1LPSA

A structural basis for the chiral preferences of lipases
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase
total genus 192
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpsA00
3V9AA 1LPNA 4M0EA 5A7GA 4PSCA 1GQRA 3LCRA 1JU4A 5E2IA 1USWA 3MVEA 2VA9A 2C5GA 1C7JA 5CURA 5BWBA 3STXA 5DNVA 1G42A 3H2HA 4QDUA 3STVA 1XLVA 1CUBA 1TCBA 4U2BA 1C4XA 4BCDA 1VE6A 4ITVA 4QEKA 4N8SA 2O7VA 1XKTA 2OGZA 4FOLA 1T2NA 2WKWA 2XUAA 4QLOA 1ODSA 1CLEA 1CUSA 4U2DA 1K8QA 1PJAA 2QS9A 4BTVA 1E66A 2PU7A 3L1IA 3H1BA 4G4JA 5K3CA 2RHTA 1GT6A 1H2ZA 1FFAA 3DOHA 1UOOA 4X90A 2WTMA 3D59A 5AM3A 1OCEA 1SFRA 1TAHA 3EQ7A 4X6XA 2PPLA 1R50A 4UBKA 2CZQA 5AHXA 4QE3A 4U2EA 4G4IA 2CJPA 1EINA 1R9MA 5AOAA 4P9NA 4EA6A 3DL4A 3RKSA 1NU6A 3C45A 2DHCA 5AKKA 1EI9A 3ZLTA 3G0CA 3GFFA 4W1QA 1YB7A 2H7CA 4PO3X 3QBJA 3WA7A 1DX4A 1Y7HA 1LLFA 1JI3A 2RHWA 2R11A 4OD0A 3H19A 4RE5A 1E8MA 5ALKA 5EHNA 1QOZA 3OG9A 3ESDA 2OCGA 5EFZA 1ODTC 1XRQA 5JD4A 4C01A 1KEZA 3VISA 4WFKA 1XLUA 1N8SA 2VT6A 5CMLA 2WU4A 2OAGA 2ZSIA 2C4HA 5AI0A 5EIEA 1YAJA 4FBLA 3QZUA 5HF8A 4GECA 3SC2A 1ZIYA 1S8OA 1XZEA 4C6HA 1QZ3A 4QDXA 2PU5A 4IQ4A 4KYVA 1LPPA 2C0PA 2EEPA 1U65A 5AK4A 5EHXA 5AI4A 2DHDA 1QIJA 2X5XA 1HPLA 4W63A 4NMWA 4HZGA 1W75A 1DWOA 4CI9A 3AINA 4GWLA 1ZI8A 1KU0A 3ESBA 3W06A 2WIFA 5AKZA 3NUZA 5HFNA 1Z68A 1MAHA 2J4CA 2WIJA 4DNFA 4DMFA 5ALRA 3D2BA 1IVYA 1RYYA 2PSHA 3AILA 3H18A 2OGSA 4MJ3A 1XQYA 2YH2A 3O4GA 1CUXA 1EX9A 3AJAA 1CUCA 5BOVA 3GROA 4HRXA 2BCEA 2WM2A 3LIIA 2HADA 3IVMA 4UBNA 1AX9A 1NU8A 4FTWA 1BCRA 2X8BA 2Z3WA 1QJ4A 1UOQA 3VVMA 3JWEA 5CTAA 1BRTA 2OPHA 5JANA 4GI1A 5JAUA 5ALUA 5AI9A 4LKOA 1ORWA 3EBLA 3FYTA 4EZIA 4FNMA 4Y9SA 1H23A 1XROA 1ACJA 5ALTA 3R3ZA 3D4LA 4EHBA 3U0VA 4BE4A 1YAHA 5ALQA 1NX9A 1MNQA 4WFIA 4AN1A 5ALDA 3E3AA 3FWHA 1QIEA 1WB4A 3I2FA 4BATA 1MX5A 1X70A 3WK6A 5ALGA 1GGVA 1QTIA 4BRZA 5ALWA 3OPMA 3QPCA 3SWWA 3GELA 3ED1A 1VXOA 3I2KA 4ARBA 4X71A 4ZV7A 2VEOA 3DYIA 3GA7A 2J3QA 3WIOA 3BE8A 2DSNA 5LZ4A 5A62A 3U1TA 2RIPA 2WJ6A 3WK5A 3GUUA 1MO2A 3WZLA 2B4KA 1M33A 2DQYA 4IH4A 2ZSHA 5CH3A 1LPMA 3E0XA 1QTRA 4Y2PA 4J0CA 1TQHA 5HF6A 1XZLA 4G8CA 1AZWA 4K6GA 2QM0A 5CT5A 5LZ9A 4K6KA 4M0MA 5LZ5A 2XQFA 4BDSA 4DIUA 5A7FA 4QZVA 5KWJA 4N5HX 4QWMA 3GBSA 2EDAA 1CUVA 1H22A 1TRHA 3H2IA 5ALXA 1LGYA 2XQKA 4J0IA 3G02A 1JJIA 1THGA 2XDWA 1LPOA 3M3DA 5K3EA 1AQLA 1ZI6A 5K3FB 3G8YA 4IH1A 2FJPA 2HFKA 4FDMA 1XFDA 4AXBA 2G5TA 3W2TA 4PSUA 4QA9A 2RI6A 3DL7A 4GW3A 5CRIA 3AFIA 3VXKA 4G8DA 4ZGBA 1EB9A 2ONCA 3S2ZA 2BAGA 4J0JA 1TK3A 3R40A 4B84A 4BCBA 4X95A 2IITA 4F21A 4FLFA 2X76A 4X91A 3MUNA 1Q83A 2CB9A 1XQXA 1BS9A 2VJAA 5SYNA 3L1JA 4E11A 5AJHA 3EF3A 4WFJA 5CT9A 2C0QA 5C8VA 3WJ2A 5JAOA 4LHEA 3VJLA 3KXPA 5DWDA 3WKAA 4JYMA 3WK9A 2OGTA 1CIJA 3E4DA 2Z8XA 4G9GA 2HU8A 4X93A 2VJCA 2JGIA 4IO0A 3WMRA 1I6WA 4MEBA 2XQGA 1J07A 4IHAA 5K3FA 1UKCA 1VA4A 3DDUA 2C58A 5JD6A 3I2IA 4JUIA 5DLPA 3HI4A 2QR5A 2O2GA 4KE9A 1GKKA 4ZXFA 4YPVA 5DYYA 2P8SA 3HXKA 1LZLA 4BE9A 1EDEA 5H3HA 4UBMA 2PSJA 2HA4A 3G0BA 1CV2A 2QMQA 3H2KA 5BV7A 2YASA 3HEAA 4UBOA 4BTLA 1JJBA 1VE7A 2PUHA 1CUFA 2H9YA 3C6BA 3FVRA 3I2HA 3H0CA 1MT3A 4H18A 1JFRA 4Y2VA 3FVTA 1C7IA 3AZQA 1CUUA 3NOXA 2I03A 3ANSA 1VOTA 2QTBA 4DLNA 1B6GA 1A8QA 3HRHA 5AKYA 2HA2A 1XLWA 1H2WA 4BDTA 3I2GA 5LKAA 4Q82A 3GZJA 1AC5A 2HFJA 5AI8A 4FLEA 5ALOA 2XMDA 4Y2YA 2HIHA 4DNOA 3A2NA 1HL7A 2H1IA 5D3ZA 2WHPB 1UFOA 4KAAA 2H7XA 4MWSA 4OB8A 1KU6A 4UUQA 1EHYA 1XZDA 4UHCA 1ORVA 3K6KA 2V9ZA 4WCVA 3WL6A 4FFWA 3FBWA 4W9RA 1WPXA 5LLSA 4YASA 4LYDA 3VJMA 1XZJA 2O2HA 1OXMA 2ZYSA 2QJWA 3BIXA 4QLAA 1BN7A 3QM1A 1A8SA 1SOMA 2OCKA 4Q1VA 5EGNA 1RP1A 3D3NA 4BAZA 2BJHA 1UK7A 5ISMA 3FLBA 3WL8A 3BL8A 4PNZA 5FV4A 6YASA 1DU4A 2AJLI 3ZPXA 2R8BA 4PSDA 5ALFA 3WK4A 3I6YA 4Y2TA 5AM4A 3F97A 3G7NA 2XE4A 1WOMA 4S0XA 5HK9A 1JT2A 4KJXA 2WQZA 1BN6A 2XMCA 2OQIA 2DCMA 4G4GA 2WU3A 4FNGA 2Y6UA 2HHAA 1E8NA 2OCLA 2XUIA 2ZJ7A 1ZD2P 4ROTA 2AJBA 2GBCA 3H2JA 2WHPA 1CQWA 1IUNA 2XQIA 4K5QA 5IKXA 1L7AA 4MQLA 5FOQA 3UMJA 4AX4A 2OAEA 2XUQA 3G9TA 1CUWA 1U2EA 3Q0TA 4TGLA 4A5SA 4RGYA 5ALEA 4UHHA 5LZ7A 4BVLA 4J03A 1B41A 1L7RA 1SCIA 4Y2UA 1LPAB 5A6VA 3LLCA 4MYDA 2XQJA 4W1PA 1JKMA 3WYDA 1CEXA 4WY8A 4FFVA 5HKAA 4CIBA 5IH7A 3G9UA 3WWOA 3K2IA 1UT6A 2J4FA 1MTZA 3QVMA 2GYWA 5A71A 1T4MA 1DWQA 1VZ3A 1K63A 1G5FA 5FRDA 2W22A 2V96A 2JGEA 1J2EA 1ZI9A 4BZZA 1ZGBA 2PBLA 5AKIA 4X6UA 4DMHA 5AM2A 5LZ2A 3TGLA 4OYYA 5AKHA 4WDRA 5HQ3B 5AKLA 2AJ8A 4LXHA 2XLCA 2FJ0A 2GZSA 5JAPA 4MXDA 3STTA 3ZLUA 4Y2QA 2XI4A 4LXGA 2Y2VA 4TPKA 2WIKA 2Q0XA 3KWJA 3FCXA 1CUYA 4BVKA 5AIBA 2QT9A 4WY5A 4KRYA 2CBGA 3V1NA 2VQ6A 2W6CX 2HA6A 4PV7A 3IUJA 4X92A 4JNCA 5ALJA 1WB6A 4BYMA 4MEAA 4I3FA 3QPDA 2HRRA 2WUDA 5AO9A 3OC0A 4H0CA 4MQMA 3P2MA 3R3XA 4RNCA 1TIBA 5HFAA 2O7RA 5K5EA 3V1MA 1HBJA 2LIPA 4X6YA 2ACKA 2PX6A 5T4FA 1R88A 3FYUB 5K3DA 1XZHA 3M81A 3LS2A 3WKCA 4B0PA 3QH4A 4ZI5A 3FCYA 3PFBA 1VLQA 4C88A 5HQ3A 3I1YA 3CCBA 1E3QA 5JARA 1PV1A 2XMQA 4OUKX 5AM5A 3OM8A 3HZOA 5C8XA 2JGLA 5AOCA 3NWOA 1P0QA 2QUBA 2AJCA 2GBGA 4X94A 3CN7A 4BZWA 5JZSA 4CCYB 4C87A 1ETHA 3F9CA 1G66A 1BEEA 2Y1KA 1EK1A 2RONA 4U2CA 3C5WP 3QYJA 1XZIA 3I2JA 2E3JA 5I8PA 3WIBA 3D2AA 1MX9A 4QNNA 4X97A 2G4LA 5KBYA 4AN0A 3ICWA 4KE6A 5K3AA 3QMMA 1DQZA 5BWCA 1ZOIA 3QMVA 3PFCA 2WIDA 4JH0A 2ECFA 4NS4A 1K4YA 3H2GA 5JALA 5C81A 3WL7A 5AKEA 4XIIA 3WI7A 2I3DA 4B0OA 3FYUA 4UPDA 4BB0A 4FBMA 2V97A 1UXOA 3X3HA 4Y2RA 5DYTA 3BF8A 3I6MA 2ES4A 1QIMA 4OPMA 2OCIA 5CT8A 4E46A 3A6ZA 2QZPA 2RAUA 2QRUA 5F4ZA 4E15A 2ROQA 2BFNA 1F8UA 3CXUA 2Z5GA 2WJ3A 2XUOA 5JADA 5A2GA 3F8SA 5ALSA 3AIMA 4FWBA 3K9BA 4BVJA 1CPYA 3AIKA 4CCYA 4FKBA 1VKHA 2CMFA 2HM7A 5I9IA 2ZYIA 1GZ7A 2WSLA 5LKRA 1K5PA 1EVQA 5ALVA 1UK6A 1ZGCA 2CKMA 1H2XA 1Y7IA 3BF7A 4Y2JA 1W1IA 1XKLA 1UWCA 5AI5A 5EHQA 1HKHA 4DTCA 2WFMA 2PSFA 2XUDA 5C7YA 3O9MA 4E14A 1EVEA 4UHBA 1LBSA 1Y37A 1A8UA 1N1MA 4Y2SA 5FLKA 3I1IA 4DNQA 4L72A 5DJ5A 2VAVA 3M83A 4BCCA 5AK6A 5AM0A 4X7BA 1XRLA 4OU5A 5ALZA 2GYUA 2Z3ZA 3FLAA 2JEYA 2VT7A 4JEIA 2WTNA 2XUJA 1WM1A 4W1SA 4HVTA 1ZJ5A 3D0KA 1G4HA 1DWPA 2XMZA 3F98A 1UK9A 3JW8A 1P0IA 5HF9A 3WWPA 4CCWA 5HCUA 2ZVDA 1DINA 2VJBA 3LIPA 2BUAA 1BEZA 1P0PA 3IUNA 4HTAA 4OU4A 3WK8A 3LP5A 5D7BA 4J0KA 2WUFA 4ZRDA 3FNBA 1CUGA 4EY5A 5EIAA 1D07A 4O08A 2J3DA 4A23A 1CUIA 3STYA 1LPBB 3G0DA 5AM1A 1IUPA 3C70A 2PVSA 1YS2X 4CFSA 1YASA 1GPKA 3BDVA 3KWFA 4UFNA 2JF0A 5ALLA 1FSSA 1LNSA 1EDBA 4BAUA 4ETWA 1EXWA 3VKFA 3BXPA 4PF1A 5JZ9A 3O0DA 3WL5A 2XMGA 4BBZA 4L0CA 3O4JA 3T4UA 4F60A 3I6ZA 2HU7A 3VDXA 1YA8A 3UUEA 2GBIA 3WK7A 3C6XA 1GPLA 4BRSA 1AURA 2XMBA 2ZYRA 1R4ZA 2K2QB 5HKBA 4DYHA 3G0IA 2GYVA 1BROA 4UFOA 2HA3A 4C89A 4BAGA 5DNWA 4G5XA 1A7UA 1QONA 1CFJA 3FSGA 4AMYA 1WHSA 2GZRA 5T4BA 2QJRA 4QDOA 1R9NA 4B82A 4AO7A 3IIIA 1QIKA 4GEGA 3PDCA 3G0GA 3HYSA 1YCDA 5CW2A 1HQDA 2PUJA 2QKYA 1AGYA 1HLGA 1U8EA 4KR0A 1CVLA 3BJRA 3ZV7A 2BUCA 2B61A 2ORYA 2VTVA 4B6GA 5A7HA 4HS9A 5KWIA 4P08A 4PQEA 4XVCA 2HDWA 3O4HA 4HRYA 4RPCA 4NVRA 1GKLA 4B80A 4J0DA 3HLKA 1DX6A 1AKNA 5JASA 5EIHA 5AI6A 4F5ZA 1CRLA 3QITA 3R3VA 1SCQA 4J0GA 1XZCA 2JGKA 1F0NA 3N0TA 3PE6A 3W05A 4OB7A 2QUAA 5CBKA 2CEKA 3C6ZA 4DSAA 2WILA 1MAAA 4UBLA 2WUGA 3VVLA 2HA5A 1UKBA 1P0MA 5AICA 3TJMA 3DJYA 3ZWQA 4PW0A 3I28A 3KD2A 1XZBA 5DTJA 1ZD3A 4H7KA 1JJFA 2QXUA 3BDIA 2FX5A 2UZ0A 1O6FA 1XZKA 3D5EA 2WUEA 3IURA 4BP9A 5ALNA 2XUFA 4GXNA 4DM7A 4KACA 4H77A 4ZREA 3WWEA 3WYNA 3HACA 3N2ZB 1E5TA 4XX1A 1QO7A 2BGRA 4J0HA 4X85A 5CT4A 3R0VA 2OG1A 5LYYA 2HL6A 1CUHA 1MNAA 3SX4A 3STUA 2PM8A 1THTA 4UBIA 1IUOA 4H7DA 4OSEA 2VAXA 4GDMA 4G1FA 2Z8ZA 3HJUA 4QDZA 3JYHA 1Q0RA 3ANTA 3C5VA 1FFBA 3C8HA 4P93A 1VJ5A 1LBTA 5FP0A 2C7BA 2D0DA 4LXIA 5FXMA 4AO6A 3KOOA 4GHWA 5ALMA 2WHQA 3RLIA 5C8ZA 4ARAA 5ESRA 4DGQA 3FYUC 3W04A 5EHZA 2OLEA 3T52A 3S8YA 2BUBA 3G9XA 3DLTA 3F96A 2ZJ6A 1FFDA 3ILSA 3TRDA 5D3KA 1E8DA 3IB3A 5ALPA 1FFCA 3PI6A 3PICA 2XB6A 4LIPD 4J3JA 4AB1A 4Z49A 2B20A 3NGMA 4CG2A 3WKDA 2HRQA 2WG0A 2QVBA 4H7HA 2ACEA 3QMWA 3WWCA 3BJMA 2JGJA 1BCSA 2PSDA 3WWDA 4BC0A 1CUEA 4A16A 4B9AA 1EA5A 5DTIA 2IIVA 3PF8A 3R3UA 1SCKA 4C4XA 4OB6A 3IUMA 4Y7DA 3EIOA 4D9JA 1EH5A 2VSQA 1DTEA 1F6WA 4GBGA 2XLBA 4EY4A 2WFZA 2G5PA 5SYMA 4I4CA 4AQDA 2XUHA 4B83A 1IZ8A 4CIAA 1XRMA 3O4IA 1QIDA 4CG1A 3ESCA 3C8DA 5J3JA 3AZOA 2G63A 3R41A 1DT3A 3RM3A 3D2CA 4LYEA 3UUFA 1FFEA 2VJDA 3H17A 2WG2A 4K2AA 5E4JA 2JGMA 3PF9A 5AKJA 1XZGA 5T4HA 3R3WA 5DYWA 5IVHA 4HXEB 4X3CA 4G8BA 3R3YA 3KDAA 4FLMA 5HK8A 3B5EA 3ZLVA 4B81A 1XQVA 1YSCA 3OURA 1CUJA 3CCCA 5EI5A 3H04A 4AZ0A 3B3QA 2JGFA 1EDDA 1EK2A 4OYLA 1Q0ZA 4EY7A 2O2IA 1JMKC 2IX9A 5AKGA 1PFQA 3F67A 4JYPA 1CUAA 3D7RA 5D6OA 5AKXA 4KEAA 5IVDA 3DKKA 1YR2A 1QIFA 2XUPA 3DS8A 3FSGD 4HXGA 2JEZA 3EQ8A 3A2MA 1SC9A 2VATA 5I7UA 2AJDA 3OTQA 2YYSA 3FLEA 5CH5A 1W6RA 5K3BA 3PUHA 2ZJFA 1BE0A 4EUSA 2DR0A 1CQZA 2PSEA 3WLAA 1MPXA 2PL5A 3WKBA 1R3DA 3DEAA 4U2FA 3TEJA 1VXRA 1QO9A 4B85A 3A70A 4UHEA 5JYCA 3RARA 1UK8A 4Q3OA 1ZD4A 2XMSA 5AH0A 1MJ5A 4IH9A 4QWWA 4MYSA 4NZZA 3BWXA 3DQZA 3EQ9A 3DOIA 3MGAA 1X2BA 3KSRA 3E1GA 4F0JA 3AUKA 1AUOA 4CG3A 3G9ZA 3HABA 3V48A 1XRRA 1QFSA 3ZI7A 1YA4A 4HAIA 2JIDA 4C4ZA 4DNPA 4FMPA 1UOPA 4DMKA 2WHRA 4UHDA 3RK4A 4ZWNA 3DD5A 2D5LA 4DSZA 1BU8A 3C6YA 3DNMA 5AOBA 1JMYA 2OXEA 4FHZA 3ESAA 1EB8A 3STWA 3O9VA 4WDQA 1QIHA 4H7EA 4UBJA 2AXEA 3W9BA 4UFPA 3WJ1A 2FUKA 2GBFA 2XT0A 2C5FA 2DFPA 3O95A 1RWQA 4J7AA 2WG1A 4U2GA 4XJVA 1WPRA 4KE8A 4EY6A 1LPSA 5IVKA 1DT5A 5T4EA 1QFMA 5HZGA 2WIGA 4AO8A 3WZMA 4W1RA 5FPPA 2EDCA 3V1KA 4EY8A 1WCYA 4EBBA 3FAKA 2ZYHA 4WJLA 2RGUA 1MN6A 1ZICA 4N8EA 1ISPA 3C43A 2PKYX 2I3ZA 3H1AA 1H2YA 3OOSA 3VJKA 1E89A 4X00A 1L7QA 1J06A 5JD5A 4XWGA 2OQVA 4QDTA 4P92A 5CXXA 4YX9A 3QPAA 4L9AA 1MU0A 1N5RA 1YB6A 5JZBA 1CUZA 4HXFB 2XMRA 1CUDA 1XRNA 3HSSA 5ALYA 1ZIXA 2I78A 5CT6A 3CN9A 5E4TA 1CR6A 5LP1A 5KREA 4BP8A 2WFLB 4H7IA 4TVKA 4BC1A 4H7FA 2HA7A 4KAFA 1GPNA 3L1HA 3YASA 1K6EA 4YK7A 1AMNA 3V1LA 2YXPX 3WKEA 4INZA 3A2LA 2BKLA 5AK5A 1IZ7A 5FKJA 5IVIA 1ZD5A 4B7ZA 1HDEA 5ALHA 4B9EA 3C87A 5JAHA 7YASA 3AZPA 1F0PA 3SK0A 4KE7A 3IUQA 1XZMA 2NW6A 1X2EA 3Q8WA 5LIPA 2JBWA 1OILA 3B12A 1WB5A 1FJ2A 1YS1X 3IBTA 3M82A 3AIOA 1U4NA 3HC7A 3WA6A 5YASA 1N5MA 3BIWA 5JATA 1VA5A 1QE3A 3DKRA 1Q84A 1ZJ4A 2WFLA 4OCZA 3ICVA 1TKRA 4H35A 1ACLA 4L3WA 4RE6A 2H7YA 2XUGA 1TCCA 1J1IA 1W4LA 4DMCA 3W9UA 5E4YA 1XZAA 1DQYA 1QIGA 2VF2A 4Q3KA 5JIBA 2CUTA 3IA2A 1UKAA 1XQWA 2WLSA 2Y6VA 5CXUA 2QOEA 4N5IX 4Q34A 2BGNA 4Y2XA 1A88A 2B9VA 2Y2UA 1WHTA 2DQZA 1XRPA 4UHFA 5ALIA 5AIAA 1QIIA 5FDFA 2DHEA 4KRXA 4GLBA 4MWTA 5CH8A 1W52X 1TCAA 1GXSA 4Q3LA 1GQSA 3IDAA 1XZFA 4AZ3A 4I19A 4H7JA 5LZ8A 5DNUA 4KAJA 1UZAA 4C4YA 3FOBA 3IULA 1MX1A 1QLWA 4G9EA 5AK3A 2WJ4A 1O6GA 3DYVA 4K6HA 2QXTA 5FPQA 2HA0A 5AP9A 3WQHA 4N8DA 4V2IA 2V98A 5HF5A 1JU3A 3DCNA 4ZV9A 3MUOA 1W76A 1QGED 1ODCA 2XUKA 4EB0A 2HU5A 4M0FA 4AMZA 1IMJA 3PUIA 1LZKA 1R1DA 5FUMA 1VZ2A 4Q05A
chains in the Genus database with same CATH superfamily
1W35A 5DX1A 4C08A 1PGNA 5JRZA 4DKJA 3TR5A 4ZAFA 4TSKA 4KHPB 1IAQA 3I01A 4ACBA 5FF9A 4M0EA 3PLNA 2GCOA 3ANXA 2BF7A 4FFLA 1ZEJA 3KCNA 5B2EA 3RSCA 2VYND 4EHAA 4HWTA 1M72A 1HE4A 4G0UA 3OFVA 4Y6PA 1CR1A 1NLYA 3UJHA 4RS4A 4KXNA 1NVWQ 1USWA 1ZNQO 2A9RA 2OUKA 1REQB 4NCHA 3MRSA 3EXIB 4ZEVA 1ZWLA 3HJBA 4GU5A 4IX9A 4P7FA 5CURA 5CBPA 1DLJA 2AVDA 4MW2A 1A8IA 4D6XA 4N40A 2YFQA 3ND6A 3NRJA 3RSOA 3D5QA 1TCBA 1C4XA 1V3UA 2OHIA 4BNJA 5I47A 3SS9X 2YOFA 2C1XA 1PJ2A 1YOVA 2IHZA 2RH5A 2PEZA 2WD9A 4N8SA 2O7VA 1KI4A 3B1JA 3CX4A 4ZYUA 1DCKA 5C4MA 3NASA 1VJDA 1RQ2A 4G67A 1P61B 1MJGM 2QLTA 3VR6A 1PK7A 2VIIA 4LRYA 1YE8A 1MHTA 1Q0PA 4U2DA 2GEUA 3C3WA 4KLRA 1Z7YA 2RGCA 3UK2A 4FXPA 1BKSB 3EVZA 3KKQA 5C5DA 2C3MA 4N41A 3DE3X 1SQSA 1GV1A 1NR1A 3A1EA 4RD6A 3SEQA 1AUVA 3VDRA 1X1TA 4O4LB 5CW1A 3DLBA 1ICEA 1U8FO 3ZY6A 3DHEA 2BH9A 4CDGA 3U6KA 1ZUNA 3NEAA 3TAXA 3W1VA 1ENPA 1NWCA 2X4GA 3LV8A 4M1WA 1EUQA 3SC2B 2H8GA 4IP0A 3A1CA 2UZ1B 2OY0A 1UOOA 2BRUC 2NADA 3DOHA 1EQ2A 1XMJA 3K30A 4HDCA 4MSUA 5C5EA 2K2WA 4CEJB 1D1PA 2KBFA 1L5KA 2BBWA 5DK6A 1JEQA 3IJPA 1TAHA 4UM8B 5CNKA 3EQ7A 4IZOA 4X6XA 4P82A 4ZVLA 3IVXA 1XNQB 1YV9A 1Z5OA 4YRQA 3MTDA 3M1IA 3ASYA 4QQ8A 4MUNA 3IDSA 4IGFA 2R1TB 2JHPA 4LNUA 4MUAA 5DHAA 2H4YA 4PAGA 3UOGA 4DHEA 5FUYA 3A4MA 1JDJA 4NBRA 4UBKA 1Z4PX 1FNBA 4HH3C 3NCTA 4U2EA 4YRMA 4TQUS 4WNIA 3ICCA 1RAEA 5JSUA 1KFKB 3NFYA 4NK5A 4L73A 1Q2XA 1X87A 4GBJA 4X1KB 4BZPA 4O2BA 4BLOA 3RBAA 1PT7A 2ZAYA 3IBFA 5F5XA 5JNVA 3BRWA 3KUKA 2B4QA 2MSEB 3RKSA 5B12A 3R77A 4PNEA 1OZGA 3PE4A 1G5HA 3RIYA 3SZGA 3Q6NA 3UAZA 3X1WA 2B2NA 2MIIA 2WW8A 3URMA 2YBEA 1JQJC 3H0KA 2CDNA 2YW2A 1E6MA 3LCMA 4DXHA 2VH5R 4MVJH 1LBIA 3PR1A 3C3MA 4L8FA 1QKIA 2VTDA 3TLAA 1JHMA 2H7CA 1MVLA 3PLRA 5EWMB 1EPUA 4G1BA 1QFJA 1WXIA 1Y7HA 2QN6A 3FIUA 1JI3A 1JPVA 2G67A 1XAGA 4ZEOA 1OB5A 1Z9BA 3K9CA 3EC2A 1G7RA 2J7KA 4YI5A 4XD2A 1EDZA 1TKAA 1YR6A 3CVOA 5EKTA 1E8MA 3OG9A 3MWDA 3ESDA 1DDOA 4ND4A 5B7PA 2OCGA 4DLXA 5C32A 4MV3A 1AA6A 4A26A 1VG1A 1DJLA 4LCEA 5EHIA 2FNAA 3FRHA 3L40A 3T1VA 4CM1A 1R37A 1QXSA 5C34B 2OBNA 2QN7A 3QVLA 1JPJA 4C01A 1JYEA 1M1YA 1U2GC 1VSVA 3INYA 3IUEA 3KPVA 3Q2KA 2PLAA 4XB2A 3L5KA 5DLYA 5T3UA 5HZMA 3R3JA 3R5JA 1E4VA 2VT6A 1IXSB 4TMYA 4XQGA 1T1RA 3T3OA 1H6AA 1LFDB 3IDQA 1R5JA 3QZUA 2OOKA 5HF8A 3RYHB 3OF3A 1W1WA 3K31A 3H8VA 4PLVA 1X9HA 4E5MA 4L78A 4RMNA 3UAYA 5L7WA 4EI2A 1DUSA 4FFPA 5EZSA 1QGUB 5F2EA 1XZEA 3RBZA 1T8SA 2XADA 1QZ3A 3WYEA 4C6HA 2XXBA 3KEQA 2L18A 4I9NA 1WXDA 5BUSA 4KFTA 1W2WB 1Z5NA 1BHO1 3JZFA 3FPFA 3MRVA 1J39A 3R5FA 3CH5A 1EWTA 1U65A 2EQAA 5JH7A 5CLHA 3T61A 4F4CA 4QXMA 4LC9A 1FUEA 2VP9A 3NX4A 1JBKA 3ZJ4A 5EHXA 2VUIB 1USUA 5AI4A 3TPZA 1NOIA 3LDGA 1N92A 5FA6A 1QH8B 1AKMA 1XCJA 3G2HA 3QEKA 1ID8A 2QF7A 4HDSA 4RY2A 1YB4A 1SXJB 2ISCA 2OXFA 3P94A 4EMTA 5B55A 1J23A 2YC4C 3GRPA 3MHTA 1I33A 4MI6A 1N5LA 1STOA 3MJHA 2WTXA 2V7QD 4A1FA 1VE3A 3C4QA 3ZYZA 1KR2A 7ABPA 3NUZA 1CT9A 5HFNA 1NJFA 2ASVA 4PXYA 4XPIB 4GXRA 4K1LA 4ENTA 3JRNA 1NAHA 1Z17A 3NH6A 2YY6A 3LP6A 4LSMA 2XGGA 5F23A 2GTIA 2AFHA 3A1WA 3R5TA 4LQLA 3T94A 1BQ4A 2EIXA 3PHGA 1XPJA 4UTNA 4D8TA 3GEIA 1IVYA 3D6FA 5HUJA 4RANA 3TF5A 5HZGA 4XCXA 1SG6A 4KR2A 3EZFA 4L22A 4MJ3A 5NULA 3WMEA 4JV5B 3NETA 2OO7A 2AFIB 2R97A 1G8MA 3O4GA 5CA1A 2WKSA 1GUDA 2OECA 4RIGA 4B7AA 1FDWA 1HDYA 3MPOA 5CAEA 4OHCA 1FTGA 1LTHR 3DHYA 3LPNA 4HRXA 3EGDA 3NBXX 3RYFA 3WHKA 2HF9A 1W49A 4U6SA 3LIIA 3G5MA 1N2CA 1FNDA 2OFOA 3I0NA 4OL9A 2JI6A 1P5ZB 3MUEA 2HADA 3EFHA 4IDDA 1ODLA 5DOZA 5BN5B 4V0SA 2CL5A 4HV4A 1G6HA 1QKKA 3VSAA 1RJGA 2QN1A 2ZTSA 4NX2A 1OU0A 4C3UA 3WVNA 2WFAA 5H82A 1MPTA 3VU3A 3GD7A 4BASA 4KQFA 2GZAA 3ZDZB 1MG0A 4OV6B 3HJGA 3PDIA 2BL4A 2PANA 3OWOA 4LHXA 1WXXA 2EWMA 1FTYA 3DFZA 4KO1S 4RNDB 4HXYA 1QVRA 3K6SB 2CXOA 3PL1A 2ZTVA 2A0KA 2MWMA 3NLLA 2FSVA 4Q4AA 1UOQA 3RSFA 3DC2A 3WLTA 3OTIA 4HUJA 3PZBA 3ERCA 4MDEA 5DGXA 3FBGA 3OQOA 2G1KA 2ILVA 2ZWVA 3IIMA 3RO7A 4DG5A 4GI1A 3GEGA 3KJGA 4OBWA 1QAQA 1V1MB 2ZAGA 3CX6A 3BS4A 4TTTS 5ALUA 3JQGA 3UMCA 3X1ZA 4FE4A 1MCZA 1FX1A 1LVUA 1QORA 3EBLA 2FW1A 5BV1A 3DAHA 1OBHA 1U7HA 1OHHD 4RL6A 4EZIA 1NKSA 3C7DB 2R9VA 4Y9SA 1PQ4A 1ABEA 5AW2A 2PGIA 1XROA 2YOGA 5EQFA 5IKMA 1N2GA 1U2DC 2B69A 2G25A 2FKAA 4BFYA 1OH8A 3SBOA 2C4UA 1T15A 2N9UA 5F33A 4I5GA 3SKVA 1LUAA 4HQNA 2HQRA 3HU5A 2XAAA 4Z5XA 4JBGA 3D8HA 5DU2A 4EHBA 1U0JA 4RKQA 1FX0B 3MILA 3Q5GA 2WHXA 1E6EA 3DE4X 1PEAA 1YVRA 3K6JA 1SOUA 3OZEA 1MNQA 1AHHA 4YRFA 1PWEA 2A5FA 2R7NA 2IQ5A 3AEZA 3WLRA 3B7GA 4X1IB 3FWHA 3ZXXA 2YY5A 5FWYB 3NTOA 1E1DA 3WDSA 4JBNA 3CZQA 2J3JA 3AG5A 3KL2A 2XZTA 3D7NA 3TVDA 3U5TA 4EZBA 3WK6A 1P1CA 5ALGA 2QRNA 1PJ3A 2XV1A 2O50A 1WMEA 1GUFA 1HM5A 1UWLA 3P97A 4HWRA 4X8HA 5AW5A 3SJZA 3TM4A 4BRZA 4RTLA 4BJ5A 5BWMA 4C4TA 3QPCA 2AYZA 3U19A 1ADCA 1QNFA 3KZKA 3OHMA 4DQUA 4D0RA 2CNDA 1XTBA 4QOEA 2NQ2C 3FKSA 4BMPB 3ED1A 1VXOA 4Y1EA 1AMOA 2WTUA 4ZALA 3BVPA 5KJ6A 2QTHA 3U4QA 2BZGA 2FQ1A 1P7CA 3UHJA 2DEUA 1QO0D 2KSQA 4G84A 1DHRA 3WRXC 4Z7JA 9LDBA 1X7DA 5E7IA 1TA0A 1VIYA 2H65A 1WDTA 5H1YA 2QZSA 2ZSAA 3GA7A 5DK4A 2JD1A 3ZE9A 3GH1A 1RZ3A 3PC7A 4EX6A 5H81A 1ISJA 1J0AA 1FYDA 3A2KA 3LC1O 2Z1MA 4UAVA 3SS8A 3EXHB 4ES6A 2BONA 4IICA 2VAMA 2ZTLA 3U61B 5ICFA 4Q02A 1JAZA 5JPIA 2YUIA 3ZHSA 4XSHA 3QLEA 2NXCA 3O8OB 1MO2A 2C5SA 1Y3HA 4DYDA 4V0NA 1LSJA 4X8MA 3R7WA 4J75A 3SIWA 1KQGA 3DAFA 1SCUA 3I01M 2PZJA 4IH4A 1T9CA 3QBDA 1S9DA 4L4RA 3B82A 2IXEA 5CH3A 4BFLA 5LQNA 3QYFA 3REQB 5JEEA 1TQ4A 3VPSA 5JHGB 1XKXA 3E0XA 1Z25A 2NSHA 3S44A 3GVIA 4I6JA 2NVUB 3T9BA 4C4PA 5BURA 7MHTA 1YJQA 3BTOA 2CLDX 4QQFA 1FFGA 3C3JA 3CQ9A 1V7CA 1PLJA 1RYBA 3WFIA 2ZB2A 2CFSA 4G89A 1ZMTA 2IZOA 4FX5A 4GL4A 1X19A 1YNSA 2YV4A 1UBTS 4UC0A 3ZLTA 4BO7A 5E6RA 2FUEA 2HZBA 2JJ1D 4DE5A 1OGYA 2Y1GA 4MQ4A 1Q21A 2FSSA 1DBWA 2PCLA 4GVXA 3O1LA 3I62A 2W4MA 3WHPA 2GEJA 1BWSA 1PGQA 3EZ7A 2QN8A 4LX0A 5EC8A 1GZDA 2EW2A 4IVQA 2R44A 3O73A 1F12A 5KWJA 3A26A 3CX7A 3X44A 5C8YB 2JZCA 3S29A 1GL7A 4PFKA 5BVGB 4CQMD 1X74A 5ESDA 3KT3A 1L3IA 1ZC4A 2EDAA 3VSDA 1CUVA 4BJ1A 3IPXA 2R751 4IQFA 2ATIA 3ZHZA 2FN4A 4JB8A 5A9RA 1LGYA 1Q1GA 1GUBA 1UPAA 2E6KA 2XQKA 1X80A 2PMKA 3KZXA 5IARA 3RKUA 3QTTA 3ZBUA 4BMCA 4IFIA 3IL2A 3AVPA 1THGA 3Q3HA 3CE6A 4JB0A 5ICGA 1ZY2A 4YCNA 1KJIA 5DKFA 3I5UA 1CDEA 5JSQA 1ZI6A 3K8ZA 3LHKA 3D6TB 2CFIA 4P4UA 3TPFA 3GLFE 2FJPA 3D0QA 3FNEA 5B5SA 3THYB 1U8YA 1KR5A 4KK3A 1E63A 1RVDA 2VH2A 3NUQA 5FV7A 2H2AA 2J59A 3AOEC 2JHCA 3VR5H 3JASA 3FDJA 5E95A 1YA6A 1WRBA 4QA9A 3LHIA 4CT5A 5CA1F 2OYSA 3ABIA 4EG1A 4WN9A 3I58A 4GW3A 1GG8A 1OR8A 3WTCA 4E07A 4WKOA 2B25A 3LQYA 3VXKA 1JHDA 4L5JA 2JDIA 1J09A 4ZOBA 3HY6A 3LXRA 5T41A 4EG5A 2ONCA 1C9MA 3THWB 3MJSA 4D8UA 4JWTA 5J63A 5LBTA 1J2YA 3ZHOA 1VI2A 4AF8A 1NBAA 4J0JA 3S2GA 1SH7A 2XCLA 1D04A 3P2OA 1X7XB 1MENA 1WMAA 3FDZB 4XIJA 1VI6A 3DXZA 4F91B 1RKQA 4WK4B 4NYIQ 1YDHA 2QRLA 4IV8A 5LMZA 1QP7A 2FAXA 4N1AA 5AOVA 3K9FC 2II6A 1UMDB 3WYBA 1QF7A 3IVCA 2VFAA 3M4XA 4JJ4A 4PX5A 1GDHA 1XNGA 1XQXA 4MMXB 2OCDA 1OZAA 5KTSA 2WWFA 1E2KA 4E11A 1ZIPA 3G0HA 2LCQA 2IBTA 4YV7A 3D6NB 4PFSA 4OM8A 1RPNA 1TADA 2A86A 3GFTA 3PGJA 2C0QA 3PGA1 4JI5B 4M1TA 3WJ2A 2CVHA 2WJZB 1BVUA 5FO1A 1Z5UA 4R84A 2WPDD 1EX1A 3NBFA 5JAOA 4Q9JA 3MA0A 2VHWA 1F1JA 4RVUA 4GOJA 1AG9A 5CNIA 3IEVA 3EPJA 3WB9A 1XP8A 4PZCA 2JVKA 4RD1A 5AMXA 5FYQA 5T67A 3WKAA 4OO3A 4W5OA 2IH5A 4JYMA 3S68A 4R2WA 1O95D 1KY2A 4YPFA 5JJLA 2IWHA 4U4AA 2M6LA 1DAOA 1QBGA 4G9GA 2BR5A 3HCOA 1II8B 4NIMA 4MWZA 4BE7B 2P2GA 4IO1A 1KSJA 4G0NA 4JL6A 1FS5A 4DWOA 2HH9A 1H0RA 4P7KA 4E30A 1EGVB 4MI9A 2B34A 4GBMA 4J0EA 8GPBA 1SXQA 4A8HA 2IY9A 2V7PA 4IO0A 1KAEA 1AGPA 2GAJA 3IQEA 3EFEA 1JVSA 3BXGA 3Q4GA 4Z0PA 1V3TA 2XX3A 3VYSB 2VNHA 3B52X 4MEBA 4WOCA 5FAKA 4GC9A 2FGJA 1FLVA 3L1VA 4L3VA 4B1FA 3TO5A 5FULA 1X1SA 1MB2A 5AVZA 3I23A 1J22A 4AJJA 3DDUA 4ESEA 2REQB 1X38A 1JAYA 2GBLC 4W6QA 2CMGA 1GHTA 3Q72A 4JUIA 2X14A 5JD6A 3K0SA 5DLPA 5IP5A 5L7TA 3HI4A 3IVGA 1B42A 4DWVA 1KI7A 3PDJA 5A4DA 2VHZA 3BFJA 4KE9A 1GKKA 5BVHA 5L8VA 4ZIRB 2CXXA 4UZSA 2PKRA 1T9KA 4RTRA 4NEHB 1Q20A 4DLVA 2VBFA 4X7RA 3SSAA 2B9EA 1CF9A 1JTVA 2P8SA 1RQ7A 1LS6A 2B4AA 1HMYA 1QX4A 1VHLA 2M98A 3VTFA 2WVHA 2FDRA 1CC1S 1SJ9A 4N7RA 1UDBA 4FGKA 4FJ1A 2DETA 1EDEA 4H0NA 5H3HA 2GPYA 1MO4A 2J8ZA 1R4AA 3ZE0B 3WJAA 2P9BA 1LK5A 2QY6A 1A71A 4A0SA 3R9XA 3H1PA 5DBIA 5DM0A 3ZQKA 1BGWA 3L8DA 4QRIA 1F3OA 5REQA 1BJRE 4MMZB 1DAIA 2IYZA 1OW3B 2H9YA 3JYQA 2VPIA 3I2HA 3GJRA 3HYTA 3SHFA 1NDUA 4O4HF 4YDSA 1C7EA 2VUTA 1SU7A 2AZXA 4XUEA 3BA6A 2HBRA 4H18A 4LQCA 4AC9A 1BZYA 4NU5A 2QEQA 3CMMA 1JFRA 3QHPA 4S0ZA 4I3HA 4IYRA 3ZEAA 1E5XA 3QYAA 3CRZA 2UUBB 4EF6A 5K0TA 1N6NA 2IPMA 1XVVA 1SZDA 2HHJA 2YQZA 2ZIZA 3L2OB 3NOXA 4KW7A 4LVNA 1C7RA 1SZCA 3IP1A 3L4BA 3ANSA 4JC8A 2DH6A 4PAOA 4BQIA 4LBWA 2R6HA 3IT2A 4DZRA 2FLVA 4CIVA 2AUNA 3L49A 4MICA 1VMAA 1B6GA 3BD6A 1ISHA 3HRHA 4YRDA 1RHJA 4Z2AA 3HJTA 2PUWA 2JW5A 1JXMA 2RK6A 2Q6LA 5CDSA 1B0AA 5ETJA 3RSHA 1JDBC 4GE0A 2OHJA 1XLWA 3CSDA 1GFIA 2Q3DA 5IJXA 5KYYB 4IGKA 4BMYA 5JSHA 3JVIA 2CF6A 3R7LA 3D3WA 1LW7A 1YC5A 3B36A 5JZVA 3HY4A 3I3OA 3OT1A 4LXQA 4DG8A 1UBEA 1C9YA 4LCJA 1NNSA 4IOMA 1AC5A 2HFJA 1P9OA 3WL4A 4NATA 1DIGA 1OX5A 1USIA 3RC9A 3IILA 5TV2A 4NAUA 1I7QB 3P2EA 4KDFA 4AZTA 1RLIA 2XMDA 3D7KA 3AJEA 4HPXB 5KKAA 4HNRA 2F1OA 3A2NA 3O8CA 1JEAA 1ZK1A 1T0JB 4TL9A 3PQ4A 1GTRA 3REOA 1NJGA 3RT7A 2Q1SA 1JYSA 1E79A 1GP2A 3O91A 4EJSB 2W98A 3T3MB 1EGAA 4RH3A 3TN7A 1N2HA 3ZQ6A 3CLKA 1XZDA 2WF9A 3OX2A 4AKEA 2AI2A 5B4VA 1NBMA 4PIMA 2R5NA 4OK6A 2X13A 5H80A 4K9DA 3K6KA 5A5FA 3LVQE 4UM9B 2JLYA 3UFBA 4QPNA 3AGPA 4WCVA 4W9RA 3LA8A 5ARBA 3GDGA 1MQSA 5LOVA 1A27A 1T6XA 4TUYB 4X20A 1EUDB 4YASA 5JMPA 2ETXA 4LYDA 3VJMA 2LCIA 1ZW1A 2NNWB 1CR0A 5C52B 3WLOA 1QNLA 4O2LA 4OJMX 1SUBA 4L95C 4R41A 1Z0AA 2PLFA 2PZGA 2ZSKA 4IOLA 3TE7A 3CW2A 5F98A 3FZQA 4YT8A 1BGXT 2HNKA 3NW9A 3KR9A 1IY1A 3GOHA 1AB5A 4KX5A 3D0OA 5IJ0A 1OAOC 2B99A 4GGMX 4HNQA 1R64A 2PBZA 1J90A 4CKZA 1G60A 1NPYA 1SOMA 3CJRA 3CEHA 4YJ3B 4YONB 5EGNA 1PZGA 2BMDA 3J81k 4BP3A 5MN5A 3P26A 2FQWA 2Z1NA 1O4WA 1X39A 1G291 2BJHA 4TMWA 2YVQA 4P4SB 2VYQA 4D92A 2AN1A 2X1MA 3FIJA 4ALIA 3UANA 2FWPA 4QG3A 4FPXA 4AY4A 1EFRD 1G7CA 2I3BA 3LDFA 4L4XA 2QUJA 1VC2A 2BYTA 1H3EA 2YXDA 3ONWA 3QVSA 4F3YA 4PSDA 2IGTA 5ALFA 4BO0A 5BMVB 5HW0A 1XXHB 3VKHA 1V96A 1ZNZA 5K8JB 1FXUA 2MMCA 3F97A 4WJKB 2ID9A 3QKRB 1EFVB 1T2UA 2PUTA 4KTVE 5TE9A 1JIIA 2X8WA 2XB9A 4N48A 4NCNA 1ZDMA 5ER9A 2HLDD 2IYXA 3CF0A 4BO2A 2OQIA 3KZNA 5DO9A 4BNDB 4ND5A 1WKVA 3FFWA 1TEXA 1Y8RB 1E8NA 1ZH0A 3ZGOA 5I48A 4IS2A 1S9HA 2VBIA 3VUEA 4DMUB 2PX8A 2J31A 4FFRA 3PPXA 1YU9A 2N0SA 1K0UA 4LEIA 3R7SA 4EMUA 3DZGA 3L9XA 4KB5A 4I8DA 3QOFA 3UMJA 2Q5JA 5DBEX 4DANA 4MUEA 1GCGA 3EZYA 5DI9A 1DELA 1WL8A 2OAEA 4MUYA 5HKKD 4TROA 4D57A 3OCYA 2ZB8A 5E3JA 1ZHHA 2QYHA 5CVVA 5FBWB 1YF3A 1PYOA 1NBEA 1YQQA 4XYLA 4UHHA 3DCYA 3IHTA 2Q27A 3P9SA 1FLAA 3DKIA 3TRHA 4BKUA 3LWBA 2BGKA 3DPSA 4CLRB 4EKYA 1XSEA 5JT1A 5DCUA 4E22A 3M6LA 3KNZA 5H59A 4WLFA 1TYDE 1F38A 1JQLB 1LPAB 2VDVE 3WGVA 4WTOA 3JQ7A 4RYDA 4JLMA 5KTNA 3EK2A 1ZGHA 2C96A 4JNKA 2V3WA 2ZUSA 1JKMA 3KM0A 1X0VA 1Y5RA 1ATIA 2QAGB 4I50B 3W1WA 1WZNA 1R18A 2B5VA 2C5HA 2FKNA 4FFVA 3U4IA 2JLUA 1YQTA 2E2WA 4QOGA 3FZGA 3TSYA 5J43A 4CIBA 1ZGAA 3RG8A 3DMTC 1AK1A 1L6IA 2W2KB 4UUBA 1MMFB 5IH7A 5CB4A 3K9HA 3K2IA 5EERA 4WHMA 3FCUB 3AEKB 4Z53A 1Z74A 1XTUA 3KQPA 4JGBA 1NN3A 3VR1A 5BSEA 2H1OA 4RLSA 1G5FA 2BE7A 1OLSA 3ZIUA 3RUHA 4XCVA 1PT6A 3TCXB 1ZI9A 1YE5A 1Q0HA 3C3AA 1M0EA 4KGXA 5JCOC 3TS1A 5JEDA 2A1TS 3RT9A 2YJ5A 4X6UA 4NDZA 4HPJB 1T0PA 4IIEA 2VJMA 3PNMA 3G8AA 2F3PA 1XOIA 3BXXA 2H1SA 4HGRA 2JCVA 4NYIR 4M8NE 4RS3A 4MVYA 1CRQA 4NU8X 2B4TO 4MV0A 4BO4A 3MQ2A 2PZ8A 3FPLA 1DJOA 1G20A 4ND2A 2DQ4A 1XQ1A 5A6SB 1DP4A 1WMBA 1WQ1R 3O4RA 5FUBA 2FZVA 2DX7A 2AJ8A 4GYKA 1SAYA 5DYIA 4E5PA 4YJHA 1A9QA 3SZ3A 5EJ4A 5L3SB 3QEBZ 2DQKA 2FJ0A 2Q1WA 2GRUA 2OC9A 3K15A 5B57C 1IIBA 4NU6A 5B6JA 4RUKA 3EXFA 4EAQA 1J2TA 2I8AA 1GU7A 3EDMA 5E4FA 2YS6A 4Q9DA 5BR8B 4TL6A 2Y2VA 3QRWA 4AZ0B 3AEXA 4EFDA 2CLMB 4LHWA 3QNMA 4Y2GA 2JJ2A 4B6OA 2R87A 2PFSA 3I9OA 3EGXA 1YBAA 1J7KA 4JLPA 4TSFD 3PEYA 1WBDA 3KWJA 4NNJA 3CW9A 4EPTA 4ESHA 5C51B 1XAHA 1LSSA 2QT9A 2R0QC 3N2YA 2IV7A 4JQOA 1XJ0A 3UENA 3VMMA 2BTEA 1VL6A 3F74A 3OZ7A 4K8OA 2NUTB 4YHBA 4ZEWA 4YP9A 4TMZA 1V45E 4DC1A 3A0RB 4JR2A 3OJCA 1M7BA 3RJ9A 3FF4A 5F2NA 2F4NA 2K6GA 1NMEA 5ALJA 1ILEA 1FUKA 1DC3A 1NI3A 2HO4A 1VYUA 4CTMA 3PX7A 4Q47A 2MYPA 3M5CA 4W8OA 4P4TA 2WUDA 2YUTA 1XXLA 4TMFA 1QP8A 3BDAA 4JASB 1S3SA 4PZPA 3LX6A 3P2MA 1NL3A 4RD2A 1WSBA 1GPUA 1TO1E 2ZYDA 3R3XA 5IT9A 2IXAA 2H11A 5J40A 3KPJA 2YICA 2FX3A 2CLLB 3D8SA 3DBVO 3ND7A 4LMAA 3HA7A 3G9QA 1CQPA 4I81A 4D8WA 4I7EA 4X24A 1BU5A 2I34A 4OHZA 5EJEA 3UGJA 3IJEB 3O74A 3SR3A 4X6YA 4CDMA 4A9AA 4BVEA 2PX6A 1L9XA 5HKLA 4D9GA 2HGZA 5AW3A 3DHWC 4Z1MA 3UMGA 1R88A 3FYUB 4QD3A 4OP2A 4LY0A 1F2UA 3AFHA 2P65A 4LK3A 4TKVA 4YHHB 1NI5A 3QVKA 1RFLA 4QG7A 3M81A 4NONA 2SHKA 1DMSA 1U5AA 1SD1A 4LNAA 4YN3A 2XHEA 1R6DA 4LV6A 4LVOA 3AP1A 4F04A 1E59A 2VH1A 3FCYA 3H9GA 1J2UA 4C88A 4R9RA 1R0LA 2HPVA 3DDWA 3KVOA 2HLHA 3AKCA 3P0IA 3I1YA 1AF4A 3CCBA 2NZJA 3G6WA 2VDJA 4RHTA 2G04A 5EL0A 2FW6A 5HOQA 3EXG1 1U3VA 5JARA 1DX9A 2EFHB 4OUKX 5TEWA 1XR3A 3PEVA 4OF4A 3V1UA 3M0EA 3OM8A 1HZZC 3L8GA 1BA2A 1LVHA 3LNTA 5C8XA 4BFVA 2JGLA 2C8LA 4H60A 1KMQA 2QUBA 4WZBA 2O0LA 2XNDD 4D9CA 1W29A 1K5GA 2NO4A 2XB4A 3CN7A 3KOUA 3CBQA 4HYQA 1ONNA 2GESA 4AYWA 4ND7A 3ABZA 3RWOA 4CCYB 1H1LA 5KJEA 4B6RA 2J5BA 4RCYA 2J30A 2VDLB 4FOTA 3RHFA 3D6JA 2GK3A 3GPBA 4P98A 1Y42X 2ZFUA 3K1TA 4PG4A 1RRPA 5EN4A 2ODPA 4RZUA 1BEEA 2G1JA 3Q7IA 2FEPA 4ARIA 4MDFA 1VHDA 5CIWA 1DFHA 1IQPA 1JPNA 3ZIAD 1HT0A 4BTEA 3S4YA 1XMVA 2E3JA 5K99A 1UAGA 1A77A 2ISSD 3RS3A 1CJMA 3WIBA 2W2NA 3O2NA 1OXKB 2IYNA 2F1HA 2PRJA 2W2QA 4QNNA 4UXJA 4Y9RA 5KBYA 1UAAA 1AKUA 3PCRB 4MUFA 1IHXA 1H0HA 2R86A 3ICWA 2SICE 5EAIA 1K7XB 1O96A 2X9VA 3LUGA 5BQOA 4AJOA 4FMBB 5KQGA 2HIAA 4I4NA 2I9KA 2ECPA 4TN5A 5ES3A 5B4UA 2O20A 3CUYA 1E3SA 3LI2A 4XGRA 1ZOIA 3DBLA 4PIPA 1Q17A 3PFCA 4QGHA 1HE2A 3V4SA 4QU5A 1OC2A 2EQ5A 3A32A 5F12A 5SZJA 5HHTA 1F14A 1N9GA 1G21B 4EA8A 4NS4A 1K4YA 3N86A 4OTZA 1ID1A 1P62B 4QSHA 1I5RA 4HYYA 1L3CA 5EMKA 5LP6B 1OIWA 4LYHA 5AKEA 5EMLA 5KNDA 1JLMA 5KYNA 2W4IA 3RIHA 2C83A 2WM3A 3GX1A 2W6ZA 1TUBB 4B0OA 4CM9A 5BNWA 4UEQA 2JBHA 2VTKA 5ILOA 3CRVA 4PAMA 5IUJC 3JVEA 4GMFA 4ZT7A 3FOCA 1PLLA 3KALA 4Y2RA 4FINA 5TQ0B 4BN4A 1GADO 4AULA 1IM8A 1B16A 1NY6A 2G9QA 1V8PA 1ZKMA 2YHIA 4GE3A 1CDDA 4KPYA 4R8LA 2R7KA 2RAUA 2QRUA 1CZNA 2PD3A 3FWKA 4BFWA 5CEEA 4NBVA 2X9NA 1YRAA 1ZOLA 4X1OA 1R0SA 3LMKA 1M8JA 2BFNA 4MGKR 2XODA 3CGGA 5DTEA 4C4RA 5L4NA 2BMFA 3CXUA 1LX6A 2HMYB 1XRJA 1N6PA 2XUOA 2VNIA 3A1UA 5JADA 5LDDC 3MBIA 4J3NA 1IHYA 3ZN2A 3HDHA 4HKTA 1A72A 1KO5A 5DF1A 4U00A 1RZRA 3K9BA 4JLAA 1E1YA 2WNHA 3L4KA 1KMHB 1QKJA 2X42A 4ZVUA 5CGQB 3AIKA 4IUDS 1O5OA 3HXOA 3KOMA 3COWA 1TC2A 4ZVVA 4BQQA 1RP7A 5TXGA 3TMYA 2IGBA 1Z0DA 4DR4B 1NVGA 1KKMA 5TQ2A 5TLSA 2R65A 3M3PA 4URFA 3TLCA 3ZDBA 1FNNA 2O07A 3TPCA 4DJAA 1FLNA 1WEKA 3B60A 1P7PA 3AVUA 2WF7A 5EZ5A 4JLBA 4U6QA 3TW8B 3EPRA 2I7CA 2Y92A 3QLTA 4B48A 3HFJA 4C7MA 2DFDA 4KIFA 3B3GA 5KAMA 1NBOA 1HX7A 1PWXA 3DE0X 1Y1PA 1H2XA 3GAZA 4F8EA 3DBRA 5AVWA 2XDQB 1GQYA 1TOAA 4IDCA 5AI5A 1Z0ZA 4XD7A 3QVUA 3KPUA 1O8CA 4MV4A 1E1RA 3N7UA 5BN4A 3AR7A 2JARA 4DTCA 2KLBA 3OJLA 2QJOA 5EWLA 2EX1A 3Q10A 4W5HA 5C7YA 3HVRA 3TUZC 1K6XA 1J70A 2ORVA 4DADA 2KI5A 1FP6A 2V4MA 4KV9A 2NZYA 3DV2A 4N7BA 4Q9NA 3AB8A 3DOJA 3OFND 4QRHA 4D41A 1RRCA 1LBSA 1DC8A 4CEHA 2K5UA 2D2IA 4P36A 4AUKA 2BGUA 3RNLA 3K0EA 1GNLA 4YYEA 4ER6A 3BHIA 4M87A 4UEOA 4R7GA 2C98A 3JVVA 4C06A 4K9RA 4ZT4A 4Z54A 4BCCA 3KXLA 3JWGA 2OXTA 2IODA 2Y9PB 2DFLA 3VV2A 1KDTA 3HS3A 3DYBA 4QXPA 4ZQHA 3MOIA 2IDZA 4Q3CA 2OP0A 3ID6C 2MHCA 1X7YA 2P6PA 3LHSA 1ZUIA 4OU5A 4GDFA 3RJTA 1CE8A 2YRWA 1G19A 2M9MA 3E84A 1WNTA 3G7UA 4YJ2F 1Z34A 2R4QA 1U0RA 2Q5QA 2VT7A 4E3ZA 2RGXA 5ITZA 4WW0A 2WTNA 4EPYA 4JKYA 5LSAA 1MVOA 1NTOA 2NO1A 1NBHA 1X94A 2PZBA 2W37A 3D43A 5DT2A 2CFCA 3GFBA 4Q93A 3UOWA 3CPJB 1ZJ5A 4LYAA 3H11B 1NG9A 4QICA 1U0BB 1ESDA 4UOEA 1RPTA 3OM9A 1WP4A 5DASA 1DWPA 1VCNA 2ORED 2XMZA 3M3HA 1UK9A 3DE7X 3JW8A 4M7RA 4DIKA 3HU2A 2IS4A 4JZYA 2A33A 4UUPA 5DSZA 3WWPA 3JQBA 4MV1A 5HCUA 1DINA 2GLTA 3RK0A 2LUOA 1U0HC 3GZNB 3SJ7A 2NQTA 3R9KA 1SVMA 2ZVQX 4M38A 1QDUA 4UEKA 4Y6LA 3UV7A 1BEZA 1I3CA 1C2YA 1UOEA 2TMGA 1L5NA 3VTAA 3QEJA 1AA9A 1P1BA 3THWA 1Y7LA 2C2OA 3VX4A 2OBMA 4Y0NA 5IUKC 2YKGA 2C07A 1ZCJA 1GPJA 1H6CA 1V6CA 2PAAA 3AFGA 3OF2A 2O7NA 3PCTA 4L1KA 4PLTA 4QJIA 5FPSA 4L75A 1BQ3A 5G1PA 4GI3A 5SY9A 3HY3A 4M1ZA 1LSUA 1PFKA 2A0XA 4QJ4A 4YT4A 4MVJG 5HPYB 2F67A 4JELA 3VR6D 1N2OA 3EGOA 3M34A 5C31A 2EX0A 3S1AA 3G0DA 3VYRB 1LWNA 1YTLA 3HB5X 5EJ7A 4J43A 2FFJA 3SJCA 1IUPA 1E3TA 2VTBA 3BZBA 2PVSA 1Z2DA 5KMGB 1YS2X 3QKTA 4FX2A 2UDPA 3I72A 2Q3MA 2P6UA 4H1WA 5EE0A 2AWNA 5AHOA 3RAFC 6REQA 1JV2B 1GLNA 4LJ9A 4IEIA 5D01A 1BXGB 3THXA 3HXQA 3MW8A 3U39A 5ALLA 3CZPA 3PQFA 2BEWB 3UMYA 4ZZ0A 1L5HB 3LRPA 3SXUA 3UMFA 2QVGA 1Y34E 4A03A 4B2PA 4XWKA 3VKFA 2EIHA 4QTYA 1E92A 2CLOB 4PF1A 1NA5A 1U3DA 5E9WA 4YBZA 2FRDA 1JA9A 3QEMA 4OHBA 1DOAA 2O23A 4IWXA 3E9EA 2TMKA 1WF6A 2OAP1 2MSWA 2CNNA 1BXZA 1RRKA 1KEVA 2GN2A 1VGVA 4L0CA 5CG2A 3T4UA 2P7HA 3PFNA 4DCPA 2HU7A 4DIOA 2VHVA 1IY9A 2C03A 3CNHA 2X6TA 1YA8A 2FR8C 2GBIA 3FZYA 3C6XA 5DVZA 3UUEA 2IHYA 2W6QA 1HDIA 2E82A 2HXGA 1L4EA 2BEUB 2Y0DA 3DZIA 3NHKA 4UZFA 1AURA 3PT9A 4BRSA 2ZREA 5JNWA 2ZYRA 1PP4A 3BRWD 4CMEA 3AJDA 5HKBA 2VZLA 2Q3LA 2F6RA 4OAPA 1HQCA 1TKCA 2IS6A 5K4HA 1OBFO 5K8CA 4XR4A 1Q6YA 3GNLA 2CWWA 3SFTA 3EF0A 2QAIA 4HTFB 3TKAA 4BLTA 4ZGGA 3MBOA 1HYGA 5HR5A 1R4NA 1E9BA 2CMDA 4QGSA 4Q4LA 4NBUA 5DNWA 2R7MA 1A7UA 2QNRA 1K4KA 1TB4A 2W6MA 3DAPA 4YMTA 1P4JA 1NJ8A 1DBRA 2ADFA 2OB2A 2IH4A 2VHYA 2XCSB 1YS4A 1Q44A 2KPOA 2IW3A 1WHSA 1X0XA 2YWGA 3ODPA 1XMSA 4BMZA 5BMOA 2G4VA 4HNAA 1R9NA 1US8B 4Z4IA 4RV5A 5CNJA 4QBFA 1TAGA 2OK7A 4WH0A 1MOSA 3WADA 1YGYA 2R47A 4GEGA 4L08A 4KYTA 1R66A 1YCDA 3LW8A 5CW2A 2X23A 2WZCA 4AG5A 5DISB 4NYJR 2PUJA 1MW9X 1ZWKA 1H1DA 1G4AE 4OI1A 3GLIA 4OP1A 1U8EA 2GCEA 3KQUA 5GZ3A 3KPWA 3DZDA 3ILHA 3ZV7A 2C92A 5ELXA 1K6IA 1R6VA 3U56A 1U6JA 2XYGA 1N7GA 4M0PA 2JBAB 2YRFA 1H5UA 3C8ZA 3ST7A 2ORYA 5P8WA 2F43B 1ADBA 2VTVA 1JEDA 3JPWA 4AQ7A 4BY9E 4YNBA 3ROKA 2FW0A 3ANNA 2H1FA 3QWAA 1KBOA 4JODA 4HS9A 4FGWA 3ET4A 4TKUB 5KWIA 2A84A 5HS6A 6AT1A 4OA8A 4GICA 4A2WA 1JE1A 3G49A 4HRYA 3DH0A 4RPCA 5FBKA 4D4IA 2BCJQ 4HMPA 2JLQA 1FW6A 3T7JA 1O4VA 3THSA 3T9EA 5KTYA 3IQIX 4WCDA 1Q77A 3VPGA 2HRCA 3IXLA 5JJ5A 5TMDA 4IFTA 4QAQA 3ES9A 2CXUA 1EFTA 4JROA 1FUIA 4PRZA 4F5ZA 4LTDA 2X8AA 3CZCA 2OYRA 3PXEA 2VP0A 2AI1A 3BL6A 3TUJC 2GFQA 5ABPA 3F3KA 1D6NA 4H1HA 3NO4A 4HLCA 1KRXA 1M2HA 1YMQA 1HI9A 2QRJA 1DSSG 1X1AA 3ABQB 4D42A 4LSZA 2OSBA 4J0GA 2XXAB 1DS6A 3H1GA 1ZISA 5FUWA 3VR3A 2D1TA 2GOYA 2JGKA 3N0TA 1VYVA 5H70A 3TR0A 4E2YA 3EZGA 5EZQA 2K7FA 3N2NA 1KFCB 2AG1A 3KLNA 1Z38A 4G09A 5JCPA 4PWZA 2C9YA 2Q2NA 4KQXA 3L82B 5CYFA 4AL4A 4EFNA 5BVHB 2KYRA 1I2CA 2YZGA 3MD0A 1BRMA 3NUGA 4G5HA 4YCJA 1IC6A 2ZTMA 3D1LA 1T91A 1VB5A 3KB6A 4DSAA 1IM5A 1QHGA 2WUGA 3CZ9A 2JJYA 4LXXA 4NJEA 5KYUA 3NHRA 5AICA 5GWXA 3ZWQA 3GMSA 2ZS8A 1ORTA 4QYMA 3P0RA 1EVJA 3N3BC 1M6EX 2B35A 2VP3A 5DTJA 1DE0A 3EC1A 4H7KA 3PJEA 4QUHA 3OD5A 1TLLA 5G02A 2W6NA 3H5LA 4ZXPA 1TQ8A 5EINA 2AYYA 3ONDA 2CUKA 4OP3A 2GZ2A 1O6FA 1YOVB 2NV6A 2I67A 2YTZA 2DR2A 1L7EA 1LI5A 3A7DA 3D5EA 2RAFA 3OCCA 1XNJA 5CEFA 3QWFA 2F90A 4DA8A 1C50A 1TAQA 1UIMA 1X1DA 3U81A 1WTAA 2D1YA 1JAXA 1MZVA 1RXSA 1RU3A 3CLRD 4RGBA 5EJAA 4DM7A 1KJNA 2V3CC 5F21A 1S2NA 1YL6A 2P79A 4WKPA 1R0WA 5G40A 1ZR2A 1PF7E 3KXKA 2D7CA 1CB0A 4UVDA 4MUHA 3HPQA 4CQLB 2B8NA 1C9EA 3WYNA 1EVYA 3HACA 2JC3A 1X13A 4B4VA 2FP4A 2AXPA 3QJ5A 2EJUA 3JZAA 3A1TA 2AW5A 3GJXC 4UMVA 1ZHFA 5KVAA 4C5AA 3HO1A 2BKAA 5FNVA 1FPQA 3UWPA 4LW8A 4KI0A 3SQNA 2CSUA 4J0HA 1DIHA 4X85A 2FR0A 5CT4A 3PFGA 1DQSA 3N2KA 4KPGA 1IATA 2UUOA 3IR5A 5A3SA 5IJZA 3GEHA 4OGWA 1AHPA 5LYYA 5SICE 3ORYA 4J7XA 4LNUB 1ZZGA 2V0NA 2HL6A 1SU4A 5L40A 3BXFA 3NWPA 4RA9A 3QNWA 4H08A 2HWYA 2J5KA 4N3AA 4QODA 4CDNA 4Z2YA 1THTA 4UXIA 3P9XA 2L0XA 2JFBA 2CEAA 2F7SA 2VJOA 1M2FA 4DV0B 4AKGA 2WJIA 3AUFA 4X84A 3IAS6 3E9ZA 3JQAD 3KYJB 5GIOE 1GWNA 5E1DA 1WO8A 1R5OA 4KBFA 3T15A 4NBKA 3FUVA 1N5DA 3TKYA 1CY4A 1XWWA 3EY4A 3GJ5A 4F9TA 2P5UA 4TN1A 1K8YB 3CISA 4OUDA 2DZDA 3E5MA 1FP4B 4FHEA 4ITRC 3ANTA 3C5VA 4PLCA 4RTPA 1FFBA 3GDWA 1XLTA 4RBNA 3C8HA 1VJ5A 1FVFA 3IPCA 4UDOA 4D81A 4G37A 1LDEA 1LBTA 1P4GA 4BWVA 1OLUB 2YJGA 3CLRC 3FKSD 4NFHA 1PZXA 3HUTA 2IEGA 4RV9A 3UYLA 4E6PA 5CDHA 3IXMA 4CMJA 3SDZA 6LDHA 1Y8QB 1Z56C 3IUSA 1DO2A 2I1LA 4IXMA 2IU4A 3PC6A 4BKPA 3VU9B 1QR2A 3KOOA 3IIKA 2PX4A 3V3KA 3AUTA 4ARZA 5ALMA 1JTEA 2JH8A 3IKVA 5LQSA 4D3ZA 4QLBA 4J90A 5C8ZA 1WXQA 4V0LA 2AWOA 2D5IA 2RKBA 1JIJA 1PS8A 1TEZA 3E3OA 3N87A 4K6CA 3AFMA 2YIJA 4UTRA 5JVDF 3BRQA 3IAFA 3W04A 4KBGA 5EP2A 4E5VA 4IXWA 6ABPA 5EHZA 3HLTA 3IKJA 3LDUA 4K46A 3S8YA 2I66A 3BGVA 1M1YB 3G9XA 3KJXA 4LOKA 4MAMA 2XTMA 3DLTA 3WHIA 1BS1A 3ISTA 2C2KA 1NE7A 2JFGA 2PMDA 4IQGA 2PPVA 1MQ8B 2VBCA 3Q7QA 3F96A 3H5OA 4RK0A 4S2UA 5AHWA 2H0AA 3RVLA 3GLQA 2IHJA 2CFTA 3I53A 1CR2A 1K6MA 5J4YA 5TEVA 2EKBA 4JC4A 1E5LA 4FYXA 5JSYA 3EIXA 1NW5A 4TM8A 4KOEC 4CIYA 3EZLA 3PI6A 4Y6SA 4OI4A 4LOJA 1WVMA 2FEKA 2WKPA 4AB1A 5HBRA 3MJFA 4RZQA 2QD2A 4NBNA 1RC1A 4DLWA 4Z49A 1A5BB 2GCGA 2VRBA 3AL2A 1LLDA 2B20A 2I4RA 3ACCA 4P84A 1JZQA 1ND6A 3T3PB 5M2QA 3UY4A 3ZTYA 3A6KA 3ZW8A 4FCTA 1E0DA 2HJVA 2ZIXB 3AF0A 3C6QA 3GN1A 3I32A 1R8JA 1PR3A 1O77A 2PGDA 3R0JA 3QMWA 2AH5A 3ROFA 3V6LA 3WWCA 1EVLA 4MKRA 1S4QA 1XE3A 3V7UA 3MG9A 4MA4A 1IZ0A 2H54A 1IK6A 2PSDA 1SVSA 3B53X 2W70A 2BBTA 3R8CA 5JNTA 3SHQA 3VYVA 3T1HB 2VNSA 1I2AA 5CA0F 2JH9A 4BC0A 5IASA 4HOYA 3L79A 4KXQA 3A3OA 4DUGD 1HR0B 5JY6A 2Q7XA 2YV2A 1KDZA 5I9TA 1I4EB 4AECA 2DM6A 4V03A 2HJGA 1K0FA 3D02A 2PL1A 3KYBA 4OB6A 4R05A 4PONA 5KC8A 4GX0A 2DKNA 2ZT8A 3EIOA 2A57A 1Q0QA 3ZZTA 4D9JA 2KMLA 3ROXA 4MR9A 4E5SA 1V3VA 1DTEA 2OA0A 1BWQA 2CJWA 4ZAGA 3RVQA 1F6WA 3D8BA 3QELB 1K5HA 4QREA 5FAXA 4HVCA 2HSDA 4LDNA 5FOWA 1BFDA 1ZC3A 3KQOA 1YK0A 3AK4A 2BELA 2G5PA 5SYMA 4DNXA 5CA1B 1HL3A 1Q19A 2HB6A 3DEJA 3N6XA 3R4VA 4BO5A 1XJWA 2WAMA 3JYOA 1HLFA 4G5QA 1MDFA 1W0JD 1QQ5A 1KOLA 1KRWA 4EKGA 2XVAA 1K92A 1C3VA 1QIDA 3CO0S 1AB6A 3T54A 3PVSA 1AF7A 3ZZ1A 3ESCA 2NXEA 2WSBA 3C8DA 2WOJA 3BH7A 3OTGA 3AZOA 4XI9A 3GNSA 5D00A 5D5QA 3WGUA 1BDIA 3R41A 5JCJA 2HDHA 1DT3A 3QWHA 3KEMA 4U02A 2LVBA 4W7SA 5TPWB 4NPHA 4RH0A 2VJDA 1PQPA 1YCFA 4DUPA 2V1XA 4HB3A 1QLJA 4L16A 3KXDA 3N0XA 1P4AA 2QNIA 5EOVA 3TAUA 4IXDA 2AC4A 1Y3IA 3AUYA 1CU1A 2LKDA 4FCVA 4CU2A 1VPTA 2PSSA 4RKWA 3IB6A 4DEVA 2I2FA 3GFOA 4QPCA 5K8LA 1OWNA 2FSUA 2VWHA 4XWOA 1SKQA 1SWWA 4PY2A 4E21A 5T4HA 2JFQA 2OBFA 3R3WA 4ZVMA 3KQKA 1HFWA 1DV1A 4CCSA 4NBLA 4GGOA 1DRUA 3FYDA 5IVHA 1Q7GA 3LW7A 4Q9IA 3ZXIA 3TNDA 3OX1A 3D7MA 2C3OA 1M2GA 2IHBA 3IDZA 2GN8A 1N7HA 3MGKA 4POOA 2PWYA 4B3IA 5IDQA 3ESXA 3H86A 3DTVA 4FLMA 4AICA 4LGCA 2ZZMA 1NRJB 3IOMA 4AJ4A 1C80A 1V2HE 3EVNA 4DREA 2VKTA 1E9EA 4DB4A 1DWUA 5DCYA 2F64A 3TIIA 4FYIA 3AGQA 5MFZA 3AUSA 2GTPA 4CM5A 5JDCA 3CWQA 1VBMA 2HWWA 3T1YB 3ZCQA 2HPHA 3QYPA 4U8GA 1RQLA 2D13A 3WHLA 4C0JA 4WERA 1RWVA 4NY1A 1OFUA 5CK4A 3CCCA 4BX0A 3X1KA 3BK7A 3H04A 3GAFA 4LDJA 3NHUA 3RREA 4Q16A 1Y9ZA 1NZJA 5KNBH 1LDGA 1X1EA 1OFVA 1UANA 2FVXA 3HN2A 3K9WA 4ENVA 1YQGA 3O93A 1DEOA 2BD0A 1OUMA 5EJGA 4CMIA 5CD9A 3AX6A 1EDDA 2RGRA 4PVDA 1C3XA 4RFVA 4TZTA 4QQRA 4F4IA 3LWNA 1ISIA 3H1EA 1MA3A 1PTJC 1W0CA 1XJCA 2B1JA 2Q8NA 4MA0A 3ESRA 4UE3S 5IH3A 4EY7A 4GYWA 4KREA 3FUCA 1T0IA 2DT8A 3UJ3X 2XIJA 1PFUA 3KEOA 3IOYA 4MWDA 1RS0A 3CSUA 5AKGA 4JLDA 1XGKA 3VVBA 5ARCA 1CJSA 3MHPA 1LQUA 1NKVA 4JYPA 4NK4A 5JRDS 4U3JA 2VCEA 2K87A 1FMFA 1XEWY 5D6OA 4GD3Q 5AKXA 5K6RA 3VKUA 3KSZO 1FF9A 1ZM9A 2O0MA 2CE7A 3KRTA 2I6TA 3JX9A 3PB3A 4I99A 4JP5A 2CVFA 3FPEA 3U3OA 4DARA 3KSDO 4G63A 1Q7EA 1OTHA 2XKJE 4A10A 4KJZA 2J3LA 5F9MA 5CPBA 2XUPA 3MMPA 5JNRA 3UQZA 1XWIA 3AESA 3TI7A 1G17A 3NPMA 4C6RA 4O63O 3A2MA 1NQXA 2I55A 2B83A 2ZPUA 3IV6A 1PT8A 2W0SA 3VC7A 3ZE2B 4EVRA 1SC9A 1G6KA 1G8PA 5I9LA 2PGLA 1TGVA 1XYGA 1Z07A 1MABB 2OZLA 4JMPA 4MKIA 3OTQA 4YJDA 4ISCA 4HB2A 4YEDA 7REQB 4MQUA 5CH5A 3K6RA 5K3BA 2BSAA 1Z73A 3WG9A 2J0QA 5E7QA 1QAOA 4O4HB 1BE0A 1KZ6A 1ZMBA 2F9FA 2D54A 3AMVA 4EUSA 2VCHA 3RSQA 3H5TA 4KWTA 3W79A 3WLAA 4Q24A 3H3XA 2H3EA 3KU4A 3EOAI 1MPXA 3JVUA 4MR8B 4TYQA 1ZW6A 3REFA 5B3KA 2ZB3A 4IJ5A 1TF5A 3QX9A 2J9ZB 1NVVR 3DDHA 3RVNA 4KN6A 1VI5A 2FWBA 1CZOA 3OJEA 1U80A 2A3NA 4QBTA 1VXRA 4EHHA 1N6LA 4B85A 3A70A 2FG7C 1TNDA 2P77A 1Q3TA 4JENA 1WIWA 1O58A 5KJCA 3TD2A 1NFQA 3BTVA 1Q1AA 3KBBA 4TRJA 5BY2A 3FNFA 4Z9XA 1WD5A 3N2EA 3RODA 5IG2A 3FNRA 4G9BA 1M2EA 1PNTA 5DRYA 4C3VA 2EHJA 5F1YA 5FFFA 1AXGA 4UDNA 5AH0A 1MJ5A 4EQ6B 4IH9A 3V42A 4MYSA 1M75A 4RVFA 4DV2B 5E6RB 3I09A 4FEEA 2BKXA 4FQ8A 4I46A 4RDIA 3ROEA 4ASUA 3RBVA 3MGAA 4OQLA 4LUCA 3ILXA 4L6IA 2FWNA 1YFJA 3E1GA 1I6LA 4JD5A 3QKWA 3IAXA 4RL4A 2J3KA 2P35A 3FA2A 3EMVA 4DT1B 1AUOA 4CG3A 3BWBA 4CKCA 3ZWWA 3TLZA 4ZARA 3SIRA 4QXQA 3UJNA 3ITKA 3UCXA 3E22A 4J29A 1NM5C 3NC0C 3IFSA 1YDWA 1E79D 3M4NA 2HI0A 3EVCA 4BPRA 2A5GA 1E3EA 2P9JA 4DIFA 1FRQA 4GAEA 2Q1UA 4DNPA 2HW8A 4XVRA 1T1SA 2I4OA 4R68A 1UOPA 5AVKA 2F62A 4H1UA 3U16A 3EVDA 3GCWA 4DMKA 3TZEA 4GZ3A 1IVNA 4ZWNA 2DWQA 5KC9A 5IYZF 3LVFO 3R20A 4DSZA 4JT9A 1SBIA 3DNMA 2AMJA 1JHOA 3DBHB 3WGGA 2ZDQA 5CLJA 2EYQA 5KTMA 4GZ6A 3ESAA 1VSQA 2JFFA 2SCUA 1IY8A 1LWOA 2E49A 2IOFK 4WDQA 3W9BA 2IU6A 2GEKA 4H7EA 4UBJA 1QHIA 4DEXA 3GPLA 3CH7A 3FROA 2XA9A 4B43A 1DQPA 3W5UA 4E12A 4Z9BA 2JD0A 3NTXA 4DPLA 2FA9A 5F73A 2DFKB 1AK2A 1PKXA 4JK3A 3VPXA 5B1YA 5IJWA 4LECA 4BMXA 1U11A 4QJ5A 1PR9A 5A4MS 3Q2IA 1T8RA 4INPA 1A9OA 2HJWA 4QTZA 1IZZA 3SFVA 1PJSA 1Z26A 3EGIA 2QMEA 2VVTA 4KXVA 3SYRA 1TGYA 5CFZA 3JD0A 3K2EA 4UTPA 1QF9A 3O2JA 4U2GA 3O3NB 2UVPB 1ZG3A 1SCNE 3LQQA 4KE8A 4JS0A 1F4VA 1I2ZA 5E3IA 4KO3S 2WIGA 4A8PA 4E70A 2I54A 4M49A 4D0SA 3JCZA 2XVMA 3BIOA 1W1UA 2DUWA 1T5OA 2QRHA 1DBPA 2Y76A 4FYYA 2PXHA 1J9ZA 1L7BA 3LU1A 4BNGA 1EWRA 4EI7A 1RWOA 4QYIA 4KFRA 2FK7A 5LMCA 4IMJB 3O2QB 2FHSA 3CS3A 3AR8A 3B7WA 1XYYA 3HKDB 1WCYA 3P9KA 5LA6F 3VPHA 3C15C 1FSPA 4KXXA 3ONVA 4LDZA 1MGPA 3DW1X 1OGIA 2ZYHA 3IOBA 4YCBA 3W2IA 1NQUA 3DTNA 4HDRB 5D51S 1MN6A 4RELA 4TV9A 4DDTA 2XVXA 4DV6B 4ZVKA 1E1CA 1C0PA 1SXHA 2ZOSA 5IM4A 4EL5A 2QUZA 5BUQA 3CB4A 1TM3E 1HG0A 4A6EA 1B1AA 2HHLA 4RYLA 5C5IA 4QYSA 3GFRA 4R3NA 1ZESA 3PQEA 2A5LA 4LJRA 1XHFA 3DL2A 2XB2A 1EJ0A 1H2YA 3ENNA 2R6CA 2IZZA 2GHTA 2P69A 5EPUA 2HU2A 4MQ6A 1E89A 3KUUA 4D3SA 2Q4EA 4X00A 2E55A 3L1UA 4BWGA 3HCFA 2QZJA 4R8VA 4REQB 1CY1A 4MKHA 5SY4A 3RE1A 4DJ5X 3GRFA 1N33B 4MWCA 4R7ZA 3MTGA 1DOZA 2MSNA 3N6VA 3OAAA 3RS8A 2UVDA 4QDTA 2D1QA 4P92A 3UJ7A 3BWDD 3RHSA 1ML3A 4ANFA 4DA4A 2PY6A 3KB1A 3PGKA 1CP2A 2HQOA 2D2XA 1V7PC 2BFDB 1WA5A 4KQIA 4LXYA 2HYDA 3L8EA 4HLQB 3TCKA 1MU0A 1N5RA 1RVV1 4TLBA 5B7NA 2YNMD 1QHSA 1VBNA 1GAQA 2W6ID 3ICPA 3MMXA 5LJLA 5JZBA 4B3RB 2EW1A 4BFZA 3D31A 4GI5A 3TNYA 2B0CA 3EBOA 4C2UA 2GASA 4HXFB 3Q7RA 1BOOA 1E2UA 3T5GA 1IHDA 2VWGA 1U99A 4HMQA 1TT7A 2FUNB 1XRNA 3HSSA 4EKEA 1PV2A 4GOLD 4M1OA 4ZTUB 1RAHA 4NJMB 1P1IA 3OJ0A 2UXBB 2PX5A 4MVJE 1DXQA 4LWZA 1LQTA 1NWHA 2DUNA 1MFPA 4YS6A 3K1ZA 4Q4JA 3CN9A 1C1XA 2HRZA 5LP1A 2H1LA 2JHGA 3ITEA 3D4BA 5ECWA 5KREA 3T5PA 2WFLB 3ROMA 1WUYA 4MRAA 3EEIA 2JFUA 4FKZA 4KXYA 1R9GA 3OBBA 4BUZA 2WB2A 4KNYA 2I29A 3WBBA 2H5IA 4B76A 4D99A 3FY4A 4LPSA 2ZRLA 2ZDHA 4YAEA 4EQZA 1LSOA 3AI3A 4JSRA 1K98A 3NEPX 1QVVA 1E5VA 3NT2A 4JL5A 1B0PA 2Z2ZA 3HDTA 4K9PA 3A1FA 4L15A 5CDUA 1ABFA 5KB3A 2FPUA 1NRXA 1VG9B 1KH2A 2O8VA 2V7XA 1C1DA 2HN9A 4BJHB 4XTCS 3A6FA 4O33A 2VUHB 2AQHA 4DB2A 4RDCA 1OF1A 3TL3A 1ULSA 5B1DA 4CFZA 4RK5A 2RHRA 5LXTA 2GXUA 1A9SA 2IF0A 4F9EA 4BQPA 3D3WB 5FKJA 5IVIA 2MT9A 2PQMA 4B7ZA 1LRLA 1YZHA 4AUMA 5FUQA 4BWYA 2RGDA 4E5DA 2YNMC 1KO8A 3I2YX 4CGZA 4MH0R 4NZMA 3E7DA 4JWKA 2D59A 1RMQA 3ROTA 2DP4E 2IYUA 1QRDA 3GT4A 4RHXA 5KSWB 1ZEMA 1FQWA 3QSGA 1X14A 1U3UA 1NGSA 2J48A 3E82A 5M3BA 4FGSA 4HAXA 4KE7A 3IUQA 3FE2A 4RZHA 1XZMA 3DPUA 3FR7A 4QT0A 3SQXA 3ROPA 1XIVA 4BBAA 2QROA 4FW8A 4LJYA 1PSZA 2Q5EA 2CXRA 4HFNA 1KI6B 1CQIA 2R00C 1X3SA 3DLHA 3OLZA 3T5MA 1XD9A 1OILA 1MR3F 4R1LA 2C59A 3K1YA 1Y7TA 2QT0A 1DMRA 4JI7B 2VP6A 2WYUA 1NT4A 3UT5B 4UATA 3HUEA 4US0R 2G28A 5D3MB 2H59A 4JBLA 1BDBA 1EXNA 3NBYC 1RMTA 2I62A 2ARKA 2QP4A 1MTOA 3RIGA 3PHBE 2Y1FA 1XDWA 1GLVA 3WA6A 4AZ3B 1ZXXA 3JALA 3JAKB 1J99A 5JV5A 1I36A 3GRAA 4RO0A 5YASA 5JSFA 4PPNA 2KLHA 3BIWA 3W5SA 4A3SA 1OVMA 3BE5A 5FTNA 2EFDB 1VA5A 2AHRA 3G23A 2DTDA 3M49A 4IGEA 4MYCA 4P1ZA 1QE3A 4IOKA 1M3SA 4JL8A 1Q84A 1ZJ4A 3AM4A 4L28A 4OCZA 2AMVA 1II9A 2W2PA 1TKRA 3GJTA 2A6PA 3ICVA 4J2HA 4MUMA 4WZAB 3HDGA 3MGGA 1IN8A 1SHKA 3QVXA 1ACLA 3SHVA 1T2FA 4L3WA 1U94A 4AVYA 3NANA 4RE6A 4XOUA 1SPXA 1L4BA 3NAQA 2IHVA 1J1IA 1VCMA 2YWFA 5H02A 3AP2A 4GKJB 3DXFA 1YRHA 4DMCA 3IH5A 3L7JA 5DBGA 1ADJA 5E4YA 4FR5A 3WB2A 1BKYA 4MGYR 3ZJVA 2GD0A 3MSXA 2QMUA 1U8AA 4CQMB 4P3YA 3WV4A 1E32A 3SY8A 3NMUF 2E18A 1JYFA 2X22A 2WLSA 3K16A 1OI2A 1JG6A 3L6UA 4ZICA 5CJ2A 3L5OA 3MOSA 2H07A 3HWRA 2IPXA 3O82A 4D97A 3AEUA 1MJHA 2Y66A 5A0FA 2WAAA 4ENWA 4ZI7A 5I7OA 1Y1TA 1X1CA 2Q49A 2QOEA 4DIMA 1DC6A 5JS2A 1P1KA 1V43A 1AO0A 1KQNA 2VOJA 2Y0BA 4JUAA 4Y2XA 4BFTA 4YR9A 1IBMB 4X1YA 3M6XA 5FBQB 3EAFA 4L5AA 4JLSA 2DQZA 2BZSA 3LGXA 4UHFA 3TM5A 4DY4A 2X1VA 3D1VA 4IEEA 4S1WA 5DM60 4MLPA 1KAHA 1FP2A 2OD9A 2OORA 4UM5A 4WFQA 2HTFA 4O5OA 1JR4A 2ZI6A 1E4EA 2LE0A 4RPLA 5A04A 3M89A 3EUEA 1MT0A 1P91A 2P2CA 1XEFA 4IIVA 2AOTB 2IYOA 3CLVA 4F8JA 3M6MD 4L2IB 4G5OA 3PJRA 3OQJA 3JATB 5IDWA 4G3XA 4OREX 4B73A 3F71A 2IEBA 1HEIA 3B3JA 2BSXA 3C0KA 3DJFA 1QP0A 1CZHA 2C84A 2C3UA 3B3FA 3RRBA 2ZB4A 4WIAA 2Z6QA 4CLXA 4KXMA 1WMSA 4JVSB 3NTRA 4Q3LA 3NEJA 3VZSA 4O25A 4G1CA 2WJHA 4EVQA 4HF7A 3KU1A 1XQ9A 2JGAA 4WLVA 3E2PA 4YUAA 1XZFA 2B5WA 1TI7A 1NXOA 1KTVA 5EY5B 3OEHD 3FTFA 1HWYA 1K7YA