3LHFA

The crystal structure of a serine recombinase from sulfolobus solfataricus to 2.3a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
136
Chain Sequence
RKVILYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEEVCKAHGCEIVVINKEEELVEDLVSILVSFSGKLYGMRSHKYEKVKKCVEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Serine Recombinase from Sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Recombination
molecule keywords Serine Recombinase
total genus 45
structure length 136
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhfA01
5C32A 1ZR4A 5C31A 1GDTA 3LHKA 1HX7A 3UJ3X 3ILXA 2GM5A 1GHTA 2R0QC 5C35A 3BVPA 2GM4A 3G13A 2RSLA 3PKZA 5C34B 3GUVA 2MHCA 3LHFA 1ZR2A 4BQQA
chains in the Genus database with same CATH superfamily
3LQKA 3ROKA 1BX3A 3C3JA 2XMQA 4BVJA 1IY8A 3AEKB 3CH7A 3TKLA 2JK1A 4RK7A 2P5TB 2QR3A 1FNSA 4DDKA 5MFPA 4LPSA 3LK7A 5A3RA 3NHJA 2C1XA 3DFMA 4B8ZA 4M0DA 2DPGA 4YDRA 2JA2A 1JEDA 4N6NA 2GI4A 1IXRC 3BRWD 4RLQA 2W71A 1R3DA 4NDAA 4D8YA 4A92A 1ACJA 3A3OA 3P9CA 3VR1A 2D7CA 5JISA 2XUIA 1TVEA 4X7MA 4RZ2A 4KNYA 3DMRA 1DRKA 3KAKA 3KHUA 1EUQA 1GJRA 2E3JA 2V7UA 4EFKA 1GUFA 3ORFA 4MP8A 2W5UA 1VHTA 4M8IA 2PU7A 2PZLA 5AVSA 4OOFA 4UUBA 1DJNA 3IHLA 3QEMB 2MYPA 4JX9A 1QF9A 2D1QA 3RS7A 1IM8A 4AZSA 6GPBA 1U8UA 1RCFA 2UYYA 4Q3NA 4Z4CA 2ZSAA 1UK7A 4GOMD 6AT1A 3LGSA 1MJGM 4FXPA 3H9UA 2QEQA 3D7NA 4JIMA 3ZDCA 2YL2A 3NDBB 1E3SA 3A6PC 1OROA 2XRYA 3GBVA 4P86A 2IYWA 3GLFB 1JJAA 2PKXA 2QTVA 2VF4X 5AW4A 1RJEA 1THZA 2C9BA 1ZK4A 4KWIA 2JLAA 3E7XA 4PYQA 3TOZA 3SD7A 2ESRA 2ORVA 4L8FA 5DN6A 2H3EA 3N8NA 4Y7DA 5DF1A 3DHNA 5G0SA 3NHMA 1DHRA 1AKVA 1F0KA 1SVIA 1A95A 1BYUA 3TTUA 3GR6A 3FD8A 5FPQA 3ZNOA 4D02A 3HVRA 2IP1A 1TNDA 2HR1A 2QTMA 1J2JA 1IVSA 3P5BA 1WSBA 2P9JA 1I7LA 2QQGA 3PYXA 4PLCA 4RDCA 4BZXA 1PSDA 3CLTC 4EB0A 1FOEB 2GNPA 2HOQA 3D7RA 5FBLB 1VZ3A 1YR7A 2XBMA 4PZAA 3ORRA 4O3MA 3I9OA 4ZXFA 2IZOA 3DZHA 3EAGA 4GBMA 4MW2A 3VSAA 2AJDA 2B4YA 3C7CB 3KAQA 1TMOA 5AJUA 3ZEAA 3B7GA 3OO0A 3D7SA 5IJ0B 2M2IA 4FTWA 3SXJA 1V9SA 1PF7E 2M32A 2WWWA 3KLBA 4CBVA 2OCLA 2IWHA 3JQGA 1MW9X 2G17A 3HZOA 3MGGA 1XEFA 1UEIA 2GJ8A 1H3EA 3WG9A 5A7GA 1C7QA 3U3ZA 4WCFC 1U8EA 1E2PA 5CLGA 2FRDC 1WV0A 2AJTA 1C8KA 1HRKA 2W8BA 4FC6A 4PICA 4UBIA 4AMYA 1QFZA 4B75A 4S04A 3FTEA 1ZU5A 2NQTA 4TVOA 2WC1A 3UK7A 4XFKA 4NAVA 1A82A 4JLJA 5TPZA 3N2IA 1Q20A 5TVGA 1YB2A 1OCEA 5EWJA 1D8AA 1OIVA 1PJBA 3C8HA 1DQRA 2XNDD 4C7BA 5BWLA 2WSYB 4OJMX 3V7UA 1KI2A 3VFDA 2H5IA 2UYCA 2HLDD 2PN1A 3THSA 9MHTA 2BCGY 2GPTA 1ZUWA 2HA2A 1TCVA 4UEJA 2IFTA 1FXWF 1MT0A 2Z4SA 2R86A 3CIOA 1GOTA 2WAYA 4DIMA 3DVAA 2WBLC 4K9DA 3EVEA 2VHQA 3PWSA 3RLFA 3WXBA 5EHZA 1KMHB 3K1ZA 1U7ZA 1KR2A 1JI3A 1TGVA 3DMFA 3WYGA 3ZIDA 1MC8A 4BQFA 4QM7A 4GMFA 1T4DA 4X45A 1F1BA 3MGKA 3G0GA 5JXGA 1G3RA 3F7TA 4AIRA 4AUEA 4X1KB 2WIAA 4HZUB 4BGIA 1OTHA 3IGFA 3RGWS 1G5IA 1Q0RA 2YUTA 2ZJBA 4LE2A 3V42A 3K70C 4ZO7A 5AVKA 3AL0C 4KDCA 2GNAA 2WUEA 5FWXA 2ZRJA 4HDMA 4DXHA 1WB9A 3A6HA 3M1AA 3PQ4A 1QYRA 3CX4A 3TR0A 5JH7B 4F4CA 1HEUA 2VLBA 3E5NA 3EOBI 3H2ZA 3HEMA 2QPOA 3PHIA 1CDZA 4L85A 1KETA 4XW2A 3VPGA 3ADBA 2PT7A 3EB9A 2ZRLA 5L4LA 1F0PA 1MN6A 2DR2A 1K0FA 4A8JB 2RBEA 2X4DA 2QRUA 2XKJE 4ENVA 3TE6A 1K4MA 1IQUA 1QGOA 4MX8A 5C18A 5LDDC 1NUSA 1Q83A 3EXIB 1RMTA 5SZHB 3WLFA 5CG2A 2FZGA 2XWSA 3BE5A 1GGMA 2YHIA 2QTGA 3W3AD 1N2CA 4KQ6A 3O1LA 3FVRA 1Q0ZA 4CMKA 1W5SA 5HVNA 1JQAA 2J31A 3H97A 4XEHA 1Z0DA 2G8LA 5IT0A 3FBWA 3E9QA 2ZE7A 2O7VA 3O2QB 1EX7A 4NK4A 2JLVA 2VYNA 2DJ5A 1ZFNA 3D3EA 4R71A 4X62B 4YMGA 1FTSA 3FG9A 2GEUA 4FE3A 3SHVA 2PL3A 2VSQA 4UBNA 3SEQA 4MITA 2JFVA 3C1UA 1OYWA 3O8LA 4QLAA 4INPA 1NP6A 5H9VA 4X92A 2H5JA 3A9UA 3KYJB 4Z4HA 1FUYB 4N9WA 4LCEA 1KYIA 1I13A 3L0OA 3TTXA 1CEEA 3T1YB 1IUNA 2BJHA 4YP1A 3GUCA 1A2QA 1HXHA 4LYEA 3V4VB 1L8LA 5CA1A 2VOJA 3R7FA 5HF5A 1XMIA 4L50A 5KTRA 1YZYA 2JCVA 5C53B 3GRRA 1TDJA 1JILA 4WJKB 2W4IA 3LW8A 1UKAA 2VJAA 1OYYA 3AXSA 3GGOA 2FMKA 3TZQA 3NBKA 1UBTS 1ZGGA 2AFRA 3ENZA 4FT2A 3G1TA 4I46A 4QUAA 3OPXA 4PPGA 4R2MA 3S0JA 3W4KA 3UJBA 5BN5A 3NGMA 1GAEO 4BKQA 4E2YA 1XL1A 3F3MA 4OQXA 5K03A 5DLYA 2EIXA 2G9UA 3D3JA 2G36A 1YK1A 2AB0A 1FQKA 4PN7A 5GJBA 1RABA 3N8HA 4HLDA 1JPUA 1ZVMA 1BMTA 4LPKA 4OREX 4F2HA 1DDOA 3RIEA 2GEDA 1H2FA 3RKRA 1U7DA 2O2HA 1KMHA 1IOVA 4WESB 3GEEA 5JAIA 2BY4A 2VDUE 5KX5B 1WULS 3FDJA 3Q12A 4QSHA 1K97A 5AK4A 1X6VA 3KVOA 1KRHA 4NONA 3DGEC 4WZZA 1QC5A 4HB4A 5C51B 1P45A 1U0RA 1AQIA 1I94B 1FX0A 1HDOA 1PD0A 4OSOA 5E9JA 1L7NA 4Z5XA 3EYWA 4FZJA 5EVCA 4KX5A 3D3NA 1IUOA 3V33A 3A6DA 5DP1A 3V00A 5HWSA 5I01A 2WU3A 4WCVA 3R5FA 1X8JA 1D2RA 1RRPA 1YTLA 5AM5A 2P68A 5T8KA 3L6BA 1WUKS 3DYIA 1YOBA 1M3SA 3E03A 3TVDA 5K0EA 2GF9A 4FSXA 3DBLA 2CXPA 1QJ4A 4B4DA 3VU8A 4BO5A 2VJKA 3QVMA 1VE3A 2HRDA 4QNNA 5M5BA 4AAYA 5A3JA 4AW9A 2UUBB 3W6OA 4DSOA 3O90A 4D9HA 3HFGA 3ON5A 2ZETA 4HGYA 4ZARA 2C7BA 4G0OA 1Y5LA 1CPYA 1G5PA 2A9RA 4KN5A 4N5IX 2VXOA 2RKBA 1IU9A 3GT4A 3NIDB 3QNUA 4WUTA 1L5LA 3RV3A 1QZXA 4PONA 4ZZ0A 1MJGA 3D8BA 2HDOA 2SICE 4CFYA 5LN1A 5CH8A 2OHXA 2QF7A 4ARUA 4QULA 2BKEA 3H6HA 4CI9A 4W5TA 3COJA 1D1QA 1JH8A 2VZ8A 4CPDA 5FPTA 1X8KA 3KQOA 5L4SA 4R54A 3ZLUA 3FX2A 4W5OA 2VPPA 2X1HA 1G7SA 3UGQA 4BE9A 4MUFA 1RXCA 4IICA 1UKZA 1FP4B 1N8SA 2VSFA 4M9ZA 4J3NA 5FTJA 4BEWA 4MKZA 1AKMA 3FKSA 1D1SA 1UMBA 1ZJ5A 3GDHA 4J0GA 4LZNA 1RAGA 2BI7A 4L08A 1N9ZA 4KIFA 3G0IA 1ZVQA 3FB1A 1YRLA 1UK6A 1EFCA 1XCLA 3A3KA 4OFZA 5LYJF 1DNPA 3RSGA 2WZDA 4P0PB 4ZO8A 3QU5A 1MCZA 4LOIA 2FZEA 5IAOA 4C4TA 4PZYA 4P2GA 1UQUA 3O26A 2ASVA 2Z8YA 2RGDA 4MARA 3ZW7A 4LOLA 1Q7GA 4YRSA 5ERYA 4BB5A 3IP3A 5KWIA 3NW9A 1J8YF 3IDZA 5KYTA 2YVAA 2XMBA 2W43A 1ENYA 1K0UA 5IXJA 5K0FA 3THYB 1H4QA 1EA7A 5DO9A 4ZAFA 1YI1A 3PJDA 1M2JA 3EFEA 3I30X 5KVQA 2C07A 5B30A 4YUAA 3TCNA 3VYVA 3B2QA 1ZW6A 3ZX5A 4WLOA 3SY8A 1TJPB 4X24A 2H63A 2ZAYA 2J6CA 2GB4A 5FI3A 5B6PA 3EFOA 2EWWA 2IHVA 1QK5A 5F1YA 1YS2X 4LDPA 1P7VA 5K4GA 5JTTA 1W19A 1EDZA 4KIUA 1PNQA 4G37A 2GWHA 4YCCA 3M0EA 1I2BA 3ORSA 1ZUHA 4AJ9A 3D6UA 4WKCA 4PO8A 3VYSB 3RQIA 1IMOA 2JATA 2ZYRA 3LX8A 2ZRFA 4UBKA 2FQQA 3ZXIA 4EL0A 4P58A 3ZGLA 3CUUA 2NSJA 2YDYA 2QQ0A 1MB9A 3FF4A 5BWNA 2H4FA 3BHIA 4ARCA 1N3LA 2CB9A 3LPLA 3OZEA 3RAEC 1P3DA 3ANMA 1C0PA 4MDHA 3CYFA 3VJLA 3KL2A 2B94A 3FIJA 4YV7A 3K2BA 5L3QB 3HG7A 2OMEA 1CJCA 4WNCA 1Y8QA 2J33A 2OZKA 1A72A 3FROA 3HKEB 4JJZA 4OEHA 3F7NA 5SY6A 1ILEA 2JLUA 2OB1A 3EIEA 4K81B 1OKKD 4PY2A 4QDOA 4K8OA 4TLEA 1GQSA 1SC6A 2GVDC 3AUJB 2QROA 5E95A 6LDHA 2XMGA 4QHSA 3MTQA 5CNIA 3MAAC 4DARA 1CCWA 4INZA 2Y0DA 2HV9A 3EPRA 4R8VA 3ZW9A 3AFOA 5EWMA 4CQLA 1P81A 5FTKA 4E70A 4NF2A 1TF5A 4NKRA 3IQEA 1KC1A 2V98A 3R3HA 4ND8A 1LW7A 1IQRA 2RGEA 3CGGA 3CGWA 3I2GA 1G8FA 1RYYA 4NYJR 4ZV7A 4U2GA 3T52A 3H75A 3LI2A 3GELA 2OENG 1T4GA 1VCMA 4NCAA 1PI3A 4XARA 1W5TA 4KGZA 5IU6A 2R6FA 3EEBA 3TECE 4M9SA 3JS5A 5L51A 1UMCB 3T12A 1UJMA 2N1MA 3M6UA 2VQFB 3UGKA 4RVSA 5FO1A 4ZHQB 5I8ZA 3D6AA 1FS6A 4YAOA 3PQ8A 2I6XA 3GEHA 7MHTA 2PFGA 3FVVA 4FCVA 3R24A 2OBLA 3QMWA 1ZK2A 2PRZA 4MRSA 1OXBB 1CF4A 5CDYA 1LUAA 1OX4A 1H2AS 1XCJA 2OCAA 2P9ZA 4MR8A 4YIKA 3RUFA 4BUCA 2JIZA 2BKAA 1D2NA 5CGQB 4TMYA 5KVSA 3IUEA 2AMLA 2AKYA 3KTFA 4XXHA 2AFIB 4KRXA 1SC4A 3NASA 4GIBA 1UM9B 1Q84A 2JJ8A 1P80A 3DJFA 3TI9A 5JFOA 2UKDA 4KQIA 5AM0A 2XUDA 3X1JA 1N8TA 3U37A 2COUA 3A3PA 2YICA 1FLAA 2J0UA 3FWKA 3LCRA 1E5VA 4YPFA 2TMGA 2G1UA 3A3NA 1KK3A 3I58A 3CEJA 4R5HA 4LC1A 2DCUA 3O8DA 5CDGA 2XCRB 1U2RA 5J5AA 5JXJA 1PR3A 2B3TA 3SE7A 3JWHA 1MFZA 4FK8A 4B35A 1EXVA 2CFSA 3GL9A 1VKZA 4QRDA 4WECA 2R1VA 1OH6A 3ZS9A 3DAOA 2C78A 4O2BB 1W4AA 3D4LA 1PGQA 1URPA 2LKDA 4D46A 1AZWA 3SSOA 1K27A 3PPWA 2ZYUX 4EGAA 2C2YA 5BUSA 3EEIA 1AF7A 2JL1A 3FCOA 3BFVA 1GILA 2V4UA 3LUCA 1AS2A 2BI8A 3MYYA 5ALHA 1FU8A 1K92A 2H65A 3G23A 5COBA 1QV9A 1H2HA 1V3TA 3W2GA 2ICAA 3DZJA 4MUIA 1ORDA 1FY2A 2CNOA 4CQMB 3R7DA 3BK1A 1DUVG 4Q6BA 3SE0A 2YZGA 4N0DA 3RFUA 3PF8A 4L9SA 1A4IA 2IXEA 1TZMA 2XMRA 1A7UA 2VHJA 3D4BA 3QW2A 2O2EA 3OP4A 5HQJA 3EGDB 2BI4A 2VQ6A 4JU8A 2VP3A 4PSUA 1I1QB 4TL9A 1L5HA 3UKDA 1D2HA 4Q03A 4E1AA 5HK9A 4YRBA 4GQAA 4NXMB 3OQBA 1YF3A 2QOEA 1DKQA 1W76A 3NVDA 4M1QA 4Y2YA 5EA2A 1P4RA 2Y1KA 3F46A 4RIIA 3IP5A 2PLAA 3BORA 1W85B 3GAFA 4K03A 4KFTA 4B31A 1D0VA 5BN4A 2XNJA 2Q21A 3GQVA 2D0PB 2RHGB 3PFIA 5T6BA 3RHSA 1S8OA 3JY6A 2WJJA 2XZTA 4D9KA 2QN7A 4NULA 3NVMB 4E7OA 4KFRA 1DT3A 3P9NA 3J80A 4TMWA 1P9WA 3K6SB 4Q9JA 4TKUA 1TQ8A 1LJUA 4MVJA 2C4TA 4OHYA 1NQOA 1Z7YA 1B1CA 3T4PA 2E1PA 3KEOA 4DQXA 5FBVB 3N75A 1IJFA 4G89A 1FDWA 4GZMA 3PHBE 1A9ZA 1E3TA 1GSHA 2VSNA 3AFIA 4G9EA 4P08A 3UB4A 3VMFA 5K8JB 4PHCA 1E2HA 1IYZA 1DOZA 4WFJA 2VTKA 1Y3AA 3HWSA 4AUMA 4L3VA 1VL0A 4YALA 4NG5A 1NG1A 3C16C 3LHSA 4ALKA 5B7GA 3EMVA 4R3UC 3U5TA 4P4TA 1ZNYA 1U7HA 2G6BA 3NDPA 5BSVA 1VRVA 3AGPA 1DADA 4LX0A 3UUFA 5TMBA 4BE4A 1G42A 4QWMA 1GTJ1 4K9KA 3OECA 3I01M 2W48A 3E48A 3GXOA 4E13A 4YLYA 5BSMA 4HGRA 1YD7A 1A9TA 1W2HA 1JKJB 3L0CA 5AKLA 1TQDA 4AQDA 5C81A 5EJ9A 3F5SA 3LMKA 1EA5A 5B6IA 5HIAA 4UOQA 4CEJB 1KOJA 3D2LA 4BVAA 3IOMA 4OHMA 1HT1E 1SCBA 3VR6H 4TV8B 5H5JA 3OCWA 1M72A 1LQUA 2QJWA 4UOEA 2YZKA 2IEBA 5HILA 4ZQEA 2UYQA 3ZZ1A 3S4YA 2GCPA 3BFPA 3FB4A 2YXLA 5AOCA 2PZ8A 3N2KA 3X1DA 3SEAA 3H9QA 5DHFA 3UWSA 1AKYA 4PLZA 4OHXA 3D3WA 1DFIA 3T9EA 4CUZA 4YMVA 2I29A 3OMXA 4CMJA 2NMVA 1D03A 4MPTA 1BFUA 4GM0A 2Y1EA 1UBGA 4MR8B 2NO0A 3CLUC 3PUKA 4M8SA 3QX3A 1ISSA 4LUCA 1X7ZB 4D4KA 2EZUA 2AOUA 4D1YA 5KNDA 2IP4A 3SS8A 1C4KA 2E49A 2ZIVB 2IL1A 4FLMA 5BQPA 3UXHA 1NKTA 2ZI6A 2NX2A 4MVWA 1KY2A 1PYDA 4EF6A 2H59A 2GJ4A 3I92A 1FFDA 4B85A 5A5GA 5L45A 2ZXUA 3OIWA 3HJAA 4DADA 4MCAA 1KI1A 1TGYA 1CTQA 4QUIA 5KS2A 1VCIA 1P0MA 1WB5A 1RI4A 4KTTE 3ZTYA 5CDTA 1RM3A 1Q1AA 3O82A 4YI3A 3REQB 4IGAA 5G3YA 1B2LA 3OOHA 2FZ5A 3IQFA 1WNFA 4XPIB 5HPYB 4K9LA 4FN5A 3IMKA 1PZEA 2VJBA 5BMVB 5JQGB 1XZCA 5E2BA 2VAMA 2JH3A 3BE4A 4I4TF 2DM6A 1AIPA 1U4OA 2GGSA 5KNLA 2A4MA 3TEFA 4NZPA 5B58C 1L5FA 1NATA 3QJ5A 4QAQA 4AMVA 4ABYA 1AUOA 1E2DA 1U0GA 2DUJA 3IKTA 1EQUA 1KI3A 1S2LA 2FPIA 1C7EA 2CXNA 3SX4A 4IXDA 1U2GA 1XQYA 2FW6A 1E2MA 1QANA 3PDUA 2FRVA 3IT1A 3JV7A 5CFOA 2A3RA 1RZUA 3DAHA 1XVUA 3OFVA 4V0QA 3STWA 1EPUA 5LQKA 3DKPA 1ODIA 1BWQA 1IBCA 5F3DA 4HGPA 3KZXA 4E22A 5JI2E 2VJNA 1JKMA 2KSQA 3S44A 2A86A 1H6AA 2IOYA 2KPOA 5BW4A 1R8SA 5IYZF 4R0VA 5G1OA 1V16B 4IGIA 2PS3A 2IZ1A 3D1LA 1GL7A 3GNSA 2OHGA 4W1RA 1X1QA 4QDJA 1PJ8A 1HE3A 4QJ4A 5B1YA 5C8YF 1SURA 2BM8A 4YJHA 5C1PA 2PDAA 4CMAA 2I4LA 3NHSA 1VG0B 4J07A 3O8CA 1LSOA 2VG8A 1OTXA 2X41A 2AIRA 1H93A 2CE7A 2HMTA 3GAMA 3GWZA 4MKRA 4JA0A 1MB0A 3OMWA 3K70D 1OH5A 2R6R1 2Q2OA 4DCOA 3WL6A 1VLZA 1ES9A 5AKHA 4AJ1A 4BV8A 5MDHA 3N28A 2B8JA 2V0GA 2B2CA 4PC3A 3TRIA 3WSTA 3ZZ0A 4BMYA 4JL8A 1WDLA 2RIPA 4I6EA 5JQGF 1E2GA 2F2TA 3A9TA 4MS4B 1XTBA 2Q3HA 4MQFB 5TJHA 3ZLTA 4P53A 4B4UA 1G2IA 2B8NA 1N2OA 4DTCA 2WUDA 1GUZA 4FW9A 3IAXA 2P5YA 4DA4A 4U0KA 3ZN2A 4I1OA 3F9RA 1MVOA 3VZPA 3R0XA 1VCOA 4ISBA 3I9FA 4IG9A 5TEVA 4F8EA 2QUJA 3GEIA 2FH5B 5EJ5A 2B2NA 1R15A 4LFAB 5IAKA 4MJ7A 2Y2VA 2Y3IA 3KKLA 4D6PA 4WBNB 5A62A 2XQFA 1C14A 2GHIA 3O1JC 2PCJA 5BORA 3VU9A 3AL3A 2HF9A 3HUUA 3NO4A 3LLMA 1SQ5A 1JG1A 4MULA 2EGHA 4JCOA 2GCOA 2QAIA 3AP2A 4R2JA 1VQ1A 2LCQA 1ABFA 1VB3A 1YU6A 3R8FA 1DC8A 1SKUA 1JW9B 1T6BY 3B38A 3FHOA 3WGJA 3N39C 2B5VA 2BFOA 3QKSA 4M22A 3RAPR 5LQUA 1FB5A 3CT6A 4DJDC 3IIJA 1XTRA 3ILSA 3C43A 4UM9D 4BYGA 2PXAA 4F1JA 4XVCA 1WY5A 1HE8B 2ZSEA 4HD8A 3I8SA 1AE1A 1SCNE 4NOKA 3IBSA 1QTIA 4PCUA 5AXDA 3WKAA 1NXPA 1XAIA 3JALB 5HG0A 4HUTA 1H65A 1TTHA 1YMVA 2G82A 1R5BA 2XYHA 3MM4A 4GC9A 3AF2A 4BFCA 1W0JD 2J0VA 4DUYB 1PTJC 3HA3A 2I03A 3KUDA 1GIAA 2GESA 2HI0A 4UHBA 2JLRA 2VFAA 4JLMA 3SDZA 1CZLA 2Q3LA 2WVAA 3EF1A 4MUBA 1W7AA 1OXVA 5CA1F 2RHRA 2BC9A 3NXSA 3CKKA 4JOBA 4REQA 3ZHQA 3SVTA 5FPKA 2ZZMA 2WOOA 3A7EA 3GJ4A 3GRCA 1S2MA 3M82A 2I7TA 4Q6WA 5DJ5A 3Q41A 3HE3A 4X20B 3L9XA 2GD0A 4L22A 4UDOA 4CEHB 3DZBA 3NFYA 2DQKA 1YH3A 1X7XB 2V7QD 5BVHB 3KJFA 1G1MA 2HUNA 2AN4A 3ACDA 1J7JA 1RWMA 1FFXA 4KI7A 4FE4A 4PXYA 1KO1A 4Y1RB 4NCHA 5TQJA 2WHQA 1WABA 3JQAA 4YCAA 1US8B 3R77A 4G0ZA 2B92A 5JI3E 1L5VA 3NR2A 4E5NA 1FP4A 2IPAB 4RE5A 3CVOA 1T5HX 3K5HA 5IAJA 5IJ0A 5IEBA 3JARB 5JAPA 3WFZA 2MSKA 5BWCA 3UAWA 2VIIA 2VEDA 3INRA 4V0MA 4G0NA 3THOA 3WSWA 3WYAA 4QXMA 4F6LA 5FFNA 4X8LA 1FLNA 2QMEA 2R2AA 3M9LA 4Z0PA 5C3MA 1OLSA 5FR1A 4C3ZA 2OMKA 4RMHA 1TD9A 4YP0A 3GBSA 5H68A 4FCTA 2JBHA 3O38A 1RRKA 1PT9A 2HDWA 4EG7A 4C4SA 2FP4B 2GN0A 4W5JA 5F1KA 1YC2A 1QQ7A 5AM1A 3ECSA 4COKA 3F90A 4LQDA 1ZY2A 4BNUA 3FETA 1NSFA 2QZZA 3K1TA 2J6BA 3PX3A 2V6JA 4MQEA 3RRYA 3QU9A 5J59A 2LCIA 1CC1S 4AS2A 2IYUA 4EX6A 5CA1B 4RVHA 2C2BA 2GK4A 1E5XA 2HRZA 2QTNA 1UZUA 4EBFA 5HQTA 3PUHA 4JLKA 3U2QA 3C8DA 4HAUA 2Y76A 4HRVA 4KODA 4RCZA 2GXUA 3IULA 1UBRS 1E4VA 3WX0A 4YQEA 2Z9CA 2OV2A 4HWGA 1LPAB 2WJ4A 3FYTA 3JD2A 3PHJA 4M8KA 5CNJA 3DLTA 3PGJA 1XZGA 3TW8A 5JDIC 4HB3A 3TB6A 4IYRA 1Z22A 2ODPA 2OVFA 2XA2A 3IL2A 2I4OA 4NH4A 4ZVRA 4ZJPA 2OCBA 3AJ8A 3JVDA 5FTNA 2H2WA 1JAHA 5CNMA 4GD3Q 1R9GA 4M54A 3VZSA 3QHPA 3F1KA 3T5AA 1LB1B 4WESA 1M1XB 3OTQA 3I39X 2G1JA 4HY3A 4TMTA 1DEAA 2PPLA 5FD8A 4LZLA 3K4PA 2C2GA 5DKFA 1R66A 2IYRA 1KYQA 3QLJA 2EVWX 3RIXA 1HMPA 3L4EA 5DT9A 3TRKA 3OZRA 1Y33E 5CR9A 4G1BA 1FJ2A 2OESA 2OD2A 1NI5A 2P2GA 3N5KA 1TUIA 3BG5A 3KZVA 1WAMA 1T9GS 3KJQA 5DTMA 1W88B 4HSEA 1X7XA 1ZVJA 3EBPA 2V9ZA 2WJPA 3CN7A 3O8OA 4DUGD 1ULTA 2NP7A 2CL0X 5DXFA 2OG1A 2Z43A 4BO9A 4YAKA 3AV3A 1X15A 2M6SA 5IC5A 1CDDA 1G8AA 2O3QA 1P0IA 2V5VA 3NTUA 1JHOA 1ULHA 2O4UX 1D4FA 3IBFA 1CUIA 1QYIA 3PNLA 4EGFA 3Q5EA 2O5CA 1FBTA 1IB0A 2Y1FA 1U0SY 3WWYA 4EAQA 2F00A 2F8SA 3OLWA 2PUHA 3FUWA 3BRWA 1DLIA 1X1CA 4W7SA 1JQEA 3M4YA 3VJRA 3I0NA 1MIOA 4R51A 1X14A 5A7FA 1LD3A 2HQRA 1YDGA 2HEGA 3OESA 3THXA 4X97A 4AS3A 5CFRA 1UR5A 1ZINA 8OHMA 1JEQA 1T8YA 4DWOA 5JNRA 5CA0F 4KOEC 1GFWA 4UREA 3NWOA 2IP2A 2FP4A 2XQKA 3PPYA 3D0RA 5G3ZA 3ZIUA 3OIGA 4TQ9A 4AJNA 3AV0B 1GFSA 1HBJA 4EZIA 3R5XA 1IDN1 4L5JA 4LJ6A 2DHRA 5TC4A 2C5HA 1XR3A 3T3IA 3TQFA 4R8RA 3I4FA 1QB7A 1HYGA 1M67A 2A0YA 2JIDA 2JJ2D 4RMIA 5EP2A 4JJAA 4UAGA 2IXBA 1MZVA 2J5XA 4F9GA 2K87A 3PFCA 4DSAA 2GPJA 4HB2A 3W6NA 3EGXB 2K6GA 1KVRA 4F4HA 2X8BA 4ZYLA 1NM5C 3LNCA 2D0IA 4V1CI 1J8FA 4EENA 1ZC3A 1PKXA 1UMDB 3OC6A 3VSBA 1FZQA 4QL3A 4BUJA 5HOEA 3DQZA 2AC7A 4ML3A 4QPZA 3KQYA 4ZHSA 3OT4A 2RGXA 2WHPA 1IHYA 1VE6A 3UN1A 1Y63A 3WBBA 4TYNA 1O6GA 1NTOA 2DPLA 3O8NA 1ML3A 2OAP1 2ZP1A 3IOBA 1KK2A 1NNSA 1NQTA 1U1GA 2PX8A 3NKFA 4MI3A 1CERA 5CX1B 2IEAA 2OAEA 2PRIA 4CIBA 3CLRD 3AFMA 3T7RA 3HABA 1X13A 4Z0NA 2J41A 2NSHA 1TT7A 2I6UA 2EBFX 1ONOA 2BKVA 4R2IA 1P2BA 3DBIA 1QIGA 3NPAA 1I5RA 3JX9A 1I0ZA 2YNMA 4X91A 1QTNA 3P26A 4AJJA 3K09C 4D56A 1KI6B 1WPXA 1ZDMA 3EUEA 4FKBA 2GRAA 2GDJA 2C9YA 2QRNA 1NQAO 2WUGA 3D2CA 2W4QA 3L8GA 2VSXA 2P6OA 3BWVA 3CZ4A 3QFRA 5EUBA 1LBIA 3W5CA 3L7IA 2ZCJA 4JC8A 1F14A 3K4QA 3ITDA 4OBWA 4YRGA 3CRNA 3B1YA 2R6AA 4G9GA 2HNKA 2QW8A 3L6DA 4TTPA 4YAEA 2AC4A 2IU4A 2PH5A 1SVLA 2ZR9A 5I9SA 3RI3A 1G5TA 2NTNA 3ZDFA 1H0SA 1VSVA 3DVSX 3O93A 3UK2A 1UFQA 5K2MA 2BGTA 3C1TA 3CM0A 1XCPA 3DXFA 3ZX4A 2ACWA 5FAXA 3WAJA 2HREA 3WWOA 3V1LA 4BNMA 1D07A 3DCIA 1OZHA 1QAOA 2FN3A 2CJWB 3C2QA 4GR5A 4TN5A 3OEHD 4OMDA 4V3CA 2WW8A 1U7WA 3KOMA 2GVNA 1JSXA 1RJ9B 2E6KA 2PSEA 1FYEA 3GLVA 2J07A 2B61A 2ZZKA 2A1TS 4PTLA 5LUBA 2UUPA 4QUBA 5JD3A 5J4VA 1IBMB 4IDEA 2WICA 3BSFA 4LY0A 3ZOKA 1VLJA 4YB8A 4E7PA 4FD3A 3RUIA 2C8LA 4RGQA 1Q57A 5CU7A 4AWBA 1T4BA 3WY9A 4X7RA 1P72A 1U3WA 5EMMA 2QUAA 3ASUA 1SCUA 4JY7A 3HP1A 1ZD8A 3QX7A 1NR7A 4NMWA 3JYNA 3ZR4B 4YDQA 4IO0A 3IAUA 1V3UA 2JAOA 1LBTA 3JASA 3RHFA 1L4MA 3H8JA 3OF2A 1VBFA 2ANCA 4IHJA 1CQXA 2PZEA 5JO0A 3BL5A 2EF0A 2PD6A 4J76A 4OV6B 4EZBA 2QLFA 1TEXA 2XX3A 1QCZA 2GVZC 5DNEA 1SU8A 3LLCA 4QM6A 1B8NA 5EI5A 3RM3A 4JVLA 3EZ2A 2YCBA 3ADDA 1SZJG 1Q91A 2BEWA 2DUWA 3OE5A 2AXQA 1GCGA 2PR7A 3EH1A 3PRYA 1NVVR 2MCFA 2BLLA 2R3SA 5BSRA 3PKZA 1NYTA 1DAGA 1FRNA 2CGEA 2IPOA 3T5CA 3OPYI 4OJTA 1EFRA 2Q4BA 4MRNA 3IODA 2I2DA 5KO2A 5FUQA 2JW5A 2X2FA 4EEKA 2HPHA 1VDZA 4J1TC 4PANA 3F3SA 3E6AA 1LV8A 3KFXA 1AU9A 1YBHA 3KVNA 3OWXA 2DR0A 3UAYA 2B5WA 1GCIA 4WNIA 5DW0A 3HV0A 2CWDA 2IXTA 5ESXA 1VCNA 4LNAA 3EXAA 3R8XA 2K7FA 4L75A 2NT4A 4IXNA 4IILA 1IHXA 3BMNB 1SXJC 1EVJA 4YRCA 3HCOA 3QVVA 2CSUA 3F8WA 4HFMA 1UM9A 2XNCA 4ZQFA 1D6NA 1OJ7A 5TNXA 2GPNA 1M1NA 2XWJI 5IAEA 5C8DA 1O54A 1VCHA 3EUWA 3OT1A 4JOQA 1X1EA 4F5YA 3DR3A 3RS9A 1EK1A 1JFLA 4Y8VA 1C1DA 1P74A 2NZ8A 3LYLA 3JCZA 3IQZA 3EZ9A 4O29A 3RWMB 3ZCSA 2EHJA 2IU6A 3HEAA 2DPMA 3F5FA 2CDAA 4XWWA 4E2WA 2NXNA 2GQ0A 3U5ZB 3ZYCA 4FONA 1B93A 5ER9A 2Q7DA 1VL5A 1AF4A 4WPGA 3RVQA 4BLSA 5J47A 1SU4A 4RTMA 4QPDA 2HGSA 3R4CA 1B7GO 2ZBPA 5FUXA 1CLUA 1U9IC 3JW8A 2QG9A 3GCDA 3Q7QA 3KT8A 4P9NA 4K46A 5HA5A 5K4HA 2JIBA 1LDYA 1U1CA 4LHVA 2XDYA 1OY1A 5IRCD 1UOPA 2CXXA 1APBA 3I6BA 3J81A 5REQB 1KWKA 1EQ2A 4H6XA 2IPLA 1XMSA 4G1UC 4EB3A 3MINA 5DM70 5H8WA 3CKMA 4FGWA 1Z4PX 5B3LA 5BN1A 3LSTA 3FWYA 2QGFA 4MWEA 5C0OE 4L5BA 5JDCA 1G9SA 2P9QA 1EUDB 1QO7A 1GNPA 2DVMA 1DJQA 3AP3A 4HAYA 4PYNA 4M86A 2IIVA 1A27A 1V1MB 1OI4A 1SGWA 2BWJA 1Z0IA 2HAEA 4LZPA 4YXWA 3VPHA 1P33A 5J1SB 3IEMA 3CTMA 4LN1A 1MRZA 4Z2AA 5LMUB 2IUTA 1GRRA 1Y8RB 3E70C 2OM6A 4EX7A 1I4OA 4HDCA 1Q17A 4FB5A 3EWAA 2CCJA 1CWUA 2AF3C 5AUQA 1HLDA 2Q9CA 3DD1A 4A6EA 4BVHA 4HUQB 2ID9A 2YWCA 4M88A 2COKA 3D8TA 3T7CA 2JF0A 4YJKA 1R0CA 1AUVA 3PGMA 3T1VA 4E88A 1GZDA 4ZYYA 1CNMA 3IAM6 4OB7A 2QR2A 1KKMA 3E0QA 2PGXA 4L8LA 1E4YA 5DX8A 3OOJA 1FRZA 1J2TA 2FHSA 4Q3EA 5HW0A 2G08A 1ZISA 4EJ0A 3GPBA 4JVMA 1DQSA 4AXBA 4WLEA 3OSZA 8ADHA 2BBSA 2DYKA 3LC7O 1F2DA 5KTPA 4JLSA 3DUFA 4F04A 3L8MA 3EVNA 1GAQA 1PG0A 2EKDA 4AG3A 2O8FA 4MQMA 4BDTA 4ZCQA 5DBGA 4NI5A 3SIWA 3B70A 3ZKAA 2Q1YA 2XR1A 2VDWA 4JKOA 1DELA 4HNHA 2EQ5A 2J3IA 4KSBA 5EUQB 5BNTA 1U65A 1Z18A 4L0QA 4W6QA 4ZAWA 3HNOA 1E7MA 2KX7A 3DE0X 5TE9A 2PD4A 3FPFA 2QTAA 2GHQA 2IH4A 1YBMA 2HCJB 2MSEB 1DCMA 3PQCA 4E4YA 3FTPA 4F97A 5EAIA 5LMCA 3WDSA 3QIAA 1KORA 5KSOA 1RPJA 1JSLA 2OC4A 3DL7A 3QVUA 1FA9A 4LV8B 3FGZA 2AFIA 5DGXA 2LZ0A 3WGTA 4G26A 4UTPA 1C4XA 3DJYA 1L7AA 2Q5FA 2XVZA 4U1RA 5FCDA 2A5YB 3VJKA 5SYMA 4FU0A 4EDFA 2BEWB 1X3LA 4O4JF 3VPCA 5E0OA 4XWAA 4OHWA 4IIBA 1Y1PA 4OK6A 5BT8A 2GCNA 1FTQA 4LMAA 4V0NA 2G40A 1UQRA 2HGZA 4ZEOA 1NZJA 3DTVA 3DO6A 1GXSB 3B1ZA 1Y9DA 1QH1A 1R9NA 1EIWA 3MOIA 4YQFA 2I71A 2V3WA 5K3SA 2IBMA 5EHQA 4CFSA 5IXYA 3TLYA 4BU0A 5ALXA 1JEJA 1TA4A 2ODTX 3ND9A 3NAGA 1NW8A 4CJXA 2V58A 2W98A 2BGKA 3UXYA 4Z4FA 2AUTA 1SULA 3SQWA 3IT2A 4DVGA 5REQA 1QVWA 3O3CA 4JJ4A 3VNRA 1Y6QA 5FPSA 2E5LB 4OAQA 5CCDA 3M3PA 3CLRC 3OPYA 5A9SB 3GOQA 4LOAA 3M89A 2B8WA 2G8NA 2ZIZA 4DRXB 3BSYA 1MHTA 3U4MA 1G66A 2XE7A 1YZLA 4UMDA 2IY8A 2WJVA 2VATA 4OM7A 2O59A 4UCQA 2QL6A 4MIOA 2JD2A 2JGKA 1NN5A 2FPMA 4P98A 5EIBD 4JYAB 3OE7A 4L07A 4WBSA 1NDHA 1ORVA 2EDAA 2V6IA 1UMKA 3MMXA 4I9NA 4L28A 5J4LA 2R4QA 1WQ1R 3AKEA 5F1OA 3QVGA 4B7AA 4RTLA 4K9MA 3BZBA 3TNFA 5FEMA 4WY8A 2R8PA 3OIYA 3BKXA 4OLHA 1VL6A 4G07A 4DR6B 1P4HA 4P84A 3S2GA 2LXNA 1Y1TA 3E53A 4G84A 2JGAA 3KQUA 3QYJA 1XGKA 3AF5A 3PNQA 3X2SA 3OEYA 1EAMA 1YJAA 3NTRA 4HPJB 3KQLA 4NH0A 2H1HA 2WHXA 5BUZA 3PLAE 1E58A 3IVGA 3KKEA 3T7TA 4ZHQA 1WXDA 2EQBA 3CZPA 3OMLA 3F74A 2WM8A 1F60A 1OASA 4QASA 5HUQA 1XUOA 3HP7A 2ZSIA 2YINC 2J45A 5ED0A 1M0SA 4YWHA 1XHEA 2JGNA 4TT3A 2RBGA 2C98A 3FZNA 5M3BA 5FX2A 4BGVA 2G9QA 1H5QA 2VH1A 1D6SA 1GN8A 1V7PC 3WDKA 5EERA 3PCXA 1RZ3A 1AUQA 4F84A 4CM3A 3NEYA 4WZAB 2YOFA 5AM3A 4TMKA 3UY4A 1CSEE 4N3CA 3TW8B 5I5EA 1WXFA 1YA8A 4HWSA 5BSWA 3A6LA 1KO4A 1BMFD 3B9BA 5KAMA 4DFDA 5K05A 1L5MA 1RIFA 2VT7A 3CCCA 4WRRA 3UAXA 5CLIA 3YASA 3CXUA 4J8PA 5JY1A 4BVFA 4BNHA 2AVNA 3W5HA 2YHIB 2D7JA 1IZYA 3DE1X 2ALJA 3UYKA 1MAVA 1VPLA 2Q3BA 4MV6A 5IVIA 4E5MA 5IZ4A 1EJ0A 5G1PA 3UNXA 3ROMA 3MGCA 2HJWA 4I4LA 2VF2A 2E4YA 3D31A 3ESQA 3ZWAA 1XQVA 2BW0A 3TRDA 3L84A 2JFYA 1NN0A 4LBYA 3RFTA 3TLZA 3ZDRA 1H4VB 1RJ9A 4EYKA 4X60A 3NBQA 2DT8A 5F52A 3L0SA 4U2BA 1J9GA 3BH6A 1N9GA 1OWPA 3Q6NA 2PWAA 1HTTA 3PFKA 4F3YA 5E6UA 2BCJQ 2EGUA 1GEGA 3BF7A 4L3WA 3AR7A 4Y2RA 5BOSB 5KCMA 3PQFA 3QMMA 5JCOA 1ANKA 1JG4A 3G13A 2IHYA 5EMNA 1EGQA 3KTAA 5H1YA 2ZUTA 1BKDR 1XRRA 2EX1A 5FXMA 4NJOA 3QLEA 4NPCA 5ALSA 3KXLA 3T5TA 3VH3A 4O2AB 2FDXA 3VA7A 5EKDA 1Z63A 4YGXB 3EDYA 2NTEA 2X2OA 4RWZA 3EG9A 2MR6A 4D5EA 2GT1A 4IIVA 2HH9A 4IVRA 3RIGA 3H9EO 1WDWB 1KH3A 2QVCA 3LY5A 1RNLA 2DTEA 3MTIA 4Q3AA 4ER6A 5BP7A 4CLXA 4GMHA 5F3RA 5A05A 5K0SA 3LT5A 3RJMA 1L5NA 5B37A 1Y3IA 1E98A 1MC1A 3IEIA 4FYPA 4N5LA 4UTXA 3CNEA 4RYDA 4YUZA 5LZ9A 4DLVA 3SI7A 2E6UX 2J6IA 4ZI3A 5HJEA 1THTA 4LVCA 4TUYA 4NFSA 2KJQA 4BWFB 2A92A 3PDIB 1T1GA 1AXRA 1N5LA 1VYTA 1G20B 2YMQA 3T4EA 2IPNA 4L76A 2H0QA 2WM9B 2RKOA 4NARA 5IC4A 3VOTA 2QMHA 4HX2A 2IS6A 1NR1A 3BT7A 3JYLA 4U7DA 3GH3A 5ALEA 4GPZA 1MAHA 4OGKA 2IWRA 5K8TA 3RO7A 3F6RA 4B6JA 1SOWA 2FPUA 4V02A 4XEUA 2PKCA 2JANA 2QAGB 3JYPA 2PUEA 1QGYA 1FBNA 3TSAA 3R3SA 1K5DA 2FSVC 1G21B 1JU9A 1E3LA 2HHAA 5IHPA 1BMQA 2G71A 1YB7A 2ZSBA 1MPTA 3BRCA 3Q6MA 1D2MA 4TWBA 2QNIA 3RTGA 1K6XA 5SYAA 4CLOA 2ZPUA 3ZV7A 1RYDA 5F73A 3G0HA 3U48A 3I52A 5KVCA 2L2QA 1JLRA 3PEFA 3AI3A 5FBZA 4EP1A 3V1YA 2E4XA 1JA9A 1U28A 2Q4TA 4TXJA 3PVSA 4WBXC 4BZZA 4C0JA 4F6CA 2ORIA 3SLRA 2BFPA 3WWPA 1HFEL 1N1EA 2C2WA 3OJWA 4JP3A 3D8RA 5TPWB 2WWYA 1C8VB 1NLYA 2ET6A 2LRHA 3PLRA 1I32A 5HBGA 4BEJA 4C89A 3GN1A 2Q5EA 1OZGA 1U3CA 3V48A 1U63A 1GYQA 2OP1A 3LQYA 2YYZA 5G4KB 2ZIWB 2V8OA 4JJKA 2EJCA 2CEKA 5IPFA 2AR7A 2GEFA 1G20A 2HHLA 3EDCA 3H87A 4MQFA 2PIDA 2F9FA 3ESYA 4CQJA 5IJ9B 1JQ5A 4YRAA 5GZ1A 3L1KA 3H99A 3OZSA 3R3VA 3WLJA 1PFYA 3WJAA 1QPGA 5I4BA 2PD3A 2CFCA 2EBHX 3M5DA 1BJTA 4EMTA 1K4YA 2P8JA 3HRHA 3MWYW 4R69A 4ZOAA 3F7OA 1TVMA 4RHFA 5F35A 8AT1A 3G9UA 4Y6SA 2PUCA 4FIDA 4GX5A 3O8OB 3AILA 5AM4A 3ACCA 2RGNA 3HNRA 1UDRA 4LRYA 5F4ZA 3LF2A 1QTQA 2FE4A 5ECGC 1GPYA 1Q0TA 2B37A 4E30A 3RBXA 5KTSA 2CW5A 4ZD6A 2VHCA 4MTCA 4OQPA 4A8JA 4CGYA 3E27A 3FNIA 2CUZA 2HSGA 5FHQA 2W42A 3VR5H 2ZQYA 3DEIA 3HU3A 4IYJA 5ALIA 1EVIA 4EH1A 3KLNA 3ORYA 3EGEA 4A15A 3BCRA 3FPKA 2ZCVA 4ZI7B 2ZR8A 1G8HA 4DT1A 2PLRA 1E5LA 3OLXA 3F9IA 3KOOA 3OQ6A 2WJZB 3C39A 4FJ2A 4FWTA 4O8ZA 4D4LA 1HDIA 4CTNA 2WUVA 3QKUA 4TTJA 2J5BA 4JT9A 3HMKA 5DYGA 1AJEA 1W75A 2VUSA 2Y1XA 4HWOA 4AZTA 4DRZA 3CG0A 3N8IA 4JP5A 1GZSA 5IH7A 2G0AA 3L4JA 1JDJA 1PS0A 1K1EA 3AR9A 4FS8A 3F71A 2G9ZA 3EW7A 3ONVA 3OZ7A 1Z33A 2Z08A 3OURA 1E96A 1TUBB 2J9FA 1TLFA 4Q7KA 4BQSA 1WPQA 5J2UB 2L17A 5FI5A 5H4GA 4B4OA 4WY5A 5DGTA 3OZBA 5AMXA 2QN6A 1ECCA 2H5EA 5KJFA 3M4NA 1GDTA 3HM9A 3DQQA 1OB5A 2ZT6A 4LXUA 1A2KC 1AB6A 4XYGA 5KMGB 3EXIA 1M7HA 3DYBA 2V03A 1NMSA 4ZRDA 1N2CB 2CBZA 5FPPA 3ZNNA 1Q3TA 1NBHA 2H48A 2W2PA 2X0DA 4RJ2A 2JH9A 3TX2A 3MLEA 3LHKA 4YHBA 1NMEA 4MXDA 1JBQA 1AGXA 3ZWVA 2R1UA 4XUCA 4AY3A 1TXGA 2NUPB 4YUYA 1CY7A 3EEFA 4EQZA 1QHSA 3RVSA 5PNTA 3ZY5A 3DKIA 5TLSA 2OUKA 2QNBA 4RTSA 1HY3A 3FUVA 3O9VA 3VOBA 5BUCA 5K6AA 3TUZC 3S40A 1YQXA 3NHRA 4C2UA 1P19A 4FR5A 1OLSB 2R8YA 4KACA 1S8NA 3SEFA 5LP6F 2ZB8A 1LTHR 3P0FA 5SY9A 3WZLA 5E3HA 2Q6VA 4D44A 5EE5B 1MO6A 3TR5A 4C5AA 1PR6A 1YDHA 4MLDA 4NBNA 4TTIA 4CGZA 3HSYA 5ELLA 5ADUS 1BRTA 2HSZA 2WMNB 3HVJA 3NFRA 2F64A 3LGXA 4LFBB 3V4OA 3VDMA 1H2RS 2NPFA 5EZ6B 5B4UA 4F3TA 1P0CA 1W87A 4FNOA 2G88A 5DB4A 2GN9A 5AKZA 5TMEA 4D4IA 1P1CA 1S02A 2WAAA 4G5FA 1BMFA 5EUCA 1KH2A 3DCYA 4C04A 2ZBRA 1LRLA 3FW1A 2QY9A 1F1JA 1RQ2A 5EIFA 4AULA 4EY4A 1RWNA 1IY9A 2H52A 1NNEA 1CUVA 3OCCA 2P2NA 4YCLA 1I2AA 4O2RA 1ZH8A 2O2YA 1F9EA 3DZDA 4OBBA 2BRUC 3DDCA 3IDAA 4LA4A 1ESMA 2DE0X 2R7AA 3U3JA 5K5EA 4D3XA 2W8ZA 1RLJA 1U7XA 1DU4A 2HJGA 3KHTA 1E1CA 1RBQA 5CCBA 2NT3A 4BKRA 4DQDA 5DHPA 1I4WA 1L5ZA 4A16A 4EO7A 4UQPA 3ECAA 5DULA 4URXR 4MROA 2MINA 2AG8A 3NJ8A 2WP8J 2DWQA 4Q9IA 3ZIAD 1UAAA 1PEAA 3L5OA 1PUIA 2FVYA 1K3TA 2XTJA 3T34A 2ZFUA 1I7QB 2RGGA 3O31A 4N5MA 4ZVKA 4HR7A 1NVGA 3VKFA 4OGGA 4JQCA 2JJ2A 2X8AA 4NECA 1TT5B 3M5PA 1YB6A 2XECA 1Q19A 3KV3O 5LP6B 4DG9A 1M2HA 4IIDA 3OOYA 1BGXT 1VYVA 4ENWA 3GGCA 4REOA 2GAFA 1LK7A 4V2IA 3FN4A 3MPUA 2C5LA 4JXXA 3NLLA 2DSNA 5CK5A 4YRZA 3EBOA 1VBKA 3KPVA 3FF1A 3LUDA 4YXFA 1WCIA 1P62B 5GONF 1YJBA 4JJGA 3JSAA 3W2TA 1N7HA 5JDIA 4GGOA 1G4HA 4BGUA 5HX7A 1KJZA 3IVRA 5GJWC 1HYQA 4D5GA 4WX2B 4O1IA 2X14A 5D7BA 3PT9A 2CV0A 5FWYA 3FSGD 3VYRB 3RAJA 3NIBA 2B4KA 4KMSA 1IAVA 3RRZA 1CHDA 2Q1XA 3BMOA 3JZAA 3TM5A 2VDWB 1HMYA 4IIJF 4AJEA 3P9PA 3PTLA 1Z0UA 1ZVKA 2JI6A 2XMSA 3CLSC 1KEVA 2HK8A 4FIZA 1C3JA 1XEXB 3KXIA 1MX1A 1GQFA 1VLQA 3G7UA 3TBKA 3A1EA 1N8NA 3LZDA 4XLLA 4NENB 4EUHA 5WRFA 1P9RA 5IUNC 2G25A 1RE1A 2BH9A 2UVPA 1IEQA 2D2VA 2EZ4A 2RHBA 1Z56C 5JLAA 5L53A 3NNNA 3C8UA 4ZZ2A 4L4YA 4BPBA 5IULC 4EMUA 2ZW9A 4HZGA 4YRIA 4BLRA 2OBMA 1RTKA 2XZDA 1ZI9A 3LECA 1J0XO 1EB9A 2V5UA 2GJ9A 3LVRE 3OA0A 4QUEA 5HIIA 3B6KA 4R2HA 1XLWA 4HYQA 2F43B 1PG2A 5JUWA 4ZDWA 2XGSA 3LHFA 3LCUA 5KHOC 3MOGA 4Z4IA 4JN6B 5LR6A 3UXMA 4D42A 4PZUA 3MTEA 3A6JA 2Y1GA 4N48A 4H7FA 3BMXA 4YRLA 2ODQA 4UBMA 3NC0C 2WD8A 3HNPA 4AJHA 1USWA 3O9ZA 2Q3CA 2CBXA 3SC4A 1Q7BA 1PS8A 1KQFA 3AU8A 3CUSA 1LQ2A 3I83A 2WB4A 1G6OA 4ND7A 3W90A 2IKSA 4QQKA 5LA6F 2RK3A 1V4VA 1R6AA 3WNVA 3VAAA 1TX4B 3RK4A 4W9MC 2A9VA 3DOIA 1V1JA 4JQSA 4LJSA 5EYPB 3BXGA 4P8RA 1Q0PA 1DAIA 1UKEA 5I9TA 4QOJA 1WKCA 4Q3OA 3V80A 4WFIA 1ZBQA 3NOXA 5LZ5A 5LVAA 1TCUA 1FTYA 5BWMA 3O47A 4RJIA 1YL7A 1ZWLA 4DCPA 2QRMA 3S1AA 4P4GA 1AVTA 3N59A 2X77A 2RGBA 1F2UA 5FAKA 2BD0A 2Z6UA 1GQYA 4IHKA 2GJKA 5JAQA 2G83A 3EGIA 1E7SA 2AJ8A 2OD9A 4YJFB 2XB8A 5DU2A 1MB2A 1NL3A 2DFDA 1NE7A 5DCUA 4EKNB 4R9VA 1LJLA 4YRPA 2QL9A 4WA7A 5TR9A 4AU1A 2RI1A 4LV6A 2NU7B 2OZPA 4J90A 3QHQA 1T3TA 1Z7EA 3DTVB 3SQXA 2Z4RA 1U02A 2CJYA 3EIQA 4PRKA 3ZEIA 4BV9A 4DWWA 5KTOA 5IKEA 2I2XB 3UMRA 2ZATA 1NVEA 1SXQA 2ZWAA 1GPH1 1QG4A 3ONEA 2C7GA 2LPMA 3ZHXA 1Y6GA 4E08A 1GITA 3DWIA 1Z4JA 2ISCA 1J97A 3D8SA 1PFQA 3EC7A 3FCCA 2GYYA 3ID6C 3KT3A 3VTAA 1HL3A 5E4FA 3D64A 1WTAA 3WFIA 3HXTA 3SP1A 5LYYA 3T9CA 1FRFS 3U4DA 4NBTA 1MA3A 4S1NA 4JFRA 1UBUS 4EG5A 4IEIA 5KYWA 1SUDA 5DFAA 1C3VA 5FNVB 2FWMX 1EFPA 1XCOA 4G4GA 5FO0A 4MVJI 2HV8A 4W63A 1BGWA 3K92A 3SDBA 3HFRA 3GLIB 3HV2A 2QE6A 3EODA 3HWX1 2FK7A 1THGA 4DY4A 4EMBA 4ZXPA 1SVMA 4KKVA 4DZRA 4RVCA 3TOVA 3LBAA 4FHDA 3PICA 3IPYA 4BO2A 3R7WB 1FIUA 3BFKA 1PR2A 1CETA 4TKVA 5HJ5A 5BNIA 1RMYA 3A4VA 1D4OA 1OBHA 3ICQB 4CN8A 3D43A 3MQ4A 1N57A 1XTKA 3UMFA 4B83A 4R05A 5HMMA 4K7JA 3RLIA 2C5BA 3A1WA 3CTPA 5KQGA 3F67A 4DJTA 4FYVA 4Y6PA 1Q0LA 5DLDA 2X23A 3AM3A 3IH5A 3UB2A 3AM4A 2QVYX 4XH9B 1T4MA 2VWHA 3MT0A 5C8YA 4QWWA 4A2QA 2BSQA 2HSJA 2FFHA 3BN3A 4LMPA 3CR3C 1B1AA 1Q3KA 1LQTA 4OFWA 2QI9F 5EHNA 3E35A 1OF1A 4ZC1A 3D4PA 3QEAZ 2PHZA 3ANYB 4YRKA 2ZI5A 5F5XA 3NV9A 4G5HA 3EZYA 3TTSA 3W5JA 4ZTUB 1CQZA 1NBEA 2C4VA 3NHPA 1G7TA 2CLIB 1ZITA 2G70A 2BGLA 1RD4A 3GJXC 4GC5A 4U6SA 4D82A 4S1TA 4CMIB 3W1VA 5C31A 1LBEA 5IBCA 3K1AB 3JTEA 4Y1GA 1YL6A 1V1MA 3MJFA 1F2UB 1BXRB 4UTOA 3WOVA 4AZVA 1EKXA 3I6YA 4B2IA 4BQIA 3AF6A 3U4QB 2PUFA 3P1JA 4R7GA 2QW0X 4MGKR 3A1DA 5EGSA 1LDGA 5A3QA 4XOIA 2BM0A 2FZ4A 4FW8A 3T9AA 1K86A 2Q27A 1AZLA 4OA8A 1IY2A 5KOJA 1E2BA 4D81A 2GASA 3NT5A 5EMJA 5AP9A 5ALYA 4XFJA 4GQIA 4FKZA 3PX2A 3UJPA 3PV0A 1E9RA 1DVRA 2WSMA 4G25A 5J5VA 3WLRA 1SZDA 2CVFA 1NJ8A 2PA0A 4TMFA 3WIEA 1ZIYA 5H3HA 1AKQA 1QGUB 2Q6IA 1XZFA 2OOSA 3UT5B 1W73A 2ZBQA 2XGJA 1OXUA 4HDSA 4LQCA 3KX2A 5ESWA 1PL8A 1T9BA 3K0CA 1KZ7B 3CVUA 2V59A 1E2QA 1FU4A 4OI1A 3VH4A 2VAPA 5EIBC 5FLYA 1OPXA 2P27A 3QPCA 1M6VA 3MHTA 4P7BA 3GCZA 3QA3E 4PC7A 1Z17A 4PX5A 5DM4A 5C80A 1ZG3A 3OKFA 2R6HA 1YCHA 1D7OA 5ELMA 4JS0A 5JOQA 2XB4A 4XSGA 3SHFA 2RK6A 1EWVA 3AKDA 5GJVC 4GOKA 1WXWA 4LS3A 1C0LA 4YACA 3K73O 5ENVA 4ZGBA 1IJKA 2FN4A 3G2MA 5GVRA 1MAWA 3DW1X 1FXUA 1K08A 5F33A 1KAEA 4FWIB 3ZCVA 5HCIA 1XE3A 4B0OA 1FU7A 4DMLA 5B3KA 4KYIB 1R6UA 4PBRA 1FMLA 5KQSA 5JWRA 5CEFA 4ENUA 3N7AA 4KQXA 2JLQA 1SQGA 3BIXA 3NYQA 3WP1B 2I34A 4HDRB 2RGWA 3TAUA 1YU9A 4OFXA 4NYMQ 3AI2A 3OQIA 1KEKA 4RK1A 3C41J 2PGNA 1JQDA 2WSBA 3I53A 1KZHA 4U9HS 3W5DA 3NI2A 4HJRA 1CP3A 4G5SA 2WKSA 3VDNB 4EFDA 2YXNA 4YHHB 2FFQA 3CKLA 2JLYA 3AH8A 4F60A 3FWNA 1ZOIA 1O9GA 1KO8A 4AX4A 3THRA 2FPKA 1YNOA 3R0JA 4Q1BA 2EBWA 3FAKA 3OWHA 4HKTA 1GGHA 1XTJA 3ZDYB 1KP3A 3ZCTA 1QRDA 4HMOA 2WSLA 3EGVA 5KPJA 1K8RA 2ZROA 5C46F 1NW4A 1YSCA 1MX5A 1UBHS 1TL7C 2OHHA 1Y4DE 2YZ7A 3BERA 4N12A 4YS6A 4DBLC 4QZVA 2QD1A 1DBQA 3KD3A 4LF8B 4D6YA 3BTSA 3E1SA 1PJZA 3NJRA 1CVIA 3OHPA 3TLCA 3U4QA 1SQFA 1NJ6A 2BZGA 1XRSB 2H9AA 2ZJ7A 4L95C 3H1FA 3O3NB 4RHTA 4PO3X 4FZ3A 1U7OA 4OOEA 3RF6A 1DARA 2P0AA 1G17A 3DR5A 2EDCA 3H19A 2V6BA 3QPVA 3FCXA 4ARBA 2VJMA 1YRBA 1L4BA 5GM1A 3VRHA 2VSOA 2DJIA 2HRQA 2Y68A 3ESCA 1JJFA 3KV1A 4G36A 3VNAA 1WQ4A 1LSUA 2HMSA 4H16A 3E22B 3RU7A 3NVKI 2QBYA 3TW0A 1V2GA 3UOGA 5CVJA 4AP5A 3I3OA 4RY8A 4L73A 2ZRBA 5BYJA 2R6GA 3OQJA 4BRWA 4L4RA 2BFFB 2DQSA 1KAQA 1TW2A 1E0SA 2WI8A 1J39A 2OCIA 1B15A 3DG9A 3G9ZA 3KUKA 3EUFA 1NJ5A 2SHKA 3JQEA 5EESA 3SMQA 4RZIA 4XI9A 4BLVA 3O4FA 2VHYA 4PXSA 1OBOA 1UOOA 2F8LA 3A4MA 2WUWE 3KKOA 5LDGA 1RBYA 5EXEA 2VHWA 4EVRA 5KUTA 1IEVA 2ZIXA 5JYBA 1XAGA 1RYHA 4OI2A 1VL2A 3DBVO 2DFNA 3TGPA 3QVTA 1A0OA 3GYGA 2VBIA 2H54A 3FWHA 5FADA 2GBPA 4ZYUA 1K7XB 4A6DA 3UC9A 2HU2A 2NLOA 1T9AA 1NUHA 3G0OA 1KTVA 2HXYA 2SBTA 5EXSA 2CHFA 3ME5A 1NVDA 2BMJA 2GLTA 4TV8F 1D9XA 4JLWA 4LHXA 3FVTA 4KXXA 3T1QA 2VNAA 2BHRA 2BVNA 2ZDQA 1GTVA 4CR7A 3UCFA 5ED4A 2XGGA 2FPRA 3CEPB 5EKTA 2KW5A 4PM4A 1NJGA 3HXPA 1KQGA 2PUTA 1HA3A 4OJNA 1HKUA 1DC3A 2FW1A 4QTXA 3OQOA 1XCGB 2FUCA 1EGMB 5EZSA 3AVPA 4O4HA 2YQZA 5LBUA 4ITVA 4KU4A 1BX1A 3AEZA 1C9MA 1UC4B 4P31A 4M7PA 1W8IA 1Z26A 2B7CA 1JDUA 2OHOA 4PAWA 3LFHA 3IOEA 1JXOA 1BE1A 4A7PA 3LX5A 3B78A 1ONBA 2H2GA 4DVJA 4KPUA 1K6EA 1J1ZA 4YUWA 2IGBA 3OBIA 5AUOB 3MJEA 1A04A 1KSHA 2HO4A 3PVCA 3S2UA 4K6MA 3DBHB 3A4NA 5C5IA 2OXRA 3NYIA 1Q6YA 1KRWA 1C3OB 3QVKA 1FFCA 1KR5A 3IIKA 2ATIA 2QUHA 4O2AF 2A1UB 1S2DA 1M2KA 4M9RA 4OHVA 4QJBA 3FJYA 3LCJA 3O4GA 4RF2A 1Z74A 4MI9A 1KQ3A 1GFIA 2Z56A 1GDDA 4G01B 4U9UA 3CCBA 1H2XA 3F73A 1H0HA 3ROXA 3RT1A 4QVIA 3E81A 4HPWA 3CHYA 5HRAA 2OEPA 2VPZA 2X4LA 1U1FA 4U7FA 1MQAA 4L4UA 5E9AA 3PK0A 1NRIA 4HS4A 4ZMSA 1E6WA 3FMGA 4Q3DA 1EP3B 4PSCA 1R0YA 1BE0A 1RLIA 1GQ2A 1DRWA 3IFSA 3NQ41 3HJRA 4L5YA 4O0MA 5GGXA 4NXNB 4W8OA 5CYOA 4ZCIA 1NXVA 2YWHA 3WGGA 4RA9B 2WQZA 3WIDA 4UVDA 2RDMA 5A4AA 5DTJA 2JFGA 4EW1A 5MN6A 3E8XA 1V3QE 2ODNA 3LF1A 2O0HA 4GOOD 1HWYA 4XWGA 1PRYA 5BXQC 5HM6A 1JLHA 1Z4LA 2WPNA 3AWDA 2NTYC 3H1TA 4QQNA 4MKIA 2FSPA 1E8NA 1WCV1 4TMZA 3TSOA 4F2WA 4DB4A 1GRCA 2HJ9A 3NDIA 3S29A 5JH7A 5D6OA 2BIFA 4UD2A 2ODEA 5JCJD 3EAQA 3PWZA 3RSZA 1XEWY 1PT6A 2VO1A 1JMVA 5IDXA 1PUXA 2PT6A 2GUWA 1KK0A 2OD7A 4FFRA 4UUMA 5KYUB 2JIMA 2Y0CA 4NFHA 2C5AA 2Z8XA 1BFKA 4IMJB 3C6QA 2I5PO 3HJHA 1G5FA 3L5KA 3AEQB 3VMMA 2ZIFA 3QOYA 2ZJ8A 1Q1ZA 4M0FA 2RH8A 3EQ6A 3DOCA 2C58A 3NONA 2WHYA 4IOLA 5EXPA 4CF7A 1UL1X 4CKBA 1WHTA 3ETGA 4O1HA 1P4SA 1ZGHA 1DO0A 4TWRA 4EY7A 2BE9A 1KU6A 1K7SN 3AEXA 4H1VA 1JDZA 2GF2A 4HDNA 2IBSA 4KCGA 4ONEA 3FTFA 2QI9C 3MCAA 5HJ7A 3EIHA 3A27A 2OCXA 2P7HA 2UZ3A 3C3PA 5GONA 3HDHA 3OF5A 1EFUA 5G4KA 4D0GA 5D3KA 2YDXA 4ZCMA 5A1JA 2IDJA 2OUIA 5LQJA 3DEJA 4U4AA 2PK3A 3EXG2 4QYXA 2F3QA 2GZDA 3IXMA 4H17A 3FHLA 4HWTA 5IJWA 5EXXA 1QK3A 3VVMA 2JVJA 1TAGA 2CL7X 4FQ7A 3EISA 4RTOA 3NALA 4LIPD 4JWKA 5KNBH 1NZFA 1CKEA 1TO2E 3ENWA 1SVNA 1Z6ZA 4JOSA 5SV2A 1JEEA 2A3NA 1A1SA 2J9XB 4FCWA 4Z4EA 5HM8A 3PEUA 5THXA 2HCFA 2SCUA 4WDQA 3KJHA 5U4QA 4HDQB 3T5BA 1BWRA 2Z95A 3C4VA 3SM3A 3PNMA 2HA5A 1K6IA 1C3LA 3UUWA 2XDQA 1E2EA 2Q0HA 3QEJA 3OE1A 3VR3A 4DMKA 3TSCA 4CEIB 5T64A 2WIDA 4ZA2A 1Z3CA 1E20A 1NY6A 4HAWA 4A5OA 3GIWA 1BIFA 2R68A 2CYBA 5KINB 3O21A 2J7PA 2GEJA 3U3RA 3WBKA 4F93B 2AZ4A 4D2IA 4BECA 1AK9A 4YXWD 3O2JA 2NUAA 4RELA 1VMDA 5ECYA 4GRIA 5EJAA 1U6JA 1XQ1A 1ZM9A 1DTWA 2QTCA 2OFWA 2ZB7A 3JR7A 4IS3A 3REFA 3AUTA 4CVNA 2F3UA 4WOJA 5CFPA 4IDOA 5DI3B 4DDWA 2BDTA 3EULA 5K0TA 1MH9A 3F6EX 2C4WA 1V25A 2NZ2A 3IKVA 4U63A 1K98A 3E61A 4FMDF 3JD1A 4Q02A 1XNGA 4W5RA 3O6VA 1TAUA 5FA6A 1EVZA 3UG7A 2Z9DA 4ZANA 1VFNA 3MRXA 3JRXA 4PBSA 4R98A 4I6GA 4Y2JA 3VHRA 3W77A 4EI8A 4A27A 4HVCA 4ILKA 4YC7A 4OQYA 1CUEA 1S0UA 4R1MA 3ED1A 1CEYA 2FPIB 2D2FA 3AY7A 3PC2A 4HB0A 3C98A 3FCYA 3LT4A 1YO6A 3W79A 1JQLB 4OXNA 5CVCA 1RI2A 3OPQA 2NU6A 4LQ4A 4FCCA 3ZTWA 1JXMA 4C4ZA 1WF3A 4TWZA 4CW7A 5AJXA 5IJ9A 1PZXA 3VSCA 3JSXA 4UPDA 2WTNA 2KBEA 4GDFA 2BM9A 3VNSA 4Q05A 3IS3A 3M49A 4N03A 2ZSFA 3WIBA 3IJPA 2AVDA 5AW5A 1QJCA 2HZBA 2J3JA 4LI0A 3U7QA 3EXHB 5AW6A 2H2DA 1P0PA 3Q9NA 5CM8B 3WB2A 3LKZA 1ST2A 3RYTC 3LHDA 4B7UA 1ONNA 1U90A 1X9HA 1JALA 2X6QA 3OY7A 4BL5A 1ESNA 1M7BA 3LLUA 3EA0A 4MV8A 4UW9A 1JJBA 3LY7A 2IRWA 1UPUA 4DIBA 3R9XA 3CUWA 5JW6A 1FVXA 2I4TA 1GLVA 2B99A 2FWPA 4IWXA 5AK5A 5E3IA 1ZXLA 2J6HA 2YMMA 5KU7A 5F98A 1D0SA 4KYTA 2YZ2A 1Z38A 3U1BA 2JFZA 4FINA 1ILWA 3OA2A 4G5GA 2WD7B 4MUXA 2HBYA 4B17A 1ZNZA 1JMKC 2G7ZA 4TS1A 1VJDA 1L7BA 1TQ6A 2X3FA 1T8UA 4RK6A 1JLMA 1NPYA 1TFUA 1MABA 1WKBA 2KB0A 4RVFA 5DW3A 3TK1A 2OORA 4EITA 4UU0A 1ZQ1A 1EHIA 4HQRA 2BFDA 1G21A 2Y77A 3D7KA 4WHMA 1REQA 3EXEB 5DVZA 3DL2A 4D3ZA 3CEMA 4Q66C 5JASA 2QVLA 3JQAB 2A6PA 4MQ4A 3QBEA 1XZEA 4N39A 2ZYGA 2JB9A 2XSZD 3EK2A 4KIJA 5AJYA 3U61B 2WAOA 1S4QA 1D9ZA 2R79A 4XQCA 5EZYF 5IM5A 3ZQUA 3PP8A 2ISSD 2MR5A 4I50B 4WOCA 1R0SA 2J9FB 2CNNA 3D81A 1U2SA 3D0QA 3FNEA 2LP4Y 4ZVVA 5I7VA 4LJ8A 3JQ7B 5F76A 4N0MA 3RVRA 4AYWA 4BJHB 2JGDB 4NABA 1EM8A 3CV3A 3U7FB 2GJAA 3CISA 2WDPA 2YQ5A 4QAJA 2I66A 2IH5A 1E2LA 2GK6A 3F5MA 2HFKA 3DUFB 4IH1A 4OXXA 4HWKA 4RLHA 5EXDA 5B1SA 5L3SA 1ZVVA 4BRUA 2YVQA 1TMKA 3OCVA 1EUYA 4IM7A 3WGVA 4MLPA 1WXGA 1R1DA 2FWIA 3S5UA 4X8MA 4A0RA 4WK6A 1GLGA 3G1WA 2DBQA 2XWQA 4JYMA 2BBOA 1QH0A 4PRZA 5FLEX 4KE9A 2RAFA 5CW1A 4ZCLA 3OQ1A 2Z0MA 2Z58A 3E3LA 5IF3A 3SFVA 3BIFA 5ITZB 2H0RA 4X5OA 2ECOA 3C3XA 2E0IA 4QOHA 2P1ZA 3KO8A 3A9SA 4GSKA 4PBTA 5TB5A 2AT1A 3G7NA 3PR3A 4X1IA 1PJCA 4EF4A 1IQ0A 4J2TA 2HF8A 3SIPA 1NFFA 3A26A 2GZHA 1YONA 3C15C 1QHGA 4DANA 1CFJA 4W1PA 1LVUA 5DYWA 5HKAA 4H9GA 3I5YA 4U2CA 1BH2A 1EFVB 4BXOA 2WWRA 1QIMA 1L5KA 1RXIA 1T9GR 1G8SA 1SCDA 3FCUB 4FLFA 4P7KA 5C34B 4DDUA 1NLZA 4ID3A 3F6YA 2YX1A 4FWBA 4E2XA 3FDFA 5T4EA 1YB4A 3DCJA 3STYA 1Z28A 3BEOA 3USCS 3TLGA 1QGUA 4MIYA 2ADMA 3PFBA 4J0IA 3PENA 1KVQA 2R1ZA 4L9RA 4KLAA 1RWVA 2HMVA 1UKYA 1EK0A 1YE3A 3N6VA 3V1KA 3WQHA 9ATCA 4J3FA 1Z34A 2W7TA 3RJTA 1PJRA 3QU4A 1AUPA 5DHSA 1NMQA 1QH1B 2O07A 5KCZA 3QF4A 3V3TA 3W2FA 4BQRA 2GH1A 2GM5A 3AJDA 2O23A 3BB3A 2AC2A 3L8EA 3MOSA 2WIJA 4IV5A 3BCUA 5CPFA 4B4WA 4RAOA 3GLGE 3EFHA 3BILA 4KYUA 3THWB 2ZWMA 2H4ZA 1XG5A 1L8OA 3MBKA 1JR3A 1RHQA 2YOHA 4NX2A 3CE6A 2QQEA 1UP6A 2IVZA 2ZT7A 3LSYA 3RUEA 1H6DA 2TMDA 3F6SA 3KYCA 1XYGA 5KNDH 1X2BA 4HGNA 5HDQA 5EE9A 1V8DA 3AWIA 1ZEJA 4GHWA 4GWGA 4BZPA 1KFEB 1Z4NA 1M34E 2QDXA 4C03A 1FW8A 2QU8A 2XMDA 3ADPA 3QY0A 1P29A 2QZ9A 3TBFA 3L7DA 2QLLA 1V7QA 4HATA 3CLKA 3SF0A 3VHQA 4ZN6A 3JQPA 1TVKB 2L42A 2LWIA 3GD5A 4JBYA 4Q39A 2ARKA 2G09A 1LDNA 4UAUA 5IDQA 5FUMA 2QTHA 2W2XA 3NS7A 1TTQB 5CB8A 1QFXA 2RC5A 2VUUA 3QVGB 3CPJB 5CLFA 3DLPX 3OT5A 1YBAA 3JAMA 2QT0A 2PLFA 4N5HX 1D8TA 4UJ5A 5G0UA 2AMYA 1ZZEA 1LPPA 1CUUA 4JGBA 1XP5A 3QXHA 1EDBA 3VH1A 1RQGA 1LLDA 4R5MA 1M6VB 5DYYA 1CJUC 3SZOA 4XVRA 3A14A 4C0KA 2J9YB 3LFTA 4XYBA 5GMOA 2ID4A 4QOIA 1JLSA 2XEDA 4RXMA 2P8SA 2GZ2A 2HC9A 1ZRHA 2XB9A 4IKOA 4RY0A 5IUKC 3TCXB 5FNVA 4EUEA 2B1QA 4DJ5X 2P78A 1AXGA 1T8WA 2HMAA 4M1YA 3U9TA 4E09A 5IMSA 4Q4JA 5HKBA 1GNTA 2WDZA 5I4IA 1P61B 1BCRB 5AKEA 1EP2B 1N9KA 3G5LA 3OZCA 1R18A 4ZOLF 5G0WA 1GTL1 4QVKA 3T35A 1ISGA 3NETA 3AFGA 4UVEA 4F4UA 4RMGA 1GU0A 3IJ5A 4DSNA 2EZ8A 4L3OA 5B4VA 1V1RA 2N42A 2UZ4A 3K6SA 4I9UA 2EW2A 2QLJA 1QNLA 4FNGA 1O95A 1K8ZB 4L51A 4LDRA 2GMWA 3FPCA 5BV8A 3OQMA 1UADA 3I5XA 2WJIA 1VE7A 3VPXA 1NQVA 1XTSA 5C8YB 1W25A 1I3MA 2XE8A 4HG2A 5KI6A 3VVLA 1M54A 1EUCB 2ENWA 4DOMA 3HO6A 3RNLA 1KMMA 1OA0A 5KSZA 1YJXA 2GZAA 3H2KA 3Q10A 4CODB 1B73A 4EPTA 2VAVA 1I4EB 5JAZA 1EK2A 1HQCA 3BTOA 4UULA 3W3AA 2OFOA 1C80A 3QE2A 1DE0A 3WGMA 1G6Q1 2DLNA 4JDUA 4DWJA 5B55A 3GP8A 5JVDA 1H5UA 4ARZB 4KMMA 4CV0A 1LBHA 1EHCA 1E60A 3AONB 4KRGA 4N40A 1S9HA 1YC5A 3FZGA 4KQWA 3W1WA 2XH8A 4PYLA 3UK0A 2IS2A 1CY6A 2O1WA 3A25A 1WUYA 2X4IA 3LVBA 4GXRA 3KYBA 4US0R 3LDFA 2ZT5A 1N2SA 2Q2WA 5KOJB 1UWCA 4M0EA 2JGIA 4MEBA 1TYZA 4HNUA 3ETCA 1MRSA 1T6YA 3GD7A 5K0LA 1KARA 4EQ6B 2E9SA 2AFIE 2ETVA 5EEHA 4RW0A 1KJNA 1O97D 3OLQA 4C30A 6YASA 3L9WA 2XTZA 4ZOEA 1DZIA 1KFBB 2GBLC 3OPMA 1EZZA 1LWOA 4N0QA 3UBMA 2Y2UA 3D8HA 1JEYA 3IMGA 5A02A 4FP9A 2X8JA 2AWOA 2C94A 4MUJA 1ZW1A 7MDHA 4K6OA 4X85A 1WR8A 3GLRA 4FFBB 4LHSA 4AJ2A 3QMVA 4N8SA 1K2WA 3SSNA 1G1AA 2HK9A 4CF4A 3DC2A 4XD7A 1GZ6A 4YJ3B 2G63A 4FD2A 4QD3A 4PYJA 4CIWA 2H29A 4BJ3A 4LHYA 3ZU5A 3SZLA 3HDYA 3KR9A 1FDIA 2Y6VA 2QRPA 1MOPA 3NOQA 5DBIA 4E12A 2VEOA 2ZIAA 3KVVA 3H4IA 2C8KA 5A03A 3THWA 2RHJA 2ZPAA 3SLGA 2VRCA 1IWPB 1HM5A 3TI7A 3G9TA 2IYPA 2B35A 1F17A 1DBPA 1O87A 1QZ3A 4Y2XA 3M2TA 3N74A 4Q4HA 4EA7A 1UOEA 3LBFA 1FYFA 1NURA 1RTTA 1YS7A 1U94A 3A05A 3V8RA 3C6ZA 3LA6A 3LBIA 4MVJH 1ENOA 4Q0MA 3QHAA 2V65A 4JMLA 3U3MA 2VP0A 2ZJ1A 2CE2X 4RTQA 3KVRA 2E5FA 4XDYA 1RQXA 5EFOA 5KTMA 3WI7A 4KSYA 1N2CE 3RK0A 4CCYA 5BVGA 4OXKA 2BFMA 2ZUFA 5IYZB 1E1KA 2AEEA 2ZI4A 4DA6A 3AR8A 1K4KA 3V9PA 1E9CA 4JXKA 4GYWA 1FXSA 1XZJA 2ERCA 4MQ5A 1NC1A 2VBGA 4PGHA 2YBDA 3SBDA 4M9QA 4DIEA 3TZLA 3JWEA 3R3XA 3Q3CA 2KE5A 1R6DA 2ZRQA 4BKMA 4XAQA 2Z3VA 3M9XA 4ZVNA 4QGAA 3C24A 2ZE8A 4K8RB 1E9DA 1SBNE 1SEVA 2BTOA 4P4UA 4NE2A 5AW3A 1OD6A 1X87A 3B1WA 4CG1A 3OT1B 3O4JA 3OY2A 3JQCA 4P5DA 2WK1A 5BO5A 2XUPA 3KYIB 3AY0A 4DILA 1BQ4A 1XZMA 3T7JA 3FGOA 1QH8A 3GJ8A 3KSMA 4BNFA 1YULA 2O2CA 4ERNA 1XN4A 3ISJA 4UVHA 1PQUA 1C8LA 2FW8A 3FFBA 4JLNA 4XSVA 2VL7A 4R1OA 2IEDA 3BB4A 4JFAA 1TK2A 2EFYA 3OH8A 3AL2A 1NP3A 2AG1A 4FDAA 2HU5A 1G5QA 3QMPA 1M75A 2J3KA 2FJPA 4MWZA 3WO0A 1RCTE 4WK0B 4RZUA 4GP7A 1AA9A 5C9ZA 3O0DA 4U6NA 1XMJA 4MDFA 1IM2A 1NXSA 1SUSA 4B44A 2XOXA 4AKGA 3GRYA 1Y8CA 4UASA 1JEOA 1T5LA 4FFNA 1NBME 2ONYA 2QD5A 2QM0A 2VYQA 3H04A 4GOJA 2FKAA 2QXYA 1ORHA 2AR0A 1VHJA 2WNSA 3GFQA 4AVYA 4AYTA 5GADl 1QR6A 2ZRDA 3PHLA 4FDUA 2GN6A 2VUTA 3AY3A 2VK4A 3PQDA 3HGMA 5F2KA 4Z1OA 5JD6A 5JTUA 1EK6A 4O02B 2JCBA 4PGGA 3S27A 4CN9A 5ITVA 1ZJ4A 3TG2A 1E3DA 3GUHA 4AMGA 3I1YA 3N7TA 1GVHA 4IJQA 3RE1A 2OGTA 4BO7A 3EZ7A 5JYCA 2JFQA 2QMZA 4JHLA 4J0QA 2YMLA 2WSSD 3OIDA 3ZK8A 4B3TB 3W2IA 1BJKA 4ED9A 3EHEA 3GRUA 5LB4A 3EE6A 2ZS8A 4JLUA 1JECA 1VGRA 3IV9A 4W1QA 3U81A 2CLCX 3I9JA 2CLLB 4RZXA 3DEYX 3MBIA 4MJ3A 4WCFB 1I7SB 4I4IA 5B3JA 1K5PA 2GN4A 3AXTA 3ETJA 2ZI3A 1GQOA 4ZRMA 2J85A 1RYEA 1A8HA 2AD5A 3CONA 1H69A 3VR4D 3ZWKA 2DHDA 2PNJA 1PNRA 4Z1MA 1RXUA 2OV8A 2PQ2A 4MJLA 5E8RA 4FVTA 1KRXA 1KERA 4ND4A 1YJ5A 3SSMA 4TLLB 2RGAA 3GGJA 3GRFA 1I2MA 2P6MA 2PL9A 3DOHA 3HBMA 3DBRA 3VTFA 2RHWA 1M6WA 4LDNA 1LKZA 2EWMA 1KI4A 3Q72A 1SA0B 4RM2A 2ZQ5A 4TROA 5D2CA 3WDMA 3D7MA 1P1RA 4LCBA 4FFLA 3FMIA 1CXZA 2EQAA 4U7PB 3KJZA 1J0AA 2UXDB 1L7XA 1LDMA 4AXXA 3F8SA 1H2YA 3DE3X 4DG8A 2RHCA 2H6EA 2QJRA 2WHRA 5DNYB 3UGJA 3UUGA 1NDQA 2IELA 3DTNA 1Z7GA 3QZUA 5CVUA 2P4UA 2AYXA 4RY2A 4Z9FA 1MV8A 3CJQA 4NSNA 4W99A 3KKQA 4FJ1A 3UCXA 2Z3ZA 4Q9HA 3DV9A 2H1FA 4W5HA 5DMXA 4EAAA 3JATB 1EHYA 1K5HA 3BE6A 4M1SA 1YZKA 4H2DA 1T0PA 2Q07A 5TQ0A 3SBOA 2OBYA 2ORWA 4LAFA 1P1KA 1L5OA 4QQFA 1E1RA 4RKFA 1S7CA 3O91A 2P9BA 2BELA 1RC0A 2AN1A 2O2SA 1NHGA 3DHVA 1VKHA 4URHA 5IANA 3S68A 5DE3A 1VMKA 3JU3A 2QRVB 2YH2A 3CEHA 1D6JA 5ALPA 3KZNA 3GT7A 3O83A 1Z7WA 1KI6A 5KTNA 1CBUA 1N4DA 2PO7A 1P75A 3LP8A 3SAJA 3TRJA 4I6JA 4LYGA 1BEZA 3CPSA 3G59A 1GARA 4NBKA 4F7DA 1AGNA 5GV8A 1DO2A 5CDFE 5IN4A 3V8MA 3NT2A 2QS9A 3C3MA 1JYEA 2OGSA 1XEAA 3ZXYA 5D6NA 2APJA 4EFNA 5ICCA 2YCLA 3SZMA 2VYFA 1GR1A 3TXXA 1WXEA 2YW9A 3VO8A 2GBLA 3PVZA 5JBNA 1KZ4A 2P9CA 1UBMS 2E4WA 3LO5A 4OQDA 3O7MA 4LECA 3QKRA 5GIPE 2NM0A 4KC0A 3K0AB 4JJ6A 1U1EA 2Q50A 3DV0A 4KBFA 1XAHA 1P9NA 4MB0A 3GW8A 4NBUA 3TSZA 4U7TB 2MMGA 1AQNA 3HYCA 1N5DA 1OBFO 2AMVA 3Q0TA 4G0PA 1ZSNA 4IQ0A 3I2IA 1H1LA 2FZWA 3RTAA 1VFPA 1SU7A 1YZTA 4BNDB 2JDID 1NFQA 2DU8A 1IG3A 2ST1A 3FHJA 3T4XA 2BFBB 1QIDA 5BPHA 3E9NA 1DO8A 3BWCA 3KTOA 1HQKA 2YJ3A 1R6TA 3KUCA 4AZ3B 1UBKS 2AI3A 3GAAA 4PFJA 3URKA 4ZZ3A 3IQHX 2D5IA 2DKFA 3DD5A 3TGLA 2QZJA 4IHJB 1G64A 3PGXA 3MIIA 1CR4A 5AK6A 4DCTA 4F1WA 2AW3A 3U60B 4BRSA 4OUDB 1U3VA 1Y6ZA 3U7QB 1NSYA 3WJ2A 1AM4D 4R84A 2PUVA 2YN0A 3AR3A 3QLUA 1PSWA 2BMWA 4R8SA 2QYOA 1CUJA 1QLJA 3OEEA 5ISMA 2JJ1D 1T2EA 3M6WA 4NCNA 1XDSA 2NTVA 3PSHA 1JR6A 4WK2B 4GH5A 3O8RA 2CNLA 2ZYVX 4G4IA 3ICCA 1H4TA 3VX4A 5HEKA 4HWPA 2IH2A 4R83A 1DQPA 4BC0A 4QE3A 3E7PA 3SSAA 2I8CA 5AVTA 1EDEA 2NO4A 3BPSA 3S55A 1DHTA 5BY2A 4OY3A 4AN4A 5A3VA 2FN8A 1Q0QA 1R0KA 1Z2PX 1FDTA 4MO2A 4I3HA 4HYYA 4JYBA 1P1HA 3MBOA 1W88A 4KVZA 2WYWA 4D96A 2ECFA 1D5CA 3WGZA 4JI4B 3EOAI 1YI0A 4R6WA 3KQQA 1T5SA 5E6SB 2CXRA 1V5WA 3NATA 3G0BA 5A9RA 3L01A 4HZUA 3UHFA 1I36A 2BFNA 3WYDA 3E5RA 3Q4GA 3NH6A 3RU9A 5K9ZA 1M66A 5LYJB 1QX4A 2ID8A 1VRCA 3IAHA 3O8QB 2C54A 1PDVA 2RHHA 5FR2A 2C5EA 2Z6VA 5I9MA 2CF5A 4EYQA 5BRJA 1E1QA 5HQ3A 5JNLA 1RPZA 1WNTA 5HIMA 5IKMA 1QQ6A 1C7RA 1Z6PA 4H7JA 4OP3A 3MJDA 3ZY2A 5LBIA 2DFKB 1TU4A 3M2PA 1F6WA 2FUKA 4V03A 1G5RA 2XGOA 1M0TA 2PT9A 2ZVPX 4EJSB 1U2DC 2WZQA 2DH5A 3FYUB 4NK5A 3ZY3A 3J7TA 4HXGA 1NVBA