1LPSA

A structural basis for the chiral preferences of lipases
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
534
structure length
534
Chain Sequence
b'APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase
total genus 192
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpsA00
4HRYA 2WIFA 4U2CA 4B80A 5ALFA 2BCEA 2JF0A 4FTWA 4J03A 1E3QA 2DHCA 3I1YA 4Q1VA 2OPHA 1MT3A 4X6XA 2IIVA 1RYYA 2XUHA 3VXKA 2XMDA 1SOMA 1A8SA 2WQZA 3RLIA 3SC2A 4H7HA 4KE9A 1VA5A 3WK5A 1LZLA 2WHPA 1QONA 1ZGBA 4X91A 1YR2A 4AN1A 1Y7HA 1ODSA 1CUWA 2VJBA 3QPCA 4JUIA 1MTZA 1MX5A 1CUAA 4KYVA 3LP5A 4DGQA 5CXUA 1MAHA 4WFIA 2QTBA 1MX9A 2JGEA 5AKXA 4V2IA 3JW8A 4KEAA 5AM2A 1XRRA 4Z49A 1WM1A 4H7FA 5DYTA 4GI1A 3L1HA 2PPLA 5K5EA 2PSJA 1VXOA 4Y2RA 5CRIA 5CT6A 1XZAA 4BCCA 4F60A 3G9ZA 1THGA 4E15A 1EK2A 3HACA 2RAUA 5ESRA 2JIDA 3IIIA 3S8YA 4I3FA 3MUNA 3WKCA 5IVDA 4J0DA 2WFLA 2HA7A 2C0PA 2GBGA 2JEZA 2J4FA 4QDXA 2ZSHA 5HQ3B 1XZIA 1MN6A 1VJ5A 2Z8ZA 3U1TA 3IUMA 5K3FA 2HU8A 1KU6A 2G5TA 1JU4A 1ORVA 3D2CA 3H18A 3TRDA 2JGMA 2PSDA 4FOLA 1ISPA 5AK4A 5CT8A 1G5FA 2WILA 5IVIA 5BWBA 4WY8A 5AICA 4K6HA 4CCWA 2HM7A 1QGED 1Q0ZA 3A6ZA 1T4MA 3W04A 4BE4A 2DQYA 2B9VA 5AI5A 3F96A 2WHPB 4AMZA 3D0KA 2WHRA 4L0CA 4DNFA 3BL8A 4H7DA 1K6EA 1IMJA 2OGZA 3I1IA 3DEAA 1W6RA 3IB3A 3F97A 4UFPA 1YA4A 4FLMA 5A7HA 4B83A 3SX4A 1CLEA 2Y2VA 4X6YA 1X2EA 2HL6A 2WFZA 1VLQA 2HA6A 5AIAA 3O4GA 4M0MA 4F21A 4EY4A 4ZXFA 3H1BA 5AI6A 5AK5A 3HLKA 1TK3A 3UMJA 3QBJA 4OCZA 1CFJA 4J0IA 4OB6A 4TVKA 4C4ZA 4BAZA 4OUKX 5LIPA 1LPNA 3QM1A 2AJBA 2O2IA 2FJ0A 1OILA 1R50A 1BN7A 4DNPA 5AJHA 2WG0A 2I3ZA 2XB6A 3PE6A 1QIIA 4A16A 5JZSA 3AILA 4B9AA 3PF9A 3AZOA 2WJ3A 5K3EA 3STYA 2J3QA 4E46A 2VTVA 5D6OA 4OSEA 4X94A 1MAAA 1T2NA 1F6WA 2WJ6A 3WWCA 5KBYA 3WWPA 3S2ZA 5IH7A 4LXGA 5AKYA 3C5WP 4PQEA 2DFPA 2BFNA 2BGRA 5CH8A 1SFRA 1AGYA 2J4CA 4DM7A 2H7XA 3A2NA 3PI6A 4WFKA 2O7RA 3ESDA 2QXTA 3DDUA 5T4FA 4UHDA 1GPKA 3WZLA 2VA9A 4X71A 1HBJA 4HAIA 3O95A 1C7JA 3H2IA 5AIBA 4LXHA 4KJXA 3G0IA 4FDMA 2H7YA 3HI4A 1A8UA 2CKMA 1UOQA 1LNSA 3PFBA 5FKJA 3GA7A 5FXMA 2H9YA 5SYNA 1AQLA 4J7AA 4KE8A 1OXMA 5AKGA 3H2GA 1YAJA 5YASA 2QJRA 1MX1A 3SWWA 2C5FA 3WKAA 1CUUA 2HU5A 1UKBA 1H2XA 1DTEA 4OB7A 4BCDA 3Q0TA 2WIKA 1JT2A 4W1SA 4YPVA 5ALSA 2HRRA 2RIPA 5AKHA 4G8CA 3WWEA 2HA3A 3D59A 2HDWA 5DNWA 2ACEA 3VJMA 4OU4A 4CG1A 2HADA 1E8MA 1U8EA 4EBBA 3WWDA 5AOAA 1XROA 2D0DA 2XQIA 4FKBA 4ETWA 4W9RA 3STTA 4J3JA 1JI3A 4HZGA 3C6ZA 1W52X 4KAAA 4Y2XA 3C45A 3G9TA 1UK8A 2WU3A 5ALYA 3F8SA 4MWTA 2Y2UA 2UZ0A 1QO9A 4BP8A 1H22A 4ZREA 1ZI6A 1K4YA 4U2BA 1QIGA 2VATA 1G42A 3G9XA 4RGYA 2QJWA 4UBKA 2QZPA 3FVRA 4G4IA 3QMWA 4PSDA 4IH9A 1WHSA 1QJ4A 3STWA 4IH4A 4RE5A 5EIHA 3W9UA 5EIEA 4PO3X 1YS2X 3G0DA 4B6GA 5AM4A 5AH0A 3ANTA 1E5TA 5DLPA 4HXGA 1EINA 2Z8XA 4W1QA 2WUEA 5AKJA 3FLEA 2H7CA 3LIIA 4UHFA 1F0PA 2GBIA 3EQ9A 2XQKA 2XQJA 4BAUA 4DSZA 3G0BA 4XIIA 4E11A 4HRXA 3K6KA 2EDCA 5A7GA 2I78A 3WKEA 5FRDA 1ZGCA 3R0VA 5LYYA 4TPKA 1TCAA 4ROTA 5K3AA 3ZV7A 3ESAA 2DSNA 3KXPA 3V1LA 1MNQA 2HA0A 3OPMA 1J07A 4H77A 3A2MA 4Q3OA 4UPDA 2QKYA 1XRNA 1TAHA 3PF8A 2DCMA 4AZ0A 3VISA 1K5PA 5AKIA 4GW3A 3BXPA 4FLEA 1YSCA 5JAPA 3V48A 1EDEA 5AO9A 1CRLA 1LPSA 1TRHA 4CI9A 4GHWA 4X6UA 1YB7A 1QZ3A 4H0CA 4Q3LA 3I2IA 4J0KA 1XQXA 1XZHA 3BJRA 1L7QA 2BAGA 3WI7A 4EY8A 3DNMA 3BIWA 3O9VA 2ZJFA 4S0XA 4NVRA 4DMFA 3WIBA 2XUKA 2VAVA 1GT6A 7YASA 4X93A 5I7UA 1ZOIA 2DQZA 4ZWNA 4CIAA 1FFEA 3BF7A 2ZYHA 3QPAA 4B82A 4UBLA 1XLWA 3ICWA 5ALDA 5FV4A 3STUA 2GYUA 5E2IA 4UUQA 4H35A 3L1JA 5AK3A 4DNQA 3I6ZA 1EB9A 2AJDA 3C6XA 4HTAA 1CVLA 1W1IA 2G5PA 3ZLVA 1VE7A 1EXWA 5ALVA 4C6HA 3R3XA 1UOOA 2GZRA 4DMCA 3D4LA 2JEYA 3BE8A 1XQWA 5ALRA 4OYLA 3AZPA 2O2HA 4ZI5A 2XUPA 3MGAA 2XUAA 3B12A 3NUZA 1GXSA 2RHWA 4HXFB 2V97A 2PU7A 1DWQA 1IVYA 3I2FA 5E4JA 3LS2A 4ARAA 2XMSA 3P2MA 1UXOA 3AIOA 2R8BA 4QA9A 1QIHA 5DWDA 5KWJA 1X2BA 4D9JA 5DJ5A 1PFQA 4X85A 2VJAA 4YX9A 1ZD4A 3FYUA 4Q34A 3G9UA 4AXBA 4BATA 1EDDA 1R9MA 1CUVA 5ALQA 4BDSA 2OGSA 2V98A 4P08A 1Q0RA 2QS9A 3EQ8A 1AURA 3DD5A 4WY5A 1GQSA 5T4EA 1D07A 4Q82A 1VA4A 3ANSA 1GKKA 3D5EA 5ALLA 5ALNA 3U0VA 3ZI7A 1EK1A 5LP1A 1F8UA 3TEJA 3I28A 2VSQA 4NMWA 5FUMA 4QEKA 5ALOA 3WZMA 2WIJA 4FBLA 3ZWQA 3H19A 3K2IA 5ALGA 4OD0A 2GBCA 5DYYA 4CG2A 4UFNA 2K2QB 5EHZA 5LKAA 2PSEA 4H7KA 3I6MA 4AO8A 5A6VA 3WWOA 1UFOA 4J0GA 1ETHA 4P92A 4QDTA 3NGMA 2X8BA 3EBLA 4BB0A 4GECA 4TGLA 2XMZA 4XX1A 1CUGA 2Z3ZA 1QIMA 1FFDA 4BRZA 3ED1A 3VKFA 5FOQA 3F98A 4MEAA 4C89A 1DT5A 2WTNA 2WTMA 5JYCA 3QVMA 3QYJA 5C7YA 2JBWA 3N0TA 4LYEA 1DWOA 4CIBA 1DX6A 2EEPA 1Y37A 1NU8A 2AJCA 3IURA 3C6BA 4JNCA 3STVA 3R3UA 4PV7A 4KE7A 3WLAA 2QOEA 2Y1KA 2BUAA 1QTIA 1CV2A 2PSHA 3C8HA 4X90A 3V9AA 3BWXA 1HPLA 4B0OA 2QUBA 3E1GA 4RE6A 4OPMA 1G4HA 3HZOA 4Y2UA 1DWPA 3K9BA 1H2ZA 5BV7A 2YASA 4NZZA 4I4CA 5JATA 1JJBA 5LZ8A 1UT6A 5LZ9A 3DCNA 4N8DA 1XZFA 3IDAA 1YAHA 2JGFA 1LGYA 3OTQA 2CEKA 4FHZA 1CUSA 1CUZA 3STXA 3ZLTA 1HQDA 1DQYA 5FPPA 1HLGA 3FSGA 2NW6A 4Y2YA 1EA5A 3G02A 5KREA 4FBMA 4BC1A 4DTCA 2ROQA 2C7BA 4FNGA 2WFLB 2OCKA 3IUQA 3W9BA 5IKXA 4FWBA 1IZ8A 3DOIA 4IO0A 4G8DA 3VVLA 4K6GA 4UBJA 5H3HA 4H7EA 4H7JA 1CUXA 1TKRA 1J1IA 2WG1A 3FNBA 5I9IA 1BU8A 2ZYRA 1MO2A 1CUHA 2IITA 1ZJ5A 1IUOA 5K3FB 2XUJA 2ACKA 5AK6A 1TCCA 4FLFA 5CT9A 5AI9A 1K63A 2HA2A 1IZ7A 5AOBA 1CUFA 5FLKA 5DYWA 3E0XA 4LXIA 3H0CA 1LZKA 1Q84A 4WDRA 3AUKA 3FCYA 1U65A 2XLBA 3O0DA 4CFSA 4B85A 4AO7A 4AB1A 4N5HX 2XQFA 3VVMA 3KD2A 4UHBA 4QDZA 3YASA 1MJ5A 1HKHA 3O4JA 4G4GA 4UFOA 2OQIA 2XI4A 1DU4A 1BROA 2JGLA 2B20A 1GPNA 3HABA 4G1FA 1YA8A 2QRUA 1UK6A 5AKZA 3G0CA 4MQMA 1JJFA 3KOOA 5LZ4A 5E4TA 1ZI9A 4P9NA 5LZ7A 3W06A 3KWFA 1NX9A 4HXEB 3HEAA 2Y6UA 1GQRA 5HF6A 1S8OA 5CXXA 3AIMA 5ALTA 5D7BA 2WIGA 3NOXA 4OYYA 1CUIA 5JD6A 4DSAA 5HKAA 5JZBA 4AMYA 4DMHA 2XUIA 3IUNA 5AP9A 1XZBA 2BUBA 2JGKA 3DYIA 1K8QA 3T52A 4MWSA 3R3ZA 3FOBA 3W2TA 4DIUA 1TIBA 4BZWA 1QO7A 5LZ2A 4U2EA 1M33A 1WPXA 4XWGA 5DNVA 3R41A 5ALPA 3V1KA 5CW2A 1W76A 4Y2VA 3F67A 3WQHA 1W4LA 1XZMA 3WKBA 5LKRA 1XRLA 5CT4A 4QDOA 4DYHA 4INZA 1A88A 5JD5A 2Z3WA 4PW0A 2CBGA 3FAKA 3R3VA 5EFZA 1C7IA 1QIJA 5ALIA 3TGLA 3LCRA 4KAJA 3BDVA 2OXEA 5ALKA 4WFJA 3DQZA 3WL5A 4O08A 1GPLA 1JU3A 3H04A 4UHHA 1ZJ4A 1KEZA 2ZYSA 1LPPA 4GXNA 5HK9A 3A70A 4DLNA 4G9EA 3PFCA 1B6GA 3R3YA 2JGJA 3E4DA 1XKTA 1XZJA 4Y9SA 2BKLA 2I3DA 2P8SA 1Z68A 3R40A 3D3NA 1VKHA 1QIKA 2C58A 4CCYA 1LBSA 2WG2A 3A2LA 1IUPA 1EB8A 1ZI8A 1BCRA 3N2ZB 4PNZA 2AJLI 5C8XA 2WUGA 2G4LA 1AC5A 4M0FA 3X3HA 1JFRA 2AJ8A 3IVMA 4EHBA 4DNOA 2AXEA 3IULA 4YK7A 4L72A 1L7RA 4M0EA 4G5XA 3OC0A 4RNCA 5JAHA 1A7UA 2R11A 1XRMA 2HU7A 4H18A 2XUGA 2YH2A 4L9AA 1XZCA 2XT0A 1FSSA 4LHEA 1VOTA 4OU5A 3BIXA 1U4NA 2RHTA 2PBLA 2PVSA 5CMLA 5JIBA 3HYSA 2WU4A 2C0QA 3V1MA 1E89A 1XQVA 5C8VA 4EY5A 2ZJ7A 4BVLA 1LBTA 5T4HA 1KU0A 4CG3A 2GZSA 4OB8A 4Y7DA 5IVHA 1G66A 2OGTA 1LPOA 1QE3A 1UZAA 3EIOA 3WL6A 1TCBA 3G0GA 4AX4A 3FCXA 1CPYA 5K3CA 4K6KA 3I2KA 3WKDA 1LPBB 2GYVA 1VZ2A 3VDXA 2GBFA 3UUFA 3RKSA 1EH5A 4GWLA 1EVQA 1AX9A 4BTLA 4N8EA 3B5EA 3C6YA 5AI8A 3FLBA 2YXPX 4CCYB 5EHXA 2PX6A 2CJPA 4HS9A 1DT3A 1XZKA 2WFMA 1ODTC 1C4XA 2IX9A 1XRQA 5FPQA 2Q0XA 2QUAA 2ZVDA 4X00A 4FFWA 1J06A 5AI0A 4ZGBA 3GZJA 4G8BA 1WCYA 1XRPA 5D3KA 1ACJA 4BBZA 2RONA 4J0JA 3C87A 1XZEA 4YASA 3IA2A 2EDAA 3OG9A 4LKOA 1ZICA 5AOCA 5K3BA 4BCBA 5A71A 2OCGA 5JASA 4BTVA 4BYMA 3GELA 3DOHA 2PUJA 1LPAB 2XLCA 4LIPD 3DLTA 1QOZA 1FFAA 5JARA 3IUJA 2VQ6A 2WHQA 1NU6A 4FMPA 4U2DA 1UK9A 5EI5A 3QMVA 4MXDA 1QLWA 3AFIA 3FSGD 4W63A 4KAFA 1JMYA 1P0IA 1CUEA 2XQGA 2XUFA 4ZRDA 5EGNA 4GDMA 3VJKA 3H17A 3FVTA 1CUDA 2XMBA 1CUCA 2VEOA 4C4YA 3QITA 5EIAA 4EY6A 4EUSA 3KDAA 1JMKC 4JH0A 4L3WA 5A7FA 5CURA 3OOSA 4KACA 1H23A 4AZ3A 5E4YA 3FYUC 4WJLA 4BRSA 5ALUA 2LIPA 6YASA 3AJAA 3B3QA 3Q8WA 2XE4A 1ACLA 1LLFA 3VJLA 1WB5A 4G4JA 3CCBA 3H1AA 1VXRA 5HFNA 1FJ2A 3H2KA 3I6YA 2DHDA 1XLUA 5C81A 2I03A 4A23A 1EX9A 2ORYA 4I19A 1LPMA 2CB9A 1BE0A 1O6FA 2WKWA 3PICA 3M82A 2WM2A 5AKLA 4BP9A 4ZV7A 3WYNA 4C88A 2OAEA 2OCLA 5JAOA 3RK4A 2XUDA 1GKLA 3PUHA 3CXUA 4ITVA 4QLAA 5D3ZA 4BDTA 1N5RA 2PM8A 1CUJA 1EVEA 3WJ2A 3G7NA 5FP0A 1IUNA 1ZIYA 2BJHA 4Y2JA 4BC0A 2QR5A 3MVEA 3OM8A 2QT9A 1CUBA 5DTJA 5ALMA 1BEEA 4KRYA 4RPCA 5HCUA 4UHCA 3I2JA 5DNUA 3C70A 4C01A 3HXKA 4C4XA 3F9CA 1L7AA 5AI4A 1CUYA 3O9MA 5J3JA 1AKNA 1MU0A 2QMQA 3AZQA 1GZ7A 3BJMA 3KSRA 4UBNA 3FYUB 2GYWA 1YS1X 1CQWA 4MEBA 3JYHA 2VAXA 4IH1A 1R9NA 2OCIA 3WK9A 1AUOA 2VJDA 1R1DA 5T4BA 2D5LA 5AM0A 4Y2PA 3QMMA 4QWMA 1P0QA 4BVKA 5ISMA 3DYVA 4Y2TA 1E8DA 2XDWA 4Y2SA 4J0CA 1MNAA 4G9GA 5A62A 3WK8A 1HL7A 4KE6A 1TQHA 1DX4A 2J3DA 4J0HA 5HZGA 1VE6A 4PSUA 1YASA 1BCSA 2JGIA 2W6CX 1ZIXA 2VF2A 4U2FA 4XVCA 2DR0A 5AHXA 1AZWA 1UKCA 5JALA 4QDUA 1ZD2P 1QFSA 2HIHA 1SCIA 1RP1A 2FX5A 4BZZA 4QZVA 3ZPXA 1J2EA 3WMRA 4Q3KA 5AM5A 5CT5A 3SK0A 1ZD3A 4H7IA 2BUCA 1R88A 3RM3A 1THTA 2ECFA 3UUEA 4W1RA 5BOVA 1GGVA 2X5XA 2O2GA 2C5GA 1EDBA 4QNNA 5AM3A 2OQVA 2PU5A 1USWA 1AMNA 1VZ3A 1CIJA 3DS8A 2WSLA 4UHEA 3IBTA 1E66A 2VT7A 5HKBA 5AKKA 5DTIA 3DL7A 2V9ZA 2QM0A 4QWWA 1JJIA 4W1PA 1SCQA 1QTRA 3LIPA 4IHAA 3WK4A 1I6WA 2FJPA 3MUOA 4WCVA 3PDCA 1N8SA 2XMQA 1YB6A 2CMFA 1XLVA 1BN6A 1P0MA 3EF3A 4PSCA 4B0PA 2XUOA 5BWCA 1WB4A 2CZQA 4XJVA 3H2HA 4MJ3A 4ARBA 1P0PA 3D2AA 5CH5A 3LLCA 1UK7A 1ODCA 1QFMA 3WK7A 3D2BA 2WUDA 2OAGA 4AO6A 1EHYA 1F0NA 1BRTA 3I2GA 3AINA 3D7RA 4N8SA 1BEZA 3EQ7A 3TJMA 2RGUA 3AIKA 4E14A 5KWIA 2XMGA 1N5MA 4KRXA 4MQLA 2ZYIA 3I2HA 2QXUA 5IVKA 1X70A 5EHNA 4AQDA 1DINA 2WLSA 2HFJA 2XMRA 2WIDA 3FLAA 2HRQA 2YYSA 3WL8A 1XQYA 4FNMA 3O4HA 5JANA 4F0JA 5CBKA 2HHAA 4UBIA 4F5ZA 3BF8A 1WB6A 2DHEA 2CUTA 3G8YA 4JEIA 4JYMA 4LYDA 5JZ9A 2Y6VA 2OLEA 3GBSA 4BAGA 3GFFA 4B81A 1B41A 2HA4A 1DQZA 3M83A 4C87A 2HA5A 5JAUA 4UBOA 2ONCA 1QIFA 4EB0A 2V96A 4GEGA 2E3JA 4JYPA 1Y7IA 4EA6A 3RARA 3ILSA 5LLSA 4N5IX 2VJCA 3M81A 1WHTA 1SCKA 5C8ZA 5AKEA 1QIDA 1OCEA 2O7VA 3L1IA 5HF8A 2ES4A 4QLOA 4B84A 3CN7A 5ALWA 1XKLA 2FUKA 5CH3A 3H2JA 2Z5GA 3GUUA 1RWQA 3T4UA 4BVJA 2W22A 3DKKA 1HDEA 2OG1A 4WDQA 2XUQA 3ESBA 3C5VA 1CQZA 3WYDA 3ZLUA 4HVTA 4MYSA 4P93A 4B9EA 3OURA 4DMKA 5EHQA 1XZGA 3WIOA 2B61A 5FDFA 3HC7A 5ALJA 5F4ZA 2WJ4A 4ZV9A 5A2GA 4FFVA 4GLBA 2ZJ6A 2PL5A 1UOPA 2PKYX 3ESCA 2G63A 1A8QA 3R3WA 1O6GA 3BDIA 1UWCA 3FWHA 2WUFA 1PV1A 3JWEA 4UBMA 4EZIA 5ALXA 5LZ5A 1WPRA 1UKAA 2PSFA 3DL4A 2X76A 3HSSA 3NWOA 1SC9A 4GBGA 1H2YA 4X92A 3V1NA 1WOMA 1R4ZA 3FYTA 5AM1A 4AN0A 3QH4A 1XZLA 3FBWA 1FFBA 3CCCA 1W75A 3QZUA 1U2EA 1ZD5A 4A5SA 2ZSIA 2QVBA 1QIEA 4IQ4A 3CN9A 3WA7A 4NS4A 2HFKA 5ALHA 4EY7A 5ALEA 5HFAA 3KWJA 1BS9A 1FFCA 5HK8A 5JADA 1MPXA 3C43A 2XMCA 3PUIA 4X97A 1CR6A 4B7ZA 3ICVA 2H1IA 5CTAA 1XFDA 5HF9A 2B4KA 1E8NA 4K5QA 2BGNA 3GROA 4K2AA 3W05A 4U2GA 2PUHA 3C8DA 1Q83A 4KR0A 4PF1A 4Q05A 4QE3A 3WJ1A 3QPDA 3WA6A 5SYMA 1ORWA 3WL7A 3DJYA 1JKMA 1XZDA 1R3DA 4Y2QA 2RI6A 3HRHA 1N1MA 3E3AA 2VT6A 5I8PA 5HF5A 2C4HA 1CEXA 5K3DA 1H2WA 5ALZA 3WK6A 5HQ3A 3DKRA 4X95A 4BE9A 4MYDA 4X7BA 3O4IA 1EI9A 3HJUA 1PJAA 4X3CA 1YCDA 3M3DA 5JD4A
chains in the Genus database with same CATH superfamily
1TM5E 2WIFA 3EH2A 4U2CA 1OZAA 4CM3A 2JF0A 4J03A 1JR3D 2G0TA 3W8FA 1YH3A 4NLLA 3WV5A 3ANXA 1E7RA 2Q4BA 1G8SA 2P7IA 3TTVA 1NW4A 3N76A 5FADA 3OE7D 1U8XX 4BNLA 3BWYA 5DW0A 2H7VA 3LY7A 4AJPA 1U3UA 3FI9A 3VDMA 4BNUA 1C8LA 1F5SA 1I2AA 4GS5A 1ZOLA 1WSBA 2K87A 3AJ8A 3L07A 5KUTA 5DNYB 1DIAA 1MV5A 4B87A 1WQ4A 4H7HA 4Q48A 1Q12A 4BTEA 4JGIA 4KKVA 1IB0A 4TRJA 5JXJA 4YJ2A 2C07A 2D1FA 1RWWA 4PC2A 1II0A 3WFJA 3PI7A 1QORA 3PLAE 2IYLD 4V0ME 1I4OA 3NJ4A 4MK4A 3CZ4A 5D84A 5IM4A 3EFHA 4XM1A 2F59A 4X91A 4CNBA 5KX5A 1A8IA 1YR2A 3GLIA 3DT6A 3EVAA 4OQFA 5K6AA 4JUIA 5EXEA 1JHRA 2Q5CA 4BWYA 4CR7A 3QVKA 3M5CA 4NENA 4RTPA 2GHRA 1CUAA 3L41A 2GDJA 4KZPA 4M1EA 3TSAA 5CXUA 2ZJZA 3WFIA 1NW5A 3PEFA 1OWNA 4WFIA 3P2EA 4G86A 2FN7A 2O06A 2Q9BA 4D3FA 2LBPA 2ZJBA 3FX2A 1MDFA 1Y1LA 2AR7A 1QV6A 2WF9A 5AKXA 3T3IA 5EJ4A 2R6CA 4ML3A 5LL6P 4MP6A 2DKNA 2HF9A 1SHTX 3OKCA 1KYVA 1E1NA 4PZLA 3I52A 2EW1A 2OHGA 3AHFA 4MS3B 5B7PA 2PXHA 5DYTA 1I36A 1KF0A 2V9PA 3B36A 4IXTA 5TQJA 2Q5QA 4G5HA 5JZOA 5TEVA 4Z7QB 3GCXA 4NE7A 5C8YF 2ZT5A 2V8BA 4CCSA 2F6RA 4MVJA 3T41A 3L8GA 1FMLA 3N2YA 5JFGA 5K45A 1XZAA 4BCCA 3CUVA 1II8B 2JIMA 4G65A 2H18A 2JI7A 1SUAA 3OJEA 5CP8A 2X40A 4F60A 5CDUA 3ZH9B 1QOQB 3MT0A 3QXHA 5F1YA 3ROTA 3K09A 4E15A 4JGBA 1MG0A 1QS0B 1FMJA 4TN1A 3MD0A 4ZZ2A 5NLLA 4TV9F 1QHFA 2HK8A 2YMMA 2YJ5A 3LBFA 1M66A 1N5LA 2M1XA 3OOHA 4TWAA 5CUQA 4ND5A 5AFSA 3S8YA 1RJDA 2Z2JA 3ZZUA 2HSGA 4WKGA 4Q02A 1NX6A 5FJJA 3LQFA 2AN5A 3NAQA 3W3ZB 1C41A 1JXAA 2WFLA 1PG2A 3Q11A 1YRYE 3GT0A 3DULA 2JEZA 3R0ZA 3SIXA 1M6NA 1V1MA 4D02A 4XFJA 2V1UA 1I10A 1KFKB 4R1UA 2CF5A 2E4YA 4D8VA 4R8RA 1TO6A 2ZSHA 1OH7A 2D3WA 3FCSB 3AK4A 1HNXB 4JZKA 3O21A 4K3UA 4B8WA 2PXCA 3IQEA 2BISA 3QNUA 4OO3A 1LS1A 3I4LA 3L0SA 4IJVA 3HP4A 1OBCA 3NOVA 2GS9A 4RO0A 3V7UA 1GTSA 3UGQA 2WWIA 1O6CA 5GONF 3T3EA 1OLXA 1YRQA 3RS4A 2MU1A 3IUMA 4LWQA 2QTRA 1M75A 3IX7A 3WRYC 2O48X 3NVKI 1FS5A 2V1XA 4KQIA 3PWKA 4BYGA 3H6KA 3M6WA 3GU3A 2A3RA 3E8SA 1N75A 1Y3HA 1B8PA 4QL3A 5BNWA 1IHDA 1KEUA 3QVTA 2YNMC 3IIMA 2N75A 2PSDA 1KZ1A 4ER7A 3O31A 3GFBA 2VYQA 3FMGA 1ISPA 4BO0A 3WNDA 2FQXA 1SIWA 4W9NC 3ZV3A 3WGMA 5FOQA 1BEUB 1XPRA 1HNWB 4H15A 5CT8A 3NMUF 4R01A 1G5FA 4PQRA 4GOXA 5IVIA 4HNUA 3WOVA 2VYCA 3JTMA 5AICA 1USKA 2AQ8A 1F6DA 1GL6A 3QA9A 4P54A 4DCSA 1NFQA 1Q0ZA 4IZIA 4RD1A 4CLXA 1ZH8A 1QC5A 4Y6PA 3PNVA 1GAQA 3W04A 2XZOA 3SC2B 3CVUA 2O2EA 3QG1A 2O0HA 4RESA 3N0RA 4BE4A 5JHGB 3A9VA 1BHJA 1WSAA 4U39A 2O52A 4P32A 4GI3A 3RYTC 1KWGA 4I1YA 1VIYA 3DMYA 2WHPB 1ISFA 3DPSA 1FC0A 2EFEB 1BMDA 4GP7A 3UFXA 1D4ZA 3B38A 4KRFA 3GFVA 3IOMA 4KODA 5TPWA 2H5EA 2Q3CA 2WC1A 4DE5A 3K1JA 3R9WA 1FS6A 4DNFA 4NCXA 1EJ6A 1T2AA 2ZSKA 2F48A 3E03A 3KT8A 3Q8KA 3LHDA 2AMYA 4OBBA 5C5CA 4TXLA 2ZKIA 4MULA 2IEDA 3OWXA 1YC2A 4HLNA 4HNQA 4KQGA 2FGKA 2WD7A 2OENG 5IP5A 2FWJA 2NTVA 1OFUX 3L8EA 5I7AA 3UJ3X 5FUQA 3NP7A 1M7HA 2Z4RA 2L19A 2OV4A 4KQWA 1G59A 3MWJA 4XFKA 3I1IA 3DEAA 4R7GA 3VO2A 1VB5A 5JQGA 3F97A 1D1SA 2P11A 3H42B 2PRZA 3CZ9A 4J2HA 3LQ2A 1QHNA 3L4EA 4Q9LA 1R9GA 1A7AA 4Y8VA 5TE9A 4B83A 2XWQA 1Y0BA 1EFDN 1AHHA 1FTYA 1GPBA 1QTNA 1HEIA 3CSUA 1H3FA 1X3SA 2QMZA 4PNPA 4KQ6A 4ER5A 3U16A 4TKMA 2AFIE 3BRSA 4DA7A 1R64A 3IVRA 3HV2A 3UMMA 2R44A 3BIJA 1P7WA 1X87A 5DIZA 4YXFA 1COZA 1VLQA 5B6JA 1K6MA 4GICA 2PA3A 3ABQB 2HA6A 1WDLA 3BBLA 4TUYB 2FQYA 3N5KA 5AIAA 1GNLA 4OJYA 1EUCA 4TX1A 1PQYA 4XGRA 1F4LA 4IQFA 1OTYA 2GPNA 4KO1S 5KMGA 3A32A 2PL9A 4ZXFA 2IDKA 1T4CA 3GXOA 1Y33E 3LWBA 4FE4A 4AD8A 2BBSA 3QW4B 3SEAA 3HLKA 3NLLA 5GADl 1PJTA 2BH9A 2R9VA 3BMNB 4DF3A 2BC9A 3FGPA 3KHKA 3NANA 4WEOA 2I4NA 1NNI1 4I9UA 5DM2A 4EBFA 4HUQB 5E6RA 1SHZA 2O19A 1RKXA 4OCZA 4BU1A 4KSBA 1XU7A 3HFJA 4Q01A 3E5MA 3H83A 1HSOA 1FX0B 4TVKA 1TUBB 4BAZA 1NR5A 1K68A 4OUKX 1TECE 4C22A 1XTTA 1G5HA 3GJQA 4DA9A 3QM1A 4D57A 4KQXA 1J5XA 5HX7A 2RGNA 2EFGA 5LSAA 1OILA 2E85A 3QPUA 3OOJA 1ORRA 1VJRA 1XA3A 4MLPA 1DRWA 2JFWA 2ZWPA 3NETA 4AKEA 4DNPA 1GR0A 2ERXA 4JLSA 2G06A 1F17A 2ZROA 3PDHA 5CG2A 2CXUA 2NX2A 3QWFA 4OXXA 4GNKA 4H4EA 3IBFA 4QFCA 1GDHA 1I01A 1IVNA 1GPAA 1J2YA 3KZVA 3QPBA 2QMUA 4JLPA 3FETA 3BS4A 3P5SA 4XDGA 2Q21A 1R0YA 1VE3A 4N65A 5JZSA 3RC2A 4FWIB 3AZOA 3MGBA 4RPHA 2D1QA 1HE8B 5MFZA 2FPLA 3U1VA 3SS9X 2W83A 3CLTD 3TW4A 4M49A 3MTQA 4OKNA 4HEA6 3C1OA 2O8CB 1WAMA 5CM2Z 3JU3A 4FSDA 5DLDA 1VKZA 4YV1A 2CDNA 1QYIA 2XKBA 3CUUA 3Q2KA 5CLIA 3WWCA 5BUCA 5KIAA 5EKDA 1DG9A 1KFEB 3IP1A 3JVVA 1E1DA 3P27A 4M1YA 1DBPA 3SS7X 4AY4A 4BKQA 4EJ0A 4KB5A 5CYOA 1NMQA 1I7QB 5IH7A 1I51A 5FO1A 1GAXA 2BFPA 1WNFA 1V35A 2CCKA 2CY0A 2DFPA 4MNTA 3VNSA 3ZDXB 1IH8A 3DXXA 3NDIA 5BP7A 3S28A 4L8FA 4HK4A 2ZB3A 2J0EA 5TARA 1I7PA 4M0KA 4IDOA 3G85A 4L16A 1QGUA 4G36A 3SHOA 5KNDH 1HZZA 5EMKA 1U6IA 2BGRA 1PGJA 1SFRA 3T15A 2OB1A 1CJUC 3E3NA 4DG5A 5TX7A 3X1XA 2X0FA 1E2EA 5TMEA 3RJMA 2J4CA 1CDZA 4CMEA 3IO5A 3K5WA 1BWPA 2DHRA 2QRMA 3PI6A 1Y6QA 4A6PA 5E7IA 3IV6A 3VTFA 3CNQS 3D0OA 4GI2A 2FSFA 4HDNA 4YN3A 3HL0A 4EO4A 1CZKA 5DOVA 2FMFA 3I23A 3K9HA 2W4IA 3TEFA 3VOBA 1F8XA 1FJGB 5DBIA 1KOFA 1GTL1 1HDYA 2EIHA 1HFJA 3IILA 5EE3A 4YRKA 1IBKB 4IDEA 2GCOB 3UCXA 3V46A 1RPAA 1VHDA 4FFRA 4IV5A 1N5IA 1XA0A 1KKMA 1CP2A 4I50B 4DJAA 4EX6A 2VA9A 3B51X 1NM5C 2JZNA 2QAGB 5I01A 4K9SA 2ZITA 4Q12A 3IJPA 1WY7A 2G9ZA 1ENOA 2ANBA 4EEXA 1OI7A 5A5VA 5B57C 2NU9B 4MP3A 4S1WA 2CYBA 2FK7A 2JFVA 1PNQA 2H7YA 4FDMA 2AN1A 2M1ZA 1MORA 3S27A 3VAYA 3VKWA 2CDRA 2QJTA 4F2WA 2QUJA 2P62A 3GA7A 4L57A 2DPGA 1Q1BA 2GM3A 4J7UA 2Q5OA 1W88B 1KYWA 1M0SA 1ZXXA 2I4LA 2FUCA 4YJHA 1AV6A 1U2DA 4LYHA 1H6DA 2M6KA 4PLYA 1E0DA 3A06A 1EZ1A 3OAAD 5AKGA 3X0DA 4D6XA 4ARIA 4XYBA 2PGXA 1MXHA 1ILWA 2YWHA 1KI6A 4S1TA 4U9UA 4AJNA 5M5BA 4JBNA 5YASA 1L3CA 1QYWA 2DFDA 2IEIA 1GRCA 2P77A 4FGSA 3WBBA 5BR4A 4NQRA 5DNDA 1MX1A 2ZR8A 4D92A 5C7LO 1TB4A 3WKAA 1NF9A 4UE2A 4V3BA 1XE3A 1TD1A 3RAFC 1UKBA 2XZLA 4R8SA 5KYXB 1DTEA 2RHGB 4PYRA 4J9UE 3A28A 3U7GA 2OV2A 3O2SB 4BGIA 2NSHA 3PIDA 4KUGA 4V0QA 2FWIA 3QU5A 1Y9AA 3VO9A 4RJ2A 2NPFA 3WLQA 4F9FA 2G71A 2PFSA 1LA2A 3GGSA 3TW8B 3GJSA 3DCYA 4MV7A 4Y6RA 2PNJA 2VNHA 4NABA 2WB4A 5ALSA 4DA4A 4FJ0A 1XVTA 3HNOA 5C3UA 3ORFA 2AJTA 4HB4A 1FCJA 3RYIA 3K31A 1HT2E 3COSA 2V0CA 4G8CA 3KEOA 2UZAA 1U7TA 4PLVA 2HDWA 5LOVF 3TQRA 1NUSA 5DNWA 4LYFA 5K0LA 5K8JB 2ACEA 3VJMA 2V7BA 4L02A 4WJKB 4D9BA 1CBUA 3BTUA 4ZOLA 4MUBA 2VNSA 1U8EA 1U7HA 5J4KA 1RC0A 4U7HA 4BNJA 4IKEA 5LB4A 3HDQA 5DSXA 3NM5A 1XROA 2D0DA 3R44A 3O75A 4FKBA 1CYDA 4HPJB 1B2LA 2RGAA 4B3SB 2QTZA 2CMDA 3P9SA 4OHZA 4M87A 3MG9A 4P3KA 3FZNA 5JBNA 2UUCB 2GD0A 4CU2A 3GFRA 4OIFA 4BV8A 3VC3A 4G5OA 4HO1X 2VR1A 1WLYA 3C45A 1FW8A 4Y9RA 3V8BA 4C20A 1GPUA 5AUPB 2LPMA 2UVPA 5SZIA 2GK3A 3EXHA 4DYVA 5BNZA 4CKWA 1ABFA 3D6NB 1UJCA 5CIQA 2VLBA 3AEKB 2VP6A 1NF3A 3P9ZA 2Y2UA 3LC7O 3K5PA 1KI9A 4IILA 4E21A 4YMLA 3D7KA 4KL8S 4ENWA 2E18A 4JA2A 4R5HA 4BP8A 3N0XA 3ZJ5A 3OJOA 1H22A 1Y3CE 3O8QA 2GYYA 4N3CA 2NYRA 3AVQA 3Q3JB 4ZREA 1OH6A 1C1XA 4IWYA 1IJBA 4F8EA 2W90A 4YQFA 2CGEA 3L8CA 4LDNA 1K4YA 4U2BA 2ZUCA 1PVOA 3U3DA 1OAAA 1UP4A 3C7KA 2IYYA 2OUKA 2VATA 4LJYA 3ADPA 2VC2B 4E1AA 1Z7YA 2PGNA 4ND3A 5LQRA 2XGGA 1NJ1A 1R74A 3JWJA 2X41A 2JI4A 5FR2A 4ARVA 2BMVA 4UBKA 2Q3MA 1XMJA 2X42A 2QZPA 4DR7B 1X3LA 3H9UA 2B9EA 3FVRA 4XI9A 3SQWA 1UBRS 1VBMA 3QYAA 2Y1GA 2EGUA 4JUAA 1ZH2A 2Y1CA 1YS6A 2A59A 2RKOA 4C05A 2J3IA 5ELXA 1T25A 1Z28A 1ZGJA 4IH9A 1WHSA 3AO0B 1T24A 3TI9A 1QJ4A 4CW7A 2ZWAA 3V2UA 3P26A 4UW9A 3W78A 4DDMA 4EYQA 2X3UA 1W0CA 3OLVA 5J2UA 1EGVB 3LVQE 3D8UA 4IH4A 5EIHA 3ABZA 1DZ3A 1OB2A 1H2RS 1N2EA 1CEYA 1YS2X 3G0DA 4EMUA 3VMFA 2RGEA 3KKLA 1HI9A 1N8TA 3PQDA 4NC9A 1QMGA 1D1TA 1AGPA 1RZ3A 1J20A 1EU1A 4IP0A 3IHLA 2MSCB 2OUIA 2P67A 4WLNA 4FYJA 2JJ2A 2C8LA 2ZRBA 5IAGA 4F86A 4RY8A 5JE8A 3UENA 3W5AA 2QX8A 1F4PA 5JMPA 1EDZA 1KAEA 5A0FA 1IG0A 1XNGA 4BNTA 5GVSA 1JA1A 3L6DA 2PWAA 3FTNA 2P40A 5EE9A 4ZI2A 1FUUA 4YJFB 3R9IA 2KS6A 3QKTA 3EQ9A 1RMTA 2XQKA 3NORA 1VM6A 5AWFC 5BW4A 2P4SA 1XQ1A 3ETGA 4PHGA 4R1LA 3H87A 4NHOA 3TOSA 4TYYA 3LWDA 4B4UA 1QQAA 3FG9A 4S2UA 4B3JA 4PX5A 2R6GA 3CZPA 4RXMA 2EDCA 1M0TA 3ZE6A 1WVIA 4K6MA 2RGGA 4RHXA 3FOZA 3QTTA 3FTDA 2XECA 2VTEA 2ZEJA 2QZZA 3T7JA 3MC1A 1K7XB 3AB3A 3HXMA 3HDVA 4TPKA 4UNSA 1QAQA 2I2BA 3U3OA 3GA0A 5LQJA 3CH4B 5L3SA 5K3AA 2OP1A 3KAKA 3ZV7A 3MTBA 8GPBA 2VZLA 4HS4A 3EIXA 2G83A 3A6PC 3CUSA 2HA0A 3HJBA 3GJ7A 4WA8A 1XCBA 4MP8A 1Y3BE 3FFAA 3KBBA 4H77A 2PUWA 3A2MA 4LHYA 5HUHA 2P2GA 1PT5A 4FOOA 4K6CA 1S2MA 4B46A 2BFDA 1RJ9A 1PVDA 4Q3OA 4UQLA 4NY1A 2R1VB 1UT8A 3EAGA 4KXQA 3J7TA 1XAIA 2CVZA 3PXBA 1TAHA 4Y1RB 5K9ZA 2R7MA 4FONA 1GUFA 1HY3A 3VISA 121PA 2VTKA 2WWRA 3CR3C 1K5PA 4S1VA 3GLHE 4TMZA 3VPXA 1JWAB 3BXPA 4K8RB 1P81A 3JQ6A 3VC7A 4R1QA 4RH0A 3WB1A 1A82A 1YSCA 2COKA 2WM3A 3LX4A 3QLTA 4ZIRA 5CA1F 2ZJ0A 3LSTA 5BSFA 4MVJD 3ICEA 1F0YA 3KFXA 3ZBQA 3MJ4A 3REFA 5IF9A 2VJLA 1EDEA 2ZIGA 2R1TB 1JPNA 3N2KB 1P1RA 1PV2A 2XDAA 2BEWA 1OH5A 1PGOA 1ZG3A 4X6UA 1IWOA 4JIGA 2ZVQX 2JLCA 4H0CA 3W0LB 1T9BA 2BVNA 5F2KA 1KWKA 1NNLA 3M2TA 4J0KA 1XQXA 3B1JA 1XEXA 1M34E 2YFQA 1HNZB 4YALA 3ZCSA 1VKJA 1DO2A 4EG8A 2IE0A 3FJOA 1RI1A 4WK6A 2JARA 4DJ5X 4D9NA 1YBHA 1L7QA 2BAGA 1PWEA 4FKZA 3WADA 3ND7A 4Z3KA 1I4DD 2MYPA 4ZZ3A 3FHOA 2HTFA 4ZD6A 2M9MA 1KERA 4OK6A 3AHHA 5A5EA 2VHQA 1OE0A 2J0VA 3BIWA 3O9VA 5G4LA 3ISJA 2B3TA 2OCBA 3CQ9A 3U7RA 4LXQA 4RUKA 1FFHA 1GZ4A 1W44A 3H9EO 3SF0A 1P61B 2FLWA 1JDZA 2GHTA 3DDHA 3WIBA 3QVVA 1D8TA 1JQDA 1QGAA 1KJJA 3ABSB 3CO5A 4JASB 1GT6A 4RELA 2DUMA 4XM2A 1UWKA 4AJJA 4IIFA 2QNBA 3HU2A 1Q7GA 1N0WA 4FR0A 4IIBA 4D43A 2H0AA 4J7CA 4R68A 4JMLA 1LBIA 1TCUA 4RV5A 3JQ9A 1J6UA 1SU8A 3GFOA 3LDGA 4RYLA 1QUFA 4PHFA 2H57A 4OQNA 3NHRA 2K4MA 2V58A 4WXYB 1ONBA 1QO0A 2VWPA 2XYQA 4IHJA 1XLWA 5ALDA 1P4SA 4BX2A 3VGJA 2BI4A 5FV4A 4BO1A 2GYUA 2PKXA 3RWMB 1M7BA 1W85A 3B20A 3Q7PA 4FEYA 1B8OA 1T6YA 4IXWA 2AZDA 1ZGGA 3Q8LA 3MAJA 2GARA 2EQBA 4RIHA 4D4MA 1BDHA 1P0FA 4DNQA 2VDUE 3B53X 1YB4A 3I6ZA 4YQZA 1KAOA 3OLCX 1IOVA 2XZPA 2VHJA 3MOGA 1GDTA 4CQNA 4JEHA 4AI6A 3L4BC 1JFFA 4QGGA 2DGDA 4Z9AA 1EX1A 3ZLVA 4ETIA 4WERA 3VQTA 3L05A 1D0VA 2BRUA 2GT1A 1GM5A 3MQ2A 4ZMSA 5ALVA 2WPDA 5DN6D 5JDIA 3R3XA 3KSDO 4NXNB 1QRTA 1UR5A 3AFMA 3DMHA 3IE2A 4G3XA 4A15A 4U9IS 3MT7A 4YRSA 3KEQA 5CPFA 3L6UA 4F12A 4NKRA 4ZGBA 1T4DA 2F90A 4Y0VA 1QVWA 1XQWA 4YUWA 4JLWA 3GLFA 2V7XA 1GNSA 1TZKA 2R97A 2IXTA 2O2HA 2QT0A 1JG7A 3FYHA 3UHJA 4D9IA 3O0TA 4GPBA 5F1OA 3JWIA 4FGZA 1V7QA 5BXYA 1E9RA 3ZIAA 2JPDA 3OJWA 3BE5A 1Y1RA 2CVHA 3QBEA 1SVIA 5FTJA 2YCBA 3ZBUA 1GXSA 2RHWA 3D9QX 4GSKA 3V4PB 3ILVA 3IT1A 4CIDA 4E07A 1ZR4A 4W5JA 5J2TB 1QUEA 1G64A 4EO7A 2HIAA 2IHJA 3NYRA 3P0FA 5E4JA 4DXDA 3VMMA 1IIRA 2GVDC 4G1MB 4PVCA 4ARAA 4JLNA 4HUTA 4M1QA 5JW6A 3P2MA 3ELYA 5FA5A 1Z38A 4ZCTA 4E70A 3ZLJA 1SHKA 4HEJA 4P35A 1JEQA 4EH1A 1X1BA 1EVIA 1X2BA 3BWMA 4CZ2A 4EG0A 1MW9X 3IUPA 5DJ5A 1WKBA 3CZMA 1PFQA 3LY5A 1H2EA 1X7YA 1X9GA 3V8RA 4LNAA 4LC1A 2F3PA 3GDHA 3ZDZB 4Q34A 2G82A 4IF6A 5F51A 3QEMA 3NDPA 3CKKA 2R751 3VC1A 3TX6A 4XQCA 2IYZA 3D3WB 5HFJA 2XCUA 4JITA 2XYVA 1SZJG 1N2GA 5T6MA 1CUVA 2JIZD 4I1OA 4WOBA 2ACWA 4QXQA 2C9CA 2BFBB 3TXAA 3TQHA 2WYOA 5EJAA 1DKPA 1Q0RA 1ZOPA 3MTDA 5FBKA 2B0JA 4DIKA 5GIPE 3DD5A 5JQWA 3SZGA 1P2UA 4OFBA 1D07A 4RK5A 3VU1A 1K8ZB 2WVJA 3AOGA 3P0JA 4MITA 2JJQA 4DWOA 5KVSA 1W2GA 4DSTA 3BQNB 3DOOA 4P7GA 1N2OA 4QSMA 3UWPA 2B7BA 3KO8A 1F2TB 1N78A 3IP5A 1PGNA 3FSRA 3W7VA 1GKKA 3VX3A 3LTEA 1Y42X 3A9RA 7ADHA 1PJLA 3Q1KA 4MAMA 1ZW1A 2XTNA 2WICA 1EK1A 3L04A 4FFOA 4MW7A 5JD3A 4A8HA 3TR5A 3BKXA 4M36A 4ZHSA 3I28A 1F3LA 3FPLA 2XA2A 1QNFA 3JRXA 5CB4F 3DE6X 3TG2A 3WGVA 1HOXA 1N9GA 2LUOA 3PCRB 5GM1A 4BY9E 3JQAA 3L93A 4BO7A 3SXUA 3TD6A 5IDQA 5EPUA 3K8ZA 1H4TA 3GGJA 4IRUB 4GMFA 1GDDA 5CK5A 2JFYA 3AWDA 5FUMA 4QEKA 4RV4A 4FBLA 5TQ2A 3ZWQA 3H19A 2C4UA 4CDGA 1W36C 4IG4A 3UJAA 2FPOA 3ANLA 1WXIA 3K2IA 3GO4A 3A9UA 4FEEA 4PGFA 3LK6A 4DCCA 4OD0A 1Y82A 2CK3D 5H3CA 4KIWA 2WDPA 3PDIB 1Y4AE 4RFLA 3VNUA 1IY9A 1D4OA 1ZM2A 5DYYA 4DGSA 1ZLXA 2K2QB 2Q1WA 1JP7A 3DTVD 4U7TB 4OFXA 5JCJA 1FA9A 4EMSA 4QJ3A 1I1HA 1OOEA 4P4NA 5EHZA 4DG8A 3OM1A 1XK7A 2OCXA 4KDEA 1R8SA 1T5IA 2IGTA 1RW4A 3AEXA 3DTNA 3DZBA 1GLVA 1QPBA 5BSMA 1LQ2A 1AU9A 4CEIA 4TYMA 3RREA 4F6RB 4ZEMA 2GA8A 5DXJA 5CJJA 3WWOA 1NWCA 4GLFA 2EKZA 1G2QA 4ISBA 4WK4B 1ETHA 1OBOA 2EFHB 2QF7A 1SXJC 1NHWA 3CS3A 3NGMA 4EYEA 1KP2A 5JBIA 2HEGA 2KE5A 4B5KA 4OQXA 3KQUA 1SUBA 1TPZA 1W96A 2FLKA 2OQ2A 2P2DA 1KH1A 3EVFA 4GECA 1VPLA 2OCAA 1OPXA 1FLNA 2GCPA 4WZAB 4XX1A 4C03A 4D82A 1IBMB 1CUGA 5LMCA 2Y9MB 3HB1A 3PNPA 3TTSA 4UKDA 2C8VA 2QQ5A 4OP3A 3ZY5A 3PSAA 2LVBA 2ZREA 3ED1A 5IEBA 3VKFA 1P1KA 3CSSA 3ZQJA 2IBMA 2Q46A 5EJ7A 2Y0PA 2TECE 3B48A 1IAVA 3DQQA 1KZ4A 3JYOA 3OJ0A 4MEAA 1DT5A 3LXRA 2R8RA 4KIGA 4CETA 1DC4A 5JYCA 5JUWA 2Z9BA 3AVYA 1B0UA 1JXQA 3CF4G 3CX4A 3Q0EA 3GNQA 5AW6A 1JH9A 1HETA 3QYJA 4IM7A 1GZDA 1E1RA 5GY7A 2AEJA 2X6TA 3WIUA 2H1WA 2OD7A 3V97A 1H4VB 1SCJA 2SBTA 1DWOA 1GCIA 1PQ4A 1P91A 1DX6A 1Q3KA 2EATA 2VEDA 2WF6A 3L0DA 4H6WA 1CHNA 4PNEA 4EJ2A 5JR3A 3IEIA 3HVRA 1KJ8A 1P5ZB 2AJCA 1BE6A 3HCDA 3OQJA 3C6BA 4F4HA 3F5SA 3URMA 2D74A 3QVUA 4LDZA 1Z4JA 1BDMA 4POAA 4WRRA 2Q0HA 3ZV4A 4B7CA 4Q1BA 4EUNA 3ZGZA 2C5EA 1ZK1A 2OD9A 2ZPAA 3IPXA 3AKDA 3OX4A 3OPYB 4MZXA 5AQ1A 1UDBA 1ST2A 1KVTA 1XDWA 1J8DA 4ZO6A 2J6BA 1CV2A 1XCGB 4REQA 1PZGA 3D02A 1B74A 2X0EA 3T4XA 4ZYVA 1HPLA 1Q50A 3H8SA 3IMKA 1QWSA 4Z9XA 1IXYA 3FWNA 4KFCA 3RAPR 1NRJB 2JLAA 4OPMA 2ZQ5A 1ZBQA 2HCFA 1G4HA 1SRQA 2JCYA 4UUNA 1ZU5A 4W7SA 4XASA 1DWPA 4GKBA 1H3EA 5CLQA 2O2DA 3Q9UA 4Q93A 2NP6A 1XD2A 2RDMA 1VRWA 1Z4KA 2PT5A 2YASA 3FFTA 1K08A 4I4CA 5F1KA 4DV6B 1FSPA 3OMLA 2H16A 1L4LA 2QN9A 5LA6F 4AS3A 3HZHA 1XAJA 5FPSA 1RXUA 4AKSA 2Q7DA 1LDMA 1AT1A 5LZ9A 3EUEA 3DHYA 1U2GA 2V6IA 3CONA 5EMHA 4C4RA 3IDAA 2ZRNA 5EJGA 5L4NA 1YAHA 3DO5A 1MAUA 2JGFA 3NVAA 4PG8A 3D5TA 4G2NA 1WKCA 1M67A 4WQMA 4XYEA 1Z17A 1CUZA 3RYCB 1XOIA 3E9QA 2B5VA 1HQDA 4IHQA 5FPPA 1RHRA 3MXOA 5B37A 1JDSA 2XZTA 2J46A 3O82A 1EQAA 2KM1A 4NOJA 2VNKA 1SPXA 3HB7A 5ARDA 3WGUA 3UJ8A 2WAMA 4DTCA 2XXBA 3O94A 4NU6A 1OT5A 1NL3A 1N0UA 2YWRA 3EUAA 2H1OA 3MEQA 4DXHA 4FNGA 1LDBA 4TQ9A 5B1IA 5IRCD 3TE7A 1G63A 2A35A 2EZTA 3VSAA 5IZCC 3DEZA 2XWPA 2FZLA 4Y6GB 4RSGA 3PITA 1RMYA 2Q27A 3O1HB 3Q88A 4OHWA 2PUFA 1JQAA 4EI9A 3SJZA 4M6WB 1GY8A 2CNOA 2AR0A 4J0QA 5CAEB 2PX4A 4G8DA 3IB6A 4CM9A 1T5DX 1AB6A 3E05A 3KT6A 2PS0A 4H7EA 4H7JA 5GZ1A 1U1FA 3AHDA 4TUYF 4ZQHA 1ZSNA 1TKRA 2PNFA 3DLPX 1J1IA 2JATA 2WG1A 2WMYA 3FYDA 1PGPA 3H7IA 3HGQA 5B30A 1U3WA 4C4SA 3SYKA 4MGEA 1IUOA 2IY7A 3MJRA 2HO4A 4M9XA 5K3FB 1C1YA 4PO9A 1M9NA 5D3QA 2ZIZA 5AK6A 3VI3B 1NZDA 4WCFC 4V0OA 1GL3A 4WOKA 1OZGA 4B3FX 5B2FA 2G5GX 1Z33A 1VRCA 3JAKA 3HEMA 1YQ9A 2X9QA 1B1CA 2J30A 3B1YA 4G1BA 1O89A 2ISQA 1IZ7A 3GFTA 1VDZA 5AOBA 3TL3A 3UJ6A 1U7WA 4P83A 3AUYA 4YAFA 3D0QA 3K2EA 3T9AA 1ABEA 2HBQA 4HMPA 4QTZA 3TZBA 1EFLA 1HLDA 3UH0A 3ZEIA 3E0XA 1ESDA 2Q2QA 3HU1A 5IAKA 3U7HB 1G6Q1 3FCYA 2O2SA 2CW5A 4ZGWA 3HCWA 3ZGNA 4CFSA 4DPLA 2G80A 4B2PA 3UVEA 2C9MA 3TTWA 4F2PA 5HS4A 2C2HA 1J2TA 4QXOA 1SXPA 1CU1A 4KLNA 1CQJA 3GLGE 1B8VA 2LTAA 3EMBA 2BFEB 2H4XA 3R3JA 3OU6A 3OQ6A 3P0RA 5H1YA 1PUXA 2VZ0A 4E51A 4QQFA 3LO5A 4AYXA 2PKQO 1JL3A 3EPLA 1I1OA 1HKHA 1NYLA 3F90A 3PRYA 2O07A 1YOVB 3N8HA 3O4JA 1RDFA 3PHBE 3KB2A 2NU6A 3S2FA 1AQNA 2RHHA 4G4GA 4G9BA 3FKQA 3OZEA 2PUBA 4PIPA 2XB4A 3SVLA 3DFMA 2GD6A 4FZ3A 1DU4A 5JECA 2QM3A 1BROA 2JGLA 4I7EA 3TXYA 2B20A 4LYYA 3SJ7A 1DKQA 3HABA 4N0QA 4REMA 1YJ8A 1VI2A 1NOJA 2EQAA 2H1SA 4G1FA 1U4OA 4KBYA 4LZWA 5T6BA 4V1CB 4L8WB 1I4LD 4P81A 2ODAA 4GI7A 421PA 1XTRA 3ENKA 3G0CA 2PWZA 1SG6A 2B83A 2NZ2A 4OTZA 4TKUB 1E4EB 4ENSA 2OB2A 3RUDA 4MQMA 4Z0PA 3ZNOA 1WCV1 4M83A 4TZ6A 5LZ4A 3PCXA 3AUUA 3FW1A 1LTKA 4P9NA 1DXOA 3JARB 2K5UA 4I6JA 5LZ7A 3DW1X 3JZIA 1VJCA 1HFEL 3PX2A 4HXEB 5C1PA 3CA8A 2NLOA 4DY4A 2YZMA 3H75A 2DUNA 4R51A 3R23A 3HEAA 4YRTA 7GPBA 3PXDA 3RGGA 1GQRA 3KQOA 3PIIA 1OIXA 1DTSA 4K86A 4RLFA 1L4UA 4Z2AA 3CVYA 5CXXA 2UU9B 1LSOA 3HJNA 4YY3B 1GAEO 1KJYA 2YQ4A 3RTCA 4EUFA 5HXAA 2JEOA 4MQFA 3IFSA 1C2YA 5JU6A 1A77A 1O4WA 1ZM9A 1T6NA 4ZU1X 3PP8A 5G1NA 3AXSA 5JD6A 2JH3A 3PR2B 5AW1A 4O2RA 4JI3B 1ZCAA 4W5RA 4R31A 4XSGA 1OA1A 1TTTA 1FMTA 1DXHA 2D1TA 1XXHB 4QU5A 4AMYA 3PWZA 7REQB 1PW5A 4KVZA 1NRWA 1MA3A 3QVWA 3Q41A 4LJ9A 4X20A 5A3SA 3ZUGA 3D31A 2XUIA 3LUJA 5AP9A 1L7EA 5ETJA 1P18A 1GO2A 2J0SA 4DR4B 2O20A 3JYPA 1KSFX 1H6AA 3L7JA 4GLOA 4K9MA 1XTKA 1T3SA 3K0EA 3LUFA 3O3NB 3TZHA 5LQCA 2YZGA 3FGNA 5ITWA 4NR0A 4JLAA 1MG5A 1BMFA 1SVMA 2QTCA 4TTAA 4DIUA 1GUYA 4UDXX 1CF2O 3RUAA 1A5BB 1FVOA 3GJXC 4YMIA 3RSFA 1REQA 1C3OB 1P4AA 2E7ZA 1EFCA 2QPOA 3ZN2A 4OBXA 2H8KA 2WEKA 3QBTA 3KSBC 1P31A 1PT8A 1WPXA 2X14A 4LGVA 2HSWA 4OHBA 1PJ8A 1MIOA 4R3UC 4E09A 5CEEA 2CSUA 3D1LA 2AE1A 3F67A 2VQFB 2YHSA 3VYSB 1H66A 2K2WA 4C0AC 3KSMA 2D5CA 3ECSA 5GJVC 2VXYA 2ZUUA 4RL6A 1T1RA 3WKBA 2PKCA 2IH2A 3D1JA 1L4BA 4ESHA 1NUQA 2ZYAA 3W6UA 3G7SA 5P8WA 3QKRB 4QPJC 3QXSA 4C2TA 2GXQA 3C7AA 2OPBA 2REQA 5EJ6A 1OT3A 2RBEA 1WBJB 2EXXA 3SQOA 4Q15A 4QG3A 1S4MA 4JLOA 2Z1MA 3CWCA 3OTGA 1UBFA 2OG2A 3NATA 3O8BA 1RWVA 4NU8X 3GD7A 4U0KA 5B58T 2C7QA 2YUIA 4MHTA 2CBGA 5EL0A 1RAEA 2KI5A 2D2XA 3H3JA 5EFZA 4J3FA 5IYZB 1DKOA 2E9SA 5A4MS 1QIJA 1A50B 2WTEA 1G5PA 1AO3A 1K97A 1GD1O 1R5NA 1ZMBA 3KT3A 3P9RA 4OREX 4PC7A 2EKDA 3NHMA 4RHEA 3RB8A 4EJFA 1H5UA 4CKZA 3W5CA 1RXVA 4N6NA 1X8KA 3LCRA 1QK4A 5IG2A 4WFQA 5JWHA 4J07A 2C96A 4R2XA 1E9AA 5ALKA 4ITUA 4J2OA 4ALIA 2VYVD 1RLUA 3GI1A 3OY7A 2F55A 4KLAA 2NMVA 1RU3A 2YHIB 2YIDA 4GT1A 4D8YA 1YJXA 1C7RA 5GV7A 3WL5A 4JBWA 2V45A 2J5KA 2VJYA 1HZJA 1ZIOA 3QX8A 4KYIB 1JU3A 1J0DA 4Z9YA 4DJDC 2D62A 4UHHA 3KS9A 5GJCA 4FHGA 1E9SA 3R20A 2Q49A 2JFFA 3LF2A 5BN3A 2A9PA 4GXNA 5H02A 4BB5A 3T7AA 1OXTA 1QV7A 4MR9A 3L1VA 5LWQA 4QQKA 1JDBC 3BRCA 4WBNB 5HZMA 3LDHA 1BX1A 2C1XA 3NV9A 5FEUA 2A5LA 4K7JA 3RODA 3E4DA 4H17A 4E5VA 1HWYA 2E87A 3AETB 2BKLA 5EJMA 4LFAB 2BEKA 3RC7A 2HR1A 2NO4A 3RVJA 1YR3A 5HG0A 2F3RA 3R40A 1Z68A 4KXUA 2WE7A 3U3XA 2X77A 3E15A 1SH7A 4LCBA 2Q5FA 2XRFA 3L18A 4LX0A 2GXUA 2VKQA 2XF2A 1LBSA 3AY3A 4ANFA 2GJKA 1Y9JA 1IUPA 1KQOA 2ZYTX 3A2LA 2XV1A 4ZCSA 4LVCA 2JJ1D 3ZE2B 2I67A 3P32A 2AJLI 3I62A 3E70C 1R18A 4QDKA 2XY4A 2O1XA 1FU7A 1ZOSA 2BONA 2P6NA 3RDPA 3LL7A 2FEPA 3H13A 2UVDA 2TMGA 3QU4A 4TV8B 1XDBA 1FVHA 1KPHA 3CLTC 4M54A 4W6QA 3X3HA 3H86A 4ASUA 1JFRA 1VMIA 1YQXA 4URYR 1HTWA 3PB3A 4B7XA 2VHCA 2NV6A 4DNOA 1E7SA 3Q8XB 3Q85A 1FLAA 4F3TA 1OUMA 2IEYA 5COBA 1XL0A 4F8JA 5HM6A 1GG9A 3NNDA 4LHVA 2QUIA 4GMDA 4CMHA 2OXCA 1SXJE 3UG6A 4O63O 4BNWA 3DDSA 4JOQA 2WB2A 2R11A 4PC6A 1E2JA 3VR1A 1XRMA 1CK4A 4ABYA 2HW8A 4FEGA 1XZCA 1QHIA 1ARZA 3IV9A 5PNTA 1VOTA 4LOAA 2R65A 3BIXA 3NM6B 2ANCA 1SQSA 4OU5A 1NPTO 2RHTA 4V0LA 2O8VA 2C4NA 2WZCA 3FN4A 3OF2A 4IRXA 3MGKA 4MQEA 1JDUA 4YCJA 1NW8A 5K0FA 1FRNA 2CLEB 1NBMD 1ZWKA 2DC1A 3ZTYA 1N32B 2E5FA 4D3SA 5CB6A 1E9DA 4NIMA 3IPCA 5CMLA 4PN3A 1OY1A 1Z26A 4PYQA 2OORA 4AS1A 3GOQA 2H4WA 1OJ7A 3MTAA 1ZESA 4M1KA 4Q9DA 5ALPA 2VZ8A 3DH0A 3TRJA 4AMBA 4F6RA 2RHMA 1E3WB 1I9GA 1NMSA 3UAOA 4EYGA 1TW2A 2AV6A 3I8XA 1XQVA 3BH6A 3OBIA 4I55B 1IBRA 2QXYA 1P5RA 3EW7A 4KQ2A 1PNTA 4HTFA 3GIDA 3M5DA 1AXRA 4UM5A 5IBRA 1EIZA 2ZBPA 2BHNA 4C7OA 2VNAA 3VH1A 3ND6A 1LBTA 2VH5R 4S1NA 4RJKA 2VT3A 1C4OA 2NU8B 2WF8A 2CV0A 3RIYA 3AEQA 1H1TA 4LPSA 2H92A 3EC1A 1R4MA 4JYBA 2ORED 2F00A 3UWMA 1E64A 1YK1A 3VKUA 3PUZA 1LPOA 1QE3A 3A4NA 2B0CA 2MYTA 3KYIB 3AMVA 3NT5A 4MS4B 1UQTA 2SICE 4AX4A 3P52A 1G9SA 2WRZA 3JALB 3P45A 4Q3NA 4F71A 3LQYA 5K3CA 4RL4A 4KOEC 5BN5A 4GLJA 4ZK2A 3HB4X 5EQTA 2IV3A 3VUFA 1E61A 5GTDA 5DSTA 3QELA 3JSXA 4G5SA 1IYZA 4LCJA 3STVA 2G08A 3UEOA 5C5DA 1V25A 1E6EA 2C59A 3RJ5A 3DLIA 3WKDA 1LPBB 2GYVA 4NBRA 5JCJD 1CJSA 2UUAB 4KGVA 1TQ6A 2KMLA 3A1WA 1E9BA 3L7LA 3SYTA 3VDXA 4RMHA 3DDZX 4EL0A 2HIMA 1RZVA 4C06A 1JYFA 4EKIA 2AZTA 2ATIA 3RKSA 3U9SA 2WTUA 1R4NA 1U9JA 1V8ZA 1ZEMA 4A2PA 4MS3A 3LCJA 1A04A 5B1SA 4EW2A 1N7GA 3AM1A 2O5CA 1AX9A 3C7DB 3AHGA 5FUWA 2QMHA 1IN6A 4IR7A 3B5EA 4YAUA 1T9ZA 5AI8A 5FIUA 5ABPA 1W5EA 2FPKA 3GMSA 1DQRA 1JR3E 2I6FA 2YFYA 2BH2A 1J8QA 3TSCA 1V4NA 4TMFA 5EHXA 3TINA 1BCRB 4HQFA 2UZIR 1WJGA 3ZBTA 4DJJA 4LJRA 3IBSA 5AJUA 2NQ2C 2ZI3A 2CE7A 1ZEJA 2W2NA 4JB0A 4EKDA 3BTOA 2CJXA 2WMDA 4UU1A 5I51A 3EXG2 4NCAA 1L7DA 1XAGA 3ADCA 2GPTA 1QS0A 3NQ41 5CA0A 3IVCA 4D56A 4ZYWA 4RMIA 1WW3A 4EG6A 2B92A 3BL5A 3HGTA 3M9WA 1LDNA 5K51A 1E1RD 1BW9B 3A6DA 2R7AA 4NMMA 1GNPA 4HDMB 5K4GA 4BXOA 2L69A 1RXSA 2EG9A 5IK2A 4B31A 1WDTA 1JDJA 4FFWA 4V02A 3ETNA 5E6SB 4DS3A 1QPGA 2ID7A 1ID1A 4QEZA 4CLEA 2D8MA 5IXYA 4HDCA 1Y7TA 2I3GA 3RABA 5AK0A 4E5MA 2CBZA 4N76A 4PX3A 3TQQA 1P4GA 1TU3A 2V03A 3DBHA 3KFVA 5EZQA 4AJHA 4MDYA 1XRPA 1G8YA 2X15A 1T9HA 3L1UA 4ZICA 1A5AB 4C2UA 1U8FO 1NC3A 3CW9A 2RONA 4YDRA 5I3CA 3HXOA 4JIMA 3U0BA 1HRDA 2CLDX 3M6AA 2Q8QA 3KPYA 3IA2A 2Y1DA 1HDRA 2ZI4A 5IUKC 4FP9A 2F1KA 4GX0A 1XB2A 1QF7A 3RC3A 1DXYA 1FXWF 1G5RA 5IULC 1TQ8A 3OG9A 2EYUA 4Z54A 1W73A 4LKOA 5FOVA 2JVKA 5KYUA 4RK4A 5B5SA 3SBXA 3SSAA 2FVYA 5K3BA 5F7JA 4DUPA 3OEHA 1A7KA 1PLJA 1T2VA 3E84A 4ND2A 1FXSA 5JASA 1E1CB 4H1HA 4HCJA 3DBIA 5F9FA 3ABRB 1M72A 3S1LA 4RBNA 1C0LA 1G7CA 3PLNA 4Q4JB 5HE8A 3R9XA 3CVXA 1LPAB 3EXIB 3MWKA 3OWOA 4BKPA 3UV3A 5CFOA 3KQHA 5AOVA 2XT9A 3UMCA 2YN0A 4HWRA 4LV8B 4MW1A 3IODA 4MKFA 4EF5A 2CC2A 4MOWA 5LBUA 3LH5A 3M6LA 1LY1A 5FO0A 5KYWA 1FFAA 3KTDA 3O92A 3B9BA 3IUJA 2VQ6A 2ZLBA 2WAXA 2PZAA 2WHQA 3MAGA 4N3BA 2OHHA 5DYIA 1E0KA 3SX2A 4DRZA 3T9DA 1NU6A 1QHXA 3R0XA 4X1KB 4MXDA 3W3AA 1QLWA 3AFIA 4YEDA 2QYOA 4K87A 1Z8HA 3B8HA 3PEUA 1QP7A 1WSWA 1Z6ZA 2XA1A 3MRXA 3W5DA 2HXGA 2P3SA 4OM8A 1OMOA 4UVHA 4DXAA 3AW9A 2QW0X 3A9SA 3KR9A 5BW5A 1YVRA 2HRDA 2XUFA 5EGNA 2L17A 2CNKA 3C0KA 4G1UC 1WMSA 3B82A 3ROEA 5BWLA 2VXCA 2VQDA 4IHKA 4B35A 4UAJA 4G26A 2JFHA 4ODIA 2PGDA 1G3RA 4WE3A 4UUPA 4UVEA 4HGYA 1X1SA 3AI2A 3QITA 4CM9D 3EC7A 5EJ2A 4F3RA 4G2TA 2P3LA 1XCLA 3HMKA 5JJ5A 2CNDA 1TEVA 3GQBA 3TQSA 3BVPA 2GM4A 2JG3A 2B5OA 4RZ3A 1BKSB 2FCRA 2ZTLA 2CLSA 3QP9A 1NI4B 1OX5A 2ILTA 3U1BA 1VHJA 4HNTA 3L0IB 4MWEA 4KIJA 1KJWA 1YFKA 1M2KA 5A7FA 3H5VA 2XCTB 1KIAA 2ZBQA 2OBFA 3NBMA 1JDPA 4BFSA 4EELA 4Y2HA 3OE4A 1JU9A 1EAMA 4KACA 5GAJA 2OXTA 2OHXA 1CJBA 3FPGA 2PGIA 1V16B 4DJFC 5E4YA 3ROGA 4ZYTA 5IT5A 3EZGA 1LH0A 4UPVA 5ALUA 2LIPA 3E35A 3ROKA 1GAJA 3QUQA 4O4JF 4FR2A 4CEHB 2P75A 3U17A 3T0FA 4YDHB 1CR2A 1J7KA 3D8NA 3M2PA 5JYBA 5KTMA 1Y4UA 2PYIA 2N1BA 4EHFA 2CHUA 2DLCX 4G4JA 2R6ZA 4JEMA 2FEXA 4KQKA 5U9CA 1VXRA 4ZJYA 1NE7A 5HYVA 2OHJA 1S6YA 1HURA 3BSFA 1XLUA 3DBRA 1MC5A 3TOCA 2GN2A 4NXMB 1BFKA 1FJXA 3BMNA 2CB9A 4QLBA 1BE0A 3OCWA 2WNIA 1WEKA 1HMPA 3KQPA 1BJKA 1EGHA 5EE5B 2R5FA 5EXDA 4KPFC 1KAMA 1Z6XA 2W8ZA 1U8YA 2VUSA 2EAUA 3Q3HA 3R6WA 4FS8A 3LDAA 4QU9A 4W5HA 5AKLA 1ZUHA 2BM1A 2OAEA 4ZV7A 3GH3A 2YY7A 4C88A 2HN9A 4HH0A 1TUBA 2PZ8A 3OJCA 3PUHA 4MWBA 1JKJA 3R5XA 3SJUA 4B33A 2ZS8A 1ESZA 4JI6B 1N57A 1CUJA 1EVEA 1U9YA 5FAXA 3NBUA 3DMDA 1I24A 4QYTA 4TRNA 2O7QA 2IWRA 4G1VA 1K9SA 1C29B 1IHXA 3HFGA 2QE7D 4R2KA 1QFZA 4CLOB 1BKDR 1VYVA 1IDOA 1NVVQ 5C52B 2CE2X 3MJTA 2EJTA 4PC1A 5HQJA 3MVEA 2JBAA 3OM8A 4A9AA 2H2HA 4J0FA 2VRNA 2XGSA 4P3XA 2Y05A 5DTJA 5IPFA 4JP2A 3LT5A 5HCUA 2GHQA 5BR7A 1XUOA 3LPNA 4MB2A 2C7OA 1Y6RA 3ZW7A 5ARBA 1KMHB 3IXMA 2QORA 3E7WA 1JXOA 3HXKA 4BNIA 2W6MA 2QGZA 3R4VA 1EDOA 1SKAA 4I0WB 3ZXYA 2VSYA 4PN7A 1L7AA 1YMUA 2AL7A 2ZXUA 2O8CA 4UHKA 2B30A 2V6MA 2V7VA 1RM3A 4PYOA 4DCNA 4R3WA 4U5XA 2FH5B 5CD9A 5K6AC 3KSRA 4NCBA 3BJMA 3T35A 3NUQA 3DZKA 3FYUB 4K03A 4N3NA 4XCVA 1Z63A 3OFJA 3I0MA 1LLDA 1Z4NA 1E2KA 5CNIA 2VAXA 2FEAA 4IH1A 3WSTA 1GVNB 1AMOA 2ODWA 1FU4A 3D4BA 3ROQA 1T36B 1NRIA 3NTQA 1QAMA 5DHQA 3BC1A 1W0KD 1RAAA 3OLWA 3SHTA 4JDPA 3RUEA 3W34A 5A4IS 3IQHX 5DGCA 4QT0A 3GOHA 3UCFA 4M46A 1NT2A 4F8YA 1K89A 4OXRA 1B14A 2YVUA 1WOYA 1C80A 1PI3A 5AM0A 1J25A 1F8FA 4PLHA 4JOBA 3H5AA 4Y2PA 1P75A 5EPEA 4PQYA 2WABA 4NJMB 2PGLA 2ORWA 3TUIC 5ISMA 3TSOA 4DARA 4Y9UA 2KLBA 5A3QA 2NACA 2XDWA 3PFKA 2XKAA 2R5NA 1PJQA 3BHMA 3GVXA 1E7MA 4J0CA 3GJZA 1MNAA 3COYA 4ZKDA 5BYAA 2B8NA 4GSYA 3KJFA 4XEUA 1XYGA 3FKJA 1DKMA 3CUEF 4I50A 4R2JA 4OP2A 4C0HA 4ZK6A 2WI8A 5AHRA 3R7BA 2HJRA 4Q1EA 1FSGA 4O1HA 5DK6A 3ZQ6A 1VE6A 3NG1A 3KEFA 4K81B 5FL3A 4ZCQA 5FBVB 1BC5A 2W6CX 4KUHA 3AVPA 4XVCA 2X1LA 1JILA 3FTCA 3JZAA 4R54A 1YB5A 2ERCA 4KJZA 2JCXA 3REOA 1E92A 4F3YA 4WH0A 4QYMA 1COWA 1SVWA 4LWZA 2ZB7A 1RKVA 4ZFNA 3DDWA 1G4AE 4GC9A 4UASA 1RP1A 1ZNYA 3NXKA 3R3HA 4NEGA 1JR6A 4QZVA 2WW8A 4BZZA 5HBGA 2AI1A 2AN4A 4E5KA 2CV1A 1Z56C 4Q3KA 3U3ZA 4WXRA 3FNEA 4YT5A 5B4UA 5KWSA 4FFSA 5CT5A 4FCWA 3NALA 4QPNA 4R1NA 4OLFA 3SK0A 4TTQA 1ZD3A 3OCJA 2FZCA 4W99A 3VH4A 4EKGA 2Q3FA 2W6JA 4A1FA 3A1VA 2ZE5A 3GNSA 4R69A 2I6XA 5KYXA 1GYQA 4HSEA 3ZS8A 4AICA 3K30A 3OUTA 3SFVA 3JSAA 1HE3A 1QR6A 2UAGA 4JU9A 4DZRA 3OQOA 3QEAZ 4N49A 1MHTA 1W87A 2EZUA 5KQMA 2FETA 2WJWA 1XC7A 5F21A 1Q7TA 3PBKA 2YXEA 4TKVB 4W1RA 5HS6A 4DBLC 4FDTA 1O0BA 5C46F 5B53A 1AGNA 3VR6A 2ZRLA 5KU7A 3BGVA 2NTYC 1BQ4A 4NV1A 1BA3A 2Q5JA 1QFJA 1LSUA 1YZ3A 4IUYA 5M34A 4PLCA 4XWYA 2ORIA 5AM3A 2O6HA 1TRKA 1ENYA 4K9DA 2PU5A 4YT4A 2GILA 2IS4A 3FR8A 4MLCA 3R6TA 3D54D 2YZ7A 1XMXA 1VZ3A 3O7WA 4NH4A 5EP3A 3OFKA 1J00A 1DQNA 2IPMA 3SC4A 3RD5A 5LXTA 5EHIA 5DVZA 4HNGA 3V7YA 1DMRA 2PRIA 4PLWA 3QLVA 4UHEA 1YTLA 1CJCA 1RZUA 3NV7A 1K7FB 2VT7A 3WLHA 4DCMA 4KPYA 2P9ZA 3QRWA 1T10A 1XLTA 3PSHA 4M0LA 4E0BA 1NBAA 3AUAA 3JAWA 3NDJA 3OZTA 1Q7RA 2R7NA 3RYHA 3TNJA 3GLVA 3ZWMA 4G8JA 3CPSA 4TS9A 4JBIA 3ABOB 4E2ZA 1JJIA 1ZAKA 2OO5A 1KQFA 3RS0A 3MB8A 3CEHA 4W6ZA 1X6VA 4QBGB 5BUQA 4JLMA 3LIPA 1UF9A 2QZ9A 1IEWA 2OO7A 4B4KA 2X7JA 4IHAA 3WK4A 4BQRA 5I7RA 4KGZA 2OOKA 4ASUD 1W5AA 1Z4LA 3GJTA 3SICE 3JV7A 1IAQA 2TMKA 3FHCB 3V7NA 3VR4H 1WUYA 1X7GA 4U02A 1V1RB 2C77A 1N8SA 2XMQA 2J07A 3C85A 3MJVA 5KTPA 5D8DA 3W6NA 1WETA 3QFRA 3T1QA 2HUNA 2ZSUA 2QW1A 4J9VA 1U0TA 1UH5A 4PSCA 5KS2A 2ZRCA 5DYNA 4PCAA 4Z7OB 4JYAB 2GUGA 3FWYA 3IERA 3QPWA 3FB1A 3QE3A 5KNLA 2R6AA 2X1MA 2R6DA 4HH1A 3ETLA 5DGIA 5CBPA 1RMQA 1WDWB 3C97A 5JS7A 2X9LA 1LU9A 5JNTA 1KEEB 4MKHA 4US0R 1T6ZA 1N9ZA 1G2OA 1OB5A 3ON5A 4XCXA 1JDVA 1RIFA 3O90A 3E9RA 3HPRA 4O5OA 4CM1A 5BWMA 1XMSA 3DVRX 2CD7A 3C1UA 1H2AS 1Z82A 2VG8A 3RV3A 3RFVA 4DTIA 2ZAIA 4MX8A 1XTSA 4R9UC 4RM2A 5TR9A 4BVAA 4XH9B 4C6RA 2HREA 2QIPA 3UGJA 4URVR 1LK0A 3TFWA 3P4YA 1RYDA 2PXXA 3I2GA 3UW3A 5DNCA 3F3SA 5CHEA 4OGKA 2PGJA 2FW0A 1WVGA 2IEGA 3S1AA 2JCSA 3LD9A 3LPMA 1SC1A 5FOUA 3E9EA 3GZTB 2AUMA 2ONZA 3CX3A 1JIVA 3OA2A 3C15C 4II3A 4YJFA 4A7PA 3OJXA 3PNYA 4QJIA 2H31A 4RXTA 3TFOA 2C2YA 3JYNA 4CMGA 5KWIA 1Z2PX 4UVDA 3IS3A 4KGDA 4BHTA 3PEWA 1MPTA 4RADA 4RAQA 1CZNA 4KFRA 4ZDKA 5JJIA 4KRXA 3TW0A 3EZ9A 2Q29A 2JLUA 4J0EA 5KYVA 3JZMA 1U2DC 2C94A 1WZCA 2I62A 1LQTA 3F6CA 1N2XA 3O93A 2YVQA 1DINA 1TKAA 3QQPA 4HWOA 4B6QA 4IVNA 1KIMA 4HP8A 1N6RA 4WBXC 3IAM1 2XODA 1YVUA 4BO3A 3PGA1 4RHCA 1ISSA 5H9WA 4ZALA 1N3BA 1D5WA 3B6IA 3HBNA 4A0FA 4ZAWA 3GEGA 2HRQA 1V43A 3ABIA 2Y1FA 5TV2A 1VJ0A 2BTOA 3FPEA 5JANA 1AUPA 5CBKA 1U5BB 2X5KO 1F9AA 4PTYA 2XVXA 4ZVRA 3QKUA 1QU2A 1DRKA 2AD1A 1JLLB 2QQFA 2DHEA 4L51A 4M86A 3MRVA 2R1VA 1ZW6A 1C3EA 4BFCA 4UOEA 1Q91A 2COUA 1DAIA 1LBEA 3WSVA 2QSYA 1G8PA 3C4JA 5DKFA 5TLSA 1OYVA 1FTSA 1R37A 3I5UA 3ADBA 2HUPA 3DC2A 5CM9C 1JG1A 1R8JA 2FE4A 3EGDB 4BPBA 1B41A 4IWXA 4NOKA 4GPAA 4S05A 1VE5A 1KHHA 3K8OE 2R4QA 3AJDA 4MYTA 1S7CA 2HU2A 3M83A 4U63A 4Y1EA 4C87A 4EG7A 4G89A 5JAUA 3NHJA 1QRAA 3VPDA 5J9FA 2ONCA 2VRCD 3F3KA 3KJGA 3PX7A 2R6JA 3RVQA 4RNDB 3N2KA 2FDRA 2VDWB 3FE2A 2EU8A 5FQOA 3TJZA 4F9GA 2CL0X 1XIVA 4E88A 4PU0A 3FTEA 3DLBA 2E3JA 3RBVA 4XPIA 1O8BA 1HT3A 4TQGA 1RYBA 4D6YA 2NQ8A 1F2DA 2BMAA 3AM4A 4EA6A 3JVIA 3ILSA 3K9NA 5LLSA 3WLOA 1E60A 3AJ9A 3CZRA 4BFUA 1NWHA 5IK2D 4N5IX 1ZKDA 2QZ4A 3L2OB 2YQZA 1UPCA 1Z35A 4N1AA 4DR2B 1WHTA 4CEJA 5FYDA 1SCKA 3KOMA 1QBKC 4CE6A 4IJ6A 2WSSA 1K9VF 3CH7A 5EJFA 3ZTTA 3UJNA 3GLIE 2APJA 1EWKA 4WA7A 2XA9A 5I4BA 5FLYA 4I3GA 4B84A 4TTSA 1KEPA 3GEEA 4CTKA 4DT1B 2ENUA 4ZI7F 4LI3X 4QPZA 4EY3A 3GN2A 1Z2EA 1H2BA 1DAMA 2PMCA 2B78A 4IGAA 3L6OO 1HG1A 3JCZA 3H2JA 4QUKA 1KMCA 2Z5GA 1J70A 2E21A 3ROFA 1A98A 2DBYA 2ISSD 3IT3A 4MWGA 3T4UA 2ZCJA 4BVJA 2W22A 1PJBA 1T3TA 1V47A 2I29A 2ZDGA 3EEYA 3FNGA 3N2LA 1X1CA 4MV0A 1QH0A 3C3JA 4RZUA 3C5VA 4O4IA 1NBHA 3GQVA 3PGKA 4F2GA 2HLNA 4JVNA 3KQYA 2QR2A 4WN3A 1N5JA 3E3OA 4ARZA 4E3WA 4B4OA 4F91B 1KQGA 3ZLUA 4GMXA 4HVTA 4B9EA 2KQUA 1RI3A 3GEMA 1G8HA 2J3JA 2WR8A 5KAPA 3WWYA 3AI1A 4EF4A 3T7TA 5LCXA 3HYNA 4MVJE 4JXZA 3BEOA 4AK9A 2LCFA 3AL0C 4KWIA 2DFNA 1EKXA 1VKRA 4MEJA 4GRIA 4C07A 2O5VA 1ZNWA 4UM9B 1VCIA 2EEZA 3ECCA 2X7HA 3D3QA 4IZOA 2CZGA 3H2YA 1YR1A 2IYOA 1JQEA 5FFNA 3W3AD 2PMFA 4YYEA 3UBTA 5IC6A 3ZYCA 2GCEA 3KU4A 2PKYX 4RKWA 3DAGA 5ECDA 5EIBD 4I9NA 4J1NA 4Q1CA 3GRVA 3QKIA 3VSDA 4M8LA 4M76B 3S2UA 3L77A 1DOHA 2J41A 1QQBA 1CRZA 3CB4A 2JFOA 5BNTA 1H65A 3L0OA 4DLVA 1UWCA 3ZJUA 3IHWA 3KAJA 4TV8F 4ADSG 3PDUA 3G9QA 1ZA1A 1WZIA 3FWHA 3D4IA 1M5UA 1EP2B 5J1TB 2OA0A 2IXDA 3JWEA 4LJLA 1EUDB 1W8IA 2Y0BA 3PT9A 4U7FA 3RHTA 3RVKA 4EZIA 5DO9A 2ZTSA 3Q3IA 1UKAA 1KK2A 3FIUA 1YU9A 4YMWA 1RQ7A 3DL4A 3GEBA 4IQ8A 4A0QA 4FB5A 3MCTA 3OT1B 2QAJA 2O0LA 5E9JA 5LUAA 2ZRMA 3D43A 1U7DA 1JSRA 2BKEA 3LHKA 5DB4A 2ODQA 2OWEA 3IEUA 3KSUA 1GSIA 4R1OA 5LP6C 1NVAA 1JHVA 5E8JA 1A9PA 1SURA 1VSQA 1X42A 2BFCB 5BORA 1T8UA 4FPXA 5J2TA 3GIWA 1R15A 1NXXA 1WOMA 2VDRB 1ISIA 3B1ZA 3HVHA 3S8MA 3T99A 3FYTA 6Q21A 1QG6A 5AM1A 3VDQA 5IKOA 3DSRA 1MB4A 2OM6A 1ULHA 2X4IA 5AT1A 5C3MA 1XZLA 2IHBA 3QEOA 5UKDA 3ENVA 3PPIA 5JSKA 4CM4B 5HCIA 5EKTA 4C7MA 4F1WA 4JJAA 5IVDA 1MB2A 5CFPA 1FUYB 5DHUA 2ZSIA 3TR0A 1HXHA 1E1KA 3PGVA 5C8YA 2XCIA 2FHPA 2C9YA 1RRVA 1AUVA 1JBEA 2Y1XA 3QYPA 4UTRA 1KOJA 3DPIA 4Q21A 4EY7A 3JRNA 2C57A 1F1JA 1E59A 4JMPA 4OG2A 5ALEA 3B3AA 3HB5X 3D3WA 2VOEA 5KNCH 2WIAA 1GCGA 4JU8A 5EJIA 3UV7A 2ZUFA 3WISA 3MGGA 2IBSA 1MPXA 5I45A 3JPYA 3A0UA 1B2RA 1HE5A 1YNOA 4TTPA 3CY6A 4X97A 4YRQA 4ZOAA 2I9KA 2QQGA 2IUTA 3MWYW 5EPOA 2QK4A 3FYSA 4E1BA 1MVNA 3R77A 3RFTA 5EJ5A 1YKFA 4MKRA 3E22A 3HZZA 2QP4A 3WAJA 4JP1A 2CFTA 1CIVA 1UDCA 2K6GA 4N7JA