The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
98
|
sequence length |
272
|
structure length |
272
|
Chain Sequence |
b'NTSNITFIGGGNMARNIVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTEQAIKVLESGNLRELFIKALTAAVNRAKELSKTVD'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Pyrroline-5-carboxylate reductase
|
| molecule tags |
Oxidoreductase
|
| source organism |
Coxiella burnetii
|
| publication title |
Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb |
| total genus |
98
|
| structure length |
272
|
| sequence length |
272
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
1.5.1.2: Pyrroline-5-carboxylate reductase. |
| pdb deposition date | 2011-09-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent |
| A | PF14748 | P5CR_dimer | Pyrroline-5-carboxylate reductase dimerisation |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | ProC C-terminal domain-like fold | ProC C-terminal domain-like | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain |
