3LHFA

The crystal structure of a serine recombinase from sulfolobus solfataricus to 2.3a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
136
Chain Sequence
b'RKVILYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEEVCKAHGCEIVVINKEEELVEDLVSILVSFSGKLYGMRSHKYEKVKKCVEELKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine Recombinase
publication title The Crystal Structure of a Serine Recombinase from Sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Recombination
total genus 45
structure length 136
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhfA01
3LHKA 5C35A 1GHTA 3UJ3X 1HX7A 2R0QC 2GM5A 2GM4A 1ZR4A 2MHCA 2RSLA 3LHFA 3ILXA 1GDTA 4BQQA 5C34B 1ZR2A 5C31A 3G13A 3BVPA 3GUVA 3PKZA 5C32A
chains in the Genus database with same CATH superfamily
1V5IA 3WK7A 4G0WA 3HXMA 2OBMA 2CK3A 3EEYA 4BEBA 2VXBA 4I3FA 4C7KA 3OEYA 4U7GA 1OWOA 5CHYA 1XTTA 2CLOB 3FRHA 3I1FA 1XEWX 2P9BA 3PFCA 1V0JA 3ZBUA 9MHTA 2ZBFA 1WNTA 1UMDA 2CBZA 2G7MC 2Z9DA 2GK7A 5CFQA 3CLRC 4MHTA 2IYYA 4ABTA 1JWLA 1E1CA 2I4TA 3LKZA 3AEKA 5JAPA 2YIVX 5L3ZA 3RIGA 3AF0A 3ZUGA 3IR7A 3B7GA 1E3QA 4OSEA 2FPPB 3OD5A 2VZ8A 4LDJA 3KKOA 4KXVA 4PO1A 3OQIA 4JP5A 1C30B 2JASA 3L0PA 3TX6A 4CNQA 1HT3A 1SBTA 2QRKA 1I3CA 3LY7A 4YRBA 5JY1A 5BQXA 5DPMA 5ADHA 3JD4A 5FPKA 2ZREA 1AVTA 4OI0A 2DPGA 2PT9A 5A3VA 5BW6B 5CYPA 3S2YA 4AP9A 2ZR0A 2A6PA 4W5NA 1IAQA 1N2CA 1NY6A 2OC4A 2D2IA 1SIUA 2F00A 2W22A 4H60A 4L7VA 5A2GA 2FVYA 1NNUA 2LIPA 2PX4A 2QPOA 2YFQA 1LK7A 5F1YA 2Z5GA 4TLCA 4FSDA 4HWGA 5BVGB 3HUTA 1ECGA 4LSMA 4TT3A 1IY8A 1SVWA 5CNIA 1AM4D 3A6LA 5TT0A 3ZZMA 2GM9A 1NYRA 1QAMA 1Z8HA 4V3BA 4YRCA 3LNTA 1TE2A 3SJAA 3JRXA 1Y6ZA 4LMAA 4ETNA 5M34A 2QMUA 2RCYA 2DHQA 3E82A 4MIOA 1B1AA 1GPBA 2Z1MA 2GZ3A 5B12A 3MGBA 2YVUA 3T5TA 4KE9A 3D4NA 4GMFA 3AINA 2QAIA 3BHMA 2AZMA 1DIRA 1DHTA 4D9CA 3GFOA 4R1PA 3CVXA 1V1MB 5FV7A 1GNLA 3DZBA 2ZUUA 1XDDA 4RF2A 3LUGA 3NKVA 1KERA 1WZUA 2G9QA 4KQMA 1H4VB 1HYQA 1CLEA 2B61A 1UAYA 3KT6A 4M9XA 1B3RA 2GFHA 2QU8A 3FWHA 3OWHA 3PQFA 4GRAA 2P90A 4OXXA 4INZA 4BZXA 4IDFA 5C51B 4DR3B 4RHCA 3UB2A 3V48A 1GGVA 4PXSA 4US1R 5EMKA 2F1OA 1FDTA 3BWMA 3UJCA 1JDBB 2XB9A 3ESAA 4B45A 5I7WA 3O2NA 2FFQA 5ALWA 4Q12A 4MWDA 2FAXA 3UJHA 2BMAA 5K45A 3L93A 5DWDA 2NX2A 5LP6B 4ZZIA 4G5XA 1RADA 2TSYB 5CT6A 2OFXA 1YMUA 4UVDA 1YOVB 5J1TB 3ZCPA 1KYYA 4BO3A 1IIBA 1XELA 2FLKA 4RTLA 1KQPA 1CUVA 1Y1KE 3CX8A 4FFVA 1HFJA 4IPTA 1YGPA 1FXSA 2BM0A 3OEEA 3G23A 4JLWA 1E3JA 4W1PA 5GJCA 1GY8A 1EFRA 1WV1A 2FWMX 2PUEA 5ALKA 2GN8A 1M0TA 3FVRA 3OQ6A 2GSWA 2P0AA 5A06A 1JT9A 1P1CA 2VAMA 1ULBA 3ZKWA 1M10A 1ZH8A 1WCIA 4D9KA 4F4HA 5HE8A 2O5VA 4HMPA 1RYBA 4I5FA 1OTHA 3W8DA 4D0SA 5KWEA 4B85A 3Q40A 1MVLA 2XE7A 3R4VA 3TZCA 1FFDA 4B09A 3NCTA 4Q5IA 4MIEA 4RJLA 5A0TA 3TINA 4NYIQ 1ECCA 3EIQA 3WGOA 4GW3A 2BUAA 4HFRA 1NSFA 5CX4A 4JB0A 3QSGA 1DUVG 1QDLB 3RTCA 1GTG1 4PVDA 2GHIA 3UA4A 3DR3A 2HA7A 3GUZA 4UCXA 3DWIA 3KJNA 2VYVD 1W36D 1Q3TA 3TNFA 3BERA 2WZDA 3GJ8A 5E95A 1ZNXA 3OLWA 4BHTA 1P73A 3HLKA 4E2FA 4F3NA 4ALIA 4EK9A 1XMPA 4ARVA 4WBNA 2UZ1B 2EQBA 4N01A 3OFVA 5FAXA 3W3AH 3WDSA 1HL3A 1LPSA 1YONA 3CPSA 5D3KA 5DYWA 5F7JA 4BLQA 2GXUA 3TN7A 4B7AA 8ATCA 3BIWA 4IGEA 3GCDA 2PS9A 1EB9A 3HV0A 4GP7A 2BEVB 1AB5A 3H97A 3D3WB 4F8EA 1YR8A 5B64A 5K3OA 4JLVA 4QQKA 4XM2A 4C4TA 2FWBA 1RP1A 1VGVA 3B52X 4D8WA 2YS7A 3IA2A 1XJCA 1YDFA 4IX1A 3NVMB 4CI9A 2CXNA 4YEDA 2IXBA 2WEKA 4M1OA 4U7TB 8ADHA 4YN3A 5MN4A 1DADA 1O0BA 1E79D 1LPAB 2QE7A 2ZCVA 2OHVA 1Y1TA 2YXBA 3KYCB 3I4LA 3C3CA 3C3EA 3O74A 4R2JA 4UUAA 3TK1A 1GV0A 4AXXA 3AF6A 3UK0A 4Q1EA 5FBHA 1SCAA 1QXSA 2Y1KA 4JVLA 4WBNF 1IU9A 4HS4A 2FWPA 4MR9B 3D0QA 3TVYA 2VQ6A 2WMYA 4FEAA 2ZYTX 4IKOA 2BRUC 3D7NA 4OHVA 3GZJA 4KAJA 4LS3A 1XLWA 4X63A 3WADA 2QE6A 1QP4A 1E63A 1JXMA 1G291 2NSYA 2XJ9A 1AGNA 1VG1A 3I2HA 2ZWAA 1D2NA 2OCLA 3L7OA 5CFNA 3PRHA 4F0JA 3PIIA 4H3SA 5K51A 1TUEA 4HAIA 2JIQA 4Y2JA 1PNOA 1XV5A 2DBRA 5ECGC 4UD2A 4EJSA 1GDHA 1T2AA 5DM60 2VO1A 1T2EA 5EIBC 5C4MA 4ES6A 4QPJC 5REQA 5ULLA 1M5UA 1RAAA 4GKJB 1UFKA 4QT4A 3O7WA 1CF9A 3A4MA 2GN4A 3NHYA 3UXMA 2E9SA 2RC6A 4UEKA 4RDCA 1KJJA 5SY9A 1IHDA 2Q50A 2NN3C 5H82A 1XDWA 3VRHA 4LXQA 4NNPA 1QIJA 1ZOIA 4PIMA 1NQOA 1LDBA 1QYVA 5EESA 5IEJA 1Z3CA 5E3IA 5DT9A 1YDGA 5F3WB 3ZHTA 4B71A 5H3HA 1Q17A 1ZSNA 3FWPA 2IEBA 4JSTA 3RB8A 4CYMA 2LP4Y 1SUBA 1FL9A 1L7DA 1XD8A 1XTKA 1FLAA 1TT5B 1XALA 3CZ9A 3JQPA 1TVEA 3LYLA 3QMWA 5EC8A 5B4TA 5K09A 5IM4F 3U3ZA 4PFQA 5I5GA 1G7TA 2NVOA 4JK3A 2OBNA 3HKEB 1MOPA 1N8TA 4PLYA 4RZXA 3V33A 2C9ZA 1L8OA 2VZ0A 3ILYA 5E0KB 3K9LA 4HCJA 4LWOA 4X20B 5FBZA 1I0ZA 1V16A 3PUVA 4N65A 1P31A 3QBEA 1L4MA 4RSHA 4ISCA 2X23A 4G36A 3WLLA 1XNRB 3PTAA 2XWBF 3DS8A 3G49A 4R9NA 3SLGA 2Z3ZA 3IPLA 2YWDA 1NLFA 5AR1A 3WVNA 4B9EA 5LU8A 1MRZA 3TLXA 2H48A 2GXSA 3OZRA 4BLVA 4L9RA 5JAOA 1R0YA 2MSWA 1QV7A 3NNDA 3H75A 4WOKA 2ZR9A 4ROSA 2ERCA 2ZBRA 3M1IA 2GRAA 3DWGA 3N8KA 4TMFA 5E6UB 4HX9A 4K26A 4HNHA 2Q5EA 4F6RA 2JLZA 1JIUA 1DG9A 2I76A 3PGVA 2B8WA 3AF5A 2NU9B 2HHCA 4LMPA 2R68A 3KQUA 3R40A 3ZDDA 2O7VA 3PS9A 4FI3C 2ONZA 2YW9A 2VPWA 4MHSA 4GOXA 1MJNA 4J1QA 1EFDN 4LKRA 4MIKA 4NL4H 3VR1A 5ES3A 3ZX5A 5FPQA 5IDWA 4ZVLA 3LVRE 3ESRA 4IDPA 4PAWA 1UMCB 3RKSA 4J1TC 3EGOA 4G5OA 5LBUA 4F84A 1K68A 2O2HA 5EQFA 1W2GA 3MD0A 2AF3C 1SFRA 1II9A 1XMJA 4M37A 4PIVA 3ZW7A 3HTXA 2C07A 3KVRA 2CZCA 2JD1A 2XR1A 1Y4DE 1B00A 1O89A 1Q7EA 4NOLA 1FLDA 1JVSA 3W7AA 1I4OA 2YJZA 1MCZA 2IDKA 3C1UA 4F56A 3GWZA 2XQGA 4P36A 4Q1VA 4C29A 1E5XA 1QCCA 4CCWA 3N53A 4G2TA 3B1WA 3CRQA 3ESCA 5CNKA 2RCNA 4IIJA 1XBTA 5BSUA 1K5HA 1EFCA 2A9RA 4WKCA 1KJZA 1W6RA 2PRSA 4GBJA 1CR1A 5H3CA 2XKAA 1HUQA 2C3UA 4M0FA 5AH0A 3W6ZA 2ZI7A 3NHJA 1B8PA 4GBED 5LP6C 1E66A 3NKLA 3KLMX 4YFVA 3BDIA 3RSZA 3QLUA 1PG2A 3C7AA 3MUEA 1U65A 1U5BA 4Y2XA 4W5QA 4FMPA 2PTGA 4HP8A 3SD7A 1CZUA 4IG9A 1T5IA 4JR1A 3ZHQA 1RMYA 3C7DB 4J0IA 3ANTA 4EGQA 2ZIXA 1N5JA 1EGVB 1OXKB 2YZ7A 1G3QA 1I32A 2X22A 3D8TA 5F51A 2AN9A 3ZNOA 1TTTA 2WUVA 2OAEA 2PR2A 3IQHX 4IIJF 1AU9A 4IOKA 1Z13A 1X1RA 2Y6VA 1MKYA 5JD5A 3TMKA 1WB6A 2W6OA 3FDFA 4M9RA 3PUXA 3DCIA 1A8UA 2EX0A 1OYVA 3EASA 3EMBA 4M9QA 1EHIA 1E6WA 1MF7A 3AM4A 1HOXA 2BGRA 3ANSA 3CPHA 4PSVA 2HKIA 5B1IA 1IAVA 1C4XA 1EB8A 2HTEA 4DEXA 4RULA 1A9XA 1EUCB 2ZI9A 5ALXA 2Q4OA 1M1NA 1U7ZA 3KKMA 1J9GA 2XKJE 3I3OA 1JDPA 3K0FA 3JYLA 5BNZA 2B4YA 1OAOA 1DKQA 1U0TA 2O7RA 3PQ7A 4O33A 3RTEA 5FPHA 5H8WA 2NZVG 5CDUA 1C0IA 4KAAA 4E07A 3I64A 3LVQE 4FHCA 4R05A 4ECEA 4RPCA 3BIOA 4JBNA 4NZ9A 4JDUA 1TXGA 4Z1OA 1GG5A 5CJJA 1U2GA 5CA1B 2WB2A 1D1PA 1G21A 3MCWA 3R74A 4RTPA 3TBHA 3CONA 3ZCQA 4B76A 1TM2A 2CDNA 4BQIA 5DX0A 1VOTA 4OMDA 3AM5A 2GQ0A 1J0CA 1EIZA 2DPHA 3N8DA 4B48A 5CITA 5AKZA 5KNDD 4H1HA 5KU1A 2VDKB 3PPXA 1KSFX 2HIHA 1C3OB 3M2PA 4L2IB 5KVSA 2XE6A 4XWWA 5KNBA 3AFNA 4GVPA 4CF5A 3KKZA 3MLEA 3GN2A 5CA0B 3KUXA 3DUWA 3ETHA 4NNJA 4D4JA 1X9HA 2E6KA 1KY5A 3NVDA 1VCHA 5DWVA 1SQFA 5GVRA 1M2VB 1R8XA 1QQ6A 2H1VA 4KJZA 3EN0A 1K5PA 3ZY4A 5KOJB 1ABBA 4S35A 1KOLA 4CKYA 4UU7A 4FYYA 3C2QA 5FFNA 4AS3A 3CH7A 5EJIA 2PVCA 4FHFA 4MKRA 1VRVA 3OPYA 2OY0A 2GSDA 5I3ZA 3Q9NA 1EQAA 4P4LA 4CG0A 4EPXA 1N5DA 1SUAA 2SCUB 4FW9A 3NORA 1VYTA 3L9WA 2WIDA 5E9JA 1KVTA 4E5YA 2XA9A 4F21A 1HDYA 3CTMA 3EZYA 2GAAA 1H6AA 2V55B 3OT1A 3I2FA 1KDVA 1G6Q1 4WFIA 3NVKI 1JDUA 1ESEA 4LYGA 3JVDA 1RC8A 1VL1A 1G20A 3I5MA 2P11A 3FOZA 3CUUA 3DTVD 2AXQA 2NTVA 4GLLA 5BV2P 4BLRA 2O2YA 2JCSA 2G1PA 4ARBA 2BUCA 3N86A 1QPZA 4JJ7A 1SRRA 3I6QA 1P75A 4GI1A 2IU6A 4GUDA 1E9BA 4D81A 1GFWA 5LFAA 2K7ZA 1OZHA 3DZCA 4NU5A 2ACKA 1LXCA 1MIOB 2YCLA 2HHLA 1LLFA 1KK2A 1XXLA 3IXQA 4JYPA 4D0NA 1YNSA 3ZWPA 4YDRA 5KX5B 1ZFNA 2QJTA 4N39A 4WECA 4CPDA 2NUAB 4WZAB 2G0NA 1J0DA 1DAMA 4DIDA 2XVZA 1TU4A 5HRCA 2Z1NA 5HF5A 1G9SA 5CDGA 1P91A 1LC3A 2A5FA 1CUAA 2OWDA 3MWYW 3RVBA 1PJ2A 1JA9A 3NIDB 5KQLA 1T1JA 1VMIA 4I9GA 3AERB 4E5MA 5B3KA 2XA1A 1O5TA 4XX0B 2GN1A 1AG9A 3AM1A 1S4MA 1U28C 4FN5A 1C4WA 3FMFA 1LSUA 3SHFA 5IC4A 5CIQA 3QIAA 5AHKA 2EJCA 2GCEA 3CKKA 1BKDR 4CKEA 2JDIA 3ZHCA 4GD3Q 1N6LA 2A0YA 2DULA 1ZD2P 2WV7A 2FG7C 3K2IA 4MW2A 5IBRA 3WP1B 1X92A 2R00C 1DJQA 2CVHA 4GKVA 1SG0A 5KOHB 1YBVA 2VRWA 2AFVA 4U9IS 3S2SA 5B3JA 3FCEA 1E2DA 5UKDA 2Q3MA 1UADA 4KREA 2AR7A 5EPUA 1P9NA 4BKMA 1U80A 2FZGA 4LCBA 4BRUA 4R6XA 1PJTA 5TGZA 2DG2A 4CT5A 1D2CA 3K5IA 2DJ5A 1K6IA 1KDRA 1C3EA 4O02B 3RBZA 5JU6A 1VHLA 4IIEA 1MAUA 4FHEA 3DOUA 1IUKA 5LA6A 5JDIA 4G0NA 3OD1A 1ST3A 4GECA 4EUKA 2PX8A 2I5PO 3S1AA 2ZBPA 4PAMA 1XWIA 1JEQA 3UPDA 5FLEX 2IGTA 2G83A 4JOSA 2ZK7A 2G5GX 2X9LA 4RDIA 2RHTA 1LJUA 4K9MA 5H4HA 4BP8A 2W83A 2AV6A 2EW8A 4CQMD 1Y4SA 3ROMA 4G1MB 1UXJA 1UDRA 4B3IA 2IIBA 1V45E 4MMZB 3BD9A 3TW0A 4AMVA 3RDPA 3HM9A 1T9AA 2V9ZA 1NNI1 4RF5A 3PVZA 2PH7A 2Z0MA 1NASA 2WVHA 1YI0A 3A3NA 3GRAA 3VHXB 5C2JB 4BLTA 1Z63A 1G3UA 1UJNA 1YZTA 5ECDA 1UQRA 2P4UA 2PJUA 1JSZA 3GJ4A 3LL7A 3HB4X 3LLSA 4Y2QA 2CEAA 3G5UA 2ENUA 1BTOA 3ED5A 4OXKA 3HP4A 1V43A 1G0NA 1MD9A 1QLJA 1OTYA 3D4BA 2NUTB 2GXQA 1LFDB 3WRXC 3HCDA 5LL6P 3EPLA 4AU1A 4NMWA 3I23A 3V4VB 3VO2A 2F48A 1QH1A 3BF7A 4Q3KA 5TX7A 5IVHA 2F4NA 2OCAA 4GXTA 3EQ6A 4Z7OB 5EUBA 1NQXA 2QBYA 3F49S 4HQ6A 1PR4A 1NLUA 4YT8A 1CZKA 4TTAA 4P5DA 1J99A 1AHIA 3C14C 4TMKA 4DZTA 5AKEA 4RO0A 2HSJA 2WAYA 4DC1A 4GR5A 4P0TA 2CZQA 3C16C 2CNBA 1OH7A 2WF7A 2CV1A 3NRCA 3PX7A 1RM3A 4J7XA 1GFZA 1EVIA 1NW3A 3A58B 3HFSA 1HYEA 1TA9A 3TJMA 2LKCA 4O1MA 3F90A 3L9XA 5T64A 1FDOA 2Q6IA 1JQ5A 4F7DA 3C85A 3MA0A 2JFUA 3LOUA 3L8FA 3QX9A 4LF7B 1DKUA 3F8SA 5FIUA 4OFWA 4TTRA 4CDRA 2W2PA 3AF1A 4K88A 3BF8A 8LDHA 1W19A 1DQPA 1EXVA 3REOA 1GNTA 1RYFA 1L5NA 2JAWA 1ZI6A 2O0HA 3IUPA 1N5MA 2IV3A 4ZYZA 1AGYA 1OAKA 1P0MA 3QUCA 4JEMA 5H1YA 3DFIA 4N3BA 4LYAA 1TCVA 4V24A 1A82A 1IXYA 1Z15A 2EYUA 4BMXA 5ARCA 3AR3A 1BJRE 3UKOA 1HMYA 4NBSA 3DO8A 5AXBA 3U0VA 1DMRA 4R68A 2Q9AA 4UM7A 4KZKA 1K7SN 1EK6A 4WDRA 4IZHA 2VNKA 1XLUA 2O54A 2JB9A 2PMDA 2VR1A 2V8BA 4ZK2A 3P26A 1NF3A 2FRVA 1H9CA 3EWSA 3QVWA 2Q46A 1ZN7A 1VMEA 4C0WA 4PGHA 2LNDA 2IYTA 4UHFA 3VJKA 3OZXA 1US8A 5AJTA 2Y8EA 2TMYA 4ND8A 5IAGA 4F8YA 4RGYA 3WA6A 3PSAA 4X3OA 3TL6A 4OBWA 1ECFA 3AY7A 1A88A 3FYSA 4LXTA 4UU8A 3G0OA 5KTNA 4X7BA 2PVPA 3RYFB 4EP1A 4ZT7A 1HT1E 2Y4OA 2ZCUA 1NXOA 3U4DA 4L73A 3K30A 2ZI3A 1YA4A 4EQ6B 2CLSA 4MWGA 2VCHA 1I6LA 1UK8A 4HQFA 4QJ5A 1JS1X 1FDVA 1TJ5A 4R9SA 2HYIC 1ZX1A 2NP6A 2BH9A 1W88A 3C3XA 4HQRA 1Y7HA 4WDQA 3WO0A 2QM0A 4U7PB 2JLAA 3VV2A 1LBSA 3C3DA 1P61B 5EFOA 1DIHA 2C1XA 2QB5A 3AR6A 5BQOA 1G38A 2H52A 4JI2B 3L1KA 2BHNA 1AD2A 1M6VB 3KYBA 3RANA 2F8TA 2DM6A 4ZKDA 2OBFA 2JBAA 1VPVA 2RHHA 2A0WA 3LF2A 3M5DA 5D5PA 3KG2A 3M6LA 4NV1A 4AF7A 1ZNWA 3PQ3A 2C29D 3ZQUA 1TQ6A 3DNMA 1XUOA 2G1KA 2J1LA 1SQ0A 1HFWA 1X6VA 2I6SA 3FN4A 5CTAA 4AYWA 2ZRAA 4MVJP 1BWSA 1QGOA 3FOCA 4KGXA 4JITA 2OFWA 4BEVA 1L6RA 2DUJA 3BWBA 3B70A 4IAOA 3TVTA 1S2LA 1QHIA 2B25A 4PBRA 1ACMA 3QWIA 3PNMA 1Z2OX 3OPYI 5JAUA 2OKCA 2MYPA 2DPXA 3LF1A 4FOLA 1YZNA 1FB5A 1NW7A 3JQBC 3P71T 3DTTA 2Z57A 1QFZA 2PRKA 1U8UA 2H65A 3TBKA 1BJTA 1POWA 1QMGA 3LAWA 3M5CA 4H9GA 5T4FA 7MDHA 2GF2A 1OB2A 2VP4A 1QR2A 4NZPA 2GJSA 1CJKC 4FR5A 5FJIA 2VUTA 1T6BY 3G8AA 1IHOA 1NMYA 4LF8B 1G8HA 3T1VA 1JSXA 4H7HA 5FWDA 1YKSA 1IJEA 2EP8A 3A1SA 4NTZA 1F2TA 5EINA 2X2EA 1IEVA 1L7AA 3MCTA 3U37A 2H9IA 3QVKA 1QK3A 5E1MA 1Z4LA 1YCDA 2EL7A 3NV9A 4NBVA 3K9FC 2KMLA 3MELA 2J9FB 3NETA 4P7FA 4LGYA 5CXXA 3FKQA 3KTAB 3HCNA 3T7JA 1E2JA 4FCWA 4MITA 1CQIB 1WQ1R 5DI9A 1MJGA 1R4NB 2ZJFA 4LDZA 3ZEIA 5U1PA 4EEZA 1B43A 5DXFA 1GLGA 4BGIA 1UFRA 3ICCA 1BVYF 3UMFA 3ZY5A 2O8FB 4NYMR 3BGOS 3PGMA 4R9VA 5CM9C 5AI6A 5M29A 3ZV7A 3GFQA 1J1ZA 1JYEA 3PHCA 3PYMA 1UINA 3QFTA 4G5YA 4GVLA 3GEPA 4Y9TA 2OHOA 1E5QA 1Y6QA 1HRDA 2DFPA 2QX6A 3UJAA 1F38A 5K6RA 2PXHA 4BLOA 1XCOA 5B7QA 4CTMA 1LJ8A 4PHFA 3T4UA 3W2FA 3FRJA 4WIAA 2QF7A 1UIMA 1S3FA 2DUNA 2Q3JA 4R0VA 1HE1C 2P9GA 1P5HA 4X1YB 3IPRA 2VF8A 4KDEA 4N0QA 5DHUA 5T41A 3BZWA 3GELA 3Q8MA 2IUFA 3PX3A 2C58A 1C9KA 3O1JC 1KNXA 4I1RA 4IDCA 1G3IA 1SBNE 4XLLA 3BWYA 2G9NA 5E7QA 1Z9BA 4YCMA 1DAGA 3NWOA 4ZEWA 1B15A 3DLIA 1V35A 1MHTA 3A1CA 5HXAA 3HH8A 3ZWNA 2VJBA 4B4OA 1ZRSA 6AT1A 4JVMA 4LYEA 4OXRA 5J4KA 4O1IA 1EVLA 3WGUA 4E5UA 1D4AA 3D54D 4LRUA 4C6SA 2P9QA 2HDNB 1OJ7A 1BVUA 4RPHA 6REQB 1GEEA 3CNBA 4G41A 1RLIA 4M53A 5A5EA 1IH8A 2CLCX 3OG9A 4KZPA 3FZEA 3ADCA 3KT0A 5EN4A 4ZZ0A 1F6DA 4PX5A 2QZPA 4X1KB 3MILA 1FFBA 1XT6A 4Q1AA 1WOMA 2RBEA 3VPDA 2GWRA 3HA2A 4DNQA 4F5EA 1TMKA 3RWMB 1C7FA 1QE5A 1UCFA 5EHNA 1DFHA 4CF3A 5ES4B 1YR7A 4OJKA 5EP2A 4CG1A 4J1SA 3NXSA 3JQ8A 3TNLA 1W1WA 1XWFA 1FFEA 2X13A 1YFKA 3D2BA 4MLDA 4PG5A 4WNYA 4O8CA 1USWA 3PTLA 4UE2A 4YUZA 4NE9A 1WXIA 3TPZA 4YY3B 3E0QA 3L6OO 4E51A 2QMYA 3UF0A 4GKAA 3WMRA 3LDHA 1E9RA 1PJBA 1KJ8A 1KI4A 2B21A 2ZP1A 3FLMA 2BCGY 2BI7A 3CBQA 1DV1A 4D74A 1JU4A 5A4KA 2ZUEA 1FNCA 1KTVA 4J0EA 4JLAA 2GTHA 5G1NA 4E88A 7REQB 2A94A 3U4AA 2FEXA 3FR8A 1CHDA 1P2GA 4UM9D 1UDAA 4MEJA 3ICWA 2XWPA 4JU9A 3H83A 2VIIA 3PEYA 1PYOA 4HRYA 2ILVA 3ACCA 1I9GA 1HX7A 2WK1A 3QTLA 1PHRA 1RJWA 2A5JA 3Q2OA 5EAIA 1P0QA 1AIPA 2R751 1SXPA 2WP0A 3WE7A 4HAUA 4F2HA 3P9SA 4QXPA 2V0CA 1YQWA 1SKUA 3FPLA 3PVCA 5E7JA 1ZA2A 4HV4A 1NMEA 4BFWA 3W0LB 1DKLA 3F6PA 4Q9LA 2BFFA 1S01A 1WZNA 1G16A 2B1JA 4RKQA 4B3HA 2DEUA 4QGGA 1VJ1A 2A35A 3HJUA 4KTVE 3UJ9A 3O3MB 3JRNA 4J4BA 5JUWA 3R2JA 4E4TA 4I55F 4QYIB 1ADGA 5JSUA 2I67A 5JE8A 1RBYA 2HA6A 1AURA 2MR6A 3UMGA 3K94A 2XH8A 2B35A 4EKGA 1FP1D 2EFCB 2IF2A 1UXOA 1BN6A 3NNSA 4CL8A 4CLOA 2HRZA 4Z7NB 5JWOA 1UJ4A 1SA0B 4GDMA 1TVKB 5DIFA 2FPIA 1X3SA 3VKWA 3DDWA 4E6EA 4HKTA 1GTZA 3S8MA 4KL8S 4DV5B 3V9PA 4P4TA 3JWGA 4CTKA 3Q9UA 1EFUA 2R2GA 3A6GA 1N9GA 3N6RA 2GO1A 2QIOA 3MMSA 1JYFA 4QPPA 4QHYA 4Y7DA 5T4EA 3URMA 4Q1CA 3V2UA 2GERA 4RBNA 3L01A 3WLPA 4MQUA 2AJDA 4PXAA 3L5OA 1MNAA 4RH3A 4RLFA 2ZJ7A 3IXLA 3TLGB 4BPRA 1DINA 5CDFA 2GD1O 3CV3A 4GI5A 4EFNA 1QSGA 3SYRA 3TSAA 1WXQA 5BRAA 1G19A 6ADHA 5F12A 3OOHA 3NHAA 5JDCC 2PUHA 2JGMA 3N0VA 4ARSA 4BLWA 1WJGA 4FMDB 4YO7A 1GTJ1 5CVCA 1C9YA 2NSJA 3TWOA 2QRZA 3U3MA 4G6ZA 5HK8A 2RAFA 2JVJA 1GAXA 2VLBA 2Y0DA 4QXAA 2D62A 4JI1B 4P3KA 1RHQA 4ZXPA 2UKDA 2OUIA 5E8RA 1V8BA 4UM5A 4AW9A 4GGPA 4RHTA 4EYEA 5IXYA 2EFHB 2VDRB 3JVEA 3NNNA 1W76A 3EK2A 4Y8VA 3EPPA 4HRAA 5I8PA 3ZBTA 1MB0A 3ISTA 3PGJA 4J94A 3EGVA 3SCZA 1R8SA 4P38A 4EA9A 1WXEA 2GPWA 5ADWA 5FOWA 3SEZA 4BV2A 1E58A 3IAM6 3R44A 2FJPA 4PGGA 4DB4A 1ZICA 1Q16A 1IMJA 2X1HA 3H1EA 3V32A 4BBZA 2C3PA 3FPHA 1TVMA 3CB2A 5ED4A 1ECBA 5IH7A 3LHFA 5EJFA 2Q3LA 3MT7A 4N6NA 4Y67A 4BJ1A 1BU8A 4ZQBA 2AJBA 4YDHB 1EVZA 3BREA 5KC8A 1EX1A 2IYSA 3UK7A 4CCSA 1QGZA 4BV3A 2YINC 3MN1A 1HH4A 3LKDA 3NBQA 3VUFA 4G0QA 3RRBA 5I45A 5H4GA 3BD7A 5KCZA 4Q3DA 1VI6A 3C45A 3CURA 1GTRA 5SZIA 3RI3A 2VBIA 1Y4UA 2G9VA 1ISMA 1CCWA 2FMIA 3HSSA 2ORVA 3OBBA 4YRSA 5HM6A 1BU5A 2GZ1A 2OQVA 4JQZA 4BO2A 4GZ6A 4QJIA 3INTA 1TYBE 4LRXA 3TG2A 1BFUA 3IVXA 1TRHA 1A2KC 3R5XA 3UWDA 4A8JA 1TK9A 2W90A 4LNHA 3V8MA 4EB8A 1ABEA 1KYVA 2X5KO 4C2UA 3K71B 1SKAA 1Z5OA 4DBZA 2JJ1A 2JHCA 4EZIA 3ANNA 3LO5A 4RPIA 1OC4A 3DJFA 2VJNA 3WOHA 4DCSA 2BN4A 3LX5A 2HJHA 4KWCA 4TWZA 4JKYA 3PNKA 3GVPA 4XIJA 3UT5B 2R48A 1JKFA 2HLDD 1QFYA 3W7VA 2XCTB 2GZ2A 3MINB 2W98A 4C06A 4YAKA 3RE1A 4INJA 3VC2A 2PSEA 3L77A 2J3HA 1PTJC 5HCUA 3U3XA 4EYSA 5G3YA 4JI5B 5JSZB 1MA0A 1ZZGA 4AKTA 4C4OA 2QLBA 5IZCC 3HBNA 4IHJF 4JVOA 5KOIA 5D3MA 5FI5A 1EFVB 2AXEA 3CEMA 3LXUX 1PGNA 5EIBD 3F7MA 1GCIA 3PWKA 4BU0A 2J48A 1PJ8A 3BE6A 4Q9JA 4GMKA 1M1UA 4MA0A 3TDMA 4UTVA 5KU7A 4C0BA 1NU6A 2HV9A 2X41A 1TM7E 2AQ8A 2LCIA 2P35A 3JD0A 4G3XA 4WXHA 3T0FA 3VXKA 2PRJA 2PA0A 3R7WA 2JAXA 1TUBB 1TLLA 2VKQA 2C82A 1XB2A 3ZLUA 4L85A 1BW9B 5DOZA 4W82A 2PKRA 3WRYC 4OM7A 1EK1A 2WF8A 4ZVKA 2YWHA 3OZGA 2BGNA 3EZ9A 4EYGA 3NASA 1CVLA 1WE2A 1VCMA 1HZZA 3DL0A 3NW9A 4EJSB 2JCYA 1UBKS 3V8EA 1TAGA 2A4MA 4BATA 5BWOA 5JVDA 3C4VA 3B1FA 2M1XA 3FOAA 3OOJA 1SQGA 4QYTA 3PLRA 5ALQA 4ZA2A 4BMDA 4NEHB 4CT0A 1EXMA 5JMWA 5JMOA 3JQRA 4BAZA 2VJCA 4OYYA 4DUGD 4L5JA 3GF4A 4FN4A 1CRLA 3GY0A 4FFLA 1GP2A 2GWHA 4MW4A 2AI2A 4ZKEA 1KI1A 3G9XA 3AKZA 3DG9A 2GZMA 2NQ8A 4KRXA 3Q3IA 3LBAA 3LWDA 1UBTS 3KR2A 3LQ2A 1B0ZA 1NVDA 1NN3A 2I87A 4L02A 2X5OA 4IXNA 4Z3OA 1DLJA 1V11A 1LBEA 1V8ZA 2RGBA 3HU1A 1BCRA 2GARA 1JIJA 2WJYA 2DECA 2VH5R 2UZ4A 5KSZA 5KDOA 1CS0B 2CNWD 4KYVA 4F5WA 5JNRA 4J7CA 3DC2A 3VVLA 2B36A 2CZGA 2HBRA 1TKCA 1OQAA 2BF7A 3GFGA 4KYUA 4QODA 4U2BA 2M1ZA 2VPPA 5D85A 2ZDHA 3CF6R 2XUGA 4IFBA 2C2HA 3IC5A 5FORA 1NE2A 4BUJA 1THGA 4QNRA 4BEJA 2OV8A 3C5VA 3ELBA 1WKCA 4BYGA 1XZ8A 4D0LB 2DE0X 1QYWA 4XKJA 3U0BA 4TLLB 1NUSA 1E2QA 2JGNA 4CEHB 1RPNA 2R8XA 1PNRA 3T7CA 3G2QA 2GAJA 2Z83A 3CWQA 4UTPA 1SQSA 2JH3A 1T2NA 1GOTA 1OXTA 2Y27A 3IP8A 1IJKA 3QEMA 1KY4A 4IIDA 4MS3A 3TOZA 4BNTA 1O94C 1YNOA 5LNK1 1BCSA 1RE1A 2CCKA 4DDTA 3IDQA 4V1CA 1PZXA 2CVZA 3BGDA 4JYCA 4BO1A 1Q50A 4CEIB 1JQEA 2QMZA 1U7PA 3PCXA 4FU0A 3OLVA 3IHLA 4AWXA 4BNWA 2WBLC 4LJ8A 2QT1A 2NUBA 1EUDA 4G9EA 5C81A 5ENDA 1I4LD 1MENA 1A5ZA 4RE6A 3E5RA 2A9PA 2WZCA 2VSNA 2ZETA 3KE8A 2C2BA 3L2OB 3MWJA 3VU9A 4KOEC 3X44A 1KL7A 3GDWA 3KEOA 3Q6IA 3IOBA 1Q0UA 2KWIA 4PNEA 4W8HA 1KP3A 2IGBA 8AT1A 2FZ4A 4JJIA 4PPFA 2BCJQ 3DBRB 4FGZA 3WL8A 4D99A 4BXOB 4HAVA 2RHBA 1OWMA 4DTIA 4LXIA 2ZE5A 1GHTA 5AJVB 1LDMA 1I6WA 4IUYA 3UZUA 1XZPA 4R2HA 1QYIA 3JZFA 5JZSA 1SUDA 1XTJA 3EZ7A 1EBFA 1VQ1A 3E2MA 3M89A 4O2LA 4Y2PA 1YR3A 3V3KA 1F3OA 1TO1E 3GT3A 4WTOA 2FFJA 1JR3E 4MZXA 4HOYA 4U7FA 5FBLB 1NUPA 1R0WA 4R7TA 4WESB 3BGWA 2QN6A 4GO1A 4P54A 1U5BB 4XGQA 3ETCA 4BWYA 1HV8A 1DTWB 3F7TA 4NXNB 1Q1NA 5H83A 4REQB 4JP8A 1W73A 1CUCA 4A36A 1NM5A 2WF9A 5LQRA 4JIMA 1XZFA 3I9MA 3R6DA 3WIEA 1UJ6A 4Z6KA 2FKAA 3AR7A 2P2GA 1ZH2A 4G09A 4KXNA 4PPNA 1PZNA 1Y4ZA 3I58A 2JVKA 3EWAA 1FBTA 1V8PA 2B5WA 4DXAA 3UFBA 1FP4B 3OQBA 2W2XA 4A0QA 4NU8X 1ULAA 2H2FA 1F1BA 1M6WA 1O5OA 1U8FO 1IK4A 3NBUA 4EF4A 4P0QB 3SR4A 1JTEA 1NNLA 2HXSA 1QWSA 3AHEA 3EWIA 4V0RA 2IXAA 4YCBA 5DF1A 2ZM6B 4FD3A 4YRKA 1YA6A 1N6OA 3FFTA 2E4WA 1ZDMA 4WXMA 3K4HA 4HH4A 4MS1B 2O0MA 5ALVA 1XP8A 2G1UA 1FNNA 3QUAA 1M1NB 1XXHE 3DZ8A 1RBQA 1GCGA 2ATXA 3K0FB 4MW1A 1II8B 4UNIA 2YWRA 4FOSA 1SVMA 3D6TB 4JKIA 4N8SA 5D6OA 2HREA 4MWTA 2WLSA 3WQRA 1CX9B 3MHTA 3FB4A 4LRSB 1Y8ZA 1QPGA 2ZSBA 3EXHB 4DMFA 2ZWMA 4JX9A 5A05A 2ONYA 3UWMA 3LTNC 4TUYA 4RPLA 1C5KA 1OFGA 2XOEA 3R1IA 4TYPA 3WFIA 3ZTTA 3PWSA 1CEXA 4DVJA 2H8GA 2WMOB 2V03A 1Q83A 3FNQA 3KFXA 2J0UB 3CCBA 2RK4A 3FX2A 3HBMA 1IL0A 2P9CA 5ADVA 4BNDA 3ND5A 3E3NA 2EQ5A 1PNQA 2XQVA 4IJ5A 2NTYC 3ETDA 2FQXA 1ZIPA 3DOJA 4I9HA 4OQLA 1EA5A 1P0IA 3V4ZA 4QTYA 2W2LD 5I7SA 1V2GA 1WOYA 1IBSA 2GJ9A 3R24A 4PZYA 2ODTX 3HN2A 1BS2A 2WUDA 1JR4A 4FNMA 3MJEA 5TB5A 3HACA 3PGKA 1OPRA 1E2GA 2HFKA 3A4TA 3RS3A 2BP7A 2VHQA 1W52X 2XCQA 3Q5GA 4L8FA 4RLSA 4TUYF 4K8OA 3K53A 5DULA 5K0TA 1YFZA 2BGLA 4ZGWA 2IT1A 4KVFA 4YRMA 4HNGA 4MQEA 4YUYA 5JNUA 1GPH1 4ZQFA 2PZBA 3JVIA 5A9SA 4U3JA 3HJGA 3LA8A 1CUJA 4TRNA 4URZR 3ZJYA 3HBJA 2XNDD 4RQTA 3IP5A 2IWRA 2QI9C 3RJZA 4RZSA 3OJWA 3LP8A 4WLVA 3PDIB 4YV7A 2F3RA 2WTXA 1JKJA 4AJ2A 1WSWA 1Y6RA 2DRIA 2XTMA 4M0EA 3AUJB 2KE5A 4MV0A 3K72B 1M8JA 2ZYIA 2DBZA 3MJTA 3V4PB 4B0PA 1U1CA 1NWCA 3A6EA 3A2KA 4B44A 4QUGA 5IUNC 2JH9A 2H11A 2PWYA 5ITWA 5DSXA 5BV0A 3QKUA 3KUCA 3QUSA 5E3JA 3BN3A 1CJUC 1B26A 1AKNA 2H00A 3WR5A 5EKDA 5KTSA 4KWTA 1NV8A 2C2XA 2J7KA 1J49A 3TQRA 4CE6A 5C8VA 2WQ6A 1DC7A 1EVQA 2IE8A 5CAEB 1LKZA 1NMSA 2P6MA 5WRFA 3UOWA 2J67A 3LVBA 2VBCA 2X4IA 5AOBA 3B1XA 3ITEA 3GVIA 2AUMA 1FS4A 2DGDA 3DOIA 5FCDA 2QYHA 3D0RA 3UT6A 4UFPA 1ZH4A 4MS4B 4AMBA 4H1WA 3U7GA 1D6SA 3SX4A 1GCUA 3WAGA 3TTTA 2P6OA 3N2LA 5GY7A 3H9CA 1V4BA 4BQOA 1JG4A 1SUWA 2WA2A 4HS9A 1QIHA 4WN9B 2G08A 2CE7A 3W9BA 1V8DA 4YUAA 1Z6TA 1I1QB 4TVOA 4CIWA 1AUQA 2WWYA 2UUBB 5E4TA 1ZI9A 5HBRA 3KD2A 2H9YA 1E2IA 5CT4A 5J40A 2I2AA 3THOA 4I6GA 4QIHA 4RS4A 1JE1A 3TAHA 4CKEB 3O2JA 2FE4A 3PXDA 3MCVA 2RAUA 2V3CC 3T34A 2DPLA 1Q6ZA 2CBGA 2ZQYA 2ZSEA 3NKFA 4EENA 3MBIA 1EHYA 4TQAA 4U6SA 3VSEA 5LP1A 2WTUA 1Z6YA 1GRQA 1G3RA 3KLBA 5KDLA 5LD2C 3BBPA 3PL5A 4UTOA 1MJ5A 2BISA 1D2HA 2M6KA 1N2GA 3T3HA 4HX2A 1T36B 2QZ9A 3K8QA 4MRMA 2OL4A 4WZBB 3UMBA 3WKCA 1O08A 1R0KA 3LUHA 5ARBA 3AY6A 5AK4A 2NXJA 4QUAA 1X8LA 3EY4A 1BEEA 4FYMA 3H5AA 3V1YA 1QP7A 5G0TA 1O57A 6CHYA 3SPXA 4R2WA 2UUCB 1E1YA 3P0RA 2BZSA 4RAQA 2YZ2A 3RFVA 3ICVA 1UXKA 3WGGA 3N2EA 2W6IA 2D1FA 2ZRPA 1GUBA 3JAKA 5LA6B 2Q6LA 3EGWA 1GTVA 3S1AB 1VKZA 5JROA 2HT6A 3J80A 2XCLA 2E87A 5DN9A 5K8JB 4C2TA 1E4VA 3WIUA 3FH0A 2MSKA 2ECOA 4CWAA 1F2DA 3R3YA 1YFJA 5A3SA 1R6DA 3GLHA 3WAJA 4ENRA 2O8DA 1UJMA 4F1WA 2LXNA 3S2IA 2GBLA 4ZOCA 4C4PA 5A5FA 3W8FA 3ICQB 1O4VA 1T4BA 3KCNA 1PP4A 4DV6B 3NBKA 2ZUTA 2VDNB 3L8GA 4XASA 4XVQA 2R6JA 4IO0A 1ZIXA 3RWBA 1PR0A 1XRNA 3IEIA 3IRUA 4WXPA 5K3FB 4Q4AA 3S7ZA 4FGLA 1R5JA 5FBVB 3MS2A 1G5IA 4UNSA 1HT0A 4MICA 4K0RA 1PEAA 2F3PA 2QQ5A 3G2OA 1H1LB 1ZUWA 4K6FA 4W1SA 4XPIA 3S2GA 4CZ2A 2AC2A 2W71A 5A04A 3IP3A 4S1VA 5EWLA 3EVTA 4G63A 1OFIA 3U62A 3D43A 4LQDA 3IBCA 5BOSA 4U5QA 2QBYB 3FWKA 1PWXA 4O1HA 3VDRA 3DL4A 2IYQA 2PZLA 4L8GA 2M6SA 4Q6WA 2VL7A 1DWPA 1GPMA 2XI4A 4JZYA 1SEPA 4Y6RA 1TYCA 2N3ZA 2QRPA 5IU6A 1FJ2A 1ORRA 2EJUA 2FWJA 4RMIA 4YP5A 3UUGA 3I6ZA 1YVRA 3AI1A 3AHCA 4N18A 1XMVA 4D4MA 3RYIA 2E0IA 3U4GA 1N7JA 2YNMA 3RUEA 5LB4A 3WNDA 2C5SA 4EA7A 1VSTA 2DU8A 2WJAA 4HDNB 1SOVA 4L4ZA 4Q39A 3X0DA 1PBNA 4Z9BA 5HK9A 5ILGA 3PQCA 2J33A 4ZEVA 3G68A 3KDSE 5HFJA 3GA5A 1SC3A 2BT4A 3DAFA 4M9SA 4BWFB 4CM9A 3R0QA 4MYUA 2ID9A 2PNJA 1VIVA 4OXYA 1NT4A 3PFWO 2RB4A 5KYYA 2EXXA 4BGVA 3WL3A 2WD7A 1FDUA 5EHXA 2FFHA 1K7EB 2R87A 1OGYA 2X5XA 4D4IA 2XXAA 1GA1A 1HNNA 3K70B 4IMIB 2OOSA 2C5HA 1LS1A 1XTIA 4ND6A 3VYWA 1HFKA 1IN6A 1M34A 3LLUA 2PS1A 5LJIA 3PG5A 3BTVA 3NBYC 3D7SA 2A3RA 4R98A 3RRNA 3DV0B 3Q12A 3K96A 3Q7QA 5D5QA 3GLFA 3MJRA 1ZJ6A 4IQFA 4WV3A 1GRCA 2C00A 2ZSKA 5EKSA 3L49A 3D0OA 5FHQA 4FD2A 4KFUA 2AH5A 4PBTA 3LLVA 3GMTA 3Q9LA 4BO4A 2MIIA 3D4OA 3GP5A 4EHIA 1ZNQO 2OK7A 3QLJA 4FGKA 1A9YA 5E1BA 4JJFA 4JVNA 1RAGA 4EABA 4KR9A 4G89A 5DISB 2BUBA 2AG1A 2O2JA 2AD1A 1XPOA 4CCAA 4ZIRA 2BJWA 5AI8A 3GNSA 4GSLA 2E18A 2Q2NA 2H51A 2VAVA 1C8KA 1XOIA 1JKMA 1QZZA 3A31A 3BDVA 3GXOA 2EIHA 4II3A 2R1ZA 3OCZA 2J4CA 2WWXA 2V97A 2XUDA 4JSYA 5JEEA 4IGKA 3IBTA 1UBGA 2AEJA 3Q5DA 1AX9A 2O4CA 3AVQA 1H2RS 3HZZA 1DRJA 5BN3A 4G1VA 2VI5A 4QX6A 2C5EA 4FE3A 1DZ3A 1U0OC 3B1ZA 4RJ2A 1REQB 2IK8A 4MEAA 4PZ9A 2OMKA 3ZJVA 5K0NA 4F97A 4PW0A 1Q0ZA 2LD4A 2VFAA 2UZ3A 1KS2A 2X8BA 2VC2B 4GSYA 1IEXA 3AP3A 1KEWA 3P19A 1BX1A 4ZICA 1EK2A 4PQEA 4B46A 5KS2A 3FAZA 1JE0A 4ZAFA 4WADA 2PYZA 3USES 4CDGA 2J45A 3F9IA 3VA7A 3J7AC 1XDBA 4KQ6A 5DKFA 4ZEMA 3RLIA 1G7CA 4KE6A 4M9ZA 4QREA 4QJ4A 5MGNA 4ZYVA 1SKYB 2I65A 2QYSA 5KSWB 3IEXA 1T9ZA 3QKWA 1X1AA 2ZBGA 1AN0A 3NHFA 2WT8A 4L8LA 4Q3BA 2G72A 1P4RA 3ZV4A 2XX3A 2PCLA 1CNEA 3CLUC 5BSEA 2PIDA 2QAGC 3B5JA 1YL7A 1P5ZB 4LZAA 3NM6B 2RGNA 3PHGA 3RVSA 3TH5A 4D4LA 1QLWA 4D6PA 3VKGA 3HZOA 2NNWB 4J7AA 3S2ZA 5KVQA 2DWPA 2CJYA 2HSDA 3H3JA 2P1ZA 4OXQA 3ZZUA 2VH2A 1OXVA 3X3HA 3TPCA 2IODA 3E22A 2K4MA 4DLYA 1P80A 1ISFA 3A32A 3LP6A 1KAOA 4BY9E 4LY0A 1OE0A 3TXYA 4X84A 3ROZA 1ESMA 4WKBA 4KITB 3UGKA 3LZDA 2VAXA 5JRZA 1NYTA 1ZYUA 2B6NA 1Y80A 1VCNA 1QVZA 1D09A 1SOUA 2J87A 2NYUA 2XV1A 1QUFA 3U16A 4JY7A 1DIBA 1XVIA 3NGLA 3U31A 5I5EA 2X0DA 2DUMA 5KKCA 2Z95A 3N0RA 3F6YA 2OECA 1DELA 4FYVA 2WF5A 4HTFA 4KYTA 3B89A 1G17A 1GUAA 1QV9A 4N7MA 3QK7A 5IUKC 4C3OB 4E7PA 1O77A 2C4NA 4PYLA 4PG6A 4H59A 2PS0A 3PJFA 1XMQB 1Z2NX 1JG1A 1U3WA 2CLKB 3R09A 1UBLS 2J3JA 1G2OA 4XB1A 5F3RA 2IQIA 2JEYA 5ALGA 3LUBA 2QUAA 3VR5A 5F1PA 4OYLA 2FN8A 3AOEA 4CMBA 2X6TA 5I7FA 1SBQA 2AN4A 5AHWA 1YULA 3A7EA 2BGUA 3H5TA 4GOOD 1OU0A 2PQ0A 3KSBC 3EA0A 3GLIB 1E3WA 1I1OA 4ND5A 3TLYA 4E2WA 1T2VA 2X5NA 4QOSA 3NPMA 3IE1A 3I76A 1T9GR 2QG4A 2E1PA 4XYGA 2C83A 2J4DA 3VFDA 1LNZA 2XGJA 2VRCD 4LC1A 5F9HA 3FJOA 1UK9A 1W4LA 5DNCA 4X65B 4LX0A 2HQOA 2LCQA 4O2AB 3IRVA 2P4QA 1A5TA 2J5BA 4PG4A 2V6MA 5LZ5A 3SZMA 4EMBA 3CN9A 5SZHB 5L3VA 4Q3EA 4BZWA 4YPFA 1RYMA 3MNFA 5B7PA 2ZZNA 2Y1XA 1AS0A 3C97A 5IM5A 1K89A 1MDFA 1S2MA 1SHTX 2Q8QA 5AIAA 2GA8A 4MKXA 4UXHA 1R0RE 2YWCA 2B92A 3ZR4B 4U7JA 2O06A 3H2HA 5HGXA 5CBKA 5JZVA 4FMBB 5ESWA 2RGWA 3HJBA 4BQNA 3I2YX 3GLKA 1NXSA 4JGGA 5HE9A 4YASA 3Q6NA 5HFNA 5EZ5A 4AZ3A 1UJ5A 2F3TA 2H0AA 3DOFA 3WOVA 4QM6A 1F1JA 3EZ2A 4MJLA 1HFEL 2PZ8A 4HNAB 2K2WA 4U2FA 2O5CA 1VA4A 3IPAA 1I5EA 4JEIA 2FQWA 4WI1A 1BFKA 3AHGA 1UODA 3EZLA 3JQ8B 5DN6A 3RV3A 2C98A 5H68A 4KQ1A 3WGIA 5BXYA 3L8YA 4RL6A 1E3EA 1OFTA 4NS4A 5A5DA 2PUJA 4RPKA 2ZJ3A 4IDBA 5LMUB 2PZFA 2OV3A 1CR6A 4FSXA 2CXQA 2JJMA 3KYDB 4M1MA 3SEAA 4F91B 1D7OA 4ERNA 1Z7WA 3R8XA 3WB2A 2G77B 4U1RA 2PUAA 1SHZA 1IN4A 2X58A 1LPMA 3TLCA 2R96A 4HGYA 2VF5X 3H9BA 1AUPA 2ECKA 3SHQA 1Y1PA 1EYZA 5IJWA 3A36A 1OZAA 4V0QA 1AKWA 1IHPA 1EXDA 1DDGA 5JG7A 3UW3A 1E77A 4HZUB 3UHPA 5F7OA 4M8LA 2VCEA 4IFTA 4EPWA 3QG1A 2JLQA 2XKBA 4HZGA 3KIPA 1QGUA 2VP2A 2F7SA 2WHQA 3OM9A 3RM3A 1HZJA 2FDRA 4L0QA 1G59A 5HJ7A 3OCVA 1IBKB 1DBSA 4E5DA 2EX4A 1SUIA 5ENZA 1Q7CA 4GH5A 2VQDA 4QU0A 4MB6A 5KSPA 1I4EB 3ZHSA 1GDTA 2BTQA 1KZ1A 1NR5A 3D8HA 3M6WA 3NANA 4GDFA 3GVHA 1K3FA 1T2UA 2X9GA 2BHRA 2ECFA 3IQWA 2J3DA 3OIVA 3DVAA 3LGAA 2ZE7A 5C4IA 4IJQA 4HFNA 5DYTA 3VKFA 5DHRA 2HWUA 4RY2A 3TRKA 5EWMA 3H8WA 3EGCA 3WL5A 1L5RA 3DEYX 3P2YA 4JXZA 3OHPA 3ESZA 4D1YA 4LWZA 4EX7A 4EKYA 5LIPA 4CLOB 3FB1A 3D6JA 1U3TA 4K03A 1MEOA 4J0GA 3U48A 1YI8A 4D96A 4JXXA 3ET4A 3V4SA 2P79A 5JV5A 3AUTA 1DCFA 2CCJA 1V7PC 2W43A 4O4HA 2AYXA 3AQIA 2RIPA 5J5CA 5F73A 3SS7X 3SWWA 4AZ0A 1OX6A 3BB3A 3EC1A 1AJEA 1IWBB 2JFVA 2ZSJA 4RKYA 4XGNA 5C7LO 5JS8A 1JDZA 3CO5A 1VE7A 1LWOA 1BH6A 1N9GB 2V5AA 3VNSA 3GLRA 2JI4A 1H9AA 2NLOA 3A28A 3LRPA 3BT7A 2BIFA 3I04A 5MN5A 1OXXK 5HW0A 3A7DA 4W99A 6GPBA 4RK6A 1ULTA 2YWJA 4M1WA 4M60A 4PANA 4PLWA 4F04A 4BFYA 1Z0IA 3K9HA 3S1SA 4JLOA 4D92A 2PMCA 5BUZA 5AVXA 3HCWA 4MYTA 1GITA 3T3GA 4QHTA 3PJRA 3C7KA 4LG1A 2ZJ2A 2HBZA 1XK7A 2PL9A 4O4HF 3VVCA 4BO7A 1U63A 2WY2D 2P9ZA 1CBUA 1GGEA 3SEQA 3SOZA 2GEBA 5IWAB 1BE8A 3B8EA 1KS9A 2ZYWX 3N1UA 4RKEA 3WSVA 5KTTA 1UAAA 3L7AA 3UA3A 3I3SR 3JYNA 3K73O 4IRXA 5B6PA 2FXVA 4DDMA 2VQEB 3C8ZA 2Q1XA 4I1PA 3FUWA 2H3HA 5HKAA 4I1SA 3WWOA 2C7BA 4B33A 3K4QA 3TIGA 3KQNA 3ZQKA 3MIZA 3MRTA 4RQUA 2FMTA 1VBNA 2ZSUA 1OV6A 1TVCA 3EGIA 1P0FA 4MVWA 4IF6A 3H0KA 3VZCA 2W5UA 4GHWA 4KMSA 5F98A 5FLKA 2XMZA 1H6DA 2BR5A 2G76A 2OAP1 1R8QA 1STOA 1YL6A 1XLTA 1XZGA 1SXJB 4R1QA 1NJ5A 3F96A 1P6XA 1PAUA 1V3QE 1GJRA 5JSKA 2J85A 1M8FA 4R71A 2Z3WA 4ESOA 4Q24A 1LLUA 1S6YA 1KK0A 4PQGA 1FP6A 5KPJA 4BO9A 1FU7A 5EQDA 1V41E 4BNHA 3IAS6 3QQ5A 1L5OA 5JNWA 5U4XA 1YASA 3LI2A 4N3AA 4C7OA 4QD3A 4OUDB 4YGXB 1DAPA 5FXMA 1Y3HA 2Q41A 1LJLA 1IRIA 2HCFA 1V7QA 2O3SA 3JALA 4NNOA 3F5QA 3A0UA 4IS3A 4FWIB 4TQGA 5LVAA 3NRJA 3PIDA 4BP1A 4ITVA 5KJFA 1P6UA 2ZT6A 1Y8AA 1M74A 1B0AA 2QVZX 1BG6A 2B8EA 3BHIA 3OA0A 5DM0A 3G5AA 3K1AA 4I4LA 3SX2A 3TQIA 4XRGA 1N8KA 1IZZA 2C8JA 2HF2A 4EM6A 1MDBA 2VXCA 4WKGA 3PFFA 4ZDWA 3C3WA 4R7ZA 3K8YA 1LW7A 2ZPUA 4BX0A 4INAA 5B37A 4JT8A 1ORIA 3R0XA 3FTQA 4GFDA 2M6RA 3KXKA 2Z5FA 2E2WA 4RIGA 5I9TA 1S1MA 4RGVA 4C0JA 2AOTA 1KIFA 2RHWA 1V9CA 4MLPA 3PXUA 1BDJA 1G8PA 4HEJA 1VJDA 3R77A 1L4FA 1TUIA 2Y1OA 1OWNA 2OCXA 2VNIA 4O2BF 3ZV5A 4AZWA 4YV1A 4Y9UA 5AMXA 3KJHA 2C0CA 4L0DA 3SKVA 3NS7A 2H1RA 2O6LA 3HJNA 1A77A 2UZIR 5CVUA 1EPUA 1B2RA 1S9HA 3KHKA 1SVKA 4MA4A 4S24A 4D98A 1FMFA 1N1MA 1Q7RA 1HTTA 1R3DA 4PZAA 2FJ0A 3ESDA 3Q7RA 3FCUB 2Q9CA 2B78A 3MSXA 2HMWA 4AG3A 4D6XA 2GUWA 4MDYA 3IHTA 1EM8A 3COYA 1BMFD 3GFRA 2RD2A 3CW8X 2OP0A 3GLTA 2JIZD 3KTOA 2RKOA 2VQ3A 4JJEA 2XT9A 1W5AA 4MHOA 2GF9A 1YXMA 2WJ3A 521PA 5IW8A 2VYVA 1N1DA 1NMXA 2QWXA 4O5AA 2IY8A 2P3QA 3W8NA 2IHUA 2CYCA 3LUCA 3EQ9A 2CLFB 4D4KA 1CTQA 4RZ3A 2VNAA 4M49A 1VYHA 4MI9A 2I7TA 4UBLA 1QC5A 1L8LA 3HS3A 3VV3A 5KNCD 5JVDB 1IEQA 3ZD7A 1NF9A 4QFBA 3AIOA 4L5BA 3HM2A 5F2NA 2HIGA 4E4YA 3B13B 4WGGA 4XYBA 3DWEX 2QR5A 3U7RA 3KAPA 3OLXA 1V3TA 3AX6A 3SBDA 2J41A 5I6DA 2WNSA 2OD7A 1XEXA 2XUIA 4M6WA 4Z4QA 5EIFA 1BMDA 3N2ZB 2I1VB 1XA3A 2R60A 4LHEA 3AYXB 5FWYB 4DLZA 4YQFA 1PD1A 2KHZA 5AI5A 1BS1A 2HA2A 3FHOA 1YC5A 3PUZA 1JWAB 3U39A 4TX1A 4B3FX 8ABPA 4LZLA 2CNDA 5DHAA 5JPIA 1E79A 3OCWA 3HWSA 1NTOA 1NC3A 4BDTA 2IX9A 1Z4JA 3FMPB 3R3JA 1HTWA 4JQYA 4YP6A 3RQIA 3ERCA 1TT7A 5FRDA 4ER5A 4AS1A 1XWWA 2BE7A 2R1VA 3FVWA 3I2JA 4F3YA 2HDOA 1ESDA 1MQSA 2NADA 1TZCA 4XXHA 1O94D 2FZLA 2ORYA 2E4ZA 2O9JA 1GL3A 2WJWA 4ZOLA 5EEHA 3CUTA 3TD2A 5AVUA 5JXGA 2JLYA 2ANCA 1L4UA 1XGKA 4Q4JA 4ZDIA 4MINA 4PSAA 1G3MA 3O75A 1GA6A 2RB5A 3LPLA 2YYSA 2JZOA 2ZUVA 5L3RA 1VJGA 4O4LB 4D80A 4ZAYA 5ITVA 4YQEA 4DSUA 1F6BA 3HCAA 3RU3A 3WGTA 3ADDA 4AUNA 4DQLA 5B2EA 4LY3A 2QM7A 3ROKA 3EXIB 3KM0A 1X1CA 2QJWA 1UQUA 5TPWA 5J1SB 3CYFA 5LQCA 3H04A 5FBWB 1J7JA 4YAWA 2UYHA 2FPLA 1BDIA 1BCSB 4RA9A 2VLIA 4Z0NA 4BO0A 2C2MA 5HIKA 2JLXA 3JQQA 3NTLA 2WIKA 3KAKA 3ZJ5A 1G6HA 1E9DA 5CFMA 2X8LA 2PX5A 1QLHA 3IOCA 4KXFB 4WBSA 4AZVA 4F5DA 1EUDB 1VJ5A 4NSNA 2AFHB 3KUDA 4NQRA 3I37X 1GZ3A 3RSCA 3RREA 3TRIA 2YXNA 3ZTYA 1LK5A 5EJ4A 5HIAA 3HCRA 1YQGA 1I5OA 3K8OE 3V5NA 4MRVA 1UKZA 2VYNA 1QKKA 3WYEA 1WUIS 1E64A 2XYQA 4DW8A 4UW9A 2DHEA 3Q11A 2Z8ZA 1TUGA 1EVJA 2MR5A 3FNFA 1HE8B 3BMNB 4N0DA 3B9QA 5AKYA 3LXMA 5DP2A 5C3UA 2OCDA 2IUUA 3HNOA 4S05A 2OVFA 3BJEA 3M3PA 1PTKA 1WDWB 3JQ9C 3D3NA 4Y2VA 5AUOB 5LLDA 2XCIA 2H31A 3HVIA 3M1LA 1RLUA 4TS9A 2CHFA 1Z0UA 1ENYA 2XWJI 2Y77A 3ZDEA 4BX2A 2WU4A 1E3IA 4XAQA 2BMWA 5BSRA 3ET5A 4RD6A 5EMJA 4HEQA 3SSOA 3TW8A 2B5OA 3GGJA 4FYIA 1BHSA 4ITUA 1X39A 2AI1A 2PGDA 5BXQC 1BH2A 2H6EA 1SN7A 2RC5A 2ORWA 2YASA 1NBIA 3COSA 3EQ7A 1ZUNB 3GT4A 3K6RA 3NDIA 1LTQA 2MSEB 4HGZA 4BLSA 1LDYA 1SXJC 1XNJA 2OUKA 2Q6VA 1WULS 2WTNA 3DZDA 3PUWA 4O0MA 3ADKA 4L5YA 4RF3A 5DASA 4A9AA 2QQFA 3VNRA 3TCKA 3NWPA 4YQZA 4PZ0A 2BAGA 1U7DA 1VL0A 3B3FA 3DMTC 3FMGA 3LK7A 1R74A 4JBLA 5DLQC 4DBVO 1UEJA 4KR2A 4XVHA 3F6RA 5FFFA 4P35A 1I24A 4Q9HA 5AUPB 1EGQA 1SC4A 1E92A 4PX3A 3M6XA 4AZTA 4OHZA 3EARA 1BDBA 3V9AA 1JMYA 4BLUA 1G6KA 4MI3A 2WQZA 2GBIA 2I03A 2HCBA 2HEGA 1LX7A 1P6QA 2HIAA 5JYCA 2B8JA 3OJXA 1TLTA 2CXOA 1P2TA 2VK4A 5LCXA 4BL5A 5IK2D 4PCAA 1KF0A 2PLWA 2WILA 4HPWA 4MAAA 5K6TA 1SOMA 1GQ2A 3EMVA 1YDWA 2WM2A 2IP4A 1IM5A 2D5LA 2E5FA 3M6UA 3QUQA 4K40A 4JLKA 4LHYA 1WUHS 4OEHA 4JJ4A 4DN6A 4ZYLA 1H2BA 1JQJC 5L3SB 4KNVA 3P9QA 3OU7A 2R5NA 4QKQA 1CQJA 4F12A 5A4MS 3VSDA 4IIXA 5H59A 1P8AA 3TBFA 4DV2B 3PNQA 4ZDJA 3JR7A 4AUEA 1JPJA 1FRFS 2OYSA 4ARZA 4DV7B 1K3TA 3ORSA 3LGXA 3LQQA 3V1NA 2ZB7A 4I2VA 3DHEA 3TKYA 5EWJA 4ZVMA 1P1JA 2P30A 3BSYA 3IAFA 4JL5A 2YFKA 1QHHA 2EBFX 4RIIA 4JB2A 1WZIA 4XR4A 3TTSA 1O96A 3AXSA 5KYUA 3DZIA 3ZIDA 4N40A 1GGFA 1S8FA 4C20A 4K1LA 2PBLA 4W6ZA 2VSYA 3K5PA 3KZCA 3ZCXA 4MRSA 3DFKA 1L7OA 5TJ9A 3F3MA 2EP5A 2DAPA 1BQ4A 2HUPA 2NPOA 4KAFA 4IXMA 1X38A 1ZMRA 2D2FA 3DL2A 1FPMA 1SUPA 3JZIA 4LJ7A 1NFFA 2CJFA 2Y1GA 2OXIA 1QYXA 3U1VA 2YHIB 1CDOA 1MX9A 1IG0A 5FOUA 1W44A 5TJHA 1WZ2A 1PK7A 2TECE 1R15A 4HK4A 1M1YE 4DNXA 3LHSA 4BC0A 4C3UA 3VJRA 2PGOA 2P69A 1S9DA 4EA8A 1JSRA 1A9OA 1UANA 3IMGA 1I7SB 2V4UA 3ACBA 2B4RO 3OCJA 2O57A 5GPBA 3UC9A 4PSKA 1DFGA 3ZWXA 1PBTA 5ISMA 2O8EA 4B8ZA 1KY2A 2XXBA 4BQRA 4MKIA 1L4YA 3QPVA 4QQFA 1EFAA 2QDKA 3L84A 4WLOA 1P1FA 3CF4A 2PJRA 5KNDA 2GF0A 2I3AA 2CVQA 1A4UA 3AJAA 4LHXA 4B87A 3IDOA 3AOGA 1FS5A 2R1TA 4LYYA 4D43A 2IYEA 3FSEA 4I0WB 2WI8A 3T3PB 4B75A 4WNIA 4CLXA 4IXTA 3W05A 1GPDG 1Y8QB 4XQ9A 3E6AA 3KOXA 2ZANA 3ITDA 1T1RA 1NQVA 3T4EA 1QO0D 4FZJA 1W1IA 4JBHA 3PJGA 1N2EA 2R6DA 3N6XA 1PWHA 1T5LA 3T7RA 4M76B 5CLFA 2XNSA 3IPXA 4NEGA 2I1WA 1E2EA 2YMLA 2ABWA 4KVZA 4DV0B 5J9FA 5JT1A 5FD8A 2D7CA 3AF4A 4I6JA 4COOA 4ZODA 2EV9A 3FXAA 4KV9A 1ZW6A 4CM3A 5THXA 1FSSA 4HWTA 2OWEA 1DEXA 2KB0A 2AOUA 3BRWD 3IE2A 3N2KA 3PITA 5ALFA 2Q7DA 5AQ1A 2F55A 2FW6A 2HQBA 1YB1A 3NBAA 3UJ6A 3E9QA 1OLXA 1N2IA 2BFWA 4X92A 1ODCA 1FX0B 2Q8PA 3D8SA 3NWBA 3SDZA 2NPIA 3O1HB 4Q93A 5LQJA 1ZISA 1RTTA 3R7NA 5AK6A 4L7QA 2W48A 1ICIA 1M66A 1QIDA 1Z62A 2H1IA 2AJ8A 3DPIA 3DTVA 3EJWA 3H42B 3KQMA 4MV7A 4RHFA 4E31A 3CX7A 2XA2A 3JQAB 4TRMA 1M5TA 2C0PA 4WK2B 2RK3A 4LWPA 2F1IA 2D7JA 5DTEA 4YUXA 3GGDA 2OV6A 3T9DA 3BWCA 4ZHQA 4N41A 4RHYA 2YXDA 4FYHA 2DQ4A 2IKQA 2O7NA 2VS1A 2FN7A 1ZCZA 2Y67A 3MSCA 1W4ZA 3FSRA 4S0ZA 2D3TA 3GBSA 5EXPA 3STYA 5I8WA 3E7DA 3GP8A 4KPYA 5FO1A 4DR1B 2NP7A 1QYRA 2D8AA 3AKYA 3JSXA 2JAPA 3Q7EA 3LX4A 5D7NA 5JCXA 5KYXB 4G0XA 1GPWB 5KO2A 5KQMA 2VHEA 1QQ7A 2B8NA 4PN7A 1RU3A 1KA9H 2J3IA 2JHPA 1VB5A 1HRKA 1IPFA 1SUFA 3A9WA 3DDCA 1IXZA 1E1QD 1T0JB 4YACA 2UZAA 5KKAA 3NLLA 3W6NA 1YL5A 2VHXA 4ZHQF 3O7MA 3QV1A 2O8DB 2QVBA 2ZVJA 1XMOB 4BBPA 1E61A 1L5HB 2IV2X 4ZVTA 3FTCA 1K5GA 3WDMA 4NDZA 4JV5B 1OXMA 1E99A 3IAEA 4YRFA 1E7MA 3THSA 4S1OA 3HY3A 1KI6A 1PQPA 2O2CA 3O8BA 5DSZA 1PV2A 3R3WA 3GPDG 4FNAA 2NIPA 3WGYA 3K09C 4Q4AB 2A9FA 3GLGA 2R62A 3A4LA 1Q21A 4I4IA 1I4WA 4LRTB 4DZZA 4YCNA 3EEOA 1CB0A 2CNKA 4XIYA 2G04A 3KKNA 3QW4B 3V4RA 4C7MA 1ZK0A 4BAUA 2PU7A 1U9IA 2XUPA 3OQVA 2OC9A 4HGPA 1KYQA 1Y3FE 3H1AA 1T8WA 4JA0A 1KE2A 1JB9A 1KI2A 4G5FA 2NT3A 1M2OB 1ZM2A 1V25A 3CXRA 4B35A 5ICSA 2V9PA 4JL6A 2P6NA 4DF3A 1XNGA 3V7NA 4W5WA 4RIEA 4XDHA 2BCEA 5BOSB 4FMCB 3JVUA 3BX1A 1ZY2A 2JLWA 3E35A 5BN1A 3LLMA 2JF0A 3TJRA 3C7TA 4OATA 2H4XA 2PBRA 1DQRA 4OHXA 1KEVA 2VDWA 1ACLA 2IZ1A 3DD1A 3D7KA 5HA5A 3WX0A 2FQ1A 3A9SA 2RE8A 3LYUA 4ZVOA 2B0CA 1EBBA 4DG9A 4QUDA 1YB6A 4LXXA 5J2UF 3LPDA 3LHKA 2X7XA 3TZLA 1OBHA 4HXGA 4E14A 4NECA 1VHDA 1XIVA 4OX9Y 4GPTA 2CUTA 4B3XA 4OLBA 4DLSA 3KJZA 4CTJA 5IXSA 4A0FA 3W8EA 1GQYA 2FX5A 5FJJA 1KRHA 2QMQA 3ISVA 3SE0A 3PC4A 121PA 3QWFA 1J8QA 2V7TA 5JBQA 1V6SA 2XB8A 3K8ZA 1GNVA 3UTDA 2ZWVA 1KNQA 5JXHA 1JEJA 3AI2A 3JZMA 2FEKA 2ZXUA 5AK0A 1RCFA 2RGGA 1BRTA 3X1MA 2PMBA 3FBWA 1WQ3A 5CVEA 5E1DA 5FHRA 1G8YA 5LDGA 3ZGLA 3OESA 3G5MA 1WLYA 2R6HA 4RELA 5HJEA 5BV8A 4HWRA 1QH9A 1W0JD 3UOAB 1UBEA 5B53A 3S55A 1A4XA 5TVGA 2GO7A 3G1WA 3EDMA 1C9NA 3N0TA 4LZJA 2XTJA 5M7EA 1MO2A 1KU0A 2BGGA 4NG4A 1M34B 3VJMA 4KMRA 5JNVA 1XVAA 3FTNA 4Q7MB 4C1BA 3LW7A 4L9AA 3PSHA 4LOKA 4X85A 1LLDA 3D4PA 1L6IA 2I2XB 4WK0B 4X90A 3TL3A 5KYWA 3OIFA 5L45A 4OGFA 2I99A 3U9SA 1SK9A 2C2YA 1Z73A 4MV5A 2C77A 3V97A 5TGDA 1BX3A 4CLRA 1JA1A 3W6OA 1SCBA 4EGAA 3THXB 2NQTA 5EUCA 1ODTC 1CIVA 4ZVNA 4QEDA 5AWFC 5DE3A 2OZLA 4CMKA 1SQ6A 4F2DA 2BEUB 2IP1A 2IXEA 4P9NA 2P5YA 4TOIA 4Z7JA 1ZBDA 2IL1A 2IHBA 2CSXA 3O03A 1MT3A 2D5IA 3MB8A 1GSHA 2R0QC 3JV7A 1HDEA 1J25A 1FA9A 1N0UA 2O0JA 5ALZA 1EUQA 4C3ZA 1CJBA 1ZK1A 2RH8A 3K05A 3LPMA 2LR0A 4OB7A 3SC3A 3WAKA 1O2DA 1RYDA 4GP9A 5KYVA 3D3QA 1Q6YA 5AVTA 3QITA 2RAVA 4HVLA 4WCFA 2A4KA 3A9VA 2RGDA 4G4SP 3NHZA 4F4IA 4X91A 3CLUD 2PWZA 2V7QA 2G28A 4QDZA 3OFKA 1QAQA 4DCTA 1NG1A 2D4AA 2G71A 2MYTA 4EPYA 5KREA 2O8CA 5D01A 2Q1TA 1GU1A 5C53B 1OASA 3MK31 2C1EA 1X7DA 2JNWA 3PC8C 4KQFA 1JNXX 3F6EX 4QC2A 4QYWA 1L3BA 4IGAA 3DDHA 1CVIA 2PH3A 2CFRA 4Q4HA 4RPGA 5IBQA 1QP8A 5AXCA 1QYDA 5H81A 4WVFA 3VPAA 3REQB 4RVGA 1H2WA 3S8YA 5I9SA 2FY8A 2ATVA 4R3WA 4K05A 1IUNA 2SBTA 3JASB 3LU1A 4FXPA 4OQDA 5KIAA 1QF9A 2XUZA 1CWUA 2O8BB 3WYAA 4M4SA 4BFVA 4OSOA 4TRRA 3X1KA 2HO5A 3HVHA 2FUCA 2HL6A 1UIRA 3NJRA 2IHNA 3MBOA 1WCWA 3CVOA 3MMPA 2BKEA 4G4IA 9ATCA 4ZC1A 3MTDA 3KOUA 4TV8A 3IIEA 5F3DA 4A26A 5I7UA 1UWVA 1DBQA 2MINB 2O2DA 3W5IA 3EUWA 4BV8A 3E22B 2OLJA 4AMYA 4D9GA 4RYDA 2JFZA 1SMKA 1KMNA 2FZ5A 3E9CA 2H07A 3QOFA 1YRLA 2BBWA 1VE6A 4WJKB 1TKAA 3RFUA 5JWHA 3QVLA 3DE2X 4RKFA 5LZ2A 1NVAA 4LCJA 3KPVA 1F6WA 5LXTA 2C57A 3FF4A 3TZEA 4URWR 2HXGA 3EEQA 1HLFA 3F2IA 4FOTA 5G40A 1KSGA 1VPEA 2DMRA 4AJIA 4BO6A 2H1OA 1I9CA 1OLSB 1VHTA 2ZYGA 2Y9PB 4EW3A 5DGXA 5G02A 2BGTA 4OVKA 3IGFA 1P45A 1XJWA 2Q1YA 2O3UA 4OA5A 4UBOA 3W90A 4HJRA 2JI6A 3PQEA 4NZMA 4TV8F 4XFJA 2WD9A 5JQGA 4R0NA 2HGZA 1PS0A 4IQ4A 1P9OA 1VIDA 5DXJA 1KMCA 2J0VA 3OURA 4FEEA 3U44B 4W7HA 4MUBA 4CLDA 1BE1A 3WL6A 4J4HA 4J8PA 4DLPA 1RHUA 2FUG6 1UMBB 4V0LA 1UZAA 3L5KA 3PNSA 3RNOA 5LXTF 1J9ZA 3VKUA 1U0EA 3MEQA 2OORA 3AL3A 1ZJWA 1EESA 1Z34A 4JUAA 1C3XA 4QFDA 2QL5A 2X6RA 4DDUA 3VYUB 1WTCA 3ZYZA 1RYZA 3HBAA 1E3WB 3H5RA 1AV6A 3D4IA 4EGCB 3MAAC 2YOGA 1FJHA 4MR7A 1K0UA 3EIFA 4UAJA 4UHCA 5JQGF 4KR3A 2AFIA 5JJLA 1NJ2A 4MWSA 2WYHA 4X7PA 2GXAA 821PA 4EH1A 4IYRA 4DY4A 4OFBA 3NOXA 3ELDA 1NC1A 3AH8A 3K1JA 3S7TA 2CF5A 2DUWA 1H8EA 2TMGA 2Y1FA 2D5CA 1LU9A 1ZVMA 2SKCA 3DJYA 5KYTA 3N0XA 3AVYA 3TZHA 3FOFC 1UQTA 3U5TA 2PJDA 4M7PA 3L6UA 3RLFA 2ZM5A 4M54A 1KC3A 3T61A 3KHUA 2UVQA 4X1IA 2ZUWA 5IDYA 2ZRKA 5D8DA 4YJKA 5IABA 1Z2EA 2NYRA 4JUFA 4PZLA 5TQ0A 2JAQA 1KZ9A 1M1ZA 4TS1A 1J8VA 3CS3A 5KJEA 2FLVA 1SKQA 2NZWA 1NR7A 4NBTA 4JEHA 2BFEB 3FHTA 5IP5A 3QKRB 1PE0A 2Q5QA 4LVUA 3TLBA 1JYSA 2HC9A 2QGFA 4UCWA 1GTSA 4FHDA 2DP4E 5IVPA 1AO0A 3WGKA 2V7EA 4CEIA 2GCNA 2PGIA 3H4IA 4KQEA 5CFPA 1F4LA 2QTGA 2HHHB 3WIOA 4H08A 2BEWA 3G8YA 3SXJA 1LLQA 1YTLA 5A02A 3WMEA 3T5CA 4IX9A 4IUDS 4PFJA 4GC9A 4WKNA 4N5MA 3OIDA 3UPTA 2X7JA 2P9EA 1FS6A 2QTVB 2E55A 4DDVA 3JQCA 3WLQA 2VT2A 3E61A 3RC9A 1AUVA 1ESZA 4LY9A 1E18A 3ON5A 4KQCA 5FAKA 3IELA 1G8SA 2FUKA 3JSAA 3QFRA 5DU2A 3VGPA 4C4AA 1H2HA 1JR2A 1RE0A 1VLVA 2R8RA 3O8OA 4MH0R 3WIDA 2PSSA 3T1OA 4MR8A 4UAGA 1R6UA 1DRVA 1WMBA 3UK1A 1QB7A 2YJTD 3H19A 3HB1A 2YXPX 3TTVA 2I34A 3P32A 3BD6A 4G84A 5TGTA 3OTQA 2XADA 2Q2WA 3WGMA 4HTAA 1R18A 4PFKA 3LKBA 3ZY6A 4KLAA 3ZYCA 4KLNA 4IY1A 3ND7A 1EK0A 1XZKA 2YICA 1KOGA 4J43A 2WW8A 2EFJA 2VZLA 3ABZA 3OHMA 1U04A 4W4TA 4WSOA 2WJIA 5LZ7A 3U4CA 1GU0A 3ZPXA 1SCKA 4D9FA 1AMNA 2C9BA 2P2CA 4KPEC 1BD4A 4GS5A 3DVAB 1X7YB 5BOVA 3ZDBA 4BRZA 1B41A 5EWMB 3E4CA 1NI4B 4AC9A 3U61B 3RYTC 2RGUA 4DM4A 1T34A 4ZT2A 1OU4A 4R51A 1G66A 3RW9A 4ILEA 3M5PA 3QX8A 2AVDA 1HK7A 2DH6A 3HA5A 3QVUA 3F47A 5JAHA 3U40A 3ORFA 4A6DA 2VUHB 4OBXA 4YDSA 2IEDA 1H0SA 2JVIA 4CLRB 3DDUA 1O6CA 4P83A 5HWSA 3C3JA 4HYEA 3RJTA 1DAIA 1T13A 4JD5A 1H4SA 2HJRA 2Q7XA 4IJKA 5GV7A 3ZJUA 1MQ9A 4YV0A 4KO3S 4EW6A 5BORA 4CKBA 5ALSA 5TRTA 1GIAA 1M6YA 1YBHA 2FFBA 3O5AA 1S2OA 1BIFA 3TF5A 1QV6A 3RS2A 2IIVA 1H0HA 3ETLA 4ZCLA 1UK6A 2A88A 1AGXA 3WLNA 5CNMA 3AUFA 3I05A 4TL9A 3SE7A 2REOA 2J32A 1QONA 1PS9A 3HJAA 2ACWA 3QMVA 4RZQA 1CK4A 3N87A 5IAOA 4P81A 1DS6A 1ZGCA 3SF8A 1RBZA 4PQFA 1OV4A 4D9BA 1WW8A 1BWQA 2WG2A 3IUYA 4OHMA 1JZSA 3QBJA 5TPZA 5DTQA 5HOQA 1H42A 3I9FA 4ZDKA 1PEKE 3UVEA 2QW0X 3K0BA 1QOPB 4UKDA 3VYSB 3VVBA 2Q3BA 3P9ZA 1WA5A 2YJGA 4QDJA 4DVGA 2Q4EA 2JFWA 3U7QB 4EI2A 3M81A 2OE2A 3PDHA 3HSKA 2RJOA 3O83A 4J2OA 1ADJA 1I01A 2ZIWB 1T2DA 2N42A 5JCJD 1ZKMA 4OHCA 1PX0A 3OQNA 3AKEA 2P78A 1YVUA 3DEKA 1M5RA 1BDHA 1QNFA 1YBFA 3CF2A 3GJYA 1NVWQ 3GZNB 3N5KA 2WT4A 4NU6A 1TEVA 5B1DA 3RS0A 1NAIA 4D9IA 3DAGA 4ICIA 4BZPA 1CR2A 3ISJA 3TSOA 2VJMA 4FLFA 2FOIA 3NBZC 1RZRD 1E60A 3AESA 2H7CA 5KZMB 1RWNA 1LRJA 2JGEA 2ZGVA 5ED0A 3FF1A 2XT6A 1WPGA 4BJ3A 4KDFA 1TIBA 1X1SA 1E4EA 4NQZA 4HRVA 2OGUA 5CGQB 4I4CA 3H11A 2PR7A 1G5QA 3LX6A 1A8HA 3L0CA 7YASA 4FGJA 4AO7A 2D7DA 4OU4A 1G5PA 5ALPA 5ALUA 5GONB 4I14A 5C52B 5FWXA 5FTNA 4MRAA 1BYUA 4PR3A 2J5RA 3CRZA 2AE2A 1SB8A 1Z16A 3H17A 3INGA 2HSWA 5ESDA 1ZS9A 2RONA 2WD8A 3EC7A 1O6ZA 2XKKA 5CMLA 4HDQB 2CLEB 3NAQA 4ND7A 4DR6B 3HJRA 2AG8A 4CMJA 5FDFA 4EVIA 3HADA 1M2JA 1D7AA 1XK6A 5K3AA 1LZKA 4BC1A 1AUXA 4LE1A 5DI3A 3KJQA 3A05A 1YC2A 4TTSA 1NDQA 5BURA 2VPIA 3G82C 1VC2A 4Q00A 2CFSA 4X66B 1SVOA 1ZN8A 1ODFA 1RI3A 4C08A 4AL4A 3OP4A 2GHQA 1UOPA 4MPTA 4K86A 2AOVA 2PGXA 3AFOA 4HWPA 4KQXA 3RTGA 3FPKA 3KVNA 3S3TA 5F23A 4QL3A 3A6JA 3D31A 1MP0A 1YJXA 3I45A 3E53A 4HN9A 1PUXA 5FULA 3ZY3A 2AZXA 1NKSA 3NR2A 4JELA 4W1RA 4YJDA 2D0PB 2PQMA 1DEKA 5BQFA 3SLKA 4HMQA 4JWKA 4QAJA 4TROA 4AJNA 2X4DA 1VJ0A 3VZPA 2GBFA 2ZAYA 3H8JA 2JW5A 1VZ3A 4BNYA 3LQKA 4B83A 4JYZA 2HF9A 3S4YA 2F3SA 1J97A 5GWXA 4G0UA 5HPYB 4DQ0A 1SKMA 1Q1AA 4ADSG 3GC6A 3LDFA 1V5GA 4ZQEA 3CA8A 1JLLA 1A0OA 1Q22A 2EF0A 1WY5A 1EVEA 2JIOA 1Q2UA 3SZGA 1EG2A 1XKTA 2RI0A 2BRUA 2FSVC 2YJ4A 3HDTA 1G42A 5CBPB 3D3JA 1VFPA 1Y1RA 1QDUA 3A9RA 3CVJA 3DR5A 1DARA 4HGQA 1PJLA 3LWNA 3RHSA 1C1DA 1FRQA 5A6SA 4UEOA 4J2HA 1FXWF 2W8BB 4YJFA 2WTAA 3LC7O 5AM2A 2X0EA 2JHGA 3I8SA 4BECA 3W5DA 2PUGA 4QG7A 1PDVA 4LZWA 1LRKA 3JATB 5H9WA 1JHPA 3IAM1 4GMXA 1IVSA 4TV9A 1XQ9A 2JEZA 2BSAA 3L7DA 5B1YA 1KY3A 1RKUA 4ZOLB 4PQYA 3S68A 5KCMA 3DYIA 1DQYA 5TT1A 4G25A 1GUZA 3CLKA 1A8PA 3CG0A 1CETA 3ZWCA 5KJCA 2G07A 4GRDA 2YDXA 1TLFA 2QRHA 2FOXA 3UKDA 1U7UA 3D2AA 4HB2A 1LTKA 1KEKA 2EC5A 3VSBA 5B30A 5BWMA 2AS0A 2YY5A 3DQQA 3LT5A 2D74A 3LY9A 3PRYA 2VWQA 4CDMA 1FQWA 4LTNA 4QA9A 2FX2A 3FWZA 2LV8A 4LV8B 5IH3A 3KQQA 2FE1A 3MF4A 3Q7IA 2FPPA 1XZQA 2JKZA 4I4TB 2C2GA 4M88A 4TV9F 3KYJB 1C30A 3LDGA 3AW8A 4KFSA 4CGYA 3GRZA 1F60A 2V45A 4IH1A 4DIMA 4BVBA 1JHAA 3JQFA 4ID3A 2J0EA 4ZI7A 3AI3A 5TMPA 3L4BC 4O4JB 3DQZA 3QOWA 2VTVA 5AVSA 1TEZA 5IJ9B 4QXMA 1NLZA 3OE1A 1G98A 1K92A 4KQ9A 4UVIA 3ETNA 1DC5A 1JT2A 5IVIA 3FJ1A 5FLXA 1FQKA 3QVMA 3ZIAD 3ZQ4A 1JQDA 2AE1A 1ZL0A 3RVDA 4AG6A 1XQ1A 2AX3A 2VTBA 3JXEA 1HG0A 1PJSA 3ZWOA 3EHEA 5DX1A 2CNWA 3N6VA 3DYBA 2ES4A 4NJMB 3SIPA 3ZLVA 2UVPB 3E7FA 5BVGA 1IIRA 1AKQA 2R47A 4KO1S 3EPKA 4Q48A 4BNJA 2QX8A 2GPTA 1JNYA 4AMUA 4CIBA 1SXJD 1JHOA 2PLFA 3STXA 3TI7A 4FHZA 3SC2B 4NF2A 4U39A 2EJBA 3QTBA 3IR6A 1FMLA 3UV7A 3I61A 2DT8A 3TOXA 4J1TA 2OYCA 2PHZA 3PRJA 4OP3A 4WJLA 3TOCA 3FR7A 1CY7A 2BZ1A 4WE3A 1ETHA 4RJTA 3EQ8A 4Z1MD 4WT7A 5BYBA 4FT2A 2BEKA 1CB7A 4I1UA 3RS5A 1L5WA 1YZ3A 2OGTA 1JLSA 3AM3A 3BWEA 1PR9A 3H8SA 4RX1A 1EHCA 5CLGA 3K35A