1NT4A

Crystal structure of escherichia coli periplasmic glucose-1-phosphatase h18a mutant complexed with glucose-1-phosphate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
391
structure length
391
Chain Sequence
QTVPEGYQLQQVLMMSRANLRAPLANNGSVLEQSTPNKWPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPYTVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYYEGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRTSAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIEYVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDADGFCPMDKFDSVLNEAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glucose-1-phosphatase
publication title Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1nt4A01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1nt4A02
2HPAA 1YFKA 3EOZA 2P78A 3D8HA 3QPVA 4QIHA 2QNIA 2AXNA 3FDZA 2EOAA 1H2EA 2ENUA 4FDUA 1DKMA 4JODA 2F90A 1E58A 1C81A 2P9FA 3ZHCA 1RPTA 3OI7A 3FJYA 2P2YA 4JOBA 1NT4A 3LL4A 3O0TA 2P6OA 1SK9A 4PZ9A 3IT3A 1YJXA 5CU7A 1EBBA 2P6MA 1SKAA 1SK8A 2RFLA 4GPZA 1K6MA 4D4JA 1V37A 2P9ZA 4EO9A 2WU0A 2P2ZA 5AJXA 3F2IA 3HJGA 1E59A 1RIIA 3IT0A 4GPIB 1V7QA 1FZTA 3EZNA 1ND6A 2P79A 4PGMA 3FDZB 4E3WA 4IJ6A 4D4KA 1RPAA 1BQ3A 1C7ZA 2YN0A 2H52A 1C80A 3DB1A 4D4MA 3D6AA 4AROA 1XQ9A 2P30A 3MXOA 5AJYA 5AJWA 3K4QA 4ODIA 1CVIA 1ND5A 2H4ZA 2EKBA 5PGMA 4HBZA 1QWOA 1IHPA 2GFIA 1BQ4A 2HHJA 1H2FA 5CDHA 4MA4A 3IT1A 3GP5A 2A6PA 1DKOA 5HTKA 2HIAA 1DKNA 3PGMA 4ARVA 3BIFA 2P9YA 4FDTA 4D4LA 2EKZA 2OWDA 1DKPA 3GP3A 4ARSA 3E9CA 3LNTA 3NFYA 3MBKA 2P77A 3NTLA 2WNIA 3GW8A 3QPUA 2DWPA 1FBTA 2ENWA 2YN2A 5HR5A 1QHFA 4ARUA 3D4IA 1QFXA 3IT2A 3QPWA 5AK0A 2I1VB 2H0QA 1UJBA 5AJVB 1DKLA 2OWEA 1T8PA 4EMBA 4TSRA 1DKQA 1TIPA 2H4XA 3E9DA 3DCYA 5CX4A 4PZAA 4IJ5A 3E9EA 2DWOA 3F3KA 3KKKA 3K4PA 5AJZA 2BIFA 2A9JA 2P75A 3LG2A 1BIFA 3R7AA 2WNHA 3C7TA 2PA0A 4JOCA 1SKBA 2IKQA 1UJCA
chains in the Genus database with same CATH superfamily
1EE9A 4C0AC 2BGGA 5DXAA 5FHRA 3FWHA 3ZH9B 1FVOA 1E2HA 2PRZA 1N5OX 1V8ZA 3D6FA 3TBHA 1LLCA 2PM8A 5EHGA 4B3RB 2FE4A 1KDOA 4HEJA 3C39A 2PNFA 1B8UA 1MA0A 2JJ2D 4QUAA 1YJ8A 5KUTA 1FLDA 1R4MA 1EFHA 2WE7A 5DK4A 4KGXA 1GTG1 5CEEA 2WIJA 2W9XA 3CLHA 3VC3A 2Z6UA 4L5BA 1KBZA 5CBKA 4NHOA 1NLFA 4P4UA 6REQA 1HFWA 3FF4A 5KQSA 3ZU5A 5ALDA 4LSZA 3RC9A 1BHJA 4JA2A 2QWXA 1BZYA 1L5ZA 2RHGB 4ZO4A 2BTEA 3PGXA 3H2KA 3LC2O 5T6BA 5AUQA 2O06A 4JR0A 4I50A 1XZEA 1G8PA 2JANA 3EGOA 2GSDA 4C2TA 5EP3A 2YYYA 5BUSA 5EXTA 3CGWA 3QI7A 4GPIB 4J2HA 1J42A 1X1RA 3WB9A 5I5EA 2EYQA 5CCBA 1G3UA 2P79A 4MI9A 4D25A 2Q46A 4E4TA 3HYSA 3LBAA 4TUYB 2J3KA 5IG2A 5ELXA 4E2XA 3HB7A 3M83A 3RASA 1FBNA 3DMRA 5L7WA 1HLGA 1AHNA 1ML4A 4UVIA 3LOQA 3RSHA 2AF3C 2G7ZA 3QEKA 3GT0A 1T4DA 2B8EA 2P8JA 2O9JA 1FRQA 1VBKA 4OSPA 3AI7A 3TOZA 3VYWA 1BSVA 2QMUA 5HW0A 3MMSA 3BG5A 1TA9A 4KH0A 5CH5A 5LJLA 5DCWA 1XTSA 4FWBA 3A58B 3I6BA 1U2ZA 4R1SA 3SYKA 1KSFX 1KBOA 3BBPA 5ENDA 4AG3A 3AVWA 3A36A 3I6IA 2IIQA 5I9TA 4X66B 1QRUA 5T4FA 1Q0QA 1YQEA 2AJDA 3E22B 1LQ2A 2BW0A 3AHFA 4QUBA 5ALJA 2CDBA 4W5OA 3R5KA 5E1MA 3BHIA 5EQFA 3H13A 3LT0A 1TF2A 1Y89A 4BO9A 1DKNA 4DA4A 5A03A 3G2MA 1V7PC 2UUAB 4LNHA 3R5XA 5F5XA 5HCIA 3TMYA 4ER3A 1UJ2A 2AC4A 2SKDA 3C3DA 3JY6A 3Q1LA 3WAKA 1E99A 4N8SA 2RHBA 4FW8A 3NORA 5EIAA 1H4SA 3D3KA 3NRJA 3MGCA 1IUPA 3CPJB 5CIWA 2NO1A 4ID3A 3NFYA 5G0WA 1SD5A 3G68A 4I2NA 1FX0B 4D3YA 2FFHA 3M2PA 4RKWA 3EODA 4EIWA 2WJ6A 3M6FA 3R6GA 5L40A 4EJ2A 1Z5WA 4P5DA 5B4VA 2E1PA 2G0AA 4CM4B 4MYRA 4IQGA 5CXQA 2I4OA 2YVLA 4RW0A 1RJ9B 2PKCA 4WLNA 4NCAA 2BCEA 3CZCA 1PYGA 2CHGA 1T8PA 4NJEA 1EGHA 1P29A 5E1BA 4EYSA 1DWQA 2ZBDA 4FZ5A 1G21E 2FP4B 2IF0A 3DTYA 2WTUA 4B3BA 3UJBA 4NCBA 1CD5A 1SQ6A 4C30A 5KYNA 1KSJA 1GGJA 1U0NA 1G6HA 4HGQA 2HH9A 1G5IA 3ANTA 5A4AA 2HO5A 5JC1A 5L3RA 1WLYA 2XTMA 4JR1A 3Q7SA 4ND8B 4RXTA 2OQVA 4DZTA 1J0DA 1YK1A 2PKQP 3DXXA 1KK0A 4Z8XA 2PX3A 5FTJA 1PTKA 1RAFA 4CQMD 2ZBRA 4TSFA 2QN9A 4ZVTA 2FEAA 4XYLA 2OHFA 1L9XA 5DYGA 4E15A 5SY6A 2CV1A 1G98A 3DT8A 2A35A 2BC9A 3HKCB 4K46A 1QO9A 4KTVE 1ZZEA 3WO0A 1Y6QA 3DNMA 1OBHA 4RVGA 4BMYA 4CKBB 2XYPA 5IZ4A 2QP3A 4HQNA 4TKUA 3X43A 1I3KA 2WSIA 4RDXA 2ZIEA 4GXQA 2IV3A 1FMJA 1GCIA 1QHNA 1J0AA 2AE1A 2PUVA 2WG0A 3Q3GE 3A32A 4ECAA 1G4HA 3F3YA 2N47A 5D1HA 5KPDA 3OPYI 3KU1A 3PHGA 3KXKA 2DQYA 3FYCA 3X1YA 2EU8A 2G1JA 3VSEA 3NOQA 4BXOB 2O59A 4F6CA 4LOAA 2J0VA 1Q50A 4HH3C 4O4JA 3PDHA 1ODJA 2JASA 3JYQA 3LBFA 1V11B 3WNCA 5JLJA 2XB4A 4PONA 5LZ2A 2E37A 4I9HA 4PBRA 5BT9A 1WCIB 1YU6A 3O4IA 2QUBA 4LGMA 1R12A 4U0JA 3DW1X 1X3LA 5CLLA 4RLFA 1CPYA 5DHSA 3GEMA 4MVJA 4UE6A 3UG6A 5I4BA 4CUZA 1O9HA 5ITWA 2ZULA 1NW7A 3BT7A 4QFMA 1YKFA 1Y33E 4X24A 4WV3A 4H7FA 4S35A 5LD2B 5AVYA 2WYIA 2NP6A 3HU3A 1G41A 4M55A 4MO2A 3SJAA 4FFLA 4Y2TA 4RKEA 1RS0A 5LLTA 2B92A 3IP8A 5FTWA 1NTOA 3V32A 2RHOA 3D9QX 1XVVA 3LLSA 2BLLA 4A9AA 2E87A 3DDCA 1U8YA 3VR4A 2WF7A 3GZNA 1TQ6A 3B8HA 4X90A 4EKGA 4L9AA 1C8VB 1VP3A 4TMXA 1CUVA 4E7PA 4ILEA 1S8FA 4UNQA 3LHIA 2HRCA 5H83A 1V2HE 1TZKA 2KHZA 2WT4A 4HNHA 4Q7JB 5C52B 1H3FA 2FWAA 3I3OA 3ITDA 5JBNA 4BNIA 5F9HA 1HE5A 5LBUA 1JEEA 2PDAA 3CJTA 3KJEA 3FKQA 4LTMA 1H23A 5JHHB 5FTKA 4PM4A 4F06A 5L8VA 1DGQA 3E82A 1QZXA 5KOYA 2QTCA 1W88B 4LYDA 3IR6A 3DZBA 1DAGA 5ALQA 4MS1B 4P92A 3O82A 1ZITA 2JHGA 1HT3A 5TMBA 5DI9A 3WOVA 1X7HA 3KLPX 3HFRA 1SKYB 1XFAA 3NHJA 1HI9A 4HDQB 4JB3A 4N6OA 4R8KA 5TQ0B 2CJWB 2HRQA 3SIRA 1W5BA 1L5VA 2Q0HA 4Q4AB 4NU6A 1TYAE 5LP6C 4DLKA 2H5IA 3CCBA 4CIBA 9ATCA 1TM3E 2EWWA 2UYHA 3VNUA 1IG3A 4QOHA 3KQQA 3ZQKA 4NRDA 1L4EA 3UEOA 4POOA 1E6EA 1EUDB 2CFCA 1A9RA 2B0JA 1CDZA 2FN8A 2BFMA 4J4TA 3NT5A 2IBSA 2NUPA 4P54A 1BMQA 1RYYA 2R6JA 2NZXA 3H17A 3B60A 3EVTA 4CIXA 4E51A 1EK6A 1NQUA 3QG1A 1GKUB 3QTBA 1FJ2A 5AKGA 2PKEA 5TY0A 1YNSA 5FA5A 5GMOA 1P4JA 4DCUA 8GPBA 2C9BA 1N4AA 3H5RA 4XRGA 1TAGA 2I2AA 3CRRA 3TRDA 2Q4BA 3LBYA 5F21A 2QLMA 1K6XA 2FW6A 4D9FA 1IY1A 1VLJA 5MFZA 3KV1A 3M5PA 4YBRA 1Q91A 4ZEWA 2V6FA 4MPJA 4KKXB 5F35A 1SXPA 1ODLA 2ENUA 4RH0A 3HDHA 4WZAE 1NJ1A 1V71A 3MELA 5EXPA 2HA3A 3MWJA 1Z0DA 2D1RA 2P2YA 2UYYA 2WZBA 4ZAVA 3KKEA 4B0OA 1XD8A 4OX9B 3L7MA 4INZA 4AZWA 1XU4A 4BY9E 3KDSE 4IMRA 4RZQA 3WO1A 3ES9A 1BXRA 2GJ9A 3FMPB 3QX7A 2BY4A 5FOUA 2L0XA 4DW8A 1QQ7A 2IODA 2YW2A 3W9BA 1GAQA 2X8WA 2OHGA 2OZPA 2KSQA 3AHHA 4X92A 3FCXA 4MAMA 3VPXA 1A2OA 4EHLA 3MT0A 4RD4A 5ECGC 3RRNA 3JQDA 3TVDA 1CXZA 2PTGA 2ZU6A 3I05A 3KR1A 3ULKA 2E49A 2MDTA 3HV0A 3WDLA 1A1SA 2GN4A 5A4DA 4NYIQ 4YAIA 1XKTA 2DHRA 1LSUA 2QAJA 3CLTC 4MV5A 1N7HA 3GA7A 3LX8A 2MOKA 5F2KA 3JQEA 5PNTA 3GWZA 1LNQA 1UJ5A 4I5FA 5IAEA 2Y2UA 3UK2A 3R76A 2K4MA 4XR4A 3KYDA 1E9SA 1LRKA 2VJLA 4I8XA 4F12A 5LDDC 1XELA 4XVCA 1NWHA 3KLMX 4L02A 5IK2A 4UCFA 3K4HA 3LUPA 1RP1A 4TS3A 3AB8A 3QUTA 1Q1QA 3C6YA 4FPXA 1W19A 2UYOA 4MVJD 4WZBE 1RI3A 3RJ9A 3AWIA 3Q2KA 5JD4A 1WS6A 4QPPA 2HNBA 2ZXUA 3HP1A 1ULUA 4MIEA 5CYPA 2QTVB 3DP9A 1PG2A 3HZHA 4G1VA 4JDPA 4DNPA 1UBUS 4PX9A 3G49A 4B6JA 1JIJA 3HSSA 1PUIA 1VM6A 4X1YA 1IBMB 5KO2A 4ROTA 4EHJA 1T13A 3HUUA 3LFHA 4FDTA 1OWLA 3IKLA 2PRKA 3F1KA 4ZAXA 1WF3A 1OFHA 3PUXA 4GKBA 2E7ZA 3FSGA 1TCVA 1FJHA 3WL7A 1B0AA 1NGSA 1OC2A 2WP0A 3OA2A 4DABA 3O7WA 4OHCA 3TSWA 1AV7A 3ZI4A 1YA4A 5BT8A 1U0GA 5EJFA 1JXMA 4B7XA 3G2OA 2M6KA 4W63A 2DWPA 3H1AA 3RAPR 1YZKA 2W8BA 2X1HA 3LA8A 3I23A 1L5YA 2AMYA 1Q6YA 2Y0DA 4E21A 2CN1A 1AD2A 1E66A 4NDAA 4URUR 1TMKA 1OYWA 5DCUA 2QVBA 2OGWA 4P80A 5G1PA 3TEFA 3LGXA 3TTVA 5JARA 1JJIA 4HNAB 5FJIA 2OSVA 4QBTA 1FXWF 3QH4A 3VYTB 4FEGA 1FK8A 1ZCBA 4N5LA 4IUDS 2WG1A 2JD0A 2RI1A 2PXAA 4II2A 4JASB 1IHXA 3UJ8A 1K6JA 2JCVA 3A2MA 4L28A 3EC7A 3TB4A 1WHTA 1JYSA 4NMMA 1XZLA 2FPPB 5HG0A 3PC2A 4LOHA 5K6RA 1WBJB 4JENA 3EQ8A 3N8DA 3QW4B 5HKLA 1JBKA 1MABA 1TVEA 4RTNA 3UJDA 3R7FA 1RAEA 4CLRA 1FIUA 1VIDA 2FN7A 3I12A 3IA7A 3X0DA 3JD4A 4FLMA 3MYYA 3EFOA 4OQ4A 2YXPX 3R9KA 4KCGA 5LU8A 2QTNA 3PT5A 2R4QA 3LCUA 3BWXA 3GVHA 3PI7A 5WRFA 4BYGA 4C6SA 2Z56A 2Q3BA 3ANNA 4TYMA 4FB5A 2UUPA 1YVPA 3WB2A 4YRIA 1X39A 4IXDA 1IZ0A 2VEDA 4C4YA 3HB9A 2KBFA 5EMHA 2OCDA 1KI7A 1H6CA 4QDXA 1P7YA 4IZHA 1Y9DA 1K7XB 1Y1TA 3BH0A 1Z88A 2HDHA 2BP7A 3HLKA 4GPZA 2QX7A 4NH4A 3TE6A 2Q8PA 5A5FA 1XZAA 1GN9A 4AULA 5E1DA 4HLDA 1MVOA 3SXPA 3NHYA 4C7MA 1AF7A 3HV2A 2BDEA 3RYHA 4C6TB 3I64A 4RF4A 4BFLA 1U2DA 5KBYA 1RKUA 4BU1A 5BRAA 1TCAA 2DQKA 3TEMA 3BGVA 3GFRA 2F1OA 1M73E 3GEPA 1T24A 4Y1EA 5J4VA 3T7TA 4FEYA 4QOIA 1OASA 4B6QA 4WAUA 3KQYA 4Q24A 3TQHA 1AOXA 4HUQB 5JS8A 1JA1A 4CM9D 3WGIA 3MQ2A 1NOKA 3VPCA 1JALA 1MIHA 1NZDA 1BS9A 2ODEA 3SBEA 2AN1A 3W6NA 2WM2A 3S5UA 1QGUB 2ZB3A 2VJBA 1XDWA 5CM2Z 2RKBA 4ZMSA 1HNWB 2PH1A 3OQPA 4W99A 3H19A 1IAQA 4GPBA 3ERCA 5A62A 3PC4A 2WWVD 1N78A 1BW9A 3R3YA 3D4OA 5JZ9A 3IAEA 2MMGA 2E4YA 4RF5A 1E4OA 2RGCA 4ZZ1A 4NPCA 4U00A 5BV7A 1NR7A 3V4OA 4G65A 2R8BA 4PAOA 4ZC1A 3FTFA 2ZVPX 4YP7A 1DOHA 2C4VA 3ZCUA 2CBGA 4HGPA 3H5IA 2WIFA 4DPLA 1W87A 4PN3A 3I83A 1G0OA 2ERYA 5IEBA 1X7ZB 2CVQA 3ISTA 3L77A 4DMFA 2MJLA 3NC0C 4BPBA 3RTDA 2W6ZA 3OZ7A 4KNWA 2A5FA 2BCGY 2PTHA 2SCUA 4ACBA 4ENRA 3RUHA 1W0KD 5IKXA 3ZDEA 2PSFA 5GV8A 4A8HA 3ANLA 2B2NA 3QPUA 1MEJA 4QFDA 2ENWA 4ZCSA 2O5EA 1P2FA 3AKYA 4NH0A 2P91A 3NIFB 5JH7B 1P62B 3HNPA 3R0XA 1GQFA 3UAWA 4AKTA 4DMLA 1V16B 2O3TA 2R7KA 4WTOA 1AU9A 2W4QA 1T0HB 1Q0UA 5AW0A 3H11B 2FDRA 3G7SA 1VIYA 1QYIA 2QS9A 1JKFA 1X1QA 3NHPA 1D4OA 5KS2A 3AEUA 2NQ8A 1NBHA 1C30B 2D1QA 3A1TA 1PF7E 1QK5A 2GNOA 1BWQA 4ZA2A 1NKTA 4YCSA 3PNOA 2FWIA 5BWCA 4HYQA 3RVMA 2WTEA 3PXDA 4COKA 2P9TA 3QRWA 4DPMA 2V4ZA 1M2HA 3KKQA 3CZQA 3A4YA 2OT3B 1A8HA 1PX2A 2NYUA 2ZUUA 1ODKA 2WPDD 4NYJQ 3TCNA 3E7XA 1VSVA 1CF4A 2WMOB 1ZXLA 1UBHS 2XUDA 3L7JA 4QPJC 4FYWA 4AUMA 4QJ3A 1UIMA 3UJPA 4JJIA 2H1IA 4F9GA 1ENYA 4E1BA 1W4LA 5E2IA 5FO1A 4JSYA 3U3OA 2GK7A 4R6WA 1ORRA 2JKYA 1W2HA 1F20A 1H2EA 2Z2IA 4YMUA 2D7JA 2Y1KA 1EK2A 2E2WA 2FR1A 2X1VA 3D43A 3CEPB 1J0CA 3GRAA 2AN4A 1TJ4A 2C00A 1CR4A 1XJ5A 4UCXA 2DQZA 3D81A 1HQDA 3G5AA 3INRA 3K9CA 1RP7A 5KAPA 1A3CA 2ZB4A 5AIAA 4JJEA 1SQ5A 1XMSA 3NFRA 3DGFC 3TGLA 3ABSB 4GZ3A 3IERA 5EEGA 2PGDA 5KYVA 1DBRA 4D45A 3BH6A 2O2YA 3TDKA 2OBMA 1UQUA 3LP5A 3OTWA 3RSOA 1U0RA 2D3WA 4EITA 3DA8A 4C7OB 1OILA 1FP4A 2R44A 4KOAA 4KRGA 4LRUA 3K9WA 1IWBB 4U63A 3WGLA 2R66A 4B3IA 4RLQA 4OCZA 3BERA 2OAQ1 1AZTA 4EKDA 5BN5B 5BMOA 2VCEA 2AI2A 2XNSA 3I73A 3ZWAA 5IH7A 2A78A 5JDIA 2XRZA 4Y30A 3KZCA 1NHGA 3B78A 1YUNA 4C7KA 3ABIA 3FPLA 2Z1MA 3UCEA 1C80A 3MJHA 3MAGA 3OUUA 4J03A 1JAIA 1V47A 2REXB 3D59A 3TOVA 4ZAYA 4G0UA 5HZGA 1KORA 1UOOA 3IELA 2ADFA 4DM4A 3W7BA 1HNNA 3I8OA 5C34B 2ATIA 4PNZA 1NOJA 2PCJA 2PK3A 4MP3A 2IIPA 1V9CA 3O4VA 4QQNA 1XF9A 1CRWG 4FE3A 4U9IS 4EHIA 5IF3A 3RUEA 3TNJA 2CXRA 1WXHA 1XNGA 4CHGA 5EL0A 4AD8A 3RODA 2XE4A 3O1LA 5IW8A 1KDTA 3X1KA 4UFPA 3E23A 4BB9A 2OBXA 1FLVA 3JW8A 2NSHA 3L40A 2QZ4A 3PC8C 5LZ7A 3BXOA 3MWGA 2WR8A 3C98A 1GDDA 2HIAA 2FSHA 2WUWE 3NWOA 2BHNA 4XUCA 3OCWA 1T3ZA 4ZFNA 1KHHA 4Q05A 3ESQA 3LECA 4AZ3B 1NUQA 2Q3HA 3WLIA 1K3TA 3OLYA 1V8OA 1X6VA 2OAP1 4L8WB 1T25A 3DDHA 3EXFB 2BOVA 3VI4B 3WJ1A 1EM8B 1O96B 3CV3A 4UFNA 4V0KA 3MWDB 4CR6A 2A92A 1BX1A 2A14A 3FFAA 3IVCA 3ND9A 1Z4OA 1L5MA 1LPOA 3TIVA 1KVUA 1AURA 1EP1B 3ON5A 3C3CA 3CGGA 5DEIA 4F7WA 2G83A 4KRFA 3RFUA 3BL6A 2VSOA 3W7AA 2F59A 4ME6A 4AFNA 1I7LA 1XU9A 1VZ2A 3IJPA 4EEKA 1NJFA 4EQ6B 2GPWA 2QLNA 5K8JB 3EAGA 4P5PA 1DCTA 1YS6A 3M82A 3WMFA 2I62A 1CZHA 5FWNA 5KTKA 4OQYA 1RI2A 3MNFA 3JARA 2DR3A 1F8UA 2GD6A 1DQRA 3A6LA 1KR5A 4EUNA 3I5YA 1YDHA 2ACKA 1JR6A 2XNKA 3H1GA 3E5HA 4TV9A 2OM6A 1CNEA 5A06A 4EECA 2DSTA 1KFCB 1WBDA 4PINA 5HZMA 2ON6A 1T9ZA 2MYTA 3D7NA 3V5NA 3GHYA 1W8IA 4EL0A 2WNHA 1SBZA 1W5AA 2JIRA 2V4UA 3SKVA 1YU9A 1BMTA 1DIBA 3GELA 4PC1A 4CTMA 2G28A 3INNA 4E46A 4PAGA 4KZKA 4DJ5X 4EX7A 3DTVD 1Y4AE 3ENQA 5CK5A 4ZT7A 4PYRA 3RHTA 5AM5A 4A0SA 2ZRAA 2P78A 2B5WA 5FTMA 4ZYWA 2Y4NA 4L76A 4BQPA 3RS2A 4EDHA 1NG1A 3N76A 5ALRA 5JYCA 4GECA 4J0CA 3ANMA 3PTZA 1N0UA 3PENA 4FE7A 2IYLD 3P19A 2CBZA 3HDVA 1B26A 3OQ1A 5AVSA 4HWSA 3OE7A 2ZUTA 2MTBA 3EASA 2PSHA 1VJ0A 4C2BA 1NL3A 4ZOQI 4QASA 3U7EB 2RHWA 1M6NA 2CKDA 2OCIA 5EHQA 1IN4A 3AETA 1NWCA 4MOWA 3OOSA 3UMBA 5HPYB 2OC4A 3JVIA 3KQHA 1KDPA 1V8PA 3DLBA 2VATA 1OWOA 4B35A 9LDBA 3FXAA 1OYVA 2Q4EA 3IT0A 2GOYA 1YKGA 2BZ1A 4HF7A 2JHFA 3L4JA 1SNYA 1REQB 4FDMA 4YDQA 3B20A 3CN7A 2UXBB 1BJKA 3UUFA 2WWGA 4RTKA 3ZD7A 2I7XA 4DQKA 4R2JA 2FHPA 2DLDA 4H35A 3W4JA 2O8BA 1IZYA 1NU8A 4RK1A 1ZIDA 4P84A 2O8DA 4NK4A 1K5PA 1O9GA 3AL0C 2GI4A 4X00A 1V43A 1XTJA 4DCTA 4DIDA 3LQ2A 1YGYA 2ZT7A 1QYDA 2ZR7A 1K66A 3D2LA 4LQLA 2ZSUA 1Y6FA 3TR5A 3H6HA 3HYRA 2VJCA 4JNCA 1OH6A 2GEKA 3G7NA 1W8DA 3T99A 1TZJA 2Y76A 4DBLE 1NP6A 3ELYA 3BFJA 3MJSA 1H0SA 3ECSA 3H2JA 1JHOA 4MVJI 1GPLA 2ZK7A 3LXXA 3H8VA 3D6JA 5JAUA 2AV6A 2H06A 1HF3A 1RM4A 3U7HB 5LUBA 1USWA 3B3FA 3MT9A 4P33A 4RZIA 3V4PB 2XJ9A 2QRUA 1PV4A 2AJLI 3AVXA 1S9HA 1K06A 3AW8A 3K20A 5THKA 1KDVA 3KUKA 2ZUDA 4OI1A 4V1CB 1NFRA 3FGPA 3H6KA 4YI3A 4H7PA 4LJLA 3U1VA 4ZEXA 1K5HA 4J0KA 1ZOLA 4JD5A 4R9NA 2AL7A 3HVHA 5AVQA 1GT6A 1ECFA 2G07A 1KHTA 3BIJA 4PEVA 4RWEA 1FVFA 1NRXA 5G53C 2C2MA 4HATA 4GOKA 2Y0PA 1NXVA 5TGTA 4RE5A 1U3DA 4NXMB 2WICA 2ZS9A 4K8RB 5AK0A 4AQYB 3OQHA 2OBFA 3F73A 1XZDA 2ILVA 1VE1A 2N1BA 1UC4B 1H4TA 3OQIA 3SQOA 3VU9B 1LWNA 2HB6A 5BSVA 5JSQA 4ENSA 4CKWA 4N5NA 3ADDA 3PNSA 4Q3DA 3A1DA 4G1EB 4ZYTA 3ZWYA 4L3OA 3AL3A 4DAOA 2ID7A 1KQNA 2O2JA 3G9XA 1J22A 2TS1A 2VXCA 3H7AA 4LQCA 3OJ0A 4J0GA 1QH1B 3NBKA 3NDPA 1B0ZA 1HRDA 1YD7A 2C7BA 2RIPA 4OP1A 4DCGA 1E5DA 1Q1BA 5L3QA 5K2MA 1ZIYA 1J39A 4D9HA 4MWBA 1IDOA 4KR0A 5DN6D 1BXKA 2NV0A 1EXNA 4KQHA 4X71A 3M3HA 3VYRB 4DNOA 5HIAA 2GPTA 1HL7A 3ONDA 4R2XA 1E3DA 4F2GA 3AK4A 3IUSA 1CULC 4ENUA 2O7VA 2XNJA 4EG5A 1W25A 1H5NA 3ZVLA 3RBVA 4RKQA 2UUOA 1ZK3A 2C2BA 3T1OA 1N5KA 2PPVA 3RLFA 2V3WA 2UKDA 4NLLA 1N8TA 4DLVA 4A36A 2I91A 1PZFA 2DUJA 3R6WA 2B20A 1EBBA 2GN0A 1SVMA 3LKVA 4YXWD 5G4KB 5JAQA 1ZH6A 4G8DA 1I10A 2I4MA 2VO1A 2PRIA 4U9HS 3SHQA 4ZJPA 2K87A 2D2XA 1U0EA 4EO9A 5JPCA 4C07A 2HLPA 1ICEA 1ECPA 1UL1X 2FFRA 2OC9A 4RK0A 4DLSA 2WWYA 1TF7A 4KODA 2QY6A 2PRSA 2IZ6A 2QVLA 1GVNB 2X9LA 3GMIA 1CUCA 2DUMA 5F1KA 3QWBA 3VHRA 5KX5A 2HMSA 4L3WA 4G26A 1PT7A 2J6CA 4O0LA 2FFQA 4HJXA 4UQPA 1TYDE 1NI4B 1OXXK 2L19A 3KC2A 3PXGA 1Z2PX 2V7WA 1Q0SA 4HGNA 5K3OA 4L0QA 5KYTA 4WFJA 3KOOA 3I0NA 3KELA 5IAJA 1WVIA 1Z7GA 4N9WA 3TUIC 1AQUA 2OOSA 4S0ZA 3HJHA 3RVRA 4FB4A 2AK3A 2CUTA 2FEKA 3W7VA 2BGTA 2VAWA 3GCGA 3T5MA 3IAM1 2IBMA 1RMQA 1XMPA 3SMVA 1MJFA 2P4EA 4Q5IA 3WP0A 2OV3A 4MPDA 3RS3A 4Q15A 5D7BA 4CM3A 2G3YA 4EM6A 4ZI7F 5BSHA 2VPQA 3L49A 5LP6B 1UJ4A 5A4IS 5BV0A 2CHQA 1XC7A 3CUYA 4PO9A 3OHPA 5B1IA 5KHOC 3TPFA 2FF7A 5M29A 4QGHA 1FFBA 2KMLA 1Y4ZA 3N2KB 3RUFA 3ZKWA 1EK0A 4GOND 3KKLA 1VBMA 4EJSC 1FMFA 3U26A 3VJMA 2X7XA 4UFOA 3V7FA 3WL8A 1II0A 1OAOC 1Z0ZA 4KSCA 1C3JA 5DMHA 1MJGM 4IMJB 5YASA 1RABA 2LP4Y 3OQMA 1NF3A 4QXRA 2AFHA 3HBNA 3U0BA 2VEOA 3VSAA 4KQJA 2FUNB 1NLZA 2E4UA 5HRAA 5IABA 1W7AA 3DT6A 1DB3A 6LDHA 1JW9B 2Q3FA 1FNDA 2R84A 3E4DA 4FUQA 1CVLA 1YS1X 1IOLA 3ROZA 4MYTA 2V45A 4JGBA 1QQ6A 1YIAA 3G89A 4RESA 3SIWA 5K2OA 4EVIA 3UXMA 3B1XA 1L7EA 1DI0A 1EVIA 3V2UA 1N5IA 1VSQA 3IEPA 3SYMA 1EGVB 5IM4F 3LX4A 3MUFA 1QHXA 1MJNA 4CF7A 3AI1A 2QXUA 1UDAA 4JBHA 4DSUA 4YAEA 3OTOB 4TZTA 2PYDA 3WV4A 3AQ4A 5FXMA 2ZW9A 2BIFA 2CGEA 3KK0A 3TZHA 3DKRA 4PLCA 1GV0A 2IHKA 1OAOA 1TUEA 1Q3HA 3R2JA 4ZGWA 3U3JA 2BZGA 1BROA 2VK2A 1R9MA 4ZAFA 1Z35A 1H69A 4JQSA 1VL8A 4GH5A 1JLRA 4MLDA 5AOBA 4CTKA 2JI4A 5J1SB 4H2DA 3RC3A 1CUFA 1QTIA 4CEHA 4XPIA 1XZ8A 2H1FA 4HB3A 5HK8A 4TWZA 3VDRA 4BFYA 3W5CA 4IJUA 1GNQA 3EUWA 1I14A 5CTAA 4N6GA 1XRMA 3LYUA 3EZFA 1T36A 2JI7A 1F2UB 4WOBA 3FZNA 1KS2A 4HEA1 1WVMA 4JLUA 3UC5A 4Z6KA 4NESA 4XGQA 4P35A 5K4GA 3JAWB 3MOIA 1R0YA 2A5DA 4HAVA 1MU0A 1ONSA 1N1GA 3OPXA 4F97A 1ABEA 1EUZA 2RSLA 1ADJA 1CR1A 2C9OA 3N2NA 5T8KC 1V5WA 4X3CA 3RIEA 5ARCA 2IPMA 1OPXA 1E18A 1O87A 2UVPA 3RQIA 3UCXA 5BSEA 3HVJA 4UHBA 1V11A 2ACEA 5JNSA 3D5QA 4I4TA 4WNAA 3GROA 3P5SA 1EFLA 4MRMA 3QKSA 1G5TA 2Q7OE 2GPYA 1RJEA 2HF7A 2RCNA 3CF6R 3BHMA 4G8JA 3AHGA 4TTQA 4RK5A 3RRYA 3W90A 1W36D 5COBA 5CPFA 2IELA 1CJCA 2JGLA 3R5HA 5L7YA 2Y67A 3F74A 2NXCA 3V1YA 3F8WA 1QX3A 2OD7A 2VT7A 1CB0A 1FVHA 1OLXA 4OMUA 1ABBA 4M7WA 4D43A 3TW8A 3D7RA 4LZNA 2Q5EA 3SY8A 4KV7A 3TQFA 1U90A 1YQXA 3BZWA 5BNWA 2G67A 3QTLA 1UKCA 4W6ZA 5T8KA 4A03A 2BEWA 2PJUA 3MHTA 2OQRA 1BG6A 3CB2A 2N42A 2O0JA 1GR1A 2R6FA 3ORSA 4MQ6A 4DT1A 5KNCH 4ARIA 3HCDA 3GCDA 4TMVA 3FN4A 5ALMA 1NDQA 3UBMA 3EW7A 2ADMA 2H51A 4WXYB 5F4BA 2HK7A 3UENA 2NV2B 3G8CA 1RLJA 3L92A 1KF0A 5P21A 2GPAA 2C2GA 1MB9A 5A5VA 4HZUB 4CG3A 2O3QA 3IJRA 1UXJA 4BBPA 3DV0B 5EKUA 5IRCD 1NBME 1Q19A 5AHWA 1NATA 5B3AA 4D7AA 1Z4PX 4BFWA 1IK4A 3FKSA 4X97A 5H82A 3VNVA 2XDAA 2P67A 3IS3A 1DJMA 1XMJA 1QZ3A 4M3NA 2PMEA 2ES4A 2VHQA 1Y1QA 2ONJA 5IUNC 5FLXA 3VKHA 1SURA 5FHQA 1VI5A 1H6DA 1NQTA 1JR3D 2CFOA 1RKQA 1VJTA 3VZSA 4CBVA 4QECA 1CRZA 4L1KA 2I76A 5JRZA 4CV1A 3I39X 4B73A 4EF5A 1YWGO 3C6BA 3TPCA 2BFEB 3VR2D 1UFOA 4LC1A 1UBKS 2DFPA 5HM8A 4JJFA 2HWYA 3IO3A 3K4PA 3G5TA 1VE3A 1DAOA 1PFVA 2EF0A 4KIGA 4B75A 2DPLA 1BIFA 3AVPA 4EY8A 2G5GX 2YC4C 5CNIA 3T9BA 4AY2A 1VL2A 1PYOA 2L2QA 1HTWA 4GPAA 1KZYC 3GVCA 3P9RA 3PVZA 4WMLA 3SYRA 2VDWB 1EFDN 3EGEA 4QDKA 3UH0A 2QYOA 4BWYA 4Y0AA 3NT4A 3SF8A 4UUQA 3RTBA 3GO4A 4N48A 1NV9A 1GAWA 1IPEA 2I0FA 2XITA 4FS8A 4N9QA 5FUWA 2YS7A 3OJOA 5HS6A 3O90A 4B31A 3A9TA 3C3YA 4JLNA 3T7AA 5LIPA 4Z53A 3SOZA 1JDBC 4YQYA 1WXWA 3RI3A 2C61A 3THRA 2DCMA 1YDMA 2GRJA 5LN1A 2VHXA 2ZTSA 3G0DA 4ROSA 1J0XO 4UOEA 2XZLA 1VGRA 1S1CA 3MJFA 1CW2B 3GHHA 3PB3A 3P9KA 4MW6A 3UKJA 2UXCB 1PWZA 4HWRA 4ITRC 4LRYA 2DRIA 1YBVA 3RT7A 4QRDA 2YMPA 1XMVA 3QIAA 5IN5A 3T7SA 3WL5A 4EF6A 5JJCA 2VDQB 3F5FA 3EPRA 2NU9B 1CC1S 3IIJA 4RMGA 2IY9A 8AT1A 4G85A 2P3QA 5JSZA 4MLZA 1FMCA 1T9AA 1YVEI 2XUGA 3HH8A 3L8MA 4G6ZA 5D5QA 3TQIA 4B6SA 2FP3A 2B4QA 4RVSA 2GM3A 1QRSA 1AGYA 3D4BA 3GCXA 2JGDA 3LW8A 3P0RA 4MB2A 3ZDZB 4HP8A 1OGYA 4NZYA 4HDKB 5JCZA 1O57A 4QYSA 1DP4A 1H1LA 1M2OB 1IUNA 1Y3HA 3MINB 4J7AA 1YZ3A 1COZA 2ST1A 4C0SA 4ATNA 1OA1A 3FM9A 1FW8A 1CB7A 2WWRA 4M1MA 4YDSA 1HFJA 1A2BA 1NMQA 1T9GR 2OCGA 3OHSX 4TLLB 3UTDA 1CE8A 3VR6D 1IRIA 1NQ5A 1SIUA 4B3DA 1O95C 2GN8A 5LYJA 3X1JA 5DGDA 2LTAA 1QG4A 4ENTA 1W36C 2WU1A 4DVGA 4NKRA 5CIQA 3BZBA 4XYGA 3E70C 4KK3A 4B2YA 3HFJA 3NDRA 4LJSA 3RGWS 5B3KA 3K9FC 4UKDA 3TINA 2XWJI 4MDEA 5GADl 3FUUA 3G8AA 2QMOA 3LM8A 3RYFA 4DMUB 4F4UA 4TZ6A 4TWIA 1T43A 3BBLA 3DMGA 2CLSA 4DMMA 3BIWA 5FAXA 5CAEB 3WMEA 2HU8A 3CHYA 3D6VA 3F9IA 3LRTA 1SEPA 2VH1A 3KPYA 3GLHA 4YAJA 2BEUB 2IYVA 1MTOA 1GRRA 1XRSB 2GAIA 4TTJA 1ZR2A 3OIFA 5FPSA 4XVRA 4R3NA 1VRWA 3RK1A 5EPOA 5TT0A 3OWOA 1RRKA 5F5LA 2P2GA 4UMFA 3GNLA 4YT2A 3EK2A 3EVFA 1LVHA 3EMKA 1O95A 1HNZB 4O2BF 2GHRA 2QZPA 1MNQA 3BFPA 3IIKA 2G9ZA 3SEAA 4GFDA 1VCMA 2GAJA 2GLUA 3A9SA 2JFUA 3EXHC 3GUZA 1N6PA 3F0TA 4X45A 3S44A 2QSZA 4EY4A 2VP0A 1N5MA 1Y3AA 2JCYA 1OBCA 1EHIA 1T5BA 3CCFA 4R2IA 4XJXA 4MZXA 3DWEX 2WIDA 5JFOA 3P0JA 4K40A 1V6AA 1NVGA 1E0JA 4CLEA 3Q40A 2GILA 4IY1A 1FXSA 2NM0A 4HAOA 1K6IA 1XJWA 4YJGA 3RS9A 4B83A 3EARA 2VP4A 3DEZA 3NALA 2H00A 3HSYA 4MW0A 5ALEA 4ZANA 4M54A 5GVRA 2CBXA 3MZ0A 3DMTC 1JDNA 3N0VA 4MKZA 3TPZA 1PL7A 2EEZA 3JYLA 2QJTA 1AQNA 4EYKA 3DHWC 2EZ9A 4IDOA 1DZ3A 1GPBA 1PK8A 2RG7A 4MCAA 2YMMA 4NENB 4TRNA 3QW2A 3UWDA 1W581 1P33A 1Z4MA 5C1BA 1Q0RA 1K0FA 3ZDQA 1KVRA 1M34A 1WW3A 5CFQA 2X8JA 5TF4A 5CB4F 4MS3A 1F0YA 3HP7A 5K3AA 2ZZNA 4DWVA 3ICQB 3L01A 3EEBA 4K6GA 1FNBA 3KOZA 1BKSB 1FZQA 5CIYA 4K9KA 1JWLA 5DOZA 1Y7HA 4KQCA 4F92B 4A8JC 1SVIA 2O5RA 4ZU6X 5LNK6 1INLA 3EG9B 3G82C 1JFFB 2YXEA 4TVSA 2W2OA 1Q0LA 3MWFA 4LXTA 1OIXA 2C77A 4OHKA 2B8JA 4QU8A 4P08A 5HDBB 3DMTA 3NHWA 2BHRA 4FC7A 4LBYA 3IUBA 4J07A 3GLFB 1EI9A 2P2SA 2GB4A 3S2SA 4BDTA 3AF2A 3UB2A 3AERA 1VG0B 4XD2A 5GJBA 1ZH8A 1RBYA 4G1UC 1HX7A 1U1EA 4CGZA 2PRYA 1V5EA 1M5UA 1RMTA 4FSHA 4QQFA 1M0EA 5IT5A 1XJQA 2R1ZA 1K9VF 1F3LA 4MR8B 3DMFA 4UU7A 1N6IA 2VDMB 2HDOA 4XCXA 4XUEA 4YN3A 5TEWA 3VBCA 4EH1A 2W2TA 4ZCRA 5KQGA 2IWHA 2O20A 1XQ9A 5DVZA 2JFBA 1Z13A 1N57A 2D59A 3O8RA 4MKFA 4G8CA 3F6RA 2G9UA 4A8JA 1I33A 4FR5A 3STUA 4EHHA 2L42A 1ZGZA 3P94A 4PYLA 4K9PA 5AK5A 1JQKA 4KQFA 1ORWA 4RXMA 2BHTA 4DUGD 3L4BC 4JJ4A 4PZEA 2NU8B 4MWEA 3VA7A 3PJRA 3TB6A 1QP4A 2COUA 3QWFA 2DQ4A 4XUGB 5JJLA 4L22A 3QLJA 1Y8QA 4MI3A 5HOEA 3TW0A 3PUIA 4R8MA 3K9QO 4F60A 2Y68A 3U4IA 4UBKA 3AY0A 4L07A 3VYUB 3QF4B 2GEFA 5EOVA 1CR6A 2IP2A 1EJ2A 1YIOA 2QIOA 4GM0A 2JGMA 5TE9A 2AHOA 4KE9A 1X7ZA 3L0SA 1N6LA 2YV5A 1HSOA 1I2ZA 4LRSB 4LXYA 3B6MA 3FCAA 2I4RA 4ZU1X 2HDNB 5E4TA 3UBTA 5DHTA 1G2QA 3HU2A 4JELA 4QEKA 1EDOA 3LDGA 2QRGA 2W7TA 1W0JA 1GGVA 1MC8A 2J59A 3I01A 1P7PA 1CKEA 2XTZA 3KIPA 5REQB 3K5PA 1IXKA 2R25B 1QS0B 1XZBA 3L4BA 2H0QA 4HGZA 4L4RA 4YMWA 5EP4A 1E60A 3VXKA 4CLHA 3A4MA 3GLTA 3H11A 2O54A 4WY8A 3ZOKA 3QSYA 2G70A 4JKOA 3FHLA 2VRBA 2ZYTX 4MJXA 1XTVA 3UWMA 1GTVA 3WGKA 1C7QA 3RGGA 1XXHA 3KKKA 2OCXA 4L5JA 4BVJA 5IP5A 4D4HA 5H5JA 4FXOA 3TD6A 2ZSHA 4JJAA 4ZCTA 2RIRA 4I19A 1GV1A 2AOWA 3QVUA 4LKRA 3DE7X 4JLVA 1Z4LA 2J3EA 5T64A 1YOVA 2XT9A 4IDAA 3WDKA 3V8VA 4EG4A 3P45A 4G5FA 1ISPA 2QVZX 4D6PA 5KNLA 1QF9A 2I2WA 2Q27A 3D02A 4LXXA 2PUJA 1OXSC 2XMPA 4KN8A 2J3QA 4X1IB 1D2GA 3QPVA 3RTCA 2WUVA 1SVOA 4G67A 3RC2A 3KTAB 1I5EA 2GM5A 4EKIA 2EOAA 1QOQB 3BE8A 3RSFA 2OHHA 1C5KA 3O8DA 4M1SA 3CUKA 1Y4DE 2IUUA 3NYRA 1Y63A 4M4SA 3PFGA 2ZZKA 4XDZA 4I4NA 5GZ6A 2HL6A 2XRYA 4R31A 1Y3DE 2BFPA 2Q9CA 1LBSA 4MICA 2VJPA 1B6SA 2Z3ZA 2O8VA 4RFSA 2VNHA 5CW1A 2RFLA 3JATB 4OMDA 4XJSA 1EQAA 1CJTC 5EN4A 4B8WA 5KYWB 1A97A 3MT7A 2WFLA 4BQIA 1O8BA 3WBFA 2UAGA 3CLSC 3M49A 2PBFA 4KMRA 4A0FA 3RIYA 1LPNA 3H7IA 1LQTA 1RT9A 3CURA 2GVNA 3B9BA 5EQTA 5J43A 5KSOA 3SP1A 3OEYA 4D9EA 4WECA 5BN5A 2XMSA 3S2GA 9MHTA 1F6DA 3PUKA 2XB2A 1J90A 1K75A 4WLUA 4Z0TA 3BKWA 4LXHA 1TLTA 3ENNA 4OIMA 1G3QA 1Y7TA 2BE9A 4MW4A 3A11A 4LYEA 1FW6A 2BI7A 3VTZA 4G0VA 3OZWA 1AQIA 4RHEA 4FEEA 1U9CA 1L5LA 4A10A 2C9YA 3REQB 3ZW7A 1K92A 3S3TA 1NLYA 2LDXA 4R05A 2R1TB 4WY5A 4AZ0B 2GFIA 4Z1OA 2DEUA 3CRVA 1K5DA 3RJMA 4LCJA 3H86A 3R3HA 4G86A 3RV3A 4GGPA 3WKAA 3T3PB 1UIRA 1EVJA 5D3KA 3DLPX 2J48A 5B53A 3NU1A 3WLPA 1VL0A 3U4QA 2GF2A 2VPIA 3CH5A 3K16A 2D8MA 3M89A 1PFUA 1V45E 3QMMA 5HJ7A 1VDZA 3A1FA 1YZQA 3BCHA 2ZJ1A 4I7EA 3EEOA 5AVWA 1GGHA 3AYXB 3BFXA 1JAZA 2WTXA 4LBVA 5KNCA 3N2GA 1KRWA 4G5SA 5AM4A 4P0TA 3JYOA 3Q9NA 1O0SA 4EPYA 1QP8A 1I7NA 1BXGB 4KAJA 2I1WA 2VF8A 4LWOA 3SFTA 2A33A 1HTBA 5FLEX 2B4AA 4KP7A 4RA6A 1IY2A 2HJHA 2JCXA 5J9FA 5JAOA 4P9NA 3VDXA 1XU7A 3HNOA 1RKXA 3DAGA 3CUSA 4OHZA 4GU5A 3L79A 4X8MA 5G3YA 2GS9A 2Z57A 4EQ6A 1SFRA 4KLCA 4WCDA 2H9YA 3QU5A 3U4DA 5BMVF 1JG3A 1NC1A 4WESB 1EBUA 3VAZA 3CNNA 4C21A 1C50A 3TR6A 1MD9A 2H4XA 1LB1B 3C1TA 1ADCA 2QTFA 3Q2OA 4YIKA 3GFGA 1RWQA 4PG5A 1A9OA 4BHTA 4DWOA 4A8TA 5EZYA 1RIFA 2WFZA 3BXEA 1M9NA 1S3FA 3RC8A 3BE4A 1H2HA 2OB1A 3HXTA 2BTQA 4RHUA 4UNRA 5IHPA 2C0PA 1F6WA 4P3KA 3ZLUA 3DPUA 3FHJA 2YS6A 2PSEA 4LK3A 4AT1A 2Q45A 2B7BA 2Q2NA 1Z5PA 4QBFA 2M1ZA 1EB8A 3PUYA 1CQZA 2P2NA 2AZTA 3QVLA 2O2DA 4DREA 4I8IA 2NPFA 5KWSA 5F1YA 1S7CA 1NJ5A 3IKTA 1L6RA 4ZPJA 2PUFA 3UB4A 3T1QA 5SYAA 1DWPA 3AR7A 2D0OB 4OYYA 5CLQA 4CLOA 3GD7A 3SN6A 3RU7A 1MO4A 1RQ7A 4PLGA 4HGOA 4CUKA 3EQ2A 4CYMA 2UDPA 2CCJA 3OQOA 1GL7A 4FX5A 3Q6IA 2JJ8A 3KTDA 1V1MB 3PL1A 4E6EA 1O58A 1QF7A 3AFGA 3IQZA 1A7UA 1P7CA 1E2UA 2ZWIA 2F3TA 5H7XA 2VTBA 7REQA 3GEHA 4FE4A 4P7KA 2GMWA 1UH5A 3SC2B 3IEMA 3SBDA 1ZKMA 1ZGBA 1HMPA 3OZEA 2PUTA 3QLTA 1Z82A 4WK4B 5HIMA 621PA 2XEXA 3K1ZA 3RUDA 3ZNNA 4F93B 4D82A 3IULA 3KT8A 3A04A 4N7JA 1IZ7A 1Z2EA 4I2VA 4GZLA 5IC4A 1SZPA 1TUBB 1X0VA 3CLKA 4BRWA 1D4ZA 2PX5A 4D97A 1TZ2A 1ZJZA 2W2KB 1JHPA 2ZBVA 4FMDF 4YJ2B 2QD3A 4QYIA 3ESAA 5ALYA 2W42A 4LE1A 1U0TA 2QM8A 2Q21A 3DOIA 1N3LA 1LBTA 4KYIB 1CIPA 1K0UA 5CB8A 1BE0A 4KIWA 4C4XA 1BXZA 1COWA 2X19A 1J7KA 1FUYB 4PCAA 3H3JA 3ZY3A 4EYQA 3MFQA 3BPSA 4H27A 1VKJA 3BWYA 1TYEB 1R0SA 2VYVA 3UCFA 2FMKA 1CUAA 1OX4B 2ZAIA 1P0QA 1OVGA 1ZNZA 4KPUB 2CWWA 5KNDA 4N49A 4GQBA 1LBHA 4XQ9A 1YL5A 1A9ZA 1DVRA 1FFXA 2WU3A 4Y9UA 3J80A 3A6EA 4ESEA 1JP7A 1UDRA 1ZK0A 5TEVA 1PEDA 2NNLD 4H17A 3K0FA 5J2TF 4UM9B 4ZMBA 4MRAA 3FD8A 1P31A 2VJAA 5FB3A 1RYFA 1P91A 1S8OA 2FPXA 3M81A 1T1EA 3IQGX 4NBTA 4P6VF 3DW3X 4PLHA 1Y9EA 3FX2A 1L4KA 2EV9A 3WNQA 3AY3A 5JNLA 2P9GA 3V2HA 5EUCA 4JUCA 1K4MA 5IWCA 1LRJA 4ZQCB 3S7ZA 1W1UA 3EMVA 3HBFA 4K7JA 5FOXA 4W7IA 5J59A 4AS3A 2R00C 5LQCA 1O5OA 2ZE5A 3MJRA 1E7YA 1F60A 2BDUA 2FUEA 1L7OA 4LDAA 2VH5R 5GONF 3HB0A 3ADBA 1K8YB 4K0RA 4X6YA 5EIXA 1II9A 1N4DA 4Q7EA 1BA3A 3OKFA 4MQMA 4XAQA 2ZUFA 3AINA 3NVAA 1R4NB 4K88A 5T3UA 3SU8A 1WOYA 4ETNA 3LT5A 4RBNA 1VHTA 2E21A 3T3GA 1SJ9A 3OE1A 2J9GA 2ZS8A 2WDZA 2I03A 2X58A 5KTTA 1APBA 3QOXA 5IBRA 3R3WA 5EMKA 1G6KA 3S7TA 1Z36A 4QVKA 3RS7A 4CT5A 5G1NA 1SKBA 3FNIA 1U3WA 5FKJA 1D03A 4NEQA 1HUQA 2H8KA 1PGQA 2BJVA 2FR8C 2R1VB 2R00A 3N6XA 5K3FB 4B2PA 1PDVA 2FJUA 4JGIA 5T41A 2RH5A 3ZCTA 2NXWA 3H1FA 2FG6C 3SJ7A 3AFNA 4AUKA 4CF5A 3ZWNA 2W71A 3X2SA 1B8OA 2FK8A 1FDOA 2V7BA 3NBFA 4GC9A 4QHSA 3FDZA 4QDUA 3RU3A 1WW8A 1D1QA 3SICE 4MI6A 3DAOA 1KI4A 3QP9A 4AJHA 3BK7A 3RS0A 2IHZA 1AS2A 3N2LA 4KNYA 4ER5A 1RHQA 3CUUA 3L8FA 3SDSA 3WLFA 3H5OA 5CVJA 4TN5A 1SB8A 3DB2A 1FP7A 1U81A 2C2YA 3GC6A 4D6YA 2ESRA 4JB2A 3EA4A 1RXSA 4MUNA 3KT3A 2PT9A 1U9JA 4ZCLA 1BEUB 3ZU6A 1U1CA 4OM8A 4TMWA 3JQ8A 4AP6A 1BYIA 2ZT5A 3GJ3A 3E9RA 3GJ8A 4BC0A 4ZJUA 1HG0A 3HK2A 2JBWA 3FBTA 3AKCA 3E2IA 3W8RA 1ISJA 1D6NA 1Q1NA 1YULA 2FR8A 1TRKA 3H5TA 3P9CA 3LUCA 1GKKA 4BPRA 5HM6A 3ER8A 2B1QA 2QG6A 4NBLA 3I9JA 2DCUA 2PLFA 4ZEMA 3MQFA 3U6KA 1R64A 3HGMA 4PLZA 5IDVA 1XZFA 2Q6IA 3NHZA 2IQ5A 1OY1A 1TAQA 2Y77A 5IJXA 3KVYA 1KDZA 4RLSA 1OWMA 1OAKA 2NO9A 1B8VA 4PZCA 5K0TA 2IPXA 4AROA 1U9IC 1E7QA 3B12A 3EVEA 5DM70 3NRCA 1Z16A 4G0ZA 4JKYA 4EG0A 3KEOA 4AIIA 1R6VA 1P0PA 2V3VA 1CVIA 1KETA 3K0CC 3K70C 3MEQA 4NPHA 4BYMA 2D4AA 2NX2A 4HX9A 4IJMA 1AGRA 1WO8A 1XDDA 3O4FA 1SIWA 1DNPA 1GTZA 1QO0D 2INGX 1C0IA 2Z9DA 4GR9A 4MRSA 4W1RA 3WLQA 4BVGA 2RK3A 1UBTS 4N0DA 2IYAA 3IOBA 1MVLA 2DQSA 3RUAA 3LFTA 3QXCA 3E27A 3DD1A 1L7BA 1JEAA 3OAAA 1Z73A 1NR1A 1M1NB 2PSSA 3F5QA 4AI6A 1GSOA 3PR1A 1NBOA 3D3WB 3MOSA 2HMVA 3CG4A 1JHUA 1GRVA 1Z6GA 3EAFA 1NW6A 4YJHB 4YWJA 4CKCA 1JPJA 2BLNA 2IU4A 3OU7A 3HJNA 4RC9A 5BYJA 4U7GA 4EY6A 2NUAB 5ABPA 1GADO 1S2NA 2RGYA 2Z09A 2RHHA 2YCLA 5ALPA 1N2JA 3W78A 2YYAA 5DT2A 4Z4EA 3L7KA 1U9IA 4FCTA 4CTOA 1I2MA 2DUUA 3N7TA 4HH1A 2J41A 2QAIA 3OMLA 3OBIA 3PDJA 4MJ7A 3ESYA 1F8FA 4IILA 3EZ6A 3P2KA 3LVQE 2HZ7A 4K3VA 3VMMA 2JI9A 1HDEA 3FMFA 3OQBA 1Z3IX 4AO6A 1PUXA 3U3ZA 4KBGA 2ZVDA 4ED9A 5J63A 4EUSA 4ABYA 2Q2QA 5HKKD 1E9DA 5E2AA 2AQKA 1SZCA 1VXOA 1DC4A 5EYPA 5LMCA 2EJUA 1KAEA 1KDRA 1T5TA 2I5PO 5AI5A 1ODFA 4BX8A 5BN3B 1NF8A 5AW2A 1AH2A 3ETLA 1QM5A 1CX9B 1W9MA 3CWZA 3NBXX 1YS7A 3L0ZA 4FFBA 4HDCA 1U7TA 4O5AA 4LOKA 5KNBH 1AQYA 2R8RA 5EXXA 3DBHA 1X1TA 4AX4A 2XZDA 2VDJA 3RAEC 4C0QC 1A5TA 3PUZA 5IF9A 4O29A 4S05A 4MV1A 2RD2A 3OMWA 4LQDA 1H1DA 1YFLA 4ADSG 2IEDA 1EUQA 4H7HA 3F47A 2Q41A 2H08A 2Y66A 1TKBA 2A8YA 3OCZA 2RHTA 4QA9A 1TTPB 1PEKE 2FB9A 2GZDA 4XB2A 4Y2XA 5FNVF 2P9EA 3TZ6A 4UTVA 3PS9A 4ACAA 4YAUA 1HO3A 2J6HA 4UUAA 5E0KB 4UM7A 3N0RA 3ZDFA 2R79A 1Y6GA 2C07A 4HVLA 1SY7A 2XE8A 3IAHA 1SHJA 4IIXA 4Z0HO 2OA0A 1Y8CA 2V7QA 4Y7CA 3T7CA 3B3QA 2MYUA 4DDKA 4AN0A 4AY5A 2O7QA 1ISGA 3HYLA 4WKOA 2JD2A 3ZWQA 1K6MA 2ZAYA 4EGQA 3W34A 3WZ2A 1LNSA 2QX8A 3NV9A 4YONB 3S2UA 4EAQA 2VBGA 5A9TA 2F8SA 3WK5A 3DOEA 3JR7A 1EUCB 2GEBA 1WD7A 2IZOA 4MJLA 3ZEAA 1EXDA 3P52A 3S2YA 1Z7BA 1UBCA 4E5MA 1K7CA 1Y7IA 4Y1RB 2JAPA 4HUTA 1X2BA 3UPUA 4IRUB 3OLWA 1NVTA 4PQYA 3AONB 4F91B 4AJ2A 1C1DB 3B2QA 1N5LA 1BHO1 3AY6A 2DHEA 2W6PA 3L6DA 2E89A 2ZAOA 2FFBA 5FPYA 3USCS 4LF6B 4QOJA 1NIPA 1WUHS 3OTQA 4JMPA 3FUXA 4S3MA 5EE3A 1EFUA 1W4RA 3GEBA 1KDYA 3HJFA 2ZRNA 2F9FA 1V5IA 2HK6A 4JHLA 4WFIA 2FCAA 3VHXB 5NLLA 3U2QA 3G2IA 2Q07A 2DH5A 4CVNA 2QTLA 3D1VA 3KNZA 3LIPA 3EMBA 1SC6A 1U2SA 2RGWA 3FETA 2VF4X 1GPNA 2ZR8A 13PKA 1U3GA 3LAWA 3LY5A 2EBWA 3BFVA 5ECYA 1CY1A 4NJMB 2OG1A 1WUIS 3AW9A 4CDNA 4JI1B 3WMRA 5DULA 2ZFUA 4A2QA 5KIAA 4TROA 4XGIA 4WGFA 3KHUA 3HN7A 5AKKA 4WD3A 2B9VA 1SHKA 4U2EA 2WNIA 2J0UB 4Y9TA 3PX7A 2XYHA 3PJFA 1E3IA 2VPTA 5ALNA 1JDSA 1M66A 3LS2A 2OO3A 2NIPA 1IB0A 1K86A 1UDWA 3L8ZA 5TR9A 3R5JA 3R8CA 5K8VA 1JE1A 1W73A 5K4HA 1RM5A 4PXSA 4WOJA 1VJDA 1H3EA 4LFCB 1JQ5A 1WOMA 2IJGX 1T9GS 3CH7A 1AO3A 5FI5A 3ZGVA 3OZDA 2XIQA 5HUHA 1SR8A 1Z5GA 4P81A 3TLZA 3EIFA 3MMPA 2QVCA 2QNRA 4NR0A 3AEZA 3V8RA 3S2FA 1Y80A 2BFEA 3OTGA 4GS5A 2EP7A 5EJ9A 4MR9A 1JJBA 3OZUA 3PDIA 1DRUA 1PWHA 3JD3A 2ZWAA 3IBCA 4EFNA 5AXAA 4CDGA 3EH1A 1Z6TA 2PMBA 1FDIA 1FXWA 1OD6A 2XMZA 1UDBA 3GG2A 3ZGXA 5KVSA 4G07A 3C5CA 3N9IA 3MWEA 5IXYA 5GJWC 3ELBA 2SKCA 1FFHA 1DEKA 1EE1A 3OMXA 1IWPB 2VDWA 4UUPA 3T1VA 1ZWKA 2YV3A 3COVA 3VH4A 1FY2A 3HXQA 1OH8A 1FP6A 1DKRA 4LS3A 4GEKA 1RZUA 3BTOA 4UC0A 4JBXA 1GUFA 1RXWA 2DMRA 4JC5A 2DKFA 5AHXA 4DS3A 4KLNA 2W43A 3H8JA 3HA3A 5CB4B 4KR9A 1QCDA 3SJZA 4PVCA 3BSSA 4NCKA 2WLSA 1YQGA 5JG7A 5T57A 2XVXA 3RVPA 3S2EA 3QX3A 3FWYA 1AMUA 2W2LA 3SIXA 2GKGA 3LOPA 1IOWA 3NJRA 4EUHA 3GFTA 5I9SA 4BTEA 4DKJA 1QNLA 1JA9A 4KPGA 2CCGA 2JCSA 1YDWA 4B7UA 3WP1B 4FOLA 4C20A 3O3CA 3P32A 5F9MA 4HQOA 2I2XB 3A3KA 3IPCA 5FBHA 1RW4A 1U31A 4KC0A 2J08A 4E2ZA 3WGNA 2MWMA 4X91A 1VJCA 2VFAA 1Y7PA 1IVSA 4R84A 2C4MA 5EWMB 1O0BA 1JEYB 2HTFA 1A98A 4WKNA 1GL3A 2P0AA 3EFHA 4BO1A 1WUTA 4ER6A 3K2QA 4TQGA 4D4MA 1WXFA 4LBWA 1LLFA 4Q02A 1J97A 3W9YA 4P7JA 5HUQA 2V98A 2C5HA 2F3SA 3OZIA 3WKBA 2C5SA 3QM1A 2EBHX 4G09A 5K0BA 2EZUA 3MAJA 5B1SA 3L8GA 1QMGA 4BGDA 3ROGA 3G2LA 2GKSA 5G0UA 1BH6A 1NQAO 5AI0A 1K7EB 4LJKA 3MT8A 4TT8A 1I80A 3RTGA 3KWMA 1XN1A 1R4ZA 2PZMA 4WXRA 1XMQB 2ZRLA 3D8BA 2NVBA 2PVCA 4MHSA 4PS1A 4U7FA 3ZWBA 2ZJ5A 2HK8A 5EXDA 3UMCA 2O8EA 2IH2A 2Y1LA 2FWBA 2C4UA 4RK7A 3C7DB 4MGIR 2AOUB 2BH9A 2HGSA 3QFCA 2BEUA 1WJGA 1USKA 2Y4OA 1HG1A 3VVMA 1NZJA 3BRWD 1OWPA 5C7LO 2WIKA 1ELOA 5JTUA 5LP1A 3TUZC 1IU9A 1MB2A 1MQ8B 2CMDA 3G2PA 4KTTE 4Y2VA 5DXFA 5A0FA 3IHWA 3DUFA 1QVZA 4ND4A 7ADHA 1BE1A 5DNDA 3G0OA 1XRJA 4JC8A 3ETDA 4OHMA 4YMTA 2SECE 2QD2A 3OZBA 1J1IA 4NNJA 4E6PA 1EAMA 2VQFB 4KXMA 1M5TA 4LGYA 1R66A 2H31A 3QOFA 1C29B 4MGHA 5AJVB 4DXHA 4F9EA 1KQGA 1KMHB 3HO8A 1VSBA 4FFRA 4WBXC 3I04M 3EC2A 4IV5A 3UICA 3PHCA 3GFPA 4YRNA 3TS1A 1GTSA 3T7IA 3DZCA 3PFBA 3B7PA 1G7SA 1X0XA 2WOOA 3AOGA 3G8BA 2A9JA 2J5XA 3UFBA 3BDAA 4YUXA 4G24A 4ZKDA 5FWXB 3K6KA 1N9GB 3BMNA 1JAHA 4WCVA 3AR5A 2BI4A 3ZGYA 1CVRA 4CDRA 3VC2A 3GFFA 4ZK6A 3T5CA 1TEZA 1E8MA 2JATA 1FSFA 2YUTA 2EAUA 4I1OA 2PD3A 4TXJA 5AW4A 4AJJA 4D41A 4NENA 5DM60 5B57C 5KTYA 1P7VA 5FPQA 2HK9A 1P9RA 4B6EA 3LW7A 3EQZA 2F7SA 4MH0R 1CDDA 3L0DA 1Z2NX 2WFMA 3ME5A 4IR7A 4IIBA 1CZLA 2JZCA 3GEIA 1OKKD 4XQCA 1EFVA 5LCXA 1MC5A 4UE3S 4OBWA 4JOBA 2P5TB 3GVPA 1G64A 4HFJA 4U6SA 1PVVA 1E7MA 1QCCA 4ZIRB 1DMRA 1LLDA 2NVUA 2PLWA 3ORYA 3C3KA 5I9IA 4QUDA 2OCLA 4WDRA 2P0YA 2XLBA 3AXTA 3TSYA 3D31A 3UW1A 2ZRQA 1OLSB 1RAHA 3ZS8A 1MG0A 4U8HA 3QGMA 5K0ZA 2TECE 4J1TA 1YZVA 4MUMA 2QPAA 5IVIA 1CK4A 2R3SA 5U1PA 4COOA 1YHNA 1VJ1A 4PFKA 3JX9A 1JMKC 3N75A 3RVSA 1OJLA 3FWPA 4IHAA 1Q17A 4QARA 5A05A 4DIKA 4TKVA 4Q18A 1HL3A 2AFHE 2Z83A 4OHRA 4XLLA 3NDJA 5I9BA 4AJOA 5LQKA 2Q6TA 3TAXA 2C88A 2HXSA 1N3BA 1TCBA 3Q5GA 4KQMA 1DTWB 3NAMA 1QIIA 4GYKA 5A6SA 5IAAA 1J23A 2I22A 3VZQA 4ARZB 3GLGB 5FUQA 2X41A 1ZHHA 1IWOA 1BS2A 1QYWA 1MO6A 2LGJA 3JAMA 4A6DA 3AVTA 4XM2A 2BBSA 3K1TA 4AYWA 1G7TA 4B80A 3H9CA 1KYIA 3W6PA 4AWBA 4QFBA 1XRQA 2PXHA 4M1QA 3KQTA 4EK9A 2NYRA 4O4HA 1Q3KA 3ZJVA 5K0NA 4BO5A 3ABRB 5BR8B 1ANKA 2FF5A 5C46F 1JKJB 3OO1A 2WP8J 4EG6A 3EVBA 3KWLA 3LLMA 4PNHA 4CF3A 3QE2A 4DTIA 1RCFA 5FUYA 2D54A 3LYHA 4IF4A 4AJPA 1VP9A 3QK7A 1TGVA 2EFDB 5G1OA 1QX4A 3G9ZA 2CXUA 2YRFA 3GJRA 1L4FA 1SN7A 1CJVC 1U9YA 3QVGB 4CEIB 4PPGA 1PZNA 4KGVA 3A7EA 3S55A 1ONOA 4K6MA 4PWZA 3WIVA 4BQEA 2E55A 1L4GA 4W5QA 4JP2A 4YEDA 4TXLA 4M60A 2ZB8A 5CGZA 4TYQA 4OXYA 2FRXA 3KE9A 1Z0FA 3BCUA 1AA6A 4D0GA 4RADA 4DCSA 5HOQA 2VQ6A 2I8CA 2B69A 3C4VA 3ZQ6A 2C78A 3B5EA 3DZGA 4KE6A 1QGED 3AUUA 3GRUA 1QKKA 3QKTA 1Y8AA 4UBLA 1O3YA 3DZ8A 3PD1A 4UNPA 5CFZA 5JXHA 5ICFA 3ZY5A 5B58T 3R74A 3PNMA 4X1KA 1GU1A 3BHNA 4V1CI 4EMBA 4MKRA 2YQ5A 3TW6A 2CSUA 5IYZF 1CZUA 2VJMB 4ZWNA 1OWNA 5C7IO 1PJCA 1Z62A 2IYZA 5BMVB 3H2HA 3BCRA 4KQ2A 2YQZA 3ZJ4A 5MF6A 3VH1A 3LQQA 3LSTA 1CG6A 1JLSA 3R7WB 3V33A 4AO7A 4PTZA 4GX5A 5ELLA 4DCVA 3F78A 5K0JA 5KQPA 2HA4A 5KNBA 4IH1A 6ADHA 1DIGA 2GK4A 2PNJA 4GOMD 3BJEA 2HCTA 2GEVA 2XUHA 3L4SO 5ERXA 1ETHA 5GGXA 4B2IA 4ZMRA 5FDFA 2H48A 2MIIA 3FLEA 3WHLA 1TM1E 3V8EA 1DOAA 5LDHA 4RZ2A 4X1IA 4LE2A 2XLCA 5LXTF 4RETA 4TWJA 3VX4A 3M6AA 3IP5A 4L2IA 4WLOA 2Q4TA 5JADA 4XGRA 4NCJA 3BXZA 5JXWA 1WP9A 4YAGA 3GOQA 5EMJA 3EIHA 3EFEA 1HH4A 4ZQHA 2DJIA 1IEVA 1T1GA 2MSDB 2VR1A 3SE7A 3VPHA 3UK0A 2HJGA 2W2VA 4FI3F 4JXXA 2FRVA 1OREA 3JWJA 1XMOB 1FVXA 3SHVA 3USES 4QU9A 3CLRD 4PO3X 4AJNA 1BVHA 2O1XA 3ZUGA 2HF9A 4DLBA 4ZYXA 3JATA 1KI6A 3HJGA 1PNQA 2XJ4A 5C3UA 3MG9A 2GEJA 4O2LA 3PC6A 5F52A 3E8XA 1E3WB 1CS0A 4JLWA 4OU4A 5E7QA 5KWJA 3IDFA 2C2XA 2QHXA 1Q20A 2FPOA 4IDEA 1PT8A 1YJAA 1Z6YA 5LVAA 5LMZA 4M49A 4HSGA 2D6FA 2J9FB 1U8CB 2VZ0A 1PN3A 1T5SA 2WD7B 4B2LA 5B1EA 2RONA 4OO3A 5IJ0A 3BMXA 3TTYA 5EMNA 5JBIA 1X86B 3RKSA 5HBGA 3SNHA 4IGKA 2IP1A 1E3SA 5JQWA 1U8AA 4MA0A 4JXJA 4O3FA 3DMPA 3E6AA 3HGQA 5EE0A 2PEZA 1Z8HA 4OHFA 1AMOA 3FZGA 1OQAA 1XLTC 3UJNA 2F48A 3ZE0B 3N28A 4QBIA 4IDBA 4LHYA 2ONYA 3T3MB 4M7PA 1TT5B 1Y8RB 3AM5A 1B41A 3R4VA 5EUMA 3N8NA 3JQAB 4OLHA 7GPBA 3B9RA 4NVRA 3ECAA 4Z4FA 1CLEA 4V0NA 5J2TB 1UBLS 2NZYA 3ONNA 4TRJA 1ZESA 3ZVMA 3JWGA 2P2CA 2X3YA 1M2VA 3FLMA 3ZD9A 1XRLA 1RC1A 1ESCA 3OT1B 3A9RA 1NDUA 1OTYA 2OD9A 4JFRA 1PR0A 4H0CA 4UD2A 2C7RA 1RLTA 2ZSKA 1K4KA 1T8WA 1GU7A 2CDRA 2XWBF 3CT6A 4O4IF 3R7NA 2QRKA 3PSHA 3H8WA 1Y0BA 4ZICA 4V2UA 5GONB 3E1SA 1XLTA 1TU4A 2N3ZA 4MWGA 4OOEA 2FEMA 1LJ8A 2FEOA 5K3BA 3WYEA 4PTYA 4B84A 2CHUA 4G4SP 2O1WA 2B3DA 1AKEA 1ULHA 2QPLA 3DKIA 3LXUX 3NYQA 3K92A 1QTNA 4WH0A 1U98A 4DJTA 1RKVA 5AVKA 2CNWD 1BKDR 2OFWA 3PRYA 1O97C 2GUGA 2V5VA 5DWQA 5AUOB 1OLOA 2ZETA 1JKMA 5CNKA 1MJ5A 3K30A 3QA9A 4LJRA 4LTNA 1Q7RA 2ZRIA 5A04A 3TOXA 3E5RA 3OX2A 4GHWA 4TX1A 2AG6A 2QN7A 4K6KA 2AQ8A 3L6OO 5BNIA 1FXUA 1L5HB 1U2EA 4Y2QA 4CN8A 4DRYA 4WRRA 3DL4A 3OECA 2IXBA 5LMUB 3SR0A 4IJKA 2FMIA 3EA0A 1ZINA 5CUQA 4Z99A 2A5GA 2X42A 1GRQA 4RA9B 3VVCA 5BSRA 5LC1A 3TZQA 2VHUA 2B1GA 3KUXA 3F97A 3NNNA 4Z7JA 4HDNA 2QM3A 4BEWA 3JAKB 3OFKA 5JSYA 2EGGA 4Y9DA 4DCPA 3I1IA 2H1HA 3GFBA 3FHOA 5B2ZA 2O7SA 1ORDA 4KR2A 1E94E 3WHIA 3DOFA 4OHOA 5HILA 5AW3A 2GQ0A 5F33A 4CI0B 4HAIA 3IL2A 5CYGA 1QZZA 3T0IA 5CLGA 3OD1A 1MF7A 5HFJA 1C0PA 3OG9A 4IDPA 3TD9A 5LJIA 2O19A 1P1BA 5IBQA 1YQTA 2AD1A 3PX3A 1HQYE 3GLHE 2OPHA 3EE6A 2IZ0A 3HL4A 2NN3C 2CZQA 3UV7A 1NURA 1KYYA 1QH8A 1OVMA 4W5RA 1X1CA 2X3UA 3AUSA 2EBFX 1U1IA 4TL9A 5JT1A 4F5EA 4OM7A 1GNVA 5DBEX 4Q1BA 3AGQA 4AMVA 1HORA 3O8QA 3UUWA 2C59A 2R2GA 3QBVA 1TUBA 3W5HA 4E07A 1Z5ZA 1JLHA 5AVJA 3FDJA 2L69A 1QLHA 4YRPA 1Z8FA 4G5OA 1VI2A 2DWCA 1RYBA 2QL7A 2ZE7A 3UVEA 1TO2E 1TF5A 2V55B 3OIWA 2P69A 3D2BA 1G20B 4MWTA 4UHFA 4D3ZA 1O0CA 2BAGA 2XOKA 3HA5A 1JX6A 2G9QA 2N75A 3F6SA 2ZBFA 4H7JA 5FORA 4A6PA 5JATA 1E9CA 4RH1A 4RGYA 4BNJA 4I9UA 2ZR9A 2JGAA 2GN1A 4DLZA 1Z6AA 3ENWA 2XF8A 4F8YA 5BR1A 1F7UA 1YAJA 1EVEA 1RHUA 1CQJB 2B36A 2J31A 4RY9A 1J6UA 1RLOA 2JJ1A 2PKQO 1K8RA 4J1NA 4XX0A 4XD7D 2JLYA 2QPTA 4IXTA 3WYDA 3AOEC 3WQRA 4YMVA 2HFKA 2HJRA 4R2HA 1TADA 2I6GA 1BD3A 2HRRA 5BXYA 4LK2A 3BMOB 1NIJA 4O2AF 4M6WB 4K6OA 2UZAA 2GRAA 3D4PA 1M8KA 3BRQA 3E3LA 2AGVA 3KZNA 4DIOA 4ZI7A 2HBZA 4BLQA 4GI7A 1VRVA 2EW1A 3GPIA 3ILYA 3WNZA 1J2JA 4TTSA 1M34E 1TX4B 3H0CA 4HS9A 1Z34A 3JQCA 3HJUA 3PV0A 3M8KA 1LH0A 2BGNA 2YBDA 2CB9A 2VXYA 3ESBA 3QU4A 4KJXA 2C3YA 2NUTB 4RGBA 1QNFA 3FVRA 4HUJA 4UREA 2EX0A 5ALTA 4XZ3A 3WL4A 4QHTA 2PVPA 3QMVA 3TXXA 1FX1A 4MIYA 1K7SN 2FKAA 1R4NA 2WHPB 4PCUA 1W75A 1M8JA 1UDCA 2AN9A 3FFWA 1G2OA 4PPFA 3L6RA 5E9QA 3O1JC 1B00A 2OORA 1E2EA 1NYTA 2WI8A 2WSBA 4LIPD 3WYCA 2XKKA 3AOEA 2IS1A 2BMWA 1UPXA 1SXHA 1J8YF 4RVOA 3Q5EA 1JLKA 2C0QA 3EWAA 1L3CA 4DMKA 3OIGA 2PX4A 4H7KA 2HSZA 4MR7B 5FPHA 5J2UF 2ODNA 3AP1A 1HDIA 1IC6A 1HM5A 4DR4B 3QA3E 4YO8A 4F6LA 2AR9A 2DBYA 5CDFA 4F5DA 5IM4A 5ALSA 3ZR4B 3EXG1 5DV9A 2EERA 2F3QA 1PCXA 2VSNA 3CE6A 2QENA 1W47A 4PO1A 2Q0XA 1PJ3A 4DC0A 3RV4A 4ENQA 1GXSA 2H92A 4YFVA 3U5ZB 1DXYA 3I72A 3G5UA 1PZEA 4Y18A 1ZIOA 2OCBA 1X80A 2AFIA 2QD5A 5AHOA 3W5VA 4GP7A 1ESMA 5J5CA 1DL5A 2LCIA 2GKOA 2ZSJA 3DAPA 3DVAB 1H66A 4RJJA 5FWAA 4KIFA 4X5OA 1EWYA 4KI0A 1D0SA 4LF7B 2NSYA 3BTVA 3PEFA 4DN6A 2HR1A 4KO4S 2GBGA 3BL8A 3VYSB 4BAGA 4BFXA 1RPJA 5EEHA 3V9AA 2V4MA 2QQGA 5FNZA 3OKAA 1SAYA 1MDFA 4G56A 4MQUA 2K7FA 2R86A 3V3KA 4RJKA 1SBIA 5LZ8A 1W4AA 2F67A 1X13A 3L1HA 4MUEA 4GMXA 4BUZA 2WWFA 7MHTA 5ALGA 1F9AA 1EX7A 3HXLA 5FA6A 4BO7A 2MSCB 4HQFA 2I6FA 3N39C 4IHJF 4ESHA 5TX7A 3COPA 4R83A 1SZDA 1A5SB 4X7BA 2JGIA 2XWQA 1RR6A 4B87A 2F3RA 2IYYA 1FUUA 4N0QA 2VUTA 2GETA 5D3ZA 3WS7A 1F4VA 5DBGA 2OVFA 3UYKA 5ALVA 3FOZA 3ZDBA 4X65B 1VBNA 1YA6A 5AQ1A 2VSFA 2ZQZA 5IJZA 1Z06A 4BOYA 5KCZA 4ZU3A 4OG2A 1ZCZA 3MMZA 3X1WA 2WHEA 3W79A 3NLLA 4LRWA 2DPMA 3MTBA 4UXJA 3NDBB 3NP9A 4YRRA 2H63A 5DHAA 2CE7A 1LSJA 5JCOA 5EZQA 4NBKA 10MHA 1XXHE 5D3MA 3C3JA 3W9SA 4ZVVA 2A6PA 1L7DA 4RHYA 1V8DA 3P8ZA 3GJTA 1AHPA 3OTHA 221PA 1P75A 1YHYA 2ZSFA 1TKRA 1L7QA 2IHTA 3AHCA 3FCOA 4MRPA 5JFTA 3GRPA 4M99A 4C6HA 2PFGA 4B47A 1NNEA 1XNRB 4UTPA 1ADGA 2FQYA 2V8OA 3H6GA 4NPAA 3RYCB 1AQ6A 4MVXA 4R54A 3I30X 4FCCA 4IIFA 4EI9A 3PTLA 4ZO9A 1MRZA 4WFKA 1DJOA 3OIYA 1US8B 2QJWA 2YZKA 4NZZA 1CUEA 2VRWA 1WB5A 4UM9D 4IF6A 2PZ8A 3B7WA 4QDOA 3RTEA 4BO2A 4C08A 1Q14A 3TAUA 4UPEA 3HHEA 5TXGA 3VAYA 4V39A 2GK3A 3FGZA 5C81A 4OB7A 1R3UA 4GVXA 4WNCA 5TF0A 2KM1A 2PAFA 2I1VB 1TIBA 5EJ7A 4A1OA 3AEYA 1UJBA 2D13A 3KPWA 3P2IA 5E2BA 2PU7A 1XZNA 4F56A 2IZ7A 3DCYA 1T15A 1THTA 1QHHA 3PG5A 1HDYA 4PZAA 4HO1X 3W8NA 3T1HB 4QSMA 1M2EA 3BDVA 2LCQA 4DZZA 1I2BA 2K2QB 1MH1A 2J3JA 3ZXIA 1ZMXA 3ZDCA 2CMFA 1X7YB 1U8ZA 4RPLA 1X42A 3CPSA 4UPDA 4YJ3F 4Q9JA 2IU3A 3NTVA 3WWYA 1GQRA 2GXSA 3PQDA 1UWVA 2IUYA 3DR5A 1OI3A 2HWXA 4PC7A 4HRVA 1N6OA 4WK6A 4WLVA 3QVVA 3IUMA 1ENOA 1JHRA 2VXBA 3E2MA 4KWHA 3ZY6A 2QIPA 3CG0A 1Q1AA 3ZQUA 3P9IA 2BKXA 2ATEA 2X3FA 3ILVA 3IB3A 5E6UB 3M9WA 1PWYE 1Q3TA 3VJKA 5JY6A 4FDAA 2M32A 5BUZA 4Q34A 2O4UX 4WT7A 2IYOA 3G1TA 4CTJA 1OI4A 3G0BA 1PJZA 2ZUSA 3ZLJA 2DG2A 1KL7A 2DKNA 1AHIA 5IZCC 4PNEA 5AOCA 4JB8A 5HTOA 2J9RA 4DC9A 3RTAA 1NMXA 1UOPA 1E9RA 3GNQA 3JD2A 3FG9A 2BTOA 3KR2A 3WZMA 5J4YA 3CY6A 1NKSA 3NOOA 3QE4A 3ZZUA 3DM9B 1QDEA 3TLEA 1ZVJA 4GKAA 5GZ1A 2YBEA 4Z1MA 4LY6A 4QXQA 3H1TA 3P27A 4JLPA 4JOSA 4B3CA 1TM4E 1CQWA 3C3PA 5EP1A 3TCXB 3ZDXB 1SCKA 3IAAA 3X1DA 2NTVA 4TMYA 3WLEA 5I7FA 1UBMS 4WUVA 4JC4A 1L1QA 4QTYA 4MP8A 5KKAA 4RJIA 4MGKR 4Z4IA 1ZUIA 2H18A 2JFVA 2YVUA 5JAMA 2HHAA 1C1DA 1VMDA 3PLRA 1A4XA 1R1DA 2E6KA 2NSLA 2OUKA 1E0SA 1ZA1A 3PICA 4O1HA 1BWRA 3QMWA 3BQMB 4LISA 4TWRA 5E6SB 1X19A 3LY9A 4JJGA 3SVTA 2QTHA 2R68A 1E5XA 5IZCA 2AG0A 3RHZA 5EWLB 4NYIR 5TIIA 4WCFB 4BNYA 3GU3A 3X1MA 2HADA 2VYCA 1TVMA 3V8BA 3VHXA 3L1JA 1H8HA 1NFQA 4KWCA 4OXQA 1CZRA 3NASA 4UARA 3ZNPA 3ZHSA 2RHCA 2AEJA 3DTTA 3IT1A 3U6BA 3VDNB 3NHUA 3TNFA 3GLIB 3MPUA 2A7XA 5JUWA 4U2BA 1MAUA 3G6KA 5K0GA 2XAAA 4Z9BA 1UXGA 2A88A 2HMWA 4GI3A 1GZ7A 2RHDA 3MCVA 2Z1DA 4PLPA 2ZRPA 2BJHA 2H59A 1H3NA 1H22A 1QGZA 3AR3A 5BYBA 3QXGA 4QO7A 2RGBA 3CSSA 3DDOA 3M6WA 1JQAA 3FSEA 5TVGA 1YUBA 4BMZA 3FFBA 2NYAA 1XZHA 4HDAA 4PZUA 4MXDA 2VC2B 3AEQA 1PO7A 3OIVA 2FV8A 5JZOA 2A0WA 2RGAA 4IWYA 2XHZA 4RZ3A 5KTRA 4IEIA 5JZSA 1I7DA 3IALA 4GGOA 4KWIA 3CX6A 4UXHA 2MYPA 4RFVA 3ZE7A 5KOHB 3J81k 1IOZA 1IZ8A 1IN6A 4YNBA 4D0RA 4E13A 1WZCA 8MHTA 2XNDA 3EEQA 2J07A 5GWXA 4U8GA 5JWHA 1QHEA 4GBMA 3HDYA 3L2OB 4O2BA 1UAYA 4LWZA 4KKVA 1GYRA 2DY0A 4BVBA 5H8WA 4MUFA 5ED0A 4Y6LA 3EZLA 1IJKA 1R9JA 3M4JA 2ZJ7A 3BTSA 3E9DA 4L16A 3F67A 4HX2A 4DIMA 4LYJA 3C48A 4RS3A 5AKHA 3VISA 4Z3OA 4AZSA 3PRKE 5DB4A 5K5EA 3PGJA 5EC8A 3I2YX 3HKBB 2JDIA 4RZSA 2ECKA 3U7IA 1ML3A 1TA4A 3WLHA 4YJFB 1CIJA 3HCRA 3BXGA 4J0DA 5EMLA 5IWAB 1E64A 1KAQA 3WFZA 3GN2A 3O8LA 2TRSB 3A6DA 4IGIA 4RYDA 3QY0A 3V8MA 1CIVA 5FOVA 4BWGA 2ZJ2A 1X8JA 3OICA 2XMRA 2JIMA 1N8NA 3LOUA 1IIRA 3C5VA 4Q9KA 3RU2A 4QGBA 1TTTA 1FP1D 2RHMA 3TR0A 3ZG6A 4AJ4A 4G0WA 4HXGA 1QAOA 5IH3A 1CFJA 5A6VA 9LDTA 2B30A 1G5QA 3V00A 1K2WA 2IHBA 1DBWA 3VSCA 4BNKA 5ENZA 4EA8A 1I3MA 3I0MA 4LVCA 4BNUA 1LBIA 4OAQA 1FSPA 1X9IA 3HVKA 3FR7A 2J3LA 1A9PA 4DADA 1IMOA 4YP9A 4ZALA 2FSPA 2FOIA 2GZHA 3B51X 4KV9A 5HXAA 2NT4A 4D9NA 4Z4GA 2G71A 4Y0NA 2GCEA 4P4NA 4XWYA 3GXBA 3N7AA 4RY0A 1UC8A 3K6RA 3KRTA 4UTNA 1OZ0A 5AD1A 5J5AA 2H5JA 4QXMA 3PNKA 3FCCA 4D4IA 1G9TA 4G5HA 4QJIA 4GWLA 3WQQA 1VBFA 3D0OA 1II8B 1NHWA 2XA2A 2XUFA 2IRWA 1ECBA 1R8YA 5D84A 4AMZA 1EWRA 2NQTA 5G2OA 3VVLA 3U7RA 2AOXA 3AWDA 2OBYA 2BH2A 1GEEA 3SKXA 4OH7A 2VTVA 5COQA 4IZOA 2FWNA 2VWQA 2NWQA 2BBTA 5EQDA 5FQOA 1HYGA 5LNK1 1G8JA 3HYNA 3UAYA 4ESOA 3AC0A 3HR4A 4ZDJA 1FE8A 1DIHA 2G6BA 2RKOA 3EMDA 3O7MA 3PIDA 5DLQC 4QODA 3TM5A 3D8NA 3GDHA 4TOIA 2OXCA 1NYRA 3WYBA 2CYAA 3I32A 1YGPA 4W9MC 3PQCA 5CFOA 2PLAA 3SHFA 3FPFA 3R9XA 1TUGA 1JBQA 4NE7A 1IXZA 1JEQB 1WX1A 5HCUA 4EP1A 3D64A 1NP3A 4JCCA 4GX2A 2FZLA 3IOYA 2VL7A 4CQMB 4OSEA 1S89A 4GKVA 2P7IA 2GM4A 3URKA 4U2DA 2NTNA 1CEXA 3G0CA 2NTJA 4G1MB 1W35A 2W6JD 3K8QA