3LHFA

The crystal structure of a serine recombinase from sulfolobus solfataricus to 2.3a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
136
Chain Sequence
RKVILYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEEVCKAHGCEIVVINKEEELVEDLVSILVSFSGKLYGMRSHKYEKVKKCVEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine Recombinase
publication title The Crystal Structure of a Serine Recombinase from Sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Recombination
total genus 45
structure length 136
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhfA01
2RSLA 5C31A 4BQQA 3G13A 2GM5A 3UJ3X 5C32A 1HX7A 3ILXA 2R0QC 3LHKA 1ZR4A 1GDTA 5C34B 3GUVA 2GM4A 1GHTA 3PKZA 3LHFA 1ZR2A 2MHCA 5C35A 3BVPA
chains in the Genus database with same CATH superfamily
4LF6B 1XKTA 1QV9A 1W2WB 2DHCA 4WGFA 3HFSA 5ILGA 4GVXA 2ZJ6A 1W5AA 1DU4A 1KP9A 4J4BA 3W5UA 1C1DB 2JATA 5A5VA 4BNKA 4XYEA 2GXSA 1ESDA 3H83A 5M5BA 2F1JA 4B9AA 4D4JA 4M49A 2A8YA 5F78A 3TEFA 4CFSA 4EWLA 3VVLA 3T3OA 1UJBA 2ZFUA 1U2SA 2B61A 2PH5A 3AKEA 4UFOA 5JJCA 1BVRA 5G0SA 1HC7A 2GMWA 1KMHA 3QUTA 5EYPA 3RLFA 3N2IA 1MJGM 4GMGA 2C03A 1CE8A 4MCAA 8MHTA 1IE3A 3PQ6A 1V7PC 2QT9A 3LL7A 2ACVA 5BNZA 4E5KA 3OZUA 4U9UA 1KOFA 1P2UA 3M4XA 1TU0A 4DKJA 1THGA 2Q0HA 1EA5A 3DB1A 3PQ4A 1JQJC 3SNHA 1N2IA 4BLWA 1G21E 2QGZA 4FDVA 4FGSA 3GW8A 1R8JA 2ZRDA 5DLQC 1Z7YA 5LXTB 5MN6A 3K0SA 1YFJA 4RZSA 3FKSA 1Y33E 2VUSA 1DG9A 3W34A 2X8JB 3I42A 1AGNA 1U0SY 3MB5A 4DVGA 4M1OA 3GUUA 3MRTA 4MPRA 3RK1A 1LC3A 1QHNA 1SZPA 1E9CA 2D00A 2OO5C 2JEOA 2VPQA 2COKA 4UNQA 5LMUB 4J16A 3HB9A 1G21A 1ETHA 2AG1A 4GI3A 4GIBA 3WA7A 4TTRA 3GV0A 1MB3A 2XHZA 4NULA 4Y2YA 1VIAA 4ZEVA 1UINA 1UMCB 3WL4A 2I4OA 4O59O 3GCDA 4HV4A 1W85B 5H9WA 4C43A 3QSGA 2ZSKA 3OT5A 1PN3A 5DHAA 4BU1A 2HRBA 4DWJA 3Q7QA 5IBRA 1QP4A 4W63A 2G06A 2NPOA 2CMDA 3I83A 4OFBA 4D80A 2PT7A 4BX8A 1WZUA 1Z0ZA 3BF7A 1R27A 4KIUA 1NR5A 4KQ9A 2JASA 4MA4A 4ALNA 1GGFA 4DQLA 1HX7A 4WLUA 1C9NA 1Q3HA 1QAMA 2H17A 1II8B 2ZXEA 3FSGA 1YQWA 3UAVA 4RA9B 4DA0A 4PRLA 4MS1A 3QUSA 3EIFA 1KEEB 5IBQA 3OU2A 1L7AA 1JWAB 1TYDE 1X7XA 5ERXA 4ZDWA 2V55B 4AJIA 1E2KA 1EWRA 4ENSA 5DYWA 4IQ4A 4C29A 2BTEA 5HZGA 1B3RA 3KETA 3HU2A 1Y6ZA 1WULS 5A05A 4IDEA 4DLSA 4Q3KA 4KX3A 1SXQA 3G2OA 5DXFA 1TFUA 4CQLB 2JJ2A 3EBOA 3COJA 1J2YA 1XZBA 3GNTA 1ST3A 4ESEA 2Q1UA 4L3VA 2C82A 2XNKA 2OZPA 4AZ0A 1M1YA 3KHKA 4ZTZB 4D3DA 2ZIUB 4JEMA 2Q4BA 3KIPA 4ER0A 5E1OA 5DH9A 5EN4A 1O6CA 4L78A 4MDFA 2OV4A 3NWEA 4H3HB 4X62B 2QRVA 1HLPA 1R0YA 3B7WA 3MCTA 4Q3LA 3T1VA 5KKCA 1W581 4BNDA 3UA4A 4K87A 1L8XA 4EARA 1I94B 3ZHXA 4EG6A 2FLWA 1IY1A 1IY8A 1S8OA 4EYOA 4E31A 2P7HA 4MIOA 1W76A 3EXIA 3LRTA 2W6MA 2H4YA 1P80A 2W0MA 1PQWA 2WSMA 1IG3A 3L6DA 3EGDB 4G37A 4ARAA 1YIOA 4R54A 3UHPA 3GDGA 1MX3A 3GRYA 3ZV5A 4Z49A 2WQ7A 1W4ZA 5LL6P 1N1MA 4LMRA 3FMGA 1DTWA 3AVQA 1LSSA 3SX2A 3WLJA 2YWRA 4WN9B 1TUBB 1E99A 2ASEA 3PNVA 1VKJA 3DE0X 5DM4A 1K6EA 3AF3A 3MT9A 1FLVA 4BVLA 4AWAA 4YAJA 4E07A 4KFUA 1HE5A 1LPAB 4DV1B 4XX0B 3QLUA 4F4DA 5GVSA 1P0CA 3FCEA 4PNPA 3ZHTA 2JFYA 3N3BC 4FD2A 2ZTMA 3SFTA 1BXZA 1QO7A 1E2IA 2G4LA 1W4BA 2IPNA 1N2CB 4ZANA 4OKIA 3RWMB 4CM8A 2VXBA 4X1OA 3MINB 1XA3A 1A9TA 2EYQA 3Q85A 1I30A 3T35A 1J90A 5C52B 4UMVA 2LRHA 2P75A 1KJZA 3GFBA 4JVNA 3ZGNA 5L7TA 4KQEA 5K0FA 3W7VA 1RJDA 1V1JA 2GM9A 3IDAA 3H05A 4NLLA 4O2LA 2PL1A 3KLBA 4Z0TA 4BV2A 4TKVA 5DXJA 2WUWE 5GY7A 4LF7B 4LKRA 3JRNA 1ZW6A 3FDJA 4KWEA 5FBZA 5JD3A 1SIUA 3QVXA 3ED5A 4A8JC 3H1EA 3OPYA 1JFTA 2JLBA 2VJNA 2PS1A 4C7OA 4MRVA 3OHSX 4HX9A 3NIWA 4HB2A 3F67A 1I2ZA 2QEQA 3W4JA 4E1BA 4C5BA 2Z2KA 3HU3A 2ETXA 4KBYA 2FP4B 3ROKA 1BD4A 2JKYA 1SVMA 1DEHA 2ZJFA 2Z4TA 4BWFB 3SKVA 5B3JC 3RU7A 1T6XA 4Y6PA 4X1IA 4LJSA 1B23P 1BROA 1TC1A 4GPTA 4R7TA 4EH1A 4PPFA 4CEHA 2X9LA 1K89A 3QFCA 3V1UA 2AG8A 1CVRA 3R8CA 4DCOA 4YDHB 3IAHA 3ROFA 3UUGA 1NYLA 2IU4A 2ZSHA 2H5JA 3NTQA 4EPTA 1ONOA 3CSUA 4FT2A 4JODA 5L3RA 2WIKA 3LGSA 3JQ7A 4PG4A 1D03A 4EB0A 4HCJA 2ZRQA 2O0LA 4Q9IA 5E9JA 5LQSA 4YV7A 1S3SA 2Z4SA 4JOQA 1NLZA 3ODPA 1QQ5A 1O0BA 2IP4A 3AJ9A 5KU7A 2FW8A 4Q7KA 5IUNC 1SR8A 1FFXB 4CI9A 3BORA 1E20A 3HDTA 5AI0A 2QLTA 3T0GA 3DLIA 2PKYX 3RT1A 4ZGGA 2PO5A 1ZGBA 4CIXA 1PT5A 2E87A 5I45A 1LDGA 2JVKA 5FPSA 4GBJA 2L19A 3G8CA 3TOCA 1JHPA 3WGHA 3AR2A 2AXEA 4N8DA 1E94E 5F23A 1AGRA 2O5VA 1ZA1A 4ZVNA 2NU8A 4HVTA 1Z0KA 3D2BA 5AVTA 5KC9A 2WJIA 2AC4A 1MGPA 2AR0A 3HCEA 3UENA 1WBJB 1JHQA 2C9ZA 1LLFA 2D1TA 3WP1B 3WHIA 2ID9A 2Q3DA 1MH9A 1TD1A 3UW3A 3GUHA 4K81B 5CVCA 1XMVA 1JPNA 3OIVA 4MVJG 4ZAFA 2W70A 4C0QC 1GKIA 2I3GA 3V7WA 3BXGA 3D6TB 2AI3A 3PHIA 2YX1A 4NZNA 1E2BA 2NO5A 1K63A 2WMYA 1HMPA 4JU8A 3AFGA 1MC1A 4OCZA 5K3FB 1G42A 2QN6A 2IEGA 4Z6KA 1EIWA 1FRNA 4QO8A 2YXEA 2K7FA 1NMSA 1Z8NA 1OC2A 3SZRA 4CQMB 1K2WA 4XB1A 1JQDA 2B36A 1QZUA 4A23A 5L4LA 4JHXA 1Y6GA 1OHHD 4Y2SA 4EY7A 1CIJA 1EFRD 2CCGA 4LDNA 5GONF 5FNVB 3D4IA 3NPAA 2FETA 4M0UA 3L4BA 3W1EA 3QVVA 4IIXA 3SKXA 4KPUB 1WU8A 1YULA 3TEJA 4BBAA 3R9IA 1KBOA 1G7SA 5DMXA 5B58T 1Y81A 4BNFA 4B09A 5KNBD 3IILA 1ZOIA 2EATA 1SY7A 4N4AA 3BSFA 3RHTA 3HKBA 2FN7A 4RF5A 3V7FA 3K70B 2ONYA 3E3LA 2OVFA 4CR6A 1NFRA 3HE3A 4MUMA 2PKQP 2Q2NA 4OP2A 2ZWVA 3L1VA 1JFVA 1NMEA 3LG2A 4KIJA 5JW6A 2DP4E 4F12A 4WEOA 2JCBA 1M34E 2OP0A 4EJSB 3UV7A 1XIVA 2OYSA 3QBJA 3VH4A 1Y1KE 4GNRA 1M3SA 4Z7NB 3RAEC 3BULA 2P5SA 1VHJA 1TZKA 2CN1A 2YZNA 5AKXA 4QECA 1HE2A 1OPXA 4HAIA 5J4KA 4NECA 3WA6A 3ZLTA 2BFDA 1OFUA 3JYHA 3AB8A 2PGDA 2WLSA 1I14A 3FDZB 3HACA 3OX3A 3PXCX 4UTOA 3CSSA 5B5SA 3BK2A 5KNBH 4BNNA 3HC7A 2CYBA 2ZULA 4BNTA 2ONZA 2GUWA 2PCJA 2MMGA 2W2LA 3PQ8A 1KRHA 4ZC8A 2YNMC 3FG9A 4NDNE 1S0UA 2JH9A 1E9VA 3OOEA 3B60A 1Z4JA 1VE6A 2PSHA 4PBSA 1P19A 2CF6A 2X4IA 1ILWA 3I28A 3K2QA 4MJXA 4OAQA 3CM0A 1JXMA 1E5TA 4QXPA 5CX4A 4YMSA 4ZEOA 1A72A 2C78A 2PANA 2DWQA 3AHGA 4UAJA 1G7RA 1VJGA 1M6WA 3IA2A 2ZU0C 1L4HA 2XDWA 3FAKA 4ZQCB 1TEZA 1X9IA 1NU6A 5BUSA 1ND5A 3Q7SA 2C9YA 4NICA 3ASUA 4G09A 4B44A 1XE3A 1KWKA 2QXYA 3KUCA 1SXJA 4BGIA 2GZAA 4URHA 3B2NA 1XL0A 5AOVA 1EINA 1LNSA 5KHOC 3ABOB 1E32A 2YC2C 3I9JA 4Q7EA 2XRMA 1BS2A 5AI5A 3P0HA 1Q2XA 4CHGA 3PNQA 5AW4A 4PHTA 2HEIA 2REOA 2ZJ4A 5CJPA 2AI2A 2ZJ0A 1WP4A 2ID7A 3T3HA 3AERA 3QSYA 5BPHA 2ZREA 3HXMA 5IUJC 4A0FA 4ZYWA 4WACA 4BNUA 5T6BA 2JA2A 2F9MA 1WEKA 1G3UA 4Y2RA 1CZNA 2Y6VA 4FWIB 2NO4A 3B38A 1XPOA 1QH8B 2CJPA 3E9CA 1SB9A 1UKBA 5K0EA 4UC0A 2I80A 1LRJA 1WW3A 2G82A 2WJAA 4EMBA 3UWKA 2YWBA 3B8HA 4Q1EA 5DNDA 1J0EA 1YACA 3MWFA 4G8DA 1RJ9B 4OI0A 2DWCA 2Q3CA 5DGDA 1A7JA 3E5NA 3GMTA 1IULA 5NULA 1OUMA 4EGJA 2EKLA 5H3LA 3L77A 3G7SA 1PYDA 4U6QA 4Q05A 4QPCA 4NAVA 1XVIA 1T2VA 2JLCA 4WFJA 4YQFA 4JHLA 3K70C 3OOYA 3WLOA 1GCAA 1G8JA 2ORYA 2WU8A 1Z22A 3KVNA 5JNWA 3O90A 2YUTA 3UFXA 3BFVA 4I9HA 4HLUA 4QYXA 1HDXA 2R68A 2FFRA 3P45A 1KI2A 2FMXA 4C22A 2HSGA 3R8XA 5A0FA 4AMGA 5BN3A 5EERA 3M81A 3GCGA 1W93A 3SMVA 1G8FA 2Z3WA 2O8EB 4LX8A 4JVLA 3AVVA 1B8UA 2J59A 1K98A 5JFTA 3HJFA 2IYSA 3H11A 3B6ZA 1NVUQ 3VO9A 1NBWB 4B3TB 3OI7A 1AGPA 4LNUB 1KFEB 4CN8A 2JFZA 3GGJA 4C7MA 5DW0A 5BY2A 3IKVA 3RAFC 1CF4A 4HSEA 5J9FA 1E1RD 1CJCA 2H65A 2H6EA 2CHFA 1H0HA 4NCJA 4UBIA 4EM6A 5ARBA 5KYGA 4JSTA 3TOZA 4DWWA 1T3LA 1RJEA 4CG1A 4OFXA 1STOA 3GGSA 3U19A 3LQRA 3HNOA 3OQIA 1U7XA 2CZCA 2ZJ1A 1V2HE 1PR2A 3FZNA 4EATA 2QDXA 3U4QA 3PX3A 1OSNA 2FFJA 3FNEA 2W2KB 2J87A 1M2KA 4FZ5A 3AUKA 1IUPA 3ANMA 3C4QA 3L6EA 4A2WA 3N39C 4TMZA 5IJXA 1Q0SA 4MRMA 1KR5A 3M5CA 3A7EA 1WKVA 2PEZA 3EC1A 3LKZA 5ILOA 2DKNA 3M2PA 5C1DA 1AMUA 5IFKA 2FW7A 1R4ZA 1QYWA 1C50A 1Y0BA 5EKSA 3T3PB 4QTUB 2J7PA 1Z38A 4KP7A 1VSUA 2Q1XA 1CY4A 1K5PA 3WB0A 4AN0A 3HABA 4BZPA 2QD2A 3IDOA 4G01B 3IQIX 2C2XA 3KFLA 1YDHA 4JOBA 3WQSB 5JDIC 5IS2A 2GF2A 1M0SA 4LJAA 1BW9B 1GTVA 5BSKA 3EFEA 1SOUA 1NMXA 2PSDA 2QWXA 3H9CA 3Q1KA 4JT2A 3TSWA 3VH3A 2D0DA 2OXRA 4Z5XA 1E9FA 2PBFA 2BUCA 4UVEA 5L3SA 1NVFA 1QQ7A 4NZZA 3EG9A 3KOUA 1Q0UA 2NYAA 3JZDA 4PGMA 3VR5A 2IXAA 1DZIA 2Y1EA 2Q3BA 4WADA 4RA6A 1FXWF 4YUAA 1T1JA 2GB4A 1D1SA 4KACA 2FOLA 2FSVA 2PRKA 3A27A 3U0BA 1TIKA 2X2PA 1BQEA 3V8BA 1RPNA 2LCIA 3AB3A 3JQCA 1RI2A 1YV9A 4JLBA 4IH1A 9ATCA 4IS3A 4NBNA 1A77A 4MAFA 2XT9A 2AN4A 2WPDD 5DYIA 2YQ5A 4OTZA 3E9RA 3HV2A 3JXEA 2HK9A 3W79A 3G2LA 2WMDA 1KI6B 2W6OA 4A2QA 3I6ZA 2JLAA 3SIRA 2PAFA 2XIJA 4LF4B 1JEJA 1M76A 3RRXA 4OP3A 1NXXA 3JPYA 3OZBA 1FVFA 5JJLA 1ZIOA 2SCUB 4LBWA 5I9MA 4A8HA 4N6GA 4P3XA 3L8HA 3HTXA 2G63A 3G17A 3G2MA 3GFTA 5HA5A 1JHUA 3H5IA 4GBGA 3TSAA 1A98A 2JZOA 1KVUA 3K0AB 4EPWA 4Z4HA 3IV9A 3AKZA 1JILA 3MT8A 4BDTA 2FSFA 1Q3KA 5DBHX 4YCSA 1DV2A 3WGIA 1OKKD 1R64A 1E60A 2O5RA 3C7TA 3QEOA 5LMNB 4Y2VA 3ANXA 3ZD7A 1R5NA 1ZVMA 3FHLA 2ISQA 1E3IA 3ENNA 3H7IA 3PGLA 1HDCA 3NWPA 2KS6A 3FUUA 3VDNB 1PR3A 2RFLA 2FVYA 1DAFA 1PJSA 1U7HA 4LHSA 1V5GA 3TGWA 1ND6A 2OBXA 2R751 2XNDA 2ZIXA 1FSGA 2PBRA 2WD9A 2EX4A 3PBKA 4I1PA 1IXSB 4B7AA 4AQ7A 3KUUA 3ZX4A 3KTAB 3BXPA 2CDNA 3KEFA 3QU2A 5A3QA 2HV9A 3KQWA 4L5YA 1G55A 2BMEA 3U37A 3SBOA 3E8SA 1KZHA 4P34A 1II9A 1KY5A 1P91A 4MW0A 4BGEA 1NJ2A 3FYTA 3VI3B 3STTA 3R6TA 2ILTA 4V3BA 3THSA 4BWGA 3CKKA 2NSLA 3JRXA 5HZHA 5HKOA 1I8TA 2ZXFA 4P82A 4ADSG 4RPIA 5E4FA 2X3YA 3Q3GE 2VH1A 4CCYB 3V1TC 1PJ2A 1U3FA 1KAQA 4PICA 1XVAA 5K51A 4BNVA 2CUTA 1YGPA 5DTQA 1VMKA 4ZEWA 4K5QA 3AI7A 1LRLA 4UCWA 2VOEA 4DG5A 5B3AA 4XJSA 1J8DA 1LW7A 4H7PA 2GM5A 2ZUFA 3K5HA 3RS0A 1DDGA 1JTEA 3KEMA 2OV6A 2WWWA 3IMCA 1JMKC 4KYIB 3TNDA 3WSVA 5C32A 1PHPA 2Z6QA 1G63A 1Y7LA 2NSJA 1L1FA 1W4LA 4GNKA 2P0AA 1T9DA 5EJEA 4FEEA 1O96A 4TV9F 4RV5A 1XTPA 3VHLB 1DEKA 2YV2A 4MW6A 4LPKA 1SHKA 1Z4QA 4REOA 4OU4A 4KRFA 1T8YA 4URUR 2OWDA 3RUIA 3VYVA 1P31A 5AVUA 1FF9A 1DOAA 1X92A 1X19A 2G3YA 3DQPA 4PGAA 3FNBA 4MJLA 2N1MA 3FXAA 4JGGA 4KQGA 1OASA 1QU3A 1Q7EA 4AKGA 1HFWA 1SBQA 3SC6A 1ZI8A 3NTLA 5PGMA 3C7AA 4NPHA 4PV7A 1IMOA 1CR2A 3DO8A 1Z6ZA 2HIGA 4R01A 5IAOA 3DEKA 2CD7A 3GJ6A 4CGZA 5AK5A 2V3WA 1U99A 5JWRA 3K8ZA 4ITUA 4C3ZA 3BIOA 2HA7A 1SCUA 3C2QA 2J09A 3KKPA 3LTEA 5A7HA 4C6TB 5HUQA 1RHRA 4TYNA 2AK3A 2G8NA 2Q3FA 4JAVC 4RSGA 4WLOA 2OCBA 5EPEA 5EJ8A 1XELA 3JQAB 1PL8A 3PHCA 4V03A 2D1QA 4NYJR 3ZIUA 3FPJA 1XWFA 2D59A 4AY4A 4BUZA 4RKQA 4EJ2A 5HJ2A 5JYDA 2J9XB 2WG1A 3GBSA 3HA5A 4S0XA 3L6CA 4FBGA 5IXYA 4ZCPA 5I7FA 3A1SA 3QFRA 1JDNA 4ENPA 4YJKA 2A5DA 2BD0A 3OX2A 1PVDA 4PX9A 3II6X 3OJLA 3AI3A 5IKPA 2VTKA 2BR3A 3D0KA 3IT3A 4PYKA 3R4CA 4UHEA 3RS5A 3SG0A 4F5ZA 3EGXA 1GGJA 1H1LA 1ZK2A 1PG2A 5CDUA 1NTRA 1XQ6A 2P6NA 1D6SA 3L92A 3WJAA 2XMSA 3RQSA 1V16B 4DWOA 4UD6A 4EMTA 4MKXA 4O4IA 1V96A 4FSXA 5J5AA 1RSZA 2C88A 3R3YA 1QH1B 3KKMA 4EG1A 2AGVA 3ZQUA 4JJAA 4D3ZA 4FONA 3VNAA 3AUTA 2V7UA 5KNCD 1IVNA 3L0DA 2GF0A 4X7MA 3KSMA 1CRZA 1G6OA 1F48A 1BFKA 1WY7A 2PSEA 3JQ8B 4JS0A 4RETA 4ZI2A 1VG1A 4KVZA 1FYEA 4HNUA 4AFNA 3TWOA 3PA6A 4P1ZA 4QTYA 2AF4C 2OGSA 3PUZA 4P98A 1AMOA 3KFXA 1RZRD 4ISBA 3HA2A 3WI7A 5FBRB 4C3OB 1JPJA 2UYOA 5KVSA 3U6KA 1QNLA 3JU3A 1ZVQA 4YJFA 2WJ4A 4RKEA 3V46A 1FNBA 2OV1A 2X15A 3ZWWA 3NALA 3KOYA 5ESWA 3JQAD 1HRDA 1JKFA 1DCFA 2AVNA 2GK4A 1JHOA 2L17A 5ITZA 3FN4A 1NYRA 4Z0NA 1E2GA 3G89A 4M0DA 5KNCH 1JXQA 2IUYA 1P9NA 5FEMA 3VVBA 1AA9A 4KWCA 2IYWA 2JFNA 1KXJA 3L5KA 1HQYE 2RH8A 1OLUB 2H1LA 3QMPA 4QVGA 5IYZF 4YXFA 4JLNA 2ZBFA 1TZBA 4JH0A 4QNRA 3N8KA 5IWAB 3RIXA 2IHTA 3T7IA 3DTVD 5ITWA 4S05A 4WJKB 2C1EA 2HB6A 1L4KA 4YQZA 1TT5A 4DCVA 1PKXA 2ORED 2ZRHA 3P9YA 2HCTA 1V4NA 3LP5A 4ARCA 4KLNA 1JAXA 3KKKA 1NOIA 3OE1A 3B2EA 1MW9X 1TJYA 2C04A 4JKYA 4MKRA 1RHMA 4IHJB 1EDZA 1F7VA 2FPLA 4LW8A 4F4JA 3R0QA 5ADWA 3L01A 3NDJA 4EW6A 1KEZA 3NO4A 3JQ6A 5BWLA 2R5NA 1FQKA 2X0IA 4NYMR 4Y9TA 4TL7A 4P0TA 1EUCB 3H2BA 4ZYYA 2HI0A 3G2JA 5KOJA 1II0A 2YZ2A 1FVHA 1E69A 1SC9A 1EB8A 1JS1X 2GJ9A 2RI1A 3G3EA 5GZ6A 4FNAA 3AHHA 1CQPA 3QXSA 2GHRA 3NORA 1W34A 1H6AA 1LSOA 3FCCA 3KZ1E 3LXRA 3T34A 3VC1A 4XKJA 2R5FA 3VR3D 5EWMB 1P61B 4LOIA 1AN9A 1W29A 2EGGA 2P30A 4E22A 5F4BA 4R81A 3AIKA 4YFYA 4TLMB 1PVVA 2G71A 2CXPA 4R8LA 4OQMA 1E3LA 3JQ9C 1E62A 1WHSA 2TMDA 4XUEA 4PONA 2I8AA 4M2LA 2X5NA 1OD6A 3EDCA 2BKVA 5A5EA 5ER9A 3PE3A 4OYYA 3HVHA 2VNIA 4IZIA 4MVXA 5I8WA 2QSZA 1GPJA 4KVFA 2ZPAA 1JLLA 2VDJA 2XECA 4XQEA 4OX9B 1P5ZB 5AKJA 2IIBA 5HQ3B 5B6PA 3FPEA 1Z0FA 1KVSA 4TSFA 5JZMA 4NBRA 4B85A 4PLVA 3KHSA 2Z8YM 1WD7A 4AMBA 2H11A 5FFNA 4IFEA 2CXRA 5AXBA 2BBWA 2A5FA 3RRYA 5B53A 1SCKA 2ZR9A 1GCIA 4BFUA 1SHTX 3CJTA 9GPBA 2HW8A 3AUSA 3Q2OA 3RUPA 1PR0A 4II3A 4J6EA 3P94A 1W30A 7AT1A 4YRSA 4WI1A 4EELA 5FLXA 1JG2A 2VYVA 3VU8A 3BB3A 3WE7A 4AJEA 5KTNA 4ZC1A 2JLSA 1FJGB 1ARZA 1PU2A 1XD2A 4DR1B 3LBYA 2V59A 3VPHA 1W19A 3O03A 4KI0A 1VCIA 1XNJA 1SKAA 2GZMA 4K6GA 4OXQA 4U2BA 3M82A 4KVAA 4X1KB 3DMDA 4EF4A 2V0GA 1S2MA 1G5FA 2QTGA 4NCXA 1LI4A 3V6MA 1ZCJA 2GZRA 3SQWA 2QTLA 4WA7A 1N2HA 2C1XA 2YVLA 3OQPA 5IPFA 4U00A 1TEHA 3DPUA 4K40A 1NC3A 4QDZA 2QQEA 4MWCA 3T52A 2V98A 5D3MB 2YXBA 3GRPA 3QVMA 4NV3A 4ER6A 1Z4PX 1LRKA 2JAHA 3ZWYA 4ENWA 2JI8A 5CA0B 4JJZA 1CU1A 3UCEA 4GP9A 4Q4AB 2YY7A 3BXXA 4XWAA 5CB4F 4YH1A 1QZ3A 4X3PA 3ZKWB 1DI0A 3OJWA 4D82A 2ODPA 3SEFA 4FINA 2YMPA 3FGNA 4C5AA 4L22A 4ZYTA 2HYIC 4EQ6B 2GZ1A 1PUXA 5JHGB 3RG2A 1P2SA 4YTEA 2R6HA 2NTEA 3VKVA 1P2GA 3QVOA 5J1TB 2R6GA 1HDRA 1T6BY 3AIIA 3UUEA 2WWIA 3OTWA 3HS3A 3WRYC 1D09A 1CY1A 1DXOA 5K6AC 1F2TB 3IKLA 1CUUA 1L1QA 2NTJA 3COSA 4PN7A 2OAEA 1JA1A 3R0XA 4DLPA 3PX7A 3VTKA 1C3OA 2EJVA 3K2BA 4J9VA 4CKCB 1ORWA 1VSQA 5KINB 3OKAA 1M2FA 1P3Y1 4DAEA 3FTDA 3BRSA 3MTJA 3ZGOA 1T4BA 3H1FA 4A1FA 4CF3A 5TX7A 2CUNA 4BLSA 2H1HA 5DEOA 1XZEA 4HNGA 1Z0JA 4DIDA 1HYBA 1XAGA 1Z5WA 3PEFA 5LBIA 2YRXA 3K31A 2ZROA 1KP3A 3FPFA 1T0HB 1MT0A 1ZEMA 4P2BA 3BMCB 4ZODA 5FXMA 4CEJB 2EHDA 1BCSB 4XPIA 5FUBA 4OO3A 1D5CA 1X6VA 1V8DA 4YR9A 1U65A 1MHTA 4LVOA 4YLEA 3QHAA 1PX2A 1V4BA 2BM1A 1Y42X 4LZAA 3KQKA 1IXRC 1ISRA 2HMWA 2ZTSA 4GSKA 2LNDA 5LU8A 1E96A 1JEYB 3EXEA 1I6KA 3EGCA 4HWGA 5C31A 2VH2A 2PGLA 4JLAA 2PRIA 4TS3A 4GI5A 4ILKA 3S1AA 2GNAA 5KMGA 4BZQA 3WKCA 4W9MC 1GQRA 2VRCA 5AQEA 4XWWA 2DKOA 3G9QA 3MQ2A 3LXXA 5EQFA 5BUZA 2QROA 1F5NA 2VHVA 1N0HA 3T1HB 5DBIA 3R7LA 3B52X 3JYPA 4GPD1 4YAKA 3IAUA 4OQEA 2OORA 3H5TA 1U0BB 1W87A 2YJ5A 2P79A 3QP9A 3RBVA 4DABA 2GCOB 1DKNA 2A0UA 4YFVA 3LLUA 3TG2A 1SBNE 3QNUA 3DP7A 3T9BA 5FADA 1XMXA 4QXOA 3GUZA 3WVNA 4M1WA 4NMWA 4N0MA 2O2HA 2OGWA 3DZKA 1BJRE 2QK4A 1GIAA 3EC7A 1E7SA 2H4WA 2YWHA 1N34B 1R50A 1KU0A 4RZUA 4E5MA 3G68A 5HS4A 3VYUB 2OFFA 4IUCS 1ML3A 2YJ3A 3OUZA 2NQTA 3NHKA 4OFWA 2HLDA 1ONPA 2BMVA 4GPAA 3BHMA 4UAGA 2JANA 1YCDA 4YXWA 3RSCA 3GLHE 1IOWA 4QZVA 1P62B 3A3PA 4A0SA 1RYDA 3IJEB 1AKWA 2X2FA 4XDHA 2OCIA 2ON6A 2ZZMA 5TV2A 2ID4A 1PR6A 2I3BA 1C2TA 2R1VA 3CFYA 2C9BA 2CCJA 1O97C 3FBTA 1VA4A 3H5NA 1RXCA 1AQIA 4EK9A 4U7FA 1T43A 3E22B 4HN9A 4W6ZA 3X43A 1GKUB 1YMVA 4TTQA 2GDZA 3GLKA 4MRNA 4JMLA 3EXHC 5CYGA 1RMYA 2EQBA 3GXBA 4H3SA 1ICEA 2FP3A 1L4YA 1FSSA 1FTQA 4WOCA 2Q4DA 2XVAA 4JQCA 3LRXA 3TN7A 1YBVA 5D7BA 5KYUB 4GLJA 2YOGA 2QPAA 1TW2A 4X0EA 4BQRA 1XWIA 2CNNA 3P19A 4ROTA 3X44A 1NI5A 1SWWA 3PDHA 5ABPA 4KQKA 1QG2A 2Q5LA 4LVCA 3DBIA 4I1VA 2G4VA 3PUWA 1LSUA 1L7OA 5TT0A 4W5HA 5LWHA 2WJ3A 4JT9A 1PJ3A 1CYDA 1I0ZA 2V65A 1RC8A 2BFMA 3PXXA 1EAMA 1WVGA 3WMGA 5TQ0B 4K6CA 2WHXA 3UO8B 1EU1A 5LN1A 1XP8A 1C80A 1H4VB 1EGVB 1KGDA 2M32A 1NR7A 3PRHA 3ET5A 3H8SA 4A7PA 1F5SA 3AWIA 3AINA 4FW8A 3HR8A 1PNQA 1FP6A 1QGUA 3CPJB 1VG9B 1MA0A 1MAHA 1HYEA 1F2DA 3R7DA 3V34A 3VPAA 5LMCA 5MF6A 5L6LB 2ERCA 3GD7A 4ZYXA 3OLZA 1RC0A 4M54A 4PSVA 3IS3A 4GE3A 1VBKA 2V74B 3T38A 2BCEA 1FP4A 1U7UA 2ZQYA 1V8OA 4B4OA 4Z4QA 2QORA 3CLTD 3UANA 2FZWA 1U2DC 1T3GA 3LX5A 4TLDA 2A33A 2HNKA 5TC4A 8GPBA 5JNSA 3EFOA 4I4CA 3TCKA 3RC2A 3MMNA 3N7TA 3A26A 5BORA 2OO5A 3T3DA 3ZTTA 1DBRA 1N75A 4PXYA 1CZLA 3OMWA 4JUIA 3QKTA 3CPSA 4QUAA 1BJTA 2OHGA 4IOMA 3K1YA 5IC6A 1C7FA 2AQIA 3I58A 3ONDA 4U7TB 5SY4A 3ANLA 1G20A 4HAZA 4TLLB 3U7RA 3WNDA 3LU1A 1TCBA 2PLFA 3A9CA 3AF5A 3WIOA 1EYZA 1BAPA 1GA4A 1JWBB 1GZUA 1N5MA 3SXPA 1WUIS 1PDOA 4OH1A 4XE5A 2BGRA 1ZGJA 1X1BA 1Y3AA 4M6WA 3TSCA 4NHOA 3FROA 1CW2B 2NVWA 2DQ4A 2P4QA 5TQJA 3PFCA 4EZBA 4A9AA 2BZ0A 3MSCA 1LV8A 1FTNA 3OIYA 3SICE 2IHZA 1WF3A 3D8HA 3H84A 3VYWA 1EWTA 1JIJA 3TQCA 2C3UA 4QG7A 3L1IA 2B4AA 1E1LA 2RI0A 5IVKA 4KQCA 3EPLA 1QHEA 4QFMA 4ZOQI 1M54A 2FZEA 1SBZA 1NJ6A 2PU7A 4RM3A 1TA0A 1E2QA 1OGYA 3TTYA 4UU0A 3NYRA 5J63A 3M9LA 4EB3A 1YB2A 2I29A 2NSYA 2OMKA 3O2QB 3D43A 3RSQA 5A4FS 3DJYA 3NXSA 1CJBA 2VDKB 2QXTA 2W6ZA 2ZKIA 2FX2A 5K3AA 5TARA 4B81A 1KGSA 3CXRA 3VHXA 1XQVA 1CPYA 1LQ2A 1ZK0A 3CLSC 3NRBA 5DPMA 3S44A 4IIDA 5AHWA 2PUJA 3U60B 4GMFA 5DNCA 2HBQA 1VPWA 4CL0A 1X80B 2NWQA 4KKVA 3V8QA 4BKPA 4ESVA 3LUAA 3DLBA 5LOVB 4JI8B 2DZDA 3EXG1 1M8FA 1OX4B 3NYQA 3WMFA 1C1DA 3KL4A 5DRYA 4D79A 2C5GA 1YR6A 4RJJA 5E8RA 1RIIA 4OIFA 3GLFB 3M34A 4EHKA 3VAAA 2WYWA 3DEHA 2IK8A 3E9NA 4R2HA 2P0YA 2H0RA 4RPJA 2SBTA 5JBIA 1CUSA 4EO4A 4IDFA 1ATZA 1CUBA 1G41A 4NEQA 1EK2A 1OBOA 2BP7B 1C4WA 5AK6A 4ATNA 1ZUWA 1I51A 1SCNE 1H8EA 1Z35A 3EDQA 4QBHA 4Z9YA 3F3SA 1OU0A 2HWWA 3ZK9A 4O2AF 4W9NC 4V0RA 4DBZA 4XGIA 1XT6A 2FJPA 2MOKA 2XKJE 4WK0B 3ZIAD 3A6EA 2IOHA 4L76A 4S1VA 4K9QA 1Z5VA 3ZG6A 2Q9UA 1SIWA 4Z2YA 5LXTA 1E7YA 3EHEA 4Q4JB 1NRWA 1R3DA 3I3SR 5EXEA 1R9NA 3NPMA 2GX6A 4QEDA 3AK4A 4B17A 1C2YA 4JX8A 1N5OX 4YAFA 3WNZA 1Q95A 4R1QA 2FNAA 4J3NA 3UMBA 5LP1A 2QR5A 3COZA 2NQ2C 3MTBA 4DXAA 3P5SA 4M60A 3K1AB 1JR2A 1I2BA 1NF9A 4AD8A 2XUOA 1TC2A 3ZZTA 1UMCA 3ROXA 3EZFA 4FYIA 3WIEA 2YY6A 1W85A 4QLOA 1FRQA 2AE2A 3O3OB 2B6HA 1NXQA 1ZRHA 2X6TA 3HRKA 4WZ6A 3G9XA 1EIZA 1LBHA 2JFPA 2QVYX 1L4MA 4UHCA 4A8JA 4D25A 2RJOA 3KJFA 1SU7A 1II8A 2QA5A 2B1RA 2F43B 3K94A 4YWHA 4DMCA 9LDTA 1ZH8A 2ZUVA 5CH3A 3IEPA 4MWBA 1OVGA 1QRSA 2O7RA 3A1TA 3SHFA 1H2WA 3KQTA 4LY0A 4OLAA 1VCHA 1U7ZA 5LDGA 4LSMA 1E0SA 2PUBA 1AY0A 2VT2A 2DBRA 4XIYA 4ZXFA 1RYEA 2X1MA 5EQJB 3U6BA 5B3JA 1PFWA 1KAEA 4H2DA 1GZ3A 1H0KA 1K27A 1P29A 1T4MA 4EYQA 4QRDA 3RSZA 4JDPA 4BRSA 3LC2O 5J2TF 3INGA 3U9LA 1FYFA 3KKQA 6ABPA 3LJKA 2OK8A 5ALKA 4ND1A 3ELUA 4CKEB 3DDZX 1W75A 1UP6A 5K3CA 2WSSD 4R9SA 2LCQA 5JYEA 3V3TA 4MIKA 4AWBA 4GAEA 1CRPA 4UUBA 5CIWA 3PIRA 4S24A 2D1SA 3SS9X 2JK0A 1P8JA 2AEFA 2H4JA 3LOUA 1SCAA 4FFVA 5ALOA 4CG0A 3DYBA 4BX0A 4ZHSA 2ZWPA 1TRHA 5F2KA 2VP6A 1Y3DE 3LX8A 1H0RA 1L4EA 1KO4A 3LLVA 3PDIA 1E3EA 2AX4A 2I8CA 3K5WA 1CV2A 1NKVA 1UKZA 2XUAA 2YY5A 3LD9A 2WZDA 4KRYA 1TD9A 3UT5A 5K4AA 3T1YB 1DBWA 3EGDA 3U7EB 1RMQA 4DIMA 3W6NA 3RUHA 2CFTA 5DSZA 3IGFA 3KKZA 4KN6A 3A06A 2ZBVA 4H31A 3P4UA 4RIFA 3R44A 3DOUA 5B2FA 3FOFC 3CGWA 2R25B 5BWOA 2MYTA 1TUBA 4JCCA 5CH8A 2XE7A 4DLUA 4ZU3A 3O4GA 4KNVA 3R5JA 3ZNQA 3ZHYA 4BN0A 1HYQA 3UOGA 4XX0A 1SB8A 2A59A 2VSNA 4ZU1X 1DRVA 2DWOA 2IYAA 4HFRA 3MZ0A 4ZCRA 5IBPA 1U3CA 2FZCA 3OCCA 2B0CA 3IAAA 3RV3A 3I2HA 1UH5A 3TL3A 4FYXA 4JP8A 5CLQA 1N2CA 3UH1A 4BLUA 1JHYA 1U8EA 2COEA 3PKZA 4DMUB 4N65A 4QBKA 3WKBA 1JE1A 3AUFA 3B5EA 2B0JA 3DGEC 3KG2A 4DCSA 3UBTA 4REMA 2QP3A 3PD7A 1VQ1A 1ZITA 3WK8A 3LX4A 3KR2A 5IVPA 3WB1A 1JMYA 3BGVA 3B9RA 2C07A 4RHCA 5LQUA 1FBTA 5BXQC 1N5IA 3A2NA 4KL8S 3AH8A 5HKAA 1YKSA 3FW1A 1F9EA 3L8FA 3K8OE 1UXOA 5HIKA 5IT5A 4ZYUA 4BNMA 2PUWA 5CDGA 3DHWC 2R1UA 4UE2A 2O2ZA 2RHRA 2V8BA 1XQ9A 4KHPB 3ZCTA 3BK1A 3CLKA 2BHLA 1QDUA 1DC3A 2BWJA 3VNVA 4FEAA 5A9SB 2HQ1A 3HZZA 1UMDB 2O2CA 3F5QA 5EMKA 1C4XA 3ZBQA 2V7XA 2Y2UA 3WFIA 2NUTB 1A9YA 3A9WA 4LNAA 3I0ZA 5AI4A 4F3TA 2B35A 4ZT2A 4K9SA 4RC9A 3WSTA 2IYTA 1N78A 2FN3A 2PL9A 1Z7GA 2ZJOA 3FI0A 1TVCA 3MERA 4MOWA 5FBQB 2PWYA 5KDDA 3GNLA 4G0VA 2GD2A 1UBRS 2RHJA 4BS9A 3IQWA 1XKXA 4DCGA 4KYUA 2FQ1A 4V1CB 4NV0A 3JZIA 5JMPA 2WFZA 1Y3CE 2YNMA 1QS0A 2WSIA 3JD3A 1KEVA 3ZWBA 2O8FB 1AKYA 4GPBA 1ZWLA 3IMKA 5CB6A 1WBBA 2JLZA 3C6QA 4BFWA 5ALLA 3CVVA 3ZZMA 1QMGA 1UAYA 121PA 2C4VA 1WB6A 2FPIB 8ATCA 1FFXA 2OHHA 3SR3A 3AEUA 2BISA 1FYXA 3IP3A 3LQ2A 5CNMA 3ZCXA 2Q1YA 1LXCA 2WHEA 3H3JA 4FHCA 4BBJA 4ZVVA 1EXWA 1LEHA 1NDHA 3VX3A 2NXJA 1P7YA 5FBHA 3GYGA 2C4WA 4ETWA 2GKOA 5TEWA 4ETMA 4BY9E 3D02A 2ZTLA 3SF0A 3M1IA 1EUYA 1SD1A 1RZUA 1CQWA 1TRKA 1VSTA 3JALB 2Z9DA 4LK2A 2BEKA 1ADFA 1QG0A 3LQFA 1SC1A 2PR7A 3EK2A 2C8KA 4MV9A 5TF4A 2ZRFA 1QOPB 5CT4A 4B4WA 4CM9A 1V7QA 2YIVX 1NQTA 2GZDA 4EQZA 1ODFA 2C4MA 2QNBA 4YUXA 4C0AC 2FDCA 1E64A 4GVPA 4MXDA 5F2NA 2VSQA 4ZIRB 5C35A 1AUOA 1ZH6A 1Q14A 2XF8A 1VYHA 4Q3NA 3TFWA 4E70A 1GFWA 4MQBA 4G3XA 3VC2A 2CNBA 1TJPB 1WDMA 2BE9A 4X8HA 3WGZA 3AESB 2Q6IA 4CQMA 4EYEA 5C8YF 3TTVA 2OCXA 1E6LA 2PJUA 5HCIA 3QKRB 3W06A 3WL6A 3DEAA 1QF7A 1CZHA 4UCQA 4W9RA 5FBWB 5FNVA 4RDXA 1CT9A 1NL3A 3GZJA 4D26A 1Q1ZA 5EMJA 4NAHA 3DF7A 5HZKA 1EVJA 4KPUA 4DR6B 3FNGA 4XYGA 5HMLA 1GDTA 2G72A 2ODAA 2OGTA 3GH3A 2AS0A 1Q2UA 3C3YA 4NBTA 3G7UA 3UICA 1OYVA 3W1WA 1GKYA 2RGRA 2WT9A 2JFQA 3HBAA 3TGPA 1X3LA 3T9CA 1X7GA 4HTFB 4QPDA 4LS3A 4RK7A 1VLHA 1WPQA 3WLEA 4RS3A 1CUIA 3Q0EA 4AF6A 4CKYA 3K53A 1GA1A 4JZKA 2WI8A 2QKYA 2IXFA 3T1NA 5BXYA 4IIFA 1ONNA 4BVFA 3TXAA 2Y0PA 4ZK6A 2PCLA 3HO6A 3D6FA 4HWPA 4Q16A 4QJ5A 2BI4A 2Y9PB 2BEUA 2HIHA 1I33A 1YJBA 2J3IA 4FDUA 4QLAA 1T4DA 3HUEA 3ISTA 1W1IA 4LFCB 1JX6A 4QUJA 2QL7A 1QRDA 1IWOA 4WESB 3GJ7A 3IUMA 1B0PA 3QA3E 4YN3A 3MRVA 4ZV7A 2DF8A 2GS9A 1XDSA 2IEZA 2QAJA 3FDZA 1S2LA 2ZUEA 1C9MA 4HYYA 1OX6A 3HYTA 4DS3A 5M29A 1JPVA 4L5IA 3I37X 4LYEA 1SVKA 3OFJA 3DOIA 1FRVA 5IMBA 1F2UB 3H42B 1IFXA 1MU0A 2UXDB 3W5JA 1CVIA 5I4CA 4LJRA 1NURA 3CMMA 4AYXA 2WSYB 3QOFA 3Q9SA 1G64A 4D0RA 2Q5HA 1CJKC 1BGVA 3TR5A 4F72A 1VJCA 3R24A 2YW9A 1Q7BA 3DE4X 3W8NA 3MFQA 1C14A 1D5WA 4IBOA 2UUBB 2GHQA 1E9DA 1NN5A 2G5GX 3Q4GA 2V7QA 4DGSA 4HNAB 2AC7A 2IXDA 3D4LA 5H59A 5JTUA 3EXFB 5FPPA 2DERA 2P78A 1AKMA 1XNRB 2KSQA 2JJ1D 4XQGA 4XDYA 3A6LA 2W83A 4ZMBA 2WMNB 3H86A 4ZPXA 3RPEA 4EY4A 2OKCA 5DDIP 3L1KA 2HJVA 4JB3A 4DNFA 1H2RS 2WU1A 1UJNA 1MF7A 3H2IA 2XWQA 5KOYA 4BP9A 3BJZA 3WADA 1I4DD 1N5LA 1Q84A 4RZQA 4US1R 5EJ9A 3CVXA 1Z0SA 3MJDA 3U3XA 4MDYA 1PYOA 1RLUA 1YQGA 2I87A 3NNDA 4H16A 4DV6B 2X0DA 4DC0A 4D44A 3CX7A 2GXUA 2OVBA 5NLLA 1JKJB 3AI2A 5ALNA 4QFDA 3EUAA 4PYMA 1CJTC 4A0RA 1L5GB 1QPZA 5MGBA 2XT0A 3DEJA 4QUEA 3RT9A 2N42A 4KMRA 1IXZA 1NY5A 1MO6A 4JQSA 4FSHA 3CH5A 1UM9B 1KI8A 3W8FA 3WGNA 4ALMA 4IKOA 4C89A 9MHTA 3CNNA 1W0KA 1J8QA 4JLJA 4B79A 5BV1A 4WZAB 4EHNA 2IXEA 4DE5A 3UH0A 4PZCA 4UEQA 1HDYA 3PEYA 4NS4A 4Q24A 2DUUA 1QOQB 4HPXB 1G8MA 4UOQA 4MVJA 5HSGA 3VDXA 1NP6A 1JL3A 2JEZA 1P2TA 1QO0A 1Q92A 2ZRLA 4TTVA 4WKBA 3IBCA 5JEEA 2JC3A 1IONA 3HFJA 4TVOA 3GEBA 1H1DA 1JP7A 4C78A 1I1NA 5DCWA 4DJAA 2FJ0A 3U9SA 4BN5A 1QV6A 4EEZA 1SOVA 5KOHB 2FWAA 2VT6A 3BIWA 2P6OA 4O4HB 2QG9A 1YAHA 3EEIA 3QKUA 4WOPA 4ZT4A 2I9PA 3V2UA 2O8EA 3GRFA 4RULA 3QLEA 4R6WA 4I6EA 1DXHA 4H4DA 3UB3A 4A4DA 1R0WA 2X4GA 3LZ6A 5KZMB 1YE5A 4NDZA 3MHPA 5KCMA 1OLOA 2E4XA 3HWWA 4DMMA 3LY8A 1KQOA 4PCVA 3SBXA 1ZSVA 3U39A 2R6AA 3Q5GA 4PINA 4ERXA 3QU9A 1JFSA 1FOEB 2Q1SA 4OI2A 1QHIA 1JLHA 3WX0A 3R3UA 3AL0C 1J9ZA 5KJCA 1OH6A 2CNWD 3RVPA 5CXXA 1IN5A 2ONJA 2J41A 2SKDA 3A1EA 3R0VA 1LBSA 1MQ8B 4KQFA 4I1SA 1NBIA 1NMYA 1U2TA 3T15A 1KOGA 2BUAA 1OBCA 1JV2B 3FZYA 3TQQA 3U4HA 5C34B 2W2KA 5EIEA 1RMTA 1TQ6A 5EJMA 3UOAB 4EAQA 3B8EA 1ADGA 3EIWA 3ILHA 1G16A 5AW5A 5LZ8A 3BIFA 4NJMA 1A9OA 5DNAA 3EWNA 2CB9A 5AUOB 3R3XA 3U3ZA 4PZ9A 3TF5A 2XTJA 3UGJA 4OV6B 1YFZA 2BGLA 4J7CA 4AO6A 2ILVA 1OBVA 3DM9B 1EJ6A 4Y18A 2JARA 2CFSA 3PPYA 2JLVA 3E84A 2SHKA 4IIBA 3QE0A 5H02A 1I3LA 5I7VA 2NOAA 1TECE 2XOKA 2IS6A 1LVHA 1QF9A 2G70A 5C8YB 3TDMA 1HNXB 2EP7A 4RELA 2BJVA 2A78A 5IJ9A 3PCRB 4QQKA 4WK4B 2HHJA 2GETA 2Q6KA 1W5FA 3NTRA 5HRCA 2HU5A 1ZNXA 2O6HA 3U2QA 1IZ9A 3TCNA 3CZRA 1KEKA 1XTRA 1PBTA 4RPKA 2QUAA 3ZWKA 5HWSA 2JI7A 3F6BX 2PQ0A 3ORHA 2D54A 5C80A 1RCFA 3CONA 4AP9A 1GXSB 4MTLA 3FUTA 3HUFA 3IUNA 3UPUA 2ENUA 3G85A 3O93A 4RACA 1ENOA 4GPIB 1K7EB 3GVPA 3PPXA 4XA8A 4QSHA 4CMHA 1CFJA 2IH2A 1VM6A 2EVWX 3NQ41 1KI6A 1FMTA 5E3JA 4UKDA 2M6SA 3M6XA 1JH9A 4CU5A 1V6SA 1IAVA 3WYFA 3TW0A 4F9GA 1U63A 2NSDA 5KSYA 4AUMA 1YS6A 2WKSA 3K0FB 4PHCA 4TL9A 2GD6A 3EZLA 1I4EB 3LDAA 4QYMA 4MLZA 3C3EA 2Q2OA 3HU5A 5HX7A 2CLIB 1C9KA 1OFUX 4L0MA 2SCUA 3QWAA 4P81A 5SY6A 1XMPA 5I9IA 2C3OA 2YL2A 2J32A 5K01A 5LWQA 2ZSDA 3HBFA 2V3CC 2Q8NA 4HWRA 3JVVA 3NTUA 5B6JA 2Y76A 1NBHA 2NW6A 3CLHA 3HNPA 1O54A 3G5UA 3ABIA 4KN8A 3VRHA 3RVNA 1K8RA 1WSAA 1I2DA 3JVIA 4XPZA 2HRZA 2BM9A 2Z5VA 3I72A 4ZRNA 1NR1A 1EUDB 1Z6PA 1LF5A 3B85A 3NHAA 4FIDA 3D2LA 4MUIA 3SHVA 1HDGO 3U3DA 4YT5A 3ZLJA 1VPTA 3PX2A 1S4QA 2UZ1B 2R11A 2C57A 2EKPA 3H2JA 1NAIA 1XYYA 3HB5X 4JKOA 4N6OA 5HQJA 4EFLA 1WPXA 3HUTA 4O0MA 3Q6NA 1BCRB 4DQUA 1AK2A 1DX4A 3B48A 3PFIA 1W5SA 5KAMA 4BV3A 3MMXA 1JDSA 3TZQA 3AP3A 1QKJA 4D9HA 5BSRA 1R00A 1EE2A 3QV1A 1JSXA 5CITA 1YC2A 3ZY4A 2J0UA 1UXKA 3HDGA 4BMOB 1J4AA 1U4OA 2V96A 5IUKC 1DFIA 3Q8WA 2VJAA 3LLSA 2B4YA 4HMQA 4QYIB 5EP1A 4XB6B 1FRZA 4HVLA 2V6FA 1BH6A 4UZFA 5ENDA 2Q7DA 4XOIA 1Z07A 4E4YA 3OOWA 3ZH9B 4L85A 3V9AA 2A4KA 1OH7A 1VRWA 4CCYA 1DE0A 3GRRA 4DR7B 1ZIDA 1WUYA 1UK8A 2R96A 1DRWA 3ET4A 3KT0A 4IQ0A 5ALJA 4A6DA 2WHYA 1E59A 2X7XA 1M67A 3Q2KA 4OPMA 2HR1A 1TK9A 1Y7PA 1XHEA 2ZIFA 2WD7B 4A1OA 1E18A 5U9CA 3ED1A 5B2EA 3DE3X 1MJFA 1EQAA 2FEOA 1EDDA 1N7JA 1TF5A 3GB9A 4H3VA 3QE3A 4JDUA 1ZVVA 3SLRA 4NTZA 2HWXA 4D8WA 3QUAA 3D3WA 1K7FB 4MQEA 3MAJA 3KUXA 1DRUA 3CX6A 1I3KA 2QS9A 3BEOA 5CX1A 4P86A 2B9VA 2YV4A 1D0SA 1Z9BA 4BO8A 3T4EA 1VPEA 4X3CA 2WF8A 2Y92A 3KU1A 4IIYA 1SNYA 2NNWB 3EEFA 2D3WA 1OLXA 2QLBA 2NPFA 3BREA 3HKDB 3QRWA 3S8EA 2Y0BA 3BYZA 1YZTA 2NZXA 3MGBA 1Y1RA 3ABRB 4NATA 4PZZA 3ROTA 3DZIA 3S2SA 2D7DA 4MV6A 4RDIA 4URFA 4MMXB 4FYHA 1A1SA 4UFNA 1TLFA 3IBFA 3ZV4A 2H08A 2XXAA 4O4JB 2W2QA 1T0UA 3KQHA 3UJPA 1HEYA 2X0NA 1RXSA 1PQUA 1W0CA 3TX6A 2OBBA 4YPVA 4ZN6A 1N5RA 2VHEA 3CKYA 5JS1A 1A5SB 2HLHA 5ICGA 5L51A 3MSXA 2P3LA 1WU7A 1NNSA 1MOZA 5AJZA 5C5DA 5IG2A 3MTIA 4BTEA 1TK3A 4K2HA 1XF9A 5CIYA 2R6JA 4KKXB 1GUZA 1Z5UA 4GU5A 4HXYA 3WQBA 4E15A 3E8MA 4FFRA 4BQEA 3VSAA 4G65A 2JLQA 1GCUA 1H4QA 3AVWA 3F7TA 1TJ4A 4H1UA 4CIDA 1YZLA 4NC9A 3A36A 4OATA 3WGUA 4RD4A 2CVOA 4LE0A 2HPVA 3P4YA 1HKHA 3G9ZA 2WJZB 3BJEA 1UFOA 4X45A 1OYYA 1QIJA 1GSAA 10MHA 3PA8A 2YWFA 4M98A 5KPDA 1E79D 5IM4A 1ZMBA 2BMAA 3RIEA 2XADA 4RF4A 1GPH1 4I66A 3ILVA 4GC5A 4LRUA 4TRRA 1YGYA 5CVUA 5DBEX 3CBGA 3ZPXA 1V16A 3EYWA 3JQ9A 4OB7A 4P5EA 3SJUA 5EIXA 1M72A 2P2SA 2W6CX 2WZCA 3KFVA 4FE4A 4DSUA 1BVHA 1ETUA 2XR1A 4HGOA 4ARUA 1N3YA 1KMMA 4YT8A 1QH1A 2QQ0A 4HDNA 3AR7A 4I4TB 5EGNA 3AVYA 1NXPA 2ZEJA 4P53A 4B3CA 5B12A 2PS0A 4OJYA 4EKDA 2R97A 1NXVA 3GPIA 1YZNA 4L74A 3T7SA 3ZQ6A 1ZD9A 1J23A 1ORVA 2ZU6A 3H13A 4OVKA 2HJRA 4RK5A 3ZE7A 1BFUA 1V3TA 1US8B 2B3TA 2N9UA 4FZ3A 4B3SB 3JQ8A 1ZICA 1ZN9A 5AK3A 2HRDA 2MU1A 1CG6A 4IRXA 1GL3A 3WWCA 1H8HA 4Y7DA 4YO8A 1YWGO 2CWDA 2R2GA 1HV8A 1NUPA 2OO3A 3I1IA 1GL6A 5D00A 3TM5A 2ETVA 2A0KA 1V6CA 4DMHA 5DN6D 3CMCO 3M4NA 3C98A 3M7IA 4TZTA 3VPDA 4B80A 3BMOB 6NULA 1Z5NA 2EKZA 2QTRA 2EKBA 2GH1A 1XU4A 3ZYCA 5IVDA 4UM9D 3FWKA 3H4TA 5F73A 2FWIA 5CT9A 2PUGA 5HRAA 5E38A 2G5CA 4L5CA 5DM60 1K4KA 1SU8A 1UDBA 2VPPA 2XZLA 1ZMRA 1L7DA 4H0CA 4M1KA 1E98A 4AP5A 5LU9A 4NNJA 4CM5A 1J1UA 4ZOLF 3QITA 4TV8F 4NMLA 1FL9A 1MX5A 3BMQB 4R0NA 5HW0A 3LNTA 1Y1PA 3QVGB 3RROA 1E3QA 2Q46A 1WUHS 4K1LA 1SH7A 5IF9A 1NBAA 1ZY2A 3H6HA 4ZQFA 1U3UA 4B6JA 5CAEB 1PNTA 2QVBA 3P0IA 3DXZA 1DMSA 4J7UA 5B1YA 3L8MA 2IU3A 3IP5A 2ZIWB 4U2DA 4AZ3A 4AROA 3UXEA 4FP9A 5CBPA 4IR7A 4YRTA 3DC2A 1PT8A 4NYIQ 5HTKA 1IZ7A 5AVQA 5K0ZA 4ETNA 1I4TD 2OEPA 3KQVA 4PC7A 2BT4A 3SX0A 2JEYA 1Y3HA 2W6ID 1L4UA 3MWDB 3T3MB 2IF2A 3NBQA 1Y4SA 2F1KA 2QYTA 4XR9A 5K7SA 1OV4A 4IHJA 2C5LA 3USCS 3IDSA 1ZJ4A 2WIAA 3IE0A 3IR5A 4X85A 4TMYA 5AKLA 3IKMB 3N0WA 1BXGB 1M10A 3TD2A 1ABBA 3J81A 3Q3CA 2H29A 1NY6A 1LCIA 1EUCA 3CX3A 3QI2A 3ZBTA 4EG3A 3Q7IA 1VGRA 2Z6AA 1QHSA 1XTQA 1Z4MA 3ND5A 1UK6A 3G2NA 4RNCA 3WRYA 3FOEC 1YOVB 1KYWA 4JVMA 1C7EA 4I5DA 3WWPA 3KPUA 5IYZA 5K6AA 1E6UA 1R12A 1B1AA 4JBYA 5BYAA 2R9VA 4LTMA 4HTAA 4JL5A 1W2GA 5JNUA 3H1PA 3C43A 3UB4A 2I6QA 2PH7A 4LCBA 1G3QA 1IJKA 1U28C 5FX2A 5CJ2A 4JSRA 4G8CA 3ZY5A 4ZI3A 4KK4A 1A5TA 3DVAB 1ZCZA 3HMQA 4NX2A 3TKLA 4JB2A 4X20A 1P60A 3O2JA 4AM8A 5AM5A 2QU7A 2IY7A 1WZIA 4K1XA 2WAXA 1K2VN 3T5DA 3K5IA 4RCVA 2QT1A 4IDHA 1PEDA 3I3OA 4GC9A 5IC4A 3DLTA 4RE5A 3GFFA 2RHWA 5K03A 1G8YA 4O5OA 4GZMA 3JWGA 1QX4A 3WAKA 1R4MB 2FZ5A 2OILA 3NVDA 3OLYA 2QX4A 4PO8A 3U3JA 3UWMA 4RTRA 3UN1A 2BFBA 2OUIA 3ADKA 2BKXA 4Z0HO 1D04A 3C5WP 5DSTA 2OHXA 3D3NA 1AS0A 1POXA 3ENKA 3HWRA 7MDHA 1ZP6A 3LPMA 5GJWC 1IN6A 2RB4A 3FTEA 2XTNA 5T5QA 1ULBA 5U4QA 2GYYA 4D3SA 1KYVA 2JFFA 3I9OA 3ZHZA 1ZGCA 4N48A 3OP1A 1B42A 3IALA 2W48A 3ZY2A 2XB4A 3R2JA 4W1SA 5A1JA 2OYCA 3O2SB 1RKVA 3FGPA 1DTSA 1GNRA 4RVUA 4DDHA 3BRCA 1VLMA 4K86A 4X1KA 2RIRA 1EB9A 4YLGA 1MO2A 4OHXA 2EZ8A 3TLXA 1ZD5A 5BSHA 3B78A 3IUQA 1WL8A 4YAEA 1E9EA 1BMDA 5E95A 4YAUA 5F4ZA 4FM9A 2QYOA 1LPMA 3KYCB 2YYSA 4E51A 4IG9A 4IXDA 2JD2A 5LQCA 3BRWD 5GJBA 2ZYDA 3HWX1 5F1PA 2C2KA 2FUCA 5E9WA 2QQGA 5J2UF 5ALPA 1N2BA 4FHGA 2IUUA 4EL5A 1BSVA 2J9GA 3OT1B 2PJZA 3OFNA 2RG7A 4GYWA 2R7KA 4TQGA 1A2OA 3G2PA 2PL3A 3EY4A 1X7YA 4FIZA 2FA9A 4OHCA 4TSKA 2NVUB 3A70A 5EMNA 4Q4AA 1C1HA 2AW5A 4INPA 1FMJA 2P9GA 3NDPA 4BVHA 1QPGA 4C1BA 3LW8A 3O4JA 4RD6A 3EVNA 3N0XA 1SVUA 2ZB4A 1BVUA 4AK9A 3MWJA 4HEA1 2XQVA 5LQKA 4GXRA 1HT3A 2FW9A 4B6OA 4EQ6A 3JQBC 4UOEA 5LZ4A 1EGAA 3M1LA 3QUCA 4PXAA 3QA9A 2YVUA 3LAWA 5AKIA 2LGJA 5EZYB 3T8YA 3WLIA 1JEDA 3RBXA 3THOA 4QDUA 3EZGA 4YECA 3QPCA 4M9SA 1SEPA 2BKAA 3AZPA 2EBUA 1CUZA 4L75A 4QTZA 5BNTA 2D6FA 4D92A 3U5ZB 2CLHB 3L1JA 3HI6A 1UJ5A 2B8NA 2IYQA 3ZE0B 2IS4A 3EXHA 3BA1A 1QR2A 5HQTA 1HLFA 3Q7PA 1O95C 1TZCA 1QIKA 1PGNA 4R2JA 2W6NA 5I4BA 4YJGB 1GNPA 2DBYA 4HG2A 4IOKA 1I4OA 2OZKA 2I4TA 1PVOA 5CB4A 1RHJA 3P2JA 3U80A 3GZNA 2FMHA 1UWLA 5G4KB 1O7JA 3A04A 1GAJA 3ZDZB 5HXAA 3PUJA 3TMYA 4G5FA 4IX9A 1K7SN 5TS2A 1YKFA 5A4IS 3RU3A 1C9EA 2IHJA 2R3SA 1C8BA 1U8TA 2C96A 1OV6A 3MJFA 2GPJA 2JFBA 4KN5A 4MQLA 4CEJA 4E14A 2VUTA 3BFJA 4BGUA 1YQXA 2AZ4A 2JLWA 5FH9A 2CB0A 2G1PA 3O38A 2H1WA 2QR2A 2MT9A 3E1GA 2PMCA 3ECAA 4B3FX 2H07A 2A9OA 1Y8ZA 2DQKA 1MOSA 2WHQA 4ND8B 1JR3A 1YI8A 4RQBA 5F9HA 1JEYA 4N03A 3CZPA 1FUYB 1YIDA 4G8BA 1N77A 4KGXA 2CHUA 3LRPA 4BWVA 2YDYA 1BWQA 2VHZA 1KFJB 3C0KA 4KNYA 4FCVA 4NU5A 2ODBA 2WWVD 2QYSA 2X86A 4M37A 1W6UA 1MNAA 4F7WA 4IVNA 2CJWB 3IJPA 3PTAA 4Q12A 1JDJA 3GD5A 4ZI7F 1BC5A 2R44A 1XMJA 5LYJF 5DMHA 4I3FA 1U2DA 3ICVA 1UDRA 2D5CA 3KLMX 2WM3A 5CEJA 3BERA 4M89A 1K3TA 2FCAA 4KSBA 4F5YA 5JS6A 2GCOA 4OK3A 4PVDA 1R9GA 3TRHA 4I8XA 4C4YA 2ESRA 4GX1A 3ZHSA 2PN1A 2IS2A 2GVZC 3E1SA 2D2VA 4KMOA 3HNRA 1NLYA 4F93B 2CXUA 4YRBA 2GF9A 2F8LA 2I3ZA 3EGOA 2WUEA 4DBVO 3TEMA 3WOHA 2DSTA 4K9NA 4WAUA 3QW4B 5GGXA 3OT4A 5CFMA 3KVOA 3BILA 2GK6A 2NXWA 4P32A 3PZBA 3RRBA 2PGAA 5EMHA 3WRWA 1I7LA 2V7GA 2WPNA 3NM6B 4M1QA 4BUJA 5A4AA 3HM9A 1SCJA 3GAFA 3N59A 4MQ5A 3O4HA 1EG7A 2J0VA 2QJTA 3NUZA 1K8XB 2O57A 3LPNA 4QUHA 4LKOA 1W52X 4F46A 1OC4A 2E1PA 2ZP1A 2C9OA 1DARA 1A9RA 3U7HB 3KVVA 4QOJA 5ESXA 5ULLA 3NG1A 4F5DA 2RGXA 3BJMA 3SXJA 4HGZA 2PGIA 5F7JA 2AFIA 3C3WA 3EVGA 2OAQ1 3PK0A 1KI9A 4X54A 2FG5A 3ST7A 4B8ZA 2OHIA 4CGYA 3DBLB 4KCGA 3GH1A 3JQGB 1WP9A 1W94A 3LUCA 1NF3A 4QREA 3W9SA 2VDOB 1SC3A 1RWXA 4KE7A 5K3SA 2ZOSA 2ZSFA 2IVZA 1IJEA 1P6XA 3FF1A 4J0EA 3ANNA 5JG7A 1TO2E 5KYUA 1IOLA 1J0XO 1RI1A 4O1HA 1TFRA 4MUBA 2PAAA 4H6XA 3C5CA 4X71A 3ADPA 3MMSA 5ANRB 1B8NA 3GJSA 3O6VA 1A9QA 1DBQA 5DHQA 4MINA 4QJ3A 4TT3D 4EYGA 5KJ6A 4L4XA 4M9UA 1GAEO 4IKEA 4CVNA 1Z17A 3O3CA 1S7GA 3PD0A 2J3JA 4DUGD 3E23A 3QNWA 5BT9A 1ELOA 3H9EO 3ONVA 4WLVA 3TE7A 4RWZA 5I7HA 2X5XA 1J8FA 3FYHA 3KRTA 7REQA 2JHPA 3BZWA 1XCMA 2EERA 4JC0A 1Y89A 2QR3A 2QTWB 1SBCA 3KB6A 4GS5A 5EC8A 2JFUA 1TLLA 4KGVA 1G2PA 3TQTA 4COKA 1AKQA 2G40A 3PNYA 4MEAA 2ZS7A 1G9TA 2C8VA 4J2OA 1GLGA 3BJIC 3L49A 4B7CA 1RRVA 2RSLA 2VZ0A 4W9NA 2XD4A 1KO5A 2G6BA 3OIUA 3WRVA 4C07A 4E5PA 1L6IA 4FPXA 2EJWA 4RJLA 5EI5A 3STVA 3UWOA 1U8ZA 1YJAA 3HDYA 1UJMA 4ZREA 1B2LA 4KMMA 2HHLA 3C8UA 4W5TA 3KU4A 1BN6A 4NK4A 2FWJA 1MVLA 2NO9A 4ZHQB 3NATA 2ZIZA 2GPAA 1Z0IA 3I32A 4Q9NA 4LQCA 3VR2A 5BSGA 1PLJA 3FSJX 3Q8KA 1XZIA 3DQZA 4NZPA 1E1QD 2B2NA 1X7WB 3ACDA 4GL2A 4TQUS 3ZVRA 2JIPA 4WZZA 1HNNA 3AMVA 3QKSA 4YP5A 3R41A 3DZ8A 1KI4A 3KQPA 2XVMA 3W78A 2YHIB 3VR1A 3CLUC 3P97A 3UAOA 1XF1A 1UZLA 3LCUA 1O6BA 2ECKA 1E6MA 3AQ4A 3KQYA 4BCDA 3HVUA 5C4MA 2BBSA 4RMNA 1MHPA 1CIVA 2Q21A 2O3RA 5ITVA 5DLPA 2QL5A 4MNTA 2QZ9A 3CG0A 3CQ9A 1XJQA 1QKKA 3EF1A 4JL8A 4M99A 1DWQA 2JW5A 3S5UA 5I9LA 1X94A 5GTDA 5CM9C 3F47A 3DW1X 1RAEA 4D3YA 2G67A 1TTHA 3ELBA 5CP8A 4V0LA 2NYVA 3CCBA 3D6HA 2X9VA 4F11A 2CBZA 3MN1A 5I47A 4O5AA 3O94A 4YIHA 1RZVA 2E2WA 4ER3A 4G5XA 4UDNA 1Z2EA 4DGQA 1RYHA 1C1XA 2HF8A 4WZBB 5EJ7A 3T7EA 4RQTA 4LJ4A 4MI1A 4DUPA 4NONA 2KBFA 5E0OA 5KNDD 1X74A 1KK1A 3GLVA 4HLNA 3K4QA 5B1EA 3AOEC 3AF0A 4YCJA 2H7CA 4CEIA 3GLFE 5LQAA 4RHXA 1XRLA 1HUQA 4IQFA 4TGLA 5C5EA 1X80A 3M8KA 1QYRA 3OLCX 1NW7A 4WERA 1BS1A 1YS9A 5LOVA 2CF5A 3ZV6A 4YRNA 2QRPA 4LWPA 1HGXA 1TX4B 1MGOA 4P35A 1NXSA 4XJXA 2DT8A 3EMVA 5DBFA 2NM0A 1A04A 3R7AA 1X14A 2Z4RA 3KZMA 3SSAA 1RXIA 2QM8A 3CLRD 5CFZA 1XZPA 3OD1A 3RVQA 1C5KA 2BGMA 1P4AA 4OLFA 1XCPA 3EOBI 3CWZA 2GVDC 3WLLA 2JPDA 6CHYA 3NETA 5FQOA 2A3RA 2FSSA 1WVMA 2PFKA 1JQLB 2KLHA 3LE8A 3SJZA 4EF5A 1YTLA 3D2AA 3I9NA 1UBLS 5KNDH 1GUAA 5BWMA 3K92A 5BRNA 3F6YA 3KZKA 1GV1A 1K7CA 4DOMA 2IBTA 1IUKA 4GGPA 1MX1A 1ZIXA 3OTGA 4NS1A 3HKEB 4UPDA 4Z0PA 2XXBA 2C2BA 3EW9A 2BR5A 4FZVA 4YA6A 3RH0A 2ZIVB 3Q0IA 1XFAA 4WNAB 1PJLA 1PP4A 2WYIA 4UXJA 1UMKA 4HWOA 2J85A 2OAP1 2VAVA 5T4FA 3EG5A 2X8LA 1L5FA 3I2YX 3NKLA 3A28A 4MEJA 5C0OE 5K8JB 5KQGA 1T6YA 4PTLA 1N2XA 1EK0A 1GQ2A 3V9PA 4ALKA 2VPXA 4EIWA 2ZSUA 3PDWA 3ZS9A 3R9WA 3C74A 4FYWA 3N2GA 4WLEA 2ZWMA 2HUPA 4RAQA 1WTAA 2C20A 4L3OA 3L7KA 4LWOA 4H1TA 4R84A 2JDID 3HN2A 1A76A 4LMAA 3M5DA 4OKSA 5DX0A 4EFNA 1IOVA 4TMVA 1Z39A 4EG4A 4X3OA 2XZTA 4YAWA 3WHLA 5JXIA 4F6RA 1U6JA 3F0TA 1VHQA 2A3NA 1O2DA 3MIIA 4HN2A 4XARA 3RREA 3KDPA 1JR6A 4LBVA 1WY5A 2XPCA 5GOTA 2AQHA 4TPKA 4QLBA 3H5RA 1CEXA 2B20A 1O77A 1RBYA 1V39A 2I7TA 1D2HA 4FQ5A 4CMIB 5GPBA 3LFHA 4ENUA 1J9EA 5AJWA 3B12A 2CBXA 3PDUA 1ZSNA 5AI8A 4I50F 1GTJ1 4KO3S 4LZPA 3TRFA 1QP0A 3EULA 4GM4A 4ECEA 5EG5A 1I3NA 1EFLA 2R1TA 3OKFA 4E1AA 4PFJA 1EFPA 2WYOA 4GM1A 5LLDA 4G26A 5G0UA 3QEAZ 2DFKB 1Z8HA 2FPUA 2HO4A 3FPKA 2V0CA 4ZP1A 4AWXA 1T35A 5CDFA 3BHJA 1UDCA 4MGYR 3TLGA 3TOSA 4B6FA 5MFPA 4BXOA 2OR3A 4G4SP 3B6JA 3GU3A 4TYPA 4GKBA 3IHWA 1NJSA 4FDLA 1EUZA 4FGLA 2D7CA 4DCNA 1ZQ9A 4ZYZA 1USIA 3C70A 2HWUA 1BQ3A 4DRZA 1VJ1A 2CVPA 3V4VB 3D3QA 4IFIA 3O8QB 1I5EA 4CKEA 1FDVA 4D46A 2VQSA 3OZ7A 5DTMA 3BMNA 4IMPA 1B73A 1P9OA 2CLFB 2FPSA 4K2AA 1U5BB 2NUPA 4HWTA 2BTOA 2DPYA 4HMOA 2BCJQ 4V24A 3T4XA 3CT4A 3ITNA 2A1TR 3O95A 2XMDA 3D8TA 3QVJA 3VZCA 1U9CA 4GOJA 2O1WA 3LC1O 3QFSA 1IQUA 4L6AA 4OXKA 3DS8A 4X1YB 4B47A 1KMQA 1RHKA 4U7PB 2RMKA 4CKBA 3KZNA 2PZJA 3LY9A 4F3KA 3IIIA 2W00A 3FOBA 3FRHA 3OM9A 4F4CA 4MP3A 1FTWA 4DA6A 4GX2A 3LDGA 4IVRA 1KIMA 1EWQA 5FYQA 4GRAA 3RB8A 1IWPB 3OZTA 3WXBA 2ZWOA 2AX3A 3GC6A 4DM7A 4DMKA 5JMTA 2IWHA 5DX1A 2G09A 3T5GA 1GG2A 3B6IA 1FDOA 2A1UB 3GEHA 1V45E 4UEJA 4E09A 2BKUA 1QPBA 1S89A 5T3UA 4L4ZA 1DKRA 4I9FA 3WAGA 1RPTA 3G8YA 2WNHA 2NO0A 3AEXA 2A92A 2ERYA 4YONB 5JV5A 3CNHA 5DTRA 5HJ5A 2F7SA 1DLIA 5JSZB 2XITA 1ZC3A 2HPHA 1U90A 3B1WA 3R7NA 1CY6A 1RCUA 4CIWA 5IULC 3K9FC 3LXMA 4EHBA 3NIGB 2R8BA 1RWNA 1PWZA 4B34A 5AM3A 1RXVA 2DBVO 1A4RA 2F1RA 3FTCA 3GRZA 3LXUX 3OAAA 4RTJA 1KSFX 1W2HA 1SA0B 4JNKA 2CDAA 1O9GA 1NPTO 2ISSD 1GGKA 2PIDA 4GZ3A 3P9QA 4R6XA 3RWOA 2W9XA 2QLJA 3H4VA 3UUWA 1H0SA 4IOLA 4FYKA 2R86A 1U81A 3GCWA 3OPXA 3VV2A 2P65A 1KERA 1N5DA 2BLLA 4NDAA 5BN5B 4CLOA 2ZYWX 4R05A 3WL7A 1ML4A 1W6RA 4D0GA 4AURA 1R18A 3HLKA 3M6FA 5IAKA 3LO8A 5F12A 2UU9B 4MYUA 1I2MA 4BAGA 3WQQA 2WNIA 1I32A 4WPGA 1ZNYA 4QNMA 5CVTA 5A9SA 5F3WB 4OHFA 3X2SA 4BEVA 4PTYA 2XCLA 1DC8A 2E5LB 2AIRA 5KVAA 1P0PA 3BSSA 2HSDA 1EGMB 1V11A 4EW3A 2K2QB 2VHYA 5CK4A 2NUTA 2MSWA 3CZ9A 3K20A 5B30A 4DUZB 5DHUA 3JTMA 2VSYA 3K0CC 4OM8A 4FOTA 3Q7TA 3N0VA 1MJ5A 1TADA 1BKDR 1TQ2A 3A6ZA 3LLMA 4Q3OA 4JI0B 1ECBA 4Y1RB 2IE8A 2YWJA 1CDDA 3SDBA 5UKDA 2OLKA 4E03A 2ZYAA 1KEPA 3N7AA 2OCGA 3OKPA 1VSBA 4HDSA 2IPXA 3V7NA 2IY9A 2O8FA 5EJ4A 2IWRA 2E0IA 4B4VA 4PQGA 1USVA 2ECQA 3F4BA 2ECOA 3CWCA 4QODA 3ADCA 2FPIA 1DG3A 4E1VA 2BZ1A 2L42A 3DO5A 3PUHA 4LOJA 1Q0PA 13PKA 3JWJA 2AOTB 1WEHA 1R8SA 4GPZA 4HYEA 2VQDA 3TTXA 1EHYA 3Q9LA 4K46A 4B75A 1NBMA 4HI0E 3UYLA 1RFGE 4ER7A 5E8JA 4B82A 3OU6A 5ICSA 3ZTWA 5KIAA 1RIFA 2PJDA 3SZMA 3LDUA 2WAAA 2A9PA 3FMIA 1FFHA 2CLSA 2AQKA 1A8HA 3JALA 1BX3A 2ADOA 1L4LA 3LBFA 4MQFB 1JF8A 1CLEA 3U26A 3ZXUB 1H66A 4D3FA 1TTPB 5LUAA 1AO0A 2IX3A 3QX7A 4JLVA 5LD2C 1SCDA 2IU6A 1P44A 3GJTA 1KZGB 2VNJA 5L4SA 1QIHA 4TQAA 1DEAA 2AH5A 1F2VA 2HBYA 4JUAA 5KNLA 3WRXA 5GQSA 1VHTA 2FN9A 1UBGA 4MS4A 4R7ZA 1PK8A 1AUPA 3CLVA 3O1LA 4LGVA 1U1DA 4WKGA 3ICQB 3C6MA 1PR9A 4IIVA 4XVCA 1MJNA 5JRJA 1VHDA 1OW3B 1YDGA 3GJ5A 3T5MA 4A73A 2OXTA 1TCUA 4JXZA 4OD0A 4R51A 3MYRA 2X13A 1U3GA 4LBYA 1ISHA 3U1VA 3A2KA 2FEXA 3FFAA 4Z3DA 4MUXA 2C99A 2W2OA 4K05A 3QKRA 4HEQA 4GKVA 3ICEA 1N8NA 2BHTA 2BL4A 4HRAA 4TUYF 4CWAA 3TUJC 3NLLA 1N8TA 1X1RA 2C5BA 2X77A 5JR3A 3KQLA 3IO5A 3SX4A 1VKNA 1RC1A 3ZDXB 4TMFA 3AR6A 1JJIA 2W8BB 5JXJA 2O7NA 2FQYA 1U6IA 3PRJA 3PNSA 3UMCA 4FDTA 1D4FA 3QFFA 2G0NA 1QGDA 1CK4A 1NE2A 1O9HA 1U8UA 1JEQB 4QYTA 2AJ8A 2AMFA 5GM2A 4GLOA 1Z8DA 4CKXA 4F45A 1Z4KA 1YUMA 1BWRA 4GGOA 4ZTUB 4DBLE 1THZA 3AVUA 1M8PA 1ZUD1 4G0MA 3IP6A 4RY9A 4DIEA 1OFGA 3TQRA 1XKQA 1T34A 3KJXA 1ID1A 2E4VA 3DQQA 1QE0A 1BEUB 1JA0A 3K8QA 3G5MA 4INZA 3CRVA 5G02A 1XN4A 2IEBA 4WESA 2QAGB 5IM5A 1QZXA 4CCAA 2QX6A 2IQ5A 1X87A 4H59A 5CCDA 2Q4RA 3A3OA 1AOXA 4Q1CA 4CFZA 4MAAA 2V54A 5HOEA 1I7DA 3BG5A 2WYHA 1C3XA 2Q07A 4QPPA 4B3IA 4DPLA 2J9YB 1VKOA 4PCAA 3M2TA 4WBNB 2BEVA 1F2UA 1DWUA 1FLAA 3BD8A 3W5VA 1E2NA 5C4GB 1COWD 2I7CA 4LI0A 4QYWA 4UM8B 5CYPA 3WIBA 4CMGA 3OEEA 5BVHB 5HR5A 2VQFB 2YUIA 1KWGA 1K66A 4DDUA 1GQSA 2O2GA 4NPAA 1SPBS 1VL6A 1JQEA 1PG5A 3PNLA 2YWCA 1YRLA 3T7CA 2HCBA 3P2IA 4R0VA 5TGZA 4O2AB 1PBNA 1K6MA 2VJLA 3LYAA 3OKCA 2BKEA 4FXPA 2RK6A 4ZO7A 3CVWA 3ZQKA 4UTXA 3TW6A 4Q6WA 4RHFA 3OZXA 2C8LA 3HCAA 2XT6A 3EXFA 4G4JA 5EE0A 2EJCA 5JWOA 3H1BA 1S8FA 1UT6A 1Z75A 2DM6A 3P2YA 4YMVA 2QX9A 1KS9A 3MNFA 4HXFB 3ZNOA 4EI9A 2P9HA 5BRAA 3ON5A 1PDVA 1U0RA 1Y9ZA 1PJTA 2JGLA 2RBKA 3F6SA 3LVBA 3PITA 1GPDG 4FMPA 1VL0A 1NI3A 1V9LA 2FF7A 3ITKA 5I5GA 5PNTA 3M3DA 3V8MA 1JI0A 3FUWA 4KWIA 4PCUA 5B3KA 2HA2A 5I4KA 3PUXA 3HXQA 4RPCA 5G41A 3KQUA 4HAYA 4KXMA 5LQRA 1VE1A 1ZBQA 4F60A 3WZMA 2IIVA 4WZAE 3QPAA 4ND4A 4Q39A 1YUNA 1RAIA 5E7IA 1PZHA 3BTUA 2X42A 3ELDA 3QFHA 4L5AA 3SSMA 3NVMB 2X40A 4ZT5A 2FOIA 2AE1A 2Q29A 2X0RA 3RABA 1UM9A 3JASB 2H7VA 5DHSA 2I2FA 3CE6A 3BH7A 3NBAA 3NZEA 1HOXA 4V0OA 4WZAA 4Y98A 5BQFA 2BRUC 2G25A 3B6MA 2HTEA 3HR4A 2R66A 3KJGA 4OGFA 4Q66C 4U3JB 4B32A 4DEYA 2NUBA 1E5QA 4UU7A 4LN1A 2WVJA 2H51A 2IFTA 2SNIE 4BECA 2CBGA 1WLYA 3W1VA 5KC8A 4R69A 3LPDA 4S2UA 1CUYA 1OZFA 2I2CA 2LPMA 4ZV9A 3B7GA 1TQDA 2FXIA 1F8GA 3D6UA 4QG3A 1J39A 2QF7A 4UNPA 5IXSA 1NW9B 1XVUA 2PGOA 4G07A 4BX3A 1ODSA 5ALSA 3S3TA 4B71A 2FX5A 4AMYA 4Q3AA 1GQFA 5EIBD 2IYZA 1U7WA 2ZT8A 5KAPA 3WISA 3B6KA 3SEQA 2TMKA 2V5AA 2CFOA 5EKDA 2HEGA 2VSXA 2P90A 3E81A 3ER6A 3FFTA 5ELMA 1G4HA 4M87A 3L8GA 5KSOA 2QAGC 2GN9A 3QG1A 4FGUA 4M46A 4NI5A 5CW1A 4GZLA 5E6RA 3WLNA 2UZ3A 3GOQA 5AT1A 4Z3KA 3RU9A 4TLAA 1JKMA 5DT2A 1JZTA 3UQZA 1Y8RA 4BQNA 2CK3A 4LJ9A 2WJWA 5JNVA 4U7WA 1OQAA 1SVIA 3DLCA 3DDOA 3A4IA 1N9GB 1N2EA 2L82A 3LHSA 3RVOA 3SP1A 1ZS9A 1Q16A 1EVYA 1Y82A 1SKQA 2WRZA 3H5OA 4Q1FA 6Q21A 4OQDA 3L5OA 2FPWA 3RRJA 4K0KB 2QTFA 4IMIB 1KEWA 4PNHA 1GPYA 5AR1A 4MR8B 1PKEA 4G85A 3ZIDA 1F60A 2MSEB 1ZJJA 1N1DA 4E30A 2Q5CA 4MDHA 2O20A 5JY6A 3TZEA 4F8EA 3WGLA 3ZZ1A 1XRNA 2JLRA 2WC1A 2O4UX 3IXMA 5FA5A 4DZRA 3GLIE 3HO8A 3NGXA 3RIYA 1ZK1A 5FHQA 4L4UA 3OWOA 4N0PA 4BU0A 2WM8A 2AJLI 4WCVA 2IXTA 1U3DA 5F35A 4XDGA 3A4NA 3C3MA 1YS4A 2HWYA 4DIBA 3K5PA 3GFOA 4UHBA 1T4CB 3AM4A 3OQNA 3FLAA 2VF2A 5TE9A 2GCPA 3KZXA 4NMHA 3LX6A 4D8YA 4EA6A 1GQQA 5DNEA 1XXHE 2XUJA 1AHPA 3Q41A 1M5UA 2GAOA 1VHWA 4E5DA 3PWKA 4LF8B 4MITA 2PH3A 2A58A 2WG0A 2OCLA 1YZFA 4Q19A 3L79A 3R3VA 1K68A 2RARA 2GNOA 2VJPA 3DCJA 3H2HA 3DR3A 3ORYA 1SO8A 3VU0A 5KQRA 3CNBA 4ON9A 521PA 4D45A 4UNNA 3WKAA 4PN3A 1RHQA 5D8DA 5JAQA 5G0VA 3P4XA 5EY5B 4N41A 2ES4A 2XMBA 1G5QA 3OJCA 1UXGA 5C1OA 4F71A 2P4UA 1VDZA 4Z51A 1EWKA 4TXHA 4DSTA 1P77A 4GLFA 4YHBA 4G0YA 2JLXA 2O6LA 1O8BA 2OV3A 2C9CA 5SZKB 3WYCA 3CIFA 3FPHA 5SY9A 2JAQA 3JZMA 1VE3A 3DNPA 4XTCS 2XUGA 3R0IA 4N54A 3GAZA 1JXOA 3LWBA 3G5AA 3KS9A 2G6TA 1YONA 2XUKA 5K5EA 4P08A 3BOSA 3K9WA 3FMVA 4ZOCA 3TLMA 4G0WA 1L7NA 2CV0A 2HJHA 1T13A 3A10A 2FB9A 1H6CA 4UDYX 4CBVA 1HF3A 1R0KA 3IVMA 1EP1B 4HZUA 1F51E 2JH8A 1AJEA 3T7RA 3QBTA 1R6BX 1GOTA 1UZUA 4K6FA 4QDTA 2UV8A 5JSQA 2GJAA 2PK3A 5EUBA 4YLYA 5U1PA 2VF4X 3G0IA 1R8QA 3MLBA 2HHHB 4H60A 2GHIA 3VO2A 3GA5A 4BIMA 4B2IA 2H1RA 3M9XA 1EUDA 2ZJ8A 4MA0A 1D4ZA 3OY7A 5KVCA 1U0TA 3DEFA 2FTKE 5L7WA 4DNOA 4DADA 2JI9A 1LVUA 3EGIA 3T3NA 3GEDA 1R6XA 3DLAA 4ARSA 3ADBA 2CHGA 1A82A 1NZJA 5M2QA 3MCZA 1T2FA 1XTSA 1ZD2P 2QZJA 3ZLUA 1BCRA 4G1CA 5KTYA 3DBHB 4G5OA 3KP1A 4QTXA 1RP1A 5ECYA 5FRDA 2XNHA 1CRLA 1TA9A 1XLWA 3CPEA 2UUAB 1GRNA 3WJ7A 5FAXA 1S9DA 1Q7CA 1XTBA 3MCWA 5DZSA 3C6XA 1YQUA 1BHO1 2QMHA 5DOVA 5TVGA 4DY4A 1TIPA 4NG5A 4C4OA 1H4TA 3D6MA 4OA5A