4ICIA

Crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
b'NSKILVAYFSATGTTARAAEKLGAAVGGDLYPIAPAQPYTSADLDWNNKRSRSSVEMNDPKMRPAIKSKKENIGTYDVVFIGYPIWWDLAPRIINTFIEGHSLKGKTVVPFATSGGSSIGNSATVLKKTYPDLNWKEGRLLNRTDEKAIRAWLDVIAVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative flavoprotein
publication title Crystal structure of a putative flavoprotein (BACEGG_01620) from Bacteroides eggerthii DSM 20697 at 1.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Flavoprotein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iciA00
3K20A 2BN4A 1ZX1A 4FX2A 3NHLA 4ZVKA 3NHKA 5EMNA 4DIKA 1FVXA 2MWMA 4QOIA 2V5UA 4C14A 2QWXA 4C0WA 1AKQA 3L9WA 4FGKA 3OX3A 2FDXA 4FGLA 4N9QA 1XYVA 1ZWKA 4ZVNA 5F51A 1FUEA 1YOBA 4J8PA 3NLLA 1KBQA 3HA2A 2BF4A 4QOGA 1V4BA 3U7RA 1BU5A 1CZHA 1C7EA 1CZLA 5EA2A 3R6WA 3KEGA 2HNAA 2OYSA 3OVMA 3TZBA 2XODA 2FX2A 1T0IA 2FCRA 3LCMA 4DILA 2BZSA 1RLIA 4S24A 3GFRA 3QFCA 5LJLA 2R97A 2BMVA 3FJOA 4DY4A 1VMEA 1XI2A 1CZNA 3OWXA 4Y9UA 3TEMA 2FLVA 3NFRA 5NLLA 1OBVA 3W77A 2V5VA 2OHJA 1AKRA 5LMCA 4YAOA 3N39C 1TIKA 1CZRA 1YDGA 4BMOB 1J8QA 3FNIA 4NULA 5LBTA 2QMYA 1AHNA 4CETA 2WC1A 1YCGA 4QOJA 1D04A 1QR2A 2M6SA 4GI5A 1B1CA 5LLDA 1GG5A 3RPEA 4C76A 1BVYF 1QRDA 3O2NA 2V9CA 1AKTA 3GFSA 2Z9BA 5A4KA 2Q62A 3ZHOA 5LBUA 4YAUA 4N82A 2MOKA 1YKGA 4QOHA 2QX6A 1AG9A 1J9GA 3ESYA 3TE7A 4YAFA 3EYWA 2ARKA 4U7FA 3NHUA 2ZKIA 3NHFA 4YALA 2AMJA 5LJIA 3O73A 3ESZA 2FZVA 1H66A 2OHIA 4ZVLA 1AKWA 4OXXA 1JA1A 1DX9A 4C0XA 4FGJA 2F1OA 1DXQA 3KAPA 4H6PA 4LAFA 3N3BC 3N3AC 3QE2A 3OX1A 5F4BA 3UXHA 1D03A 2HPVA 1OFVA 2MT9A 4PU0A 3G5MA 4LA4A 2X2PA 4U7GA 1XT6A 3B6MA 5TGZA 4M0CA 1AMOA 4LTMA 4CF6A 3KLBA 4ICIA 3B6JA 1FX1A 3FX2A 3OJXA 6NULA 4H2DA 3NHJA 1YRHA 4U7HA 3JSXA 1CZKA 2BPOA 1FLAA 1J9EA 5BUCA 1RCFA 2XOEA 3NHRA 2FZ5A 3NHPA 3P0RA 4Y7CA 5FUQA 2GSWA 1WSWA 4R81A 1I1OA 4HS4A 3S2YA 1SQSA 1D4AA 1CZUA 1RLJA 3SVLA 3W7AA 1AKUA 4D02A 2Z9DA 3OX2A 5FX2A 2QMZA 3F6RA 3ES9A 3LT5A 2Z98A 3F2VA 1FTGA 3EDOA 1OBOA 1AKVA 3NHSA 4BMPB 3F90A 3W79A 2OHHA 4N65A 4GR9A 3UXEA 3D7NA 4PTZA 3B6KA 4LTDA 4HEQA 3HLYA 1E5DA 1TLLA 3B6IA 3L9XA 3NHYA 4F8YA 1AZLA 5JROA 3U7IA 3GAMA 5F12A 1SG0A 1JA0A 5FA6A 1FLVA 2QR2A 2QX8A 2X2OA 1YCFA 2Z9CA 5B3LA 4PTYA 2QX9A 3OWHA 2R96A 4XDGA 5NULA 1QHEA 3QFRA 1YCHA 2QX4A 3FW1A 1FLNA 2KQUA 1CZOA 1ZWLA 1QBGA 4XDHA 2FOXA 1XYYA 1C7FA 2A5LA 1H69A 4NLLA 5LVAA 4GQIA 3NHWA 4QOFA 5B3KA 1DXOA 4YAWA 1J9ZA 2FVXA 3KAQA 1WSBA 4QODA 2W5UA 3HR4A 4Y9RA 1NNI1 3W78A 2FAXA 2Q9UA 2N1MA 3GFQA 3OJWA 2MTBA 2M6RA 1X77A 5ULLA 2RG1A 2KLBA 3K1YA 5EAIA 1FLDA 4ESEA 4YQEA 4ZVMA 4QOEA 1T5BA 3F6SA 2B3DA 2HNBA 4LTNA 1RTTA 3FVWA 3ESXA 1KBOA 1F4PA 2D5IA
chains in the Genus database with same CATH superfamily
3W6NA 1OWLA 3ZD8A 2QN3A 4TLLB 4BPBA 4DQXA 3AUSA 3NUQA 5IK2D 3HC7A 1T43A 1QTRA 2QN6A 3AUYA 3F8SA 4B33A 2ROQA 4BLOA 1E96A 3TAXA 3RJMA 1T24A 2AUNA 2GF9A 3LX8A 1T26A 4ZALA 1E9AA 3X1XA 3L7LA 4L6AA 5EWJB 5LNK6 1QP7A 4BB6A 1EVLA 1ZO8A 2QTAA 3EMKA 3L8ZA 3DEYX 3V97A 1FVXA 3BDIA 1VPLA 1YDEA 4PTLA 2GJKA 3BILA 2C92A 2D6FA 1RRKA 1E2DA 1W9MA 1DBIA 3ZY4A 1XLTA 2YKGA 3O3NB 2AXQA 2PZAA 1QH8A 2ZULA 3D3NA 3Q3IA 4N0EA 5ABPA 2DKNA 2X42A 1RP1A 3R7LA 3T9EA 1G17A 2GK7A 3DM5A 3ER9A 1R3UA 2F1RA 5BVHA 4X45A 3T5GA 5ADVA 2B4KA 3CURA 2CZGA 2ZCUA 2A33A 1I24A 4MRPA 1D6SA 1XZJA 2FPGA 1DCMA 1Y3AA 3DMTC 4UXIA 1JQEA 5DGDA 2C0CA 1JHDA 2OCGA 2QUZA 1MHTA 1VI2A 3PGJA 2C1ZA 3AEKB 4G1CA 4V0ME 2P78A 1IEWA 3I1YA 4OJTA 3GT4A 3LGAA 3ASVA 2X1LA 4C4PA 5KINB 2E4AA 3AV0B 4MYTA 2LIPA 3TBFA 5GADl 1NKTA 3Q88A 4YRIA 1PL6A 5JCOA 3L41A 4BO3A 1DJPA 2W6NA 4RW0A 4C7KA 1Z7WA 2XUZA 3FETA 4FUQA 4D3FA 5H9VA 4CHTA 4KQFA 3HMQA 4LYGA 1XJ0A 4W5JA 3UOAB 2J09A 3VO1A 2PGJA 1OAOA 3QX9A 1FBNA 4UQOA 1T35A 3LNCA 3OHMA 4A9AA 1CP3A 3LVQE 3WHPA 1JRLA 3VAZA 2UU9B 1RHMA 4GOLD 3JQ7B 2QJRA 4JVSB 2QVZX 3GC6A 1M34A 5B30A 3LJKA 3V42A 2GAAA 1WIWA 1UMBB 4LHSA 2QE7A 2VTDA 4MVYA 2PUEA 3TI9A 1QRTA 2JGIA 1ENYA 4DADA 3OY2A 4GE0A 3SYRA 1CNFA 2KM1A 3V6LA 4BWVA 1ESCA 3E9CA 3FOBA 2VP0A 3F3SA 5I9NA 1ZGHA 1GTL1 4WE3A 5KQMA 1CB0A 1FSGA 2D2EA 2VUHB 3E9QA 3EULA 2VWGA 4RM2A 3GUHA 4Z0PA 4IYJA 3LCMA 4URUR 5LCXA 2BHTA 3FHLA 3E4DA 2RE8A 3GCDA 4HXFB 3P0JA 2P11A 4FSXA 1KO5A 1KYWA 3OOJA 4DILA 4GOMD 5E6RA 4ZN6A 3RRXA 1QKKA 3GFRA 1ULBA 1GGMA 4NMMA 2FP3A 1SKAA 4XJVA 3GMTA 3CWQA 5GVRA 2TECE 3D31A 4I4TF 3SSOA 5IZCA 3UW3A 4ZT6A 1V9LA 2JD1A 3ZV7A 4XWTA 1Y5IA 9ABPA 1U7TA 1HMYA 1UXJA 4GKBA 4JBNA 4PIPA 3BZWA 3L1UA 4EMUA 1SXHA 4CKCB 1HKHA 4HZUA 1DO0A 3NFRA 3TW8B 3IDFA 5AI8A 1RKXA 2NWQA 4MV5A 2GKSA 2ZSAA 5BPFA 1GM5A 4F5DA 4GQBA 2IITA 3G9TA 2DBYA 5T3UA 3SC3A 5K01A 3LX6A 2VSXA 3EPPA 2BEVB 4JBHA 1P62B 3F1LA 2I54A 3QWIA 2PZEA 2IE0A 3E3AA 1ZU5A 1UAYA 2ZOSA 1JEAA 1SK9A 1RADA 1FNMA 4BVLA 1JS1X 3ICEA 4OQYA 3F9IA 5JU6A 2I2XB 1GSHA 3ZI4A 1G9XA 1OV6A 2ZUVA 3CVXA 3DD1A 1E2NA 4RIHA 3SKYA 4WFIA 1RT9A 4YMLA 1JQ3A 1GG5A 2AFVA 4KPYA 3P4UA 1NDUA 1WVMA 4UDYX 5EGSA 3WRVA 1I36A 2OD9A 2ZUTA 1QRDA 2WOJA 4EH1A 3OU2A 5HX7A 4WNCA 5ALTA 1CVIA 1EI9A 2C4VA 1T2NA 3BGDA 4WLEA 3OQOA 1NASA 4R9SA 3MA0A 2OV4A 3LCRA 1JIQA 3V1LA 4ZI3A 3G8YA 4DCSA 2AV6A 1UXIA 3HKDB 2FWJA 4JOQA 1SKMA 3ETJA 3FFBA 4R3UC 2VHJA 3GGCA 1GU7A 4QOHA 1QE0A 3I32A 1J8MF 2FMTA 1DQPA 2FWNA 3QVJA 1CUWA 1WP9A 3N0VA 3AF5A 4FC6A 3IEPA 2WWXA 4HTAA 4ND5A 4TXHA 4AKTA 4ZFNA 3DO6A 1TQDA 4GPD1 1WZNA 1HTWA 3KWLA 1N5RA 4XCVA 4LDNA 4ETNA 3GJXC 4RKFA 2BUCA 3D4NA 1CRLA 3NDIA 3QXXA 4ND7A 4HGPA 1NBMD 4CV2A 3GLTA 1UBJS 1T9GR 3Q8KA 4G0PA 5C80A 4AURA 2NOAA 4HDRA 4C9BA 4DJFC 1A9RA 1H9AA 4CM6A 1SVMA 4HT3B 4WMLA 4H7EA 2GM5A 4PLYA 1MAUA 3QKRA 4HNSA 4LYHA 1N57A 1A96A 2G5GX 2AH5A 3RIHA 3GH3A 4RD1A 4B6JA 4W9NC 1OBFO 1PZNA 3FWYA 2EOAA 4O4HB 1KI7A 4Y3UA 5HS4A 1EFLA 3PCTA 5F2NA 3ROEA 1IQ0A 2HA6A 2ZB3A 4GW3A 2E9SA 2J48A 4N7JA 5KYWB 1E99A 4V02A 5K05A 3U3XA 1QMGA 2QRVB 2YIDA 1S8OA 3L7CA 3NH9A 3T06B 1RZ3A 3QEMA 2ODQA 4IFEA 5HR5A 1I51A 1PUIA 4C0XA 1ND5A 4J0FA 3IAS6 5HCIA 2Z1DA 3O4VA 4AIRA 1U7DA 4FZVA 1E3IA 2XXAB 1MDFA 3CJRA 3KQYA 3BCRA 1C7IA 3ENWA 1H0SA 2PG3A 1DRVA 2PL1A 3AXSA 3I73A 3PRJA 3WMEA 1ARZA 3ZXXA 2JLSA 1YC5A 3PD7A 2H4HA 3LP5A 2XYGA 3OX1A 4V1CI 3GVXA 4EX7A 4A23A 1ID1A 1XAIA 4TM7A 4B7ZA 5L3RA 3H5VA 2PH1A 3DFMA 1KYTA 1K2VN 5IF3A 5H4GA 1IXRC 1D8AA 1JG4A 3LWBA 4JUCA 1C8VB 2G40A 1WBBA 2ZJ3A 4RY8A 3UIEA 2OMKA 4LJ5A 4JB2A 4CW7A 1UBGA 1T5SA 3BWEA 4TWJA 4ZMRA 1OXBB 3UKOA 2OK7A 4GH5A 2IUEA 4HLQB 5BN4B 4A36A 2HF2A 3KTFA 1WTAA 4L5IA 4O02B 3ZCPA 4TVOA 4DGSA 5BSKA 1J2JA 2CL0X 2X7XA 1HM5A 1PW5A 1HYEA 2WU3A 1QHFA 3HB5X 3PFNA 1RLMA 4QEDA 3BHMA 5B4UA 4JYMA 3NOQA 4L9WA 3TR0A 4FM9A 2RD2A 5H8WA 3NHZA 1WBJB 4M0CA 1J70A 3ZQKA 1ZBQA 3L0PA 2AZTA 3A2MA 5L7TA 3DV9A 2I6TA 4B6OA 1JP7A 2OXIA 4LHVA 1Z63A 4CL3A 4NZPA 1M6EX 4WDRA 5DSTA 4ESVA 4MKIA 4E2YA 1MA3A 1LLUA 3B51X 2FNAA 4L28A 1C4OA 1EVZA 3FBWA 3PDUA 5DWVA 5TPZA 3WLRA 3HO6A 2UZ1B 1W2HA 1WL8A 2V7WA 4FPXA 1ZGZA 1ONSA 5FCDA 1NW7A 1OHHA 1UT5A 3CUKA 4UNRA 1K89A 2V03A 3DEHA 4G09A 1SPBS 2PWPA 1WXQA 3GNTA 1SHUX 3M3HA 5DHTA 2EX4A 4IXWA 4TTSA 4ALJA 5JSZA 4E6PA 1EK0A 3KKNA 3CMCO 2I3GA 4GFDA 2Y1XA 3DWGA 4BLQA 3BXPA 3WGGA 4LF5B 1BTOA 1ADFA 1YB1A 2TMDA 3C39A 1Q3KA 3GPIA 1BS9A 1YULA 3KKMA 3NHRA 3FRHA 4H7HA 5JPIA 1P0QA 4URFA 1O9GA 1RJDA 3VSBA 1EQAA 1EM8B 4BBAA 1R00A 3GIWA 1KMMA 1GGVA 4PSVA 3L8MA 4S2EA 1IHPA 1RHUA 4PRZA 3TEJA 3PXUA 2ZSHA 5HFAA 5JVDB 3JQDA 3C8HA 1BX1A 5CBPA 1SQGA 3K2IA 3KCQA 4FCWA 2ZJZA 2J59A 2PGLA 3BMCB 1B8UA 4HWOA 1RI1A 5WRFA 3SOZA 3U4CA 4QQRA 3KJXA 4TMYA 1J42A 3IQGX 4EJ6A 2VBCA 2J4FA 2WJ4A 3H13A 4LDZA 3V1NA 3TJMA 4Q19A 2Z5LA 2VP5A 3HFJA 5E3IA 1F2DA 1T4CA 1F5NA 2B30A 2WM2A 3DTVA 1NZFA 3MWKA 1KNQA 3UAYA 3GFVA 5H80A 1FZTA 5KS2A 1KI4A 1T9BA 2DFPA 1B6GA 1GRNA 2EEZA 1L1RA 1U8EA 4B0PA 5M7EA 1U0EA 3MWDA 5DKFA 2X86A 5DMHA 5AK6A 3FBGA 2IX3A 4E13A 1QZUA 2ID8A 2JJ8A 1NY5A 3OCCA 3DBRA 1RXWA 3CZQA 1M5UA 2YS6A 3EXAA 3DEAA 5CT4A 3RSFA 4DREA 5IT9A 1GTSA 5CA0F 3IT3A 3TTTA 3VOTA 1E8MA 1POWA 1A5ZA 5CB6A 5L3VA 2HTFA 1MB0A 3H9EO 4FQ8A 4KI7A 3B6KA 4Q05A 2JFHA 2RMKA 4PXSA 3T1HB 2UUAB 1A1SA 2JK1A 3M33A 4PR0A 1NOJA 2F64A 2OCLA 3JR3A 4KLRA 3PGKA 1EVQA 5EY5B 4Q7QA 1QGYA 2BLLA 4JLPA 3GAFA 4BLRA 3RF6A 4H1UA 5EHIA 4I5DA 4D9NA 3C41J 4H27A 1G6KA 4L5AA 4CDMA 4M0UA 4Z3KA 3SQWA 2FEAA 3A6HA 1OFUA 2BGUA 3N2NA 1EEXB 2AQ8A 2WW8A 3INTA 1QHHB 1Z4IA 2CYAA 2VZ8A 1JZQA 4X84A 3AQ4A 2O5EA 1D1TA 1U9IC 4J16C 2QYTA 3HU3A 2LD4A 3ITDA 1M2NA 2VEDA 2HQBA 4A73A 4BKQA 2JLCA 4YX9A 4DPLA 1YU6A 3LL7A 2VFAA 1ML4A 3AFIA 3KOWA 4LQ4A 3WQBA 4UTRA 5JAZA 3DLAA 2Y1KA 3I9OA 4CM1A 4ZRDA 3TECE 1W36C 1NZDA 3WL3A 3BCUA 1A82A 4BZXA 5A2GA 2Y77A 2X2OA 3AV3A 5JD5A 1QF6A 3QE3A 2J6BA 1ZJ6A 3TSAA 1YCFA 2VSNA 5TJHA 4QBKA 1E6KA 3TLAA 3UHOA 3W6PA 2HLDD 3WGHA 1LDGA 2QN7A 4KO4S 4J75A 1EFKA 1K68A 4MHOA 4IMRA 3STVA 2GZDA 1RQPA 4CLDA 5JASA 1X7YA 2GZMA 3X3HA 1JDBC 3Q40A 4ACBA 1XR3A 1GXSA 2G7MC 4YRSA 2VRWA 3OY7A 4BV8A 4DMUB 1GQSA 3BE6A 4G5YA 2JD2A 2ZIEA 3GD7A 3KZCA 4TLEA 3UJ8A 3KM0A 3WL4A 3TG8A 1R4MA 4EI9A 5ALRA 2DGDA 5LIRA 1ZOIA 3A1FA 3HGTA 1W88A 1KR5A 1U1DA 1ZWLA 1XEXA 3VGPA 1CKEA 5F1KA 1T5IA 2QB5A 2WM8A 3FH0A 3TUZC 1UQRA 2FOXA 2NO4A 1RZRA 3CLUD 2CLEB 2I0FA 2OLKA 3BWXA 1HUQA 1L0BA 1K06A 3QVGB 1HL7A 4BUJA 2HBZA 1ESEA 3FWZA 3WLTA 2IXGA 4HRXA 1JAIA 1CVLA 3PX3A 1QG4A 4KX3A 2N0SA 5AVKA 1BZYA 1CS4C 3KFXA 4Q3KA 4XWYA 2C42A 4FYYA 3SHOA 2JFOA 3ZEAA 2DWUA 3H1AA 2A9FA 3H0EA 3D3QA 1I0IA 3HY3A 3Q41A 1LLDA 3IKLA 3K1AA 1ZXLA 3DDSA 3EWAA 1Z8DA 1PDVA 3A4TA 4I3HA 3HXKA 5ALVA 1CJMA 1AS3A 1O94A 2G0AA 3DO8A 2O3JA 3H1GA 3GVPA 3QGMA 4IVQA 4YTEA 5ALGA 1XZFA 4Y67A 3A6LA 3BH0A 1OAAA 1PE0A 2YJ4A 4ID3A 5FXMA 1NNI1 1CY4A 3A26A 3QE4A 4HNRA 3OPQA 2HDNB 3SFTA 4DPMA 3NT2A 1IHUA 1RXEA 2VDJA 3K0KA 5IJAA 1YJQA 2N1MA 4X3OA 4NC9A 4TZTA 5J59A 2G04A 2GO1A 1IATA 3USCS 3WWCA 1LX7A 2O2CA 2B4RO 4GIBA 3BXEA 3JD1A 4G1VA 5EPOA 1IY1A 3URMA 4HDMA 2IS2A 1T13A 3KJHA 4H3HB 4Y0AA 5C1BA 1KAEA 1LLFA 1W34A 3SJAA 1VZ2A 1WUKS 3VU3A 3T3HA 2ZJ7A 3GXOA 1VL2A 5LU9A 3K1YA 1KK0A 1ODLA 1TJ3A 3CF4G 5JRDS 1U0GA 4Q34A 2V0NA 1IM8A 2I55A 1U3DA 1WKBA 2ZRDA 3K0CC 2PM8A 4Y1RA 5EZYB 2X19A 3V4LA 2Q2OA 3THYA 1VIYA 2J5RA 3S0JA 3ZH9B 3BL5A 1XK6A 3A2NA 3KEFA 3WJ1A 1QNFA 2PBRA 3WYDA 4PYJA 4BY9E 4GKKB 4KQKA 3RRBA 1CIVA 3RREA 2XB9A 5ITWA 1KBOA 2BRUA 4MA4A 3NATA 1ZIYA 2O8NA 1WMAA 3SIWA 2OBYA 4IIVA 1NT4A 4EECA 1MKYA 5AVOA 2RBGA 5B12A 2PA0A 2JLRA 1OE0A 1YO6A 4LJ6A 5FYQA 3K32A 5CCXA 1LS1A 2GPJA 1DX6A 4N54A 2B5VA 2PMEA 3EPRA 4L74A 5T6MA 1JHQA 1XLUA 3F78A 4EHIA 3W9BA 5GTDA 1IN1A 3SBDA 3OSUA 4GBGA 3E5RA 2MSNA 4EL5A 1LS6A 4AX8A 4RL4A 1F2VA 2QQ0A 4B3SB 3FYHA 4BKUA 5BV1A 4FIDA 1DVRA 3GRFA 2WHEA 3ZI0A 4B3TB 5F1YA 1FDIA 3IILA 5FLXA 2Z3ZA 3Q85A 1KVUA 3F2IA 3HEMA 2OHOA 2Y3IA 4R83A 1UXHA 3H5NA 2QJFA 1T25A 4JMPA 4PRYA 5TPWB 1L2TA 4QUHA 4CG1A 1MO3A 4WLVA 4ZVNA 1LBIA 2QMEA 1W73A 3IGFA 4LJYA 5C32A 2FMXA 3E9YA 3TLGB 1CEXA 1GPWB 5B3JC 2BM0A 3ROMA 1FDTA 2VYND 5IUJC 1RYDA 2A9OA 1NP3A 5KOIA 1CUFA 3B5IA 1HG1A 4MYRA 5FTKA 3JALB 1K7CA 1KY4A 2AUMA 3CRVA 4YCMA 1G2IA 4BB0A 2VDVE 4OXNA 1RC1A 4Z86A 1V3TA 1V45E 2BBOA 4NOLA 5EMLA 3S2IA 4X95A 3W8RA 1J8VA 2IUSA 3TYXA 2YWFA 4KSBA 3WE7A 3NT5A 4C6SA 3L1KA 2QIPA 1KZ7B 1NXTA 1M8FA 1O4VA 2D5LA 2PSEA 2GCOA 2HI0A 1CY7A 4MK4A 1W52X 3WLIA 1VMIA 1B3RA 2E87A 3VYRB 3FVTA 3MMZA 4TL8A 3VUEA 4EMTA 1ILEA 4X6UA 3MFYA 3ITKA 5B2EA 3U4IA 3BIXA 2DEUA 1SKBA 4PZPA 1V3VA 2ONCA 4E2ZA 5SY6A 1IWBB 4G67A 4CM5A 4GUDA 1JFRA 3FPEA 4ZOQI 2KW5A 2AJLI 4DOMA 3RUCA 4ZDJA 1OLOA 1I01A 2K87A 1D2NA 1N2JA 5HKAA 1EX9A 1FE8A 3Q6NA 2YHBA 4FYXA 2X4GA 3BAFA 2Q1XA 4MUAA 5KC9A 1C81A 2AIRA 4KAAA 1GTJ1 2PLFA 1NI4A 1SQ5A 5AW4A 3D2BA 2NPFA 3ZHYA 2OCYC 3UMJA 5TNXA 4BVJA 1NULA 4MITA 3NWJA 4B75A 4IMIB 1M2EA 3PWTA 4Y9UA 4UUMA 3B6EA 2GM4A 1DNPA 1Z16A 3V8MA 4EENA 1D2GA 3R0IA 2X0DA 1P5RA 1HDZA 3DD5A 4DG8A 1UZNA 1ISHA 3QK7A 4PINA 1XTBA 3IT2A 4TV8B 4CQMA 3IPLA 1IEQA 1EFCA 2AOUA 2D0DA 1XL1A 2P0EA 4HMPA 4K6FA 4M0MA 1N6PA 4YRLA 5EMKA 5LLSA 4FB4A 1Q1AA 2QAGB 4P4GA 3MPOA 4RMHA 4B1FA 2X4DA 1W4AA 3TLXA 4Q9KA 5BOSA 1OZFA 4GPTA 2NUTB 1X7WB 1LQUA 3L6EA 4YQFA 1Q74A 2EQAA 3KB2A 4GDMA 2AG0A 1SXQA 1GYQA 4CETA 4B31A 3NVAA 4C0KA 2D5CA 5IM5A 4ITVA 1W30A 2R6DA 4FGUA 5LXTF 4K9SA 5I7RA 2FRDA 1MFZA 4YJ2B 3ZZNA 4HB0A 3CRMA 3PV0A 4AXXA 1TVCA 4HWRA 4L76A 3HBLA 5CT5A 4A0RA 1JPJA 2R8EA 3O1JC 3PPIA 1K3FA 4R1OA 5M3BA 4I1PA 3OEEA 3AUAA 4OFZA 4BKOA 2R85A 1FTYA 5HOEA 2D5AA 4M38A 3U19A 1DRKA 5I4IA 2REBA 2Z9BA 3CRZA 5BNZA 4KB5A 4PYMA 2DR3A 2M32A 3WDLA 1VLZA 3WMGA 1JLLA 3O31A 4KQWA 2XWJI 1DAMA 4IDPA 2DR0A 1LI7A 1LA2A 1T15A 2GNPA 4MB6A 5KO2A 1MGOA 1NBAA 1L4GA 1P2TA 1XVIA 2E85A 4IV8A 4OG2A 3K5HA 3LWZA 3QVTA 2BFCA 2IU6A 1QSGA 3AI1A 3HQ4O 3ESYA 2W42A 1THGA 3LT0A 2V4UA 4V0RA 3A2KA 1YUBA 5HKLA 3SVTA 4RFVA 4DCNA 2JLUA 1WG8A 2X5NA 2MCFA 2BEJA 2ZSUA 3OURA 3KJIA 5FBRB 3RFFA 1JMKC 4UD6A 2EAUA 5JARA 3FROA 3JATA 3C48A 4KP7A 2PSHA 5B1YA 3M89A 3KHUA 4G26A 5B6PA 3TZKA 1ODFA 4EATA 2YYSA 5LLTA 4KR0A 1H0RA 1K5HA 2HX1A 1OXSC 3JQ8B 1EDBA 4IOKA 5BMVA 3EGEA 5AIBA 3FE2A 1FIUA 4LJSA 1GKUB 5GZ3A 1MZPA 2QTMA 1PJSA 5LJIA 1KU6A 1R18A 3ISVA 3MAAC 4J0IA 1H2XA 5HUHA 2ADOA 3LZCA 4P32A 1XN4A 2DH5A 1BYUA 2JI9A 4KW7A 3K9FC 3AIOA 4WGFA 3VKUA 3ANMA 2Z1NA 3HDVA 5ERXA 4MUJA 3N1UA 4I9UA 4NSNA 3JD2A 3ENNA 4EG0A 1P9LA 1WMFA 3C3PA 1UM9B 2NO7A 2R4QA 2C58A 2DG2A 4IXDA 4MW7A 5FWYB 4ZYVA 1NUQA 5I51A 1OQAA 1SXJA 4URHA 5AI0A 3RKRA 3SVZA 3K96A 3TMYA 4TZ0A 1JMYA 2EX1A 3C3CA 2DJ5A 1CG6A 3AT1A 2OXEA 3B3FA 5J5AA 1A0OA 4KGDA 1ULSA 4UM5A 1X1QA 5G0UA 3WIBA 2QMHA 4MGIR 2VR1A 4XIYA 3TKYA 1QO0D 3E15A 1WS6A 3F6PA 3QA3E 2VA9A 4ENSA 5J47A 3G1WA 4N49A 1J09A 1ZU4A 2XIQA 2XCRB 4I50A 1P7VA 3E8XA 1XF1A 4IDHA 5FUMA 2OD7A 4Z53A 2V9PA 1UIMA 1M6YA 4GSLA 2C9OA 4E4TA 3P2EA 3R3SA 1ST3A 4B7UA 1NSYA 4OHCA 1YVPA 4UVDA 4ZV7A 3UMFA 2EKPA 1WZUA 5J63A 4X24A 4X64B 4AMBA 5J9FA 3ADCA 2QK4A 3BK7A 2W2VA 3M6VA 5ETJA 1XMOB 1F6WA 3T5MA 4DANA 1TYEB 3BGSA 2WG0A 2QG4A 3EGXB 3I34X 2R3SA 5JNTA 4KO2S 5BQFA 4QPCA 3WLFA 2P4HX 1NY6A 1JEQA 1VLQA 4R6WA 2JKVA 3FKSA 3NHJA 4QU9A 1X0XA 4IIGA 4Q9AA 2BEKA 2Q9AA 4L50A 3K09A 4ZAVA 5AJWA 3IEMA 4F97A 1LNZA 3O2QB 1IOWA 5HS6A 3N58A 1AKNA 3GLUA 1LK0A 3RRFA 5K0SA 2A5DA 1ADBA 1BKSB 3QEAZ 1PTJC 5L6LB 4QQ8A 4ENPA 1L3IA 3NIFB 2A58A 3DAYA 1FXWF 3LVRE 2H92A 5K03A 1CZKA 4PPNA 5E1OA 4H3VA 1QFXA 1QMPA 2FFQA 5BUCA 1YR6A 1XZBA 4ZYTA 2H0QA 4R2KA 4UKDA 1TLFA 3QXGA 2W6PA 2Z56A 3BMQB 2ZRMA 1UZLA 4Z4IA 1UAAA 4LJRA 1XUOA 5DI3B 5G02A 4C89A 1Z6GA 4KI0A 4V3BA 1YDWA 3VU0A 4AB1A 1Q14A 2FVYA 1P18A 3N0XA 4K9KA 4WOBA 5EUMA 4CCYA 1WSWA 2BYTA 5T6BA 3MM4A 1VJ5A 4R1LA 4LF6B 3D8BA 3B6ZA 4R81A 2XX3A 1I1OA 4HS4A 3BBPA 1ZCJA 3BHJA 4O2LA 3H2SA 2CVQA 2XRFA 3PXAA 3OCVA 1D4AA 5B2ZA 5FI5A 5E0KB 3I4LA 4KQHA 4WZBA 2WTAA 4TT8A 4IPTA 5IARA 4J1NA 3ZK9A 4CMCA 2ASEA 2A1TS 1USUA 3GK3A 5CLHA 3V1MA 3HLTA 1JT2A 5AK4A 1V16A 2IDJA 5REQA 4Z4HA 2QQ5A 2V3VA 1CYEA 2UVPA 4AJJA 621PA 1PV2A 3Q15C 4EY7A 5EIBC 3K0HA 1YS6A 1CEQA 1J0CA 1JXAA 3L8GA 2R7AA 1VMKA 1FNSA 3BYZA 2PUHA 2DUUA 4OH7A 5LQKA 5AICA 3UFXA 2FFRA 4N3CA 2XDAA 3DVQX 1SVSA 4TXMA 3NETA 3BSWA 3BRWA 4CDGA 2D4HA 4Y6LA 4D45A 4NBUA 1SRQA 4XVUA 4YGXB 1HK7A 3TGPA 3K8YA 3LCUA 3PA8A 2B8NA 4L73A 4NZOA 3TNLA 3NASA 2QNBA 4UVIA 2W37A 5J58A 2CCKA 3A10A 4MUKA 4MZXA 2N9UA 2ZVPX 3GCGA 1N5OX 5DM0A 4UHHA 5AT1A 3T1NA 4DXDA 4EYEA 5C8DA 2A8YA 2XDQB 3R7BA 1F4VA 5CDHA 3MCAA 1VA4A 4UTVA 5I3ZA 2IYEA 3P9SA 4L9RA 1XZPA 4R84A 4FFRA 4OLJA 4QPDA 4TV9A 4PGAA 5BORA 1V43A 1NJ1A 4I1YA 1OREA 1ZP6A 1THMA 2ZJ5A 4KXVA 1GVHA 1PS9A 5JZ9A 1O95C 1MX9A 4XQGA 2ZI7A 1JHRA 1ESMA 2WTNA 1KEEB 2H5EA 4A2QA 4PSKA 5FWXA 3WRYA 1AN9A 3EIHA 4MKHA 3GAMA 1E6CA 2DULA 4PF1A 2O7SA 3CUYA 2YL2A 5HRCA 1BCRA 3CINA 2XTNA 1TGVA 1VIVA 1Q12A 4MMXB 4RDHA 5EYPB 4BIMA 4HGOA 4MARA 4QPPA 3RFVA 2IT1A 1DWQA 1JW9B 4DLUA 2QUAA 2VJPA 2CV1A 3FCYA 2HD4A 2HQSA 1G5PA 4ND6A 1BMFD 3JQ6A 4U7WA 4ASUD 4BV3A 1M8JA 1B26A 4Y2UA 1EJ2A 4XD7A 2PAFA 1QCCA 4XLLA 4JD5A 3N8NA 2GBPA 3UQZA 1XRQA 2P3QA 2WUWE 1WXEA 1GP2A 1HKUA 1U1FA 1RJ9B 2J32A 3ACDA 1T6ZA 3OPXA 4OA8A 4PC3A 4TX1A 2ZI6A 3RLIA 4RESA 1P19A 3ROPA 2JDID 3GEHA 1LPAB 3AVWA 3BEDA 4I5FA 1P2FA 2YXNA 3IALA 1Q3HA 2PZMA 3QLJA 3ZU2A 1E7RA 3OFKA 1PYDA 3A7DA 1NJ6A 3AF2A 3G0IA 2DWQA 3A6DA 3L40A 3OPYB 4FHEA 4NENB 1DP4A 1NMQA 4PONA 4UCXA 2O2SA 5HMMA 3PXGA 3UK2A 5IJ9A 3FW1A 1DTWA 4K1XA 4KIGA 3AB8A 1Z0AA 4L3WA 2GKGA 2ZATA 1FEZA 2YY7A 1W8IA 2Q21A 3EOAI 5CM9C 2RHWA 4ZT4A 1Y98A 2J4CA 1DC6A 1FMTA 4CIWA 2X8LA 4CM8B 3A1TA 5EKUA 4DHWA 1DAEA 2V0GA 3GHHA 3HL0A 1NKSA 5FFFA 3LQ2A 1L7OA 1G9SA 1XD2B 3CT6A 2E4VA 4EVSA 4BLVA 4CKXA 2K2WA 4KCGA 4FMCB 3RABA 5IW8A 4G2NA 5BWCA 2P9TA 3KHKA 1FNDA 3TLJA 4EB8A 1H8HA 1V8FA 4EF5A 1DEHA 4MWOA 1OVGA 5FV4A 1REQB 2UVQA 2WF6A 2I2FA 4HFRA 4MPTA 1YBFA 2L18A 4N7MA 3CX4A 4G5FA 4RZ2A 1BDHA 3WQQA 1A2QA 4H1HA 5C1OA 2CZCA 4GMXA 3W2FA 5JAMA 3RUPA 3O93A 4JOSA 1MOZA 2YOFA 4RIFA 1A9XB 1K3TA 3GLHE 4EA8A 5BR1A 1N2CA 3PPXA 2BJVA 5IT4A 1LF5A 4QSMA 4X6YA 5TQ2A 2C2OA 3H4IA 4ZYZA 3ET4A 5EXPA 4BNMA 3U7GA 1S9HA 1ZDMA 1E1CA 1XVTA 1FVFA 1EP2B 1TYBE 2KI5A 1G18A 2POQX 3UK6A 2BFMA 3FTQA 4BV9A 4LI0A 5TJ9A 1EFVB 1JG7A 4MO2A 4UU1A 1ZXXA 2MTBA 2YX1A 3PUWA 3PWKA 4GI2A 4D99A 2DLDA 1FYDA 3RUFA 2GBLA 2JJMA 3UATA 5HQ3B 1TM2A 1MU0A 1PTKA 4CEHA 4JLUA 3IJ5A 4A10A 5A5DA 1MA0A 1NI3A 1NPTO 4DLKA 4CLHA 5FPKA 4FYKA 1L7XA 2PKWA 3TXXA 3ZHUA 1T3HA 3ZD7A 4M60A 1W25A 5A6SB 4JI5B 1LJLA 1XDZA 1BH6A 3BXZA 2CVOA 4CRWB 2DFDA 2FDCA 1GGKA 1KYVA 1Z9BA 3ANNA 3PA6A 3ZCRA 1PLKA 4ESEA 2QRGA 1QHYA 3ZIAA 3TOZA 4BS9A 3RVPA 3HY4A 3TLMA 2YXDA 2ORVA 3F6SA 4NE2A 4HD8A 2Q3LA 1QK3A 2WZQA 4BJHB 5K0CA 4JUAA 4X8MA 4MQMA 2NUBA 1R0ZA 4YV2A 5JZMA 1WD7A 1V8OA 3OZTA 3UUGA 5HIIA 4LE0A 4RZXA 1W29A 3LPLA 2P5TB 3IP9A 4NP6A 4R2WA 5JAHA 1TJPB 121PA 4Q82A 5AW9A 2Z8XA 4P7JA 4RTRA 3PDCA 4CMIA 5FLKA 2AKEA 1N9ZA 1IIRA 1J2YA 4P3XA 4MTLA 3NONA 4DBZA 2R1UA 3RYCB 1VL6A 4KX5A 1H93A 2Z6UA 3RBAA 3KSRA 3L84A 4QKQA 4ETMA 2FN4A 2ZRFA 2VNSA 2EJWA 1G16A 4E70A 3ELBA 4C0AC 3QKSB 1JSZA 2WP8J 3H11B 1Q50A 5CW1A 3RFTA 1QNLA 1FVOA 5FTJA 1JLRA 2AQIA 4QU8A 3VPGA 3G1TA 1NVVR 1LDNA 2RGNC 2PKRA 1X0VA 3NJRA 5DWQA 2QLLA 5FB3A 3K8OE 1FY2A 1UWVA 3EFHA 3BN3A 4M9SA 5BSFA 5LSAA 2FR8C 1HQCA 3AR4A 3ZHTA 1EMDA 4FDTA 3BL6A 3IB6A 4N9QA 2P3LA 4ZAYA 1JHPA 1G60A 5A03A 3KT0A 4X8OA 4QGBA 5AMXA 3E9EA 1TCBA 1CY2A 3DDHA 3HVKA 4G3XA 2CVFA 4MA5A 1WDWB 3GVIA 3JWHA 2IHKA 1VSBA 4YBZA 4B7CA 2Y05A 1NBME 4F4CA 1OVMA 1OF1A 4I66A 3W04A 4RNCA 4EL0A 2EXXA 2R7NA 3LC2O 3IUMA 2AYXA 3WLJA 4EVIA 4EPTA 3GFOA 1F48A 2FXIA 1UWKA 2FW7A 3GFTA 1M1YE 4PO1A 3T0GA 3VJMA 5KNLA 1GIAA 2GD1O 1CR1A 1DBVO 1O9BA 4QQFA 3ZGXA 4XM0A 3M6AA 2Z09A 2I33A 3JTMA 4YT5A 3N07A 3ANTA 3M1AA 2CJWA 4P84A 1HDYA 2E4UA 4XOUA 3SE0A 3JRWA 4PY2A 4Z0HO 3K71B 2IH5A 1NXSA 1S01A 2BSAA 2I7VA 2QQFA 1CW2B 1YOVA 1ZN7A 3O9VA 2NVWA 4JBWA 2H2WA 3OIUA 3H6KA 4ENUA 4Z7OB 1IVSA 1PNTA 4S1PA 3GBVA 4J1TC 2H59A 1NOKA 4NABA 4RLSA 2Q4RA 2JHGA 1QOZA 3IE2A 3KXIA 4JOCA 4HAOA 1L4KA 1N0VC 1R15A 4R3WA 4QUAA 3T38A 1GPUA 4N47A 2VDPB 3PX2A 3M3PA 5JWHA 4LNUA 5DHSA 5DULA 4F3KA 1KYQA 1ZGBA 2EG9A 3WJAA 1YQGA 1ECFA 1H1DA 4EX6A 5GIPE 1MNAA 3K9HA 4FONA 4B2PA 1JXQA 1YE3A 4ND2A 3AR8A 4E5DA 1QVWA 3SDZA 1A9PA 1EGVB 1B3BA 3OTIA 4F3CA 3P26A 4QDZA 4W63A 3QFCA 2DWOA 2A59A 3DWIA 1WETA 4NDZA 5K09A 3ZVRA 1XG5A 2QHXA 1E8NA 2HMSA 3ZW8A 2A1TR 4JEHA 4KC0A 4BX2A 1EVJA 5EOVA 5LWHA 2FV8A 1OLXB 3TCXB 3JCZA 1WB6A 2BMAA 2YH2A 1I6KA 2P4EA 1GR1A 4TMWA 5D3MB 1Z73A 1OGJA 2FK7A 2VQFB 3RIEA 1QS0B 3DA8A 4P2BA 2J3MA 3CEAA 3HDYA 3LSTA 3PU6A 4FOLA 3FDJA 1CR0A 2D06A 4RVOA 4YAOA 3ZKAA 4H6VA 3FTCA 1Z2AA 2HCRA 4HYEA 4YRCA 4S1VA 4P81A 2IYYA 3AL2A 4C4RA 3WXMA 2Y4OA 4D44A 5KNCD 2VUSA 3EXIB 2ZQYA 4JP1A 1Q7CA 4NULA 3RIMA 2XWSA 5J4HA 4N5MA 3NOOA 4NHOA 3L6CA 2FUG6 2R6FA 4QBGB 4D3ZA 2PDAA 3QFSA 1E4YA 2AF4C 1KSGA 3GQBA 2JHCA 5ELXA 4UNIA 4CLRA 1R12A 3OKAA 4XEHA 3OHSX 3ZU4A 4GI5A 3FNFA 3NBFA 2AOTB 3I64A 4QSHA 2FPIA 4L7QA 3G7UA 1GPDG 3D4BA 3RPEA 4J4HA 4RZ3A 1XTIA 1UKZA 2C8LA 2X2FA 4YK7A 3ZVLA 3EA5A 3EF0A 4O8CA 2XGMA 2ZDHA 2B9VA 2GJ8A 2P62A 3DBVO 3FMFA 2IYRA 3QU9A 1RIFA 4V3CA 3TBKA 3IEUA 4IXNA 1WCV1 4D56A 2IOFA 5CX1B 4GI1A 2XRMA 1FX0A 1VLVA 3CF0A 3EIOA 2B82A 3COWA 4E5VA 4PG8A 2CE7A 2N3ZA 3C14C 4BE4A 3DE3X 4MR8A 2FYTA 3BRQA 3THXA 3IUSA 1SEPA 2GFIA 3OTOB 1D1QA 1PJZA 3R1IA 3DXXA 5K0TA 3PEYA 1N7GA 4RORA 3FMOB 2I4LA 2VHVA 4ZOEA 4ZREA 4ZXFA 3TCKA 4D9FA 2QX6A 2H51A 3K6KA 5IVHA 1XPUA 2VP6A 1NQWA 2PLWA 3BTSA 1EFPB 2QTTA 5HIMA 4AZVA 4BNHA 1YZTA 3UOWA 3KDSE 5CA1F 3D6UA 3GZNA 3BDVA 3I3OA 1GPMA 1JU3A 3D6HA 3HDTA 4B48A 4KN9S 1GO2A 4O4JB 2EFCB 2PPVA 2R8XA 2XBUA 4R98A 1FU7A 3ZY3A 5ES3A 4BO2A 1B23P 3VZSA 4EG4A 4C4AA 1EUCA 1W5EA 1RJWA 3F47A 3EG9A 3BWVA 1C1XB 3VH4A 3EIWA 4CT0A 4E1BA 1OA0A 3L8HA 3CSUA 1NL3A 1Q7RA 3HUFA 1CX9B 3T3DA 2J30A 3DZJA 5JSYA 1F2UB 4JROA 3L0BA 1PNVA 4BTLA 3AOEA 4ARUA 2EFEB 5F3DA 2CDBA 2AMJA 3JARB 1S0UA 2J0UA 2LCIA 3G8BA 4NS1A 1V9SA 4N6GA 5CYGA 2D8AA 4KQ9A 1MV8A 1SO8A 4NU6A 1MABB 3P9KA 3PNQA 4LOJA 4RK1A 4DIEA 3KKEA 4YWHA 5HZKA 1EJBA 1QYWA 4WKGA 2WYVA 2Y92A 3I53A 4WCDA 3WSTA 4CM9A 4CKBA 4FBMA 3IQEA 5ADWA 2D7CA 5JS2A 4K3UA 1XNQB 1MO4A 3UFBA 3OLWA 1GZ6A 1PRYA 5GOTA 1CY1A 1ULZA 3IFSA 3ZX4A 3NAQA 2P1ZA 1HT0A 2O48X 1LPSA 5H3CA 3EUEA 3UGTA 3IMGA 5H81A 2B8JA 2J4DA 1SQ6A 4RPKA 5EP3A 4EPYA 3GU3A 1U2SA 1ZRSA 2PUVA 3KDPA 5C3MA 1XU9A 2FPUA 4JJ4A 1EDDA 4E1VA 3H8JA 3NWOA 3QE9Y 3FPJA 5CCDA 4RTJA 3E03A 3N8HA 2P8JA 2Z58A 4IJ5A 5EE9A 2WF8A 5KWEA 4HWKA 1ZCBA 4ZO6A 1KHHA 5JYEA 2J3LA 1F5SA 4ENVA 3Q4GA 3G2HA 3F96A 1N5MA 4WKNA 1C4KA 1P2BA 4D2IA 1BYIA 4R9VA 4MW5A 1AZWA 5EL0A 2WILA 4QOSA 1DJLA 4BQOA 4ALNA 4UQLA 1PJRA 2R8PA 4YR9A 1H4QA 1EUDA 2C54A 2F1HA 2WIFA 3FR8A 1IOLA 3OQIB 4EJ2A 2JCVA 1XDSA 4KTTE 5LZ5A 4JQSA 3TDMA 3A06A 4A8HA 2GRAA 4ZQFA 1UQUA 3W06A 3OJXA 2I71A 1QIEA 3K53A 3SWWA 3MD0A 2PZ8A 1L4YA 3EWNA 2I8CA 4KGVA 3S2GA 1OLUB 1CXZA 2OQ2A 4IJKA 5B53A 1L1EA 3W1VA 1Y6QA 1RBZA 3GEDA 3PEUA 4MJLA 1KK2A 2F1IA 4NCJA 3TOVA 4N48A 4AKGA 2X1MA 1A69A 4E46A 3K70C 2RH4A 1HEIA 5JC1A 1Z74A 1Y3FE 3ZHVA 3NXSA 5IAGA 4YRGA 3UMMA 1ORVA 3JSXA 3MWGA 5A4IS 4K6KA 1T3LA 2OE2A 4XRRA 3RK1A 3ZGOA 1U0HC 4B35A 2YWCA 4CTNA 2H31A 2LW7A 2X5JO 3G5TA 5JG7A 2I2AA 2ESRA 3S68A 1Q6ZA 1H6DA 3C0KA 1Z0IA 2CB0A 3BULA 3DOOA 4OD0A 4UUBA 1O0BA 1YDFA 3PSAA 2YMMA 4LRTB 5K8IA 2OQRA 1R0BA 1N3BA 1UDWA 1X13A 2PRYA 3AETA 2OSBA 1R6XA 4K8RB 3SXUB 2WHPB 4PLWA 1Q7EA 4EPXA 1UBTS 4RE5A 1RMQA 4JLWA 2EQBA 4AF7A 3T15A 2MHCA 2DKFA 2QM0A 4LQLA 4CWAA 1HDGO 1Y48E 1RBYA 3D5QA 2FP4B 1BD3A 1DEKA 2NTEA 1FA9A 1U65A 3FOWA 4RQUA 1I2BA 4GYKA 2CNNA 5D3QA 2UXDB 1ZVKA 2BKEA 1XTQA 4KR2A 1PT7A 3D0OA 4YECA 3WGLA 4HADA 3L3BA 1Y8ZA 1DCKA 1FMJA 2WNSA 5H4HA 1MB4A 1T91A 1KI6B 2X6RA 2R8RA 4KBFA 1VXOA 1DFIA 2OYRA 2ZYWX 1ABFA 4HDQB 5T8KC 1KHTA 3H5LA 2WTXA 3C87A 4IICA 4EFDA 1HE8B 1FTGA 2X5OA 1BQ3A 1KC1A 2HGZA 5JOQA 1GCIA 5JMPA 5SYNA 4BBZA 10MHA 3ROFA 2VLIA 5KJEA 4UEKA 1K7EB 1VPDA 1G8KA 2O0JA 2XI4A 1NX6A 3AEUB 4C30A 3GY0A 5CPFA 3OTGA 4UAVA 4D8UA 1X8KA 4XPIA 3TGWA 2GN6A 2FEWB 1E0KA 1NF3A 4LCEA 2H1RA 2AX4A 3KRTA 1V35A 3PXCX 4UHEA 4UZFA 4XARA 2XD4A 1WV1A 2CL7X 3NIDB 3VVMA 4I4LA 4CLEA 1RHRA 3CRRA 4FYMA 4G0NA 5ERYA 4X6LA 1QK5A 3D7NA 4H1WA 1GITA 3OFJA 5FO0A 3QHPA 1ELOA 1IOVA 2UXBB 2VZLA 3CT4A 5HE9A 3GRAA 3LKZA 4Q02A 2WFAA 5FPSA 3R9XB 5AJZA 5HKKA 2DFKB 4MYSA 4PFSA 4HNHA 3T7IA 3HBNA 2CHEA 2G9ZA 1M0TA 2Q6IA 1ECJA 1CY6A 1LX6A 2XB4A 1N77A 2PKQP 1P3DA 3U7IA 4B83A 2QI9C 1HC7A 5GONB 3WX0A 4EY8A 1B42A 2VDOB 2PA3A 5A5GA 4C87A 5A4JA 4A4DA 1E2FA 2OC9A 3I4CA 1BVRA 1KK1A 3GNQA 3INYA 13PKA 1DC8A 1SOUA 2H4ZA 4KJXA 4DEXA 2AMLA 1XU4A 2XMBA 1W46A 3KNZA 1XCMA 4TZKA 1YVRA 5EP1A 4DEYA 2DCMA 1YI1A 3CY6A 3N2EA 2IBSA 4IUYA 5A3SA 3GGGA 3M8KA 1JZSA 1MEEA 3L1JA 4OM7A 2IRWA 1UJ4A 2QTLA 3S8EA 1VTKA 2ORWA 5AHWA 4GE3A 3ZWKA 1E7MA 1UKBA 2CN1A 4B4DA 4CR6A 2OGUA 3NIBA 5ALYA 5KYXA 1Q20A 1Q0LA 1IJKA 1Z39A 2H85A 2QTFA 1T29A 3OO1A 3RS0A 5A06A 4H60A 4KLCA 4ZVRA 4QRHA 2YDYA 4ZDIA 4JJKA 4Y2QA 4B6EA 4CE6A 2ZIZA 2W2QA 2F8TA 5K0JA 1DAHA 5F3RA 1WDLA 3AWDA 2C0PA 3FOAA 2X4IA 3D5EA 4WHMA 3RC9A 1KOLA 3G3EA 1P1CA 3ZDBA 2XHEA 4FHFA 3FR7A 2IHNA 5JNWA 1RS0A 3LPMA 5KOHA 1DKPA 2AN3A 3ZW9A 4B3BA 2C4NA 2J45A 3FLMA 4Q9HA 4XZ3A 1MOSA 2Q2QA 2C4HA 5BXQC 4AS1A 1KIMA 3AW9A 3ZU6A 1BGXT 1PWXA 5DP2A 1CF9A 5EI5A 4GO1A 3KZNA 1IPHA 1QYCA 2C99A 3C4JA 1RFLA 5E4TA 3DV0B 1GTMA 4DY6A 1XZMA 3O1IC 1ESNA 3HNPA 4CLOA 5AW1A 1RWNA 2NQ2C 2AG5A 1G7SA 1C7FA 1RWOA 2YHIA 3H5WA 3KKZA 4PO9A 2GPBA 4WWHA 2TSYB 5ECGC 3PYLA 4AAYA 1AN0A 1U02A 1GU0A 3OZEA 4LY0A 1FXSA 4XR4A 3F3KA 1GAJA 4YI5A 2ADFA 4MDYA 3U1TA 3MRXA 1YQDA 3BT7A 4DR4B 1J0BA 3E58A 3FZGA 1II0A 1NLYA 1FRQA 2GTIA 4FD3A 4KOEC 2Z95A 4BLPA 1EXDA 2IH2A 3R5HA 5EXSA 3T9BA 2X1HA 1IJFA 1AUVA 1TFRA 1G8SA 1H2WA 1VKOA 1CRQA 2VC2B 2OZKA 1R4ZA 3E27A 3EVAA 4P83A 3SHQA 3SQXA 1T2FA 3KKPA 1QPZA 3WDMA 3GLFE 4MRAA 2Y2UA 1DC5A 1OLSB 4M1KA 2F48A 3KOMA 1XVVA 2J5QA 4TGLA 5JNSA 1WLSA 2WR8A 2P91A 1GQRA 4UNNA 1HSZA 1UT6A 3W78A 3PUKA 3NTVA 5FOQA 1JLSA 2HBYA 3DL2A 4RVSA 3K9GA 2LKCA 1KR2A 2CMHA 2ZXEA 3ZZ1A 7ABPA 1FQJA 1ODJA 4WA7A 3LZ6A 1ZNWA 2IQIA 1E6LA 4OUDA 3QLVA 5JSHA 1C30A 3BXHA 3BD6A 2XLCA 2A0UA 1X7GA 1K5PA 3GUUA 4OY3A 2PEYA 5LDGA 5G0TA 3KJEA 1N6KA 4WN9B 5HZHA 5C81A 2WKPA 1ZC3A 5JYDA 1IAQA 1NN5A 1C7ZA 2GN0A 3WAKA 1IY8A 3E5NA 2O6LA 2ZT7A 1Q1QA 2VWHA 4KE8A 4MCAA 4WXRA 5DW0A 4B84A 3MBIA 5HMLA 2F9MA 2HWWA 5FQNA 1PK7A 2FRVA 1G8FA 3F5FA 4J3FA 3TXAA 3UF0A 1JDTA 5KAMA 2ZZMA 2IA5A 1YQTA 2ZRAA 1U2GA 4OGWA 2ERXA 4P53A 5EHZA 1OX4B 4G1UC 5AM0A 1Z35A 3PI7A 3PK0A 2GAJA 3FFTA 4EO7A 2D7DA 5SZIA 5FUYA 2HK9A 1QR6A 4DCVA 5F35A 4M8LA 4RV5A 3CE9A 1RTTA 4OAQA 5K3SA 1ZM9A 5LZ7A 3S44A 3WGKA 5JRJA 5U9CA 2IH4A 4WPGA 1TT5B 1L7MA 3BAZA 1OIVA 1KO4A 4MVJH 4ZVSA 2FUEA 1G66A 4AWAA 4DQVA 4XWKA 1MEOA 3GH1A 2E4ZA 5I5EA 4C7OA 3CEJA 4ZWNA 3RHSA 2HV8A 3ADKA 4JT2A 4F93B 5FA8A 4KR7A 4HNGA 2FH5B 5FIUA 5BMVF 1Z3IX 1N8NA 3PF8A 4I55B 4GGPA 4QRDA 3WKEA 3IOCA 3RG2A 2AXEA 2JLZA 2XMGA 2F43B 4LX8A 3ZIDA 1IBRA 1ZK0A 4DSZA 1VP9A 1FP2A 5B4VA 3EXHC 1WD5A 4ZO8A 3WDKA 4YJDA 2MWMA 3HPQA 4W1RA 3SEFA 2P7IA 3ZJTA 3D81A 4DLRA 3BCHA 3VGJA 3PDHA 4Y30A 1YIAA 1E0AA 1DC7A 1RI4A 1VI5A 1R10A 3EAFA 2H2HA 5TX7A 4WCFC 3ZDCA 1NNSA 1LWOA 3LT4A 3H99A 5ICSA 4PCVA 5KVCA 4LOLA 3WYFA 4BZWA 4IRMA 5DX0A 2VT7A 3A8TA 2IOYA 2QLFA 3BF7A 3L7YA 2WU4A 2G25A 3NQ41 1B4DA 2C4KA 4F4HA 2QE7D 3O4IA 4GOOD 4BZPA 3TLZA 5G0SA 1YOBA 2IZZA 2Q4TA 4MEAA 4PSDA 3U3KA 4WRRA 3WWEA 2P3OA 2QRPA 7REQB 5DTQA 3ZE2B 3EXEA 3EJWA 3P8ZA 3IUNA 5G1PA 3SZUA 5ITZA 4MPDA 4I50F 2C00A 4KXFB 4UUNA 3WAJA 2W6OA 3V9AA 2IPOA 4NNOA 4JKIA 2XRYA 3A4NA 4J0CA 2FLWA 3Q7RA 3B1WA 4FJ1A 3DHYA 1Z22A 2JLAA 3H2IA 1OCEA 3AESB 4QFDA 1AGXA 3NBKA 1MP0A 1NN1A 2R5NA 1T1EA 2WV9A 1XJ5A 4IXTA 1ZOSA 1WSDA 1K7YA 2P9FA 1YK1A 3GUZA 1L4UA 2C9BA 1P1RA 4LJ7A 1TJYA 3PXEA 4LWPA 3VC2A 5KYWA 1ZESA 4KXQA 1NNLA 4FEAA 4D9JA 2WB2A 4G5QA 2R7KA 1JTFA 3VNAA 5IKXA 2IKSA 3KEGA 4KAXA 4GRIA 1H1TA 2VQSA 3ELYA 3VH2A 5J4KA 2J0EA 3PJGA 4AT1A 1CQJA 1OI4A 1PJ2A 2PCJA 2HSWA 4TXNA 3TDKA 4TKUB 5L3SA 3QJYA 4GECA 8MHTA 2R86A 2XUKA 2ZRJA 3E2MA 4JXJA 1FRVA 1U8TA 4MUXA 1UPBA 1KERA 1DG9A 2I67A 1EEHA 2ZBPA 1VPTA 5LR6A 4EYOA 5JYBA 1DFHA 3OZXA 4UULA 4YRRA 1OPRA 4WEOA 3BIWA 4EA7A 1PG0A 1PV4A 1P77A 3AC0A 4IEFB 1YNOA 4R1PA 2R97A 2GN4A 2OFWA 3LS2A 1SHLA 3ONVA 4LG1A 2AZMA 2ZRCA 4JI0B 1EZ4A 1K6MA 1N3YA 3GJTA 4MULA 4PO8A 3HJNA 2PKQO 1CV2A 2HMYB 4C7JA 5ADHA 3OWXA 4KNYA 4H4DA 1TW2A 3IEKA 3R7FA 3BG5A 1MQ8B 3BWMA 1OZHA 3CGGA 4BQQA 2NVUB 1AKRA 1YZNA 2C7BA 3R8CA 2R84A 3ZE0B 2NO1A 4LKRA 3X1KA 4AJKA 4EB6B 5JUWA 4LC9A 1I7SB 1PNRA 2PD4A 3ELUA 4JX8A 1CZRA 4RTSA 3PRHA 5L51A 3OKCA 4BMOB 4K9RA 3DLIA 3DH0A 3JQQA 3G02A 1BXRB 2AEMA 2B2CA 2HDHA 3QV1A 4AP5A 4KQ1A 4G0QA 1M72A 3HZZA 5AI6A 4DA8A 4D6YA 2XZDA 2WC1A 2YINC 3R3HA 4WECA 2C61A 2ZJOA 2VWQA 3TQIA 1A8UA 4RY2A 2AI3A 3HCAA 2AN4A 2Y9MB 2MIIA 1P72A 4IY1A 2CDAA 4C0BA 4DSUA 5EIAA 2ZSJA 3FSJX 4JJAA 4RK4A 3CLTD 3ZWBA 4D41A 4ZMBA 5LYYA 2G1UA 3ZLVA 4JENA 4HXYA 1RWPA 4MGYR 2B34A 4ZT2A 4BE9A 4WI1A 3VO9A 4GX2A 2IC5A 4FIZA 2VYFA 2EVWX 1X6VA 3STWA 4BV2A 1NMXA 2DECA 1IIBA 4RNDB 2MOKA 2B1QA 2BKVA 4QARA 2YRWA 4MV7A 2FN7A 4X66B 4RKEA 3TZQA 2D62A 3E6AA 3EOZA 1K92A 3G8AA 1FPMA 1TTPB 1QQAA 1VPWA 2I99A 1BJKA 2GM9A 4IW3B 4TTTS 3A3YA 2ANCA 4TV9F 3SJCA 2A1UA 2XUPA 5BMOA 2AQHA 2PSDA 2BI7A 5JPDA 3S40A 1VGRA 3CNEA 2G4CA 3PC4A 2Z8YA 4I2NA 4DV2B 4KTVE 1TMKA 1L5HB 4W5OA 2E1RA 1ZW6A 2O7RA 3KSBC 4KIUA 4Z4CA 2JZCA 3MK31 4D7AA 4DV0B 4L5BA 1MH1A 2XF8A 3G8CA 1MIOA 5L3ZA 4FXOA 5I8WA 4TN1A 2YZGA 1VCNA 4HNAB 4XE5A 1IL0A 1RRMA 3JYNA 3ETNA 1RLTA 1G8AA 2JBWA 2LBPA 1GN9A 1Z8NA 3D6TB 3F7MA 5B58T 5KJ6A 2WAYA 1PVDA 1Q92A 4BJ1A 2CW5A 3RROA 2WDPA 4KXXA 5HQTA 4IDFA 4KQIA 1Z0UA 1T8TA 3LPCA 3HLKA 3BORA 4D0RA 2PD6A 2RBKA 4KSCA 4CF7A 4C0SA 1ZR2A 3EZ2A 4KE6A 2XYVA 1P5HA 3OLCX 4NZNA 2NZVG 1YGYA 4MVJA 4C43A 2NO5A 4FZRA 1WHTB 3E9ZA 3HJRA 2A9KA 4COKA 1QOQB 2PXAA 3CO5A 3EVFA 3OOEA 3PNBA 2WF7A 2BKXA 1BQEA 3E9RA 4A2WA 1EFTA 4MIEA 3AFGA 4X41A 4D6PA 5BVGA 2OBNA 3N76A 5EXDA 1GGNA 4QULA 3UCXA 4G4IA 4QJ5A 4DYDA 2BFDB 2ZXFA 1GZHB 2A9RA 2F1OA 2OZEA 4IDOA 1UBSB 2OZLB 3UJCA 2AGVA 4AP6A 3I0MA 3EIQA 1SUBA 1TRHA 1Z33A 1WMBA 3GEBA 4OBWA 5DGHA 4AY2A 3M1IA 5E6SB 3WWYA 2CJXA 1TB4A 2IOQA 4M9CA 3EXG2 1XXHE 3UHJA 3W2EA 4G0XA 4EAQA 2BGJA 3GI1A 1MDBA 1FTQA 1I10A 2VYVA 2MSWA 3I0ZA 1ABBA 2QMQA 1G3IA 1KVQA 1JFLA 3NNNA 3HDQA 5AJTA 4KVGA 1Y63A 4M7PA 1YMVA 1V11A 5ANRB 1VCHA 1CF4A 1DOHA 4MP8A 2Y76A 2W8BB 2OGWA 2QYSA 3H8SA 1XNJA 4QYTA 4TRNA 3W4IA 2EDCA 4CTKA 2FFJA 2H08A 1TVKA 3PL1A 3CUWA 1OHHD 1D2EA 2YW2A 4GYYA 2O8VA 4P9NA 1P6XA 1RAHA 4DTCA 4MP3A 4K6CA 2YYYA 2JAHA 3T0IA 3L05A 4ZRMA 3QFFA 1NNUA 5D5PA 3N2GB 5C34B 1ORHA 2OAP1 3S8YA 4KHPB 4KAJA 2HJSA 1JJ7A 2NZXA 4L27A 3V4SA 3G59A 4MCJA 3KUDA 3RS5A 2HA5A 3K2EA 2IYPA 2OD2A 2DB3A 1I7QB 3WLSA 1MAWA 2YBDA 2HY7A 2ZUBA 2IS4A 1P8JA 3ICOA 3C4VA 2ZYAA 4FN5A 4QO7A 1Y9AA 4RA6B 3LYLA 2IU4A 3BTUA 4A16A 3HRIA 2JIQA 2YJTD 4CI9A 5KTNA 4R8RA 2ZWMA 4EK9A 4FMPA 2HRBA 3KYCB 2EF0A 3AF0A 3THSA 4TPKA 4U7HA 3BJEA 3BJRA 3SQMA 1IZ0A 1Y7TA 4JX9A 1AY0A 4ZAGA 2PXHA 4OV6B 4HKTA 2NACA 3VNBA 1EK6A 1F60A 1TLTA 3UKJA 4Z4QA 4PX3A 1X80B 3QUCA 4B32A 2XZLA 2G72A 2CMFA 3F4LA 3QBVA 2QENA 1LD3A 2QY9A 3IO5A 4MS3A 2J3IA 1XMJA 3KQOA 4PG7A 4OJMX 1EHCA 3FYUB 4FLFA 2YVUA 1XA3A 4L8FA 3RH0A 3A04A 1BXGB 3DTVD 1FJGB 3EGDB 3AFNA 1WUTA 2C3YA 4B79A 3A3KA 4XQ0A 2BRUC 1L7PA 1XVUA 2XBLA 3KQQA 1GLVA 4O2AB 4DF3A 4QVKA 4Q1FA 3EHEA 3MCVA 3UAZA 4XWOA 4UEOA 2B37A 3VBEA 1X87A 4NTZA 4HAUA 1A4XA 2V7XA 3T7RA 2Q3MA 1GHTA 1XOIA 3CG4A 4NE9A 3P9IA 1ECPA 1UFQA 3W2HA 1BW9A 2RHCA 4NBVA 1Y4AE 1FDUA 2JGJA 2ZLBA 3P20A 3RC7A 2I6GA 3BFPA 1B14A 2FUKA 3LWDA 4HGYA 4AZ3A 4BMNA 5BT8A 3PQDA 3CRNA 3KV3O 2PNJA 5B37A 1UP6A 3X2SA 5IDXA 3NOVA 2WK1A 5TEVA 1Y1PA 2R6ZA 3ECCA 5ICCA 1E3LA 1E3WB 3F2VA 2VAVA 4U7PB 4CMEA 3HN7A 4UBJA 1TM7E 1UFKA 2XUJA 2OY0A 2ZSDA 3B3QA 5EZ6B 3HWWA 1CR6A 4G0MA 1U2EA 5K0NA 3MT0A 3D43A 3UT5A 3PE3A 3I42A 1XMSA 3RQSA 3HKBA 4PSCA 2H1LA 3E81A 1ZK2A 2AFIE 3KZVA 2JFWA 3L2OB 5DEOA 5DN6A 3TUJC 4UZSA 2ZZKA 1WY5A 1QC5A 1G4AE 3MBKA 5A9SA 2G1AA 4LIPD 4JWTA 1V1RB 3B52X 1PWYE 2BHNA 4N65A 1N4AA 3CVWA 2C4MA 2PL5A 3IIKA 1L5RA 3L18A 4KFSA 2XAUA 4LGMA 2QSZA 3UXEA 5CB0A 4OKIA 5AQEA 1VHTA 1UZAA 1PUXA 1YL6A 2P2DA 1DO8A 4NJEA 1HA3A 3GRYA 1NUTA 2ZAYA 2B61A 2QD4A 4HDCA 4HEQA 3T9FA 3RBXA 2IY8A 2NU6A 4EEXA 1BMTA 5KTKA 1MRZA 3PUIA 2VYCA 3HCRA 2G9RA 4F1WA 3FCSB 5A4FS 2PRSA 2J67A 3P9QA 2A7XA 3NALA 2WJJA 5I7WA 2P79A 5AJUA 3JQ9C 3K6SA 2X8JA 1IZYA 4U2GA 3C1UA 1PK8A 2Q0QA 4L72A 2NUAA 2F8SA 4X93A 4FEYA 3MINB 3GEGA 4ARBA 1R66A 3F46A 1JUDA 2G67A 2QY6A 3L6RA 1P9RA 1S2DA 3E2PA 4AQDA 2XAAA 3I30X 6AT1A 3UHAA 3DQZA 3A27A 1A2BA 4EYQA 4TQ9A 4DDUA 4NJMB 4QA9A 2C4WA 3N2LA 3QVLA 5DHFA 4R51A 2Q5IA 2GWRA 3SX0A 1JR3A 1Y1RA 4FS3A 5L9AA 3LNTA 2H11A 3I6ZA 3GO4A 2BBWA 4F85A 3IVXA 1Z6TA 5JLJA 4LEIA 2QX8A 3OTHA 3MZ0A 1A27A 4UFOA 3U4QB 1I7NA 3OZSA 2PY6A 1XCPA 4LJAA 1RZRD 2AEJA 1O1YA 3ONDA 4NPHA 1TF7A 1O6CA 4RA9B 1VCOA 1Q0ZA 1ZLYA 4EG8A 4OGLA 5CXQA 1HV8A 4H08A 1JKFA 2QVXX 1MORA 4C7XA 4ZGGA 1U4NA 3CFYA 1AQNA 1NRXA 5C18A 2ZREA 2YV3A 4IDGA 2WICA 2PMWB 4TTVA 4F4IA 1ZRMA 1GV0A 1VJGA 3M6IA 2WG1A 5D5HA 1Y8QB 3GLHB 1ZZGA 3HM2A 5E8JA 5GWXA 3RC2A 4F4FA 4J49A 1ZJYA 3QYFA 4GMHA 4D3YA 1B7GO 2WUFA 3H5IA 3F5QA 2EATA 1ATIA 2QL7A 3NM5A 3JYHA 3RVLA 4C2TA 2O0KA 1O94D 4BVFA 3ENQA 2OP1A 2QM7A 1GNPA 2HMVA 3BTVA 3ILHA 4L7VA 1HTBA 5KI6A 2J9YB 1XHFA 1MB9A 2BGTA 1W2GA 2O2YA 1N33B 1C29B 1UJ2A 1F2TA 4MUHA 1OWOA 1P5JA 3WB0A 1X9GA 4GGOA 4G37A 3HBMA 3O7MA 3QW4B 4QTUB 1Y7IA 2GEFA 5INTA 4IZHA 1JXOA 2JHAA 3GJRA 2GD0A 4KE9A 3GW8A 4A7PA 1IUOA 2GXQA 2NQ8A 4C7MA 4PIVA 4QOFA 4PBTA 1HFWA 1WW8A 4PHGA 2HFJA 2A0YA 5TQ0B 4AUMA 2D59A 2YS7A 4DLWA 3OLXA 2FX5A 2WUEA 4MYUA 3KAQA 1QVZA 1LDMA 3GG2A 4C04A 3ROGA 2WIKA 2BSXA 4LSWA 4DMMA 1TPYA 2RGAA 3DT9A 2ZI4A 3OD5A 5ALXA 3SYMA 1NVFA 4RSRA 2DFNA 2OFFA 2PZLA 3LHIA 1EVIA 2B3TA 2I2WA 3GV0A 3GLQA 5EP2A 5H0IA 5SY9A 2ICAA 2EG5A 3LUFA 4HB3A 2Q7DA 3WRXC 3P2MA 4FI3C 4B6QA 1IN5A 3W5HA 3WWDA 1QWSA 1N2ZA 4R8KA 5EJGA 4LQCA 4C0LA 4CODB 4P3KA 5CD1A 2ZUDA 3OBBA 3WGQA 4KLAA 4BKMA 4LOIA 3V9PA 3Q9UA 4JGBA 5F76A 2M6LA 2R87A 3LQ4A 1IMOA 4B8YA 2XRZA 3WGIA 3WLNA 1K5GA 2MINA 4LRXA 4K81B 4WLNA 4OMFG 2ZUUA 4GLOA 1MIHA 5IUKC 2C8VA 3C3WA 3TLBA 2WWRA 2IS6A 4JAVC 1PUJA 3TRKA 2DFVA 2DRIA 4BIIA 4BDSA 2BV3A 1OTYA 3QF4A 4I9HA 4RFLA 1Y3IA 1XKXA 4WZAE 3UUWA 3WK6A 4OKSA 4N6NA 4YP6A 1BGVA 1I0ZA 4MSUA 1XDWA 1PQ4A 3FGPA 2AEFA 2DSTA 2P9JA 4DZZA 3IEXA 1K6IA 2ONZA 3WYNA 1AV6A 5LP6C 2ZYTX 2CNLA 3LY5A 4CEJB 2CEAA 1AHPA 4ZQEA 5T64A 3JRXA 1NA5A 1E2HA 3S2EA 3FNHA 4YAKA 4KV7A 4NYJR 1LXCA 1V47A 1Q0TA 1YS9A 1JHXA 3TL2A 1PDWA 3DBHB 2H29A 3I0NA 5BSWA 1X74A 1Q83A 3GMSA 2FWBA 4Z7JA 2VPQA 2HA7A 4IIUA 4L2IA 1NV8A 3EHDA 3NDRA 3IAEA 3L0CA 5DT2A 4CIDA 4E4RA 1IFXA 1OFGA 2XCUA 4RVGA 3NHLA 4M0KA 5J2TA 1Q7GA 4IHJA 1ZN2A 4H18A 2V4ZA 3KUUA 2FMHA 4IGAA 2P65A 4CEIA 4P31A 3K0AA 4U9UA 1M1YB 5EMNA 3R3YA 2DX7A 4HQFA 1ISRA 1N5JA 1T0HB 5CYFA 4MMZB 5I9MA 4XQCA 2HCJB 2VF2A 1AK1A 2QRNA 2VF7A 2XCIA 4S0XA 2WQ6A 2HHLA 4CQLA 2F3TA 2VWPA 2RI6A 4N7RA 2FW9A 3LYUA 5ERGB 5DDIP 2VEOA 2RK3A 1JTEA 2EEPA 4I1UA 1M1XB 2ZWIA 1SQFA 4QATA 1IVYA 3KSUA 3NJ4A 3OLYA 4PFJA 4UM7A 4YN3A 6ADHA 5LD2C 1JJAA 5C46F 2I4MA 1TJ4A 3IKTA 1CDZA 1IUKA 1DLIA 2BCGY 3II6X 4HAXA 1YE8A 3RYFA 2AB0A 3S3TA 3KQLA 1T3GA 1YQEA 2WJIA 5T4EA 4TMKA 2RB4A 3ZWCA 5LZ9A 2IPXA 2J85A 2P41A 5F51A 2WZDA 3MMXA 1U3WA 1XCBA 1BFUA 1G20A 4FEGA 4I6GA 3V2GA 4V03A 2P4UA 5I6DA 2FWRA 1S2MA 1XROA 1J0AA 2XCQA 4LZZA 4FOSA 2ACVA 3ME5A 4EELA 1YR2A 4C6RA 4JKYA 2C3UA 4AI6A 3PVCA 3PHHA 3SR0A 1M66A 4RGYA 1ZNQO 5MFPA 3MUFA 2GOYA 2B7BA 4HZIA 4OJNA 3VPSA 1KOGA 1C7EA 1VL1A 2XXBA 4UUPA 1U8YA 3S7TA 4CM4B 3ND5A 1PYOA 2P4SA 1AQYA 4JL5A 4PZDA 4NDNE 5CGQB 3W3ZB 3ZBQA 3OCXA 5H1YA 5BSRA 5GJWC 3DE6X 2VH1A 1IY2A 3NFYA 3LWNA 4IZIA 2ZS8A 1RZVA 4AN0A 4BX8A 1XZDA 3DMTA 1VYTA 3DB1A 4I6EA 3SMVA 3UZUA 1CUSA 5KVVA 1UF9A 2H1OA 4R7GA 4RM3A 1YSCA 2ZROA 2WSSD 4CJXA 2ZYGA 5CG2A 3LC1O 2IEGA 4YONB 4EJFA 2W6ZA 5BWLA 1WXWA 3D64A 4IWXA 2PRIA 4ZARA 4BMZA 4GVPA 3QELB 4Z7QB 2H4JA 4IVPA 1Q57A 4WZZA 1GLGA 1TC2A 4HSGA 3H1TA 4GKVA 4IF6A 4UQPA 1XV5A 1A5BB 1Z68A 3WQRA 1F8XA 1R1DA 1ZGCA 4G9GA 4L0QA 3RADC 3KPVA 1R5OA 4P0TA 3GOHA 3B5JA 2WT4A 1DINA 4I5GA 5A3RA 5JHHB 2O8BB 2RCYA 3WFZA 1B73A 5E9AA 3OMXA 1CDEA 5HYVA 2C5EA 2OXFA 1BXKA 2RHBA 4DT1A 5MGNA 3ZBPA 4DVGA 2AMFA 1GG9A 2HRQA 1RPZA 3OEED 1KI2A 5EJ2A 1U9YA 2WIBA 3A9VA 5CFZA 3VNUA 1VL8A 3ND8A 1RQLA 1N2BA 2GKOA 2FEOA 1KZYC 3G6KA 3M9XA 4LZNA 1MO6A 3L0SA 4LUCA 1GTZA 4EO4A 2GPWA 4BP8A 3KXKA 1J8QA 3QLUC 5K8TA 3GGOA 5CHYA 4ALKA 3WGTA 4MUEA 4OHUA 2GDZA 2OC4A 2XWQA 4YT2A 5BW5A 3RVJA 2CVPA 2H2FA 4BFZA 1PD0A 3TTSA 2UZ4A 1U8FO 1YCGA 4P0QB 1OGIA 4BBJA 2HU5A 1L5OA 2DHQA 2WMOB 5FL7A 3RGGA 3UGKA 3U1VA 3BM5A 1A95A 1L5ZA 2SCUA 2VAMA 3AF4A 4LXQA 4BO4A 2P5SA 2HV9A 1MGPA 3AF6A 3QX3A 2XH8A 3PDIB 4OKNA 2NSDA 1EB8A 4MJ3A 2BCEA 2JGLA 4Z0NA 2YN0A 1RD4A 2IUYA 3DC2A 3VQTA 4AJLA 4RAQA 4QWWA 4CF5A 2BFBA 4UFPA 3HE3A 3MLEA 2C2GA 3DNFA 3RAFC 1HSOA 1ST2A 1CJCA 3TM4A 4KN6A 5COQA 2FN3A 2QD3A 2XYHA 4M1WA 4TXJA 3WFIA 4LF4B 3IT0A 2E4XA 1YKGA 4EJSC 3FPAA 3HYCA 2QPAA 1M73E 3NV9A 4D4IA 1YACA 4OHFA 1N6NA 1QCDA 1AG9A 1KJYA 3OZIA 4KWEA 3R7WA 3UUFA 3OKFA 3U16A 1NW9B 2PWAA 3PIDA 1AM4D 4NARA 1U8CB 1GL6A 4PQEA 4W8OA 1Z4JA 5D8DA 1XJQA 2AE1A 1CQIA 4QBHA 4YCSA 5B6IA 5KTYA 3WAGA 5FPQA 2KWIA 1XWIA 4HGQA 3NXKA 3WTBA 3IL2A 1IWOA 3GEPA 2JVIA 2C7GA 1O77A 3E0XA 3WNVA 5E7QA 2WPDA 1DMSA 3JAWA 2GA8A 3H4VA 3E9NA 4JQYA 2OBBA 3C3AA 3O4RA 1SXJD 4XVQA 3GXBA 1YB5A 4L8LA 4EHFA 4ZP1A 2ZYUX 2OFOA 5LKRA 2W11A 3AIKA 5DJ5A 5CFLA 5CUQA 5KMGB 1LK7A 2BFFA 5E8RA 1P2SA 3KALA 5HM8A 1U1GA 3G7NA 2AEEA 4OHKA 3TFOA 4WA8A 2W90A 3HYSA 4U3JB 3O73A 2VTVA 4N39A 1A04A 1L7VC 3KFVA 1LPNA 3NTQA 4R69A 4Y2PA 5DE3A 3VR4H 1Z4OA 3TOSA 4PZEA 4EAAA 2C1EA 2TMKA 1X1AA 4U9IS 4ZU3A 5LQDA 5EIWA 1DX9A 3C3KA 1BHJA 1FMLA 1XXLA 2WM3A 3R09A 5KNBH 1BROA 2GPYA 3RBZA 4BFSA 1KDPA 1TAQA 2AR7A 3GJ8A 1Z0DA 4H6PA 1TU4A 2BMWA 1A7KA 1I7DA 5LZ2A 5JAOA 1JI3A 2O2ZA 3SHVA 2EJUA 4L85A 1K6XA 5ECDA 4FD2A 2WU0A 3RAJA 4TWAA 4V1CA 2B20A 3OSZA 3D4PA 2QNRA 4Q4AA 1W1UA 1XTRA 4F2GA 1SAYA 2JH9A 2ZVDA 2WJPA 5I7AA 4X9XA 2IXEA 2GPTA 1E4EA 3P19A 1OZGA 1MZVA 3FKSD 2AG8A 3DM9B 3G5MA 4Y1FA 4FE3A 1V5WA 3G2QA 5EXTA 5AW2A 1Z4QA 4W9NA 3AF3A 1CWUA 4JDPA 4RMIA 3QWBA 4LRQA 2G36A 4D26A 3T1VA 4TTPA 1KO8A 4AJ2A 5I48A 1G42A 1NYRA 1S8FA 4ERNA 5AI9A 2QU8A 4J7AA 5D6OA 2O7NA 1RCUA 1CSEE 1SVKA 1K97A 1U28C 3N8DA 5JE8A 1V39A 4B4VA 4E31A 3ZHCA 8OHMA 1I5OA 2REQB 4O4IB 2GN8A 2Q6TA 1Z18A 3U4MA 4MVJM 3OO0A 1D4OA 5IYZA 1YBMA 2QL9A 3ETEA 1K5DA 4CFZA 5KWVA 4HBGA 5HK9A 1RKBA 3I4FA 1KPHA 4F2PA 4I8XA 4OQLA 2HL6A 3HKCB 3LUPA 1TCAA 4TUYA 1P3Y1 1S1CA 1UBNA 1Z4LA 1JJIA 3CWCA 1FF9A 3PNLA 2UYYA 1P44A 4MUYA 3GJ0A 4HWTA 4INZA 3B2NA 4RPCA 4PN7A 4DQKA 1Y6ZA 1PJTA 2RGEA 3PKJA 4MINA 5JT1A 4KWIA 1UEJA 5EHNA 2BPOA 1TW3A 3D1LA 3TQSA 4QG3A 1AMNA 4PWZA 3S1AA 2BKAA 3AR6A 3PR2B 2QTVB 4UBOA 2E82A 4PS0A 2ZDGA 1U5AA 3H2HA 1U90A 5K6AC 3ANLA 5HIKA 4O3MA 3OZUA 1GY8A 3TIIA 3TTVA 1Q0QA 2GSWA 2W2MA 5JDIC 2YZKA 4A03A 5K2OA 2R1TB 4OGGA 1DPFA 4FMDB 4NAHA 3PYXA 4MX8A 2GRJA 5DK4A 3SZLA 3BRWD 5EWMB 3G13A 4HEJA 1X2BA 4DIDA 4JJ8A 1OC4A 4FEEA 4BNXA 1O3YA 1RYFA 4ZXPA 3UB4A 4WINA 4XYMA 4JB3A 1D7OA 2BTQB 2YWXA 2K2QB 3OZRA 2V7UA 4XR9A 4YO7A 2FZGA 4JELA 2V55B 3OX2A 3L82B 4N3AA 4YGYA 5GGYA 3TK1A 3RV4A 4EVQA 2G8LA 4AICA 5IEJA 2VYQA 1SHTX 2R6AA 5DMXA 4TYWA 3AY0A 4RHCA 5I9BA 2HUNA 3E05A 4CV0A 4BKRA 3OA0A 1E3SA 1KDVA 4GRDA 4XSVA 1J5EB 2NZ8A 3LK6A 3ONFA 2QORA 4R2HA 4UHKA 2JAOA 3RVKA 2PFGA 5HJEA 3WHKA 4JC8A 2GLTA 5I4BA 2OBLA 5CB8A 1SUFA 1E7SA 1SCDA 2CXPA 3CKYA 3A9TA 3OIGA 2H7YA 1DDOA 1FC0A 4CMHA 3ZHZA 2QSYA 3EEYA 1EWYA 1N7HA 1I5EA 4HNTA 4HSEA 1VHQA 1X7ZB 1KZ9A 2GBFA 3AJ9A 3C7TA 5F9FA 1Q22A 3ANYB 4O0LA 3NTLA 2B4AA 3LKVA 3I92A 1E2LA 1JLHA 2L69A 3JASB 2R1VB 5TT1A 4K6OA 2QUBA 1L4MA 4BFTA 1F20A 4BRSA 4FW8A 1M2KA 4P4SA 1K3UB 3G89A 3BHNA 4QDOA 4X8HA 4YY3B 2YXEA 3CZCA 1RQRA 2JARA 2XWBF 3Q3JB 2O50A 2VF5X 3G0GA 4WN3A 3RWBA 3WG9A 5B55A 1D09A 3O91A 5FF9A 2H1FA 3D3KA 1IM5A 1QKIA 3O8OB 3E9DA 1G55A 3WP0A 5FULA 3L8YA 1E2BA 2QD1A 3DKKA 4OP2A 1UBRS 4HDAA 2OP0A 3H0KA 4V0SA 3EQ2A 3M5CA 2C0QA 1ENZA 4WNAB 4DM4A 4XCQA 3COJA 3HI4A 3PSHA 2GARA 3AERB 3HB0A 1ML3A 3NWEA 1OTXA 2OGZA 5LDHA 2V7TA 5B7PA 1PFWA 1MJGM 5DTIA 3SKVA 2C07A 4IR7A 1R0SA 1XJWA 3R77A 3LRPA 1L3CA 3I9V6 1U04A 1NVKA 1MRSA 2ZB7A 4JYCA 2HO4A 2VP4A 4QVGA 2ZTHA 3I28A 5DYYA 1Q17A 4IFIA 2O2IA 2WVAA 4G41A 1X38A 3CR7A 4D43A 3EARA 4ENTA 1PGJA 2VUUA 4GSYA 3LTEA 4JS0A 1KJNA 3U7QA 3VVLA 2KLHA 3NYWA 3Q98A 3HCCA 4JFRA 1Z6AA 5ALKA 5LA6B 3N7TA 3RR2A 1J2RA 2O2JA 3H84A 3RS9A 3T9AA 1H8HD 2X9NA 4BNUA 1KNXA 4DBLC 5ITSA 1G3QA 4Z1MA 4ZVPA 5IJ0B 3VR4A 4LBZA 3GLFB 3P96A 1M34E 1WWKA 2BP7A 2Z30A 4YDSA 1C3VA 3VPAA 1FYWA 2QVBA 4NEQA 2BTEA 1KDRA 2G9VA 3DLPX 3QKUA 5G40A 1HDOA 4HX5A 5LC1A 4C1BA 4TKVA 3U0BA 4ZHQA 5KNBA 1GNVA 1O58A 1U9IA 1D0IA 4J16A 1G0NA 3R6LA 3STUA 5LDDC 3U44A 1RHKA 2OHFA 3EDQA 3FGNA 1QYRA 1W0CA 4BFLA 4JQZA 5CB4B 1VG9B 3A25A 4P4NA 3COYA 1N0WA 3T7SA 1OAKA 3NTUA 6CHYA 1RRCA 2YOGA 4OQ4A 2PT5A 3GCZA 5LVAA 3BHIA 4KWTA 2B35A 3LW8A 4LXYA 2ID4A 3F1KA 3K0FA 2J7KA 3RYHB 8AT1A 1V6AA 4GYJA 3MW8A 4GVXA 2PKCA 1KKLA 3OI7A 1TNDA 4HRAA 1VYHA 5TF4A 5JNLA 2VTBA 3ASYA 4F84A 2X0NA 2BKUA 2D8MA 3STTA 1RRFA 1SNYA 1XPJA 3R0JA 5MN5A 1H4VB 5A9TA 4C4YA 1FP4B 2QN2A 4R16A 3IPYA 3PL5A 1WQ4A 2HU8A 2CY0A 1HETA 4RWEA 2DAPA 1VZ3A 1ZGGA 3I05A 3L0YA 2YASA 4NONA 1LI5A 1L5KA 3MWFA 3D3EA 3ZIAD 5C8XA 4E5YA 1N9GA 4J0GA 4KWHA 3TNJA 1W44A 2Q4OA 1OH5A 2OILA 1A8QA 4R5MA 1IONA 4E11A 1L5MA 2C7VA 2P68A 3OUZA 4JI3B 2G09A 3U6KA 4Y0NA 5A7FA 3CB4A 3SHTA 4UCFA 2XVZA 1JSXA 4Y2GA 1DDIA 3QVUA 3ZE6A 5F2KA 5FNVA 2M9MA 4PM4A 1N6HA 1JYSA 3B7PA 1Z7BA 2C57A 3OM0A 4UBNA 4D8VA 2DXIA 1ZVQA 3E61A 4G8JA 2XTMA 1XLWA 1JL3A 1RXCA 3OQ1A 1X1DA 1CRPA 1Z5GA 3AKZA 3RTDA 4D9BA 1QVAA 3CLKA 2EC5A 3GF4A 3PNPA 3SGLA 3FB4A 1ZUIA 3VRHA 1GDDA 1TTQB 4WOKA 5ALEA 3ZS9A 4Z4EA 1I2AA 3N05A 4PLZA 4TLBA 3A4VA 3INRA 3VHXB 2D0IA 4XYEA 3SM9A 5LQRA 3FOEC 2PMCA 4L0DA 4B2IA 3LTNC 1Z3CA 3M4XA 5D5QA 4ISCA 1U2QA 1XLVA 4A8JA 3K20A 3JRNA 4RVFA 5EVJA 2F3SA