1LPSA

A structural basis for the chiral preferences of lipases
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
total genus 192
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpsA00
1A88A 1R3DA 1G42A 3I1IA 3ZI7A 1QIGA 3WYDA 5FV4A 2IITA 1ZGBA 1XZMA 3WWCA 4E11A 4ZXFA 4CG3A 2OCLA 4O08A 2B4KA 3W9UA 2VATA 2RHTA 3LLCA 3I2GA 5JALA 4AMZA 3C70A 2WFLA 1UOPA 4N8SA 3TEJA 3VDXA 4QLOA 3H2IA 3G9ZA 4QDZA 2QJRA 5FKJA 1K4YA 2OGSA 1UKCA 4E46A 3O4HA 3V1LA 1MNQA 2WUGA 3G0GA 1TCBA 2X5XA 1WB6A 1MPXA 1F6WA 3VJKA 1VXRA 1RP1A 4K5QA 4QDTA 3BJMA 2PKYX 5ISMA 3TRDA 4WJLA 2QVBA 2BUAA 5AK5A 1YR2A 1FFEA 4ZV7A 3G9UA 2QM0A 2OPHA 1ZGCA 4J0HA 3G02A 1LPMA 4KACA 4ZRDA 5FDFA 4W1QA 5EIAA 3CCCA 2W6CX 3E4DA 1CUEA 3WJ1A 5ALUA 3MUNA 2HU8A 3F96A 3IDAA 2ACKA 1LPBB 1XRMA 2XLBA 1BCSA 3IUNA 4KE6A 2ACEA 1XZDA 1BE0A 3WL8A 3DQZA 3C5VA 2DQYA 2OXEA 4EY7A 4QA9A 4X7BA 1C7JA 2WIDA 5AKGA 2WUEA 3R3YA 2JGMA 1GT6A 3CN9A 1JJIA 1CPYA 5AM0A 1HKHA 1CV2A 3HEAA 5HKAA 3VKFA 3DNMA 3FCXA 4NVRA 2OAEA 3BJRA 1CIJA 3HC7A 4MQLA 3F67A 5AK3A 5HQ3A 4WDQA 2O7VA 2G4LA 3PI6A 1SC9A 5EHZA 4H18A 5ESRA 2WHQA 1BROA 4NS4A 3OURA 5IVHA 2VF2A 1CEXA 5EGNA 3ZV7A 5DNWA 3ESBA 1UXOA 1AC5A 3LIPA 4FNGA 5LYYA 1XZGA 2HA2A 4CFSA 1YS2X 4J0JA 5T4FA 3WWEA 4I4CA 4V2IA 2QUAA 3OTQA 5CT4A 4X90A 2VQ6A 4UBIA 1GPNA 3FLBA 1G66A 5CT8A 3RM3A 1N5MA 4C87A 4KEAA 3H0CA 4W9RA 2ZSIA 4H7DA 1ZJ4A 2HRRA 1BN7A 4I3FA 5LZ2A 1A7UA 5ALNA 1GPKA 2Z5GA 3HZOA 4GECA 4BVJA 4PSCA 2DR0A 1EDEA 2OCIA 4Y2RA 3M3DA 3GELA 2CEKA 5C7YA 3R0VA 2JIDA 5CT9A 3NOXA 4FKBA 1VKHA 5ALJA 4HRYA 2Y6VA 4TGLA 4MYSA 5DYYA 3B3QA 3A2LA 1DX4A 1ZD5A 2WIGA 2XMSA 1TCCA 1Q0ZA 4IHAA 1DWOA 4G9GA 1HL7A 4BVLA 3KOOA 3I2HA 1EK1A 3VVMA 2R8BA 2PU7A 5AK4A 3MVEA 4GXNA 1E66A 4E15A 5ALMA 1RYYA 4GDMA 2WIKA 3EQ7A 3CCBA 5ALRA 3ZLTA 4IH9A 5AM2A 4ZGBA 1SCIA 4C4YA 1EB9A 2PSJA 5JZBA 3ICWA 4A5SA 5DJ5A 4KAAA 1EDBA 1CUJA 1CUWA 1AURA 2ORYA 3DD5A 1VA5A 2WUFA 3W06A 4UHHA 1S8OA 3V1MA 2PSDA 2OGZA 1ZJ5A 3CXUA 1W6RA 3PE6A 3ANSA 2CMFA 5K5EA 2BCEA 1UFOA 4OPMA 4X6XA 3VISA 4OYYA 1FSSA 4B7ZA 4QWMA 5ALSA 5E2IA 4Y2YA 4GEGA 3I2IA 3H2GA 2PM8A 2WFLB 2QXUA 1HPLA 4AN1A 3WK6A 1U65A 4LIPD 2DQZA 5AI9A 5IH7A 3ILSA 5KREA 3IB3A 4X97A 1XFDA 3BF7A 2WTMA 1WHTA 1DWPA 2AJCA 1TQHA 1ZIXA 4DNPA 3WLAA 2ZJ6A 3G8YA 5AKYA 4MYDA 4JUIA 2VT6A 3C6XA 2C7BA 4BE9A 3ZPXA 4C89A 4UBLA 5I7UA 3C8DA 1AZWA 1MT3A 1H2ZA 1T4MA 2JGKA 3LCRA 4BAGA 1RWQA 2D5LA 1JT2A 4MEAA 4UHEA 4JH0A 5ALIA 4DMFA 3R3UA 1MO2A 4X92A 2EEPA 2QS9A 4BDTA 4H7KA 4X94A 4AMYA 5HZGA 2WU4A 1MX1A 3QPCA 4Y2VA 3ED1A 4Q3KA 1QJ4A 2Q0XA 2FJ0A 4B81A 1L7QA 3AILA 4Y2QA 1LZLA 5AM1A 4C6HA 2C0PA 3H2HA 4X91A 3WQHA 4INZA 1XZIA 1PFQA 1QTRA 1CVLA 3CN7A 1B6GA 5DNUA 1UZAA 3BIWA 2WIFA 1TCAA 3IUQA 4Q3LA 2XI4A 2OGTA 1XZJA 2WG1A 4B0OA 4KAJA 3G9XA 3WKCA 3I2FA 5AM3A 1XQXA 1XQWA 2J3QA 3YASA 4GI1A 5LZ5A 1ZICA 3SK0A 1QZ3A 3QMVA 3D4LA 4KRXA 1VJ5A 3R40A 3KDAA 5DYWA 1R9MA 3R3WA 2GBIA 2HA5A 1H22A 5D3KA 3ANTA 1A8QA 5JZSA 4Y2JA 2YYSA 4PQEA 4P08A 4AO7A 1ODCA 1P0QA 1EVQA 2XUQA 1LGYA 5LZ8A 3H04A 4RNCA 5AKJA 4H77A 4K6KA 1WB5A 2ZYSA 1QIJA 1LBSA 5A62A 3BIXA 1AGYA 2QR5A 3FBWA 4H7HA 3AJAA 1KEZA 2I03A 1YA4A 1YS1X 3R41A 4UFNA 1EA5A 2XMGA 3HJUA 4EZIA 4B9AA 5AP9A 1J06A 3QPDA 4QNNA 4DYHA 3IVMA 3MUOA 2HRQA 4CCYB 3WL6A 1H23A 4QLAA 3U0VA 1N1MA 4U2CA 4N8DA 4YPVA 1VOTA 4PV7A 4OD0A 2VAXA 3WK5A 1CLEA 2XMDA 5CH3A 3IIIA 5HF6A 3R3XA 1HDEA 1K63A 3WYNA 1HLGA 1PJAA 3WJ2A 1AUOA 2XLCA 2O7RA 2BUBA 4BE4A 3FNBA 3PDCA 3STUA 2XQKA 2J3DA 3VVLA 1EVEA 2I3ZA 2DHEA 3H1BA 1ZD2P 1EHYA 5LIPA 1IZ7A 3Q0TA 4WFIA 5ALLA 2XUDA 1CR6A 2OLEA 1UT6A 2WILA 4ARBA 2WUDA 4NZZA 1CUXA 3D2AA 4Y9SA 3K2IA 3WKBA 3KSRA 5E4YA 2FUKA 5HK9A 3WMRA 4CG1A 3IURA 4CIAA 1DT5A 3DL4A 2GYUA 1FFCA 2AJDA 4B85A 1THTA 1YAJA 1ISPA 3AIOA 5CXUA 2Z3ZA 4WY8A 4BP9A 1HBJA 2DFPA 1WHSA 1LPPA 4U2FA 2HFKA 4K6HA 4OB6A 4BZZA 5KBYA 1CUGA 3N0TA 2VJBA 4MJ3A 2XMZA 3BXPA 4B6GA 4F21A 3GA7A 3EQ8A 3WIBA 2AJBA 4B9EA 1DTEA 4X6UA 1GZ7A 5CMLA 4DSAA 2VAVA 2OQIA 1WPRA 1W75A 4KE7A 2QJWA 2EDCA 2PL5A 1W76A 4GW3A 3SX4A 4XVCA 1WCYA 1JKMA 1CQWA 3WK4A 5EHXA 1XZHA 1J07A 2J4FA 5LZ7A 3O4JA 1XKLA 3FWHA 1J2EA 2XQIA 4H35A 2ZVDA 2XUGA 1WPXA 3D7RA 4HXFB 2WLSA 1QIDA 1SCKA 5HCUA 4B0PA 5ALVA 1XZBA 2XT0A 5DYTA 4HRXA 5FRDA 2WHPB 3QPAA 1W52X 1R1DA 2VT7A 4QDUA 3D2CA 1BS9A 1FFBA 4IH4A 2WTNA 3C43A 4EY6A 5ALZA 1R4ZA 3GFFA 4FWBA 2VA9A 1Q0RA 5A7GA 5EHQA 1A8SA 2XMQA 4FOLA 3WL5A 2XUJA 4BZWA 1F0PA 4EA6A 1DQYA 3FYUC 5AKKA 2JEYA 3G0CA 3PF8A 2H9YA 4PSDA 3QVMA 1IUNA 5JYCA 2PPLA 3HRHA 1QIFA 2PX6A 4P93A 3AZOA 3HYSA 4L72A 4M0MA 4WCVA 3V1NA 1XRQA 1CUIA 5I9IA 2NW6A 2HA4A 4C4ZA 3I28A 3PFBA 2HIHA 1XQVA 1U8EA 3HI4A 3EBLA 5AI4A 1LBTA 2JGEA 2WHRA 3V48A 5BWBA 3FVRA 2WQZA 3O9VA 1XZLA 3UUEA 5A7FA 1TKRA 5AOAA 2PSHA 3X3HA 2ZYIA 4B82A 4GWLA 4W63A 3BWXA 2VJCA 3I6YA 3WA6A 4X6YA 4NMWA 3RLIA 4MQMA 3ESDA 4DSZA 4H7EA 4DMKA 1YB7A 1CUFA 3Q8WA 3FLAA 2QRUA 2C0QA 1JU3A 4OB7A 1IVYA 5ALEA 3G0BA 1ACLA 4FNMA 4FMPA 1ACJA 4EY8A 5AHXA 3IA2A 1DINA 4QDOA 4PNZA 4HVTA 4CCYA 3JW8A 1CUUA 5CBKA 4HAIA 5CT6A 4HS9A 1GPLA 1JJBA 2GYWA 4Q34A 4BC0A 1DX6A 3HLKA 4XIIA 5ALPA 1TIBA 2QZPA 1EK2A 3WWOA 4BDSA 1I6WA 4TPKA 4QZVA 2RHWA 3EIOA 4IH1A 2GBCA 5D3ZA 2GYVA 2YXPX 4ARAA 4YK7A 2PSEA 2HDWA 4Q05A 2HHAA 4UHCA 2PBLA 1ODSA 3ESCA 3WI7A 1LPOA 5HFNA 3DS8A 2RONA 3D0KA 4P92A 4DM7A 3FLEA 3DYVA 5EIEA 4GLBA 1QIEA 7YASA 1EDDA 4N5HX 1NU8A 1IUOA 2ES4A 2VSQA 1DWQA 4AX4A 1QLWA 4BAUA 2Y2UA 3M83A 4JEIA 1SCQA 4CG2A 1GKLA 4Y7DA 1MJ5A 5DTJA 4B80A 4KE9A 4U2BA 4DIUA 5ALDA 1MX9A 2RGUA 2BUCA 1WB4A 3JYHA 1LNSA 2YASA 3WK8A 5IVIA 5C8XA 1X2EA 2QOEA 1U4NA 4UHFA 1OCEA 1QFMA 1P0MA 1Y37A 4RE6A 3C6BA 4FBMA 5AKIA 3IUMA 4XX1A 1TRHA 3W2TA 3AIKA 1SFRA 5AI8A 5JAHA 5FXMA 2XMBA 5CTAA 4UBNA 5K3AA 4MEBA 3TGLA 3H2KA 4EBBA 5AKEA 2HU7A 4BAZA 5IKXA 1BRTA 5CT5A 1TK3A 1OXMA 1QIMA 1XRPA 3AFIA 1P0PA 4BCCA 5LKAA 2BAGA 3NUZA 1ZD3A 3V9AA 2H1IA 3I6ZA 2WHPA 5HF8A 2AXEA 2B61A 1TAHA 4J0GA 2WJ3A 3R3VA 2R11A 2C4HA 2C5GA 3RARA 5A6VA 3DCNA 3O0DA 2AJLI 4J0CA 3NGMA 3WKAA 1KU6A 4YX9A 3C45A 5DTIA 5JASA 3STWA 1XZKA 1THGA 3C6ZA 4B84A 3W04A 4XWGA 4Y2PA 4H7IA 2BGRA 2PUHA 5A2GA 1CQZA 4Z49A 3C87A 3E0XA 2XUIA 3WZLA 2XDWA 3FOBA 2H7CA 4PF1A 1R50A 3OC0A 5ALQA 4OCZA 2WJ6A 3GROA 1VA4A 1Q84A 4UHBA 2DHCA 2RI6A 1YA8A 3WIOA 1N5RA 3DKRA 2XB6A 2QT9A 2QXTA 5A71A 5JADA 2OG1A 1VXOA 1IMJA 1QIHA 4AZ3A 2XUAA 5LLSA 2WG2A 1E8MA 2Z8ZA 2HADA 4N5IX 1XLUA 3FSGD 5EIHA 4FTWA 3KWJA 4AQDA 3QM1A 1EB8A 1UKBA 2WU3A 1JMYA 5AOBA 4ZWNA 4W1SA 1VLQA 4KYVA 4CCWA 1H2YA 1UK7A 3O9MA 4QWWA 1MN6A 1ZI8A 3DEAA 3KD2A 2HA6A 1K8QA 4UBKA 1UK6A 4U2DA 1QTIA 3DDUA 5SYMA 2HU5A 3ZLUA 4G8BA 2JGJA 3HACA 4KE8A 3RKSA 3AINA 5AK6A 4BRZA 2XUKA 2JF0A 4JNCA 3QMWA 5AH0A 1GXSA 2ONCA 2OCGA 3FAKA 2O2GA 4FFWA 4FLMA 3GZJA 4J0IA 1O6GA 5ALOA 3D5EA 2C5FA 3E3AA 2HL6A 3B12A 3WWPA 3G0IA 4EB0A 2EDAA 4G9EA 3OOSA 3U1TA 1AQLA 1QFSA 1XROA 2CUTA 4MXDA 5EI5A 3KWFA 4AN0A 1XRRA 1CFJA 1VE6A 4F60A 1JMKC 4FBLA 3H2JA 3PUIA 2UZ0A 2B20A 5C8VA 1AKNA 5AI0A 1C7IA 3H1AA 4BCDA 1ODTC 1Y7IA 1H2WA 4WFJA 1L7AA 2QUBA 1LPNA 2X8BA 1JU4A 5FUMA 1JFRA 2PSFA 5AKZA 1DQZA 6YASA 2RAUA 2JGLA 5JIBA 2WJ4A 4A23A 1FFDA 4XJVA 2J4CA 3LP5A 4X3CA 3LIIA 1ETHA 4LYEA 3T4UA 4EY4A 1DT3A 3BDIA 1CUSA 1CUCA 2H7YA 4FLEA 4B83A 4X93A 4Q3OA 4HXGA 2AJ8A 3A6ZA 3O4GA 5T4EA 2Z8XA 5AI6A 5K3FB 3WL7A 3WK7A 2VTVA 5K3CA 2HA3A 3A2NA 2JBWA 1MU0A 4HZGA 5BWCA 4AZ0A 5SYNA 2V97A 2VJDA 5JD4A 1CUZA 3ZWQA 1E8NA 3DYIA 1AMNA 4M0FA 4C01A 5ALHA 2G63A 3DKKA 4F5ZA 4PW0A 5LZ4A 5ALWA 4HTAA 5JD5A 1LPSA 3AUKA 3PICA 2HA7A 3AZPA 4J7AA 1XKTA 5JD6A 3C5WP 3BL8A 1E8DA 5FP0A 4LKOA 3N2ZB 1ZIYA 4JYMA 4DNQA 3FSGA 1CUVA 4H0CA 4G8DA 1MAAA 1GQSA 4K2AA 1CRLA 1QIKA 5KWJA 3GBSA 1EXWA 3QBJA 1USWA 1XLWA 1ZI6A 4EY5A 5K3EA 5BOVA 1XRLA 5CRIA 3ESAA 3K9BA 4N8EA 4MWSA 1F8UA 5JAPA 3WA7A 4RE5A 3FVTA 5JANA 3H18A 5FPPA 5LP1A 2CKMA 1QIIA 3A70A 4UUQA 3DLTA 1ORVA 2ROQA 3VJLA 5D6OA 3O95A 4ITVA 5HFAA 5K3DA 4BC1A 2K2QB 5C81A 1QO7A 4QEKA 2V98A 3H19A 2XUHA 2JGIA 2CZQA 2QKYA 3QH4A 2HA0A 5JZ9A 4OU4A 1ZD4A 5CURA 3SWWA 4Q82A 3C6YA 4J03A 1Z68A 1XRNA 4X95A 1ZOIA 3WK9A 5AM5A 1PV1A 1QO9A 5JAOA 5AIBA 1E3QA 2XUPA 3P2MA 2BGNA 1GQRA 2Y2VA 3QZUA 4G4GA 2DHDA 3HXKA 3EQ9A 3UUFA 4BVKA 3LS2A 2ZJ7A 2Z3WA 1XLVA 1UK8A 1UK9A 1QOZA 5EFZA 1UKAA 4BRSA 3STXA 1C4XA 1EX9A 2WIJA 3QITA 4BTVA 3A2MA 5ALFA 2LIPA 2O2IA 4UBJA 2GBFA 3DJYA 5AICA 2GZRA 4ZREA 4DNFA 4I19A 4UBOA 4Y2XA 2HM7A 3WZMA 5HF5A 1VZ3A 2YH2A 2Y6UA 2I3DA 2ZYHA 5ALGA 1A8UA 4K6GA 5AIAA 1Y7HA 1BEZA 3I2KA 1DU4A 4KRYA 2FX5A 4OUKX 5FPQA 1CUYA 3O4IA 1K6EA 1JI3A 4Y2TA 4L3WA 2XQFA 5AI5A 4FDMA 1K5PA 4J0KA 4M0EA 5JARA 4LXGA 3GUUA 5K3BA 5J3JA 2P8SA 1XQYA 3BE8A 1O6FA 3FYUB 4W1PA 1BN6A 1CUDA 5KWIA 3L1JA 3D59A 4G1FA 3WKDA 3TJMA 3T52A 2WFMA 4FFVA 4GHWA 1LLFA 3F9CA 4H7JA 1IUPA 4IQ4A 5DNVA 1E89A 2PU5A 1CUAA 4UHDA 3DOIA 3MGAA 1MAHA 1MTZA 2Y1KA 5FOQA 5I8PA 1CUHA 2B9VA 2O2HA 4KJXA 4BBZA 5A7HA 2CJPA 1MX5A 4KAFA 5AKHA 4YASA 2WKWA 5DLPA 3G7NA 1R88A 4J0DA 1ORWA 1X2BA 3M81A 4X71A 5AOCA 1BEEA 4U2GA 2GZSA 3HABA 5HKBA 2VJAA 5D7BA 2V96A 1YCDA 5H3HA 3F8SA 5E4TA 2PVSA 1G5FA 3IULA 1OILA 2D0DA 3QMMA 4X85A 5AKXA 1FJ2A 1YSCA 2QTBA 2ZYRA 1YAHA 3L1IA 1T2NA 1E5TA 4BP8A 2BJHA 1BU8A 1FFAA 4LXHA 5K3FA 3R3ZA 3W05A 1N8SA 1QONA 4FLFA 4S0XA 5CH8A 1ZI9A 4Y2SA 4UPDA 4E14A 1HQDA 1YASA 3RK4A 2XMRA 2V9ZA 5BV7A 1XZCA 1R9NA 2IX9A 4BB0A 2WFZA 5FLKA 4Q1VA 2PUJA 4EHBA 2JGFA 3DL7A 3WWDA 4KR0A 1XZAA 4OU5A 5LZ9A 2XMCA 1VZ2A 4P9NA 4ZI5A 1J1IA 4FHZA 4RPCA 4L9AA 5F4ZA 2XUOA 5T4BA 4GBGA 4OSEA 4BATA 5T4HA 3PFCA 4CI9A 3I6MA 3VJMA 1WM1A 5E4JA 2H7XA 1H2XA 1KU0A 3KXPA 3C8HA 3I1YA 3S8YA 2WM2A 4OYLA 3AIMA 4A16A 3STTA 2GBGA 4PSUA 1NU6A 5JAUA 2JEZA 2OCKA 1Q83A 5AJHA 5IVDA 2C58A 4G4IA 4BTLA 5JATA 1GKKA 1UOOA 4F0JA 1XZFA 2QMQA 4Y2UA 2ZJFA 4PO3X 4ETWA 1MNAA 4WY5A 5DWDA 4C4XA 5CXXA 4RGYA 5C8ZA 5EHNA 1P0IA 1G4HA 5HF9A 5HQ3B 3DOHA 1BCRA 2VEOA 2OQVA 3S2ZA 1EINA 4X00A 3G9TA 1IZ8A 2XQGA 5ALYA 2WG0A 2I78A 4QDXA 1SOMA 3AZQA 4LXIA 3ICVA 3D3NA 5LKRA 1QGED 4AO8A 4G8CA 4WDRA 4G4JA 3QYJA 5AM4A 5HK8A 3FCYA 3OPMA 4ROTA 2RIPA 3B5EA 2G5PA 3PUHA 3JWEA 4L0CA 3V1KA 4W1RA 1NX9A 1EI9A 1EH5A 1F0NA 4AXBA 4BCBA 4H7FA 4OB8A 4MWTA 4TVKA 4QE3A 1X70A 2DCMA 2FJPA 5IVKA 2ZSHA 3D2BA 1YB6A 1LPAB 3IBTA 1UOQA 3L1HA 3VXKA 3FYTA 1GGVA 1QE3A 2OAGA 2XE4A 4AB1A 1WOMA 2BFNA 4DMHA 4LYDA 3I2JA 3M82A 3PF9A 4UFPA 3IUJA 4UFOA 2XUFA 1JJFA 4ZV9A 3STVA 1W1IA 3EF3A 4DTCA 4U2EA 5CH5A 3E1GA 1W4LA 2CBGA 3NWOA 2WSLA 5ALTA 3ZLVA 2HFJA 4DLNA 3STYA 3BDVA 3OM8A 4BYMA 2IIVA 3BF8A 2XQJA 1UWCA 4LHEA 2G5TA 4G5XA 5CW2A 3HSSA 4CIBA 4AO6A 1LZKA 1AX9A 4IO0A 3FYUA 4DGQA 4EUSA 3OG9A 1M33A 4HXEB 2DSNA 4UBMA 3UMJA 3H17A 4DNOA 4WFKA 2E3JA 4J3JA 1L7RA 5AO9A 2BKLA 1D07A 4D9JA 3F98A 5AKLA 2CB9A 5ALKA 3W9BA 3G0DA 4DMCA 2X76A 2W22A 2ECFA 3K6KA 4JYPA 1CUBA 1B41A 5ALXA 4C88A 3WKEA 1U2EA 5YASA 3SC2A 1VE7A 3F97A 1XZEA
chains in the Genus database with same CATH superfamily
1A88A 3HP7A 3ZJTA 1ZA1A 1LDYA 121PA 1C3OA 1HSZA 3F2VA 4UUPA 4AF8A 5EWLB 4D5EA 1XEXA 1JE1A 3AF6A 1D1PA 5L51A 4KXLA 3JQCA 4DY6A 3F5SA 3WYAA 4WVLA 2X9QA 4QBHA 3BCHA 1RWBA 1KWKA 1DEXA 2VBGA 4ZEVA 4GMGA 4HGQA 3IO3A 4RJIA 5C0OE 3L0CA 4JUCA 4G0VA 4DEVA 1NX6A 3RVJA 3GV0A 1FLAA 2MU1A 2ISQA 1ECLA 2SCUA 3OZDA 2AI1A 4O08A 3A4LA 3WIEA 3TECE 1EFKA 3N2KA 1S9HA 4BO7A 1BDIA 5E7IA 4QELA 1KJNA 2QGZA 1ONBA 2IUYA 2LDBA 2VG8A 3UW1A 4A0RA 3MN1A 4NDNE 1DMSA 3G1TA 2WFLA 1GGNA 4HDAA 4KW7A 2I2CA 3FHJA 1KH1A 2H5EA 2ADMA 2CF6A 3QBDA 3IUYA 5DGIA 2DFDA 4W8OA 4BFYA 1TTTA 2PS0A 4QDZA 1XI2A 2PL3A 2QJRA 1NP7A 4C20A 2A59A 4WBXC 5F33A 4CNBA 1Y7PA 5FFNA 2NTYC 1UXKA 1O9HA 2YINC 4KQJA 5CBPA 4Q93A 5EE1A 4JI5B 3W34A 1RFGE 3AHHA 1MNQA 3DE3X 1KEKA 2XVYA 1E3WA 4V39A 2BLLA 4D8WA 4MB2A 4E7PA 1ZR4A 1SXJA 1TCBA 1QRDA 4JIMA 3AQ4A 4J2HA 2F64A 3J81A 2P6OA 5IF3A 3BT7A 2Q5OA 3NNDA 4CTKA 2NU6B 1GILA 4IJKA 4P0QB 1D1QA 4YACA 2OHVA 1B0AA 1FEZA 1OTXA 2WWHA 4ND2A 2QAGC 2P5TB 1RLUA 4QDTA 1IHYA 3WRVA 3BJMA 3MBKA 3NQ41 4AUEA 2ATEA 2RGGA 3DMPA 3OKFA 3QG5A 1C2TA 4IWYA 3JYOA 3TRDA 4ETIA 2BUAA 2V7QD 4XGKA 1FFSA 1UZMA 1WDMA 2JNWA 2ZTLA 2P27A 3NJ4A 3OWHA 3IPLA 1CXZA 1FFEA 4ER7A 5ICEA 4YONB 4ZV7A 1FW6A 5E6UA 1W44A 1OQAA 4E08A 4H08A 3RRZA 3CNQS 5DXFA 1OLSA 4CLRB 2QE7D 3WLEA 4FW8A 1W5AA 2NUTA 4L8GA 2OPHA 4R7TA 3EGXB 4GQAA 4YGXB 4BBJA 5LN1A 1QFJA 3HA7A 4Y6SA 3HVRA 1M5TA 2RE8A 3LC1O 1P72A 2WWVD 1YVDA 4GC5A 4BNLA 4EI8A 2Q3LA 4ZRDA 1ESMA 3EZLA 1OSNA 4YJFB 3KUDA 4EG7A 3ETGA 1U9JA 3HI6A 4W1QA 4C0XA 3N2LA 3NTOA 1IEVA 2YIMA 4HADA 1ZH8A 2YJTD 3TE6A 4CM8B 5BQFA 3MMXA 3NIWA 2XBMA 4ZO6A 2J9FB 3KLPX 1JKIA 4LRSB 1TO1E 4YRJA 1Y33E 5I9LA 1Z17A 3KZOA 2J7KA 5ALUA 1PE0A 2M6SA 4X1YB 4G0ZA 1OD6A 1MG5A 2HU8A 2ZITA 3F96A 3OPYA 3PXUA 5EZQA 4P0PB 1J33A 1RRVA 4YA6A 1DOZA 4URUR 4GQIA 2ACKA 4GBJA 4IJ5A 3FG9A 4M1SA 2CNWA 1UKEA 3D8BA 3KQWA 3I37X 3ZY4A 3WLMA 1X1CA 4FFPA 3SIPA 4EA7A 4Z4HA 1OYYA 2ZRFA 5J2TB 1MAVA 1BH6A 1XL0A 1MRSA 5G0VA 2B5VA 3U7IA 4E4RA 1I30A 4ZCLA 3HS3A 2J5KA 3K2EA 2W6NA 1NXXA 2PGJA 3EIFA 3WL8A 4LQ4A 3MUEA 5G4KA 4OJMX 3BMQA 1SAYA 3EA4A 4NBTA 2OMKA 1I4EB 4KPYA 2FZ4A 2LPMA 3Q11A 4QPZA 4QA9A 1FVXA 1LNQA 2YMQA 5AKGA 1PFUA 1EDOA 2WUEA 3M4JA 3DEHA 1G9XA 4NCAA 2GTIA 1GIAA 4MVJA 4BVAA 4L6AA 1Y9JA 1QVZA 2JI4A 2Q7OE 4GLJA 2H92A 2ZJAA 1E6WA 5HKAA 4OGWA 2BF4A 4PO8A 1VJ1A 2PSSA 1XALA 4EVIA 2NX2A 2OAEA 2WMOB 4QJBA 3H9GA 3HTXA 2J31A 4EGJA 1WTCA 1WXXA 2E6KA 2ORIA 4Q3BA 1HYEA 1N2XA 3F67A 3DEKA 4MS3A 3MAGA 5HQ3A 5JWOA 3TW0A 2Z1MA 1SC9A 2VJMA 1QTQA 1E3DA 1FLDA 1G5QA 2P5YA 1JFVA 3OT1A 2X1HA 1ZQ1A 2J9RA 2JIBA 2WM8A 5ESRA 3W5UA 1BROA 3NAMA 2XKKA 2X1LA 3GK3A 4C7JA 4NS4A 4K9QA 3B13B 3T3NA 1IK4A 3T1NA 2WPNA 3RJZA 1DS6A 5GY7A 4HYTA 2P79A 3LU1A 2VC2B 1FPQA 3ESBA 3PGVA 1AC5A 3LIPA 4PLYA 2VF5X 1PT6A 1LH0A 4Q3AA 1BQEA 3FZGA 3EUEA 2I4LA 4JUFA 2V4UA 1F1JA 1TM3E 4U39A 3AB8A 2Q28A 1E9SA 2V7UA 3BYZA 1FXUA 2PTHA 3F3MA 2X13A 4MLCA 3N39C 4WKCA 4FQ5A 4KQIA 2YJNA 1M2OA 2FTKE 3CEJA 4FXPA 1XCOA 2OCDA 3M1AA 3DZHA 1GM5A 3IQDB 5JNUA 4EHFA 2ZYUX 2HNAA 2O19A 2WWWA 2Q5QA 3RJ9A 3R09A 4URHA 1FMCA 1N3BA 5CT4A 3CVOA 4YP6A 3K0AB 4Z1MD 3SZGA 2VQ6A 3HXTA 4UXIA 3K0CC 2ERYA 5LDHA 3FLBA 1G66A 3NC4A 4RZSA 5CT8A 4EBFA 1Z5UA 1N5MA 2JCBA 4DSTA 2OHXA 3H0CA 2OD7A 2ZSIA 3ETDA 3ANNA 4Q66C 4LX0A 1V2HE 3GEMA 2HRRA 2E82A 2I4MA 4AWAA 4CQLA 5HTOA 1BN7A 3HL0A 2IXGA 4I3FA 4PZZA 2XGSA 4G8JA 1X7XB 3NC0C 1A7UA 2H1FA 1OWMA 2Z5GA 3HZOA 4GECA 5ALNA 4B73A 1XPOA 4FN4A 1HTWA 1WW8A 4D98A 2LVBA 4NBVA 3L8YA 3OFVA 3QPBA 5EJ7A 1Q0PA 1P5HA 4EL0A 3ZU5A 4DC1A 3L5KA 4II2A 2MHCA 2EZUA 1EUDB 4KFUA 1I7NA 1V1MA 4H60A 3UN1A 2ZIXB 2IP1A 3WRXC 4R0NA 5K0FA 3GRCA 1CFZA 1M2HA 4JKIA 3RUIA 3PC4A 4FKBA 4HB0A 4ZQEA 3GZNA 2KPOA 1FTQA 1BAPA 1RXYA 1OBVA 1VKHA 2DPHA 2IQIA 3B3GA 4GL4A 4TQUS 1RI4A 3PEUA 2X8AA 4TGLA 3RO7A 2CJWA 1I24A 2PA3A 3EXEB 4GZLA 4DN6A 1G7TA 2VXYA 4PVDA 3QLJA 4HYYA 4M1EA 3RHZA 3WGOA 2R5WA 5LL6P 1ZD5A 3KTAB 1LJ8A 4TSFA 4B79A 2IPXA 3BWEA 1MORA 1X77A 3AB3A 4K6CA 4DNXA 2F00A 1TFRA 2QRMA 4OJTA 4QIHA 3M6LA 4C0KA 3O4RA 3UG7A 3RUPA 4G9GA 4INOA 4AECA 1SCJA 4BVLA 1Q1QA 2DWCA 2WM9B 1QBGA 3GFBA 4YRCA 2R6FA 1LW7A 5INTA 2GPBA 2FMUA 2HCJB 2WD7A 1NLMA 4MW5A 3T15A 4BVFA 4HNGA 3G9QA 2QXYA 1WKCA 4FCTA 4I2NA 4JK3A 3SQMA 5CNMA 2W43A 4FCCA 4PX3A 4MHOA 4YYEA 2PRIA 2QE6A 2J32A 2WWFA 2J8ZA 3NIFB 4E15A 1ZXBA 2IYQA 5FWAA 3F6YA 5BV2P 1RYYA 2P9ZA 3OFNA 4GMKA 3CCBA 2TMKA 3F3KA 1TO6A 3WHLA 4EB6B 4CM5A 4BX2A 1XEFA 1AUVA 4LMPA 5A4DA 2JKYA 1YRHA 4FYKA 2ECPA 3LH5A 3PENA 4IH9A 4HDNA 4LE2A 3L8GA 3X1MA 2V59A 4IIJA 4QC2A 5FFFA 5CVVA 1GVHA 5BR8B 3ASVA 1EB9A 1NW5A 2PSJA 5JZBA 2REOA 3O8QA 1H4VB 3P9PA 3L41A 4WEOA 3DH0A 4MS1B 1R5OA 1SUEA 1DRUA 2P6RA 5AQ1A 1Q2XA 4IGFA 1BQ3A 2IYZA 2P6NA 4FZJA 4RLFA 1KPHA 4OP3A 4UZEA 2WDPA 3BE5A 3M70A 2FSFA 4JD5A 4XVQA 4RIFA 2HK6A 1V25A 3FSJX 4UHHA 3V4SA 1X86B 4INPA 1PJQA 2PSDA 1R8QA 2Y1EA 1NF9A 1J99A 1TJ5A 3EUFA 5LBTA 5J1TB 5DPMA 3CNLA 1OPRA 2Y4OA 3JARA 4EKEA 2CXQA 2Q4DA 4M1TA 2XNDD 5B2ZA 4PWYA 3TQHA 1TQ2A 1I2BA 1UM9B 4R8RA 3QW4B 1ONOA 1UFOA 1MF7A 1U8TA 4RY0A 4OYYA 3OIWA 1RLIA 2YZNA 8ATCA 4AY2A 4KC0A 4LJYA 3UA3A 4EUKA 3LNTA 3LUAA 4D79A 1T5IA 4MQ6A 1EDZA 4XYMA 4MARA 5KDDA 3H2GA 4R1LA 1E1QD 3CPSA 3RRYA 5BV8A 1XMQB 4YCAA 1JZSA 5IHXA 3BUSA 4IGEA 2C57A 5ESDA 4PHHA 1U65A 4LIPD 1C14A 3T99A 4KO1S 4LJAA 2DY1A 2DQZA 2ZDGA 1P1KA 4BO0A 5E1MA 1CY6A 2C95A 5T57A 2QMOA 3ILSA 4YRNA 5GTDA 3RU2A 5KREA 3IB3A 2K7FA 4RZQA 5DTRA 1XFDA 2IQ5A 1NNUA 1OZAA 2WAYA 1WHTA 4ARVA 4E88A 4FFLA 3JASB 3IMEA 2H5LA 4F1KA 3R3JA 2AJCA 1ZD1A 2UVPB 4DNPA 1QHFA 1ZUIA 4IRXA 1Z5PA 4M60A 4MRPA 3WLAA 4AJKA 5KNBD 1E7QA 3P1JA 4ZEOA 2F8TA 3RWOA 1V8DA 3QYPA 2VT6A 3I04A 5GZ1A 3ROXA 4ZTUB 1AZTA 5DB4A 1UDXA 1SJ9A 3IDFA 4YALA 1WY7A 4YRPA 3ZXYA 4C89A 4YMGA 5I7UA 3A6PC 1OX4A 2WI8A 3C8DA 2OQRA 1AZWA 1GWNA 1ONPA 2QU8A 3OD1A 1MT3A 4J0EA 4MP3A 4UCFA 3CVUA 1JN0A 3KJEA 3KM0A 4NBRA 3LVFO 3A1FA 1NXVA 1P4GA 3PFIA 1I36A 1NUSA 2QRJA 4CV3A 1ADGA 4CHTA 2FOIA 3LCRA 3TVDA 4CJXA 3RRBA 1H8HD 3OFSA 4KUEA 1ULSA 1LKZA 3G0HA 3O84A 4JH0A 1HDIA 1IZ0A 4H1VA 1UF9A 1TAGA 4M38A 4UM8B 1SKQA 3UWSA 2PX4A 4RH3A 3QVOA 1BJTA 4RYDA 2QS9A 3D6TB 3ON5A 3RC3A 1U0FA 5A4FS 5LU8A 3VPDA 3NI2A 4EGCB 5I51A 4BDTA 4CDNA 1EYZA 1P1CA 2VQDA 4H7KA 3SBDA 3WNVA 1UJBA 2CL6X 3PWTA 1WXFA 2CHEA 3BORA 3R74A 3THXB 1ECGA 5HZGA 2WU4A 3T3OA 3M5DA 5HFAA 1RPTA 3E7WA 3ED1A 4L8VA 1DC6A 5H68A 9LDTA 3CTPA 4Q3KA 4J1SA 5BN5B 5C1BA 2BFWA 2C42A 2YJ3A 1VCIA 4B8WA 4EO9A 4K9LA 2YJ5A 2Q41A 4GMHA 1JYSA 3O1HB 1FIUA 1RJ9A 1Y4ZA 5IVPA 2CC2A 1UPXA 3GGPA 1LZLA 1J0XO 3LYAA 4FW9A 2FSHA 3ZWPA 4DLSA 2CE7A 5AM1A 4XM2A 1JQKA 2C0PA 3H2HA 4D45A 1H4TA 1RVDA 3RIEA 4XUDA 4F46A 2X2OA 3CRZA 3RHFA 4EX7A 4XSGA 1NY6A 4UOEA 2ASVA 5CU7A 2ZJYA 3H97A 4U2KA 1PFQA 4D4IA 1MRNA 2VZEA 3O8NA 4UDOA 5A4MS 2A5GA 3IAM6 4K3VA 3RYIA 4IZIA 3JQ9C 2BL4A 1PBTA 4BNDB 2IBMA 4YMVA 2A4KA 5FFMA 1GCAA 1PTJC 3IS3A 1P7VA 1PT8A 4IG4A 4EFNA 2IYVA 3HXLA 2QMZA 1LDGA 1SVUA 3CGWA 4R7GA 5FR1A 2A1UA 4YDRA 2PCJA 5BXQC 1LRJA 4KN6A 4G0OA 2DFVA 1A9XA 1FNCA 1UQRA 1XEWX 3IA7A 5H1YA 3WGKA 5B37A 1NXPA 4CM3A 2ZWMA 4LJLA 3TKAA 4F12A 3RBVA 3WYBA 4GI1A 5LZ5A 2FXIA 4BNZA 1AK9A 2GBLC 4EARA 1V5EA 1FFHA 2Q5CA 3ZHTA 4X54A 1Y1KE 4ARZB 3GUYA 5REQA 4MVCA 3P52A 1HEIA 1CZRA 2E4XA 1TUBB 2IYFA 3Q3CA 1EVZA 1JRLA 2FAXA 3BHMA 3D4LA 1VJ5A 1WCV1 1BYIA 1NZDA 3Q8MA 5DYWA 2WF9A 3K73O 4KO3S 1DKUA 4DJ5X 3IMKA 1X7HA 1Y63A 2GM4A 3JALB 2HA5A 3M5CA 4S2EA 2YWCA 5FUYA 3RTDA 3TCNA 1D1SA 1WXDA 3DONA 3RC2A 4YAIA 2FK7A 2AFHE 4YRGA 4O4LB 5DGDA 1Z8DA 4XWAA 3RUCA 1GAJA 1Q3TA 4EIWA 1XAIA 5CA1B 2Q5IA 5JZMA 3BIFA 2BGGA 1T3SA 5K6AC 1LLDA 2I2BA 1ODCA 2Z5FA 1T1IA 1UAYA 2AMVA 2MMCA 3A32A 3AU8A 2VUTA 3WJ7A 5B2EA 2XUQA 2VDNB 4KXWA 3BOSA 1N33B 3K6SB 2XIQA 4EABA 2I29A 2OZPA 4RNCA 5TGZA 2QLBA 3KJGA 2AOTA 1W5EA 1U11A 1NE2A 1U2DA 2HK8A 1QH1A 4KDFA 1KMHA 1H1LA 4CF4A 4CNQA 3LKBA 4D26A 1WB5A 2VP6A 3EIUA 3EWNA 1UADA 3VYVA 1TYZA 3D0QA 1VBMA 2X8JA 1VKZA 2AK2A 4FPXA 4PANA 5A62A 2QA5A 3FBWA 4MIYA 4TVBA 3UFBA 3D7KA 2EBHX 1FTSA 2B6HA 1T0PA 2LTAA 2Y93A 4H1HA 5KVAA 3IPCA 3X1ZA 5F76A 1M5RA 1ZQ9A 3N3BC 3R41A 1GPWB 4UFNA 1KR2A 5FWYA 3QSYA 1NUPA 1XTZA 5D7NA 1FFXB 2QF7A 3NEYA 4ONEA 1U8UA 2ZT6A 1NN1A 1QGUA 3BMOA 3PBKA 5AP9A 3RCBA 3TL2A 3QPDA 5AW2A 4KMOA 1GZHB 3DA8A 4PRZA 1W88B 1IULA 4NYMQ 1TU3A 4C06A 4DNOA 4QNNA 1EFVB 2Y1XA 4DYHA 5EVJA 4QT4A 1G20E 1KRHA 1CB7A 2HMSA 1FW8A 3I04M 4HUQA 2OFFA 1DG9A 1H23A 1Z2AA 2C5AA 3AEZA 1W5FA 2Q0SA 3R0IA 4EUFA 4DR6B 1N1MA 1TRKA 1RWKA 4KLZA 1H69A 8GPBA 2JJYA 1UFRA 4Z86A 4FDLA 4NJOA 2E2WA 1HE8B 1T43A 4PRYA 3EIEA 1FP6A 2VAXA 3RS8A 3Q3GE 2AG1A 1SULA 5DM4A 1WQ4A 5BMOA 2UV8A 1SOAA 3G2MA 2J0EA 4DUGD 2AVDA 3R3XA 1J0CA 5DI3B 1IY9A 1YGPA 3PQ5A 5DGCA 1T26A 3B3FA 1PJAA 3UJCA 2YS7A 5JD6A 3T4EA 4UNQA 1D2RA 5JXHA 3VZQA 1U3TA 3E9CA 5EXSA 3ZWAA 1AUOA 3ISJA 5J4VA 1PK8A 5LQCA 1QO0A 1RLJA 2XLCA 2X5KO 4URZR 3UV3A 3LP8A 4MDFA 1O0CA 1WCXA 2BUBA 2FZ5A 1P29A 3IAUA 4QT0A 2M98A 2OBNA 1H2EA 3QVUA 2I2DA 4B3XA 4DG5A 1ZC3A 5ESXA 5LM3A 2I3ZA 2EKLA 4F6RB 1Z39A 3H1BA 1K5GA 1NN5A 2HJVA 1HRKA 3BULA 3CNBA 3ZV6A 2VA8A 3L4KA 5E9JA 1XA4A 2RGWA 3L7MA 3Q0TA 1MOQA 4RCVA 1E64A 1NBWB 2OLEA 4PGFA 4RIIA 2ORWA 5DXAA 2ZXEA 3VR6H 3FNFA 5J2UB 1KXJA 1G20B 2WUDA 3JTEA 3TIFA 2VJYA 1R27A 4O63O 3MS7A 1NN0A 3WRWA 1EP2B 2JJ1D 1R9JA 1DUVG 4DRXB 1XUOA 1CQPA 1GUZA 4Y9SA 5CX1B 2IDMA 3KSRA 4GPEA 1KDZA 2CUNA 3SBEA 1L7MA 3D3QA 4BFTA 2FPPB 2FUKA 2TMDA 1Y1RA 2K7ZA 2BSXA 2YWFA 1YCHA 3HA3A 3S6JA 3WMRA 2FG5A 2F43A 4CEJB 2XXAB 3FDZA 3U39A 1DQNA 2YWDA 5GONA 3ZE0B 9GPBA 3RT9A 2PUVA 2I6UA 4DM3A 4EFMA 4F8JA 1BMFD 1KPIA 2CLIB 3KT0A 3L02A 3W5CA 2Q6LA 1YHZA 3E70C 1TIKA 4YB8A 1Q0SA 4B85A 4AZSA 1AKTA 1C8LA 2XYQA 4M88A 3P9SA 2DUJA 2RHRA 4EUHA 5FX2A 2VAWA 3S7ZA 1XDWA 5BSGA 3OF3A 2WPDD 2YDYA 3AESA 3HV2A 3BBLA 1JT9A 3BS4A 4HR7A 4XPIA 1HBJA 1D0SA 4V02A 2G0AA 1VIVA 2LV8A 3VBEA 3T5BA 1JECA 1PDWA 4X8HA 5DWVA 4ZOAA 3U09A 2X0RA 5B3JC 4ZYLA 5E1BA 3JWGA 1G5IA 4OB6A 1Q0TA 2DQSA 3TTUA 4KN8A 1G64A 1X7YA 3HDTA 4BB5A 4YI3A 4D56A 1K3FA 4OQZA 2DU8A 5JS8A 5KTYA 1J20A 4LYHA 1KS2A 2H1CA 3ETJA 1SELA 3VDNB 4OM7A 1Z62A 1BXKA 2ZU6A 4UM5A 3BXPA 2P4UA 4D6YA 4YNBA 1MQ9A 4F21A 3EAFA 3U7HB 1B6TA 1VC2A 5CVEA 1H5UA 2XVXA 5CXQA 1Y9AA 2VDJA 3WIBA 2PUFA 4D5GA 5BSRA 2YX1A 3I6BA 4B9EA 4I36A 3CKLA 2PRSA 1DTEA 2PYDA 1GZ7A 2JCXA 4BNJA 1YK1A 3TNJA 3ZV3A 3UHJA 4IJUA 1B0ZA 1WPRA 4WNAA 5TIIA 1ZHOA 2GTPA 2DLCX 1W75A 3SVLA 1KVTA 3NCHA 4EY3A 1JEJA 3HCAA 3ROFA 3QELA 4JSRA 4A8JC 2FPOA 2GPJA 1ZJJA 2D54A 2EDCA 2J3JA 2PL5A 2PO7A 5KWVA 3LK7A 4B8ZA 1EBUA 1Y6ZA 2B37A 3TAHA 2MIIA 2UUAB 3H1EA 2AW5A 3WK4A 3NHFA 1QQAA 3U17A 2XYRA 2HJWA 3GU3A 4DG8A 1Y5LA 3FTNA 1W0CA 3L7YA 5EHXA 3JQDA 4JODA 4DL9A 4D0NA 2XBUA 1J07A 2CNKA 3HB9A 4II7A 3Q9UA 2QT1A 3UOGA 1IXRC 4OHWA 3ZOZA 1GKUB 1W30A 4ZA2A 5F1YA 3ZCTA 2ZRBA 2ZUWA 3SFTA 3OZ7A 2D1FA 1R6VA 1G16A 2WVGA 3HEMA 4QODA 2EKPA 4PO1A 3D5TA 3LD9A 2YXEA 4R0VA 3H84A 1ZL2A 5C2JB 2PGNA 1IRXA 1C9MA 1J2EA 1KO1A 2XQIA 3N0RA 1XJWA 1GN9A 2C29D 1P17A 1DAHA 2JI6A 2V7EA 1KFBB 3MB5A 1P5FA 2XUGA 2QUJA 5AW3A 3KOZA 3OBBA 1NDUA 4MYHA 3A25A 5TQJA 4RD1A 1QIDA 5JDCA 5JSKA 1VJ0A 3VHQA 3WBBA 1J2YA 1IPFA 2OG2A 1GV0A 3WAJA 2YFYA 1XZBA 5TS2A 1ITZA 1T3GA 2XT0A 2QVXX 5A6SA 3O8OB 3K9LA 4J8PA 3X0DA 4B31A 1O89A 3QPAA 3OTGA 3TSOA 1W52X 2HRBA 10MHA 4UXJA 1I9CA 1TYBE 3WOHA 5L3RA 1KDPA 2M6LA 4W5WA 4EYQA 1V16B 1BDJA 2A35A 1FFBA 2HW8A 3ZWWA 4C7OB 1C0IA 1IXSB 2ZVPX 4UVGA 3C43A 4RACA 2PDAA 1SHZA 4WHMA 2IOHA 2J3IA 1GZSA 1RWPA 3L01A 2QL7A 3I53A 3SSOA 1BH2A 1V3VA 1F9EA 4IHJB 4UZFA 2OD2A 4FFOA 3Q9SA 4C29A 3GMSA 1TYCA 2OB1A 5IBPA 2JAOA 4FWBA 2VA9A 4HNAA 3R20A 1RJGA 2ATVA 3TTWA 3GZ4A 1T0BA 3TEFA 1A8SA 3OIFA 1M1NB 3T94A 3I6QA 4PCVA 2XUJA 3V4LA 4HDKA 2IHJA 3X1XA 4AKTA 2NVUA 3MMNA 1F0PA 1F3OA 1VKOA 4EA6A 3QEAZ 4PICA 4UDYX 4FCVA 1H2AS 5MFPA 3T3MB 3GN1A 2JEYA 2Y92A 5DSZA 1QC5A 3AERA 3C0KA 1U3GA 3D8UA 3GFVA 4IVNA 4M36A 1N77A 3PF8A 1GJRA 3K71B 2H9YA 1C1DB 2OGUA 4PSDA 1FQKA 4R1MA 4X1KA 4ZO7A 5AOVA 3U2QA 2XNKA 5DHQA 3EVTA 3UAGA 2J41A 3D6NB 2OFXA 4YV0A 4HNVA 5JSZB 2BT4A 2XEDA 4K9KA 4XX0A 1KSFX 2A0UA 1K4KA 4P32A 3SQOA 5JEEA 2B4QA 2ZIZA 3HRHA 3DTYA 4JLPA 5FLXA 4DV5B 3D43A 5CB4F 1TMKA 1XHEA 1ZLXA 2JEOA 4I1YA 5ICCA 1YJ8A 2G1UA 3VR1A 3OIGA 4AJPA 3GDOA 3AZOA 2P8JA 4LDQA 1R4NB 2YN4A 3HYSA 1WUIS 4MWGA 2NZ8A 4RO0A 4TWZA 4WCVA 1PS9A 3DAHA 4IYRA 1Z4MA 4KXXA 1J09A 3RVLA 5I9IA 5JPCA 1F2VA 1E5XA 1TUIA 1U0JA 3ZHYA 4V3BA 3OJEA 4EI9A 3IEKA 2HIHA 4TKZA 4YRIA 4LGMA 4XRGA 4N65A 1O8BA 1LJUA 3EBLA 4FEEA 4KV9A 1ZGZA 4D44A 1RTKA 3KQMA 4CMCA 2H9AA 5IJXA 2YJZA 2ZSEA 5B4VA 3U26A 1PZHA 1WV1A 2CN1A 2PT9A 1E32A 2DQKA 3V8EA 3HJFA 4BO2A 1E59A 1QF9A 4TTJA 1Z0ZA 3FVRA 4YBZA 1RCFA 1EVJA 4O5OA 4UZSA 4ETMA 2WQZA 2FEMA 4AUKA 1X92A 1G5PA 3QQPA 1E7RA 1DPGA 2DF8A 4HN4B 3TAXA 2VQSA 4N18A 2VPWA 3LF2A 1H0KA 2O9JA 2Y77A 3UJPA 1WMFA 1K88A 3CLUD 3ONEA 3CR3C 5SV2A 1YRLA 3H9QA 2PXCA 4ZDKA 1WBDA 5IKPA 1KSJA 3IHLA 4Q4HA 3H11B 4N0DA 5GOTA 4NOKA 1ST2A 3X3HA 4BKRA 4ID9A 2CLSA 2ZYIA 3KYBA 4YCJA 5C7OO 5CDFE 4GWLA 1VFNA 1Y4SA 4N7MA 2UVQA 4YYZA 3PGKA 4W63A 3EOAI 5IEBA 1DFIA 4QJ3A 4GT1A 1YONA 2IXFA 2ANBA 3BFJA 4P7KA 1KQNA 5IC4A 3MTJA 1W9MA 1VHLA 4PYNA 3OPNA 1KVUA 1GG8A 4I9UA 3TW4A 2FXVA 4GSYA 1U3UA 3SQLA 3ESDA 3MPUA 3QTTA 1DC5A 2JGRA 2N47A 4H7EA 5FADA 1PGOA 1Y3AA 2XA2A 4CMJA 4DMKA 1L5WA 4KQGA 3CVXA 1VIMA 2Y0DA 2SKDA 4JVNA 2Q6IA 2R8OA 4ZOCA 2BKXA 4OXIA 1G3UA 1QVAA 1YH3A 2WJYA 3OPVA 4RSHA 3FMVA 3P0RA 4HQ6A 4C3VA 4OB7A 3CZAA 2PO5A 1IVYA 1D6JA 3Q2OA 3G0BA 2G04A 2OY0A 3MRSA 1ACLA 2AYYA 4FNMA 3FYHA 1ACJA 2O20A 2VWHA 4LC1A 4A2PA 5CB0A 1ETUA 2L0XA 3IVXA 2FYTA 3JY6A 3AP3A 4BBAA 4D0RA 5IM5A 5HMLA 4O25A 2GZ2A 3DULA 2OYRA 2BYTA 1VB3A 4CCYA 3M33A 2HGZA 3Q5DA 1MFPA 4YXFA 4HS9A 3SKXA 4OJQA 1CB0A 1N8NA 1E1RA 3VKWA 3L4JA 2LR0A 2C84A 1XYVA 2EX0A 2HN9A 3QIAA 4S24A 1MOPA 3HLKA 1PZFA 3VAZA 2PUWA 1G8AA 1ZO8A 1II8A 1TIBA 4DA6A 5ADWA 5ECYA 3BMCB 2VTBB 3VR6A 5CD9A 2RIRA 1Y8RA 3DDHA 3WTCA 1KZ4A 2G5CA 3G68A 5LA6A 2ZUFA 1OI3A 3OCCA 4TPKA 1PW5A 3GOHA 4JI3B 3WGQA 5K0JA 4UATA 4ESOA 3PKJA 1VBNA 4GOXA 2IUFA 3BB1A 4S04A 3HCWA 2BBSA 1SXPA 4KVAA 4I8XA 2D59A 7AT1A 2BKUA 2GBCA 5C7LO 4BN4A 5TQVA 3VYWA 4YQFA 4XSHA 2YXPX 1G6Q1 4MUNA 1VSTA 2GK6A 3ELYA 2PSEA 2Q1SA 4YJ3B 1R0BA 3TM4A 4G84A 1HI9A 3AEXA 2YYYA 3V2IA 4CHGA 1ODSA 1YQTA 4KOAA 3RVKA 4DQ0A 4JU8A 4TQAA 2VXOA 1LPOA 3CO0S 1VPEA 4WV3A 2C5HA 2RONA 1WDTA 2WD8A 3PXDA 4OKNA 4R2MA 1OH6A 1GCUA 2KMLA 3SYMA 3UO8B 1XDDA 1JWBB 1RWOA 3HU1A 4DM7A 1PT5A 2ZTHA 4F6CA 4CKEA 3FYCA 4B47A 3W5AA 5A9TA 3OQOA 5FO1A 4OHRA 4HVAA 4JMLA 4A8PA 2EERA 1EUCA 1WP4A 2YQZA 4W9NC 3OX1A 5KC8A 2JHPA 2NAFA 1T9GS 3OPXA 4MUJA 3GAAA 1N7JA 1CVIA 3DM9B 2VSQA 2Z2ZA 1DWQA 4FOSA 4KNWA 4S2UA 2BHNA 1QLWA 4BYGA 4ZHQB 2IWRA 1QZZA 1KZGB 2X86A 3CQ9A 4HLUA 3VSDA 3N59A 3TI9A 2ACVA 2FA9A 3UYKA 2ZE7A 3QYFA 5DSXA 1FU8A 2DJ5A 1W46A 2EZ9A 4DQXA 1I7PA 1E6UA 2ZUVA 4Z2AA 1VL0A 3WLLA 4WPGA 3E2MA 3LUCA 1T13A 1VYVA 5ALDA 2JHFA 1LFDB 3FY4A 3K35A 1ILWA 1A7JA 2RGUA 2X3YA 3NW9A 3IJPA 4LHXA 1Q44A 4HDCA 3DHWC 3DWFA 3H6HA 4R1SA 9ABPA 1B8OA 1AXRA 2OESA 4V0LA 5EE3A 5K0CA 3B85A 4B6EA 3PXCX 1NXWA 3RBZA 2I8AA 5IVIA 1CJSA 4EMTA 2TS1A 2KE5A 2K5UA 3SGLA 3SMQA 2QOEA 1R64A 3R0ZA 4C2BA 1L4NA 2Y4NA 3FCCA 2DR3A 3KHSA 2BGKA 3TLJA 1COWA 3J80A 1P0MA 3KQQA 1IBLB 1YMVA 2AWNA 2EJCA 4NCNA 1XN1A 5T41A 3ROTA 5IN4A 2CWWA 1FZQA 1XL1A 2BZ0A 2GVNA 3JWJA 5AHRA 3SHVA 3UFXA 4OBBA 3RTBA 1TD1A 5EPUA 2N1MA 3A9CA 4IDEA 2C3YA 3WP1B 1ZNXA 2W48A 3ZDEA 2B6NA 4K6OA 5K1ZA 4AYWA 2YZKA 5JROA 5IDWA 4CIXA 1G9TA 4UD2A 4CV1A 1W4ZA 4GC9A 3UH0A 5I3ZA 1D6NA 1SFRA 1U5CA 2VYQA 4MWEA 4B3JA 2GT1A 4BO5A 1BHJA 3IBYA 3CS3A 3GLIA 4IOJA 2Q3DA 4MQFB 2C5EA 3PNVA 4PZEA 1V1JA 3DKIA 4WCFB 5K4HA 1QHIA 3ED5A 4LSGA 1DIAA 3GEGA 1Z5GA 2ZWVA 1LJLA 3UGKA 1LFAA 3B6KA 1BFUA 3JXEA 5K3AA 2EZTA 5C32A 1PSWA 1QP0A 5GINE 2HZBA 2IPOA 3IAEA 1R16A 4WXEA 4CPDA 3ZQ6A 1C50A 1SH7A 1RTTA 1VJRA 2P9QA 2B69A 4OFXA 1GZDA 1TVKA 3E0QA 2FP3A 3C4QA 1A8IA 1QVVA 5TMDA 2OHHA 1U5BB 3O94A 5I7AA 1NL3A 4TKMA 1T2DA 4NBUA 2Y9MB 3CH6A 1ZUNB 2PMDA 1Y6QA 3M6FA 3Q7IA 1H6AA 2O3JA 2VJOA 1VLJA 4IMRA 4NNJA 3SX2A 3UHPA 3JVVA 2WJWA 3F4KA 4IHKA 2ZBEA 3AFIA 4PTLA 2QW0X 1NR1A 4QUHA 3CWQA 4ENVA 1N0HA 3NEJA 2XDAA 1U99A 3HXPA 4FHFA 3KR2A 4TMTA 5LKAA 3TNYA 2OHOA 3GNQA 2QRVA 4JI2B 1ZD3A 4LYYA 1MOSA 5A4KA 2I8CA 3JQBA 1G7CA 1Z22A 3T1QA 1QCDA 2JH8A 2ZB7A 1Q7BA 1Y3DE 3RUFA 3H05A 3RROA 1V3UA 2I9KA 1POWA 4KR3A 1HE3A 3F6BX 4KREA 1P4SA 4CQMD 3G5TA 5JH7F 2VPXA 2HDOA 4Y1EA 4IIBA 4LW8A 1XQ6A 2J0UA 3SJ7A 2CVQA 4ASUD 5L3SA 1P9NA 1SIOA 5JJBA 3LHFA 1MABB 1AKEA 1N32B 1SVIA 5FL7A 1GPUA 2ZRMA 3HMQA 4J0GA 5EE9A 3RTCA 3V4PB 3KLBA 5C9ZA 3QU2A 4WIAA 3LUHA 4OI2A 3FPCA 3RARA 2GD6A 2HMAA 1OGYA 3QOFA 3VQTA 4DQLA 1V9SA 5ITZB 4CMKA 1RKBA 4GMXA 2AJLI 3CONA 5DSTA 4WK2B 1V8OA 3GLFA 1AHIA 4OXKA 4UTVA 1CHDA 1ZVKA 3AM5A 5DN9A 1S1CA 3NGMA 1KU6A 1XQ9A 3ZNPA 4YX9A 1X1TA 2O8EB 5KI6A 2ZB3A 1TD9A 3E9ZA 1UDWA 1P7ZA 2OK7A 3R0QA 4M22A 2FSVC 2E49A 3C8UA 1JHDA 2FDCA 3HBJA 4IX1A 1PG0A 3L49A 3SDZA 1THGA 2HLDD 5C1PA 3BIOA 3TLBA 5BN4A 5HTKA 4FYWA 3AEUA 3EHDA 4DV1B 1LD3A 3JQQA 1Q1GA 3N87A 3R0JA 1OWNA 3HB5X 4HH1A 4JASB 1M34B 1PWYE 2BGRA 4JLBA 4KWEA 4RWZA 5HUHA 4KRFA 3OESA 2I33A 3ZN2A 4AG5A 4D42A 5A2GA 4BXOA 1RAEA 1UPFA 3S2FA 2HSJA 3AF4A 5FA6A 4RW0A 4XASA 1ISSA 3H0KA 4I2VA 2QLFA 2X14A 5A02A 2VHCA 5B36A 2DT5A 3SC4A 3EGVA 3TI7A 3PD0A 5IXYA 4UEWA 5DTEA 3WB9A 2DWOA 4DV4B 1C7ZA 3G2NA 1IDN1 3ENKA 4Q12A 3OY7A 2Z1NA 3QF7A 3KU4A 3PA8A 1NVVR 3Q10A 4OLHA 3QNUA 3TSAA 4ZRNA 5EJ8A 2E5LB 1YMQA 3B89A 3A1TA 1J39A 5KS2A 1HQCA 1EFLA 2MYTA 1FXWF 1NJFA 4G37A 1A7AA 1VTKA 3KNZA 2YXDA 2BJVA 4PG7A 3L0YA 4UHBA 1IZZA 4KUGA 3CEHA 2RI6A 1YA8A 3WIOA 2RKOA 3M6AA 5IWCA 1M0EA 2QTCA 1NT4A 1N5RA 2MINA 3MNFA 3OQNA 2XB6A 1PN3A 3UB2A 4DLKA 3KJHA 3MWYW 3OUTA 4LDZA 1VKJA 4WN9B 1N9ZA 4KK4A 3ODPA 4EHNA 2Z6AA 2CCJA 2KJQA 2AX3A 2EFYA 3LT5A 2Y1DA 3R7DA 1RXVA 1E1LA 2XZOA 1L5RA 4OOEA 3GEEA 2Q6VA 2IFTA 1E9RA 3MTAA 5G0WA 3ZE2B 1YQ9A 1V1RA 2JDID 3DWEX 3N5CA 2ONZA 4KHPB 4AS2A 4EPYA 5TF4A 3AYZB 1F38A 1IN7A 4PFQA 5BQ5A 3GDHA 1C80A 1SXJD 1Y34E 3CYFA 1QSGA 1GLGA 1DKOA 2I34A 3HDHA 3T7RA 4PSAA 1PX0A 5KQRA 1ABFA 2P67A 3C3CA 1W29A 4JOQA 2BFCB 3VR2A 3ZDAA 3O1LA 3DE6X 4RKFA 1XLUA 2Q8QA 3B1YA 5B53A 4BKUA 2Q6KA 1E1CA 5L45A 2DBZA 1H3EA 3MWKA 3UJ9A 1F8FA 4M8KA 5AVSA 5IDQA 3ZIAA 5DBIA 4TV8A 1JR4A 3HY4A 5GJVC 5SY4A 1V96A 3MSCA 3KR0A 3V2UA 4HDRB 4JXXA 3BPSA 1DQRA 4W1SA 4HQ0A 4JWKA 1CERA 1GEGA 1ZMXA 2PGDA 3UK0A 2VT3A 4JAVC 4MYCA 3HR4A 5JCJD 1Q19A 1RWNA 1QH8A 3TLGA 2I2XB 3DL0A 4LUCA 1YCFA 1J5PA 1I7QB 3DEAA 1SA0B 4P84A 5B55A 1U1GA 5FB3A 2FEKA 4KFTA 4DIFA 3IE0A 1LQUA 1K8QA 5KNDA 4GPZA 1XV5A 2ZCUA 3UBTA 1PEYA 4XYEA 1D09A 1MUUA 3EA0A 2QN2A 4DLWA 3V6MA 5A0VA 1Y48E 3ZTWA 3GVIA 1TL7C 3I4FA 3ETLA 4I1IA 4EFDA 1GFZA 3I9OA 3HVJA 5B4UA 5JXIA 4AK9A 2E1RA 3ESRA 2EGGA 3FM9A 1GCOA 1ZISA 1QKKA 2JGJA 1E96A 1UJNA 3NEPX 1BOOA 1EFHA 3HACA 4GKAA 5BW6B 1Z13A 5BW8A 1GFIA 4QL3A 1JQBA 3RKSA 4HAUA 5EZSA 2AEJA 1XVVA 2CNWD 2XKBA 3IBGA 2HRCA 1J0DA 1X14A 1IXKA 2FEXA 3M1YA 4C76A 3GXBA 5KC9A 3COJA 1Y9EA 1WF6A 2OCGA 1JLLA 4UCQA 1DCMA 4U0JA 2O7QA 3VVCA 4YUYA 2C7GA 4MCIA 4QUEA 4EO4A 2O2GA 2QRQA 3N7TA 3ZV5A 1QWOA 5G2OA 3THRA 3W7AA 3TQCA 3T7JA 4J0IA 1OXKB 4PINA 2VWPA 3DPIA 1P2TA 2J5BA 3ILXA 5L3QB 1ZMBA 4HY3A 3ZJYA 1J6UA 1GA4A 4A6PA 2VQEB 4N01A 4YIKA 1R4AA 3WMWA 4NK4A 1X6VA 3VR5H 4MVJD 2HL6A 2PXXA 2FX3A 4J2TA 3TXXA 3G13A 3ONVA 4EB0A 4WX2B 1N7GA 3IIKA 3K9NA 3DE7X 2B2XA 4G9EA 4HEJA 3EW9A 3IR5A 3OOSA 4M37A 1GYQA 3EFOA 1HE2A 4EDHA 3F6SA 3GT7A 3A1DA 1LSUA 4IEFB 1QZUA 1R0LA 2XGGA 3HVIA 4RJTA 5JZVA 2CUTA 4MXDA 1A9RA 2ACWA 3GGCA 3KPYA 1SMKA 1VIDA 2NYVA 5EI5A 3KWFA 3BXEA 2PNJA 1DIRA 1XRRA 3BBPA 3QPWA 4HH3C 4Q9DA 1Y3BE 3A3NA 3BGSA 4J6FA 4LE1A 4WASA 4UOQA 3RC7A 3U0BA 4ZT3A 4F60A 2XD4A 5K51A 1KFKB 4AW9A 1DE0A 1RZUA 5H16A 1TI7A 1H4QA 4ND3A 4RZUA 5BUSA 3UPUA 4B4DA 1OV4A 2OSVA 5D5HA 1QCZA 1U7XA 5DK4A 1Q0UA 3CW2A 1XOIA 2QMHA 3DQQA 3FHOA 3IMFA 2GD2A 4HI0E 2EP8A 1NQAO 3EXHA 2UZ0A 2B20A 1LVGA 3IIMA 3SOZA 4B7UA 3BMXA 4PAOA 4YUVA 4CMEA 5LQNA 3AVUA 1JDSA 3U4AA 5C8VA 4GUDA 2Q3FA 2XR1A 2QDKA 3N2GA 5JHHB 4YV1A 1PVVA 5JS2A 1PCXA 3FUTA 3DGEC 5G02A 2ODAA 4BX9A 3WGYA 4DR3B 3QKIA 3T7KA 2EFJA 1YJCA 2JJQA 4O2AA 4WFJA 1HE5A 3PGJA 1WWKA 3P9IA 1FTNA 3PHCA 3HL4A 4HQNA 1FL9A 3P9XA 2B3DA 2CL5A 3EA5A 3ENNA 4A1OA 5IWAB 1B16A 2VHTA 1PUJA 1JU4A 3UGTA 5H81A 4HDSB 1D4OA 5E7MA 5FUMA 1JFRA 1T0IA 2R2GA 1NV8A 3A3OA 3BD8A 5G1PA 2XDYA 2AYXA 2HJSA 1VLVA 2PSFA 2IYOA 3KSDO 1KI1A 3QKWA 4WY2A 1EIZA 5F21A 1UPUA 2YOHA 5C31A 1HYQA 2RAUA 3CZQA 2HNBA 2JGLA 4MS4B 3EEYA 3HA5A 3K4QA 4FB5A 5JIBA 2C77A 3KTDA 1M2GA 5DBEX 1RRCA 2WJ4A 1RWWA 2XKAA 3FUUA 4MRRA 3TW8A 3TPFA 5KINB 1KQFA 1D9XA 1WS6A 3CTMA 2IS6A 2QNIA 4M98A 1JPUA 3SYRA 2J4CA 4AF6A 4RTPA 2RMKA 2Q4EA 4XYLA 4IOLA 4J4TA 4OGKA 2IEIA 4GP9A 1CKEA 4AP5A 5KVSA 1CNFA 3NKFA 3JAKB 4JDPA 1Y6JA 2HT1A 3ZWYA 1DTWA 3QWBA 4KLNA 3ONNA 2Z0MA 3VPSA 4M1ZA 1AKUA 1T8UA 4JX9A 3WNBA 3B3AA 4KXFB 5ELMA 2GN9A 4ZD6A 3BDIA 3RG2A 1WKBA 4MQ4A 3LWNA 1GR0A 1T0UA 2XHEA 3NBKA 3TOVA 2H7YA 1QORA 2E1PA 3EG5A 2IE0A 4FLEA 3TUJC 4B83A 4X93A 4YRZA 3HPQA 4X1OA 4ZK6A 1Y9DA 4YGYA 2NVBA 4XOUA 4HXGA 2AJ8A 3NTRA 3PFWO 1SC3A 4NMHA 1H05A 4UTNA 3THOA 1I2MA 3RT7A 1WQ3A 4DSUA 3O4GA 2Z8XA 3WK7A 2F3QA 4TSFD 5HIIA 2HA3A 5EL0A 4HZGA 1C3XA 3QVKA 4PZAA 5FNVB 4Z6KA 4AZ0A 4GYKA 1KKUA 1E9DA 3ZW9A 5LSAA 4F7WA 2B7LA 4YP7A 3ZGYA 4MP8A 3SF8B 1E2JA 2J9YB 3HDGA 4YC7A 4G26A 3WB0A 3T9DA 2IF2A 4W82A 3C7TA 3L0IB 1Z5WA 3QA9A 2CY0A 4EVRA 3DKKA 5LJIA 2C2XA 1A1SA 2B8JA 1RAAA 3DTVD 2VDWA 5AXAA 2JKZA 3D3WA 4HTAA 5MN6A 4HJXA 4BB6A 3M4XA 1C7QA 3ZJ4A 2OK8A 4PPFA 2HA7A 4QGHA 5JFTA 4R9SA 2O8FB 1YF3A 5DHRA 3GJQA 1NHWA 1XKTA 3HDVA 3D6HA 2XE6A 1LK5A 1XU4A 2DVMA 1HGXA 1K6JA 2NOAA 3BL8A 4ID3A 1K5DA 3OZTA 4X1IA 1J9EA 1D4FA 1HLPA 4MVWA 3SQNA 2GRUA 4LKOA 4G65A 3KZ1E 2R7LA 3ZKWA 3VZBA 4D57A 5KYWB 1SUDA 3B3JA 1CUVA 2CK3A 3PHBE 4ZVSA 5BNIA 2OHJA 3ABIA 3KT3A 4KQMA 2R68A 4MO2A 1GQSA 3FTQA 4K0RA 1KYVA 3ET4A 3MRVA 3FPBA 5BMVF 4BUCA 1Z5OA 4ISCA 1S9DA 4U02A 5L6MB 4QECA 3T0FA 4BLRA 4YCMA 3WO0A 1ZD9A 3I4CA 1ORTA 2BM0A 3RYCA 1EXWA 3LT2A 3JQ8B 3H83A 4DXDA 4E33A 3H5TA 4KQ2A 3QBJA 4ZK2A 1USWA 3UBMA 1JEDA 4BFUA 5AHKA 5TPWB 2R8PA 2EGUA 5M2QA 4IG9A 4TWIA 4BFLA 5BOVA 1VGRA 1Q7RA 4GRAA 4NMXB 1E1YA 4WK0B 3U7RA 3I8OA 3ZKAA 5BWOA 1JIXA 1XRLA 3UK2A 4MDEA 4QHTA 3FKJA 2JA1A 4I1SA 5CRIA 3IMCA 3K9BA 3VR4H 3IE1A 2C7RA 4RM2A 4W5RA 3CUTA 1G9SA 1T4DA 1S7GA 2NO0A 4KGXA 3SS8A 1A9QA 1FP2A 4X8MA 4B33A 5AW8A 3GBVA 2KX7A 3EWAA 3WFJA 3ZNNA 2PG3A 3ST7A 1WXQA 2ZQ5A 1E5VA 3O03A 3R5TA 3ODGA 1RWXA 4H6XA 5FPPA 3HJAA 3KKOA 2CKMA 1MQ8B 4Q7EA 4UUQA 5BNTA 3ROKA 5LP1A 5C52B 2J9ZB 3DLTA 1U7UA 1XMJA 3HWRA 3DCIA 4OREX 4FNAA 2O6LA 3VJLA 3QPVA 3R7WA 3AR8A 1X39A 1ONNA 1D5WA 1OAKA 2NZWA 2W11A 4QPCA 3ZNQA 1UDAA 3M4ZA 4QX6A 1WD7A 1PR6A 2I6TA 1GKIA 2ZQYA 1P0FA 2BMWA 2IPLA 4FHEA 4LKRA 4OHOA 3ZK7A 2CL0X 4INJA 3K20A 1IDOA 3BTUA 3GUHA 2X9LA 4DF3A 2K2QB 4HHEA 2QZZA 4J75A 3UB3A 1XMSA 2OFPA 4XUCA 2WIAA 3LWDA 2B5OA 2UU9B 5F3WB 1BEUB 2KLHA 3AR3A 2XB4A 5F35A 5IX8A 4RQAA 1W36C 2V98A 3BMNA 2JGIA 2GR9A 1OGJA 4BO9A 1SQ6A 4DLAA 3QH4A 2WSBA 4IICA 1NW4A 3FPFA 1LBEA 2XA9A 2YIVX 5ADUS 1O9GA 3A1CA 4F4FA 3T8YA 1LA2A 3SIXA 1GSOA 1U9YA 4R1UA 4E7OA 5FWXB 3ZDRA 4LF7B 3UT5A 2OHFA 1WV0A 2QV7A 3USES 3ZHUA 4OQPA 5G1NA 2ZR7A 1Y1PA 3PQCA 2L18A 3G7SA 4L8WB 1BKYA 5THQA 3WK9A 1TJ3A 2I6FA 1JGTA 1GPDG 1PUIA 4Q3CA 4QQKA 4MUAA 1PV1A 5AM5A 5KX5F 2V5VA 1EFPB 2A14A 4PC7A 5AIBA 2HV9A 4Q9IA 3KCNA 4URFA 3RJ5A 5KU7A 1RP7A 1K7EB 4BP3A 1UC5B 4BNKA 2JIOA 2V55B 2RJNA 1TKAA 1R0WA 3MD9A 3S29A 5TLSA 4IIJF 3THYB 1CTQA 3N0WA 2BISA 3QZUA 3ZCPA 4HWRA 1OJ7A 3C3AA 3KU1A 3NGLA 2HY7A 3HXKA 3MW8A 3EQ9A 2G0NA 2PKQP 1KGDA 5FPKA 1T8SA 4O4JA 5L95A 3GC6A 4R16A 1UBUS 1USGA 3EXG1 2VSFA 4UU8A 5E3IA 3V8NA 1UMDB 4RENA 4TSKA 4DBZA 1UK9A 1XF9A 4WOKA 1YIDA 3COVA 3DC2A 1M6YA 1YQWA 3KFXA 3SZRA 3WAGA 1TM2A 4YROA 3VU9B 3V4RA 1ICIA 2SECE 1DTSA 1IBSA 2REQB 3OI7A 2AZDA 4GR5A 3ROEA 5TEWA 2O2IA 4UBJA 2IYLD 4QYIB 4ZQCB 5EZ6B 4E2ZA 3OZSA 4JLVA 2O0LA 2HXGA 4X7PA 4XYBA 5ERXA 5EZYA 3ZYZA 1W2HA 2GZRA 1D5CA 3ABSB 4M7WA 1RI3A 5CJJA 4ZREA 5ERYA 3F3SA 2GHQA 1QKIA 2FRDA 1RYHA 5FBKA 5G4LA 5JFOA 4ZGWA 2FW1A 3CSSA 4V0KA 1VZ3A 5HF5A 6CHYA 4ZZ0A 1O6ZA 2Y6UA 5AW4A 2I3DA 4JLOA 1O94C 3EYAA 5F77A 1Z37A 3A4YA 2V9PA 3MT0A 3D6MA 5BVHA 2XX3A 4IVPA 4LGVA 5KHAA 1PGNA 5JR3A 1PQ4A 3AHFA 4L74A 4QVKA 1JXMA 2G9QA 2QZSA 4PFKA 1WZCA 1PL8A 1VE9A 1DU4A 1M8PA 4KRYA 3R7SA 4OI0A 3ETNA 2IE8A 1I4TD 1X7ZB 1CUYA 4X20B 1M2VB 1D6SA 2X2FA 4N4AA 2AN9A 3UXYA 5A5VA 5JQWA 2OBBA 3MTBA 4FDMA 5AI5A 1CDZA 3KLNA 1YR3A 3P0EA 3K70D 4M0EA 2FK8A 4ITUA 4FEYA 1UJ6A 2CGEA 5IYZB 1TIPA 1U04A 3EZGA 2H0QA 3ILVA 4NOMA 5J3JA 3GLGB 1K3TA 5GJBA 2P8SA 1PJLA 2UZ1A 2XIJA 2XGJA 3OCXA 4NRDA 1VL5A 3AUSA 4MYRA 4REMA 3INGA 2C54A 4ZIRB 1TT5A 4BMDA 2CLFB 3W9YA 4EYEA 3JYNA 5CEJA 5JT1A 1P2VA 1MQSA 2IVZA 4FD3A 1E79A 1Y42X 4RF5A 4BFSA 4PN7A 5B12A 3MWFA 2DGDA 1CUDA 4ZAZA 4ENSA 3KJFA 5KWIA 1H8ED 2XDQA 3DSRA 3MIZA 3PXEA 4P82A 4RJ2A 4F56A 1O5OA 3L1JA 3D59A 3QBEA 4OBEA 1S2IA 2CLMB 4YCCA 3LLSA 3CURA 3R7BA 2NV6A 4QAJA 1II0A 5DN6A 4DTIA 1LNZA 1VYTA 3A6GA 3TCKA 3E27A 4L78A 4GHWA 4L95C 1LLFA 3BFXA 4WESB 3WYGA 4Z4QA 1IUPA 3K5WA 4LC9A 2CXTA 4OXQA 1M6EX 1P75A 4IXTA 1L2TA 3AKDA 4RJJA 2PZGA 3DOIA 3MGAA 4UHDA 2ZRNA 5AW9A 3BXOA 4CMIB 3UYLA 2F8SA 5FOQA 3AEQA 5C4GB 5I8PA 5HILA 4NAHA 1N57A 1OLUA 1CUHA 3MQFA 1H4SA 4BNUA 2FY8A 2JANA 3OIUA 1PYDA 2AC7A 3AO0B 4LTDA 4OQMA 2B82A 4B32A 1P2UA 2GKOA 2Z43A 2YW9A 1F5NA 1UJMA 2VJKA 5A7HA 3B6IA 3VNRA 1NW9B 4XIFA 1NBAA 5GGXA 4U5XA 3RDPA 1HZZA 4Q1DA 4CLEA 3D8RA 4FDVA 4KI7A 4NATA 1IWPB 4YASA 2C20A 5DEOA 1IXYA 2JFQA 3H6KA 3I0MA 3JR3A 3G7NA 1R88A 3LMKA 4DLPA 4J0DA 4NEGA 5IJ9B 2YJGA 4M83A 1QAMA 1SXJE 5AOCA 1VG0B 1XTJA 2ZBPA 4WUTA 3HUFA 2YNMA 2QU7A 4ZEMA 1PWXA 1SPBS 1W581 5DX1A 3GQBB 2C4MA 2BTEA 1XPJA 3NORA 4HEA1 2V0CA 3F5MA 4P3XA 5FOSA 2QIPA 1I14A 3UH1A 5EWMB 4B4KA 1GUFA 2E21A 3F7OA 5H3HA 3F8SA 3HKCA 2PVSA 5H70A 1SC4A 1R0YA 4ZPJA 3AWIA 4TUYF 5DW0A 2SCUB 2AJTA 1K5HA 1OILA 5F9MA 1JYFA 2K4MA 2D0DA 4CN9A 4AIIA 1C9EA 1U3CA 3QXJA 4I5DA 4Q00A 1Q14A 5HJ7A 3JQ6A 4QGBA 4KIGA 1JHXA 1CJBA 3T54A 2AG0A 2C2WA 2J07A 1P6QA 2QTNA 1QQ6A 3I72A 5CFLA 3E22A 3C74A 4F3TA 2FW0A 2XQVA 3GB9A 3WIVA 1DOHA 1MAUA 4QXAA 4BB9A 4R83A 1BU8A 2D74A 4TYYA 4IW3B 4QU9A 3VHXB 1C8BA 1TM5E 4G2TA 2AVNA 4PZPA 3F9RA 3EZ9A 2AT1A 1IQ0A 1E3WB 2CWDA 2QRLA 3AF2A 3BE6A 2C03A 3O1JC 3OLZA 4K46A 1SXJB 5BOSB 1AKYA 4KB5A 4Z0PA 1VGQA 3QHAA 1UCFA 3OEYA 4TLAA 3U1VA 2O8CB 4GIBA 4F2PA 1HR0B 1F60A 1VCMA 2C3PA 1XDSA 4CTNA 1RNLA 2W42A 3OPQA 4U0KA 4WLVA 5EMLA 4E14A 4R0MA 5JBQA 1H1TA 3H1GA 3PNYA 4TKUA 3X2FA 2X19A 1RXEA 3MZ0A 2RFLA 5JCXA 1M8FA 2V9ZA 4R01A 4DCTA 1BFDA 1EXMA 1PWEA 4TWRA 1YTLA 5DULA 2OAP1 1AY0A 2I22A 1B42A 1IPHA 2NU6A 2QN1A 1U2SA 3CUUA 2GSWA 4IVQA 3WQSB 4GZ3A 5AVUA 2ZM5A 3NBMA 4BB0A 3CFYA 2IZ7A 4IBOA 1R0RE 2PUJA 2NUTB 3SOPA 2V4ZA 5IZCC 3NT2A 3M6WA 4WZZA 3OZEA 5M34A 1E0JA 1E9BA 3AOEC 1HF3A 3G7UA 4M55A 1ISGA 1SU8A 4I14A 2B9EA 5LZ9A 4NCBA 1XB2A 5DCWA 2Z9DA 4R81A 1VZ2A 1J0BA 1A9SA 1FUYB 4JEUA 1SBHA 1J1IA 4UMEA 4HXYA 3I0NA 4M46A 4L9AA 1WCIB 2XUOA 4AYXA 4MVJE 1ZK3A 1BRMA 1LLUA 1VL8A 3D9QX 2NAPA 4W5OA 3EDOA 3MJDA 4Y30A 3ROMA 1L4GA 3TEMA 2FSIA 4J2OA 1OU4A 2ZRHA 2Z3VA 1SHLA 2G07A 1DX9A 1ZC4A 4HEQA 3WBFA 3BWCA 4YJFA 4CI9A 2JBAB 1CRPA 4G0MA 3OIDA 1RYDA 3AF1A 4WERA 4MW2A 2YWEA 1CJTC 4AUMA 4UTRA 5LIRA 2H2FA 2C4UA 1J8MF 4L76A 1IQPA 4C4TA 2X41A 4IJVA 1GGEA 3LVRE 4FMCF 4F06A 1JFSA 4PU0A 2ZJ3A 3M7IA 1LS6A 4FE7A 2GEDA 4MUFA 5D3QA 4Y7CA 4JP2A 3EIXA 3KXPA 1N2IA 1Z6TA 5EVCA 4X1YA 4YQYA 3OOJA 1HTBA 2GCPA 2JARA 2NO5A 4DA4A 3R1IA 3BDAA 3C7KA 5AYVA 3P7MA 1EWRA 3G2OA 4W4TA 5K99A 1FP1D 2B34A 2CVZA 3PDHA 4PSUA 5JAUA 1VL1A 2PKEA 4HNSA 1GYRA 1UJCA 3UWDA 6Q21A 1YDFA 1ZM2A 2QTGA 3DAPA 4Q7KA 4X6LA 2BDUA 5J2TA 4JV5B 1AGRA 1T8WA 2VYFA 1IE3A 4MVXA 4TMVA 1KI9A 1JG4A 3FOAA 2M6RA 5T8KA 3ZQJA 4D9CA 4CLHA 4XUGB 1GITA 1P73A 4PO3X 4Y2UA 4K9DA 4EB8A 3X1DA 2X6QA 1AHNA 4C4XA 5CXXA 1R8YA 2I3GA 4FT2A 1Y4DE 2BI4A 1HT3A 1HH4A 2H00A 1D2HA 2J4DA 3AJEA 3LWBA 3W5HA 2JD2A 2Y9PB 3KQVA 5DBHX 5HF9A 2N9UA 1QV7A 5HQ3B 1ULAA 3DOHA 1RZRD 1Z36A 2V7TA 3CEAA 1L7EA 2FE1A 2PRJA 3OT1B 3R5FA 1K0UA 3S2ZA 5I6DA 1RWVA 4R51A 2WWIA 4E6PA 3A1EA 4PGMA 4X00A 5AVVA 3Q72A 1I1QB 5EP1A 3W4IA 1GQ2A 2W98A 4FWIB 3AC0A 4HBZA 4PPYA 5ELLA 3NANA 3D4NA 3K16A 3PGLA 1J56A 4Y0VA 1IZ8A 2QVYX 4NBLA 2Y67A 1T8TA 2E87A 2QJTA 2WG0A 2PKWA 1N6LA 5CFZA 2V7PA 2Q9CA 4AJ4A 2R7KA 1XHLA 1OVGA 1XCGB 3KHTA 5I8WA 3ADCA 1AH2A 5KTNA 1FP4B 5C18A 5BSKA 4US1R 2IPAB 2ZSAA 3Q5GA 4OQQA 2GEUA 2JD0A 1QGED 2AGVA 3D3NA 3RPEA 4LRYA 3S2UA 4WDRA 2WR8A 1D04A 4GE3A 4CKWB 5F4BA 3QYJA 4IINA 4CKCB 1DV2A 5LCXA 2BLNA 3MCWA 1RPAA 5FBVB 2DTDA 4ROTA 2GLTA 3GH1A 2C2OA 3Q6NA 1I4DD 1L1FA 2CLKB 1NPTO 1HV8A 3E2IA 1V6SA 1J8VA 4GZMA 4IIYA 3CZMA 1CR2A 3I01A 1QOQB 2HT6A 1ZIDA 1D7AA 5K8LA 1UQTA 1Y5MA 1EA7A 5K20A 1T4BA 4RKEA 1SCAA 1LF0A 4PC1A 3FWZA 2V5AA 1KIMA 4G85A 1W0JA 4H7FA 1UBMS 5CPBA 1OLXB 4K3UA 3UTDA 5LOVB 4MCHA 5BRNA 1KEWA 1U7DA 3SI7A 3K0AA 5EC8A 5IMBA 1X70A 2RD2A 4JI6B 5B4TA 1GP2A 2FJPA 3IILA 3FDIA 3SBOA 2O0HA 3D2BA 4HWGA 1LPAB 3M2TA 1DUIA 3A6DA 3IBTA 1FDVA 5IZ4A 5EIXA 2ODNA 1WSWA 4LOKA 3UMBA 4KQ9A 2HKIA 1QE3A 4M4SA 4N6GA 4EG4A 3NIGB 4E12A 4AB1A 1KDOA 1D9ZA 5GM2A 2BFNA 1TW3A 1TOAA 2P6PA 3KWMA 1CG6A 5SYAA 3I2JA 2AK3A 4TZ0A 1X7XA 4UFOA 2VPPA 1P19A 1UODA 3GZNB 1V0JA 3NP9A 2R8ZA 2FQ1A 1VGVA 1NUQA 1O77A 1SQFA 2ODPA 1W1IA 2QYSA 3QVVA 1F48A 1J8YF 2GHTA 3TAUA 5CA0B 5JXGA 1ZVVA 1CNMA 2QMUA 3ZQ4A 5CLJA 4JB3A 1MMFB 1W4LA 2ZIXA 3IXQA 4LG1A 3IELA 3NDPA 3UOAB 1Q1ZA 1ZMTA 1P5JA 2BR3A 2XCLA 2B1QA 3ZX4A 2WSLA 1NJGA 2O4UX 1P2FA 3OZUA 1Y82A 3DV2A 5D87A 4N48A 2WB4A 2LCQA 4K6FA 4MHSA 1AKRA 3NONA 1YO6A 1KFCB 2IU3A 3BDVA 1ZYUA 1YR8A 2IIVA 2R1VA 3EXEA 3IQFA 3OM8A 4BYMA 4YMUA 5JHGB 2CCKA 2IZOA 1NBMA 3K9GA 2ZB8A 3KTAA