3AQIA

H240a variant of human ferrochelatase
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADAILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title H240A variant of human ferrochelatase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 147
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aqiA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aqiA01
1TJNA 2HREA 2Q2NA 2XWPA 3AQIA 3M4ZA 4KMMA 1DOZA 2PNJA 4F4DA 2PO7A 1L8XA 2QD5A 3HCOA 2H1VA 2XVZA 3GOQA 2XVYA 2C8JA 2QD1A 1LD3A 2XWSA 4MK4A 2QD2A 2QD3A 4KLCA 2Q2OA 2Q3JA 2HRCA 1C9EA 4KLAA 1LBQA 3HCRA 3W1WA 4KLRA 2QD4A 1HRKA 1AK1A 1QGOA 2DJ5A 1C1HA 2AC4A 2XVXA 2JH3A 4CCSA 1N0IA 3HCNA 2HK6A 2AC2A 3HCPA 2XWQA 3LYHA 2H1WA 2PO5A
chains in the Genus database with same CATH superfamily
3O8QB 4Q7LA 4Q7KA 2IH4A 3LPCA 3T7KA 1XLWA 4W5WA 3RARA 2UXBB 1V4BA 4WK6A 2IYAA 2PR2A 3GEGA 1AURA 2WNSA 4IDNA 4F3RA 1LLDA 3AINA 5FQOA 4ZVLA 2X22A 1W73A 2PIDA 1X94A 4Y6RA 3IGFA 1G2IA 1ES9A 2XNHA 3PT9A 4L76A 2AXEA 3MRXA 5BN4B 3ZBQA 2CVQA 3NGLA 3NJ4A 1YMQA 3GWZA 4KYUA 4LNHA 4PGHA 1HOXA 2XD4A 2I65A 1STOA 1K7SN 4TZ6A 3AI7A 3RV3A 4QDTA 3IV7A 1CQWA 4YCLA 2V65A 1VL5A 4OK6A 3I6ZA 1DQSA 1FX0B 2ZT7A 3QRWA 1NY5A 3OC0A 4HX5A 5L9AA 3WG9A 4EVRA 1U0TA 3HBNA 5I9LA 3TSAA 3P9YA 4IIUA 4Z3DA 1XRMA 3U40A 1N7HA 2CXPA 4K9RA 3L7YA 4W5OA 1DUIA 1IEVA 1YU9A 4EHDA 1KRHA 2GBCA 3JZIA 2VF8A 3PXCX 1M75A 1L0BA 2I0FA 2P3LA 1VBFA 1YBMA 4KLNA 3NEAA 4DV0B 2F55A 1UZUA 1T9KA 3CPHA 3L0IB 1NUPA 1GAWA 1Q3KA 3ZY2A 4XJVA 1V11A 2GZAA 3Q88A 4MYRA 1AN9A 4EM6A 4G0ZA 3CRW1 4HDMA 4YDRA 1R5OA 1ANKA 5FORA 2FPPB 3THWA 1FQOA 3TDKA 2QI9C 5C1OA 2NG1A 2NTEA 2R1VA 3DT8A 2B3DA 1E64A 2C1EA 2O7RA 3MBKA 1E9CA 2CEKA 3GV0A 2YR0A 2CXSA 2NUTA 3SKXA 3WGMA 4X90A 2W2MA 2IUTA 3U3MA 4PZPA 4ARUA 4DSTA 1IHPA 3QNUA 4FCTA 4QQFA 3O92A 1RJ9B 4EYQA 4MMXB 2VSFA 4ENPA 4FHGA 5H81A 5IASA 1T5LA 1QB7A 5A02A 3HSSA 4OSEA 4XFJA 3VPAA 2X0IA 3HRIA 1U2SA 3VHXB 4CCYA 3MS4A 5L4LA 1DUVG 1KVQA 1RQ2A 2B98A 2FHPA 3TI9A 3TYXA 1JILA 2RARA 1UXIA 1EFTA 2E87A 2IEGA 2WMYA 2XUGA 5KJFA 1PR6A 4I08A 3VR5H 1E6MA 4BLSA 4S0XA 1BH2A 4DXAA 3CLSC 1IN4A 5AESA 1FFYA 4F4UA 2XUFA 5DOVA 4EEXA 2GOYA 4L8WB 3JWIA 5ENVA 1E1RD 3B5EA 1ID1A 2ZBPA 3DV0B 5AIBA 2V7EA 4O6VA 5JSZB 1ZD5A 4BQSA 3I6BA 3LP6A 1TEHA 4FFVA 4LMRA 4LYFA 2GA8A 4PSDA 5CT9A 3DPIA 4P81A 5ICSA 5CGZA 3KUXA 3WK6A 5HUQA 3NCTA 1VJ1A 3A6ZA 3KYDB 4ASUA 1OX4B 3HKBA 4P34A 1A8HA 4Q9LA 3KAJA 3I1FA 4X24A 4EAQA 2Z8YA 3TIVA 5LMNB 4OBEA 1G9TA 2Y1OA 1NKTA 4Q7JB 5H59A 3VKUA 4CG2A 2FQXA 3NHAA 2VJAA 3C6MA 5LP6A 3GAFA 4B74A 1L8XA 1BA3A 3AY6A 1WSDA 4ZJPA 3HR8A 2Y0DA 2UYHA 3DBRB 4FW9A 2IKQA 2VDOB 2I6FA 5IAJA 3MCTA 3RKUA 2ZIVB 4DUPA 4EW1A 3PNSA 4M36A 2ZI9A 3D7RA 5CDTA 4B48A 2ANCA 1HE5A 3IE2A 2O0MA 4I5IA 1UXOA 4QWWA 1U0RA 3T12A 2G5GX 1R6BX 2F43B 4OAPA 2HSJA 3DL0A 1JG6A 1ZXLA 2A0UA 2AGVA 2IY8A 3TRFA 5JNWA 1N2JA 1YIDA 4OH7A 3ZLBA 3HCBA 2WHRA 3SX0A 2A9RA 2C78A 5L8VA 4Q1BA 1H05A 4RGQA 1RPJA 2Q4EA 3FTEA 1FX1A 1OWMA 3UUEA 2UZ4A 5BV0A 1XG5A 2PKQP 3I2FA 2JLUA 2ODQA 1QPZA 1D1SA 1NVDA 4L51A 4Q1VA 4ZICA 4HDRA 1M2OA 2JFGA 3DDSA 4JJ8A 4RAQA 2RG1A 5ESWA 2ZYWX 1SQ5A 2AOUB 2ZT6A 1JFFB 4X1YB 1JZQA 4ALKA 4B6EA 2YKGA 3F6SA 3CN7A 3G7SA 4UE3S 4A26A 2V3VA 2H1CA 3EA0A 4PBRA 3SC6A 2OMEA 4N7RA 4UULA 1YR7A 1YOVA 2ZVPX 3L6DA 1WSWA 5A0FA 3K4PA 4X6UA 1H9CA 4P4NA 3B1JA 1M7HA 3E9NA 3OICA 1ADYA 5DHSA 2OG2A 3MYRA 4QU0A 4NBRA 2C4UA 4FS8A 1RU3A 1NX9A 1X8XA 2BBOA 4IIBA 4R83A 4PN3A 3ETNA 3VR4D 2JVIA 3DBVO 4ZYZA 2WDPA 5H02A 2PUFA 1KC3A 4J90A 4QBHA 4BAZA 1RBYA 1K6MA 4K6HA 1NZFA 3FSRA 4NU5A 4J16A 3HYLA 4B3SB 2WUFA 4I9GA 3PEYA 1QQBA 4MEBA 1LKZA 5ERYA 3UO8B 3ZWBA 4ICIA 1RQGA 4XPIB 1RAHA 1MAHA 3T3EA 1E2LA 3OIDA 2HI0A 1XDSA 3NBFA 5C7YA 3E18A 2ZJ8A 4HR7A 3LYHA 1JWLA 2PUBA 1NUQA 7REQB 4DRZA 1T3TA 1D1PA 1V1RA 2J7PD 2KM1A 1ZD1A 3ZJYA 1V71A 3CZRA 1Z68A 5JQGA 4MIOA 3IUEA 3HHEA 4XDHA 4EH1A 1JLMA 5HFNA 4LV6A 2XMDA 3WIUA 2O8BA 1B0UA 2DWCA 5EP1A 3PA8A 1A7KA 3K1AB 3L7CA 4KO4S 2YXEA 1YB4A 2QIOA 2EWMA 3ZKWB 2EP8A 3TQCA 1NTOA 2H00A 1A98A 4MYUA 1U0EA 1CXZA 2J9ZB 1X1SA 5JS6A 2W42A 5C8DA 3HI6A 1WZUA 2Z57A 4XCXA 4EKDA 3BQMB 2B8EA 1N2ZA 3L4BA 3LVQE 2J9XB 1HQYE 4GE0A 1NMYA 2FY8A 3FTDA 2J0QA 5BV7A 1N36B 5ALVA 2UU9B 2OCAA 4E14A 4CF7A 4RTLA 1WMEA 2R25B 1WCYA 3WGJA 3WP0A 3E05A 1OTXA 3OOWA 3HRHA 3H9JA 2P0AA 1L9KA 1KNXA 1YB6A 1TE2A 2BDUA 2DUMA 2O4UX 3SIPA 5K3EA 3NBUA 2XIQA 2CNWA 2ZRCA 4LC1A 2HXSA 5A5EA 3QKWA 4ER3A 2OD2A 4P2BA 1KDOA 3GLGE 3OVMA 2Q6VA 3DQZA 4R9NA 2AQ8A 3EAGA 4A5OA 1FL9A 5T3YA 2EW1A 3ZZ1A 3BD6A 4BX2A 4OXIA 3PC7A 5JRZA 4DLNA 1V7ZA 3NVDA 4BNTA 5AI9A 1M2VB 4FE7A 3SZGA 4DADA 4LJAA 2WF5A 3BHNA 5LL6P 5IXSA 1T2NA 1P31A 5IHPA 3RI3A 5KHLB 4KQFA 4XQ0A 3KQWA 4K3VA 3EH2A 4A10A 4AJIA 4BQQA 2FPMA 3HDGA 3FUWA 3GLUA 6ABPA 4FOLA 5A3JA 3GELA 1DQRA 4Y9DA 3SBEA 3V46A 1F0YA 1UWVA 4BYGA 4TYQA 3PD1A 2OBMA 4FQ7A 4YRLA 4HVCA 4IIHA 3NC0C 4B3HA 1PSWA 3B1KA 2X0DA 2FEWB 3D6TB 4RK5A 3BMCB 3WFJA 2XTAA 1QHNA 4DLVA 3SGLA 3AVYA 1BWPA 2NTVA 3BPSA 4TKVB 1G19A 3VKFA 1BKDR 1FXWA 3D4NA 3IR6A 1O4WA 4MVWA 1IN8A 3K0BA 1S2LA 4BMXA 1HEUA 4QPPA 4U9IS 3UIEA 3LKDA 4HVAA 4V0NA 1V96A 1N2BA 3AF2A 1FU7A 1MX5A 2ZSJA 3CG0A 1HEYA 1Q1EA 1YK0A 1E1DA 3OCJA 4W9NA 4WRRA 5C5EA 4RTOA 1U81A 3FJOA 4BGDA 3GDWA 2FVYA 1T1SA 5A05A 3N6XA 2AH5A 3QVOA 2JAPA 1HO3A 4LA4A 3Q6NA 1W75A 2QN1A 4I4TF 3PGVA 5ED4A 1HLFA 2H11A 1B74A 1C9DB 4XLTA 4YQZA 1ZVJA 5K8VA 4FBGA 1IUOA 1YRWA 5IT4A 4XOUA 5DSTA 4WEOA 1GZUA 2FLVA 5EUBA 1PTJC 5HKKA 3SMQA 1JI3A 1MJGM 1UK9A 3WRYC 1B3RA 2QT1A 1H8HA 1ZD9A 1UKCA 1OVGA 4UNQA 3OAAD 1L5HA 3TJMA 5IPFA 5H8WA 1PZEA 5KYVA 2XZOA 4MWZA 4KQMA 2Y2VA 1NVFA 2ZWPA 3CN9A 3IUBA 1KMNA 2B4YA 4M21A 1JU3A 2DRIA 5SYAA 1AXEA 3ZVNA 1M0TA 2RHOA 4UCXA 3WB2A 2IYUA 3KVYA 2A92A 1FYEA 3S27A 3KLPX 2BJHA 2V6FA 5EE0A 3WJ1A 4NX2A 2ZVDA 3K53A 1FQKA 5FUYA 1FU8A 2QD2A 4D80A 1RVV1 1M1YE 1YDGA 4LBWA 1K7FB 3OLZA 2HRCA 4MB6A 1L5OA 2WJ6A 2VK8A 3K0CA 5CA0B 4NBWA 5DKFA 4BO8A 3EWNA 2NXNA 4IKOA 2IZZA 4GEGA 5I6DA 1K0UA 1XCGB 2C9YA 1NXQA 1W93A 4AS1A 5JOQA 2G71A 5MF6A 3A1SA 2PKQO 3KELA 1N5MA 1JG3A 3A3OA 4XIJA 1HT1E 3CVJA 3RC9A 4LUCA 1QGDA 4HDMB 1H2HA 4MH0R 2Z5GA 3VU1A 4MUEA 2V0CA 4ZYLA 5GJBA 1Z7GA 3DZFA 3QEMB 4ZEWA 3WYBA 3TNYA 4HOYA 1IYZA 2W6CX 3IO5A 5HIJA 1BCSA 5AW8A 1A95A 1OT3A 1Y3CE 2H2GA 3ROKA 1C5KA 2Q5HA 4XVQA 3R4CA 4OY3A 1F14A 4X7BA 3V1UA 3AP3A 1PL8A 1X1RA 1Q19A 3CW8X 2GPJA 4MARA 1OE0A 5FF9A 1KZGB 1CJMA 2RI0A 1A76A 3D3JA 2JLZA 1U8YA 4TV9B 1BXRA 5BW8A 4LHXA 4CWAA 1G7SA 1OH8A 5AOAA 3QWHA 1GLNA 1NN0A 3OY2A 5CB0A 2AXQA 3KKPA 2F7SA 1B1AA 2C2KA 2DT5A 1ULSA 1R6UA 2JI6A 3CPJB 3ONEA 4HDNA 2R8OA 3MMXA 4E2YA 2ZTHA 3EC2A 2PMDA 5AFSA 3QXJA 1C3LA 4P54A 1PDVA 1AA9A 3D9QX 1ZJWA 2EZ4A 3ZCUA 1JXMA 4FMDF 2QUZA 4PZYA 4B3IA 5F9MA 3UBTA 2HCFA 1A9ZA 4FYMA 2DU8A 4OGFA 2PA0A 5CFNA 4ZJYA 5F1YA 3MAGA 1F6WA 2JAHA 3PRYA 5TQ2A 3PX7A 4IWYA 4F8JA 2B20A 3OY7A 2BGTA 5F5LA 3UXYA 2C2YA 5EMMA 2Z6UA 1PVVA 1MA3A 3TDNA 5LP6B 2VAPA 4FE4A 5MN6A 1OAOA 3OFKA 4JVLA 1YD7A 2BY4A 2IZ0A 2OZLA 4LZAA 3GLFA 1X70A 5M04A 2ZS9A 4L75A 3PU6A 3IEPA 5HRCA 1G3IA 5LBTA 2JGMA 1BYUA 4NMMA 2B3TA 3V2HA 4DT1A 3HEAA 4FK8A 3R40A 5G4KA 5GAJA 3NR2A 4E5KA 4L16A 2JA1A 2GPSA 2DR3A 2FW1A 4TLAA 4EGCB 3BXZA 3WP1B 4PCVA 2ZRAA 4ABTA 4G1UC 5IKEA 3KKQA 4BQIA 5BV1A 2BGKA 3KM0A 2ONYA 2ZITA 3KOUA 2FN9A 4JBIA 2FPUA 3LUGA 2CXOA 1JDNA 4IJMA 2FYTA 3GBPA 2C57A 2A7XA 3A28A 3E22A 4QRHA 3RC3A 2I7CA 4BNIA 3F8TA 4KTTE 1DMSA 3MVEA 4HDRB 1QORA 1M2OB 1B8OA 3QFFA 4OB7A 3F9RA 3O73A 3OURA 4DIOA 3UJBA 1YSCA 3K0FB 1NBWB 2D1QA 3L1HA 4G5SA 3WE7A 1LPMA 5BT8A 4KKXB 3UMFA 4NEHB 3OOYA 4WXHA 1YHYA 1TKBA 2G9UA 2ZRQA 3M6IA 1GXSB 4B45A 4CR6A 5HX7A 3DYBA 1JHXA 3N0WA 2WKPA 4D4GA 1KYVA 2BKAA 3G3EA 2HCRA 3FLMA 1ZN7A 1GYRA 2HSWA 1CWUA 2A78A 2VHQA 2WWXA 2ORIA 3G17A 4DEXA 1T5HX 1FE8A 2BLLA 2AEFA 3ZDCA 2NQ2C 3L8FA 1NUAA 1ETHA 2Q3FA 2FWBA 2OYCA 2ZOSA 3W8DA 1QFJA 2VT6A 4HGPA 2Z58A 4C6SA 1U28C 2ZVQX 4GPAA 5TQ2B 5DHRA 3FB1A 3BMQA 2O3QA 5TS3A 3THYA 3T5TA 3QVJA 4LCEA 3SPXA 4MW6A 1OH6A 3EZNA 1TIKA 5IJWA 2R7KA 3H16A 3RS8A 4DW8A 1T1RA 3ESXA 1V45E 4UOQA 4K03A 4P3NA 2XT9A 4EFKA 2VZ8A 2QBYA 5AVUA 3N8NA 3ZHQA 4HQFA 4Z49A 3BTSA 3CNNA 1G20A 3HM9A 4FGSA 4UJ3A 3W8NA 5K51A 3L5KA 4MDHA 4EFNA 5D5QA 1SCJA 1JJBA 2CJWB 3OQNA 3FHCB 4YV7A 1U3TA 5BV2P 4I1VA 3AEKB 3UJNA 1B6SA 2XTMA 1V1RB 3QF7A 5ES3A 1SKUA 1AKEA 3UAXA 1W48A 4L02A 2FSIA 2CXQA 1VG0B 5FHRA 4RTQA 2RB4A 3RVNA 3ZDYB 4DDTA 2VHZA 3JYQA 5IKXA 1G5RA 3DS8A 1OXBB 5JC1A 1LQUA 1PLLA 2CLMB 4BVJA 5A9SB 1OH5A 2O8BB 2F8TA 1KJWA 2L82A 1W5TA 1W2HA 1Z06A 1KQNA 1EA7A 1V8ZA 4YT5A 1R12A 1MEJA 3ROXA 4N48A 1JPJA 2QLJA 4AJ9A 4BRSA 3ZJVA 1E5XA 2OILA 1ZJ6A 1FDUA 1HQKA 1FMFA 3EIHA 3DHYA 3HJGA 3ZWYA 2W2VA 4CGZA 2PQMA 3DC7A 1PWXA 3SQXA 1LDYA 2E5WA 4CM5A 1E4EA 3HVUA 1HLDA 2YVUA 5H80A 2WKWA 4FFNA 1M1XB 5AHOA 1BYIA 1FFCA 1D5WA 3H17A 2NN3C 5L40A 2PKWA 1MMFB 3KQKA 4YRRA 2W90A 4KDFA 3SEAA 2I6XA 1KAGA 5E6UB 3T0GA 4ETMA 3TFOA 2VF7A 4U7WA 4J6EA 4NBLA 4D4HA 3AIKA 4I9NA 4WKCA 3IDQA 3ZZ0A 1BVHA 2PBFA 1TEXA 5AJYA 4YASA 2Q3DA 4OGWA 2H17A 2Q99A 4X20A 3FI9A 4FLMA 2M6LA 4PX3A 1ZFNA 3DB2A 1VGRA 4YJFB 2PL3A 2WIAA 1RAAA 2ZB3A 3IBCA 4KOAA 5DPMA 3GRPA 4FGUA 4RK0A 2BP7A 1F4PA 3FCOA 5LOVB 2JJMA 3WLNA 5EI5A 1QFSA 1YQEA 2XEDA 2GYUA 3MTEA 3KE9A 1TAGA 1UJ6A 2G77B 1M0EA 1BX3A 4EG5A 3EIUA 4G86A 2VNHA 5KSPA 3D6UA 2Q4DA 4I1RA 1TYBE 1L7RA 2I6UA 1ZI9A 4ZO8A 3NV7A 4J7XA 3W1VA 1JTFA 4A73A 2O07A 2V5AA 4CF4A 2ZCJA 2QAGB 4DV7B 3IJ5A 1J2UA 2NP7A 5FJJA 2VF5X 3OLWA 4CQNA 4NG5A 4OXKA 4HWOA 1T6NA 4XUEA 4YREA 1Q16A 1ML3A 4E2WA 5ITWA 2RJOA 3TGPA 1C7QA 4YVFA 3SNHA 1UR5A 3M6WA 1MLDA 2JLAA 4I19A 3EVBA 3KEFA 3WFIA 2IQIA 3NUZA 1NMQA 4D0GA 3U44B 1YFLA 1UFOA 1Z22A 2CLKB 2FETA 2XVXA 3D7NA 3HEMA 3MB5A 4A92A 4E33A 2OHXA 5E9AA 4DCMA 2V6IA 2C83A 4GMDA 3GA0A 1RWWA 2A30A 1V6CA 1L5RA 3ITEA 1Q84A 4O0LA 5GINE 2F1RA 2VHCA 1TVMA 3ZQJA 4JP2A 3BZBA 2IZ5A 4GUDA 4CIAA 1JQ3A 1SVSA 1WBJB 4QQRA 1FXSA 2EJWA 4EO9A 3PFWO 1D1TA 1NRIA 2DHRA 4RANA 2D4HA 3QNMA 4TN1A 1JIQA 1QZXA 1UFKA 1Y9DA 2NT4A 1CQJB 4AMYA 5HM8A 1EGHA 1V39A 4WN9A 1RWNA 4OATA 1PZNA 4TLLB 5DCWA 2QX9A 3H1FA 3O0TA 4J4BA 3H4MA 1E20A 1I5RA 1TJPB 3SZOA 5ICEA 5A2QA 4IIFA 4MR8B 1I2AA 5F3DA 5IBCA 1HMYA 4RIGA 1XXLA 3M6UA 3A1DA 4W99A 4PSAA 2ZUCA 4U1RA 5LWHA 4IMRA 1CS0B 3KC2A 1VLLA 1P4GA 1GQOA 3TW8A 1G8PA 3DSRA 4FNGA 2ZSHA 4KMMA 3HKEA 1CUIA 4ER6A 1MAWA 1O9BA 1LK7A 4KQJA 4KN6A 1SGWA 5FLKA 1IOVA 2G9ZA 2EFCB 1HR0B 1NN5A 4YT2A 4Q9DA 5KWIA 2PMWB 2F3PA 2GZDA 4J1TA 1Y6JA 1MV8A 3W5JA 3WL3A 1UCFA 2J6BA 4PRLA 4G1EB 4IXMA 2QN3A 2JJ1D 1NR7A 1KBZA 2W2OA 2B1QA 3KR9A 4JQCA 4R81A 3LKBA 4DAEA 2A1UB 1XK7A 4C0QC 3M34A 4MWDA 3E5MA 4DTCA 3I23A 2G8NA 2VG8A 2ACKA 3H5VA 3VM6A 3ZLVA 2PGXA 2ZDHA 5REQA 2I3AA 1VTKA 3CY6A 2H4JA 3VC2A 2PJZA 4KPEC 3IP7A 1FPMA 3L0SA 1M8GA 1GM5A 1BNCA 1V9LA 4JENA 4CT4B 3NIWA 4IX9A 5F2NA 1UEXC 2DPXA 5KQPA 3L4JA 2LDBA 2MSWA 3I5AA 1XTVA 3IIKA 4Q3OA 1WNTA 4C04A 1W35A 1PN3A 2Q8QA 1QAQA 3DOJA 3QUSA 4UDYX 2BEUB 2RGBA 4IIJF 1GA6A 3W8FA 3RB8A 4RYDA 2C95A 4JASB 3EXG2 3EZLA 3GFFA 1CSEE 3NLLA 3RH0A 1LLQA 3JRXA 3ROPA 4B7ZA 1E3IA 4EW3A 2JD2A 2D0DA 1HRKA 1M6EX 1E2JA 3NFRA 4HFRA 3S2EA 2ZQYA 3ADOA 4A9AA 4PZAA 4EGJA 3ROQA 1BDHA 4EW2A 3BULA 3SOPA 4BNVA 3UXMA 5H82A 3D6HA 4L08A 1A88A 3L4KA 4J2HA 3ZS8A 4KR6A 5COBA 1R5BA 3STUA 3BG5A 2Q6IA 3U9TA 1LI4A 1U31A 2OXCA 4V0MA 3J80A 1NVWQ 4IWXA 4U5XA 2HCJB 2GILA 4M99A 2B61A 3C45A 3HV0A 2ZDGA 5H68A 3V8EA 5CBPA 1KOJA 2JDIA 1Z4PX 1IIRA 3A58B 3UGJA 3ZGYA 5TMBA 4ZCMA 3GLRA 2UVPB 3RFUA 3I61A 2PK3A 1OC4A 4MTLA 1V5GA 3AG5A 3R8CA 5KYWB 2WEKA 2VHVA 3G0IA 2XF2A 1TU4A 1UFRA 3QFCA 4H59A 2FWPA 1LF5A 2PGLA 5BRNA 3T9CA 2CSXA 3GHHA 4CLHA 5ALOA 2VYNA 3SK0A 2QVCA 4TTIA 1ZK3A 2XTJA 3F71A 4MI9A 4FDTA 2KE5A 5EIBD 1I4EB 4CL8A 2F8SA 4ND6A 2WPDA 3CR3C 1EWQA 3D8TA 2RKBA 3DUWA 3PWSA 3W9YA 4BEJA 3OH8A 1EH5A 1XAGA 5JNTA 3BE5A 5LZ5A 3SF8A 2ZK7A 2P4QA 1NI4A 2XRYA 3CF6R 4I99A 4ZO7A 5DEOA 5BYBA 3QVXA 1I4DD 2DG2A 4RF5A 2HJ9A 2VI5A 4CV0A 2DXIA 3DKPA 4K9QA 5I51A 1GRVA 5A4KA 1ZW6A 3ANMA 2AMVA 2PJRA 4JUBA 5L7YA 1CQIA 1L1RA 3EZGA 2COUA 4WK0B 2VAMA 4NJEA 2SHKA 3Q3JB 2R00C 4RABA 3KOOA 4G85A 2XUIA 4MIKA 1WAMA 3H2BA 3OQIA 4KXWA 4RIIA 4V3BA 1BVUA 1U8FO 4PLZA 5FNVA 4IBOA 3GVHA 3RAJA 4B80A 1X77A 1DTEA 1LGYA 4FLEA 3ROMA 4N8DA 1UMCB 3IUQA 2DUNA 3DAYA 4FONA 3K9HA 3I04A 2G07A 2P6UA 3JQBC 2QRVB 2D3TA 1UZLA 2VPXA 1N3BA 1NF8A 3KQOA 3NG1A 1YS1X 4BUZA 4YT4A 3BGDA 5HOEA 1MJNA 2OC4A 3I9LA 3QF4A 3S4YA 4A2QA 5KMGA 1QSGA 2VAVA 3A9UA 3PUYA 3PJFA 3E3OA 1QO7A 1SG9A 3K6JA 1E89A 3DAPA 1T3ZA 3NBZC 1Z4IA 3RE1A 3BMQB 1E18A 2YBDA 4EJ6A 4OL0A 2YX1A 3WVNA 3I37X 2C7OA 4WXYB 4QG7A 2I4MA 2CZQA 4OFBA 1DT3A 1ZK4A 4QA9A 3V00A 5CLGA 1E58A 1G20B 2P3OA 3FF4A 2VSQA 3KSUA 3Q1LA 3INNA 3RU9A 4HVLA 1FPQA 3I2YX 4GLLA 2O8EA 2I1QA 2ECQA 3O90A 3R5TA 1Z35A 5D7NA 5LYJB 3RF7A 4LWPA 4LJLA 3TIFA 4OTZA 3JS5A 4MGZR 2NYUA 4D8VA 3COVA 3CX8A 1J0EA 1UXJA 2C8LA 4EI7A 1QNFA 3DMNA 4K9SA 1E3SA 3AEYA 1G17A 4OXRA 4R41A 5BR7A 1DIOB 4J0DA 3BZUA 1HNNA 2D0OB 5CYGA 1GYQA 2YWJA 1NKSA 2YYYA 3ZYZA 1X74A 2HU5A 3O4IA 1BXGA 1XAJA 1O96A 4Z7JA 1GNRA 5DU2A 1BC5A 4G97A 4M8SA 2H0AA 4C7BA 4BVKA 4RTPA 4RA6A 3AHJA 4K86A 4OBWA 3ZV3A 4FEGA 1GZ3A 4TL7A 1WL8A 4I14A 4CIYA 5C80A 2QUAA 1KQFA 1P1KA 1S9DA 1X8KA 2A1IA 1J21A 1WU7A 5EJFA 4J1NA 1GL7A 4IR7A 1XF9A 4KQKA 3KPYA 3GDHA 1MC8A 3PWZA 3R9KA 3AUKA 1VIYA 5JXHA 5DNEA 4KHPB 1XK6A 2FR8C 2PMFA 2XGGA 2QQ0A 3E8XA 3IERA 3LQ2A 5FFFA 1JHOA 4PO9A 5F7OA 5LN1A 4J4HA 4QYIB 4BFSA 2CNDA 4DIUA 1IWOA 1ZOOA 3DVAA 3OCUA 3IKTA 1QIJA 2WP0A 3GFRA 5E4FA 1KERA 3WL6A 2HK6A 2BN4A 1Z36A 3PHGA 4MVJA 3S55A 1R88A 4B5KA 1P8AA 4GBMA 3K2IA 5HS4A 1E2EA 4Q5IA 1HGXA 1J33A 1T2AA 4UAVA 3AY0A 3VDMA 8MHTA 4EUSA 1G291 1BTOA 4F85A 5KPJA 1G6Q1 3GUZA 1W4AA 2I29A 2VDQB 1DRKA 2QIPA 3OOHA 3PQCA 4FYVA 5BMVA 2OORC 1Y5RA 2QN7A 4TMYA 1IB6A 2UXDB 4CEHA 1V16A 1B1CA 1CUBA 2BP7B 5TT0A 2KWIA 1QTQA 3OTQA 5B5SA 1HT2E 4A2PA 3ADCA 4L9SA 4U7GA 1BDBA 2WZDA 3NHUA 5M29A 1ENZA 5ECGC 3MOSA 1T8PA 1BE0A 4X97A 1IWPB 4KQHA 4BFVA 4EG3A 2XQGA 2AK2A 3DOHA 3ZY4A 3E81A 1AQ6A 2P78A 4DJJA 1XMSA 2C9MA 4IIGA 2X9LA 3L79A 5EIEA 3LOPA 2V45A 2QENA 1NHWA 2D7JA 4GKJB 3AEZA 1SB9A 3JAMA 2OZEA 4HCJA 1V8BA 1YUBA 1IC6A 1WR8A 1G5QA 3R5FA 2AFVA 2JFHA 2DPHA 2KX7A 2CVFA 5LWQA 4YCNA 1V4NA 3EGOA 3GQBB 4O2AF 1CUHA 3O75A 5DBFA 4UNRA 4CM4A 1JL3A 1Y8ZA 3B60A 3WGYA 2JLYA 4C2TA 4RVCA 3PEEA 3RS0A 5CFPA 5BMOA 2IYWA 1KDRA 4XB1A 2O59A 5COAA 3W5VA 1V1JA 2I4NA 1T15A 1CHDA 3LUAA 3MHPA 3SSNA 2A14A 2C7QA 3KKZA 1UBMS 3AIIA 3BERA 4PF1A 2WOOA 2FG7C 5IRCD 2IYVA 1JHDA 3H4TA 1VFNA 4FNOA 3N05A 3I5MA 4FN4A 2POQX 2PNFA 5JR3A 4JOBA 2XECA 5E6SA 4BLRA 3H75A 1LY1A 3K7EA 3HZRA 1AA6A 2J6IA 5CEFA 5ALKA 3AOGA 1D8AA 1H8EA 5GTDA 1C0EA 3EFOA 1Z0FA 1DJNA 2ZE5A 3DKRA 5AVQA 1MVLA 4U2FA 4I4TB 3AF6A 1Q11A 1MKYA 1UKAA 1NUUA 3WLKX 4BLUA 4L95C 4MYCA 2BSAA 3ETJA 1VPDA 3P2IA 1S2MA 1JDBC 5THXA 4MULA 2I80A 3TW8B 3IEIA 3T15A 4AZ3A 4W5QA 1W9HA 1MG0A 3NBXX 3MGBA 4JVOA 4YX9A 1O1YA 3O0DA 3TSZA 5FLYA 5KU1A 1Q17A 1ZNYA 1Q1GA 2CCGA 5KSZA 1Z0AA 1LWNA 2VTBB 3TAHA 3PIDA 4Q9IA 2GEKA 4B43A 4NE9A 2FQWA 5EIXA 1EAMA 1PWZA 1EX7A 2BFMA 2IW1A 2QB5A 2Z1MA 4ZT6A 2PUAA 4QE3A 3FZQA 4B3FX 3PICA 1SHLA 1RHJA 2HRBA 4JT9A 4ARIA 2JFOA 1QK4A 2H2HA 3T4EA 3UFBA 2VUUA 4N3BA 3DOOA 4X60A 1Q1QA 1UINA 3T38A 4ZVPA 4I5GA 4HNGA 2VZLA 1YR6A 2N3ZA 2FX5A 2ZANA 3QPBA 5T3UA 1EFPA 1H6BA 1UZMA 3ESRA 3H5LA 1VYTA 2GK6A 1TJYA 3GH3A 3JAKA 3H11B 3HU5A 3PC8C 1FF9A 4NENA 2E49A 4YS6A 4DQXA 4MDEA 3IKJA 4FR2A 2HLHA 4V0QA 5C46F 4HQ6A 3PPXA 2EBFX 4NIMA 4PFQA 5AM5A 3Q1KA 4M37A 1TDJA 1E7SA 2HLDA 3C8MA 3EOZA 3L92A 4ODIA 2J4DA 4G1MB 5DM0A 1Y3DE 2C5FA 3D5QA 1MIOB 3IVGA 3I42A 3CUVA 4RKYA 3NCHA 2Q41A 1DG9A 4JJKA 2GB4A 4R1PA 3K70D 1ZGCA 4GBGA 3V8BA 1Y5NA 3SIRA 1WA5A 2CHQA 3GF4A 3OKPA 4FQ8A 4G4IA 3W9BA 5LVAA 1C7ZA 5EPUA 3FMFA 1W0CA 2NZWA 3P2OA 5KSWB 1JV2B 4RMGA 1QGYA 3CIFA 4P3XA 3QSGA 1D03A 9ABPA 1H3EA 1TL7C 1EHYA 4XARA 1H2ZA 3AJRA 4KUHA 4X3CA 1VBNA 3W6NA 4P7GA 1LLCA 1Q91A 1TCBA 4HXFB 5CBPB 4DV3B 1J09A 2ISSD 7MHTA 3LI2A 3MWDA 2VBFA 3NUQA 3RHFA 1GZ4A 2VBCA 4FB4A 5BNWA 1SCKA 3OE4A 4FMDB 4QVIA 2C2XA 1T0BA 4J94A 1KDTA 3LO5A 3CVYA 1T2CA 2H8KA 5LQJA 1AGPA 4TZTA 5ESXA 4BCBA 4BJ5A 1FS6A 4P0TA 1L8LA 3LDGA 2B2NA 2I6QA 3C98A 1DC5A 1VSUA 1N5OX 2G5CA 4MX8A 3RVLA 5LA6F 3RTEA 2GJAA 4R3UC 1OB2A 2LWIA 2PWBA 1T6XA 3Q2OA 4IUYA 1XQ1A 2K5UA 2RBKA 3DMPA 4LJ7A 4Q01A 4JIGA 4GU5A 1ZRMA 3VOAA 2NO0A 2OP0A 2YCBA 3IUJA 4IQ8A 3JALA 3IQFA 3RIGA 2IYZA 4LX8A 4KV9A 4MROA 2ZB2A 3NVKI 1GO2A 1R0KA 3BXOA 3FPAA 1ZM3A 2V6GA 3LCVB 4HDSB 4UXIA 5EQFA 3KJXA 821PA 1ZWKA 2YW2A 2AR7A 2EG5A 1ZA2A 2IJGX 3N76A 1XTQA 3Q85A 2XPCA 1SBZA 2XUOA 4P0QB 1NQVA 4PC7A 3CRMA 3RYIB 2PTGA 4EJSC 4JI4B 5EJAA 2CUZA 1Z83A 1OD6A 4J3JA 4COOA 3FLAA 3A10A 3ZJUA 1QH1B 3RFCA 4NFSA 3ZXYA 4XFKA 1UBHS 2NQTA 4R1QA 2OHFA 1J9GA 4YFVA 2AX4A 5F12A 1YKGA 3NHKA 1XTTA 3T1NA 1EP2B 1KBQA 2R60A 4HAOA 4L0CA 2PAFA 3GFPA 2ZI7A 4NESA 3SQDA 4V2IA 1ECPA 1RAIA 3HR7A 2JJQA 4BNZA 1X1BA 4BBJA 4DVGA 2GRJA 3BF7A 4GRAA 1ZITA 2P75A 2WJJA 5ALFA 5IH7A 2KYRA 3T1TA 1N2XA 3LGAA 4O25A 2IYQA 3JR3A 4PS1A 3VYSB 4LZZA 4EY8A 2Y0PA 4QU5A 4G0QA 5EE1A 5ETJA 1IEXA 1O5TA 2WTUA 1DCKA 2MINA 4C7OA 2CYAA 3KT3A 4Q66C 4MKGA 4C29A 4DJTA 1YMVA 1BH6A 2IDMA 2OV3A 2P27A 4PVDA 4MLCA 2FAXA 1AM4D 4NECA 1JIKA 2BFDA 3SJZA 2O8EB 3ZE0B 4YDQA 1HORA 1IY1A 4BTLA 2H1WA 1E66A 1LLFA 4ND7A 1PAUA 1EPUA 1M66A 1W7AA 4M1ZA 3VTKA 3R24A 3Q7IA 1A9YA 5GMOA 1EX1A 4AWBA 4AUEA 2O2JA 4TTTS 4HRVA 2CNLA 3DWFA 1YJ8A 1O4VA 1ZUIA 2JFFA 3CF0A 4NJOA 2QUIA 4LOHA 3CISA 3LD9A 4M8LA 3NUGA 2Y9PB 4HQLA 2FXVA 3V7NA 1CZNA 3VH1A 4BJ6A 1RYFA 4LJ5A 4RM3A 3BRSA 3HDHA 3KJNA 3T0IA 1O96B 3GD5A 1NJ8A 2V7QD 1HQCA 4MWCA 2QVGA 4QXRA 1VCMA 5EZYB 4LYGA 3VZPA 1XMOB 1HKHA 2O8VA 1QNLA 1Z08A 5LB2A 1CEYA 3FJYA 5ENDA 4I6GA 2PUHA 4TXLA 2C5AA 1L5WA 2FWAA 4MPDA 5JAZA 3T1HB 2GNPA 3FNBA 2FDRA 1EFVB 1IN1A 4URUR 1T8SA 2EU8A 1LZLA 1ZC3A 4RHXA 2QRJA 3GMTA 3UAZA 4F11A 2ZYVX 1JG1A 2WJIA 1V7QA 4N47A 4YYZA 5WRFA 1RRGA 3EB9A 1DC6A 3SC4A 3TIGA 2X1LA 3AL3A 2Z3VA 3WXMA 5CCDA 1I1NA 1EUDA 1XCOA 4LE0A 2OA0A 1EK0A 4EJ0A 1JNYA 2JFZA 1XRJA 2HHLA 5F76A 5F51A 1VHJA 1R4ZA 3WGUA 4LECA 2VDMB 3DYIA 3UN1A 2Z8YM 1E2QA 3EWAA 4Q4JB 1KARA 3G89A 4R2KA 4RVSA 5JJLA 2JIOA 3KZCA 1E5LA 3NBMA 2NTJA 1V16B 5IAGA 4A8PA 4FFMA 1PFVA 2W6IA 3K70C 5G2OA 3C3DA 1KMQA 5E4TA 4NATA 4GEKA 4H3HB 2HRRA 1JIUA 3UCEA 2J85A 5KNCA 3I9NA 4YROA 6GPBA 4HUQA 1U0HC 4RQAA 1MDBA 3OPMA 3VKGA 2NACA 3OHPA 4BZXA 3F7TA 3DKIA 1JXOA 2AN9A 3C0KA 3C24A 3T7EA 2D74A 1KYIA 5JO9A 3ZK9A 4BX0A 1R4NB 2IHKA 4M1QA 1D4AA 5CVDA 1XWFA 4E5UA 3MCZA 4YRZA 2BGNA 2P4SA 4X95A 1G7RA 3DE4X 3LPNA 1YCHA 3D2LA 2QM0A 3KT8A 4YLGA 3DZIA 3C1AA 1HURA 1IBLB 3ZU4A 3W3AA 1LWOA 4YAUA 2AYXA 3D4OA 2FE4A 5CH8A 3TLZA 4BNUA 5C7LO 2ZSDA 1Y9JA 4A1OA 2CFCA 5D6OA 3GMIA 1H93A 3HBLA 2V9PA 3IP1A 2VT2A 3ND8A 2QLMA 1B4DA 3MT8A 4CKBA 5J4KA 1M1ZA 4IHJF 2O2HA 4BN4A 5LZ2A 5GADl 2OYRA 1FJXA 3A06A 3ZEAA 1G5IA 3EY4A 1MJFA 3IBSA 3K31A 5D1NA 3TOXA 4JI7B 1C0LA 4CMEA 3FCXA 5D6NA 4DXDA 2OAGA 1OASA 1UC9A 3CGGA 3MB8A 4TUYA 3RS2A 4CKZA 3E2PA 5IK2D 4TVBA 2WUGA 1UBKS 3LPDA 2JGAA 2HEGA 1E3DA 1BVYF 3AOEC 4N6GA 3UK7A 4WKGA 3RS5A 1GAJA 4YCAA 4DSNA 5EYPA 2ZBGA 2HN9A 3UAOA 3LVBA 3ICPA 1AC5A 1R9MA 3LVFO 4MQUA 4B9EA 4BN5A 2VPZA 1OTYA 1S7CA 1VCNA 5IDVA 4AZ3B 3UAYA 3PF8A 2VSXA 4R51A 1N2OA 2VSOA 3DCIA 3R0QA 3KV1A 4B79A 4NCNA 2J3IA 4AZ0A 1Z7WA 1XEXA 3KO8A 4PLYA 3OZFA 2RGRA 1OYYA 3G8CA 4PC2A 4MRVA 4CT0A 1CJKC 3W8EA 1K63A 2PVSA 3VVLA 3E9DA 5JJCA 1U4SA 3NDJA 4JWTA 3CLUD 1N33B 2F1OA 4JYPA 3OQJA 3OHMA 3R0IA 3NTOA 5KC9A 1YXMA 2OC9A 2ZJFA 1FJ2A 1S6YA 2CFSA 4KSYA 2DFNA 2FN8A 5FLEX 4ZK2A 2B0CA 1SRRA 2E55A 1FJGB 2XADA 1XLTA 4YV0A 1N9GB 2EF1A 4Q93A 2AFRA 2ZPAA 4BO1A 2V7UA 1FP1D 1UOQA 2QMYA 3NHFA 4PYLA 2AUNA 1RXUA 2J32A 5AHKA 5JAQA 5EN4A 1N2IA 4A1FA 1ETUA 1YB2A 2BPOA 5BUZA 2Q8PA 2J09A 4X54A 4KBGA 4JR1A 3HE3A 3QXHA 2DFDA 2Y1LA 5AK6A 2YYSA 1FXWF 4HB2A 4M6WB 3CRZA 2VPTA 5HNKA 3ADDA 2WNIA 3FUCA 3ISVA 3UMBA 2CZCA 4Z7QB 4RU1A 5BWLA 3IRVA 2FR1A 4YI3A 3IEMA 2O54A 2B25A 3STVA 3N8IA 3DXYA 1CZRA 2GJKA 1CDEA 3DE0X 2QWXA 4EY4A 1DRWA 1ZAKA 1XFAA 1VHTA 1F48A 4QVGA 3GUVA 1NF2A 1I7LA 1OXXK 2ROQA 3HJUA 3I01A 2ZWOA 3S7ZA 1MIHA 2I3ZA 1Y4DE 4LV8B 1JEAA 2L19A 4TTRA 1DAEA 5EAIA 4F1JA 3M5PA 1TKAA 4X5OA 1V5WA 4WNAB 1A27A 1SWVA 5CFLA 2OWEA 4NP6A 4IIJB 1B76A 1A3CA 2XQFA 4JB8A 3HVKA 4U3JB 1SIUA 2P9TA 2GDJA 3LT1A 4Z3KA 4BNKA 5J5VA 1CP2A 1E79A 2Q3CA 1L7NA 3OWOA 4MICA 5TMEA 3M70A 1JDPA 1QIEA 3QKUA 2QPAA 4EA9A 1EDDA 2B99A 3LRTA 3QKSB 4C0HA 4Y1GA 1J4AA 3MWDB 1T5OA 4KWEA 1UDWA 5TSDA 5GJCA 5D5PA 4UNNA 4OUKX 4JA0A 1Y80A 4R9UC 3RIHA 3RKSA 4G23A 2FMKA 4Z1MA 4AYTA 1K2WA 3FPLA 5TGTA 2UUBB 1UKZA 2OCDA 4KOEC 3ROGA 3KJGA 4D8YA 3ZGNA 3PQFA 4QBIA 4RQTA 5LQSA 1I3MA 3NWEA 4LYEA 5JSQA 1D4FA 2LUOA 2ZSKA 3U4GA 5K8CA 1I0LA 4GLOA 4EA7A 4B82A 2E5FA 2Y05A 3DDZX 1MFPA 2WF7A 3JW8A 3MWEA 3JALB 4MGIR 2BKVA 3OQ6A 3X1ZA 5FP0A 3QI7A 3PC2A 5IJ0A 3U4CA 3PITA 1PT8A 2E0IA 1K89A 1QCCA 3AUFA 3UICA 2HR1A 4KK3A 3SLGA 2GAAA 4RIHA 1AHPA 2DSTA 2H1FA 2MMGA 4Q3KA 4BKUA 2JJYA 3CEPB 3KZNA 1IPEA 1KSJA 1L7MA 3NANA 1SK8A 1ZIOA 4N8EA 3WIEA 3LNCA 2P67A 1ICIA 2OBFA 3W79A 1PWYE 2ECKA 2RIPA 3AVPA 4U6SA 4UARA 3EOBI 4S24A 3P2JA 3N87A 4KYIB 2FRVA 4REMA 2Y6VA 2FW9A 5DO9A 4YMUA 4JAVC 3A8TA 3CEAA 1XMJA 1M72A 4AF8A 2NYRA 4E6PA 4AF6A 1F4VA 1GRNA 2WKRA 3GRUA 1FOEB 2QHXA 4EYKA 3JRWA 3LCJA 2WG1A 4CDRA 2XIJA 4CMGA 1SPXA 2ORED 4I8XA 5FWYA 4R31A 3KUCA 4Q7EA 3V80A 1H65A 1JLSA 2G6BA 2WIGA 2IZ7A 4PO3X 4URXR 2HREA 4X64B 3HGTA 4QX6A 5DWDA 4I8DA 1LFDB 1XKQA 2JF0A 1L5YA 3I1JA 2H4HA 1FDVA 2CNKA 2IDJA 2C5HA 4DANA 1M5TA 1VJTA 4M9CA 1E4YA 1GTZA 5JMOA 4TTJA 4GZ6A 2QXTA 4ZZ2A 5B7NA 1KZ6A 1I4TD 4YR7A 1GUYA 1E6LA 1MH9A 4OM8A 2QL5A 4B8WA 3KWMA 4K6GA 3ZR4B 3N28A 4QELA 3AKZA 2G7MC 4AY2A 2P9QA 5BW4A 4BLQA 4C6HA 3PX2A 2FRXA 3UEOA 4N5DA 4ZKEA 1G20E 1NWCA 4PG8A 1DAKA 1Z2PX 3BYZA 4G01B 3L01A 2H92A 3CUSA 1SN7A 3BILA 4I1PA 5A6SA 2YDXA 4CBVA 2J48A 2QRMA 4R2WA 1IBMB 3VDRA 1Z29A 4FZ3A 2JZNA 2VAXA 5KNBA 4RTSA 2ETVA 3Q0TA 4RH3A 5EESA 4LMBA 1YOBA 4RACA 3RUCA 4I1IA 3D7LA 4D57A 2QRPA 2CHUA 1A5SB 2YV1A 3CLUC 3HA5A 2WFAA 1GCIA 3A3NA 4P93A 4ZU1X 4KAJA 5DNYB 2ECFA 1J22A 1H0RA 2DLDA 3CXUA 3MERA 1XYVA 4S35A 3RWBA 3REQA 1BX1A 1EI9A 4B3XA 1HNXB 3HYCA 3FXAA 3T3MB 1HNWB 1W5AA 1H3FA 3PHJA 2VJLA 3KTFA 1XD9A 3ONWA 2CHVA 5ICCA 3A4LA 3QXSA 5K7SA 3HR4A 3TNDA 1P1HA 3J81k 5JADA 1JBQA 2VHEA 1L5LA 3ZXXA 4O3MA 2P2DA 1IXSB 4PINA 1B16A 5AKIA 1NULA 2QJFA 1GRRA 4ESOA 5IF9A 4RELA 3FNIA 2DY0A 1EUDB 2A0FA 3GN1A 5HVNA 4KR3A 1N75A 4TVOA 1CUWA 4WX2B 1X1AA 2NO4A 1N4AA 1JW9B 3LBFA 1K97A 1UWCA 3MJRA 4MV1A 3UJHA 2AFIA 4PAWA 3VHQA 4BMOB 2PSFA 4IJ6A 4AJ1A 1IHOA 2ORYA 1ZO8A 4H1UA 2PX5A 1QCDA 4BKPA 1H1TA 5A0TA 4BJ1A 4KXQA 1YU6A 4JUFA 5CH3A 4ZQIA 2Q07A 3TMAA 4BVAA 5L45A 3DE2X 1ORTA 2REOA 4QOHA 4FQ5A 4F86A 1VI6A 4IZOA 1K0FA 1G7TA 3EVEA 4R7GA 2EEPA 3HVIA 1PR9A 3WA6A 5IDXA 1XRNA 1RQLA 2OFOA 1TMGE 3CLVA 3K2BA 3VO9A 3W2HA 1T36A 5GVSA 1KZHA 3IP5A 5CLHA 4OX9Y 3D0QA 2XNDD 5KINB 2R62A 2I9KA 2FUG6 2IUFA 1HM5A 2MR5A 2A9PA 3H1AA 1H9BA 2UVDA 2JIDA 2PFGA 3L18A 3L6BA 2WC1A 3WWZA 2WLTA 2PYZA 1O3YA 2H0RA 4GPEA 1GFWA 4CDGA 2HTEA 1P5HA 1W5FA 2W2PA 2PSJA 2ZBRA 3PXXA 2NNWB 2P0EA 3ASUA 4AQ7A 5C7IO 3A1WA 2B5OA 4JI1B 1FRNA 3AFOA 4J2TA 5DBIA 4PHFA 3T0FA 4CRWB 5JUWA 2A86A 1ADFA 2QLTA 4GNKA 4DA8A 1S3IA 1Z88A 3MWFA 2JARA 1B8PA 1JXQA 3FNQA 4P9NA 2V0NA 1YK1A 4QQNA 2HBQA 4XB2A 3RSHA 4C3OB 1B00A 3PR2B 1EK1A 2VXOA 2O2GA 2Y66A 3L8MA 3ORQA 4GW3A 2VOEA 4MW0A 1BKSB 1T3GA 1GOTA 3Q3HA 4D0NA 4B85A 2FZKA 4R40A 4DJDC 1EE1A 3HJTA 5BSTA 4F7WA 2OV4A 2JCSA 2XV1A 3S28A 4F5ZA 2NP6A 4ZI7A 2PX3A 1S0UA 2VT7A 4O2AB 4RF4A 1UWLA 4J1QA 1MHTA 1JKMA 2QAIA 5C52B 4G1CA 3QYFA 1E3WB 3Q7QA 4NS4A 5C34B 3RIXA 1OH7A 1YJQA 5KS2A 4JI6B 1SHUX 2G8LA 2HMAA 1I0ZA 1MT3A 4IIEA 4NLLA 5DHAA 5EP3A 3UF0A 3PUVA 4HNVA 1XD2A 1XRRA 3KTOA 2OGTA 4V1CA 4J0FA 3ADBA 5EJ8A 1QG0A 3UK6A 2J31A 2EL7A 3VC1A 5JXGA 5FWDA 2YIVX 2Q4BA 3DZCA 3GXBA 1M76A 4Z4CA 3HV2A 1I1QB 4QL3A 1ODCA 2PBRA 3GVIA 4OP3A 1B2LA 3FWKA 3TBHA 2D7DA 4OJQA 3D8SA 4CLRA 2YRWA 4TZ0A 3IYLW 2ZJ1A 3U4DA 1UMKA 1BKYA 2PQ0A 3H3XA 4TTVA 2AOVA 2Y1KA 3JZDA 1JIIA 3QVSA 4ATNA 5GZ1A 2WQ7A 2IX3A 2A88A 3M1IA 1AQJA 4W4TA 3G7UA 4CKEB 4JLDA 4JUCA 5ENZA 3UJ6A 1EK5A 1GHTA 1EM8B 1VE9A 4K2HA 2C42A 1T26A 3PTLA 3DFUA 2BE7A 4ZTZB 3DOEA 1PG0A 3D3WA 5C37A 4PHTA 3P2MA 4OQDA 1S9HA 1KGSA 2V7XA 3WLLA 1H2AS 2JIBA 1ISRA 3H2JA 3TXXA 2IYFA 5HCUA 4QOFA 4BRWA 2C3UA 4LMPA 3MJCA 3WDSA 4O2LA 3OEEA 1CC1S 4H0FA 1TK9A 3D7SA 2I6SA 1YR3A 3WGIA 2QLFA 4C3VA 2FG5A 2HSDA 1Z56C 2WWFA 3LF2A 1KAHA 1WVMA 4PYQA 2G7ZA 2QRHA 4Q3NA 4WE3A 4B2LA 4ZI7F 4RDXA 3JQQA 2EDAA 1E1QD 1W19A 3GJXC 1R6XA 2ZQ5A 3LKVA 1Z4NA 1NP6A 1WB5A 2GEDA 3B6ZA 3N2NA 1NBIA 3WXBA 3SQLA 4ENQA 2OHHA 2QE6A 1K27A 1MPTA 3JTEA 4RENA 5JD4A 5K2OA 1JR6A 3EUAA 3PZBA 3V8RA 1IBKB 4HS9A 1QRAA 4KCGA 1Y8QB 5FPSA 4AKSA 1ODLA 3I32A 2ACEA 4Z0PA 2AJLI 4ETNA 4BX9A 5AHWA 1CF9A 1GD1O 5LSAA 3TLAA 2QMUA 5ABPA 1L5ZA 1LRKA 1QYDA 4HPJB 4P7BA 2ZJBA 5FPQA 3I58A 4BMVA 3I4CA 5BQPA 4MWSA 2WE7A 2R0QC 1Q50A 4IM7A 2APJA 3E9QA 3FFXA 1J7JA 2FNAA 4A4DA 4BAGA 4PR3A 4D8WA 5BPHA 1C14A 5EXSA 3PT5A 2ODBA 1QR6A 4H3VA 1MZPA 3G85A 1PR3A 5AQEA 5A71A 3CX6A 4UOEA 1YZGA 3UANA 4W8GA 3DM9B 3E1GA 3OUUA 1X7WB 4UUMA 5KSYA 1GAXA 1WJGA 2Y0BA 4FPXA 1R4MB 1O2DA 3IOMA 3IAUA 4LHVA 5JZVA 4IDPA 4Z4IA 2XX3A 1TQHA 4JS0A 3P94A 4TSFA 2IFTA 2C99A 1H4VB 4GQBA 3UHOA 3KT6A 1OI2A 2WU0A 5JZSA 2YMMA 3VI4B 1TMYA 5TPZD 4E12A 5EHXA 2RMKA 3D6VA 1NXSA 2NU7A 4QEZA 3AFIA 5LDGA 5TRTA 4YDHB 1I6WA 4S12A 3WGOA 5B4UA 4QXOA 2H1IA 1GUBA 1MRNA 2OCYC 3IEVA 1KYZA 4OJYA 1T2EA 1P1FA 2CNBA 1VL1A 3OEWA 4DIBA 1ISGA 3GGSA 5A03A 3OMWA 1T5DX 4YMHA 4EI8A 5FWNA 2PXAA 5HGXA 4RZ2A 3NMUF 1YZHA 2Q7XA 4F56A 5LA6B 3PE6A 3Q9SA 3PUXA 1M9NA 2AKYA 1IXZA 1X7YB 3AETA 3T8YA 1Z4JA 1HKUA 1HZJA 1OMOA 1E7WA 1X9HA 1FC0A 1OLXA 3RJTA 1HG0A 3L43A 4QDUA 4JQZA 2UV8A 4ACBA 2HCTA 3AVVA 3V1TC 4UZFA 4YCJA 2I3DA 2OT3B 1RAGA 3A3PA 3HYNA 5A9RA 1PSDA 1J0XO 3UJ3X 3U4QA 4HYEA 2WWTA 4IH9A 5FQNA 1CIJA 3L82B 1GJRA 2GERA 1TYCA 3BGVA 2W2LD 3Q6MA 4ND8B 4Q3AA 2H8GA 3RSQA 1DTWA 4HFMA 2QG4A 4I50A 4PAGA 1H9AA 5E1MA 1KO8A 4RV5A 4F1KA 2C7BA 4EEKA 3R4VA 3JQFC 1C7RA 3FDZB 1ULBA 4H4CA 4F12A 5J2TA 2Q45A 3RU2A 1DLIA 3IPYA 4C6TA 2GLTA 4TRMA 4BXOB 3IPLA 1S2GA 4CIBA 4TPKA 1BHJA 4FX2A 5IZ4A 3FR8A 5JZOA 4AN0A 5F33A 1DAHA 4BIIA 4KU4A 3CUTA 2ID9A 4YR9A 1LDBA 1SK9A 1SVOA 1VMDA 4HO1X 3WLHA 3LLCA 2J3JA 3Q41A 2ID8A 2JCYA 4IMPA 5FBZA 1N2CA 2H51A 2XMGA 5CX4A 1J97A 1NDHA 1AMNA 4HNQA 2OENG 4MPRA 3UOWA 2WT8A 5C4MA 1FP2A 2Z3ZA 3RTAA 3MTQA 3FD8A 1E5DA 3KSMA 5HZGA 4FW8A 5AVWA 5JAPA 1G16A 2EFDB 1GQSA 2BHLA 2FOIA 2QKYA 4ZEXA 2RAVA 3CTMA 2CHGA 4Y6SA 5KJCA 1B23P 2XOKD 1R5NA 3BSFA 4FYIA 4NARA 4YQEA 3CMCO 3D0KA 2UKDA 3KXKA 3OX4A 1AO3A 1FVFA 1YR2A 2VP6A 4HMQA 4WSOA 4EMTA 2FN4A 2BMFA 3K09A 4WEQA 1G64A 2O5CA 2C2BA 5AKHA 1ECLA 3RVJA 4M1MA 1Z2CA 4ZRNA 2NYAA 3BDIA 2Z98A 3VA7A 5DT9A 1RRPA 1VL0A 2NUAB 1EUYA 5AKGA 3ZHZA 2Z9DA 2BHSA 3CX7A 2XOEA 4LNUB 3AFNA 3HFRA 3RVRA 4B4WA 1GR0A 4P08A 1A9PA 2GKSA 3UG6A 2GXUA 1YVPA 1RLUA 1E2PA 2ZIAA 1NJFA 1G8GA 1GZHB 1KEUA 3MCUA 4HAUA 3F6BX 1Y3FE 5BPFA 5FNVF 4F0JA 4K26A 3QWFA 1S4QA 1C9NA 4MPJA 5I4IA 3L0BA 4QWMA 2NZJA 3MN1A 1SC1A 3CG4A 3V6MA 3CPEA 1IULA 2C4VA 4JLBA 4GR9A 1KVTA 5KOHA 3DEIA 3SSOA 1IZZA 4FINA 1P1JA 5KWSA 3B70A 1J00A 3CX4A 3LJKA 3ELWA 3KDAA 2QT0A 5JQWA 1BD4A 2FSPA 2QTGA 2OAEA 5CB6A 5HKBA 3TECE 1RZRD 3MAAC 2I8AA 4QREA 2IXAA 2GHRA 3UWSA 1URPA 4E4TA 5FKJA 1V8DA 1Z38A 4XQGA 5J59A 4ZQEA 4I2NA 2GBGA 3PA6A 2DHDA 3LDAA 5ESRA 1RP1A 4JGGA 1VPLA 3GJ5A 3WMEA 3QX8A 4LOIA 4MV3A 4TWIA 2NU8A 3L8DA 1TECE 3KSRA 1TC2A 4RA9B 3EPRA 1H5UA 3SBOA 1YL7A 3MSXA 2QLBA 3NAQA 2BEKA 1K75A 1BA2A 3DLAA 3UHAA 4F5YA 3AJ9A 4QXAA 1SH7A 2VZ0A 3FYUC 5L3QB 2JHPA 1NW8A 3DEAA 4MYTA 4RFVA 4GKKB 3TN7A 3ABZA 1YZFA 2AEJA 5LFAA 3ZUPA 4A0GA 3A0UA 1NOKA 4PPGA 1BEZA 4Y9RA 4P7JA 4G5RA 1J1ZA 1U8TA 4UM9B 1RKBA 3G79A 2PG3A 3GOQA 2O8DB 4DMCA 1EUZA 2X9VA 3GZNA 4C4ZA 1YQDA 4GVLA 5BVHA 4G0WA 2VXBA 5CB8A 3LKZA 2GAFA 3PPYA 5LYYA 1T8TA 3UGQA 4ZIRA 1LV8A 2IGBA 1YQ9A 1I94B 2NUBA 2GPNA 1K6JA 1FA9A 1M5UA 1BE8A 2YV5A 3EWIA 4LG1A 3MT7A 1DRUA 4BRZA 1PX2A 1UPUA 1N5DA 2A0WA 4C1NA 2HWYA 1Q0UA 1HFKA 2QORA 3DCJA 3IO3A 1OAAA 3RVMA 3EA5A 2H2AA 1S2DA 1RC8A 1MB9A 5CG1A 4EKYA 1EESA 4O08A 1I6LA 2X4GA 4FXPA 1YDEA 4V1CB 1CERA 1SWWA 5KDDA 3OZWA 1QGUB 3DAFA 5EKTA 2G25A 4IHJB 1ZMRA 3CUKA 5KAMA 4GECA 3T7AA 2BTEA 1IG3A 4BBPA 4UFNA 3O03A 5AOVA 2M6KA 2IXTA 1DVRA 1UADA 4G25A 4A16A 1T3LA 3GG9A 3KLBA 3ZD9A 2GBPA 1XN4A 2HQ1A 4CJXA 2IUEA 3JCZA 4UUOA 3K0AB 5A6VA 1CUUA 3TKLA 2WAOA 5BMVF 3M81A 3LUCA 1TTHA 3LWBA 4ZDKA 1D2CA 1ZXBA 5JY6A 4DN6A 3BJZA 2XSZA 4C9BA 5B12A 1IMJA 3TIXB 4YH1A 1TKCA 2XYVA 3VZSA 3QE9Y 1XEWY 3PPWA 2X0KA 1HDCA 3O3NB 2PMEA 4Q4LA 2B4QA 3ETCA 3W3ZB 5IYZA 2JLQA 2FWJA 3RK0A 1QV9A 5L6MB 3T7DA 1JU4A 1C8KA 1KEPA 1PJRA 1IJBA 1P7YA 4GP6A 3F90A 4YXFA 1J2YA 3N0RA 5B37A 4QUEA 4ASUD 2G17A 4NV3A 4HAVA 1EIZA 2EAUA 2B78A 3PNYA 3R3SA 3EZFA 2GM9A 4Z4GA 1L7DA 4EW6A 1MW8X 1VHQA 4FHCA 4F21A 4S05A 3TW4A 2JKVA 4POAA 1QVAA 2RGYA 5CAEB 2ZUTA 3C48A 2BAGA 2GX6A 3L41A 1GY8A 2EGHA 4YRNA 2VNJA 3KD2A 4A6XA 3USZA 1Z8DA 2DYKA 3PUHA 4PRYA 2GLXA 4FBMA 2E18A 4KXVA 2EFYA 3HG7A 4EYGA 1NNI1 3FDXA 1GFZA 4RM2A 1BN7A 3RRBA 2M1XA 3FZEA 4B33A 1N8KA 3H99A 1G3UA 4FMCF 3PSAA 3ZV4A 1CS4C 5IJZA 1LTKA 1T4CB 2C7VA 4OSOA 3UB4A 1NOJA 1VLMA 5H5JA 1QVVA 1TQ8A 1Y8CA 2ZS7A 3D3NA 3KVNA 4MVJM 3D5EA 2CLCX 5CM8B 5ITZA 2C84A 2J0SA 4DR7B 3VSCA 3IXMA 5AVKA 3OJCA 1SCBA 3RLIA 3H9BA 5LQAA 2XVAA 1G9SA 5KTOA 2WM8A 3MD9A 4Y6OA 2JLCA 2SNIE 5TIIA 1RNLA 3R8FA 1Y98A 4OQMA 3VPHA 5FBRB 1QHSA 1U6IA 2ZM6B 1CHNA 2BELA 1RWPA 3P26A 2C97A 1Z7YA 3WYGA 3CCBA 4Q9HA 3G2KA 2REBA 4O1HA 1HE3A 2P9BA 5A9TA 3RQSA 1WCXA 4E21A 1SVLA 3TR5A 2ECOA 2PS9A 3FBWA 3OX1A 1D09A 1Z5ZA 1WW2A 3HBMA 1GKUB 3ETGA 4HLUC 3V7WA 3TW0A 4QNMA 4J7UA 1GUAA 2CGEA 4RF2A 2NX2A 2AOWA 1RE1A 2IYLD 4IIVA 4X1IA 5EIOA 3T5CA 4BGVA 2NU7B 4BTVA 3N59A 2J6CA 5B3JC 1PFGA 4BPBA 3ZWWA 1UKVY 2BI7A 4LF5B 4QICA 1N5LA 1K7EB 2I6GA 5C3MA 3CZCA 3B1YA 5G41A 5E2IA 3U4AA 2WSMA 2POCA 3FF1A 2ZIXA 3FMIA 3TQFA 1QOPB 4L5YA 4HNTA 2HC9A 3DGFC 1VBKA 3IDSA 4XZ3A 5L4SA 1YKFA 5EHGA 2E1RA 2YJ6A 3WWOA 3ZW9A 3V8NA 1XVUA 4C3UA 3P96A 4KN8A 1Y3AA 2FPSA 3AETB 1R8JA 3G68A 2REXB 1WUTA 3G0BA 3OLCX 4JKOA 5LU8A 1H2XA 3BFKA 4XTCS 2C9CA 3HMQA 3VMMA 2P65A 3IVXA 3DEFA 2R96A 2O4CA 4LWQA 4EMSA 5JYBA 1QMGA 2R6R1 3L46A 2E21A 2X4LA 4R98A 4RH1A 4Y7CA 4TWBA 3WGTA 5JDIA 4KW7A 5KYKA 1D04A 5A3QA 1LA2A 4ER5A 3P9ZA 4QOJA 2LW7A 2CXTA 1XNGA 1ZEJA 2Y1DA 3V1LA 3ZDZB 2PN1A 3K5IA 4FFBB 3EBPA 4ARCA 2JL1A 3JZMA 4XM0A 4B0OA 5BWOA 1P1BA 4P80A 1LSUA 3F7OA 4R7TA 2XZLA 1MRSA 1RJGA 3RV4A 5ADWA 1NI5A 1QWOA 1X15A 2QQFA 3ONFA 4IEIA 4I55A 5DCYA 4DBLC 721PA 4OKSA 2BM9A 5TE9A 3ACCA 1N3YA 4RSGA 3SC2A 3DVSX 3F6PA 5BXYA 1U8XX 2IYEA 1RAEA 2Q2VA 3DM5A 3MJSA 4RE5A 1M54A 1SIBE 3BK7A 3OIVA 4UU8A 3UCXA 3A1UA 3BB3A 5EQJB 4DKJA 5KTMA 2HJWA 4I81A 4MW9A 2IELA 4YAOA 4UNIA 2QP4A 2QXUA 1PKEA 4NMLA 1K7CA 3UT5B 5LUBA 3WNBA 5K6AA 3A6EA 1N2CB 1PF7E 1IMOA 2DHCA 3FCCA 2H18A 4D3FA 3GC6A 2DKNA 1OWOA 4GM4A 5CPBA 5SYNA 3QVVA 4DNXA 2GN4A 1YS7A 1PEDA 1OBFO 5AKKA 2P5SA 3MFYA 2A9FA 3PR1A 1ZGJA 1QANA 1SKQA 2IP4A 3OTHA 4DIMA 3SXJA 2VUSA 1RBMA 1A77A 3AEUA 3JV7A 4E70A 1VKRA 3NHYA 2QM3A 3HWWA 1D2AA 1N5JA 2CNWD 3L7JA 4B8YA 1U2GA 2G40A 5JNRA 4MUXA 4H3SA 4LOAA 1OFIA 2H4YA 3WR5A 1HA3A 5T67A 4W82A 1V2GA 2A5FA 4REOA 2O8FA 3HKDA 2P9EA 4B73A 4YRKA 2BGUA 1YDFA 1ZGZA 5AM3A 1DCTA 2QMZA 5IC4A 2BBTA 1UQTA 3C8ZA 4BFZA 3HLYA 1W25A 1QX3A 2PWPA 2JFQA 2VJCA 3CO5A 3VPBA 1BHQ1 1VP9A 4P3KA 4AICA 2HPVA 2GS9A 1SMKA 1H1DA 4RKQA 2ZUDA 1ULAA 3ZWVA 4L5AA 5BOVA 1GGHA 4AMZA 1EBBA 5DYYA 5FV7A 3LNTA 5AW9A 5KVCA 2VATA 3LYLA 4K40A 4G07A 1JG2A 1FNSA 4YHHB 3L7DA 1G63A 4RVOA 3EDOA 2PZKA 1JVNA 5CH5A 4NCXA 1PI3A 3MIZA 1JDJA 3LBIA 4G9BA 4I1UA 3U7GA 1GZSA 5EINA 4EZIA 1KH1A 2XNSA 4WCFC 5DLQC 5KWVA 3K2QA 4Q1CA 4XJXA 1G1MA 4JYAB 1Z7EA 4OHPA 5DHFA 5A7FA 2HMUA 4U02A 4QLAA 4DLSA 1ISHA 4BKOA 1WXWA 4FSHA 3NTXA 4G8DA 4HFJA 4O4HF 4X92A 2P69A 5JJBA 4R71A 4GRIA 2P6NA 1JYFA 4R2IA 5ISMA 4JX8A 1JHQA 1T9GS 2FJUA 1GCAA 3FBGA 2WDZA 4IGIA 3KUUA 3DTTA 3PJRA 2JGLA 3ICWA 4B71A 1Y6GA 2HHHB 5CYPA 2NU8B 3C8HA 4EG8A 2C9OA 3T54A 1UWKA 1Z12A 2CJPA 3HJAA 1ZH2A 5T5QA 5HKKD 1AS0A 4Q82A 4BV9A 4XJTA 2IU0A 3ZWNA 4COKA 3DHEA 1H8HD 5EZ6B 2PGAA 1YCDA 1JHAA 3B8HA 2FW7A 2XVMA 3M5DA 2DERA 4ZVRA 3TE7A 1F2TB 4MEAA 2DF8A 2X5NA 1PW5A 4LVNA 1AXRA 3EMDA 4L6IA 4E5VA 1GNSA 4UKDA 2IVFA 4KP7A 2OGSA 1ULTA 2HQBA 2XNJA 1BN6A 1NSTA 2ZIEA 4CEJA 1JTVA 2Z08A 3WLAA 4M0KA 3I53A 3C7DB 4MAAA 1DX6A 2D0PB 3NTUA 1A72A 3PNOA 3VNSA 3MINA 3PDUA 4GYJA 1V5IA 1AKNA 3HKCB 5E3HA 5G0WA 3T5PA 4D7AA 4KQGA 4G2TA 4REQA 1LNZA 1P6UA 3DEYX 2WA1A 5C1IA 4KO8A 5IVDA 4PYIA 3IAM1 2I66A 3UG7A 4R8LA 3GVXA 4DYHA 2OBLA 2QXYA 3GCDA 3H13A 3M8KA 4P3PA 2F1HA 1C2TA 4S1PA 5F1KA 3QEAZ 2H07A 3EBOA 3RUHA 3CTPA 3VH2A 5CVUA 4KH0A 2JLBA 2EKDA 3H65A 1EQUA 4RCVA 1COWA 5C5CA 4J16C 5F2EA 1G8AA 3QW4B 3HXOA 1Y8RB 1Y1PA 2Z04A 4LXXA 4PICA 1N57A 3ILSA 2WPNA 1SD5A 5EWJB 3O2JA 2GASA 4DJFC 4S1OA 1E2UA 1HQDA 2HHCA 2Q3MA 2QZPA 1EFUA 3DFFA 4LC0A 4F6RB 4MI3A 2R47A 1Q0RA 3KZVA 4WA7A 2VEOA 3WMGA 2CT8A 2QK4A 3L2OB 1O89A 4UHBA 2L17A 1XN1A 3BH7A 4HJRA 2IHBA 1VG1A 4WIAA 1EUCA 4UZSA 4L74A 2C4NA 4QDKA 1E2MA 4WJLA 2PRIA 4OQPA 1V0JA 2WTXA 1UEIA 3REFA 1AOXA 1P5JA 1UMBA 2IIVA 2W8ZA 3AZOA 4TGLA 3K8ZA 3WS7A 3VNRA 4Q1EA 1NG9A 5E3JA 1C1XA 3MUOA 1ID8A 1G5HA 4CL2A 1P1IA 2QJRA 3O31A 3EXEA 4JB2A 3E7PA 1RQRA 4O4IA 4WGFA 1EIWA 2PO5A 3LUJA 1XVTA 1YJAA 1YVUA 4AYWA 4HXGA 3U7IA 1UXKA 3P2EA 4HN2A 4NMWA 4UQLA 2XYRA 2W8BA 3G0CA 4C0SA 1JDSA 1EHCA 2JEYA 1LPBB 2UDPA 3GJ7A 4Y2VA 3U19A 1RWXA 3DE7X 3LA8A 3THXA 3LDUA 1KJYA 1OFUA 3VAYA 2JKZA 5LZ9A 2Q4OA 5CURA 4M46A 4JC0A 1XELA 4KLZA 2RC6A 3B38A 1JLKA 3GGDA 4FD2A 3PVZA 1EWVA 1KS2A 4UBOA 4ESEA 2F00A 5DH9A 5DT2A 1ZISA 1OYVA 4N3NA 5EJ9A 4HNUA 1U2DA 3DP7A 4TMKA 4F4CA 2BEWA 2Y93A 4KYTA 2CB9A 3SZMA 5GOZA 1ZRNA 1IJFA 1MTZA 2ZAMA 2VDNB 3RBAA 3RNOA 1I10A 2HLPA 2CBXA 3WL4A 5CW2A 2C82A 5IHXA 2PUGA 4RKFA 2C61A 2JLRA 1B0AA 1YZ3A 1GKLA 4JL5A 1NV8A 1SXIA 1T4MA 4XVRA 5AJUA 2FFRA 2X9GA 1J2RA 4H18A 3UGTA 3HRKA 1XRPA 3BDVA 4EKEA 2PZLA 5DSZA 4S1VA 2YTZA 5T6BA 1YVDA 2NUPA 3LUHA 5ICFA 3I0NA 2QOEA 4BV2A 3R6DA 1GT91 3UYKA 4R84A 3QPDA 2A59A 4MVCA 1YHZA 1CY0A 1V7CA 4O8CA 4TUYF 2QJOA 4U6QA 2Z5LA 3A9TA 5IANA 5DP1A 4HFNA 1UPTA 4INOA 4PGGA 2QTVA 4R6WA 1PD0A 1NG1A 1XOIA 1JBKA 5F9FA 3KG2A 3PYMA 4FT4A 4G5QA 1FYVA 4L6CA 4CTNA 4U6NA 3JVDA 3OZRA 3SZUA 1TVEA 3AV0B 4ND5A 4G8JA 1A9QA 1JKXA 5FWXA 4LF9B 2IEAA 1J07A 2PUJA 1JFLA 1NRXA 3EN0A 3D81A 3OWXA 4W5NA 1L7VC 2FQYA 5AW0A 5I47A 1AHNA 1QQ5A 1PJQA 1SCUB 1ZKMA 2OHVA 3A27A 4LSWA 3RO7A 4AZWA 2NZUG 3KOWA 4PLCA 3C1UA 3TQOA 1UBCA 1MGPA 1LU9A 2QZ9A 3EZ7A 4MGEA 2BLNA 4W9NC 4RSRA 1QK5A 1U2TA 1KP2A 5G1PA 1RM4A 2ZSBA 3HJCA 3CB2A 3HXPA 1GA4A 3NBKA 2PSSA 4AVYA 3JWHA 4ZYUA 1Q20A 3A6HA 4D79A 4S04A 4UCWA 4WDQA 3TZ6A 4GAEA 4R7ZA 3JD3A 4ECAA 1W0JA 4IUCS 3JYOA 2ZIFA 4R9SA 2GESA 3FZNA 4FKZA 1TCAA 1WHSB 2X77A 4DQUA 1H3NA 3QVKA 4MCAA 5KHAA 5F7JA 5JZMA 1XBTA 2YWDA 4V2UA 1PQYA 5JY1A 3A6DA 4CQMA 4OMUA 1D0VA 3BQ9A 3OIUA 3IMCA 4N0QA 3PJGA 3SZ3A 1MR3F 3OT4A 1IZ9A 1W8IA 2R1UA 4RXUA 1B0PA 1XC7A 3DKKA 3GLKA 3TQRA 3UAVA 4G36A 1E2IA 3VYWA 3SFZA 4DQVA 3FWHA 5DCLA 2GBFA 3P9PA 1LQ2A 5G53C 3E15A 3LTEA 1JR3D 1CPYA 1NLFA 4RWEA 2Z3WA 3VVBA 4ALJA 1N7JA 1PV1A 1T0PA 3QFTA 2Z09A 3V1NA 2AKAB 4CMKA 5KPDA 1XZJA 3QVMA 5F78A 4DRXA 3HEBA 3B89A 4BZWA 1PQ4A 3OSZA 5AOBA 4DWWA 4MJ7A 1DPGA 2BL4A 2DFTA 4QT0A 3PQ2A 1CR4A 2GK4A 2P8SA 4CMCA 2JHCA 3C15C 4HDOB 3IB3A 4XRGA 1QGZA 2ZTLA 3JASA 1UBGA 2O5RA 2OVFA 1E8NA 4I55B 1DBIA 2BZSA 4MQFA 4TS3A 4G0YA 2TS1A 4RK6A 5K4HA 2Z56A 3O4GA 4AY3A 1I2CA 2F6RA 1T9AA 2QJTA 2QX8A 2CN1A 1NC3A 1E60A 2W37A 4MRPA 4PZCA 4KXLA 1L5SA 1P4JA 2QRLA 4G5XA 1F0KA 1NSYA 4OX9B 2I4OA 3HJRA 1R9JA 4LXQA 1DT5A 1PSZA 3VYRB 2WQZA 4ME6A 4B5LA 1DIAA 1GU0A 1KMHA 1WPGA 2HA3A 3SLRA 4DA4A 2R7NA 5IZCC 2VDVE 4WBNF 1Z0ZA 2GFHA 3OP4A 2RGCA 3JQ7B 3CEMA 5HQ3B 1QV7A 1DKLA 2WWHA 4QKQA 2JBAB 2JGJA 1J6UA 3SR4A 3WLJA 5DFAA 1SXJB 3DHNA 2HA7A 3MWGA 5BOSA 4IHKA 3ZU6A 2MSLA 5CDFA 1FLVA 4AG6A 4J8PA 4YJGA 1AUXA 1M6WA 3BT7A 4N0DA 1G8YA 1SPBS 3SI7A 1CCWA 1RKQA 1DOZA 2BUCA 3B52X 3R3XA 4RUKA 5KKCA 1WUJS 3DVQX 5T4EA 2PXXA 5BUQA 1Y4SA 4UOZA 1UBRS 3T95A 5JTTA 3T5DA 4B44A 4YBZA 3NTQA 3DNMA 5EVJA 1IH8A 4DVJA 2RGDA 1BJKA 1U99A 3NIGB 2Y1WA 5G02A 3PF9A 4AO7A 1LCIA 1VE5A 2OFXA 4BP8A 2IEYA 1W5EA 4LBVA 2CL5A 4BC1A 5DM70 3H9GA 1KZ1A 2HMYB 3BTOA 1JR4A 3TSWA 2C2GA 1FVXA 3F4LA 1GU7A 1NXOA 1OXSC 2OLJA 3AT1A 3JVEA 1JGTA 2DLCX 3NC4A 4IOLA 3RK4A 3I01M 4P5EA 4OA5A 1Z6AA 3F4BA 1FYWA 2E37A 1TJNA 5HS6A 3UMVA 3TG2A 4A2CA 2C88A 4CMIA 1EVYA 4TOIA 1A8QA 4AS2A 1PGNA 3G88A 3K05A 5CLJA 1DZ3A 2P6PA 5BSGA 4AKGA 4Z5XA 8OHMA 1X14A 3P2KA 5AK3A 1TZKA 3RHTA 2FN7A 3D8UA 3A37A 2VHUA 2W4MA 2A58A 2HXGA 3NYQA 3ON5A 2I1WA 1HLGA 4MS4B 1VKOA 3KFXA 5BYKA 2BFEA 3QBJA 2GBLA 3L7AA 4BV8A 2FSVC 1KFCB 1UC4B 1YQQA 5HZHA 1RPTA 4JEMA 5JCXA 4I4CA 4C0KA 4Z2YA 3JPWA 5CM2Z 4IJVA 4F2PA 1IDOA 4LVOA 4HV4A 5BR1A 1PFYA 3W7AA 5JBNA 2RHRA 4MAMA 3SVTA 3K1TA 2ENUA 1XCMA 1ST2A 4XQ9A 3I6QA 1TUGA 1Z34A 2DCUA 4UW9A 5AYVA 1AHHA 2ZVJA 4JGBA 3CMMA 3AWDA 1FW6A 2D1TA 3ZCQA 1TX4B 1Z5VA 3BVPA 2HBZA 3ZN2A 4LJRA 1DIGA 2P77A 3OJWA 4RPCA 4OLAA 4ZD6A 5KB3A 3SZLA 4MDFA 3F2IA 4CEJB 3E9MA 3ZHOA 4XVHA 4K28A 3ZZMA 1I7SB 3VPXA 3E3MA 4QYTA 2BDTA 2WUWE 2EXXA 4QECA 1B8UA 1UANA 3MINB 3PR3A 3WZ2A 3OTOB 3U7QB 2QN9A 2PRZA 2PT7A 2H9AA 3FMOB 3PSHA 3A32A 4IRMA 4JFAA 4P4TA 1I0IA 3ZHUA 4OXNA 1PDOA 3A9RA 1GADO 1OLSA 4WLOA 5EKSA 4B17A 4BNWA 3BB1A 5JSUA 4ZEMA 4KBFA 4HPXB 4ML3A 3RASA 2P5YA 4PNPA 3DUFB 3FPFA 4DMHA 3R0JA 1YIOA 4DUZB 3R23A 2QD1A 3BTVA 2RFLA 4L3WA 4IEEA 4M49A 4MRNA 2G1KA 3C6ZA 4ZAWA 4LX0A 4CNQA 1WPQA 1D4ZA 3G2NA 3IUNA 3KQTA 1EVEA 1G0NA 1C0KA 2HDHA 3VH4A 2DE0X 1Q7CA 4DDVA 4FFWA 4KBYA 4ZHSA 2VTVA 2JGRA 3R6TA 1BU5A 3H42B 1DZIA 3IRUA 1QIMA 2PUCA 3MXOA 3F7NA 4JITA 3MC1A 4J76A 5B30A 1ENYA 1M0WA 4HWGA 1PL0A 1EWKA 3F1LA 3TUJC 2OP1A 5A4IS 3O94A 3VKHA 4EGQA 1G8FA 1O5OA 1XU9A 4GXTA 2IUUA 1XRLA 4Z4FA 3SJUA 3P4YA 3IA7A 4OD0A 2V0GA 1GRQA 1X3LA 3GLHA 3OU7A 3GJ6A 1IJKA 3WHLA 2IGTA 3HJNA 1FP4B 3ANTA 3HB7A 3PEVA 5ULLA 3ZE1B 4FXOA 4M1EA 5AVOA 3WGVA 5FX2A 3KEGA 4JFRA 2SCUA 2C96A 3EXEB 3SIWA 4QPDA 1T8UA 3IQZA 3KWLA 4MUAA 5GM1A 3R0ZA 4EKNB 3SVLA 1ORIA 1UL1X 2EHJA 1E69A 1JH9A 1I2BA 3QEOA 2BDEA 1Y3HA 4ND4A 4BNLA 4G9EA 3F6EX 3RVQA 4Q9NA 4E09A 4HSEA 2G72A 4LVUA 1KI1A 1E59A 1WXQA 5F77A 2BF4A 4HHEA 1P5FA 3IOCA 3WLSA 3ZWPA 1T43A 2KS6A 1XO1A 2WHPA 5I3CA 2Q49A 4U2EA 1AKMA 1BEUB 2AW5A 3VYVA 3FLBA 4TT3A 5MFZA 2F17A 2BEWB 1WNFA 2H7YA 2JDID 2OCXA 4RZIA 5DV9A 2FSHA 1V41E 2VK1A 1SKYB 2HA2A 4P36A 1JF8A 1PLKA 2X2OA 4RK1A 4ISBA 1NW9B 3ZC3A 2PS0A 2PX6A 3GBVA 1XZBA 4BB5A 1KJQA 4WNCA 1TZCA 4M38A 4DR2B 4TV8A 3NH9A 4AY5A 2L18A 3I0MA 3ABOB 2NU6B 3FSGA 3VPGA 2IWRA 4PSKA 3W1EA 2WPDD 1X9IA 3OKCA 3R20A 3B3GA 2NWQA 5KTSA 1T10A 3L0CA 2WJWA 2W00A 1DI0A 3UJAA 1A8SA 1HL7A 3QMVA 4ZO4A 3HPQA 5KNDH 2C92A 2EBUA 4LGYA 4PFJA 1HZZC 2J46A 3C97A 5BN1A 5DX8A 1DRJA 4Y9TA 1ISSA 1FYFA 2WAXA 5JLAA 3M4NA 1KK1A 4I8IA 4JLWA 4HDCA 4ZP1A 4OF4A 5D51S 5DE3A 4FMCB 4L72A 4OQYA 4KLCA 3KDPA 1QLJA 4UEWA 4XYGA 2O19A 3LIIA 1ZICA 2O7QA 2NZYA 3DH0A 5KTRA 3K5WA 1Q15A 3FUVA 2FQQA 2XUKA 1E9FA 3N2ZB 4CMHA 2QZ4A 2NO7A 4RAOA 4X61A 4GZMA 1RFGE 1NZJA 3D1JA 3OA2A 1R6DA 4K9DA 5JVDA 1B42A 1V95A 3A9CA 4RX1A 3UK2A 4ENWA 1JJIA 3JQ9C 2A0XA 2PV0A 4YMIA 3MM4A 4ZCPA 3FVVA 3RBVA 2MDTA 4A8JB 1EBUA 4ZYXA 4HH4A 2WTNA 4Q03A 3RUIA 1OFTA 4H7JA 4LDJA 4GDFA 2CHEA 1MD9A 4FDVA 1D9ZA 1RBQA 2WA2A 3FOBA 1S3GA 2AIRA 3REOA 3CVOA 3L1KA 2OXIA 5DULA 1T0HB 4KJXA 1LF0A 3BCRA 2YXBA 2UUAB 1WP9A 4FJ1A 4G4GA 2W4QA 4ZPJA 1MP0A 3AF0A 2PQ6A 1OFGA 3R74A 1HE4A 2I4TA 1VGVA 1LNQA 4B7AA 4C7KA 3O7MA 3RYCA 2NQ8A 1E1LA 3LGSA 4ABYA 3ZHYA 2ERCA 4E5DA 5KU7A 1X7GA 4HX2A 5IC5A 2VJYA 3OQPA 4LXTA 5KREA 4UM8B 4GVPA 5DWQA 4MO2A 1LPAB 5ALZA 2IHNA 2XR1A 2BKLA 5A4DA 2VF2A 3L0YA 5TVKA 1YRHA 3CSSA 4N5IX 1V26A 3I30X 4ZPXA 3OPYA 3ZGLA 4H6VA 3LLVA 3G5TA 1C8BA 1S1MA 3JASB 4GX0A 1QFMA 3TLGB 1TYDE 2YFKA 5EMLA 5BQ3A 1AKYA 4NCIA 3BGOS 3CM0A 4GD3Q 4YJ3A 4CQMD 1JQAA 4WESB 2OB1A 2QN2A 4IV5A 5FXMA 1ODSA 4J1TC 1EDOA 2DPMA 3FHLA 1XEAA 3T1OA 3T4PA 4QSHA 3WO0A 1W49A 2I71A 3DA8A 2RDMA 1WUHS 3HXMA 1WXXA 2WJVA 1KMHB 4UZEA 4L4SA 1MQ9A 2VPQA 3P20A 5ALUA 3KQLA 3EMKA 4NOKA 3GEBA 3HWSA 5DHTA 1GYPA 1QKJA 3BJEA 3OIFA 1F12A 1U4OA 3C14C 4TWAA 3FRJA 2JFXA 3JVVA 4GMGA 2FMFA 3UJ7A 4URYR 5A4JA 5CB4F 1G2PA 2GFIA 1A8IA 1NE7A 1N2CE 1ORHA 3CF4G 4HDKA 4PCAA 5FO0A 5JWRA 2UXCB 1Z17A 4RBNA 4IDBA 1KA9H 4X7RA 3UJ9A 2FX3A 3EXIB 1NMZA 3V1YA 2E6KA 2ZKIA 4B6RA 3V97A 1OI3A 1SZPA 2JFUA 4Y6GB 2FCAA 2PA3A 3VZRA 1ZHFA 2DGDA 1AS3A 1F6BA 2A57A 3TVDA 1ZH6A 1XQWA 2IXGA