1NT4A

Crystal structure of escherichia coli periplasmic glucose-1-phosphatase h18a mutant complexed with glucose-1-phosphate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
391
structure length
391
Chain Sequence
QTVPEGYQLQQVLMMSRANLRAPLANNGSVLEQSTPNKWPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPYTVYAYANSLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYYEGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRTSAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIEYVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDADGFCPMDKFDSVLNEAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphatase
publication title Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature ec 3.1.3.10: Glucose-1-phosphatase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1nt4A01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1nt4A02
3GP5A 1SK8A 3IT3A 4D4MA 1QHFA 4D4KA 4ARUA 5HR5A 1XQ9A 4PGMA 2WNIA 2EKZA 1DKOA 1UJBA 4PZ9A 1IHPA 1DKPA 3R7AA 3D6AA 2P6MA 3IT0A 4IJ5A 3HJGA 1BQ3A 1E59A 1C81A 1H2EA 2BIFA 4JODA 1QWOA 4ODIA 2P6OA 2EOAA 3FDZA 2WNHA 3DB1A 3NFYA 3E9DA 2PA0A 3E9CA 3NTLA 2WU0A 3DCYA 2OWDA 1BQ4A 4GPZA 1EBBA 4AROA 3EOZA 1RPTA 2P78A 3D4IA 2EKBA 3PGMA 2DWPA 4GPIB 2P79A 3BIFA 2H0QA 1QFXA 5PGMA 1ND6A 3D8HA 5CX4A 3MBKA 5AJZA 1YFKA 3F2IA 3GP3A 2P77A 5AJWA 1ND5A 2H4ZA 4TSRA 1FZTA 1SKAA 1UJCA 3ZHCA 4ARSA 3K4PA 1DKMA 1SK9A 3E9EA 3EZNA 2P2ZA 3IT1A 3K4QA 2H4XA 2ENUA 1RPAA 2QNIA 3IT2A 4FDUA 1CVIA 2DWOA 1RIIA 3O0TA 2GFIA 4D4LA 5HTKA 2OWEA 2I1VB 3LG2A 2HIAA 5CDHA 3QPVA 1K6MA 1T8PA 2A6PA 1DKNA 2P30A 3LNTA 4HBZA 2P2YA 3FDZB 2H52A 3GW8A 4QIHA 1DKQA 4JOBA 2P9ZA 3QPUA 4EO9A 3OI7A 2P9YA 1DKLA 1NT4A 4MA4A 4EMBA 2RFLA 1V37A 2YN2A 3LL4A 2AXNA 1H2FA 4ARVA 5CU7A 5AJVB 4IJ6A 3FJYA 2ENWA 1C7ZA 3C7TA 3F3KA 2HHJA 2A9JA 2HPAA 3MXOA 2YN0A 1C80A 4PZAA 3QPWA 1YJXA 5AK0A 4E3WA 5AJYA 1BIFA 3KKKA 5AJXA 2IKQA 2P9FA 1TIPA 1FBTA 1V7QA 4JOCA 1SKBA 2P75A 4FDTA 2F90A 1E58A 4D4JA
chains in the Genus database with same CATH superfamily
4AJHA 1I2MA 1K6JA 1X9GA 1VRVA 4PG6A 4Q7EA 4CKCA 3CX4A 4B17A 3ME5A 4NE7A 1ZAYA 2HR1A 5KCZA 4J75A 3N0VA 4G1CA 1XTJA 2UZAA 2ADFA 1L5SA 3FDFA 3NNDA 2PNJA 3ZUPA 4FWIB 1F6WA 2ZYTX 4F8YA 3L4KA 3UMBA 1OVGA 1UDCA 4FOLA 3TIVA 4NYJR 1YS4A 4OCZA 4S1VA 6LDHA 4CFYA 3FVRA 4OY3A 2SECE 4Z3KA 5LN1A 4YIKA 1WDLA 1J2RA 1SZJG 3G85A 4KTTE 1K7EB 1VG1A 4EA9A 2OGUA 1EM8B 4LKOA 4P93A 3ZK7A 4R2KA 2CBXA 3U3DA 2OBLA 4G23A 5JADA 1U2PA 4M86A 5IT5A 4MVJF 1RM5A 4PSDA 1QS0A 1EFKA 1ZUIA 2PUHA 3CNOA 3SAJA 4Q3NA 4QU5A 5D8DA 3A36A 3ENQA 1QGED 1SUCA 4UUAA 1PNRA 2AXQA 1D4FA 4Q9AA 4YJDA 1ABEA 3ZBQA 1MJGA 2G1JA 2FP4B 4BB6A 1PBTA 1YI1A 2FF5A 5G0WA 4FNAA 2ZB2A 4KXNA 4UARA 3W06A 1EFRD 2WAMA 4GOKA 5JO9A 3UUGA 2G1UA 3HWX1 5C0OE 1QHYA 4KMRA 1B0ZA 1H1LB 3JSXA 2II6A 4G8CA 4CKBB 1U81A 3FBGA 3GDWA 3KS9A 4DC9A 3P0JA 1Q0TA 2OMKA 4KRFA 1K7YA 2XHEA 3NCTA 2XUKA 4PSKA 2FPKA 2I4IA 2J9ZB 4LK3A 2IUUA 2DR2A 1T36B 1J49A 3AEXA 3NHYA 1DLIA 2C59A 1UXJA 1YVPA 3HDQA 4JEUA 3BJRA 2A92A 2PYIA 3LHFA 4UNRA 5AM1A 3GRUA 4QU0A 3ZQ6A 1TAQA 5SZKB 1EEHA 3PC8A 3KG2A 3TE7A 2RCYA 3FBWA 2H1HA 3EAFA 4UUMA 4BGEA 3ELUA 1G20A 3KTFA 3R3ZA 1RJFA 4A03A 1U2EA 5IPFA 2ZAGA 2X15A 2XX3A 3I92A 5DBEX 3GMDA 3X2SA 3OU7A 1XU4A 3IYLW 4XARA 2AKEA 4P3PA 1AM4D 3F8TA 4KQXA 4MMXB 1ORTA 3OJWA 1RJWA 1H0KA 3FDXA 4X6XA 4YREA 4LF9B 2FG5A 2JDIA 1NVDA 4M8LA 5D3KA 3W3AA 5BSMA 2FSSA 1GADO 3E5NA 4W5NA 1CW2B 1T13A 2VCYA 1AO0A 1WMEA 4Q16A 1AF4A 3IVCA 4OHPA 5D1HA 5DISB 4XYGA 3SJUA 4BVAA 1GTSA 2ECPA 1ZX1A 2JLSA 2FV8A 1IAVA 2R47A 3IQGX 2JGAA 5D86A 2E82A 3JQAA 5LIRA 1A9XA 3VTFA 3AUTA 4MV0A 1VPTA 2FZGA 3EQ6A 4OPMA 4BEWA 4DIFA 1OC4A 4D9FA 3OQIA 3OZUA 4ND8A 1QP4A 3IQXA 5KYWA 2J48A 2NXEA 2QEQA 3FJYA 4A8HA 1T9CA 4Z9YA 2WB2A 4D26A 3WO1A 2HWYA 3OLWA 4E6EA 4PYJA 1PVOA 1Q74A 3QG5A 3T7JA 3NEAA 1D2NA 3FPJA 4A2WA 4RTNA 1ZRNA 2XDYA 1P9OA 3UW3A 7GPBA 4KX3A 3JY6A 1XZ8A 4QLOA 3CWCA 4EVIA 4F3CA 1KH1A 2XWQA 3MLAA 1X1BA 1NQ5A 1JDBC 4GGOA 1RXCA 4KDEA 3GCGA 2H1LA 3O74A 2W4IA 1N75A 1N25A 4G0PA 3OCXA 3VPGA 4DABA 2IGTA 2EP7A 4EG7A 5TF4A 2QJFA 2ZTMA 3ZGOA 1OTHA 2ZSIA 6AT1A 5K3EA 4L0MA 1NIJA 4LJLA 4D79A 3KM0A 2UYHA 2B1RA 4ZO4A 3E70C 1P2UA 1TX4B 2PD6A 2I6GA 2PU7A 2VK4A 4LW8A 4U9HS 1VHWA 2EFDB 1X7YB 4JJFA 3WGJA 1FQJA 1US8B 3FYSA 1ISSA 4GX0A 4PAWA 4TV9B 3UUEA 4DCOA 3O3NB 2JG3A 3TK1A 2UYCA 2C1XA 1MJGM 1Y3CE 1YHZA 4B3RB 4IHJF 1JU9A 5DKFA 2ODAA 2XT0A 3IP5A 4DNXA 1IQPA 1P5FA 4ZEMA 1T1JA 4B6RA 4RVOA 4EKGA 4Q24A 5LQMA 1XRMA 2LE0A 1Z5NA 3ZBUA 1QV9A 3WVNA 1GHTA 4DUGD 1FYVA 3GUZA 4NR0A 2N1BA 2BFNA 1F2TB 1U6IA 1OE0A 3FKQA 3T4EA 4L8VA 4RA9A 2H2FA 3QVOA 2J9FA 1MIOA 5EUCA 3W6NA 4BMVA 5KYKA 5JRJA 4O1IA 3HBJA 2F3SA 4AAYA 4FYJA 1DX9A 1N7IA 1ZI8A 3GJ4A 4K1XA 3JQ7A 2XRMA 5ALMA 1LK0A 3FUUA 4BNKA 3KEOA 4WI1A 5JVDB 5J2TA 1K6IA 2ETXA 1JHPA 3KBBA 3AIOA 5TEVA 4HGOA 1O9HA 1JL3A 3LUFA 3KJHA 4J07A 2B78A 3BH7A 4MS4A 1IRXA 4TV8F 5AVOA 2OCAA 4PV7A 4C0AC 3QU4A 1DV2A 1XKTA 2FPPB 5KC8A 3HUDA 5C4MA 1R5JA 2YVKA 4US1R 2HXYA 4C07A 4YCMA 4QYTA 2AN1A 2FFRA 1FVOA 1PW7A 1E0JA 1D6MA 1OBVA 5PNTA 1IOLA 1E5QA 2GSWA 4NZOA 3BE6A 3U3XA 3I62A 3GLQA 3NBXX 1N3YA 5K0CA 1MVLA 2J3KA 3ZX5A 4RYDA 1PRYA 4P4NA 4ARIA 4D0GA 3WMWA 2ZIEA 5CX1B 5KIAA 4GC5A 2IE8A 4PO1A 4CG2A 5DHRA 1T0UA 1THGA 2BE7A 4ZARA 4E2YA 2MYPA 4NE9A 4YMWA 1DOHA 3QXJA 3HSYA 4ZMSA 1SJ9A 4TLBA 3K9QO 1Z6GA 4KVFA 2Q2WA 1KSHA 1WXIA 3AIMA 2ZBDA 5B12A 3KQTA 5BXQC 1P45A 3QIVA 3VTAA 2ZBQA 1ORWA 5HM8A 4N39A 4I2NA 1QH8B 4RFVA 5F9HA 4MDYA 1L4HA 4RFSB 5AESA 1WUKS 2OA0A 5BSRA 5A5DA 1BTOA 5CDHA 3QF4B 3B6MA 4K6GA 3GGPA 4ENQA 1VHQA 1A7UA 2FRXA 4J0EA 1Y9AA 4LKRA 1GGKA 3TQQA 3IL2A 1U0SY 1S02A 1DQNA 3GEBA 3CEAA 4PCUA 2FJ0A 5FL7D 3RSQA 4I3HA 5KVCA 1EFPB 2NX2A 4NU0A 1SCUA 2Z4TA 4QNRA 4Q48A 4C4AA 3AESA 2P5UA 2V74B 1FCJA 4HYTA 5DOVA 3QOFA 5KYYB 4Y2YA 1EQUA 2C2MA 2YICA 5COBA 4DIMA 3UK7A 2L2QA 1S3SA 4U0KA 1Z0FA 1YCDA 4OBXA 2FB9A 3D3WB 2UZ1A 1IHUA 2HF7A 2MOKA 3LQYA 2Y66A 1GPAA 3E35A 3E53A 1ZW6A 2H31A 4HDQB 4UNNA 5LFAA 3EEOA 3OLVA 4WK2B 5SICE 1YAJA 2WNSA 3RIGA 4ZYTA 4IIHA 2V7TA 3N6XA 4JHXA 2EEPA 3DE2X 5IC4A 1I30A 3DPIA 1ZD5A 4AQ7A 1F8UA 3UCXA 1DTSA 1PHPA 1UJ6A 2OD7A 3LT2A 3DMDA 1E1NA 1JUDA 3UMSA 4ZHQF 4LVNA 3H5IA 4XQ0A 3ONNA 1RSZA 4FPXA 3K9CA 4LRUA 2L17A 4ZYUA 2FPSA 3GVHA 3ANNA 4J49A 2ECQA 1SCQA 4BLQA 2CFIA 2FHPA 2B2NA 2LNDA 4UDNA 5FADA 2QMZA 3T3IA 4CMEA 1N2JA 5H4HA 2GBIA 2E4UA 4KWCA 4WZAA 5I4KA 3SIXA 1EI9A 3JASB 4P53A 3PZRA 5DYYA 2AC7A 2VLBA 1WNFA 1T4DA 3G2JA 1PW5A 3P0FA 2FCAA 2RAVA 3ZVKA 4MW7A 1Z0IA 1FFXA 4KK4A 4Q6BA 1QR6A 2C7PA 1FW6A 4PPQA 2VUSA 1VQ1A 1QCZA 3KK0A 3VZDA 2PT9A 4IUBS 3C3DA 3PX3A 4DMKA 3AOEA 5T5QA 1A5SB 4N47A 2O05A 4RMJA 4QAQA 1RWNA 1R6AA 1FRZA 1YT5A 4ZC8A 5F1KA 3N75A 4XWGA 3ICOA 3CF0A 1BX3A 1B15A 2YASA 4DNFA 3STYA 4FLEA 1V47A 4LY6A 4OK5A 2BI8A 3DLHA 5CG2A 1GVNB 3S2UA 1SU8A 3W5BA 4DMMA 1JEAA 3K05A 4TTIA 3NDPA 3X1WA 4DSOA 1EP3B 2WIJA 1D1SA 3ASVA 2HDHA 5HKKA 5IXJA 1Z4JA 2CE7A 4DJFC 2IYEA 5CT5A 3SEQA 1JU3A 3B53X 1TVCA 4XQ9A 5LZ7A 3HHEA 4L9WA 4F2GA 3LX5A 1JSXA 3GP3A 4JK3A 4W99A 4LWQA 2QTBA 3TQTA 1SQ0A 2VHEA 3DEAA 3O9MA 1NM5A 1YAHA 2GK6A 4GNKA 5AXAA 2IS6A 4HAIA 2QQ0A 3FLEA 1CYEA 3R09A 4IS2A 4CF3A 5ITZB 2GPAA 1NSYA 5KWVA 1USWA 1XRLA 1V3TA 1BH2A 3PDIA 1C9DB 4N5NA 2WJJA 1RBMA 4RHFA 1XCOA 2C29D 2CFRA 2I7VA 3WDMA 1L7PA 4CF4A 4ENVA 1UFRA 3EUAA 4LE2A 1Y5IA 3ILYA 3UNXA 2QTTA 3K70C 2GASA 4RABA 5E0KB 5FI5A 1O9BA 3N2GA 1XK6A 1NJ5A 2WIAA 1XFDA 3BXHA 3K16A 3PQ4A 4IYJA 3VOBA 2HIAA 4MR8A 3WMXA 5ILQA 4LXQA 2GTIA 4LV8B 4WIAA 4G25A 3ZV5A 3IHLA 3RJ9A 5HBGA 4ER0A 1QO9A 1QRAA 2C3UA 4ZAXA 2P9ZA 3R8FA 3SSMA 5AW2A 5KTMA 1QPZA 3N59A 3WBFA 1HBJA 3VI3B 4G01B 3WL8A 4B73A 1XFAA 4ZO9A 2R62A 2YYYA 5DTQA 2HMTA 1ZK3A 2DHRA 4UUOA 2OAEA 3GUYA 4KQWA 3KSUA 2OQ2A 5FR2A 3UUWA 4DY4A 4JI8B 2QX4A 2FLVA 1JJVA 3E1SA 3I4FA 1N9KA 1P2DA 3GRFA 1X7HA 1C3EA 1E64A 4OFZA 1AZTA 3E8SA 2G5GX 1EU1A 2PWAA 3ZDBA 3NR2A 1ORIA 3HCRA 4TTRA 4Y8VA 2REQB 1YZQA 4MGZR 1FXWF 1VG9B 3TLYA 4JUBA 3ETNA 3H11B 4WUTA 3AHFA 5K6TA 5L4LA 2QLTA 4HP8A 1CKEA 2A33A 2CUTA 3KZOA 1G8YA 4PVDA 4WERA 2FZKA 3AF6A 2FE1A 2QE7A 2IYLD 2IIPA 4IIYA 3TWOA 4U2GA 1NBAA 1X1DA 3BDVA 1WU8A 1IEQA 2POCA 4UNIA 4JLWA 3LUPA 4W7IA 1NVVQ 5HTOA 4X7BA 3IXQA 5KU1A 3JD4A 2X8LA 1GCUA 2PS0A 2VDLB 2ZBRA 3HKEB 5LU9A 4PNHA 2NV0A 4EJ6A 3P9RA 4HDSB 2PUJA 4RK5A 2X7JA 3GQVA 1YDHA 2WJGA 2QD4A 4WVLA 1F2DA 2VZ8A 3PF8A 4DLZA 4JAVC 5ICFA 3O4GA 3OIDA 2PMEA 3QNWA 3ZJYA 2PKRA 2GSDA 4JLSA 4N3NA 2VDRB 4AJEA 3N39C 4BGIA 1KDVA 3BL6A 3FVTA 4EG0A 2XA2A 4M88A 5LVAA 5K0EA 2P6OA 3GLGA 3U6KA 1AS2A 3KB1A 2B4KA 3AFIA 5E7IA 4B79A 2D2VA 2BHLA 2PWBA 1QHIA 2QVXX 5TLSA 3GJZA 1L5KA 2I80A 4OQ4A 1UBMS 2D5CA 3K8ZA 1P60A 3LGSA 1WNTA 4U1RA 2I6SA 2JK0A 3SOPA 1ICEA 2JLUA 4ZO6A 4RIFA 5I8PA 2RHMA 5IABA 1NLYA 3UA4A 2Q49A 1LNSA 4KI7A 1SBNE 2DCMA 2OHHA 1GNTA 2Q3HA 3B1YA 3JWEA 4R1MA 4F91B 4ITRC 4G9EA 1Y5NA 3K20A 5IFLA 5ITVA 4PLVA 4ESEA 1DO8A 3MFQA 4DA9A 1ADGA 4QD3A 4Y9RA 2W8ZA 1BU8A 2DYKA 4BLOA 4E7PA 1YONA 2NO6A 3WTBA 1RLTA 4BDSA 4DB4A 2JW5A 4CNQA 5HGXA 5EIBD 4LY3A 2CXRA 3D6TB 1BMQA 3O03A 4WKBA 3ZQ4A 5JSFA 1ZLYA 2QRLA 4KIFA 4E30A 3I09A 1Q1GA 3ZZ1A 5LJLA 2A59A 3VV3A 3RKSA 1YTUA 1KYZA 4PLYA 4RY2A 1QK5A 2C94A 1NY6A 2AG1A 2W8BB 3KDSE 2DQYA 3E22A 2OGWA 1SBHA 3E58A 3K9HA 4IHQA 1V9SA 4MW4A 5FV7A 3BE4A 2QR5A 5GV7A 4EB3A 2UYQA 2LCQA 4UKDA 5BQFA 4I3FA 2HI0A 4DS3A 3W2TA 5I48A 4KQKA 3RGWS 2WE7A 1TZKA 1DIGA 4MB2A 3Q9SA 1Z8HA 2GCGA 1ZMOA 2W93A 4MKRA 5HFJA 2A5DA 3T7SA 4UAGA 1N0UA 2M1XA 4Q6WA 1BXZA 4AZ0B 4YV2A 1U3VA 4KDCA 5LMCA 2JFQA 4EFNA 4E03A 3K30A 1O94A 1EX6A 5EXTA 3SQLA 2QAGB 3TFOA 3UYLA 4QREA 5K4HA 5LWHA 1P9NA 4EB6A 3GH3A 3RYIA 1PD1A 4QTZA 1DWPA 1E7WA 3EH2A 4D8WA 1XJ0A 1JFSA 1UMDB 2LD4A 3FSRA 3CX6A 2ZB3A 2EZ4A 3ETCA 3NO4A 1OU0A 3T9DA 1H5QA 4RIIA 1JMYA 2A0UA 2GN2A 2Y0BA 1MD9A 3I2KA 3WGQA 4CMKA 3BCRA 1GA6A 1NMEA 4OAOA 3CLKA 1B0PA 2H1SA 4HEJA 1BS1A 1XL0A 2VXOA 1PX0A 2E6KA 2JHFA 2JA2A 5BOSA 3QY0A 5TIIA 1IM2A 1SVMA 3EIFA 3SJ7A 3CVUA 2OK8A 2BH2A 2C4WA 2XKBA 4YLEA 3WGKA 4EVSA 4RTOA 1OLUB 5DHAA 1XHFA 1WDTA 2CLSA 1TM3E 4RENA 1IPHA 3M1LA 2ZBGA 5TQ0A 4OHZA 1ZZGA 3NU1A 4G84A 4MR9A 3SWWA 1CEYA 5SZHB 5CG1A 4CM4B 3CW9A 3V6MA 1FQKA 1KH2A 5ALZA 4HJRA 2W37A 1RYMA 3LC1O 2RDMA 4G2TA 2HT1A 1SKMA 5CFRA 2BD0A 2WRZA 2V5UA 1R4NA 5HS6A 4BS9A 2UUCB 1J4AA 4G85A 5J4HA 3GDGA 1SU6A 4ZYWA 1E7SA 1VJ1A 2IPLA 5DM0A 3HFSA 1NRXA 5EXPA 3E3LA 2P62A 4ZZ0A 4OP2A 1TM4E 2GJAA 4FFSA 4Z4GA 5K8IA 2G9RA 2Z5FA 1ADFA 1D09A 1XKXA 2J4DA 3H0KA 4HLCA 4ZTZB 1GGFA 4GKVA 2I9KA 4F5DA 1VIMA 2ATCA 2WYUA 1CBUA 2NV2B 5KHLB 3R5KA 4L4YA 1XLTA 2RMKA 1TUGA 3E5HA 3BUSA 3QX7A 4YALA 5J1TB 4Q19A 1CUEA 1O97C 3CXUA 5INTA 4I1VA 1W1WA 3A6DA 3JSAA 2P6PA 1PFVA 5K4AA 5C4IA 4JEMA 5KUTA 4UTVA 2PEZA 1CE8B 5I3CA 3ZE2B 1KFKB 2OHXA 4HWKA 3R77A 4WZAE 1GUZA 4FCVA 2P9CA 2VF4X 3CNHA 4HNVA 1D1TA 3BD8A 1X87A 1XOIA 4CKWB 1HSOA 4H7DA 5E2BA 3HMKA 2GPJA 2JCSA 1U1IA 1O5IA 3B7PA 1Y1LA 3L7IA 3GMSA 1B0UA 1YZHA 4QPZA 5TPZD 1OTXA 3RBZA 5AVZA 1AV6A 4YWJA 3FSJX 3EQ7A 1FPMA 1TRKA 3LVFO 3P9NA 5FWXB 4PPNA 3KHUA 4HAUA 1PR0A 2BCEA 5CB4F 2A4MA 1KI8A 2H11A 4W5WA 4PXSA 5JMPA 3NWBA 3PFBA 4NG4A 2FTKE 3IE2A 3C4QA 3E61A 4GOOD 4P4SB 4QJ3A 3K5WA 3VNVA 1G3IA 1G5TA 1N0HA 2PT5A 2OLEA 3O7WA 1N34B 2H4XA 3RS8A 1OXUA 4M53A 2DLDA 2WUVA 1KZ7B 3U9LA 2X9VA 4K9SA 4A5OA 3GPLA 1GQRA 2VDOB 2B7LA 1ZRSA 1OZAA 1XF9A 1JHMA 2P9QA 2GWHA 3Q8XB 4PLWA 1SQGA 4WESA 4XQEA 4BX9A 2NU9A 1LLQA 4AZVA 4EUEA 5JEEA 3L3BA 5TEWA 1LSSA 5C8VA 1E18A 2G4LA 2FRVA 3LPNA 3B6EA 1KZ4A 2H52A 3GLIE 1CIJA 4N65A 4A0GA 4ZAVA 2W42A 1LSOA 2QOEA 4OHYA 2QRHA 5A3JA 2AL7A 5H9VA 2JFZA 4PLHA 1JDNA 2P9YA 1H9AA 2B5OA 2C4UA 4U02A 4BRWA 2DVMA 2NO1A 2P1RA 2ZVJA 4AI6A 4JKOA 5BURA 4P0TA 1ZQ1A 4EW6A 3AETB 3KEMA 4B7XA 1LPAB 2AMFA 2QL9A 3F3YA 1YV9A 1BEZA 1U8AA 3ASYA 3GGDA 5JLAA 4YRZA 4HNAB 2XYGA 1BFUA 4TQAA 4OL9A 5AJVB 3H97A 4BNDB 4UBIA 4BWYA 3I8OA 1PQ4A 2XR1A 2I3BA 1N1DA 1YGPA 4KPGA 3ESYA 3DOEA 4NQRA 2OCKA 1Z12A 1BC5A 3SMQA 4ACBA 1ZESA 2V7BA 2G06A 4K6KA 4UXIA 1JVBA 3E3AA 5L51A 2GILA 2ZYIA 1YKFA 1M66A 3L7YA 5CVUA 4YMGA 3C2QA 3DKIA 4NBUA 5D85A 4BFWA 1ZK4A 2VHUA 3LC0A 3T1TA 1RKVA 1UK8A 4TUYF 1I5OA 3N2EA 5AHXA 1MG5A 3H4VA 1X1AA 2ES4A 3B52X 4TVKA 1ZVJA 5JCJA 4JJIA 2UXDB 1HYGA 3HU5A 1E3WA 3BSWA 1Z33A 4U8HA 1PU2A 1Q84A 5B4VA 3DFMA 3W5VA 4DM4A 4BGDA 3R44A 1T6ZA 2FPRA 3AY3A 1H0HA 1XUOA 5CDFE 2AH5A 4HTFB 4HWPA 3U56A 4NFSA 4NCIA 4A16A 2QPAA 3IA7A 3HJFA 1GV0A 4E70A 1NAIA 1Z2AA 1R0CA 1TQ8A 3GCDA 2H4FA 4RV5A 3EULA 1IVSA 1IBCA 2NW6A 2RC5A 4C0WA 2VT3A 5JC8A 4XUGB 5E1DA 2XUPA 4KCGA 3HA7A 3TD6A 2PIAA 1EP1B 1W4ZA 2H2GA 3MFYA 2OORC 1G7RA 1N6LA 2BFFB 1C5KA 1DFGA 2HRDA 2WHEA 2A9PA 1R5BA 3QTBA 4HQFA 3U1VA 3TLMA 3Q5GA 2A0KA 5FWYA 3M3PA 4TMFA 1Z17A 1U90A 4A8JA 2F64A 4IWNA 2J9XB 4C6SA 3CZ4A 3LSTA 4DMRA 1Q3TA 5IVKA 3LQ4A 3K4HA 3KKOA 1J0BA 1X3LA 3OURA 4M4SA 2H17A 3IKMB 5FRDA 4XUEA 3F74A 3BCUA 2NU8A 3PVZA 3QOYA 3GLGE 4B2IA 3K94A 4F96A 2NTVA 2X5XA 1E1RA 3LWBA 4ITVA 1KPHA 3U44A 3I9V6 2QRVB 1XVLA 4XX0A 3OZWA 2PZBA 2W2QA 4D3XA 5BW4A 4FR2A 5ITWA 1WWKA 1X77A 8MHTA 2QNIA 5DE3A 4PLTA 5CYPA 1J0CA 2C20A 1JKJA 2GDJA 3KOOA 3I0ZA 1VHLA 5J1SB 4H59A 3ZI0A 4D4LA 4WAUA 1MVOA 1SCBA 3IIJA 3L8MA 3U1BA 2I1VB 3K2QA 4OFXA 4YRDA 3FPHA 4ZCMA 1N5OX 4QXRA 4HBZA 1E2JA 2P9GA 1T2DA 1Y80A 3KTOA 3GAZA 1A5TA 2Q4RA 2JA1A 2BONA 2R1TA 4GI2A 4GRAA 4U2CA 4LYHA 4W5TA 1CUCA 1DWQA 3WYDA 3FW1A 2DE0X 3HLKA 3IO3A 3WWCA 1O6ZA 5BWCA 2TMGA 5LDGA 3CLSC 1JHRA 3B12A 3MSCA 4B6GA 1VL5A 2BGUA 5ADWA 1ISRA 4W1QA 4RKEA 3ICEA 4RLHA 4DQKA 1J8QA 2NU6A 5EE3A 5FWAA 2V7WA 1JTVA 2AA3A 3GEDA 3VOTA 4RDXA 1QJCA 1BDIA 1HTBA 2J0SA 2R751 3UJNA 1Q2XA 2CJYA 4BB5A 3IRUA 1RMQA 2OO5C 1WW3A 5IASA 1ISFA 1JECA 2R48A 4JUAA 2ZBEA 4LI3X 2PLRA 1DC6A 1QIHA 1K7CA 5K0NA 2ZE5A 3OQPA 2WJ6A 2XKJE 2J3JA 4P33A 1IG0A 1Y3BE 3PR1A 4A4DA 1W94A 2WABA 1XRSB 3UJPA 3GU3A 1TM1E 4IIUA 4IIDA 3E05A 5IC6A 4FYKA 1OZHA 4QXQA 4A26A 2C7OA 1VPWA 1EHYA 3BQ9A 1DAOA 2ZI9A 1JP7A 3AB3A 4MV8A 4PAOA 3S1LA 4D6YA 3PWSA 3CQ9A 4HDNA 1EE9A 2NTNA 1HFWA 3I6QA 2QTCA 3C3PA 5JXGA 1FZQA 2OT3B 4P7BA 1MGOA 4RWEA 5CIQA 1DKUA 4YACA 3MOIA 3UK0A 3V8PA 2J3QA 4ABYA 1HE8B 3D81A 4RDCA 3QBDA 3CG0A 3QHAA 4UQPA 2QG4A 5CYOA 3X44A 3ZWYA 5K0JA 4HGYA 4X1KA 5JALA 2RAUA 3DYBA 1W8IA 5GJBA 3JZFA 2OZEA 1OIWA 2YWXA 4P0QB 1VI5A 4PQRA 3R40A 1OY1A 5T4EA 3WYGA 4P8RA 3DTVD 3PIRA 1T34A 1HL3A 5BNWA 1UDBA 4JLVA 4JIGA 4F45A 4D56A 1QE0A 5FLXA 4LQ4A 5JUWA 2WSIA 3T4PA 2J41A 4DW8A 3L0IB 2L69A 4C06A 2V96A 4ZREA 4CFSA 2AN9A 2WHPB 4OREX 3QJYA 3REOA 3A9UA 1B4DA 4URVR 3GLVA 1QGAA 4FINA 4PHTA 1O77A 3GBVA 3JD1A 3OQ1A 4M1MA 4QPNA 3TIIA 4W5QA 3EGDA 4Z9AA 2NUTB 4ZXPA 3Q6IA 2Z3WA 1Z5WA 2MSKA 5LOVA 3Q11A 3LDAA 4IVNA 5A4IS 5DN6D 2L19A 1BXGB 2CNWD 2Q3DA 4C0HA 5FX2A 4DDMA 4QGGA 1KO5A 4LF6B 3EZGA 2FEKA 2ECFA 3IKJA 3RG2A 1SKYB 2WWWA 3OICA 1I4LD 1KZ6A 5K6RA 1PG5A 1DJLA 4ZOLB 5H80A 4RUKA 2VLIA 3MJHA 3UJDA 3QP9A 5J2UA 1OB2A 1T2EA 1ECJA 1B23P 3ICWA 2DT8A 3BKXA 9LDBA 2VP3A 5HW0A 3J7AC 3RIHA 2JZCA 4PQYA 4OI0A 3G49A 3TVDA 4QPJC 3FDJA 1RQRA 2DWQA 5L53A 2EZ8A 2O19A 1T1EA 2HA2A 2R87A 4MKIA 5EI5A 1BX1A 3N28A 5FOQA 1XDBA 1XTRA 2GF2A 3ZDEA 2HY7A 1AT1A 1QVVA 1VI6A 3LYUA 3NAMA 3P0HA 4H17A 4LA4A 4MA0A 4IZ6A 5F21A 1SC9A 3RV4A 3AEUA 1IN5A 1Z2DA 3OX3A 4EHFA 1RC8A 4ZT5A 1DKQA 2OYSA 4PINA 2CBGA 4BE7B 1RAGA 3JAKA 2C7BA 2PZGA 3BWBA 3ZHQA 2OCBA 3I2IA 1GU7A 2OC9A 2HJGA 4XOIA 2BN4A 3M49A 4RDHA 5DTEA 4E5UA 4XYLA 4QQKA 2G17A 1JSLA 2X2PA 3T1OA 2JJ2D 3M4ZA 4WNCA 5E3IA 1P9LA 3VR2A 2YNMA 2APJA 4KXVA 2DR3A 2IOFA 2E0IA 3B7WA 3ZW9A 4FEEA 3J81k 3U7IA 5F73A 2ZT6A 1U98A 3C7TA 3RU9A 3V4ZA 1KQGA 4WLUA 2EJUA 3DLCA 1HWYA 3P9IA 4QAJA 1KDTA 5HZMA 4RLFA 4TZ0A 4DADA 1KRXA 4IHKA 5IBQA 1IM5A 1O95D 3TUJC 4F04A 721PA 3C45A 3UN1A 1Z39A 5C8YA 4Q9IA 3C1AA 4HRXA 1RWOA 2FMKA 4O4LA 2Y0DA 2IQIA 1SD1A 1D4OA 1Z5ZA 1ZNWA 2J46A 4FZVA 2V4ZA 2FW0A 3JVIA 4OF4A 3T41A 5F4BA 5FLYA 5HVNA 4CRWB 4RTPA 2BGGA 1ZMRA 5EWMB 1W0KA 3O92A 4GKAA 4HAXA 4JI4B 3HN7A 1Z0SA 5HPYB 2Q3FA 5JNSA 5IKMA 4DR3B 1QP7A 2CL0X 3ZW8A 2HLHA 4MEJA 5AT1A 1JHVA 1ZJ4A 3ESQA 1QCYA 4U2DA 5BYKA 4BJ1A 1QRSA 5JJ5A 1CP3A 1MNAA 3M2TA 4OFWA 4Y7CA 1BOFA 5E9QA 3RVSA 2B92A 3L4BA 2Q0QA 4UM5A 4U63A 3TZCA 2NYAA 3CUSA 4BXOB 4EUKA 5CP8A 1E9BA 1VKNA 3I76A 4O8ZA 4D9NA 4MLDA 3T4UA 1DT3A 1YI0A 2DUJA 3B89A 3O8BA 3NVMB 2QW1A 3QU5A 5G53C 2IYNA 3HY4A 5E9WA 2QM8A 4JLUA 2OAQ1 1R9JA 2V1UA 4H0CA 4FYYA 3S1SA 3GL9A 3S70A 3NBAA 1MZVA 2X0EA 3TNJA 3PE6A 3EIXA 2VDNB 2SCUA 4YTEA 2KWIA 3T3DA 4C0BA 3L0SA 3OPXA 4YJFA 1I4DD 4H6WA 3VR4H 5GV8A 2X58A 4P7JA 4ERNA 1CXZA 1DIBA 2WJZB 2HRQA 4EPWA 3IUSA 2WFAA 5LBUA 4MB0A 4Q4HB 1G3RA 1P1IA 4IQGA 4WBNF 5ADHA 1J6UA 1G63A 4CMIA 3N7UA 2Z2ZA 2EU8A 3R5FA 1RHJA 4N49A 3K1YA 1ZM9A 1Y48E 1R6XA 1Z3IX 4G63A 4YRAA 1Z5UA 3FCOA 5B6IA 4BNNA 4Z9XA 1HPLA 1SZDA 3I6MA 2O54A 1LDGA 4JC0A 3DPSA 5IN4A 3RYHB 421PA 2EWMA 1QFZA 1WU7A 5CH5A 3KCQA 4BV3A 1BU5A 5HXAA 4NAHA 4GH5A 1A82A 3B5JA 1JHQA 3UMRA 1XYGA 1TQ6A 1ZK0A 2WU8A 3C5HA 5CGQB 4KQ1A 1SXQA 3DBOB 1QZXA 4GPAA 3L7MA 1A7AA 2UV8A 1T4GA 3RIYA 1RYBA 3RTCA 2ZXEA 1EJ2A 3PRYA 3OTGA 4F5EA 1AUVA 1T3LA 1E77A 1HL7A 1POWA 3LLSA 2IUTA 1V16A 3P45A 3ZWAA 3OQHA 1Q12A 1RHKA 2H16A 5EIOA 3LUAA 4B7CA 1C9MA 1WB4A 1TTQB 4PWZA 5EQFA 2VPXA 3KR1A 3M81A 1ES9A 1E1CB 4HGNA 3C5WP 4FHZA 3IAEA 4TROA 2B4YA 3Q98A 1JYFA 5BVGB 4KAFA 1A97A 1IEVA 3IVMA 5A2GA 3V1LA 2XIJA 3W5SA 3ZKWB 4HYQA 1IJKA 5F2EA 3ESCA 4Q4CA 2O2EA 1GNLA 1ZW1A 3F47A 5KHOC 4TN1A 4JQSA 2PSFA 4Q02A 1EUCA 1KPIA 4RV4A 1KOFA 4YXWD 2ODTX 1SXJB 1ZGCA 2RHJA 4EJSB 1DAMA 4RWZA 2XCTB 4GKJB 3SBDA 5E6RA 2F43A 1SVKA 2WIDA 4C21A 4XTRA 1N2HA 2A0YA 4PG4A 4ZA2A 3GJ3A 5K8JB 2PX6A 1X8LA 3QLUC 2QZJA 2HRZA 5DM2A 1A4IA 3NIGB 5HCIA 1ZD4A 1QG2A 1XQVA 2EV9A 1O96B 1A9ZA 1EESA 4I4NA 5A9RA 4EAQA 4UUNA 1V8DA 4CBVA 1O03A 5TC4A 4KXQA 2VNJA 3CF4G 5L4NA 5ESWA 4EEKA 3DUFA 3C3CA 3C0KA 1Z4MA 1TGVA 2VQ6A 3RFTA 2VPIA 4UFPA 5LJIA 1EAYA 4KZPA 5AM2A 2Z3ZA 2VATA 2GYYA 3M4JA 2RGBA 2QZZA 1L1EA 2GAIA 5FYQA 3IUEA 1TK9A 2XB6A 1R6TA 3SC3A 3M6UA 1QORA 3FCCA 5DWDA 1UBJS 4C0QC 1EFVB 2VJMB 5DZSA 1E59A 4KPYA 1QYCA 2DWUA 3ZZUA 5DK4A 5EXDA 1U2GC 4I4TF 3ENVA 3W2GA 1GZDA 3BJIC 3QNUA 1R0XA 1FMTA 5L3ZA 3IAM1 4FWTA 2AJBA 3DWIA 3ZY6A 3RLFA 1IQ0A 3FKSA 3GXOA 2IYUA 1QF7A 3OQMA 4G24A 2FFAA 5DGIA 3W6OA 4ARZB 3TSOA 2ILTA 2AN5A 3ZIAA 1YZLA 1ITZA 3T12A 4F9FA 1W76A 1L4GA 4BMSA 3O4HA 3SEZA 5BR4A 5AW0A 4P35A 1J0DA 1YJCA 1GQSA 2WZDA 5E7JA 5DRYA 4E51A 5DBFA 1Q0PA 3KQLA 2ZAYA 5CJPA 5CHEA 4L5AA 1AQIA 2YRFA 5T6BA 2O0LA 5KTSA 1QC5B 2RG7A 3GT7A 3OT4A 4FNGA 4N7RA 3DFKA 1Q15A 3PFFA 3QVMA 4LOAA 3TOVA 5K45A 1MHPA 1AHPA 3PVCA 3VYUB 5ED4A 3N5KA 4IXMA 2CXOA 1J25A 1Q0ZA 2XHZA 1RZRD 3TR6A 4AMBA 4YYZA 3MT9A 2OFPA 4WNAB 2BH9A 5IAKA 2HA5A 1AKEA 1ZVKA 1GZSA 5HA5A 4LN1A 1WDMA 5FBWB 5CFPA 1YIAA 2FMXA 1YRQA 3V8EA 5JNWA 1N78A 4FTWA 1I2ZA 1OB5A 1GTMA 2KM1A 3TKLA 4TXHA 2PSSA 3AR2A 5C7IO 2JFVA 1NQUA 4AB1A 2PANA 1JDPA 2C9MA 3E9ZA 1ZCJA 4FX5A 4JOBA 4PX5A 4WY2A 2R65A 2A35A 2XUDA 3EOAI 3EXHA 3ONWA 2AJTA 1WPGA 3S99A 2X3YA 2OP0A 1DJNA 2P9TA 2GPBA 2QRJA 2WILA 4MWDA 5BV0A 2O2HA 4MAMA 4CF5A 3WHLA 1I33A 2DSNA 2Y99A 1IXYA 1T6XA 1PT5A 2I66A 2W11A 3D0RA 1T25A 3AR5A 1OXKB 2QT1A 4OK3A 2LVBA 2BP7A 1LWOA 2B6HA 1NX6A 2LXNA 1X70A 1PZEA 1UDXA 1AKYA 5T4BA 1TKAA 1FFWA 5JC1A 5C52B 4KR2A 1FSFA 2I87A 1M5TA 1X1QA 3MJTA 4PRKA 3BGSA 4B2YA 5C7OO 5ICSA 5LSAA 3DA8A 2FKNA 4NVRA 3ROQA 4QQNA 2AYYA 4ZI7B 1CUJA 1LJ8A 1TF5A 3KKKA 3TJRA 4XR4A 3L4JA 1XRRA 5IFKA 4MO2A 1L8OA 3MBOA 4MEBA 4AUEA 1K27A 5JAHA 1BROA 5CCXA 5B6JA 4F4DA 4ALNA 3TI9A 1BH6A 4DAEA 1KVTA 5DM4A 4AKEA 5ERGB 3MELA 3UO8B 1ANKA 5DYTA 2VHQA 4ARAA 2NVWA 3H9BA 4D9KA 3USZA 1MLDA 2UAGA 3FF1A 3IP8A 3TE6A 4K46A 3AEZA 2M6LA 1ZUNA 3ZHBA 1BCRB 2G63A 4CM3A 4D02A 4R41A 2O5EA 4HZUB 4JZYA 4OH1A 3V4OA 5C4GB 3VH2A 2AD1A 4EA6A 4Z5XA 3GG2A 3OFKA 2OFOA 3R7AA 1CCWA 4BFLA 1W5AA 1XB2A 4L4ZA 5LDHA 1XD2B 4K8RB 2OBXA 4QDXA 3IQWA 1P1CA 1AQLA 1DCKA 3I6IA 1L0BA 1BEUB 1I24A 3E9DA 5LP6A 2VUUA 1NW3A 3DLTA 4LOJA 4WOCA 3BA6A 5CYFA 4FK8A 4MS3A 2A3RA 1DO0A 2V3VA 5TV2A 1Z0UA 2HNAA 3CUYA 2PXHA 1DQZA 4RZ2A 1MO4A 2Q3BA 4HGZA 1LQUA 3WJAA 2OHVA 1XTTA 3C7DB 1Y3DE 2QL5A 4YMVA 2JDID 3WSWA 3OEHA 1QDUA 1GG5A 4RE5A 2JIDA 3FNHA 4WCFB 1KYQA 4X8OA 5CVCA 4U7GA 3B60A 4PZDA 4RW0A 4EY4A 1AQUA 2FEOA 2PUTA 2ZYAA 4B6JA 4G1VA 5KSOA 4AJ2A 4X3PA 1PBNA 4UCWA 1KJ8A 2ORWA 1GILA 1ULZA 3BWMA 2X8BA 1IC6A 2J4CA 2AHOA 3B38A 3JQAD 2ZIFA 3ZHSA 2X6RA 3M9LA 4JA2A 2L82A 3L0PA 1O95C 4KXFB 1SUSA 2GOYA 2JGDA 5KOJA 1CU1A 4KH0A 3DAPA 3EDYA 1UKEA 4MKZA 4J1TA 2QD2A 4MNTA 4D46A 5GIPE 1BD4A 2P91A 2YHBA 4O2BB 4A2CA 2DGDA 2PTHA 3CN7A 2IU4A 5K1ZA 1LX6A 2D0IA 4TKUA 2ZPAA 4BNMA 3HADA 3OPYB 4V38A 4WN9A 1T9AA 1RPJA 2C2HA 4X24A 3UGQA 4F4CA 1VDMA 3ZHZA 1Y8CA 3FPSA 4Y9DA 3I4LA 3KELA 3EGOA 4Q4JB 4AS2A 4OEHA 1F0KA 3CEJA 4ZP1A 2JVJA 2B20A 3DJFA 4I7EA 2OXFA 3V6LA 3F1LA 4HNRA 2Q1UA 3V2GA 3HUTA 4LMRA 3GGJA 3B2EA 3NBMA 3FZGA 1TM2A 4LISA 4BFTA 4C1BA 2FGJA 2RFLA 5K3CA 2A5FA 3TFWA 1VE7A 3KVYA 5B1SA 3KUKA 2CJFA 3IPRA 5M29A 4P2GA 1KYVA 3DUWA 2XUQA 3OMLA 1KFBB 1QHEA 2WF9A 4UVDA 1J9ZA 3DEZA 2A4KA 1T26A 1M10A 3NWEA 3R3SA 1GQQA 1RYYA 4IZOA 4YH1A 3FHLA 1D8TA 1QAOA 2F48A 2HHJA 1U0NA 1HDYA 1M2HA 1VG8A 2ID8A 4JR0A 3P9XA 1DADA 5B36A 3GPBA 2YFKA 4FZRA 3DEYX 1USIA 4MPDA 4TL9A 1COWD 5EUQB 3T1QA 1IL0A 3PX7A 3PNVA 4IEIA 4X8HA 5JATA 3PUJA 3ZLJA 3O9ZA 5DI3A 1V7QA 1EWKA 2QP3A 3JQ7B 3W34A 1NJ1A 4DA0A 1RAFA 1Z5PA 2B3DA 3NOXA 4FR5A 4O1MA 3HBMA 1WABA 4PPFA 4EI8A 3DO8A 4GYWA 1AG9A 4N01A 3K1JA 3RVDA 1XTIA 2IVZA 3DH0A 4OIMA 1KYWA 5CM2Z 1Z2PX 3VV2A 4C9BA 5A4DA 1T5BA 2R1VA 4N0QA 1PT8A 4KVAA 1QF9A 5BN3A 2VRWA 1X74A 5JSKA 1ACLA 2BEUA 2WWFA 1TDJA 2C9YA 1H2EA 2Z4SA 1AGPA 3MUEA 1ZNQO 1JNXX 1OBOA 3BJZA 2XZOA 1B1CA 2Y27A 1QLWA 4K9QA 1ID8A 3CGWA 3EARA 1QXSA 1ADJA 2VAPA 4JP5A 2CLKB 4LFBB 3MF4A 4L5YA 3W7VA 3VC1A 4LNUB 3WLNA 4WFQA 2O1EA 1I01A 3KKZA 1YZNA 2V98A 3CNNA 4IIJA 3NAQA 4L75A 4ZRMA 3VYVA 3I9MA 4A15A 3T5DA 3WK4A 3HV2A 1NJSA 4A8TA 1UMKA 2R2GA 3FJOA 2FSIA 2D8AA 3I9JA 1HM5A 4Y2PA 2REXB 3ON5A 2VYVA 4S05A 1J5PA 2DQZA 2ZROA 4KIUA 4U6NA 4EUNA 1R00A 3KALA 4FUQA 3INYA 4E14A 3RIEA 3SHVA 1SCIA 4P82A 5JXHA 1LQTA 4B8YA 4P98A 3ZHRA 2HBZA 3FUTA 3CCFA 1BXRA 1X86B 1E3SA 3LUKA 3V4RA 5ITSA 1L5MA 3UFXB 3H84A 3FWNA 3CU5A 4MIYA 3QBEA 5CTAA 4MVJA 3U60B 1CUZA 4KTVE 3T5GA 1F5NA 2PS3A 4DQDA 4LSWA 3W77A 1A77A 1PJAA 4FFVA 4HR7A 3AUAA 5HGJA 4C5CA 2Y93A 4OAPA 4DOMA 5EXXA 5AW1A 1GZUA 3QVVA 3U9SA 2CV0A 4BQIA 1HT2E 1SCDA 1WL8A 3NIDB 1CD5A 1VA4A 1RRFA 2VEDA 3LYHA 3ACDA 5CEFA 3I3SR 3NVKI 1LPBB 1HT3A 2XOKD 3REQB 3ZVLA 4IIVA 3VYSB 1YULA 1OVMA 4C4ZA 1SVIA 2IPMA 4JI1B 3KKEA 5H82A 5KWIA 1JHOA 4MSUA 2BJVA 4EGQA 4JUCA 1XDDA 5LB2A 1TJ4A 2RJ3A 3PT9A 4Q3DA 1RP1A 2E4XA 2VP6A 1UKVY 2B34A 3B36A 3RASA 5LD2B 5C32A 1CQIB 4PRZA 1CZUA 1ZO8A 2B8EA 4GQAA 4BY9E 2ZRIA 4HK4A 2G82A 3T9FA 4ESHA 4QDOA 4OKSA 2I2WA 2OESA 2FWIA 3HBAA 3CLUC 1AKQA 4FCCA 4XGQA 5KDDA 2ZJ2A 3EXFA 3FWYA 4G8BA 4LCEA 4RXTA 4U00A 1CZNA 1R4MA 4N5IX 4S2EA 1KEEA 5DPMA 1UZAA 5LNK1 1SBIA 2E55A 3PENA 3SZUA 5B3JA 2QU8A 2DFTA 3HEAA 2ZRHA 1WCYA 3EZFA 3RNOA 2ZREA 4C3UA 1YS6A 1V4VA 1JFVA 3BRWA 2HSGA 1X3SA 1DT5A 4JN6B 4ND3A 4V0LA 1RRKA 4Q1DA 5TMEA 4F38A 1S5PA 2XITA 2X0IA 3PPXA 3G2KA 1XXHB 2FMFA 4L3OA 4FE7A 1LVGA 5COQA 1IWPB 2PX0A 4PEVA 2WD9A 1J0AA 2WWXA 5E9AA 3SHOA 3COSA 2ORIA 3A32A 3BFXA 1J0EA 5AQEA 4CM9D 3EPHA 1SVLA 4L0QA 3UAVA 3NW9A 4NBTA 4QO7A 4G4GA 1XZMA 4AULA 3KKPA 2EQAA 4TTQA 3GNQA 1QDLB 3JQQA 5FUVA 4OO3A 2W9XA 4CQNA 4UNPA 5L3SA 1WB9A 5JD3A 3KZCA 1BKDR 1MF7A 3HRHA 3R2JA 1O08A 3HGTA 2WM3A 3L79A 3HPRA 1AKWA 1GTG1 4UNQA 4B35A 1PQUA 3OP1A 1NJGA 3K0KA 2HLDA 3U31A 2JFUA 1PUXA 2QZPA 3KPYA 4MVWA 1DX4A 3LUCA 4PC2A 4AU1A 3AXTA 3OEEA 5JNUA 2F3PA 5A3VA 3NV9A 3ETDA 1HDOA 5K2MA 1YC5A 1U9IA 4HLQB 1D7AA 2RGYA 5AHWA 4JX9A 4NU5A 4UVIA 1O6CA 2IH2A 2EKDA 1CQZA 3PV0A 4TT8A 1MOSA 1JKIA 2XYQA 1FFDA 5DNAA 4WINA 1HUQA 3E15A 4GMXA 4ZCLA 2PQ0A 4EF6A 2YMQA 2FN7A 3C15C 3PG5A 3QI7A 2DWPA 4LZZA 4N4AA 1O6BA 3I5AA 3DBRB 4IHJA 4MR8B 5EZYA 3V1TC 2GKGA 1QTNA 3CO0S 4LZAA 3JXEA 5I7EA 2H7XA 3HJNA 1WB5A 2HV8A 4RVSA 5ETJA 1P6QA 3OJLA 1VSQA 2FSVA 4NFLA 4XASA 4Y6QA 2X40A 1T1RA 1ETUA 3NHWA 1MJHA 1V35A 1VL1A 5DHPA 4ZN6A 3LPCA 4F85A 1DBPA 4ZXFA 3MCWA 5AI0A 4ZAYA 3E7XA 1M6VA 1KI2A 3FMOB 1KIMA 2G6BA 2ZATA 4L72A 2BZ0A 4Z4QA 4BNGA 3TPZA 1W0JA 2DJ5A 2QE7D 2O07A 4TV8A 1TUEA 3KV1A 5GINE 4Q1CA 5LBIA 3IP3A 4LX0A 3ONEA 3WLJA 2ZSJA 1M34B 2J31A 3C4VA 3PFHA 2L18A 3FROA 4PG5A 3WFZA 2AS0A 3QLTA 3ID6C 2FMTA 4BVBA 2HH9A 4MUYA 1RBQA 4LXYA 3DD5A 4R1OA 1IHYA 1XAIA 3QE4A 2YS7A 4L3WA 4HAOA 2W6CX 5DCYA 3RAJA 2ZUUA 4GEGA 1NW5A 1OHHA 4Y2JA 3IDFA 3A58B 3WB1A 4O2AA 3DG9A 1S6YA 4RD1A 2JGMA 1OFIA 4TMZA 4OQFA 4YRQA 1RRMA 4YA6A 1AKMA 4KREA 4AF7A 4DA7A 3AY6A 3HUFA 1H4VB 2VYNA 3O8QA 2WF5A 4K87A 3R7LA 5MFPA 1UKZA 2XNDA 3UJ9A 1P3JA 3B1FA 1F7UA 2PX2A 2EG9A 3YASA 4ER6A 2E1PA 3WX0A 1O1YA 3ORFA 3EC1A 2FZVA 2P1ZA 4HNGA 2B4QA 4LDPA 4TRJA 5F5XA 3RVOA 2DFPA 4TTAA 2KE5A 1KI4A 3I5MA 2COKA 1K3UB 2XW6A 1OZ0A 3T35A 2C9OA 1HEUA 4ARBA 1BSVA 2ZSHA 1Z25A 1CUGA 1Z4OA 1EXNA 1CFJA 1WVMA 1PCXA 2VSXA 2HDNB 3RH0A 3QVGA 4DWOA 4RKWA 4JVMA 1RVDA 4LBWA 1GQYA 1KVQA 1W85B 3PNYA 4FYMA 4Y98A 1UOPA 1W34A 4ZWNA 3SIRA 3TM5A 2Z30A 3IA2A 2PH7A 1M2EA 3DDUA 2P6UA 4ZJPA 4RKYA 5SYAA 3EIEA 3C8MA 1EEXB 3UC5A 3WGNA 2C5EA 2GBLC 3UH1A 4UM8B 3CF6R 4FE3A 1Z4NA 4LEIA 4PYLA 3ZGNA 4ASUA 4OYLA 2VHTA 4GI3A 5HSGA 1VL2A 5ICGA 1E1MA 4IJ5A 5AI4A 2GAOA 1E2PA 1C81A 1I2AA 2QL6A 3R3HA 3C3YA 4M9QA 3BDAA 4LZWA 3GRYA 2WSBA 4P5EA 4CKEA 1ATZA 2YTZA 4IVQA 1HYBA 4GC9A 1AZSC 4XSGA 2CFTA 1MPTA 3WXMA 5KJ1A 4A2QA 4ZHQA 3ZY2A 5LCXA 5A4KA 2ZBPA 2WV7A 3LGAA 5IAOA 1G0OA 2ZKIA 3IODA 2H18A 1SUPA 4GPZA 2JK1A 5AQ1A 3T1YB 3VNAA 1PNTA 1ZICA 2H8GA 3K6JA 4NONA 2WHXA 3UBMA 3H19A 1H2YA 2KMLA 3QWFA 4IS3A 1BWSA 1N9ZA 3W7AA 4LS3A 4PW0A 1VYTA 1O94D 1V7ZA 2X9QA 4J1NA 1QGUB 3C48A 3F4BA 4XB2A 3RRFA 1EXVA 2DLCX 2RGRA 1R18A 1E60A 2HXSA 2IYVA 2H5LA 4EDFA 1AKNA 3FI9A 1ESCA 1UEIA 3QIAA 3RABA 4DHEA 3FYCA 1QX4A 2B2XA 2QTRA 4UPEA 2Q99A 3F73A 1NAHA 5D7BA 4ERXA 4KO4S 1C2YA 2G6TA 3EGIA 3EDCA 5TX7A 1GFSA 1NMQA 4QPPA 2XE8A 1MW8X 2JCYA 2EBWA 4ZMBA 4CLXA 2PZLA 1G8HA 1ULUA 2ZIWB 2YJ3A 4FDUA 1SGWA 4K2AA 3U49A 4YAGA 5CFNA 3BQNB 4FDAA 3MJDA 4KN8A 2GN1A 2C0QA 3HXTA 1WSAA 2E85A 2B7BA 3KOYA 2O9JA 4WGFA 5HIIA 1PTJA 1EVEA 4NCAA 1O58A 2EYUA 3GFGA 4DQVA 1FU7A 3JWPA 2Z09A 4HXFB 2DPXA 2A94A 2AHRA 2BR3A 2W83A 3L6DA 1BN6A 2IXTA 3CUEF 3PZBA 5ALFA 3NTOA 2EAUA 5TRTA 3FUWA 4FGLA 2VDVE 2P7HA 1L5VA 2ZDGA 4IV5A 2XUZA 2PBRA 1R8SA 2IV3A 4C4RA 4EO9A 1ZR4A 2GN9A 2VC2B 1P61B 3QFFA 2IBSA 4I81A 1YGYA 4NFYA 1M73E 5A3SA 2AX3A 1FFAA 3U4GA 5FI1B 2PZ8A 4E94A 1OFUX 1AUXA 4MVJE 2DEUA 2ODNA 1VL0A 3DAFA 4EBBA 4IDGA 3SFZA 2D2EA 4NHOA 5BNFA 3TW0A 4ZOEA 1YMVA 3ETHA 3S68A 1QYDA 3VVCA 5BYAA 5F98A 3WGVA 1H2ZA 4G8JA 1VDZA 3ESXA 5DYWA 1FNMA 1WG8A 2DBRA 2ZVQX 3WGZA 2P2CA 3LXMA 2I1QA 3GHYA 3R74A 1JEYB 4B33A 1E20A 1OLXB 3LLUA 5ERYA 1IY0A 2JCXA 2ET6A 2C3YA 4FBMA 5L7TA 1AOXA 5IJXA 2OLJA 3HCEA 4W6QA 3V46A 3L7CA 4KODA 1VCOA 1VZ3A 3M6IA 3QUTA 1H5NA 4B7UA 4QM6A 2DMRA 3ENZA 1BGWA 3GOQA 5THKA 3WLTA 3HM9A 3EMBA 3OCCA 3B2QA 2ZUSA 2CXQA 2XDAA 2ZR8A 1YHYA 4PO8A 4F2WA 1MEEA 5DASA 5IYZB 3RT1A 2KHZA 3UHPA 4QICA 1RABA 3RS5A 2MSWA 1B6TA 1UFQA 2JHGA 1N2CA 2OBFA 2PKQP 4C7MA 2B82A 2N9UA 3DWEX 1V1RA 3CS3A 2XECA 3EB9A 1YJBA 5JTUA 3DWFA 5CW1A 3BGWA 1WY7A 3G1WA 1M3SA 2ALJA 1LBHA 2BHSA 2OM6A 3C1OA 3FPFA 3FCSB 5DTIA 2CFSA 5JANA 1KMHA 1NVFA 1Z7GA 1I32A 3GP8A 3HVJA 3EXIA 3OCVA 3T7TA 4XRRA 1WHSA 1GUYA 3HU2A 4RMGA 4H4CA 5CA1F 1Y4SA 2WSLA 1ISPA 4BO3A 3SQNA 3OIVA 4XX1A 4GPBA 2DHCA 1LUAA 3IE1A 5TQJA 1JHDA 4XCVA 4QUJA 1DEHA 1LVUA 3FIUA 5EOVA 5TVGA 4EOGA 5GADl 5AHRA 3KP1A 1S4MA 5E0OA 2O5VA 4L8WB 4MV3A 4AY3A 3GUCA 1XAHA 3L8CA 5FBRB 3IEIA 2RH5A 4JUIA 4WESB 2QTWB 4DV0B 2AI1A 1JQEA 3K71B 3NJ4A 2NU9B 5FOUA 4N1AA 3D31A 3UA3A 1UBRS 4PC6A 2BF7A 1RR6A 4M99A 1U2QA 3JWGA 2FOXA 3A1WA 1Z37A 3OIGA 2RHDA 4FLFA 4FMPA 4FMCB 5CHYA 1M6YA 1W5BA 4S1OA 1WOYA 3ABIA 5HE8A 3TINA 2JL1A 4AJ4A 3OE1A 1EIWA 3FNFA 1PEAA 3OQ6A 4O4IA 1CSEE 3DT6A 4YQEA 2OHIA 3BK7A 3DVAA 3IT1A 2J45A 3HKBA 5JFTA 2PFGA 5I4BA 3QKIA 4FP9A 4LYEA 3SIPA 2P6RA 4EGCB 4OHKA 2K2QB 3IPLA 4TSKA 3IBTA 1LI4A 1CR2A 2QRNA 4MR7B 1UBTS 3N6VA 2BUCA 1YRYE 4KMMA 5DXFA 5FQOA 1NW6A 4PN3A 9ATCA 4X66B 3DV2A 4RCYA 5A5EA 3LW7A 1LLDA 3HWRA 3WOHA 2DBVO 3WBBA 3L8YA 1JV2B 3DZDA 5EJ9A 2F3RA 2CLOB 1Y4ZA 3AJDA 4QA9A 3TOSA 1V2GA 3LKDA 3QF7A 4OX9Y 3MTGA 3O8NA 1IUOA 4ND7A 5JCJD 3W4IA 1G64A 3SIWA 3L04A 1KDPA 3DE0X 3F5SA 3QU9A 1FLAA 2Q5QA 5KQLA 4FFBA 1JPVA 1Q7GA 1DAHA 1YI8A 3CT4A 4DXDA 1LDMA 1LS1A 1XTVA 3PEYA 1VIDA 2WM2A 4NZMA 5DNDA 5IS2A 2O2ZA 3RYCB 4DR2B 2IXAA 2YZ7A 3VHRA 2RHCA 1U7HA 4FT2A 2GCOB 2IZ7A 4F9EA 4X90A 4CV1A 1NUHA 4IOMA 2V7XA 2YYZA 2ZR9A 3PXUA 3I2HA 4OHMA 1LTKA 2QN2A 3UWSA 2IIBA 4DUZB 4NXNB 2EFCB 2FSUA 4H08A 4HFJA 3TZBA 4GNRA 3UJ7A 2IYQA 4MCAA 4MCIA 4P9NA 4K05A 4BZZA 3HB0A 1NC3A 2RAPA 1R1DA 2OYRA 3RJZA 1GRNA 3QVWA 1O4WA 1FTGA 2A9OA 3FA2A 1WUHS 4HDMB 5AICA 5JCXA 5C1IA 1NR1A 1F9AA 5E2AA 3MGAA 3CLTC 3I1YA 3M4XA 1D07A 1WPXA 1NYLA 1U0FA 4LJKA 1EK2A 4EPXA 4H1WA 1FLDA 4UW9A 2EHJA 3X2EA 4JVSB 5HX7A 1U94A 3G5AA 1WF6A 3LK7A 1L5LA 2XSZA 1RE0A 3UYKA 3VH1A 2ZM5A 3AVYA 5A4FS 1M0WA 1HNZB 2XGJA 1E1QA 3Q7QA 1JS1X 1XL1A 2IUEA 3CKKA 1WEKA 4CM8B 3OIWA 4KW7A 4AJOA 1OWMA 2BFCA 3NHUA 2VDQB 3VR4D 5DWVA 4DEVA 4XEUA 1JPNA 1YDFA 4CLOA 5HQ3A 1I5RA 3GJ0A 2FUG6 1LVHA 4K8OA 5DCLA 3WV5A 4KPUA 3ZK8A 5BW8A 3L7NA 2XWSA 2WJ4A 1V8ZA 1E4OA 3PQ2A 3FNQA 2OTCA 2FRDC 3OHMA 2FEWB 2CB9A 4G65A 3A6KA 2QTVA 4M7RA 1U2DA 3KSBC 1FSPA 3ANXA 1F2VA 4ZYXA 1JZSA 2H06A 2ZLBA 1G3UA 1NULA 3IX7A 1B8UA 2WTNA 3LH5A 4BNIA 3QKRA 1VLVA 4QGBA 1Q20A 5DHTA 5T3YA 1M74A 4NFHA 2D0OB 3H4IA 3EVBA 3VAZA 2Q6TA 4C4SA 4RTMA 2VPTA 3TUZC 2WMDA 1U4OA 2OMEA 4IGAA 4U7HA 3G5UA 3LT4A 4UTZA 5D87A 3SC2A 4GYKA 1IN1A 4F6LA 1SN7A 4ECEA 5KYUA 3TIXB 1ZH6A 1JXMA 4WZ6A 4B4DA 4DA8A 5JQGF 2JASA 5JARA 2QYOA 6REQA 3PQ8A 3DZBA 5GIOE 1E5TA 3KSAC 1JVSA 3TVTA 2H5JA 4U3JA 1L5FA 4HS4A 1PS9A 1L4LA 1ONBA 3AEKB 1RPNA 3VU9A 4ZJUA 2YH2A 3IELA 3D5QA 3ASUA 5ELXA 3ZU4A 4XPIB 1YBAA 4H6XA 3VSAA 1Y89A 1K9SA 1KBOA 3BG5A 2JD1A 5HWSA 5IZ4A 5C51B 4MMZB 3KBOA 1MC8A 4QODA 1GPNA 1M8GA 3P96A 2C8KA 2BTQA 2Z08A 4GMGA 5F7ZA 4TTJA 4UOQA 3PD0A 4LSZA 3M0EA 2R7LA 4KQMA 3NYWA 4GBJA 1ZS9A 2JI6A 3U81A 1FP4B 4O4HB 1I7SB 1VCHA 3GJ8A 3LUHA 2QM7A 1P4GA 2BLLA 2NVUA 4N03A 3LTNC 3FTEA 1UADA 1AMNA 1CS0A 1T15A 1ECFA 3T9AA 5FEUA 3I1JA 3IUBA 5JY6A 4ZC1A 2ZTHA 3BS4A 3PFIA 1TXGA 1U11A 1W93A 2WTXA 1WCXA 2ZI4A 2P0AA 4Q0MA 4X64B 4CR8A 4IHAA 2HSJA 3PYMA 5F12A 1U3GA 1OU4A 1IZ0A 5YASA 3N2KB 4D8YA 4TMWA 4ZVOA 4TPKA 3O38A 5CB4A 3HVIA 2W6IA 1JJ7A 4DCUA 5E8JA 2GZ3A 5IAJA 1BCSA 5A3QA 4BFYA 1OI2A 3U62A 1SELA 3KRTA 1IN7A 3OQNA 3Q8LA 8AT1A 3EVCA 2BR5A 3AU8A 3N70A 3TB4A 3A10A 4DLNA 3KZXA 5IF9A 2KSQA 5K8CA 1W581 1J39A 2P7IA 3JQDA 5K2OA 1GGHA 1W47A 1P7CA 3AFHA 4QDJA 2VXCA 2Q3MA 4PZPA 1SULA 4CR6A 1U1GA 3SSOA 5I7WA 4N76A 3P52A 3PKIA 4POOA 4JU8A 4QBKA 4QNMA 1E9EA 3DMPA 3LIPA 3TXXA 4MW6A 5JI2E 2R8OA 3GH1A 1JF8A 1U3WA 4N5DA 4WNIA 3NJRA 1YS7A 4EIWA 2GS9A 3JVEA 2ZULA 2CNLA 4RHUA 4WUVA 3FFXA 4KITB 1LA2A 2GPYA 3TOZA 3QEJA 3ZIUA 1N9GB 3UM9A 4YMHA 3DOUA 3ITDA 4B4UA 1V45E 4XFKA 4QBFA 2X2OA 1KAMA 3V7UA 3WGIA 4H0NA 1E6LA 3ZTWA 5ES3A 5E1BA 2M6KA 5B1IA 2FEMA 5ER6A 1RZVA 3IHTA 5TGTA 3G6WA 4O63O 4V1CB 4BO7A 2EW2A 5U1PA 3A2KA 4EBFA 4W6ZA 1EP2B 3BBLA 2Q5LA 4FS8A 1UBGA 3IO5A 4HWSA 1Z6TA 1JZTA 3B1XA 1SHUX 2FCRA 2QRUA 3LXUX 4IMPA 4JMLA 2F4NA 2GMWA 3N76A 3J80A 1KS2A 5J63A 4DJEC 2A9QA 4LJ5A 5J2UB 4GR4A 4IVPA 3GAMA 2CV2A 2CXTA 1W8DA 3BRCA 1Y7TA 3A3NA 4BZWA 5GZ1A 5B1DA 1FNCA 1YOVB 4FSDA 2Q6KA 1FP2A 2HJHA 4IF4A 1U8ZA 4F4JA 4WLEA 3Q7RA 3ZCSA 2XB4A 1KZYC 2OB1A 2PRJA 4G5HA 1JI3A 3TD9A 4IZIA 5BUZA 3AM3A 1RWMA 1VP9A 2QF7A 1A95A 2XUOA 3ZUGA 3CURA 4DJAA 4L9AA 3B8EA 3COPA 4PXAA 2P3LA 3ILXA 3N2ZB 5JS8A 1W52X 2AQIA 4EG8A 2FQYA 1UINA 2XOXA 3A8TA 4FGSA 2CCKA 2VH1A 4MUEA 1ZCFA 3KT0A 3RVLA 1FZTA 3TGWA 1VIYA 2HQ1A 3VR2D 2YNMD 3VSDA 4OM7A 1DIOB 2PLAA 3QMVA 4DNOA 1J7KA 5F2NA 4JITA 4IJVA 1VLLA 4UCFA 3DDNA 3FPAA 4GOXA 4RD2A 2BGLA 5BR1A 4YI3A 1MVNA 2LCFA 3RSGA 3ELYA 4B5LA 5IJAA 2IL1A 1L7DA 4ZODA 1CEXA 1UMCB 3MVEA 3DF7A 8GPBA 1Z29A 3BSFA 3KJZA 4YK7A 4AS1A 5HDBB 4JT4A 4D9CA 2BGRA 4WLNA 1UDAA 3AQIA 4R2WA 2BZ1A 5DHQA 3FHCB 5JAIA 3FLMA 4Z1MA 4CODB 4FMDF 4KK3A 1EVLA 5BUCA 3TRIA 1RFLA 4D9GA 1ZN7A 2LV8A 1LWNA 1EGQA 3ZE9A 1TF7A 4D0NA 1G8AA 3N8IA 4WKNA 4WPGA 1Q1NA 4PFJA 2IKSA 1EK5A 1MABB 1E2KA 3DKKA 2TMKA 4J0QA 1UZMA 1EPUA 1TW3A 3AZPA 3EDRA 3GAAA 3GLUA 4EHAA 2NAPA 1RD4A 1XEXB 2ETVA 2QIPA 3SXPA 2K7FA 3T99A 3AY7A 3KDAA 5I01A 4LZNA 4GAEA 1XVTA 1OQAA 1MTZA 1EHCA 1ZMBA 4N6OA 1M8KA 1GPBA 4L8GA 2CSUA 5BV1A 1DC5A 5AVQA 4PZCA 2GJKA 2CMFA 1RWVA 3NT2A 3PHLA 3ROKA 2XXJA 4C0XA 3CNLA 1MH9A 1S8FA 3H9EO 5M2QA 1KEZA 1YUBA 1DVRA 1T24A 3UJCA 4PSAA 1TFUA 2F6RA 4Y2HA 1G7TA 1FYWA 1I7NA 1SHJA 3C7AA 4PR0A 3UJHA 1F4VA 1Y98A 2C7QA 1CRPA 2YHAA 3CX3A 3OG9A 1Q6ZA 2ZSFA 4G9GA 4JJGA 3AC0A 5TSDA 5MF6A 1C3XA 5B64A 4HADA 2GAFA 4D4JA 5F7XA 5IWCA 2DFLA 4U4AA 1Z2NX 2RK3A 2AW5A 3P71T 4X54A 4WVFA 4EA8A 3GA7A 4Y0VA 5HR5A 3KHTA 1ZAKA 1Z26A 3JZMA 4JIMA 3Q87B 4UBNA 5EHIA 3Q12A 3ZS9A 2GZDA 3UUFA 4CMIB 2WJYA 1Q1ZA 3GEHA 3HR4A 1EK1A 1VE6A 3IMCA 3R3JA 3MZ0A 3SE0A 3ZWBA 4JLAA 2H9AA 2VA9A 2WTMA 3TF5A 3LY7A 8ABPA 1G4AE 3F97A 3Q0EA 5GM2A 4UASA 3VKWA 3THYB 2UXBB 3NFYA 1PS8A 4D25A 3DM9B 2ARKA 3QXGA 3L06A 5CXSA 3RPEA 3HUUA 1QBGA 3AVTA 3KYIB 2ZUTA 2OZVA 2YDXA 1PJTA 1RZ3A 2CL5A 3L0OA 3PKJA 3QEMB 2G1AA 4YT2A 1QHHB 4QPCA 1L1QA 2W2KA 3RTEA 3JQBC 4L1KA 1MJFA 1A9SA 4WCDA 1Q57A 1L8XA 4RK7A 4Y2TA 3L9WA 3DHEA 3HRKA 1FNSA 3GB9A 4DR5B 2CK3A 3ROXA 2YVLA 1KFEB 3EXEB 3QWHA 5EE0A 5F52A 3IMKA 3O3MB 1GOTA 5LZ4A 3QEBZ 4YP6A 3KAJA 4PCLA 3WYAA 2RHGB 4BECA 3BMNA 5K0GA 3GYBA 1QFJA 2I8CA 4R1SA 1UF9A 4NJMB 5DYNA 2I29A 1RJ9A 3HDVA 4WK4B 5KJFA 3BK2A 3VR5H 1M5UA 2Q28A 3I2JA 3L6BA 4AC9A 2VTDA 1GV1A 4U0JA 1DUSA 4PYRA 4M1SA 2X19A 2P2ZA 3GAFA 2M32A 3H1TA 4G1UC 4WKOA 1ONPA 1WCV1 2IEDA 3SXUB 3CPSA 4F9GA 5IULC 3NHLA 4FYXA 4ZGGA 2A1UB 2HF9A 5FUMA 1ORVA 2BFEA 2DCUA 2GXUA 2M6RA 1QWSA 2IBTA 1KNXA 2WOJA 1ST3A 2XGMA 3AUUA 3EWIA 4O3FA 2BT4A 2HA4A 2OFWA 4HGRA 1U5BA 4QUEA 4DPLA 5FPSA 4EJFA 2I6FA 2XQIA 4FOTA 4ND2A 3ZY4A 1BE1A 4A6DA 1L4YA 3M5CA 2X0KA 1KZGB 3KU4A 1XPRA 4JJKA 4Y7DA 3MRTA 3FTQA 1JSZA 2Z04A 3DXYA 1VBKA 1E2NA 4M9SA 4BQOA 1LK5A 4E32A 5CK5A 3URMA 2VPZA 3U7QA 2PE5A 4BO6A 3OTIA 3B3AA 1JVNA 2QAGC 4QE3A 4CIDA 4OSOA 2C61A 4U2KA 3OFNA 3OQJA 1IATA 3NEYA 2GNOA 3I9V1 3NHFA 1FRVA 5T3UA 3D6VA 5EYPA 1J07A 5KTKA 3ROEA 4HRAA 3O4IA 3GQBB 2RI1A 2Z4RA 5DN9A 2Y9PB 2CUZA 3CC8A 3NZEA 4X1IA 5JWOA 2B0JA 5CJJA 2QRQA 2ODEA 3HPQA 5BSKA 1E5VA 3EQ2A 4WXHA 1M0EA 3OHPA 3FKSD 2C2GA 3O2SB 1NATA 1ODJA 1STOA 4DSTA 4EG3A 5IX8A 2GFHA 5ADUS 1C4OA 1BGVA 3IOEA 4ZV7A 3RRMA 2P0EA 2XCIA 1DV1A 3T9CA 3ZIAD 1GM5A 3KO8A 1G9SA 2VNKA 4LWZA 2EBFX 3HI6A 5BN4B 5LXTA 2VOJA 2ISCA 3V8NA 3S7TA 5GWXA 1YQEA 2GPSA 3FOAA 1CHDA 5EERA 4C4TA 1GN9A 1OYOA 4PFQA 3JARA 5KNDA 1E7RA 3F8WA 5JPDA 3A26A 4UZFA 4AO6A 2N0SA 4AKSA 1AGYA 4KYIB 1N5IA 3PE4A 4NBNA 3D6NB 1DPGA 1DPFA 3IDQA 3BILA 3H5WA 4YGYA 5TF0A 1TAUA 1DRKA 5JR3A 4HH4A 3UCEA 1ZP6A 1IY8A 2CYBA 1C50A 2E48A 3TBHA 4MJ3A 5AW3A 2O6LA 2BEKA 2LKCA 5JMOA 2B2CA 2HDWA 2XUFA 4QBTA 5JJCA 2CW5A 4GOMD 1T6BY 1X14A 3WDSA 2XCQA 1XZPA 3Q7PA 4NE2A 1W0CA 1YA4A 3EFOB 4K1LA 3KQKA 2VHXA 5H3LA 3RKRA 5H4GA 4BVKA 4HDKB 4YXWA 1CB7A 5KI6A 4V39A 3LCCA 3M1YA 4ZMRA 3OX4A 1MB9A 2GAJA 5G1NA 1CUIA 4IX1A 2IS1A 1BS9A 1UUFA 2Z2KA 2G36A 3PRKE 1SQ5A 3ZD8A 2QVBA 2BDTA 3AM5A 3EA0A 5A9SA 3IEPA 5CTJA 1B8VA 4IJQA 1IXKA 3MWDB 3S2FA 4E2FA 2FEAA 2GVNA 4MTCA 3ZU2A 3BICA 3KC2A 2W71A 4R1NA 5FOSA 3ZE0B 5KQSA 4I46A 3VOAA 4K6MA 4KO3S 4QTUB 1W75A 4C6TB 1JA9A 1GUFA 1PK7A 2VTKA 2IF0A 2VJBA 2PXCA 1JDVA 3REGA 2D0PB 3E9NA 4Q4DA 5IRCD 2IH4A 1H93A 4ZAWA 4MYCA 5C18A 2Y4OA 3BTOA 2C92A 4HFNA 1Z08A 1SZCA 3E9MA 4H27A 4NZZA 3SZGA 3AR3A 2WWRA 2H9IA 3AL2A 3R6TA 5LC1A 4BC1A 1M1YE 3HVUA 3DBLB 3VSEA 4B8WA 3TIFA 1YBFA 1DXYA 2BELA 2E1RA 1M2NA 3PITA 2RH9B 4RF4A 4RZUA 1WLYA 1NGSA 2EGUA 2RHBA 1SHKA 3R41A 3DAGA 4YECA 4WBNA 2AE1A 2XUJA 4F4IA 1ECBA 1NV8A 1RI4A 5A5GA 1UXIA 1ISHA 2FETA 3NM4A 4CQMB 3CVWA 2VYQA 4XVUA 1ENPA 5AI6A 1URPA 4X85A 1MB3A 1E3EA 2AJLI 1XTBA 2R00A 1ODSA 3V4SA 3G3EA 3TNYA 1M83A 1QMPA 2QVCA 3WMFA 2QTMA 3CB2A 3QFRA 5LLTA 3NDJA 5KKAA 1Y6GA 2CXPA 2GZ1A 5GVSA 1K7FB 2Z6UA 5FFMA 1V5FA 3AI2A 4MWZA 3GD7A 1DBVO 1QR2A 2IPXA 5J5VA 4BO2A 1QPGA 1QAMA 1KFCB 1TQ2A 3GLKA 5JH7F 2QUZA 1GZ7A 4DIEA 2ONJA 4CTJA 3DVLA 1UZLA 2QMYA 2I3DA 3G9UA 3MHPA 4M1ZA 4DC0A 1YB7A 3ZGYA 2JFHA 1GZ6A 2R97A 2PX5A 2LKDA 4BNTA 4DF3A 2ZWVA 3OEHD 1Q50A 5H16A 3IKVA 1IWOA 2F90A 4URYR 1J0XO 3BSYA 5EIWA 2M6SA 3ZDQA 1C3VA 5EWLA 1MRNA 3WNZA 5EIXA 1QVWA 1WXWA 3ED1A 5TPWA 4B4WA 1FX0A 2IZ6A 4G0XA 2Y0EA 4XJSA 1M9NA 2BGIA 3ESZA 1ZHOA 2Y1FA 1MCZA 1TKBA 5H81A 4BIMA 2NGRA 4ENRA 1L3IA 3OZCA 2G4VA 2ZRFA 4B3BA 1GA4A 5EQDA 5LU8A 1Y81A 4R1TA 1V71A 1HMPA 4DMFA 1XQWA 2XKKA 1R9MA 5EKXA 5EJ7A 4ODIA 5K0BA 1IZ9A 1K2VN 4CVNA 2DQKA 3NRJA 3PC3A 4B5KA 3DT9A 3R5SA 2TMDA 2I55A 4AL4A 3H04A 1B74A 1PZFA 1QNFA 1CQPA 2B21A 3AP3A 4HF7A 3U61B 4YO8A 1W96A 1U3DA 4RJIA 2PS1A 5HUJA 3BMQB 3CX7A 5AW6A 1TFRA 4B40A 2VP0A 2ABWA 1O3YA 3HYNA 2EX4A 4QU9A 3VM6A 4WN9B 2BYTA 1QCCA 1CZLA 1IHDA 3QUQA 2XNKA 1I10A 3LCVB 3QV1A 4FLMA 4KR0A 4UHFA 3VZCA 2JB9A 5C5EA 4HLUC 3KXKA 3KU1A 5CDTA 1WCIA 3THXA 3ZDDA 3F98A 1OZGA 1DXHA 1XZJA 4BN5A 3BGVA 3DVQX 3AK4A 1L1FA 5K8VA 4JNKA 4B3JA 4YQFA 3HXLA 2AYZA 2W2LA 5I9LA 1ZC4A 2IXDA 1EFRA 3F8SA 3CH5A 3QFHA 3SDBA 2JEOA 3DHWC 1WSDA 5AI5A 3S4YA 2ADOA 3NOVA 2CMHA 3E1KA 4IQ8A 3UAYA 1X19A 4XDZA 3KLBA 2VDWB 4UTRA 2AOUA 2VAMA 3SLKA 2XD4A 3A3YA 2ZVPX 4QSMA 4RVCA 3R6WA 5L4SA 1SHTX 3BXXA 4MWCA 3A1NA 3OE4A 5JCPA 5JZBA 1WKCA 1ZH2A 1XRNA 3JX9A 2CLMB 3QE0A 1FTSA 1EDDA 5TMPA 5HQTA 3P94A 1C7EA 1GAWA 4DCJA 1C1YA 1VXRA 2EX1A 1RLJA 3DZ8A 2C4NA 2ZE8A 2ZRGA 3BMCA 2ISSD 5AK6A 3B1ZA 1FK8A 2F8LA 1TA4A 1RC1A 4QQRA 1G3QA 1PO7A 1DJQA 1KI6B 1Q3HA 2PRKA 3DZIA 3M6FA 3OZSA 4ZVKA 1EDOA 3S29A 4WECA 1C30A 2J07A 3KHKA 4BGVA 4EK9A 3AERA 4G09A 4WZBB 3QW2A 3SMVA 5AVVA 2L0XA 1DFHA 4BKRA 1DKLA 1J9EA 3TMAA 1LBQA 4QYMA 5IJ9B 1K5HA 2RKWA 4R05A 3E8XA 3QUCA 3NBYC 2OEPA 2H00A 1C1DB 2KB0A 4Q7MB 4LECA 3DC7A 2J5KA 2C7VA 1TM7E 4B1FA 1JIJA 1VJDA 1X8XA 4TRMA 5DTJA 1RT9A 4OYRA 1J90A 4HEA1 5B53A 3RK1A 3W79A 1XELA 1CUFA 3LSYA 2GZMA 3EHDA 4GXRA 3RSHA 1U3CA 1JMKC 2F9FA 3I28A 3PPYA 1TVMA 4EELA 3CF4A 4AZ3B 5ANRB 4R3WA 3ZD9A 1GARA 3QPWA 1U0RA 2Z56A 4CE6A 4Y1GA 4X71A 1ZONA 4YCJA 3DSRA 3D7MA 1GTZA 1U8FO 2EC5A 3MC1A 4BQNA 3WQBA 1ZGGA 2PKCA 2WZBA 1W88A 1U9YA 4J4TA 3VHXA 1Y6ZA 3GZTB 1AXRA 3QMPA 3R0ZA 3ABOB 4KSYA 1LNZA 2BI4A 2MJLA 2V6JA 1S0UA 2UVPA 2VYVD 3LPMA 3D54D 3G5MA 1JLRA 4MVJI 5B4UA 4G5FA 3X3HA 3UKJA 4YDQA 4FBLA 2CKDA 3JD3A 2C4KA 1TQ4A 4U6QA 3KZ1E 3DMTC 4GM4A 1W30A 2AR0A 3EZ9A 3TSAA 3KL2A 3K0AB 5AIBA 1OAAA 3AZOA 4Z99A 5JIBA 2YWJA 2IXEA 2JFXA 2W7TA 4BMNA 3PQ6A 5BPFA 4K0KB 4URHA 5TNXA 1JEQA 4TRRA 2Y71A 2UYGA 5GOZA 2GH1A 3RVNA 4DDUA 5BSFA 3QELB 4MVJD 4N5LA 1M8FA 1NY5A 4Q7JB 3CH6A 4R81A 4LQLA 3VR6A 3QKSA 1A8PA 1VE9A 1YQUA 3ANSA 1BXRB 3DTYA 2OQVA 4J7UA 1KYXA 1OLSA 4B46A 1J24A 4BNZA 1FOEB 1N3LA 5AM4A 4DUGA 1YJQA 2PYZA 4M6WA 1I0ZA 4ZVNA 1M7BA 2EF0A 2O50A 2PNFA 3I8SA 3FVVA 5B2ZA 4EW2A 4ZZ3A 4PHGA 1M0SA 2W5UA 3MCAA 1ONNA 4TV9F 4EKDA 2CZGA 2V58A 4Z0HO 4Z54A 1EH5A 3Q4GA 5BNIA 2YW2A 4DGSA 2JPDA 1RDFA 4R1PA 4RIEA 2R8EA 4JSTA 5D1NA 1X80B 5GM1A 1Q44A 1HE2A 2I6QA 1R6DA 3DF9A 3DT8A 3WYCA 1HZZA 3FTCA 5AI9A 4DLXA 3LBIA 4TRNA 1H5UA 2NXCA 2OHJA 3BIFA 5CPBA 4YMSA 5PGMA 3TRKA 1OI7A 1QONA 1SAYA 3D2CA 5CAEA 1EUDA 3MBKA 3TEJA 1JIXA 1FU8A 1V7CA 3CV3A 4FNMA 1YFKA 4XJVA 1EVKA 2GTHA 3L05A 1Y3FE 2EFHB 1XQYA 2CHVA 1JKFA 4TM8A 3K31A 1QDEA 2ZR0A 2PX8A 5ENVA 4ZT2A 1EG7A 5BN5B 5JVDF 2R3SA 2IH5A 1XN4A 3BRSA 3EUEA 3QFTA 4UXJA 1HE4A 4X41A 2BSAA 2Q4DA 3OLZA 4MUKA 5CVVA 1KEEB 3WMRA 3I64A 4XGRA 5JAPA 3KYCA 4I99A 4J90A 3DXXA 1C7QA 3QVKA 4OK6A 4ZKEA 3ZKAA 2D6FA 1YR1A 1BOOA 3WLAA 1QYRA 4F6CA 3PGKA 4X60A 4UHCA 1CQWA 2QP9X 1LDYA 1PFYA 3R1IA 4D0RA 1TA0A 1Z4LA 3WYFA 4UM9B 5EL0A 3T94A 3RI3A 5LBTA 1C14A 2PR7A 1ZA2A 5DX8A 3VU3A 4CL0A 2VNIA 3OVMA 2ZJFA 5FL7A 2R4UA 4JP1A 2Q1WA 4E5VA 4D9EA 2H92A 4GLOA 2NZ2A 3TLCA 3R7WA 1WM1A 2BVNA 2DSTA 3DBIA 1A9YA 1RHRA 2K2WA 2WTEA 3VR3D 4G5XA 3NXKA 5DLEA 2O2DA 2PV0A 2HLDD 3HYLA 5AJHA 2ZYRA 4Z8YA 3RJMA 1E92A 4RJTA 5LMUB 2HHCA 3WMGA 1WVIA 3OEED 4M1KA 1Q19A 2K7ZA 4MHSA 5DGCA 3SC4A 3K0FB 1GL3A 2WVJA 1PGPA 3ONFA 4NCJA 4K3VA 1GSIA 1SA0A 1XCLA 2FWPA 1TT5B 3QWBA 2ZIZA 4MLZA 2XA1A 4HQ6A 2ZJZA 5ALEA 5CPFA 3NB0A 4GRDA 3WZLA 1WETA 4AVYA 2J1LA 2O2JA 4LK2A 4XWOA 1T2FA 5MDHA 1XKLA 1XVIA 1KGDA 2O57A 3RC1A 1P0CA 4IP0A 3K2IA 1ZCAA 1EFUA 1L7VC 4GWGA 4TVOA 2FQWA 3OIFA 3RJ5A 3WICA 3AOGA 3QVUA 4MYTA 3SK0A 4BBJA 3U0BA 2I71A 3RARA 2YVQA 2GESA 3THWA 2YMLA 1SIWA 5EZYB 1QFYA 4R40A 3WWEA 1ZJZA 4EY6A 2CNKA 3OCZA 5JZSA 5JYCA 3W4JA 3UANA 3AI1A 1HOTA 4PLGA 4IUCS 2B36A 5AM5A 4BMCA 3A1EA 3FFTA 4J3FA 3AF0A 3I37X 3LCJA 1D04A 3TJMA 4BB9A 1FLVA 2EZUA 2I2AA 1G2PA 1UOOA 5IJ0A 4P83A 4DV5B 4B4OA 1Q16A 3G2IA 1W0JD 4G4IA 2B83A 3N2IA 1DIHA 1JN0A 1RAHA 2W00A 4RBNA 1CYDA 2EJVA 4BIIA 3GOHA 3B7GA 4QARA 5CA0B 1Z82A 4HVCA 1W4AA 4L4SA 4NPCA 2E5LB 5AW9A 1CY1A 1NR7A 4P08A 2JFWA 1JXOA 1GUDA 1WF3A 4IDCA 4C14A 1QB8A 2J0EA