3LHFA

The crystal structure of a serine recombinase from sulfolobus solfataricus to 2.3a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
136
Chain Sequence
RKVILYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEEVCKAHGCEIVVINKEEELVEDLVSILVSFSGKLYGMRSHKYEKVKKCVEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Serine Recombinase from Sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Recombination
molecule keywords Serine Recombinase
total genus 45
structure length 136
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhfA01
2RSLA 3GUVA 5C31A 4BQQA 2R0QC 5C34B 3BVPA 5C32A 2MHCA 3LHKA 1GDTA 3PKZA 1HX7A 5C35A 1ZR2A 3ILXA 2GM4A 1ZR4A 3G13A 1GHTA 3LHFA 3UJ3X 2GM5A
chains in the Genus database with same CATH superfamily
2NYUA 3R3XA 2PRIA 4REQB 5IT4A 3PUYA 3H7IA 1XL0A 4TTTS 3BICA 1KMNA 3RIHA 5C3MA 2E7ZA 5JFOA 4PC1A 5IC5A 1FX0B 2D0DA 4R8RA 1KETA 4NYIQ 3FTCA 3TMAA 3G5TA 3KD3A 4RTKA 1KAEA 1UXOA 3O92A 5B7QA 4KXQA 2O8NA 4JBNA 1N33B 1XDSA 3I73A 5IASA 4JT9A 5BVHB 3P9KA 3K16A 3WBKA 1VJ0A 4EO9A 2BGWA 1GQQA 3CEPB 3ZWVA 4I36A 2UXCB 1XQVA 1HPLA 4HNAA 2ZYVX 4EB6A 4H7KA 1GKIA 4EEXA 4BQSA 4W1RA 4KXUA 1AM4D 4MUMA 3HGMA 4QU5A 2QRLA 2YV2A 3BE8A 3KU4A 2JCYA 3PC8C 4W9NA 4QQKA 3BRQA 4OREX 3UG7A 1N2CA 2ZWVA 3AY3A 1AUXA 2QTGA 4J1QA 3IQWA 4M1SA 5KOYA 1ORHA 1QQAA 4MJXA 1KBZA 2P90A 3DKVA 1JPUA 2Z95A 1GNRA 4IDBA 4TOIA 3TRHA 1BJTA 3KFVA 2X2PA 2JFNA 4RMJA 2UYOA 1VLMA 3AHIA 1Y0BA 1D2RA 3BK7A 4S0ZA 2J31A 3LWZA 3ZHTA 3RVKA 1P1RA 2E82A 1ZD9A 2G06A 2DTEA 3EIOA 3GZNB 4UEOA 2D5IA 2C1XA 2ORWA 1RAFA 3JD0A 3KYBA 4WA7A 1NW7A 3UYLA 3V2IA 1V25A 1CC1S 3GLGA 3WE7A 4WOBA 2MYNA 1WUHS 2Q1TA 3NXSA 4KO8A 4YALA 5K0LA 4DG5A 5HOQA 3SHQA 1NKVA 1WZUA 4X6XA 1U98A 1RRMA 3PZRA 1N2BA 4MR8B 5K51A 1E3IA 5CFLA 2XPCA 3WYDA 4FDLA 2OXIA 3BRSA 4I55A 3WBFA 3VZQA 2C00A 4KLAA 4YREA 2FMUA 4Q9IA 2E18A 1CR0A 3S4YA 2QR2A 4DDHA 2CLOB 2C9BA 3GA0A 4EW6A 3WVNA 2FWIA 3DQZA 4RDHA 4TQUS 4DWJA 4F86A 1IZYA 1GGFA 2BTQA 1L3CA 1NVXQ 3PPXA 4XJVA 3L0OA 1H6AA 2I4NA 4FNAA 2WU8A 5ALGA 5J5AA 2JBAA 4R81A 5KTKA 4F04A 3PCTA 4E5KA 1G17A 3WYFA 4L78A 4DR1B 4C2UA 1BE6A 1OI7A 1MRSA 3HLKA 3IALA 3IIJA 5HQJA 2B4YA 4L5BA 3HCFA 1JEYB 4L6AA 5I9TA 1BX3A 5CIWA 4LKRA 1X1CA 5T8KA 2AG8A 1S4QA 3C6YA 1LFAA 4R31A 3V4SA 2QRUA 4GYJA 1IN5A 4HH3C 4OXYA 3T61A 2ZIEA 4XM2A 3KQSA 1SAYA 1ISIA 3C8ZA 1AY0A 1CUCA 1L5VA 1JU4A 3PHCA 3FTEA 1PS0A 2HNBA 3H8WA 3KQYA 4LE2A 5KSPA 1YFKA 2Q3EA 2DOKA 3IVCA 1Y3FE 2PUVA 4AJ1A 5U4QA 3UGKA 1N4DA 3IQEA 2JA1A 2LV8A 3USES 3A6JA 2V7EA 3QKRB 3R8XA 3I5MA 4MX8A 1FNBA 1ZZGA 1PQYA 1TAHA 2O2HA 3P2EA 1EBUA 4KRXA 1CB0A 2O4CA 1DWPA 4H7EA 3WTBA 3ZZ0A 3ZZ1A 5BN4A 4DM4A 1A8IA 3VYRB 3PC3A 5IXSA 3AJEA 3Q3EA 1JXAA 1NUSA 4KYIB 1PUXA 2H51A 4LX0A 4TRNA 4HLQB 5IJ0A 5EE0A 1TU4A 2JNWA 4LAFA 5DNCA 2GRAA 1H5QA 2VSXA 3ETHA 3OIGA 4ND7A 4DLXA 4DAOA 2OWEA 1DEOA 4A7PA 2O0KA 4QICA 4IDHA 4CUZA 4YRAA 4G0VA 2VDOB 4D4IA 3IQDB 3ST7A 3ODGA 5JHHB 1N6HA 5DEOA 2R8RA 1N9GB 4P80A 2AR7A 1RJ9B 1CDZA 1U0EA 3OZTA 4QT0A 2ACKA 3K9HA 4EI8A 3TSWA 3GV0A 2O3JA 3AJDA 5IHPA 1K0UA 4TL6A 2CXQA 5AK0A 2GBFA 4NDAA 5EVJA 4BNDB 4H1WA 5BWOA 1YUBA 3I4FA 3JZFA 5EJMA 1NHGA 1RJ9A 3D5QA 1JQ5A 1LBQA 3JWJA 3KB2A 2G3YA 1CUJA 1FVFA 4CQMA 4IGKA 4JI4B 4UAUA 4UHEA 2Z5GA 3CB2A 1DO8A 4IG9A 4IW3B 4LJAA 2HPZA 4IIFA 1VLVA 4N5LA 4U9UA 2WWIA 1GHTA 2QROA 2RGGA 2V6JA 2FVYA 1G59A 3HYTA 3VSDA 4OCZA 1E3QA 1QV6A 2P2GA 1XMOB 3HKCB 3QU7A 4XAQA 5ADHA 3ZCQA 3HC7A 1ECBA 3L7KA 2CL5A 4J0KA 2CXPA 2GFQA 2B25A 4D56A 1IFXA 2YCLA 3GZ4A 2MSEB 3NQ41 1D5WA 3GHYA 4LNUA 3NB0A 1J8VA 4ND6A 5A03A 1L0BA 1CUHA 3O4IA 3JRNA 2HA3A 3IVRA 4TXHA 2G1PA 4AG6A 1QORA 3N6VA 1XJCA 2FFHA 3KYJB 1U3FA 2WJJA 3HCOA 2XAAA 3MTBA 4FP9A 4TV9F 5IAGA 2R87A 3UM9A 3X2EA 4DMGA 1KARA 2G1JA 4A0FA 1ZR2A 3EH2A 4YCSA 1L7NA 4L9WA 2J3LA 2QMOA 2HI0A 1NF2A 2NV0A 1MEEA 4JT8A 2ZB2A 4OP2A 4WCFC 1B1CA 3ZTWA 3A4IA 2YYAA 3OCYA 1KDOA 3FHCB 2C5LA 2H59A 2F3TA 3DMTC 2C5SA 3FMIA 1LBIA 3A9TA 3DUFA 1Q0QA 3PDIB 2ZJ8A 1F8UA 3R23A 1VHQA 4XTRA 4NCKA 4CHGA 1SG9A 4MUAA 1M1XB 5KTNA 1W4AA 3N70A 5E95A 4N3BA 5FCDA 4FYVA 1T1IA 4MV6A 1S2GA 2CB9A 1NQWA 3F96A 3IDFA 3FNRA 3KKOA 4F5EA 1QHHB 2B9EA 2DBRA 4CG1A 5F2EA 3TNFA 5A5GA 1L4LA 1S8NA 1YQTA 3T3EA 1Z0JA 4FNGA 5HKKA 2B8TA 1RFLA 4Q3NA 4LV8B 3WTCA 3ZHXA 3D6JA 1DDOA 2J7KA 3GEDA 3V6MA 3AP3A 3P9IA 3PD7A 3GMIA 3L9WA 5KYTA 4DY4A 1XZQA 2YHBA 3AG5A 5KPDA 1XPOA 5I45A 5CG2A 4TYQA 5AHKA 1Q0SA 4ETIA 3BHIA 4XIIA 4QXQA 4F6CA 1NDHA 3LUBA 4RL6A 1G64A 1DAGA 3AEZA 4GLFA 2R6JA 1JDTA 4IIDA 5CRIA 1IE3A 1NC3A 1N1MA 1REQA 3IB3A 3DPIA 1ENPA 4AX4A 3K9GA 1XMQB 1WBBA 4PYIA 4XD7D 4AO8A 4E22A 5KTYA 4GH5A 3GUCA 1Y6ZA 4JR1A 1ZMTA 2ZZNA 2I8CA 1TMYA 5EZSA 4FHDA 3FYHA 3EULA 4PHHA 1H8ED 5KJ6A 4Z2YA 1IN1A 3JATB 3USCS 7ABPA 3EFBA 3T38A 5L3SB 2AXNA 2GWHA 4DIBA 1R8XA 4JROA 5IKPA 4BYGA 1QIGA 3U7RA 5BPHA 2VUUA 3ETNA 2ZOSA 1XWIA 3GI1A 3K6RA 1T9GR 4I08A 1UBKS 1MC4A 3G7SA 1S4MA 4ZDJA 1CNMA 3P4YA 3AZQA 2OGTA 3OH8A 1KO1A 2DSNA 2WD8A 1P62B 4NZOA 4EY5A 2VPXA 4ABYA 2AW5A 4NS1A 2PEZA 3OZVA 4MS4A 5JG7A 3E2MA 1LW6E 3T8YA 5F1OA 5CEFA 1IPFA 1VRWA 4ZVRA 4E2FA 5H0IA 1WDLA 3WLEA 3KLOA 2O8BB 2G9ZA 4EYEA 2CSXA 3AG6A 4R54A 5D1NA 5HNKA 2RKOA 1OOEA 1XMVA 2W6ZA 3P0HA 2RGCA 1V95A 1KWGA 1W73A 1V96A 4DSZA 3TQFA 1LPBB 1AA6A 2OAEA 1WHSA 1AQJA 1XDBA 1T2VA 5CA1F 3BKXA 4QDTA 3RFVA 3W3AD 4UZFA 4RABA 3ZDAA 3MOIA 5IT5A 3EMBA 1QP7A 1QIFA 4DQLA 2DQ4A 1JF8A 4O2AF 1TF7A 2I7TA 4JQSA 3WYEA 1WIWA 1YS2X 2IYNA 2R66A 2ONJA 3RAPR 1UXJA 1GKUB 1E2LA 4MW9A 1D6JA 1XEAA 2QVGA 2W2KA 1IQ0A 3NEJA 2VQFB 1G6Q1 5K6AA 2OY0A 2ZM5A 1VPDA 1NJ8A 5BOVA 4C03A 1C1DA 4P0QB 4E2WA 1STOA 3AI2A 3LBHA 3R4VA 5KX5A 1FLNA 1GU1A 5LQMA 4D45A 2ODQA 2OZLA 5C1DA 1QWOA 1ID8A 1HT0A 1Z36A 1MW9X 2AS0A 3K0FB 3ZK7A 1Y6GA 3AL0C 5HXAA 2CLSA 1PD1A 1Z4LA 2CLEB 4E3ZA 4HX2A 1PFVA 4JBYA 4QPJC 4BO2A 2YJ3A 1T1GA 1Z0SA 4G1MB 4JKYA 4NBUA 2FR1A 4ZD6A 5CXQA 1P39A 1GV0A 1NA5A 2V1XA 4URZR 3MAAC 1YGPA 4KRYA 4V0SA 3VI3B 1ZN8A 5D1HA 1AKTA 4B83A 1MH1A 3NAMA 3RG8A 3AVVA 2FEOA 3L7BA 2OGWA 1PEAA 1HYGA 1CUDA 2XADA 2IDJA 2MR5A 4M0CA 1H2EA 3FWNA 4OP1A 4RMNA 3TCNA 3HNPA 2FFAA 1U11A 5FOTA 3I2YX 1UODA 4OMUA 3MCTA 1KRWA 1VECA 3AHJA 1MRNA 3RRFA 1W25A 5A6VA 2PBFA 2C7VA 3LQFA 4HN4B 3S5UA 2DYKA 4HJXA 5HGJA 3UIEA 1UMKA 3AEUA 4RBNA 3RIEA 1DV2A 2R5WA 4OL0A 1JIUA 2IYOA 3H5WA 3G85A 2DFDA 2DH5A 2ISSD 2ZIZA 4UUNA 5JCOA 3T4UA 3ZPXA 1PLJA 1U81A 3BFVA 2V45A 3ITDA 4J49A 7GPBA 1QK4A 3NRJA 3JPWA 3F6EX 4FU0A 1Y8QA 5C3UA 4J76A 4AAYA 1U3DA 2F1OA 3PL1A 5KKNB 2R6GA 3OMXA 5DMHA 5LSAA 1XWFA 2YWXA 3OQOA 3KEQA 2F48A 4K9NA 2QAIA 4ITUA 4JELA 1CJMA 4GFDA 5B37A 2QVLA 4I50B 1GLNA 1X8JA 3MRXA 4Z4FA 3JALB 1GZ4A 4KN6A 2CF5A 5DT2A 5LXTF 4ACBA 3QQ5A 4LG1A 4U6NA 1KY5A 1Z73A 3O4FA 3OOWA 5C5CA 2UUCB 4EFLA 1T0IA 1JNXX 2VUIB 5E7MA 1KVRA 4YCNA 3PNBA 3M4XA 2ZIXB 4HVAA 3U44B 3HY6A 1LV7A 1BCSB 1EP1B 1QRTA 1ADGA 2LP4Y 2IYSA 3IQHX 4ZCPA 3LZCA 4CNQA 3O4HA 4F5WA 4KDFA 2PIAA 2JC3A 3O8QA 3U44A 1JIVA 4U2GA 3JYOA 2QRKA 1RAAA 3ZVRA 5TX7A 2LWIA 4P1ZA 3DE3X 1BW9A 4KNWA 2BM0A 1M2EA 1YKFA 1KEUA 2AT1A 3AR3A 1CZNA 4EGFA 2CY0A 2D5LA 1LWOA 3JALA 4TVBA 2V9PA 4I1YA 4CE6A 1Q77A 1SM4A 2Q9UA 3ROEA 3QU4A 1RZ3A 2KS6A 2NV6A 4Q05A 4U6SA 2GCNA 3BVPA 3G0DA 3JY6A 5BUQA 3EARA 2C82A 4MVJP 1OSNA 3HP7A 1TZ2A 4UBNA 5JD4A 2UU9B 1E3DA 1OLSB 1RM5A 2QLNA 2CKMA 2PVCA 5T64A 2D5BA 3QBTA 3LECA 4DR3B 2PUAA 3G0OA 5HUHA 3AUTA 3V42A 2C7BA 2FCRA 2I2CA 5BY2A 1KK0A 4QSMA 1JU9A 4UD6A 1J00A 1B4DA 1KKLA 4B75A 2Z98A 2H00A 2P7HA 4KXFB 4XLZA 1NNI1 2IV7A 1ZYUA 3DT6A 4WD3A 2J9XB 1ADBA 1QHSA 1NBWB 1YONA 1T9AA 2BV3A 2R5FA 3KJXA 4LZPA 4YWJA 3WYNA 3W5AA 1US8A 4EF4A 4FB5A 3DCJA 1QC5B 4Y2TA 4ZJZA 5GIPE 4OP3A 1YUMA 4JUBA 4QFDA 1KI8A 4IIBA 3TLEA 3ZDCA 3COSA 5KQMA 4HO1X 3EGCA 5BV2P 4DLYA 1FMJA 2CLLB 2ZCUA 2FJ0A 3L7NA 5F7OA 4ZYTA 1BX0A 6LDHA 2JFGA 1DAHA 3U6KA 4MMYB 1E9RA 1W6RA 3WMFA 3I58A 4MVJA 1CE8A 3H9EO 5F1YA 3ANXA 1EM6A 4AXXA 4NU0A 3QYPA 3H0EA 3VU1A 1B43A 3K1ZA 4LQLA 1C7IA 2NO7A 4G8CA 1YDMA 1SUSA 4NMWA 3VJKA 4LI3X 4D26A 4MDHA 2O19A 4ROTA 1I4LD 3QPDA 1PL7A 3UHJA 1ZD5A 2HRQA 3VZBA 2WBLC 3JQFC 3Q9SA 1KAQA 3Q4GA 5LDDC 2FN8A 2OO5C 3GYBA 3I09A 1ZW6A 1GRRA 4KMMA 1UBJS 4C3ZA 4OK3A 4DR6B 4G01B 3QEMB 1W35A 3M3HA 4G2NA 3ZHSA 4C4SA 4DA0A 1A72A 3VMFA 3EGWA 2A84A 2PZEA 4D99A 5AVRA 3FKSA 3FIUA 4MUEA 4FM9A 4LGVA 5CP8A 1UH5A 2DCMA 3OD5A 4EB6B 5BN5B 2Q7XA 5A5DA 4B3TB 5JROA 2WP0A 1IM8A 2QSUA 1G60A 2B1IA 4KZPA 1BXGB 1M5TA 2ZT8A 3HE3A 1NYRA 2QJOA 3F5FA 1J97A 5ALIA 4F2HA 1Z17A 4OIFA 2TYSB 3EYWA 4NAHA 4UXHA 5H68A 1H5UA 1XO1A 4O2RA 2R84A 2YKGA 1NQTA 4MDEA 3QMWA 2P2LA 2V03A 1HFEL 1U4OA 2ZRAA 2AFIE 3IIEA 3B9BA 3ISJA 3FVVA 3EA5A 1UPTA 4JI6B 5B1SA 3MELA 2VBIA 2FEMA 2WYIA 2IYYA 3N8HA 4DEVA 2G07A 4GE3A 2AHRA 3ZXIA 1A5BB 1T8SA 3D6UA 4MUKA 2C54A 1G5QA 2IOQA 4FMCF 1UJCA 4LVCA 5EYPA 3WK9A 4J0DA 1SCUB 3N76A 4N03A 3RTGA 2OV8A 2RGYA 1AKRA 3G8BA 1O58A 3WBBA 2I3AA 1VRVA 2PKEA 4H6PA 5C1IA 3T3DA 1RYBA 2KSQA 4RELA 4MNTA 1EVKA 3D54D 4JLKA 3QLVC 3GEMA 3NBXX 3R9KA 3GUVA 5JFGA 1RXWA 2C2YA 1V2GA 2CLFB 2DG2A 1QGDA 3A3YA 1XJQA 4NU5A 3DP9A 4U5QA 1P0CA 4LRUA 4E4TA 1VYTA 2PLAA 2OHVA 4LECA 1P2GA 1F7VA 1CF9A 3SWWA 2AR0A 4KFUA 1DSSG 1L4BA 1K8YB 1Y34E 3DOUA 5HTOA 1XTRA 2JJ2A 2L42A 3OI7A 1UMBA 2I6FA 3CW2A 2XUIA 3GK3A 3UW3A 1M6VB 5BQ5A 5CXXA 1T26A 2QY6A 4G3XA 3H9CA 1E6CA 1BVHA 2IW3A 2D3TA 4JBHA 2P7IA 3JRWA 4RZXA 3CUSA 2GEFA 5D3MA 4ZT4A 3U4GA 4LY6A 1DO0A 5ALMA 2FSGA 3W0LB 3WJAA 2W2LA 2Y66A 4IXDA 3IC5A 3O8DA 4Z9BA 1HUQA 2Q6OA 2G09A 5AW4A 3C3PA 1FFCA 2MSNA 2JHCA 2VXCA 4LF9B 2YXEA 1N0IA 1LVGA 3I2GA 1NONA 2VYVD 4YWHA 2I55A 4UOEA 3DXXA 4TYWA 3KUDA 4CG3A 2VO1A 4JUAA 4TWZA 1UJ5A 3AEKA 3MWEA 2I3BA 2YRFA 8LDHA 2HTEA 2J9GA 5CH3A 3KO8A 4RMGA 3VAZA 3BXEA 3QH4A 3WFZA 1J24A 2ZSUA 1UM9A 3UHFA 2VSNA 3ZVMA 3VZPA 4MITA 4M1KA 2FXIA 4RVOA 3F47A 3V4FA 5IG2A 5ICCA 4B48A 4C1BA 3HM9A 3P4XA 1DRVA 3OQBA 2FZGA 2ODTX 4KQEA 4F06A 1L7RA 3LW8A 1TAUA 3GWGA 4FSDA 3TLGB 3RQIA 5JZSA 3BIOA 1G18A 3JQ6A 1OV6A 4QYXA 3T7RA 2JK1A 4GPIB 2ZRGA 3JU3A 2CHEA 1B41A 5EXTA 5IAEA 3UCXA 2JIPA 1GQRA 1HTWA 2X42A 3QKTA 5AKJA 2QD2A 3RH0A 1GZ3A 1C8KA 3ZJTA 4QASA 1E6LA 4QAQA 1E4EA 1O96A 1ESDA 4HPWA 3AUYA 1P4GA 1KNXA 3FJYA 3N6XA 1YBMA 4NYMQ 1RQXA 1P17A 1SXPA 4PW0A 4I9NA 1DT5A 4RV4A 4NZYA 4YRGA 5IBQA 1MC8A 1Q17A 3WYAA 1HDRA 5JEDA 4MWCA 1C0LA 5REQB 2TECE 2C3YA 1WZIA 1Z6QA 3M81A 4DXDA 3FPEA 1CY4A 3SMQA 1TF5A 3RTCA 1XNRB 2WYOA 2GJ8A 2R7NA 3L6CA 4NE7A 3ROPA 3VVMA 2VDQB 1U2DC 3ZE2B 4KIUA 4A6EA 1WPRA 4JXKA 4UD2A 1V8PA 2QAGC 1JG7A 5FI5A 1PZHA 5JAIA 4GSLA 4HDOB 1Y8ZA 4NJEB 1WCV1 4LTMA 2G82A 4MVJF 4UXJA 2ZP1A 2ECPA 3D31A 4L0MA 4TT3A 3S55A 1TCAA 1YV9A 4J03A 3IHKA 1T9BA 3MQ4A 1XLTC 5C8YA 3T9FA 4KQMA 3PF8A 1D1SA 2VSYA 1URPA 4MVYA 1BTOA 1QANA 5LQRA 2OO3A 3P0FA 5ALOA 3QV1A 1BEZA 4OVKA 4UBJA 1FDWA 3E8SA 5IWAB 1OF1A 3SD7A 4N12A 2PT6A 3DG9A 3R3HA 1DRJA 3EZYA 4QBGB 4QM6A 4RS3A 4EYSA 5KMGB 4WLOA 1ZJWA 2FOIA 3FZNA 4DCGA 3CCCA 4NSNA 5KTOA 3BT7A 5G4KB 4ANFA 2R9VA 1CRPA 3S27A 3G0BA 2C83A 5CA1A 1N0UA 1YZTA 1YUNA 4BWGA 1EUQA 4XIGS 4G5QA 3IOMA 3LQ1A 3RLFA 3UHAA 1SZCA 3I8SA 5K9ZA 3PFGA 2OQRA 2P4SA 2ZBDA 2JLRA 4RY9A 4C6HA 2L0XA 1OBCA 3ODPA 2C20A 1RYYA 2F3PA 2ZUUA 2O3TA 3DV0A 4GEKA 3ROGA 621PA 1N3BA 2L82A 1LNQA 2NTNA 4U7FA 1YIOA 3CUYA 3GNSA 3KYDB 4NBKA 1Z2AA 4W9NC 5AXAA 2W58A 1OTHA 3K92A 3OC6A 5HE8A 5JS6A 1N5OX 1ZK1A 1DB3A 4NBNA 1TYAE 1ATIA 1OBOA 1UWKA 2H1CA 2ZBQA 3NBFA 5FV7A 1KVSA 2MMCA 4FMCB 4AUNA 1J1ZA 5EUCA 1QG4A 3T7EA 5BVGA 2GKSA 4HAYA 4NI5A 4D6PA 4AIIA 1BE8A 1GLGA 1L9XA 2EQAA 4U1RA 3RANA 3TQQA 4LQ4A 4XDYA 2X1LA 2Z09A 1YL6A 3WMRA 4YRRA 3HHEA 1FYVA 1GFZA 2VP4A 3JZMA 3DVLA 3HCPA 3AR4A 1LDGA 3DTNA 1UBGA 2RHBA 3PXEA 4JB3A 4UDOA 4BEBA 2PRKA 1YCFA 3ZCSA 2I4TA 1XZMA 2ECQA 3ELBA 3RKUA 4EZEA 3BFKA 4CM5A 2OZKA 3MBOA 4MW6A 2BFNA 2ZIAA 2QTZA 3AP2A 2HWUA 5P8WA 3W04A 2WFMA 3W8DA 1BGVA 1NR5A 3AERA 4QREA 5FXMA 2JLYA 2YJGA 3PV0A 1B0PA 4HAXA 3A70A 3H6HA 3TTSA 1NN3A 3FMFA 4J4BA 1H1TA 1WUTA 5KDDA 3L4BA 3CNHA 4C0QC 2B5OA 3FYUA 2CVPA 2ZZMA 2JGLA 3CW9A 2DBZA 3G2MA 1K63A 3QI7A 1ML3A 3NCHA 4XLTA 1DC5A 3THXB 1BE0A 3H1GA 4CN8A 5CA0B 4I5GA 4C6TB 4YT2A 3OD1A 4P0PB 2Y6UA 2OWDA 4NLLA 5JAQA 3NTOA 3JR3A 3ANSA 3E7PA 1WHTA 1FBTA 2Z4RA 3WNCA 2A1TS 3OKCA 4QOIA 4DV1B 2DVMA 5FB3A 3M6XA 3UXMA 2RHLA 4IUBS 4K1LA 2IUUA 2P6MA 4G6ZA 1JYFA 3HXLA 4X1IB 4CLRA 2HBQA 3OZXA 1TK9A 2QENA 5JMTA 1CIPA 2WA1A 3CH7A 2JLZA 1QGAA 2ZIVB 4ZJYA 3LPNA 5DTMA 2CJYA 4CMEA 1N9ZA 1XRJA 2PXXA 2F4VB 4ENWA 3THYB 1NLUA 2I3DA 5EFOA 3VZRA 4RPKA 2JEZA 2XMPA 2V7WA 1E5TA 1U9IC 4J0QA 1Z5UA 3B82A 3BSFA 1G19A 1UOPA 4JL8A 1O7JA 1NSYA 2AUNA 1EX1A 1RRGA 1NLYA 1CS0B 3ABQB 2I22A 2QTCA 3GCGA 2ZR9A 1EGVB 3I64A 3IKMB 4TTSA 4U9HS 4GSYA 3RUHA 4OHUA 5J4LA 3DTTA 2FZ5A 3ESDA 4MI3A 2AC2A 3ELWA 4UMDA 4PRKA 3F9CA 4N6NA 2HUPA 2I1QA 3RQSA 5F9FA 5KKCA 2GESA 5J2TA 1JIJA 4EAQA 3KJFA 4AKIA 1Z8HA 2ODNA 4ARSA 3VPFA 3W4IA 1FJHA 1RYEA 4RTSA 3LA6A 4ZA2A 2QX9A 4RHTA 3MTGA 4K3VA 4XWYA 3N2KB 3V4ZA 2C4WA 4O2LA 1K97A 1BC5A 2BCGY 1EUZA 3H2ZA 4UU8A 5GGYA 3WLIA 2D5AA 4YEDA 5K1ZA 3JQDA 3L0DA 4OGLA 3J80A 1N8NA 4OX9Y 3DBVO 5J5CA 3S8EA 1AV6A 1Y9ZA 4L08A 4HNUA 4HAZA 2ADOA 4Y30A 3TLCA 2P1DA 4MVJH 3SSOA 4X20B 1UOOA 1Y6FA 1VMAA 4MEJA 4WN9B 4Y0NA 3SBOA 5KBYA 3FPSA 3H2BA 1EFLA 3ORHA 4KO1S 4FJ1A 3OZIA 1R6BX 3Q3IA 4GUDA 4TLDA 5AI0A 2P2CA 1H2FA 1ONOA 2IPNA 5TQ2A 3L0CA 3STYA 3RYTC 4E15A 2Q5OA 1DEKA 4W82A 2ODEA 4C2TA 1DKMA 3THSA 5JXIA 1Z06A 3SEAA 3A3OA 3B7PA 4RGQA 5FH9A 2X58A 3FZEA 3DVAA 4Q5IA 4EJSB 5LXTB 1YHYA 4QUIA 4C9BA 3BGOS 4TKMA 4GUAA 1GPJA 3TCXB 1OWNA 3PGKA 4OLAA 2O8DB 2HA7A 3CJTA 3WLLA 4X65B 1J39A 2N47A 3VH2A 4Q9HA 5HF8A 4A82A 1K2WA 5EE5B 2WTNA 3NW9A 4BNLA 5JCPA 2HR1A 3AB8A 4BVJA 4C07A 1I7PA 3WSVA 1SK8A 2XNHA 4WBNF 2NZUG 4MQ4A 4O4IB 4HH4A 4PLGA 3R2JA 1S2NA 4IHJA 4ZAVA 4ZVUA 2ZE5A 1AK2A 2X5XA 3QRWA 2I6XA 4NABA 3I76A 5JXJA 2YVLA 5EJAA 3PIDA 3SS7X 3ZH9B 1JDPA 1V1RA 4ZIRB 1G7CA 1NP7A 1R37A 2AFIA 3R24A 2XQIA 5ERXA 3OCJA 5JNRA 1L1RA 5A6SA 4QPNA 2EBWA 2Z56A 1CB7A 3CRZA 3CSUA 1SB9A 1MABB 3HTXA 2ORYA 2V7QA 1Q84A 4PQFA 3NV9A 4Y6QA 1E59A 1Q7GA 3B9RA 3GD5A 3GQVA 1V7ZA 2ZK7A 4CI0B 2H92A 4XSGA 4NZZA 5CFRA 1V6AA 1Z2OX 3W9UA 3D6VA 2A59A 3T5AA 3FSJX 1M8GA 5DM4A 3BAFA 1NDUA 2AOUB 4MVWA 4TS9A 3W8NA 4GBMA 5F21A 5DGHA 5CCDA 3GGDA 2WU3A 1O6ZA 521PA 2O2XA 2JFWA 4O2BA 2XNSA 5LB2A 1LVUA 5L3SA 3UGTA 4WZBB 1UEXC 4B3BA 3HCNA 3A06A 1CS0A 5JSHA 1LV8A 3IX7A 3JQ9A 4F4UA 1JR6A 2OEPA 1A1SA 1ZIYA 1ZONA 2APJA 2Y1WA 3M1AA 1LDYA 3ELUA 4R51A 3R7LA 5T3YA 2CFSA 1H05A 4CV3A 1DRWA 2BGGA 2FB9A 2MYTA 1VE7A 1FTWA 3B6MA 4PAMA 2EBUA 2J33A 4L75A 2B34A 2PWBA 4LTDA 3EUFA 1M6NA 2E3JA 1C0KA 2W8BB 3JVUA 4QAJA 5ER6A 2RHTA 3EHEA 3LPMA 4M8KA 5AR1A 5F12A 1J2RA 4D3YA 3GLFE 1PNRA 1Q1BA 5HDBB 4Q4JB 1IU9A 4TSFD 3EF1A 4IFIA 1B0UA 2AZTA 4XOIA 1Z62A 5KNBD 3I32A 2HHHB 5DCUA 3PNOA 1ESNA 5TPZA 2WTEA 3VHLB 3BWEA 3G79A 2XMDA 4ER0A 2QUZA 1TB4A 1TLLA 1U94A 3KV3O 4RIIA 1N7GA 4XJTA 2FUCA 2CV0A 4C3UA 4JBXA 1TU0A 4X8LA 3N05A 5J4KA 4CKBA 4RJJA 2OYRA 4ZK2A 1ZJZA 2GJAA 2VP0A 1SKBA 3ONEA 1JQEA 3QEKA 4GPD1 4LE1A 3GLTA 1GOTA 1QZZA 1E3JA 1W6UA 4DB4A 1Q14A 1I3CA 3N3AC 4XVQA 3VSCA 1CUIA 1R4NA 2DUUA 2YFYA 4ZIRA 4RC9A 1XB2A 4TXMA 3V7YA 1JMVA 3OTHA 1RSZA 1FRFS 2W37A 3P9CA 5IDYA 1DAFA 2NUTB 1T6ZA 3EW9A 1GAJA 4A2QA 1T3ZA 2C8KA 3LAWA 4F21A 1JDZA 1GTSA 3GBPA 1JIIA 1RP7A 1WUJS 2GEBA 2XNKA 4JDPA 4UTOA 3KKKA 4MKFA 3R7SA 5CFZA 1WTCA 2ORVA 3QA3E 2QBYB 5M5BA 2EKDA 5ANRB 2NSJA 1FRNA 2AJLI 2D3WA 2QVXX 4FDMA 1BQ4A 3U31A 3K9BA 9GPBA 5DTEA 3RDPA 5BN3B 3GBSA 2RGDA 3FETA 2WE7A 1YKSA 2ZYTX 3IP3A 3LA8A 5FA5A 3SPXA 4ZFNA 3VR6A 3G5UA 2VOEA 4JNKA 4S1NA 2R86A 3F7TA 2GZMA 4PRZA 2GF2A 2PFGA 2YBEA 1B6GA 3HGQA 3KQHA 4OBEA 4RXTA 5AM5A 4GL2A 3I05A 2VATA 1WW8A 3FR7A 3JV7A 2BEJA 5FNVF 2J6IA 3HYCA 1O0CA 1RXVA 1QIDA 3DFZA 4KU4A 4I4TA 3F9IA 5EINA 3SQOA 4G8BA 3A6ZA 2QR5A 2QTNA 3GG9A 4MWOA 3D6AA 1X87A 2HA2A 3W5IA 1C50A 2BRUC 4MQ5A 2TMKA 4I4CA 4PANA 3ASUA 2MWMA 4F38A 5IYZA 1U63A 1JPNA 4AJEA 3U13A 5TGTA 1GYRA 1JU3A 4HYTA 1XQ6A 1TJNA 1Z75A 3Q3HA 1YZ3A 4II3A 5F78A 4ZYXA 1FFYA 5AKEA 5CFOA 5FO1A 2PMDA 1JXQA 4NONA 1RYZA 3OF2A 3QF7A 3CZMA 4MWDA 1B26A 2I7CA 4CIYA 1RIIA 3N0XA 4M0MA 2XDQB 3EC1A 4ML3A 3C45A 1DG1G 5EYPB 3U4HA 2FEWB 4GQIA 4CNBA 4HDSA 1GGMA 1M1UA 1W94A 5D5PA 5CA0F 4X00A 1H0KA 5HWSA 3E70C 1OI3A 4FZ5A 5LP6B 1Z28A 1KP3A 3PCRB 4IEFB 4MB6A 5KVSA 1GGHA 2WY2D 3W90A 3HACA 4M8IA 4RFSB 3QE4A 4HQ6A 1G20B 4IIHA 3G2NA 2SHKA 3KDPA 3M2TA 2FPXA 2CF6A 2ZJ5A 3EGXB 3H65A 1FFWA 3L7YA 3AOGA 1G9TA 4BDTA 1NWCA 1TKRA 3KOUA 5EE1A 3VR6D 4EPRA 2AI3A 3DDOA 3FTQA 4CT5A 3T4EA 2BMDA 2EZ9A 2O3QA 2GPAA 1YQ9A 2Y0EA 3C7KA 1MX9A 3G9QA 3EXIB 3H83A 2PSJA 3MWDA 4FE3A 3B60A 4HEHA 3GJ7A 2H2WA 5KYWA 1OU0A 4F2GA 4J94A 1A95A 5I7VA 3N6RA 1TA0A 3OMLA 1G4AE 2PJZA 4J7CA 1B6SA 4AM8A 1X3SA 1BX1A 3OUUA 5KWEA 3TZQA 4PTLA 3H16A 5LZ8A 4OSEA 1ZVMA 2FZKA 1V3TA 1Y82A 1RQGA 3HEAA 1RXEA 4PGFA 3UG6A 1YB4A 5C51B 2LBPA 3PCXA 4L5AA 1AQIA 4IINA 4C89A 1I01A 3D1JA 4LWZA 5EZ5A 5DKFA 1E99A 1XA4A 1KC1A 1U9YA 1KYZA 2R96A 1E94E 4N0DA 2W8ZA 5ICFA 3HCEA 4AJLA 5HGXA 4Z49A 1OXUA 2ZSEA 1IY1A 1BQ3A 4I2VA 4F60A 3EMDA 5I5GA 1IXYA 2V0GA 1RYHA 4QPDA 1C80A 1YZLA 2F43A 3NRBA 1RYMA 3PUVA 2ZBEA 1AE1A 2Q5IA 1OAAA 2C98A 3ONDA 4J16A 4JVSB 5E8JA 4ZI3A 5AK6A 4GDFA 4YJ2B 4OMFG 4ASUA 3N0RA 2PLNA 3CVOA 4LHSA 1JAHA 1CF2O 4DYDA 1DUIA 2Q3CA 3K31A 1K7FB 2OFOA 3M5PA 5CW2A 5DVZA 6PFKA 3WSWA 2O50A 5DBHX 5FFMA 1DI0A 1G8PA 3EQ6A 4LOJA 3D43A 2DQYA 4IV8A 3W7BA 4JP3A 1KEPA 2ETXA 4MULA 4F71A 1WV0A 2ONYA 1MX3A 4O2BF 3RVJA 5K8VA 1RAEA 3NC4A 3PR3A 4LZZA 3TTWA 3BXFA 4NU8X 2DWOA 1L8XA 3DW1X 1Z4QA 4TRRA 3V9AA 2QW8A 4V03A 1N2XA 1ZUIA 2GVDC 2H29A 4MHOA 3R6TA 5K05A 5K0GA 1TT7A 2ZI6A 2H0QA 4RV5A 6YASA 4RTNA 5H3CA 4KR9A 2CN1A 4OUKX 2WHQA 4K9DA 3ZDXB 4IJQA 3EEBA 1N7JA 5DNEA 5EZQA 4ZALA 1DQSA 5JH7F 1D7OA 2FSVC 1Z5ZA 2JHPA 4I1IA 4M37A 3T1HB 1TM5E 3M1LA 3L7CA 1YS9A 3RAEC 5FLYA 3M33A 4YRZA 4DN6A 3N2GA 1PT5A 4ND2A 3U3XA 2FKAA 4HATA 4LNAA 2VTKA 4Q12A 3TKYA 1WDTA 3QLEA 5K3FA 3RUFA 4JZYA 3TQSA 1PFYA 4C05A 3T9BA 2H0RA 1II9A 4RKFA 4UE3S 3VOSA 1K8XB 4PNEA 5K8JB 5KEIA 1ZN7A 3ZLTA 3P9SA 1G6OA 2FLVA 1B8NA 1EINA 3L9XA 3LKBA 3C1TA 3O9VA 5EI5A 1RI3A 1NXWA 4ZOLB 3RVDA 1B6RA 1MOZA 2A4MA 5IH3A 4FHCA 4EHHA 3C6MA 5JPCA 2EYUA 1HNXB 4DMHA 1ZWKA 2GMWA 2EZTA 3DC7A 3GVIA 2ANBA 1LQUA 2R00C 3QVLA 4LZJA 4RL4A 2OE2A 2ZI4A 3TEFA 1D2GA 1L5WA 1HEIA 2I71A 1QGED 4A8JB 1O6FA 3BMQB 1IEXA 3NEAA 4V1CA 1N5JA 2Y99A 4LYAA 4B79A 1A96A 3WL8A 3ZN2A 2W6MA 3RYHB 5AXBA 3SM3A 2BGJA 2Z3ZA 4FHGA 1P6QA 4ENRA 4AI6A 1R8QA 4U2FA 2GN6A 4PZPA 2WDPA 3NT2A 5LQSA 4YS6A 2GCOB 3QKSA 5BWBA 5HX7A 1CZLA 2DFPA 1CJSA 1GKYA 2HKIA 4OHKA 4OY3A 5DX0A 3VHXA 3KSBC 1Y8QB 2PM8A 2RAUA 3JAWA 1H9AA 1PFUA 3OZUA 5HJ2A 5A6SB 3B2EA 5A1TA 5SYAA 1P81A 1XSEA 3B9PA 3FUCA 3LPCA 4I9GA 3DWFA 4MR9A 2OBBA 4K7JA 1TVEA 3SY8A 1ZHFA 3X2FA 5FAXA 1DPGA 1X15A 4GGPA 3N2YA 1DFHA 1T9HA 4RNDB 3VNSA 3WHPA 4A73A 1PZMA 1W52X 4BMSA 1MAHA 2XODA 5GQSA 1YVEI 2J6CA 1C1HA 4LJYA 5J2TF 4F72A 5K0BA 3EF3A 4LPKA 4OHXA 4ROSA 1YA4A 3A1VA 4XRRA 1VG8A 4DCJA 3SIPA 3L6DA 1EDOA 2X8JA 3ZE7A 2RHMA 3TVTA 1M6EX 1T1JA 4MV8A 1JX6A 1PK7A 3A28A 1MT0A 1XQ9A 4IHQA 1LS1A 1XAHA 4PCUA 4W1QA 1HTTA 1MAVA 1T9GS 1O5OA 2PKWA 3PC2A 4N0MA 2QMUA 3WO1A 3DAGA 4TTJA 3LCUA 4RSMA 1OWPA 1SUCA 3JYQA 4OH1A 1LZLA 2J3EA 4P32A 5JCZA 1G8YA 3MINB 2BP7B 3O9MA 4X3CA 5GV8A 2H4HA 1W44A 4CXMA 3RIMA 1GVNB 2VTVA 3S81A 4D92A 3IEUA 2FK8A 1GPAA 1T5SA 2R8XA 1JTEA 4C22A 4BZZA 2IYLD 3MJEA 2NUPB 2WFLA 1WNTA 4KFCA 5SV2A 3UPTA 1T25A 1UJBA 2GBLC 3AUAA 4YAGA 5JBQA 3KSAC 4L4UA 1YQEA 5BV7A 4FN5A 5ES4B 2ZE6A 5L3ZA 1GCIA 4KQWA 3RVSA 3DM5A 3RHTA 5A9RA 3PIRA 4IOJA 4IZ6A 1GNTA 1H2RS 1USGA 1XFDA 1KDRA 3O93A 5DOZA 4DIFA 2W6NA 2G0TA 2IWHA 1TGYA 2C4KA 3TVDA 1NW8A 4A9AA 2AXPA 4HI0E 1ORIA 1TJ3A 3KUUA 3LBAA 4RDCA 2PS0A 1DCTA 1TT5B 1H3FA 1RLMA 3UXYA 3K4QA 3O8NA 2V54A 2DB3A 2KJQA 2DPGA 1PBTA 1YASA 1QZ3A 2JLBA 1TOAA 1ULTA 3OM9A 4YI3A 5HILA 3H18A 4HADA 5GZ1A 2GEJA 2EZ8A 1HA3A 4I2NA 5LP6C 3ANMA 2YHAA 2FG6C 1FA9A 4RAOA 3KUXA 5A7FA 1OC2A 3UUEA 2VJQA 3ICEA 1VHWA 4QLOA 4D96A 2JD2A 1ZOIA 2OHXA 3G89A 3I3SR 1IWBB 1V8FA 4MQMA 1TQ8A 3SN6A 1WEHA 5G3YA 2XZLA 2GUGA 3AEQA 4R01A 5IU6A 3D9QX 1BMTA 4P5PA 3GNLA 4PG4A 4QOJA 3WIUA 4WQMA 1M74A 3CRNA 4LBVA 3V4VB 2YNMC 1F60A 4OATA 2D2IA 3PP8A 2Q2NA 3UOWA 1FVHA 5BRJA 1VBFA 3MNFA 3DOEA 4P7BA 4TRMA 3WV4A 2GFHA 4KIJA 4BMCA 5EERA 4QBTA 4P4TA 2ZTHA 1SRQA 3AHCA 3G8YA 1PJ3A 1IJEA 4WNIA 3AW8A 3GELA 1ISHA 1DQPA 1G55A 1Z68A 2QD5A 5I4KA 4B3SB 1MDBA 2HK9A 1A4RA 1DOAA 1MAAA 4JNCA 2GCPA 2GEVA 1PJLA 1GRNA 2OD2A 5DBGA 2BCJQ 4GOMD 3WDKA 1H8HD 2AMVA 2IE8A 1TAQA 2HF9A 4H4DA 4KQHA 1KQGA 4X44A 3DMPA 3DW3X 4YFYA 1GKKA 3O8CA 5KCMA 4L3OA 3FYTA 2ENWA 4Y0VA 3EAGA 4UNRA 2I1WA 3EA0A 5ES3A 5G0SA 1OD6A 1EFPB 2F9FA 3CVWA 2CUKA 3JWHA 1DO2A 1XTIA 1LK5A 5AXDA 1CYEA 1UBEA 3H1EA 3MJRA 1BDIA 2XMSA 2YY6A 5DTRA 1AXRA 2Y9PB 3IPYA 3K1JA 1YZUA 2VCEA 4IH1A 5BN5A 2BJWA 1H2AS 3BJEA 5LMZA 5ICSA 1E20A 2FLWA 2NG1A 3CEAA 2VZ8A 2AWNA 2QRJA 2O20A 4L2IB 4LK3A 4M1QA 1BXKA 1I9CA 1QHEA 4YJKA 1V16A 3BXOA 4IQ4A 4DQXA 1HMYA 4D43A 5AIBA 1CEYA 5B12A 2FDCA 4N5DA 3RS2A 3A1CA 2P0YA 1DC7A 5EMMA 3ZS8A 5EQDA 1LU9A 1DIBA 5T4HA 1ND5A 2IUTA 2P8SA 1G8KA 4KFRA 2CZQA 3TQTA 3R3JA 4YJ3F 1QPZA 1QRSA 5AKLA 4FIZA 2AKAB 5FBRB 1SZDA 5AW5A 1H6BA 2PLFA 1J5PA 1RQPA 3CV3A 1WMAA 2IEZA 4XGNA 2VYVA 3RM3A 1ELOA 2Q4OA 2J0UA 4JJKA 5EWMA 4RSHA 2VYNA 2ZI3A 2FPSA 1Q1NA 1SZPA 3WHIA 3CISA 2Y0PA 4V0MA 3OJXA 4NIMA 1L1EA 3WLOA 2EIHA 2OECA 4HKTA 1AQ6A 4ICIA 5JZ9A 1YJBA 1Z12A 2YUTA 1JAZA 2YFHA 3H9JA 2XE7A 5FPPA 4IFTA 2GYWA 3FD8A 3CUVA 2XUOA 1QTIA 1BA3A 1ZUHA 1G42A 5KTMA 4IMRA 2HYIC 5C7OO 1G8JA 2OV1A 4U7DA 1E2JA 4YN3A 4E21A 1X7DA 3MGCA 1DG3A 4JHXA 5E6RB 3TDMA 5JQGA 2CLIB 1PR1A 4MJ7A 4GMHA 4U7HA 4QQRA 4DV3B 1TXGA 2JVKA 2ZIFA 4IYJA 4DDKA 3D1LA 1MFPA 4FINA 3RSOA 3TM5A 4E46A 4MKRA 3HNOA 1VHLA 2P79A 4RCYA 1VI6A 4WVFA 3ZZTA 1J0DA 2DFTA 3O2SB 4IUYA 3BHMA 3H1AA 3PKJA 4U3JB 3V7FA 3ZWOA 3FPLA 4CM8B 2YMQA 3WL4A 5FEUA 4XX1A 3PNMA 3UAVA 3EGEA 5GPBA 3X0DA 2V5UA 4TSRA 4ZI7B 1RMYA 1ORTA 2KBEA 4G24A 2XCOA 4OGKA 4ZEOA 3PJDA 1NG1A 2YH2A 3C74A 3I04A 1FJ2A 2JVJA 3KR2A 5EQFA 1KVUA 3E35A 5F5LA 3A05A 4CKEA 3T41A 5EP1A 3AIIA 3U16A 3O7WA 4W5OA 1ONBA 1Z8DA 1HL7A 4TKUB 4GPEA 1J90A 4OXNA 1WXDA 3AF1A 4XDHA 4XDZA 3QPVA 2IU6A 4MVCA 1OYYA 2YIVX 3W4JA 1XGKA 2RH8A 3ASYA 1NLMA 2AE1A 3D2CA 1QIEA 3THRA 2ZIGA 1Z9BA 2L19A 4H3VA 4B47A 2W2QA 1IVSA 2XBMA 1CERA 1VLHA 4LF4B 4DYHA 2BHTA 5AW8A 1H1LA 3KKNA 1OFIA 5AI9A 1K3FA 4BQPA 3TG2A 4GSKA 1KL7A 3VSAA 1BCSA 2P75A 5TJ9A 4S12A 3SIXA 3GLIA 2C61A 3UT5A 2FUNB 4BP9A 3AESB 4WFQA 2WJ4A 3GJYA 2IS2A 1MO3A 4P36A 5A04A 4BLUA 4HDNA 4W8GA 4KXXA 4LBWA 5C8ZA 4JEUA 1K66A 2OD9A 1SCDA 2X9QA 4YMSA 1NYQA 3MILA 3MIZA 3H0KA 3TZBA 2GN1A 5LKAA 3C6ZA 5CYPA 1FK8A 4HBZA 3UKOA 1OXBB 1IK6A 1OX5A 4WZAE 1V4NA 3TH5A 1VKHA 4OMDA 1H2WA 3TZEA 1OJ7A 2DTXA 3O95A 3AEXA 3CZ9A 4V3CA 4QGAA 4ZGWA 1XCLA 2XKBA 4BYMA 3MMPA 1Z0UA 4YJ2F 1XIVA 1QZUA 2GCIA 4JLUA 3D7MA 2IP4A 1PR0A 1ZWLA 2FF5A 3L7LA 3T34A 5BOSA 1G2QA 1Z6YA 2OORA 1DAMA 3UT0A 1HKUA 3ILVA 4EX7A 1UKZA 4H6XA 4EY6A 4NDNE 3LT4A 3WGGA 4HQFA 3GH3A 1HDIA 1FS5A 3FRHA 2VJMB 4MIKA 4IZHA 4DM7A 5AICA 2W2NA 4DCOA 2X77A 4YV2A 4IJVA 4XB6B 5AFSA 4B5KA 5IDWA 3I5XA 4UDYX 1E1DA 4ZVQA 2DEUA 2OTCA 4J0FA 2NU9B 5IT0A 1W5TA 3DB2A 1TI7A 4MS3B 4LJSA 1Y98A 5E4JA 4AUEA 2CFCA 2AQKA 4N18A 1EWRA 3B6IA 2UYCA 1JFLA 1L7DA 3COPA 1YJ5A 3MZ0A 4DARA 2RGRA 1VXRA 1Z2EA 3K0BA 3TQIA 3CSDA 2XJ9A 1S3FA 3H5VA 3FDZA 3PDJA 1TCVA 4N7MA 1VL1A 2XVXA 4U0JA 4U5XA 5TQ0A 2G77B 4XR4A 3TIXB 1YFJA 3D7LA 2Q0SA 2Q6VA 3RLIA 2CEKA 5I48A 3A6HA 3WXMA 4IDEA 4IKPA 5ITVA 3Q8KA 5KHOC 4FMBB 2JEOA 1A8PA 2Q7DA 4AF6A 3NIWA 2J0VA 3ACDA 2R2AA 1DJOA 2V7XA 4CKWA 1RWPA 4CEHA 5A3VA 3WI7A 4UUMA 3FNEA 1GTMA 3IVXA 4Q7QA 3UPDA 3DCNA 3BWMA 3K4HA 3OT5A 4HMQA 1PR4A 1Z4NA 1CSEE 1N2CB 1PUJA 2PV7A 2R7MA 1Q1GA 2WG0A 2ZS8A 4JXZA 6GPBA 5AOVA 1ZOOA 2OHGA 5FWNA 1WDKA 1ECPA 1RM0A 2DY0A 4BKUA 3UGQA 4F1WA 2F62A 4D3FA 1IQRA 2PD3A 3EPPA 1DMRA 2CV1A 2PU7A 5D5HA 4GM4A 5BMVF 2DLNA 3O83A 1ST3A 4LXQA 3IT0A 3ZY6A 3OJEA 2EFHB 4O02B 3G0HA 4BIIA 4U2BA 3M6FA 5C8DA 2PQMA 2AVDA 1EYZA 5ALUA 1TEHA 2I29A 2GRUA 1TA9A 1WWKA 1Y7LA 2IYQA 3DPSA 3HL0A 3LXMA 4FHFA 1MOPA 1MRZA 2UZ0A 2R7KA 2XF8A 2ZW9A 4BV2A 5C4MA 4GX5A 2H1RA 1W0JD 3A1EA 3NP7A 3IHTA 1MB4A 4YJ3A 1UXIA 2IIBA 3IBFA 2BFBA 1NU6A 2P3LA 1BZYA 3Q8XB 4P82A 2XTZA 2PTGA 2WC1A 2BOVA 4KEAA 1E8DA 1X7XB 1C30A 2WTAA 1A88A 3GEHA 4FWTA 2QU7A 3OG9A 4KPUB 3PG5A 4WUVA 4DG8A 1CUYA 3UPUA 4Q1EA 4R7TA 4EG1A 1SA0B 2VFAA 3LY9A 2O2IA 1QP4A 3OOHA 1LDBA 2HMWA 2I5PO 4D42A 1J8QA 3RBXA 1DNPA 1W85B 4FLFA 4RD2A 2GM5A 2IYTA 3TNYA 1L1QA 2DR0A 1THZA 3AZOA 3EZ2A 4RZSA 5JTUA 3WQRA 1KOGA 2GBIA 5DXFA 2L18A 3LGAA 1UXHA 4J6FA 4QEZA 1N5KA 1J22A 1U3GA 4UFPA 4NOMA 4J0GA 3GEIA 4TLMB 5IJ9B 3SHVA 2RARA 1VC2A 4A6PA 1CY8A 1ML4A 1DKLA 4DNXA 4BZQA 2Y92A 1PT8A 3PDCA 4MIOA 3U48A 3D6MA 1XZKA 2ZBRA 4L15A 1KMMA 2QRVA 2ZRJA 4MAAA 1QFYA 1QVRA 2QT9A 4GRAA 4MO9A 1FXWF 3HCDA 5BORA 3QVGB 1Z3IX 4QDKA 1EWTA 4EKNB 3EH1A 2AFHE 3GDGA 2BR4A 4UMVA 5ELMA 3WJ1A 4Z7QB 1AJEA 1NY6A 3SJUA 1VIMA 3W5BA 1OKKD 1CETA 2FQXA 4KB5A 4GS5A 5T8KC 4QNRA 4BNKA 4RPHA 1RTKA 4C3VA 1L4GA 1EKXA 2CD7A 4LYFA 3FOZA 4ZO7A 2ATEA 3QLTA 4CMHA 1TK2A 4P4UA 5CYGA 3CZ5A 4E70A 4QKQA 1TO1E 1ZM3A 4WGGA 4HP8A 5JANA 1UDWA 2QLTA 5CD1A 4KPYA 1V45E 4IOMA 4UE6A 1X8KA 2FQWA 2IXFA 4K26A 3TBKA 5AJUA 2G0NA 1WDWB 3L84A 3MMXA 4MROA 4BL5A 4K8OA 1VLQA 3IA2A 3ID6C 4AJ4A 1AMUA 2R8YA 3PXXA 1OXMA 1ZHHA 1MN6A 4MUHA 3KBOA 1VIDA 4P5DA 2CDAA 4DSTA 1DOZA 2YIDA 1WU8A 4US0R 3LVFO 3HR8A 3M6WA 3NM4A 4LHWA 4EDHA 3GJ0A 2PWAA 3EXAA 1E5XA 4RM3A 1GXSA 2FDXA 4DHEA 3RT9A 1AN9A 4H7JA 2ZREA 4JSTA 5CCXA 5TV2A 3QEAZ 4IIJA 3ZNNA 1H4VB 5YASA 1W0KD 3TTYA 2P9CA 3OECA 3VUFA 4OI0A 2ZRNA 5BWLA 1K7YA 1TF2A 4KXMA 2PJRA 4B85A 1AKUA 3HS3A 1JALA 4L4YA 3PUIA 3D7KA 3EYAA 1T6XA 4RZQA 4D41A 4IL5A 3SYLA 1FRQA 1GG5A 4ARVA 4X71A 3EOAI 2GK3A 2HSEA 3F3MA 2ZJOA 3CG4A 5BSTA 4EKIA 3SE7A 5TF4A 2PJUA 3VR5D 1XEWX 4GYWA 5SYNA 1GQSA 1SUIA 2BSAA 1X9GA 2UVQA 1IPEA 1OA1A 2FRVA 2VH1A 3QVVA 3SDBA 3WK4A 2W0SA 4XKJA 1E2GA 2JI7A 3NATA 5DW0A 2ID8A 3R44A 3UC9A 1XYYA 1AGNA 2HIAA 2FEAA 1MBZA 3SDSA 2GH1A 2PGIA 2RGUA 2QG4A 3IFSA 3W9SA 2BRUA 5M34A 3DE7X 3FAZA 2JW5A 4OFWA 4EG0A 5IZCC 1Q74A 4TXNA 5KC9A 3WB2A 4DSAA 1MTZA 1R0BA 1KZGB 3IAM1 4AMBA 1M34E 1EK6A 4U8GA 5EZYB 5BVHA 4PSAA 4JVLA 3WRXA 4CMIB 5I7FA 1KAGA 2X0RA 4HDCA 4WCDA 1FVXA 3G2LA 4C30A 2QN2A 2AKEA 3D8UA 4PN7A 1SBIA 4DJFC 2I66A 4YCMA 1AB6A 3D02A 3DZ8A 1U2DA 4WI1A 3PT9A 4UTRA 1UIRA 2RI1A 3U2QA 1E3EA 5K0NA 1R00A 3WLHA 1D4FA 3MGBA 1Y89A 3G0IA 3RODA 1V11A 3GLHA 1E2DA 1PJQA 2BI7A 2J3MA 4N82A 5B1YA 5BQ3A 5JI3E 2W5UA 5E6RA 1JWAB 2QL6A 1F9AA 3WGHA 2EV9A 1DTSA 1V7PC 5C4IA 2YV4A 3I8XA 4NJOA 4WCFB 3VV2A 3WGIA 2IH2A 2YWCA 1KJZA 5CH8A 4Q66C 3BD9A 3RSFA 2NXJA 3NG1A 4EABA 4JX8A 3P71T 2EF0A 4GPBA 2GJ9A 4PYLA 1YVRA 1IQUA 2X4LA 1JLLA 1YQUA 3AYXB 1M54A 3KAJA 4K9KA 1KYQA 1LPAB 5A0FA 5EUMA 1YCHA 2B0JA 1XCGB 2PEYA 2WIKA 3IP9A 4R9VA 1OZGA 3OHSX 4H7PA 3DAPA 3CE9A 1AC5A 3HDVA 3OQMA 1F1BA 1RI1A 5E3HA 5GMOA 2AJDA 4FI3F 4C6SA 3HRHA 4ZXFA 5ARCA 2HIGA 3LYHA 4KMSA 3LNTA 2VJNA 3UB3A 2GA8A 3VNQA 4CR6A 1F12A 3AXSA 1N57A 2PUGA 4LXIA 3NBZC 4UVEA 4WY8A 1E1MA 3FI0A 1PJ4A 2A0FA 3UOGA 2YNMA 1ODTC 2F8SA 5LUAA 1U7HA 4KPFC 3QXSA 2ADMA 3X1MA 2FWJA 3PNSA 2JGDA 2W22A 2X8WA 5IYZF 2VJLA 4RVGA 3SBXA 5FBLB 2MYPA 3Q7PA 2NGRA 2PMKA 3QF4A 1VRCA 2PZJA 4P81A 3RVQA 2C07A 3EQZA 1ZCBA 2FSFA 1U7PA 2WZDA 5FQNA 1NUHA 4DDTA 1FMLA 4ZCQA 3DBRB 3GA7A 4ALLA 4PM4A 5AVKA 1JHYA 3RC8A 3LBFA 1U1IA 2CXNA 1GCAA 2VNIA 4K05A 1KEWA 1LNSA 3WGQA 3KSUA 4D9CA 5CDTA 4YAFA 2Q3MA 4BQOA 5CB4B 3DT8A 1JLSA 1T4GA 2TSYB 3QXHA 2ERXA 3UQZA 4Q1DA 2F1IA 3PNYA 3AXTA 2CLHB 4RH3A 4RQBA 3AKCA 1RHQA 4U63A 5EY5B 3NIBA 3I28A 3DYVA 2GN0A 1R5JA 3LI2A 3EXHB 4LBZA 2H7YA 3E48A 4UCWA 1F06A 2P9EA 3ZR4B 3ZV3A 4HVCA 4ARUA 4ZHQB 1CUZA 3ZVNA 4KSYA 1A7KA 2VKQA 1QMGA 4XEUA 5J4HA 1P60A 3I2HA 4KO3S 1TKCA 4V1CB 1AS3A 1FNDA 1U5BB 2IYPA 3KKPA 5IVHA 3HQ4O 4N5HX 5FDFA 3BE6A 3KFXA 3DFKA 4UFNA 5MHTA 3E0QA 2VLIA 4TKVB 4GXTA 3ND8A 4DADA 2VJPA 3LJKA 4IOKA 2P6PA 2NT4A 3QFHA 1BYUA 1EXNA 2QQEA 2R6FA 3ICVA 4FNMA 4FWIB 3H4IA 2B78A 1U8UA 5AVZA 4ARBA 2ISQA 1J99A 1MVOA 3GR6A 3T5DA 4DA4A 2BBTA 1P0PA 1SOUA 2YZNA 5FYQA 2WABA 2G5TA 1ZQ9A 4XEHA 3WIEA 1I7QB 3RJMA 1NXVA 5LD2C 4MRMB 5C46F 4TKUA 4IIXA 3ABSB 1E3MA 1DJNA 2I8LA 1KYYA 3ZYZA 2XKAA 2DT8A 4ZCSA 1SCJA 3GY0A 4I4TF 1CY7A 2ZXEA 5ESWA 2XUAA 3H75A 1NYLA 1FDRA 1L7EA 3JQAB 3RVPA 4JLVA 1ZM4A 2X8AA 5DF1A 1JI3A 2UZAA 4IVQA 1KBQA 3EDRA 4HZGA 3DVSX 3OE5A 4M53A 1KZ1A 4RVUA 2PQ2A 3KIPA 4M88A 1JB1A 2JGDB 3O3MB 4TS1A 2Q29A 4UBOA 2D1RA 1B2RA 3ND7A 3RNOA 4HNTA 4BAUA 4CM8A 1AKWA 3O8RA 5F9MA 2JI6A 2QJFA 2ZYHA 2OO7A 3FUTA 3H2IA 1Z7GA 4D1YA 2CMDA 4PWZA 3AJAA 2XMGA 3UBTA 3DTVB 1N7IA 1VL8A 3TSAA 2ZYIA 2VTBB 1XN4A 4Z3DA 3VYWA 4MARA 1AZWA 2JFXA 1BWRA 2HNAA 3FPBA 3X1ZA 4DABA 1LF5A 5EHZA 4DCMA 1SVNA 3NHWA 3I1JA 2I3GA 2AQ8A 1A76A 5FUWA 1GNQA 1BKDR 1FU4A 1FQWA 2AN1A 2WLSA 5J1TB 5TPWB 3RHZA 1HEYA 4JC0A 1XJ0A 4PC6A 1KSGA 4B73A 3IPAA 2OXTA 1USKA 2IEGA 3U4DA 1M1ZA 1R0KA 5JLAA 2HJSA 2PGXA 4OU4A 2WD9A 3N2NA 2RK3A 3PQ3A 1OWMA 1B7GO 1WOMA 1AN0A 3FHJA 3BE4A 4GXRA 2QN7A 1RXCA 4R3UC 2C9MA 2ZYUX 3NPAA 1U4NA 1SMKA 4BRSA 2DFNA 1DBIA 1M2FA 4HB2A 4XVHA 3TOZA 3UK0A 4Z7NB 1E92A 1NF3A 4FR2A 1YTUA 5BR4A 2HMYB 4IIYA 3WGVA 4N8EA 3CLHA 4JU8A 5T4EA 4P2BA 4D74A 4HV4A 2DXIA 3DBHA 3E7DA 3URMA 3IT2A 1NJGA 3D4NA 1Y1PA 3EC7A 4EG3A 3HSYA 5JS7A 1FVOA 3LO5A 2NYAA 3CWCA 4UHHA 2HJHA 2V7QD 3EISA 3K8OE 2GK7A 4C1NA 5KWVA 5DGTA 4LC1A 4IVNA 1W96A 4QNMA 5KU1A 2WVGA 4NZNA 1ZGCA 3ISTA 4PPQA 3DDWA 1YZVA 4KXNA 4OIMA 1FNMA 3QVWA 4UDNA 3VHXB 2DX7A 2MSWA 4PLPA 1BGWA 5CIQA 4Q3EA 4AMUA 1SC1A 4AICA 3B13B 1QLJA 1NVWQ 3KEFA 1IB0A 1A8SA 4RMIA 1V6SA 1DKQA 1EFPA 3RYIA 1B74A 3MRSA 1XK6A 1SHJA 4D9IA 5GJCA 2F55A 3CU5A 3LGSA 2F00A 3UMGA 3EEQA 3BMQA 4MB2A 5IDVA 3C3AA 1P5ZB 4WK4B 1IAVA 1P72A 4ISBA 4L6CA 5AHOA 2ZJ6A 5TARA 3SC3A 4TTPA 3BE5A 4MH0R 1XC7A 4A0HA 3EGIA 3PDWA 3GJZA 4L5CA 3RV4A 4I55F 4O4LB 4NOJA 3EJ6A 5CNMA 1JJFA 2K4MA 5JNLA 2JIBA 2DECA 5LOVB 1RLOA 2ZGVA 5CVVA 5JQWA 1A5SB 1E4OA 1YIAA 1UXGA 1YQWA 3K15A 4KLCA 4O25A 4PIMA 2R2GA 2HD4A 2ZIXA 3VTFA 1XWWA 3BK1A 5MF6A 4KWTA 1P77A 1A2KC 1M76A 2G9UA 3JWEA 1RACA 2QNBA 3MM4A 3OTWA 1K68A 4M38A 3SX2A 3UKJA 3ZD8A 2E5WA 3GPLA 4O4IF 4JYZA 2IHNA 1JSXA 5FWYA 4YIKA 4J0JA 3GFTA 1L7AA 4ODIA 3B1WA 3BD6A 1CUGA 3KQVA 1NURA 2EGGA 2JLVA 3QEJA 1WUKS 2Q0HA 3IGFA 4OYLA 4KACA 5ULLA 1CXZA 2YZ2A 4N7JA 3VR4A 3SC4A 1EFCA 2PRSA 3AYZB 4FQ7A 2V6BA 4UMFA 4YRBA 4FGSA 1PS8A 3TZ6A 4QYIB 1W4ZA 2PCJA 3E7FA 3QVUA 4JB8A 4X1KB 5EAIA 3NBMA 3NETA 3R6GA 3GLHE 3IPLA 3LBYA 4IY1A 3VU0A 1W7AA 4JEMA 3L8HA 2JI8A 3H3FA 4GI2A 3OJWA 1Z2DA 3H5OA 2BONA 3OEWA 3AJRA 3PK0A 4MKXA 4OAOA 2ZSFA 3UNXA 4CV2A 3A8TA 3F74A 1NV9A 3VO2A 3II6X 3ZVLA 1QR6A 2AZMA 3FOCA 2V6IA 4PCAA 4YDSA 4X41A 4EYQA 2CNNA 2ALJA 1P1FA 5ICGA 1YQQA 3RJTA 3RVBA 1BMFD 1X42A 2IXAA 4FEAA 3ZKWA 2F8TA 1Q6YA 1G38A 3ZGYA 2BEUB 4MUIA 3ZJUA 1HC7A 1R4AA 4RD3A 2B4TO 5FUYA 2GT1A 3GRKA 3E22B 4OD0A 2P62A 2WF7A 5I7EA 1I6WA 1X2EA 4Z3KA 1Y6JA 2K87A 3CA8A 3QLUA 3WS7A 4UBIA 4GBED 3VVLA 2Z2ZA 4KLZA 3X2SA 1LLCA 1RU3A 1E64A 3ZW9A 4Z9YA 2DT5A 4TMFA 2C2BA 2HFKA 5AUNB 4H60A 4Q19A 1E61A 2QZSA 1HQCA 1PR3A 3E3MA 3IAFA 4RV9A 1JVBA 5HJ7A 5KJ1A 2REXB 4U2DA 2X2EA 8GPBA 5MGNA 5JR3A 4CV1A 4GO1A 5FPHA 2NSDA 1V37A 4Y1RB 1QM5A 1B23P 1O97C 4HSGA 3L5OA 4MWSA 1FYWA 5FNZA 3OOSA 4Z53A 2VJDA 4OBXA 4NBTA 3SEFA 1E4YA 1ILWA 1N6NA 1D2MA 1ZA2A 3SSMA 3AI7A 1F2DA 5B36A 1IY9A 2CDRA 2O4UX 4P3YA 1BWSA 2XQJA 5AK5A 2SNIE 1F4VA 5AUQA 3CTMA 1QPBA 3N2EA 1EWKA 4ZV7A 4X7PA 4HQOA 3EXIA 2Q28A 3MWDB 2IDMA 2C2GA 2JFHA 4HL6A 3TE6A 4RTMA 3HFJA 3N39C 4AYTA 3ZKAA 4FGZA 4MQEB 1XZNA 4CCSA 4EF5A 4FGWA 2B92A 4Q47A 2C2ZA 1IBLB 2FGJA 3NDRA 3IDSA 3R5XA 4MQFA 2ZU6A 4HDKB 4Y2GA 3UWPA 3YASA 4NESA 4Y18A 1QF9A 1NRWA 1RXIA 2F3RA 4AUMA 4PIVA 3VSEA 5K6RA 1DWOA 3U7HB 3JAWB 3H11B 2BEVA 3R20A 1P6UA 3SK0A 2H4ZA 4CMIA 1RWXA 2HIHA 4QPPA 2NUBA 3W3ZB 1Y8RA 4YO8A 2C58A 3MCZA 3N86A 5AVSA 2VAVA 4QBIA 1UJMA 2I4LA 3M6MD 2YVKA 3KHKA 4YRJA 3REQA 2GZDA 4GKAA 4F2WA 1QE5A 3ZCXA 5I8WA 3K3PA 4A0QA 1H8HA 1UMDB 2A6PA 1F8GA 1WMFA 4J7XA 5CFNA 5BRNA 1ZCZA 5B3JA 1FQJA 5KAPA 2HWXA 1HLGA 3SQLA 4QT4A 3OQJA 5COAA 1RAGA 1ES9A 2EFGA 2NOAA 4YQZA 3AV0B 2Z57A 5L40A 4DLLA 4TKZA 3OLVA 3TMKA 2GO7A 3E1KA 3TW4A 3T7DA 2WD7A 1GRCA 3FY4A 3O2QB 4LCBA 4N39A 4MGHA 1N78A 1A8QA 2HWKA 2D0PB 1RWWA 2ZRDA 3DE1X 1VE9A 4HHEA 1HZZC 3U0VA 4FFNA 5KNBA 4XPZA 4HPXB 4R2XA 1U3TA 2EX1A 4ZYUA 5H9WA 3CN9A 4HMOA 3ZHZA 3M4JA 4UHFA 2ZRMA 5AHRA 2F8LA 3GGCA 3KXPA 2RKWA 3C1OA 4EJSA 3DVAB 4R2WA 3WMEA 4EMBA 2H6EA 4A3SA 5BN3A 4HAIA 5EHGA 2G88A 3RUAA 4YASA 5SZIA 1KF0A 2A9QA 1JGTA 1AG9A 4DFDA 4TYPA 5IBCA 1SXJD 5CJPA 4IFEA 3D0RA 2A0KA 1CUFA 5JC1A 5TT1A 3ZLUA 2VRBA 3EIEA 4BU0A 2XWSA 4E4RA 3KZMA 2A0UA 2XA1A 7REQA 4AW9A 4FFSA 3WWCA 1J07A 5L45A 4QGGA 3PHGA 1MNQA 1HQDA 4BLOA 1B3BA 3V48A 1GAEO 3Q3JB 2HA5A 5CM2Z 3JQEA 3AFMA 1E7QA 3LDGA 4WERA 2X5KO 3B70A 1U0TA 4YRKA 2AK2A 1FFEA 3J7TA 1EFVB 1AV7A 2MSDB 1YQDA 4NCJA 4MVXA 3IYLW 1Q3KA 4KQ6A 3J7AC 3QTBA 4FKMA 1IUOA 5EKSA 3B85A 2Y1DA 4JOCA 4LMRA 3GGPA 2X0KA 1I4DD 3M83A 1KMHB 3N7UA 5CVCA 3JZDA 3I3OA 5LBUA 2O0LA 2EFCB 1QXSA 4JUFA 4ZN6A 3TXAA 1SBTA 1UIMA 4CV0A 2VBCA 2MSKA 2Z5FA 2ZDQA 4M8SA 4W5RA 2VJKA 3MAGA 2H16A 4GD3Q 4CU2A 3PHJA 3BSSA 1FTNA 4UUQA 3NUGA 1AHIA 2NTEA 3O5AA 3HBMA 2PS1A 1YNSA 1TZJA 3AESA 1YH3A 4YJFA 5AW3A 4YP6A 2W2MA 1GZ5A 3VFDA 5EIXA 3FCAA 1J9GA 1JQDA 1Y9JA 2WEKA 3ZCRA 4JI2B 3G9UA 5JLJA 3GFFA 2REOA 3JSAA 1M2HA 1XXHB 1PO7A 2DFVA 3OFVA 4GU5A 2QE7D 2NPFA 1YMVA 3C87A 5EJ2A 4TTAA 5CUQA 5LN1A 4RGBA 3I45A 1TD1A 2UVPB 1R6UA 1XDGA 3LLVA 1PJZA 3LIIA 4BLQA 5IC4A 1H9CA 2B9VA 1E3TA 4CLDA 2ZAOA 4LRTB 5EZYA 2FTKE 4E94A 3UK1A 1CZKA 2CYAA 2J7PA 1J0EA 1KZ6A 1NW4A 2R7LA 1QRAA 3L6OO 5DGIA 3A2NA 1SXIA 4IVRA 3ZBUA 3I01M 4GGMX 2NW6A 3GLQA 3T35A 2VUSA 2E5LB 3HVUA 3UWSA 1QRDA 1WR8A 3JVDA 2H1LA 4LXYA 2J5BA 4ITVA 1R9NA 4BZXA 3CR3C 4HUQA 4FCTA 5KYXA 3CRRA 3O1LA 3WWOA 4GICA 4AP5A 2WF8A 2O6HA 3I92A 1E6MA 3A31A 3Q6NA 4BB5A 3C4VA 3ICPA 3KJIA 2OVFA 4W7SA 2REQB 1ZVQA 3D5TA 4WKCA 3HJRA 3EDQA 4E2ZA 4EB0A 4RGVA 3ZJ4A 1JYSA 2M6RA 1OZ0A 1FIUA 2NU7A 2PSHA 3OICA 2HHJA 1YBFA 1NUPA 2W4IA 3EXEB 4HWPA 1JJAA 2BY4A 3U9TA 3VR3A 3DC2A 1LPSA 3S44A 3TBHA 4AJ9A 3QVSA 4RTOA 4MMZB 1DUSA 4E07A 2O54A 3WLSA 1R5OA 4JEHA 1WRBA 2BZ0A 3F90A 4JGGA 4ZMRA 1D2EA 2F59A 2JFQA 4LXHA 2VZ0A 2QVZX 1WY7A 4N8SA 2NT3A 4POOA 2Z6UA 1PW7A 5L6LB 4MV0A 4PXYA 1DWQA 2QWXA 3OIUA 1JKMA 3IV6A 4NZPA 3CKLA 3OP4A 3P2MA 2MMGA 3BKWA 3G2PA 3HRIA 4FEYA 4I4TB 4Q3KA 4D3DA 4CUJA 4DMFA 1KORA 2IW1A 1HFJA 3G17A 4QRIA 3RJ9A 1Z6XA 2GZ1A 4AURA 5JJ5A 3DLHA 4LMPA 3COJA 2FP4A 2H1HA 4PWYA 2XCIA 1YD7A 3UJ7A 4J1SA 4LYDA 1CHNA 3ED5A 3GPBA 4FFLA 4N65A 1KPGA 2AEEA 5BV0A 3Q5EA 1SURA 1OLXA 3GUYA 2XB4A 2CE7A 3DZKA 4PZUA 3AWIA 1BH2A 3W9BA 3UTDA 1CRQA 5KTRA 5AKIA 3ZGVA 3KXDA 2OXEA 3MF4A 4BQRA 3MJCA 5B4TA 3QVTA 1G98A 2J07A 5J2TB 2HIMA 3AF0A 4R0NA 3U7FB 1PQWA 2OG1A 1MVNA 2AIRA 1SHLA 2NZ2A 2WWWA 1IULA 5DLYA 2QZPA 4RLHA 1K6EA 5KYXB 1V71A 3B5IA 2YC2C 2VZEA 5E7JA 3HUUA 2J7PD 2FMXA 1QO0D 4FFBA 3BL5A 3ZDQA 5D3QA 4JVMA 2WSBA 4LUCA 1R6XA 4BCBA 2BPOA 2F2TA 2I54A 2V7TA 1GA6A 4FC7A 5ICMA 3VQTA 1W36C 3LFTA 4QHSA 3DEJA 1WXXA 4GXNA 4FNOA 3D59A 5JWRA 5EJ5A 1Q2XA 1PTJA 3BB1A 3DD1A 2Q9AA 4KVFA 4YI5A 4EARA 3FOBA 4M36A 3ROFA 4ZQGA 2IRWA 3EIQA 1Z5VA 1OIVA 1CLUA 4BV9A 3U4MA 2GN8A 1T0BA 2Q62A 3R40A 3VPHA 4RTQA 1NMQA 2O3SA 4B3JA 1SKYB 4RLSA 1E8NA 1LSOA 1GCOA 3AEQB 3OFND 5DXJA 3TI7A 1ISRA 3U4CA 4ECAA 1IDN1 4BJ5A 1P1KA 1N75A 2D8AA 2H11A 2ILVA 2Q6LA 1EHYA 3FCXA 5E2AA 3R7AA 1GPUA 4DHWA 4PS0A 4KR7A 4IDAA 3BGIA 3TTUA 2AXQA 4ZTUB 2X9NA 3K09C 4DLPA 3CVVA 5KNDH 2FV8A 3WNZA 3WFIA 4A1OA 2WPDD 2A9KA 3LUPA 4AC9A 5AVUA 4ZC8A 2WTUA 1I32A 2B1RA 3Q6MA 5EJEA 2JHGA 1NVVQ 3FVTA 4I3FA 4IDCA 4YNBA 4CTJA 1IATA 3R9XB 3VR2A 2RHJA 3Q1KA 4KJXA 2RHHA 2ENUA 4KGDA 1KBOA 2PX8A 4R7ZA 5ALXA 4JP5A 2ZVPX 1IVYA 2AG1A 2L2QA 5DYWA 4HVLA 1C8VB 3KQNA 6REQA 5JZMA 1NXQA 3A9CA 4IXTA 4IR7A 4DV6B 5C18A 3DQQA 1AQNA 1P2TA 5DRYA 1VKJA 4ZI7A 5M3BA 4I5DA 4DLVA 2RGXA 1ZKDA 4TV8F 4W9MC 1O87A 3B2NA 3DYBA 3UK6A 3NTRA 4PAQA 1AF4A 5JCOC 3DKRA 3L8YA 2NTJA 2LXNA 4A5OA 2XCQA 3OLWA 2A14A 3OT1A 4G8JA 3O8LA 4N40A 4LV5B 3N8KA 4G37A 3KDSE 2G4LA 3U61B 2PYDA 2RK6A 1ZICA 5AJYA 5DYGA 2Q0XA 4MRSA 2DSTA 1XTSA 3KX2A 1QFSA 1W29A 1YR3A 2PXHA 3AB3A 2Q6IA 3AOEA 3BMXA 1JFFA 3NOXA 4AT1A 2LCIA 1XMIA 3RK4A 1YHNA 3BSYA 5DEIA 4KPEC 5L3QB 4LGYA 2G9VA 3FMGA 3H1FA 3DV0B 3ZTYA 3LCRA 4W5NA 2W0MA 1E2QA 3RWBA 3DO5A 1A7AA 4HGOA 3MFYA 5TQ2B 3O8BA 1X77A 2PL3A 4WINA 2H08A 1NJFA 4O59O 5BPFA 1E9CA 4TL7A 1UZUA 2VTDA 4IZIA 2A9RA 1N6RA 4UPVA 4LDPA 1M2OB 5LQCA 3MW8A 1XK7A 2FWAA 3ETLA 5H3HA 4KLRA 1SPBS 2P3SA 2AN3A 2GN2A 2QS9A 4G63A 4EENA 5BNIA 3GO4A 5LA6A 3PEYA 2G40A 4IGAA 3VX4A 5FTNA 3K72B 1LTKA 3CXRA 4UM8B 2O5RA 2YQ5A 3OQPA 4QUGA 1J0CA 2RH5A 3CEMA 4O8CA 5AJTA 5JCJA 3HDHA 1YU9A 3AVOA 3ML1A 4GZ6A 4I9UA 4D8TA 2QW0X 2IQIA 5DM2A 5EXSA 1EM8A 5HHTA 1HNWB 3REQB 4LV6A 3WP1B 4D4GA 3L02A 2FGKA 3UC5A 4AWXA 3K20A 4B0OA 4HD8A 1ZRSA 2VHQA 3K96A 1O77A 1W30A 5HA5A 3P0EA 1QHNA 3BYZA 5ALTA 1GR1A 3ME5A 2BE9A 1U1FA 4BVGA 1L3IA 2VHEA 1EFDN 2HMVA 1E6UA 2ZTVA 2RG1A 2LE0A 1NW6A 3AUFA 4DLAA 1PGJA 3I9FA 1Y1TA 3AETB 4TS3A 4RLFA 2GM3A 2GCEA 5CLFA 1C0PA 3R3UA 3NRCA 2PE5A 1EK2A 2QTLA 4NL4H 1ILEA 4FC6A 5I9SA 2DLDA 2PO5A 3OQ6A 4CL8A 2Q41A 4LTNA 1JEDA 4O33A 2P8JA 1HV8A 1ZH6A 2PUJA 4EA9A 4F92B 3CRVA 1M2KA 3QBJA 3TQHA 2QXUA 4O08A 5CNKA 3UJ9A 4Z51A 3QI2A 5E4TA 4RPJA 3TTXA 2B0CA 4G5HA 3FFAA 4FIDA 1PG2A 1UP7A 4BFSA 5EL0A 3NKFA 3T7IA 4ENQA 1W59A 2DERA 3RS3A 5ILGA 1N1GA 2LGJA 5F73A 1EAMA 1TTPB 1IYZA 2XF2A 4FUTA 3H7AA 1EWYA 1E7SA 4TL8A 4BN5A 1V5GA 3ER6A 4M98A 3OVMA 4J43A 2ORED 2V7GA 3OO0A 4Y6LA 4E30A 1TLTA 5HRUA 3EVCA 4YCDA 1DAPA 5I7AA 3RRBA 3S1AA 5FL7D 4QTYA 2E6KA 5EIFA 1DDGA 1PF7E 2RGNC 1HO3A 3K0KA 3H8SA 4Z99A 3MWYW 3V34A 4YMGA 1GLVA 3DVQX 4G0WA 3TZKA 1A9PA 4CM4B 1KZ4A 3K0CC 2JFUA 1OLUB 2V7BA 3AERB 4RZ2A 1OBVA 3ESZA 3M49A 1Z3CA 3N7AA 2NM0A 1WCWA 2HU2A 3HZZA 3NFRA 1ODLA 1XOIA 1O5TA 3OY2A 5DK6A 2G5CA 5B3JC 4ZT3A 1UT5A 2WMNB 3MEQA 3PVCA 3H2HA 5DO9A 1VZ2A 4BFUA 2WJYA 3PNQA 4RIHA 4D9BA 1K86A 1R0RE 5K7SA 1S96A 2AMFA 1DKRA 4QULA 3JXEA 2VSQA 4NG4A 3WLNA 3KZKA 1IH8A 4DY6A 5LQNA 1SCBA 4TMZA 1YFZA 4QYIA 1D2CA 4IQ0A 5JH7A 2J3KA 3RSLA 4JAVC 1CFZA 4BQIA 1AKEA 2VHWA 3CINA 3JQPA 5FULA 4Y1EA 3HNRA 2BLLA 2FJPA 4LFCB 1J4AA 1LI5A 3NHPA 3PFFA 5AKKA 4D80A 1YS7A 3W78A 4LXGA 3MD9A 1PL0A 3QOXA 4FOSA 4H6VA 4ND1A 2AOVA 3QM1A 5DBFA 1K7CA 3VJLA 1DRKA 2KYRA 1BMDA 3FROA 3H2GA 2XZPA 1KPIA 2XDYA 3INYA 4Q3BA 1G0OA 4BNNA 1JDVA 1P74A 5F1KA 4IG4A 2JGNA 2OHFA 4Q7EA 3UJAA 1YI1A 1V5EA 2DWCA 3NOQA 5G0VA 1MHTA 2GCGA 3LY7A 2OCYC 5DCLA 1D07A 3VAAA 1B8UA 2GKOA 3WX0A 4CBVA 4OFBA 2FUEA 2GQ0A 3RVRA 4AZ0B 5A1JA 1X7GA 3BFJA 1T6YA 3BQMB 1HDGO 3ZY4A 4ZU1X 5EHXA 1DGQA 4JBLA 3U7QA 1OH7A 3EXG2 1NP6A 2EJVA 2PAAA 4G0ZA 4JB2A 2JATA 3EA4A 3EVTA 4B4UA 4P4SA 3ON5A 4O4HA 5FTKA 1CF4A 2A94A 4NU6A 2WIAA 3MUEA 5EVCA 2A57A 2WM9B 2P9ZA 1E2UA 4EJMA 5K0CA 4MGYR 1W8IA 3EZFA 4NCHA 3DBLB 1ZM2A 4MIEA 1TFUA 3ENQA 3ZHYA 2I34A 4ZVVA 1G9XA 3BWCA 4BKMA 3GX1A 2XH8A 4ND3A 1EG2A 3L7OA 1FYEA 4TRJA 4M1EA 4P3PA 5DHQA 1SVUA 4AROA 3SR0A 3SQMA 5DU2A 5IXYA 1ZBDA 3TLJA 3UHPA 1YZFA 1NM5A 2XTNA 1ZMBA 2Y1FA 3LVQE 4H35A 1YB5A 1BVUA 2JIZA 3AFNA 4KYTA 1VCIA 5FR2A 1GFSA 4C0HA 4AKHA 2CXXA 1NLZA 3FG9A 4FYHA 1P8AA 2VWPA 3I52A 4LDRA 3TG8A 4M46A 4HUTA 4YAJA 2FEKA 2HJWA 1SK9A 1SCNE 2GF0A 2PAFA 2XSZD 3GUUA 3S29A 1ZI9A 2ZSIA 2P3OA 1Z47A 1DXYA 1OIXA 3QXCA 3TOSA 1NVBA 3C48A 1ESZA 2V59A 2IEAA 2O2GA 1UC9A 2HCTA 4V2UA 5B3KA 2I2XB 1CY1A 1GM5A 4EQ6B 1UBOS 2BFCA 2IZ6A 1K5HA 3GT7A 3HUFA 4UTZA 4G5FA 3EG9B 4RHEA 1IUNA 4ESEA 4CEJA 3DONA 1M33A 1TW2A 2K6GA 4A91A 3EGDB 1T4MA 2BE7A 8ABPA 1DC3A 1OHHD 3LHSA 3L0BA 2D59A 4CF6A 2WPNA 2HU8A 2BGRA 3JR7A 3QUCA 3PEVA 121PA 1T9DA 4BVLA 2QBYA 4UASA 4IEEA 1WABA 2BGNA 1T3GA 1SUPA 4FI3C 4OK5A 1NXSA 1O3YA 4ETWA 3CF0A 5HFAA 4OPMA 1TL7C 2AW3A 3Q3VA 1YULA 5DI3B 1MAUA 3NH6A 4Q03A 1KE1A 1COZA 3NI2A 4RD1A 1PEDA 2GBCA 3U3MA 4RE6A 3LDHA 5K03A 3IOYA 3V80A 2BH2A 4Z9AA 1SIOA 4BBPA 1QZTA 4JA0A 1JEJA 4G0MA 4OBBA 2WM2A 4XGQA 4JODA 3IMCA 3PHIA 4FDTA 4HDMA 4PRYA 3AF6A 3UMYA 4TLCA 3TLBA 4DCSA 2JLXA 4PG8A 3BIFA 1I2BA 1SVLA 4DPKA 4EZIA 5A3RA 1XTBA 3D4IA 2PSSA 3ONVA 4R1PA 1PTKA 4B3HA 2PN1A 1RJWA 5HM6A 3W6PA 3UAZA 3LIPA 1MVLA 1SO8A 1ZN9A 2OM6A 4Y2QA 5E3JA 1AF7A 1OFUX 2EWWA 4JL5A 4PXSA 5AHXA 3PWTA 1RPNA 4MW0A 1L5GB 4UFOA 1VPWA 5GVSA 4PGMA 3QG5A 3STHA 3NHKA 2GXQA 4ENTA 4XVCA 4CLOB 5E1OA 1E1CA 4RY8A 4BVBA 3VYTB 1U1CA 2W6CX 3KCNA 3QLUC 1S01A 4HWSA 3IIKA 4Z3OA 4G1UC 1MB0A 5AI4A 4IS3A 5DP2A 5BSMA 5FUMA 2Y05A 1VJ1A 3DPUA 4M9ZA 3LUKA 1P2BA 3K9WA 2H9AA 2BDUA 1XZEA 4Q7LA 2F8MA 4P22A 5CEJA 1M0WA 5LJIA 3AVQA 3P97A 1ABFA 1LJLA 1W4RA 3G2QA 3ZQ6A 3BFPA 5L4SA 4BMYA 2A35A 5JS2A 1JVNA 5BWMA 2HA0A 5JARA 1ONNA 2IHJA 5BV1A 3GW8A 4OLJA 2P27A 1BXRB 3UMVA 4IWXA 1GT6A 4DVGA 5JDIA 3S68A 1IMOA 2A5JA 5LBIA 3THWA