4ICIA

Crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
NSKILVAYFSATGTTARAAEKLGAAVGGDLYPIAPAQPYTSADLDWNNKRSRSSVEMNDPKMRPAIKSKKENIGTYDVVFIGYPIWWDLAPRIINTFIEGHSLKGKTVVPFATSGGSSIGNSATVLKKTYPDLNWKEGRLLNRTDEKAIRAWLDVIAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Putative flavoprotein
publication title Crystal structure of a putative flavoprotein (BACEGG_01620) from Bacteroides eggerthii DSM 20697 at 1.40 A resolution
rcsb
source organism Bacteroides eggerthii
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iciA00
2FCRA 3ZHOA 1CZLA 1KBOA 1E5DA 4CETA 4Y9UA 4YALA 3W79A 1RLJA 3EDOA 3F2VA 3FJOA 1RLIA 1ZX1A 3KAQA 3S2YA 2R96A 5FA6A 1AKRA 3F90A 4LTDA 2QX8A 4CF6A 1BU5A 3B6KA 4QOJA 3U7IA 3EYWA 1SG0A 1TIKA 5LJIA 3N39C 2Z9DA 4R81A 4YQEA 1OBOA 1DX9A 4NLLA 4QOIA 3B6IA 4Y7CA 3GFSA 1YDGA 1FLDA 4YAFA 5LBTA 4S24A 3OX1A 1AHNA 1FLVA 1SQSA 3OJXA 3G5MA 2BPOA 3HA2A 3KLBA 4DILA 3ES9A 1YKGA 1FTGA 3TZBA 2XODA 4FX2A 3ESZA 4QOEA 2HPVA 3QE2A 4GQIA 5LJLA 1WSWA 1D4AA 5EAIA 3NHFA 5EA2A 1AKVA 2AMJA 1OFVA 1CZKA 3JSXA 1AKWA 2FOXA 3D7NA 3ESYA 1VMEA 3OJWA 1D03A 2Q62A 1AG9A 1YCHA 1FLNA 2HNAA 1J9GA 1YOBA 2MTBA 4N82A 1CZNA 2OHHA 4XDHA 2FX2A 4GR9A 3OX2A 4Y9RA 4BMOB 2QMYA 5A4KA 4HEQA 5EMNA 4ZVMA 2KQUA 1WSBA 4U7FA 4PTZA 1JA0A 4YAOA 2MT9A 4C0XA 3FX2A 2MOKA 3HLYA 2MWMA 1BVYF 2QWXA 1CZOA 2KLBA 4FGLA 3FVWA 3LCMA 5F4BA 1FVXA 3KAPA 5LBUA 4ESEA 1QR2A 3FNIA 5TGZA 4C0WA 4C76A 5ULLA 2QX6A 1T5BA 4U7GA 4H2DA 4QOGA 5LVAA 5B3KA 4PTYA 4XDGA 3NHWA 3NHYA 2BN4A 4YAWA 4D02A 1RTTA 3B6JA 4NULA 2ARKA 1XI2A 2OYSA 4F8YA 3LT5A 1XT6A 3NHUA 2M6RA 2BZSA 4FGKA 4M0CA 4LA4A 1QHEA 4N65A 1QBGA 1B1CA 1H66A 1C7EA 3RPEA 3NHKA 2BF4A 3O73A 1I1OA 1DXOA 5FX2A 3ESXA 1QRDA 2WC1A 3NHPA 2FZ5A 1FX1A 4BMPB 2X2PA 5BUCA 3O2NA 3UXHA 1D04A 4LAFA 2GSWA 1AKTA 4HS4A 3L9XA 3NHLA 2QMZA 3OX3A 3GFQA 5LLDA 1DXQA 3L9WA 4ICIA 1C7FA 4LTNA 3OWHA 4H6PA 2OHIA 4QOFA 3W77A 1J9ZA 3OVMA 1AZLA 3NHRA 3N3AC 3F6SA 3K20A 2FLVA 1X77A 1YCGA 1FLAA 2D5IA 4GI5A 3UXEA 5NULA 2F1OA 2FVXA 3TE7A 1AKQA 2Z9BA 4N9QA 3OWXA 3P0RA 3U7RA 2W5UA 5LMCA 2XOEA 5NLLA 1AKUA 1J9EA 2N1MA 3W78A 2FDXA 3QFRA 2FAXA 3R6WA 4C14A 3SVLA 3KEGA 1CZRA 1RCFA 2Z98A 1XYVA 1NNI1 2BMVA 2A5LA 2B3DA 1AMOA 3W7AA 1V4BA 2OHJA 3GFRA 1XYYA 3GAMA 2QX4A 3HR4A 3TEMA 4U7HA 3F6RA 2HNBA 2Z9CA 4J8PA 1JA1A 5FUQA 2V5VA 4YAUA 1YRHA 3B6MA 3N3BC 3NLLA 4ZVKA 5F12A 2QR2A 2M6SA 1T0IA 4QODA 1KBQA 2V9CA 3FW1A 1OBVA 1F4PA 3K1YA 2Q9UA 4ZVLA 4PU0A 2RG1A 1FUEA 4DY4A 2R97A 5F51A 1GG5A 4QOHA 1YCFA 1ZWKA 1CZUA 2V5UA 6NULA 4DIKA 4LTMA 4FGJA 3NHJA 2ZKIA 3NHSA 1CZHA 2FZVA 1J8QA 4ZVNA 2QX9A 2X2OA 3NFRA 5B3LA 1TLLA 4OXXA 5JROA 3QFCA 1ZWLA 1H69A
chains in the Genus database with same CATH superfamily
3JQAA 4MJLA 1UCFA 4U5XA 4ENUA 2P4QA 2XOXA 3JD4A 5H4GA 3LA8A 2Y1CA 1JHXA 1UJNA 2NZVG 3DDUA 4GPD1 1JAZA 1EVQA 4WMLA 2NU6B 4CKZA 2BHNA 2FLWA 1YTLA 2H8KA 4EO7A 2I2DA 5E1BA 1OBCA 4OXIA 5FPPA 3B20A 1BAPA 5HKAA 1ZSNA 3TSCA 3KSRA 1QOZA 1FMCA 1X1TA 1C1DB 1V37A 4NC9A 3RDPA 3RIXA 1N2CA 5IT0A 3FPJA 4LI0A 4DL9A 3AUKA 4NXMB 4YRQA 4C7XA 3LY5A 5KWJA 1KEEB 4FFOA 2O2JA 4N3GA 4YWJA 4C2AA 1JHVA 1MJNA 1CS4C 4XB2A 1RFGE 2WJZB 5BSEA 2PTHA 1WDMA 4WUTA 4F8EA 2W4IA 3K9HA 5C4GB 5T4HA 3UNXA 3V55A 5CNKA 2IYVA 4QUGA 1ZM2A 3RS7A 1INLA 4BWVA 4QJIA 4MGZR 1J2YA 1FFEA 1T36B 3NETA 5G02A 5IWCA 1T91A 4GO1A 5F33A 5EQTA 2I22A 2IL1A 1QFMA 2PX5A 3ULKA 1J7KA 1Q6ZA 3G0OA 2P40A 2NXJA 3H86A 2Q9CA 2ST1A 1TL7C 4Z0NA 4WWHA 4EABA 5LA6B 2CC2A 1YR1A 1GPYA 2O2XA 4GDMA 5AHXA 2ZUVA 5ER9A 1KI6A 3U39A 1M83A 2ZXFA 4UUOA 4ENTA 4OHBA 8ATCA 5KOIA 1L8AA 3PLAE 3FDIA 4OEHA 4IZIA 5EIFA 4CL8A 3T34A 5ITWA 1II0A 1WLSA 1W52X 3GELA 4L02A 4QQFA 1ZCJA 2WF7A 4ZAYA 4BX3A 3HCPA 2WSLA 2ZI6A 1L7BA 3LVBA 3ANNA 4CMIB 5LPNA 3A25A 1YASA 1Q0TA 1Y7TA 1HG1A 3HCNA 1SK9A 3GG2A 3BXZA 2ZIAA 1XP8A 4FD2A 5COAA 1VQ1A 2NTNA 5IANA 1JNYA 3Q8MA 1T8RA 4FMPA 4N7MA 4I4TF 4IAOA 3W2FA 3R5JA 5K3FB 4N5IX 5B4TA 1GA1A 4TZKA 4NESA 5C5DA 1M6VB 1MABB 1T2FA 1P0IA 1T8YA 3GPIA 1Z6XA 3LPAA 1X1SA 2QUZA 2BHTA 5E8JA 1UP4A 1XD2B 2BIFA 2I2CA 2WYVA 3I3SR 1RHUA 1G291 4L85A 3FM9A 4ARVA 4CF7A 5JOQA 3MD9A 4FS8A 4M8IA 4R83A 2F3TA 1B0AA 5M2QA 3RJMA 2HK6A 1OZ0A 2DHCA 4AL4A 5H9WA 5MGNA 5IM5A 3OJXA 4AD8A 5I5EA 3V2IA 1Q0SA 3DE7X 3AHCA 4PV7A 2ABWA 1YQWA 5KX5A 3R4VA 1JQLB 3T06B 5K99A 3OOYA 2QLTA 5E6UA 2ZCVA 4DS3A 2E48A 3A27A 5ABPA 5BQOA 4PG7A 2F7SA 3H4VA 1RSZA 3BGOS 3Q2IA 5KDOA 4OLBA 3RJTA 3IBYA 3NIFB 4A92A 4D7AA 1P5JA 4PXSA 3G79A 2YC2C 1PT7A 4MJ3A 3W06A 4HPJB 1JNXX 1UBSB 1ZLXA 3IAS1 3V4RA 1N8SA 3HY6A 2XXAB 1CLEA 2EOAA 1FQWA 5IFLA 4YP6A 4GOXA 5EAIA 2LPMA 1X80A 2CXUA 1U4OA 5H5JA 3RREA 2ZWOA 2R47A 5HGJA 1SJ9A 2A92A 4DV4B 1M7HA 2C96A 3LG2A 3LF1A 1F2VA 1ICIA 5HOEA 1L4LA 2R7NA 3PC4A 2IEBA 1JDSA 3FOFC 1AKWA 4BOYA 1H5QA 2MMCA 1I7LA 2R66A 3DAFA 1PNQA 4HDQB 4PM4A 3S28A 2Q6VA 3NBZC 3WJ2A 1J39A 4HH1A 3C4JA 3HDVA 3K1AB 2ZWAA 2GEFA 3GG9A 4L27A 1DHRA 1PVDA 3HXQA 1V7QA 5T8KC 2FWPA 2NTYC 2VTBB 1PT6A 4WA8A 1DARA 2Q2NA 4RLHA 4S12A 5HA5A 3D31A 2XB8A 4E09A 2QB5A 4KO1S 5EMMA 3DH0A 4BEBA 1DT5A 3ML1A 3PI7A 5A6VA 4PWYA 3KKZA 3O9ZA 2YV3A 3DBHB 2FPXA 1WTAA 2PS9A 4HAXA 1I7DA 4B17A 3L8ZA 1JVBA 3OEYA 1GPLA 1F0NA 3OZIA 3RWMB 1USUA 3SJBA 4FK8A 2GRAA 1B93A 3UV7A 4NMHA 4E5YA 1Z25A 1J2JA 1A98A 2Y0DA 4RK7A 1UZMA 1VRWA 1T2DA 4F5ZA 3LCJA 1DPFA 1U81A 1VPVA 3HRHA 1NW3A 1I4DD 5K4AA 1JEEA 4LX8A 2NX2A 3NDIA 4HEQA 1L7QA 2QDKA 3V97A 4ZKEA 2HPAA 2I4IA 4EQZA 4EM6A 3VH2A 3ER9A 3P27A 2HT1A 1D0IA 2OB1A 4JYCA 3A9VA 3DDCA 5K8VA 2XVMA 5LP6A 5HIKA 3KX2A 3K6JA 3RHSA 3EZ6A 1KO5A 4BQFA 4IJKA 4ZVPA 3ERCA 1FFXA 2ZI9A 4D8XA 4B4KA 1RBZA 1A8IA 9GPBA 1WKVA 2D2XA 3CH6A 5BYAA 2W2PA 3QGMA 5AM5A 4OI2A 3DOFA 4HDOB 4H31A 2GCGA 4NNPA 3T7SA 2GRJA 2IYTA 3EPKA 3CJRA 3H0KA 2O06A 1G4UR 4QJ3A 2C4TA 1XU7A 2Y93A 3ET4A 3NIBA 2EFEB 5AJVB 5FTLA 1YI0A 1E6UA 3V2UA 1LBEA 2A1TR 3ADBA 2X4GA 2WEKA 1JFVA 3KQTA 2RGBA 3OCWA 1Z39A 4RCYA 2BP7A 3VNUA 5BXYA 1NHGA 4XX0A 4XKJA 2XE8A 2XMGA 2XKBA 4OATA 2QZJA 2IYZA 4IXMA 3FZEA 4IIFA 4E03A 3T3HA 3R7WB 5IH7A 3A6HA 1H9AA 2XYVA 1BSVA 4EYOA 3MINA 2WMYA 2KX7A 1KDTA 2X7XA 2ZUCA 3DHEA 4H2DA 1E3TA 2B6HA 3DQZA 3BDVA 3DOHA 3V33A 1HYEA 3L1UA 1FVHA 1GQOA 2KM1A 3CVOA 1JF8A 1EWVA 4A36A 2NUAA 3PX3A 2PSFA 3BD7A 3SFZA 2HSEA 1GADO 3H0EA 3G02A 2TS1A 3QUSA 5JJ5A 1KKMA 4HXFB 3VHRA 3X44A 1XU9A 5HKOA 5F1KA 1G38A 1TK2A 3D4LA 1RI3A 3L4BA 2BEKA 1GGNA 4JR1A 4KRGA 1GNQA 3L8EA 3O8CA 1ECLA 4Z9BA 4NBWA 3TVDA 5ITZA 4WKNA 5AOVA 3R2JA 4MGIR 3TFWA 4EJ2A 1FPMA 1P1JA 3BFJA 5B2EA 4O4IB 2YNMC 3U4QA 3HYTA 4P7JA 2ZXEA 1KK1A 2JGLA 1GL9B 4WOJA 5KIAA 5CDFE 4NENB 1P7PA 1FFYA 3NT4A 1B0UA 1SVMA 2V7GA 5G41A 4PN3A 2Y1KA 2VPTA 5B6PA 5JTUA 5KQMA 3DFFA 4RPLA 3KOWA 3WQQA 1G8YA 3GMTA 5GONB 3S1AB 3GBVA 1H85A 4JQCA 4CBVA 5TX7A 3TSZA 5KMGA 1UZLA 2VNJA 3NEPX 3NNSA 2GA8A 2L17A 1CT9A 1KI2A 2JGMA 2XD9A 4RH0A 3ZE1B 3PD1A 3NHPA 3N0TA 1EK0A 1H2BA 3GWZA 3VPCA 1J97A 3K70D 4YP7A 2EVWX 2JF0A 4A0GA 1M1YB 1QX3A 1PYGA 3PUJA 1U7XA 4BLPA 1R10A 5JVDF 2P3SA 3AF3A 5CXUA 2BONA 6REQA 2C5BA 2HK9A 1R27A 1XMIA 1YVRA 1GTMA 3WIOA 2GERA 3WYEA 1KOLA 4CVNA 2ECFA 4K0KB 4TTQA 1JLLA 4MUJA 3R8XA 5LNK6 3A58B 1RD4A 3RODA 4HS4A 3OQBA 2HBRA 1DTEA 4FW9A 3IO3A 2V0NA 3A1SA 3AERA 3KPJA 3O8OB 4AI6A 4HGRA 4IVRA 2QV7A 1F06A 1AXEA 1JAHA 2C1EA 2CJFA 5C8YB 4V0NA 2GVDC 3THWB 2BFNA 3JALB 3RIMA 2P3LA 4XLLA 1R1DA 3WLMA 3IUBA 2EFHB 1V47A 2WLSA 3QU7A 2NYUA 3IV7A 2XB2A 4I55F 3A9TA 3LGSA 5HZGA 1IJKA 1X92A 4W5QA 3KV3O 2HAEA 1XSEA 3BICA 4I50B 1RYHA 1SCBA 4HYTA 3CZAA 4QOFA 1QIEA 5K0NA 2O8DB 1YJXA 3F6SA 3RYTC 1RWBA 3DLBA 1Z2PX 2JJ1A 2YWBA 5H4HA 2CMHA 4RF2A 8GPBA 3FOBA 4HNAB 2AR9A 4MCHA 4UBNA 2FJ0A 1B43A 3TAUA 3AVPA 3TXYA 1CJTC 3KKKA 5JV5A 3FHCB 3HLKA 4OLHA 2YHUA 4QELA 4KQWA 3LOUA 4H9GA 1Q14A 3AL2A 4CODB 3ZU3A 5JSHA 2YZ2A 2I2WA 1XA3A 4V02A 1VFNA 1QGUA 3ADOA 2BJHA 1M34A 1MRSA 5BMOA 4CL3A 6GPBA 2HWWA 3N2KA 4LHXA 5A4JA 2ZDGA 1CUIA 4HQOA 3C48A 4LXHA 1JJ7A 2VZ8A 1T3TA 3G9ZA 4YQFA 4TZ0A 4WACA 3E0XA 4JBWA 2W8BB 4FB5A 3DEYX 3P2YA 3JQGA 4U7JA 1C8LA 2DUJA 1UP7A 1E98A 1IOLA 1DIHA 1V7PC 1OV4A 4KIJA 4XGKA 4D26A 3R0ZA 2BGTA 1RAHA 5D1NA 3OIUA 5NLLA 1CSEE 1XTJA 2OORA 2I2BA 4CM7A 3HCBA 3GBSA 1ZZEA 5A1JA 2ZE6A 4P9NA 1II8B 3GDWA 3AJRA 4YMSA 4Y18A 3W5UA 1TECE 5FNVF 1U2PA 2V3WA 4MGHA 5CDFA 3S68A 5AR1A 1P2UA 3T0GA 1WV1A 3QVUA 4ZOQI 2B99A 4TGLA 4LV6A 4MO9A 2X7JA 4IDCA 1JQJC 3SPXA 4KN8A 2JJ1D 1E2FA 3BK2A 4J0CA 2DFPA 4RK0A 1Z06A 3REGA 1NV9A 2P0AA 2PEYA 5EXSA 4FVTA 4IVQA 4JLBA 3BSYA 3TB4A 1U8YA 3BMOA 2F1RA 3F0TA 4DKJA 3NHMA 3BERA 1T8UA 1PR0A 1XCJA 2VA8A 3GGOA 4D9KA 1VE9A 1KVQA 2WUDA 5ISMA 1VG9B 3E3AA 3GLQA 1M54A 3ZUPA 4DCSA 1YCDA 2ZT6A 3HWSA 1LDBA 1ZUHA 3JRXA 2PMWB 1MRZA 1QPBA 2DYKA 3CGGA 3DBIA 2B0CA 1PFUA 4L9AA 4KU4A 1IY0A 3GDFA 4TV9F 1VJGA 2C2WA 1X13A 3N7AA 4IGIA 3HH8A 3S44A 3VYWA 4US2R 1E0DA 1KYWA 3HVJA 2XWPA 3PQ2A 3TRIA 4IGEA 3D3QA 1S1CA 4RTSA 2C04A 4M83A 1YZGA 1V43A 3F6YA 1P0CA 1GCIA 4OYRA 2YWFA 1Q3HA 2HWUA 4FYKA 3BWDD 1E8DA 3D7LA 1HMPA 1O96B 1YZVA 2A78A 3OE7A 4PHFA 3FGNA 4CUKA 2EX4A 1IWOA 5B3AA 3REOA 1DRUA 5JECA 4KIGA 1RAAA 3N2ZB 3V32A 4FZ3A 1XDWA 1ST3A 1A5ZA 2JLQA 3UPDA 1T0IA 1EX7A 3LYHA 4KH0A 1FUKA 1EFLA 1G5RA 1DEHA 4URFA 5IJ9B 1FX0A 4JIMA 4R1PA 4TLBA 4GXTA 1THZA 2PH5A 3JZAA 4PE5B 1ZJ6A 1KDZA 5BUSA 1QIKA 2F3SA 4ROTA 1HFEL 1OLOA 1V1RA 1YR6A 4MYDA 4TMVA 5JVDA 1GTZA 3BC1A 3M9XA 2X8JB 4UKDA 3G8BA 3FTEA 1AK2A 1Z6AA 4H6VA 3ZDZB 4CI0B 4UCWA 5CB0A 1D6MA 1WDWB 1K88A 3LLCA 4UDXX 4UAGA 1F12A 1NMYA 3C7DB 2CLHB 3M33A 1PS0A 1K2VN 1BQ4A 4UATA 1QF6A 3BAZA 4KKXB 3V9AA 4QOHA 4R2LA 1FFSA 3NAQA 3T0IA 3LT2A 2V6IA 3F3MA 3T9FA 4B2PA 1H94A 1WHSA 4E51A 3IP9A 2H4XA 4F9TA 1PJTA 3NRJA 3WGKA 3QKSB 5GV8A 4XVUA 4KQFA 2HDOA 2KW5A 3R77A 3OE7D 5J47A 1AK9A 4CU2A 3D0OA 1LLDA 4BQRA 1EFCA 2O3UA 2WTXA 3TLEA 5LWHA 4IHJA 2NPIA 1C3LA 3OIVA 1QOPB 4I7EA 4I55A 4B4VA 1FMFA 4CLHA 1OZGA 4J0GA 2CJWB 1G5HA 1U9CA 1EI9A 1HI9A 1MIOA 1PZFA 2R87A 1XQ1A 2WHRA 4KSYA 4OG2A 5AM1A 3UKOA 3RKUA 3GGDA 1WRBA 1ZN2A 3EXEA 3FTQA 4OQEA 3RYFA 2FSSA 3V8PA 2YOHA 5D84A 2WJYA 4GMKA 4KYUA 5HIAA 2ECOA 4XWOA 1WEKA 4P3YA 3NFRA 1DJLA 1W5EA 2YOGA 1NVXQ 2CNDA 4NEGA 4ER5A 4K26A 3ZNNA 5JPIA 3ZHQA 4BIMA 4J4BA 2FEWB 4X6YA 3CZCA 1WETA 4B6RA 1FTNA 2HMYB 4EO4A 2BR4A 4BE7B 1Q1EA 4KWCA 4RD6A 3Q8WA 3V48A 4Z9FA 2ZZNA 4QGSA 1ULBA 2Q6OA 2NVUB 3IA7A 2A35A 3ZHRA 4A8HA 3O8LA 3EFEA 3LFUA 3MN1A 4OIFA 3IH5A 2RGNA 5TF0A 2AMVA 5JWRA 5FWYA 2X0KA 5L3QB 1T8TA 4YI5A 3DAPA 2D1FA 2C4KA 4EW1A 2ADFA 3BHMA 1KP3A 1NJ1A 3GGSA 1LVUA 4KJZA 3UMVA 3E9QA 4EA6A 3EDOA 1XCGB 3IQIX 4QPJC 1URPA 4O02B 5FNVA 1ZNYA 3S99A 5LOVB 1LRKA 1DQRA 3C6QA 1TO1E 4YJKA 4RQAA 1ZD3A 5JNVA 1AU9A 3ENKA 1E5XA 3R75A 3X0DA 5CDSA 4BL5A 1ZX1A 3QMWA 3CLTD 1ABFA 2D1TA 3LUPA 5DLQC 3RQSA 4AY2A 2O14A 2JCBA 1FUIA 2QE7A 4JJKA 4BO9A 1OTHA 1UKEA 4NIMA 2A2ZA 3VNAA 3HXTA 1R00A 3OAAD 4GX2A 4O0LA 4JVLA 2XB4A 4B87A 4RFVA 2IS6A 2O2GA 3B5EA 2KWIA 4NSNA 4M1TA 2W2TA 1UIMA 2AN4A 2WRZA 2C94A 5FXMA 2RH5A 3GJ6A 1UJ2A 1RHKA 2MSNA 4OQQA 3FDZB 3EOAI 3P4YA 1UXOA 4TRRA 4ARSA 2Q99A 2IOFA 3CRQA 3U1TA 1NBWB 1NOIA 3EHDA 2J48A 3WGHA 1JIVA 1XRQA 2EYQA 2DQKA 4FDVA 3A6EA 1GILA 1EXMA 1GPAA 3MQ2A 2CLCX 4REMA 4HQFA 4JLJA 1VP3A 1WX1A 1ORRA 3MWLA 3QEMA 3VBCA 3WGVA 5JZVA 4P31A 2HY7A 2XGJA 2CV2A 2VUHB 3QEJA 5LKAA 1KC1A 4NV0A 4YQEA 3RV3A 3C3XA 1OIXA 4XH9B 5IU6A 5JH7B 2ZYSA 5IXJA 2X4DA 3UUEA 3EFBA 1QG6A 3OFSA 4DUZB 5JD4A 3FIJA 3A10A 1CV2A 1V1JA 2DKNA 3PI6A 4FEEA 4RWEA 2ZLBA 5JSQA 1O87A 3Q8KA 5EZYF 2YASA 4R54A 2I8CA 3GJRA 3ER8A 4E5UA 4AZ3B 5DP2A 2VH1A 4Y7CA 4CFZA 1TK3A 2ZBEA 4FBGA 3V6LA 1N8KA 2QE7D 1DG3A 2XWQA 1BCSA 4KQMA 4EF6A 1G7SA 1SQ0A 3GRRA 5KYGA 2DY0A 4DAOA 1M6HA 2VHVA 2YY7A 3AX6A 3H1EA 1Y37A 1QHIA 1ISHA 1KI1A 4L4UA 4NK4A 4NMWA 4UFOA 3WK4A 2BWJA 1DQSA 1UFRA 5CFRA 3N86A 4G4GA 3CWCA 2D5BA 2GEVA 5C4MA 2JGIA 1ZH2A 3R5HA 1ADFA 1BD4A 1WU7A 1U4NA 1D7OA 1ZP6A 2O5VA 4MQEB 5H02A 4CLOA 1EH5A 1UBHS 1YTUA 3SHQA 2XNDA 4FGSA 1Z68A 2Q3HA 1WY5A 2BRUC 3EC2A 3PQ5A 4COOA 1H0SA 3CSDA 3PA6A 3U3KA 4BZPA 2C3UA 3LCCA 2PLRA 1JFFB 2NG1A 3PRHA 2JAUA 4XXHA 4E94A 3UAXA 3N28A 2JH3A 2GJSA 3PGKA 2G9RA 2P2GA 5DM0A 3AVWA 2RHBA 4N0EA 1ZCZA 3D59A 1GGHA 1SOWA 1VHTA 2I6QA 1KRHA 4I9FA 3ZVRA 3ZYZA 3E7FA 4JLMA 1UT5A 4P58A 2V7WA 2NVBA 3DZDA 3KOZA 1SUBA 4G0YA 5CDUA 3NAZA 3T3PB 1WCV1 4NEHB 3SBXA 2WWGA 1H6DA 4MLDA 4GPZA 2XE4A 1I3CA 3RNOA 1PWZA 1JQBA 1WZIA 5HW0A 3BHJA 1IHYA 2FGJA 3IJRA 4HMOA 1TAQA 3S55A 1I6KA 3BRQA 1D6JA 2ANCA 1YFLA 3N6VA 1J6UA 3KTDA 3DWGA 2AC4A 2PGDA 3II6X 5K01A 2XNDD 2G6BA 3S8MA 4RMIA 5CHYA 4ZC1A 4UQLA 4UE3S 1V11A 3I4CA 1GITA 1GSAA 3KB2A 1XZMA 5EWMA 3H5OA 3W5CA 2WWTA 4WCFB 4XDHA 2GJAA 2V7EA 3A4IA 3EUFA 4BB0A 2ZJ7A 2BGLA 3PSAA 2IK8A 3RTEA 1WXFA 1TQ6A 4I9HA 3VTZA 4K6OA 2O23A 1HE2A 2IF2A 2VHXA 3EZFA 4KSCA 3IE1A 1YF3A 4UM8B 2ZPUA 4CKWA 4PY2A 1IZ0A 5A4KA 3M5DA 1PV2A 5CA0F 5HQTA 2HFJA 2IHJA 3K9LA 4WKPA 3KG2A 1KARA 4QFCA 1NDQA 3UMGA 5B1EA 2O5CA 3CMMA 4QUBA 4TX1A 4JYBA 4ZQEA 1BX3A 4GIBA 5EIEA 3BBPA 2H1WA 2D1YA 2Q5IA 3PNYA 3UCXA 1VE3A 3IHKA 4TS9A 5G1NA 3HM2A 4Q9NA 3TRDA 2JIZD 1JQ5A 5IAOA 2VYVA 1XMQB 4GI2A 2HCRA 2C0QA 2XCTB 1NUAA 2MOKA 5IP5A 3AETB 3K0EA 3WXMA 4QREA 2I1LA 5BVHA 3DVQX 3GEEA 3HLYA 4MCIA 3K9FC 2VJCA 2XT0A 4FGLA 3T1YB 2D3WA 2OPHA 2PMCA 3ZX5A 4B35A 2FN4A 1L5RA 3MUNA 1CXZA 2PE5A 1CCWA 1KF0A 2XE6A 3OX4A 2R5NA 2L82A 3ANLA 5SZIA 4ETWA 1OQAA 4IEEA 3VPSA 1XTSA 5KDDA 1WP9A 5EJAA 4BVAA 2XYPA 4DB4A 3NWOA 5CTJA 2QUBA 5I7UA 2WTAA 4MWEA 2H85A 1Y0BA 3EQ2A 1QHFA 2ZB7A 2ZE5A 1EWTA 4C0WA 3A04A 1VI6A 1SBTA 3WIVA 1Y6JA 1ORHA 4EY7A 1QFYA 2UAGA 4A03A 4RKYA 2WSSA 4F11A 4X90A 3DUFB 2CLFB 5FPQA 3LE8A 3MQFA 3ONDA 4BMXA 2QTZA 1OTXA 5AVSA 1DVRA 2QROA 3V4LA 4BS9A 3ROTA 4DC9A 4TYQA 2YZMA 1PL0A 2JVIA 5DHPA 5EZYA 1ZW1A 2Y1FA 3H1GA 1Y48E 1QRRA 2JCSA 2OCLA 4YLYA 1UQRA 3PA8A 3JQ8B 4C0LA 4OP3A 2OZLB 2ZK7A 3EDYA 4ZEXA 3PFHA 1O6BA 3M2PA 3TVTA 1AF4A 1KHHA 4CLDA 4YRZA 3ORFA 5M29A 4RQUA 4TLLB 4DR6B 1GFZA 4Y98A 3S2FA 4LSGA 3NYIA 2OKGA 4NZZA 4NE7A 4KFCA 2V7UA 2ZB3A 2Q5EA 1I7SB 2IS1A 2EGGA 1D0VA 4WOPA 1ZCFA 2FMXA 1TZMA 3HJBA 1J5XA 2FGKA 3PGJA 5CLIA 5EIAA 4WZZA 1GLNA 3SZ3A 1U98A 3RH0A 5AW0A 3RW9A 5KJFA 2A6PA 4UBJA 3EUAA 3BKXA 2X0NA 4L8WB 4N8SA 4O2LA 3N59A 4RX1A 3WYBA 3QTTA 1Y9AA 3GRZA 3LTNC 3ZY6A 1S3SA 3RSOA 2WY2D 4A0SA 4DIOA 1KTIA 4ML3A 3PHIA 3WL7A 2D6FA 3BK1A 1NG1A 2WSSD 4FC6A 3RUHA 1WEHA 3KYDB 3T5TA 4NATA 2OY0A 3FPKA 3K2IA 3NWEA 2VOEA 4KQIA 3C3WA 5C7LO 3JYOA 1E2JA 1U0NA 1J23A 3JRNA 1CQIB 4KUEA 2ZRBA 4NBLA 4BZWA 4M3NA 4Z0HO 2C54A 3QW4B 4X60A 4YCBA 3SWWA 1M2GA 3JAWA 4JBLA 4TL6A 3E8MA 3F6EX 1REQA 4X71A 2WD9A 4D9CA 2QU8A 1P62B 1L1RA 1OR8A 1NJ6A 3AM1A 4UNPA 1EFVB 1HFWA 2CVQA 4H7HA 3QEBZ 4UTVA 1UWKA 5GWXA 3ZGXA 5GV7A 3PNVA 5ENDA 5HIMA 2Q5LA 2QVBA 1RAGA 1IPEA 2C5HA 5IFKA 4OPMA 3L9XA 4K9QA 4Z6KA 3ZLJA 4JI6B 1UT6A 2DULA 1JPUA 3H7AA 1SVSA 1JDNA 1TD9A 2G04A 5LDHA 4G0MA 3IT0A 3KLMX 3KUXA 4EUFA 2M2IA 3IODA 4C3UA 2PJRA 1UKCA 1J4AA 3CW2A 2ZYAA 2CT8A 3GV0A 1ZL2A 2ZRLA 4QBGB 4PZ9A 1XN1A 2P67A 4PQEA 4RHTA 3TZEA 1NNEA 4E2YA 2HMSA 3QVXA 4CG3A 4Z7QB 2AOXA 2LTAA 2NUTB 2Q4EA 3HUTA 3WKBA 2GESA 2Q9BA 1KMMA 3IVGA 2A7QA 3ZHZA 5TMPA 4BP1A 3PFFA 5BYBA 2JAXA 1J9ZA 3FUTA 4XQEA 1Z4LA 5A2GA 4J1TA 1JS1X 3MGAA 5LQCA 1POXA 3R40A 4XARA 2WIAA 2HYIC 3G3EA 3G2OA 3NTRA 4IXWA 4YJGB 5M7EA 3FWPA 2WF5A 4F12A 2VUIB 2FI1A 5CA0A 4MH0R 2XMPA 3T3GA 2FJUA 2NN3C 3DJFA 3PC2A 2EF1A 2DUNA 2N47A 3A6DA 1PR6A 3BZUA 4PC2A 2QI9C 2RFLA 5NULA 4I3HA 4B8ZA 4F4DA 4R0MA 5JAOA 4G89A 1G20B 3DZBA 3WDSA 1TX4B 4TPKA 3EODA 3WI7A 1P19A 3PDJA 4MVJP 1RYMA 2IITA 3SM9A 3SSNA 1U3WA 3UN1A 2ZJ0A 4RTQA 3RBVA 3OWXA 4CLRA 1M2VB 1R5JA 1XTQA 1J20A 4DUPA 2E4ZA 4JNKA 1QM5A 1OU0A 5EGSA 1K66A 3CZRA 4HATA 5B36A 1O97D 2REQA 1DZ3A 4UU0A 3W4JA 2I78A 3ZI4A 3K72B 3M7IA 4RPIA 2E82A 3E9CA 3V4ZA 1G18A 4JLUA 3A1TA 2BEJA 3VYTB 4NK5A 4P32A 1YQTA 2H5IA 3BEDA 2YJZA 4ZTZB 4N39A 4DJEC 4LHWA 3U48A 3W78A 3MWFA 4EG0A 1A9XA 2QJTA 3D2BA 1R16A 4UULA 1U7UA 3RHZA 1IPFA 4X44A 3WHPA 1YVUA 4KLZA 3QYFA 3IBTA 2PKQP 1KY5A 1KSHA 3MELA 2PLNA 3FVTA 1ZGBA 1RZ3A 2RBKA 3DZGA 4ZRNA 1SAYA 1WMDA 3IURA 4NY1A 4HZUA 4QYTA 3C5HA 1GRNA 2XXJA 3T7TA 4YMWA 1EHCA 3OA0A 5A05A 5KHLB 3GVCA 3WDLA 2QPOA 3GOQA 1VJ1A 3OIFA 5HMMA 1SUDA 4E1BA 3D6VA 1ZD8A 4R2MA 2B94A 4KV7A 3RJ9A 1XYYA 4KI0A 1NG9A 4QRHA 3TK1A 3TEMA 4KK4A 4MDEA 5T4BA 1QRSA 4QNMA 1FY2A 3LQ2A 3W5AA 1Z6QA 4J8PA 4P0PB 1JQ3A 4O33A 5CNJA 2AOTB 1XOIA 1VB5A 4ZT7A 1WCXA 1TLFA 4JL8A 1TTTA 3USES 1K1EA 3B3FA 3A1EA 2R1TA 3LC1O 1QIJA 3W04A 4PZYA 4MEJA 5EE0A 2D8AA 3L4SO 2OENG 3PJGA 3IX7A 1V7ZA 3O2JA 3GPBA 5AICA 3WLJA 1IEVA 2PMEA 3G9QA 3E27A 2ZYVX 2QN6A 1G5IA 1QCCA 4PSUA 4QRDA 4C6HA 3JD3A 2HREA 1TNDA 5GIOE 2XMRA 1CRLA 1P0MA 4ER3A 3NVKI 1ORTA 1AO0A 3HKEB 1NXWA 2ODEA 3KSZO 3VHXA 4ZIRA 2XW6A 3SOPA 2HQOA 4EWLA 4G1MB 1VSQA 3WZ2A 1WZNA 2CXSA 5D51S 3UATA 5BWMA 3VR5H 3OD5A 2OFFA 2WTBA 1K92A 3H8VA 4QTZA 5FBQB 3W2TA 4MULA 2GCOA 4YR7A 4BU1A 1DEKA 5DHSA 4CMEA 5JBIA 3L0SA 4RXMA 3FVVA 3KQPA 1W1IA 3LECA 1JLMA 3F6CA 2V65A 3H4MA 3OTOB 3GUCA 3R8CA 3DTYA 4M38A 3I6YA 2OD7A 4RA6B 4XUCA 1L7PA 5FWDA 4OVKA 1OFTA 1XNQB 1GXSA 1GG5A 1JDBB 1HYGA 4IDGA 1MA0A 2RI1A 4BJ1A 3RT1A 2XCIA 1R4NA 1SURA 4FOPA 3DZCA 4MICA 3N05A 2ZVJA 5K0BA 1P77A 3OLQA 2V5UA 5H81A 1W25A 4ZOLF 3UUFA 4HRYA 3HI4A 1CEXA 1LBSA 2VYCA 2VNHA 3F6PA 3OSUA 4E33A 5AVZA 4CKCB 3H5IA 5I4IA 1XELA 2YQZA 3CEHA 1RKXA 5G4KB 4TLMB 3H1BA 5CB4F 2CHQA 4R84A 2QEQA 3MFYA 2O20A 4ECEA 5HJEA 1Z12A 1DCMA 3QVGB 3I01M 3VZQA 3OY7A 5A4AA 1J8QA 3GFPA 3HJFA 2QYTA 2OD2A 3CE6A 4W6ZA 1LI4A 4D9BA 3EXFA 2CCJA 3O21A 4LY0A 4UD6A 2W2VA 3MCZA 4H4DA 5GJCA 3I64A 2XA9A 1P1BA 4PC6A 1N5RA 2Y71A 4RADA 4DDMA 3FJ1A 4EA9A 2OBBA 4MVXA 1E7YA 1BWSA 5DISB 1NQAO 3RLFA 1AGRA 1Z16A 1F38A 5JROA 1P2BA 4IH4A 4KGXA 5CH8A 3JQ7B 3D5QA 5DLEA 4BFYA 2C3YA 2GD6A 2AFIE 3E48A 4Q4JB 2FWRA 3VZPA 4AN1A 4QYIB 3Q7EA 3VSAA 4B7AA 2XMBA 4OHMA 1JDZA 2C2YA 3AM3A 5EP4A 4IL5A 1R5OA 5D5QA 2WJGA 2XVYA 1FNDA 1NW9B 2GLTA 2FZKA 2XYRA 3O1LA 4OCZA 5EESA 1GPH1 2J4DA 1YR8A 3TL3A 2V4MA 4ZCQA 5G1OA 4F2DA 1ETHA 1F3OA 4OY3A 4XJXA 1KYTA 4PZAA 2V03A 5ALNA 2QAGA 3AJDA 1U1DA 4P7FA 3EGVA 4E46A 3RFCA 2R6HA 3DTVA 4ZO8A 1F8YA 2XCLA 4K05A 3MZ0A 2AMLA 3GUUA 4HDMA 4X1YA 3EXG1 4RGQA 1WW8A 4GBMA 4U2DA 2IHZA 4LYHA 3DHNA 4HO1X 2FVYA 2R96A 1KC3A 3ROFA 3A2NA 4M49A 4DQKA 5I4KA 5H0IA 1P44A 2IOYA 4AYWA 3VKHA 1V8PA 1CUJA 4ZYTA 5TRTA 4JJIA 5DHUA 4B79A 1J0DA 3OCVA 4DLYA 5FD8A 1TT7A 3PUYA 3WMWA 5JSZB 5JDCC 5EVJA 4BN4A 1NMZA 4Z3KA 8ADHA 1MB4A 3KQUA 3DOEA 1TO2E 1Y98A 4N12A 2JFZA 4CCAA 2WAYA 2FG7C 2P0EA 3G82C 1L7MA 4K88A 3U3MA 4IOJA 1SVLA 5EN4A 4EHIA 2FWJA 2XAAA 3OUZA 3OCJA 4F46A 3UJAA 4EJSB 5BV7A 3IPAA 2RHGB 4YJ2F 5FUYA 3IIIA 4YWHA 3HBFA 2F90A 3FRIA 5LJIA 2GN8A 2PD4A 1Y7HA 4JQYA 2BH2A 2RHRA 4FINA 2Y92A 1R6BX 1PV1A 2OLKA 1C0LA 3W3ZB 4I5EA 1EM6A 5C34B 1RQ2A 4FNMA 5ESXA 3LRTA 4OQXA 2FPWA 2C5EA 4NYMQ 3KJGA 4US0R 3T1VA 4S05A 3AVVA 2WWXA 2XUDA 4AG3A 2EFDB 2DPGA 3DGFC 2O50A 3CUTA 4CT5A 5LXTA 2XRZA 5LMZA 2QTWB 4EG6A 2E49A 1RJEA 3HG7A 1JPVA 3BYZA 3E8SA 4RTLA 3B6IA 2BGWA 2CVPA 1B3BA 3KQLA 4DR3B 4J16C 2LKDA 4GWGA 2FUG6 5HCUA 1SHTX 2QRHA 4F9FA 1CJCA 1SOAA 3AUAA 2W98A 1YDEA 3D8TA 1AIPA 4TKVA 1OBFO 4EUEA 4G0WA 3D6TB 2H2HA 4IJ5A 3LDFA 3B6ZA 2GF0A 1WR8A 3CG0A 2P6PA 3NC4A 4L08A 2FWMX 2OEPA 4TQ9A 4D0GA 3R0VA 1M6EX 4DR7B 1SQSA 2W83A 5CH5A 4L9WA 1J8MF 2EBFX 2ZWVA 3L8HA 3M4NA 3V8BA 3JX9A 5ICMA 2VH5R 1B4DA 2QL6A 4E88A 1PWYE 4MPJA 4XFJA 4MW7A 1FRZA 1TCUA 4DNFA 4L4YA 2E5LB 2FF5A 2XQVA 4G0PA 1QQ6A 1NJSA 3W8FA 4YRMA 1M75A 2VCEA 2G82A 1SUAA 4OI4A 2Y99A 4EY5A 5CBPB 4HKTA 4D42A 1NLYA 2BFFB 4WDRA 5TSDA 1BCRA 4KO2S 1K8RA 1DAFA 1ZESA 4HX5A 2ZBQA 4MKFA 1IQUA 1D4AA 2H8GA 4RHCA 5KI6A 1I5EA 2LKCA 4H15A 2P5TB 3ZVLA 2ID4A 1P2DA 5DIFA 5CB4A 1RCTE 1XZPA 2I62A 1EVIA 5CXXA 4AY5A 4Z51A 5JFTA 1AHPA 4RQTA 2UUAB 1CZKA 1ZU5A 2PGJA 4LYJA 3SQLA 2N3ZA 4DCOA 1LI7A 1Y3AA 1TEHA 5K3OA 1N2JA 1Y6QA 3KVNA 2XF8A 1U7HA 3LDHA 1NM5C 1X39A 4WBXC 4IV5A 4DLLA 2Y05A 3D7KA 4TXJA 3SIWA 4B3MB 4HUQB 5EXPA 4N5MA 4C2BA 3H17A 1B76A 3A4VA 4H0NA 1UMBB 4JUAA 2HRZA 1MGPA 3FN4A 2NAFA 5TPZA 4RTOA 4IOKA 4HMPA 3DFKA 1OFUX 1GAQA 4E15A 1VLJA 1G3MA 4PQRA 2AMFA 1D4ZA 3AEQA 4NPCA 1TQ4A 1XXLA 5ALUA 3KKPA 5IHPA 1G2PA 2CB9A 2H57A 4OA5A 1HEIA 2QM8A 3CX4A 1DQPA 4BE9A 4ER6A 3EA4A 3OF2A 3RYHA 1Z2EA 1P6XA 2A0FA 2GR9A 3I1YA 5ANRB 3E0QA 3ZJ4A 5CBKA 5IJWA 1E7WA 4KIFA 5JXHA 2GX6A 4ODIA 4QPZA 5EWJB 3MJSA 5KWVA 1LU9A 4F4IA 5BV2P 3EGXB 1VP9A 4JU8A 1TUEA 2D0IA 2BMEA 1WS6A 2ODTX 4RVFA 4XI9A 4IQFA 3TECE 1U04A 1UXKA 4CJXA 4F3NA 4JYZA 3O4VA 1RXUA 1S89A 2KQUA 1TIBA 1QHYA 1WSBA 2AZTA 2FN7A 2ZSUA 3QPAA 3L93A 3NO4A 5EMLA 4LECA 4H7FA 3KR2A 1R4ZA 1A27A 3OTGA 4PTZA 4N4AA 5DYNA 3UQZA 3IULA 2HQRA 1HSZA 3NCTA 3FJYA 1SKBA 3OU2A 1M2OB 5HJ7A 1B23P 2C3MA 3K5HA 3AINA 5K51A 4OHPA 3DE1X 5GVSA 2GD0A 4ALIA 2FW9A 3VKVA 2ZRFA 2JGJA 4QXRA 5FTJA 2X15A 2QTNA 2X9LA 4OK5A 3PHGA 5KNCH 2AQKA 5K8CA 5L45A 2WSMA 5TQ0B 4F6CA 2ACWA 3UUWA 5TPZD 3RAGA 4YUAA 3OFNA 3UFBA 5IWAB 1RYDA 4QSMA 2HV9A 5COQA 2QTVB 1JEAA 2DTXA 3FFXA 1V5WA 2E2WA 1XMSA 2YJGA 4QEKA 4JB8A 2QL5A 4M9RA 3W1WA 3ZG6A 1NBOA 1OJLA 2ZYUX 1WCIA 3S5JA 4KE8A 3LX4A 3LBAA 2H2AA 2XX3A 1UODA 2C9ZA 1NE7A 4JL6A 3VOTA 3IYLW 3FNEA 5HRAA 3TGLA 4AJ9A 4R1TA 4C30A 4CQMA 1UBTS 3UC9A 2PCJA 3GCXA 1PJCA 3HP4A 2FV8A 3H3XA 3KFVA 4MS4B 2JI7A 2V5AA 2FPGA 3C4VA 3MXTA 3NEYA 1IVNA 1ZD2P 4MQLA 4NECA 5H83A 4EZEA 4ATNA 3P2JA 4U4AA 2BFBA 3WZMA 1HC7A 2AJ8A 2QRGA 4WN9B 1U28A 1VCOA 5L3SB 4P4NA 3OCCA 2Z1NA 3BK7A 3M6UA 1Q0RA 4GD3Q 4OHKA 4PTLA 1JI0A 4P4TA 4RTNA 1YHNA 2Y6UA 4OFBA 1NN5A 1QAQA 3CLSC 3DMPA 4WUVA 3BMNA 1X1DA 3CIFA 4LWOA 1I2CA 3DTNA 2GCNA 1JH8A 4RKQA 3SYMA 3OFND 4EUSA 3F96A 5I7SA 4GX5A 4EYEA 5EIWA 1ID1A 1VL0A 2BEVB 2Z3ZA 2PLWA 3PPWA 4W5WA 2BT4A 1UXHA 1QJ4A 3KAJA 5A9RA 5JZ9A 2CJYA 4BMYA 3N76A 1H66A 2YRXA 1G19A 4FYIA 2RARA 1Q20A 3I5XA 4HT3B 2ZTUA 1NBEA 3RPEA 4A0QA 2D1SA 2G5TA 1GVNB 3ECCA 4OQDA 3W6PA 1O7JA 1XF1A 2XUFA 3HP7A 1SUWA 1DKMA 2EATA 4IO1A 4ND8A 5F7ZA 4CQMD 4TVSA 1N3BA 1KYIA 2QN1A 2QT0A 1L5WA 1QRDA 2P6OA 1U8FO 4OP1A 1DBSA 1N5IA 4RJTA 5ALJA 4KDFA 2P91A 3KVOA 4ZCSA 4X65B 3HDJA 4G97A 4GI1A 2HJWA 2B0JA 4QTXA 4M8SA 4FHCA 3N75A 3WMFA 2Q46A 3C3AA 3MT8A 2H4FA 2PGNA 3NRCA 8OHMA 1TKCA 1U1CA 2ZTHA 3MNFA 4CW7A 1CE8B 2I9KA 2FSPA 3UK7A 2DPLA 2JC3A 3VVBA 4C01A 4CQNA 3DT8A 3H0CA 4RHUA 1BE6A 3FLAA 1CD5A 1CY6A 3JQPA 3LK6A 3SHVA 4BMZA 4DJ5X 4HQ6A 1K27A 3CIOA 2R6FA 4QTTB 4U9UA 3U2QA 4KP7A 4M1ZA 5KYWB 4OX9Y 3TQRA 3ESQA 4CU5A 5F9HA 1RXEA 3ZPXA 1WB5A 4LZNA 2Q5FA 1WHTB 4PCLA 5DN6D 1U3FA 3RGGA 1O5IA 1O6CA 4LFAB 2ZUFA 2HU7A 4GFDA 1V96A 2HCJB 3L0CA 1J2UA 3WLTA 821PA 2O54A 3IT2A 1R5NA 2FMFA 3FTDA 3GLUA 1CHDA 4K28A 4TTJA 4JI4B 4RHEA 3SG0A 3KSDO 3DFIA 1WO8A 2XNSA 3C7CB 5KNDH 2RH4A 2H1HA 2GF9A 1KMNA 3DO8A 1PZMA 1S01A 3LUJA 3MWEB 3KKLA 1Y5IA 1YRYE 4BQEA 1RXCA 2WFAA 3QBTA 3SE0A 4Y2SA 2HJHA 2XQJA 4ANFA 1V1MA 1KS2A 1T3SA 3SFTA 4CCSA 5KOJB 3BIXA 1WXIA 5E7JA 1XTZA 4P80A 4B34A 2G7ZA 4AIIA 3JVEA 5J2TB 3PIDA 1RMTA 3C3JA 5IZCA 3FETA 5JBNA 1ODLA 2DR0A 3MIIA 1T0JB 2FVXA 2QYHA 1JHYA 4B48A 4DSOA 4DRXB 4ZYWA 2YCLA 1J5EB 4DTCA 4ALLA 1UJ4A 4GQBA 4B09A 4QZVA 5FOWA 3SR0A 2RHCA 3TSWA 2Z3VA 4RACA 1E92A 1Z0IA 3HKBB 1WU8A 2X23A 4Y2VA 1T13A 1UIRA 1Z6PA 3CV3A 1BTOA 3QUBA 5F5XA 2CLLB 4DT1B 4LJRA 1OWOA 1FA9A 2WPDA 3T4XA 3ZHSA 2I54A 1ZBDA 5KHAA 3C7KA 3QIAA 2W90A 4YMTA 4OQLA 5BT8A 1KSFX 3R3YA 4ZGWA 2FPIA 4JDPA 4OL9A 1QANA 1E3WB 2IDKA 3TNFA 3GI1A 3D54D 5EHZA 3BGSA 1R4MA 2FQQA 3FUCA 1NIJA 1H0HA 2Q3MA 1GAJA 3HYRA 3FWYA 4INZA 4AO8A 5HDQA 1JBQA 1JHZA 3A14A 4OQ4A 3H11A 3FNFA 2DERA 4QGAA 5IC4A 4BLUA 2J6IA 1DCFA 3RSFA 2FW0A 3UF0A 4E2FA 2O5EA 4ER7A 4RY0A 3IBFA 5HKKA 4U2EA 2PGAA 3ZLUA 4G0ZA 2GZSA 5TDHA 5IM4A 4EHBA 3H16A 3RJZA 1MG5A 3TXXA 3VO2A 3P9YA 3UMYA 1F3LA 2PT5A 4DDUA 3PLRA 4CV3A 4BRUA 1D5WA 4Y8VA 4BC0A 3G0GA 3DEFA 3A06A 1X9GA 3I04A 4Z7JA 2UXCB 1UFKA 1IFXA 1XRMA 2PL1A 2WPDD 3NUZA 4OA8A 3SZGA 3HR4A 1YACA 3HACA 2CN1A 3UAZA 4A8PA 1PSZA 1E59A 3LPMA 4CIYA 5KNCA 5A0TA 3UAWA 2PUCA 4C5AA 2HH9A 3O3OB 4MKZA 5CIWA 5BV1A 1L3BA 3BHIA 1HLFA 1R6TA 4BBJA 1JA1A 2RGAA 3O92A 5JNSA 2GYVA 1EVZA 5HF9A 1AX9A 3WSWA 3L7AA 1UINA 2G1AA 1YRHA 5AW4A 2Q4RA 2ZIWB 3PNQA 5A9SA 3PS9A 4GYJA 4MP3A 1RQGA 1EVLA 1ECGA 2NZUG 4NYIR 5FL7A 5H82A 1TT5A 3O38A 2NXNA 1YR9A 2FR8C 5E6RA 1NTOA 1T4CA 2JAWA 2WABA 3OZWA 1P3DA 3QW2A 4FI3F 3B1WA 4GH5A 4RVGA 1FXSA 2CNBA 4WINA 4PIPA 1Z0AA 2OECA 4X20B 1SK8A 2OO3A 3R44A 2JFQA 2HSDA 3L7MA 4YS6A 5IASA 2V9CA 3RUEA 2QSZA 1E2GA 3EPHA 3LCRA 1G8FA 4P54A 1I7QB 1E2NA 2XUZA 4DDKA 2DETA 4QXOA 4MUMA 1IDOA 3BRWA 2CHUA 2C3PA 4UHCA 4Q6BA 3NIDB 1Z22A 5FLEX 3WQHA 1GP2A 1KXZA 2C7BA 4A8JA 4URWR 2GEJA 2QW0X 3OMWA 1QTQA 1ADBA 1YFKA 2FFBA 5KNCD 2EC5A 1KU0A 4D74A 3OKCA 3TOCA 2HXYA 4UAVA 3BXFA 4M1SA 4XSVA 5DSTA 4AJ4A 4AROA 1EVKA 4WKGA 1JDTA 4B43A 5BSHA 1KJWA 4IGFA 3LO8A 4L9RA 2AX3A 1RRPA 1KS9A 1PJBA 1CZUA 2WD8A 4QDUA 1SZDA 3SIPA 3MAJA 1CETA 3PNKA 4B4OA 4K6CA 2P9TA 4Q24A 1HDIA 2PPVA 5BOSB 3CZMA 1TJ4A 1YIAA 4GNRA 3VKUA 3K0FB 5HHTA 1ECCA 4DUYB 4WFQA 4WE3A 4QX6A 4C7OA 1QVRA 4QJBA 3DAGA 4QUDA 5BNZA 1U5CA 4GWKA 4FE3A 4HWPA 2B2CA 4F93B 3I0ZA 3KUUA 2RHDA 4LF7B 1KO7A 5K8JB 4LVCA 2CNLA 2ZRQA 2WPNA 1MJFA 3QI2A 4OIMA 3EVDA 4BMCA 3O0DA 1GZDA 2KMLA 3NBYC 4PFJA 5E9JA 5KBYA 4PO8A 3VAYA 1KQOA 3L04A 4CM8B 5B57C 1NQXA 3BRWD 1G9XA 2G4CA 2X2OA 3C1OA 1KXJA 3IERA 4J07A 5AM4A 1E2IA 2AH5A 3FWNA 4OJMX 4DNOA 2J0SA 1S96A 4EPWA 2QJFA 4BWYA 4EL0A 2VZ0A 2VTVA 1Q1QA 3GFVA 4Y2JA 5B58T 4GKVA 5CFMA 3H3FA 2X5KO 3LDUA 3H97A 2DKFA 2H7XA 4JI5B 3ZOKA 2JZCA 5COBA 2YHBA 1XDDA 2F4NA 2BDEA 2F6RA 1R66A 1E9AA 4LJ4A 5JQGB 5REQA 1EFUA 4MDHA 1YVPA 4Z1MD 1KO8A 1YDMA 2XNHA 1OWNA 5EEGA 4B6OA 5J4YA 4RTKA 3GFTA 2VDWA 3I28A 2JNWA 2YQ4A 4O4LB 5YASA 5MDHA 2VXBA 2C2OA 3PDIB 2GNAA 2FWIA 3WICA 4S3MA 5AXAA 5JR3A 3EVBA 3TOVA 3IMEA 3SKYA 3CUYA 5KNDA 1I4EB 4EPYA 5IAGA 1X74A 3S7TA 2XKJE 2ZIZA 2AOWA 1PUXA 1UZNA 1GGVA 1RWVA 1A82A 5I7EA 2V54A 3UIEA 2V7PA 1FYEA 3BL5A 3D3NA 2OFPA 3NOOA 1E9SA 3EY4A 1KMHA 3CKYA 1I6LA 2PJDA 3MILA 5U1PA 1RBMA 3R3HA 1TM3E 5TMEA 3F90A 3LNTA 1P31A 4DCNA 2M9MA 3GAAA 1OX6A 1X1AA 3O84A 5E38A 3PD7A 5E7QA 3GU3A 3LLVA 1RPJA 2B4KA 5F2EA 5GJBA 1EUDB 1G5FA 5DGIA 1KI4A 1BHSA 3FPSA 2EKQA 2QTLA 4HDNA 4TTVA 1ACJA 2B3TA 4O2BB 1S6YA 1AQ6A 4DXDA 4TKUA 4LW8A 2WAAA 4OLFA 1SXQA 3IC5A 2QVZX 3F4KA 5B7PA 5AK5A 3U09A 1O5TA 2ZVQX 5AVQA 4D82A 1EK1A 3GFFA 5KNDD 1P8JA 2WLTA 1T2UA 4B2YA 3PHHA 4WFIA 5FF9A 3VR3A 4AS2A 3VYUB 2QLLA 5A5GA 2OK7A 1RDFA 2PGLA 5EQJB 1DX9A 1GFSA 4JEIA 1G2OA 1MHTA 5IN5A 1Q0HA 3K1TA 3EVGA 3H5VA 4HNUA 1FP1D 3KFLA 1HE5A 4ND1A 2CDNA 1EM8A 3VYSB 3WK9A 1Z0UA 1XTBA 3L3BA 4WY8A 2HBYA 1A5AB 2WE8A 4BFCA 4TYYA 3S70A 4IUYA 3V8QA 3HUFA 4IMJB 4PF1A 2CLKB 1X70A 2Z5LA 4TXNA 4QTYA 5KB3A 1BH6A 1W48A 2C00A 1AS3A 4NZ9A 2JATA 1TW2A 3OX1A 3R7NA 5BQ5A 3OLZA 2EXXA 4ESOA 1H4VB 5FBLB 3AJEA 2H2WA 2DY1A 4W1PA 3A6FA 3HJRA 2ZYWX 1F0PA 2C2BA 3CUWA 4JI0B 2VJAA 2BPOA 1O57A 2PSJA 2NM0A 4Q3DA 5JG7A 4M87A 2H0AA 4HDAA 1L4BA 3JD1A 2V9ZA 2VK1A 4PG5A 2ZIUB 1B8VA 5AW1A 3JPWA 4YFYA 3AB8A 4Q1AA 4QOSA 1XX6A 3TZBA 3W5JA 4BO2A 2PUTA 2HSZA 3QV1A 2IIBA 3Q12A 3ZJTA 1KZGB 3OOHA 1X9IA 5LCXA 1UKBA 3EGIA 3WAKA 1K0FA 3I05A 1C9NA 4AZ0A 3M5PA 2UUBB 2O8CB 2YV4A 5LIRA 3M2TA 1WSWA 4GKAA 3T1HB 3PUZA 1FFHA 3NHFA 1U0LA 5AT1A 5EA2A 4N3AA 2W58A 3STUA 2WT9A 2BTEA 5DWQA 4FFLA 4MWSA 5KYXA 4I14A 3JYHA 5CUQA 3TNYA 3THSA 3QXGA 5LZ9A 2OTCA 3KETA 1X7ZB 3ZXIA 4YMVA 4WN3A 4OHUA 2D5CA 1N78A 1PQYA 1IH8A 4MQ5A 4JJEA 1MBZA 4OHCA 3ISVA 5E4JA 4DW8A 4R1UA 1CIVA 2GDJA 2P9EA 2PVSA 2Y76A 4U0JA 4M7RA 5H9VA 2QMOA 1KK3A 3UMRA 3UGQA 2R9VA 3MWDB 2JD0A 4W1SA 2AUTA 4Y6GB 3O9MA 3WMRA 1WMEA 3X2FA 5JS8A 5ALTA 1CEQA 2FZEA 3K6RA 4AT1A 1AQYA 2CVZA 4Q93A 4HDKA 4Z9YA 3O4RA 4E08A 1FYFA 4OREX 4B5LA 4RCZA 2IBTA 4HFNA 2XTMA 4NZOA 4ERXA 1HQYE 1P2VA 1Z2AA 3ZDXB 3VPAA 4C4AA 2QNBA 4WI1A 7YASA 2PL5A 1X1CA 4BNXA 4P22A 5CCDA 4QGGA 1MORA 1OV6A 2HWXA 1N7JA 5KYYB 1C7JA 4GR9A 2E1RA 3IP3A 1P45A 5AVXA 1PT9A 1NBME 1LLFA 3M6MD 1LPBB 4RC9A 3FPLA 4YASA 3SICE 1SKUA 1AF7A 1G8SA 2P0YA 5FP0A 4TXMA 3VJKA 4XRRA 3GFBA 1WMBA 4RZUA 3B5IA 4Q1DA 1NHWA 1E0SA 1YAJA 2AOUA 1L5SA 3ENZA 4W6QA 5CURA 5DXFA 5LSAA 3LQYA 3P4XA 1BMQA 1QFZA 2ZIGA 3N74A 1P7VA 3HGMA 2X0IA 4KYTA 2CSUA 3CR7A 4ZOEA 3RRFA 3MMNA 2VAPA 4R2XA 4EFLA 4O5OA 2A14A 2R84A 4BKOA 2IXEA 1Q74A 1Q92A 3EVCA 3FX2A 4UEKA 3I2KA 2FXIA 1QUEA 4IR7A 1G60A 4PQYA 4CFSA 2MMGA 1BIFA 4PLYA 2DSNA 1BVYF 1TIPA 4JVOA 5DASA 2WHYA 1HF3A 3A9RA 4X6UA 1MP0A 4MRVA 3RANA 5DIZA 3WADA 1AGXA 4C0JA 1SVIA 5KNBH 1BXGB 3JYLA 3FE2A 4F6RA 4OM7A 4M0EA 1M6WA 1TRKA 5CA1F 1EXWA 1P2SA 1DFIA 2B2XA 2P2LA 1GGJA 1PJQA 1S8NA 3IAUA 2QV0A 1T9GR 4L22A 2ZTMA 4Q7MB 4HZGA 2IV3A 4WY2A 1NY5A 3Q72A 4BBZA 3GB9A 3A1WA 4LC0A 4MGEA 5ERGB 3HZRA 3Q0IA 4R3NA 3INGA 2QOEA 5HILA 3J7TA 4LRSB 2V7XA 2GZRA 5DXJA 3M3PA 4BGUA 3E1KA 4Q7QA 4UHFA 4IUCS 4PW0A 1N5JA 4I1IA 3SC2A 5DCWA 5IJXA 3RUPA 2C2MA 2QL7A 2X9NA 2ZWIA 3DVSX 1RJWA 2IX3A 4Y1GA 4KMOA 1U7PA 3MGCA 4XYGA 2D00A 5E8RA 2VZEA 1VKHA 1E3LA 2P65A 3QNWA 3GNTA 1F7UA 1SB9A 3KL2A 4QYMA 2DBVO 1QC5A 4OF4A 2QPLA 2JJ8A 2ID8A 4KPGA 4YAJA 3C7AA 4NYMR 2VNSA 1KSJA 1S2LA 4CNQA 3QM1A 1GNRA 4HWOA 3CH4B 2C83A 3B2NA 1OVGA 1XA4A 2G40A 4QE3A 4QEZA 3GPDG 1F6DA 3J7AC 2SICE 2YHAA 4PRYA 3H6HA 4ZANA 1N2ZA 1SKAA 1ZINA 2ATEA 3H5NA 3VKWA 4EMTA 1XT6A 4URVR 4BJ3A 2M6RA 3PXUA 5TIIA 1G21B 1H4QA 4YVFA 1XZQA 4YMUA 3CLTC 2ZG6A 2H0RA 3AV3A 4NABA 3JQEA 2GWHA 2GBLC 4KITB 4AMVA 1Y1RA 3H5TA 2HEGA 1K6MA 3AR7A 2Q5HA 4M0CA 4U6QA 5EUCA 4F2PA 1WZEA 4RJIA 3B9BA 2VWQA 4HH4A 1E66A 1W4BA 1MB9A 2FRDC 1YXMA 2EKZA 2QP4A 2YY6A 4WH0A 4B0OA 2EJUA 4RW0A 5GQSA 3TW8B 5H1YA 2Y0CA 3HVKA 3VUEA 1KAQA 1E9CA 1OLXB 2NZ2A 1GA6A 1FSFA 5ARCA 2QVGA 4DJTA 5JANA 3A4MA 2QZZA 4DA8A 4KBYA 1VKRA 2Y1GA 2NU9B 4D4IA 1CQJA 3UHPA 3ILXA 1PE0A 1T8PA 3IXMA 2G9ZA 1QIDA 2Q21A 2RGNC 4MW2A 1SRRA 3V1YA 3X43A 2R5WA 4GP7A 1EFKA 3W4KA 3ZZ0A 5JAPA 4KPYA 4M1QA 4LNUA 1M9NA 2ZIXB 4UCQA 5IK2A 3VH1A 1BKSB 5JMTA 1L1QA 2DBQA 3L7JA 4K9KA 1N6PA 2X2PA 1RXIA 4M22A 4QQRA 1MH9A 2A9VA 3REQA 2XITA 3K35A 2OWEA 3L6OO 3UA3A 2OP1A 3SZMA 3AY0A 1DJPA 3T4EA 3OOSA 1ZEJA 3KHSA 3ZBUA 1RT9A 1GU0A 3JQAB 1IEWA 1XRSB 5KJ6A 1Y5RA 2WTEA 3EIWA 3OM0A 4PIMA 4UNRA 5AW8A 1E3DA 1QUFA 4GOND 2CBXA 4M8KA 2EFGA 4I8DA 5FDFA 4MAFA 2ODWA 2XLCA 1DEAA 2P2DA 1WW3A 4CV0A 7GPBA 1WPXA 3IAFA 4P1ZA 2GZMA 3PVSA 4D3ZA 2IBSA 1Z28A 4QBFA 1JB1A 3EXHB 4XAQA 4LK2A 4TYMA 4MA0A 1C2TA 1H2XA 1SUFA 2OT3B 3NVDA 4Z4CA 2YX1A 3CNEA 4X8HA 5DPMA 5JNTA 4IVNA 1BN6A 3CCCA 1KZHA 1Z82A 1S2OA 1ZRNA 2HB6A 3RAPR 3I37X 4D45A 4H6PA 4ZI2A 1UFVA 3QVOA 3E9DA 2I6UA 1NUTA 3NM6B 2J0UA 1TVMA 1C4OA 1JXMA 2G36A 3DWFA 1QH1A 1FNBA 4JEUA 5ADWA 1T9BA 4S1TA 2FSGA 4FCVA 4ID9A 1YNSA 1OXVA 4WBNF 3LX5A 2JBWA 5ICSA 5KTTA 2AG5A 3MCAA 5BNWA 5EE5B 1B6TA 1U0BB 4U8HA 2C4VA 1DCTA 3KHKA 4J7CA 1KI6B 4A0FA 1R2QA 2Y3IA 3IKLA 3M9LA 4A27A 5BP7A 3OHMA 4R8RA 1CK4A 2IXTA 4IIXA 3VYRB 3ICQB 1JIQA 2DLDA 3WRXA 3HXOA 3MG9A 3KZMA 1TEVA 3AU9A 3P8ZA 3W8NA 1NN0A 2DT8A 1IM8A 1ND5A 1N4AA 1SXJC 2ADMA 1U8ZA 3Q3EA 4PX9A 4ASUA 4EJMA 3PXDA 3A4NA 5CCEA 4MMZB 5CA1A 1XAIA 3ZWOA 1Z37A 1MOSA 1PJ3A 1XDBA 3LWZA 5KWEA 3EGDA 1YMUA 3F4BA 2UU9B 3DKIA 2QJWA 1E7SA 4OXQA 2E5FA 3AY7A 4R8KA 2FDXA 2O1EA 3DNPA 4N01A 4QBHA 5BR1A 2W2XA 2YJ4A 5KYUA 3JARB 3R6WA 5KINB 3QK7A 3B9RA 3G9XA 4A6PA 3WFJA 3ZJVA 1NXPA 1VCNA 2OXCA 1CHNA 4J9VA 5DM60 2WQZA 2PBRA 1ADGA 1LX6A 1W6RA 4LHYA 1MDBA 2PWBA 5EKTA 1SUCA 2MDTA 3OICA 1OX4A 4KXLA 5DF1A 4ARZA 5LZ4A 3R3ZA 1VL6A 1SQ6A 1JQEA 1EYZA 4GM1A 3RC9A 3ZQKA 3SM3A 3K31A 2V59A 1SVWA 3PFNA 4X24A 3D6UA 4C2UA 5KX5B 8AT1A 1Y4SA 1AKNA 1YI8A 3D0RA 4MB0A 3GRPA 2BLNA 2AZMA 1NFRA 1VPDA 2JFBA 1PG5A 1G55A 4JY7A 4BP3A 1Y8AA 3GFRA 3RC3A 1NTRA 2Y4NA 3G88A 4JKIA 2BI7A 1B8UA 4XYBA 4YUWA 2VI5A 4NPHA 1LBQA 5AYVA 5H8WA 4FYJA 4TMFA 4ASUD 1AB5A 1D3AA 1S2GA 1JKMA 4YAKA 1W35A 2COKA 2R8RA 3F9RA 3R5SA 2BMAA 5KOJA 3VR1A 1X80B 4AF7A 1E61A 1ZVQA 1LTHR 3ETEA 3LD9A 4MVWA 2DX7A 1R8XA 4UDOA 4AIRA 3A11A 3ZXXA 2NYRA 3WA7A 1NXTA 5E9QA 4FFVA 5C1OA 3P2MA 5LOVF 4JELA 1G8JA 3NLLA 3WYAA 4Q3EA 2BGUA 2BFOA 1XTPA 4IXDA 2GM4A 1GUYA 3L8GA 3O8DA 5HJ2A 2CXXA 1VGQA 2WB2A 1P0FA 3BTVA 2GOYA 3JASA 4L4ZA 2YFKA 4X1KA 1VKZA 2VWPA 4B3HA 4WVFA 3A70A 4C4ZA 3EGEA 1CULC 1F4PA 1G8GA 3QWAA 3WAJA 4MS3A 5KC8A 1LJLA 2LR0A 1EX9A 2JFGA 3CH5A 3ZOZA 3OZDA 4TWBA 1C3EA 1D4FA 5BN4A 2FR1A 3T7CA 3K9CA 5FBVB 1SQ5A 5JC8A 1PGQA 4F4FA 3RBZA 3UQYS 4HNTA 1V8DA 1BVHA 3ZCQA 3CA8A 4X8MA 5E0OA 5IT9A 1XXHA 1ZUNA 4GS5A 1L7RA 4JITA 1AT1A 3DB2A 1ZNWA 3FUWA 2IPAB 3C6BA 3QUCA 4ZJYA 4FFSA 2Z2JA 5L51A 2WVHA 3FOCA 1PWEA 2R00A 4FNAA 4JBYA 4LJ8A 1BXZA 4PQFA 4LTMA 4DIKA 4J29A 5JH7F 2ESRA 3DMTC 3H8SA 4L6AA 2H7VA 2IFTA 2QTMA 2H65A 2K5UA 1P6QA 3NHJA 3ZWPA 4NS1A 2PWAA 2GASA 5LP6B 1W2WB 4IMPA 2IRWA 5T64A 3IBGA 2F3UA 5AUOB 4LHSA 1FFXB 3M9WA 1H2ZA 1WMAA 4ZQHA 2P7IA 4C7JA 5DGHA 4K6GA 2HQSA 2OM6A 5F73A 4O4JF 3TMKA 4LFCB 4I9UA 4BFSA 3KE9A 4J3JA 2GHQA 3UK6A 3IALA 3LFHA 5U9CA 3R76A 2KBFA 4CTNA 3MJTA 4E12A 5F2NA 721PA 4K9SA 4ZCMA 2DJIA 4QA9A 3G1WA 4CDMA 1VB3A 4HB4A 3OUUA 5DNYB 3EZ7A 1BEEA 4WBNA 2AD1A 1TVKA 5CU7A 2Z8ZA 4DMFA 2YINC 5CD9A 1OT5A 1AQNA 4BXOA 2BP7B 2GCIA 2XVAA 4QXMA 3WV4A 3STHA 4XX0B 3UBTA 1GA4A 3STXA 1KBZA 3IPCA 3TOSA 3UMFA 4D8WA 4PZEA 2X77A 1ZWLA 4PICA 4IEFB 4B2IA 3LTEA 3GFOA 4RY9A 1EXVA 3MINB 4L6IA 2J5XA 1J2EA 1E8MA 1LS6A 3CTMA 4U2FA 1CQPA 4BNMA 4YRIA 5K9ZA 3HCFA 4ZT4A 3T3IA 2VDPB 3STTA 3ACDA 4EB0A 3R20A 2EU8A 2FMKA 3ZGZA 3KE8A 1J2TA 5DNUA 2DUMA 4NCBA 3G9TA 2NUAB 5HOQA 2ZM6B 1XTTA 4D80A 1KI3A 1X7DA 2AYZA 3HY4A 4RS4A 5EIBC 1HORA 3K70B 4FBLA 2IE0A 4I4TB 1VLMA 2IEYA 4N7RA 4X7MA 4WK0B 3L7KA 1E1LA 1LW7A 3D3KA 5DSZA 3WMXA 3RR2A 4XGQA 3B7GA 4DV3B 3K4QA 2V58A 3HL0A 2CHEA 4UVEA 1BOFA 4OI0A 2R60A 4ZVRA 3JYPA 5FHQA 4JLSA 1Y3BE 2EP5A 4BZXA 4EVRA 2P75A 2QSYA 4WADA 5ITZB 2ANBA 5EINA 2HJVA 1KNQA 5K0JA 4AJ1A 2RHTA 3NT2A 3ODPA 2Z5GA 2ZB8A 4UTZA 5HMLA 3T61A 4C4XA 3QWBA 3U4QB 3M6LA 3FPCA 4NBNA 3FDXA 2QGZA 4UUMA 1R12A 5IMSA 4G9EA 1SFRA 1TF5A 2FKAA 3EISA 4LZOA 2Y1EA 1H2WA 1SR8A 2QMHA 5E1MA 1CJUC 2NQ8A 2NZYA 4HDCA 5KCZA 2FPKA 4ZD6A 4QC2A 1WUJS 3TLGA 1YGPA 2JAOA 4ZAVA 1N2EA 2HHJA 3TPZA 4JJ7A 2PR2A 1NSYA 3HJAA 1BDIA 4JC0A 3M6IA 5I6DA 3OQOA 6PFKA 1GL7A 1IL0A 4EPRA 4IDFA 1ZNZA 3PNSA 3O4HA 2JI4A 2QD4A 2XCUA 5J5AA 3VFDA 1X7YA 1D8TA 5J40A 3WLQA 4XB1A 4IKPA 1O97C 1F8XA 1NXQA 1E6KA 2CLDX 3OD1A 4P3KA 4M1MA 1E2EA 1YD7A 3ZE8A 4NTZA 3RVDA 5LKRA 3E35A 5EXEA 1IMJA 1CB0A 3SNHA 5FI5A 1G17A 3HDGA 1JLLB 2QP3A 1ULAA 5B12A 3BQNB 2VNKA 1Z36A 3FFBA 3DQPA 2G70A 2HZBA 2X19A 1R50A 4J1TC 4M89A 3AVUA 3R8FA 1I36A 1S2DA 4KB5A 3A9UA 1WUYA 3BF7A 1NKSA 5LBTA 4EA8A 4MV4A 1PCXA 2VYNA 1CF2O 1TZKA 3LOPA 4G1CA 2YIMA 4GZ3A 4P4GA 4EW2A 2JHAA 2XTNA 3L7BA 1AZWA 2LCQA 1VPWA 3QPUA 2D74A 3DO6A 1LJUA 4CIXA 2EG9A 2F3RA 2OB2A 4ZEOA 3GJSA 1IN7A 2MSKA 1SCDA 1O0BA 2GVNA 4IGAA 1YK1A 4GLBA 1ZUWA 1YMQA 5F78A 2XYHA 421PA 5C37A 4H16A 3AP1A 3P71T 3GLGE 1E99A 5CTAA 4EGCB 4F4JA 4HAIA 4GQIA 3FVQA 4ZEMA 1SXHA 3JS5A 1J8FA 3H9EO 4B81A 1DTWA 1FFCA 2D7CA 1HETA 4KAJA 1T15A 2H4ZA 5JEDA 3INYA 3J80A 5IUKC 3KNZA 1IMOA 4M7OA 4PVCA 4R2WA 3KS9A 1QGUB 1YV9A 5HRCA 3CVYA 4AKIA 1AUXA 2FOXA 1SH7A 3N2KB 3KR1A 5H16A 4CMHA 4LSMA 5BT9A 2WVGA 4CUZA 4B3GA 4O4JA 3ROGA 1N2SA 5LNK1 3HXKA 2VYND 1QP8A 3JQGB 3QPWA 4W5JA 4LDNA 5J4VA 1LPPA 1Z4QA 2GJKA 5ALFA 4WZ6A 5AM0A 1JEQA 1W8IA 1T5LA 3AG6A 1BE1A 2C20A 1AHIA 3JZFA 2A0WA 1HL7A 3AJ8A 2PANA 5LZ2A 2I3ZA 1FUUA 3I1FA 1FYWA 4DMGA 3G0IA 2VP3A 3IBSA 1NFQA 1RQRA 2HMWA 3JWIA 3M1IA 4GSKA 1PJSA 1N7IA 4ILEA 4MJ7A 4EEZA 1JR3E 3DEKA 3ETLA 4IYRA 4XOUA 2R3SA 1BGWA 3NGLA 2R1UA 1OFHA 4JA2A 5CAEB 3DFMA 3WHKA 3PFKA 2G83A 4X54A 3EQZA 1EWQA 4BNKA 3U5TA 3IESA 3RAJA 3D9QX 2FSFA 3BMOB 4Q4AA 1JHPA 3GEMA 4E07A 2PQ2A 1XD9A 3RNLA 2PRKA 1K9VF 1DMSA 2BM9A 4MA5A 2ZCUA 3SLKA 1R5BA 4J0QA 3UXYA 2PR7A 1FDUA 5TY0A 3WRWA 4CIVA 3CNLA 3DVLA 1NNLA 1H2AS 2IIQA 2WJ3A 2NTEA 2XGSA 2NQ2C 3Q85A 5EE1A 2IHTA 4DR1B 3NAMA 3ZNQA 3WV5A 4AG5A 3LKZA 5CEFA 1RE0A 1U5BA 5IVHA 5TT0A 4KXWA 5IVKA 2GTPA 5K09A 3ZBTA 1THGA 4B6EA 4X84A 2KLBA 3RS2A 3D64A 4CMAA 3BFXA 4UU8A 2REXB 3FHJA 4DIEA 4U1RA 1YZQA 2XBUA 4JLNA 3DCYA 4KAAA 3T95A 4WXEA 4CV1A 3AF6A 1QBKC 1L9XA 4RIIA 3OFKA 2NTVA 1Z17A 3DV0B 2J3DA 1FVXA 3LT1A 3I2HA 3TN7A 4AN0A 1LNSA 4P98A 1NUUA 2A9RA 3SI7A 3X1ZA 1M76A 3I5UA 4RY2A 4Q82A 2A9FA 4DLBA 2IV2X 2RGDA 5TGZA 4CMBA 1YBMA 4CI9A 3RHTA 2VCHA 4GE0A 1O0CA 1Z6YA 1U2DC 2EQ5A 3CKMA 2L69A 3AEKA 5FCDA 1FX0B 1W1UA 1KZ7B 4HXYA 4I1SA 2FOIA 2YXDA 4KSBA 5T8KA 4PPQA 4MUIA 4QOGA 5LVAA 4O5AA 1WPQA 4ZGBA 1QVAA 3FOAA 3GLGA 2W0MA 1BMFA 1MUUA 5TF4A 2AUNA 1I8TA 1V1RB 2B98A 3GEPA 3KXKA 4LUCA 5JVDB 1BFDA 5FKJA 4Q19A 2W00A 3WJ1A 4PLGA 3EA5A 3MUOA 4UCFA 1K6XA 4K6KA 4WLEA 5EP3A 4D02A 5A3SA 3UG6A 4EOGA 2R48A 4E13A 1Z63A 4M54A 1ORWA 4RFSA 5DX0A 3KSMA 4LYFA 3L5OA 4HHEA 2Q3DA 1USGA 4CMCA 3KEOA 1WHSB 3MOGA 2VHJA 1FDWA 3RSQA 1Y81A 4II3A 4URHA 5HCNA 4FGKA 4WLVA 1E3QA 2B4TO 4YO7A 1DLIA 1RI5A 4M9UA 4PWZA 4Q4HA 1QO9A 2GZAA 3BH0A 4C4OA 1B3RA 3CRNA 4L95C 1NYRA 1DBRA 1FSSA 3HDQA 3TBHA 4A2WA 4BNUA 3U44B 2PTGA 3NTVA 4I55B 5JCJD 2D7DA 3R5KA 1O8BA 4UU1A 3MGGA 1NUHA 4RH1A 1DI0A 1G64A 1P18A 2QUJA 1PYOA 3VAAA 1MIOB 1C7QA 2MINB 2X0JA 1JR3A 2FA9A 2ASEA 3FVRA 4B40A 5AI4A 3SOZA 4DB2A 2PS3A 1BMFD 3ESXA 3EXEB 1ZVMA 2FEXA 1J00A 4RKWA 3RYFB 3OTHA 3EXIA 3A6JA 4P4SA 1G7RA 1GQ2A 2H06A 3OT1A 4FR5A 4OAPA 1OJ7A 4YJHA 3DDSA 4ZDWA 3SNKA 1SN7A 4UAJA 3SLRA 1XZDA 3TTXA 4ZAFA 3BGWA 2IUUA 1F4LA 2OOKA 4FZRA 5JWOA 2WIJA 2IY9A 1TA9A 2B8JA 3D5EA 3U40A 2GO7A 4JL5A 4P3XA 3WG9A 3BD9A 1D04A 4CCYB 3G59A 1OKKA 5HP4A 4NFYA 4TLDA 2E4UA 4MAAA 4Q9IA 4H0FA 3H1AA 3BWXA 4N3CA 2DR2A 1U0EA 3SC6A 4BNJA 2Q3BA 2PRJA 4FLEA 4LI3X 3H18A 2A59A 5JSFA 2KBEA 3FROA 1IHDA 1WXQA 4N48A 4BKQA 4B6SA 4LVOA 2CFIA 2QKYA 3BFKA 4O8ZA 5E1DA 1NVAA 1Z47A 3SS8A 3ZKAA 3ZIAA 5CEJA 5LLDA 2XRMA 2JLYA 4ZRMA 4ZOAA 4NVRA 1MOZA 4M0KA 5JE8A 2W6PA 1RTKA 1YQXA 1ZK1A 2BSAA 1A8QA 2ZR8A 1Z6GA 5FNVB 5U4QA 5ICGA 3AFMA 2IH4A 3GJYA 4ESVA 2JAQA 2MJLA 2H1SA 4L72A 3SZLA 4CIWA 4XM0A 1MEEA 1UC5B 1WXGA 3DL2A 2QXTA 4BLTA 2XZOA 4Y2YA 1AKEA 2UZ3A 3I6BA 2H3EA 4H4CA 5I9TA 3HO1A 1GPJA 3SDBA 1RVV1 5JS7A 1RKBA 2CLSA 4P92A 2GPAA 3U7HB 2RSLA 1OH6A 2J5KA 1PJZA 3DMGA 1H2RS 4DANA 2YNMA 3N8GA 3VPHA 1ZFNA 1ABBA 3A26A 4W7IA 4MKHA 4ZAGA 3TE7A 4C9BA 2W0SA 1LDMA 1ES9A 2QY9A 4MVJG 1TI7A 5ADHA 2TMYA 1O89A 2MSWA 4FFWA 3L7DA 3I4LA 4FSHA 3IFSA 2JI6A 3FPAA 4IS3A 4ZI5A 3OJFA 3S0JA 3TR6A 4ZN6A 2BGKA 3PE3A 2O4CA 3E7DA 3QEMB 4PFSA 4C5CA 3K6SB 2PUJA 3ZQ6A 3AL0C 2GQ0A 1YJQA 2BAGA 2W6ID 4I4LA 4A2PA 1IHPA 1MT3A 4RZQA 1GUDA 2MCFA 3C15C 3FKJA 3IAHA 2HF7A 2OLJA 4EKDA 4DIBA 3JQFA 1YE3A 4F21A 4Q3LA 2PRYA 5KU7A 3S2IA 4OAQA 5EVCA 3TRHA 3OCXA 4LOJA 1P91A 2ZS7A 3TGPA 2H0QA 3RS3A 4MUKA 4C14A 5KVAA 1B6GA 1BCSB 1FFAA 3ABOB 3GCWA 4YK7A 3WWCA 4YUXA 3BSSA 2RD2A 2NP7A 4B3BA 4L7VA 2WKWA 4D9IA 2B8WA 5EL0A 1QE5A 1P5RA 2F9LA 4CTMA 4MQFA 3WQSB 1VLQA 2YNMD 1DAEA 2ZZMA 1JLRA 1GZHB 1PNOA 1YRAA 4XSGA 1CJKC 3PPIA 1SCKA 1M2KA 4CLOB 1DWQA 4L8LA 3VR6H 2PT6A 1R9MA 2QBYA 3U4DA 5HYVA 2CLIB 3KDSE 4B6JA 3DMDA 3PDCA 3HFRA 1HSOA 2QX4A 1KVRA 3AEUA 2WU1A 1U1EA 4HFJA 3ILHA 1VYUA 4OOFA 4BZZA 1D2EA 4KZPA 2ATXA 1Q7BA 3FHLA 2C42A 2OXEA 5HR5A 5CX1A 4J0DA 3RAEC 5LMNB 1DAIA 4Y0VA 5DWDA 1PFQA 4GDFA 1MC8A 3L7CA 5K03A 3BSWA 3M0EA 5C51B 1ZA2A 2NXWA 4TKZA 3HKDA 1SHLA 2Q1YA 4NS4A 4R4JA 1V8ZA 1TAUA 3LQKA 4CE6A 5ALMA 1SXPA 3BXGA 3VC2A 1WQ3A 4LFBB 3W4IA 5JDIA 2OQIA 4F8JA 3QLVA 5JU6A 3P0FA 2JCXA 4LISA 5F12A 1Z5VA 2RCYA 1FFWA 4LRQA 5IN4A 5DX1A 2EP8A 2D54A 4QGFA 1Z45A 3I45A 3O31A 4N6GA 5FQOA 4DIMA 2F48A 3W5VA 3AVTA 2R6JA 2R11A 4MUHA 4OJYA 2I67A 3D2LA 2GUGA 2IA5A 5BXQC 1TM4E 4GL4A 1L5ZA 3GDHA 2AYYA 3ORRA 1SQGA 2RAUA 4X94A 3ZNOA 3KP1A 4YV0A 3AVXA 1GTG1 1SZPA 1XK7A 3KJZA 4QQKA 1C0EA 2GSDA 1YE5A 4LF6B 4PXAA 4ZZ0A 4L5JA 5EWMB 1YL7A 1NPYA 3A1NA 4FOSA 3TLXA 5BRNA 2PNJA 4NQZA 4CHGA 4EY8A 4M0MA 4C6RA 4D8UA 5JAQA 3JVUA 3BWCA 1RVDA 5K0EA 1VJTA 1DBIA 3PP8A 3EB9A 4P3PA 4IIBA 2P1DA 1NJGA 1H0KA 1KJIA 1NP6A 1PD1A 5CT6A 3NNDA 5CYFA 5KDLA 4CKWB 5JJIA 3FMIA 1AGPA 4WZBE 4LC9A 1JJAA 4D2IA 1Q22A 4XD2A 5ALDA 4F3CA 2RI6A 2WKSA 4FHZA 5JWHA 3LIIA 4EUNA 3IHLA 4II7A 4AMUA 3O3NB 4DG9A 4FYMA 2HTFA 3HY3A 4QBTA 3CBQA 2ZTVA 3VJMA 3U7GA 2BW0A 3WGNA 2WAOA 2ZGVA 3BMCB 4M37A 4D4JA 1OMOA 3X1XA 5BVHB 2C4MA 1XRRA 4ZXPA 5TS2A 4Q4CA 1EGAA 1KYVA 2G4LA 3F71A 3HDYA 3LUGA 4Y67A 1QNLA 2PS0A 3ZKWB 1ENYA 2I4TA 5A3VA 3DLHA 2J4CA 3QVWA 1S02A 1QP0A 4CHTA 2PQ6A 1PFVA 1OXKB 1ORVA 3BE8A 4JOSA 2R7KA 2CXRA 3H19A 3GMSA 3LQQA 2B37A 4M9ZA 5CMLA 5FHRA 3U13A 4AJ2A 1XNRB 5CW1A 3TTSA 4B3JA 2R1VB 3K5PA 4R5HA 3UV3A 4JFAA 1U28C 1QIMA 2HEIA 4N47A 3FOZA 4Y2XA 3DBRA 3DMFA 3SXUA 2HDHA 3R9XA 3MA0A 4YCMA 1GLVA 3INRA 1H69A 3PHLA 4EG7A 2R65A 2DHDA 1IJFA 2VBGA 1PT5A 1S8AA 4HWGA 2VF8A 4OXYA 3HL4A 1NL3A 3KTOA 3OIGA 3CJQA 5FOVA 4QJ5A 3WWPA 2Z56A 4LX0A 1ESZA 2XI4A 1LLQA 4GC5A 1YUNA 2VSFA 1ONOA 2K6GA 3NOQA 4FTWA 4J7AA 4MS1A 2D4AA 5CHEA 4C0HA 2PSDA 5K4HA 2O05A 4FD3A 5EZYB 1AZSC 3JQ9C 1HEUA 1NQWA 2PBZA 4U0KA 4IIJF 1OH5A 1MO3A 3T1TA 1JE0A 1IZZA 3DXZA 5K6AA 1IY9A 4EHNA 2D5LA 3MAGA 3B1ZA 1WXEA 4UXIA 3RVJA 4BV9A 3ZGYA 1YOVB 5C1DA 4YYZA 2H4WA 5FTKA 2LE0A 3SKVA 4XWTA 5FA6A 3C98A 2A5JA 2DFVA 2WKRA 1ZOIA 3AR5A 3GT4A 3HJCA