3LHFA

The crystal structure of a serine recombinase from sulfolobus solfataricus to 2.3a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
136
Chain Sequence
RKVILYARVSSSTQKDDLVNQVKYLEEQVKEYDQVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEEVCKAHGCEIVVINKEEELVEDLVSILVSFSGKLYGMRSHKYEKVKKCVEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine Recombinase
publication title The Crystal Structure of a Serine Recombinase from Sulfolobus solfataricus to 2.3A
rcsb
source organism Sulfolobus solfataricus
molecule tags Recombination
total genus 45
structure length 136
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhfA01
2R0QC 2GM4A 5C31A 5C35A 1ZR4A 1GDTA 3LHKA 3PKZA 1HX7A 3LHFA 1ZR2A 3GUVA 2RSLA 3UJ3X 5C32A 2MHCA 2GM5A 3G13A 5C34B 3BVPA 3ILXA 1GHTA 4BQQA
chains in the Genus database with same CATH superfamily
2CHGA 2X5NA 5DBIA 3AUKA 4M55A 1TQ8A 2PEZA 1I7DA 3W04A 2XDWA 4K9LA 1R5OA 3WRXA 1G8PA 3HCPA 1AGXA 3EDCA 3EQ9A 3NEPX 1CRWG 4AYTA 3R9IA 1IB6A 2I65A 2Z8XA 3VTFA 4YRMA 4ZIRA 5HRCA 3AVOA 2WWYA 1ZP6A 2HFKA 3KWMA 4HN4B 3U1TA 1Q3HA 1MJ5A 4C76A 3NHWA 1ZO8A 3A58B 4FNAA 2L69A 2WHEA 5ESRA 5FBZA 3W0LB 1IY9A 3TG8A 4HH0A 4OMFG 2AFIB 3VNBA 4JP8A 5K0CA 1GUAA 2FWPA 3B60A 4YAGA 3GARA 5ALKA 3VR5A 3W8FA 3UO8B 1ODKA 3RC9A 4CU5A 4JI2B 2PX0A 1Z8FA 2AOUB 2JHCA 4NQRA 3IPYA 2P2CA 3ZHVA 1B4DA 1NR5A 1UQTA 4AMZA 3KALA 2EFJA 3ZD8A 1FSZA 2F1HA 5FD8A 4UUAA 4DLSA 5A02A 3U44A 1QAMA 2ZSEA 4B46A 4WLEA 3U4AA 3ER8A 2WHPB 2AJLI 4PLZA 1HL7A 5LQNA 3KKZA 2ZE5A 3CPHA 1J07A 2X9QA 3ZXYA 1HLPA 2BELA 1CD5A 2GN2A 1NONA 4H35A 3RHFA 1UBMS 3CB2A 3LTEA 2XODA 5I9TA 4YRPA 2DP4E 3FNRA 1TLFA 1Q11A 1XPJA 3R75A 4B3CA 1V9SA 3GUUA 4CMIA 3PG5A 1T5DX 3DBHA 2YWJA 4QAJA 1QRSA 2QORA 1JIQA 1GRVA 1WS6A 3Q10A 3V4OA 2B98A 3NHYA 4E13A 3GRKA 1GDDA 4G2TA 3I2HA 5IT4A 4QRHA 2FSPA 1JJBA 4R1TA 3HR7A 4X5OA 5AYVA 1R88A 4CG1A 3CM0A 3KAJA 4KZPA 2Q5FA 3AU8A 3W1EA 3ESAA 4CV3A 2RBEA 1YS9A 4TLBA 1YZ3A 3ENQA 4LI0A 1Z8NA 2Y4NA 2QIOA 5BXQC 1PYDA 4NEGA 4ROSA 2QUKA 5DDIP 3M0EA 4B4DA 3GVXA 4F4UA 4N4AA 4LRUA 3E3NA 2E1PA 4MW7A 4DS3A 4Z9BA 3CPEA 1V5IA 1SKAA 1WZUA 2A9KA 4FYPA 3MS2A 5H7XA 3LI2A 2H8KA 5CGQB 1L9XA 2EG5A 2HRQA 3L4BA 3P20A 2I91A 3SJCA 1TKAA 4RY0A 5IX8A 5CB6A 3AUXA 1E1MA 121PA 1E5QA 3PB3A 2ZBGA 4FK8A 4U7HA 2QVBA 3G9ZA 1ZRSA 4ENVA 1K5GA 1DTWA 1N5IA 2GXSA 3QE0A 4HKTA 2VC2B 1XROA 1UP7A 4I14A 5HCNA 3RSCA 3WLPA 2AF4C 3O38A 1O4WA 2JLWA 1XEAA 3M83A 3DZJA 3VVMA 7MHTA 1USWA 2Q2QA 2BVNA 1FYFA 3LWDA 2Q28A 1K88A 2D7CA 3L6CA 4OXIA 3ZCUA 5A4MS 1FP6A 1PR4A 4ODIA 3EXEA 1I5OA 1M33A 5DXJA 3S27A 3TLZA 5JS7A 3SICE 2GCOA 5DHRA 1IN4A 4D56A 3OZTA 1OPXA 2VK1A 2W6JA 2HDOA 1KRWA 4BNKA 1W34A 3MJHA 1U4NA 4I08A 3VVBA 1MHTA 2BFCA 3HZHA 3WBJA 4I9HA 3EQ7A 3R7BA 3V00A 4CTKA 3THYB 1PF7E 3N75A 3NHAA 3HYNA 5L4LA 3IOMA 1TVKA 1X9HA 1HYHA 4MZXA 2R7KA 2VZ9A 1SKMA 3NPAA 1R66A 2ZBRA 4LEIA 1TD1A 1FMJA 1NW8A 3IR5A 3UCXA 5AIBA 2YX1A 1QCCA 5CEFA 5HIIA 1EFPB 1SCJA 1W2WB 5BYAA 1SRQA 3X1XA 4PSUA 2CLLB 1JUDA 1PL8A 1ZD5A 3PENA 1JB1A 5J5AA 2NXCA 4P9NA 3BCHA 3PUVA 2HLNA 4I6EA 1CFZA 1Y0BA 3B1VA 3C3AA 2PWYA 1CUYA 5IC4A 3B12A 1OX4A 1WXXA 1PZMA 4H6XA 4QE3A 3GLVA 4YP5A 3DLTA 2UDPA 3E3LA 5D3MA 5EIFA 3ESQA 5F9FA 1SB8A 1ZA1A 3F8SA 1Q1QA 2AEMA 1N8TA 2I0FA 1EKXA 2ZQ5A 4CL0A 4DAOA 4ZEMA 5HZKA 4MI9A 3WLMA 2WNIA 3I6BA 1UBTS 1JT2A 5FJJA 4BVBA 10MHA 3E61A 1XEWY 1XXHB 2A92A 3QLVC 5EWJA 3EVEA 2E49A 1AE1A 1WV0A 2TMKA 3NKVA 4O3FA 3ZU5A 1RW4A 1Y6JA 1N2HA 1SBZA 3KD2A 5IARA 4EMSA 1HFKA 4EYEA 4O4IB 2O0JA 4MOWA 4QJIA 2IS6A 1OU4A 4MTCA 5C5DA 1RYZA 5EAIA 4JP2A 4RK6A 5DN9A 3OICA 4AP9A 1UFVA 1XVVA 4LJYA 1W2HA 5HK8A 3R7NA 1VJ1A 4N7BA 3GROA 4TWJA 2PA0A 3DCIA 5HZMA 4LF8B 4PYMA 1IEXA 3CPJB 2C9MA 1Z36A 2IDKA 3WGHA 2F9MA 3HDQA 5L53A 1WMSA 3H11A 4MVXA 4TXHA 4MMXB 4EY8A 1XI2A 2PT5A 1DAPA 2ON6A 1NVDA 3HYSA 4ZICA 1HXHA 1BCSB 3H5TA 3RAGA 4DARA 5JS8A 1Q0QA 5FDFA 4NPAA 2B69A 4M3NA 1AGRA 1T5OA 3A31A 1GUBA 2EC5A 2PRYA 5GV7A 1CXZA 1K1EA 5DCYA 3PDJA 5AVXA 1I0ZA 4YP1A 5K0ZA 4TKUB 2GEDA 3ETEA 5FOTA 1Q21A 3UG6A 3EOBI 1DADA 2V5AA 3FOAA 4RY9A 5TQ2A 1RWVA 3ZUGA 1Q92A 4HBGA 4G1FA 3BF8A 3B5EA 2IZOA 3VYRB 1WCV1 5EHZA 1Y3FE 3CQ9A 5IZCA 2Z6VA 5LQJA 3CINA 1EFTA 4IWYA 1IXSB 1B8OA 3NCTA 1ZK0A 5IUNC 2ANCA 5DYNA 2J0EA 1O94A 5B1HA 3ZDFA 2ECOA 1PYGA 2XNJA 3NGLA 5HMLA 3R74A 5JD4A 1M6HA 4OM7A 1H05A 3E9CA 3G79A 3MTAA 1G6Q1 1UR5A 1E1QD 2X5OA 2P3QA 2P5UA 2XNKA 1PEAA 2WOOA 3FRJA 3KZKA 4IVRA 4NJMA 5CHYA 1O0BA 3FUXA 1EFKA 1VCHA 4EEZA 2Q3HA 1CQJA 13PKA 2VSXA 2ET6A 2Q1WA 2FRXA 3JVIA 2YHAA 2NV6A 1HDIA 1I2BA 2WVAA 9LDTA 1G5HA 2JGDB 1J24A 2X19A 1H5NA 2MSLA 2WIKA 3AI7A 1I4TD 2OLJA 2B1QA 2C3YA 1XJWA 2QJOA 3R3XA 4MQEB 4Z99A 1TU3A 4MUJA 2R5WA 1MAUA 2O0KA 2NX2A 3IMFA 4IJMA 1YJXA 5CXXA 1JQAA 4ER7A 3WMXA 3VHRA 1WCIB 3D3NA 1GXSA 3FKJA 1S9DA 3PLNA 5KCZA 4BWVA 2ZWAA 1PJLA 2X3FA 1RM4A 1CJCA 2C3MA 3UB4A 1S02A 1XEWX 2ZK7A 3RIHA 3FVRA 4JLAA 3OWXA 4E46A 4Q3DA 1TTQB 4OFWA 1OYOA 2GESA 4A23A 5EFZA 3HY6A 1BEEA 1FNCA 2O2GA 5FWNA 5KSWB 4EA9A 1A8HA 4ZD6A 3WK7A 3F6CA 3KJFA 5B4UA 1S5PA 1I1OA 3IUBA 4FFVA 4NKRA 3EC2A 3JARB 3OCYA 1RDFA 1Z75A 2O0HA 2GPSA 1XNHA 4A0FA 2JANA 1IFXA 1RXUA 2TECE 4IDPA 1C4WA 1UBSB 2Z0MA 2ZQZA 5JJ5A 3BXGA 2WNHA 3MWKA 2QVYX 4HMQA 4ZOAA 3GDHA 3WWDA 1AK2A 5GWXA 3OM8A 5IT0A 2JJQA 5A04A 3VTAA 3NYIA 2CL7X 3UXHA 3R44A 4OMUA 3VKGA 4DREA 4O8CA 1K0FA 4QLBA 2QOEA 3LVFO 3ZNPA 3RK0A 3EQZA 4X92A 1P4SA 3ECAA 3PA6A 3BXZA 4RIFA 1TEHA 1JR3E 2PSJA 2XXBA 5DW0A 5FTMA 3PT5A 3TB6A 1YQ9A 4ILEA 1NJ2A 2JJ1A 1I4OA 2G82A 4KX3A 4EBFA 2AUTA 1VBMA 4HTFB 4YALA 1T6NA 3IVAA 4P4TA 5PGMA 1OSNA 2LXNA 1VLHA 3T5GA 2A7QA 3OZCA 3L0SA 1BZYA 4CLOA 3ITEA 3T3OA 5AW0A 1TA9A 1POXA 1WP4A 4E4RA 3SC6A 3ZQ6A 1DG9A 5FOXA 3HA3A 2VDUE 4BX0A 5F9MA 3KTAA 2J3LA 3DD1A 4C0SA 4W1RA 4H16A 4DR5B 1W0CA 3AM1A 1DSSG 2BFDB 1PWEA 1U2EA 1UMDB 5DI3B 5F2OA 3H75A 4IJKA 3PS9A 3QVOA 3EQ8A 4US0R 1G5FA 1OFUX 5CM2Z 4XTCS 2W2LA 1I9CA 2YOGA 3BE4A 3WAGA 2F1OA 3NWEA 1TEVA 3CFYA 3OKFA 2V45A 5H81A 2Z6QA 2P4EA 3BXHA 4B3TB 1KP2A 3IELA 3T1YB 5ABPA 3R5JA 3RS0A 2AVNA 1AU9A 2ADMA 2H65A 3F9IA 3OCVA 2EG9A 1FLVA 4OLHA 3T7JA 4D82A 1XMJA 1XZNA 4KQ9A 4LTDA 2E6KA 1BE0A 5AJWA 3RYFA 1E2UA 3CF0A 2OWDA 3HUDA 3OOWA 5FPHA 3DMDA 2CW5A 3TQSA 5HKKA 3ASUA 2GPAA 2CLMB 4R2KA 2WAMA 5LUAA 1YMVA 1XKXA 1QYRA 2QT0A 3DONA 1NV8A 3GGDA 5B3AA 5BNIA 3WQRA 3U4QA 3OTGA 1B2RA 1IY2A 3W2TA 4YCAA 3OEHA 1NXTA 5FL7A 2PXAA 1U5AA 3CJQA 3F96A 1R0CA 4C5CA 4PG6A 3IUPA 2PUAA 2Y2UA 1C1DA 3TTTA 2A3RA 5DM1A 1VRWA 2GM5A 2J31A 4DZZA 1GV0A 4P0TA 1BCRB 5DRYA 1P29A 3P2OA 2MSKA 2K2QB 3A6ZA 4FMCB 4WBNF 2YMPA 3OSUA 3RHSA 1Z22A 3S7ZA 2GN4A 1DBRA 5AK4A 3R3VA 4Q37A 2X1HA 5IKOA 4B31A 2EARA 2G88A 4FKBA 3QE9Y 3MUFA 3DP9A 2XUPA 2VT7A 4JOSA 5CFZA 4PRYA 1PNRA 4B7ZA 1SXPA 2ODQA 2VBFA 3WWOA 1LBEA 4DCSA 1NUPA 3H1BA 1ENYA 3BHJA 3S8EA 2WQ7A 1ZUWA 3UMSA 5TX7A 3RVSA 3F4KA 1RJ9B 5BYJA 5AI0A 4BX9A 1H69A 4DB4A 1ORWA 2JGMA 4NOKA 4UUPA 1G4HA 4BUCA 4J49A 1GPKA 1P75A 2R3SA 4L51A 4FYJA 2FNAA 2HSGA 3HBAA 3I6QA 4DCUA 2B1JA 1XZDA 1CIPA 5BN1A 3ZZNA 4QJ4A 1MO3A 1ZXXA 2QTNA 3VYVA 1UBFA 2ZIEA 3A32A 2FK7A 2I8LA 3MCAA 1M0TA 4R2JA 3TGLA 3FUCA 4MMYB 3ZIAA 4QTTB 4X1YA 5IJ0B 1C2YA 3UJCA 3OE5A 5AK5A 5AKJA 1BMQA 1G1AA 5HF9A 1MW8X 3II6X 1PT9A 1W5FA 4YRCA 5EC8A 1NPYA 2A5YB 3DFZA 1ZITA 3SAJA 2W9XA 3SKXA 3V80A 4EQZA 4CEJB 2FN7A 2YWBA 4HSGA 1UFRA 4KYVA 3DDUA 4LNUB 4QQRA 5CFNA 6Q21A 1AO3A 3OJOA 4Q15A 1LW6E 4G0ZA 3SC2A 3PHIA 1XTJA 2DFTA 2Z6UA 3N2NA 2EBHX 1H8HA 3JWPA 4D9HA 3N2EA 4R5MA 1ONOA 2B2XA 5KYVA 3R9XA 1DRKA 1SVSA 2ZIVB 3ZK8A 1Y4ZA 1ECLA 1UJCA 4XWOA 1B0UA 3QVWA 1JRLA 2FN9A 1ND5A 4LUCA 3QEMA 5A3JA 3U3KA 4PO3X 4I66A 2YWRA 1CEEA 2PGLA 2PHZA 5JZOA 4PYNA 5JCJA 3RTDA 4AD8A 4BMSA 3DT8A 5CK4A 2LTAA 2HBZA 4MQFA 3ZV7A 4OUDA 2P40A 3CUYA 4GPIB 4OP2A 1CY7A 5DN6D 2VZ8A 4KQMA 4HXGA 3WQSB 2FP4A 1FJHA 1QV7A 2OBNA 4YBZA 1R6VA 4QGBA 5BRNA 4N41A 4L8FA 1BYUA 4B4UA 4M1QA 4GI7A 1J2TA 1PZHA 2R00A 4UTNA 2YJ5A 3GYGA 1T4MA 5H4GA 2CXOA 1U2GA 3QOFA 2RC5A 3ON5A 5DYWA 4JHLA 1OR8A 2R1TB 3W9UA 4ZMRA 2XCLA 3W2IA 2NO6A 1TPYA 3WG9A 2Y6VA 1E61A 1NN5A 3IERA 4TMZA 1XLTA 5HBRA 3JWGA 4G01B 3X44A 1JSXA 1UM9A 5CTAA 3OLZA 3HFGA 3JTEA 2I6XA 3O8CA 5ALDA 1I4EB 2Q3FA 1VQ1A 1XELA 4G2NA 1PG2A 3RO7A 3URKA 4FKZA 3WIUA 3LOUA 5BN5A 4EPTA 3N2ZB 1TFRA 1ZNXA 3WL6A 3NRJA 3Q8KA 5ESWA 1OYVA 2X8JB 3QWIA 2XCIA 1SO8A 3CMCO 3THSA 3VOBA 2ABWA 5IVDA 3ZD7A 1A3CA 2OOKA 1MIHA 2FPMA 2PX2A 2WJJA 3FGZA 2J41A 3KBBA 4LQDA 4YMGA 3PJEA 1AS2A 1SZCA 3Q87B 4QGGA 5JQGA 3WGIA 1GCAA 1G5QA 3DKVA 2M6KA 5BRJA 1YKGA 1YWGO 1WWKA 4JGGA 2A33A 4B3JA 3HDTA 2J0UA 4FFSA 1AD2A 2PT6A 4YPVA 1HDXA 3PVSA 4Q3OA 1KH1A 1G9SA 2WJHA 4QOHA 4PZCA 1U0LA 2ZIUB 2VYFA 5B2ZA 2HR1A 1J9EA 2P65A 1DOZA 1JILA 2ADFA 3E35A 1W87A 2G8LA 1X1RA 4JR0A 2ASVA 3DH0A 4PV7A 3S1AB 2F6RA 3ZGNA 4YREA 1FUUA 1XMXA 2VZEA 3C74A 1BVHA 4I1UA 3JSAA 4L02A 1LDNA 4A1OA 4MQ6A 1CUCA 4MWBA 4E94A 2OSBA 1Y4UA 2GD6A 1EBUA 2CLSA 4CW7A 1FTYA 1NXOA 1NC3A 4F3KA 1QHFA 3I12A 3KT8A 1A9SA 2R79A 3RJZA 5JLAA 2DERA 3FWZA 3IAHA 2NV2B 3DE2X 4P3OA 4LJ5A 2C1ZA 2DHQA 4XYMA 4KIWA 2D1TA 4FIDA 5HDQA 1CY1A 1GL9B 2PS3A 3D3QA 4GKAA 3TAUA 2WU0A 3BVPA 4M53A 1NW4A 4W7SA 3PXGA 2P2LA 1AQ6A 1LRKA 4INJA 2M6SA 4MEAA 4YR7A 2RC6A 3NBUA 4INAA 1KDRA 1BA2A 3EZNA 3SKVA 3MBKA 3IEMA 4DV4B 1NZJA 2H5LA 3C41J 1DIOB 3M33A 2IDJA 2Z2ZA 5JVDA 3ZNQA 3DB1A 1FMCA 1TZBA 3H2JA 2CY0A 4JT2A 1E1DA 4NMHA 4JJ4A 2D06A 3H8WA 3N53A 1X7WA 1CQZA 4KXFB 2GBIA 2Z57A 3W34A 1WXDA 4CKZA 1AV6A 3I3OA 1IZ7A 3UAVA 4Z4HA 1JQ5A 4JJAA 1TVMA 4RL4A 2PMWB 1B0PA 3NC0C 4ZQIA 5CXSA 1BDHA 2FTKE 3PDIA 2XD9A 3L8FA 5CG1A 1OXSC 1NFFA 4JC5A 1NUQA 3M3DA 4UXHA 5DCLA 1LJLA 5JZSA 1IUKA 3WK4A 4OQYA 2NO7A 4IRUB 4LJSA 1F2TA 3KB1A 1YJQA 1U2QA 3Q98A 3PE6A 4TWZA 3RWOA 2Q8PA 2C9DA 2QUJA 4AY2A 1TF7A 2PSSA 1R6AA 1Y3AA 3IEXA 4E5UA 1A77A 3EWAA 3MS7A 4GMKA 2QL6A 4DPLA 1U3UA 2KBEA 4JI5B 4I55F 5FF9A 2EDCA 3EA5A 1MD9A 3BIXA 3O2QB 3QFHA 1E63A 5C4GB 2WZBA 2QDKA 3IC5A 3R3WA 3TIVA 4J0FA 1PR9A 4BRWA 5J4VA 1JIKA 1PZGA 1WD5A 2AFHA 5MN6A 3M70A 2FUG6 1YDEA 1Z5ZA 3LFHA 3RBAA 3AUJB 1Q1AA 3CRVA 1UKBA 1YK1A 3NXKA 1IVSA 3ED5A 3I3SR 1X8LA 4DJ5X 2PCJA 3KL4A 3RYCB 2YXBA 3OZWA 3PPWA 4ZOBA 3WLNA 1JP7A 3I73A 2ROQA 3IIEA 1J90A 1LSSA 4B71A 5IAOA 1XQXA 4F45A 3EPKA 4KBYA 1DG1G 3HU2A 3HZRA 1E3JA 3JZFA 3LVQE 5HEKA 2C9YA 2GN6A 2EGHA 2VKQA 3IQWA 5IMSA 5JSZA 4Q05A 1TE2A 1ZJ5A 3RHTA 1TT5B 4HO1X 3NBKA 4CFSA 2D54A 4U39A 4JJEA 3PQ2A 3RV3A 5J4LA 2AH5A 2YMMA 2J67A 4WN9A 1IXRC 3DAGA 4Z4GA 2I54A 4RZIA 1YGPA 3LX5A 1QQ6A 1NQAO 2YJGA 1A7KA 2FMKA 2CMGA 3HBLA 2FSGA 3OLXA 5A6SB 4DHEA 5I7UA 4HAYA 1EE9A 2VTEA 3DYVA 5IDVA 4X9XA 3NTQA 3A1VA 4F4JA 3BL5A 1KPHA 3V9AA 4JP5A 1P77A 5LM3A 3EXHA 1ZBQA 1MN6A 1G63A 5TEVA 2O1XA 2QY6A 3FWYA 4MWZA 5SY4A 3R8XA 1PVDA 3LA6A 4DA4A 2CL6X 5HXAA 2DHCA 5B5SA 4DCCA 2CHQA 1XNJA 3L0OA 4Q1FA 1E7WA 1MQSA 1G6OA 4HC4A 2WYVA 4H15A 1BX3A 2FZKA 1SCUB 3AVPA 3FDIA 2DJ5A 4IKOA 1QG2A 5LP6C 1UFKA 2QUAA 5FOUA 1Q83A 3PI6A 2WMDA 3QYAA 1VPTA 4PHHA 5T64A 4B4OA 3NLLA 4MKFA 4G1VA 4Z4EA 2W22A 4PSAA 3OE7A 1P2SA 5CA0A 3PF8A 1E2KA 2XMSA 2PNJA 5IDYA 3PJGA 1O77A 1P81A 2ID9A 2RARA 3JD1A 2EZTA 1EM8B 5EJ5A 5CB4A 4HT3B 2FZLA 5A6VA 2YV3A 4NONA 5IM4F 3VHXA 4ZO7A 2CXNA 4TGLA 4Y9DA 3WBFA 4C0LA 4GI3A 3AJ8A 1DCKA 3ASYA 1U8CB 4RIEA 2IV7A 1YF3A 1ES9A 3O4FA 4IEEA 3SVTA 4AJJA 3PEWA 1R37A 2HQSA 4I1VA 4IX1A 2R6HA 1VIDA 1V45E 1P6QA 3DTVA 3F1LA 3G0IA 2FMXA 3OFJA 2OC4A 2CLEB 4U2DA 2BHLA 2WP0A 2Y0EA 1ZHHA 4S0ZA 2O52A 4RMNA 1IBKB 3NM4A 4F7WA 5KTKA 4QDKA 4UAVA 3F3MA 4DW8A 1KY2A 3IBCA 3JALB 2O2IA 3NVMB 5EXPA 4R9VA 2PIAA 5DULA 3OFKA 1DCTA 3K96A 3BGIA 4C7VA 2A30A 1DFGA 4CMBA 4QASA 1KQPA 4ZDWA 3ZYCA 2JJYA 4LF6B 2PVCA 3C85A 2RKOA 3P32A 4OVKA 2QL5A 1YR6A 1T2CA 5B55A 1SQGA 3WR5A 1ORDA 3PC8A 1B43A 4LRTB 4X0EA 4XB1A 1H8ED 4YH1A 3WKEA 3QELB 1E2MA 3P4XA 3T38A 1UBOS 3KKEA 4Q3NA 3PWZA 3UPUA 1WW3A 1E99A 3VR6A 1FSSA 3JWIA 4ND3A 2FE4A 2IZ0A 1FYWA 2AA3A 1XNRB 4MTLA 4DMFA 4IDAA 1PL0A 2E37A 2OUIA 1I3KA 3GGJA 4EI2A 3O1HB 3TPFA 1X8KA 1JPNA 3BYZA 5F9HA 2CD7A 1J4AA 1DEHA 4B4WA 5JYBA 1J39A 1X92A 4LJLA 5AVUA 2YHIB 1YONA 4I50B 4EF6A 2BC9A 4X20B 1JHMA 2GK7A 2H1LA 3PWKA 2IH2A 4CI9A 3GBVA 4TV9A 2C2XA 1SKBA 4W7IA 2UYHA 1ZC3A 5LJLA 2IUTA 5EQDA 3HKEA 3ZWVA 1M34B 2ZDGA 4N0DA 3V2IA 1ZGJA 3MCTA 2QRGA 3EB9A 2A6PA 2ZBPA 3NBZC 3U5ZB 3OQPA 2A9OA 3SX2A 4BV9A 4B3GA 2QX9A 5BWNA 4WOKA 2PZGA 3DO6A 4HWOA 1QH8B 2H00A 1BGWA 1C7RA 1KZGB 2YVKA 3BM5A 1DKOA 1MX9A 4M1SA 3SIRA 2PUWA 5AUPB 2IYQA 4X54A 1FNMA 2QRUA 4NJEB 4LGCA 2CMHA 3P9YA 1UBEA 3GXOA 2XOKD 4C01A 1KP9A 4ARCA 4Q00A 2PH7A 1P62B 2CV1A 3A0RB 2XXAA 2BMDA 5K8CA 1JNYA 3D6JA 3UKJA 3CZ9A 1R8SA 2O8BB 1IHDA 4XM2A 3SXUA 1EGAA 1Y9EA 4LTNA 4XCXA 4DGSA 4C29A 2AC2A 3CUEF 1UMBB 2H16A 4TN1A 1XTUA 2OZEA 4QPJC 3HCWA 3K1AA 4CMGA 1O2DA 4Q4DA 1QTIA 3D2LA 3E27A 4GLLA 1YE3A 4DUYB 3RAFC 1AGYA 5JWHA 1UM8A 2PU5A 3IMKA 2X3YA 3UUFA 1SCNE 5C8DA 2CBXA 1GGEA 1KI6A 4YJ2F 4RZUA 4ZU3A 1Y3DE 2IV2X 2NYUA 5H16A 2HQ1A 4Y6PA 4N40A 4G5YA 4LX8A 1W47A 4W8OA 1DAOA 4WOBA 4LS3A 3KZXA 4CGYA 1T1EA 3OZXA 1Q3TA 3PUYA 1G9TA 1IHPA 4H7EA 3ASZA 4C0XA 4D9FA 1SIWA 3NM5A 1NXWA 4J1NA 4ZA2A 4DMGA 2AT1A 2GDZA 3IA7A 4PLPA 1DIBA 3IPRA 3VX4A 2P6MA 4ZT7A 4UNIA 4UATA 5KVVA 2HRZA 1DIGA 3B82A 2VF7A 1PSZA 5FTWA 4D4IA 4HD8A 3EXFA 1BWRA 3OOJA 2QTCA 2QR5A 4G9EA 4PZLA 5F5LA 3AI3A 3QUQA 5DBGA 5JJBA 3F73A 2W2MA 1CU1A 4G5HA 4J6EA 3LKBA 4KHZA 3IUNA 3W5DA 2NVUA 1QP8A 1BFDA 4U7JA 3PNPA 3R3SA 4MRAA 4C3ZA 1DEXA 2CUNA 3EMVA 1PT7A 5KZMB 2ZCUA 1AF4A 3WNQA 3KQUA 1JX6A 4QDOA 1NMSA 4FFDA 3R9KA 1MV8A 1LY1A 2R1UA 4IHKA 5EFOA 1EMDA 4WV3A 5H83A 3FTNA 1K08A 3PFWO 4B75A 4CUZA 2N46A 1QQAA 4TVBA 3BAZA 1I0IA 4B6PA 3R5KA 2GZ2A 3TIXB 5JH7F 4GOKA 2RH9B 4N5NA 4AJ4A 3MOIA 1Q17A 3TTWA 1YFLA 2FW1A 4Q7LA 1OPRA 4DQUA 5AI5A 3EHDA 1RR6A 3ZDZB 5I7VA 1F3LA 3IYLW 1P17A 4C03A 1YRQA 4JLSA 1CWUA 2ZUUA 3Q3JB 4IVPA 3NP9A 3RDPA 3FZEA 2HSWA 1C2TA 3H5WA 3G1WA 3SQNA 4NEHB 1MNQA 4YA6A 3W9YA 5CYOA 3EZ9A 2JL1A 4B33A 2Z6AA 2JF0A 4GOXA 3RG8A 3GFBA 1L7DA 3BMQA 1TD9A 1QHYA 2VJAA 5L7YA 2JJ2A 3QMWA 3TZ6A 2HWWA 3JAKB 3TLBA 1Z5OA 3AF0A 3TLGA 2XB8A 4DNFA 3LT4A 4RJIA 2C94A 1N7JA 3E58A 3LXUX 4AZ0B 3KQHA 1KYVA 4EO7A 1GZUA 2P75A 1LPOA 1SU6A 2PX8A 3N2IA 4HDKA 4N7RA 1BH2A 3ZQ4A 3EBLA 2HTEA 3A11A 2BR5A 3W4JA 3K1YA 2PS1A 2IHNA 2ZRPA 3JYNA 3MCWA 2YHSA 1TLTA 4HZIA 1OBHA 3FCEA 1EVKA 2YFHA 1H22A 2GD1O 2PSHA 2IXAA 2YZ7A 4DUGD 5LQDA 5ENDA 4KR0A 2ESRA 3T5MA 4XIYA 3B3GA 4A6DA 3SYMA 4BB5A 4H7DA 4LYJA 1N2GA 2BGIA 1L5KA 3M89A 2AG0A 1WMBA 2GM3A 1QHHB 1XU9A 4URHA 1SAYA 1SQ6A 1E8NA 4CN8A 2C8VA 1B0ZA 4XPZA 4CEHA 2I9PA 2HBYA 3GT3A 3KG2A 5JYDA 3NTXA 3LOQA 2REBA 4AW9A 3FROA 4ECAA 2Y8EA 2H1WA 3R3JA 2FPOA 4ZAWA 3UXEA 5KVQA 3ROTA 1F2UA 4NCAA 5L7WA 3EG9A 3EA4A 4GGMX 2BF7A 3FXAA 2R6AA 4G0WA 3DAPA 4M8NE 1TECE 5BNFA 3VU1A 1GTMA 5AFSA 3A1DA 4CLRA 1U8XX 3IJEB 2J6HA 4DMMA 2WTNA 5A06A 1E9DA 2C7RA 3NWBA 2OAGA 1NIPA 1EQAA 1P9LA 2IXGA 4DV2B 2WFAA 5K51A 2VYCA 1FJGB 2GDJA 2JI9A 4IZ6A 3BIWA 3EIWA 5F73A 3QF4A 5CIYA 4CQMB 2BEJA 4BGUA 2H63A 5FR1A 2YH2A 3E9YA 1QOQB 4DCPA 1G98A 3CLRC 5KMGB 4XDGA 3OZ7A 1N4AA 3U7QA 5THKA 1ANKA 1E5VA 5IF9A 5IPFA 4NC9A 3TFQA 3VRHA 3DOIA 1GKUB 5HJ5A 3JAMA 1XK6A 1IDOA 3I2IA 2D00A 3TQHA 4PSDA 4UFNA 5DW3A 4F12A 3GBSA 5HTOA 2DY0A 3BCSA 2REQA 3G8BA 5ALJA 2C5LA 4H0NA 3FTEA 1FY2A 4M54A 3O73A 2YJ3A 3FNHA 3UW3A 2B34A 3WGUA 2CFCA 2CXQA 3ROFA 4F8JA 3O3CA 4V3CA 4M6WB 4CNQA 4YCDA 3UTDA 3C5VA 4WNIA 4BKMA 5BWOA 3MVEA 4FZRA 2VRWA 4YI3A 2WU1A 4MP8A 5EXTA 3EWSA 4YB8A 3VO1A 3PZRA 3UTCA 1S8OA 3BILA 3HXLA 3Q7TA 3ZOKA 3HACA 7REQB 3CUUA 2QRPA 1P0QA 5KYNA 4XYGA 3PHGA 3HDHA 3U80A 4JLNA 1IJEA 1HG1A 4EI9A 2COUA 2QRLA 1M9NA 1TO2E 3SS9X 3UJ7A 1E96A 1XZFA 2P5SA 2EZ9A 2XXJA 1EK1A 2C1EA 1W5SA 1JEQB 1L8QA 1XA3A 4IGFA 5DNVA 2WFZA 2RGEA 4BMVA 3E5RA 4PS1A 3PSHA 5IVHA 2K6GA 1J1IA 4J2TA 4C04A 2BMWA 5JCOC 1ZUIA 3DMHA 1MXFA 3PEFA 3Q3EA 1K27A 1TQDA 3U4IA 4PBTA 5SZIA 4E2YA 4EENA 5C51B 4G0QA 5H68A 4ZN6A 2XUOA 3KLBA 4I19A 1VI5A 3MLAA 3ZNOA 5BR8B 1LQ2A 2BKEA 4IDGA 3K05A 2PG3A 1EZZA 1HETA 4KLAA 1E9CA 4LZWA 4LYAA 4MZDA 4OHRA 1P2BA 5LQMA 3DAYA 2OD2A 5ISMA 5LUBA 5AHKA 3I4FA 4WCFB 2JNWA 2IQIA 3KR2A 5LIRA 1H4VB 3K35A 2D1RA 3QBEA 3RS8A 5JLJA 1L5NA 4Q21A 1ADJA 1B8VA 1IPFA 1U1CA 4JUCA 4ZI2A 1Z5NA 1KVQA 4MQUA 1GZ6A 3QJYA 3VR2A 3TXYA 3PKIA 4C1NA 2C07A 1EFVB 1JKXA 4YYEA 1XZCA 5A4DA 3JQ9A 2QBYB 1FU7A 4RDHA 1CP3A 4OHZA 4NG4A 4OY3A 2C97A 3WK9A 1NKVA 1N5LA 1B8PA 2XB6A 1K86A 4EG4A 5I8PA 4O25A 2FQYA 1QKIA 4H7JA 1GNRA 4TRMA 3OFVA 2C8KA 3KQNA 1DUIA 2EJBA 2F64A 3DCYA 1RXVA 2NQTA 2I78A 4Q6BA 2FPRA 1H5UA 4ND5A 1XZBA 5A5GA 1P4AA 4RYDA 3DMYA 3NI2A 1TCUA 2C2KA 3R0VA 4YP7A 1KZ4A 3O3MB 1F8XA 4AQYB 3ZXXA 4JCOA 1O95D 4JL8A 3VV3A 2WZDA 3L4JA 3PUIA 3K0FA 1SXJB 3IPCA 3TLCA 3FPAA 2XDQB 4YEDA 1NXQA 2YR0A 2WPDA 3OIDA 5CH5A 3TFWA 3TNDA 4DSZA 4JI6B 2HHAA 4QTUB 2GM4A 3BG5A 1Z13A 1K5DA 2VHWA 1JR6A 2C5BA 1FP2A 3VBEA 1DMSA 2EZUA 2LNDA 2VAMA 5ALWA 2QTGA 4G65A 1JHUA 2C4MA 1FU8A 5THXA 3ZJYA 2HA3A 3EHEA 3JPWA 3UYLA 4FHZA 2R44A 3ZJ4A 1NNI1 1QKKA 4FYHA 4MS4B 4XJTA 1DPFA 2B7CA 3KKLA 5D8DA 5HGXA 2G9RA 1ZR2A 1R4NB 4HYTA 1BC5A 3RUCA 1II9A 1UBJS 5T4EA 4IX9A 4ESVA 3K0CC 2BH9A 4XQ9A 1QK4A 5I4BA 1ZH4A 4QUBA 3N07A 3QUBA 3JD0A 2QD5A 3OAAA 1DRUA 3HY4A 1I3NA 2I4RA 4KBFA 2VXCA 1D4OA 1G8FA 3OCWA 1H4QA 3X1DA 1Z6QA 4RETA 1TGYA 4OXXA 1PZXA 2JLSA 3EVCA 4REMA 5TJ9A 3CU5A 4IUYA 3OJLA 4PX5A 1QGOA 3ACDA 2WIFA 3INGA 4MINA 1F4LA 1PSDA 1YB5A 1OJLA 2A1UB 1OLXA 3HEMA 2KMLA 1D2AA 4M8SA 3A4VA 4KPGA 3IO5A 2AXQA 4MDYA 1AK1A 3E3OA 1T91A 2V7WA 2WKSA 4IJUA 4MUAA 4OATA 4Y2UA 2YIDA 2XMQA 3BWDD 4KH1A 4QNMA 5EWMB 1RLTA 2EFCB 4JIGA 5AOBA 5I5GA 1EXWA 4LHVA 2IU0A 3UMVA 4U00A 4YX9A 2OB2A 1Q19A 3B7GA 1IG0A 5HFNA 3UV7A 1JE0A 5JW6A 5JYCA 3DE4X 5C3MA 4HGRA 1Y3HA 4P7KA 4QDZA 4YK7A 4BMXA 3DTNA 3CJRA 4PG7A 2ZAMA 2HWXA 4CUKA 1TM5E 2RG7A 4DRXA 1DDIA 1KIMA 3MHPA 2EL9A 2OAQ1 1O54A 4TWBA 1CVLA 3N6VA 4FLFA 2CNOA 1K4MA 1GAXA 1JSZA 1VXRA 3ID6C 3ZU3A 3X2EA 3N8NA 4L3OA 5G02A 3CLVA 1QAOA 1XYVA 1YBAA 2QLJA 2Z3VA 3QJGA 3COZA 4LXHA 4UVIA 4ZAFA 5EZYB 2C8JA 4GRIA 2IIPA 1DKNA 3D2AA 3P9XA 4TV8F 1P3Y1 2AUNA 2IYLD 1IK6A 3IIIA 3JQAB 4RD1A 1Q0RA 3W2FA 5BUQA 4LCJA 3NQ41 2P41A 1JHOA 4EQ6B 4RJTA 1SOVA 5CLHA 3VZPA 3DR5A 4ZPJA 5CVEA 5KPJA 1RC8A 1UZNA 1WPQA 2IGBA 3AFMA 1F1BA 2ZS7A 3B6IA 4Z8YA 1HYEA 1R3DA 2EWMA 2V7TA 3GLHB 3D7RA 2QXTA 1WF3A 2HO5A 4GX0A 5AOVA 2I4NA 2OCYC 3IOCA 5MGBA 4HDSA 5LJIA 1P3DA 1PHRA 3V1UA 3D6NB 4QBKA 4TM8A 4BKOA 1QOPB 5BV7A 2TYSB 5J1TB 3RUIA 1CS0A 4LVNA 1WXGA 4RPJA 1S89A 3NAGA 1U8ZA 1KU6A 2FPLA 1JQJC 4LWZA 1B1AA 1BXRB 4LW8A 4MVJE 3ZTTA 3PEEA 1TM3E 2HOQA 1YCDA 2IEZA 3RSZA 3E5MA 1I32A 1EXVA 5KS2A 3E9EA 3I2FA 3WLQA 2ID7A 4MQBA 1OLUB 4GC9A 1Z12A 2GTPA 5DTQA 3JZMA 5CFRA 1D1SA 3C6YA 3LT2A 3VR4D 4F6CA 1LSUA 4QUEA 1J42A 4ED9A 1TJ3A 1LXCA 1UP6A 3CX7A 1COWA 3ZZTA 4NBKA 3V42A 1TYBE 1VBFA 3IHKA 3KUCA 3MMZA 5J5CA 2F43B 3SM3A 3UV3A 1XLUA 3LUBA 1G2IA 2PYZA 3V8PA 1PDOA 1N2BA 1T1JA 2J4CA 3B6JA 2VDNB 2JHAA 3FKQA 3KEQA 5JJCA 1NRWA 1OXVA 5FQOA 4GYKA 2HWKA 2WWHA 2O2EA 3GFRA 4S05A 3OZEA 4LXXA 1I7LA 4JVMA 4JZKA 5AHXA 5K99A 4F5YA 1Q50A 1W85A 3IDOA 3BD8A 3THWB 4RACA 1EXDA 1X7ZA 4F1JA 2D74A 3WLOA 1YA6A 2Y77A 5TJHA 4HB4A 2CE7A 1NF9A 1Z3IX 3H5VA 4D43A 4PLTA 4DSOA 4JI8B 1W1IA 4JAVC 1GZVA 4MV0A 2R2GA 3GA5A 2X7XA 2PDAA 5A0TA 2PKQP 2XSZD 5ESXA 4E0BA 1HSOA 2ORIA 3LQ1A 4R1SA 2ZPAA 1O97C 1OCEA 3KJEA 4YRIA 4LMPA 3BB1A 4GGOA 1W0JA 4OQQA 4L6IA 1G3QA 4F91B 3ZHTA 3SSNA 1K7YA 2B2CA 2ID4A 1RQLA 3TMAA 4C4SA 1FCJA 1V1RA 2MINA 4ZVUA 1JFLA 4TS3A 2NP6A 1SU4A 3PFIA 1BMFA 1DTSA 2FN8A 3M6IA 4ZVSA 2ZJ4A 1HE1C 4CT4B 1WJGA 2X86A 1UZLA 4GQIA 2CNNA 4C7BA 1BXGB 2ZAIA 1IRXA 1NOKA 1UPXA 4Z7JA 2QRNA 4KRFA 3EVNA 1ZQ9A 3D4OA 5ALZA 2B9EA 2J9ZB 2O54A 1R12A 3WHLA 4ARZA 5G3ZA 1OAAA 1UMCB 3VFDA 2ZW9A 2XYRA 2UV8A 2R62A 1TEXA 1P45A 1TVEA 2D0PB 3JY6A 2PV7A 5CX4A 2PA3A 4RZHA 3WWZA 1OHHA 4GMDA 1PR3A 4EFMA 6ADHA 3T7EA 1BTOA 1UIMA 2OOSA 1NQVA 2FWMX 2JZNA 1BEZA 1PT8A 1EEHA 4ZCPA 1WB9A 3G2MA 3ORRA 5DMHA 2OPHA 2WKWA 4EJ0A 5IN4A 1MRSA 1K66A 4B34A 2RGXA 3KTOA 4D9BA 2BTQA 5HS6A 3EVAA 4TVSA 1BH6A 4TTJA 1RPZA 2G4VA 4RPHA 5HKBA 4OLBA 4YJ2B 1VB3A 5H9WA 2PK3A 5BYBA 5JJLA 1DINA 4KLCA 4XEHA 4ZOLB 3CSUA 1ZMTA 4M7PA 2W98A 3C8UA 1E0DA 1U0RA 5HF5A 5DTRA 1I3CA 3HUUA 2H29A 3O8QB 3TZQA 2WTUA 2QNRA 2EYUA 4YVFA 1TM1E 5BW6B 1NXSA 3JATA 4BLUA 5CA1B 2CV2A 1MV5A 1L6IA 2EBFX 3AYXB 2OFPA 1K3FA 1FX0B 2H7CA 4PAQA 1SC6A 4QPZA 4XB2A 3TM4A 2BIFA 3BH6A 5BSRA 4UHKA 1TMKA 3RVKA 2ATVA 4CXMA 1EQUA 1LLUA 1P2VA 4U8HA 4DL9A 3Q7SA 1NJ1A 4DCVA 3A1CA 1MF7A 3BD7A 3MQ4A 3R0ZA 5BQOA 3GMSA 3JQ8A 2Y1KA 3UG7A 2EP7A 1EM6A 1U0OC 1B6SA 4EJSA 4IDFA 1UJ6A 4WLOA 2ZR8A 5EPUA 3ETCA 1T26A 3IDSA 1NULA 7YASA 1MJNA 1EUCA 2NMVA 1SEVA 1BMDA 2IW3A 3MWJA 3REQA 2ZRMA 4IYRA 1EWRA 1ZSVA 3DYBA 1EG2A 1SXGA 2VNSA 1D4ZA 4HUQB 5EJMA 4UOEA 5KNCA 1A96A 3FYUB 2G77B 4X45A 3K09C 1GA6A 2YIJA 1OH7A 1FSPA 4YNBA 4KXYA 5IYZB 2EJTA 4JEIA 1T6ZA 3ZEIA 1Q0PA 4D8UA 5H02A 2VJKA 3KLNA 1J21A 5F3WB 4YLGA 1TK9A 3VR5D 3W7BA 3EDMA 3VOSA 4TYNA 4RXUA 5CXUA 1H2HA 2WTAA 5C1BA 2QUZA 3UB3A 1R0YA 2L82A 4ND6A 1EJBA 3ORSA 2C2HA 3UOAB 3RM3A 1GKLA 3IS3A 3FPCA 4J90A 4X6XA 5IU6A 3OLCX 3U3JA 3AW8A 4P36A 1IZ8A 3UOWA 2IT1A 4AB1A 3EPLA 2BE7A 3I92A 4UMDA 2X22A 1YZTA 3TRKA 1L7EA 1Z4IA 4Z7QB 2FSVA 5EJ2A 1O4VA 2C31A 2QRMA 4AXXA 1CW2B 3H42B 4GXQA 1DJNA 4UHBA 1XZAA 1V41E 4F6RB 1KERA 1LTQA 3GUCA 2G25A 4HAZA 5FB3A 4J0QA 3RIGA 3UFBA 4CKBB 5HOEA 5B7NA 2HU5A 1NMYA 4EW2A 1GPYA 2Z5FA 4QARA 2IPLA 1I6KA 3CURA 3NHFA 1Y98A 3WDSA 4L4RA 5JADA 4NV3A 2HIMA 1T8TA 4UDXX 4ENTA 1I4LD 1CQXA 5KNCH 4G8CA 4MJLA 2RK3A 2WILA 4PRKA 1U1EA 4YRDA 5D6OA 3VJMA 2D8MA 3R6LA 5CBKA 2Z98A 1PJRA 3A27A 3CVUA 5CR9A 4EJFA 5JCPA 2XNHA 5I7FA 1CBUA 1IBRA 3F78A 4MW9A 4L2IA 1TEZA 4BLPA 1G5IA 1GN8A 3MYRA 2C59A 4NU0A 2DQKA 4CL8A 4N47A 1XMQB 1NVXQ 1FDWA 2RKBA 3T5DA 1H4SA 4X63A 4FCCA 1GNPA 2AE2A 2QE6A 4KXWA 4G1UC 4X8LA 1MOZA 4B6QA 3AT1A 1E2FA 2B8JA 4KVAA 5BVHB 3D5QA 4MO9A 2GJKA 5GY7A 3UANA 1E2JA 2Y1FA 3G8DA 1PG0A 2BFBA 4YY3B 2JGKA 2OUKA 3LK7A 1F4PA 4P4SB 4O59O 3OO1A 4LA4A 5LXTA 4BNWA 4CKWB 4DC0A 4PZDA 4QYIA 2P9GA 4AY3A 5D1NA 1C9JA 3BJMA 5BO5A 5HUQA 2Q4EA 5LYJA 3DLCA 4KEAA 1D0IA 2Z08A 1HT1E 5F7JA 1JR4A 2G71A 2J46A 1QDLB 1A5ZA 3LUPA 4KREA 3K71B 4WERA 1A8IA 1K97A 3PI7A 2AOVA 3IE0A 4DSUA 1E92A 1V2GA 1WB6A 1RIFA 3U40A 2DRIA 3FBGA 3OZDA 5FWXA 4PNEA 1RMQA 3AVYA 3U0VA 3TPZA 4KWEA 3NVKI 5BXYA 2NP7A 1YXMA 2XVXA 2X1LA 5A0FA 1Z6GA 5J2UF 3DS8A 4MJ7A 2BGWA 1L3CA 2C83A 2QL7A 2ZJAA 4L8YA 3E53A 4BIMA 4X1IA 1YVUA 2XB2A 5F7OA 2X5XA 3EVTA 3OD1A 4MYRA 3RIMA 3Q72A 3O7WA 3NANA 5DNDA 4DDMA 2ZB2A 3GWZA 3OQMA 2W6JD 3LP6A 3BHNA 4M1KA 4MW6A 1FDUA 1G3UA 1MGPA 4RPIA 2Y27A 2XUGA 1PGPA 3IMCA 5K8JB 3DW3X 1DKPA 4GG1A 3D8NA 4JCCA 1A4IA 3GT7A 3QTTA 1PTKA 1ATIA 4EITA 2G8NA 3EARA 5C7IO 4QHSA 3OE1A 4WIAA 1VKOA 3ESBA 1RWKA 1N57A 2IWRA 3VNSA 5C5IA 2W8ZA 2O59A 2F7SA 5HM6A 1QRAA 3IKJA 4DWWA 2I7XA 2NUPA 2QN1A 3CT6A 5LZ7A 4D0LB 2ZYWX 4YCCA 3UPTA 2BP7A 2NPIA 1SUAA 3VU9B 3KPWA 3HCOA 4GBMA 2G0NA 4B2IA 3TTXA 1VL2A 5T7BA 1PJ8A 4KXMA 3TW4A 1NDHA 1V6SA 2G0AA 3OPYB 2Q2WA 3GG2A 4R2LA 5A05A 1VYVA 4YCSA 4G4JA 4NFHA 4Q16A 4WXRA 1ZOIA 4WGGA 3T7DA 4A0QA 4DLWA 4E6EA 2EZ8A 2VDWB 4QFBA 5F1YA 2FKAA 4IG9A 3AETA 2X3UA 5LZ2A 2HF9A 3MBOA 5E1OA 4BPRA 3TNJA 4H17A 3P27A 5JXJA 1C14A 1JEAA 3VDMA 2QS9A 4KQFA 4WZBE 4KTVE 4XCVA 5DNCA 1JB9A 1GCUA 4BKQA 4KIUA 1WQ1R 2HSJA 4QOJA 3AVTA 1FPQA 1NVMB 1YSCA 2HGZA 2YIMA 4WSOA 3A6EA 1AVTA 4BO9A 1U5BA 2VLBA 4G4SO 1FQOA 4MA0A 4MAFA 1NVTA 1ZIXA 4X6LA 1HDEA 5CW1A 2P3LA 4RPGA 4P5EA 4WDQA 2ZIGA 1VIAA 1W7AA 2O8CA 2FF5A 2DPLA 3KVYA 4AZ3A 2VUHB 1KYIA 3K6KA 1AS0A 3LL4A 5B58T 4ATNA 2WJ6A 3LZCA 4BDSA 4F38A 3AKYA 4Y0NA 3EGEA 5FHRA 5ANRB 1VL8A 1IXKA 3H1GA 4NE2A 1I0LA 3D8SA 1RXCA 3NBFA 3AHHA 2FQ1A 3KP1A 4LZPA 3TEMA 1TAUA 2AW3A 1GN9A 3UUGA 2WI8A 3BOSA 4HN2A 4TLAA 4JI1B 1FBTA 5GONF 4U6QA 1NE2A 4ZVMA 3CRZA 1FTGA 1UCFA 1XHEA 1L7MA 5FRDA 1OTYA 2J9RA 4O4LF 1CUXA 1VC2A 1R9JA 3DBLA 1F8YA 2ZT8A 1PYOA 5T4HA 3O2JA 4PM4A 3VNAA 1X9IA 1NJ5A 3Q8XB 4NJOA 1GAWA 3FNEA 2RHWA 4EW6A 4GE3A 1Y1TA 1TK2A 2CHVA 3OZRA 1PW7A 2ZS8A 2Q29A 3CCCA 1J49A 3WLKX 5HQ3B 3RW9A 2X77A 3I01A 2JAPA 3QU2A 3G0HA 4OHYA 4JVSB 2GGSA 2FPGA 4OFZA 4QLAA 4CM4B 1O94D 8MHTA 1XU7A 2MHCA 3SX4A 3QLUC 3QVVA 4Z9XA 4WNAB 3BRQA 3EXIA 2IXDA 4EPXA 3HB0A 4D46A 1QG0A 4EH1A 2ECPA 4IW3B 4J2HA 2GEUA 4S35A 1MU0A 1VG8A 4JX8A 3OZUA 3M4XA 1AIPA 2G7ZA 4IO1A 4MUKA 4L07A 1ZIYA 1ZK3A 4RQAA 4Q9KA 5CLFA 2W2QA 1S01A 1KF0A 4NYJR 3HP4A 1FRQA 2M6RA 2PSEA 4OXRA 2XEDA 4A73A 3CZPA 2X5JO 3JU3A 2CVQA 4CKEA 5DTIA 1W52X 4EP1A 5JNTA 2BR4A 2XIJA 4TKVB 1L5ZA 3UJ3X 3IA2A 3KYDA 5E6UB 3DV0B 1Q74A 3FN4A 2BGJA 3S2YA 1IZ9A 3UJ6A 4FCTA 1Z5GA 4DG9A 1ZD1A 2I62A 3TE6A 4R2IA 1IBLB 2JAUA 4ZODA 4BNJA 2O8VA 5DIFA 3WJ2A 2QD1A 3O6VA 2ZIAA 1M1ZA 2DWCA 2QU8A 4UM9D 4BMDA 3SR0A 4Z5XA 2HGSA 1Z15A 4QPNA 3GVCA 1OI7A 2Y1OA 5LOVF 1CTQA 1RSZA 2PBZA 3N2KA 4MS3B 4TYPA 4C0JA 4UTVA 3WRWA 3HPQA 1JHAA 1ARZA 4CMEA 4MRMA 4DWVA 1B7GO 4KNVA 1E79A 1YFZA 3P2IA 1KI2A 4DMLA 1UF9A 5BV0A 2VH2A 3ZGOA 2CUKA 4NWIA 4TQGA 1ISJA 1H85A 1R6UA 3HZZA 1O6GA 1I80A 2QN6A 2W90A 1IQRA 2N0SA 4F2GA 4II3A 1PEKE 1UKCA 4ZHQB 4D8WA 5KNLA 2F8MA 4DY4A 1M6VB 4WASA 3COPA 2F17A 1N34B 1FQKA 5CLGA 2FQXA 1V1MB 5FNVF 3COSA 4F8YA 1IN6A 2CKDA 3WWYA 3IHWA 4TX1A 1VRVA 3CLTC 1PNVA 1W93A 4RWEA 3CBQA 1WETA 2V0CA 2FPWA 2G36A 2BDEA 2VSOA 1XQYA 2E6UX 2WG1A 2OBXA 1WW8A 3H2ZA 4U1RA 1VGQA 2AR0A 5CVJA 5HUJA 4JKYA 5TARA 2BM0A 3C4JA 1LNQA 4RF5A 4RTQA 1E2IA 3L7BA 3GUZA 3WKBA 1DBWA 2O3JA 4PVCA 2XUQA 3NH9A 3PITA 4MUHA 4DM7A 2AXPA 4LQLA 3S8YA 2O8EB 4NENA 3N2YA 1AKTA 3HA7A 4M7RA 1CE8B 1II0A 1KQOA 2GPBA 1THTA 3V2GA 4JOCA 4BYGA 4KOAA 4LF5B 1DRJA 1GQSA 1FXWA 2H6EA 1YZUA 4MYTA 2O2XA 3SJAA 2HXGA 4BNYA 3OVMA 3EGDB 4KMMA 3WLFA 2PLRA 1ZM4A 5J5VA 1M8PA 2SBTA 2MDTA 1OE0A 3R4VA 4WOCA 1Z4KA 3CKYA 3HBNA 4M88A 4P4LA 4BO8A 5JASA 5LU8A 4KLRA 4D3XA 4HX5A 2Q2VA 2I8AA 2VQ3A 3B53X 3N9IA 5FI1B 1I1QB 4E5YA 4Z4CA 5HKKD 1RZRA 1H3FA 5MGNA 4ZEOA 2R1VA 4BMOB 3RIEA 4I4TB 3NH6A 5JHGB 3OX1A 4AECA 5HBGA 3UIEA 4B9EA 4CM1A 5CVVA 2DXIA 3R9WA 4ZDJA 1ZL2A 2AFIE 3OEHD 2F2TA 1JFTA 3D0OA 2QT1A 4JZYA 3FMGA 1HE4A 3SSAA 2PZAA 1QIIA 5TC4A 3GRVA 3RSFA 5FUBA 3A4IA 3NS7A 4E21A 4XWKA 5E95A 1YACA 2DX7A 2FG7C 3C6KA 1QP0A 3N3AC 3FPBA 4ISCA 2JA2A 4LRXA 4AN1A 2DB3A 3L1KA 4RQBA 3ZU2A 2H0AA 4GZ5A 4RLFA 1WHSA 3G0OA 3G2OA 3A6LA 1RJGA 3PQ7A 3UHPA 3EPHA 1Z73A 1Z4NA 1O6ZA 1XO1A 3N2LA 3T7CA 3F7OA 3VBCA 1SBTA 2IYEA 4R2MA 1R6TA 3G2KA 1YAHA 4IIJF 4RLSA 4D3DA 2APJA 2H4YA 4DDHA 3PGKA 2BKVA 4Q6WA 2IIBA 3DEJA 2R9VA 3MRVA 4OK3A 4RV5A 3MPUA 4X90A 5CUQA 4O4HF 1DKQA 2QZJA 3L84A 2QTMA 1VKZA 3N86A 4I46A 4YROA 5LD2C 2I4LA 4KXLA 1U5CA 2OHHA 2VDKB 3AHGA 3OY7A 1Z0DA 3ZIAD 1HORA 4ARUA 3S99A 1RRCA 2NU7B 2XT6A 1XRMA 1LX7A 3DGFC 3IKLA 3Q1LA 4J7XA 4N8SA 1UZMA 4CLXA 2GZHA 2WFMA 4Q7EA 4YQEA 2H7VA 3LY8A 3ROKA 3AV0B 3H05A 3CEHA 4C0WA 2IH4A 4PHGA 3K6SB 4J9VA 1LDEA 1G1MA 2G1JA 2Z04A 4NHOA 4BO3A 4I3FA 2RGCA 3RSHA 1QV6A 4ND1A 4PQEA 4Q01A 3BGOS 3UVEA 4CFYA 4HRYA 5JPIA 3D4NA 2YXLA 2XZDA 5T3YA 1E3WA 1NR7A 1G291 3E5HA 5K4GA 1I7QB 4TKMA 4Q4JA 1AXRA 1IEWA 3D6VA 3MWFA 3TBFA 1JIVA 3B5IA 3ODPA 3F6PA 3G89A 4R2HA 4M1YA 4UHHA 2ZSDA 4B9AA 3PIDA 3TSZA 4ZV4A 4HFJA 5LBUA 1M5TA 3WGKA 4LJKA 3AY6A 4DLZA 2PIDA 3MK31 4UHDA 4UPDA 3F3KA 3T3IA 5B2EA 1O57A 2I67A 1T6YA 2JIQA 2QSJA 3MMXA 5JCJD 3CRNA 2QX8A 4G0OA 4L4ZA 2BJWA 3PTLA 4L8LA 2VF2A 3X3HA 2C03A 4TXMA 1A8UA 5I8WA 1N77A 3BMNB 3MS4A 1W48A 1YOBA 1T9ZA 2A1TS 1IZZA 2G04A 1A2OA 1KAGA 1PRYA 1PKXA 3OJCA 2OYCA 3SI7A 4DBLE 5BUSA 1EZ1A 7AT1A 1CZOA 3GJRA 2W00A 4FZVA 2AN4A 2PM8A 1RAGA 2V6FA 3SYLA 4ND4A 3CKLA 2GF0A 2BFEA 5TQ0A 2DOKA 3LDAA 3VGJA 4ZYWA 2X0EA 1M2OB 1Z6ZA 2ZIXB 5HE8A 1IY1A 2Q50A 4L76A 3UMJA 4FNGA 4S1WA 3BSSA 4D02A 3GA7A 2QTAA 1S2DA 3FF1A 3LQKA 1SOUA 2HADA 4BMCA 5IBPA 1KJ8A 1ECBA 1TADA 1DV1A 1SKYB 3F5SA 5B4TA 2DCMA 3CKMA 1UBCA 1I8TA 1BO6A 4WXHA 1U2SA 4DMRA 4IIFA 3S3TA 3GAFA 5EYPB 5FBKA 1PFWA 2C29D 1JAZA 1QTNA 3WISA 4LE1A 3ST7A 4ZAVA 2GLXA 1A7JA 5A3RA 5ITVA 2AKYA 1G18A 3BEOA 1QZTA 4AIRA 4P0QB 5IKPA 2G70A 2QM7A 5J9FA 3C4QA 2RHDA 4FB5A 3A1UA 2F8LA 1B14A 2R751 3LBIA 3Q9NA 3CXRA 4ZO8A 3LCUA 1IN8A 2H3EA 4RD3A 1CVIA 4DJTA 4EPVA 2MWMA 2DPXA 4DZTA 1EEXB 1FRNA 4JBXA 4KQEA 4PIVA 1EXMA 3W3AD 5JEEA 2BGNA 1JLLB 4HGZA 4B2PA 3R0QA 4KR6A 3VMFA 1J1UA 2CVFA 2QX6A 3FBTA 1F6BA 5HP4A 1F5SA 4HDOB 4Q4AB 1KEKA 3BZUA 1GG5A 1K9VF 1LTHR 2FPSA 3EZ6A 1LFDB 3JVEA 4M7OA 1XXHE 2BMEA 1IEVA 4JENA 5IKXA 1GG8A 1O9GA 2XE6A 4F4HA 1CFJA 5E7IA 5D1HA 5CM8B 1RM5A 2Z1DA 4G1MB 3ONDA 4ZJZA 1J0EA 4MVJH 3T1HB 3W1WA 1EDOA 2E5WA 5AI9A 3ZWMA 1NI4B 1TCBA 1BA3A 2X0KA 2Y1DA 4D4HA 4JLJA 3F6RA 3FDZA 3A9CA 1N2CA 2UVQA 2CWWA 2ZRLA 4GYYA 2I2AA 2QMHA 3OPYI 4KIFA 4NL4H 1PV4A 4E08A 2WC1A 3MQ2A 3KLPX 1KKLA 2AEEA 2O48X 4F3NA 3NIFB 3STYA 1J9GA 1QIMA 2PVSA 1L7NA 2QM0A 3F1KA 4B0OA 3FB4A 3MSCA 1E9VA 1A9XB 3MTGA 4KTTE 1J56A 3WIOA 2VP0A 3HV0A 4BZZA 4QQKA 3AIOA 1DAMA 1E2PA 1GRQA 1QFSA 1U99A 1ZN8A 1PV1A 3BTVA 1MRNA 3ICOA 1KE1A 3R6TA 1RHKA 1J8FA 4CIVA 3N1UA 3SBEA 2ODPA 4CV1A 1CYEA 1RVV1 2P9TA 2ONJA 3VZQA 4LI3X 1YR7A 2G07A 4DCNA 4EJ2A 1IH8A 1PK7A 2Q2OA 3BXFA 2J3JA 2FK8A 3GP5A 3AOGA 3IIKA 1BDMA 2ZIWB 3E82A 3K8YA 4QDJA 4X71A 3VM6A 2XCTB 2A58A 3K0BA 1H2YA 3NHKA 4JJIA 3TTSA 4YMHA 4UTXA 2ZUDA 4FMBB 1HF3A 2BEWA 1IAQA 1QCZA 3TDNA 2VRNA 4HFRA 4R05A 4CL2A 2ZYRA 4BFWA 2C9CA 3DOJA 4J0HA 4C88A 4FMDB 3WLEA 5KX5F 1GTRA 4YRJA 2IZ5A 3SPXA 4A6PA 3TGPA 2GK4A 1NPDA 4OHVA 4MGYR 4TL8A 3RABA 2DPMA 2I4IA 2VF4X 3HP1A 2OBFA 2X4DA 2A0XA 4D41A 1U6IA 3QNUA 5BN3B 3AESA 4DLYA 2W6ID 1XMVA 3EASA 4OQXA 1MB4A 3TRDA 3I58A 2QNBA 3A4TA 4LV5B 4RCYA 1E0JA 1K68A 3D7NA 2ZU0C 4G5RA 1GRCA 1WG8A 2RGUA 4MVWA 4QPCA 3DOHA 1Z2AA 2YBEA 4JWKA 1ISRA 2IDZA 5LPNA 1W88A 2VP5A 3FGOA 3M3PA 4H4EA 4ZVPA 4CM7A 2GM9A 2XQIA 4R9SA 4UMVA 4H6PA 3LCCA 3WIBA 3LKZA 1RHQA 2O2JA 1AQUA 1XZEA 5DHUA 2IEYA 4KYUA 1Z5VA 3ASVA 1EIWA 5CFPA 1JPJA 2W8BB 3G6KA 1FFAA 3NJ8A 3UAGA 1IWOA 3A6PC 1DHRA 3IQGX 4YUZA 1M73E 1ZL0A 3O9VA 3WWCA 4EVSA 3PTAA 4GM0A 2FFQA 4D97A 4CEHB 1V3QE 2CDCA 4X94A 2JBAB 1TO6A 2Q1YA 3IV9A 3AIKA 3MTJA 4YRLA 5FBWB 1QU2A 1EHYA 4MUIA 4C22A 1VOTA 2FKNA 3WOHA 1XP5A 2HU2A 3KE9A 4D92A 4BNVA 2LE0A 3BMOB 4MULA 2CF6A 2Q5HA 2DLNA 1FU4A 2OC9A 3DF7A 1X2EA 3ES9A 3H9UA 3Q40A 1Q12A 3ZLVA 3DKKA 2KHZA 3AHIA 4C08A 4DA9A 1R6BX 2Q7OE 5JO0A 1MC1A 4CDRA 4EY4A 5K8TA 2AWOA 5LYYA 1RFGE 2IUSA 2W4QA 4ZT4A 3LP5A 2OAP1 1M74A 4KDCA 4JUDX 4TPKA 2R7LA 4C4RA 1VLZA 3IQXA 3OF2A 4GX1A 5JV5A 3IAM6 2JI8A 3K94A 1BVRA 3LDUA 4L5JA 3W5AA 1GU0A 2I5PO 3LUJA 2WSBA 3CEJA 4YJGB 3OZVA 2Q1UA 4Q3BA 2PY6A 1VHLA 3HABA 5HX7A 5JS6A 2IP4A 1NSYA 1RRVA 2ODWA 2YJZA 3DTVD 3MBIA 2NUAB 3U7FB 3A3NA 1UXKA 2G67A 1ZSYA 3F8TA 2Y1GA 1XZKA 4F06A 1W6UA 4DCGA 2OM2A 3JYPA 3N2GB 3VYTB 2QD2A 4E15A 1CB7A 5EMJA 1D2HA 3TM5A 4KB5A 3ZTYA 5JE8A 1UADA 3CO0S 3IEIA 1CJTC 3N7TA 1RKVA 2V0GA 4UULA 1VDZA 2GJSA 2BLLA 2XIQA 3I0MA 1A9TA 3K6RA 4B48A 5C2JB 2XQVA 3KV1A 5E6RB 4CBVA 3HXQA 4AI6A 5DBHX 4LVUA 2HB6A 5GONB 1YVRA 1GWNA 3IXQA 3IXMA 1MAHA 1TUIA 4UTOA 2Q6KA 1YQQA 3DBOB 5FUWA 5IDQA 1QYVA 4X8HA 1I2MA 4I55A 1NJSA 3C3MA 3M5WA 3L43A 4MK4A 4Z0NA 4BKUA 1KEEB 4QKQA 1HZJA 1UQUA 3RSGA 5JNRA 2IYXA 3CF4A 4KRGA 3T99A 3TB4A 4CIWA 3VR6D 4V3BA 5EIHA 1LVGA 4MV3A 4LHXA 2OVFA 2QVCA 2G0TA 5IAJA 1SQ5A 4DLRA 5LFAA 1U7XA 4HJXA 4IXWA 3T5AA 4FEAA 1PQWA 3CONA 3TBHA 1GQOA 2X8LA 3TLKA 1P2TA 2VYQA 3F2VA 2C4NA 3OLVA 1SG6A 3OOSA 5FLYA 3KJHA 1YD7A 3ZE6A 1NUSA 1UC5B 1ZCFA 4Z2AA 4O1IA 1QK5A 3QY9A 3OUZA 3AEYA 4AMUA 2XUDA 5KOHA 1NC1A 4FDLA 3V4SA 4LHWA 1PV2A 2OHJA 1L8OA 2NZ2A 2YNMC 5LWHA 2JEZA 4K03A 1JG7A 1D2EA 3VJRA 5KPDA 2YY6A 2B94A 3CW8X 3K5PA 4IIBA 3D0KA 4PLVA 1ZGGA 2ZJ1A 3WADA 3WLTA 4AY4A 1XHFA 3DBVO 4DABA 3CZ5A 2WTBA 3M5CA 4PZAA 1ZMOA 4R1QA 4BN0A 1Z0SA 1LF0A 1PR6A 1TAGA 1SC9A 4A91A 3BXEA 2BV3A 2O7SA 1DPGA 2PGIA 4MMZB 4QXPA 3C5EA 3C7AA 1QYWA 3EBOA 1R50A 1T5TA 2CNBA 4IPTA 4BC0A 2B8NA 1KEZA 2SCUA 2ZWIA 3ABOB 3G9UA 2XZPA 1U1IA 2RD2A 1YFJA 4W5HA 3RI3A 1QFMA 1CY0A 2JARA 1AUOA 1DWQA 1G9XA 5HIJA 1HZZC 1Z26A 5AXBA 3SWWA 3WYFA 3N59A 1YCGA 1B00A 1L5MA 5LNK1 1BKSB 2XW6A 1DJOA 3FPSA 3OJEA 4XQ0A 1Y8RB 1YI8A 3I28A 4P81A 5K4AA 3QITA 3G0BA 1IMOA 3QVLA 4DGQA 1CDDA 3OQIA 3R7DA 1QS0B 1ML4A 1J20A 1L5WA 1S4MA 1TB4A 4HQNA 2JFUA 2PGXA 3S81A 1LLFA 2OHOA 4JGIA 3M6FA 4UASA 4XSHA 1AJEA 1NRIA 1UAYA 4NMWA 2YN2A 1KSJA 4W5QA 3EYAA 4MEJA 4YP6A 2FCRA 2C5SA 4IKEA 1CUAA 3WNZA 1DJQA 4AJIA 1V2HE 5FNVB 4CCAA 4MLDA 1B0AA 1F2VA 1MUUA 4FGZA 5LL6P 3I52A 4AFNA 1R4AA 1N5MA 1UXJA 3AONB 3H6KA 1VFNA 4FONA 4X1KB 3OT4A 4WZBA 3ORFA 3TD6A 5AVRA 5KIAA 4FDAA 4REQA 5LQUA 3AVVA 4IR7A 1QPGA 1MVLA 3NT2A 3R5XA 2Q9UA 4K9NA 3IAEA 3WV4A 1ZNWA 1H1DA 2HUNA 2NO9A 4BLVA 6REQB 4MYDA 3UEOA 3LBYA 5BNWA 2YQ4A 4INPA 3KZ1E 3D3WB 4FCWA 3LHKA 5AIAA 2PXXA 3HFRA 4ERNA 2SICE 5TE9A 1XEXA 3H4VA 2CBZA 2HMUA 2GTIA 4DT1A 4D4MA 1BE8A 2J6BA 4PWZA 3TEFA 3RLFA 1Y5MA 4UE6A 4CCWA 5EHXA 1GPJA 5JD3A 4P86A 3Q8LA 3GIDA 1H2BA 1LUAA 1O5TA 2J9GA 3P9ZA 5JCXA 4OGLA 1H2RS 1Q16A 3T3GA 2OP1A 2PWZA 2NU8B 2E3JA 3MJSA 1OILA 2XB4A 1T0IA 1SJ9A 1Z34A 1KMNA 3C3YA 3EMDA 3GQVA 4GPTA 2AK2A 4JELA 4GD3Q 5KAMA 1DMRA 3T1QA 2GEBA 1MEEA 2IYOA 4YWJA 3UQYS 1KNQA 3I01M 4RA9A 1RHUA 4RKYA 2DKNA 3AEKB 1F3OA 1QGZA 1XU4A 1YJAA 4XDZA 4GM4A 3R3YA 5CGZA 3D0RA 7ADHA 4G5XA 3TX2A 4QUDA 5J59A 2JJ2D 3ELYA 4YMLA 4UZEA 1MOQA 3SR3A 5EJGA 4DUPA 3MWGA 4JYMA 4MRPA 3M4YA 2A9RA 4YJKA 1S0UA 3FHLA 1A97A 1FP4A 2BBWA 3BJZA 3IP1A 4MB6A 4WKNA 3HMQA 4D6PA 4ENQA 5KTMA 1FOEB 2PRKA 2J9FB 5DSZA 5KYTA 4A8JC 3HKBB 3HSSA 5FOWA 1V71A 3PZBA 1YNSA 1MLDA 1UT8A 1MTOA 1KI9A 5A9RA 1QUEA 5EKXA 3P4YA 3SDBA 1UDRA 4Y2SA 3LVRE 1L5HA 1MA0A 4EUSA 4LXUA 1GTZA 3SQXA 4PE5B 3NNSA 2HMVA 1VMEA 2ZCVA 2YW2A 3RB8A 5JPDA 4L85A 3ZWOA 2BJHA 4MIEA 1KVUA 1IQ0A 4CCYA 3KEGA 3KTDA 2PWPA 4W9NC 4BJ1A 1PEYA 5HZGA 1NX6A 4NATA 4XFJA 1EB8A 4BNZA 3P5BA 5AVKA 1ZJZA 3UA3A 2A86A 3ZWCA 5E6SB 3KOUA 3SIXA 2EIHA 2QXYA 5E4YA 4AAYA 4OJTA 2IOFA 3GFGA 1FTQA 1D4AA 4KK3A 5HHTA 1ECPA 3Q7EA 4UAGA 4RY2A 3P26A 5EIEA 3AMVA 4I1RA 2E89A 2ZTVA 1EFDN 4A16A 1T4CB 1YR2A 2GVDC 2XMCA 3DOFA 3JASA 4L9SA 3AKDA 4AMBA 1WPXA 2JIBA 2DQZA 4ABYA 1YB1A 3F5FA 1HNZB 1YDWA 3V8VA 4JXJA 2NQ2C 2FFHA 4RGBA 3S28A 5IEBA 1WOYA 3QYFA 1EVYA 4FOTA 3FB1A 5JOQA 5B1IA 3P9QA 3QHAA 4TQ9A 3PE4A 3CLRD 2YFQA 4IVNA 1T9GR 3LUAA 2XYQA 1YQXA 1S3GA 3QU7A 3QU5A 1ZD4A 1VHTA 3MYYA 1AMUA 3IEPA 1UK7A 3N58A 4TYWA 3UJBA 4F7DA 1PFKA 4P84A 3EEOA 1II8B 2CVPA 2NZYA 4ZZ2A 2H4JA 2Y1LA 4DHWA 4DG5A 3KYCA 4C4OA 1JXQA 4DDWA 1GD1O 1UBRS 4F0JA 2J87A 2K5UA 2CL0X 8AT1A 1KARA 1ESNA 1U6KA 3ZE0B 2NVOA 5LQAA 4QEKA 3H99A 4KDFA 2D5BA 3Q7RA 3LOPA 2JGJA 4HADA 4O6VA 2FEMA 4WXYB 3B2EA 1IQUA 3KSMA 3K32A 1WAMA 1THGA 2OE2A 2OBMA 2RCYA 1TJYA 2J3MA 2IYWA 2ORED 3AU9A 3DWIA 3I30X 1M1YA 4JMPA 2D2VA 3P1JA 3Q7PA 5AJHA 5DCWA 4RGVA 1KSHA 1QH1B 3S2SA 4DJDC 2JLXA 3RT9A 3AEXA 1XPOA 3ZK9A 2C58A 4H27A 1KR2A 4HLDA 5IVIA 3AEZA 3EY4A 4OREX 4J0CA 4ZWNA 4IJVA 1U0GA 4D9KA 4IDCA 1X1DA 4PR0A 3R7LA 2BI7A 2FQWA 1N6PA 4ZDKA 3GFQA 1LC3A 1MG5A 1GFZA 4K8OA 3RF7A 3LIIA 4H4CA 1FVXA 2Q5QA 2E4AA 1ZI8A 2I2BA 1O8CA 4K6HA 3U61B 2WDPA 1K9SA 5K6TA 1VYUA 1EUYA 3QPCA 3L0DA 2AN3A 2XWPA 3A4MA 1XTIA 1YQEA 1D7AA 1E3DA 3CSSA 3P94A 3PVZA 2R96A 2MTBA 5HF6A 1JYFA 3GEIA 1A69A 5HUHA 2FW0A 3DDWA 2AFIA 4GE0A 4YMVA 3KOZA 2Z5LA 2ZTSA 4YUAA 1U4OA 4L5YA 1W35A 3R6DA 1TZJA 4U2KA 3F47A 4NABA 3EZLA 3LPLA 3VV2A 3QFCA 3VR0A 2AFRA 1GPWB 1NZDA 2WINI 1ZICA 2AOUA 5CT8A 1N6NA 1P5JA 3IALA 1X7DA 3VPCA 4B32A 5KJ1A 3R8FA 3VR2D 3CW2A 2IPMA 4GVPA 3PJFA 1UJ4A 2VHCA 3FNGA 5IAAA 1S96A 2CJWB 2JCSA 5L3VA 2X1VA 2WHPA 4MW5A 5MN4A 3W5BA 1AZSC 5LKAA 1KBOA 3IFSA 1OI2A 1XVIA 2VHJA 4N7JA 4OCZA 3W9BA 4C7KA 1NTOA 1L7BA 3A3KA 5CPBA 2DKFA 4FEGA 4YASA 1JDPA 2O7NA 2OKGA 3R0JA 3LA8A 3UK1A 4K1XA 4EVIA 5L51A 4Z54A 3DHNA 3ZLUA 1YS1X 2BYTA 4MQMA 4G5GA 4FFBA 1H0RA 1JVNA 4N39A 4KRXA 3KHKA 4MR9A 4G8JA 3LC2O 4TZ6A 3EODA 1YDGA 1JYSA 2MSNA 1NBOA 3JAWB 3L77A 5H4HA 5HIMA 3O92A 1MAVA 4CLDA 2N9UA 2PAAA 2ORYA 2WPDD 1EUZA 3A6FA 3GPIA 4W1PA 1O58A 3MAGA 5GPBA 2Z8YM 3RV4A 5K6AC 8OHMA 1TYCA 1JXOA 4WKPA 3D7KA 1I7PA 3EK2A 4PGHA 5DOZA 3JQBC 3KWJA 4KXVA 2QG4A 5CH3A 1C3LA 2FJ0A 4D98A 3BUSA 3QM1A 2B0CA 3E3AA 4A0GA 5AW4A 4WPGA 4ON9A 4GR5A 1LH0A 3NEYA 4Z2YA 1WKVA 4XVCA 4KR3A 4EGQA 2V55B 2XUIA 4RTMA 4FE4A 1P72A 2LD4A 3U9SA 1D6NA 4BFCA 2WJVA 2AQKA 1Q6YA 3GH3A 4RZ3A 1EGMB 3OAAD 1L7RA 3T9DA 1YV9A 4WZAA 4X7RA 4LYEA 1M34E 2SKEA 3E03A 1T8YA 2QTRA 3HRIA 1N2JA 1W4RA 3FLEA 1E0KA 2W0SA 2E4XA 1Q7CA 2YJNA 1WL8A 3LHDA 3QVTA 1Y9JA 4JB3A 1V39A 4G07A 4BO5A 2ST1A 2Q46A 3KDAA 5L3RA 3OPVA 4Q5IA 2F67A 4L0QA 4X66B 1U8TA 1UZAA 2W2NA 3PRYA 4FYVA 4NS4A 2REOA 4EPYA 4TS4A 2GBPA 4MW1A 2XX3A 5J4HA 5IZ4A 4GS5A 3UAOA 1I3LA 4NI5A 1VPLA 5AMXA 3AKEA 1M8GA 3DUFA 1SUCA 4MVJM 4X64B 3ZVMA 4YN3A 1E1KA 4H1UA 3KT6A 3D31A 4QJ3A 2Q4BA 1I6WA 4HEQA 5K3AA 1DC8A 3NMUF 4PZEA 1HLFA 4HEA6 3I04A 3F2IA 2YRXA 3H84A 3L8DA 5DNUA 1VPWA 1UPUA 3R7WB 2E82A 1T9HA 2OCXA 1JECA 1XRLA 4F2WA 1ECFA 1ZM2A 2PTGA 3F6BX 3RYIB 3G2LA 2GXUA 4BQEA 5BWCA 4EG1A 1RNLA 3AFIA 1GM5A 3EA0A 1OIWA 5A9SA 2O50A 3VSEA 4MGZR 1CZNA 1G2PA 1NBHA 3DXXA 2H85A 1RFLA 4RH0A 4P92A 2OG2A 1EFPA 5DV9A 3ZJVA 1NLYA 1XTPA 2FPXA 3P7MA 4YV1A 1P7CA 1KQGA 1U0EA 5IXJA 3GEPA 1EINA 5AKXA 4F6LA 2Q6OA 2UZAA 1CY8A 3K2EA 1J00A 1GKIA 1PTJA 4D81A 2HHLA 2AG5A 1RCTE 4IO0A 2VHVA 1EVIA 5G0WA 1VFPA 1E2GA 2ZJBA 1JIJA 2WHQA 1ZY2A 4UDYX 2WD8A 5EKTA 1ORIA 1XXHA 5A2GA 1LV7A 1QV9A 3RT7A 4QYSA 5JQGF 4NAUA 3N74A 4O4IA 5EL0A 3HB5X 1GKYA 2DWPA 1NV9A 2VJBA 4MVJP 3OEEA 4JXKA 4R9NA 4S1TA 1GTVA 4TTIA 4YAJA 2GXAA 2JAOA 2P68A 3JZDA 5A7HA 1EWTA 9ABPA 2CVOA 3ZVNA 2WU3A 3AR8A 2C7OA 4R31A 4HRXA 2WJ3A 3AR7A 1FFXA 2Q49A 3KKPA 3VPDA 1COWD 2IXEA 4PCVA 4DVGA 2WQZA 2QUHA 4DMUB 3F6EX 3STWA 1PI3A 1EVQA 4IUBS 1X14A 4JASB 2IYNA 4IHAA 1ZJJA 5EP4A 1BCSA 4MPJA 1FP1D 2WKRA 5EHIA 4A27A 4AQDA 3QKWA 3O4VA 1G8MA 4Y2JA 1ULHA 1MKYA 4JBHA 4WA7A 4AKSA 3JQ7A 3ET5A 3QY0A 4W6QA 4PIMA 1KXZA 5FO0A 4KXXA 4TKUA 1SD1A 3WDKA 2FUCA 4PPGA 5LA6B 1DKUA 3AR4A 4XW2A 5A1JA 2OECA 2XTJA 4FNOA 3BH0A 2DPYA 4YCMA 1KI8A 1JZSA 2XTZA 2OCKA 1HT2E 3PGXA 1KO5A 1BS1A 1Y3CE 2P7HA 3ELUA 5JVDF 1XZLA 5K5EA 3TXAA 2BFMA 2O3TA 4RHTA 2ZJ0A 3VAZA 2AR7A 1S8FA 2R97A 4IY1A 4PG8A 5AVVA 3UMMA 1VJRA 5EMHA 4KFUA 4OBWA 3CLUC 1O87A 4G5FA 1Q1ZA 3ZS9A 4BATA 3GUHA 1WVIA 1XYGA 2B8WA 3K9QO 4ZO6A 8LDHA 5LQKA 2OWEA 1BKDR 1UXGA 3HSYA 4X62B 1P1HA 3KKMA 2C5FA 1ONPA 3OE4A 4OA5A 2HKIA 5K05A 5LR6A 1N32B 4JI7B 3QI7A 3BE5A 1BMFD 2A9FA 2GARA 1XZ8A 1U28A 4PVDA 2I7DA 3AUUA 1KDOA 5EPOA 2J48A 5IJ9B 3DZDA 3PPYA 3D0QA 2Q07A 1NMZA 2V9PA 3CC8A 2YINC 2VPPA 4V1CI 2VSFA 4DIUA 3L4KA 2O3QA 3FSGD 3UYKA 2NWQA 4RGQA 1JG4A 3M1LA 4LF4B 2HLDA 3ISTA 3ZJ5A 4DXAA 1F38A 2HF7A 3HI4A 2NO5A 3TZCA 4TSFD 3UV6A 1VSBA 1KS9A 4LF7B 3T5CA 2ALJA 2H4XA 3JARA 4WFJA 1Y4SA 1QZUA 2CNWA 4BE7B 1YQGA 2VBIA 5K8IA 3P2KA 1DTWB 5CLJA 3C1UA 3NC4A 4KAAA 1KFEB 2GZ3A 3EVZA 3DZGA 4AULA 3D4LA 3E3MA 1WF6A 2FF7A 3A6DA 2ZSBA 3GA0A 3GJQA 3L7KA 1L7OA 5C1OA 5IWCA 5KSOA 4HN9A 2R25B 1ZNZA 1G21A 1QWSA 2PKXA 2W43A 4FC6A 4KFRA 2ZT6A 1Z18A 3ZWKA 1A4RA 4DKJA 3B1JA 1GUYA 1Z4PX 2CXPA 3GY0A 1T8PA 1W5TA 3SZRA 1NG9A 1RJWA 4XYLA 3BFKA 3EE6A 1HPLA 4PCAA 4M49A 4BFVA 4EK9A 2Q4OA 2IC5A 2Q0QA 5DRTA 3KXLA 2HMWA 2B21A 3GCGA 4QEZA 4CIXA 3IB6A 1NW5A 4GKVA 1GCGA 4TKZA 1G6KA 2BMAA 2NQ8A 2VAWA 4MKHA 4PRZA 2M6LA 3AY3A 1JSCA 3OJFA 2BFCB 1G3IA 4PG5A 1TM7E 4E12A 4X6YA 4K05A 3MGBA 2JGLA 4E30A 2PZMA 3KQVA 2O2YA 2VT6A 3T15A 1HE8B 1CNMA 2VN8A 2YZ2A 4I5DA 4QFDA 3G02A 1N1DA 5I9NA 2BFDA 2J8ZA 5DI3A 1UMDA 3H6HA 1S3IA 3PGA1 4PQGA 3IP8A 1KWKA 1A5BB 1NSTA 3MD0A 1R00A 3CSDA 2IYPA 3E1SA 3FA2A 3RVJA 3V8QA 3W05A 3IR7A 4U7DA 4XIFA 3QG1A 1MABB 1WO8A 1E4YA 1QDUA 2CMKA 1STOA 1MAWA 2JFHA 3I2GA 3PWSA 4WL0A 2ZP1A 4CKYA 2DJIA 4NH4A 5DK4A 3DL2A 1OX4B 5FIUA 3B85A 2PL3A 5D3MB 3TBKA 1UUFA 1VE9A 4BQOA 4KQHA 1M1NB 1T6XA 1GZ7A 4ND2A 5CB4F 4JI4B 1XX6A 2SHKA 1PJAA 3GGPA 3LP8A 4MSUA 4R0VA 3UENA 4AZTA 4IUCS 4CQLB 4DPKA 1NNEA 3Q3CA 2NUBA 5EWJB 5E6RA 3FOCA 1AXGA 4LVOA 1S1MA 1UPFA 4XJSA 2PZBA 3Q9UA 2CCGA 1BFUA 3FYSA 1WUHS 3MOSA 4HZUB 5HA5A 3SHQA 5BRAA 1H2FA 5JAHA 2GYUA 1ABBA 3FW1A 1USGA 4M0DA 2VDJA 5IJZA 2BFFB 1P73A 5DBFA 3ISVA 1BCRA 1PQ4A 3RS7A 1XSEA 2W2KB 4BFZA 4DRYA 1M8FA 3LDGA 1DO8A 5JY1A 4OI4A 3VTZA 1NN3A 1IVYA 2WSIA 2PE5A 3A1SA 2QWXA 4GOLD 2BGKA 1XL1A 1JA9A 5B4VA 5IFKA 2FFJA 3MQFA 5K8UA 5A4AA 1A0OA 1DXHA 4S12A 3ITKA 5BR4A 1ZRHA 5I47A 3DO5A 4DIFA 1JFSA 1AB6A 3ED1A 1ECGA 1CEXA 1RPJA 3T7RA 1NRXA 4NRDA 1YKSA 4R7ZA 4GPAA 1RJ9A 4R7GA 5AR1A 4P6VF 1NW6A 2PT7A 1HE5A 4C7JA 3K2BA 3B8EA 3TNFA 2ZTMA 1PVVA 4DTIA 4OAPA 4EFDA 4LFBB 4ER5A 1JQEA 3OFNA 2WJPA 2JGNA 4Q9LA 2H06A 3U7RA 1YQUA 3W6OA 5DK6A 3OWHA 3ZCXA 3T8YA 2UZ4A 3WYGA 2YC4C 3Q5DA 1YUBA 1OAOC 1GL6A 2P11A 5IJ0A 3OFSA 5LQRA 3BDAA 3MUNA 4M36A 1KEUA 3IL2A 1SXJE 1XVUA 2HHHB 4GP6A 3RIXA 1NOJA 1BE1A 2J3DA 1E98A 1TYDE 1PG5A 2AJCA 3DPUA 1CUWA 3E84A 3KEFA 4HHEA 4NVRA 4RZQA 4TV9F 4V24A 5DTMA 3DNMA 4LNUA 4NJMB 2Q6IA 5G0SA 1J2EA 2KLHA 3CZ4A 4PWYA 4ICIA 5EUQB 1IAVA 1S7GA 3AL2A 3D2CA 3RYHB 3RR2A 1ZESA 1NVFA 2YWCA 5JDCA 4J9UE 3WQBA 4A15A 4UC0A 4HQFA 1P4JA 2V5VA 1JDNA 3BZWA 4MUGA 4WBSA 4GDFA 1ATZA 5TMPA 2KSQA 2D2EA 2VK2A 2Z1MA 1DAGA 4IQ8A 4B35A 4ZTZB 4RTKA