 4JWTA 1GKKA 3BH6A 3QWBA 1GRVA 3L6OO 3M9XA 5K0CA 3EH2A 5CLLA 5NLLA 4CU2A 1M6NA 3PHIA 2ZB3A 3V3KA 5AKJA 1Q22A 3KKQA 3NCTA 1WSDA 2PL1A 2WU3A 4QGSA 1I4EB 3B1XA 3K32A 1ZD2P 2IH5A 1H2XA 5LIRA 2BBSA 4DUGA 3STYA 4EJMA 4IJQA 5TT0A 3W6ZA 3ZE2B 2J3JA 1VL6A 4HGOA 4TYQA 2OXFA 2XQFA 4CCSA 4R2KA 3LMKA 4EBBA 3A4YA 4QDTA 3WZ2A 1OHHD 3BE8A 2LTAA 5AUOB 5NULA 3M6AA 1ABEA 2DWOA 1X77A 3I39X 3R5XA 3QLVC 3Q0IA 3FIJA 4TTPA 4YB8A 5DYNA 1RHKA 1OLUA 5JQWA 2FCAA 1ILEA 4Q93A 2O0HA 2HSDA 1RQRA 5F78A 3BRWD 4Y9TA 3PI6A 3EA0A 2LDBA 3QLTA 3TR6A 5DBOA 4GYKA 2DTDA 2Q2QA 2Z83A 4TMKA 3CF0A 4AZVA 7ABPA 5EWLA 2H5IA 4K9RA 5DI3B 1ORTA 3ISVA 3RRBA 1UDBA 5LMZA 4EKIA 2GZMA 3FNIA 2ZIGA 4CHGA 3E5NA 4MWBA 1ZD3A 2GO7A 1E5VA 1JG4A 1CB7A 1WW3A 3O8NA 1B14A 1LWNA 5JSZB 3B6EA 2XTZA 2PMWB 5TF0A 5WRFA 3EIEA 5JS8A 1UCFA 1CRQA 4PN3A 2EHDA 2C4NA 1N7JA 1N6HA 1PJ4A 2FVXA 1DKUA 1Y8RA 2IYSA 2AMYA 2J85A 2V6BA 4HEA6 1JTFA 3RVLA 4R1QA 3UMGA 5KJCA 3PC6A 4ARIA 1E0DA 3JR3A 3M5PA 4L76A 3BA6A 1WE2A 1E5QA 1JKJB 2HPHA 2YMLA 3KZXA 4YLEA 3T7SA 2JCSA 4DDWA 1J42A 2H18A 3EWIA 1BAPA 5EMNA 5I5GA 3ELUA 4LHSA 3REGA 3DV2A 3U7QB 1M6EX 3CVOA 4RTJA 5MN6A 4HX5A 1YNOA 5CP8A 1Z88A 2I4NA 2PGDA 1L7QA 2X3FA 4V3BA 1I51A 4ITUA 1UBEA 2B3TA 5YASA 1SC9A 2AMLA 4HUJA 3PKIA 4WE3A 2CXPA 1FJ2A 2PV0A 3R9KA 2I4RA 1Z0AA 4Y18A 2JNWA 5KYWB 3GPLA 2QX8A 3K4HA 2OAP1 3IBCA 4JI6B 2PL9A 4IDEA 5FEMA 4BVHA 4CDRA 4E4YA 3FUXA 3IRVA 1HE2A 4IGIA 4B3IA 4DW8A 3T3NA 1AXRA 5T67A 1XO1A 4Z0PA 4BJ5A 1N7IA 3Q9LA 4GNRA 2W2VA 1X38A 1KAHA 2Q21A 4U6NA 1QG6A 2X77A 3VR4H 3L8CA 3TNDA 2IA5A 2VT6A 1Y8QB 2HKIA 5DMHA 2IF0A 1VXRA 1U65A 4RPCA 4G4SP 1QC5B 1U9ZA 5DHQA 5ARDA 3K1ZA 1TIPA 2BLNA 2O8BB 3U7RA 3NBMA 3UKDA 3SXUB 2C82A 2WKWA 2JI4A 2QTCA 1C3JA 1Y81A 3KTFA 2DBYA 1GKLA 4Q9KA 4QXQA 2FP3A 2ZRFA 3SHFA 3LDUA 4K6MA 3O2NA 4W7IA 1Z82A 2A33A 2ISSD 2KBEA 1P3JA 3PFNA 4AJOA 4JNKA 4BWFB 5CNMA 3BTSA 1W47A 1V26A 3REQA 5IDWA 5LP6A 1TEHA 1C0LA 1WKBA 2XQKA 3T5GA 2WMYA 1KZ7B 4HAVA 2CSUA 4X93A 1N3YA 4LYHA 5ALEA 4Q7JB 3RTAA 5DTRA 1C2YA 2J9XB 5FPTA 1RJGA 4ZO7A 4FIDA 4DQDA 1BG6A 4AJJA 1V4VA 4H6WA 1FFCA 3U1BA 4ZDJA 1WZUA 1U99A 5M5BA 4MWGA 4KPEC 2QQ0A 4ETMA 1ZIXA 1CLEA 2UZ3A 3IJ5A 3P0RA 2PX3A 1JJVA 2E6KA 2Z98A 3LYLA 3R3XA 4JBGA 4P1ZA 4RVFA 4YJ3F 1CNFA 1P62B 4DYDA 4F11A 5EPUA 1DAPA 2PCLA 3HCDA 3V8QA 3PRHA 3REOA 4O4JA 4ZREA 5CFMA 4LY3A 4R7GA 4G01B 3U2QA 4D99A 2BFFB 3HDYA 4TKLA 1DAMA 4YS6A 4TYNA 3K0CC 5JCJA 1G19A 1YDFA 2FN8A 4PO8A 3ZD9A 1ZMOA 2BFNA 1A88A 2C5EA 3IE0A 1THTA 4QX6A 3KBOA 4W5JA 1JAYA 1T5TA 3F6SA 3BHNA 1YHNA 4H16A 4NHEA 1U1FA 1B1CA 2OHJA 2QM3A 2ZWPA 2CLKB 4FK8A 2GAJA 4R8MA 4X6YA 1TO2E 5FUYA 5SZKB 1CJBA 1JVNA 2Z95A 5C1PA 4LNUB 3A6PC 3NDBB 3SYNA 4DLPA 1T35A 2EQAA 1GGKA 5B58C 1LBQA 3LZ6A 4MUIA 4PTZA 3SX4A 4MVJP 3WNZA 3ADDA 4KPYA 4RSRA 5EXDA 1GZ4A 2FUCA 4PPFA 1UINA 4CQLB 1FMJA 3T9AA 4BP8A 4Z7JA 4C5AA 4E08A 3ADKA 4YASA 4WEOA 3WL8A 1HDRA 3LAWA 3PSHA 2QLLA 4O02B 4QBIA 3R7WA 2GKSA 2VJMA 5E8RA 2NWQA 4MRAA 4DIFA 4M55A 3W1VA 2A1UA 2WD7B 1GT91 4YMLA 3ANLA 2PKYX 1XLTC 2UYOA 1WMDA 2R8OA 4HNSA 4NNJA 4OL9A 2WHXA 1CRLA 4LC1A 3DAPA 5ENVA 3GGJA 1LY1A 5GJWC 3QNUA 2H2HA 1HE4A 3DMDA 3O90A 4I5IA 3RI3A 3HP1A 4JOQA 1LDEA 4LHEA 3R8FA 1X1AA 5DU2A 3TRJA 1ZU4A 3BWDD 5KC8A 1VJTA 4Z3OA 1NKTA 2HMVA 1QB7A