3AQIA

H240a variant of human ferrochelatase
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADAILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title H240A variant of human ferrochelatase
rcsb
source organism Homo sapiens
total genus 147
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aqiA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aqiA01
2XVXA 1C9EA 2Q2OA 2C8JA 1LBQA 2PO7A 1TJNA 1QGOA 2XVYA 1C1HA 2PO5A 4CCSA 3LYHA 3AQIA 4KLRA 2H1WA 2Q2NA 3W1WA 2DJ5A 2Q3JA 2XWQA 4F4DA 4KLCA 3M4ZA 2HRCA 3HCOA 2JH3A 2QD3A 3HCRA 1HRKA 3HCPA 2HREA 2AC2A 1DOZA 2XWSA 2AC4A 4KLAA 1N0IA 3HCNA 2QD5A 4MK4A 1LD3A 2PNJA 2XVZA 1L8XA 2HK6A 2H1VA 1AK1A 3GOQA 2XWPA 2QD1A 4KMMA 2QD2A 2QD4A
chains in the Genus database with same CATH superfamily
2HLHA 4Y30A 2X4LA 5EJ8A 4R8MA 2H4XA 4F8JA 1KMHB 4MIOA 5C7YA 2ZRHA 4MITA 3ZE0B 2XXBA 5L53A 3GA5A 5DNYB 2X41A 1F7UA 1QRRA 2R2AA 3B3GA 3N0XA 1SN7A 4B2YA 3WAGA 4RIHA 4GLFA 2J9RA 1E6UA 1XZBA 2JCGA 3Q7RA 4HB3A 1QQBA 3WWEA 3B52X 4C7XA 1XAGA 1SQSA 2H1CA 3FW1A 1YCFA 1YS7A 4IL5A 5ALUA 5AVXA 1Q7BA 3KKEA 2ZYIA 4E46A 4MYHA 3SS8A 4YRSA 3CW2A 2OG2A 5K8IA 1M1ZA 1PLLA 1FOEB 3G2NA 4AJ4A 5JD3A 3UT5B 3VU1A 4L5JA 1PWHA 1KIMA 1M7GA 4MUXA 4WXYB 3PQ2A 1FDOA 1V1MB 1E7MA 1L0BA 1XEWY 2IA5A 3BTUA 4KYUA 2FEWB 3TNLA 2I9KA 2EC5A 1RM0A 2NSYA 1CY6A 1FBTA 2WHYA 4X94A 2P5UA 3MQFA 5JCXA 1GUFA 3VHLB 5DU2A 4NFHA 3ANYB 3K73O 1VYTA 3QEMA 2BMEA 3OZSA 3Q6IA 4GX1A 4AN0A 4ABTA 2P79A 1NJ1A 3BDIA 4KBFA 1KMIY 4U7JA 3U81A 3UXEA 1HZZA 5L9AA 4WAUA 4NCAA 1U2PA 4Y2GA 1Z0AA 2VH1A 2XUKA 1O4WA 1OCEA 3PUJA 1E2UA 1J06A 3OWXA 3AHIA 4XJTA 1EXDA 3EDMA 3AERA 3CLKA 5F23A 2ON6A 3CVJA 5D1HA 1YGYA 3T35A 2GBFA 4J0IA 4KDEA 4LISA 1ICIA 2Z95A 2HLPA 2REQA 3A6FA 4GYWA 5ANRB 2Q3HA 3LCVB 3NTRA 4WH0A 2WIKA 1DAOA 4R1MA 3VNRA 2RAFA 3SQLA 3TPZA 1SKMA 1WAMA 4RTQA 3AUUA 3IMKA 1ZNQO 5FLYA 5DWVA 3CXRA 3SSMA 3ZBPA 4RD6A 1YOVA 4YCBA 1X7YB 1AXGA 3ESZA 4L50A 3KSBC 1NNI1 4TSFA 3RWOA 5LNK1 2AN9A 3RS2A 4II7A 1CVLA 3IIEA 2O2IA 2R97A 4QL3A 4Y6PA 4HFMA 4G25A 3ZY2A 1B3RA 3L7AA 4ZI5A 3SY8A 3UXMA 4JA2A 1UPTA 5G0VA 1P9WA 4GBED 5L3ZA 5ESWA 2H9YA 2G70A 2QR2A 2GN2A 1NATA 4PLWA 2IXEA 4V39A 4WD3A 4YJFA 3U60B 3EZFA 1IIBA 1OC4A 2ZAIA 4QYIA 5AVOA 3GT4A 4LV6A 1LEHA 4YBZA 1CTQA 2DPYA 3K8QA 4YQEA 1R9NA 2FN9A 1UT6A 2MIIA 1PKEA 1ONSA 1RQGA 1YR8A 3NHAA 5J59A 4DC0A 1Y5RA 4EY6A 2RJ3A 5J47A 1NBEA 4D4KA 2Q2NA 4QZVA 2X1VA 3TLZA 2WSSD 2XWQA 4Q37A 16PKA 4D9KA 5EIAA 1LK5A 2QSZA 4LYEA 4BMSA 5LZ4A 1SEVA 3EQ7A 4GL2A 1WE2A 4MR7A 4NL4H 2XNJA 1Q1QA 2G7ZA 1U8XX 4HQ6A 4Z0PA 1MAWA 1ODTC 3EIHA 1GG8A 1L7EA 4X91A 3TDMA 2YJGA 1KR5A 3DZ8A 4Y7DA 4UU7A 1YZUA 2C2XA 3EVGA 5IKMA 1U3UA 3ADPA 1V3QE 4FINA 2QL6A 4KO3S 1FFSA 3O47A 4Q9KA 2D3TA 1E2KA 4LRYA 4C7VA 2VSOA 1AK2A 2JIRA 3AEKB 1J0XO 3AUYA 2AHRA 4WA8A 5AK6A 4EMSA 5BVHB 1X1SA 2BGLA 2WC1A 2WWIA 4IRMA 4LSWA 1V3TA 2VZ8A 1T5LA 2EBWA 2QSUA 3AFNA 3MXOA 2YMLA 4WOKA 2Q8NA 3FZGA 1R0YA 3DCNA 5EKDA 5J2TA 2W8ZA 1JR3E 2BY4A 4MZXA 1A8IA 4MO2A 5BYKA 3DQZA 2W6NA 4ILKA 1EE2A 4I1OA 3GLFB 1A5TA 2HF2A 3WL3A 5E3HA 3A7DA 3V42A 1Y33E 1EFTA 1I4OA 1L7PA 2XR1A 3HEAA 5THQA 4OJTA 4E32A 1V9CA 3GDOA 5FI0B 5TT1A 4EG1A 3W04A 1F2UB 3QKWA 5FUQA 3AF0A 1RU3A 1U3CA 1W2GA 2YNMD 3O2SB 2OORC 2NVUA 4PLVA 1M2WA 1SOWA 1W35A 3EMVA 3ZKWB 2FAXA 5FJJA 3RYIB 3PWTA 4JXXA 2EZTA 5EMKA 5FOTA 1EFLA 5EAIA 1XPRA 2Q9BA 3VMMA 3P0RA 5FWXA 1U7HA 1D1QA 1KSHA 5EHGA 2V55B 2BFWA 4OQPA 1TXGA 1XJCA 5DXAA 1KYIA 3G82C 3OP4A 4RAQA 3FYDA 1IQUA 4JK3A 4ZOQI 3AEQA 2QRQA 2D0DA 4IDAA 4TV8F 4ZODA 2ZJFA 4UZEA 4F6CA 4LJ8A 3NHUA 3UAYA 3BILA 3E2PA 2EKPA 1IPFA 2WU0A 3U39A 2REBA 4BMZA 5BV0A 3QSYA 2IS2A 1VJDA 4AWBA 821PA 2QM0A 2UUBB 1VZ3A 1DRJA 2JFNA 1KGSA 3KK0A 4Z4IA 1KH1A 1P6XA 2XQFA 3GD7A 1U8ZA 4P34A 3TTSA 4ZHQA 3LC2O 1QIFA 5CVDA 3UOGA 4CKBA 5HIKA 3ICVA 2AMFA 4O33A 1ZLYA 2WHRA 3ZWVA 1AXRA 4ICIA 1UBFA 2A7QA 2PR2A 2DUWA 3FDZB 5LQMA 1M0SA 5IAKA 2F55A 2NAFA 1QZZA 3WKEA 2VWPA 3BQMB 3ORFA 1MB3A 5B2FA 3HU3A 1YZFA 2LDXA 3GZTB 2VDKB 3RBXA 4JI7B 4R3UC 5G40A 3F0TA 4TVKA 3OPXA 2Q29A 1J1IA 4UREA 3R8XA 4Z7JA 1BVHA 1G5TA 2YRWA 3PZBA 4NCIA 2FI1A 3AB7A 1A8HA 1Q83A 3PDHA 4C4TA 1UINA 2PDAA 4NBUA 3EIXA 5EPEA 3VSDA 3GGOA 4B3CA 2UU9B 3HVHA 1TE2A 3SS7X 1QAMA 3WXBA 2IYEA 1DADA 5E7QA 3AJAA 4XZ3A 2QD2A 5B30A 1AHPA 1JFTA 4CIAA 2ES4A 4B09A 4IMJB 1NJFA 3NH9A 2OFOA 4XGNA 3UICA 1VI5A 4FXOA 5IANA 4JJZA 4F3KA 3CRW1 3N3BC 1UPAA 4LDAA 1ZIYA 3T8YA 5F9FA 3PCRB 3HV0A 1I7LA 1BXKA 1ULSA 1P6UA 3DMTC 3KEFA 2FYTA 5DX8A 3VSBA 1IJFA 1GG5A 3F2VA 3ZW7A 2H1HA 2YYYA 4EHAA 4QARA 4DLLA 5KHLB 3U61B 1Z47A 4IMPA 5AJHA 3QVWA 2AZXA 4Y2XA 1GG9A 3KQNA 1CY4A 3HJUA 4G9BA 4Q9AA 2V7PA 3TL2A 4XJSA 4PZPA 4QNNA 3V6LA 5FOQA 4IHJF 3ZQ6A 2GAIA 2Q7XA 3QE3A 2JJMA 2QVBA 4G89A 4WGFA 4CM9A 4EL5A 3ISTA 4GAEA 1QO9A 3E1SA 1SC1A 3QBTA 5JZBA 1C3XA 1JKXA 2M98A 3G0GA 4BFZA 1A4RA 1IIRA 4K6HA 3BKWA 3GLKA 4A9AA 2E4YA 1HDYA 3GARA 1M2VB 1NVMB 4K9LA 2VQEB 5COQA 2PQ0A 5REQA 4AURA 3D9QX 4YFYA 5BSFA 3R7LA 2Q5QA 4UVDA 5DRYA 3ASUA 3K6KA 2XGJA 1ARZA 1P5JA 3RJTA 2JB9A 5F77A 3TAUA 2O2ZA 1Q1NA 3GMDA 2I2DA 1R74A 5HTOA 3CZQA 1NMXA 3QBEA 1W9HA 2CVFA 2PWYA 3ZIAA 1I9GA 4FGUA 4IXMA 2HA6A 3RRXA 2CHVA 4GSKA 5BYBA 4N9QA 2YWCA 3THYB 3NCHA 4ZARA 4Y18A 1PI3A 1THZA 5G1PA 2ZM6B 3VR6H 1TTTA 1KH3A 2IW3A 2PLFA 4YP0A 3QE9Y 5L8VA 3RYHB 3H86A 1QIMA 1QPZA 4EQZA 4NV1A 4Z1MA 2VQFB 1JHRA 1P73A 4K7JA 3A1FA 3BMOA 5LIRA 1RC0A 1TZ2A 3BK1A 2G9QA 1Q12A 1EUCA 2P9GA 3AILA 1UIMA 2GUGA 4LNHA 3E03A 3N74A 3UATA 1ZICA 4IIUA 4UQLA 5HQJA 3CIOA 1MRSA 2A94A 2P9BA 4LHYA 5KX5F 5TS2A 3VYWA 2BKXA 5LQDA 5EUQB 4Q21A 5LA6A 4C7KA 2V6MA 1EUDB 3QMMA 3IHKA 3ZCTA 4F04A 5CFOA 3CBQA 1RAFA 1Z26A 2Z2JA 3T4XA 4IM7A 4GI5A 3DAHA 4FLFA 4K26A 3CVWA 4RJLA 3OLVA 3G49A 3MBKA 5FBLB 3JD0A 3GUZA 4H3HB 3GPCA 2A4KA 2JK0A 2BEWB 2EBFX 1OV4A 1MJGM 2QNRA 1GPKA 5FOVA 4BO7A 1DWQA 3IKVA 3K31A 4HV4A 5BURA 1R4ZA 4KK4A 3PD7A 3OU6A 1XCMA 4MHOA 1JSCA 3SC3A 3MT7A 3UY4A 5KJCA 2BR5A 2Q6KA 2GZMA 2BHSA 1AUVA 1LK0A 1WETA 5DMHA 2PN1A 1E32A 2G83A 2JLVA 4AZVA 2HV9A 1UXGA 2J7KA 1Z16A 2VPWA 3L43A 2NTVA 5EJMA 5G02A 4KR9A 3DAOA 3CJQA 1N1EA 4B2PA 5BW8A 3L4BA 3Q7EA 1SUEA 2WTEA 5JSHA 4IY1A 1QR2A 2VJKA 3IBFA 4PR0A 3BUSA 4QOGA 4N47A 2D7DA 1ELOA 4OJKA 2XUFA 3HBMA 3LT2A 2F9LA 2R8RA 5IEJA 1ZI8A 3F5MA 2G28A 3WWZA 1YJCA 3K9WA 3HVJA 4ENVA 3L8YA 3W4JA 3T9FA 1WCIA 4RFSA 4JQYA 1OX5A 4MVJP 1DKQA 2EHDA 4MV8A 2VAMA 2GD1O 2A5YB 3N8IA 4OATA 2GN6A 3V7YA 2CVHA 4L0CA 3BERA 1XV5A 4ERNA 3HVRA 1ZGZA 3MA0A 3LZDA 3OX1A 4X3CA 4CKWA 2CCKA 1T4DA 1QKJA 2NN3C 2WJWA 5AK4A 1F3OA 1MFPA 2DFTA 1SOUA 3VR6A 4LXGA 1B6RA 5CFLA 4R0NA 4RZUA 1U0LA 4BNHA 5CGZA 3BJMA 1BXRA 1T5HX 4Q1EA 2N1MA 4LCBA 5B1IA 2ZRFA 1AB5A 4MV7A 3LW7A 1WIWA 1W4BA 1Y1PA 4RPCA 4JN6B 4US2R 1BDBA 2QN7A 3KDPA 4EG7A 1RQ2A 3H9UA 3NNNA 1NQTA 3C98A 3EMDA 2FMTA 4HBZA 1E0SA 4D0NA 2Z2KA 3ETLA 3DM9B 2WF5A 1MQ9A 3O1IC 4R98A 1PTJC 4TWIA 2QIOA 2QRKA 3C3WA 3GGGA 4O0MA 2FE4A 3SM3A 1DC5A 3JQGB 1X1AA 2OCAA 3R3ZA 5A1TA 1UZUA 3R5SA 3CJTA 5AXBA 2XSZA 4C4RA 2I6SA 1FP1D 4ZT2A 5F51A 3EPJA 2AFHA 4OAQA 3CVYA 2A30A 5AM2A 3WDKA 2ADMA 1ADFA 2XD9A 3TQSA 2DP4E 3L4KA 5DYYA 2QMEA 4MK4A 1KR2A 3TLMA 1RWXA 1YFKA 1PFQA 4Q16A 4MS4B 4DCJA 5BN1A 1YJ5A 2B78A 2CCJA 2ZI7A 4LWZA 2QP9X 4RZSA 1IB0A 1RSZA 2WDPA 1XWWA 5FI1B 2XNDA 1NN5A 7YASA 5ALOA 1CC1S 3K1AA 3SWWA 3BQ9A 4GGMX 3GJ6A 3NTXA 1XL1A 2D5BA 1PFUA 3T1OA 3FRIA 1FS4A 3ZYZA 3GAMA 3D81A 3TLJA 3UVEA 4JB0A 1U90A 1QWSA 4YCAA 3FZNA 4AN4A 1LY1A 1ZD4A 3V4ZA 4HNVA 1ILWA 2QDKA 3WK6A 4ER7A 5DHUA 3A4VA 4EY3A 2H11A 4Q12A 621PA 2FXVA 4K28A 4MKFA 2IWHA 2P4EA 3LS2A 4ZCRA 1JQKA 2WNIA 3DKRA 1TO1E 3C7AA 2W6PA 2VDWB 3TZKA 1L3CA 4Q1DA 5I9BA 3SN6A 2W6JA 3D31A 3UC5A 4P93A 2WQ6A 3LWZA 1SKYB 2IU6A 3LC7O 3KR2A 1JQ3A 3A37A 1QZUA 4J3FA 1RYYA 4EHBA 2ZTMA 3O74A 2DPHA 2QSJA 1SG6A 2WAMA 4XAQA 4YAIA 1PCXA 1V7PC 4IHKA 3T41A 2IZ5A 4ZVUA 4AJJA 3DPIA 2Y4OA 4IXWA 5F3RA 1NONA 3V1LA 2YUIA 4YUZA 1VA4A 1GR0A 1SCUA 4HYTA 4G4SO 2GILA 5DNAA 1I7NA 3GH3A 3JZIA 3N8NA 4Q7KA 2AN3A 1NRWA 5HJEA 4UJ3A 1CY8A 4IILA 4MW2A 3OQPA 1E3EA 4WCFA 1WZ2A 2V8OA 3H8WA 4G2NA 3OO1A 1VJRA 5CVEA 1J07A 1JEQA 1VI2A 4Y9DA 4C29A 2OV3A 1XZHA 5F5NA 2O0KA 4C0JA 1ZONA 3RVKA 2VVTA 2IU4A 2ZUCA 2ZUWA 4NXNB 1FEZA 3H11B 4DDWA 4GX2A 5DISB 2HLNA 4J91A 3HWWA 2VHEA 4EEZA 5ITWA 1T8SA 1Z7YA 2QRVB 4A2CA 2RHTA 4N0PA 4NS4A 2VT6A 2V4ZA 4OLJA 3Q72A 3F2IA 1R0ZA 4ED9A 2IHUA 4X95A 4EAQA 3S29A 2C8JA 1LDNA 1WNFA 2CWWA 3H2ZA 3MFQA 3EVFA 2R6GA 2J07A 1VLHA 4LVUA 4YAFA 5CT4A 4C20A 1MH1A 4ESHA 3GDGA 1B15A 2OV4A 3IX7A 3USZA 4K0RA 4TOIA 3SX2A 3T6KA 4E5DA 3PUYA 1TJYA 4RY9A 5T3UA 2W2KB 1XP8A 1JDTA 4QA9A 2CFOA 1V3VA 3JVEA 1NM5A 3SDZA 2PEZA 1WLSA 4HNUA 3T1TA 2VG8A 4UD6A 4KE8A 3ICPA 3PC8A 5JYEA 3GELA 3KZ1E 3CTPA 1ZD3A 1P3Y1 1VSVA 2XTJA 5F2OA 1ANKA 5AUQA 4A0SA 2I4OA 4HGOA 3OVMA 3AL3A 2H8KA 2VDJA 4Q82A 1B26A 1VG8A 3OKAA 1Q0UA 1OX4A 5LB2A 3RHZA 2V7XA 4PXSA 1SVUA 2CFTA 3K9CA 4DQVA 3AO0B 4CL3A 3WQSB 4MRVA 1BWSA 1NAIA 1TEVA 4IMIB 1BCSA 1E1YA 1XRJA 4WZAB 3OJCA 3WLFA 3WLLA 5B1YA 3VDNB 1YXMA 2GCGA 1E9VA 1OXUA 4KZKA 4UUBA 4F91B 3LF2A 1E62A 2I6XA 2ODBA 4ECEA 1MB4A 4BY9E 4UNPA 3RUDA 1A9SA 2Z30A 1M2JA 1WU8A 4IUBS 3GWGA 3VPFA 3B1WA 1FNMA 4K3UA 1M8PA 1AGRA 5K8LA 2D00A 4ZO9A 4AMUA 2H7CA 1Z5OA 1Y37A 3QE4A 1RBZA 2M6SA 5DXFA 3ZS9A 3IUQA 2RI6A 3EDYA 3QUSA 2GEJA 2ZRBA 2IDJA 4CDRA 4I5FA 1C0LA 1RMYA 5BSHA 5IJXA 2ZZNA 1LSJA 2XUDA 3AR4A 4G0XA 4YMSA 5CBPA 1GCIA 3KT3A 1RKBA 3R9WA 4KNWA 2B34A 2R6CA 4I4TA 3INTA 1J2UA 2XBUA 4DNPA 3FTDA 1Z5UA 4M83A 4UZFA 1K5GA 1MEJA 3HHEA 3U9TA 3VOTA 4CN8A 3CO0S 4EHJA 3RG8A 3PEYA 2VBFA 3R5HA 1ULHA 3OLWA 2YIVX 3BFJA 3TW0A 3CLVA 3GRKA 1P4AA 4L22A 3OTQA 1YR9A 1G7TA 2ZSFA 3LXUX 3UZUA 2Y1FA 5K0FA 3OQ6A 4TRMA 3NWEA 3VZRA 4NQRA 2OGUA 5JJ5A 4UTZA 4WESA 5IAAA 4N03A 3RFVA 4UTNA 1R9JA 3UB3A 2FW9A 1FQJA 3R75A 1KOFA 1M75A 4ZTBA 4BKOA 2PUJA 1RLTA 3VNUA 1X14A 4FU0A 3P2JA 2GKOA 4V0RA 4YNBA 2CVOA 3NNDA 4C7OA 1NF3A 4PN3A 2HF8A 4KGZA 5U4QA 3ER9A 4ODIA 2ZRGA 1Y5LA 3ZY3A 3TN7A 3H2GA 4AMZA 1CZOA 1USUA 2QUIA 1D3AA 5D86A 5FTNA 2I55A 3ADOA 4M8NE 3ZC3A 1QU2A 4C14A 4JGGA 3HU5A 1BGVA 2GT1A 4OFWA 5A4DA 2HBYA 5DW3A 3TCXB 4F56A 3THYA 2HUNA 2W2QA 4TMTA 5CGQB 5B6JA 4NHOA 4I1PA 3W6ZA 1UANA 3C8HA 4KLAA 5JAUA 3F4LA 1OOEA 4MTCA 1GN8A 1ONNA 1CJUC 2QJWA 2EFGA 1JG3A 3GMTA 1GKLA 4Q7LA 3QVOA 4I9HA 521PA 3T0IA 4F21A 1QPGA 4FILA 4ZVNA 3ZHUA 3PXAA 3SD7A 3OCWA 2BCEA 1JIUA 1JLKA 2D4HA 2OC9A 4P0PB 1E64A 3HLYA 4ZJUA 3EVZA 1F9EA 2H5LA 4RD4A 1L6IA 3T3DA 3HL0A 3OFND 5I4KA 1G1AA 2AMVA 4ML3A 4S1WA 1BS1A 4W99A 2W6ZA 3VISA 4PAOA 3ICQB 1FNNA 2BBSA 3WYDA 2HMAA 1WZCA 3FTQA 3S28A 5JEEA 5K2OA 1SULA 3VI3B 2INGX 5I6DA 1BMTA 3AR6A 1OXSC 1G3UA 2JIBA 2JLSA 1PQPA 3LCJA 1IUNA 2IQIA 2Z04A 3A9UA 4QRHA 5K3SA 3VMFA 4BZWA 3O31A 4KRFA 3EG5A 3E84A 2CSXA 2ZRAA 3SKXA 2OZLB 4GWLA 3RVQA 1SHLA 4XUCA 4B7XA 1IBKB 3U16A 4WNIA 4OX9B 2DE0X 1YFZA 5LMZA 4DIDA 1N3LA 4HWPA 4ZVKA 3P45A 4TX1A 3EWSA 1KXZA 5JVDB 1FF9A 3F5DA 5JFOA 1W96A 3CMCO 4PPQA 3QVMA 2ALJA 1CF4A 3U1BA 3BMNA 1GGHA 1MJNA 3FUXA 1NR1A 1ZXXA 3HL4A 2XA9A 8LDHA 5HM6A 2VPXA 4J7XA 5TB5A 1HUQA 2XECA 4JOCA 4BLSA 2GGSA 2PA0A 5LVAA 5A5DA 2JKVA 2JGJA 5DASA 1GXSA 2O2GA 2I71A 2C2YA 2PJRA 3BE4A 3L1UA 1TAGA 3EG9A 3VZBA 4H0FA 1RYHA 5F21A 3FCAA 2DG2A 4DR6B 2QYHA 4LOJA 1EFRA 2B2XA 1P0MA 1OBVA 1O6GA 2C3PA 2IYOA 3JXEA 3OZVA 4IDGA 1XKXA 3ZE7A 1BJKA 3TZ6A 4TMXA 1ZW1A 4MAMA 1R4NA 3ADCA 1BAPA 2DPLA 4AUEA 3ID6C 1MBZA 3JPWA 3CURA 1X92A 1OY1A 4JLBA 2CUZA 3BX1A 3VPSA 4IDQA 2JFYA 1Q3KA 4OCZA 2GZHA 5FNVB 4D8VA 2Q3DA 3S1AB 4HCJA 3U4CA 4AROA 4BV8A 3FGZA 2K87A 2R96A 3RUPA 1QE0A 1RE0A 4L07A 4ENTA 3IXLA 3N0VA 5BQFA 5JCZA 1ECLA 3KFLA 1NWHA 2VP0A 4QDUA 4YJ2B 3ENZA 1XNQB 3IQXA 2GEKA 3DCIA 5F1KA 4Z2YA 2QLFA 4M9CA 5ALKA 4DC9A 1N75A 2O8NA 3MTEA 5ECGC 4RVUA 1UFVA 3BIOA 3H9BA 4ZRNA 1V1RA 2PLAA 3OFJA 1S4MA 4KLNA 5ABPA 3PC6A 1JJ7A 5JY1A 3M5WA 3SZGA 1AC5A 3D8TA 3OU7A 1J22A 3I9V1 4L5BA 3JATA 4HL6A 1VDMA 4XWOA 9LDBA 1ZHOA 4PPYA 5GZ6A 5C1OA 3CISA 2DFPA 2O52A 3KE9A 1I5RA 3NDPA 3TE7A 1J0DA 3QLVC 1MABB 3W5BA 4F45A 3BE5A 4U3JA 3RGGA 5LR6A 3ADBA 3KCNA 1VHQA 3BMQA 1APBA 3BXFA 3PFCA 1S2OA 5ARCA 1CFJA 1QDLB 5BY2A 1O7JA 2WVHA 1P72A 3PFHA 2ZRDA 2O3JA 3CH7A 2FQ1A 1IRIA 2XT6A 1SC4A 2HBRA 2OGTA 3FWYA 4DW8A 4KIGA 1R0BA 2BMJA 4F84A 3VJMA 3AVYA 5JE8A 3ZH9B 2HSWA 1XXHB 4KR3A 4NS1A 1TAHA 1Z4LA 3L8DA 2NU7A 1ZD2P 3ELUA 3H84A 1Z6ZA 1AZTA 2GYYA 121PA 2OGZA 2VDMB 4A8JA 2XD4A 1UFOA 1R3UA 3DXFA 1TLFA 1LI5A 2X9NA 1T9BA 2BJHA 1UC5B 4X20B 3OBIA 4TTPA 4F5WA 3SCZA 2IS6A 5HFJA 5HZHA 1ZDMA 1EVJA 3D7NA 2BM1A 2IYLD 3F3YA 2O20A 3G2PA 3GEDA 2NVOA 3O1JC 5C8YA 5KYVA 3QV1A 1NKVA 1D09A 4RA6A 1U4NA 3ZIUA 4N5NA 1B43A 1F2DA 2J5KA 5IN4A 4HKTA 4KN6A 1Z3CA 5B4UA 3FE2A 2P91A 1HDIA 2FPWA 3MNFA 2O57A 5AYVA 1MB0A 1C30A 1TJNA 3PK0A 3O8LA 4N39A 3PKIA 4M1QA 1JQ5A 4PTZA 2Q1WA 4RFVA 3U09A 1OLSB 1XTQA 3G9XA 3MBIA 4XSHA 4KU4A 4O8ZA 4DM3A 5BWBA 3KYJB 1HNWB 3E82A 4DR7B 1L5QA 3ER6A 3QLUA 1KK2A 2JH3A 1URPA 1W36C 2H2FA 5AOVA 4KUEA 3ACBA 3DD5A 4I50F 4B6JA 4BQOA 4TWZA 3GEEA 2WJIA 4I14A 3FZYA 4CR6A 2D1QA 1IXYA 4U0KA 1MIOB 1GILA 2GEUA 3ZVLA 1K2VN 1IHXA 2XF2A 3PYMA 1U9CA 2DBZA 1A4XA 3MSXA 3A36A 3OEHD 4L76A 4JP5A 5C3UA 3B5EA 5T8KC 4CV1A 1WX1A 2YBEA 1IXRC 2WD7A 3EQ6A 4WRRA 2H4ZA 3DEFA 1G3QA 1PYDA 1QHIA 3HXKA 1ZJ4A 4XJVA 3X1KA 5I7HA 5F2NA 4DLBA 1JG2A 5KYWA 1HR0B 5KNDH 1WULS 2IPOA 1CZRA 5DLQC 4PBTA 4FS8A 4XX1A 5DFAA 4ZV9A 1KZYC 2A3NA 2JGAA 2F64A 5IW8A 1RYDA 2PPLA 5LMNB 1VKHA 2W6MA 3QBVA 5EHIA 1GPDG 2N75A 1A9QA 3ASYA 3PGJA 2J3HA 4EDHA 4BVAA 3BXEA 2H0AA 1BX3A 1KSFX 2AV6A 2H2AA 3VR2D 2FTKE 4X41A 1PNRA 1ZVMA 4C4YA 3OPYI 1L5GB 4F4FA 1HLGA 3JSXA 3TOSA 4FTWA 2P1RA 2YXPX 1MJHA 3C2QA 1ZESA 4KH0A 4CN9A 5FH9A 3JVDA 2O8CB 2QYOA 2NUTB 2HM7A 4DWWA 2EF1A 3AUAA 4ZXFA 3C7KA 3WLSA 3KE8A 2J3IA 2VZEA 5CNMA 1TOAA 3MTGA 1GRCA 1JDVA 1BD4A 3OC0A 3GLIE 1G20E 4ZOLB 4MPTA 2BH9A 2IS1A 3QFFA 1VE3A 4A91A 2FSPA 1GZ4A 4G36A 3QF7A 1TDJA 3W8EA 2JZCA 3ZV5A 4BGDA 4D9HA 2YJNA 3M3HA 3Q3JB 4PC6A 2MTBA 4GRAA 4B83A 4BP9A 1YZLA 1AMOA 3W5HA 2OFPA 1G291 4LXYA 3ND7A 5J63A 1B0AA 1TYBE 2NO6A 3CEPB 1HORA 5CT9A 5LP6A 1ST3A 1TL7C 5TEWA 4D4HA 4KWTA 4BO5A 1FXUA 3UCEA 2ZANA 3VOBA 1UXKA 4RDIA 4QHSA 3WIVA 4DR4B 2E5FA 1YBAA 3X1WA 2CK3D 1AF4A 3LPMA 3R6DA 4EEKA 1IATA 2CLSA 3FBWA 1F6DA 2Q8PA 3U13A 2HHJA 1FTQA 1NRJB 3GVXA 2IYQA 3W1WA 1VJ5A 2FSIA 5JI2E 4KPYA 5CXSA 2V9ZA 1OI4A 4RQUA 4UPVA 2P9YA 3OOHA 1T6XA 1T5SA 3V4RA 2DPMA 5J2UF 3DZCA 4HAUA 5CLHA 3F1LA 3KKOA 1W85B 1EQAA 2AEEA 3VVLA 2XQVA 4B4WA 1QYWA 3TUIC 4D3XA 4DAOA 4WBNA 5C1PA 4CJXA 3I45A 3BXZA 4ZOBA 5IDYA 1SUPA 3LDFA 2LKDA 4A92A 2V98A 3FGOA 5HUHA 1U7UA 5BNZA 4I55B 5KNDA 4RSRA 3IRUA 4NEQA 5ED0A 3B7PA 5GP1A 4PONA 2VNJA 4JJIA 4WNCA 1ECPA 2RHBA 4LJ7A 5C2JB 3PI6A 1ZIDA 3IDOA 2FRDA 2HSEA 4K6MA 1D0IA 2ODWA 4L51A 4CIVA 3GGCA 1RCTE 3W3AD 3I58A 3ZH2A 4Z6KA 3DVAB 3OCVA 3D3EA 4A26A 5E2BA 2QUKA 4ZAZA 1XRLA 4ID9A 1JUDA 4AXXA 4C3VA 1YZQA 2Y0BA 3U4QB 4GP9A 4ACBA 4EJSA 3A9VA 3QH4A 2Q5EA 3QOFA 5F12A 3U7FB 2B1RA 2HMTA 2ODPA 2UZ1A 4YCLA 4X1KB 2R6R1 3AXSA 1T2DA 3BK2A 5GGYA 2X3UA 3T38A 4DQKA 3RBAA 3N6RA 1JIXA 1Q21A 1A7KA 1ZS9A 2Y8EA 3UBTA 1AJEA 5EZYB 5D3MA 5B3AA 2IU0A 4EW1A 4X9XA 2HQRA 2NO5A 1N6PA 1ZK1A 1E4EB 1YC2A 3HI4A 3QVSA 1YQDA 3ZZ1A 3DHWC 5TV2A 4C4ZA 4R0VA 1O3YA 1TCAA 5E7IA 2OENG 3E7PA 2X8JB 3S68A 3THXA 3V1UA 2C0PA 3PNLA 9LDTA 2IGTA 2YZMA 1TZCA 3WMRA 3BICA 3RAFC 4MRRA 1P5ZB 4AG5A 2Q5JA 2OLJA 4Q05A 3TLBA 2QX4A 4BXOA 1R12A 3QOWA 2IP2A 3LIPA 4MB0A 5LU9A 2OCPA 2VT2A 3T9BA 2J45A 2GBLC 4V24A 4DADA 3OQJA 2HYIC 3OCXA 3HMKA 4PY2A 1KO8A 4M1ZA 5F7XA 3ZWPA 3BIFA 4W6QA 2VAPA 3QBJA 4PYQA 3B6KA 4X5OA 1TYEB 2YTZA 2ZI5A 5J1SB 2A5JA 3EIQA 1MOPA 4LMPA 5CIQA 3TM4A 4D8WA 2Y0EA 5L95A 3M4NA 1YDEA 4LRTB 5FV4A 3JQBA 4GT1A 1FTGA 1TC1A 1SK8A 2GMWA 2NZXA 3FPBA 4KLCA 2ZYSA 4RM2A 3FDJA 4UNRA 4FJ0A 1K5DA 3KOMA 5BN3B 4MWSA 3IAEA 3CX7A 4CLRA 5ELMA 3MT9A 3DOEA 5D5HA 4AJPA 1KAHA 2P6PA 4B32A 4BLWA 5ALPA 2J59A 1INLA 1NP6A 4RXUA 3U3KA 3V2UA 1XZ8A 3Q5DA 4MS1B 3CR7A 3O26A 4Y6GB 3HXLA 2QMUA 1TLLA 1XTZA 1QQ7A 2C1EA 2JGDB 2PZJA 3L0SA 1UJ4A 1XELA 3VTFA 4JL5A 4I1IA 2QG4A 2V5AA 3GDWA 1RPTA 1U5BB 3LKVA 3M81A 1AQNA 4A36A 3DS8A 4JP2A 1N2EA 4MR8A 5IEBA 3B5IA 5K2MA 5T5QA 4QWWA 4L7VA 5MGBA 3QMVA 4RD3A 4ESEA 5F3WB 3PT9A 1ESDA 2PYIA 3FNQA 4H0NA 3GJ8A 3T3IA 4TZ6A 4ZAWA 4AT1A 1Y0BA 2BDEA 4XVHA 3ITKA 5I4CA 3X2FA 1HTTA 2QW1A 3NT4A 1KEVA 3MS7A 1HQKA 4PLHA 5ULLA 1OD6A 3BREA 1G7SA 2IS4A 2BZ0A 2H31A 1S02A 2AG0A 1X39A 3U7EB 3RS9A 1QG6A 3LSYA 4GOOD 4TTIA 3V1MA 4GHWA 3PGVA 4R2KA 4ZP1A 3UGKA 1QTRA 3VO1A 1WF3A 1ZUD1 4G4IA 4UATA 4ETWA 3O3NB 5J1TB 1DG3A 3AV3A 3VA7A 1TYDE 4ZO8A 3M1IA 1U65A 4O4HF 1THTA 3DDCA 6CHYA 1S3IA 2HWWA 1BO6A 1JSLA 3DQQA 1S2LA 4A27A 3ZU3A 4ENQA 4KJZA 3E7WA 4GUAA 4N1AA 4RENA 1V4BA 2J48A 3F5QA 4KXNA 4MA0A 5FT9A 3OPQA 1O95A 1D2MA 2R62A 1DRKA 4WOBA 2ODAA 2I91A 1L5OA 3O9VA 3PQ4A 4IBOA 1N2BA 2EG5A 1RJFA 3H1PA 4Z8XA 3SXPA 3N7UA 4B3BA 5CCEA 1AA6A 1WUKS 2HK7A 3U44A 4RM3A 1ZU5A 3N8GA 4RKRA 3O0DA 5DYIA 4ZT3A 1NMEA 1ZKDA 1RXUA 1E2PA 2ARKA 2I99A 3ETNA 4FMPA 3PA8A 1AZWA 4RPLA 1N6HA 1V48A 3BGOS 3OJXA 5C4MA 4N7MA 3UHPA 5HM8A 5E9WA 4BFYA 2I29A 3Q5GA 1C8VB 1KMMA 3SDBA 1GA1A 2P27A 1PT7A 2AQKA 3L79A 4MW1A 3REFA 3DP9A 4XWWA 4YT4A 2QX6A 3M3PA 1I8TA 1Z2AA 4GPZA 3FCSB 4RV4A 2ZTSA 4J76A 4NCKA 4WZBA 1RXIA 3MF4A 2FSGA 1F38A 3TPCA 4OQFA 3ZD8A 3DBLB 1Y7HA 5D3ZA 4Q3DA 2FN7A 1DV2A 4CEHB 3ZHCA 2J5RA 4IOLA 3AF4A 5EJIA 2GQ0A 2VRNA 3ADKA 2E4XA 2QKYA 4AJNA 5BMVA 1JXOA 4QGHA 3T3MB 4AP5A 3T5TA 2HT1A 2XXAA 2W71A 1B8PA 1U02A 1YB7A 2OD2A 3ZD7A 3HFRA 5BR7A 2TYSB 4KQKA 2EL7A 3AR8A 3HRIA 5KOJB 1FYXA 3NHJA 3COYA 3GJQA 3OF2A 5EVCA 3ES9A 2QMOA 3OEED 4GICA 4CI9A 1C3OB 1ZMBA 4EOGA 2EX4A 5J58A 4BU0A 3W5CA 2HFJA 1E58A 2FGKA 3IKLA 2CL7X 5DWDA 2YDYA 1Y4DE 1CWUA 4KITB 3BDVA 4HDRB 1XE3A 4RF4A 1KARA 4MCIA 1DFHA 1I32A 4R3NA 3UAGA 4EKGA 1YL7A 1X80B 5BW5A 1Y6QA 2HA5A 2ZYHA 5FPPA 1U7ZA 1WZUA 2NW6A 1J9GA 1VMDA 1HL7A 4NULA 1RPJA 4P3YA 4WBXC 4MR9A 1QWOA 3OKPA 5BT9A 1V39A 4UBOA 2HJHA 2WT4A 4URYR 3MJFA 5E6RA 3WGGA 4KWCA 3GUUA 2QD1A 4YRTA 5GOZA 1PX2A 2GPBA 2J6BA 3AYZB 5BSUA 2NSDA 1XT6A 1H8HD 1SOVA 4LRSB 1PIWA 2WZDA 4FSDA 3V9PA 2HDWA 1G8JA 2GUWA 4RA9A 1GL6A 3S81A 1AN0A 1EDOA 4MUHA 1W5AA 2W93A 3DEYX 1KEEB 5KX5B 4CM8B 1M8JA 2QUZA 1U8UA 2PGXA 2B3DA 3RRYA 5TE9A 4KFTA 4ZWNA 4BVGA 4BIMA 1L5HB 1SQ5A 4A5OA 4FN5A 1LH0A 3V6MA 1X94A 2A0FA 2Y27A 3HB1A 4FZJA 4LPKA 2PUTA 4TLLB 3THOA 5IJ0A 5KUTA 1R0KA 3ENWA 4IKOA 1VJCA 3WA7A 4X64B 5KTMA 1PNVA 4YVFA 2YKGA 1EX9A 3ESAA 4Y8VA 4V02A 4NAHA 4IIJF 2Z6AA 1W0CA 1FY2A 3PJGA 1W1WA 1C4KA 2PU7A 3CKLA 3LUJA 3T5GA 3C4QA 4YPFA 3UK1A 5J5AA 3KLPX 3WTBA 1QGED 5IT4A 1K9SA 2YVQA 3H6GA 3Q8LA 1D0VA 2IW1A 3QWBA 4HRYA 5FWAA 3ZXSA 4LGMA 3KLMX 1Z4QA 5GGXA 2NGRA 4KPUA 4AU1A 4F3TA 1CZHA 1L8OA 1MO4A 1XTVA 3UHFA 3FNIA 4L8WB 3UGTA 5JO0A 1YK0A 4MINA 2D0PB 3ZE6A 4TQGA 4TS3A 1KDPA 1Y48E 3UT0A 2HQOA 3AHEA 3EUAA 3FGNA 3OM1A 4MWGA 4B3SB 3IEPA 2OKCA 4V03A 4GMHA 1HEYA 3RWMB 4WE3A 3RFCA 2POQX 4UHDA 2FEOA 4W7IA 1HTWA 4N9WA 5EL0A 4AY5A 2AZ4A 2YYAA 3CLHA 3CX4A 4OG2A 4CM7A 1JA9A 5JMWA 3UMFA 2FDCA 1IFXA 1R8SA 3LLMA 3QVGB 1E3SA 1T4GA 1MF7A 4Q1VA 2R1VB 2OXEA 4O4IB 3NOXA 4BKPA 1UBEA 1LTQA 2ZYAA 3QKSB 4B74A 3MT0A 4CMEA 1I3CA 4KVGA 1IEWA 2DY0A 1YQEA 2VCHA 1EFUA 3GVHA 2PLWA 3ROQA 4R69A 4C9BA 1AA9A 3T1YB 5FAKA 4M60A 5E6UA 3X2SA 2NO1A 3IUMA 2C29D 3EZLA 3NTOA 2NNWB 4L6CA 1HOTA 1L7RA 3IIKA 2C99A 4HY3A 3KOUA 3PHBE 5IXSA 3L6DA 2FPKA 2LR0A 4UPDA 1DP4A 1UEIA 2NTEA 3F7TA 1H93A 1MV5A 1C3JA 1R3DA 2WOOA 1WMEA 3EGXA 1FPMA 3C0KA 3FMGA 3NEYA 5IDWA 4CEIB 2YY5A 3SYKA 2Q1YA 1SY7A 1T2CA 4Z9AA 2IFTA 4YLEA 1T25A 4JOBA 1XDZA 1NE2A 1ESEA 5FL7A 1ZGCA 3GJZA 2OB1A 4DNQA 1L7DA 1MX5A 2O06A 2CLOB 4FFBB 3CX3A 4OP2A 2QLMA 4CG1A 5DN6D 5DNCA 3ZY4A 3DJFA 3IDAA 4MVXA 4NJMA 5TVKA 1TT7A 2J0QA 4CCWA 2DBYA 1J0BA 3IPAA 2DQSA 3ZHOA 1KSJA 5G3ZA 4N6NA 1VPVA 2WVJA 1QFJA 1RYMA 2WTAA 3UH0A 3FOEC 2DETA 1QCDA 1P7WA 4YAJA 5HKKA 3TOCA 3I01M 1A9RA 3EB9A 1LBEA 2R6JA 1DQZA 5JH7B 1XMVA 4MQ4A 1U99A 2B8WA 3TAHA 3IQWA 1RMTA 3WV5A 2IHBA 1X0VA 1NBWB 4FWTA 3OZEA 2JARA 4LRUA 1ZZEA 2QXYA 4CG3A 3PPIA 5HF9A 2WG1A 2H92A 4P33A 2CJWA 1E5LA 3LHSA 3SICE 3CVVA 4HWGA 4CTMA 1OLXB 1KETA 4JU8A 1BJTA 3FPKA 5B37A 2PTGA 2R5NA 3RT9A 2V1UA 3OZXA 1P1HA 1W8DA 2OHGA 1LW6E 1UWKA 4I8IA 5CXQA 5AVSA 1W34A 2YOFA 4WI1A 4PG4A 3G8DA 3GNTA 4TKZA 3PFGA 1G66A 4UBKA 2R00A 4DABA 3FKJA 3QX7A 2PD4A 5CLQA 4OO3A 4RHYA 3H16A 1LF0A 1WZIA 1TVCA 3D0OA 3TLAA 1UWCA 2V7TA 1A27A 3K09C 4XQ9A 5SYAA 3T99A 3WRXA 2AFIE 1VE7A 1YJQA 3B60A 2ZE8A 3MHPA 1JR3D 4RVHA 4XRRA 1RHMA 1CS4C 2XGSA 1QVZA 3GGDA 3VAZA 1FYFA 4MYUA 4RF3A 1DQNA 1QQ6A 2NAPA 1WMDA 2VLBA 1T8WA 2XQGA 4TWJA 1R6AA 1WZEA 1H5UA 4HQOA 2BFDB 3BRWA 2R6AA 5H8WA 2Z0MA 3NKVA 4PLPA 3NOVA 4CE6A 2GKSA 1WHTA 1E63A 2F00A 2ZT5A 4OMDA 4M9XA 4CWAA 1YCHA 2XW6A 3DEJA 3SS9X 2FPIB 4B6PA 3E23A 1USKA 2XDQB 3VDRA 3FRJA 1R0XA 5IAJA 4AF6A 4EY5A 4E5NA 2FW7A 1U9ZA 3E9QA 3PTZA 4TKVB 2XCUA 4DDMA 1R8XA 1QV6A 2ENUA 2ONKA 3BHMA 3ZVNA 5B1HA 4C7BA 5C7IO 3OIGA 2GBPA 4A10A 3NM5A 1KK0A 1BN7A 1Q7TA 2A0YA 2I3GA 1QUFA 2JRCA 4MUAA 1Q7GA 4PZ9A 4YCSA 3OG9A 4DKJA 3KXLA 2ICAA 4GP7A 3ELYA 1NLZA 1NBMA 2R6FA 2JBHA 2VT7A 3W90A 3SAJA 5SY6A 2A9PA 3I6QA 3QLEA 4PAMA 2H1IA 1IEXA 4MKZA 4UCFA 4EFLA 2WJJA 3GH1A 2ZI6A 4JBWA 3QVTA 3S27A 4BVKA 5BUQA 2ZTVA 2X0RA 2PWAA 3RIMA 5KTTA 1W49A 2IVFA 3CEMA 3PFBA 3R0VA 5CM2Z 1K8RA 4N0MA 3RC1A 1Y1KE 3JR7A 3R7WA 5CDUA 3S8EA 5B7NA 1NQVA 4WKBA 1GLNA 2BFBB 2GD2A 4G5SA 4CIDA 3WGLA 1ZCZA 2TSYB 3G0BA 5LYJA 2ONCA 3BB3A 4RQTA 3RVMA 1SUWA 4KL8S 2CE7A 2EV9A 2D0OB 4IJUA 5ALNA 5AVJA 3NKLA 3PZRA 1ID1A 1Z4PX 2Q1SA 4K05A 1L8LA 3CMMA 2FR1A 4AZSA 1UQTA 2GK6A 3NHPA 3BWXA 4MVJE 1KK3A 4KOEC 5HDQA 3KAPA 2GHRA 1ISSA 4PQYA 3I53A 5IT0A 4WT7A 3O1HB 4XVRA 2YJZA 2ZRMA 4QICA 3W5VA 1PGQA 2FFBA 4F46A 2A1TR 2EZUA 4YRZA 3EZXA 5AW0A 2J3DA 4RE6A 5HPYB 3F6YA 2QP3A 4DE5A 4D79A 4F3YA 5KOHB 1TJ5A 2VRCA 1FSFA 2X9QA 3D2LA 4QXQA 1KPIA 4DA8A 1GZDA 4U8GA 4D26A 3K70B 1XMPA 2OFWA 1P3JA 3KKQA 1UMCA 2HWKA 3NHKA 2QROA 3UXYA 4BO0A 2PQ2A 4J8PA 3RD5A 1X7XB 2I2FA 4GKBA 4Y2HA 4A8TA 3G5MA 1Z2CA 4DOMA 3OSUA 1C9MA 3HPQA 5GY7A 1V47A 2R1TA 4HX9A 5I01A 2JCXA 2H1VA 2PKQP 1U3FA 1ZO8A 3PC7A 2JIPA 3QU5A 3SIPA 3UJHA 4DCTA 3U62A 4YV0A 4JYBA 4P81A 3C7TA 4G0WA 1UWLA 1MV8A 1LS1A 1H2RS 2QTVB 4DA6A 1XALA 2P6UA 1RHRA 4FYVA 3AQIA 4ALNA 4AAYA 4HP8A 2XUHA 1QXSA 5DHTA 3IT0A 5AIAA 4JVMA 1S2GA 3LGSA 2H3EA 1BU8A 1DEAA 4KI7A 5AVTA 3R23A 1LDYA 1TU4A 4G8JA 3HQ4O 4RIGA 2JAWA 5CB4A 3EVEA 4CMJA 4ZYZA 4YPVA 1NNEA 2QPAA 4YN3A 5CU7A 2HSDA 1Y9JA 3H8SA 3QVUA 4XDHA 3DF7A 4ZVRA 4JIMA 3ILYA 3BTSA 4PEVA 4TL7A 4JLOA 3SXJA 1K6XA 1OFUX 4RHEA 3WDMA 1OFUA 3UM9A 2P6NA 4OMUA 3BH7A 5A9SB 3JQ6A 3VPDA 2PLNA 1AX9A 4MW5A 4PWYA 5F7OA 4L8GA 1SHTX 4JLDA 4QU0A 3ZBUA 3F47A 1RZRA 2NXNA 5A3VA 1T0UA 3NVDA 3U4IA 2PS9A 2O2EA 4C0LA 2YN2A 4LRQA 2R87A 2EZ9A 3LPNA 3L84A 5DHQA 1NVDA 2DHRA 3H2YA 1K8XB 3GFOA 4IX1A 4FR5A 2R47A 1V2HE 1ACJA 1T3SA 4NVRA 4OI2A 3WHLA 1NX9A 1L3IA 3KALA 4PF1A 4A3SA 3OLQA 1GHTA 2ISSD 1JVNA 1Z4OA 5EZ5A 1T5OA 5CA1F 3AF5A 4CMAA 2GEDA 2VR1A 1LC3A 1FXWA 1ZOIA 1KI7A 2OMKA 3A58B 3O94A 5DH9A 4B6FA 3P52A 4GXTA 4QEKA 3G1UA 5AKKA 4UOZA 2PZGA 3KDSE 2XE4A 2AF3C 2QMYA 4RMGA 3UQYS 1Z63A 4XFDA 1Q1GA 3K9HA 1X1CA 3PYLA 4G1VA 3FVTA 3IV7A 4OHPA 2NYUA 3M4YA 3V97A 4C1BA 4AJIA 2PVCA 3R3WA 2F2TA 2FP4B 5AW4A 1QK3A 3G68A 1J8YF 1M8FA 1YA8A 1YR3A 1WB6A 4UEKA 4ALKA 4BQFA 4JZKA 4OI0A 1H22A 4PS1A 1OLUA 3KPJA 3M6MD 1Z36A 4W5TA 1CJTC 1EWRA 2I62A 4TLBA 2Z56A 3B53X 3QF4B 3RVBA 4GC5A 1DL5A 3HDQA 1YUMA 2IIPA 2YZNA 1SM4A 3ZUPA 3ISJA 2IIBA 1FVFA 3AESA 4GPEA 5MN4A 5JD5A 1ZK0A 2WKPA 1Y98A 2G71A 2X40A 2ZIVB 4AKGA 5D3KA 2C5FA 2SBTA 3FKSD 1V26A 4HD8A 1U0OC 2WUFA 4J1TA 3AU9A 2AZMA 3COPA 2WWXA 3NDBB 2DCMA 1S3GA 3V1KA 5KU7A 2HAEA 1TFUA 1CD5A 2CFRA 1IWOA 3CCCA 3MMZA 4G3XA 3A25A 3LYLA 4IXTA 1MAHA 2Q07A 4MVJG 1IVSA 1M34A 3KUDA 3P9PA 1XZEA 3I5XA 4RAOA 1KPGA 1HFEL 3DKKA 1XEXB 1YRHA 3BCUA 3LUBA 4D3SA 3ONNA 4E88A 5HFNA 1UBUS 2HBQA 1I5OA 2RGNA 1DQPA 1IHDA 5EE1A 1JIJA 4ZCSA 5J4YA 4LN1A 3F7MA 1HDRA 1QTIA 1G21A 1QTNA 2C77A 2J3EA 2VH5R 3C87A 4QAQA 5LDGA 4G26A 2OM6A 2I34A 2FFAA 2IYWA 3MRSA 5HJ2A 4TS4A 1EU1A 3KCQA 3A9SA 1PGPA 2ACVA 3DMYA 1E5VA 1MTZA 4E12A 1G16A 3TIIA 2AE1A 1N3IA 2AWNA 2H16A 2B36A 1OXMA 5DX1A 2XT9A 4K8OA 1M1YB 5DSTA 2CXRA 4MVJF 2JAPA 3QLTA 3UMCA 5IVHA 2XCQA 1CJMA 4PSAA 2WSIA 1COWD 3HWSA 4AXBA 3DT6A 2ZKIA 1KEZA 5T6BA 4BTLA 4HQNA 3O8QB 4EGQA 2WY2D 1JEYB 4GVLA 1HYEA 2ACWA 4QODA 4GXQA 4DDKA 3U3OA 3UPTA 4Q4HB 4LHVA 3EAGA 3CRZA 4CODB 3GLGB 4ZIRA 3GJRA 2JD0A 2XEXA 3ANXA 3KQKA 4M1MA 5K4GA 1CIPA 4Q1CA 1YIDA 5HCUA 4FNGA 2DWOA 4KXVA 4KQ1A 1K0UA 3W6OA 1RWQA 4R9UC 4C3UA 1UC4B 4D7AA 2OO5A 5IDXA 3MSCA 3M49A 5E1BA 3GT0A 1P5FA 1LX6A 4OHKA 1RRFA 2CB9A 2PUDA 4Y2UA 5CH8A 3TIGA 3W9YA 2XMQA 2VXBA 5JXIA 1N4AA 3E5HA 1C4OA 3N8KA 1AHNA 4J7AA 1M2HA 3UJ9A 3L07A 4N3BA 1OFHA 2EJCA 4RCYA 4JVNA 1E79D 4DANA 4D99A 3OE7A 5K45A 2YW9A 1X8XA 5EMJA 1P62B 4DCGA 5K4AA 1PW7A 1QNLA 4TTAA 1EINA 2JEOA 2O2CA 3AONB 3FYUA 2H6EA 1BIFA 2G06A 3NP7A 1Y4UA 1PU2A 3IULA 2ZBGA 2FK8A 3RT7A 4ZK2A 4PO9A 1ULZA 3DVSX 1FDTA 2AJLI 3RRMA 4CF3A 3I2FA 1CZUA 4ZQFA 2X0IA 1E5TA 2JBAB 4PZ0A 4BX3A 3IUPA 4IGAA 4WLVA 3I9JA 3EJWA 2A9RA 2B7CA 2BEUB 4B71A 5JPCA 1S96A 4YREA 2ONYA 1DU4A 4KDRA 3TOVA 1EP3B 1GTL1 2BKLA 4KIUA 4PC2A 1SCKA 4GOMD 3WVNA 5L4SA 2GEFA 3WP0A 1ORDA 3F73A 5DM70 2RONA 5LQAA 1JLSA 4G9EA 3LT0A 5FWNA 4M0MA 1L8XA 2FPOA 4GLJA 1D6JA 3WHKA 4NCNA 5A2QA 1Y5IA 3PKJA 3VPAA 2C4KA 1JBQA 5HVNA 1QS0B 5EHXA 2R5WA 3PD0A 1N5JA 3OHSX 4TUYB 4TXHA 3B89A 1TKBA 1R5BA 1WPRA 2QV0A 1ZRSA 4BO6A 4ND4A 4YXWD 2O8BA 1V5EA 3PEUA 1P1JA 2A5DA 4N49A 4WMLA 4KACA 2QE7A 3HJNA 4RCVA 1SOMA 1T5DX 2RH5A 4A6PA 5A4JA 4O4LA 2QL9A 2ANCA 2P65A 2UVPA 3UTCA 3RS5A 5ITSA 1KZGB 4IIGA 3FHJA 1L5LA 1DRVA 1JPVA 4C2AA 4PAQA 4DV0B 4I9NA 3A6PC 1VJGA 3WGKA 3B9RA 1PS0A 3J80A 6GPBA 1W48A 3GDHA 3TLEA 4AS3A 1HDOA 1KL7A 2R25B 3NHLA 4RQAA 4B4VA 1R37A 4MGEA 2JIOA 4V0NA 4AY3A 2OQVA 3V8PA 3BAZA 1ZHFA 3TZBA 1WTCA 4BBJA 1NR7A 4UC0A 1NKSA 1A7JA 1BX1A 4Z54A 1KZ7B 4IMRA 3MGCA 4P53A 5E7MA 2C2HA 3GEGA 2X58A 1QJCA 4C6RA 3N2EA 1P1IA 3CFYA 5D51S 5ADHA 1YTLA 3RUHA 3Q2OA 2DYKA 2JFZA 2VSYA 5JW6A 1Y8CA 1QYCA 3KUCA 5NLLA 4L6IA 4FBMA 3SLGA 4HUQA 5ITZA 3QFCA 2LWIA 1GPNA 4E6PA 1QGZA 1U3GA 3T5MA 1D6NA 1HZZC 2DY1A 4UVEA 3ITDA 3IE1A 5IBPA 5HXAA 1SCDA 4JIGA 4DIKA 1QHNA 4RHUA 2Y1EA 4KO1S 2VP4A 5DHAA 3OZ7A 5A4MS 1QYDA 2EBUA 1CP3A 1UAYA 3P9YA 4DYVA 1OTYA 2F43A 1LBTA 2GO7A 4UNQA 2C03A 1T6YA 1CCWA 1Z68A 2XKKA 1VL1A 5KKNB 2MYPA 3ANNA 3W5SA 3ZZUA 4RXTA 1GDTA 3FTEA 1K66A 4JD5A 3PUXA 2WU8A 5AHXA 5DHFA 2VCYA 2BMDA 3LMKA 3FBGA 4MPPA 4OHUA 1PJ8A 3T4EA 5JC8A 3BGSA 3P2YA 5J2UB 1G8KA 2YXDA 3ZU6A 3GO4A 2Q3BA 2VDOB 2X22A 4A8HA 1EM8A 2OT3B 1X6VA 1F4PA 1TAQA 4F7WA 3UJPA 4J43A 1N5OX 3ONVA 1UKYA 3AH8A 3OZIA 1K7CA 1ENYA 4QGBA 1II8A 3DTYA 3NHZA 1IK4A 2J46A 3RC9A 6LDHA 3BIXA 2HJ9A 1YJ8A 4PPNA 4R8SA 2HW8A 3NORA 1NW3A 1ETUA 4UAGA 1JGTA 1C7ZA 3X1YA 1XGKA 4X85A 3RVRA 3P71T 3TPFA 2BBTA 2PEYA 1U1IA 1X87A 3IEIA 1FRQA 1YHYA 2NO0A 4CR7A 3OJWA 5FLEX 3T7DA 5AW3A 4MV3A 2F7SA 4R5HA 3VUEA 2QVGA 1PQ4A 2MINB 2Y1WA 3K0KA 5DLEA 2FOIA 2HMUA 3X1MA 4HRVA 2DUJA 3FRHA 5KMGA 4G4SP 4H77A 3GFSA 3I2KA 1BG6A 4TROA 2YXLA 2IELA 3CINA 4JKYA 1QYRA 2XMPA 5G4KB 1A97A 3IL2A 421PA 4MQEA 2C9DA 5J2TF 4ZI7F 3YASA 1NUQA 1Q15A 3GQVA 2ZJBA 1REQB 4D56A 1LJLA 3S2UA 3BHNA 3HKEA 4KHZA 3ZHSA 1U94A 1DBRA 4YONB 3T7EA 5COAA 2R85A 5HOEA 3C1AA 2Z98A 1FA9A 1B41A 1JXQA 2MR6A 1JP7A 1DTEA 3KP1A 3R8CA 2FFQA 3RRNA 1ZM9A 2IPMA 2BJVA 5JNLA 2G9RA 4HAYA 2BDTA 2VBCA 5JG7A 4AMGA 4EGCB 1PJRA 1IJEA 1ZBQA 2BLNA 4H7PA 1DLJA 4DDVA 1B8UA 1N2CA 4WJZA 3ZE1B 2BP7B 3U7HB 1FE8A 3IB3A 4S0XA 1ZH6A 3CSUA 4G5YA 4TN1A 5D6NA 2ZYUX 1KF0A 3E9YA 3K1ZA 1KI4A 2TMKA 2YHBA 3VAAA 4D3DA 1AV6A 2ACEA 2N42A 2VK2A 3OX2A 4FCTA 1RKUA 3BGIA 3VR5A 3B70A 5FRDA 3UAOA 2I2AA 5FJIA 3QJ5A 5JLJA 4II3A 2Y0PA 1O97C 3DKPA 1P0QA 4HQRA 5TPWB 5F52A 4DTCA 5K5EA 2Q0QA 3VKUA 4GOJA 1CY2A 3BRCA 4HBGA 1PZMA 3ORSA 5FTMA 1MO6A 1TIBA 1Z2DA 5DYGA 4FQ5A 3G9QA 4JYPA 2WFLB 3SHOA 4PX2A 1Z0FA 1F12A 1LQUA 1FL9A 2CD7A 2PT5A 3MWJA 1O96B 4RGVA 1J42A 2X6TA 4ZYLA 1V16A 2ZSKA 3L8HA 4KPFC 1LLDA 2CFSA 1O6FA 2J3LA 2Q5HA 3AIOA 4Y2SA 2ZEJA 1T9AA 5T4EA 5JAPA 2P6RA 2BI7A 2OQRA 4RJ2A 3GFPA 2NP6A 1N6LA 2FCRA 13PKA 1IMJA 1ZC4A 2WP8J 4UCXA 1A77A 3AF2A 3BZWA 4K6GA 4UHHA 3FFTA 1G8SA 2HGSA 4B8YA 1ZI9A 3AUSA 2JHPA 4UEJA 3ZK7A 1PJLA 3QTBA 4W5JA 5EP2A 3DXXA 4R8KA 4HZGA 1USWA 5IKPA 3BT7A 2V5UA 3MUNA 1G5PA 2AFHE 1P3DA 4DDTA 3EIEA 3KYDB 4U2EA 3PU6A 1NZFA 2IZ0A 4HHEA 1G60A 1CEQA 1GEEA 2DHDA 3FLEA 3NG1A 3QYFA 4GRIA 3L1IA 4KV9A 4QUGA 4B0OA 5L40A 1I2AA 3LFHA 4KX3A 2PGJA 4L7QA 4KXUA 4FYMA 4D44A 2YY6A 3OZDA 4HZUB 4RY2A 3VYRB 3U48A 3GLIB 1PK7A 1V8OA 5DI3A 2G8NA 4OA8A 4URWR 3PVZA 4DXHA 4BYMA 3T5AA 3VOAA 3IE0A 2VJQA 2ZB4A 1DAFA 4EPYA 2AB0A 4G8CA 2XODA 1TK2A 2JH8A 3AUFA 5DHRA 5AM0A 3QXJA 5KOIA 4I9GA 4G65A 4NK4A 2IXBA 4W7SA 1G38A 1CQPA 5H3HA 1W0KD 1BMFA 2WVGA 4LMRA 4CCYA 5A5EA 1I0IA 5LJLA 2FWAA 1UK6A 3AEXA 3GVPA 1K4YA 1JDUA 2XUGA 1GDHA 2GPJA 4JYCA 1J8DA 2M2IA 2WF7A 4C6TB 1XB2A 4HDOB 3SSAA 4BJ5A 2FB9A 4F96A 4DSNA 1YJAA 2C5BA 4RZIA 3MBOA 4Y7CA 1Q2XA 3IQZA 3ZHXA 4PX9A 4M0UA 2HR1A 3ECAA 3L7NA 3LW8A 3KZNA 4M9ZA 3SF8B 4G5QA 1ZRMA 5G2OA 4OHFA 1ONBA 1VB3A 2FRXA 2LGJA 3INGA 1D1SA 1W30A 5I8PA 3BMCA 2ECKA 4DG9A 1E77A 1USVA 3U80A 1ILEA 1VYHA 1TT5B 3PCXA 2NG1A 4KSYA 4XRGA 4H16A 4PLTA 4RKFA 1JKJA 5A5GA 3E58A 3DAFA 4GMXA 4G9GA 1OZHA 5D5PA 5DI9A 2QAGB 3QWFA 5HILA 4B5KA 2QENA 2ZB7A 4BMPB 1UUFA 2F1OA 2YWRA 1QU3A 3W1EA 1I51A 1E2BA 2GNPA 3IVCA 1EFKA 2P8JA 4EGFA 1MEEA 1P4HA 3R5JA 1N9GB 2ZR0A 4M7OA 4YHHB 5EKTA 4F93B 2AYXA 2J9FB 4M9RA 4QUDA 1P9OA 4N48A 1DB3A 3IPRA 5K09A 1OH7A 1NHGA 2GK4A 1RHUA 1N34B 3KC2A 3CUSA 4P4TA 3QKRB 4YAOA 3ZDAA 4CKEA 1PHRA 2XMZA 4OHOA 5K4HA 5GIOE 4ESVA 3D3WA 2ZS7A 1I10A 2QVZX 1QX4A 3FOAA 5IJ9B 2ORWA 5ERYA 3T95A 1OWPA 1Y7IA 4ANFA 4BBAA 2JFFA 2PMDA 3SLRA 1LRJA 3TX2A 4B3TB 3FTFA 4FYYA 2BM9A 5L3SB 1E7RA 5LC1A 1A5BB 2H2DA 3EOBI 3BXGA 3BM5A 3I5MA 2I4RA 2PZBA 3QELB 5BYAA 4L9RA 4XWGA 4B3IA 3P2KA 1NTOA 1ADJA 1P44A 4FI3F 1TKAA 1F6BA 2LNDA 2ZDGA 4UW9A 3VHXB 5AKHA 3DOHA 5CPFA 3DE7X 2CZCA 4FI3C 4YRNA 5LMUB 4MV9A 2E9SA 3L3BA 3IMCA 1ECGA 3OCCA 1EUYA 1HFJA 2VBGA 2ZI9A 4GLLA 1L5KA 4CIBA 4AI6A 2PZMA 3QP9A 3RHTA 2X77A 2XDWA 4XXHA 4YP7A 3UWMA 2VPYA 2JL1A 4EENA 3U9LA 1XFDA 1AO3A 2W70A 4IW3B 3AGPA 3IMGA 3ZZTA 1SZCA 2DF8A 1US8B 3IUYA 3KEGA 1NOJA 5EWLA 1KJJA 1SCAA 1G8AA 1Y8AA 2WG2A 4IGFA 4LXXA 5C5IA 3GLRA 3DBRB 1MT0A 1YI8A 3L4BC 4LWOA 1NVAA 1QHXA 2VJPA 1NFQA 2ZBPA 2OEPA 2XKJE 3H5WA 4TLAA 4U8HA 5TMDA 1J9ZA 3WNVA 1SQ0A 1W1IA 5CX1B 3OTOB 2ZG6A 2V7GA 3GEHA 3GPIA 1LRKA 1JLHA 5M29A 2GTIA 2QD4A 2JBWA 4G2TA 1RAAA 2FP3A 4ALLA 5IASA 1CRZA 1YD7A 5JOQA 3OQOA 2AH5A 3PV0A 2O7RA 1HH4A 4HSGA 4RH1A 2OB2A 1KYXA 4ETMA 2PD3A 1KYVA 1PT8A 4S3MA 2CDRA 4C30A 2X9GA 4S2EA 3WB1A 4TLEA 4YJKA 5B6IA 5DT2A 1OYOA 5FCDA 1FJXA 5H7XA 1JV2B 3SFVA 4IV8A 3TGWA 2PUFA 2ZWVA 2GHIA 2FMHA 1XMSA 1UMDA 1IG3A 1UJ5A 5LZ8A 3IEMA 4LNUA 1E2FA 1BQEA 4JGIA 2V4UA 3ND6A 5GJVC 1OHHA 1X7GA 3MW8A 4QASA 4RPIA 2IY8A 3ROGA 3V4OA 3PC4A 1IHUA 1FFWA 5AKEA 4UMFA 5HMMA 4D45A 1IU9A 3V8NA 4FCCA 5FBKA 1JYEA 2F8LA 4KTVE 5IMBA 2DULA 3JQAB 3ILXA 2OBNA 2IY7A 1IXZA 4NBVA 2XZPA 4UOQA 2BUCA 3EXAA 4X7MA 1NSFA 3UK0A 3WGYA 3BRSA 5HF8A 4LZNA 4DZRA 1KJZA 2BTQB 1XMIA 1E2GA 3SHVA 1AB6A 1CUSA 1YDWA 1E1QA 1KJ9A 2OTCA 4C05A 1L4EA 3MIZA 2WU1A 3FTCA 4HGZA 4V0SA 2VLIA 1QE5A 5FWYB 3ZDEA 4UMVA 4Q4AB 2GRAA 3RU7A 4YAEA 4WKPA 3GBPA 2DTEA 5EP3A 1Y3IA 2HA2A 4GRDA 5AK0A 4EKDA 1Q50A 2R8PA 2EQ5A 2P30A 2RC6A 3G8AA 3KJGA 1IY0A 4HMOA 3C1TA 5HMLA 4D5EA 2XIJA 5BR4A 2DM6A 1SUFA 4ARAA 1TLTA 4AJLA 1UK9A 4DLKA 4HLCA 2VJCA 3HH8A 3QW2A 4XYGA 2GZSA 2JZOA 4KE7A 2O0LA 3TS1A 3O8RA 3W6NA 3JQ7A 3H8VA 5FR2A 3LAWA 4P2BA 1N2OA 2NZWA 2Z43A 2E18A 1JJBA 3U7JA 4X7RA 1KY5A 3B1FA 4OXRA 4QU9A 5JYCA 4D9JA 3P4UA 1EVEA 2A9KA 2EQAA 2K4MA 4Q39A 4DVJA 3AVWA 4IDDA 3LFUA 1M6YA 4L2IB 1LSOA 5DK4A 1PJBA 2DR0A 1L4NA 3DNFA 4IOMA 3ABZA 2B8EA 2ZXEA 1KYZA 2W8BA 4PHHA 3A32A 2QU7A 1WSAA 1S1CA 1U1GA 2A33A 3LLUA 4CMCA 1C9JA 1Y63A 4G97A 3UJNA 3FHTA 1F7VA 2Q4BA 3FNFA 3ODGA 4WLUA 1QC5B 2VHYA 4DPLA 4JKOA 3G1WA 4QQNA 1Z5WA 2HA7A 4FWBA 4E5UA 3RU3A 3K35A 2BM8A 2C2GA 4FYPA 4FZ5A 2G5CA 5ALTA 3UENA 4WCFC 1MAAA 1IZZA 1S9HA 3H5LA 3HN7A 1GKIA 3NRJA 3P2MA 3WQBA 4BEVA 1I1HA 2WW8A 4RC9A 3CE6A 3X3HA 2C1ZA 1AQLA 4Q34A 4W9NA 2IPXA 3VVBA 1T26A 4TMVA 1GPMA 5FA8A 3ZJVA 1P4SA 2Y05A 3QI7A 1JG4A 2XRFA 3CXUA 5DEOA 1H2EA 5U1PA 4A6EA 3NVMB 3BFVA 4B3GA 4PFQA 3UBMA 5MN6A 4WDQA 2DX7A 2XBLA 1A7UA 1S9DA 4EEXA 3C8ZA 1N57A 4HGPA 3ULKA 4LF6B 2JZNA 1SRRA 5H4GA 4AQYB 1H5QA 4XDZA 4IIHA 1B2RA 2UVDA 2P2SA 1M33A 4IXDA 3WOVA 1EXMA 4WNYA 2QY9A 4RF2A 5J5CA 2WYIA 1KJIA 1WXXA 4BYGA 4KREA 2B5OA 3B51X 3IT3A 1A5AB 3NUZA 2N46A 4HN4B 3RC3A 4N18A 3MWYW 4RDHA 2OXIA 3EVDA 4NDNE 3VYVA 3HC7A 4ZJPA 3QXHA 2SCUA 1NM5C 2G76A 4NFSA 2FQYA 4URXR 3TF5A 4MA4A 1FLVA 2HEIA 2OG1A 1HT3A 2R79A 3MELA 3PC8C 4JFRA 4K40A 3TE6A 1WSDA 4E51A 3JWEA 3PXGA 2VPPA 3SKVA 3ND9A 1ZWKA 4F5YA 1XRRA 4MCHA 5IUKC 4H17A 1GQ2A 4ZT6A 4E1AA 3I0MA 3TW8B 5IFLA 4ZCTA 2VPIA 2R8YA 3GQBA 4LC1A 1EG2A 4QM6A 1XK7A 2A1TS 3KYCB 1W8IA 4NKRA 4FT4A 5L7TA 2Q7DA 4I2VA 2VDUE 5H5JA 4CUJA 4XUEA 1KERA 1QH1B 2I4TA 4ZEWA 3CPSA 1H5NA 4GWKA 1JR4A 1C8BA 1KAOA 2Q3CA 4MV5A 1DTWA 2FCAA 4ALMA 3WLPA 3RLFA 2PK3A 5BUCA 1JHUA 3QKUA 2ZJ5A 4HGYA 1EK1A 3ICEA 3FUWA 1VE1A 2I1QA 4H7JA 4N01A 5JS6A 3UMMA 2MMGA 3PQ7A 4LE2A 4ME6A 3IAUA 1O1YA 2R60A 1GPYA 3EGDA 3HZZA 4MZDA 4JLUA 2QTFA 4H3KB 4ONEA 1NC1A 4UDXX 5CVJA 1XCPA 2ZSIA 4I4TF 1JSXA 1XZDA 4I1RA 4IDNA 4F4HA 2IOFA 5KWEA 3N28A 3JRNA 3LPAA 3CRMA 1PQYA 5A2GA 1WLYA 5MFPA 4KZPA 4WECA 1NYRA 3WQRA 3UEOA 1ESZA 1HYGA 1RTTA 1VL8A 2IYXA 4QJIA 5CAEB 1SVKA 2CLFB 2EP7A 1Y7LA 4HT3B 1HDZA 3OKFA 5KU1A 3PGKA 3REGA 1SA0A 5LUAA 4E33A 4CDGA 1J5XA 1VIVA 2AXQA 4R7TA 3WGIA 3V7FA 1GPAA 1SPXA 4RKEA 5K3CA 1FFXB 1U5AA 3BGWA 4RWEA 4Y1RA 1TFRA 1WDKA 3GP3A 3UMSA 1LVHA 1PHPA 1I3MA 3VPGA 1L7AA 4J1QA 1XUOA 5KEIA 2PY6A 1SB8A 3MIIA 2JFUA 4QECA 3V32A 1Z18A 1IHYA 3DOCA 3EBPA 2FJUA 3H2IA 4KR0A 4OBBA 1K97A 3RIGA 3K0AB 5A9TA 3ENVA 4P2GA 1KC1A 4PC1A 2EYUA 3BL5A 3PR2B 3EXG2 5EIEA 1PL7A 2XYVA 3WE7A 3SVLA 1KI6B 4NBLA 2QT1A 1C1XB 1FRZA 2Y6UA 2JGKA 3WGVA 2YN0A 1X8KA 1A04A 3A14A 3TRDA 1Q0RA 1QHEA 3OT4A 5C5CA 2FPLA 3KAJA 3K53A 4F06A 2GAOA 1JEJA 1NLYA 3QXCA 5AESA 1N5MA 1KMNA 1C3VA 4LQ4A 4AJEA 1NWCA 3P19A 3M3DA 2YRXA 4E03A 4YWJA 4GMGA 1ODIA 5C4GB 4DMKA 3V2GA 4F8YA 5ISMA 1MG5A 1TZJA 1Y80A 4UVHA 3LWNA 1HE1C 1E6CA 3E5RA 4DV1B 5LZ9A 2PZKA 3BSWA 4RHTA 2VJLA 3OX4A 1U4SA 2IP1A 2VUHB 3HCFA 5C1DA 1CY1A 2WFMA 3EXIB 1AKRA 1U0GA 1W88A 3A3OA 3L1HA 1EFCA 1P80A 3VR3A 2X5NA 4EBFA 1YZTA 3TDNA 3O38A 3LY8A 3R74A 3W4IA 4MW0A 4FYHA 3WWOA 5JADA 1XWIA 2IDMA 3I05A 3P7MA 5I51A 4JUAA 4UBLA 3K5IA 3L8CA 1LI4A 4ESOA 1MQ8B 3EIUA 2CDCA 1FFYA 4N4AA 2C59A 2D2VA 3FYHA 1P7CA 1PD1A 1Z6QA 4RTOA 2W5UA 4PCUA 1JFSA 3SX0A 1EWTA 1IN1A 1W4ZA 2RHJA 2D1SA 4KMRA 4P1ZA 4BB9A 1K4MA 4DREA 4MHSA 4TL6A 3CF0A 3PRJA 1L4HA 5HIJA 3SZLA 1KDVA 2HZ7A 3PTAA 2KI5A 2AOVA 2XRYA 1E3IA 1DKMA 1QFSA 2FFRA 2PMKA 3BZBA 3KQUA 4B3RB 1SKQA 1CJVC 4OMFG 1FC0A 2O7QA 4KUHA 4MLCA 1JPNA 1JHPA 1QIDA 4R81A 1EPUA 3SBOA 3LKZA 2PMWB 1GNLA 3DTVA 3E8SA 4ZI7A 4ASUD 2PX2A 5LKRA 4G5OA 1NUTA 4YAKA 4OQLA 4G0PA 3L7DA 2DJIA 1LWOA 2IBMA 3DD1A 4G1EB 5FAXA 4DSUA 3DT8A 5FWDA 2Y76A 1Q7CA 3FCEA 3DPUA 1J20A 4LYDA 1CJSA 4NABA 4EVSA 5IVPA 3UNXA 5K3FA 5AW8A 2X15A 1BYUA 3LCCA 3QTTA 4L8FA 4AY4A 4ZRDA 4BJ3A 5ALMA 3H2SA 1TRHA 5LZ2A 2PFKA 1K6MA 3B85A 4UHBA 5CA1B 4BBPA 1E7WA 3A0RB 3KPYA 2ZETA 2E89A 3BD7A 3GB9A 4RY0A 5BR1A 1KY2A 3QWHA 4HMQA 1KMHA 1K7YA 5EUBA 3AVXA 2YBDA 3VX3A 3E61A 3GWZA 4GW3A 2ZATA 4Y6LA 4YYZA 1OU4A 2AR9A 2PGIA 4ZC8A 3WHIA 2HOQA 3EBOA 4Y9TA 3FCYA 3OKCA 2WR8A 4LJ4A 3EGVA 3C5HA 1W19A 4HMPA 5GV8A 3UV7A 4P7KA 5DCUA 1HPLA 5JAQA 3TJZA 3ZNQA 4NOKA 1CE8B 1EWVA 4U9HS 1JT2A 2JEYA 3HYRA 4U6SA 4X92A 3SC4A 3I62A 1QQTA 1TK9A 1TQHA 2UYQA 4FFMA 2V7VA 3BKXA 2P3OA 1NNLA 4NZNA 4D0RA 3AC0A 1GSHA 3B78A 4CTJA 3SG0A 1WA5A 4JXKA 3JD1A 5ALSA 3TTXA 3UT5A 4GPTA 1YDMA 3M34A 1XA4A 1V1MA 5FADA 3SSOA 3QEAZ 5JQGF 1SIBE 3SEQA 8ABPA 4RTKA 3EVBA 3TCNA 1ENOA 2X3YA 3HMQA 4E3ZA 4TRJA 1V9SA 4ON9A 2P9CA 1Y42X 4HNTA 1TUIA 1XWFA 3CG4A 1JHYA 2DTDA 2YVAA 3DBHB 3RK0A 4RDXA 4X7PA 1UM9A 4HDSB 1T9GR 1VHWA 3E9DA 1NLFA 2XYGA 3MJ4A 5ALDA 1HT2E 2E21A 3VTKA 3W5DA 2DFVA 4Q00A 1BKSB 3MJRA 1JMVA 3QQ5A 3OPVA 1FS6A 4FN4A 4US0R 4B6OA 3PR3A 4B44A 4BECA 1QR6A 3R5KA 2MWMA 2JGRA 1JLMA 2ASVA 2C4NA 2CLHB 2I87A 3B2EA 3AHHA 3HKCB 2Z4TA 3ZWOA 1ATIA 1C4XA 2B6HA 1HDCA 4OD0A 1J97A 3E35A 1A8SA 5AI8A 4ZEVA 4B3HA 5FDFA 2ZIGA 3PFIA 3S1LA 4XPIB 4HAWA 3E3AA 4E21A 2OOSA 3IE2A 4C04A 3T3OA 1JZQA 2G72A 2C7QA 1IY8A 4JKIA 4UCWA 1TKRA 1V2GA 2UKDA 4R84A 2E48A 4NU8X 4A8JC 3FIUA 4OXXA 1ZSYA 8ATCA 2NZVG 4F3CA 1SAYA 1X7YA 2ZIFA 4O2RA 1T1SA 2G9UA 4LS3A 3R3VA 3EA0A 4QQRA 5C8YF 1QCZA 4ZDWA 1R9MA 3HVKA 2BJWA 2WSYB 1KQ3A 1UDBA 3HGMA 4BVFA 2OCIA 2XKAA 1IH8A 1Y9EA 1VRWA 2OBLA 2NV6A 5AI5A 2GTPA 1AMNA 4HDCA 2RBGA 3QNMA 4AUKA 2G9ZA 4QC2A 4ZA2A 5FUBA 2FG7C 3K5HA 1GCOA 1BHO1 1GSIA 1RWNA 4GSYA 1E8MA 4W5WA 4BWVA 5ILOA 4BTEA 2UXBB 1VC2A 1XZNA 3FNHA 2JAXA 3AR2A 3H4IA 2HBZA 1BN6A 1TADA 3I1IA 2D8AA 3QLUC 3RUIA 2OSVA 3OZRA 4JBXA 5IF3A 3T9CA 3W8FA 1ZR4A 3DKIA 3TTWA 5F2KA 2MSCB 1GZUA 3ENKA 3RAEC 2ZCJA 1OIVA 1IG0A 1FBNA 3SBXA 3NNSA 1HRDA 4BQSA 2FH5B 4Z4EA 1K9VF 1FX0B 1C7RA 1SH7A 4GXRA 5ALJA 4LJLA 4KB5A 3AEKA 2I8AA 1DBVO 2RSLA 4G0UA 3DL7A 1YB6A 1U7TA 1NYLA 2D1FA 3BTOA 4RK1A 5BVHA 3DJYA 1XD2B 3NHMA 2FMFA 2GYWA 2R6ZA 1HFKA 3TTUA 3WMXA 1YWGO 3NGLA 5IC4A 4M87A 1JALA 2LW7A 1PBTA 3DHYA 3LDGA 4LY6A 2I80A 2QM7A 3TSOA 2JK1A 1BGXT 1J7JA 4BOYA 4DJTA 3CCBA 1I30A 2RHMA 2FW6A 5CNJA 3B1KA 5K0LA 3ADDA 2GCIA 2HRCA 4RMJA 1K3TA 1S8NA 3GLFA 3KZCA 1YA6A 3PVSA 4Q4JA 3NONA 5FO1A 1XFAA 4EWLA 4LJKA 2A1IA 3LIIA 3HZHA 4OK3A 2M6RA 3V4LA 5CVVA 3W9UA 4BN4A 1LD3A 1A5SB 1FUUA 3NEPX 4M49A 5JLAA 1BD3A 4RH3A 3R9KA 1F2UA 4EF5A 3OCJA 4R3WA 1I14A 2W2XA 3F67A 1YCGA 3IAM1 3NTQA 4FDUA 3ZKWA 4EA7A 1P2TA 1U2TA 3O91A 3RYIA 1W5SA 4L4YA 4EG5A 5JWRA 2ZIUB 4OJNA 3WK8A 3D3QA 3RT1A 3MB5A 2QNIA 2YHAA 2ONJA 2AIRA 1DKRA 1U1EA 2W48A 5DLPA 1KPHA 4HRAA 4N0DA 3FOWA 1D5CA 4RZQA 1J33A 5D01A 1XTRA 2M6KA 3UTDA 2NYRA 1IOVA 5DPMA 2FX5A 5EKXA 3M9XA 5LP6F 2J8ZA 1W75A 1TW3A 1Q16A 4E22A 3GRRA 1ENZA 1XYGA 5LP6C 3TXXA 4BCBA 3INRA 4G0ZA 4XJXA 3GIWA 5JAZA 3K32A 3FCUB 1LBQA 4CRWB 2JD2A 1CS0A 3K96A 4BC0A 2NIPA 4CQMD 4MUMA 4YAWA 4MEBA 4YDRA 3FDZA 4Y9SA 2ZBQA 1HV8A 1TCBA 2GB4A 5KTOA 2VTBA 4P3KA 1FTSA 1JRLA 4RULA 2FPPB 3LZ6A 1TM5E 5F7ZA 5A04A 1P0PA 3UPDA 3ZYCA 1Y7TA 2ESRA 4M22A 4DCVA 2DQZA 5JAOA 3T5BA 1ZUNA 4XB1A 4WBNF 4L16A 4BV2A 4LI0A 2HRRA 3QU7A 4WZBE 4ND6A 3FFAA 2AT1A 1NVTA 1ZGGA 4QYXA 3PSAA 2ZWAA 3C6ZA 1P8AA 4MS3B 5IAGA 4EB8A 1JJIA 3NEAA 1RHKA 2C54A 4MVJD 5EQDA 1ZD1A 3TNFA 2AVDA 4YUVA 3QNUA 3S5UA 4B6GA 4ER0A 2PH1A 1Q0LA 2WT8A 4QBTA 2HU8A 4HTAA 5DULA 1DSSG 4IQ4A 5ADUS 4IWXA 1OVGA 7MDHA 3DOJA 1K7FB 4KDCA 1O0CA 4XYLA 4FXPA 5A0FA 2J6HA 5BR8B 4FC7A 3QVJA 3LYHA 3UMVA 2FRDC 3M33A 4E31A 4I8XA 2HU7A 2P2ZA 1K0FA 2B5WA 2ZRLA 2GCEA 5DBFA 1Z6GA 1YOVB 2FLVA 4YQZA 3SIXA 3UJDA 3VR4D 3F6EX 4ZCMA 4HXGA 4Z8YA 2C7OA 1N6IA 3IILA 3PD1A 2JJ1D 5HOQA 4OLHA 4YP5A 1UQRA 3X0DA 3AQ4A 4FNAA 4EJSC 1WV0A 4Y1FA 2I6TA 3NLLA 4ZQEA 1SRQA 2MSEB 1FRNA 3M6VA 5EIOA 4ZVVA 1G18A 4H1TA 4UPEA 2CYBA 4UBNA 3RC8A 1L4MA 1ABEA 2FDRA 1M2VA 3GPLA 1BNCA 4OFZA 1CQIB 1J4AA 3O4HA 4JMLA 4YCNA 1HA3A 2JI9A 3FPEA 4BGEA 1VPTA 2X0NA 3AG6A 2XCOA 3O8NA 4LYHA 4CVNA 4QPJC 3ZJYA 5L51A 4R41A 2Z1NA 1PR1A 4CZ2A 1E18A 4JEHA 4MROA 3AR9A 4EARA 4F6LA 1U0BB 1VL2A 3BXOA 1ZJ5A 4U7PB 5ALIA 3UFXB 3WQQA 1BXGB 2IHJA 3IHTA 5DT9A 3HADA 2CXUA 3RRJA 1T1IA 2W4QA 4PR3A 4R8RA 3RS0A 4RK0A 3QA3E 4PZEA 4DMHA 3RYHA 2Y67A 5L7WA 4JSTA 2B99A 5GONB 5LXTA 4HUTA 2PJZA 3RC7A 2PXHA 1C0PA 1QGOA 3ZCUA 4L78A 2D7CA 2RHHA 4BUCA 2F62A 3IQHX 4XI9A 3JARA 3LUAA 3PJFA 3C39A 3GG2A 3MK31 3X1JA 4CDMA 2H1RA 3LOUA 5H0IA 5TQJA 4RXMA 2OO7A 2ST1A 2FG6C 1TTQB 2WPNA 3JQBC 4ARBA 4BDSA 1KAEA 2Q46A 1EUDA 1YF3A 3GFTA 1BDHA 3SFZA 2W00A 4JP8A 3QMPA 3UC9A 2ZYWX 1X1BA 1Z6TA 5BNFA 4DA0A 1QV7A 3LL4A 3CBGA 4F9TA 2ZSBA 1II0A 3ANTA 5B58T 4P4SB 3SC6A 2BEWA 1EP1B 1L9XA 3I72A 3ILVA 1SZJG 5IM4F 1OPRA 5KQMA 5BQXA 1RWMA 4JYZA 1G5QA 3SYLA 1P2DA 4D3ZA 2V1XA 1EP9A 2WUGA 4P84A 3KELA 2IPAB 3RJ5A 5J43A 2C4WA 5C4IA 4N82A 1WPQA 4ZV7A 4FCWA 2FMKA 1L7MA 1G5RA 1VOTA 5K0NA 5LA6B 3IQIX 3ZCQA 2XVAA 5AD1A 2QVYX 1E69A 3EUWA 1HNZB 1J1UA 2RH4A 1W76A 2BCGY 2YMMA 4EECA 4EQ6B 2D2FA 2X6QA 1BC5A 1EB8A 3L4SO 5HW0A 1EVKA 3AI1A 1Z8FA 1VE9A 1RXSA 2ZR9A 2CBXA 3IAHA 1HGXA 5A5VA 1HLPA 1Q1AA 2W4MA 2Z3ZA 4DDHA 3F98A 1XDBA 3DG9A 4Z4HA 2E5LB 5MN5A 1CDDA 3BEOA 1H85A 3L46A 4YJGB 4BIIA 5JSZB 1G3IA 2HQSA 2YXBA 3CX8A 2Z2XA 4JLWA 2HHAA 2Z09A 3BORA 4AULA 3QE2A 4KWIA