4ICIA

Crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
NSKILVAYFSATGTTARAAEKLGAAVGGDLYPIAPAQPYTSADLDWNNKRSRSSVEMNDPKMRPAIKSKKENIGTYDVVFIGYPIWWDLAPRIINTFIEGHSLKGKTVVPFATSGGSSIGNSATVLKKTYPDLNWKEGRLLNRTDEKAIRAWLDVIAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative flavoprotein (BACEGG_01620) from Bacteroides eggerthii DSM 20697 at 1.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Flavoprotein
molecule keywords Putative flavoprotein
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iciA00
3U7IA 5B3LA 5A4KA 4N9QA 3GFRA 3K1YA 3OX3A 5LJIA 3F90A 3FX2A 1SQSA 2W5UA 3OWHA 3R6WA 4FGJA 2KQUA 1J8QA 3N39C 2QX9A 1D04A 1D4AA 3NFRA 3NHUA 4FGLA 3NHJA 2QR2A 2Z98A 4XDHA 1FX1A 1J9EA 1AKQA 1YOBA 3LT5A 4XDGA 3ZHOA 1B1CA 4ICIA 1F4PA 2FLVA 2M6RA 1QRDA 4LTNA 1XI2A 3W78A 5FUQA 4LA4A 3FNIA 4DY4A 2Z9CA 1TLLA 2BF4A 2MWMA 3OJWA 1RTTA 3JSXA 5F12A 3F6SA 1H69A 1NNI1 4LTMA 4QOFA 3L9WA 4QODA 2GSWA 1FLVA 2FVXA 3TE7A 5F51A 2A5LA 1SG0A 1XT6A 3OX2A 1CZKA 2OHHA 1FVXA 2MOKA 3ESXA 3N3AC 4YAFA 1X77A 4R81A 3L9XA 1QR2A 1QHEA 3B6IA 2V9CA 1FLNA 2AMJA 4C76A 3P0RA 2QWXA 3NHFA 4PTYA 5FX2A 1DXOA 3NHSA 3G5MA 4D02A 4Y7CA 4N82A 1CZOA 1ZWLA 2BPOA 2X2OA 3ESYA 5NULA 5B3KA 5JROA 1BU5A 2QMYA 2FDXA 3LCMA 2HPVA 6NULA 1VMEA 4YAOA 1GG5A 1CZLA 5NLLA 1T0IA 3SVLA 2XODA 5EA2A 1KBOA 1RCFA 5LLDA 3QFCA 2V5UA 1FUEA 2BZSA 3QFRA 1FLDA 3K20A 4PU0A 2V5VA 4C0WA 3KLBA 4FX2A 3W7AA 1JA0A 4PTZA 4QOEA 2ARKA 4DIKA 2OHIA 4QOJA 3F6RA 4F8YA 3FVWA 3N3BC 1TIKA 1YCFA 1YKGA 4S24A 3NHPA 4Y9UA 4ZVNA 3EDOA 2FOXA 3HR4A 2D5IA 2OHJA 3UXEA 3ES9A 4NLLA 1J9GA 1E5DA 1WSWA 2QX6A 1ZWKA 2QX8A 4LTDA 4U7GA 2B3DA 2XOEA 1ZX1A 1AHNA 1C7EA 2QMZA 2Z9BA 2FCRA 3W79A 1OBOA 4U7FA 1JA1A 1FTGA 3FJOA 1CZNA 2RG1A 1AKWA 3OVMA 5TGZA 5ULLA 2F1OA 3NHYA 1AZLA 4GI5A 4DILA 2R96A 3FW1A 3TZBA 1RLJA 4QOGA 3OWXA 2X2PA 1AKRA 1AKVA 2KLBA 4GQIA 3KAPA 1QBGA 4H2DA 1YDGA 3O2NA 1AMOA 3D7NA 5BUCA 2ZKIA 4YAWA 1T5BA 5LJLA 4LAFA 2FX2A 2FZ5A 5LBTA 2M6SA 1FLAA 4ESEA 5LVAA 4C0XA 2R97A 1WSBA 3HLYA 4QOIA 1YCHA 1V4BA 3OJXA 2Q9UA 5F4BA 4HS4A 4YQEA 4CF6A 4CETA 1CZHA 1BVYF 1XYYA 3NHLA 3NLLA 3HA2A 4N65A 4QOHA 2FZVA 4BMOB 4ZVKA 3GFQA 1I1OA 1AG9A 2FAXA 3KAQA 2BN4A 4J8PA 5FA6A 3B6JA 1C7FA 3F2VA 1RLIA 4NULA 1XYVA 4YALA 4ZVMA 3KEGA 1YCGA 2OYSA 1CZUA 1DXQA 3GFSA 5EMNA 3B6KA 3UXHA 2MT9A 1YRHA 1KBQA 2MTBA 5LMCA 1J9ZA 2QX4A 4GR9A 3OX1A 4ZVLA 4U7HA 1AKUA 2HNBA 3QE2A 3U7RA 4BMPB 4Y9RA 4YAUA 1AKTA 3S2YA 3GAMA 2BMVA 3NHRA 2HNAA 4FGKA 5LBUA 3TEMA 4OXXA 2N1MA 3W77A 3RPEA 1CZRA 4H6PA 1D03A 1OBVA 1OFVA 3NHWA 5EAIA 4C14A 3B6MA 4HEQA 3EYWA 2Z9DA 2Q62A 1H66A 3ESZA 3NHKA 4M0CA 2WC1A 1DX9A 3O73A
chains in the Genus database with same CATH superfamily
1MD9A 1SGWA 1XRQA 3PFNA 5A7FA 2JFWA 2RJNA 1PW7A 1AQJA 3VXKA 5ITZB 3HNRA 4F4CA 5FEMA 4DRXA 1YACA 4DVGA 4E2YA 4FBMA 3RW9A 4J0EA 1ECCA 1UZLA 4MWDA 5JS6A 3E6AA 4UKDA 2QL7A 3FLEA 2RI1A 2ZUBA 3UG7A 3QOFA 1ACJA 1MIHA 2BTQA 2VXOA 3F3KA 3HRIA 4FUQA 4LJ6A 4P38A 1RD4A 3GMTA 3PV0A 2BKEA 4GPD1 4HEJA 3VU9B 3OETA 5CDYA 1H69A 4Z1MD 5B64A 4C7VA 1H5UA 1DV1A 2FWPA 4LJ9A 4NBNA 5JPCA 1M6EX 2C58A 1SG0A 1UMDB 5BN4B 4E6PA 1RRGA 5JVDB 4PX3A 5FWYA 2WTAA 5K20A 1A4XA 1RXUA 4DREA 1TYCA 3KLMX 2BGJA 5J5CA 5JVDA 5DI9A 1N34B 1FFGA 4H1TA 3UUWA 3MLEA 3EZ2A 1YBVA 4C0AC 1O0CA 1Z7GA 4U5XA 1SZJG 2D8MA 3LDAA 3I64A 1ORHA 4LJRA 3TM5A 4IMIB 2GD1O 2VG8A 4FFSA 1QVRA 3HBNA 5FRDA 1XJWA 4ZN6A 4J0IA 4AJPA 2G1PA 2QNBA 1V43A 5KSWB 1P2BA 2QB5A 1CQXA 4UREA 3MSXA 1WB5A 1JKJB 2YNMA 2GMWA 2XQIA 2XCRB 4ZU3A 4FT4A 5BN5B 2R4UA 5KHLB 1JMYA 1C4KA 2ZB4A 1UFRA 5J1SB 2V6MA 3RJZA 4ER0A 2NIPA 3UK1A 5ICFA 1UBCA 1H6AA 4JVSB 4X20B 5IEJA 4YB8A 1AKWA 1E7RA 2CBZA 2QRKA 3D6JA 3NTVA 3NZEA 4FM9A 2BGWA 1RWKA 3QHPA 4O2AA 1I3KA 1HQCA 2I80A 5GONF 3CNNA 1XCPA 3F5QA 4BFCA 3R7BA 2Y6VA 1R8XA 1QGUA 4JU8A 1OWOA 3UJNA 3P9PA 2FRVA 4Y1RB 4KWEA 2KBEA 3PFCA 4LVNA 2VTKA 4UM8B 3KQYA 521PA 4PGFA 1QU2A 4RD0A 3FVTA 2V3WA 3ABIA 3LZCA 1L4UA 3N5CA 1PT8A 1NTOA 3PNQA 3PUZA 5AIBA 2GJ8A 4A0HA 5TEWA 3VV3A 3OHMA 5BMVF 4MV5A 4YNBA 1K7SN 2JPDA 5IKEA 3DHVA 3R0IA 2Z56A 4R0VA 4LVCA 2I4IA 1AGYA 2IZZA 1MU0A 1N7HA 1SK9A 2FPGA 2HFJA 3FNEA 2CD9A 3B52X 2YZGA 4RQAA 3NORA 5ECGC 4GEKA 3SJBA 3AY0A 4A4DA 4BQPA 1E9CA 2IEGA 2R8BA 4WESB 3O21A 4P6VF 1BFUA 2WIJA 3UBMA 1FK8A 1BD4A 1HFWA 1Y5NA 2IPOA 2O3SA 3WAKA 2PGAA 5DHTA 5FBLB 3VUEA 5BNIA 1CR0A 2VUUA 2GBFA 4TQ9A 5HILA 2AF4C 4YCCA 1DINA 1JIKA 2ZOSA 5E8JA 2YNMC 1FVHA 1TZ2A 2D0DA 4FQ7A 1PI3A 4DE5A 1NVKA 4YJ3F 1JU4A 1KKLA 2DH5A 2O14A 4P4TA 4KO3S 1LLFA 5DTIA 4BPBA 3INTA 3H05A 1W96A 3K0BA 5G4KB 5LSAA 3X1ZA 1GFZA 1XEWX 1U3VA 4B33A 2PV0A 1W5BA 2BP7A 2HA7A 3GB9A 4IJ6A 4BDSA 3FOEC 3U7GA 1BNCA 3J7AC 5PGMA 3VMFA 3EHEA 3QVTA 2LWIA 4G0YA 5HKKA 3N2NA 3R6DA 2X13A 4W7SA 3GVCA 2FVXA 4OMFG 5H7XA 5BVHB 2CJFA 1N7GA 3BE6A 3USZA 2OHFA 4IZIA 2PRZA 3M3DA 2H1SA 3CRNA 5HKAA 2PMFA 3QLEA 1JU9A 1C8LA 1U8UA 2I99A 4OLHA 1KS2A 4L5AA 4YP9A 4RORA 4GQAA 4G8CA 1E3LA 4DYHA 4AQYB 4RKQA 4UCWA 1SUEA 3S44A 4PN3A 2QMYA 2XD4A 1RFGE 4A1FA 3QVGA 4WCFC 1WCXA 4YAOA 1WPGA 2PWYA 2BEUB 3IEIA 1U0TA 1CJBA 1L8AA 1Z0SA 4JLWA 2GTIA 4G25A 4MJ7A 1PLLA 2G9VA 2P27A 4EVIA 1IHDA 1IU9A 1V4NA 3MIIA 4MGZR 2FX5A 2EATA 3BMCB 4MIKA 4QG3A 2C20A 2FHPA 2YHUA 2G17A 1E1DA 2OV1A 3OO1A 3PIRA 3W9SA 4QM7A 1GT91 2GAAA 2XMSA 2B82A 1S2GA 1M2OB 1TVKB 3OICA 4JBLA 3FAZA 3GFTA 4MSUA 4R01A 4W1QA 1J7JA 1RABA 3A58B 3KUDA 1IQRA 4J0JA 2ISSD 5C8YA 2FR8C 1GQYA 4J1NA 3TQTA 1QYDA 4CHTA 3ZCUA 2GGSA 3O4HA 4FN5A 1S3FA 3TTVA 3GAFA 3KM0A 4LNUB 3VR5H 1X2EA 4EGJA 1O7JA 2EYQA 2WSIA 5I7RA 2HHHB 1V9SA 3JQ7B 5JBIA 3VR4H 1DAHA 2HMYB 3W5DA 1EFRD 1OXSC 4JVOA 3K73O 2AE2A 4YAWA 1USKA 1VIVA 4OJNA 3D8SA 4LRUA 4B7AA 5FPQA 1Z45A 5HNKA 2IEIA 5ALVA 1DX6A 1PT6A 4UCFA 2IUYA 2GJKA 1L5MA 2DPMA 3IPXA 5DV9A 4MAFA 1K88A 1WMBA 3DKKA 2Q29A 3EC2A 4HGRA 1MG5A 3L0DA 3TZEA 5JDCA 1ZLYA 1W0JD 1ITZA 3GO4A 4DIMA 2HPZA 5M29A 4GICA 5A04A 1E6EA 1Z0AA 2DT5A 2M9MA 4F4HA 2L18A 2MSCB 3G68A 1VJ5A 4URWR 1U8AA 1M6VB 3C7DB 4TVKA 5H83A 3N74A 5F1OA 3SQDA 1FRFS 5E95A 3BMNB 2QMQA 3GGPA 1TM7E 3DWGA 3PCRB 2OCGA 4C3ZA 2LZ0A 5AHXA 1ZIXA 7YASA 4DQVA 1P45A 1H5NA 3WWPA 1IOVA 1Z6XA 1Y9EA 5B37A 1QYRA 2Z09A 3KKPA 4XIFA 2IZOA 3TE6A 1O3YA 3GFRA 4AT1A 3PNOA 2X8LA 1DBSA 2VJNA 2NO4A 5IPFA 2DGDA 1I3LA 5D2CA 3WNVA 4MV9A 3C1OA 3CLUC 5EIAA 3NHJA 5ER6A 3KWJA 3DB1A 5CLLA 3HZHA 1KY2A 2B35A 4E0BA 3WAGA 5KREA 1WCV1 5TEVA 3TTSA 3RTAA 5K6RA 2ZT6A 2C0QA 4V38A 5MN4A 2WHYA 4GBJA 1H2HA 4JJ6A 3F6SA 3E9ZA 3VHQA 3AVWA 2NV0A 5TS2A 4D8VA 1QRUA 1IQ0A 1YHZA 3HJCA 1ISMA 2HSEA 4G5FA 3KJQA 4I50A 5KMGB 1UIRA 2Q8NA 2R1VB 4L2IA 4ERXA 2AFVA 3QUCA 1LK7A 1Z13A 4CODB 2GETA 1WABA 1KI1A 2CB9A 3NIFB 3R3YA 4BMXA 4RYDA 5L4LA 3CCFA 3IP5A 4H7EA 4UE2A 5LB2A 3D0QA 4JSYA 2GR9A 2ZRHA 3K71B 5ANRB 2Q3MA 5AVTA 1NYRA 1GG5A 4BIMA 1AHHA 1O9GA 2QSJA 3EBPA 3MGAA 3PHGA 3LV8A 3ETNA 1I10A 1QDLB 1R6UA 2JZNA 2YWDA 5MHTA 2RJ3A 1CQIB 1ZJWA 3KLBA 2EC5A 3MBIA 4IV5A 3BREA 2PO5A 5H81A 2XB6A 1Z37A 1OXBB 4A0SA 1YZ3A 5LKRA 3FRHA 5KNBH 2H4ZA 3ZN2A 4EECA 4L5BA 3UJ8A 5KNLA 4P82A 2W8ZA 4X97A 2WKSA 1KHTA 1NVAA 1PEAA 2W2QA 3RYCA 1NVVQ 1LK0A 3HHPA 4JH0A 3K96A 1MW9X 1LDMA 1PS9A 5T3YA 3UHFA 1IG3A 4OP1A 4DBLC 2BFPA 3LI2A 4M9XA 1OW3B 1D0VA 1L5FA 1SCDA 3FVRA 3JAWA 3CPHA 1ML4A 1XMPA 2MSDB 2XNDA 2ZIWB 4TROA 1A8HA 4WCFA 2VLIA 1RC8A 2IS2A 1ZN9A 3KXLA 5BYKA 4G2TA 4QYTA 1CRZA 5KSPA 1E2NA 1NHWA 3AW9A 4GMKA 1AQYA 1I4WA 2OGSA 3BCUA 3SFZA 4CF4A 2O4UX 4CCWA 5A03A 4K8OA 3AU8A 5T64A 4ZRMA 4IUBS 1I24A 4KIGA 4KVZA 4JLSA 1VCHA 5CVJA 1U3DA 3L93A 5AM5A 4CR8A 4XWOA 4FI3C 4PSDA 5A5VA 3AR9A 3AILA 3GUUA 4KVAA 3U40A 4MP3A 5IDWA 4EYQA 2GPYA 4GP6A 3HKDA 3KYCA 1U2EA 1K3UB 3V42A 1IUKA 1YE5A 3EH2A 3OCVA 2NXNA 1V1MA 1GEGA 1K92A 4EHBA 4KBYA 3EGDB 1V8BA 1W59A 1AS3A 2QPLA 5GJVC 5K51A 4UBMA 3AT1A 4KR3A 2BD0A 4MDHA 1PVVA 2O3QA 3HN7A 1RI3A 3IAFA 5I7VA 1A9XB 1KSJA 4UARA 5AXBA 1SU8A 3K2QA 1NYQA 3LXXA 3VHXB 3NHRA 4CW7A 1EVJA 4I1UA 3QWAA 1OZGA 1VMDA 3I53A 3KKEA 3LOUA 4OV6B 3TKLA 2Q3BA 3TPCA 1TJYA 2EL9A 4X85A 3Q9LA 1X1QA 2ZRFA 3HP1A 1PEKE 3ADOA 3VJLA 2HU8A 4I9HA 1CIPA 2FZGA 2DUNA 1NQTA 4FYVA 4BZQA 1QIKA 5DSZA 1VIYA 5A2GA 1XX6A 3REFA 4KI7A 4DKJA 2FW1A 2QIOA 4BNWA 1UBMS 1X1SA 2KI5A 2H2HA 2FLVA 2XVAA 3P9RA 2NUBA 4JVNA 4O2BA 2QPTA 4HNQA 1A5ZA 1E69A 3CGGA 1LEHA 3ID6C 4RA6B 4BLPA 3ZHUA 3L8FA 2Q28A 1XZFA 2I87A 3AKZA 3SYRA 1DRWA 3X1YA 2WRZA 1UEIA 1JDBC 5FOVA 4WFIA 2J9RA 1JLRA 1JS1X 4WW0A 4B45A 1E89A 1UL1X 2PX3A 2FJUA 1GGNA 2H4JA 2ZI4A 2C4NA 4RTNA 4U9UA 5GONB 1Q50A 3ZUPA 1ES9A 4B48A 3RUPA 4L8LA 4W1PA 3F49S 4HJRA 5KVAA 4CM6A 3RGGA 2CXXA 2FDXA 4AD8A 2VJYA 1GRRA 2GHRA 5JSQA 2QUBA 1DJQA 3GGSA 4GSLA 1OZAA 1VKOA 3VMMA 2FLWA 3HABA 4NKRA 3HP4A 2GSDA 2J0UA 3BCHA 5EWLB 2V6JA 5F2OA 4RCVA 1Z38A 3UO8B 4LPKA 4O4LB 1Z6GA 4HDNB 1WZ2A 1JB9A 1YCFA 4XUEA 4NCAA 1W4AA 1ZKDA 1MN6A 1H8HD 1LLUA 4IL5A 5LOVA 3LVFO 3R3SA 5EGNA 1SULA 2IIBA 1WO8A 3ND7A 1X8JA 3LLMA 1NN0A 4LJ4A 4X7BA 1M0TA 5D84A 1K5PA 4Q5IA 2IIQA 4KP7A 2AC7A 4NZMA 1XWWA 2J3IA 2GN0A 4TYWA 4MEBA 3KQHA 3K9BA 1CR2A 2Q1WA 4ARZA 3ND8A 4LN1A 4DEXA 1QXSA 1BOFA 3JVUA 1QONA 4OOEA 4IIGA 2G70A 4TKLA 2NQ2C 5GZ6A 4P7JA 1KXJA 3PL5A 4H7DA 4CKYA 5A9SA 3U5ZB 3AR8A 4QUKA 4Y2SA 4YJFB 3SY8A 4DTIA 4UBIA 4ZEWA 3I8OA 3OZXA 3TIXB 4NJOA 3U60B 2P3QA 5K3CA 1N0HA 1T3SA 1YQDA 2WIAA 3KLNA 1XV5A 4HDAA 5DYYA 9LDTA 3V46A 1G17A 3L7MA 4BO2A 1C9JA 3LZ6A 1QK5A 2IT1A 1P7WA 2QTLA 2VOJA 3R3ZA 4PZLA 5BSWA 3MTDA 5GADl 5ARBA 5GZ3A 2D62A 1KTVA 2EFHB 2VDRB 4E5NA 3AL0C 3GXBA 5KYUB 1K6IA 1VJ1A 5I7FA 1H4SA 3PQCA 1RRVA 2AJBA 2C59A 4MR7B 3OT4A 3VZSA 3HB7A 3DO6A 3DPUA 4K6FA 1DWOA 3AERB 4TKUB 1E32A 4I50F 4Q37A 5G4LA 2JG3A 1XDSA 2X3UA 5SICE 2XZLA 1J8YF 1E4EA 4AZVA 4AAYA 3TAUA 3PCXA 2QMEA 3O73A 5CVVA 1GTG1 1RSZA 3EQZA 3NCHA 1EFHA 1QORA 2AK2A 1OOEA 5J9FA 4FZJA 4EVQA 4Q3EA 4EY6A 1I4LD 1W8IA 3K05A 5G1NA 2PXXA 1D4AA 5KNDA 1YKSA 2WUDA 4LWQA 1DMSA 3C5CA 3I6BA 2XB9A 2RHRA 4PLZA 4V0LA 2HSZA 1SB9A 1FJGB 3A6LA 1TVMA 1S2DA 1L4BA 3I42A 5J47A 4IQ4A 5CDFA 1Z2OX 1Q83A 3FSEA 1VECA 3P2EA 3JQAA 2FWBA 3KWFA 4EY5A 3R9XA 4QPDA 2NYVA 4CMGA 4M60A 3V2IA 3WGUA 1UBGA 4DUGD 1FP2A 1KYVA 4CR7A 3IJEB 1GNLA 2MOKA 3P9CA 4IJUA 3PC6A 3PUYA 4M1OA 4MQBA 4A1OA 3E7PA 2GM5A 2FFBA 4WXYB 2A9KA 2PL1A 4MWBA 4B4OA 1OE0A 3JASB 1GPAA 2IDMA 1EWKA 2YMPA 4POOA 4KPUA 3V4LA 4BNDA 1L7XA 2HXSA 1NY5A 4DB2A 3ZE2B 3OZAA 3L84A 3DAYA 1JILA 3L0IB 1IHUA 3DTVA 2ZSHA 3TR6A 4FYJA 4PTZA 2JAWA 821PA 1PJZA 4NU8X 1X7YB 4K6MA 1KI2A 2G1KA 3GELA 4BU0A 4JMLA 5IHXA 4Y98A 4ZVNA 2J4CA 2R8XA 3LHIA 2E21A 4X1OA 3RNOA 1PD0A 3MWGA 1KYXA 3Q41A 4KVGA 2W6MA 2C4VA 3PNVA 1GSOA 2XYRA 1QNFA 4EM6A 2QD2A 3BMOA 4ND8B 3VDRA 3GU3A 3E48A 1W36C 4MUNA 3UMSA 3TG2A 3T9BA 4JBHA 3RWOA 3BE5A 4X8LA 4UPEA 3H11B 3HRKA 1GCOA 3B5JA 1N8NA 1QKJA 1TA0A 3RFUA 4E5UA 2OOSA 4PG8A 2E5WA 5KC9A 2FF5A 1Z4IA 2QJTA 3EA4A 1R0LA 1S8OA 2J7PD 1G7CA 2QTVA 4QO7A 3EC7A 1UT5A 4D3SA 1RI4A 5AJZA 3U44A 4I5EA 3NBAA 2VDKB 4M53A 1FVOA 2C07A 4PCAA 1FX0B 2CLHB 3DEFA 4NZ9A 2EIHA 3FDZB 3R6LA 4PF1A 4Q93A 5HR5A 2QTHA 1FXWF 4RIEA 2VUTA 1RJ9B 4IDPA 3JD0A 3TOVA 4D8UA 2UZ4A 1ZVVA 1K08A 1BHJA 4N65A 2HWUA 3HA2A 3U7EB 4N8SA 1NE7A 4FNOA 1DTWB 1VKNA 3KXKA 2FAXA 3OE4A 3T7DA 3GNSA 1JWLA 5REQB 1KK1A 4BMDA 3B6KA 1O5IA 4PNZA 4EJFA 3VBEA 2QVGA 1QO0D 1SC1A 5JD4A 5L3QB 4NDNE 1ZXXA 1ZGAA 2WSYB 1L7DA 3VRHA 4MUJA 3DE2X 3LT2A 5FI5A 1F0PA 1SKQA 3IP9A 4AJEA 1H3FA 1T6YA 5ER9A 4UBLA 4HNTA 2OP1A 1E1QD 1G9XA 2DKOA 4LPSA 2O7SA 4COOA 5J4YA 5ILOA 1ZM3A 4MPPA 1E62A 3VZRA 2FR8A 1FMLA 3F4LA 1JIIA 5TMPA 2ZBPA 3I39X 3LP8A 2QBYB 4X90A 4KQ9A 3B3AA 3ND6A 2GJ9A 2ZEJA 3L7CA 3U7JA 1W7AA 5FAKA 1M34B 2DJ5A 5KYYA 2ZI6A 3NHZA 2ONJA 3DHWC 3HKCA 5EOVA 1OLSB 4KE8A 5CP8A 4B9EA 2CSUA 1XXHA 2N42A 4DFDA 5JADA 1K6XA 4DBVO 4UD6A 3F5FA 4GS5A 3Q7SA 4F2GA 2O48X 3G8YA 3O1JC 3ZK8A 2XDWA 4WPGA 5K0SA 1LW7A 2G83A 1GPYA 1XHEA 1HWYA 1XQXA 2QN3A 4XGIA 4N54A 1NV9A 2XUZA 4WD3A 3NCTA 3BD7A 4IDCA 1BWRA 3DR3A 4IDEA 4I8XA 5JCJA 2OCLA 4G4SO 4X84A 3D6FA 2CUTA 3GYGA 3SHQA 4EAQA 3THXB 3FNHA 5CDUA 2Y3IA 5ICSA 1E1RA 3BSSA 1F51E 1LA2A 5LOVF 4QULA 2HR1A 1J99A 2BSXA 2H0QA 4WNAB 3AEKB 3RJ9A 4AX4A 3E82A 3F97A 5JH7B 1Z7EA 4KQMA 1EFVA 2AUTA 3AJRA 1EDDA 3ED1A 2IELA 1P0IA 2C2BA 3U62A 3TX2A 1UP4A 2YIJA 4US1R 1QF7A 5HS4A 4OYLA 4L6AA 1UDBA 4XOUA 1K8XB 3LKZA 2ZTLA 2GK6A 5THXA 4MP8A 3ONVA 4DYDA 4E5VA 3BYZA 3H1PA 1FJHA 1Y4AE 2EG9A 2NZVG 4L57A 4XIJA 3GPIA 4ZZ2A 5LQJA 3ZVLA 4IKPA 3C8ZA 1KA9H 4LXGA 1ZIPA 2D5CA 5I47A 4F3CA 5DNCA 1L7PA 3SZUA 4LF7B 3JRNA 1FTGA 2GLTA 3KVYA 1DOHA 1EKXA 1YQGA 3AF4A 3IELA 2BFFB 3NHAA 4WZ6A 5FLKA 3JWGA 2GARA 4MB0A 3WK6A 1FNMA 2CLFB 3DDUA 5EMHA 2X2EA 4ALIA 2IUTA 4L9SA 2ZYHA 3RGWS 4OATA 1WD7A 4J0KA 3KLOA 3L01A 4MKZA 3BH0A 1DOZA 4REQA 4QUJA 4FDTA 3CNQS 1ECFA 1NLYA 2BFEB 2GVNA 3I6IA 3WNZA 1V37A 1XJ0A 4FK8A 2Q1UA 4E03A 3R40A 4F72A 8ADHA 1UT8A 2OKGA 1DRUA 2JGJA 2KYRA 4YDHB 2IYNA 1P80A 3LIIA 3ZWXA 1WKCA 2VVTA 1NP6A 2JBWA 3OLCX 1I2CA 4JNCA 4C89A 1FB5A 2YWJA 3BIOA 5IZ4A 5HKLA 3VZCA 1S2MA 2A5YB 3MINB 1ISSA 3G2MA 3O8NA 2YW9A 4GSYA 5IT9A 5AM2A 3K5WA 5B3KA 2O8FA 1YL7A 1I3OA 3HDQA 5IFKA 1VPLA 2QM7A 2AEFA 2FMIA 3E84A 3KB1A 3D6HA 3MFYA 4Y8VA 4XVUA 1QJ4A 4KR2A 5FIUA 2VHYA 2XLCA 1Z5OA 3S5UA 3HU1A 4EA9A 3LPCA 2BEWA 3B78A 1H6DA 3DP9A 1DQSA 1JBQA 1XLWA 4QFMA 1O95A 2HQRA 3QI2A 3CMCO 4RHEA 1SKAA 2W6QA 4MINA 2EWVA 4F04A 1J22A 1SOWA 4REQB 4Q7QA 5KYKA 3RYFB 2I03A 1JMKC 2R7MA 1E8NA 1LBTA 1OZFA 4ANFA 1CYDA 3BFPA 4ZZ0A 3VH1A 4M38A 2FFJA 1JH8A 1XLVA 2C2GA 1ZAKA 4GG1A 4LOLA 4Q7LA 2XDQA 1EGVB 3VU3A 4QO8A 1BGVA 4HEHA 5F78A 1P1RA 2OBXA 3NFRA 4RZIA 2DBZA 4R8RA 5CD9A 4MKRA 2I3BA 3OJCA 3DBIA 5E8RA 1W1UA 4X6UA 2X0NA 1XZPA 5HDBB 1G5PA 5CA1B 2GKOA 3DUFB 1JL3A 1NQXA 5IFLA 3E1GA 2ZCVA 2NO5A 3EG5A 4MRMB 4W8OA 4ZGWA 1NF8A 3QKSB 3LLUA 4QU5A 4ENWA 4NSNA 1P0QA 5KTYA 5M34A 1MG0A 3IQFA 3WK7A 2BGGA 3UMFA 2RHMA 4EG5A 1QBKC 2W6CX 2COUA 4HD8A 4PBTA 4X6LA 4GWLA 3QEJA 5D6NA 1IWOA 3AUYA 3HCBA 5EXTA 5B1IA 1ZH0A 3VR3D 1F1BA 1JXMA 3EVBA 4DT1B 4C0LA 1S3GA 1ZRNA 1T9GR 2AF3C 9ATCA 1NVFA 4FR5A 1PV1A 2CXNA 4NEQA 4AO6A 4E30A 2FEMA 3OQVA 4G8JA 4H4CA 1FSPA 1SIUA 2EWWA 3FBWA 3HB1A 3OFNA 4PWYA 4LYAA 4DWOA 4GVXA 3CO0S 4KDEA 4IFEA 4FFMA 1KEPA 2GEUA 3FPKA 5JUWA 5DNYB 1NNUA 4OQLA 1MXFA 2OCYC 3Q7PA 5EMJA 3THXA 4QLAA 3KKLA 1XRSB 1XDBA 3FH0A 3N28A 2HWYA 3P9IA 4HB4A 1N2IA 2PX5A 1R8SA 1KGDA 3AI2A 3ML1A 3NIWA 4LBZA 4OUKX 4OYRA 4YRSA 3PHHA 1B0ZA 3MC1A 1OI7A 3IXQA 5ADVA 2KM1A 2OR3A 3Q10A 4TXJA 1LDGA 1DJLA 1I0IA 2JGDB 4YGYA 3CLUD 3K6SB 3LRTA 5KB3A 1I2BA 3D8TA 1X13A 5DI3B 4ZPXA 4WBNA 2FSSA 3TLKA 1T2AA 4BBJA 3I9MA 4OSPA 3OZGA 4PYOA 3ZH2A 1H22A 3IE1A 1GM5A 2XA1A 1T34A 1NPDA 1ZRHA 3A3KA 4LV6A 1R10A 3CXRA 4R68A 1V8FA 4A0QA 4M6WA 3H5NA 5E7JA 3I73A 3AF0A 5LCXA 4ID9A 5A2QA 4IHJB 5L6LB 4P83A 2A0FA 1S6YA 3WISA 4ADSG 2XYGA 4CQLB 2JA2A 4DV5B 4W5RA 4WX2B 3OQIB 4E31A 3BQNB 4YXWD 2UUPA 3LT4A 2JVJA 3E8XA 3U26A 1J06A 1DJPA 2ZB8A 1M7BA 3LY8A 4UTZA 1T5OA 1J00A 1AV7A 2GPBA 3CUSA 5JAMA 1KC3A 1SVKA 2XGJA 3IT2A 2J4FA 2QK4A 2YHIA 4OFZA 1QQBA 3O03A 3CR8A 3L40A 2C5FA 4J90A 4KGXA 4R1UA 1WL8A 4RBNA 4DCJA 5REQA 3CSDA 3TIVA 4G41A 1ZRMA 2PQ2A 4E2ZA 5CA0B 4R7TA 1E6LA 3QU2A 1ZRSA 1JWBB 1E1MA 1W5SA 3B8HA 2ZRBA 3SNHA 4L0MA 1E98A 3K70D 2WNSA 4RK5A 7AT1A 1G3IA 1QG6A 2QD1A 3P97A 1RJ9A 2VZ0A 3TZ6A 4JUAA 4JJ8A 3IAM1 4FGKA 5T6MA 4NYMQ 4CKBA 3Q3JB 4RGBA 5D1HA 3TWOA 2I6FA 1OT3A 2C0CA 3RFCA 1ETUA 4NBLA 4U8GA 1F8FA 5DK4A 4FB4A 2B6HA 2CLIB 5FB3A 3CUTA 1N57A 3LT0A 1CQJB 3PC7A 4OHFA 2C84A 4LGMA 4JEHA 1IWPB 3M70A 4KOAA 4BFZA 5BR8B 4LF8B 1HZJA 4BP8A 4MGKR 4JT9A 2GXSA 1AUPA 1H9AA 2JNWA 1NRWA 5FWDA 2QL9A 1M6NA 3LJKA 1GZ7A 4NCHA 2OB1A 1QFXA 1KHHA 2ZI5A 2AXQA 5C34B 1BYUA 1CJCA 1IEWA 3IGFA 3QVOA 3U4QA 4FJ1A 3W3AD 3P9XA 4B43A 1T26A 3CYFA 4N5MA 2RD2A 4C43A 3I0NA 2Z43A 2VKQA 4DGQA 1PS8A 1XK6A 3PHJA 4JENA 4IDNA 2GSWA 5HIIA 4ZCMA 2DR3A 4QRIA 1II8A 1UAAA 4J7XA 2X3FA 5FL7D 4QGBA 2CLLB 2BRUC 4WDQA 4BEJA 2VAXA 3IIJA 2DLDA 4IX1A 3LQQA 1GTSA 1ZGZA 3FMIA 3T35A 3V7UA 5F98A 5IW8A 4MTCA 4BLRA 1Y4ZA 2HBZA 1NR7A 2X2OA 2X9LA 3OZUA 2JJ1D 1PV2A 5EZYF 3EDQA 3JASA 5I5GA 4C7MA 4KNWA 2X15A 4ML3A 3GLHA 2C7BA 1OLUA 1FXUA 2EIXA 1JHOA 4ZGGA 5E1DA 5FTKA 2HT1A 1LDBA 1V95A 1UPFA 3LUAA 4M49A 5IDYA 3W5SA 3DMNA 5GV7A 4E2XA 1QHSA 1CPYA 1ZCBA 2G04A 2GHQA 4FE7A 5H82A 1H2AS 4TMTA 3HXPA 3K72B 3X2EA 4IMPA 4WERA 2ABWA 3JQBC 1RR6A 3ECCA 3VGPA 1ADCA 1Q0RA 4QAJA 1YJXA 3GRYA 1ISRA 3WXBA 1G0OA 4BX9A 1JDUA 3H5WA 3L06A 4UJ3A 4JP5A 3D0OA 4BNIA 1TYAE 1E0AA 4WDRA 1JB1A 1J0BA 4QDKA 1RAFA 1T4BA 2PVPA 4M1EA 2YNMD 3R5TA 1JUDA 4D4GA 1E3IA 1AZLA 1EJ0A 4JYPA 1MOSA 1RYZA 2ZWIA 1G8MA 2AI1A 2B21A 3IIEA 2R86A 2Q6VA 2K2QB 1UP7A 1DU4A 2AA3A 2DULA 1KI6A 3TAHA 3PTZA 1Y89A 1JRLA 3B1WA 4H1UA 5DW0A 4CLRB 2PJDA 5DASA 4WLOA 3IEXA 1NBAA 5DYGA 1X8XA 2B4KA 4MR7A 5EUCA 5CDSA 2EX1A 2NP7A 4OQEA 4Q3CA 1VI2A 3WYBA 1I94B 5I9LA 1VFNA 4B84A 4U2BA 2OHOA 4MLDA 2JKVA 3KS9A 1P8JA 1Q92A 5JZVA 4DV1B 3RABA 3IT3A 4DSNA 2I91A 3O3MB 4HNSA 3B1FA 4UNPA 3W90A 4XIIA 3ZCXA 4BVJA 5AK6A 2XYPA 5K3BA 3B3JA 3ZHRA 3PGMA 1Q57A 1F3OA 4AKHA 3SJCA 4O59O 2UVPB 3KQPA 1HK7A 1PFKA 2CLKB 2V5AA 4BOYA 3QU7A 1E2EA 3P2KA 1RMYA 4X45A 2FCAA 3DHEA 3C8DA 3DE4X 1EBUA 2QAGB 4ARVA 4CM9D 3SCZA 3SI7A 5HIKA 4YRTA 1ZGJA 3OZCA 2VPTA 4W7HA 3V4SA 1D5CA 4FP9A 4MUKA 3RBVA 1KYTA 1FYFA 1Q2XA 1YR3A 2GWRA 1SUWA 2Q99A 3GDOA 3RI3A 3SHVA 4CV1A 3T3EA 4AS1A 2I22A 4CF5A 4BP9A 2CC2A 5BNWA 2I9PA 5JMTA 4RCYA 4GMFA 4NFHA 4KACA 2NZXA 3WLJA 4M9ZA 2W6NA 1FPQA 1QC5B 3O4IA 3ZQ6A 4DIOA 3H6HA 4L5JA 2G7MC 1U2PA 4Y2PA 4PHCA 5DTEA 3T4XA 2H2AA 4QGAA 1N77A 3M1YA 3I2KA 4U6SA 5AK0A 3PRYA 5BV0A 3IC5A 3OE7D 2WZCA 4HGOA 3RV3A 1LZLA 2JFXA 1U0NA 1AE1A 1Y9ZA 3M6LA 5EWLA 5EWJA 5J4VA 1A1SA 4M8NE 4XX0A 5BQFA 3JAMA 4YECA 3RQIA 4J0DA 4F86A 1XMSA 4DLLA 2JGRA 2AXPA 2FTKE 1E9SA 2RHCA 3PYLA 2OYRA 5M2QA 3KLPX 2ZATA 5J2UF 3A11A 2F48A 3PE4A 4JIGA 2VQ6A 1TYDE 1S7CA 1T5HX 1TW2A 2VF2A 4GOJA 1E2BA 1KDRA 1VZ2A 2PUBA 1GV0A 4J76A 1A95A 2BZSA 5F2EA 5KAPA 1HEYA 1KQFA 2J31A 5AW9A 4C6SA 1SOVA 5EN4A 1BX1A 2G0AA 2GAJA 4RVDA 4OJMX 4GIBA 3A4TA 1CJUC 1C0PA 5FF9A 2P2NA 3H2BA 4Q4AA 3QRWA 3PSHA 2AN9A 2APJA 2YVUA 2OB2A 4CIBA 2O52A 4IICA 3TVTA 5F35A 1CS0A 5CDGA 1OLXA 1QMPA 3SJAA 3QKWA 3TLJA 4UOZA 3DNMA 1UPAA 3BOSA 3COYA 3D0RA 2ZTUA 3IVRA 4Y30A 4Z7JA 2IU3A 3E9CA 2VT3A 4EDFA 2J08A 4B3MB 1TQ4A 3K15A 2DRIA 4XA8A 2W43A 4RLSA 4CUJA 1MAVA 1DJOA 3P0HA 1FNBA 3Q2IA 4H77A 2AE1A 4M8LA 4G67A 2AQIA 1YMVA 2Q4DA 2A67A 3T5AA 3DJFA 2ZCJA 3ABRB 3FWPA 5KQMA 4MGHA 1XEXA 3ZQKA 1QUEA 4UVHA 4P2BA 1EP1B 1NRXA 2R6ZA 4IH1A 1Z29A 4B2PA 1X39A 1M33A 4WOPA 5TNXA 3DL2A 1L4NA 2V7BA 1ZNQO 3NIGB 1OAOC 2ZB2A 2F3SA 1X42A 4H18A 4NK4A 5JSZB 1AA9A 1G1MA 1L7VC 2EW2A 3H1AA 5YASA 3GT3A 1HLDA 1TFUA 2BMJA 1DFIA 3NVAA 3F67A 2GM4A 2DETA 3CW9A 4MA0A 1ZD5A 4ACAA 2ZSEA 5JEDA 5HBRA 5JQGA 4D80A 3GJQA 2FPMA 1RACA 4AKGA 2IFTA 3T7KA 5BV8A 2Q62A 1C0EA 3DW1X 3LQKA 4HL6A 1C3VA 1EHIA 2A35A 1TCCA 2G77B 2QSZA 1SVUA 4ERNA 4OHYA 1NBME 4L95C 3JQFC 3QVSA 1ZU4A 2AW3A 3X1JA 1OSNA 1K89A 2IOFK 2X3YA 4MW5A 3A8TA 2G09A 1FMJA 2I71A 3PWKA 3R8XA 3E27A 2JRCA 3TR0A 5BYBA 1MZPA 1NQUA 1DUSA 1P2UA 3PCTA 3ZIAD 2Q3CA 4IDOA 4ZOAA 2XADA 2GBLA 5ALJA 1JZSA 2V6FA 5DRTA 4DUGA 1FTYA 3BCSA 2QRHA 3TI9A 1JLKA 4A2WA 2NG1A 2N0SA 2P5TB 3ZIAA 4D0RA 1WXWA 3Q3CA 4O1HA 2HRRA 3AYZB 3AHCA 3ZDRA 5BWBA 1G20E 5AW1A 5DWVA 5KZMB 1KARA 4CG1A 1Z5GA 1R6TA 1PJCA 3ZJTA 1UBNA 5H16A 4C04A 4YXFA 3D0KA 3SJUA 1RAEA 3AZQA 1A9QA 3FCCA 4MVCA 2QG6A 2JB9A 4MRNA 3BL6A 4TX1A 5EFOA 5ELMA 2FP3A 2N47A 3EF3A 5EP3A 4DNFA 1SRRA 2Z2KA 1Z4QA 4P80A 5CNMA 4I66A 4ZDIA 1O95C 3MBKA 5HOQA 1SUDA 2ATVA 3PVCA 3KZ1E 1ADBA 1ZOSA 2NXCA 2V5UA 5JCOA 3TJMA 1M1YE 1LJUA 1ZGBA 4OQXA 1D1QA 1Q17A 2AJCA 2I6UA 2P4QA 2QEQA 3OIFA 3RKSA 1B8NA 2J0SA 3GR6A 1NBIA 4E5YA 1MOQA 3DBRA 1Z25A 2ZANA 4E4YA 2EERA 2CFTA 3EXEB 5AI5A 4OMUA 2NZYA 3WSVA 4F3NA 3G8BA 4KOEC 3ZOKA 4QKQA 3N2EA 4PIVA 3U1BA 1T6ZA 1Z6QA 5JS7A 3L8DA 1QYWA 3PVSA 5FTWA 2PT9A 2SCUB 1QGED 3CS3A 3IO3A 1OIVA 1YTUA 2AI3A 4O25A 4ZU1X 3MG9A 2BKAA 2E4YA 2UYOA 3AETB 4R1TA 2C3OA 3RSHA 1P6XA 4EX6A 4XQEA 1A4RA 4DJDC 2WQ7A 5AHKA 2GZDA 1PFVA 4Y6PA 2A57A 4BVGA 4EF4A 5B1DA 3DEYX 3WE7A 4BL5A 5JWRA 2Y93A 3VU8A 4NV3A 7ABPA 1OWNA 1GNPA 3SR4A 3ADBA 1NLZA 4PZ0A 2RGCA 1KIAA 3Q8MA 4WA7A 2CGEA 2EYUA 2Q2VA 3OSUA 2FJPA 1IULA 5F4BA 4AL4A 4HS4A 5BV7A 2V9ZA 3G8AA 4HNGA 1HTWA 1NU8A 5FTJA 2TS1A 4XR4A 2L17A 1USGA 2Z1MA 3JRWA 3QEMB 2IU0A 4C0QC 2A0WA 2JLSA 1XRRA 3KT6A 5ELLA 5J58A 5EQTA 5JANA 3TLGA 3LW8A 4HFRA 3T41A 4R4JA 4ZK2A 2QBYA 3NMUF 1GDHA 3W2TA 3R3UA 4ZO7A 4UMFA 2CVOA 1EEHA 4PICA 2WMYA 5HJEA 3ED5A 2A9OA 3B51X 4EKGA 2WIGA 1W0KD 3QIAA 5ALIA 5F1PA 1DX4A 4GAEA 5TV2A 1TGYA 1WXHA 1DC5A 2P8JA 1ESMA 1EJ2A 3H8VA 3L7NA 4CM8B 3NBFA 5CW1A 4XYLA 3AIKA 1OYYA 1TAHA 2VHJA 5FP0A 3UUGA 3OCXA 3QA3E 5CB6A 5CT5A 5IXJA 4OB7A 1ZNYA 2FY8A 3RFTA 4TTQA 1UBUS 1E2QA 3ZDZB 2F17A 4XH9B 5EMKA 4AF8A 4EEZA 4G36A 2XUKA 3LTNC 5KINB 1J8QA 3GT4A 5JDIA 5DM1A 2I1WA 3QSYA 2OCXA 4AUNA 3B12A 4XOIA 5C7OO 1Y3FE 4Y2XA 1US8B 1TVKA 1IN6A 1JQAA 2A1TR 3O8OB 1W25A 4G86A 2AVNA 4TWAA 4BB5A 1JE1A 2FFAA 3D6VA 1IN1A 2ZREA 3RV4A 1I0ZA 1AC5A 1LBQA 3FZQA 4UBOA 4C7XA 5GINE 5BSFA 3AW8A 2X5KO 4EVRA 5HX7A 1RWPA 4ZAFA 3EGEA 3X1XA 1KJIA 1XTQA 3BHNA 4NZPA 3AUUA 1JN0A 4C4TA 3JYHA 2OGZA 1NF2A 3I1YA 3P5BA 5ALEA 1I8TA 1UBJS 2BEJA 4Q1DA 3HXTA 4S3MA 3CUEF 3HWWA 2DFDA 3AJEA 3PJEA 4QC2A 3OPMA 1DKUA 4FI3F 1VDMA 2D1YA 2PUGA 4G9BA 1OC2A 3GJYA 3QYAA 4Y2HA 1NIJA 5F64A 1V5FA 3ZDCA 4ZOBA 1VL0A 4GWKA 2AWOA 1TEVA 3WBKA 4I19A 3HWSA 4DMRA 4URYR 2WD7A 4MV1A 5ALMA 3QX7A 1P6UA 2ZJ3A 2FPKA 4WOKA 4EHIA 1C3OA 4UUOA 2FV8A 1H4VB 3G7UA 2XDAA 3TFQA 2JI9A 2P9HA 3UAXA 5MN6A 3N2KB 1W2WB 2A78A 2V6GA 4FMCB 4FZ3A 1ECLA 1JHAA 4FZ5A 1MAHA 4IKEA 1ESZA 1HYBA 2JD1A 4OGWA 5I7HA 5JNRA 4RF2A 2I8CA 3MGCA 1FP4A 5BN3B 1RYYA 1KKUA 4PYNA 5KQLA 1U5BB 2DHDA 3FOZA 4PPNA 2WDZA 4QDXA 1IE3A 4HLDA 4M9RA 4GPTA 3BMQA 4JOBA 4N5NA 4OXYA 1LFAA 4TLBA 4GLBA 4XYMA 2Z3ZA 3UA4A 3BGWA 2R1UA 4ZCQA 2VF8A 2RH8A 1RT9A 2WTBA 4LW8A 1BWQA 4OIFA 4H60A 4Z8XA 1DHTA 4Z8YA 3AR6A 1IB0A 2GXAA 1YVPA 5CYOA 1P0CA 1JXQA 2R1TB 1A2BA 1NW8A 5DFAA 2VK4A 1DXHA 2X9QA 3IA7A 1SO8A 4ZPJA 4BX8A 2K6GA 3LK6A 4CFZA 1NT4A 4OQDA 5EKDA 3FWZA 1Z7YA 3HCPA 4D56A 3NHLA 3LGAA 4GI3A 1KO8A 5DHQA 2R66A 1AZWA 1J39A 1GFIA 1HQDA 2QRGA 4LZZA 1GPNA 2JRLA 4BVFA 2B6NA 2X1VA 4NG4A 3PGA1 4WAUA 3RYHA 3S70A 1LXCA 1N5DA 2H00A 4FW8A 1OWPA 2WNIA 2PX6A 3CBQA 1EHCA 1ORIA 3U7QB 3ZQUA 5ITVA 3PU6A 1L7RA 2H7VA 3QXHA 4RH1A 3I2IA 3UAVA 2B3TA 2GWHA 4MS1A 4J7AA 1B42A 1NAHA 4GOOD 4J91A 4KC0A 1NNLA 4J3NA 4BLOA 3GZTB 5B57C 2BISA 3Q1KA 1CB0A 3KC2A 5EJ4A 3ANLA 2D7CA 4HZUB 2WG1A 2WWRA 3AZPA 3RANA 2OLKA 4BBAA 4TSFA 3W5CA 1YQTA 1DZIA 3LPLA 1M9NA 1NXPA 5JASA 4E11A 4RMNA 1SHJA 2DTXA 5JE8A 3EEYA 3JZFA 1TYEB 4BYMA 3RSCA 1ECBA 3I9JA 2H8GA 3HM2A 4WZBA 4GM1A 2OZVA 5EVCA 1LC3A 3C3CA 1WW3A 1VIAA 2C7GA 2HMUA 5IXYA 1A9YA 3STXA 2VF4X 3PNSA 3WC4A 1QIJA 4QJ3A 1E9RA 2HTEA 2R5WA 3JQ8A 2YJNA 1CUEA 1JNYA 1W2GA 3TKYA 4RV4A 2UU9B 3T4UA 1YC5A 2J5RA 2LTAA 3GEIA 2D5AA 3LVRE 1I6KA 4TT3A 3QPUA 3R7NA 2XNHA 1U3WA 3PQFA 3B7GA 1CUCA 1UK6A 2P6MA 4XEHA 5I7SA 2YKGA 4KREA 5EPEA 5JLJA 3BERA 4PHTA 1B74A 1USIA 2OCKA 3D54D 3EWNA 3IEVA 4IQGA 3MELA 4JB0A 8OHMA 1MOPA 5JD5A 3CVVA 4OI4A 2GK7A 5TQ2A 1EK2A 1LWOA 1NOKA 1KQOA 2ZLBA 3NBUA 4RADA 4XCQA 3ULKA 3ZTYA 1AF7A 5JSZA 2YINC 2JLXA 4PGHA 4F1WA 1WUTA 1Y3AA 1Z7BA 1E2MA 4NH0A 1E58A 3JVEA 3KQOA 4FT2A 4B6OA 4BZXA 3UAOA 1RCFA 3EXEA 4DUYB 4YJDA 1RYHA 2NU9B 3GN2A 3WHIA 1FUEA 1CETA 5JZOA 1AZSC 3W5VA 4EJ0A 4LGCA 1Y1KE 3ZBPA 2IPLA 2OZLA 1KQNA 4FYIA 2IUEA 2P78A 3B9RA 5DZSA 3U13A 4A5OA 2WF8A 1KAGA 1U9YA 3HVJA 3NJRA 2RGRA 1Q1QA 2ZJYA 3NI2A 1QKIA 2ECFA 2DSNA 5LU8A 2CLDX 1NI3A 3AOEC 4G5QA 3PJFA 3COVA 4C30A 1R4AA 1BFKA 1TC1A 3LYAA 3WWCA 3PQ7A 1L8LA 4YMHA 1QO7A 3QYJA 1Z4LA 2YFKA 3LLCA 1NF9A 4B83A 3EFEA 3LGXA 5K3EA 3KSDO 5B12A 5DCUA 4YO8A 1BDMA 3RIYA 5GONA 5COAA 1DKQA 3OEHA 1YE8A 4IIHA 3K9CA 1XN4A 2B94A 2ZQ5A 1Y7IA 3DR5A 2IEZA 1ZEJA 2VQ3A 4D8TA 2FWNA 5DP2A 4OSOA 3W5HA 3QWBA 1SIWA 4N48A 1FYEA 1FDUA 1DCMA 2BKXA 2PRSA 3OY7A 4TLCA 1RJDA 5FO0A 3V9AA 5EJ7A 4YIKA 2ZPAA 2JKZA 4QOIA 1C1XA 4YQEA 4UTOA 1E4EB 4X94A 2I6SA 3HJUA 3NLLA 3R09A 2OKCA 4UATA 1Y33E 3KETA 3RUEA 2EBFX 1VLHA 1WUHS 3GJ4A 1N8SA 1P3Y1 3OURA 2ZUCA 3R3HA 1U7WA 3DL7A 4J6EA 2MHCA 2IYQA 3MTEA 4JQOA 4WOBA 3UAZA 2I4OA 2IYUA 3WIEA 3RB8A 4RJLA 3ZXXA 3WL8A 4W1RA 2FF7A 3R5JA 4CIXA 5MN5A 3KVVA 1TZCA 4RWZA 1RPTA 3DZDA 3NP9A 4UMVA 2I55A 2PKRA 1GXSB 2VHZA 3OPXA 4Z0NA 4BS9A 4W4TA 1U0BB 4Q6BA 2PGXA 3BM5A 4L22A 4ND4A 4PS1A 4XD7A 1T0UA 3JYLA 5DSXA 5FTNA 1R4MB 1YJ8A 4K9MA 4L74A 8ATCA 1SHLA 4HS9A 1O87A 2A88A 3MJSA 1AZTA 1P4RA 4XYBA 2KPOA 5SZHB 2QTCA 4G0VA 1T0JB 3GFPA 1ACMA 1QYCA 3FNGA 4XX1A 1JFFA 1HUQA 3NM6B 4YJ3A 1B8VA 1S0UA 1ZMTA 3CZQA 3HCEA 4YCDA 5EG5A 4OQPA 2JIRA 2VSFA 3LC1O 4P5DA 4YJFA 3FPGA 1MVLA 3TIIA 1EFKA 3ZI0A 3PBKA 3T1HB 3QTBA 2JAUA 4J4BA 1HE1C 2ZT7A 1Q1EA 3CZMA 3KJHA 5BRAA 3I6ZA 4FXPA 3I34X 5BQPA 3TSZA 3N53A 4ASUA 4GXTA 3CLSD 4BASA 4CKZA 2DY1A 2SHKA 1NX6A 3ZCVA 3NEJA 4ZMBA 2ODEA 1TOAA 5KCZA 1A1VA 3WYFA 1UZUA 3QITA 1SFRA 3MPOA 3OTGA 3SC2A 3SSMA 3T7CA 2AYXA 4E1VA 2IWRA 5LMZA 1E7YA 3AUTA 3OQ1A 1Z6ZA 3RS4A 3OMXA 4E3WA 5K0ZA 1I30A 2F3UA 4BCBA 3UTDA 4K9DA 4Z9YA 3URMA 2JI4A 2FN8A 1Y6JA 1QHEA 1SUSA 5FWXA 4KW7A 1UKEA 3O2SB 4DBZA 2JFZA 1E3MA 1XLTC 1QVWA 1BDHA 3QQPA 5GM1A 4D9KA 1R0XA 2W6PA 4WGGA 1UPCA 5AVKA 1TUBA 3UMRA 1ODKA 3KZOA 3BXEA 2ZBRA 4ZDKA 4L50A 5DF1A 3RIEA 1E2DA 2IHVA 3O1IC 2QUJA 2PUEA 1UBLS 4PNPA 4WXEA 2J3QA 1GTVA 1MGPA 1Q0QA 1XQVA 4ZT6A 2FUG6 2HT6A 2IOHA 4WT7A 3STUA 2B8EA 1VKHA 5GOTA 4RC9A 2H9IA 2FOLA 3DO8A 4JZKA 2IIPA 1SCBA 2WTEA 5A71A 4C7OB 1GADO 3QJGA 3X1MA 5E6UA 2YMQA 3CX4A 3IQHX 3ZVKA 5IVPA 3FZEA 3T94A 4QU8A 4PYQA 1BOOA 5D5PA 4EY8A 1VPTA 2Z5GA 4EKEA 5F76A 1ND6A 4Q03A 4L07A 2Q2OA 1VLJA 3MTQA 5FPPA 1IM5A 1BJKA 1M6YA 1NWCA 3HJHA 4AMUA 1YIOA 2NT3A 1CUZA 3JX9A 5LZ8A 3MA0A 3VJKA 5IN4A 1KR2A 1QWSA 1T4CA 1WS6A 2AZ4A 2WWGA 2JK1A 3DOOA 3OOEA 4U02A 4D9HA 3NDBB 1AMOA 1EIZA 1VB3A 1RC0A 3VDQA 1CNFA 4FZRA 4EPWA 1VGVA 1C2YA 1JYEA 4XSVA 4JLUA 4Y0AA 2D0OB 5TQ2B 5IANA 4TOIA 4ATNA 1XIVA 1CSEE 5SV2A 1B43A 1YFZA 3T3OA 2NXWA 3GT7A 4HUJA 4S12A 4YASA 2Q5LA 1W8DA 2H1RA 2VT7A 4MOWA 3Q9SA 2ZSDA 1V9CA 2X0EA 4TZKA 4JI0B 1O77A 4AP9A 1O1YA 2YY7A 3HJGA 1OH6A 5ESWA 1BZYA 2OYSA 1VA5A 1S9DA 3F5DA 2DYKA 2YWHA 3IO5A 4P98A 4AULA 1YA6A 5ADHA 2AXEA 4WI1A 4U7HA 3KIPA 4EUFA 4DAOA 3DLPX 3E23A 2D7DA 1I7PA 2WJJA 1F6DA 1RAIA 2EFDB 2V98A 4X62B 4FB5A 1O9BA 1NR1A 4MS3B 1PYGA 2FN9A 1E1YA 1OYVA 3GCZA 4V3CA 3DOEA 4F92B 3D7SA 4L9RA 4TUYA 4LF5B 1X92A 1BKYA 3SZ3A 4O4JB 1KPGA 1U04A 1AQIA 4XLTA 3G0CA 1VCOA 1G20B 5LJIA 1X87A 3D4IA 4LK2A 4KXYA 4RSHA 4EUHA 4Q47A 1ORRA 3ETGA 3C16C 2DB3A 2CJWA 3AFIA 3N39C 4NFSA 4EKIA 2RE8A 1BSVA 3L6RA 2VP3A 1N0WA 1PNOA 3E0QA 1IVSA 4Q34A 3UOGA 3I9LA 4RKYA 2M6RA 1DAMA 1IC6A 2IEBA 4FMDB 4EI2A 2WSSD 5C3UA 2VH1A 4LRXA 2I65A 2JFGA 1IPFA 1ZQ9A 2ISCA 2VDUE 1RI2A 5T5QA 3ZH9B 4E7PA 1JEQA 4O5OA 4WJKB 5TQJA 3GT0A 2ZITA 3ABOB 1WF3A 1Y1QA 4K26A 3L6UA 3VO9A 4M1ZA 3EIXA 4MQMA 4JYBA 1BXGB 1DTWA 2ERYA 1A9TA 2SBTA 2V96A 2Y0EA 3GRFA 3VUFA 3EUFA 3QE0A 4HBGA 1R6VA 1OBFO 1B8UA 3GY0A 2QU7A 5HSGA 5B3AA 2MSLA 4C29A 4IM7A 4CMIA 3ZY4A 1LDEA 2P1ZA 1VG0B 2QE6A 1WDTA 1CQWA 4JJAA 1FFCA 1CZLA 3LHSA 1TJPB 1ZC3A 3BEOA 5EHXA 3HUDA 4DG8A 4ABTA 1EQUA 1TM3E 1WOMA 1JQ3A 2JH8A 2IXDA 4FWBA 2WB4A 1X14A 2WM8A 1OVGA 2GAFA 3HY4A 4ZRNA 5BSMA 3ZWVA 3M1AA 1JJ7A 1JIUA 4CUZA 4RTKA 4S24A 2CDBA 1W4BA 2EZTA 5AUQA 3RRFA 5A6SA 3W1VA 2KWIA 4G07A 1OU4A 1Q0HA 2IYZA 2WU1A 3FYCA 2QTZA 3NT4A 2O1SA 1C8BA 3LQRA 4DPLA 1W4ZA 5HM8A 3HU5A 2BFWA 1CRLA 1LBHA 3M8KA 1K6EA 1X7YA 2EZ4A 2G08A 4IHKA 4KEAA 4MWEA 1DUIA 2ZDGA 4RWEA 3HCRA 3LRXA 5C5IA 3VC3A 3TLAA 2OCPA 1E5VA 5F21A 1UMCA 2GLXA 1S96A 2CCGA 2W7TA 3Q40A 2WUWE 2GXUA 3QUSA 1ZNZA 3O2JA 4GDFA 5DWQA 1R6DA 4JS0A 1V1RA 4F6LA 3K7EA 1JDBB 1SMKA 3C70A 3KT0A 3ZNPA 1PT9A 2NXEA 1IZ0A 1YB5A 1SQ0A 3JVDA 5LUBA 3ZGLA 4EY4A 4YPVA 2P3LA 4Q01A 4B85A 2QUAA 2X7HA 3IQGX 3O2QB 5DMXA 3AUXA 3Q8LA 2W2VA 5KDOA 2DP4E 4NZYA 3GFOA 1QZZA 2OG2A 2ACWA 2PYZA 3I6QA 2C83A 1SOUA 3KB6A 5BOSA 4ZV9A 2RG7A 4CMJA 1HEIA 1RXCA 1CV2A 3L92A 3NB0A 1W5FA 3X3HA 3Q2KA 5ETJA 3OIVA 4KV7A 2CFCA 1YZKA 3KAQA 1EFTA 1R37A 2C3UA 2QLMA 5C53B 1REQA 2LDBA 5CEJA 1UZNA 1SBHA 1UBKS 4BO1A 2OAQ1 2YC2C 3BMNA 1WHSB 2WWYA 1CCWA 3ST7A 2O06A 3RK4A 3WTCA 2JLBA 2JLWA 4LMAA 4Z2AA 3QG1A 2AR0A 2MYPA 1Z75A 4N18A 1TU3A 3TEMA 4JJEA 1K4MA 1XHLA 3VTFA 3ANTA 3ZI4A 3RRXA 4U8HA 5EAIA 3W5BA 2DPYA 3ZD6A 1GR0A 1U2SA 1SVSA 4HWKA 2CFSA 2H3HA 2HA3A 2PD6A 5FBWB 4DDVA 5JC8A 4IEIA 1NMXA 2IYAA 3O3OB 3AFGA 3EH1A 3FHOA 1NVEA 5GQSA 1BWSA 1ZUIA 1ZM2A 3SX2A 3V48A 3WICA 4DL9A 1P5FA 2ZBEA 5K0EA 4W82A 2PS0A 1FTNA 4D6YA 5EUQB 1IZ7A 2ZRKA 4FQ8A 3L5KA 1AXEA 1FDOA 3JWPA 1U3CA 2X58A 3F8SA 3FTQA 3MNFA 2WV9A 1UAGA 4HGQA 2AFIB 1NUUA 2H5JA 3ADKA 3EXIA 4O2BF 4RKFA 5JRZA 5FHQA 4AVYA 1F9EA 3FGPA 3B5IA 1JFFB 2JZCA 2Q4BA 3H4IA 4PX5A 2PZLA 2B37A 5HF8A 3RUCA 5BQ3A 1Q0SA 3WGGA 1WRBA 2YJ5A 3IR7A 4N8EA 4LTMA 4PO8A 4TYQA 4WK6A 3PXGA 1FLVA 4FYKA 5J5AA 5CFRA 4KXWA 4JB3A 4P7GA 1NQ5A 1RLUA 1E3JA 1KORA 2AL7A 4IHJA 3UWKA 4CI0B 4NBKA 3AR4A 2YMLA 2GZHA 1C3EA 1QR2A 2O1WA 1P2FA 3ZE1B 2IS6A 4P0PB 5ELXA 1W1IA 3CB4A 3OQHA 5L6MB 4B6SA 2XQKA 1KJQA 3N05A 3L8HA 5J2UB 4E4RA 1M2WA 2ZWVA 4CZ2A 5JJIA 5CH5A 1E79A 1GGVA 2HGSA 1TTTA 3H9QA 4J1QA 3EY9A 3HDJA 1QHHB 2Q5IA 1EIWA 4NH4A 3T7AA 1K7YA 2QM0A 1M10A 3COSA 4F1JA 5K05A 1KVQA 3RAPR 4L5YA 4X1IB 4DCCA 2BZ1A 3BF7A 3W5IA 4P34A 2OHGA 3CU5A 3SIPA 3I9OA 3DZBA 1RLTA 1YDWA 1QHGA 3V4OA 4WL0A 3CN7A 1WSWA 3FBTA 4Q82A 3ANSA 3HACA 4Y2RA 2E4UA 3U3DA 3WR5A 1H2YA 1NW9B 2BFFA 4NZZA 4R9RA 4INJA 5AOBA 3L0OA 1G0NA 3GMSA 3IOCA 2P9EA 2GEFA 3BRWA 3RSOA 4HDMA 5HQTA 1QTQA 3L41A 3WADA 3C4JA 4M1QA 4AYXA 5BSEA 1UR5A 3OWXA 3PWZA 4MGEA 2X2PA 4CDGA 5EP4A 1J2YA 2VF5X 3P8ZA 2YY5A 2NNLD 1O96A 2E55A 3MGKA 5AI8A 3PEEA 2VHCA 4YFYA 2QM3A 5FWAA 1AQLA 1XTPA 2ERCA 3NX4A 4ZDJA 3R8FA 1DAPA 3OKAA 1HE2A 1QRRA 3PPVA 4MRMA 3W4JA 5HA5A 1RPJA 3OI7A 4KDRA 4EPTA 5KNCD 2G4VA 2PVSA 1AD2A 4GM0A 2QPOA 4GO1A 2ODWA 4YV1A 3TQSA 3EPJA 2YIMA 2C0PA 4CN8A 5BW8A 3EXAA 1Z88A 5JSUA 1OKKA 4W5HA 3G2JA 2CXPA 3PUJA 2QYSA 1V9LA 4A2QA 4EKNB 2R2GA 2R6JA 1RMQA 2Q5OA 3G9XA 4GQBA 5EJ6A 3T7TA 4HDKB 4MUEA 4J9UE 3M34A 4KXMA 3FPEA 3U4IA 3THSA 5JAZA 2FKNA 2VJKA 4V2UA 3ZS9A 1M8GA 4OXXA 4GR4A 3A1CA 4FCWA 2C2KA 4QDUA 5AKLA 5C4MA 1TU4A 3BG5A 1L2TA 5LIPA 1BMFD 3K09C 5AESA 3Q9NA 3C7KA 3HJRA 3OIDA 2JIZA 2HIAA 3AM3A 3H4TA 1W85B 3H0KA 2YJGA 4D81A 4D92A 1TQ2A 1OMOA 2PY6A 2WJYA 5I9MA 4FEYA 4ZYVA 3GDHA 4OKSA 2GN4A 4M86A 2H7CA 3KR9A 3KG2A 2VAMA 3CRQA 3SC2B 4IHQA 3ZEIA 4JUIA 4DTCA 1N9ZA 2LCIA 2PHZA 3WZMA 3WDKA 1K68A 4HNRA 4X7RA 3RTGA 4EW6A 5KYYB 1A5TA 2C4MA 4H1VA 5AW8A 2CWDA 4BE4A 1A9XA 2ZSUA 3GLGE 3CBGA 3EIHA 3UICA 3TUZC 2BMWA 3K8OE 3EUWA 5F12A 1NNI1 3JD4A 2P77A 5BV1A 4TSRA 5CT4A 4MW0A 1FRVA 2SKEA 2RC6A 4QFCA 3G1UA 3ZWDA 2IZ0A 5K3SA 1Q16A 3SYNA 1YI8A 4FMPA 2CNWD 1NSYA 4YH1A 1T8PA 3B6IA 3BWCA 3EXIB 3OCJA 3RE1A 1TQ6A 5A4JA 4IDQA 3M9XA 3C98A 5JZSA 1CUAA 2WYUA 1RNLA 2IIVA 3EAGA 3ESYA 3DMTA 4PHFA 3RYHB 3S5JA 4AIIA 4CG3A 4WK2B 1V8DA 4L4RA 5H3CA 3PVZA 2C96A 1QV7A 4K9KA 4L3WA 4WXRA 3ZXYA 5BWMA 3GCXA 4MRPA 1KI8A 2QRPA 2IPAB 2BH2A 3WYNA 1EG7A 2HIHA 3OMLA 4FYYA 3B9BA 2A5JA 3HKEA 3W7BA 3AKCA 4DIKA 1L5WA 2O6LA 4QBTA 4E4TA 4LI0A 4XFJA 2ZE5A 3DAHA 2AV6A 2ZS8A 2GN8A 4AUMA 1ML3A 3TLXA 1G2QA 3T3HA 1C7RA 5LWQA 1N2CE 4XAQA 4OOFA 4FTWA 4AZ0B 1L7AA 1Z4KA 1X7WB 2ONCA 4KHZA 3R9IA 1XEAA 3QVLA 4WNAA 3MB5A 3TLYA 3W79A 2ZUUA 4C9BA 1THZA 1OH5A 1JA1A 1TNDA 3AB7A 3IUBA 3HV2A 4L7QA 1DT5A 2ADFA 4RY9A 2RFLA 4H7HA 3B13B 4A6DA 4B4UA 4CT5A 4YYEA 4DR1B 3D1LA 2EBUA 1CIVA 3STVA 2BE9A 3P9QA 1XKLA 3PR2B 1NM5C 4C4YA 1ZHFA 2HCTA 1PJ3A 3HU2A 1KZ7B 1T2UA 4UW9A 5LZ7A 4H4DA 3SGLA 3DAPA 4BJ5A 4D6XA 1MO6A 3ANYB 2IKQA 16PKA 1WJGA 3EXFB 3M6FA 3R0VA 4H08A 1L1FA 1IAQA 4BU1A 1TECE 3EFOA 4ESEA 3EVDA 3PT5A 1IG0A 1UXKA 2GYVA 1K75A 2R97A 3P1JA 3QVJA 3T0FA 4RULA 2E7ZA 1KEVA 2XGSA 1RADA 4I46A 4JLOA 3Q0TA 3M9LA 2FMTA 3EQ6A 2Y0BA 3FPLA 3C3KA 4U7WA 1DEKA 3OPYA 2JDID 4K5QA 1ZEMA 3U9TA 3VI4B 4CT4B 1OX4A 1SVWA 4R5MA 1RWOA 3GN1A 4Q3AA 3N2GB 1VJRA 1E7MA 1UJCA 2F3PA 1YRLA 3IR5A 3PE3A 2IPNA 5CNKA 2C82A 5E6RB 3IKMB 3N2YA 5CCXA 5KOJB 2BR4A 3LL4A 1R4ZA 2G4CA 2PXCA 2RH4A 1KY4A 2YHAA 4W5NA 4D6PA 3ANMA 3CEJA 2P79A 1PR2A 3I5UA 4G63A 4F9EA 3KL2A 2PCLA 3KQWA 3NBZC 1G5IA 2FH5B 1DEOA 1R1DA 1OUMA 3OCZA 5K0BA 2OD9A 4TRJA 4E21A 2OXIA 2BFDB 5JAUA 2OBLA 4L8VA 1XBTA 1EHYA 4R2MA 2YH2A 4DOMA 1IBRA 2IU4A 2UYHA 1ULBA 2YOFA 2PSFA 3L7LA 3KKNA 3NEAA 3ORHA 2W5UA 2O5VA 3ZOZA 1D07A 1KBZA 3O0TA 3DZJA 1S2IA 1QFJA 4MVJP 3B6ZA 2B4AA 3NV9A 3OE5A 4I2VA 3A28A 4BWFB 3IDFA 3KPYA 1CF9A 3RWMB 4EK9A 2BCJQ 2QAIA 1Y8ZA 1YBHA 4AKSA 1E2JA 1XTSA 4TVSA 4HH3C 5JFOA 2AXNA 3ZY2A 1XT6A 2VJMB 2BELA 2X22A 3FZNA 3NGLA 2OQRA 4WVFA 1PFWA 2HWXA 1NPTO 2ZT5A 1R6XA 3FAKA 3GBVA 4QTUB 5GVRA 2XMPA 3T1QA 2AMJA 4CRWB 4C76A 5FLXA 1EZ4A 3OMWA 1RVDA 3OU7A 3G2OA 3VDNB 2W2PA 1YF3A 5KYXA 4YAEA 1JP7A 5CX1A 4YI3A 5GPBA 3BJMA 3KQSA 2WFLA 2YICA 4MQ5A 1ZC4A 2BC9A 3AUJB 1VL5A 5DX0A 2WHPA 5LLTA 2I7VA 3ZWBA 4RE5A 3CPSA 1O5OA 3J80A 5DBGA 4FOSA 1Q15A 2IEAA 4IHAA 1BIFA 4OHVA 3T7SA 2WMDA 2H92A 3FZGA 4J49A 3DMHA 4GPAA 2GM3A 1A82A 1P5JA 5LQKA 3SVZA 1FDWA 1CLUA 3V97A 5AT1A 4GYYA 2ILTA 1MQ8B 4RPLA 2R0QC 3DOJA 4QZVA 3NT2A 4ALKA 3BK1A 4E5MA 3I5YA 1EFCA 4MVYA 4QBIA 4MNTA 5DIFA 4GZLA 1FA9A 3RH0A 5BPFA 2IYRA 5L7YA 1HNZB 4KFCA 4UNIA 1MAUA 3B5EA 1O8BA 1B41A 2YRFA 4HBZA 4MVJD 1H2EA 3TEJA 3LBAA 2D2EA 1WX1A 3FJOA 1P4GA 3ICWA 3ZWOA 3GOHA 4EJSC 3KJEA 3BB3A 4EABA 3AONB 3G0OA 1XDZA 3TZBA 2HJGA 3I4CA 2OTCA 3STHA 3UH0A 2HI0A 2MSWA 4YRGA 4HR7A 3BBPA 3JQGA 4MR8B 5TS3A 4LHYA 1T29A 3BKXA 2NZ8A 3HL0A 3Q3HA 2DKFA 2M6SA 4D9NA 4ZIRB 4JL8A 4FUTA 1NBMA 1OF1A 1YCHA 4KQ2A 5LUAA 3ER9A 4L3VA 1ZP6A 1EDBA 3HJAA 1VLVA 4B5LA 4MW4A 4KFSA 1I1OA 1YSCA 1NOJA 2I7TA 2IY7A 4KXVA 1C3OB 3LX8A 4GLFA 2NAFA 4CLXA 4MXDA 3IH5A 1NI5A 1XZLA 1SURA 4KHPB 1SZPA 3Q3VA 2DEUA 2AJ8A 2YV5A 1R4NB 3M6IA 4F7DA 4X0EA 1H8EA 4FOOA 2D13A 4QYIA 1JSRA 4JN6B 1N6RA 3MUOA 4S0XA 3Q8KA 4D0GA 4UQOA 3RT1A 4DA4A 3QKRA 2E3JA 1X7XB 3E5MA 4JDPA 3EZLA 3D4BA 3GJXC 3THRA 1K8YB 2G0NA 1ZK2A 3OU6A 1Z5WA 4OPMA 4C3UA 1A77A 1H93A 2WM3A 2EJBA 3PD0A 3HSSA 1XTRA 2ZBFA 4G1MB 4HRAA 4D3XA 4YT8A 1GWNA 1RKQA 5CFZA 2WW8A 3F90A 4MR9B 1OGYA 3SD7A 2F7SA 1PP4A 1E6KA 3BXOA 2Z98A 3JAKB 3W2IA 3LLSA 4EAAA 1Q44A 3MTJA 4F6RB 5KKCA 1SUIA 3MAGA 1Q19A 3K8QA 3QBVA 4HKTA 4RZ2A 2IVFA 2HJSA 5TE9A 4G1FA 4TT8A 2EKDA 4Q18A 4IJWA 2V9PA 3KL4A 4F06A 3ZR4B 2XSZA 1U1IA 3EWAA 4QJBA 4CCAA 2XY4A 3WJAA 1WA5A 2WWXA 2XH8A 2WNHA 2ZIXB 3Q2OA 1QGAA 1N2CB 2ZPTX 5I9TA 4EIWA 4EDHA 4ENQA 2F62A 2EJWA 1FLNA 2C9BA 2UV8A 2YIDA 5IASA 1GGFA 4RDXA 1EUCB 4UULA 4Z0PA 4HAUA 5K45A 1EQ2A 4KXFB 3GA5A 1FYWA 5DTJA 3PQ2A 3FYUB 4JAVC 4MVJG 5CW2A 4WBSA 3OKFA 1N7IA 3FI9A 1G8SA 3N9IA 1C9KA 2A0UA 3I6YA 2XRFA 5BUSA 3AVYA 3SDBA 5AFSA 1P4HA 3EVNA 4P5EA 1P5HA 3SSOA 4TYYA 4RF5A 2X6QA 4C5BA 1QYIA 1M2KA 2C00A 5SY4A 2IZ5A 2YVKA 3ZI7A 5IG2A 4IVNA 5BR4A 5DI3A 3MCWA 4J3FA 5M5BA 2YY6A 4BFSA 3O95A 2W2XA 5JXWA 1YZQA 3CCCA 3K6SA 4JGIA 3ORFA 4Q1AA 4RMGA 4MO2A 3CY6A 4MWCA 4REOA 1UK9A 3VYWA 3OKPA 4RF4A 2NZJA 1I6MA 4ARCA 3OVMA 1WKBA 5ULLA 2XTNA 3CFYA 5DGDA 3RHZA 1CU1A 4F85A 1EWRA 3K0AB 4HAOA 3GEPA 5ABPA 1WY7A 3ACBA 1PJ4A 5F5LA 3FE2A 4AROA 3E3MA 2C5SA 2Z6UA 4GOKA 1UK7A 3DOIA 1C8KA 1IDOA 1PNVA 2BKUA 3RT9A 4LWOA 3G0BA 4JI7B 2X6RA 4UE3S 3WIUA 4BAZA 4OHUA 2P9CA 5AVYA 1X1BA 2QQ0A 3ZYZA 5G0VA 4GX2A 2QT1A 5EHGA 1ONOA 4HGNA 3QA9A 1MORA 2KS6A 2QN2A 1O08A 1QPBA 1U3TA 2BHSA 2FZEA 2P40A 3IOMA 5L3RA 2XUQA 3G0HA 2Z8XA 1FMFA 3O26A 5BN4A 5C7IO 2R7LA 1XYVA 3QHAA 3IVMA 2VJBA 2CYAA 4BE9A 4CI9A 4BUJA 5AM1A 3ADPA 2IHNA 5FUMA 4U2GA 1LTQA 2P8SA 4RKEA 4DPKA 1W9HA 1XMOB 4AZSA 2H4HA 1D9ZA 4C14A 4I8IA 2WTMA 1DOAA 3ASYA 1Q20A 2O9JA 1QVAA 4COKA 3GJ6A 4B6PA 1R0CA 1PL6A 2HRCA 3ESZA 3HMKA 1FTSA 1JT2A 2GH1A 2XB2A 1WETA 4D5GA 2PU7A 2FSFA 3DM5A 3L6BA 1EESA 4BZZA 3HI4A 3BRQA 4L6IA 4Z1MA 3LS2A 3KYCB 1IRXA 2PA3A 4RHXA 1J8DA 1F7VA 5FL7A 1KE2A 2RB5A 1B1CA 1P39A 1R0WA 2ZK7A 3BK2A 3P9SA 5THQA 5K2OA 3NU1A 3MGGA 1RXSA 1V26A 3NYQA 4DUZB 3PXUA 3E4CA 5AJXA 4LFAB 3AKYA 4HDQB 4FEGA 2J9FA 1JQKA 1A7JA 1HDXA 3A3NA 1LGYA 1FU4A 5ERYA 1UMBB 3Q98A 1H8ED 2R5FA 5CA1F 4FFNA 3O8RA 1M6VA 4FIZA 1U1GA 4KL8S 4E13A 2J46A 5AVWA 1PDVA 1GNTA 1D1PA 2QI9C 1ZD4A 1YO6A 2REBA 4N82A 4X93A 3QOWA 1EPUA 1V35A 4Q4JB 3TRJA 3P0JA 2PN1A 1FS4A 1XQ6A 1O58A 1NMQA 1NJ2A 2WVJA 3D4PA 3Q7QA 3VR5A 4BN0A 3BXFA 4KMSA 2AFIA 3CWQA 4NJMA 1OCEA 4TS4A 4FCTA 1G63A 5DRYA 3TB6A 3WRWA 2VBFA 3Q9UA 2BRUA 3EGXB 4WKNA 4F8YA 2XMDA 3K9QO 1T9DA 5LC1A 2E87A 4R40A 5AUOB 5CB8A 4D3FA 1XVAA 1ADYA 4LOHA 1FXWA 1G7SA 2GYWA 2VPYA 4UNRA 2H16A 2BFOA 2AJLI 3U7QA 4QRHA 1SUBA 5J4KA 4LC1A 3QG5A 1EEXB 2C3MA 3GJ5A 2G07A 4LKOA 3R0XA 3ZLVA 1AK2A 2OE2A 5JT1A 2HDNB 1IM8A 2DH6A 4UBKA 1ST3A 1PFGA 2ZJ1A 5F3RA 4BNJA 2UXCB 1GAJA 1ZN2A 4JL5A 5FXMA 1FEZA 3COJA 1PQYA 4DV3B 5JJCA 2OPBA 3K5PA 3MM4A 1R3DA 3K4HA 1NBOA 1DC6A 4YXWA 1AK9A 2XMGA 1UDXA 2QQGA 1Z18A 3OD5A 3JS5A 4EYKA 3MJTA 3AKDA 5B2EA 3D3WB 2ADMA 2FX2A 3BMCA 1XNGA 1UANA 1ZZEA 4M0DA 5CAEA 5IKMA 3ZG6A 2GK4A 4M0UA 4RHCA 2YWFA 5IH7A 1M73E 4BRUA 1Z4PX 1BMDA 2EFGA 2JIMA 2PKWA 2R8YA 3H2KA 2RCYA 3EGVA 3ILYA 3K4QA 4NBTA 2IY8A 2YN2A 2OFFA 3WMXA 3KQUA 1LX7A 4R2JA 3BMQB 5FJIA 2Z8YM 4IDDA 4M7RA 1C3XA 4YDSA 3VOBA 3ZLTA 3L8CA 5JNWA 2WOJA 3LOQA 3F2VA 2FQQA 3S1LA 2V97A 4CE6A 2ZRAA 3W8DA 5K4GA 1PRYA 1XF9A 3DDSA 1PYOA 2OGWA 3S40A 3OFSA 2XKBA 1V1RB 4NBUA 1Z2DA 2B69A 1GGKA 1JFLA 3COZA 4K9PA 4YRLA 1O6ZA 5JC1A 1RP1A 5IF3A 1BS2A 2PTGA 3EAQA 1L6RA 2OV3A 1DG3A 3OUUA 1HE3A 4ZARA 5KX5A 1ZU5A 4KWIA 4IGAA 1YHNA 4I36A 5DPMA 5EJFA 1JEAA 1FQWA 2WD7B 3C4QA 3QBJA 4GD3Q 1KXZA 1UC9A 1Y0BA 3GRUA 3K0KA 4MUBA 1GR1A 4F93B 3KV1A 8MHTA 2DUMA 2Z5FA 4TWZA 2LCFA 1XAIA 2FSGA 3AR2A 3H1TA 1YXMA 1Z0KA 3EQ8A 1W9MA 2QL5A 4MDFA 1M8FA 2GZMA 5KQRA 4O4HA 1L7OA 4NYIQ 1A0OA 2IV2X 3RSFA 2ASVA 3GD5A 5FL3A 1JE0A 4N03A 4L28A 2NVOA 1ODIA 1N5JA 4DIBA 3WK5A 1EX6A 2HCJB 2C8JA 2FPIA 4C7JA 1O0BA 13PKA 1CR1A 2V4ZA 2X40A 1HL3A 1QE3A 1V2HE 1NURA 3D4LA 3DNPA 3AM1A 3CRZA 4U2FA 3WGJA 2A5LA 3BT7A 4OCZA 1D0SA 3CRMA 2XCQA 4HAXA 2BGRA 2I34A 3AIIA 3FMOB 4PSUA 5LYJA 2R4QA 5G0TA 3M5DA 2KJQA 2EKZA 5LDDC 4TSFD 4IV8A 2C5HA 4PFKA 4F5YA 2O8BB 1M75A 2D74A 2QAGA 1VKRA 2XUPA 3CUUA 3E9NA 1UIMA 3NHFA 2QY6A 3RM3A 3TM4A 4F9FA 2VUSA 4AU1A 4YYZA 4LDJA 4TZ6A 2QUIA 1YVDA 3WWEA 5B3JC 2WYOA 3ZHXA 3U44B 1B26A 2MMCA 3F47A 3L0YA 4RVOA 3A04A 5AXAA 3EYAA 5KCMA 4HUTA 4OHWA 2CL0X 4P3YA 4RAQA 4TQUS 2HMWA 3TMKA 4MV7A 4X41A 1QJCA 3EF1A 3ME5A 1EJBA 4MWTA 4PYKA 4IWYA 4RHUA 1RYMA 3RS3A 2JL1A 3RTDA 1GTMA 1AUVA 1CEXA 2F59A 2X0RA 3ONNA 4FWIB 3GPCA 1Z7WA 4TTVA 1HDRA 2V0GA 2CLOB 4NQRA 4LYYA 4NCBA 4HWGA 2V7QA 1ESDA 2PANA 3QQ5A 1KZHA 4HWRA 1BXKA 3D5EA 4F84A 3TZCA 4V1CB 1XPUA 3L0BA 1YFKA 2JVKA 3CZCA 4CEHB 1QTNA 1U0RA 2ZYDA 1MRSA 3F7TA 3MUEA 3NEYA 2BZGA 3FUXA 3SX0A 3WLOA 4GI5A 4C0HA 2RCNA 2DQKA 4NV0A 4MI6A 4RH0A 4ZFNA 3OCYA 3QI7A 5C8DA 2Y4OA 4KX5A 1N5MA 1KVUA 2W2MA 1ID1A 3IPYA 3ETCA 1KU0A 5A4FS 4ALLA 3IOBA 4I6GA 4WH0A 4D9FA 4DIDA 1PAUA 2I76A 3SWWA 1RPZA 1OI4A 4K1XA 1GUBA 2QGZA 1UBFA 1UFKA 4JT8A 5BQXA 1KQPA 3ZYCA 4EA7A 3DZCA 2CMFA 1OH7A 1C8VB 2X1MA 5JI2E 2QP9X 1UDCA 1Q21A 4N12A 3ZEAA 5KTTA 3FTCA 1KYIA 2WIFA 3FYTA 2VNIA 3EZNA 3BTSA 3MWLA 2C2YA 4PO1A 1BE6A 3Q85A 2JGIA 3O74A 1DNPA 1RHRA 4DEVA 2LV8A 1ZHOA 4GYKA 3T7RA 3GFSA 2P2ZA 4AZ3B 2WT9A 1KIMA 3NM5A 4IGEA 3NQ41 2PH5A 4E5KA 3IKVA 1XUOA 4DY6A 3PX7A 3B70A 1R0ZA 1N2ZA 2PJUA 5I9BA 5AK3A 1E7WA 4EFDA 5I01A 2XA9A 1GZSA 2ZSBA 3NP7A 5FNVA 1C7ZA 3LX5A 1LQ2A 3IPAA 3RD5A 3RREA 3V4ZA 3VH2A 5JQGF 1YDEA 2FWMX 3RO7A 3OZEA 1JZTA 3AFMA 1LPBB 3BEDA 4NAVA 4CMIB 2VZ9A 1K9SA 1JSLA 5BMVB 3EDYA 3NC0C 4HGZA 3OQ6A 2IPMA 3I05A 4ZAVA 5CBKA 1L9KA 1ZVQA 3N2LA 4TPKA 1Y3DE 1EK6A 4I6EA 5CA1A 5JNTA 4G3XA 2QN8A 2IDZA 3K6RA 2BWJA 3SE7A 4NU0A 1NR5A 4OFXA 2XQGA 1COWA 3EWIA 2E85A 5T57A 4A26A 2A5FA 5AUPB 5JD3A 1I4OA 4MIYA 1A69A 4HDCA 1DKOA 1HOTA 5D3ZA 4AFNA 8ABPA 4I5DA 3ETLA 3TDKA 1ZUNA 4QTZA 4BLUA 3BHJA 3LYHA 4KH0A 4MUHA 1O03A 5C18A 2OFWA 1BMFA 1TTHA 3HP7A 1IQUA 2J0VA 2Q49A 4IRUB 2XCOA 3FFTA 3GRCA 3RHTA 1SU7A 4I5FA 5EQFA 1V7CA 2YTZA 2ODBA 3KZVA 3N3AC 3PHIA 4WQMA 1JR6A 4PZZA 4FILA 4BQQA 2ID7A 2J5BA 4O2AB 5LA6F 4FKBA 1CDZA 1UMBA 1XAJA 2EGHA 4ZZIA 1XTIA 1QTRA 4IG9A 5TSDA 1X74A 3L6OO 2ON6A 2WAXA 1SOMA 1ZJ5A 4FHCA 5BURA 2CJPA 2VI5A 2WZQA 4REMA 3VPXA 4TTRA 1Y5MA 2ZYVX 3A9CA 2HCBA 3EMKA 5GV8A 1QCDA 4INPA 1NNEA 2P68A 5LM3A 3ZWCA 1OT5A 4HRYA 3SSNA 2YDXA 4OLBA 1B6RA 1K6MA 1IAVA 2WKQA 3BRCA 5BWLA 3T9FA 3A1EA 3BH7A 1T13A 1VPVA 3WY9A 2DKNA 4MX8A 1VSTA 1LU9A 2CMGA 1LJ8A 3TD9A 2HSDA 3C85A 2XZPA 5FCDA 4EJSA 4EW2A 3SR3A 4Q05A 4DCPA 4AKTA 2JCSA 2ONZA 1W0CA 1LKZA 3D2BA 1X7DA 4NBSA 1QIMA 4D26A 2JC3A 2C2ZA 5TJ9A 1DCFA 4CQJA 3OF5A 4CU5A 1XD2B 2ANCA 4TWBA 2VPZA 4GOLD 3RFXA 2OBFA 4DADA 5IJ9A 4M9QA 3L1IA 2DHEA 1JJVA 2J0UB 4S05A 3AI3A 2PS1A 3QLVC 5TVGA 1J49A 3TQOA 4AQDA 4EG6A 4F4DA 2HHCA 3AINA 1DUVG 3AGQA 3DJYA 1XAHA 3O2NA 3PQ8A 1VLMA 2Z2IA 3PC4A 1XRLA 2O3TA 2IX3A 1RI1A 1O96B 1RIFA