1OR8A

Structure of the predominant protein arginine methyltransferase prmt1
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
313
structure length
313
Chain Sequence
HFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 1
publication title Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of Its Binding to Substrate Peptides
pubmed doi rcsb
source organism Rattus norvegicus
total genus 94
structure length 313
sequence length 313
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2003-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1or8A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1or8A01
5ICCA 5CVVA 2NXNA 3OE4A 5GM2A 1WY7A 3FUWA 1NW7A 1MHTA 2ZULA 2JH9A 5DXJA 2GB4A 2OO3A 5CD1A 4PYMA 5FWAA 3IHTA 5CUQA 3LSTA 5EKXA 4RTJA 2HWKA 4OX9Y 4PINA 1Z3CA 1IXKA 2P40A 1UWVA 4OA8A 4BLWA 3E23A 3G7UA 1QZZA 2JH8A 3CJRA 5E8JA 3C6KA 2AOUB 3FUVA 3UA3A 5EPEA 3UJ6A 5BP7A 3CKKA 5BW4A 4QVKA 5DSTA 2B25A 1XCLA 4HTFB 1YF3A 3G8AA 3ERCA 3EEYA 3HCAA 3HA7A 3KQOA 1SKMA 5FUBA 1G8AA 4HC4A 4MWZA 5EGSA 3UBTA 3CGGA 3NW9A 4C04A 2OBFA 3LHDA 1G60A 4HGYA 4L7VA 5FA5A 1YUBA 1EJ0A 2QRVA 3NVMB 1SQGA 3HEMA 3DLCA 3GGDA 3R24A 3CCFA 5EMJA 2CL5A 3UJCA 3PS9A 5K05A 1YZHA 1RI2A 5LQCA 3T7TA 2BR5A 2VDVE 1JR4A 3BKWA 3MTEA 2GPYA 5EC8A 3SSNA 1RI3A 4YUYA 3SGLA 2EX4A 2G71A 1M6EX 1VQ1A 2OZVA 3PX2A 3VSEA 3DULA 3GDHA 5EZQA 3LBYA 4P7GA 4E30A 4NECA 5E1OA 5K09A 2PBFA 5DX1A 3ER8A 3ANXA 4Z2YA 3REOA 1WS6A 2YXDA 3UJ9A 1T43A 3SMQA 2GS9A 3DTNA 4AZSA 4BLVA 4HRAA 3HA3A 3GNLA 3M6VA 1X1BA 3BKXA 1NW8A 2F8LA 3BXOA 1L3BA 2YUIA 3A7EA 2FCAA 1EG2A 2YX1A 3I53A 4K6MA 5E1BA 3TQSA 1R8XA 3HCDA 4ER0A 4AX8A 1RJDA 5HZMA 3EVFA 2OY0A 3ID6C 4XCXA 3EMDA 1RJEA 2UYHA 4C06A 2FPOA 3SSMA 5EQJB 3TMAA 4EVIA 5LSAA 1YFJA 3BWBA 5K0JA 1JSZA 2PXXA 2ZIEA 3LCUA 4U7TB 3HVHA 2IFTA 4AUKA 4YV2A 4QQNA 1G6Q1 1PRYA 4U7PB 1I1NA 2UYCA 1L3IA 3E7PA 1X1AA 5BW5A 5E1DA 4LWPA 3A25A 3NWBA 3OU6A 4QTTB 3TOSA 7MHTA 1NW5A 1H1DA 5DM1A 1O9HA 4PCAA 3KPYA 3FPJA 4FSXA 3KQQA 2PV0A 3OFJA 4CKEA 5LQAA 1Q0SA 3LDFA 5HIMA 3G2OA 4HSGA 3HVIA 2ZW9A 4GEKA 3EGEA 3CJTA 3G2QA 2GLUA 2P7HA 1INLA 2QRVB 3GRYA 4QTUB 5EZSA 4AZWA 4RTLA 4RTPA 3K0BA 3B3JA 4X41A 1TPYA 4GF5A 1G55A 2FK7A 5DXAA 3CC8A 1BC5A 4DQ0A 1YFLA 1TW3A 2G72A 5IKMA 2ONZA 3KR9A 2VDWA 4F84A 1JQEA 1ORIA 2IP2A 5DRTA 1N7IA 4IKPA 4LECA 1R00A 3P9IA 2AN3A 3EVZA 1NW6A 1Y8CA 4YV1A 1VPTA 4F86A 2I7CA 2IPXA 5K0BA 4C07A 3O31A 1OR8A 2PWYA 3M6WA 4ER5A 2PSSA 4CXMA 4YUWA 2QE6A 3U81A 4QPNA 2ZLBA 3C0KA 4ER3A 4JXJA 2I6GA 4FR0A 3CBGA 1JTFA 5GINE 5D1NA 5LQKA 2ORED 2UZ4A 2ZVJA 4KWCA 2XBMA 2KW5A 2NXEA 3QOWA 1KHHA 3KR0A 4FGZA 2PKWA 4QDKA 3DLIA 4UOEA 5GOZA 3LCVB 3SR4A 4PONA 3BWMA 1XCJA 3KQMA 2Y1WA 1PJZA 2LD4A 5F2NA 3FUUA 3TLJA 1QYRA 4Y30A 1FP1D 4E32A 1KYWA 1VBFA 3OCJA 4DA4A 3P2KA 2ONYA 1KPIA 3HM2A 3OFKA 1FJXA 3OPNA 2B2CA 5DRYA 2P1DA 3V8VA 3SSOA 4PNEA 4OQDA 3Q7EA 4A6EA 1AV6A 3MCTA 2YXLA 5GWXA 3GIWA 3THRA 2XVAA 2IH4A 5CVJA 3Q87B 3ELYA 1VL5A 5K03A 2PT6A 3LDGA 5DX0A 4E2ZA 3RW9A 2PX2A 3DR5A 3LDUA 3KQSA 4Y2HA 1VP9A 1ZGAA 3BWCA 3ELDA 3GJYA 4YUZA 2BM9A 3NJRA 4M7RA 3AXTA 4BP1A 4DM3A 2H11A 4E2WA 5FQOA 4E70A 4MHTA 2IDJA 2O57A 3OZRA 3AXSA 2ZBPA 3HCCA 4IV0A 4RTRA 2EJUA 2AOXA 2AN5A 4ZTBA 1XXLA 3LX6A 4RVDA 2FK8A 3RODA 3HA5A 4V0QA 3G88A 4QDJA 4PYJA 1JG4A 5EG5A 2JJQA 2GAFA 3CJQA 5K0EA 5GIOE 5LQRA 1ZKDA 3FPEA 2HTEA 3BWYA 5LQNA 3MHTA 4GBED 1M0EA 4BP3A 4PIPA 4ER7A 1TW2A 2AOVA 2OB2A 3ELWA 3JWIA 4PYIA 5EOVA 3FYCA 2P7IA 3X0DA 3A4TA 5FULA 2VZ9A 5CCBA 3EEOA 1NBHA 4EQZA 1HNNA 1NKVA 4R6XA 5E9QA 2FHPA 5EHIA 1O9GA 5FHRA 2ZCJA 4WVLA 3C3PA 1Q0TA 3GO4A 4PGHA 1UIRA 4PYLA 4EMSA 4RTSA 1M6YA 2R6ZA 5K0NA 5HIKA 5EMMA 3IEIA 4PCLA 4RVFA 2WA1A 3EVGA 2UYQA 2JHCA 5C9ZA 3SVZA 5CIYA 2ZBQA 5C0OE 4YMHA 2K4MA 2E5WA 3KQTA 4RX1A 4P58A 9MHTA 4GC5A 4DCMA 2VS1A 4KRGA 8MHTA 2ZZKA 4GC9A 2BR4A 3A7DA 1BHJA 3EPPA 3FTEA 2YTZA 3FZGA 2PX5A 3TRKA 5FA8A 5EIWA 1WZNA 3NDJA 4P7JA 4BLUA 5EEHA 3A26A 3OE5A 3P2EA 2OKCA 1KR5A 1D2CA 5H02A 1XTPA 1KP9A 1XDUA 5E2BA 2ZBRA 3NVKI 3FUXA 4PYOA 3TM5A 1IY9A 2P3LA 1NV8A 5E2AA 4MQ4A 4RV9A 5E9JA 5KQRA 1N7JA 2QM3A 2IBSA 4IWNA 2H1RA 2O05A 4B17A 4YUXA 5K0LA 4PIMA 2CMHA 3KU1A 3R0QA 3BUSA 4FSDA 4GOLD 1DL5A 2B78A 3D2LA 4PWYA 1I4WA 3GCZA 5CM2Z 1ZG3A 1VP3A 5ICGA 1P39A 1L3CA 3R9XB 3OU7A 2PVCA 4RVGA 5M5BA 2B9EA 2PXAA 4QVGA 4AZVA 3P2IA 1B42A 4M36A 1RI4A 3M6UA 3MERA 1JG3A 1JTEA 3M70A 4R8RA 1JG2A 1NE2A 3B3FA 5K0GA 4RTNA 3DMGA 1SUSA 4KIFA 5EVJA 2IGTA 5HIJA 3A27A 1FBNA 3BZBA 3F4KA 4QQKA 3HVKA 3LKDA 2OYRA 2JG3A 2HR1A 4G56A 4R6WA 3SM3A 3G8BA 4X60A 1WXWA 3GWZA 5JR3A 3OU2A 5EKUA 3HVJA 1L1EA 3UA4A 2PX4A 3EVBA 2GA9A 1P91A 3DP7A 3P71T 5DWQA 2Y1XA 5IH3A 3HCEA 4FT4A 4WXHA 4MTLA 5GM1A 3VC2A 5FCDA 1BKYA 2OB1A 3EVDA 5KQSA 5JUWA 2ZSUA 4ER6A 4C03A 1WXXA 3HCBA 4C05A 1R74A 3GRUA 2AOUA 4DF3A 2BM8A 3G5LA 5T6BA 1QANA 4E33A 1G38A 3AJDA 1UFKA 5B1SA 2PY6A 3KPWA 4HTFA 2ADMA 1QAOA 3ORHA 4X61A 5KVAA 3DXZA 3TM4A 3KPJA 3MB5A 5ICFA 3QV2A 2IBTA 1IM8A 4GOOD 5DTQA 4DCGA 2QYOA 3KR1A 2AVNA 2R3SA 3LPMA 5ERGB 4CWAA 3MAGA 5U4XA 4H0NA 4E2XA 3EVEA 4E2YA 2ZWAA 1F38A 3PFHA 2Q41A 5HOQA 5LR6A 5E8RA 1X1CA 3CVOA 4KW7A 2PGXA 5E9WA 3LECA 3ER9A 4C4AA 1U2ZA 3SXJA 3FRHA 1EJ6A 4EK9A 3G89A 3MTIA 3I9FA 2HMYB 2ERCA 3I58A 4PYQA 3GXOA 2VDUE 1MJFA 2XYQA 4PGGA 4DKJA 4KDRA 3KPUA 1EAMA 2CWWA 5FHQA 5T67A 1HMYA 4FS8A 4ISCA 4GOND 1X1DA 1ZGJA 3S68A 1AF7A 1XJ5A 1G8SA 2YQZA 4X1OA 2DULA 2CKDA 3E8SA 5DTRA 3KQVA 4F85A 2P3OA 2WA2A 1YZ3A 3FPGA 2WK1A 3BGVA 3LCCA 4GUAA 4LG1A 3TFWA 3KHKA 1DUSA 2AOTA 5EMLA 2FYTA 1EIZA 2HNKA 3G2MA 1BOOA 2PT9A 3LKZA 1O54A 3EGVA 5BXYA 4OBXA 2YXEA 3M33A 4HGZA 3GU3A 3BGDA 2I62A 2AS0A 4GQBA 5EHGA 2P8JA 2CMGA 1RI1A 3JWHA 3R3HA 2NP6A 4GOMD 3P97A 3TKYA 1SG9A 2NXJA 5CCXA 1QAQA 4P7KA 5KYGA 2EG5A 3PVCA 3E05A 2FRXA 2XYVA 2EJTA 3C3YA 3LBFA 1D2HA 3FTCA 4ATNA 4RTKA 4RTOA 2DPMA 1R6AA 4OQEA 2AVDA 4DMGA 5DT2A 1JQ3A 5F2KA 3T7SA 4PYNA 3GRRA 1ZQ9A 3NWEA 4RWZA 5DLYA 3KR2A 3KPVA 3UZUA 4BY9E 2P41A 1NV9A 4QPPA 3OZSA 2B3TA 3B7PA 4MIKA 4YV0A 2ESRA 2ZTHA 1JQDA 2PX8A 3L8DA 2BZGA 3M6XA 4OBWA 1EQAA 3FRIA 2EFJA 2P3QA 2G1PA 1SQFA 4XUEA 1SVUA 3PLAE 3NTVA 2OPBA 4P7FA 2BH2A 3FPFA 1R18A 3O7WA 3PFGA 3T7RA 3V97A 3HCFA 5DTMA 3PTAA 2V7EA 2PXCA 3B5IA 1ORHA 4CTKA 4FT2A 1NT2A 1R8YA 5G02A 1RJGA 5DPMA 5E1MA 3SX0A 4CKBA 1P1BA 3LGAA 4YUVA 3FTFA 4M38A 5HEKA 2Z6AA 3UJ7A 1ZHFA 5FTWA 3PX3A 1P1CA 5EEGA 1YB2A 3K6RA 3PT9A 2C7RA 5P8WA 2Z6QA 2ZIGA 4RVHA 5T64A 4R8SA 2QY6A 5CVDA 5DM2A 3BGIA 2O06A 2PJDA 1AQJA 1VIDA 5ICEA 1KPHA 1RI5A 2AOTB 3EGIA 3HP7A 4HH4A 3BT7A 5CVEA 3UJDA 3RIEA 1WG8A 1NBIA 3VYWA 3HNRA 3KQYA 1SUIA 3JWGA 2YR0A 3I5UA 4KIGA 2ZZMA 2Z6UA 4POOA 3GRZA 3MGGA 2I9KA 1F3LA 5HILA 5LQJA 3DH0A 5K0FA 1RJFA 2C7PA 3P9CA 4O29A 4XUCA 3EVCA 3B3GA 2IH2A 3UFBA 5MHTA 2AZTA 3DMHA 1DCTA 5K0CA 3KKZA 3FUTA 2IH5A 3UJBA 4OA5A 10MHA 1QAMA 1VLMA 5HIIA 3HTXA 3M4XA 3FTDA 2XYRA 1FPQA 5FQNA 3DMFA 3MCZA 1L9KA 4HG2A 4IV8A 5D1HA 1AQIA 1KIAA 2H00A 1N2XA 2NXCA 2UYOA 5GIPE 2C7OA 2XVMA 5EMKA 3O4FA 4CTJA 1NW3A 2PWPA 4M37A 5C1IA 2NNWB 1KXZA 4FZVA 1JG1A 3LL7A 1XDZA 2OXTA 3PB3A 3GRVA 3I64A 2G70A 4RTQA 4LWOA 3UWPA 4X63A 1V39A 3JWJA 1D2GA 2JHAA 3TR6A 3NMUF 2AR0A 1XVAA 2IDKA 2O07A 2N47A 2GH1A 4PYKA 2PLWA 4KDCA 4XUDA 5GP1A 3TPZA 4RSRA 4EKIA 2JHPA 3UJ8A 4A6DA 2O0LA 4FP9A 4RTMA 3EVAA 2C7QA 1X19A 2NYUA 1FP2A 2V74B 3KQPA 3P8ZA 4V0RA 3KQWA 5EIFA 3ME5A 3G5TA 3H2BA 3T0IA 2HV9A 3DUWA 3VC1A 5FWDA 1KPGA 3NDIA 4KVZA 3FPHA 3G2PA 4R05A 5KS2A 2IIPA 2VP3A 2ZZNA 3C6MA 4YMGA 5DM4A 3B89A 3ELUA 3THSA 2NP7A 2YVLA 3R6TA 1JSXA 3EMBA 2AN4A 5DX8A 5FADA 3TKAA 5K01A 3AY0A 3DXXA 4C08A 5K8VA 2A14A 5CVUA 1XDSA 3FYDA 3P9NA 5HFJA 5DSXA 5DM0A 2G8NA 2P35A 2ZWVA 1VE3A 1I9GA 3DOUA 1KYZA 2ZFUA 5F2OA 3IV6A 4DZRA 2AOWA 4EKGA 3P9KA 4RYLA 3AWIA 3WSTA 3MQ2A 3IYLW 3UJAA 5LQUA 2ZIFA 3DXYA 3QOXA 4CKCA 2BR3A 4AZTA 4E31A 3OZTA
chains in the Genus database with same CATH superfamily
4TSRA 1XQXA 5CURA 3RHZA 3UUWA 2YWRA 2MR5A 3HMQA 4FYMA 4AY6A 4BYGA 5EVCA 2A0YA 3TCXB 1JHAA 5LP6A 3TLEA 3N3AC 1DKOA 1XNJA 3GIDA 4X8HA 2GKSA 2JBAA 3DDNA 1MFZA 3EG5A 2Y92A 2P40A 3NCTA 3FHLA 1VTKA 2HJWA 5HTKA 1QK3A 3TVYA 5A0FA 4BLWA 4YAKA 1MQ9A 4FU0A 3EMVA 4XJTA 1MJGM 2NTNA 3E3MA 1G59A 3ZGYA 1GAWA 3UWSA 3S2UA 1MEEA 3ES9A 4XGQA 3ZV7A 1WULS 2XCUA 2ZROA 3DAGA 4WX2B 2ZE8A 3VO8A 2JGIA 3NGMA 1E9DA 2OP1A 3PEUA 3WLKX 4UQLA 3BGWA 1B15A 3ACDA 5EE1A 3WAJA 3LUGA 3D0OA 1RC1A 3C41J 1VBNA 3U3MA 3NW9A 4BEWA 3LMKA 1W5FA 2YJ5A 3QVJA 3X1DA 1R9GA 1B6SA 3COSA 1YBVA 4HGYA 3Q7SA 3KEOA 4KXLA 4PFKA 4A5SA 1IJKA 2BKLA 3G0BA 4EY8A 3QW2A 4IMIB 3RSQA 5AKJA 2B1IA 4DPKA 3M0EA 2W2LD 4N5IX 2QJFA 5TQ2B 3ZJTA 3MXTA 1OXTA 3QMWA 2HK7A 3K35A 1XTIA 3A28A 3IQGX 1N5DA 3VU9B 5CLFA 4JXZA 1TECE 2FW1A 2ZYAA 2CJWB 1X7XA 2NVWA 1BS2A 2ZUUA 3FSRA 2R8BA 4NATA 3IQZA 4ND2A 3I6QA 1LLCA 4HFJA 5J59A 1II8B 5U1PA 1M9NA 3DPUA 1J20A 1NMYA 3B52X 4QRHA 5EXDA 1E1CB 2WAAA 5HKOA 1L7VC 1SBYA 5DCLA 1A04A 5L40A 3IOMA 2BKEA 3REOA 4YVFA 5BSEA 1QCYA 3MJEA 5KWSA 3F5FA 3HN6A 4PRKA 1MEJA 2XGGA 4AMZA 3EDRA 2ODNA 2WTXA 4Y7DA 5FBQB 1CY1A 2XXJA 4PZUA 1MIOA 3II6X 2QR3A 1LSJA 3CF2A 4I5EA 1KK2A 2FEXA 5LP1A 1CYDA 2AD1A 6YASA 4D7AA 4CHTA 4ZJZA 3HMKA 1GTVA 2BGMA 4AZ0A 3AOGA 3LUAA 1M8GA 1EINA 3N2LA 3ROMA 3HVUA 1R5BA 4AG6A 3BSWA 4JX8A 2Q5HA 1AKYA 1EM6A 1KDPA 2BMAA 1ZHHA 4ZPJA 4CKWA 4L1KA 4C7JA 2J85A 1KERA 2OQVA 3ZD9A 1ZJ5A 3AGPA 3FB1A 3A25A 4W1SA 2H59A 5KYYB 1YZQA 1AKEA 4GYWA 1FMFA 4OSPA 4J3FA 3X2SA 1US8B 1KAQA 3GDFA 3ZLTA 3SVLA 1BXKA 2IS1A 4EUFA 5BQOA 3A1UA 4UM9D 2HEGA 1DEKA 2O1SA 3CXUA 3OZWA 4PCUA 5L7YA 1YK0A 1IVYA 3CN9A 4HSGA 1UAYA 2LV8A 2Z30A 4TTQA 4AZWA 1Z07A 1OCEA 3EUWA 3HJCA 4MQEB 1K8QA 5CAEA 1YRLA 4GGPA 3WHKA 3WV4A 2O8FB 3D64A 1GPJA 2VK4A 4JCOA 4LY6A 4QXPA 4UFOA 1ZC4A 5DXAA 3Q7RA 3KOOA 2AX4A 4D0GA 1DVRA 1KS2A 3C7DB 5E0KB 2P1RA 5JD3A 2ONZA 2P4SA 2RGEA 2Y76A 3CLKA 1IG0A 3EOAI 4O0LA 2XMRA 3KIPA 2JLBA 4IIBA 4TTVA 4INPA 2BEVA 1AKTA 3EZ7A 2AN3A 1H0SA 3P1JA 1O6BA 1Z4LA 2GVZC 2POQX 4G5RA 4L85A 1BIFA 4F0JA 1ZEMA 2WHPB 2JGLA 4RDXA 4EG5A 2Z9CA 2PSFA 1ONNA 3JQFA 1BRMA 4HWOA 4NV1A 3H11A 4FR0A 4B85A 4U8GA 2O6HA 2HA7A 3ADKA 1U28C 2DHCA 3WBKA 1R37A 4C1BA 1U1DA 2WHQA 1PGNA 1S6YA 5AJHA 3F3KA 3RU2A 3DE4X 4G1CA 2MHCA 4KLAA 1G6HA 1Y3FE 4G0UA 1XCJA 2XCLA 3KVVA 3ODGA 2AI1A 1QYRA 4Y30A 1TJ4A 2NZXA 3H83A 4NJEB 4LS3A 1IWBB 3DMDA 4LQDA 3H86A 1HDOA 2P75A 4OGKA 2W2XA 1GTMA 1N34B 1P5RA 5EXSA 1IL0A 1MOPA 2GPTA 2ORYA 2X9QA 5GJCA 3TX6A 4M8SA 1W35A 1W6UA 7REQA 3MCTA 1AV6A 1NQXA 4Q7EA 4JU9A 3RUPA 4EH1A 3B48A 2R8ZA 1N2GA 2FF5A 4H1VA 5JY1A 2IS2A 2CXRA 3GZJA 3RW9A 4UBIA 1C0LA 4ZK6A 4YRKA 1H23A 5BNWA 5LCXA 1QFSA 4E70A 2H11A 5JTUA 1JG7A 1H2HA 1RABA 1XA3A 4Q7MB 4RSGA 2VNAA 3C5CA 2PH5A 5K3SA 1F6WA 3VUFA 3SC2B 2X9LA 2J5XA 1C3VA 3FDXA 4LOKA 2EFYA 5JAHA 3HN7A 4FFDA 4PQYA 3T5TA 2Y77A 1LNSA 2XNDD 3THXA 2I1QA 3FCCA 1OI4A 4OQFA 3G3EA 5AVKA 4FLEA 1KIMA 2C7GA 1YS4A 1D2RA 3EG9B 1Y3HA 5DGDA 2ACWA 4AY2A 1ONPA 1SA0B 1BGXT 2VP4A 2VTVA 3WYDA 4KEAA 4LGMA 3S1AA 4AROA 3ZJVA 1K1EA 1PS9A 3CEAA 5JALA 3WVNA 4KREA 3HR7A 5EWMB 1UQRA 3L7YA 5FBVB 1IHXA 3DLAA 5TE9A 3QX8A 5AM4A 2KBEA 3OHSX 2G5TA 3S2FA 2O14A 5IUKC 4AF7A 1P5HA 2EX1A 3FPSA 1QS0A 4R0NA 2D2XA 2F17A 2P68A 2AFHA 3OTIA 4Q4LA 5HJ7A 1DAIA 4PSCA 4FJ2A 2QMHA 2RHWA 2ZRNA 3QIVA 3CPHA 5F4BA 4YRZA 4P84A 3TLXA 2WJ4A 3OE7D 3RSOA 3PKIA 2ZAGA 2JFQA 4BC1A 2IPLA 2JFYA 2OXFA 1CJBA 1C1DA 2YN4A 1JMVA 1VE1A 3U4IA 4KXVA 1PQ4A 5EMHA 4DC9A 3RADC 2QENA 2B6HA 1QDUA 5ALTA 1V7PC 5AVZA 2QTRA 4OXXA 3VNRA 1CERA 4E22A 2Z4RA 1P33A 1QH9A 2HF2A 4DDUA 3T3OA 2BE7A 3FN4A 5E6RA 1FTYA 1FMLA 2IU3A 4ZIRB 2AFRA 1ST2A 3NRCA 1OASA 1S89A 2QGZA 1VI2A 4JJGA 3S6JA 4LDRA 1TF2A 5FUXA 4HDRB 5EE5B 1HF3A 2O05A 4PFSA 4K6GA 3RV4A 3GBPA 3GUUA 3JD4A 4L8WB 1T36A 4PWYA 1CV2A 1SHUX 1DIOB 1V1RA 2O8VA 4FNMA 4TOIA 4RQTA 5CM2Z 2XRYA 3T7EA 1IATA 1JFFA 3JYNA 1J09A 2B9EA 4L8LA 3W4IA 4HFRA 2WM3A 3T5AA 3LF1A 1SXPA 2Q1XA 3A9SA 1NI4B 3M2TA 1W4ZA 1N1GA 1YU9A 2V7VA 5DB4A 2PX0A 4TMVA 5JASA 3EZ2A 1DO2A 3LUFA 3C8ZA 3R7FA 1XKQA 3UQYS 3A14A 4QQKA 2OYRA 4RZ2A 2X2EA 1FDTA 1WBDA 3ZK7A 1KYTA 4X60A 1PVDA 2GCOB 1CZKA 4EI8A 3BN3A 5HUQA 5EKUA 4UBJA 4O8CA 2BBWA 5DWQA 3BTSA 3MLBA 1W36C 5ULLA 1TGVA 3DSRA 3ASUA 3ITNA 5FCDA 4YI5A 1KI8A 2WVAA 3KJZA 4NF2A 1V96A 1R0SA 3F4LA 4NNOA 4C03A 4Z9YA 4AN0A 4AIRA 4C6TB 2NO0A 1HK7A 2QTCA 1NLUA 5AKZA 3URKA 4C6RA 1OYYA 4QM7A 3R3WA 3PK0A 3RNOA 4TUYB 2IHBA 4YFVA 1YA4A 2Q4OA 3JPWA 4XI9A 3QNWA 5AM1A 3QBVA 2E4VA 5B1HA 4AURA 2MMCA 5KMGB 1DS6A 3JYQA 4W1RA 5IMSA 3EDMA 5EE3A 3V4LA 3CA8A 4CM7A 5AVWA 4RH1A 4EZIA 5HDQA 2ASVA 2WJVA 3P52A 1SVSA 4G6ZA 4L8YA 3RM3A 1F2VA 1FDVA 4Z1OA 4CEIA 4OHOA 4RK1A 3IDFA 2WFLA 1QP0A 3O4VA 1G5RA 5BV2P 2X1HA 4F8EA 1H0RA 4MW2A 5ALWA 2DLCX 5EKTA 1CRQA 4NU8X 3U4HA 5A1TA 3K8QA 3AL0C 4GR9A 4D3ZA 4LZJA 1YBAA 1YE3A 5GZ6A 3KVYA 4NICA 2DHRA 2HMYB 5HE8A 3CT6A 1RWPA 1KAHA 1VLHA 5IT5A 1MXFA 1T0IA 2CWWA 3BQNB 1RM3A 3PNSA 1N9GB 4FBMA 1E3LA 3HYNA 1CQJA 2PDAA 2CNKA 3FMGA 1ZGJA 5TXGA 3R7LA 4KB5A 1AF7A 4OAOA 1XJ5A 2O2HA 2PYIA 4ENUA 2QAGA 4DABA 2VQ6A 1T5OA 1RHJA 3E8SA 4IZHA 4RLSA 5DTRA 3P9ZA 2QRNA 3FOCA 4MUJA 1Z29A 2JIZA 2BSXA 4NCNA 4RKQA 4WCVA 4Z4FA 4GAEA 1DE0A 1R3DA 2JL1A 3QXXA 2HGZA 1CNEA 3G2MA 3PLRA 2PT9A 3ZCXA 3G8YA 3MK31 2V1UA 2G9ZA 4O2BA 1BVRA 4TQUS 1HDZA 3FFAA 2B82A 2JFPA 1TCCA 4WGFA 3IKVA 1GL6A 4OIMA 4DZZA 4GQBA 1XP8A 3PJGA 4JLNA 3OIVA 5G4KA 5IDWA 3NQ41 4MARA 5GVRA 5HCNA 1DCKA 2O3SA 1OOEA 1HNXB 1LW6E 2PPVA 3F90A 3NASA 4FMCF 4MKRA 2QLLA 2NXJA 3MWGA 2GGSA 4RK5A 4CMCA 2EG5A 3EFOA 3LQ4A 4FKBA 4F3KA 2CFRA 1N0HA 3G0GA 4KACA 3H3XA 4OHXA 2GZSA 1C0KA 4LVUA 3KDSE 1RVV1 4NG4A 3E9YA 2B0CA 3D43A 2ZAMA 3D8BA 4QOIA 1OH7A 5AKYA 5I5GA 3A6DA 1QF9A 3GJRA 3OT5A 2JKVA 5EHNA 3FLMA 2D2VA 4ZCSA 4HDAA 1JDPA 4LGCA 4RZIA 2WWXA 4B84A 2A1UA 4C7OA 4U1RA 2MSEB 1SZCA 3U09A 1AVTA 4W5JA 1X9IA 3L8DA 3D6HA 1T29A 3D7KA 4HYQA 1WLSA 1ZMOA 4H0CA 2PA0A 5EJ2A 3WWDA 1AKVA 1NVKA 1ZMXA 4AMYA 2BI8A 1SUWA 5K8TA 3JPYA 2IV7A 4JBHA 1S2MA 4Q9IA 5CDFE 3W5AA 1F7UA 2Y9MB 4L6CA 3LVQE 1UQTA 4BO4A 4C0AC 4DWJA 3FY4A 4X3PA 2V7EA 5EXTA 3VR4A 4OI4A 2LR0A 4WDQA 4BN5A 4I50B 4Y1GA 1ZK4A 4G0OA 4YRJA 3MJHA 2OZKA 1PFUA 1F8XA 2Q3EA 3ML1A 1ORDA 4A1OA 1ABFA 5HEKA 2DWUA 1YHNA 3PPWA 1KY4A 2VUHB 2F00A 1WSBA 2AMVA 2M1XA 1JIUA 4ZAZA 3PQ8A 5C52B 3UYKA 3K0HA 4K7JA 4JSYA 2IYZA 4MKHA 4EGFA 1U4SA 2PZMA 1YDFA 4UTOA 3ZR4B 3WLSA 3GX1A 4B40A 2IXBA 3C6QA 3NHZA 1RFGE 4K9NA 4D8WA 5DSZA 1LV7A 2YWHA 4EUEA 3TOCA 4S0XA 4E5DA 3PSHA 4MUEA 4OJNA 4ZO4A 3P9CA 4KXUA 4DIFA 4M1WA 2OV4A 3U4GA 3TUZC 5CA1B 3BZUA 1DRUA 4P35A 4AJJA 4A10A 5AOBA 4AKIA 3EIEA 4WNAA 1D4ZA 2HA2A 2NVUA 3N8NA 3MAJA 1QH1A 1U9JA 1YRAA 2REQA 5TQJA 3RE1A 1J2TA 4B7AA 1Q92A 2CVZA 1R4ZA 2HWUA 3LY8A 5GIPE 2GZDA 4OI1A 2D0IA 1A9XB 4PG6A 4BAZA 1J8FA 3D3QA 4OMUA 3WO0A 2CLHB 1EUYA 2BLLA 4ZA2A 3TW8B 4PYRA 4H35A 2IU0A 1Z2AA 1JIJA 3KE8A 3NBUA 4E09A 1QC5A 3UVEA 4EGQA 3KLBA 3GRVA 2VLBA 3KYDB 4Y3UA 1RKXA 1X38A 1J39A 5AHKA 2QTFA 2IDKA 1WCWA 3P9RA 3AZQA 4HEQA 4IZ6A 1W2WB 4K5QA 4IJUA 1NUPA 4U7HA 5D85A 4KW7A 3L0CA 4OHBA 1AZWA 4QOHA 4N5NA 4DV7B 1VKOA 3B6IA 2OBMA 3O73A 4A6DA 4HNUA 1C7ZA 4CPDA 3ICEA 1BJRE 1S1CA 4OUKX 2DT5A 3ORQA 1I6WA 2WTBA 3Q9LA 3NYQA 1GQRA 4NYJQ 4TWBA 3VGPA 4EYSA 3U1BA 4AMUA 2A78A 3PFWO 2XE7A 3KEFA 4NR0A 4Z1MA 3PC3A 1BA2A 2BFFA 2HV9A 1TYAE 2RAPA 3QKRA 4KJZA 5LJIA 5EJ8A 3NFYA 1HA3A 1UBFA 3KB8A 3E9RA 2GN2A 3FDIA 3CLHA 4XVHA 3VBCA 1JLSA 3DMYA 1AURA 4MVJD 3VHXB 2JLWA 4U6QA 2F1HA 4UMDA 4YR7A 1NOJA 3PFIA 5JQGA 4KSYA 3TTUA 4HGOA 4CDNA 2WW8A 3DO6A 4BJ3A 3YASA 4DZRA 1RM4A 4DMMA 2QSJA 4RZXA 5C7LO 3CUSA 3VNBA 4CLOB 3VAYA 4BS9A 3DTYA 1QHIA 4Q6WA 2OXEA 2QM8A 5B3JC 1MQ8B 4AXBA 3ZVNA 2H0RA 1SBIA 1SHZA 5GM2A 1FYWA 3FUWA 3SYRA 3GQVA 3ZQUA 3AHEA 3EQ9A 2OO3A 1B6TA 2GEDA 3EXHC 1YSCA 3OUZA 4KN8A 4LZNA 3IBGA 4NQRA 4NYIR 3QLTA 4EP1A 4OX9Y 1Q7CA 2C3MA 4LJYA 4KJXA 5F7JA 2YY6A 1UWVA 2NO7A 4ZVNA 2H1SA 3FYSA 4C01A 2LKCA 1F7VA 5E8JA 1WU7A 4DV3B 4FWTA 3PKJA 3UJ6A 5BW4A 5IJXA 3JQAA 1C14A 4BIMA 4F3NA 3OCZA 2A84A 2QR2A 3L93A 1T4CA 3LPNA 1Z36A 4IL5A 4KGDA 3HU2A 3UATA 4E88A 1T3ZA 4ZO8A 3BMXA 2FW8A 4ZMBA 1ZCZA 4RKWA 4ZOAA 2CT8A 1NUUA 3P94A 4J2OA 3ECCA 1G60A 1A3CA 1EGHA 3I5AA 1BHQ1 3BFKA 3ZK9A 1E3SA 2KB0A 2V7TA 3OH8A 5IN4A 1YUBA 1SK8A 4H1HA 4TXLA 1FXUA 2Y1KA 3GGDA 4P5DA 2J3HA 3VNAA 2C83A 4BYMA 1P4JA 1MRNA 3O2SB 2Y8EA 5B3KA 3T7DA 2E5LB 4N5DA 4O63O 1U1FA 1W46A 1C7JA 1JMYA 4JWTA 3S7ZA 1WQ4A 3IBTA 5BV0A 1UCFA 3MTEA 3E6AA 1K06A 3OEHD 5IK2A 1UP6A 3PHBE 1W9MA 2AEEA 3OWHA 2VP5A 4CQJA 2KMLA 1Z33A 1XWWA 2AYXA 1FSPA 2PS0A 5BN4B 1K92A 1OWOA 4E30A 1NY5A 3MMZA 3SLGA 1QKJA 1GFZA 3E9DA 3MLEA 2ZUVA 4PC2A 2WIJA 4R1NA 3TB6A 3T3GA 3VOBA 2FF7A 1YL5A 3P0IA 3DKRA 4LK2A 4WK0B 1TYZA 3O4IA 2BMVA 4J1NA 4U2EA 3ILYA 3EA0A 3FNQA 3GMSA 3AHHA 3DTNA 4MYHA 2BHTA 4NU6A 4RL6A 2QE7A 4JWKA 4WFKA 1ECLA 3C3KA 1X1BA 4IHAA 4GSYA 5EJIA 4OGFA 1UMCA 1BW9B 1TM7E 2YUIA 3G7NA 3K6SA 4XJVA 1EG2A 2YX1A 2GZ3A 4JU8A 2YCLA 4C4XA 4CIWA 1MORA 3OD1A 4JFAA 1G3IA 4MWBA 2A0XA 2XH8A 4OO3A 4M0KA 2AK2A 2EWVA 1L4MA 2XQGA 4MEAA 3RANA 1YFJA 4GQAA 4XGNA 2JGNA 2KE5A 5EJ5A 1C7EA 4RLHA 2PK3A 4KTTE 2AFIA 2QUAA 4YJKA 1C41A 4HRYA 5AMXA 3RIHA 1L3IA 2FUEA 3HC7A 4QPJC 4ALKA 1ZM9A 1T5TA 4R54A 2RJ3A 2FR8C 3N5KA 4C76A 1VJ5A 4DE5A 1PZGA 3ED5A 2WSYB 1MAHA 2I29A 4J8PA 1X0VA 2HGSA 5LQAA 1TADA 4PHHA 3ZGOA 4RHFA 1L5GB 3PQ7A 5T5QA 4ZT7A 1ZLXA 4QTUB 5F4ZA 2FKNA 2AG0A 4EA9A 4GBGA 3GJXC 1ESNA 3AMVA 4L9RA 4EG4A 2YY5A 3EDQA 3G6WA 1O95D 4PC1A 3DONA 4ZZIA 1QG6A 2F3RA 4CKXA 3T54A 1D4OA 1YA8A 2QP3A 3HCNA 4JR0A 2ZWMA 4LYFA 4WK2B 1NASA 3BL5A 1XVUA 2YN2A 3VAAA 4Z51A 4G0WA 2CBXA 1ECJA 5BSVA 3DEZA 1EFVA 2CLOB 4UKDA 4JOSA 4KE7A 4F1KA 4PXSA 3N76A 3CUYA 4BMPB 1HLGA 5JWRA 1HYEA 3MYYA 4KXYA 2A4MA 4E5VA 1GTL1 2JF0A 4ONEA 4TLMB 3BIWA 2JDIA 1P77A 1IQRA 1A0OA 3PR1A 3M3HA 5IANA 2J08A 3RKUA 4D9MA 4JQZA 1JFLA 2ZB4A 4BO5A 2PCLA 5KJCA 1S3GA 2X6QA 3KCNA 3LCRA 4MULA 5BN3A 3EYWA 4YX9A 1JA0A 1NHWA 1C8BA 3B1FA 3F6SA 4KWCA 1XT6A 3TNDA 4JC8A 3Q8MA 4TZ6A 1NVAA 2GDJA 3B1WA 3GQBB 5AESA 1V5WA 3AEQA 3FOWA 3GPIA 3UKJA 1E5VA 1NIPA 3BTOA 5JDIA 4LISA 1Z2NX 2Y1WA 3SQLA 2I78A 4E32A 4DV5B 1E18A 4QUDA 4I99A 1I0ZA 1UPTA 3GGSA 3FOEC 4MUAA 3QMMA 6REQA 2OFXA 1P7VA 1NQWA 2P4QA 4IS2A 3FMFA 3C70A 2PQ0A 1SCKA 3GLGB 1FU8A 4JAVC 5CT6A 4OJMX 4YH1A 3C3AA 5GWXA 1YB4A 2XVAA 3PEFA 1KJIA 4MVXA 4OLFA 4HNVA 3DHEA 3LDGA 1ZFNA 2PTGA 2BH9A 3ADBA 2QORA 1RQ7A 2XB4A 1ZGAA 4EEKA 5AI8A 3RTAA 3ZZ0A 2BM9A 1X7ZB 1EJBA 3DDSA 4YCJA 4Z3DA 3VR6D 3WBBA 4ALMA 1XZGA 4URHA 3C1OA 1AD2A 1IXZA 1TK3A 1N2OA 1HZZA 1XZEA 4ARZB 1VLQA 2W6ID 2YHSA 1K6JA 1L1RA 4V02A 1CTQA 4BATA 4WKPA 3IILA 2M6LA 3PNKA 5HKAA 2H51A 1XRQA 4NULA 3BYZA 3NHUA 4F7DA 1TVKB 2AN9A 2O3QA 2Y4OA 3EHDA 2GK7A 3TOXA 2RBGA 2HXYA 4WFIA 1M66A 1TUBB 4X00A 2QIOA 4OXNA 1EZZA 3JATB 1XX6A 2NN3C 3NWPA 2KJQA 2AQIA 1RXEA 5IKOA 3CX6A 3HL4A 4V1CB 1DQYA 4FXOA 3L4KA 3WB2A 2IY7A 4R2XA 4PGAA 1GG8A 2XI4A 3DVLA 4JJ7A 4DCCA 1PUJA 2BFDB 3GEPA 5G40A 1SG6A 4UE6A 4HT3B 4BMSA 2H4YA 4LY9A 2P78A 3BRWD 3NGXA 1T24A 2BGJA 2YFHA 3MJTA 4LOJA 3ONFA 3V48A 1W4RA 5HQTA 3FNFA 4MICA 4UM7A 3V80A 1HI9A 1EHIA 3WWYA 4N3GA 1F9EA 4XQ0A 4O2BF 5K6TA 2BR4A 3OIFA 3WRXA 5I7RA 2DBQA 2W6MA 3EWIA 3F2IA 4OQXA 1J8MF 1P7PA 1DIHA 2AX3A 3UOGA 5EYPB 3OE5A 1ONSA 3SF8A 4DYHA 5ICMA 2E1PA 3ETLA 4PZCA 3PYLA 1XEWY 4FX2A 2EEZA 4JB8A 3KZKA 4L5JA 1M2VB 2V7BA 1LX7A 4ARSA 1RPZA 2EATA 2FSSA 4XWGA 4D9HA 1NV8A 1O8CA 2ZB3A 3VPGA 4RV9A 4K0KB 2KM1A 1Q0LA 3KQHA 5BYBA 3LX4A 1Y6FA 1NG9A 3G13A 1QZTA 2J5RA 4MHOA 1E79D 3VNSA 4Z4HA 3KU1A 3KSDO 4YP1A 4C0QC 4CTOA 3D2LA 3ZWVA 1OI3A 2Q5QA 1HQKA 3R9XB 1U0SY 3I37X 1GR0A 3V8RA 4CT4B 1OMOA 5JS7A 2ZKLA 4R1LA 1C9YA 1L4FA 3GFFA 3I3SR 4OXQA 4GWLA 4RS3A 1JTEA 1EUDB 1MD9A 2ZYGA 1H2YA 1NF2A 3HEBA 3C8HA 3I5XA 1CZNA 5JFOA 3ZIUA 3E9EA 1S1MA 1RLTA 4IX1A 4JB3A 1K9VF 2NMVA 4MMYB 3W5UA 2R1VA 3SM3A 4D5GA 4I8DA 3H8SA 4JZKA 1XU7A 3TDMA 5JR3A 3DTTA 3HVJA 4L78A 1K7FB 3DEAA 4KR3A 1YS2X 5K0EA 5KNDD 3I5YA 1RYNA 1FP7A 2L0XA 1QCDA 5KNBD 1GSOA 3BFVA 1FIUA 5F98A 2XX3A 4M76B 2UUPA 5LZ9A 4IQ8A 4B0OA 4CMEC 4C05A 4S35A 4F9FA 2AOUA 3GMDA 2H29A 1DXHA 1N6HA 2C82A 3I9MA 1RWNA 3ZVRA 4E1VA 5CDGA 4LVNA 2B8EA 5JS6A 3BTVA 3Q7QA 1Q2XA 1VMDA 3KZXA 3GMTA 2XOEA 1BU8A 4WD3A 1KK1A 2AJDA 3RAPR 3W5HA 4YIHA 3KL4A 2YN0A 1SNYA 1VL2A 1I24A 2NO6A 2Q3JA 2R7AA 2VP6A 4G0PA 2F1RA 1POWA 3OAAA 1P81A 4XPZA 1KVQA 1QGED 2ZWOA 3DE6X 3O1LA 1E99A 5F1OA 1YZNA 3KUUA 7GPBA 3QWBA 3QSGA 4EA7A 3ANMA 2DLNA 2J09A 1T9GR 4ENTA 1Z6PA 4TZ0A 5KYVA 3AEUB 3K0AB 1V43A 2CZCA 4C4AA 3AETB 1U2ZA 4B4KA 1F14A 1GZUA 2GHIA 4G2TA 3MTIA 2ANBA 2Z5LA 4K3VA 3ER6A 4ME6A 2FLWA 4NH4A 5SY4A 1OV6A 3GVCA 2JJ8A 3WYGA 5FEUA 2A0FA 5T67A 1XQWA 4CCAA 3Q7PA 1DAGA 2VKQA 4GOND 4M4SA 1P45A 1X1DA 1YQXA 2P9GA 2ZYRA 1I6LA 1WSAA 2IQ5A 3TSYA 3EXG1 3N7AA 2D54A 3D6FA 2F3SA 4YT2A 4UCFA 4DKXA 4HNTA 2P3OA 4NMLA 2WE7A 4AS1A 1VMEA 2ZRLA 1Z2PX 2WPNA 2IL1A 3RGWS 1JDVA 1T8RA 2REOA 3LH5A 5EJFA 2FSPA 2O2IA 2YJ4A 1B6GA 1C9MA 4K9OA 3TG2A 1P8AA 3EGXA 3FG9A 4GRAA 1SC4A 2QRZA 5DE3A 3PZRA 5MFZA 3KS9A 4GE3A 4C7XA 1C0PA 2P2ZA 2PZFA 2R6HA 5DW0A 2IXEA 4F2HA 1H5NA 3L84A 4OAQA 3JALB 2N3ZA 2CJFA 3BGDA 3QEAZ 3HRIA 4HYEA 3USES 1I14A 2P8JA 3KJXA 5BVGA 4HQRA 4MJ7A 1Z22A 2IXGA 1MRSA 4MEJA 4K26A 3R7WA 3TKYA 4MJXA 1W5TA 1H6CA 1VHWA 1XQ6A 3TD2A 4HAUA 4B2YA 1T9AA 1QAQA 5CCXA 5JQGF 3VV3A 4Q15A 2HJVA 1YOBA 1NVTA 3FJYA 1UZNA 4FLFA 4LXTA 4NMMA 5A6SB 2HEIA 5T6MA 1JEOA 2QUKA 2EFDB 1DOAA 2RD2A 2C03A 1JWLA 3BHMA 4CQNA 1D2MA 1PQWA 4YRMA 4H1WA 4E21A 1EP9A 1PTJA 2WSMA 3F3SA 5B36A 4DA7A 2YWFA 4REQA 3D0KA 2DWCA 2QN3A 4HQFA 3JQ8B 1Z08A 5KUTA 3A1TA 3M6XA 3CFYA 1N5OX 1D5CA 3FLBA 4Y2VA 1BE1A 3HI4A 1WZCA 3M1YA 2QX6A 2CMDA 5SYAA 1QRSA 3H9CA 5ALPA 3PTAA 4D3XA 3E53A 4IJWA 5CK5A 1T3GA 3OJ0A 1DJLA 1LNZA 4EM6A 3SQWA 3SX0A 5AJYA 1BMFD 3TKLA 1JLLB 1RQLA 2Q6LA 2V9PA 1N6RA 5BUZA 1GDTA 1ZU4A 1P1CA 5EEGA 1YB2A 1JKIA 3K6RA 2FVYA 3JQCA 2J0VA 1TAQA 3IHLA 4MGYR 1N6LA 5TT0A 2CFSA 3RUDA 4CRWB 4W5TA 3RDPA 2Y0CA 1G2PA 4PZDA 3HP7A 1YCDA 5CVEA 1WG8A 1E8DA 4AWXA 2ZZMA 1XG5A 3GUYA 3I5UA 1KS9A 4J9UE 4M9CA 1F5NA 2AWOA 4GPEA 4QREA 4Y8VA 4DLYA 1ZH0A 3LFUA 2O19A 1GLVA 1WVGA 4KQHA 3W2EA 5LQJA 3MBIA 2AJCA 3HRHA 3O26A 3X1MA 3G1UA 1XVVA 4LXXA 4RF5A 1PSDA 2DPHA 4QICA 4TSFD 3T52A 2ZRMA 1L4GA 3PDJA 1W5EA 1LFDB 1NXVA 1T2AA 4YIKA 2H9IA 4KK4A 3GDWA 2D5AA 2YNMC 4G5GA 5HIIA 1GAXA 3AUYA 5FQNA 2RGUA 3A1CA 5KYWB 3J81k 4IV8A 1RPJA 4RK0A 5FWXB 1GDDA 3GLGE 2C7OA 2I6FA 4MHSA 3RWBA 3IVGA 4XD7D 2WYHA 1GCAA 3PNOA 5JDCA 2I76A 2Q5OA 4IG4A 4MS3B 4V0LA 3QQ5A 5KDDA 3JVIA 2AYYA 1TC1A 5KI6A 3ZD6A 5HRAA 1Z5OA 5AO9A 4JLMA 3WIDA 1CHDA 1ZX1A 2FPPB 2HF9A 1S8NA 1M75A 2X77A 2CUTA 2O07A 4X8LA 3GUZA 4AECA 4KDCA 3HU5A 3WNBA 3NHKA 2C77A 2DC1A 3KWLA 1YZGA 4IY1A 1PP4A 4FP9A 2VHUA 1X19A 4DDTA 4RK6A 3IL2A 4IIEA 5FPTA 3SICE 3U3OA 4CKBB 1BH2A 1RZUA 5A4DA 2WSSD 1CF9A 4MB2A 1ZIXA 2DP4E 1HDEA 2CDBA 1WABA 3HABA 5D86A 5TQ2A 4BB0A 4PPNA 2WWTA 4KLNA 4DQLA 1CEEA 3F2VA 4KQ1A 2X15A 2K7ZA 3PI6A 4REMA 5CU7A 2OD7A 3G8DA 4A26A 3QYJA 1A88A 5AHXA 4QEDA 2CJWA 2VP9A 3N8HA 2CF5A 1PQYA 4UU8A 3SIRA 1Y8AA 3BF7A 1PJ3A 2JIMA 1A9TA 1L5NA 2ZFUA 3N2IA 3AKYA 3AU9A 2LXNA 1NRWA 4XRRA 5JZMA 1CU1A 2CSUA 1L8AA 2Q46A 3NETA 5DBIA 1M2NA 1J5EB 4DAOA 2GJ4A 3GW8A 1PYGA 1J2YA 3RSZA 4F4FA 4EI9A 5DP2A 2I2DA 3L6BA 3FBWA 2QJOA 3SR3A 3Q5EA 4PSKA 3ZWMA 1QTQA 3NAZA 3GEDA 4G63A 4D2IA 1SRRA 4AG3A 1MH1A 2HUNA 3BK2A 5GQSA 1R8QA 3W8NA 1WXEA 1RZ3A 3RBAA 3FFBA 4PINA 4B5KA 2FFBA 2QN7A 2ZBDA 4P83A 3VZBA 1T5DX 5L53A 5TB5A 3U7QB 2EEPA 1X0XA 3C6KA 4YJFB 4EKEA 3BGOS 1HDCA 4IDNA 4G67A 2YQ5A 1XCLA 2GBCA 4HTFB 4KQ9A 1M2KA 1QX3A 2ADOA 2B8NA 5ALNA 1I4TD 2FA9A 4HB3A 5LVAA 3PT5A 3TQQA 3JQEA 3HA7A 5EHXA 3R7BA 4U7JA 1US8A 2TRSB 2XIJA 3KKNA 3PFKA 4Q9HA 3VO1A 1EFKA 3D8NA 3BL8A 3LHDA 3MFQA 4QUBA 4YDQA 4OB7A 1OPXA 4L7VA 3RQIA 5PNTA 4GFDA 2R2GA 4RA9A 3DVAA 1E98A 2GPSA 4AS2A 4OM8A 1YKGA 1YZHA 3NT4A 3PF8A 5TDHA 5I45A 2QRQA 3BRQA 4LF8B 4MH0R 5CDFA 1Z5ZA 1J2JA 3SY8A 2FNAA 2SECE 4OP1A 4C4TA 1KZ1A 1A8PA 1B41A 1IAQA 5JSKA 2WNHA 5BV7A 2H5LA 3A2MA 1ZW1A 4QYMA 1VQ1A 2YJNA 5EIBD 1RZRD 5ECWA 3VSEA 4MVWA 2XQVA 1MF7A 5EZQA 3FOFC 3V1MA 1T6ZA 1W49A 4TWRA 1A96A 4DQDA 4ZU3A 5JTTA 3GP3A 4IIJB 2WHPA 1HURA 2DXIA 3KOZA 1T43A 3DZGA 4RCZA 4Z0HO 1NTRA 2XJ9A 4RXTA 1NUHA 3C4JA 1UBHS 1B3RA 1F0KA 4RIEA 1QHEA 2O3TA 1VMKA 1EP3B 1PR5A 1T25A 1TKCA 4WKOA 5H81A 1GCUA 4PN3A 1YWGO 3H1FA 2JVKA 4U2BA 4UBKA 3I53A 3SKVA 2XUHA 1B6RA 2CNWD 5BW6B 3D6AA 3S7TA 5C7YA 3D8SA 3IBCA 4TZTA 2IZ6A 3TF5A 2FPOA 4RIGA 1GCGA 2CXPA 1X1TA 3JD0A 4LGVA 4RY2A 3RI3A 3VHRA 4EVIA 5CFOA 3R0IA 4I46A 4XQEA 3Q9UA 3A06A 3WKBA 3GH3A 3BOSA 5BORA 1Q7EA 3ZDFA 4BB9A 3RS2A 3ILSA 2UYCA 3OHPA 3PVZA 3R6DA 1N9ZA 5DGCA 4O4HA 5E1DA 4DV0B 4LWPA 1P7ZA 4FN5A 5ENVA 5AKEA 3ANSA 2R6JA 5AKHA 5F76A 5EIOA 3RV3A 2IF0A 5DYGA 1X3SA 3F97A 2W2KB 2Y1FA 2ZVPX 4IZOA 4X6YA 1PR1A 1RAFA 2B1QA 2WWIA 3DDHA 4OHWA 4EYKA 5BR1A 1OB2A 4FTWA 1E5XA 4QYWA 5ALDA 5BSRA 3KYIB 4YRIA 1MQSA 1F0NA 2QA5A 1T8SA 4D26A 1DPGA 1P9RA 1E4OA 4Q6BA 4CU5A 1TPYA 1P72A 3SC2A 2DJ5A 4HAIA 4GNKA 5FPSA 3IDQA 2VJAA 3F9RA 3GLKA 5FBWB 1YCHA 1Z47A 4G1EB 3W4KA 1YFLA 1YVDA 3GEIA 2W6JA 4Q1DA 3T4UA 3X3HA 4LHVA 1N5IA 4B3TB 4AJ9A 2D7CA 2GXSA 3DT8A 1VA5A 3IVCA 2HH9A 4KN9S 1QFMA 3SE7A 3KQLA 3E84A 3ND6A 5JPDA 3TXYA 5COBA 3TXXA 1SO8A 1QR6A 2GD2A 2MMGA 4BRUA 4ND3A 1EFCA 4BNGA 4CCSA 4NABA 4A8HA 4IIGA 2XCTB 3WFJA 4MKIA 4MO9A 3ZU6A 3CR8A 4UNIA 2CHGA 4H3HB 2GHRA 3DCYA 4GI5A 1P0PA 4S1NA 4WBSA 3T5GA 3R3SA 1ZR2A 4F93B 4ZVOA 5LQKA 4ALNA 1VIYA 2ZI9A 4PCVA 5ED0A 5EIHA 3H5VA 5AJTA 2HT1A 1Q50A 3QOWA 5B58C 5C7IO 3K9LA 4FHEA 1P7YA 4NPAA 2QNIA 1U98A 1HT1E 1SUDA 4QXRA 3WMRA 1OTXA 3HU1A 3Q2IA 3G2IA 5AIAA 2OV2A 4FEYA 2ZT7A 5KPJA 1QIEA 3OLCX 3P2KA 3RIYA 3V1YA 3VZRA 4HH1A 4D4GA 4A5OA 2GPJA 4HN9A 5K7SA 2F7SA 2P1DA 2P9BA 5FTLA 3JSAA 4KAXA 4CN9A 3Q7EA 4RESA 2VATA 3VI4B 1ISIA 2G0NA 2IH4A 4MV4A 5KOYA 3HRKA 3U4DA 2RONA 3QTBA 3TSOA 2EFEB 3GJYA 1TIKA 4F1WA 1PT7A 1U0EA 4G4IA 4TT3D 3EB9A 3RYHB 4BP1A 4HADA 4REOA 2Y2UA 2Z58A 3EDCA 3GD5A 2WABA 3IHKA 3COWA 1ETHA 4HDRA 4MSUA 1ADGA 4N8EA 2AOXA 5JSUA 2OBYA 4W7SA 1UDXA 4IJMA 1GAEO 2BKXA 2FK8A 3N70A 1VIVA 2PGAA 2J6IA 3UHOA 3Q88A 3FVRA 1SXJB 3VJKA 3VBEA 5HFNA 4C87A 1K7SN 4KMRA 3FNBA 1KK0A 2I1WA 3L43A 4WN9B 2G09A 2QL5A 1E4EA 4EI2A 3ANLA 2DHQA 4L76A 3AVUA 1N32B 4B48A 1DTEA 3IIEA 3Q8KA 1KNQA 1NI4A 2CYAA 3A3OA 3UBMA 3S99A 3E1KA 3H5TA 2FEMA 4L9AA 2VK2A 2QM0A 2AMJA 2Q3BA 1X8KA 2CXQA 2BI4A 3EQ6A 4Q00A 4QYTA 1SQ0A 3VTFA 4MZDA 4CNQA 4D4KA 1XNGA 2RHOA 5CVCA 5J47A 2GCOA 1O5OA 2VJMB 3KSMA 3M6IA 1YZUA 1MBZA 2Z83A 1Q14A 2O1XA 4JCCA 3RJZA 3TLAA 3PC2A 4U39A 2G83A 2GK4A 4WY2A 1EUQA 2XZLA 3KJEA 2R751 4C6TA 3PCRB 2X8WA 4PX3A 2J9YB 1RWQA 3DFZA 2XCOA 3EIUA 5JCPA 4TUYA 4AJIA 1VPDA 4K6FA 2ZQ5A 1BHJA 3L6EA 4EG0A 3RROA 2Z5VA 5KMGA 3QVOA 1TVMA 2RHGB 2OO5C 1V41E 5ALLA 3LIIA 3UTDA 4IWYA 3HB0A 3EEFA 5C2JB 2LWIA 2MYPA 4U7WA 1L7XA 2PIAA 3VR1A 4LZLA 5TF0A 3UCXA 2OAGA 1BHO1 3HJFA 4DUGD 4OQ4A 5A9TA 3RYFB 5A1JA 3OQNA 2L2QA 3VC3A 1CUVA 1QHHB 1Y4SA 3W2IA 1LPOA 1HZJA 1R5OA 5M7EA 2R6GA 2RB4A 2WVGA 3I3OA 3NHSA 4JA2A 5E2AA 3ABOB 1E2JA 1Q3TA 1FE8A 1Z0SA 1KIFA 4M7PA 4WUTA 3AUKA 1GWNA 1MJ5A 5GPBA 4WY5A 1I30A 1PV4A 3L8ZA 1YDMA 4QO8A 1AXRA 3TIXB 4AJEA 4COKA 1L1FA 4MI9A 3T1TA 1YVPA 1ZH2A 1WUTA 2G25A 5ALOA 2AG6A 5L3SB 1VLVA 2Y0PA 3ZGZA 3BAZA 3HVKA 3T4XA 2ECPA 1CR4A 4X1KB 4CF3A 1GFIA 1EI9A 2ZVQX 3NC0C 4TTAA 1RYFA 1PT8A 3AJEA 3GVXA 3BMCB 3R20A 4P4UA 5K0TA 1MOZA 1H4QA 1YDGA 3PXCX 1ZNWA 4BGDA 1XQ1A 5AR1A 1PHPA 5FLEX 3QENA 5CLIA 1O77A 3CNBA 2NO5A 3OICA 3OPYB 4LI3X 1XEFA 3M82A 3VPBA 5P21A 4BMXA 1MENA 3IELA 3ESYA 3KXKA 3UAZA 1UDAA 2PY6A 2NYAA 4P36A 3W1WA 3ORHA 3CNQS 4XJSA 5EAIA 5IARA 3ZWXA 3QPAA 5J2UB 1SCDA 4EB6A 4KP7A 2CB9A 3KWJA 1W0JD 2TECE 1COWA 1KI3A 4JEIA 3I42A 3WLJA 4Q4DA 3NP9A 5EI5A 4M0CA 4US1R 2CNOA 3MXOA 3HBJA 4ZVQA 3V8QA 4NBRA 3FMIA 4HK4A 1SH7A 5A4JA 4EJ0A 3VR5H 4BE9A 3LECA 3KCQA 4KFUA 1Y98A 2GD0A 2PV7A 2F4NA 4LF9B 3PYXA 3I0ZA 3LQ2A 4IFIA 4Y1RB 2H8KA 2YY7A 3A1SA 3GXBA 1OHHA 4A7PA 5B12A 1G8FA 1PBNA 1PJTA 2XODA 3Q98A 1G8PA 5A5GA 5FI3A 3ZJYA 1UJBA 1Y7HA 2W6QA 3BDVA 4I50A 1O0BA 3WJ1A 3M4NA 1DKMA 2GAIA 3OQVA 1L7MA 2AQHA 1NP3A 4P3NA 4RAQA 2X8AA 2Q7OE 1JI3A 2HSDA 2Z3WA 4LK3A 5G0SA 1O6CA 3L0YA 5KYTA 2ICAA 5EUMA 1GTJ1 3LRXA 3BGVA 1H85A 1U04A 3LCCA 5DW3A 2NNLD 5EWLA 3GVHA 5A7HA 2WMNB 4ZKEA 3U49A 3ZQ4A 5IBCA 2QL7A 4MGIR 3GJ4A 1O54A 1HFWA 3W6ZA 3GFRA 3H9JA 5KAMA 2HF8A 2YXEA 1WHTB 2HA6A 1D07A 4CTMA 1SQ6A 4FFMA 1CUIA 4IGKA 3B1XA 3ZCVA 4QGFA 4K86A 4ZQFA 4BXOA 2PWBA 4FYYA 2W37A 5CA1A 3CF0A 1E6KA 3LIPA 1QYWA 4NE7A 2IW1A 2GFQA 2FFQA 4KYUA 4L8VA 4P22A 1FK8A 3T61A 3ZXYA 3E05A 3ISVA 1VE5A 2J87A 1TTQB 3FTCA 4AXXA 1PLJA 4HPXB 5A7GA 2YS7A 3ZLUA 2XZTA 1OILA 3HE3A 4IFEA 3WTBA 2KQUA 1G3RA 1A9XA 3IMGA 5THKA 3RK4A 2DQSA 3U9LA 3GRRA 2YBDA 1P9WA 4PX5A 1GSIA 3Q12A 3TW8A 3ONNA 2ZRGA 4GMHA 5LWQA 1XRNA 1K0UA 1M8KA 1KI4A 2OHFA 3I8OA 1EXDA 3KYDA 2X41A 3IUJA 3JQQA 1V1MB 3P9SA 1U0OC 1Z5WA 2P6MA 3RRMA 2ZYTX 1MT0A 3L7CA 2I4RA 1HR0B 3QEOA 5DI9A 3UANA 3ZCSA 4J16C 2VA9A 5A0TA 1AQYA 4RMGA 5EQTA 2X7JA 2FFJA 3OX4A 1R18A 3T3HA 3U7RA 4AJPA 2W58A 3QYAA 3HPRA 4F71A 1V7CA 3GARA 4TRRA 1UP4A 1NT2A 5E1MA 3CLUD 3E8XA 2JI8A 3N59A 3TGWA 3V2UA 4JV5B 1PG5A 2C0CA 1IXRC 3KXPA 4JQSA 4RD2A 4X91A 3BE4A 3SLKA 5JI3E 3TCNA 4G0VA 1U0FA 4P2BA 3FMOB 4R5MA 3V4OA 1HE8B 1YR1A 3S8EA 1SKUA 2Z6QA 1LF5A 3USZA 1JDTA 3L6RA 1G1AA 1M1ZA 1VYTA 1NBMD 4CU2A 1P44A 3AIIA 3T1HB 3THYB 2WWYA 3R8XA 4PIVA 2ATCA 1YQUA 3H2YA 3L8MA 7AT1A 3I04A 2NAFA 4HO1X 1M6VA 2X0NA 3A9WA 2WOOA 1QJ4A 1Z6AA 3GRZA 3AJAA 1YR9A 4YMSA 2NWQA 5BSUA 4EQ6A 1GU7A 4J3NA 1XLWA 2QSZA 2WINI 3N75A 4BQFA 1X77A 1J00A 2Q2OA 3VOAA 2QJWA 4G86A 3EVCA 3B3GA 3FHTA 4JY7A 3PQ4A 2WPDD 1TJNA 1G8KA 5BWBA 4O4LB 2H4WA 1XLVA 3CB4A 4XR9A 2C07A 3QFTA 5CT5A 4HH0A 2JLYA 2A7QA 4TYWA 3K5HA 4MAAA 4P0TA 3FTDA 1CYEA 3ETCA 4PGFA 1WPRA 2AC7A 1E5TA 3AO0B 4JLWA 1HLDA 1UT5A 3ACCA 3V2HA 5EMKA 2CL7X 1YE5A 3GPBA 5BR7A 1UEIA 4FR5A 4GSKA 4IINA 4JGIA 2EJWA 5LB2A 1TKRA 2FPSA 1S4QA 2FW0A 3LL7A 4MQUA 1KYVA 4LGYA 5DNVA 1KORA 2Q3MA 2XT9A 1SR8A 1UDRA 4A73A 4PLPA 2FEWB 2XECA 3EN0A 2C8LA 5IDXA 1WKVA 2DLDA 4LRQA 2JGRA 4N0DA 1UOEA 5GONB 5ALGA 2O2DA 2PJUA 4FN4A 4EKIA 5DYYA 2CNDA 1D1SA 2XT6A 3OBIA 3TRDA 2IIQA 5CG2A 5FNVA 1SXJE 1QTIA 3ZZMA 3FJOA 4C2TA 2X0IA 1ENYA 3P8ZA 2JS7A 3I2HA 2GJKA 1YZKA 1TIPA 1YV9A 2O7VA 3EULA 5EIFA 1QE0A 2AEJA 3T1VA 3ZI0A 5AVXA 2VHTA 2R7MA 3FWPA 3LX5A 5SZIA 3LL4A 4YJGB 4DCOA 1ZJYA 4O4HF 3OOSA 5LA6A 5TJ9A 5ARCA 1FFHA 1YZFA 4YMGA 4MNTA 3THSA 1SHKA 1T9ZA 1J0EA 5DX8A 2AHOA 2WYUA 1TEVA 1XD2B 4E4TA 1KOGA 4A8JA 3QF7A 1G8JA 5DO9A 3V6LA 5JYDA 2E4AA 1YS1X 4H1TA 4IJVA 5EWJB 2Y1LA 2P35A 4JLPA 3NALA 3CVYA 1E7RA 1KEZA 1UFOA 2WQ7A 1L7PA 4ZCIA 1M6NA 3L49A 1XTTA 5FI0B 3ESDA 4KXXA 2I66A 2ZYVX 3LLSA 3DXYA 1HLPA 2YJ3A 4FYKA 4M1EA 5C31A 3ZWNA 2IZ5A 2WJZB 3PHCA 1K5HA 2CGEA 2QGFA 2WUVA 1NYRA 3H4MA 4IUCS 4OJQA 4TWIA 1UR5A 4I2VA 3W5BA 1UBTS 2RK3A 4FIDA 1L5WA 1TVEA 1MHTA 3P0EA 3ZW7A 1EXVA 1BW9A 1GUAA 4XM2A 4B82A 4H15A 1JNXX 3U0VA 5K8LA 2D1SA 2XUFA 1MW8X 3OOEA 1H3FA 2CV1A 3RFUA 4ETIA 2H5IA 3AJ8A 4KH0A 1HFEL 3NPAA 4ZC1A 3U13A 5SZJA 2IYPA 1LPMA 1ODIA 4O6VA 2OYCA 3WWZA 3GH1A 2CL0X 2OEPA 4MRVA 4XGKA 2I7DA 4CG0A 2FH5B 1OROA 1M7HA 1RLUA 3QWHA 2D13A 1MR3F 3B6EA 5JXIA 4BPBA 1QIFA 4NAUA 4Q1EA 4ITUA 5EGSA 4MWZA 4F3TA 1QKIA 3Q8LA 3H3FA 5TSDA 4NFYA 1I2AA 1ENOA 2OCLA 1XVLA 2OR3A 4ZVVA 1ORTA 2QMOA 3SM9A 4Q7QA 5A9SB 3HSKA 3IRVA 1YUNA 2CVFA 1GILA 3AP3A 2XXAB 2BTOA 4MR8B 2JAWA 3D6VA 3WDKA 3ZWQA 5EMJA 3IAM1 5IT0A 5AK5A 4X7MA 4CI9A 1DAOA 3GLFB 4NY1A 4Z8XA 2DUMA 4AFNA 1CUUA 1JKXA 3IUEA 3WAKA 1KP3A 1Z6ZA 4NBVA 3UK0A 1Y1RA 1R10A 3S3TA 4EY6A 3AKEA 2SKCA 1I4DD 5TVGA 2VPZA 3C3WA 4ZREA 1JR3E 3IAXA 4ZVMA 3AR2A 2XQKA 2FE4A 3UEOA 3DLTA 5KSYA 5E1OA 4HS9A 3DF7A 1OBOA 2NV6A 2NPFA 4DV4B 1KI6B 4CF6A 1T0JB 1Y6JA 3CB2A 3DOHA 4ENQA 4CKCB 1Q1NA 1A8UA 5I48A 4QUKA 5TJHA 1IN1A 1THTA 2O9JA 1LC0A 4GZ3A 4DJTA 1F8YA 3AEYA 3ZEAA 1NW8A 4HY3A 4AK9A 4B35A 4RVOA 1ODTC 4PPFA 2HF7A 4MQ5A 4W8HA 4AX8A 5DP1A 1JHZA 1SELA 3GQBA 3DEFA 4RK7A 2D7DA 1ZICA 1Q7TA 1SB9A 3ANYB 3OLZA 3PPVA 1T13A 1R9NA 3BULA 1W1IA 1W8DA 1JSZA 1RBYA 2PXXA 4I2NA 4LNAA 5FKJA 1U8UA 4EIWA 4Q34A 4XYEA 4YV2A 5AJWA 3OFND 5H0IA 3C48A 1A4RA 3E7PA 3NAMA 5A5VA 1A4UA 2CFOA 1FLDA 1SVNA 2KWIA 1AGPA 2FPWA 2RSLA 4XAQA 4ZAXA 1Z18A 3GLGA 4GMFA 3M5CA 1O9HA 1MGPA 1U9IA 1DFHA 4NBKA 3FPJA 2CL6X 1JJIA 3L7KA 5F5XA 4NNPA 1G2IA 2GSDA 3CF4A 3QUCA 4Q03A 1Z38A 4GEKA 1R4MB 3P0JA 3W6OA 1HEYA 1OLXB 3ESZA 3GRYA 3KVNA 4OGLA 3V2IA 1X7ZA 2Q5IA 4V03A 2WF5A 2WJGA 1NJ8A 3HDJA 4GF5A 4HBGA 4IIFA 5H8WA 4NAVA 1BKSB 3COVA 2VRWA 3VH2A 1XLTC 3IQIX 3WZLA 4ARZA 4UQPA 3JWPA 2B7LA 3ZGXA 1JQEA 1SC9A 8ATCA 1Z0DA 3CUVA 1UBMS 3AHFA 1R00A 1EE2A 1TVKA 1UBKS 3MJVA 4I6GA 4NCXA 3COPA 1Z4KA 3VU0A 1C9EA 3ZE1B 3JCZA 1H2BA 2Q1YA 3WGTA 3GGGA 1TUBA 1N1MA 4FOLA 4FYVA 1QGAA 1OXUA 3RS5A 3JATA 3V1NA 2QBYB 1WETA 2QE6A 5KTMA 3PFCA 4RXMA 5CB8A 2G6BA 2GFHA 3DOIA 1YRBA 4KQ6A 4V1CA 1XYGA 2EGGA 4FS3A 3GRFA 2VXBA 4FE3A 4MVJH 5KWEA 1KMHA 4BZXA 2MSNA 4QPCA 1T34A 4MUKA 2BFDA 1D2AA 3WQSB 3E0QA 2KW5A 1Q5PA 4K9SA 1MX3A 2V4ZA 3PRHA 5FEMA 1TYCA 3GRAA 1XMOB 4KVFA 3FMPB 4DLTA 1AF4A 2V03A 2SCUA 1ADFA 1DJOA 3PNBA 3NORA 4AWBA 2WSLA 3AVOA 3DA8A 4AL4A 2Y1GA 1A7AA 2PMWB 2ONYA 2XITA 4RGQA 4RQUA 5DRYA 4J2HA 1QNLA 2FZCA 521PA 1A5AB 1E2EA 2FCRA 5KTPA 4KAFA 1A77A 4WEOA 5IEJA 1CULC 4MMZB 4L27A 1FRVA 5EJ6A 3HXTA 5A71A 1LCIA 2BP7B 3DR5A 3FNIA 1M2VA 1IXSB 3B9BA 4G5OA 4EUNA 2EBUA 3GJ6A 4R1PA 4M7RA 3RKRA 4Z5XA 4Q0MA 1AKQA 3W9UA 3T0FA 4HRXA 3O90A 6ABPA 1A5SB 2QN6A 3K70C 4RTRA 2X22A 2J0SA 3AVWA 1Z9BA 3VHLB 2X1MA 4Y6RA 4RNDB 2I2XB 3RF6A 2DZDA 1BROA 4V0QA 1Y9EA 3G88A 5ILQA 2CSXA 3R9XA 5BNZA 1H65A 3IVAA 3QU2A 5GIOE 5A0VA 2R7NA 4G1UC 3QPCA 1W48A 5BNTA 1KK3A 1ZGBA 4BVKA 3IS3A 2WWHA 1E9EA 5DNEA 2YS6A 3WRWA 4ER7A 5EKDA 5D3MB 4LHEA 5DCYA 2JAHA 4MDFA 5FOSA 2YFKA 1VXRA 2I99A 1G63A 4JDUA 5FAKA 2A9VA 3A4TA 3ZTTA 4RZQA 3ECAA 3OM0A 4BFXA 4Q24A 3OIDA 3MSCA 3ZY5A 4I50F 2ZCJA 1ZCBA 5FHRA 1RADA 3TQOA 2NAPA 1M3SA 2FEPA 1RAIA 2ERYA 2ZRIA 4ESEA 5CB6A 3M5WA 2C8JA 2I6UA 3I23A 4EY7A 5HGXA 2JB9A 1NRIA 2X7HA 4JLDA 4AW9A 2OMKA 3IPAA 4OL9A 3EPLA 5GZ3A 5C0OE 3U62A 4IEIA 4RADA 4Z7JA 2EGUA 1BWQA 1JN0A 5IVPA 1JVBA 3DMRA 1ULAA 1VDZA 2E87A 1EU1A 3ZS8A 4LSWA 5FA8A 2XUPA 3D31A 5I3ZA 3P20A 1BD4A 3PDIA 1CUZA 2YC2C 5EEHA 1CUGA 1YR2A 3DZFA 3EMKA 3TD9A 4BFYA 4R0MA 4KHPB 1RXIA 2RHCA 5CA1F 5JCOC 2G7MC 2IEYA 3I2GA 4YMLA 1XRJA 3H2SA 2CXSA 2EKPA 4ZICA 2ZBRA 3ZIAA 3B2QA 1KC3A 1U0TA 1Y4DE 4BRSA 2ZUSA 1H1LB 3DS8A 3MMPA 3AEUA 3K0AA 3ENKA 4B3MB 1U0BB 1G7RA 3AETA 1UK8A 3WMGA 1FQWA 1VKJA 3HNPA 4PLZA 1Q7GA 4FSDA 3CTPA 4UEJA 5IJ0B 2B78A 2SNIE 4YJ2B 3E9MA 2RJOA 3GWGA 4O4JF 2JJMA 2X6RA 4M89A 4LVCA 3OZXA 2GNAA 3HXKA 2UAGA 4PR0A 4RLQA 5EXXA 4XVCA 2WLSA 4YPOA 3DZJA 2ZWPA 4L5YA 3O84A 4UHDA 3AHCA 2PR7A 3TIVA 3TTTA 1JF8A 2VYQA 3O8NA 5M34A 3GPLA 2Z2IA 3N7TA 1P3Y1 3PWSA 2F8TA 1DWQA 4A0RA 2HIMA 3BVPA 1IBKB 2FWIA 1Y6GA 1FBNA 2DTDA 4X92A 3SXPA 1C2YA 4BGIA 2E4ZA 4EW6A 2XKBA 1L8LA 3TBHA 1RNLA 4C5BA 3ENZA 3G2LA 1KRWA 1L1EA 2CVOA 3FSGA 3PHHA 4QHTA 2GA9A 4LKOA 1SRQA 1V71A 4O2LA 3I9NA 3NNDA 4RIFA 4TGLA 3IQEA 4Q9JA 4D8TA 4QT4A 3KOYA 1ESDA 3SKXA 5BSKA 2Q07A 4ZPXA 5CIQA 1NHGA 5BVHB 1KDTA 3EPJA 2WJPA 3PIDA 1Z7GA 5ESDA 1P6QA 3UWKA 2PZKA 1T5IA 1YB7A 3VKVA 4JVSB 4CFYA 4N03A 4N3CA 2MSDB 2G80A 3VYSB 2I6TA 3HGMA 3QG1A 1P0FA 3DBIA 1O3YA 3E8MA 2GBLC 1AV7A 4MI6A 4POAA 3RT7A 4CVNA 4ZT5A 3RC9A 2A94A 2VPPA 3FGNA 2QW0X 4Z4QA 3NNSA 1B93A 1XZPA 3UAYA 5G0WA 3PFHA 3NP7A 1KI7A 1G8MA 1X1CA 2FFHA 4MOWA 3GLFE 4Q39A 3NHRA 5DYIA 1NQUA 4DR7B 1N6KA 1J90A 1K86A 4BKPA 4X7BA 1QLJA 4PO9A 4QOSA 1QO9A 2ARKA 3HQ4O 3I9FA 1UF9A 4BDSA 1GAJA 1MJFA 1XAHA 1OIWA 3L6DA 5KTRA 1ZSVA 4QHYA 1TTPB 3WLQA 4OFWA 3M81A 5AM0A 2IUSA 3TO5A 1DRVA 3EY4A 2C2OA 1Y5IA 2GM5A 2VJPA 3QUBA 1Z39A 4KL8S 3PEYA 1QH8B 3NYIA 2FZGA 3E7XA 1HNWB 1X7HA 2CDRA 2AWNA 2J9FB 1GQYA 3DNPA 1X94A 5FNVF 3L7JA 1A9QA 5I7FA 5ICSA 1EBUA 5ITSA 1YMUA 3AK4A 1JB9A 2YYAA 3G5UA 3JYPA 4ZI7B 5L4SA 4OBXA 3IJEB 2OQRA 4J7AA 4MB6A 4HAWA 1NWCA 3WGOA 1GRNA 4LC0A 4H59A 1YUMA 5JI2E 2I6SA 2NUPB 4NJOA 5EPOA 5LA6F 3TZ6A 5GOTA 2IWRA 5G1PA 1KMQA 2BFPA 3F74A 1L5HB 5JMWA 3MD0A 1ECCA 3JWHA 3R3HA 3WDSA 1SM4A 2IVFA 3NR2A 2QL6A 4S1TA 1E3DA 4G25A 2B4QA 4I9NA 1GKIA 1AG9A 4K9MA 5GJVC 4YWHA 3VR5A 4W4TA 5KYGA 3RC8A 5KYWA 2RHBA 1JNYA 2EJTA 2FR0A 1D2HA 4PRYA 4XFKA 2FOXA 1JEQB 4GPAA 2ZSKA 2DPMA 3QLVC 4OFZA 1SIUA 3CW2A 5FWXA 4DLXA 4IGEA 2B83A 1L5SA 3T7SA 2EP8A 2AG8A 2PAAA 2C8KA 4DVJA 3OZSA 2D1YA 2GTIA 5B6PA 2DUUA 3ZVMA 1W4AA 3KZOA 1X42A 3AUAA 4L4SA 3HXOA 3Q5GA 2FPPA 3VPAA 1HG0A 3K9FC 3TPCA 5JOQA 1XMQB 3H2JA 4I7EA 2H31A 3BIFA 3U26A 3PUWA 1E0DA 1V2GA 3OPXA 1PHRA 4RVCA 4FYIA 3DFIA 4HZGA 4BN4A 2ZYWX 3N0RA 4QG3A 2BMWA 2H7CA 4QG7A 3W7BA 1M1NB 5GADl 3ZWAA 4JJAA 3Q3GE 3T6KA 4CKBA 1KYIA 4WOKA 3ILVA 3JD1A 3SHQA 3AESB 2X4LA 2AF4C 4OYRA 2Y93A 3PT9A 2OORC 1JA1A 1BEUB 2RKBA 5BOSB 1SHTX 3WHPA 2Y05A 1DAKA 3IOEA 3KZNA 3RVQA 4EYQA 4ZAVA 5AM2A 1F6BA 2XOXA 4URUR 3MTDA 3BHNA 2HWWA 2IQIA 1EGVB 3D4OA 3N2YA 3TS1A 3BT7A 1T35A 2CMKA 3GNSA 1K3TA 1K98A 1LGYA 1A2BA 2YR0A 3JWGA 3R44A 3TLGA 4EGAA 2GN9A 5K6RA 4FJ1A 1DU4A 3CG0A 1DO0A 1JRLA 3DCJA 3WRYA 4IXNA 4YAGA 3JAKB 2C2YA 4UASA 4IHQA 5JPCA 4U7DA 1NNI1 1NVBA 3U16A 1U1EA 1U3DA 2FV8A 2I4NA 4ACBA 4LJSA 2HFJA 1AA9A 4JVNA 1J0DA 1I4EB 1QIGA 1V3QE 2ZJZA 3IXMA 1VLMA 1BRTA 3OE1A 5DIFA 4Q82A 3TYXA 5H7XA 1LX6A 1FA9A 1XMSA 3FIUA 1AQIA 4Q4JA 4UVIA 1GNSA 3GFTA 3A3NA 1Q77A 2JGDB 1HYHA 1NW3A 3DP9A 3QXGA 2HI0A 3R4CA 5IBPA 5C1IA 5TR9A 1GR1A 1X2BA 3QOYA 2QB5A 2K87A 5A02A 3M3DA 4B43A 1XAIA 3RC7A 5FWNA 1IK4A 4JYAB 1W30A 3EF1A 3Q2OA 3PI7A 4Q02A 2H54A 3M34A 4I55B 4YJFA 5KNBH 1EGQA 5DOZA 3AG6A 4PRZA 1GUYA 4IWXA 5JFGA 1WVMA 1WXFA 4WGGA 1FFWA 3RS8A 3K2QA 2EJVA 1PE0A 5LU8A 5D87A 3TPZA 4RSRA 3HL0A 4COOA 1N6PA 1I7SB 1RXCA 1C1XA 1LY1A 5LMUB 3Q6IA 1IHYA 1TU0A 4YBRA 3TBFA 4B7XA 1L2TA 3DBRB 4KE8A 5AXDA 1DZ3A 1PLKA 2UVQA 2HW8A 2QRPA 5JAOA 2W98A 3QTTA 1YMQA 2DHEA 2JIZD 1GZDA 3VHQA 5JAIA 2NLOA 1GPMA 1KPGA 1RRPA 2AFVA 4WBXC 3ZZTA 4GL2A 2BFBB 2ZDGA 3G0DA 2FQ1A 2ZCUA 2JI6A 2F1KA 3O6VA 3U5ZB 1N33B 3D1JA 3GAMA 3PQ2A 1JH9A 3G9XA 3MRVA 4DA0A 1LI7A 5E7IA 3AY0A 1GYPA 2XPCA 4LZOA 5K8VA 3KC2A 2A33A 1GO2A 2C5FA 2ZIUB 2G77B 3D02A 3L7MA 3O8OB 2REBA 4MYCA 2V7GA 5KKCA 2AW3A 2PZGA 3OZGA 5LBUA 2W8BB 3LPDA 1P2TA 2DCMA 5I8PA 3EX7C 2QLFA 3QE0A 2W70A 4FHDA 3A4IA 4YCNA 1GOTA 1SCQA 3S2SA 2BKAA 4IIJA 2NZ8A 4JP5A 4YMUA 2R9VA 4GVLA 2ZRHA 5LIPA 1QQBA 4OOFA 1GGVA 3VYTB 3W2TA 3DZKA 3HZRA 4WACA 1GGJA 5D3KA 1U9YA 1C3XA 2C2MA 2CY0A 5CPBA 1V26A 4X62B 4B7ZA 1G21A 3RT9A 4BLSA 1MZPA 2OQIA 5F35A 4F2DA 3GBSA 2HQ1A 3G7UA 4LRWA 1QZZA 4AMVA 1ZH8A 2OBNA 1KETA 2GEJA 4ENPA 2DH6A 4ED9A 2O5CA 3GNQA 2ZRJA 1RW4A 1ZN2A 4V38A 2QNRA 1GN8A 2P9EA 3ZV5A 3T9CA 2SHKA 2GEUA 1XLUA 3VR4D 2Y66A 1BOFA 4D4IA 2GA8A 1MO2A 4FUTA 2LZ0A 4PC6A 3HCAA 4RACA 5F5NA 4AYWA 4EMTA 3H7AA 3DQQA 4I5DA 1BCSB 2VT6A 3ICWA 3PQDA 3CGGA 4TMXA 2W2KA 1CR2A 1CHNA 1SUAA 2VJBA 3WMEA 4CIYA 4GKKB 2EVWX 4WFJA 3VKWA 1JJVA 2ISSD 3P9QA 1XZFA 4WK4B 4PW0A 3ONEA 3JQRA 4PPQA 1WDLA 2KS6A 2NQ2C 5AW1A 3VVCA 2CL5A 2JH3A 4BO0A 4EJFA 4BUZA 5KREA 1Z75A 3EZLA 2BGWA 4NMWA 2BGKA 3MS7A 2EBWA 2QW8A 4G1MB 1XOIA 1O08A 4A9AA 5E9AA 3IDOA 4PBTA 1UDBA 2PKQO 1PJ2A 3ZDBA 2OZVA 3RK1A 3A2NA 5THQA 4DLZA 1NDUA 2PUHA 3VUEA 3ZX4A 5CDYA 3ROQA 2FPMA 3FYTA 1PUXA 5JDIC 4O1MA 4BWVA 1V5EA 5HVNA 1IUKA 1WS6A 1TQ4A 3AJRA 1CQXA 5DMHA 1AZLA 4BRZA 3EXAA 4YK7A 5LIRA 2BGGA 3ZW9A 2VDNB 4Y67A 2R6DA 1Y4ZA 1FUKA 1FX0B 2PGLA 3NEJA 3LUKA 1QGOA 2HBQA 5AFSA 4G0QA 3UV6A 4URFA 4JLBA 1O2DA 5E1BA 4UEOA 1R4NA 5ARDA 2NUAB 4BQRA 4C4SA 4AIIA 2PMCA 2DSNA 3G17A 5JNRA 4GD3Q 3LWNA 1ZD1A 1R0RE 3RRNA 3BWBA 1ZC3A 3MPUA 2XUIA 3ILHA 2YDYA 1JP7A 1Q0PA 5JSQA 3SZUA 5A5DA 1KFBB 3TIGA 2ZRPA 1TCUA 4GKAA 1JPNA 2ZIXB 1HZZC 1KFCB 4JLVA 3TK1A 2OV1A 3OX2A 5FTKA 4H4CA 4Z1MD 5BWOA 1VPVA 1J2UA 4OIFA 4WEQA 1MUUA 2OP0A 4M53A 3A4MA 5CH5A 4BCCA 3M1LA 3LDFA 4GH5A 3WHLA 2AZ4A 2WUDA 3EGEA 5EZSA 1GSAA 3NB0A 4RVNA 4RTLA 1Q15A 3N8IA 5KQLA 2N0SA 1J07A 2IYTA 3K0BA 4WBNB 3LUBA 4CM6A 1E1NA 1VMIA 1KSFX 2Z8YA 3PLNA 4RJJA 4UEWA 9GPBA 3VPSA 5E3IA 1TK9A 3RIGA 2ZOSA 3FPCA 5IYZB 4IICA 3I9LA 3UMRA 3O75A 1SXJA 5A2QA 3ZUPA 4RMNA 1VLLA 1ORIA 4D97A 2BBSA 4WN9A 4G1VA 1OKKA 4AULA 1KO8A 4YV1A 4UOQA 1C9NA 2IGBA 4EAQA 3H2HA 1U90A 2BFNA 4RDCA 3KETA 4AMBA 4H7KA 4D81A 2FETA 2PMEA 2VHCA 4NK4A 2I3DA 3NIDB 4H6PA 4D45A 4TS9A 1JUDA 3WRXC 3LPCA 3HBLA 1Y82A 3F6EX 1RQXA 3LQKA 1KH1A 1U5AA 1AS3A 1KAMA 2VJMA 3K8YA 4F5ZA 3FRJA 4C4PA 2UZ4A 5E3JA 5FBLB 2ZAIA 4IVNA 4YRDA 4QM6A 4YRQA 3IMCA 1NVWQ 4FGZA 1H6DA 1DWUA 1IIBA 2YJTD 3GF4A 3JQAD 3NPMA 4LKRA 2P6UA 5EIAA 3V3KA 3WS7A 1P2DA 3A1FA 1WZ2A 2XYPA 3DAFA 4IBOA 3JVEA 1VZ3A 4HQ6A 4Q1FA 4ZQGA 2VOJA 5JHHB 3ZHTA 2PS9A 3U7JA 1Z16A 3OFKA 1UBGA 2I3AA 2PFGA 4M0PA 4P7BA 1JPJA 5AP9A 1QF7A 1BWPA 2QEQA 4PC7A 2H2AA 2G6TA 1IZZA 4WHMA 3HYSA 3LBNA 4XD2A 4ZRMA 4ZN6A 4G5HA 3Q87B 5KPDA 4HZUA 3RYFA 4BFZA 3R6GA 3G68A 1TMYA 4G97A 3SHFA 4E2ZA 1RXWA 3CG4A 1VOTA 2PYDA 1E8NA 3PE3A 4BX3A 1QHHA 4ZI5A 1PI3A 3L1JA 3T3NA 4QDUA 2Q5CA 3KAJA 5CEFA 1JSRA 5CEEA 2H4JA 3VH1A 3SVTA 2QD4A 4MHTA 5LDHA 1TC2A 1WV0A 4IV0A