3LHFA

The crystal structure of a serine recombinase from sulfolobus solfataricus to 2.3a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
136
Chain Sequence
RKVILYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEEVCKAHGCEIVVINKEEELVEDLVSILVSFSGKLYGMRSHKYEKVKKCVEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Serine Recombinase from Sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Recombination
molecule keywords Serine Recombinase
total genus 45
structure length 136
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhfA01
2RSLA 3UJ3X 2GM5A 1GDTA 2R0QC 3BVPA 3GUVA 3LHKA 1ZR4A 1GHTA 2GM4A 3ILXA 5C32A 3PKZA 5C35A 3LHFA 1ZR2A 2MHCA 5C34B 5C31A 3G13A 4BQQA 1HX7A
chains in the Genus database with same CATH superfamily
4EYGA 4L5IA 4D45A 1K88A 5AM3A 3VQTA 5JQGF 1FTQA 2PTGA 2FUG1 3L7MA 2B4QA 2PE5A 3W5UA 5K2MA 2IYYA 4KFRA 4KQGA 1VLVA 2JGFA 4H59A 1RLTA 3QGMA 1LCIA 1SUBA 3H2ZA 1GLGA 3UW1A 5IU6A 1HF3A 4X7MA 4BMVA 3UMVA 2YVLA 3JZMA 3WMGA 4HLNA 4JAVC 4RULA 2YQ5A 1RJWA 1JW9B 1PV2A 5KQMA 2WG0A 5DHQA 1DEXA 4G5GA 2AFIE 4PHGA 1UMBA 2CLSA 3OCYA 4X1OA 5SYNA 2CHUA 2B8JA 3W7AA 4BAGA 1HE3A 2V7TA 4FGZA 1A82A 2R1VA 1K75A 4G1BA 3CH6A 3VPDA 4NJEA 1Q84A 4HDNA 2W2PA 1TLLA 1WSBA 3CVOA 5ALVA 3BB1A 4QJ3A 5HGXA 1XLTC 5JD5A 1JPJA 4MKRA 3SI7A 4S2EA 1G2IA 3FI0A 4HFRA 3SJAA 2NU6B 2QDXA 1M9NA 3GGJA 2AZXA 2Y99A 1G2QA 3NYWA 2XRMA 3HV0A 3QHAA 4HGOA 4MUEA 4PNHA 2CEKA 5EJ6A 1QQTA 2JA1A 4N41A 4PO3X 4CCSA 2M9MA 2ZREA 4LSWA 4NF2A 1VECA 3TLBA 1EUDB 5H3LA 2HADA 2FPPA 3UPDA 4JY7A 2BV3A 9MHTA 2I2DA 5HIIA 1I4EB 2WKQA 2ZVQX 3ZKWB 2E87A 2J9RA 5KTNA 2YWFA 4HGQA 2BFCA 4RDHA 3OCCA 3JQ6A 4TL8A 3D4PA 3DTVA 4P54A 5A4JA 3CLRD 3EAFA 4QYTA 2E0IA 3WLSA 1QIMA 3HEMA 3W5SA 4GDFA 4GGPA 4N12A 2HRDA 4DLVA 2JFBA 3D7RA 5JCXA 5KOHB 3M4YA 5K0TA 1W36C 3AVPA 4LNAA 5GJBA 1KDRA 2J07A 2GPBA 5H68A 4RK7A 1DKRA 4OQFA 5C32A 4J16A 4R4JA 2ZYRA 2QBYB 4JQOA 4RL6A 1IZ7A 3EVZA 5KVAA 1KMHB 3FWYA 3SXJA 2XGSA 1K4YA 1L4BA 2QTTA 3BQ9A 3Q1KA 3TAXA 3W6OA 1RNLA 1JBQA 3RF6A 2VPIA 3L02A 4MS4B 5C5IA 4FHZA 1G5QA 4B46A 5DSTA 5F1PA 1N32B 5FEUA 1EVIA 1JDVA 1A7JA 4QT0A 1N5MA 1US8B 1QR2A 5SYMA 3E1GA 1Y80A 4TGLA 1FQKA 2CHGA 2GK7A 2QLLA 5JCOC 4OM7A 1K7CA 1I4TD 5DN6A 4DC0A 3NBYC 3AB3A 3UAZA 4MIYA 1Y5IA 4QTZA 2RAUA 2HWYA 3FJYA 4L5AA 3TRDA 4QOSA 4MDFA 1A2QA 1A3CA 3L6EA 2E4YA 3IUQA 3V8PA 5BR7A 4E1AA 1AQYA 5TVKA 1TO6A 3ICEA 1KO4A 2RCYA 2LUOA 2QF7A 3SN6A 1Z6PA 4BC1A 2GR9A 1ZM2A 1OAOA 4XJTA 3QKWA 4O29A 4JB2A 2RGWA 3DZIA 1NBMD 2GMWA 4OYLA 1NNUA 5CP8A 3V3KA 1GDDA 3WZ2A 2PSHA 1JLKA 1HLPA 1YJCA 2FQQA 4YRGA 5AKZA 4N5LA 5LQNA 3GGOA 1NQXA 3U16A 2HSGA 3DMTA 4CQNA 2Z0MA 2XR1A 4HWSA 1K89A 2AOVA 4ZU3A 1FC0A 2E5WA 2ZJFA 4I7EA 4QUDA 3BB4A 3I1FA 2RONA 3B6MA 4KN9S 4RKWA 4KNYA 4UTRA 1ZR4A 1N1DA 4EW2A 4B76A 3F8SA 1KZ4A 3K31A 2CFOA 3M5PA 5B2ZA 4ZEXA 1UIMA 4M22A 5KAPA 4I3HA 3TDNA 4YAUA 1DRUA 1EMDA 3G9XA 1U8EA 3QX3A 3G2PA 4TMZA 1YT5A 2KSQA 2W6QA 4IP0A 1P4SA 3IE1A 4CJXA 3LXRA 1IDOA 4Y1RB 3HR8A 4NAHA 1JQEA 4KVFA 3ZI7A 1JS1X 1NYLA 3UPTA 4Y2JA 2HF2A 3KT8A 4FMDB 3FZQA 3VHRA 1B4DA 1YAJA 5KNBD 3K32A 3KKKA 4Y67A 3L4KA 1DQZA 2UAGA 1VBFA 1P1IA 3ENKA 2XA9A 1Y1TA 3BZWA 3AF1A 3E9EA 3NIDB 1M6VA 5IDYA 4N76A 1CB0A 2B6HA 4NRDA 5DNYB 3H04A 3KR0A 1RIIA 4I50B 2MYPA 4QGSA 1GZ3A 2FEMA 4IDFA 1P29A 4UC0A 2XDAA 1Q83A 2W48A 1ZD5A 3BFVA 3ETGA 2GF2A 4Q3LA 1XNHA 3D0RA 4NJEB 3VR5A 3TS1A 5IASA 2YVUA 4UTXA 2H2IA 4ND4A 1R6BX 3SAJA 3OCWA 2JGKA 1O95C 4IUCS 3VO9A 3WS7A 4ARUA 4DTCA 4HQNA 3CQ9A 5FV7A 4ZK2A 2R60A 1PR4A 2YV3A 3PNSA 3B12A 3MCTA 3UXMA 3LL7A 3NYIA 2ODQA 3ZGLA 1DE0A 4A03A 2AEEA 3S2YA 2OGUA 2GX6A 1E7MA 1I2AA 1JQJC 3P5BA 4LDNA 4N39A 3I09A 1WPGA 2JARA 5AIBA 1U0EA 1MT0A 1XYGA 2F1IA 3D8BA 3CCCA 1GTL1 1L7RA 2ZW9A 4PFJA 3VU1A 2FPPB 2WV7A 3EQ6A 2C7GA 3AL3A 4G4SO 1HQYE 3UMRA 4HDCA 2CUTA 2CV1A 1E3WB 1RU3A 2TS1A 1SXIA 2R6AA 3UMSA 2DPMA 4TQAA 5I9LA 1CX9B 1FLAA 4KMSA 4DLSA 3ZZTA 5A4MS 5EYPA 5LUAA 2HA5A 1R0WA 1ENZA 4CL2A 4X1YA 4JJ8A 4ESOA 1G4AE 2A78A 5KREA 3J81A 1VYUA 4UTZA 4YUXA 4KQXA 2DQ4A 1ZWLA 2QX7A 3MS2A 4QIHA 4WV3A 3L7DA 4IWNA 1RZRA 3PR3A 1NTOA 4I2NA 4Y2PA 4BY9E 2C4KA 1GV1A 2FRDA 4TSFD 2I99A 4ZODA 2OB1A 2FHSA 2YRWA 5HMMA 1U4SA 3DDCA 2EZ8A 3BMOB 1BFDA 3D5EA 3HB0A 4CKWB 1J5XA 2JIDA 4BRUA 2ZVDA 2HJRA 2HHCA 3D5TA 2E49A 2PFKA 3RS9A 4XLLA 1TPZA 1H5NA 2FYTA 4YTEA 4C08A 3O8RA 4KIWA 4BVGA 3N53A 4EKEA 4BNHA 2F3UA 5ENZA 1TKRA 3OFJA 5K8LA 3ILVA 3GNLA 5LP6F 3S8YA 3CVUA 3I58A 1UK7A 3EOZA 3T1NA 2BCGY 3AUKA 3VGPA 4IS2A 3TTSA 1QYVA 4RLFA 4EX7A 2C4VA 4QVGA 1DAHA 1OPRA 2YV1A 4LXTA 10MHA 4PTLA 4Y0VA 1KYXA 1RBYA 2DFNA 2B30A 4D8XA 4MA0A 1U8CB 2N46A 5JQGB 1JZTA 3DUFB 3S28A 1P0MA 2FF7A 2FLWA 2H92A 4C0KA 5LQAA 2NUTA 4RVOA 4I2VA 3OCUA 5B5SA 3OU7A 1XTVA 4AUMA 2J9GA 3ZN2A 4UTNA 1VXOA 2CNDA 4B4DA 2I3GA 3FROA 2OQIA 2ERCA 1QVAA 2OGTA 2X0IA 5C46F 1C9YA 4LV8B 1GRNA 1NRWA 2HF8A 3DVSX 4BQRA 2WSSA 4Q24A 4E70A 3OIWA 1UOOA 3PQ7A 4GECA 2MSWA 1ZXXA 2W8BA 2X8JB 3KJNA 3OLXA 2C5BA 1O7JA 4MQUA 3O4RA 2DPGA 4ZOBA 4LG1A 2CXHA 1I6MA 1E1NA 1SRQA 3SOPA 3EWAA 3VGJA 2IQIA 4IVNA 4J4HA 1GPWB 3WO1A 4A8JA 4PLCA 3RBAA 4AY5A 4WA8A 4E5KA 2G1UA 2GEUA 2EWWA 2POCA 2INGX 4PQFA 1QYDA 4LRQA 4MRAA 3FH0A 4TLMB 5GV7A 1H65A 3ZV7A 4ERNA 1UBLS 4F4JA 3V4FA 1FX0B 3F9IA 3N8IA 4Q82A 1KAEA 3LXXA 1BDJA 1E2LA 5CTAA 3VR1A 2J5XA 5ALZA 3WXBA 3UV6A 3WNZA 2FUG6 5K0GA 1G4HA 1EBUA 1Q91A 1XTSA 2OCAA 3EDOA 3SLGA 4TMFA 4HRVA 1E96A 1E1LA 3KUKA 2P5YA 4DA6A 3TVDA 2ORED 2Y76A 3IIMA 1E6EA 1RT9A 4TLDA 2W93A 5CEJA 1YVPA 3BBPA 2FN3A 1OQAA 2DKFA 4GR4A 4I4TA 3G7NA 3W4IA 2ISSD 4PPFA 4Q4HB 4UU8A 5BRAA 1A9SA 2BFAA 1YB4A 2I1LA 3HUDA 4OBWA 1K1EA 3CSUA 4MJLA 3INRA 1Z0ZA 3QFCA 4KQWA 3G7UA 5ALIA 1DC5A 1NVAA 4KAXA 3CVYA 4JLJA 4DUYB 2PVSA 1J56A 3LW8A 4QQ8A 1O6GA 4OMCA 1E5TA 4Y1GA 4A0SA 1KZYC 4PPYA 1E9SA 4DUGD 3KQNA 3U5ZB 3H87A 1N0HA 1XDZA 3G2IA 4Q1DA 1JQKA 4HAUA 2G7ZA 4TLAA 4L2IB 2FV8A 3IDSA 3IKTA 4EAQA 2CVQA 3FGPA 1CY0A 4PANA 3I5YA 1BHQ1 4DZTA 1Y6RA 3THWB 4W9NA 5DM4A 3HKDA 4AY4A 5L51A 1LTQA 4DV0B 2PKWA 3G2QA 3KPVA 2PUJA 2LWIA 3L79A 3JYHA 4FN5A 3GG9A 4QFDA 1IU9A 3ZTTA 1DX4A 3IQFA 3LSTA 1PFUA 4X44A 5TSDA 3OFKA 4URHA 4FNGA 4EVSA 2GUGA 4R8RA 4RVDA 3U9SA 3OPMA 4FTWA 2YN2A 4GPIB 2NSYA 1XMOB 3S4YA 2J4CA 1W85A 3DF7A 3LYHA 3URKA 1H3EA 1EH5A 1EDOA 3OICA 2IOHA 1PFWA 1B8NA 1I01A 3I9JA 3SPXA 5EZSA 5I9MA 1OXKB 6REQB 4K05A 2ISCA 1N2HA 2YMLA 1YU9A 1T2VA 3H8VA 5BSRA 4L72A 2Y9MB 4AXBA 4EG1A 3LWNA 2O0JA 4MULA 1XYYA 4EJSC 1LZKA 1MF7A 1LJUA 1XXHE 4WI1A 3WJAA 3AVQA 4XA8A 3PDUA 1T1GA 3N2YA 721PA 3V1KA 3GG2A 4CF6A 1QORA 2XZDA 4UEOA 5AWFC 2G0TA 4ER6A 3KE8A 4CN8A 2D74A 1IBCA 2VBIA 4JLSA 4GBJA 2HR1A 3M1YA 4MO9A 4MLPA 1YASA 3FHCB 4AYXA 1VL1A 1PL8A 2Q9UA 5I45A 1ZWKA 3V4SA 3GO4A 3TKYA 3KZVA 4F3CA 1TUBA 3W4JA 4D2IA 4W9NC 4MQFA 4J03A 5CYGA 5AW7A 1GARA 3HNOA 4A26A 4KGDA 2FZCA 2MYTA 2CWWA 1RLUA 2QTNA 3T7JA 3F8WA 3V2IA 2ZPUA 2ZRKA 4EJFA 1E2DA 4H3SA 3MJFA 2GYYA 2O7NA 4B83A 2W6CX 3GPDG 1W4ZA 3P9CA 4AJ1A 1R66A 2GJSA 5DGHA 4CQJA 4YHHB 1RZUA 3N0RA 3ZGYA 4D43A 4DRYA 2JANA 5TB5A 1OLXA 1BG6A 1DEOA 5I4CA 1DLIA 5JQWA 5I7OA 3KS9A 2C95A 3OTQA 4G89A 1Q11A 1Y0BA 2AFHE 1GLNA 1RWMA 3Q6NA 4I46A 1D2RA 1E3DA 2Z4RA 3GRYA 5HM8A 1PJLA 1NI5A 1Z33A 2DG2A 2DY0A 2BKEA 4INAA 3ETCA 1IEQA 4N7RA 5ALUA 3UB3A 5GVSA 4G2TA 1FDTA 3CUKA 4IXMA 4CI9A 1M34E 2UV8A 4D1YA 1WW8A 2ZSIA 2QV0A 2Q7DA 4KIGA 1PI3A 1JZSA 2FRXA 2ZT5A 3SBXA 3ETHA 2FPGB 3DE7X 3Q10A 3UMJA 2B3DA 4CETA 1AB6A 1JQ5A 2E7ZA 2E4UA 3OOHA 2E5FA 3H8SA 4WIAA 5K3OA 4D0RA 2OD7A 4B2IA 1J42A 1DKUA 2P75A 2DFDA 3AEQA 5EUQB 2FGKA 2GPNA 4FU0A 2VHTA 3SHQA 1BQ4A 2ZT6A 1X9IA 3K4HA 4CFYA 2VHZA 5LZ5A 4E5VA 1GTRA 4IJQA 1HT2E 3EWSA 2EZUA 1CDEA 3MWDB 5E9QA 2HK9A 2P6OA 4FDAA 1URPA 4OQZA 4Z3KA 2EFJA 1BO6A 2DUMA 2JGJA 3VJMA 2VH1A 2RGDA 1DRWA 1MORA 4OQXA 3RVKA 2P1RA 3CJQA 4IYJA 4JT9A 3H6GA 1M2HA 4BKRA 2ZITA 3K16A 4GNKA 1L1RA 3ZS8A 5CFOA 3FAZA 3RBZA 4M98A 5HOQA 3H86A 1DARA 2XYGA 1FW8A 5CM2Z 2FMTA 1SXHA 2WWFA 2X76A 4F92B 1DELA 1G3RA 3IODA 2I2FA 3GT4A 2PV0A 1SCNE 4XVQA 5E7IA 5J63A 1IBRA 3CGWA 2Q3JA 3HJGA 3I9LA 1J1UA 5E7JA 4OXKA 3FGOA 3PE6A 4E46A 3UAVA 4PPGA 4CT5A 1FFGA 3NGXA 5P21A 3ZHUA 5DOZA 1PVDA 3ILSA 1SXGA 3K6SA 5BVGA 5DLEA 4B8WA 1M54A 3R7LA 4UOZA 2QD4A 1F17A 2BUBA 4OFBA 4KVAA 3EZNA 2A9VA 2IRWA 4QUJA 1LF5A 2WF6A 3ZJYA 2G70A 1EK1A 3LMKA 1NDQA 2VK8A 3L9XA 1ZD4A 5ILQA 4NV3A 4LV6A 5J4VA 4LMBA 1IAQA 3SX4A 2QLJA 4WZZA 2WNHA 1T2EA 1YE8A 3TG2A 4I19A 1GKYA 4Z1OA 4IJWA 1AUQA 1NLYA 1M1UA 3NHMA 4QOJA 1FNMA 1Y5LA 1PX0A 1RCFA 4BVJA 3IV7A 5CA1B 3N76A 1K7EB 1K8RA 4ZDIA 3AR5A 4RTLA 5D3ZA 2Q4OA 5K3FB 4P0QB 2I87A 3K2IA 5D51S 1GTSA 3ZXXA 3PXXA 3WYEA 1U11A 2I7TA 2CDCA 4G36A 4OBXA 4LF6B 1RHRA 3PPWA 2A1UA 1C3EA 3A7EA 3OZ7A 1NULA 2ZGVA 3WLMA 4AF8A 2B1GA 3BTOA 2DFKB 3R20A 1USWA 5F3DA 1PU2A 1C29B 3V32A 5A3SA 4DANA 5JRJA 3UPUA 1Y8RA 3OZEA 3R3UA 1SXQA 2LBPA 3IP5A 3G49A 4X1IA 4PYIA 2G83A 3QY9A 2WF9A 1KEWA 4OHZA 2VK2A 3KKPA 5DIFA 3DL0A 1VYHA 5JBNA 1TKCA 1X2EA 3QXHA 5LWHA 1Z18A 1MH1A 4MV4A 4URZR 5LC1A 3QEMA 4GX5A 1NVVR 4IW3B 3O4FA 4I4NA 3V7WA 3IUPA 2GTIA 4CF3A 2RGEA 1U8ZA 5EJ9A 4G23A 4I4CA 3JASB 4O5OA 1HE1C 1AQJA 4COKA 3LHDA 2HU7A 1YS4A 4Q3OA 4A6EA 1PNOA 1UIRA 1KEUA 2W6JA 3IJEB 4M8IA 3LGAA 5E1BA 1CS4C 4DQDA 3RRBA 1T8UA 3WNCA 3DMNA 1C8LA 3WFZA 2HF9A 1THZA 3PC3A 4HXFB 4TLLB 2HDHA 4KQFA 4UXJA 4XM2A 1VCMA 2P2LA 4B3GA 1H22A 4H7FA 2X8BA 4F04A 2BFBB 4NCAA 3H5AA 3JQFA 3TH5A 1PGJA 2XNKA 3F74A 4KQ6A 5EAIA 5SZHB 4PCUA 2B4YA 1K3UB 2Q46A 2VHCA 4WY2A 1E69A 1FW6A 5AW2A 5DTIA 1VHLA 3I9MA 2VUHB 3LY7A 4O3FA 3E8XA 4U2BA 3ZLTA 5KZMB 4K9MA 1HDCA 1JR2A 1K3FA 1JA9A 1OILA 3EBOA 1UJMA 3KZNA 3VSAA 5B7PA 4D26A 4EM6A 1FDSA 3TAHA 1QS0A 1UBGA 1AKWA 4LHZA 4W8HA 1XQXA 5E4TA 1DIBA 5DDIP 2X9GA 3AMVA 3O03A 3CPHA 4QOHA 2GK6A 4BL5A 3HCCA 1ZSYA 1CRWG 2HHLA 3ODGA 1AKNA 2FWNA 1EGAA 2NZUG 3TL2A 1DJNA 3AWIA 4HWKA 4MWTA 5FPQA 1R18A 1L4GA 1RYZA 2WWHA 3B1WA 2FFRA 1AGPA 3EXHB 3JY6A 5IEBA 5BV2P 1HH4A 4KE6A 3TQFA 3CHYA 5UKDA 2IYZA 2WPDA 4C4RA 2EHDA 1ECLA 1V7CA 4FONA 3ZBUA 2I2CA 2QW1A 1N6LA 1I7LA 3D02A 2I78A 1W6UA 2AFRA 3HUEA 2BF7A 2CY0A 2H1CA 2V5UA 4L0DA 4RMHA 5BV8A 5KU7A 3AKCA 1LNSA 2VHUA 3CLRC 3HU1A 1EFRA 2XX3A 4H3VA 3WBKA 3W5BA 3NJRA 1MJGM 1E2UA 1D4AA 3B6ZA 3KSDO 3PFFA 4X97A 1U9JA 3WADA 3A6ZA 3G6WA 4I1OA 2D0PB 5SY4A 2VYVD 1QQ7A 4DNPA 1YZYA 3JSAA 2OILA 4H6PA 3TD6A 4AP9A 2I91A 2D2XA 5LYJF 2GUWA 4Z9BA 3E9YA 6ABPA 1J99A 3O9ZA 3G0DA 1Z5UA 4D3SA 4ZDJA 3ZK8A 4BB5A 5IF3A 2PIAA 1JG3A 4Q9IA 2H7YA 3SHVA 2B8WA 3VPSA 1Q1AA 5EVCA 2P9EA 4IZOA 3TNJA 3NBMA 2QAJA 4ZAZA 5IYZA 4LWZA 2IBTA 4LHXA 2OKCA 1IZ9A 5DLQC 3FZNA 2RD2A 4ZFNA 2Z2ZA 1JVSA 5FI1B 2Y1XA 1UQTA 2VDKB 1HQKA 4K6MA 2WHQA 5AI6A 1DUVG 1U9CA 4ZQEA 2YXNA 1M72A 5H4GA 3LECA 1V71A 1AQIA 2CNLA 3CINA 4R5MA 4PQRA 5CD1A 1CJUC 1DBQA 4RD4A 2P6RA 1UBKS 3NONA 4GBED 1W8IA 3N2KB 3NIBA 1R5JA 1USVA 3ROGA 4WN3A 3H7AA 1E4VA 1S01A 4TTRA 4EI8A 1JTFA 5A4FS 3QEBZ 3MTEA 3WDMA 2FY8A 4M7RA 5I9SA 3KOMA 3E3NA 4R0NA 4I66A 1XIVA 1ST3A 2K87A 3K0KA 2C0PA 1B16A 1VCNA 4LS3A 1BS2A 2A57A 3EIEA 1XTKA 3OY2A 4NG4A 2DH6A 4LY6A 4LI0A 1K7XB 4BASA 2QTWB 2QA5A 4O2BB 2DTDA 1A9XA 3TW4A 3P26A 2CJWA 3IV6A 4FKZA 3JRXA 4WLNA 1Q19A 1ACMA 5CXQA 3A8TA 5I8WA 3HDTA 1BDMA 4OLJA 5F9HA 2BMJA 2P9BA 2IBMA 4B9AA 2C5FA 3TQOA 4PU0A 1UJNA 2H7CA 1TIBA 3MLAA 4WJZA 2HZ7A 1ORHA 2IZ7A 1P9WA 3C5CA 4YJGB 4AO6A 4YMTA 1ECPA 3LUKA 2H7VA 3S55A 1DTWB 3TX6A 3IRUA 4P0PB 4EWLA 4ENPA 1VPTA 1N6OA 5F7XA 1AHPA 1PYGA 3OY7A 1ZD3A 2NVOA 3IR7A 3A9WA 2BT4A 4INZA 3T7TA 1IWPB 4A1OA 4N47A 3UJ3X 2O8BB 3KXIA 3C3BA 1G8AA 5EHIA 4B74A 1FCJA 3TSCA 3VTAA 1QO0D 2IDKA 2L42A 2YW2A 3ZHRA 4YJFA 4YRRA 1R3DA 2ID4A 4MJ3A 3R2JA 5TQ2B 3VU9A 1RLOA 4MWCA 1K8QA 4YNBA 1IUNA 2Z9DA 2BVNA 3R8CA 1GGVA 2ODPA 2RH5A 4ZOAA 2PXAA 1OA0A 4YALA 2ZWOA 1O54A 5C35A 3KZMA 3GX1A 1UC8A 2A1IA 3D9QX 3I5UA 3A32A 4UHFA 1LBEA 3KZXA 4Y1FA 2FP3A 4MAMA 4P53A 1Y3CE 4WZBE 5SICE 3OI7A 4RETA 1M0SA 2R8XA 2BC9A 1AHIA 2B98A 2HX1A 3E05A 4IMIB 4J0KA 4L22A 4YCBA 2ZKIA 4WBXC 3RU7A 4DLNA 3P20A 2DR0A 4RZQA 5IJ0B 4Q7JB 4DMHA 5IX8A 2WQ7A 1TEXA 3U0BA 4JR2A 2CXNA 2WTEA 1SH7A 2WM2A 3Q8KA 5LU8A 1RQNA 4D4IA 3KLNA 3TTTA 4E4RA 1W36D 4D25A 1R0CA 2HCBA 4NU0A 5FBZA 1K7SN 3E5NA 4N3CA 5JMTA 4OJYA 4ZVNA 1AGRA 3RVSA 4BXOB 2YTZA 4XWKA 4FE4A 5GZ1A 4UAGA 4HDAA 4BLSA 4HX5A 4Y6QA 2WF8A 4MV7A 5ALSA 2NGRA 2JI4A 1FFAA 3HMKA 4DMLA 4UHEA 1GITA 1T4GA 3PC8A 1ISSA 2C2GA 1GLVA 1UBJS 2G28A 3LUAA 3PDWA 4GT1A 5DW0A 2XKAA 5DISB 4B3SB 1OLUB 1LV7A 1XMXA 3AHFA 3S70A 1ECBA 2IWRA 4NU8X 3FVRA 1CE8B 4FGUA 1FRZA 2G7MC 1JWAB 2ZYTX 4IWYA 4ZHQF 1G55A 4O4JF 2HLNA 4W4TA 3ZD8A 3O8OB 1QHEA 3KAKA 1LRJA 3V4LA 3KP1A 5EMNA 3UJNA 2AUNA 3PL1A 5SY6A 1S2NA 1XZAA 5T4BA 5TGDA 3GDGA 3DVLA 3QF7A 4EKGA 1PT8A 1X1EA 2DQZA 3FYTA 4M76B 1U0FA 2FN7A 3EOAI 4XFDA 4UAVA 1KYIA 4J2OA 4DLWA 2FSPA 3VFDA 5FPSA 2OXTA 1CK4A 1LKZA 1Y89A 4BO3A 4AY2A 2JJYA 4L28A 4UDXX 2XMGA 1MHPA 5FNVA 3RJ5A 3TSAA 1MB4A 3GCZA 3OF5A 4H3HB 5A0FA 3QVLA 3WYBA 1KDOA 4N0MA 2VSXA 4GRDA 2H2WA 2N75A 5HKBA 1DQYA 2J08A 3I2KA 1UKYA 3E2MA 3LTEA 1X1QA 1GZ7A 5FHRA 1RBMA 3GBVA 1PNTA 2P9HA 3OP4A 5BQPA 5TPZA 3THOA 3BDIA 1T6YA 2PXXA 3L5OA 3U4GA 3ITKA 2AFHA 3T35A 1DNPA 3AR7A 6REQA 1VJDA 2REQA 1M8KA 2DCMA 1J2YA 2PZGA 3DCNA 5BSUA 5EHQA 5C8XA 1OLOA 1ZI9A 2J9ZB 4NTZA 1UBEA 4ZCPA 1NXPA 3TXAA 1QGUB 1U2ZA 3W3ZB 2I2XB 2V9ZA 5B30A 1R0KA 3CRRA 4YAKA 2JIZA 3WKEA 1DI0A 2QYOA 2G72A 2QM7A 4EFLA 2WSBA 3IALA 3U6KA 1P8AA 2XMRA 3TQSA 3TQIA 3ODPA 4WJKB 3PFWO 2ONJA 4F45A 3A9TA 2VJQA 3DEZA 2CXQA 4K9QA 2YIMA 4TWZA 1BX3A 2XB6A 1E79A 1EAYA 1SB8A 3PDIB 1D9XA 1NT2A 1U1GA 2QUAA 1QIDA 1LWOA 2BLLA 3KB2A 3LGSA 4JU9A 3T3EA 2CCKA 4LYDA 3UJPA 3VPCA 5JVDF 3JWHA 2EX4A 4H1VA 3PDJA 4H1TA 3CF4A 3PF9A 2VUTA 5HTOA 3BCHA 3RFXA 1VMKA 5CVVA 4BFWA 1JXOA 1P7ZA 3NKFA 2UZ1B 1JSCA 4QPDA 2FPKA 2IY7A 3WTBA 4ZPXA 1YMVA 2BGRA 2FOIA 3UUWA 1U5AA 4DPMA 3QKRB 1V3UA 4Q93A 1IRXA 1SNYA 3OTIA 4OMDA 1JLMA 4PQYA 2IHUA 4RKQA 1XLTA 4XCQA 2BZGA 2QLBA 3MERA 5EEHA 1JAIA 1JB1A 3NUZA 1G2PA 4K6OA 5E0OA 1L4LA 3IQIX 3UJ6A 3ITEA 1EXDA 3HY4A 5K7SA 5ETJA 5HX7A 1NP6A 3OURA 1TFUA 3V8BA 1PZXA 4GSKA 1QTRA 5EJEA 3AG5A 3PYMA 1QIGA 5JDCC 5I9NA 4EPTA 3GUUA 3ZLBA 4A4DA 2R68A 3IMFA 1H9BA 4HNUA 3HY6A 2J7PD 1BWSA 4LHVA 3PG5A 4P3KA 1YQGA 2Z1NA 2CYCA 1GKIA 2OFXA 3JQAD 4IDPA 4BVFA 4MUAA 3HB1A 5JAQA 3JXEA 2FK8A 2Q5JA 3QEKA 3PX3A 4WD3A 1NP3A 4B6JA 4IDQA 1OB5A 4FGJA 3OF3A 1O97C 3UJ9A 3IMKA 4Q3AA 1MA3A 3AEZA 4YH1A 4JUCA 2QI9F 1RI4A 1GQQA 3DE6X 3UAOA 3WMXA 2BR3A 4X00A 1PO7A 1CE8A 1QDUA 3THRA 3GDOA 4H4DA 3X3HA 3S1SA 4BVAA 1GV0A 3DVRX 3PJEA 2A5FA 2WVJA 1TA0A 5JS1A 1R4NA 2QD1A 3CY6A 3NWBA 2PS9A 3KQPA 3QUTA 1DBWA 2X0DA 1X7XB 3ROKA 3WR5A 4YYEA 2C94A 1IC6A 3TMKA 2ZT7A 4BO5A 2XTMA 4E4TA 3VNVA 3WK4A 5FB3A 5FI0B 3V4PB 2C0QA 4YQYA 1E64A 3HKCA 1P6UA 3TIFA 2IT1A 5KI6A 3G5UA 1IZ8A 3MBIA 1XO1A 4LK2A 1STOA 4KO2S 4MYTA 5T3YA 5C7LO 4ABTA 3CXUA 2DH5A 1UBCA 2JGMA 3CEAA 3FZEA 4H4EA 5CDGA 3TOZA 3FWKA 5BSVA 1J9EA 2WUDA 4JUDX 1GQFA 3C8MA 4I55F 5KYXB 4XI9A 3ZIUA 2CZGA 2QRJA 2Z30A 5BVGB 2OLJA 4GQIA 3NOXA 3OBIA 4ITVA 1SUDA 2WF7A 2ARKA 3PNMA 1XXHA 3FUWA 3DW1X 4R6XA 5ALRA 3EG5A 1BKDR 1DCMA 2WFZA 1S2OA 3ZWBA 4ILKA 3LY9A 1S0UA 2QN3A 3QV2A 4X95A 5CLIA 4ZVTA 2HJHA 5BW6B 4BFVA 3C6XA 3GUHA 3JQBA 2DRIA 2Q3HA 4Z7OB 5B1YA 3B60A 2F00A 1RM0A 1Z4MA 3QU9A 3WMFA 4MMZB 1MEEA 1VIMA 2AGVA 4IMJB 1BOFA 4EF6A 1N6PA 3E0XA 3AVUA 4YR7A 1AXEA 1PR2A 2PH1A 3B38A 4EW6A 3F46A 2B6NA 4KR6A 2BN4A 2QE6A 4IDCA 4WTOA 4LCEA 1H4VB 1AX9A 3W5HA 1AZLA 1YRWA 5BWOA 1M6VB 4X85A 2FEAA 2AD5A 2X5XA 1XU9A 4N9WA 5EQDA 2PZFA 1MOZA 5L9AA 2QJTA 4N0EA 2Y1FA 4M8NE 3D8RA 1T5IA 4RWZA 3QU2A 2PT9A 4ZI3A 1KIAA 1PJBA 5CCEA 1W0CA 4YV1A 2ENUA 3EY9A 2GBLC 5CU7A 2I2AA 5DU2A 2JFFA 3OZXA 4DFDA 2O54A 1MUUA 1KEPA 4B8ZA 1NF8A 2JKVA 3H9GA 2HSEA 1DC8A 4XIGS 4CM5A 5LD2B 1DKQA 3BIJA 1NXQA 4REQA 5EJAA 1RXSA 3BEDA 2FUEA 3NVAA 2C9OA 2NZ2A 2O2CA 5LYYA 4RGQA 4MTCA 3RQSA 1G60A 4CE6A 3A6DA 4JEMA 4EPYA 2NPIA 5REQA 3H0KA 3U81A 2E85A 2FX2A 3WL4A 5FUXA 4BMDA 2GBCA 3QU5A 4BJHB 3CXRA 4BWGA 4DN6A 5CNMA 4QDTA 3MIIA 4FFSA 3B5JA 4YK7A 3UAWA 4C0SA 1ZMXA 3VC1A 4BJ6A 4P7FA 3KD3A 3HWX1 4G4IA 3IEUA 4HEA6 1TLTA 5DCWA 5DYGA 4A2WA 4OX9B 2IK8A 3BWVA 3NC1C 4TV8A 4GOMD 1JFTA 2BZ1A 1ZD1A 5FUWA 1MQ8B 2AB0A 4CRWB 5HW0A 4TWBA 2UXCB 4LZLA 4ZV7A 1NVUQ 5JAZA 3PENA 3A1NA 3J7TA 1QCDA 3WRVA 1E66A 1G41A 5IKXA 4RMJA 3VMFA 4O33A 2Z5LA 3JAKB 1PGNA 3HHEA 4IJMA 4F12A 3H2JA 3C8UA 5KJEA 5IVKA 5ES3A 5LYJB 2AI3A 1NVXQ 3PQ4A 4J90A 1YB7A 3G0OA 2B0JA 3MGBA 3P0FA 1RXYA 3CZ5A 3P2JA 3HM9A 1E2NA 2ZWAA 3RVMA 3ZQ4A 5I7SA 1N1MA 4HUTA 1M83A 1P5HA 1SVOA 1GCAA 2JL1A 2WMOB 3ZCQA 1RP1A 2EBWA 2QVYX 3MBKA 4EY6A 4JOSA 1NW5A 2ZULA 2HYIC 1P9RA 1UM9B 1R12A 3Q4GA 4YCJA 1L4MA 1YR7A 5FOUA 1E79D 1GEEA 1WCIA 2XD4A 2IOQA 3L8GA 3ZCUA 4K6KA 1FSZA 1O1YA 4D0GA 4KIJA 5DEOA 3EVTA 4IEIA 4KR7A 4O2AF 4MUMA 4CL3A 4FDUA 1WBJB 4UUNA 1H8EA 4B2PA 1TA9A 5LFAA 1PW5A 3MAGA 1ZOIA 1XZHA 3PI7A 4IQ4A 4PXAA 3VR4A 5JD6A 3WGLA 2DBYA 4MP6A 3W34A 2K6GA 2DLNA 4M49A 3UWPA 1IY2A 4XPIA 5EOVA 3VC7A 5BT8A 5C37A 3FYUB 4HAVA 4BWYA 1U8YA 5LSAA 1BWRA 4L0MA 3MB5A 5JWRA 5JFGA 2CLEB 1XVLA 3U9LA 2ZYIA 2NQ2C 4LFAB 1LLFA 1M7GA 3BK1A 4FBGA 5IDWA 4G0WA 2G82A 3RC3A 1CQJB 3CB4A 3G8BA 2PD6A 1P2FA 1JMKC 1R64A 4IZHA 4BNGA 5I3ZA 1GUAA 1PKEA 2Y1CA 3L7JA 4ZZ0A 4JGIA 4KO8A 1TIPA 2FEXA 2Q3CA 2FEOA 1EFUA 3LY5A 4IJ5A 4S1NA 2BBOA 1SKUA 5F3RA 1LFAA 5BO5A 3PCTA 3R7WB 4WN9B 1H69A 2WU4A 1IE3A 1QR6A 3GLHA 3DLBA 2WPNA 4IGFA 1WY7A 3OJEA 3HYLA 2B99A 1XKQA 2NNLD 1XZCA 5AI0A 3AGQA 2CBXA 3KKQA 4YJ2A 3ZW7A 2YMPA 2J09A 1NJGA 4NZMA 1AM4D 3LRXA 4MHTA 3UA4A 3SM3A 1YOVA 2JLXA 2QVBA 4LQCA 3W05A 3RC8A 3M49A 3QY0A 1L5RA 1XN1A 3KFVA 4BN0A 2JPDA 1S89A 2V54A 1CZOA 4HEJA 2C2BA 4UM8B 2NPFA 3WBBA 1PZEA 4RAOA 5DTMA 1PV4A 1ULSA 2OPBA 2SKEA 2AZTA 2NV6A 3COVA 2VDMB 4CDMA 5HUJA 3TCXB 2BGLA 2ODAA 2PZAA 3EFEA 5KJ6A 4GFDA 1TL7C 3BG5A 4I55B 4ON9A 4QO8A 3A58B 3B3FA 3ZE6A 3RHSA 4JJEA 4ECEA 4ZT7A 1V4NA 4V0NA 2FPXA 2OK7A 5DRYA 1FTSA 1X1SA 2I6XA 5B12A 2ZRGA 1GZHB 4C5AA 2DR2A 3HN2A 1D7OA 5A2GA 5JARA 3LCMA 4NOKA 5DNUA 3KXKA 4BDTA 1B3RA 3WGNA 3I05A 2IS6A 1W46A 3DHNA 3O8CA 3WGKA 1JHZA 2DULA 3KIPA 1Y48E 4U7HA 5AJXA 3O4IA 2Q5HA 2Q5QA 5LP6B 5JSZA 1QHIA 4WJLA 1P91A 3DMHA 5K4GA 1TCAA 2KJQA 2BTOA 4G5RA 1YHZA 2WU0A 4JLOA 4QM7A 3H1BA 4XEUA 2YY6A 3OU6A 3E22B 3BXZA 3VC3A 3VO2A 1JECA 4MQ6A 1RWXA 2QRGA 2CNOA 4MQLA 1WW3A 2PWPA 1XTBA 3DG9A 2FWMX 5EWLA 2OOKA 5SZKB 3K9QO 4MRMA 4AD8A 4KC0A 3K70D 4RF2A 1J0AA 2DQKA 2PX4A 4CQLA 3N6XA 1B0PA 3F6SA 4IIGA 3KEFA 4K40A 4M9CA 1XPOA 1OLSB 1JILA 3ASVA 1FVFA 1VIYA 3DNMA 4XIFA 1QMPA 4KSCA 5DLPA 5GONB 2P4HX 2GCOB 5EJIA 1P7PA 4BFTA 3DOJA 4ZVMA 4BZZA 1GT91 3CW8X 4G0PA 4RCZA 3ZYCA 3EGXB 3MLBA 4L74A 1ST2A 4RLQA 1CNFA 2WIDA 5K6RA 1I7DA 2JIQA 2NTVA 1JEYA 1MVNA 1B76A 5LBIA 2X40A 4IVPA 4M1QA 4TL6A 2EBFX 5LD2C 5KJCA 1G63A 1FIUA 2OZKA 2H4HA 5D5QA 3AEUB 4FZ5A 4DCVA 4LJ4A 4A10A 2Q9CA 3U0VA 5HM6A 4AWAA 1EUYA 4QXRA 4ENQA 4O2RA 3M0EA 3ZY2A 4WEQA 5CLHA 1MPXA 1XLUA 2XW6A 4G4GA 1CTQA 1KJNA 3R77A 5AI9A 2VP4A 3K0AA 3HB9A 2QM8A 3WP0A 3RPEA 3T15A 4G81A 2VDWB 3NUQA 2AC7A 2FW0A 2GVZC 3PEWA 4IGAA 1YJXA 1P44A 1I30A 4Q4AB 1OFTA 1WM1A 4JC5A 1V8BA 5EMJA 2R96A 1GDTA 1IXSB 4JBWA 2NUTB 2UVPB 1LI5A 1L5GB 3FYUA 1UAGA 4OP3A 1H5UA 5DMHA 5TJHA 4DS3A 3GLQA 4E08A 3JCZA 3PIRA 5EN4A 3AVXA 2UYOA 4QULA 4RGBA 4DWOA 1XVTA 4EUNA 1U1CA 2C58A 3PTAA 4GI5A 2ZTVA 1RYDA 4MV3A 1G59A 4QOEA 3G7SA 4IG4A 1P72A 4BNNA 1P9LA 4PPNA 3EEFA 3W4KA 1NX9A 3ZDXB 2LW7A 2PU7A 1IB0A 2VF5X 4N3AA 3D1JA 4O59O 5CM8B 1N5RA 3AUSA 1VHJA 5DZSA 4UTVA 3AI3A 3UV7A 4KRFA 2KX7A 3V8EA 4N8DA 2CEAA 3DMTC 3HH8A 1TQ2A 4W9RA 5H02A 4OATA 2PSJA 2IIVA 3BORA 4DG8A 3AQ4A 2XCIA 2A94A 5JHHB 3BGVA 1N7GA 3S1LA 3G2LA 2Q45A 3WHIA 5JJKA 4N7BA 5MN6A 1EQ2A 4KFTA 1E8NA 2C4NA 5CNIA 5G0SA 3P0IA 3STTA 4ARVA 1M1YE 3FPCA 3OJCA 3RCBA 2Z8YM 3B1VA 1B42A 3CNBA 3O47A 1A4UA 5CB8A 1MMFB 4RW0A 2Q6TA 2EW2A 1RWVA 1N1GA 3NM5A 3ZWKA 3GPBA 1OC2A 4DNFA 1RKUA 3KUDA 2WC1A 1V9LA 4MW5A 4TT3A 3RVDA 4Y2UA 1ESZA 3Q5EA 521PA 3AESB 3IAUA 2C2WA 3HZHA 3LVRE 5MF6A 1HKHA 4QL3A 5AK0A 2I22A 1IYZA 5THKA 1QAQA 1T8SA 1WKVA 3PWSA 3H4IA 5DGXA 5KB3A 5KWSA 2FMKA 4LYEA 2GZ2A 2O8VA 2ZUFA 1OH5A 5L7TA 3KKNA 4RLHA 4BLOA 3HXOA 2XUKA 3G0CA 4A1FA 3U09A 1TVKA 1YE5A 5KKAA 2CBZA 3FPSA 4KLRA 3N07A 4A9AA 3HVJA 5JROA 2CL5A 4BGUA 3Q12A 2CB9A 2QMEA 4KL8S 1ONOA 1Q7RA 3HKDB 1OYWA 5D3QA 3WV4A 4BB6A 3V7NA 2X86A 3I1JA 4TTPA 3MQ2A 2B1RA 2V8OA 1H93A 1Z7WA 4C7KA 3BE8A 4ZHQB 4RELA 3Q6MA 3IDOA 3FCEA 1LK5A 5T41A 1KEZA 4HEA1 1OZFA 2YWDA 1W4CA 4M0LA 2B5OA 3BE6A 3HKEA 1MTZA 1WVGA 1N3IA 1WZNA 1YRBA 1FU8A 4NQRA 1QH9A 1V43A 2AD1A 2WTXA 2XVZA 4EHJA 3FKJA 3SG0A 4NABA 5IZCA 2WJ4A 4B9EA 3GU3A 5ALQA 1JDNA 3RC9A 2XRFA 2VKTA 5TARA 3RVOA 2QMHA 1WHTB 1ETHA 3SX2A 4J29A 1SBNE 1P1RA 2YOHA 4LY3A 4RTOA 3ESYA 1KWGA 2D8AA 2C96A 4R81A 1PWHA 5K3FA 5AVQA 3E03A 4KMOA 2G63A 2DCUA 4H2DA 4PYRA 1DBPA 1YJ5A 1RJ9B 4P32A 1F12A 4RE6A 1C1XB 2R66A 2P7HA 3BSSA 4FYVA 4MNTA 4WERA 5M34A 1CZNA 5J23A 3NM4A 1Z2PX 2XVXA 3EMBA 4PQEA 2V6IA 2ZUBA 3F0TA 2ET6A 3TLMA 2Q50A 5MGNA 1NBEA 5CEFA 2ATIA 2ZUDA 4JMPA 4UBOA 5HE9A 1IQ0A 1I3KA 5CDFA 2ZR0A 3VC2A 2P79A 1NBIA 4XIYA 4PAWA 1ECJA 1XU7A 4QPJC 2VDWA 3OVMA 4RHYA 2F43A 4LXQA 2HRCA 3RE1A 3TXXA 2QTGA 1SUWA 5HJ5A 3NP7A 3UGJA 2AJLI 4ER5A 3U7RA 4C7JA 2B2XA 1LBTA 6LDHA 1QCZA 4LDPA 4EPVA 5J4KA 1G6Q1 3ELYA 4F4FA 3PHGA 4PGHA 2Q5CA 2V5VA 1WUIS 1OT5A 3GVXA 4MP3A 3RS4A 3ONNA 2H4WA 3RLFA 1LDBA 5G2OA 4KKXB 3NWOA 3LDGA 3LDHA 5FLKA 5LA6A 2QTCA 5GM1A 5ITZA 1Z0FA 3OJ0A 2NZ8A 4IFEA 1TJPB 1AMNA 2AN9A 2IYXA 3ZJUA 5DHPA 4HMOA 5E8JA 3PQ2A 4TWIA 2A0UA 1QNFA 1F20A 3HQ4O 3IV9A 4CYMA 3ECCA 3RTEA 3TOVA 4DWVA 4BEBA 5H59A 5AT1A 3BXEA 4FUTA 3HFGA 2PUDA 1NURA 2CXUA 1FVXA 3A37A 5K8CA 2OFWA 3EZGA 5FUQA 3IB6A 3HXQA 1Z4JA 3AHDA 3DLTA 3ED5A 3JQCA 3KVRA 4KCGA 3TB4A 4F71A 5HZKA 1PHRA 3LA6A 4JLDA 4C0AC 4D9MA 3ZDQA 4DVGA 5DSZA 3TGPA 4R2HA 2X6RA 4AN1A 3F1KA 4PQGA 4URUR 4XGRA 4E5PA 1H4SA 4LXXA 4Y9SA 4IV5A 2Q2QA 3TLKA 4DDTA 2D2EA 3E82A 5AVVA 3HP4A 3ZE2B 2IEYA 4O1HA 4PBSA 4UEKA 2Q6IA 2GZDA 1A8PA 1UWKA 2BJVA 1YFZA 2QZPA 3C48A 3D6JA 3GV0A 3L1VA 5LN1A 4L6CA 1JTVA 4NCJA 2FQ1A 3BA6A 4IMRA 3M9LA 2VL7A 2OENG 4GIBA 2ZRDA 4TYQA 1E6MA 5TF4A 1XI2A 2PJUA 1HDXA 1JGTA 3OFND 1W34A 4JITA 4KUHA 4URYR 5BYAA 1NJ2A 1P2TA 1QYRA 2XF8A 4TMWA 3WGHA 4EP1A 4OSOA 2IF2A 5AYVA 1J8FA 1VPLA 1P33A 4UEWA 3IPXA 2A14A 1DQPA 4GI3A 1TW2A 1YIAA 1E9AA 1ES9A 4AB1A 3EHEA 2WAXA 4X3PA 1Z6GA 4EMBA 3ITNA 1EA5A 3O9MA 2C9CA 2MDTA 2ZSFA 3DR5A 3PDHA 4I4IA 4KLZA 4XD7D 2D1RA 2IELA 4P33A 5FTWA 5G4KA 3SCZA 1RAEA 1WF6A 5E9WA 1N9KA 4J0HA 4ZHQA 4DPLA 2HWUA 3N2EA 2QQEA 2QAGC 1LQTA 2GBIA 1MV5A 2RAPA 2RFLA 1RXEA 2XAUA 2WIJA 3ESQA 4AZ3B 3P4YA 4TUYF 4YN3A 5C3UA 3IVRA 1MRZA 3SOZA 2R4TA 1BE8A 2D6FA 3LPAA 4WE3A 3WTCA 2RBGA 1T9AA 3SQOA 4TM7A 4GR5A 1UPFA 4R01A 5B7QA 1PFQA 1Z7BA 3AZOA 4PYJA 1LXCA 2C07A 2ORVA 2C3MA 4D9IA 2IXBA 1D8AA 1QC5B 4GICA 3UHOA 2NXWA 1KQGA 2ID7A 2QRUA 3FWHA 3IQWA 3C39A 3LOQA 3PFGA 4R9RA 4YJHA 3WGJA 4EKNB 1DKPA 3O0TA 1UP4A 3HGMA 2AMLA 3DFZA 3W5VA 1H94A 3GLIA 3R9XA 4J76A 4HH4A 1W581 5AVWA 4N6OA 4EW1A 5F5LA 3L3BA 4NPHA 3ZZMA 4UUQA 5HPYB 2ZTLA 4UNIA 3KYDA 5DI9A 5G0VA 4I50F 3ZCXA 4H7KA 3E5MA 2I3ZA 1TK9A 4HAOA 4QRIA 1BHSA 3M83A 2PLWA 2AOTB 4LRSB 4ND8B 2XIJA 1O08A 2BR5A 5J2UF 2NYUA 4AXXA 2I8AA 4DCNA 5I5GA 2Z9BA 2RIPA 1GJRA 2I7XA 3WJ7A 1E6UA 3LUGA 1GYRA 3TCNA 4DG5A 4QGFA 4MPDA 3RYCA 4LBZA 4S12A 1XUOA 5D5PA 5DF1A 1SXJC 1W25A 1XEWX 2OC9A 2XA1A 3V34A 2GEBA 3UJ7A 4JI8B 2CDNA 4LRTB 4JI1B 3GARA 3M6VA 2VDQB 1GPJA 3NHFA 3AYZB 2A2ZA 4FMCF 4YRTA 3RREA 3VSBA 3S8EA 3GLSA 3EHDA 2PA0A 4YHBA 4QBHA 4HBGA 1COWD 1TQDA 2G6BA 4J0CA 4WX2B 2HREA 4RJKA 2YV4A 3V4OA 3M8KA 3PWKA 5A0TA 3FUXA 3OT5A 2KWIA 5IVDA 1YDMA 2YDYA 5C53B 1NASA 1DOZA 3GC6A 4FE7A 4LBVA 1FZQA 4EY5A 4DV5B 2A4MA 5KTTA 4FNMA 1GN9A 1UF9A 1SHUX 2I4TA 4GMDA 1XQVA 3OETA 3H9UA 3QNMA 2AYXA 2B7LA 2OCDA 2Q0XA 4KQ9A 5F1OA 3N3AC 3OJOA 1D03A 4FR0A 2JHGA 4PBRA 3AOGA 5BXYA 3W5CA 2EERA 2WILA 3C6KA 1YDWA 1XKXA 5JVDA 1M2OB 3BJMA 4H0NA 4C22A 4OHKA 4P6VF 1I2ZA 5CA1F 5DBOA 1SR8A 3FXAA 3F5SA 1N2XA 1ODCA 1B2RA 1AB5A 2D62A 5EI5A 3VNUA 2NZWA 3N6VA 1ODIA 2WIFA 2ZJ7A 2P67A 5AMXA 1F2VA 3QLVA 3LLMA 1QV6A 5CRIA 5KQGA 2Q6LA 3NLLA 1LDMA 1GRVA 2ZSAA 4IIBA 3WRYC 1Q92A 3WY9A 3X2FA 4DOMA 5CEEA 2G88A 3FCCA 4B48A 2J87A 4EGAA 1W35A 2YYYA 3KQHA 4MYHA 1YWGO 2WF5A 4M1EA 3JZAA 3VZCA 1F3OA 4NBUA 4Z0PA 2P8JA 2A5YB 4LKOA 1RRFA 1RYNA 4OCZA 1ZK0A 3IEVA 4GH5A 1L5LA 2Q5EA 3ONWA 3VNAA 4MZXA 1F8XA 1EGVB 1BC5A 2IXEA 5JJIA 3MJCA 4L9SA 2ZJ8A 1EX6A 3W1VA 2QB5A 1M34A 1S96A 3D7SA 4ER3A 3DFFA 1WS6A 4KTTE 2P68A 4GSLA 4X91A 3D3QA 5IABA 2OHHA 3F6CA 4GW3A 4JLWA 1JJFA 1FTGA 1V8ZA 1L4UA 1M1YB 2WE7A 3EXAA 3FSEA 3I3SR 3K09A 3RVJA 1IMOA 1YQTA 4ISCA 4PAOA 1TE2A 4RACA 3GNTA 3KO8A 5CIQA 3PGLA 4XD7A 3GAFA 1CBUA 1LW6E 2PGJA 7GPBA 5F64A 1E9FA 4K9RA 3OZUA 1QH0A 1SHJA 3SEFA 1C0PA 3NETA 1GZUA 2IWHA 1UJ4A 5ULLA 3T7IA 1F8GA 4PICA 4C20A 2C1XA 3VV2A 4P5EA 5EJ5A 1I5OA 3CEPB 2NT4A 3RHFA 3B1XA 2JK0A 4LY9A 4C88A 1FFYA 1P62B 4M37A 1LNQA 1HUQA 5DXFA 1EE9A 3DTTA 3TTYA 5COQA 1L7AA 1KFCB 7AT1A 1EBFA 1G5FA 1QHNA 4KH1A 4L5CA 1KI4A 4QTXA 4C1BA 3IQEA 1QYCA 4IDDA 1Y4UA 2ZE5A 3D8NA 3KR9A 1MEOA 3WXMA 5MFZA 4GBGA 2Q6OA 3DL2A 3IAEA 4YMVA 2ZUEA 1F5NA 1R6TA 4D9JA 3GT3A 4PGAA 2J9YB 1ZIDA 4QYIB 4E13A 1XTTA 4XKJA 2AC2A 3AU9A 5AJZA 2GEFA 3LPNA 4PLPA 1D4ZA 1CUWA 2Y77A 3I37X 1ECFA 2Z5FA 2QW8A 3RADC 1PUIA 1ZOSA 2EOAA 3T99A 1YR9A 1NUUA 3O73A 3B9PA 1GAQA 1PL7A 2CV2A 1PCXA 1P2GA 2VYVA 4ISBA 1DL5A 2HMWA 5F35A 2Q62A 1WUTA 3VAYA 1LX6A 3ZJ5A 5AHWA 2A30A 3ND7A 3D54D 3LUFA 4TXNA 1HFWA 1Q3HA 3BJEA 3ONEA 4IS3A 1BXGA 1NR7A 1ZD9A 1E2HA 3LIPA 4LQ4A 1I0IA 4UMFA 1WZEA 3TOSA 1IMJA 2JEZA 3A6EA 3OMXA 5AW5A 1H1DA 3L8MA 4I6EA 1U9IA 3U4CA 2P77A 4O5AA 2C4MA 5EWMB 2PY6A 4WH0A 16PKA 3KV1A 5KNCH 4B47A 3E2PA 1MCZA 4RESA 3IEXA 1CXZA 4H0FA 2BMAA 4PTYA 3ZWAA 4N5DA 4BNTA 1UDAA 1YDEA 3FWPA 4W5RA 1AQNA 4PV7A 1HR0B 4NDAA 4P0TA 4XR9A 3VYSB 2IW3A 3M6IA 1L4YA 4N49A 1LA2A 2IPLA 8AT1A 3BZBA 4Q3CA 1KYTA 2FW6A 3PQ3A 5FAXA 3VKGA 4FILA 1U6KA 4Z9XA 3DJYA 5JS8A 3DOFA 2AXQA 4IGIA 1DAKA 1ZG3A 3B52X 4BE9A 4JEUA 2BGGA 4BKPA 2Z09A 3TCKA 5FLXA 3WRWA 3JQPA 2Z5GA 3GP8A 2BY4A 4MIKA 2GAAA 3I2IA 5T3UA 4Q4HA 3R5SA 4W1PA 4XUGB 1X7YA 4EPWA 4JEIA 2O3TA 2WU3A 2BMDA 5EWJA 3SBDA 3K4QA 4Q4LA 5KNBA 3KSBC 1JQBA 1X39A 2GPJA 2PO7A 1SOMA 4OIMA 4HDKB 5JXJA 4BRSA 4AJ2A 2GD2A 2X6TA 3UTCA 4NXNB 2J67A 2F3QA 3ROEA 4C4PA 3PNPA 2VHXA 3HFSA 2QEQA 1C2YA 1G38A 4KXXA 3L4SO 4ZYZA 1UC9A 1E6WA 1NVKA 3IPYA 1GY8A 1ICEA 1V5IA 3LU1A 4E5SA 4B4WA 1LQUA 2W2QA 2IIBA 5IMBA 3PSHA 1XTZA 2GZSA 4IXDA 1G8SA 3ONFA 1ZW6A 3F6EX 4GPBA 5EY5B 3RVRA 1GRRA 3QVTA 4ZYTA 3MD9A 3KYBA 4NJMB 4ZV9A 4ES6A 2Z8XA 3O8QA 3PEEA 3RK4A 2YOGA 3UXYA 5DNEA 4EUEA 2HRBA 3ZLUA 5KOIA 1MPTA 4R9UC 4Y3UA 4LJ8A 5B36A 4PRLA 4G8BA 3B2EA 4WACA 5I7HA 4DV3B 2UXBB 2AYZA 3IT3A 1LS1A 4AWXA 2O8EB 4WKNA 3EMVA 4JWKA 3PVCA 1DADA 4B84A 5FQOA 2L82A 3ANNA 1JPNA 1TO1E 1XCJA 3QWBA 3T5DA 3WZMA 4OXNA 4DA4A 2ZBEA 1T8WA 5CGZA 2PMBA 4D0NA 3OPVA 3HCNA 5CDYA 3MHPA 2QRZA 3BHJA 5A62A 1ULZA 4O8CA 4RGYA 5AW6A 3N9IA 3OA0A 4TMXA 2H63A 1I1HA 3OM0A 4DT1B 2AEMA 2PZ8A 2G80A 3PZBA 3JARB 5BQFA 1RYMA 1A69A 2I03A 3H05A 4O2AB 1C1DB 3TD9A 1J24A 1AG9A 4L3OA 2HB6A 2W2LD 4HRYA 4J6EA 3RNOA 2JATA 2ACWA 4PRZA 1XTQA 2FKNA 1BSVA 4IUDS 2PUEA 4NMHA 1DO8A 1EEHA 2HMVA 1SUCA 5CB6A 2VXYA 3JVDA 4GLJA 4BV2A 1IWOA 1T3LA 1TTPB 2DR3A 1U0SY 2NV0A 4ICIA 4ROTA 2V6BA 5LDGA 1U4OA 1IG3A 1NI4B 4RGVA 2A6PA 3AJ8A 1NJ1A 1M6NA 1QHHB 4JP8A 3KE9A 4RORA 1C7IA 2AOWA 2AYYA 3ACDA 4XSGA 5DT9A 2FQYA 1NVDA 4HAIA 4KDRA 4L8GA 2QPAA 1H4TA 4RXUA 2G6TA 4UULA 4Z8YA 5LIRA 3KQKA 2QR5A 5TDHA 1JHMA 1SG0A 2H2DA 2O20A 4I5IA 3DEHA 2QL7A 4ZGGA 4U7TB 5M7EA 3BDAA 1SAYA 3EEYA 3A26A 4I5EA 5FUYA 4WKBA 5FOTA 1TCUA 3OHMA 1E0DA 5JNUA 4Q3KA 1T8YA 2PZBA 4EZEA 1V95A 2PJDA 1TCBA 1Z4LA 3LC7O 3QKTA 1I24A 1XF1A 5FL7D 5F78A 5LB2A 5TEWA 2YJ4A 1B43A 1K27A 5CH3A 3LI2A 3OQPA 4UTPA 1MC5A 3EARA 1GGFA 5F2KA 5G0UA 1Z9BA 5EMMA 1S3FA 5JUWA 4GX2A 5GGXA 2QS9A 3GJ5A 1NXVA 2E4WA 4TTTS 4B4UA 4W9MC 1OI2A 2QP3A 1T2DA 5H3CA 3FIJA 2RHGB 3M5DA 4QBKA 1O2DA 1F7VA 1F3LA 1RVV1 5IYZF 4M21A 4LVCA 2EDCA 4GOXA 1EK0A 3UK6A 1E6KA 2P9TA 1YI1A 3TIGA 3HCFA 2REOA 3E0QA 3PXDA 1CJMA 4XM1A 5TMEA 2AIRA 2ZYDA 4J0IA 1K97A 4R31A 4U7DA 1QHFA 1Y9AA 2R5NA 3RKRA 1NUHA 1V9CA 1CIPA 2XF2A 1X94A 3H3XA 3NG1A 3GLGB 2C7OA 4JBHA 4TKLA 1G5PA 2CXTA 4YAJA 4BQEA 4F85A 4LN1A 1WCYA 4CKYA 3CRMA 3NRBA 4JFAA 4HQRA 3THXA 5CLLA 1Y98A 2ADMA 2AQHA 2E6KA 2IYOA 3EODA 3OM8A 4JROA 1VDZA 4P86A 4ZVQA 3GP3A 4EBFA 3ETDA 2GVDC 1G8HA 3ANYB 4M6WA 4M53A 1G8PA 2A1TS 4GUDA 4RF4A 1H1LA 5FORA 5BW5A 2XEXA 1SXJA 1WCIB 1Z22A 3QOYA 5HKKD 4OAPA 4KAFA 2HMAA 5I7AA 3ZDAA 3QWIA 4RZUA 4M1ZA 4FYPA 1ESCA 3UT0A 4YV0A 3A25A 5JEDA 2BFDA 3LBNA 2HA2A 1PZGA 4PG5A 4QGGA 1Z8NA 1AV7A 2HPZA 2QJWA 3C4VA 2Y9PB 4FN4A 4IG9A 1OBHA 2K4MA 2RC6A 3EXEB 3RIMA 4UHKA 3E8MA 3H1EA 2QG9A 3LRTA 1PS0A 2P6MA 3EZXA 5B58C 4ZEOA 3PA8A 5LP6C 1T34A 2WJ3A 3N1UA 1YQQA 5BURA 1K9SA 1P0FA 3UMMA 2ACKA 4RKYA 4E7OA 4BQIA 3DT9A 1ZVJA 3K6JA 3FFAA 5DBHX 3RSLA 2Q1YA 4CKEB 4GLBA 3WKBA 5FH9A 1JQLB 1VSTA 1VFPA 3F98A 4FIDA 4JENA 4LIPD 1Z4OA 4PLVA 4QJIA 3T7RA 4A36A 5SZIA 3QMMA 1SN7A 4L4XA 3P9IA 4M7PA 1DKNA 4MRSA 5G1OA 4DLPA 4BHTA 4KRGA 1VE9A 2OBMA 3RT1A 3ZWXA 1K63A 5B57C 3I1YA 3SSOA 2E5LB 1N8KA 1GTJ1 3AY6A 3DLAA 2PA3A 4GP7A 2PT7A 5CNJA 5E6UA 3PDCA 5AVYA 2J33A 4PZLA 1VTKA 1JWBB 2Q3LA 5CBPA 4B6PA 4IF4A 2EKPA 1YFKA 3H2HA 4P3NA 5CA1A 1NZDA 2Q1SA 1GPNA 1T3ZA 2FXIA 2QNBA 4YJ2B 1H85A 3X1KA 2YN0A 1FE8A 1NPDA 3TDMA 3COJA 4W8GA 4EGJA 3OQJA 1JXMA 2I8CA 2R8BA 3DGEC 5L45A 1I80A 1P0IA 4CLHA 2P9YA 5F2EA 2JRLA 5ELXA 1ZUIA 1SOVA 1GXSA 2Q4BA 1YKFA 5FIUA 3TTWA 1IPFA 1C7QA 2GB4A 2PSSA 1GYPA 1RE1A 1KZ9A 1YBAA 2PWZA 1F2TA 1ZH6A 2X1HA 1M0EA 3HVUA 3SE7A 4Q9LA 2JGAA 2PU5A 3QJGA 2YQ4A 5KNDH 2D7CA 2R6FA 2WJGA 1FNBA 3DP7A 3W2IA 2FR1A 1AK9A 3HDQA 1J9ZA 1NM5C 4FEEA 3HEBA 4HNSA 5CURA 5EJ2A 4B3FX 4BLWA 4YCMA 1EVQA 1O9GA 4QXOA 2I2BA 1MRSA 1L4NA 1KO5A 2CUNA 2PMFA 5FPTA 1HMYA 5JAIA 1TVEA 3BF8A 2EL7A 2C00A 2PRJA 1UM8A 3AEKA 3BVPA 3HBLA 3A1DA 4JNKA 2VZ9A 3OPYB 4XUDA 3HZOA 2G9RA 2XWQA 1NC3A 2W2TA 1X80A 4J9VA 3G8YA 1SD2A 5FPPA 2VSQA 4BCDA 3OMWA 3MRTA 3QVSA 2E89A 4L16A 4HVAA 3ZU3A 3G2MA 2ZM6B 2ZEJA 1ZSVA 1WXIA 3MJHA 5EPOA 4FEGA 3GLFE 2V45A 1R16A 2EZ4A 2FUCA 3WGVA 3WSTA 3TGLA 1EBBA 2E1RA 4M1KA 2XVAA 1XRRA 3GNSA 3OE5A 4IV0A 4N5IX 2LDXA 1U7HA 2G1JA 3QE0A 3IIIA 3U4AA 2CT8A 1K8XB 3K92A 5GMOA 3KWFA 5LBTA 1XVUA 3CZRA 4WW0A 1Q2XA 3DEJA 1N78A 5JV5A 2WAMA 3PKJA 4M2LA 3QX7A 4Q3EA 3QLEA 7ABPA 4FYKA 2Q6VA 3EE6A 3HBNA 4G3XA 4YAGA 3VKHA 3MT7A 1E3QA 2C9BA 2XE8A 3T4EA 4RD1A 4JU8A 2Y1KA 2GPSA 4BMXA 3FLAA 4DR3B 1JEDA 3WIUA 3TECE 2JVKA 1N33B 4J1QA 4UNPA 2HFKA 3I30X 1K7YA 4NMLA 3THYA 1DDOA 4ZJPA 2H00A 4LQLA 4LHSA 2ZJBA 5A1TA 4DR1B 3K1AA 1JYSA 3AR2A 1D3AA 5JTTA 1TK2A 4WOCA 1VQ1A 3TOXA 5JANA 2IIQA 2A0KA 1EX1A 1UM9A 3AUAA 4MA4A 5EIHA 3FHOA 4NE7A 4NYMQ 3G23A 4JZYA 2PGOA 5CB4F 4UBNA 4AX4A 5J43A 2LRHA 3CGGA 1KXZA 3MTJA 1CQIB 2G77B 3WRXA 2W2OA 3ZH2A 3E9QA 5IDVA 1R74A 3WA7A 1TUIA 1IN6A 5D2CA 4BEJA 2GAFA 1KAMA 4JUIA 2ONCA 5I8PA 2AN1A 1T1RA 1UXHA 4YLYA 3GFSA 4GP9A 4ZCMA 1YR6A 2WD8A 4URXR 4FYJA 1SBQA 2ZATA 2ZB8A 2ZIAA 4XPIB 1BWQA 1QO7A 3OZSA 3M6WA 2PHZA 3F47A 4KYTA 3UKDA 4ZAVA 3RSSA 3PC4A 5K0CA 1JEOA 4ZCIA 5CDFE 3KELA 1PR6A 2WB4A 4TYNA 1VE1A 3NYQA 2ZI3A 2V4ZA 5B1HA 5EGSA 2O8DA 4KPYA 4OOEA 2EJWA 4RENA 4YI5A 4BNZA 4K87A 4H31A 1RPTA 5LNK1 2BCJQ 2QTAA 3FJOA 5LKRA 4JA0A 1F7UA 1B0AA 2WWIA 4MITA 4ZXPA 5J4YA 5AK6A 3MWEB 3S2EA 5LB4A 3AVTA 4MV0A 1L5MA 2DKNA 4M1SA 5KSPA 1M1NB 3JZFA 4QUBA 5HQ3B 3M4NA 4X0EA 1KK3A 2YZGA 1T8RA 4ZT4A 3DDZX 3L8EA 1C3JA 1VBNA 1DRVA 1PFGA 1RYEA 3AFOA 4RFVA 4B2YA 1UBNA 1O8BA 4J3NA 5HCUA 1DOAA 1ZR2A 1E3IA 1N2JA 5FEMA 2BTQA 2BSXA 2ZJAA 4Q3DA 2VSFA 3F6BX 4PVDA 3TLGB 1KEEA 3T3PB 5CW2A 4EB6B 3NOVA 3PGXA 1EUCB 5CYPA 1SU7A 3UUGA 1JFSA 2OLKA 2CXPA 3H2YA 4YP9A 1J9GA 4MVJM 4YRZA 2CZCA 4Y2RA 5AXBA 3WWEA 4C0JA 4JVOA 4CMHA 2GRUA 1OGJA 1ZK1A 1KF0A 4OL0A 4B6RA 4N01A 2C77A 4IMPA 4EHBA 4BFSA 4OGKA 1ZY2A 2X4LA 3DAHA 5EXSA 4A2QA 3PJFA 4M4SA 2IUTA 3L8YA 4BAZA 1XD2A 4TLCA 3ESAA 3VH3A 1NN0A 5AW4A 2NYRA 2H4JA 2E21A 4GI2A 3W04A 4C7VA 3NAZA 5EZYA 4D41A 4EBBA 4YEDA 3I4LA 4MCJA 3O2JA 5JS2A 1P4HA 4WADA 2EFGA 2VT3A 4EARA 4KV7A 3KQUA 2O50A 5DWDA 5C1DA 1VHTA 2GLXA 4MGHA 4NBNA 2JLYA 1PT5A 1YZKA 2PVPA 3OQVA 1DHTA 2QMZA 3A6GA 4OYHA 2H8GA 1T15A 3R0XA 3ISVA 1ONSA 2XBUA 6GPBA 3A1UA 3K9FC 1KPIA 4IAOA 2ZIZA 1COWA 1M67A 2BHRA 1U7PA 2CLMB 5ICFA 4D92A 1Z56C 3QITA 1L8LA 1QKJA 1SIBE 3KB6A 2LNDA 3WLKX 1C9NA 1MC8A 3OLWA 5F21A 4B81A 1A0OA 1Z5OA 3OLYA 4LSGA 4UDYX 4CQLB 3HHPA 3K8QA 4WLUA 2HU2A 4UE3S 3EBLA 3H9BA 3IGFA 4FIZA 2AFIB 5KOJB 1IY0A 5LIPA 4BIMA 4KR0A 2J46A 2VHEA 4XE5A 1JHQA 1XG5A 1O57A 4AKTA 4ZREA 3UGQA 5IBPA 2QTFA 3RRYA 3SICE 1FDIA 3I9V1 2D1QA 2C42A 5D3MB 2AG6A 2PUFA 3VJKA 3IO5A 2Z2XA 2PNFA 3MFYA 5TPZD 2PL5A 5KX5A 4QHTA 1TA4A 4U9HS 4AP6A 2FWJA 2ZS9A 1VCHA 3EVCA 4KFSA 2TMKA 3A31A 4LDZA 4G8CA 2XOXA 1SUFA 3P8ZA 1I4WA 1OIWA 3I04A 4HPWA 3SS8A 4HQKA 2LKCA 1BEUB 5IVPA 5AKJA 5JMOA 1W9MA 1BH6A 1P4RA 4Y9DA 3LS2A 3B48A 4G5HA 4QNNA 3U9TA 2A58A 3VUEA 2OM6A 2WM8A 3RG8A 1DDGA 3A70A 2G76A 2OWDA 2QSYA 3UXHA 2HLHA 1RVDA 1SK8A 2WJPA 4ENVA 2J3EA 1WUHS 3F96A 4GGMX 4DE5A 4ZAWA 3C7CB 5A5DA 2DQYA 1TM3E 2XWBF 2GJAA 4PYOA 4YT4A 2VJAA 3DNPA 1ZOPA 2FSVA 3GYGA 3P4XA 1INLA 5I7EA 2G4VA 5JSUA 2Q6KA 3ORFA 4CCWA 3OE1A 5FNVB 1ZCAA 1N3LA 3NTVA 4NBKA 2OFPA 6YASA 3MCVA 4ARIA 2Z3WA 3CW9A 1FSGA 1OX4A 3BRSA 4LRUA 5EKUA 5K8TA 2HV8A 2NU7A 1GG8A 3FPFA 4UEQA 5GQSA 3V5NA 3DZBA 4DV7B 2ZSUA 2FDCA 4WFQA 4JELA 1D6MA 1LDNA 1UZMA 4R41A 2WVAA 2W83A 1H0RA 2RGAA 3HLKA 4J3FA 4NONA 4KMMA 2UYGA 3TM5A 3EA5A 4TTAA 1L5OA 4MHOA 5EIBC 3EEOA 2WJIA 4JB0A 1G0NA 1Z2AA 2FJUA 4TXLA 3AHJA 2XITA 2P3QA 3EEBA 3I92A 3OPXA 1MBZA 3W9SA 1M8JA 1WPXA 1UWVA 4W6ZA 4RTKA 2JLRA 4PC1A 3A2NA 4W5JA 3TZEA 5KC9A 2BDEA 4JDPA 2FSSA 5EKXA 2NUPB 1VRWA 1I1OA 2P2NA 3QLUA 3ZI4A 4UDOA 2HY7A 3NH9A 5A7FA 1G5IA 4GSYA 3GRPA 1FUYB 5A05A 2GHQA 3OHPA 3QFFA 5DVZA 4NV0A 1RTKA 4LZZA 4X7PA 3K0FB 2GA9A 3NOOA 3NTOA 2ZDHA 1T9ZA 2XUGA 2J0SA 5EXDA 3MELA 1HDGO 4LF5B 4UBMA 2FU5C 2GLTA 1I7NA 3FCAA 4K1XA 3P19A 2NU8A 3EEQA 3C1OA 4X6YA 1W4BA 4RF3A 4TTVA 4CKCA 4PM4A 1PNRA 1NYRA 5TNXA 4RTMA 1WMAA 2CNWD 1UPBA 1VPVA 2ZQYA 2NT3A 2QM0A 3OFVA 4HAWA 4OBEA 1U0BB 1BFUA 1HO3A 1WMBA 4OD0A 1D09A 2CF5A 1YZLA 2FPWA 3QMPA 3UOAB 4ZKEA 3ID6C 1MENA 2OHIA 3VPHA 4W5OA 1NLZA 2KLBA 2ZB7A 3KWMA 3FLBA 3R3WA 4J1NA 5IH3A 4E5NA 4QTYA 2YWEA 2UVDA 2RK4A 2A33A 3LBYA 1BGVA 3GBSA 1QP8A 1E2QA 5M3BA 1ESMA 3ANLA 4BMYA 3T41A 2AQKA 2AWOA 3SEZA 4Z6KA 3HU3A 1T36B 2QG4A 2ZROA 3U4IA 2PJRA 1X7WB 5FJJA 1M2EA 3WZLA 4QWWA 1F1BA 2RB4A 5LJIA 4M87A 2QMOA 2UYQA 4WSOA 1A9PA 4CMCA 4CLRA 1PG0A 4Y18A 1T13A 5JR3A 3HA5A 3OPNA 1JSXA 5TQJA 4KE9A 5D5HA 3VPBA 1EPUA 1BD4A 1H3NA 1TMGE 2EYUA 2RI0A 2V9PA 1OVGA 2VTKA 4EYEA 1OTHA 3FOEC 1VG1A 2G25A 4L5BA 4ZRMA 1BFKA 1VA4A 1NV8A 4D3FA 4RZIA 1WMFA 4C2UA 4IXNA 5TT0A 2O07A 1W75A 2Y0CA 3USZA 4R1MA 3LO8A 3T54A 3VUFA 3AM3A 4CT4B 3ZGZA 2FQWA 1R4NB 3I23A 2QENA 5FKJA 4LDQA 4F3TA 3O90A 5IJXA 1CUGA 1A76A 1O9HA 2JI6A 5EP1A 3WO0A 3C87A 4HLQB 3MWKA 1PKXA 2B5VA 1Z25A 2VTVA 4MVWA 2GN2A 3DZGA 2VUSA 4G24A 3L8HA 3ZXUB 4S04A 3LHIA 2VAVA 3KQMA 3PGJA 4FSDA 2FI1A 1ZUNA 2VDNB 3DEAA 1T6BY 1CUYA 1SCJA 2EFCB 2GLUA 2HYDA 2R6DA 2VPTA 1Q44A 2LKDA 4G1UC 4HFMA 4C06A 3HJNA 1A9QA 2C97A 4P4NA 4W63A 4BNJA 5JRZA 2I4MA 2EJBA 3D8HA 3H2SA 1KRXA 3OFSA 1YDGA 1K6JA 4HJXA 2VXOA 3E7DA 4RC9A 4DEYA 1FFXA 3RUDA 3L77A 4JC8A 4YGXB 3SVLA 2IQ5A 1UXJA 1AKUA 1XZPA 4MICA 5ALOA 3TLJA 1ZUD1 2X8AA 5LMZA 3LQ4A 3TSYA 1QX4A 1F4LA 5JY6A 3GEGA 1NVTA 1FMTA 2C8LA 3KPWA 3LXMA 4HP8A 4YCDA 4HFNA 3KT0A 4YDSA 1N34B 3RS5A 1P4GA 2OMEA 2AC4A 3STWA 4D57A 4L73A 4JD5A 3MLEA 3R7DA 3FFTA 2FWRA 4AKHA 2H29A 1XEXB 3NHLA 4WOBA 2REQB 3WGUA 4WBNB 4BJ5A 4GYKA 4L9WA 3HKBB 1M75A 4IIJB 1VMIA 2VT6A 2K2QB 1F4VA 2PQ0A 2V7QA 2A9JA 3OJFA 2GAJA 3RSQA 4E11A 4LMPA 5EHZA 5K0EA 2F67A 2JFYA 3PSAA 2W71A 4DLBA 1JKMA 5D87A 1XWIA 4KWCA 2ZYGA 5D7BA 5AK5A 1X9GA 3T5MA 3K20A 2FMHA 4YRFA 1N3YA 1X19A 2D0IA 3O7MA 4LOHA 4CEHB 5JCJD 3AIMA 3NT4A 2EGHA 1XPRA 2R85A 3CH5A 3Q5GA 3PJDA 4K7JA 2R25B 3GFBA 4LJ6A 2EGGA 4XR4A 1WVIA 2C3YA 2H08A 4NYIR 1DIHA 1QPGA 3W2FA 1E4EB 1KMNA 2C82A 4L75A 2JJ1A 4ZIRB 2ASEA 2D2FA 1CC1S 5E3JA 3D64A 5E6RA 2XCTB 1NA5A 4EELA 5B3JC 4ALJA 5JALA 2YJTD 1YC5A 2WV9A 5I51A 3I6MA 2XHEA 2J9XB 3W5AA 2O2IA 5K3DA 1C41A 1V8DA 1YCGA 4OGGA 5HIAA 4DCCA 1US8A 4LJYA 2IUSA 2WYWA 1ODFA 2IW1A 4WZ6A 2C8KA 4PRKA 4UHBA 3G9QA 4D98A 3IUYA 1GPLA 3EFHA 3FX2A 3JD1A 3GBPA 3CRNA 2XXJA 4QARA 4BXOA 2Q41A 1B23P 1P7CA 2WW8A 3C7TA 1NHWA 1XK7A 2NM0A 1EFLA 2G9QA 2ONYA 3AFHA 3ND6A 4B2LA 4J6FA 3R8XA 3GP5A 3PUJA 5K3BA 1F0YA 1UOQA 1AIPA 4OLHA 4OP1A 1VC2A 1S2LA 2R8RA 1E62A 3MWLA 1T6ZA 1YFJA 3G5TA 4C6HA 1DXOA 3TJRA 3C3DA 3FBGA 2QTHA 3PC2A 3PIDA 5CW1A 5DX8A 2R1TA 3ZOZA 4P4TA 4G0VA 1EHIA 4R3UC 3FVQA 1OXBB 3JQ8B 4B3XA 5IJWA 4EATA 3W1EA 1ZA2A 1U2QA 5K6AA 3F7NA 2HK6A 2VHJA 2VS1A 4MJXA 4MV9A 5I6DA 1J2RA 4L08A 3RU9A 3HN6A 3N05A 4XSHA 3T1OA 4M60A 2NYVA 4PZ9A 1E7WA 4YDRA 1YMUA 5ESDA 4ZU1X 1HNNA 1ENPA 4UUOA 4A0RA 1HETA 1SBHA 2FEPA 2B25A 3ROMA 1E1KA 3HCWA 4XWWA 3JRNA 1A1VA 3DBLA 1Z7YA 4BZXA 3LDFA 4IRUB 2GJ4A 2VK1A 3MUOA 3IDQA 2FKAA 4KBYA 1W87A 2PBFA 4AN0A 2IH5A 1YZTA 3MS7A 1VLMA 4JYAB 1SIUA 2WA2A 1R50A 4XAQA 2PSFA 1FSFA 2Y1LA 1YRAA 2ZRQA 2RGRA 1SXJD 3GPLA 4C87A 3B7PA 3IVGA 3HN7A 3JPYA 2P9FA 1NMQA 5AHKA 4AKEA 4DA7A 2AX4A 3LA8A 4DRXA 1AHNA 1V37A 2CFCA 4BQNA 7REQB 1J6UA 3LT2A 2PRYA 4XYEA 1XHFA 4I1IA 2WEKA 3ZDZB 3ZHXA 5IAOA 3E1KA 4KPUA 4J2TA 5LMUB 4DV1B 2V3CC 3ZLJA 3UENA 3VNSA 3K9BA 3QVOA 5HQTA 1IVSA 5DCLA 1BXGB 5EIEA 2ZJYA 4F6RA 3E48A 3TR0A 5L53A 1UKZA 1EGHA 1P2SA 4EKIA 3SYNA 3IQZA 3KWLA 4MI9A 3T3MB 1ZNQO 4CW7A 4AZ0B 3AJDA 3KHSA 1JT9A 1M2JA 1Z0AA 3PHHA 4P08A 3KDSE 1XXHB 2MMCA 3PFKA 1W4RA 1K4MA 2QLTA 2XB4A 3PITA 2GSWA 4TLEA 2CZQA 1EE1A 1GFSA 1B8VA 2FLVA 1F1JA 3AX6A 4HTFB 4RTNA 2C5AA 4FR5A 2PK3A 4GXQA 4RK1A 4DG9A 3CMCO 4PX3A 5MGBA 1PX2A 3HDVA 3M2TA 4YCSA 2XXAB 4AZSA 2IP1A 2X9VA 1D2MA 1Q1EA 2Z56A 1KQPA 1T1JA 3NEYA 5CCBA 1YHNA 1ZIOA 1E3WA 2IY8A 3B1ZA 5AOAA 1ZIXA 3UN1A 4HNVA 4RTSA 3VRHA 3TTVA 2RARA 1I32A 1H9AA 1TQ8A 4BRZA 1XLWA 3VVBA 5K99A 2FB9A 2F3SA 1A77A 4AKIA 2OZVA 3D4IA 3NH6A 4NENA 4EPRA 3FOBA 4CIBA 1TYEB 1VCOA 4A5OA 5CG1A 2IH2A 4G4SP 3SQLA 1U0GA 2QRVB 5JG7A 2EWVA 3T3OA 5BOSA 3FDIA 3RYHB 5B4UA 1NVEA 1UJ5A 1KI9A 3FB1A 3PP8A 5AH0A 1GUYA 1Z37A 2NUAA 1WWKA 2PX5A 1A8QA 2Y67A 4H1UA 4HDKA 2HKIA 2I66A 5EE5B 4DQKA 4DQXA 3ZVNA 1AHHA 1XA4A 2O1XA 4XZ3A 2NU9B 4CKWA 1EFRD 5DYYA 3N70A 2C04A 2PT6A 3V80A 1JX6A 4OHBA 3C5HA 1XQYA 2Q2NA 4AM8A 2PEYA 2OORA 2CHFA 2R2GA 4JLKA 3PNKA 2E9SA 4FKBA 3EUWA 2CXRA 3WMEA 4B35A 4K9PA 4DJ5X 3NALA 4H6XA 3VOAA 3G59A 2IEBA 3BH6A 5F33A 1KYYA 3A4MA 4D81A 3REQA 4NX2A 3C7AA 3O8QB 3CCFA 3VKUA 3ZJTA 3QOFA 2NADA 1EHYA 3QH4A 2R2AA 4FXOA 2GNAA 4NP6A 2RC5A 4ZDWA 1XMSA 4MJ7A 2IEAA 3I62A 1JALA 5BNTA 4BZPA 4EAAA 1NXTA 1MIOB 4AECA 1KFBB 1TZ2A 2PD4A 2OYCA 4UQLA 1FJGB 4RA6B 3R74A 1CERA 4AFNA 3BKWA 3PFBA 1NW4A 5HUHA 1C80A 4N18A 2YMQA 1IBKB 2KLHA 4PPQA 5JPCA 1QFMA 4UZEA 2B2CA 1XJWA 2O2DA 4IDOA 1TMYA 2GAIA 2XGJA 4WXMA 5JNRA 3EG9B 3KZKA 4PRYA 1B0ZA 4C6RA 1FF9A 1ZDMA 1U7DA 2R7NA 2BP7A 3CZPA 3L0ZA 3WE7A 1WU7A 3QFTA 2BTEA 5GWXA 4OSEA 4MUNA 4X1KB 4RLSA 4HSEA 3DONA 1O0CA 2DUNA 1Z4KA 3FMIA 4EO7A 2J3KA 4CG1A 4Y6LA 2X8LA 3MS4A 4JFRA 4U7WA 3S40A 4A73A 4BEVA 1A2OA 4XVUA 4KDFA 3C7KA 5JFTA 3IMGA 1M7HA 4M86A 4YXFA 1DAMA 2NTJA 2VNKA 4ND3A 1SB9A 4JIMA 2DPYA 1NM5A 3L0BA 5EVJA 4TS9A 4X24A 5KVQA 4KQ2A 3MUFA 2BHTA 5AXDA 2D5IA 3CE9A 3RTBA 2PCJA 2R7MA 2XDQA 4QEZA 4JLAA 4MWOA 3A1WA 2P0YA 4S2UA 1MO4A 1V11B 3Q41A 1TUBB 3N8DA 1X0VA 1FFHA 1YXMA 2I1QA 4NH0A 4IHQA 1D2CA 1LVGA 1BAPA 3I52A 1JHOA 3BMXA 3COSA 3MBOA 5L4NA 3BF7A 1F8YA 2GN1A 2YWCA 4G5OA 2BZSA 3N8GA 5AM0A 2X2EA 4WA7A 3BXXA 2AS0A 3PPXA 3SX0A 3UAXA 2QUHA 3PEVA 1XKLA 1NQAO 1ZFNA 2XMDA 2XT6A 4TRNA 3UCEA 3QFHA 1KSHA 4A0QA 2YINC 2D2VA 1PQUA 2PAFA 3CX3A 1TAHA 1Z39A 3VVLA 3N5CA 4TLBA 5I7WA 1M5UA 4CR6A 2WJJA 3WLNA 3FUVA 2NSJA 3ITDA 2QP9X 2X9QA 4XUEA 4AUEA 2XWSA 3Q5DA 4G0MA 4H27A 4BC0A 3MA0A 1QANA 2RE8A 4OHFA 4MYSA 2AG1A 2HK8A 2HXYA 2J5QA 3QF4A 3E5RA 4FZRA 4UAUA 3THWA 5E0KB 1BGXT 5T4EA 1TZMA 3GZTB 3D3JA 3KDPA 4OXYA 8MHTA 2JD2A 4OQNA 1Q1ZA 4LZOA 4R0VA 1PR1A 3WSVA 1XAHA 3RIGA 5KYWB 3AETA 1P9OA 2QJRA 3HM2A 1H8ED 4QVIA 3NXKA 1CW2B 1N8NA 2Q27A 1U5BB 3IELA 4MQFB 3RNLA 3TDKA 1YZGA 2HGSA 2N47A 2AMJA 3FOZA 2GXQA 3QVKA 3TVTA 3B6IA 4HXEB 4UE6A 3T8YA 4YDQA 4U2GA 3ICVA 4JBIA 5H81A 1K6IA 1ZA1A 4UMVA 3WBJA 5EMLA 4GYJA 1XT6A 4K2AA 5JNSA 1QOQB 2VAWA 3MWDA 2REXB 1B1CA 4WXRA 1AKEA 3QWHA 2PG3A 1RRPA 3I5MA 4J0QA 1TYZA 1ZHHA 3KJXA 4TN5A 3AEXA 1NBWB 1N2SA 3BKXA 3DMYA 3I32A 4YPFA 3ZZ0A 2VCEA 1CRLA 4EIWA 4EEKA 3QBDA 2QRQA 1I2CA 2Q2VA 2FW9A 3L93A 4HRXA 2ACVA 4M9ZA 4BBAA 1F8FA 2AOUA 4MO2A 4Q3NA 2ANCA 4ID3A 5EXEA 1JIJA 1XZBA 3TNLA 4F1KA 3MGCA 1QTQA 2VBGA 4LVNA 5TE9A 3DVAB 2XNJA 3P71T 1I6LA 4NK4A 3HXLA 1MQAA 2VUIB 1VLQA 4XB1A 2R97A 3BSFA 4B82A