3AQIA

H240a variant of human ferrochelatase
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADAILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title H240A variant of human ferrochelatase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 147
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aqiA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aqiA01
4KLRA 2XWSA 4CCSA 2Q2NA 2Q2OA 1QGOA 1C1HA 2PO5A 2QD2A 3HCOA 1HRKA 1DOZA 4MK4A 4KLCA 2AC4A 2C8JA 2JH3A 1AK1A 1L8XA 2XWPA 3HCNA 3W1WA 1TJNA 2PNJA 2AC2A 1LBQA 2Q3JA 2XVXA 3GOQA 2DJ5A 2XVYA 3HCRA 3M4ZA 2QD3A 4KLAA 1N0IA 2PO7A 2HREA 2H1VA 2HRCA 4F4DA 1C9EA 2QD5A 1LD3A 2QD1A 2XWQA 2H1WA 3LYHA 3AQIA 2QD4A 3HCPA 2HK6A 4KMMA 2XVZA
chains in the Genus database with same CATH superfamily
4KLRA 2B8TA 4DPMA 1RJEA 4NJMA 3MUOA 2YYYA 1OI3A 2UKDA 3FFXA 2AI2A 1JNXX 1KOLA 4PU0A 1ZS9A 1U5BB 2JGKA 4F2DA 1RC1A 1K4YA 1XKTA 2R87A 3SDBA 3WNBA 4HLUC 4RENA 1YASA 5LM3A 4QYTA 4ENQA 5AI6A 3FSGA 2O8EA 5KKAA 4R5MA 1H0RA 4AXBA 5THQA 4A0RA 2P0YA 5FQNA 1NUQA 5C1PA 1F9AA 3S7TA 4YXWD 1JQLB 4B0OA 2WIDA 5IDQA 1NHWA 3MHPA 3KRTA 2ZYDA 2FQYA 3U2QA 5HF6A 5A0TA 3BF8A 4Y1EA 4DLXA 4PX3A 2XOEA 2F3SA 2RAFA 1XGKA 3JU3A 5I9LA 2YH2A 4UEKA 1QCCA 1QB7A 5JZ9A 1WNTA 5IAGA 4J03A 1UPXA 5CXSA 2GPAA 1K3TA 3V2HA 4B7UA 1E2KA 5EE9A 1O03A 1I0ZA 5AW2A 5FLKA 5LSAA 3LXRA 1F17A 1DBIA 4I5DA 4J0QA 4KR3A 5DGHA 1ORWA 4LJRA 2FJ0A 3NRCA 7ABPA 5DYNA 4D9IA 3BB3A 5KU1A 3BX1A 2QRPA 5D1HA 1TI7A 4A36A 3AR2A 4R69A 4DJDC 5BVHB 1T13A 1J0CA 1TQ2A 4ZCRA 2V7EA 1JJIA 4C4YA 4D56A 3RAEC 2ZJ0A 1WSBA 4IVPA 9ATCA 1FLDA 3C5CA 3MTBA 3EQ2A 3ZKWA 1NUUA 3BRQA 2X9GA 5C5IA 3JTEA 1H2AS 5JJIA 3T7EA 5MDHA 1BMFA 5AVJA 1Y8RB 3GT4A 4FMCB 5FL7A 4Z7OB 1TK2A 1SG6A 1CSEE 3PPXA 5JAIA 3C2QA 3Q7EA 1CB7A 2C97A 3AOEC 4R7GA 1YCDA 3A25A 1NVMB 2FB9A 3FYUB 3L93A 1SKYE 1N6NA 1KFCB 3IV9A 3PGMA 4JEIA 3U26A 5IWAB 2DG2A 4NH0A 5KOJA 3T5PA 3W5IA 1FX0B 2VNJA 2WWIA 4BL5A 2W6ID 4L85A 2A2ZA 3RRYA 1ABEA 3EWIA 1FFXA 3F98A 3WIBA 1N2OA 1RI3A 2XE8A 2LZ0A 3LVRE 1J2UA 3OH8A 2GH1A 4CM5A 1T0PA 5AW9A 3O7MA 1E7RA 2GYWA 3I01A 1LQTA 1H8HA 4XTRA 3E8MA 4B33A 1Z5WA 4L8YA 1KSJA 1ULBA 2RHWA 2XX3A 5CT5A 2YKGA 1L7OA 3CGWA 3O21A 1RM5A 4HLNA 4Z9AA 2GM5A 4ARCA 3TLEA 3PHLA 1VIVA 1NW6A 2XEDA 4WH0A 3HB1A 5H16A 1E2HA 4ZTBA 5CK4A 1CWUA 4UD6A 1WB9A 5DP1A 2ZJ7A 3QZUA 5C8VA 3K0KA 2HF7A 5D3KA 4DB2A 3G8AA 2Q5FA 1G2QA 3FJ1A 1FXWA 4C88A 2CXOA 3CR3C 4N6GA 4KQXA 4Z4FA 2FUG1 3DUFA 4J6EA 3MCTA 3PXXA 1ISRA 2H1LA 5JAZA 1KL7A 2R96A 1I7LA 1U2DC 3EMKA 2PA0A 4OKIA 3RTBA 2BM8A 4JWKA 3GT0A 2C7OA 1M34B 1MC4A 4HEQA 4KV7A 4QATA 4F7WA 2QMOA 1JPUA 3LT2A 3WLMA 4W6ZA 4E7PA 2ABWA 2OQIA 3PUYA 2EL9A 4JIMA 4Y8VA 1TLTA 4YB8A 3V7YA 1TT5A 3M1AA 4OUKX 1P4AA 3PWSA 1TZBA 1QRSA 3KK0A 5SZKB 5COBA 1KRHA 3K1ZA 3AY6A 5L7TA 5C8DA 4N3NA 4HMQA 2II6A 2ZIXA 1RYYA 1NDQA 2Q2QA 2QM8A 4KYVA 3ZWNA 1WXXA 4EI2A 4LHSA 5DM4A 1UWKA 2PU7A 3S2SA 4KK4A 2VNAA 1K8RA 5IH7A 5KVSA 4FGUA 2CLFB 3FCXA 3VSDA 5EIEA 3RR2A 1TFUA 1ZHFA 5FJJA 2PT5A 3BTOA 3KE9A 2XHZA 4BNIA 1P1HA 4WKPA 2FMKA 3WYAA 3A6KA 1CP3A 3GD5A 3UMFA 2A58A 2L19A 3ESAA 5TIIA 1X14A 1H1DA 2VDPB 4XLTA 2CV1A 1G8SA 3PTLA 1R3DA 4W82A 1CZRA 3SMVA 3FFTA 1TF5A 1VE6A 1K89A 2QLLA 1MO2A 4Q4CA 2AGVA 4ZREA 2O0HA 3WTCA 2BR3A 3N2ZB 3OLCX 3FPGA 4MVJI 2JZCA 3CTMA 4RF4A 1Q15A 5J58A 1KO5A 1JHAA 1L5VA 4MGEA 1ZD2P 4REQB 4WCFB 4CF7A 1QP4A 3ENWA 3Q0EA 1VSVA 3WLKX 2P4EA 3ZY5A 5IZCC 5JMTA 2BE7A 3ST7A 1E3JA 4H7JA 5EZSA 2Z2KA 5C1OA 2A84A 2GYVA 4DUZB 5DLPA 1NVAA 2OXCA 5BO5A 3OX2A 5HEKA 5B1EA 3VU1A 4AM8A 1GTL1 4RAQA 4M76B 1DVRA 1I2AA 3W7VA 1JHUA 1GPNA 3URMA 3W34A 3C7CB 4KXXA 3DHWC 4G37A 4MGZR 3L8FA 3DVLA 4MINA 2O7RA 1A8QA 4PYMA 1LK5A 2WUWE 3D6VA 1VE3A 5DXFA 4ZVMA 3RAPR 3ZXUB 4EAQA 1Z0DA 4QM7A 2H1HA 1KH1A 4M8IA 1A9YA 3GT7A 4I3FA 2E87A 3DQZA 3K20A 2WSLA 3ONFA 4DMUB 1KK0A 1ZH6A 2HBYA 4ANFA 3U37A 3AEKA 5LOVB 1CJTC 1Q0PA 3PIDA 4FGKA 3DZIA 2DOKA 1JILA 3DTNA 3EGOA 3P97A 5DEOA 2VJKA 4YQFA 2WFLB 2RCNA 3EVGA 3S7ZA 2ILVA 2QD4A 3EIFA 2ECKA 3VSCA 5JY6A 2HYIC 2CZCA 3S2IA 2FMUA 4NJOA 1FSZA 2J09A 4CLRA 4JX8A 3A9TA 4BWYA 4BQFA 2QRKA 5JAPA 4FU0A 2O06A 4PS0A 5ECGC 3ZDDA 2X4GA 5CAEB 4OI4A 3WLRA 3G79A 1DEXA 3BXEA 1CKEA 3U7HB 3R7BA 2RAUA 3LV8A 4PLPA 1KI6B 4QIHA 3MT9A 4A0FA 2PKRA 4TL7A 5E2AA 4FONA 4C0AC 1XWIA 1GG8A 3FMIA 4MPPA 3IO3A 3WS7A 4DM7A 1XKQA 1J9GA 1N5MA 1WEHA 2MDTA 2V4UA 1L2TA 1N4DA 4Q34A 5HIJA 4NZ9A 4E2YA 1VL2A 3EMVA 3TTSA 1FNDA 3AESA 1EFDN 4EZBA 2ZXEA 1E9EA 1TU3A 3KEFA 3TZKA 1SKUA 3HEBA 4EW1A 2B92A 1I5EA 4WY8A 3LCRA 1O5IA 4D96A 3OBIA 1UKYA 2PZKA 4QPNA 3WO1A 1U31A 2RAVA 5G4LA 1V11B 4MS4A 3GWZA 5KVVA 4FBLA 2PMFA 4QD3A 2QJRA 3TFQA 2C2GA 4AJPA 4UM5A 5IDWA 6LDHA 4F2PA 2IJGX 3AM5A 2G0TA 3GPCA 3A6DA 4TLBA 4CU2A 4DANA 4B9EA 4QODA 2A9JA 1XFAA 3VR0A 5JS8A 1JHZA 4P58A 1QGED 4LJAA 1NTOA 5FBKA 3NUZA 2G1UA 3NBMA 5CA1A 2JGEA 1UMBA 3IQGX 1Q74A 2ZROA 3ASZA 4YRGA 3PNLA 4E51A 3AVVA 3UJNA 3OWHA 5IKOA 3MMPA 3O1LA 2AS0A 2JLAA 5BVGA 1W6UA 5LXTA 1PEKE 3E2MA 1K8ZB 1IY0A 1TL7C 3SC3A 5KO2A 1QP7A 4CKEB 4V02A 3KL2A 1EP2B 4EG3A 4CM7A 2Z1NA 1G21A 5ICGA 2FZKA 4Y2HA 3NIGB 3BK2A 1JALA 2FN7A 4G4GA 1NW7A 1PV2A 1KTVA 2QUAA 3R5KA 2JH8A 4RWEA 1HMPA 5C52B 2DMRA 5L40A 1DXOA 3UK2A 3O5AA 1ESMA 1UXJA 1FVFA 2WHRA 2BSAA 5AMXA 1TM4E 3WTBA 3AFGA 1P2UA 1VSTA 1PSWA 3GNQA 4BMPB 4IO1A 4CPDA 4KUHA 1VE5A 5A1JA 2DY1A 1JA1A 3NXKA 4DJ5X 1KWKA 1Z4JA 2D00A 1FUIA 3AUTA 4G1UC 1EJBA 4K9DA 3CEPB 4UASA 1ORRA 5JYCA 3GBSA 3LDUA 1B16A 4MRVA 4OAPA 4ZZ3A 4W5RA 1U5CA 3I76A 3ETHA 2LP4Y 3U19A 1AHPA 1G20E 4GPTA 5I9MA 2WWFA 1NQOA 3ZHOA 4RXTA 2VSFA 5DGDA 3NHRA 1NYRA 1DC8A 2V59A 3EF3A 2ZYGA 4KUEA 3EVFA 1USIA 4JAVC 2IHTA 1QG0A 3I04A 1R8YA 2WIJA 3OOSA 4F6RB 1FRQA 3KR9A 3ZVLA 5HKBA 1YA8A 4NZPA 2NYRA 5DYYA 5I9IA 1XA4A 1BFDA 5J23A 2JAXA 1Z0JA 4BMNA 1ZA2A 4Z0PA 3GP8A 1L5NA 1DJMA 2QTHA 3WNQA 1GPBA 4IPTA 4IUYA 1AQNA 4X66B 1Z29A 1EXMA 2H1CA 2XRYA 5A03A 4URXR 3IRVA 3WYGA 1DV1A 3GLFE 1YL6A 1VMKA 2A78A 2TSYB 3DYVA 3KWJA 3IUMA 4OAOA 1YE3A 3CRRA 1CR1A 3FFBA 3QHQA 4RIFA 3ZHBA 2FOLA 1T2EA 2ZIFA 4BBZA 1W8IA 3KLBA 4QUDA 5LYYA 3U3ZA 2OO3A 2F8SA 1YR6A 4ZALA 1R0BA 3FN4A 4IIJF 2IZ6A 4EOGA 3WG9A 1SCBA 1A5AB 2WUGA 2G63A 2PUBA 3GR6A 3ZWDA 1LI4A 4HC4A 5G0WA 1IXKA 3V1YA 1N5OX 2PM8A 1EINA 2K5UA 3KDSE 3RJZA 3KU1A 5JY1A 3DWFA 2PRIA 4QRIA 1Q1EA 4HN2A 4UUPA 1QH1B 2YRFA 1J20A 1IOZA 4Z4EA 1WX1A 3DKKA 4TT3A 2FZCA 1CZHA 4W1SA 2PT6A 4ZHQF 4H3KB 3IURA 4GPBA 4B75A 3X1DA 1VCOA 5BN4A 3TNDA 2VNHA 2OEPA 3B6JA 3FOBA 1RTTA 1ZM3A 2HAEA 4BS9A 5I7AA 5EINA 3HDTA 3H5AA 5HA5A 4CVNA 3IIIA 1E2LA 3OCJA 4Z4CA 3E7XA 4XX1A 1ZIPA 2C9ZA 3C7DB 4NAVA 3DMFA 4ZMSA 4RD6A 4B3FX 1EESA 4AD8A 1CZKA 1LGYA 1B42A 1O95C 3OIFA 1ZY2A 3N6XA 4PXSA 1MIOA 3EDMA 2PRJA 2WLTA 4WXMA 3ZHTA 3T99A 3K6RA 4A27A 5K8TA 4X44A 4PWZA 2RH4A 3UQYS 4BO0A 2VJLA 4LGVA 1SWVA 4WNAB 1P0PA 1XC7A 3C8MA 3QBDA 5EG5A 3LS2A 5B5SA 3KYCA 1PG5A 4IIFA 2NXEA 1U0FA 3IVMA 5DFAA 3D3EA 3WNCA 5E6UA 3G7UA 4AUKA 4CM9A 3WSTA 4P2GA 2XVYA 4RH3A 3L4KA 4HAOA 1KZ7B 1IUPA 2ZQ5A 5I01A 4BLVA 2GETA 2Y1DA 2QIPA 3HYCA 3G2HA 3E3AA 3IULA 3KQOA 4NBKA 2H6EA 1UZAA 4B6OA 1YK0A 4NYJR 1AC5A 1O6ZA 4QNRA 1D2EA 3V9AA 4G4SO 2R2GA 1TCCA 3IVXA 4OQNA 4LKRA 4XJVA 2W6NA 4JLSA 1U0HC 1RP1A 2MYNA 4FIDA 4K40A 2WWHA 4PQRA 3FXAA 1NAIA 4JC5A 1Y3DE 3S8MA 2ZSJA 3JQFA 4MI1A 4MYUA 1AQJA 1QHNA 1ND6A 2VF2A 3U17A 1UL1X 5FUVA 1E2EA 2OZVA 3QG1A 1JEYB 4JJFA 3EGDB 2Q99A 4FKZA 4J49A 5EFOA 2CL6X 3QJ5A 3W9BA 3L0DA 5FEUA 1L1QA 2AE2A 3B1ZA 4MITA 2G06A 3KZXA 2JAOA 3O03A 3ZXIA 1YF3A 3HPRA 2HHJA 5BSMA 1X80B 1ZPDA 4RKYA 4GGPA 4KPGA 4RHXA 5KYUB 1QB8A 3MCUA 3FLBA 4RA6A 4HWKA 3UUFA 1JFLA 5E1MA 1YJAA 1UJCA 1Q7CA 1TCAA 1LZKA 3EA0A 1XNJA 1J1ZA 1GKIA 1GGJA 1G8KA 1QIJA 2I4NA 2EIHA 3KEGA 4PAOA 1FW6A 1SH7A 2X0RA 421PA 1JGTA 4L1KA 5L6MB 2I1QA 2DKNA 3DLPX 4G4JA 3ROQA 4HDSA 4YMWA 1RZUA 4OJKA 3C1OA 3ZEIA 4EWLA 3SVLA 4CQMB 5K20A 2BMVA 3L7NA 4QGFA 3L9XA 3R7FA 1L4KA 3TD6A 3W5CA 1A7JA 3ESCA 1SRQA 1U9ZA 4D3FA 3DBLB 1DBVO 3AVXA 1G291 1SXGA 1XELA 3ITKA 4KW7A 4BKRA 1ZGCA 4MP8A 2H2DA 4BDSA 3BIJA 3TLGB 5CCXA 1HT2E 4KLNA 5EVJA 1KVTA 4JI5B 3QUBA 2DC1A 4QG3A 2R8XA 4XSGA 1FSFA 2XI4A 2BOVA 3M82A 4YREA 1XJCA 3H9BA 3K6SB 4IG9A 4E46A 1II9A 1PNRA 3HJUA 3AIKA 1LSUA 4JK3A 1T15A 2H2IA 1LF5A 2PTHA 1QO9A 4HAWA 4EGAA 1QGOA 4QJBA 3RVOA 4I2VA 5L3RA 1F60A 4G5XA 3DOCA 4RFSA 3ELWA 4AS2A 2JH3A 1V9LA 4XWAA 5DDIP 3CYFA 5A4FS 3KAJA 4BASA 1AO0A 1FTGA 2YQ5A 5ARBA 4PZYA 1UBUS 3MWEB 4OGFA 2BI4A 3O26A 3JVIA 3WL4A 5HQ3A 1KSFX 1NTRA 1OVGA 4NZOA 1YVEI 3QLUA 3NJ8A 1Y9EA 4IFEA 5LMUB 2CLSA 4X63A 2YRXA 4MV0A 3WMRA 1GUFA 1MN6A 3N7UA 4H3HB 4K1LA 1YJBA 2C3OA 1ZYUA 4YEDA 1TKAA 3RGGA 3UIEA 1RABA 4KXQA 1SFRA 2J46A 2P3OA 5J4YA 1K7FB 4JHXA 1AN0A 3DE1X 4S1NA 1TAUA 4ZMBA 4QDTA 1AXRA 3BK1A 4XIGS 4HQNA 2HRZA 3I5XA 2R0QC 1CFZA 2HCRA 2FN3A 4ECEA 3AF5A 1XUOA 3STYA 4BLUA 4EITA 1JLLB 3KZMA 2RHOA 4FVTA 3VO8A 5SICE 3JQEA 3EQ8A 1G4AE 3G6KA 3Q3HA 3DAPA 3EFOA 4O5AA 2GD1O 1PVOA 1EUZA 3MW8A 3VNAA 2VDLB 2QLMA 1UMCB 3DZDA 5M7EA 4KFCA 3K0FB 1ADYA 1PT8A 1WKBA 3EFHA 2J9FB 4RTMA 3EOBI 3G2IA 4CWAA 1TIKA 2FCAA 3ZDBA 3AL2A 4BQPA 1LCIA 1HYGA 1Q83A 4TT3D 5E6RB 2WNSA 4CQNA 4X6UA 1T9GR 4AZVA 1JV2B 1Q1ZA 4Y2RA 5GVRA 4MYSA 3W7AA 1ZMXA 3CVOA 4G5GA 1OH7A 5SZHB 1YUNA 3WJ7A 3AJEA 2K2WA 4YHHB 4TGLA 1USVA 1BDHA 5JWOA 3VVCA 3SU8A 1MO3A 1QQBA 4NG4A 1Q3KA 1O96B 5ALGA 4F4JA 1WCXA 2CNWA 2VHTA 3NKVA 4F3CA 1ZHHA 4X1IB 2GKOA 4HUTA 1EDEA 1HDOA 4LS3A 4ZVLA 4AMGA 1RXYA 1YB1A 2O2DA 2YJ5A 3D6UA 5JCOA 4C5BA 4BAZA 2R7NA 2ZBEA 1J2EA 1KJ9A 2ZIGA 4YJ3B 2FW8A 3MMNA 4AZWA 1IIRA 4LY0A 3UW1A 3OZWA 4PHCA 3GJ8A 1B2LA 1EX6A 3GFPA 3CIOA 4RHEA 5KYYB 4ISCA 3K70B 4CKBA 1F5SA 2X1VA 1G8MA 3NX4A 2NU8B 1M66A 4FINA 3LDHA 3QXHA 3E2PA 4G9EA 3E5NA 4HZUB 3LQ2A 3SSAA 2D2EA 4KQGA 1W46A 4J0GA 1YDGA 3UICA 2A7QA 1IBRA 3E61A 5D7NA 4LYFA 3WWPA 1CK4A 3BZWA 2C4VA 2EL7A 4FTWA 5B6JA 1F7VA 2OV8A 2VXYA 2FHPA 3K1JA 2NO9A 2VVTA 4KR7A 1KNQA 2EG5A 3TZ6A 3L1JA 1DZIA 1U0TA 2PT9A 3ZV4A 2BTOA 2W9XA 4BCDA 3D7KA 2FZGA 4AY2A 1V5GA 3RTEA 2G76A 2O14A 4JJIA 1EP1B 5CA0F 3W3AD 1XAHA 1YRAA 4O29A 2X7XA 4D45A 1Z56C 2YY7A 1PW7A 1U7DA 4N47A 2BMJA 4N65A 3QI7A 2HGSA 1DOZA 1BMDA 2OBXA 4PSUA 3TSWA 4TKMA 3BERA 3JWEA 1CF4A 1P81A 2PUHA 1Z13A 2Y0PA 3AR3A 4IGEA 3NM6B 1D6SA 3PFCA 2MJLA 4RVCA 1FMFA 5CVCA 1QV9A 3DNMA 1VXRA 3DD1A 1LRJA 4UHHA 3TIVA 1M6VA 5ENDA 4LK2A 5K8VA 1CY6A 3FCEA 3K0BA 4ZKEA 2WDZA 1J2TA 5K51A 2O3UA 2IE8A 4EF4A 4RTJA 1N3IA 5BSFA 3K0CA 5EXDA 5EJFA 3FVQA 3V4ZA 2QLNA 3VYVA 4KO3S 3EIXA 4X95A 2GHQA 4R3NA 2D59A 2MSDB 1TA0A 2ZBFA 2J32A 2VHWA 3IQWA 5IEJA 4U5XA 3G82C 2Q3EA 3WYBA 5IFKA 3ZY3A 5KYWA 3RG2A 1SQGA 3AF3A 3RYIB 3O2SB 2NQ8A 1AQIA 2CXUA 2R6JA 2H1SA 2VBIA 4L08A 6Q21A 4C7OB 2ZI6A 2WBLC 4FW9A 2CNBA 4M0KA 4FDAA 2ZZNA 2G4LA 3BGSA 4H6VA 2JJ2A 5F2OA 5BSVA 2BUBA 4KZKA 4NRDA 4ZV9A 4C78A 5AJZA 3VZQA 4D0GA 3NIFB 1R74A 2EX4A 1TPZA 1CJMA 5BQXA 4JMLA 5FP0A 3LX6A 2GGSA 1QVRA 4HNHA 3STTA 4CLDA 2FI1A 1R6AA 5ECWA 4DTCA 4G5QA 4ZV7A 5JXHA 1CF9A 3PUJA 3JWJA 4M7WA 2C84A 1UMDA 3WGQA 1MZVA 2B4AA 2AFIA 1ONNA 4MW4A 1F2UA 4OF4A 3PEEA 5T5QA 1ZQ1A 1L5KA 3V46A 4D6YA 1QXSA 2O2XA 3MJVA 1QPBA 2EJBA 2R44A 3KYJB 1MW8X 1C8BA 5BY2A 4DM4A 2RBEA 4P8RA 1KEUA 2ES4A 3NORA 1Z6TA 2X2PA 3QLVC 1Q6ZA 4GX5A 1VPDA 4RPCA 3DO8A 3IPXA 4HRYA 3ZU6A 2UUPA 1KZ4A 1XRPA 3HADA 3A1WA 3QVXA 4EMTA 2YCLA 1OMOA 1R3UA 3OT1B 2JIZD 2O20A 2WAMA 1M2GA 3P9ZA 4A2PA 3B9BA 3B6IA 4NF2A 2PUEA 3GYGA 1ZUHA 2Q6VA 4J16C 1T0IA 2A59A 1TCBA 2E7ZA 4C03A 2XUHA 4G4SP 2ZT6A 3VKFA 4DMFA 5F7ZA 4KIGA 3BSYA 2G77B 4KDRA 2OK7A 5CTJA 4AZ3B 1A98A 2YWCA 3QSYA 3HRKA 1ZP6A 1X94A 1UPFA 4KRYA 3ZZTA 4GLBA 4URFA 4UU7A 3Q5EA 2EJUA 2IH5A 2R00C 1R4NA 3FPBA 1I14A 3LC1O 5BUZA 3A14A 1VMDA 4XUEA 5CNJA 3UPDA 4CRWB 2MYUA 1PF7E 4GXTA 2BL4A 4CUZA 2HIAA 1D4ZA 1N2GA 2IW1A 1QR6A 3GOHA 2HIGA 1QIGA 4K6HA 4GKKB 4GP7A 4X8HA 1GNTA 1PN3A 3P45A 1R6VA 2XUPA 4HFNA 3FHJA 4IS3A 4L50A 5BMOA 2XUFA 4M6WA 5GJBA 2W2NA 1P62B 2I67A 3HS3A 1NT4A 1FVXA 2XWQA 2H29A 3IELA 3T8YA 1ESCA 1DCKA 4TRJA 4WQMA 4D9FA 5JXGA 5MGNA 3BJEA 5TQ0B 5ECDA 1ZZGA 2H0RA 5EVCA 3OZTA 1PSZA 1NXPA 1K9SA 3B1YA 4M38A 3L92A 1JHVA 1ODTC 2G9UA 2NU6A 4EA8A 1QVWA 3GV0A 4GNKA 1DHTA 1BQ4A 1KAQA 1ZNWA 2CNWD 2Z4SA 3PA6A 3B5JA 3R6LA 4MS3A 4Q1AA 4U02A 4UEQA 3I6ZA 3DV2A 4JXJA 1YS6A 3DUWA 3K9WA 2ADOA 4BNDB 5LIRA 1C81A 1OGJA 1GOTA 3A0UA 5A05A 1IJKA 4OJQA 3PGVA 1B1CA 3GPBA 1GPKA 4RIHA 1KZ1A 5ETJA 4BECA 4E2WA 1B8PA 5EA2A 1FP1D 3UJ8A 3GLSA 4RJJA 1E7YA 3UMVA 4FYPA 5BPHA 4B71A 1J5PA 2PANA 2VXOA 2YVUA 2IIQA 1UF9A 4LJLA 4XDGA 1GKLA 4YHBA 2PUAA 2FP4B 1JHXA 4TMTA 1OX4B 4PS1A 4UTZA 4WXEA 1WWKA 2DHDA 3LECA 2WV7A 1NBMD 2GBLC 4QRHA 3TGWA 3TXAA 4PYIA 4JYCA 4NENA 2WSMA 5IJ9B 5CDHA 1RU3A 2FSVC 3Q6MA 4JVLA 4C1BA 4Q3BA 1NJ5A 2CUTA 2IHKA 4WE3A 5EIWA 2CKMA 4MQ4A 1CNEA 3JALA 2NX2A 5H68A 5L3QB 2V3CC 5LZ8A 5EP1A 5AW1A 1OZGA 4BU0A 3OOJA 2WPDD 5LYJB 3RVJA 2JCBA 5L9AA 2PSDA 1A72A 3OPYA 3EGXA 4YBZA 5K5EA 4GU5A 5FUMA 2YMMA 3N2IA 3MA0A 5AW6A 3CT6A 5E9QA 3MGGA 5AVZA 2NVWA 5E8JA 2IK8A 4HI0E 2VJCA 3ISVA 2Q29A 3HNOA 3S99A 3H4TA 4M9QA 1JAXA 4ZQBA 3JZDA 1YB4A 4RNCA 4PCAA 2J3EA 4DGSA 1NASA 2IOQA 3P2IA 4ZYWA 5JATA 1W88A 3SM9A 4ZD6A 3ILSA 3G8YA 4IYJA 1I6LA 4R40A 1ZITA 4WZ6A 1EXNA 2YWFA 4D9CA 1CYDA 4BNFA 3H2SA 4C4OA 3LQQA 5LQUA 4HDKA 2CBZA 2VJNA 3ND8A 4EVIA 4RDXA 2WTMA 3RRMA 3WJAA 2JLUA 1RCTE 4KPYA 2ZUEA 2V7QD 1B43A 1F4LA 1M2VB 2GSDA 2GN6A 3E0QA 3PC7A 3RU2A 4B85A 3BIWA 2X0NA 2WAXA 1ADFA 4F97A 3VR2A 1T5SA 5BSTA 1SCQA 3A4MA 5ILGA 1HE4A 2DFKB 1FTSA 3UPTA 2D3WA 3U4GA 4YRMA 4NSNA 1LK7A 2HA5A 2YYSA 3SGLA 8GPBA 2FFAA 3L0IB 4ENTA 5AVVA 3G2JA 3PB3A 5TVGA 2JJ2D 1IN4A 1GFWA 3TLCA 3MC1A 1NXXA 2XMZA 3COSA 2VL7A 1OFUA 3D8RA 3WLOA 2FPPB 2Z6UA 1HDXA 1NWCA 4G63A 4WV3A 3WLIA 4BN4A 4DILA 3D8TA 2WYOA 3AHHA 4ZGBA 5BOSA 3B3JA 1PX0A 1RSZA 2HSJA 4GVLA 4JOCA 1LDMA 1M8KA 3CLTD 5EMJA 1ZU5A 5E3IA 2CXPA 5DWQA 5EIOA 1NUHA 4EDHA 3BC1A 2Z6QA 5K01A 2LCFA 4C7JA 3W1EA 2XGOA 3E9YA 1Q0LA 3HJTA 5A9TA 3FE2A 2PXXA 4NBNA 4M7RA 4AMZA 1RYDA 3HKDA 2OQVA 4LDZA 2Q6OA 4TKVA 5EWMB 3F73A 1NOKA 2KB0A 1JIQA 4Q7JB 3A10A 4RIEA 5LPNA 4AKGA 1C3VA 3E9CA 2D0OB 3QGMA 4GPD1 2JKYA 1KAOA 4YRAA 2COKA 3VUFA 1QZTA 2VJYA 3OQJA 4UDNA 2GBCA 4FHZA 4N12A 4ND5A 5T8KA 5I3CA 5TX7A 3U48A 1BCSB 2VNIA 3OO0A 4Y2JA 4YMHA 1FUEA 3DR5A 5AXDA 1NN3A 1TPYA 2YCBA 1Z9BA 4C6TA 4D41A 4D57A 1DMSA 3E9QA 3IV7A 2PUCA 1ZA1A 4IGKA 3NYRA 1R4ZA 3OLXA 3D3WA 1L9XA 4OM8A 5CLJA 4G2TA 4ZAFA 4UARA 4WK6A 3O3MB 5IMSA 2VPZA 4TZTA 1Y63A 2MYTA 3IQXA 1MFPA 2G1KA 3IHTA 3RWBA 3PDHA 2QUIA 3O4VA 4FOOA 1O9GA 3F3MA 1RDFA 2VQSA 1EJ0A 4KWEA 4K6MA 5FUYA 2AF4C 3TR6A 2AJLI 2YIVX 1W1WA 3NUGA 4GMDA 4ZI7B 4DMGA 1YQEA 3VZBA 1H2ZA 4QVIA 3GA0A 1YBAA 2C5FA 5KNCH 1MEOA 3KKNA 3WL5A 2Q9CA 4ITRC 4HLUA 4I0WB 2QT1A 4IIJA 5AK3A 1RJDA 1SHUX 1T2NA 3NEPX 3ZNQA 1MB9A 2CZQA 3L1KA 1IK4A 2R751 1NM5C 2NACA 2WM8A 1LLDA 3EGVA 3L04A 3K71B 3LBFA 2FZLA 5AJVB 5HCNA 3PBKA 2JFOA 1U6IA 1N7GA 1D1QA 2VZLA 3G0GA 4JLBA 3WGLA 3ZE6A 3JY6A 3Q2OA 4ALJA 1V3TA 2CYBA 3PE3A 1HT0A 3RAGA 1MT0A 2C7RA 3NHAA 3C6BA 4U63A 3LRXA 1H2BA 3WB1A 4ZHQA 5JNLA 4JLAA 1YI8A 3TZEA 3N5CA 3PENA 3ELBA 3EGWA 4F46A 1CQPA 4B34A 3V33A 1XMOB 3ELDA 3L8ZA 5FV4A 3WWDA 4RU1A 4MUYA 1WQ3A 1R4MA 2GPJA 4OYYA 4D8VA 4C4SA 4BBPA 2QF7A 4RANA 4HF7A 2ZSEA 3LWDA 1BCRA 4Y67A 1KO8A 5BP7A 1HYHA 2R1ZA 1IHYA 4LF8B 1Z2AA 2OZEA 3QEBZ 2FMIA 2VDUE 4ZEOA 4FC6A 5F7OA 1JTFA 4E3WA 3VRHA 5G1PA 2PH1A 2C8VA 1MEJA 3TX2A 3UN1A 1PR1A 1VA4A 4BJ6A 1SD5A 1U4OA 4J9VA 4LISA 4X24A 2XB9A 4TRNA 2VBGA 4EG4A 5KNBA 1E1QD 1B4DA 1QANA 3ND5A 1JVNA 1KY5A 3NVAA 2O0LA 3ILHA 2VPQA 2IXBA 4LWPA 3WQSB 4I50F 4UDYX 5KKNB 1C2TA 1WZUA 2AZDA 1V45E 2IHJA 3I8XA 4GD3Q 5EWLA 4YJHB 3KYIB 4NYMR 1BA2A 1JU4A 1OV6A 1X7YB 2OM2A 3OU6A 5FO1A 4ZEWA 5IC4A 4WVFA 3UWSA 4QUAA 5AJUA 2RHDA 3BXFA 3NW9A 2BC9A 2NU9B 3SC6A 2MSNA 2AR0A 3N58A 4MGYR 4O3FA 5JCZA 4K81B 3TIIA 5KAPA 5KNCA 1FTWA 1RLMA 1HRDA 1YA4A 1HK7A 3BJIC 2PXAA 3PUVA 4R8SA 721PA 3LKBA 4MR9B 2GBFA 2CVPA 3CNLA 4GAEA 2EZUA 4Q9HA 4B46A 1TEZA 4RTLA 4Q3AA 4RHTA 2ZS9A 1C5KA 2ZB2A 4RJ2A 1UP4A 2O8FA 1XN1A 2H7XA 1Y4DE 3E9NA 3F3KA 3QPBA 2EFJA 2WILA 3P8ZA 4G89A 2GPSA 3VR2D 3TLBA 1P31A 4AKHA 1DQRA 4D74A 3TSCA 3USCS 4GLLA 3S3TA 3GGOA 1RPAA 2CFCA 1G3RA 3N39C 4Y6RA 2AKAB 2QRNA 4R2WA 1NC1A 1BO6A 4WKCA 2X2OA 1KZGB 4RS3A 2WMDA 2BHRA 4WUVA 3TEMA 1RAFA 2DEUA 1H0KA 3OOYA 2EW8A 4N0PA 2Z09A 4OB7A 3WGUA 1RPJA 4QQFA 3B1VA 3PJRA 2K6GA 3FA2A 5FPSA 1GPYA 5K99A 4D1YA 3N0RA 3K53A 3PDWA 4OJNA 4KKVA 4GG1A 2QAIA 1YQ9A 4XW2A 5EHXA 4OLJA 5FWXA 2J3LA 2GF0A 5FYDA 5AKGA 3UXHA 3NI2A 3QOFA 1GU7A 1ZM7A 2AFIE 3FNGA 4NDAA 1YVUA 4OHWA 4EHDA 1JE1A 4F92B 2XVXA 4MVJD 4MQ6A 3NNNA 2G04A 3KWMA 4F60A 4MLZA 2QTGA 5C7IO 4HZGA 1BQEA 2QJOA 2VHXA 2ANBA 3SICE 4BQEA 3ADKA 1NI4A 1EX1A 4WXHA 5LLSA 2VP6A 1WCWA 2PTGA 3KVRA 3PJDA 3KX2A 1Q0UA 2QENA 2HM7A 1NJGA 2YL2A 4G5RA 4ON9A 1QHXA 3I53A 4KV9A 1O54A 1DPGA 5JXWA 1KP3A 4QEDA 3WNDA 1R00A 2O0JA 1F3LA 1JZTA 2EJWA 1WTAA 1MOSA 2H4FA 3A37A 4FDVA 4PEVA 5AI0A 4KIUA 3T0GA 1M76A 2VAXA 3FVVA 4U9UA 3WAJA 4CEHB 1LTKA 2O2SA 5CVDA 3RT7A 2WAAA 1DTSA 2OGSA 1WHTA 2RHBA 4TLMB 221PA 3D8NA 4HMOA 3I3OA 3E0XA 3EDOA 4ZTZB 1Z4OA 1BGWA 1L8QA 1X8XA 3F6EX 4H6XA 1MA0A 2HQRA 4OXIA 1SOVA 5D6OA 1RR6A 3ZOZA 4J2TA 1JIXA 2I4IA 2YFHA 3JARB 2C7PA 3RVNA 2IF2A 1Q1GA 1KO1A 4WKBA 1WXQA 1C3XA 4NZNA 2ZIVB 2HV8A 1V4NA 4EGCB 3OETA 1JMYA 1Q57A 2DFVA 3MXOA 4KCGA 1SXQA 4O4JB 4GR5A 3V8VA 4G1VA 5C4GB 2FW7A 2Z8ZA 2BFFA 1YH3A 2OD9A 3CLTC 3L8DA 4L6AA 3VH4A 1Y3AA 2ZRAA 4FR5A 5J4HA 4UATA 2G6BA 4BB0A 4IJMA 5DCLA 4QT4A 3RLIA 2OLEA 1I0LA 2CMDA 1Z6PA 1NJ1A 3KTOA 3X44A 1XROA 1J1IA 1UM9A 3GDGA 1IWOA 3WYEA 3H11B 1H9CA 1TGVA 1ZVJA 1E5TA 1WCV1 4DIEA 1PBNA 3HJAA 2Y92A 3DV9A 4Q1FA 2ZW9A 3DEHA 2ST1A 4XQEA 1MIHA 1UOEA 1W49A 1XI2A 3NJ4A 4DIDA 1ZC3A 3JS5A 2G7ZA 1PQWA 3L8CA 2C3YA 5BSUA 1D2HA 3O1JC 3E6AA 1M5UA 3B12A 1QTIA 3EASA 1Z82A 5JBNA 4GYKA 3AUAA 1XEAA 4MMYB 2BT4A 1C7EA 5KNBD 2C9YA 1HQDA 1LPBB 1I33A 4MRPA 2F17A 3D4NA 2OK8A 1GXSA 5HCUA 2XWJI 3UBTA 1WMDA 1KYXA 1QH8B 4HDOB 2X8JA 3K8OE 4DR5B 2IZ5A 3U4IA 1DCFA 4HBZA 5AUNB 2GZRA 2ZE5A 3KFXA 4NEGA 2WFMA 2RC6A 3RPEA 1EU1A 2O5RA 3C48A 3KUKA 4N7BA 1XCMA 4BE4A 4WBNF 1BN7A 2C5AA 4ZU1X 3ZQJA 3D4BA 4YJFA 3V32A 4WFIA 4YAOA 1BVYF 2VSNA 4GX0A 2LCQA 2BEVA 3QXJA 3QKRA 1UKBA 2X58A 2H5JA 2XT6A 1R6UA 1ZMTA 4UCFA 1BTOA 3I1FA 2OL4A 5TQ2A 4CI0B 4ENPA 5JNVA 4ZOQI 5HW0A 3B3QA 3H1TA 4GYJA 4AK9A 1W36B 4OH1A 3B51X 2YDXA 4J0HA 4RHFA 4YFVA 1WXGA 5KWJA 3PKJA 1OXMA 3PYXA 1YB7A 3EG9A 3R23A 4NV3A 4Y0NA 1LNSA 4GUDA 3N8KA 3Q3GE 3K5HA 1WLYA 2WWRA 4QDXA 1HZJA 1JYEA 1PLKA 2VH2A 1KRXA 1K7CA 1SN7A 2C4UA 1E0SA 3FPAA 3GP3A 4K1XA 4RZ2A 2C2HA 3D31A 1U3VA 1DBPA 1EI9A 5BSHA 3LDGA 1ZGBA 5CA0A 3V8NA 1LSJA 3QITA 5KB3A 1U4NA 3IMCA 3HUFA 5HF8A 3RVPA 1AIPA 1ZMBA 4J0IA 5KNDH 5LWHA 4C5AA 1JR2A 1ZMRA 1LLFA 3IL2A 3MOSA 3P0JA 1DEAA 1MQ8B 5PGMA 4O59O 1AH2A 5GGXA 4D92A 2CT8A 1DCMA 3B2EA 4ARZB 1TAQA 2ORVA 2V7GA 4FJ0A 3S0JA 2IHZA 4BNJA 5L4SA 2ZTHA 3SFZA 1FYEA 1Y7IA 5T6MA 5AOAA 5IK2A 3V7WA 3COWA 2HDNB 4MJLA 5HJ7A 1VIAA 2GRAA 3C4QA 1JG6A 2AC2A 2O57A 2QDKA 3QPCA 1YU9A 1SIWA 3L0BA 4GP6A 3QJYA 1KFEB 3DBHB 3M4ZA 3PL5A 4RZXA 3RROA 5I48A 4M46A 1L7BA 5DX8A 4RCZA 1N6RA 2ZPTX 1AGYA 3DQQA 3BWMA 3PUKA 3TB4A 1OYWA 4AMBA 4B44A 1T1GA 4WK0B 4OG2A 3ULKA 4IXWA 1UFKA 3QX3A 4D6XA 4J90A 5REQB 4ZPJA 4MR8A 1YRQA 3GBPA 5FQOA 4B3IA 3TX6A 4HQFA 4KGZA 4EIWA 2AX3A 1HE8B 1S3IA 1BS2A 5BN3A 4GL4A 4ZT3A 1E9BA 3FF1A 3I72A 2FUNB 3A11A 3ZDAA 4L3WA 4B82A 3MS4A 4RPKA 4RXUA 2WHPB 3ZG6A 1LBQA 3IJPA 3BMQB 2QU7A 1DEOA 3AF0A 3GN1A 3ABSB 4IJQA 4GZLA 3BCUA 2YXEA 4Z1MA 4NICA 1HE1C 4JI1B 1YGYA 3DMTC 1QVAA 3PNYA 2F1OA 4O08A 4QUGA 4AZ0A 3H7IA 1JX6A 1P33A 4O2BB 5DHPA 3FSEA 2Y1FA 4RL6A 3G0CA 4J3JA 1NE7A 3KPYA 2EBUA 4XGRA 1QP8A 1BDIA 4M9XA 3R4CA 2R1VA 5JCJA 3V4PB 5GZ1A 1EXVA 3JRNA 4LV8B 5CPBA 3HWX1 3P32A 3RHTA 4WBXC 4LOJA 5KNDA 1B0PA 5DIFA 1QIDA 1TCVA 4XH9B 5K3CA 5LDGA 1IUOA 3KT8A 5DW3A 3AETB 1Q1BA 5AKLA 3R24A 4XGQA 5AVRA 4Y2QA 3C3XA 4WNIA 4W9NC 4WHMA 1LLUA 1OPXA 1JI0A 1HQKA 2V3VA 3I73A 3HSSA 1ILWA 3LVFO 4NJEA 2GBGA 4RCYA 3ER9A 4L4RA 4UOQA 3WOHA 5THXA 1CVIA 1KORA 4JWTA 5FF9A 3RIYA 3E15A 4ETNA 4E1BA 5A1TA 4TL8A 2IUTA 3NGXA 2OHVA 3OHSX 1AMUA 3EW9A 3TCKA 3LZCA 4UXJA 5BNTA 3FMPB 1NP7A 1FRNA 2CSUA 2F90A 3SHVA 1ANKA 2D62A 4Q3OA 1L4FA 1H8EA 2AH5A 4PQGA 4RIIA 3H5RA 3T5MA 3SYRA 4RK0A 1QOZA 3OF2A 5JG7A 3S1SA 4RNDB 4EVSA 1V16A 1L5GB 4NE2A 1WDKA 3AWIA 2AIRA 3AONB 3VYUB 4RTRA 1GDTA 5AKHA 1A2KC 1VKOA 2ZUCA 3LY8A 3IUEA 3ND9A 3ON5A 1L8AA 4BC0A 4TVSA 3ZLTA 3F9CA 1BX3A 4EBFA 2P9JA 5LNK6 2B3DA 2GPNA 3OEHD 3DMHA 1JXQA 3AVQA 5KVQA 4BFVA 2Z5GA 1JU3A 4DNPA 2V65A 2J0UA 1EIWA 2J7PA 4CEJA 5E6SB 4B1FA 2C29D 4F4HA 3ZZNA 2QDXA 3LBHA 1R9MA 1FP6A 3H2YA 5C8YB 5KSOA 2DB3A 2WIAA 1RWPA 1PT5A 1TK9A 3A1DA 5DNCA 5HM6A 2PSJA 5KJ6A 2NSHA 2ZVPX 1FYXA 2V7VA 5GZ3A 2NPOA 3O3CA 2BDEA 3JPWA 4BUZA 3A06A 5ALSA 3P0EA 3F1LA 2UVPB 2B61A 2C0PA 1L3IA 3GFRA 2EYQA 1LWOA 1Z0SA 4IIXA 3A1VA 1Z6XA 3H97A 1PLJA 4L6IA 3RF6A 4C87A 1I3LA 4QU9A 2AMLA 2OY0A 1DQZA 1Y6JA 4C14A 2VTBB 1ZG3A 3KQNA 2XDQB 1IULA 4FGWA 3H9CA 1C1DA 3BGVA 1E79A 4MCJA 4QWWA 1T6BY 3LUHA 4OP3A 4PZPA 4UUBA 4QPJC 4AL4A 2OM6A 3JD1A 3IEXA 3PPWA 5IYZF 1X7XA 5CLHA 3OVMA 3ZIUA 4ND8B 2ZBUA 4FHGA 1SVUA 4TS4A 3T0IA 3LBAA 2AOTB 3AF2A 4MUIA 2IZ7A 4YT8A 5CDUA 2QQ0A 4ETMA 3W9UA 1EVJA 1RKXA 4PHHA 4LVUA 1E4OA 1QGDA 1J2JA 1XDWA 2EIXA 2XKJE 1GAEO 3DCNA 4KMSA 2BYTA 3NANA 4Y7CA 1A4RA 2GZDA 1JYFA 1REQB 2PX0A 1W2WB 3FYDA 5E8RA 5ESXA 3E7FA 3RBAA 2A9QA 2YFKA 3BKWA 2OMKA 4Z9XA 1RWOA 4ZCSA 2IL1A 4P1ZA 4DQXA 5KCZA 4YCNA 5CXXA 5AOCA 4N48A 3RQSA 4MA5A 1B8OA 5E95A 5I9NA 2Q6LA 4B6GA 4BZXA 2H85A 2W6PA 3GLIA 2OZLA 2VK2A 2JHPA 1JFTA 2QY6A 3DP7A 4ZP1A 4OHRA 4EHJA 1J21A 3M70A 4NHOA 3KLOA 4R9SA 3KFVA 3ZDFA 3MD9A 1BS9A 4LBYA 3IAXA 1LH0A 1ZM9A 3QUQA 2QTVA 3AHJA 4R1SA 2O1SA 4DIFA 4HDCA 4WZAB 4BNLA 3BMXA 1VBNA 4JLDA 2EZ4A 2FGKA 1PDOA 3GDWA 3H0CA 4DSZA 4BBAA 1YE8A 3AJAA 3LOUA 3PQ5A 3QLJA 2DSTA 2I87A 2BZSA 2I2AA 3O91A 1H9BA 2D8AA 2FPRA 2R1TB 1XDGA 2PHZA 5IEBA 1JJ7A 2ASVA 2BSQA 2J31A 3D64A 3N2GA 2R6AA 2BFBA 2OV3A 3NTRA 4ESEA 3LF1A 4FFOA 3T5AA 3LLVA 1ORVA 2NP6A 3IH5A 4TTQA 5KJ1A 3MHTA 1TVCA 3HABA 1CVLA 5U9CA 2QN3A 3GGDA 3KO8A 3VHRA 2E5WA 2NSDA 4OMCA 3SQLA 3WV4A 4ZJUA 4JJGA 1AUQA 4EW3A 2AR9A 1ODLA 3HA2A 5M5BA 4MX8A 2NO0A 4L4UA 1XSEA 5JDIA 4NXNB 3JQDA 2CHEA 2O5CA 2BD0A 1XL0A 3GCZA 2VF8A 2O2YA 3BL5A 4IINA 1WMAA 4QULA 3VR6H 3B7WA 2Z3VA 5DYWA 1JEQB 4M1SA 3HGTA 2HKIA 2IIPA 2JB9A 2ZULA 1BE1A 1N2BA 2Y2VA 3FSJX 3JWGA 5TEVA 1CQJB 4EYKA 1E8NA 1GRRA 3M6XA 2WYHA 3GRFA 3H05A 4ZAXA 3U80A 2WT9A 1AZLA 4WJKB 1FQJA 4BFZA 1GGFA 1N1GA 2E6KA 1DKPA 3ZHVA 4DSTA 3GRVA 1BXRB 1E4YA 3GW8A 4GPIB 1SCKA 4JBXA 3EXG1 2YIMA 4L3VA 2I2WA 4LDNA 2WJAA 3M5DA 5G4KB 5IHXA 5FEMA 1IM2A 2BFDA 4OHXA 2Z9BA 2RC5A 3WWYA 1XP5A 4F11A 4NX2A 2A6PA 3RT9A 3RVQA 1JR3D 3ZK7A 3P9NA 2Y99A 4BGIA 4KE9A 2E4WA 5CM8B 3C3DA 3G2MA 1ZONA 3D59A 3S2GA 1JQJC 3U6KA 1U8UA 3JATB 5I5EA 3ECSA 4A2CA 1VKHA 2HA3A 3QMPA 1MJ5A 2R47A 3AV3A 3TUZC 3MCZA 4OHBA 2RH8A 4CN8A 1BJTA 1MCZA 1SVLA 2GF2A 2HSWA 3LO5A 2IU0A 3K73O 1WDLA 3QELB 1GZUA 1TT7A 1OWNA 1P7YA 1UINA 2BEWA 3E9RA 3EEBA 4X20B 4L8GA 2HQ1A 5LLTA 2JLBA 1D8TA 1SKYB 1N34B 1NR5A 1PV1A 3CRW1 1CJCA 2PL5A 3GH1A 4EG8A 3PD1A 2GJ8A 2PJZA 3CW8X 3ZV6A 2O48X 4LSMA 3JXEA 1LC3A 1L7RA 2F43B 4HADA 1A9ZA 1CQWA 2H4YA 4EVRA 2DAPA 1P2BA 1KETA 5CB6A 4FN4A 1CEYA 3UJHA 2PEZA 2Y67A 4CIXA 2ZCJA 1JEOA 1DINA 1FDUA 4UMDA 1VJGA 2H4ZA 5ESRA 4ETIA 1Z38A 2P1ZA 1CYEA 4RY0A 3PV0A 4DE5A 4IJ5A 4G8CA 5C7LO 5A2QA 1LRKA 1P8JA 3EXHC 1SXJA 3GJQA 3KHUA 4II7A 2XUGA 4NOMA 4V0OA 5J63A 2FCRA 4H3VA 1CY7A 3R7WA 4OQZA 1VHJA 2JJ1A 1M74A 4Q3EA 1U99A 1WD5A 3JV7A 1CG6A 2FPMA 2BR5A 3PUHA 3VR6A 3DE5X 1QQAA 3JQBC 3O1IC 3OOEA 5T4HA 5HIKA 1KR2A 1IJBA 2HPHA 5JVDF 2HW8A 4TS9A 3OQVA 1Q20A 1LJLA 2WABA 3L77A 4NYIQ 3HKEB 1CUZA 3IP5A 3A7EA 4MEJA 3SY8A 4PWYA 4DMRA 2ATCA 3MB5A 4Y9RA 3OQIA 1ZDMA 1OZHA 2XYHA 1IL0A 5ELLA 4FR0A 2UXBB 2QR2A 2JIDA 3ER6A 3JQ9C 3K2BA 2Y27A 3DSRA 3GQBA 3K1AA 4I50A 2PVCA 2FR1A 3D7NA 4R1LA 4DUPA 4PLCA 4U9IS 5LJIA 1JAIA 5CYPA 4EHBA 2H4WA 5TPWA 3T1NA 1I4TD 1U9YA 1XAIA 4H4DA 3OCZA 2A9VA 2PV0A 4MWDA 4J3NA 2O07A 2UYGA 3W2TA 3ZV3A 1N8KA 1GL3A 4A2WA 2P67A 3Q3VA 1X77A 4GBJA 4PBSA 4Q9AA 9LDTA 1T26A 1KAGA 2ZSUA 1N77A 4RHYA 4CKWA 3SR0A 3B1FA 2XHEA 1CLEA 1XR3A 3KQMA 1F06A 4Z86A 3ZDYB 1GTRA 4YYZA 2C5EA 2D1TA 3CCCA 1NX9A 2D1SA 1IPEA 4HY3A 1GWNA 4DWWA 3LG2A 2QRZA 4AO7A 1ENYA 3MIZA 4FFBA 4UEOA 2O0KA 3C98A 4QUHA 1MAHA 1SVNA 3M5WA 5HPYB 3PA8A 3ZIAA 2XBMA 1BKYA 2VJPA 4OHCA 5FADA 2FUEA 1Y5MA 2FVXA 1ULSA 2OZPA 2XNCA 4FFMA 3W06A 4P3NA 4E5SA 4JUFA 1C7FA 2EATA 4GZ3A 2QTFA 4M0UA 1QS0B 3C45A 3OEYA 3C3MA 4PSVA 5BSEA 3EVAA 1YZ3A 1TO2E 1V48A 3OD1A 1FSSA 4DCPA 3R4VA 1G2PA 3K8ZA 5C8XA 1W29A 3MJRA 3A2NA 1XZIA 3HG7A 3V8RA 3DV0B 3GT3A 2IPLA 1P6XA 3ZCUA 4QUBA 3OA2A 4UMFA 4XCXA 2WIKA 4Q3DA 4HLCA 4YRBA 1WBBA 4K03A 2CXHA 2WAOA 5E7IA 3UKJA 4AZSA 1QRUA 2ANCA 1CRPA 1FYFA 5JQGF 1ACMA 4TS3A 1P2GA 1QRDA 1LLCA 4WOCA 4M87A 3RYHA 5J9FA 1IZ8A 3AM4A 4I1YA 3QLVA 2DBYA 1LDNA 2HJHA 1Z0KA 3CNBA 2LV8A 4MKHA 3LWBA 2I66A 2XNHA 3JASB 4LRXA 3QVSA 1T5LA 4P3KA 1M0TA 1W9MA 2C9BA 5CLIA 5KNLA 2B9EA 1FNNA 4XXHA 3OAAD 3ADOA 4IRXA 4OLHA 1K7XB 1CZOA 4AKTA 2D7DA 4IHKA 3H83A 5G3ZA 1VI2A 4IDFA 2WSSA 2FRXA 3FNFA 3KPWA 3O2NA 2IWRA 4C22A 3MOGA 3OZEA 1IMOA 3B2QA 3LQ4A 4HH4A 4QJ5A 4MVXA 3AB8A 3G0DA 4PLGA 1KSGA 1E3IA 5IJ0B 3GLHA 2C0CA 2V0NA 3IDOA 4ZOAA 2LCIA 3AVPA 3CZCA 3K05A 2AK3A 1NLZA 1S8OA 3QEMB 1S2DA 2R00A 3HBFA 4L8FA 4TYQA 3TQCA 3VPSA 2Y77A 4YP6A 4F5WA 1T6YA 2I22A 3UWOA 2IOHA 3FPHA 3H4IA 1I4LD 2PUJA 3DT8A 1Y33E 3ZW8A 2BMEA 2HLDA 3UJBA 3CMCO 1KAMA 3TSYA 5AHRA 3CUSA 2PQ0A 4MB2A 1EDDA 3JD2A 2IP4A 3O74A 3BFKA 2NO4A 3O4HA 4GKBA 4CCAA 2G1PA 3R2JA 4BKPA 2KYRA 3I6YA 2VR1A 3N07A 1RQ7A 3BD7A 4A8JB 5BQ5A 4D3SA 2J0QA 5B55A 2BFEB 1ZGZA 2Z43A 3T0FA 2AG0A 1OE0A 5IT9A 2ZYRA 2XZTA 3U3MA 1YTUA 4JJKA 1YE5A 2IPAB 4B48A 1HLPA 3EZ2A 4YQYA 2GSWA 3C3AA 3DFUA 1OROA 2OECA 1TYCA 2XWSA 3PITA 4Q6WA 2EZ8A 3UMRA 5K4GA 1SVOA 1N5DA 3IEUA 5CG1A 5SZIA 2NNLD 3OTOB 3ZVNA 1I2ZA 3EZNA 1D6JA 1B0AA 1D8AA 2IHVA 4ACAA 1HEYA 2ZB4A 4Z3DA 1OLSB 1QGYA 3MGKA 5GONA 4QOGA 2W93A 3FF4A 4PR0A 1UDXA 4CMHA 4RWZA 2RONA 2D5LA 3HC7A 4Z99A 4AO8A 1OYYA 4WOKA 4DV5B 1SXJD 4TX1A 3E5RA 2PV7A 1FCJA 4MUFA 2HJVA 1W96A 3QF4B 4KXYA 1FNMA 4X91A 4ZT4A 4G0NA 4UAUA 2E5FA 1IDN1 4C0WA 1CJUC 4D26A 4C0BA 5HVNA 3TQIA 5HZGA 2X0IA 5I7EA 1OB2A 5FI0B 1NVGA 2CLLB 2Z98A 3AEQB 4DXDA 1PNQA 1TC1A 2FPXA 3UMBA 4DA0A 1TM5E 2HSZA 2Q46A 4P22A 1M0WA 3C6QA 3LHDA 1Q21A 4UHJA 2IS2A 4R4JA 4J43A 3AERA 2I6GA 4WBNA 4OSEA 2I2BA 4G24A 1P2FA 3SQNA 3TL3A 3L82B 2DE0X 3EZ9A 2YFYA 3FUTA 4JQCA 4QASA 4FFSA 4YRIA 4S04A 1KPIA 3QY0A 4KBGA 3C3JA 3LUJA 1W4BA 1W35A 1VDMA 1XCOA 5J2TF 4W5QA 1LLQA 3V4LA 1MZPA 1U2EA 2BFPA 3K96A 1R7RA 3W77A 2EG9A 1UM8A 2QU8A 1APBA 2VBCA 4MVYA 4EX6A 3W5UA 1T1IA 4LZNA 4BXOB 4GWGA 4J76A 1QDUA 1RMYA 4GGOA 4V0RA 1EVLA 1FZQA 1R5JA 3R1IA 4TXHA 1DT3A 3ZZ1A 4B2PA 5KUTA 2CNDA 3NIDB 4UE3S 3MSXA 4MV5A 4R8VA 5DTMA 5AVKA 4AWXA 1GAWA 2GLXA 3T5TA 3RI3A 3I64A 3ZDZB 1H3NA 3EEFA 3RUEA 2D2VA 4YRJA 2GCIA 2YQZA 3M3HA 1VMIA 1SA0B 2QR5A 2X5KO 3IESA 2IXDA 4EYEA 1PD0A 4NP6A 2H11A 1T3LA 1TUIA 5JFOA 1UFVA 1BS1A 4BFWA 3GVIA 2XBLA 1LPSA 3UXEA 1KQNA 3REQB 1INLA 1P7WA 4D4HA 3HEAA 1QHIA 1IWBB 1Y6FA 4KQHA 1VPWA 1UAGA 3TAUA 4AICA 4DCTA 2CLDX 1F3OA 2Y8EA 3FAZA 1Z3IX 1RMTA 3N74A 4G07A 1NW9B 3QNMA 1NLFA 2OR3A 4GMHA 4HWPA 5JSHA 1BEEA 2HIHA 3GLFB 5A3JA 2W71A 2ZDGA 4NJMB 3HDVA 4H31A 1HEUA 3C97A 4CLEA 1SD2A 1G5FA 3EEQA 3LKVA 1DV2A 1KZ6A 1PVVA 1Y42X 2VWGA 4NU0A 4Q7MB 3RYFA 5ITSA 4JGGA 4N5NA 5FOSA 4MPRA 2UZ3A 1EUCB 3GJRA 5KC9A 4X3PA 4O4HF 3KT6A 2J7KA 4HFRA 5B7GA 1P0MA 4FHEA 3KM0A 1MC8A 3NHBA 3LW8A 3K2QA 1E6KA 4K6CA 4HN9A 2H1RA 3MTDA 5G1OA 3U1VA 1Z37A 1Z16A 2CB0A 3H3JA 4DR6B 2IZ1A 3KQVA 1GQFA 3VO9A 3QHPA 4HUQA 4BX2A 2LUOA 2QMZA 3GJZA 4HXFB 1I0IA 1T4DA 4ZVTA 2W42A 2R8PA 1PNOA 2CD9A 2F4NA 1Q0TA 4Z53A 1QHYA 1W30A 5CLLA 4Q00A 5U4XA 4X85A 1B23P 1XLTC 4D6PA 3MWKA 3ETDA 4D4KA 2ZUWA 5LMCA 1GCAA 1LQUA 2YNMA 2LKCA 3ROZA 2JD1A 2R8RA 3RSSA 3WYCA 2AD1A 1VZ2A 1DPFA 4JGIA 3ZDEA 3ZGXA 5DVZA 1PZEA 1KHTA 2WJYA 3PPIA 4AQDA 1KDRA 3HLKA 1T0HB 1G1MA 4G0OA 1ZI9A 9GPBA 1NOIA 2B8JA 3U3RA 3Q7TA 3BCSA 2C3MA 4ZU3A 2QX8A 1ATZA 2X6RA 5AJYA 3OFSA 4M54A 5K4HA 2GZ1A 1A9QA 4E33A 2PX6A 4OFZA 1KYWA 3ZKWB 3U7EB 3KV1A 1JUDA 4J3FA 2I55A 1Z8FA 3AOGA 1KEVA 2PGXA 3GG2A 2Z2XA 1DARA 4OQYA 4AF8A 2HWWA 4XI9A 1H05A 2PXHA 1ECPA 2NPFA 3RK4A 3GMIA 3ZK8A 1NM5A 4J1TC 1K1EA 3ZWCA 1V3QE 1SPBS 4I19A 1RAGA 3OWOA 1E4EA 3O0DA 5KOJB 4QELA 5DRYA 3SS7X 1XTZA 3UKOA 3K5PA 4HDRA 4EATA 2PH3A 2A94A 1FFXB 3DL2A 2CJPA 5COAA 1E0AA 1WMEA 3LWZA 4HYTA 5CURA 1EFRD 5LA6F 3RBXA 4BTEA 3PC8C 3OJLA 4UDXX 2I2DA 3BTVA 3KDAA 1M9NA 3OX4A 4L27A 3HN6A 3U5TA 4UTVA 1WQ4A 1Y80A 1NQAO 1IONA 1QLWA 1Q91A 1SXJE 2GCOA 3IP8A 3HZZA 3WSWA 3HVIA 1Y4AE 3NRBA 3S2FA 4LX0A 2VJMA 1NVFA 3EK2A 4Q9NA 1IN7A 4MV9A 3AVYA 3JCZA 4KNWA 1YULA 3CUKA 1DIHA 1MH1A 3JQ6A 3UAXA 3ZWWA 4YAEA 5KCMA 1B26A 1JQAA 1U7XA 3VAAA 4XFKA 4DMMA 3RRNA 3AUUA 4PONA 4UTOA 3U1TA 2JHFA 3QLTA 1Q1NA 5A7FA 1AS2A 2AJTA 4R8LA 4MGIR 5I9BA 4C20A 3IAM6 3GJ3A 1XZCA 3V97A 3WWOA 4ZCIA 5AKYA 1E5XA 3BM5A 3FPJA 4P98A 1KO7A 2I3AA 4RM3A 1QK4A 1UPAA 1BU5A 2B25A 1TNDA 2AJDA 5KJCA 4D46A 1AZSC 1JDSA 1GFSA 4HZIA 3S2UA 1ZO8A 1RRFA 3KE8A 5TNXA 3KHSA 3U9LA 4EGFA 3W4KA 3OP1A 3RGWS 1YJXA 4KQ1A 2GHRA 1XTBA 4CCYA 3T5GA 1WB5A 1EVZA 1C9DB 3LHIA 2JBAA 4WOJA 5CX1A 1IBLB 3GMDA 1BRTA 2OGWA 4G1MB 4JBIA 4NE9A 4KODA 3OLZA 3E03A 4J4HA 4DSOA 4ZK2A 4MNTA 4EA7A 5IYZA 3EIUA 3ZVKA 1E3LA 2JHAA 3UGJA 4R8MA 3IQEA 1B7GO 4TXNA 4H7KA 4TWIA 2WU3A 3CIFA 2BTEA 4ZTUB 2IGTA 1CS0B 2OCDA 3IP9A 1SD1A 1FK8A 1MPXA 3CU5A 5IT4A 2FSIA 3DNPA 5L53A 4G0UA 1CUAA 2D1RA 1IE3A 2L2QA 4JGBA 1WZNA 2G5PA 3LI2A 1CUBA 4G01B 1W52X 4GXRA 3RU9A 3M5CA 1GM5A 1P2VA 1QLHA 1DFHA 2A9PA 3MT8A 1GV0A 2XJ9A 2ZIEA 3EJWA 1Z0FA 4PZEA 1ST2A 2NWQA 3O8RA 4HQKA 1Z5VA 1JHRA 1E5DA 1EFLA 1TADA 3JAKA 3R77A 4RSGA 2AI3A 2I7CA 4HTFA 2X42A 1MTOA 3I1JA 2YHIA 3NDIA 3TW8B 2D8MA 2DQZA 3PQ8A 4JKIA 5JNTA 1UZUA 4I9NA 1NA5A 1ACJA 1QQ6A 3L7KA 5J5CA 1YR3A 1FRFS 1AKUA 5JHGB 2IP1A 1P0IA 4RDHA 1J25A 1SKAA 2IE0A 1EBFA 2JGFA 1E2DA 4J7XA 1GFZA 1L5ZA 2IY9A 3F5FA 3MGCA 4EZIA 1XVTA 3RYCA 4X92A 3RAJA 2QT9A 2ZTSA 3WDSA 3D81A 4CMKA 1Y5NA 4HNVA 3N28A 5LQDA 1P9NA 4YWHA 3SPXA 3ZW9A 4P4TA 4NQRA 1HOTA 5DYGA 4L9AA 4QJIA 3WMEA 4IDQA 4IXMA 3QG5A 4NPHA 1DXHA 1TECE 1T8RA 2CLCX 2ZRHA 2ZSIA 1Y1PA 2OFFA 4FQ7A 4HEHA 4G6ZA 3LT5A 2ORIA 2EFGA 2PJUA 2A1UB 4P82A 3UMYA 1XZKA 1N2SA 2C2MA 3DDWA 4IM7A 3C87A 4J94A 5K3SA 3PWKA 5FFMA 2Z0MA 4IIDA 4PX5A 4FE7A 2HSEA 2ZFUA 4NU6A 2E1RA 1PQYA 2WEKA 4L07A 4OIMA 1OHHA 4WOBA 4LXIA 3GDOA 4QL3A 4TN5A 1SU6A 4BJ5A 1LKZA 2CWDA 2XT0A 3MQFA 5ADVA 1YCHA 2W0MA 3O93A 4ZVOA 1E2PA 3NBKA 2H06A 2JCSA 3CLHA 2UXCB 3ZCQA 2WTBA 3GLHE 4CLRB 1TKRA 2OT3B 2Q4RA 1IAQA 4ZV4A 5AOBA 2LE0A 2Q7XA 4KLAA 4RQBA 5I8ZA 1XYYA 1Y8ZA 1KAHA 3LCCA 3O8NA 4ZRMA 4HH3C 3KWFA 2ORWA 3WK6A 3X0DA 3I9MA 5JD5A 4YTEA 3AVUA 3ZHRA 4BX3A 5EZ5A 2R4UA 1XNQB 1V6CA 1CJSA 1E5VA 2MWMA 1MKYA 2QE7D 3MN1A 4MQFA 4I3HA 5I4CA 5C8ZA 3IXQA 3UH1A 3P71T 4N40A 3RIEA 3AESB 3ZH2A 2QZ4A 1UJNA 1YBVA 2OGZA 4RMHA 1PKXA 1NVBA 2IUFA 3IPRA 3U7FB 1DRVA 3ILVA 2XNDA 5B1SA 4DLRA 1I3MA 4ASUD 1UPTA 3ZJUA 2CB9A 4WNCA 2QKYA 3VVBA 4RJKA 5JMPA 1TYBE 5I51A 2CNOA 4G86A 3C1TA 5I47A 4KSYA 2JLVA 4MS4B 2PLFA 4ND3A 4R1OA 3GCXA 2BUAA 3VX4A 5CFQA 1Y3HA 2GQ0A 1AJEA 1ZVKA 2AMYA 1ADCA 2AWOA 3AH8A 3KHKA 3RVDA 1PTKA 1X1EA 1ESNA 1ODSA 2C2YA 3NBXX 4BPRA 4YR9A 4OREX 3ZXYA 1LFDB 2WT4A 4RF2A 5TARA 1DRKA 5I3ZA 2XMQA 4G5OA 4DQDA 5L95A 1EFPB 1GTG1 2IVFA 3QUSA 5CA1B 2G25A 3VVLA 2C31A 4CIAA 1UMBB 1RWQA 1Y1TA 4Y1RA 2AKEA 5JADA 2PKYX 2Z56A 4OY3A 3CZAA 1MDBA 3EMDA 1WS6A 2GD6A 3AINA 2FW9A 2AR7A 3RKUA 5LXTB 2I71A 1YZTA 2IT1A 3CKKA 3V55A 3NQ41 2ZBQA 1L7QA 3QKUA 2CJFA 4MW1A 1RZRD 4RPHA 3HYTA 1SBCA 1E6LA 2C94A 3VTFA 1NL3A 1ZZEA 4OJMX 2HPZA 1V2GA 2VYNA 3C15C 3Q9LA 5M29A 4L9RA 5EJIA 4M0CA 2WU4A 2OQRA 1US8A 2MYPA 2FSGA 3SLKA 5IABA 3ESZA 1XZHA 1WPQA 2NU7A 3WGZA 4JT4A 1OAOA 4JU9A 5JZOA 2IDJA 1Q84A 2O8BA 1Z18A 3FYUC 4A9AA 1GARA 3N2KA 1BE6A 3JYLA 3OCUA 3R5FA 4U8HA 5JVDA 3BWBA 5B1YA 1WL8A 2L42A 4JYMA 5JPDA 1CIVA 1BWSA 1GPMA 1R2QA 2EBHX 2G0AA 1R0RE 2W98A 3RK0A 3I61A 1RRMA 2OAGA 1IOWA 4FN5A 2HLHA 2ZAYA 3B7PA 3CA8A 4ILEA 3RIGA 3S55A 2FOIA 3VZSA 3F2VA 3VHQA 1J00A 1AZWA 4FYYA 2P1DA 1KYQA 1IBSA 4PHFA 4TV9F 2R6CA 2YW2A 1N3BA 1YMUA 4K8OA 3ND7A 3R0JA 3EC1A 1OIVA 4ZO4A 3VU0A 3NVKI 5HFAA 1PFGA 1T3ZA 3RF7A 4NBUA 1XU9A 2JVKA 3WGHA 2C4KA 2XTJA 5HM8A 4IHQA 3P4YA 2J0EA 5A62A 4N5HX 1LVHA 1LVUA 2Y2UA 3SMQA 3F4LA 3W05A 2CVFA 5I7HA 1KOGA 5LBIA 1O89A 4DCNA 4X1YB 2HA7A 1R6DA 1R9NA 4XUGB 2DM6A 3W8DA 3M5PA 1X9HA 4MVJG 3CZQA 3FLMA 4UHBA 1GNVA 5J3JA 4MV6A 1M1YA 4QTUB 2VSXA 1RQPA 2QLFA 5EP3A 4WZBE 3SBEA 2QM7A 1L5FA 1LSOA 1MVOA 5LWQA 1USWA 3SZUA 3GGCA 1SHTX 5JARA 1ETUA 3GGSA 2YICA 2YVLA 2GERA 2XW6A 4H6WA 4LRYA 1U0EA 2VDNB 2GZ3A 1K3FA 3SZOA 3CVXA 3IUPA 1ML3A 1XTUA 4FB4A 2X0JA 4XPIB 1U1FA 3C7KA 3K9QO 4BRWA 3QFHA 5B57C 2MMCA 3C8HA 3ESBA 4KK3A 2SCUA 2PRSA 2V98A 1XZFA 3PEUA 4HWRA 4P33A 5EWJA 4TMXA 4NBSA 3SP1A 1KYZA 1N7IA 3AXSA 2DPHA 1G60A 2I33A 2ORYA 3DT9A 2GCEA 3G6WA 3GQVA 2XGGA 4GRDA 3M3PA 3TBKA 2WWWA 2XB8A 3DMTA 3R9XA 4E6EA 3JVVA 4IDNA 5JQGA 3PVCA 3T5DA 5IKEA 5BN4B 4ZYTA 4MQLA 3SBDA 1GKYA 2FPIA 4LTMA 5LIPA 5KI6A 4R9NA 2W2TA 2WD7B 3BJRA 4KH0A 1AK9A 3M49A 1BJKA 2RKOA 3BIFA 3T34A 3IO5A 1UWCA 3KLNA 2PPLA 1TQDA 4GRAA 3LUBA 3CX8A 4TPKA 4CLOA 4UUNA 5JSUA 2C57A 5JDCA 1XJWA 2AZMA 3NR2A 4XB6B 1VG9B 4UFPA 2I03A 1L5YA 1MIOB 2MR6A 3CBGA 3Q98A 3TW6A 1P7ZA 3GAFA 4WCFC 1BH6A 3NIWA 2WWGA 4AMUA 2EJVA 5ALKA 2Z2YA 4B4DA 1OLXA 5FLEX 2AUMA 2BRUC 1ZM2A 1EZZA 2SKDA 4EPTA 2QX6A 4MUEA 5L7WA 4W9NA 1ULTA 1E2JA 2X3YA 2I1WA 3KYCB 4GM0A 3CURA 2QT0A 2XAUA 3QVJA 4TL6A 2OBNA 3T3HA 1PZGA 3INYA 1M7GA 2JI7A 1G5PA 4U4AA 2H54A 2XNDD 3HB7A 2QTMA 3KEOA 4O2AF 1KF0A 3FI9A 3RUFA 3D1JA 3HGMA 2HUPA 4HK4A 1XA0A 2DPLA 4KAXA 4QVGA 2W2KA 4BIIA 1UPBA 2P2SA 1CQIB 3ML1A 1JDUA 3KAKA 4J7CA 4TS1A 3M1LA 3AVTA 1JG7A 1RKBA 2FEAA 1ZESA 3C24A 3OPVA 3B9QA 3GFTA 4R0NA 4KTTE 5TE9A 3I8SA 4O0LA 3O31A 5KYXA 1E3WA 4FWBA 3TQTA 3UM9A 2CLHB 5I9SA 3COJA 1H9AA 1MXFA 2J5BA 4TWZA 1XLUA 1YOVA 2YZ7A 3NGMA 4RLFA 5I5GA 3UYLA 4K86A 2F48A 4B32A 4DGQA 1OREA 4I1IA 3H2ZA 4CGZA 2D6FA 1G3MA 3AP3A 1GPDG 1TJ3A 3N8GA 3ORQA 3O3OB 3PFHA 3F71A 4P4SA 5A6SB 3V2IA 4E88A 3GVXA 1O94C 2GPBA 1T9ZA 2UZIR 2AEJA 2BGMA 2IPXA 2PKQO 4CKCA 3DDZX 4ZJPA 4H1HA 1EH5A 3CLKA 1YAJA 2BGKA 2UDPA 2GTPA 3QP9A 1ZK1A 4NBLA 4XB1A 3T95A 5G41A 1GQOA 1GTMA 4D80A 1L5QA 4GOXA 4NZMA 4Q9DA 4ER3A 5JD3A 1KBZA 4B3MB 3AM3A 1IOVA 2M2IA 1NYQA 1WW2A 2XSZD 4DIBA 3EZFA 1EG2A 2VYND 3V80A 4Z54A 4Q1CA 1PEAA 5E1BA 3NCHA 3SF8A 1D9ZA 1G55A 2C42A 3A1TA 4HDSB 3FCCA 1WB4A 2HREA 1PS0A 4PCUA 2CYAA 1J99A 4KLZA 3AB7A 4FYIA 3W8RA 3G7NA 1JG1A 2VHCA 4HAUA 1ATIA 5FBQB 4N0EA 1F4PA 3E2IA 4UPEA 3JQQA 4AWBA 2CL0X 3IUSA 3NHUA 1EGMB 1JMVA 2IYRA 3P4UA 3PQCA 4QYWA 3VYTB 4E2XA 1S3FA 2E85A 3K2EA 4JOQA 3WDMA 1X1SA 5EZYF 3ETGA 2WTEA 3NVDA 2P2ZA 1DIRA 3R6GA 4E13A 4ATNA 4DLVA 1M2OB 4D4GA 1JBQA 1XRJA 5J2TA 2P2GA 1A96A 4X6YA 1UBGA 3JX9A 2OHHA 3CEHA 1KFKB 1N0IA 4A6XA 1Z45A 4N7JA 2D5BA 2YJGA 1JTEA 4HR7A 2BFCA 3FNIA 2I1LA 4A2QA 3ZU2A 1B15A 1Z15A 2VI5A 1WQ1R 4CMGA 3P7MA 1L5OA 1AHNA 3HJRA 1XQ1A 3H2GA 4YCAA 3UFXA 4CM8A 3L8EA 5EIXA 3H99A 3QVLA 4NOKA 5UKDA 2A7XA 4N41A 1HPLA 4J75A 4L7VA 4TM8A 4UAVA 5DLDA 4DBZA 2VWPA 5H9WA 2ZKLA 1WU7A 3I92A 2F1IA 4MUNA 2DJIA 2OAEA 4O4LB 1D4AA 5HDBB 1TW2A 3L7CA 1XP8A 3NV9A 1EHCA 3QEJA 5JYEA 3UYKA 2J3MA 1F7UA 5DLYA 4KGXA 2N1MA 3BRWA 4DOMA 5FBRB 3QWIA 2RCYA 5CM2Z 3AGQA 5T57A 3W9YA 5HGJA 4GBED 2Q9BA 1W94A 3GA5A 3KZ1E 4L73A 4ZJYA 5EJ8A 3V6MA 1Y9AA 2YBEA 2PX8A 2KBFA 3R6DA 3NP7A 2RHHA 1E9FA 4BRUA 2GZHA 4HVCA 3RIXA 3CZ5A 4RABA 2Q3MA 5JRDS 2JW5A 1XVLA 2J33A 2Y9MB 4P53A 3OCVA 5EKUA 1HFEL 1MT3A 1Q0QA 1ZNYA 2FA9A 1PW5A 2PLAA 1D2RA 1LFAA 2REOA 3MWYW 3KTDA 3PPYA 3G8BA 4OQLA 5DTJA 3UTCA 4DM3A 1YFLA 2H2WA 3A1EA 4BNHA 5KPDA 2I6XA 2HFKA 4BVAA 3F6RA 3ANTA 2Z8YM 1Z5PA 1J97A 1EA5A 1OJ7A 1PX2A 2NT4A 1FBNA 2VAWA 3CKMA 3HKBB 4NAHA 2IYNA 1JF8A 5ALNA 4X6LA 3WIOA 2PX2A 1DEKA 3DT6A 3WGVA 2FZ4A 2JLYA 2B1GA 4O63O 4PBTA 4QTTB 3VU3A 2GEBA 5C1IA 1EB8A 1JH8A 2J07A 2ZB3A 1UBMS 5U1PA 2XQGA 2I6UA 5ED4A 1PQPA 1JBKA 5CFLA 4TXJA 1W7AA 1WDWB 3UT6A 1XEFA 3GFFA 4S12A 4D9KA 4KO8A 3WK5A 2AOVA 3NEYA 4MR7A 1KVUA 1H5UA 4HP8A 5KQMA 3CQ9A 1VC2A 3IHLA 1ARZA 4P7GA 4S1TA 2AN1A 4V0KA 5A5FA 5JNWA 3EGCA 4KEAA 1PL7A 5HK9A 1S2IA 1WF3A 3D3NA 2XZDA 2N3ZA 3RM3A 3J81A 3QU9A 4O2RA 1WXHA 1TQ8A 2B4YA 1ESZA 1XHEA 3CHYA 4QPZA 1CTQA 3UJAA 1B76A 3D6HA 1ZKMA 3FWZA 3PTAA 1VLMA 1R6BX 3UG7A 2QEQA 5JAQA 2QBYA 4C1NA 1H2FA 1ETHA 1XYVA 4RVNA 3FD8A 3STWA 8OHMA 3WGIA 1FZTA 2ZOSA 3ZI0A 1OBFO 1EUQA 1SKQA 1KBOA 5F5XA 4BJ1A 1E2QA 4M37A 3O8DA 2OCXA 2FQQA 3CFYA 3JQ8B 4K0RA 5AI4A 2BHTA 1N0VC 4BWFB 4RHCA 1E2BA 3CXRA 3BXGA 3FOCA 3HPQA 2D3TA 2GFHA 2FN9A 1ISFA 1ISSA 3RVRA 2ZXUA 4ZEXA 1V1MA 3WIDA 2JA2A 3MMSA 2NP7A 4PYKA 4A8HA 4HGPA 4ISBA 2G4CA 2OPBA 3RS5A 4F85A 2C2BA 3EEYA 4IL5A 4TMYA 1XEXA 3H86A 4TUYB 4BNTA 4CR7A 3QX8A 1EFUA 4KQCA 5BV1A 4RGQA 1Y81A 5LA6A 1IY9A 3VOTA 2PS0A 5HZHA 3U4HA 1M6VB 3OIYA 3EXHA 4BO3A 3LVBA 2PRYA 1OX5A 1V2HE 2ZI4A 4BCCA 2C7GA 3ZJTA 1U3CA 1QR2A 4O4IB 5AUQA 4F7DA 3G9QA 1GPH1 2QRQA 1IZ0A 2RARA 1X7WB 3Q85A 2YC2C 1VMAA 1C3OA 1KC1A 2HMWA 2XOXA 2V96A 4FMCF 4U9HS 3X2FA 1XZGA 1NBOA 2KWIA 3H87A 3JQBA 3CWCA 2XWBF 3JZMA 3LGXA 1EQ2A 2GNPA 3PXAA 4N0MA 4AAYA 4ZYZA 4TTAA 4JQZA 4WY2A 3S2ZA 3LP6A 3TIFA 2DLDA 3UAOA 2EEPA 2VP9A 3FKSD 3GUVA 1NRIA 1RLTA 3CKYA 5B30A 4Z4GA 3LIPA 3SEZA 1Z74A 3WK4A 3KQSA 4QQNA 5G02A 4Q4JA 4R2MA 2BM0A 2OP0A 1LPMA 3R5TA 5KWEA 1SK8A 2ZBGA 3K6KA 1JXOA 4BLTA 3DLAA 1VBMA 2QUJA 2EX1A 1FS5A 1E3TA 3D2BA 3PGXA 3V4VB 4DAEA 4JIGA 4BGUA 4ZGWA 4EJMA 3FDXA 2CDNA 2Z3WA 5D01A 5K6AA 5K0FA 1H3EA 3THWA 5DCWA 1UODA 1C8LA 3U44B 3OBBA 5KEIA 3CX3A 1VLJA 1F2UB 1L5HA 4H15A 1UOOA 3GCWA 1HC7A 1P0CA 2P2YA 2RGYA 3PJGA 2V6IA 2BLNA 3ECAA 5KYGA 2ENWA 1UBFA 2YJTD 4GX2A 3HU2A 3IKVA 5CCDA 4C4ZA 4E4TA 5LJLA 1XDSA 1X13A 2JLXA 3P9PA 2WOJA 3NTQA 3H7AA 3GEMA 3SJCA 2DWQA 1FSPA 1MC1A 2FWBA 2JNWA 4JCOA 5ALXA 4E1AA 1KP9A 4YUAA 1IXYA 3OX3A 5F23A 4EF5A 2REQB 2FK7A 3Q3IA 1SXPA 4J4TA 3HA3A 2F3PA 4A26A 1Y1SA 3DEIA 3M0EA 3M2TA 2C4WA 4MIOA 4XRRA 5IVDA 5JCXA 4NCAA 1DB3A 4U1RA 4KN5A 1Q0ZA 3ELUA 1P45A 1WUHS 1HL7A 1MLDA 1J70A 1GPWB 3IT0A 4EY4A 2HZ7A 2WHYA 5HOEA 1ZJWA 5DI3A 2XRMA 1V7QA 2J3DA 2QN9A 2WWXA 4KBFA 4YRQA 2O2GA 5DYTA 4EA9A 1T2FA 3K4PA 4MI9A 2AD5A 3C7AA 5EXEA 4I1VA 4BMXA 2V9CA 5A4DA 2Q1XA 2XQIA 4ALMA 1ZR2A 3GXOA 5IFLA 1ULAA 2F3RA 2PZAA 3TD9A 2XDYA 1WXDA 2PKQP 3OZRA 2VJBA 3P9XA 4W7SA 1E1RD 5HIAA 3WXMA 3RC3A 2PLWA 1PK8A 4TYNA 5JSZA 5L3SA 3LGSA 2R79A 1BYUA 1MX1A 2PH7A 4GR9A 1ZD3A 4NK5A 5IDYA 3CRQA 4N03A 2FEXA 3O9ZA 4ZRNA 5HILA 3C5EA 3AHCA 3EQ6A 3UMGA 3UO8B 3ZZMA 1QUEA 3A9WA 1XCLA 3C41J 4BO7A 5EMLA 1OH6A 1GG5A 1ST3A 3NNSA 5JFGA 3TRJA 2NU6B 3C8UA 2TMGA 3GLVA 4O3MA 1NR7A 3ENNA 2XADA 2X2EA 1ITZA 3KQWA 3FRIA 2DXIA 4MJ3A 1E8MA 3MLEA 5LBUA 5HKOA 1UIRA 5IP5A 4CL2A 1PJRA 1J09A 1ZQ9A 3H8SA 4AY3A 1IHOA 1G42A 1M8GA 1VA5A 2N0SA 4RAOA 3OLWA 1GUAA 5DYIA 2O8VA 4KMOA 3A3NA 1GKUB 3ZX4A 5IVKA 4NFHA 2QGZA 2XE7A 2EWVA 3H04A 5BWLA 1WMBA 3F9IA 5AM4A 1U8YA 2PKCA 1LW6E 2GA9A 3CX6A 2Z6VA 3REOA 5BMVA 1LRLA 2QI9C 5JJCA 4GLFA 3H17A 3GEIA 1KJIA 1P5RA 2ISCA 1YL5A 4FNOA 1BROA 3QPVA 4RD3A 1YVRA 2BAGA 2DFTA 2A9FA 2OFOA 3GUZA 1QF7A 3H2JA 3L8YA 4NESA 1XZ8A 4ZXFA 1GRNA 3O2JA 3ANLA 1MB0A 1S4MA 2ZRBA 5TF0A 3K1YA 1PFYA 1KE1A 3TTWA 3SJUA 2J30A 1Z4PX 2IODA 4WXYB 5E7JA 3ZQ6A 4RTKA 3LL7A 1PIWA 2DHEA 1O7JA 3BH7A 3JALB 4TQ9A 3DONA 4J1QA 5LOVF 4X1OA 1Z6ZA 3FMOB 2G9QA 4HDNB 4BRZA 1ZJJA 2TECE 3FFWA 3PNBA 3EGXB 2RG7A 3OEEA 3S1AA 1PGNA 5LVAA 1E3MA 3CCBA 2ZZKA 1IWPB 3QU4A 3MNFA 2H5EA 3P26A 4RPIA 4RJIA 4OKSA 3ROMA 2V5VA 3JRWA 1VE1A 1M8FA 2QNRA 4ED9A 4JVSB 4NCHA 1HTWA 1NRXA 5KHOC 4TYYA 2ROQA 5JECA 4W5HA 4L57A 3IXLA 1U3WA 1QMGA 4Q4AA 4AJ4A 4G0ZA 2VCHA 2VDQB 1RLIA 5MGBA 5BSKA 4FZ3A 4OPMA 3OIUA 4NIMA 3QVKA 3RC2A 1OTXA 5A6VA 5ITZB 4BUJA 2YOHA 2IYFA 3H9GA 2O2JA 1NLMA 4AMYA 1IJFA 1KEEA 3OG9A 3I2YX 1QYRA 3M4JA 4EH1A 5A4AA 3HI6A 2DBQA 1JRLA 2HPAA 2I3GA 3V7NA 4EUKA 3A9CA 1CRQA 3K70C 3TNLA 1U3FA 3H0EA 1RCUA 2AVDA 5DH9A 4X7RA 3FDJA 5F12A 1A2BA 1Z3CA 3KNZA 4JUAA 4B40A 4JASB 2WY2D 3ZGYA 3K5WA 2JI4A 3VO2A 5AQEA 1LTQA 5JWRA 1CUJA 2NVOA 2HJRA 3EAGA 4P0TA 3A28A 1IHPA 1ZXXA 3NONA 4Q66C 1X92A 3U9SA 4BAGA 1BH2A 2IUSA 3G9TA 2NAFA 3S8YA 2RGNC 4GMXA 4OV6B 3BD6A 1B41A 2JI9A 3M4XA 4I14A 1BIFA 4NNPA 4U0JA 1A7KA 3DCJA 2VOEA 4LV5B 5DXAA 5JAHA 5KQRA 1XD8A 3GU3A 2UYOA 5H7XA 2GJSA 1D5CA 4PG6A 5BOSB 5GJCA 1Y3CE 1FLVA 2CMKA 3LYHA 1G6KA 2O4UX 2CEAA 4ZQIA 4M7OA 4GI1A 2R7AA 5FLYA 5SYAA 1KVRA 1ODIA 3EDYA 2PR7A 4TZ0A 3H5WA 4YDQA 2FV8A 1RBYA 2PGAA 2PSFA 4FPXA