3TRIA

Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
272
Chain Sequence
b'NTSNITFIGGGNMARNIVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTEQAIKVLESGNLRELFIKALTAAVNRAKELSKTVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrroline-5-carboxylate reductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Oxidoreductase
total genus 98
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 3triA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3triA01
3NGXA 2G5CA 3JQBC 1LJ8A 4QQRA 3BYZA 2F00A 1ADGA 4KWHA 1UAYA 4L75A 3JYOA 4W7HA 3IL2A 3UW3A 1D8AA 1ARZA 2Z5LA 3OQBA 4UEKA 3QA9A 4H7PA 1B16A 3C7AA 4BNIA 5GMOA 3PHIA 1UDBA 1UJMA 2P68A 5BNIA 4M89A 3GZ4A 3KUXA 2HMVA 5DCWA 2IRWA 3AW9A 5CG1A 5KIAA 3PLRA 5G4KB 4NR0A 1TXGA 2V7PA 1EFKA 4II2A 2PKRA 1CETA 1SNYA 1Z82A 2YFQA 5EQDA 4NMHA 2J3HA 3TOZA 1AXEA 4WNCA 2O4CA 1DXYA 3VOSA 4BNFA 3OMLA 4BKRA 1NX6A 2CZCA 3DC2A 1J5PA 4CM1A 4J91A 3MZ0A 2X7HA 3I52A 1TVEA 1VL6A 3A28A 2WM3A 4NNJA 4WLVA 3AU8A 5CPFA 2HSDA 1ZUD1 1DAPA 2PD3A 2HK7A 5KJFA 2AE2A 1PJTA 2FPGA 3FNFA 3QSGA 5A9SB 4J7XA 4UUPA 5L45A 3ROQA 4CUKA 1LDNA 2I99A 1I3LA 4KMSA 1B26A 3V8BA 4YWJA 1GPDG 3D3EA 4ZN6A 3NDIA 5ITWA 2C59A 1NFFA 4O59O 4JGBA 2GCGA 5A9RA 5ILGA 1GZ6A 1PGNA 4CMIA 3RWBA 1LNQA 4WNIA 2DPHA 4E21A 5EINA 1N1GA 1B8PA 5TNXA 3FR8A 4B8WA 1P1KA 2EW8A 1Q0QA 3GGPA 4YJHA 3E9NA 3GEDA 4QT0A 1XQ1A 2NACA 5T6BA 2RBEA 3BHJA 1GYRA 3GVXA 1S6YA 4DBVO 3JQ7A 3ZHXA 1X0XA 2CVQA 2ILTA 1GV1A 1DIGA 3DHYA 1PS9A 2B37A 2AW5A 3GDGA 4CM6A 3FPLA 2BD0A 1N7HA 4BNLA 2D5AA 2H6EA 1UZMA 3AI2A 3R1IA 4M54A 4IJKA 4NBVA 3EVTA 4ALJA 1E5LA 4E4YA 2EP5A 1DFIA 1EVIA 4OJNA 3UGKA 2GYYA 3PXXA 1XLTA 3PWKA 1OC4A 3W6ZA 4CL8A 1B2LA 4AJJA 5G0UA 3JQAB 4WCDA 2JD2A 2C7VA 3ZHZA 1VE9A 1D3AA 4XB1A 2XXJA 1A9YA 4W82A 4H15A 4ROSA 3GDFA 3JQ6A 4PCVA 5JY1A 2PD6A 3BHMA 1KC1A 4DLLA 1RM4A 4YT5A 2ZATA 1ZKMA 3VPXA 4D46A 3H3JA 3JD3A 2WYUA 3WIEA 2JD1A 4N18A 2V6GA 2X9VA 4FIZA 1UXJA 3ICPA 3CZRA 3LC2O 5I9MA 2I6TA 2YV1A 2W98A 1UXIA 3AOGA 1U9JA 3LF2A 4CM4A 4WASA 3VH2A 1UZNA 1PQUA 3FSRA 3ON5A 4XDYA 1V3TA 4J4BA 1RM3A 1PSDA 2I67A 2JFHA 2RH8A 3HNPA 2JCVA 4YR9A 4FC7A 5DN9A 3D5QA 2E82A 4XIJA 2EXXA 2ZYAA 2OL4A 3ZNQA 2BI7A 3AOEC 1PX0A 1FJHA 2AMFA 3WFJA 1ZEJA 5A1TA 1HF3A 2PLAA 1SO8A 4CMCA 1SMKA 2AHRA 4BO3A 3DFZA 3VVCA 5CDYA 4RDHA 3OA0A 3R3JA 4HY3A 2X0IA 1PL7A 2NNLD 3PYMA 4MDHA 1SAYA 1CEQA 4HFMA 2WJPA 2O3UA 3EY4A 1LDEA 4YJFB 4A27A 2HLPA 3BZUA 2O7QA 4IDBA 1YRLA 2C2XA 3RUEA 1VL0A 4I5EA 2QYSA 4PN3A 1T2FA 3WMWA 4J1QA 4AJOA 1O95A 3C24A 1K2WA 1KERA 1ZBQA 4JCOA 2UUOA 3QWIA 3FTPA 1KS9A 4IDGA 3DBRA 3W4KA 2PA3A 2UYYA 1E7SA 2FHSA 4EEZA 3E03A 3KYCA 3EAGA 2Q46A 2Z95A 2NTNA 2D59A 4QFDA 1I8TA 1ZIDA 4HFNA 4XGNA 5TLSA 3RC9A 4EDFA 4K6FA 2AQHA 4CLRA 3B1JA 2P5YA 4GGPA 3WQQA 2QRKA 1BXGA 3A14A 3P2OA 5KVSA 4JJGA 3ZH2A 3DBHB 4PRLA 4TSKA 1WZEA 1CERA 3NJ4A 4BMSA 2ZTMA 5GY7A 1SBYA 3KZVA 4FFMA 1HE2A 2YJZA 5JBIA 1E3LA 3JQGB 4LRSB 3PHGA 1XWFA 4NJMB 2ZTVA 5CP8A 4E5KA 3AFMA 2GO1A 2PY6A 1HETA 3NDRA 4J49A 4XQ9A 1HDGO 4GX0A 4IXWA 5FYDA 3MJEA 3L4BC 1SEPA 4R16A 3UCXA 4E2YA 3C7CB 5TRTA 1DIRA 1PJ2A 4DIFA 1HYEA 1MP0A 2B5WA 4CQMA 3IKVA 4XWYA 3BTUA 4G2NA 4CM9A 1LDMA 1WDMA 2TMDA 5DBFA 5B1YA 1K89A 4TKMA 1E0DA 3WGGA 3ADPA 1MC4A 4KTTE 2GASA 3KYDB 4QXMA 2Q99A 1E6WA 4BNZA 4XIYA 4YT4A 3GY0A 3W8DA 1I30A 1GUZA 4IS2A 1WAMA 1IUKA 1WXDA 1HDRA 3GMDA 3K2EA 1KVUA 4ILKA 4Y6RA 4ZRMA 4W9NA 1N7GA 1X1EA 3TNLA 1A4IA 1ZSYA 1I36A 1GY8A 4CODB 3JV7A 3WLEA 4ND2A 4B3JA 4D42A 3QJ5A 1XYGA 1JTVA 3IDSA 4Y6SA 3LK7A 3RJ9A 4R5HA 2VUTA 3PTZA 3M1LA 5T57A 4FFLA 4IIVA 5T64A 4BQPA 4XR9A 3GUCA 4FQ8A 4EBFA 3RBZA 2O3JA 2ZCVA 3A9WA 2GRAA 4FJ0A 4WOKA 1GYPA 5I9LA 3WGYA 4QECA 4NPCA 3ZWWA 3H2ZA 5ER6A 4DUPA 1I33A 2P4HX 4J2OA 3OIFA 2G82A 2VWPA 4BS9A 1T4BA 1ZK4A 3OJOA 5K0ZA 5L4LA 1KBZA 3ZWPA 1Y5RA 1P9LA 4AJEA 1HZJA 2A35A 4IDDA 4LCEA 4Q3EA 2GZ1A 3IOYA 4IIUA 4BNUA 4FGSA 1F0YA 5IZCA 2ZIZA 4RDIA 4Y9DA 5ENVA 3WGZA 3L77A 3WICA 2Y67A 3FRJA 2PZMA 4OHUA 5IDXA 5TT1A 4JP2A 2YQ4A 2VT2A 3PQFA 4DGSA 3S2EA 1GFSA 1DIHA 2A4KA 2X4GA 2YQ5A 4WJZA 3KEOA 3DOJA 5I8ZA 4DC1A 5KKCA 5AYVA 2EGGA 4A5OA 4E33A 4GQAA 4I5GA 3LC1O 4CMKA 1XEAA 3CMCO 4RZIA 1YJ8A 5T67A 5I7EA 3QY9A 3DZGA 4D79A 4Q39A 2AQ8A 4YQYA 4P8RA 1YQDA 2C54A 3ASVA 3T4EA 3WGIA 1VJ1A 2IZZA 3LT2A 5CDUA 4BNGA 4G81A 5JDIC 4ZICA 1BXZA 4O63O 5JSFA 2TMGA 3OIGA 1RM0A 4Z9FA 3ZN2A 3F6YA 4BL5A 4PGFA 3CPSA 1KIFA 4CUZA 2PKQP 3OM9A 4CM8A 5BSEA 3M2TA 5L4SA 4IXTA 3KTDA 5JAZA 4CM9D 4MIOA 4R69A 3JYNA 5HTOA 4L8VA 2VUUA 1O9BA 2ZJ1A 4RLHA 4EEXA 4CLOA 2YZ7A 5TX7A 2R00C 4MP3A 1B8UA 4I5FA 4OL9A 4D44A 4DTIA 3ETEA 3T4XA 4DYVA 4RPJA 2GDZA 3TFQA 2GN4A 2GNAA 3RC2A 3E9MA 4NBWA 2B36A 1E7YA 4CMEC 4RJTA 2FZEA 2IZ0A 4K1LA 1GCOA 2FN7A 2E48A 3OETA 1E3WA 4KQWA 2V6FA 3V1YA 4OSPA 2BHLA 1GTMA 3LLSA 1C0IA 3JYPA 2NLOA 4FN4A 4DMMA 3IIEA 4EITA 1U5AA 2PWZA 3O9ZA 4B3HA 2UAGA 3DBLB 5ADHA 1B14A 3WB9A 4DQUA 1P44A 1E3IA 3INGA 2YDYA 2Y1DA 1LRJA 3SLGA 3IS3A 2HU2A 3D4PA 3TF5A 3TL2A 3G17A 4UUMA 3IQDB 3PQDA 1MG0A 3EGOA 3CKYA 5IG2A 1NWHA 1DIBA 1SC6A 1ZK1A 3MJVA 4FB5A 2OP1A 1U7HA 4QTZA 1EZ4A 1C1XB 1Y8RB 3MOIA 1HE4A 4BUCA 4DWVA 5THKA 1AXGA 4EW6A 3SJUA 3TL3A 3SJ7A 4INAA 4QUKA 3KLPX 2EWMA 3VPSA 1E5QA 1PJQA 4IDFA 3W6UA 1LLDA 2VRCA 4FR5A 3K92A 4IQ0A 1EMDA 2OGUA 8LDHA 3WGTA 3ZV3A 1YVEI 4PG4A 5J23A 3EZYA 4PVDA 1LX6A 1NPTO 1XR3A 3ANLA 4GKBA 2P9CA 4JBGA 4TVOA 4UREA 4CM7A 3WJ7A 3NUGA 3H2SA 3F5QA 3V1UA 3EVNA 4CR7A 1NHGA 4UUNA 4UULA 3ONDA 1SOWA 1PZEA 5KTKA 1U3WA 3M6IA 5EMHA 5A04A 4G5HA 3DZBA 1SOVA 3IP1A 5JE8A 4WEQA 1NVTA 4IINA 4WEOA 1PR3A 5COAA 5G0TA 3D7LA 2GZ2A 1PGJA 4WCFA 2HQ1A 2J5KA 2HMSA 1R12A 1HT0A 4IGFA 1CQIA 3DONA 2PV7A 1ONOA 3SEFA 4HV4A 1NVGA 4J90A 1JU9A 2IYOA 1DLJA 2AXQA 3GNTA 2Y05A 1QYCA 2GN6A 4XQGA 5KOIA 1GUFA 1BTOA 2EF1A 3GPDG 3FBTA 1T2CA 1EK5A 3O8QA 4WK6A 4H16A 4ND5A 5IN4A 3ZWNA 1E7QA 1DFHA 3U49A 1GDHA 4OYRA 4JN6B 5EESA 3RU9A 5A5EA 4XYLA 3PZBA 3ETGA 4R9RA 3PGXA 1ZMTA 3JD0A 3ZWYA 1YQXA 3IUPA 4BB6A 3CZMA 2NTJA 4PZDA 3DHNA 4E5MA 4MVJM 2IDZA 3QLJA 1N9GB 3TWOA 1CYDA 1I0ZA 5BR7A 1IZ0A 4HP8A 4CUJA 1HSZA 3ULKA 1EDZA 3ZHYA 4CV1A 1Z74A 2BH9A 2X9NA 3I9MA 2YW9A 3QP9A 3SX2A 6ADHA 5A06A 5CHEA 3JQ8A 4YQZA 2EHDA 1OI7A 2J6IA 4AJHA 5JMWA 1I10A 2O3RA 4BKPA 5L7TA 1M67A 4GX2A 3KOUA 1DC3A 1DRVA 2D0IA 2FMUA 3H9QA 3HB4X 4NBRA 1A7KA 2HO5A 1J4AA 4NBTA 3D3WA 2O3SA 2BFOA 1WVGA 4IY1A 1H93A 2R6JA 3IMFA 1Y8QA 4JIGA 4NU6A 1ENZA 3MJ4A 1UP6A 3LVFO 3LT1A 5A05A 3BMOA 1Q2XA 4RPGA 5JDCA 4AG3A 1SB8A 4DRYA 7MDHA 1C0LA 3PK0A 1BVUA 4AJ4A 1F14A 2D1YA 3B1KA 2HMUA 1DOHA 3KM0A 2EJWA 2YV3A 3TQHA 5LDGA 5IAAA 4FD3A 4ONEA 5G0SA 3W8EA 4AJPA 2ZQZA 3WNQA 3RC1A 1V9LA 2RIRA 2B35A 4PLFA 1HDYA 3DZKA 4BNWA 4CLDA 1V8BA 3NRCA 4AJ2A 1E1KA 1LQTA 1W73A 1UDAA 3AM3A 5JO0A 1ENYA 5HS6A 1U3VA 1R6DA 3AY6A 1NQAO 3ZGYA 2NSDA 4BNNA 1ZSNA 3ITKA 4GGOA 4E30A 4QSMA 5BSHA 5CEFA 2D5CA 4YT8A 1R4MB 1TEHA 3MOGA 4ZA2A 2X86A 2JCXA 3FNEA 3DTTA 1PGOA 3LLVA 2X22A 4J1TA 1W4ZA 4MP8A 1GQ2A 2ZTUA 4BO5A 1V3UA 3PDJA 2QZZA 5HM8A 4NU5A 1H2BA 2OP0A 3QWBA 2Q4EA 1TA4A 4DC0A 1E7RA 1PZFA 2C29D 4RQTA 5BNFA 3UN1A 4N5LA 1DAOA 4Z6KA 4CV0A 3WMXA 3W8FA 4GPD1 2DUUA 3ETDA 4CMAA 1LDBA 4FOOA 3DMTC 5AVOA 1P1HA 3NV9A 5DCUA 5KVVA 1NM5A 1QRRA 4HFRA 2C07A 4HNHA 1BWSA 1CRWG 1DRWA 4IDEA 4IDCA 3NDJA 4JJIA 3VPGA 3WIDA 2HK8A 1HYGA 1VC2A 3WTBA 4BMNA 1TT7A 2Y0DA 1MFPA 3WR5A 4Z0HO 3P19A 4L0QA 1RPNA 3JQBA 3K30A 3AWDA 3LYLA 3VZPA 2B69A 3O26A 1VJTA 2ZTLA 3HFSA 4PLYA 1LLCA 1NR1A 4X54A 1V3VA 1E1MA 1IE3A 2J8ZA 1KVQA 3QVOA 4ZQHA 3UAGA 3ZZNA 2DTXA 2JD0A 4FFRA 3VTZA 3WNVA 2YUTA 4YA6A 5LCXA 1EUDA 3WYEA 2NQTA 3FBGA 2UVDA 1N92A 1P74A 4BOYA 3ROPA 1C3VA 4YJGA 1UUFA 2EW2A 1T1RA 1LRLA 3WGQA 1GYQA 1XGKA 1DJNA 1Z7EA 1DJQA 1IHYA 4AJNA 1QP8A 2POQX 3VC7A 2C7GA 2YV2A 1LU9A 5H81A 1GCUA 4RLSA 5EN4A 3WGOA 3JQFC 1WMBA 1ZJYA 1NASA 3K5PA 4BGEA 2FPIA 3LU1A 4P22A 3RJ5A 5DNAA 4CQLA 1B3BA 1KOLA 2PGDA 2NVWA 1IB6A 3RI3A 1HDXA 3N7UA 3EMKA 3RAJA 3W1VA 4CMIB 3ZNNA 3AM5A 5K9ZA 2B0JA 2PGLA 3K6JA 4OH1A 4PLVA 2EJVA 1HL3A 2B5VA 4YAEA 2C82A 3FTNA 2FR8A 4YJHB 1HSOA 5C7LO 3MJSA 3RFVA 2BLLA 1R4NA 3JQ7B 4XA8A 1X0VA 4DBZA 4FJ1A 1OAAA 1QYXA 4B7XA 3GDOA 4ND4A 3H5RA 1MFZA 3H9GA 1P33A 1HLPA 1QSGA 4WLNA 4YEDA 4C7JA 4YVFA 2YDXA 4FFPA 3AY7A 2JL1A 1T26A 1PR9A 1VSUA 3GH3A 4RF2A 3WSWA 4J1SA 2GERA 1H0KA 3RROA 4ZJUA 4YRDA 1H6DA 1ZNQO 5F5LA 3GFBA 2GN8A 4IBOA 1EQUA 4XD2A 4E3ZA 3PPIA 3U4CA 4MIEA 4O5OA 4UVHA 1NR7A 3GN1A 5IZ4A 4DQVA 1JVBA 1NHWA 2ZB3A 4E5NA 5IXYA 5F1KA 1J49A 2FY8A 4RCVA 3WYBA 3HG7A 2FZWA 2Q50A 1U5CA 2XXBA 3NAQA 2FSVA 2PH5A 3FCOA 3HDYA 3Q9UA 4PG5A 2NU7A 3AUAA 2QYTA 2X0JA 1M76A 2LDXA 3NX4A 3SVTA 5TSDA 1XG5A 7ADHA 3LF1A 3QWFA 2W2KA 1YOVA 2FR1A 3OQ6A 4YJDA 4ZU3A 2AEFA 2O50A 1ZK3A 3PGJA 4RVUA 1C14A 3BMQA 4HUJA 3ENKA 4CM4B 4W99A 1O6ZA 2H9IA 4KWIA 4P4GA 3NT5A 2EP7A 5ICMA 2GPTA 4XYGA 3ONEA 3KYBA 1EFLA 1NQTA 1CJCA 1MA0A 5I7SA 4ZGWA 3DAGA 4N54A 3RFTA 2DPGA 2DAPA 4AL4A 3QQPA 2CVZA 4DREA 3IUSA 5KJ6A 2YHUA 4F6CA 4Q9NA 4KP7A 3MEQA 3COSA 2ZB8A 5FWNA 1LSUA 4JK3A 3RBVA 5JNLA 1ONNA 1T2EA 4E32A 2CFCA 4WLFA 3DBVO 3DOOA 5I7VA 2QZ9A 4PZEA 3U4IA 4XGKA 5KVCA 4MPDA 4F6LA 1EVZA 1ISFA 3E18A 2WDZA 3UOGA 2G1UA 2QX7A 4KOAA 4PLPA 1JAXA 2O7SA 4DPMA 3TFOA 2QRLA 1I3NA 5H82A 3UCEA 4Q3CA 3BMCB 3RBXA 4R4JA 4UEJA 1FDVA 1Y9AA 2XPCA 2A94A 3IKTA 3RU7A 4YAKA 3BHIA 1LRKA 3Q2IA 6LDHA 1P1IA 1OBFO 4M86A 3WXBA 1PIWA 2OXIA 3C3XA 4B4UA 4R54A 4AVYA 4A10A 4YRBA 3KVOA 4D45A 2O3TA 3WLFA 2CDAA 4IM7A 3VZRA 2HMWA 3DBRB 4TRRA 4HFJA 5JAQA 3FWNA 4RV9A 3RKRA 3VZQA 3KSDO 5G0WA 3H65A 3D4OA 3BA1A 3KSUA 1P3DA 3KYCB 3C1OA 3FNHA 1KVRA 4P4NA 4IMPA 3HDHA 2CDBA 1NVMB 1C0PA 4A03A 3VPFA 4XGIA 5EERA 4URFA 5JCXA 4FJ2A 3UVEA 4CLRB 3Q2KA 2VCYA 1U7TA 3ITDA 3ABIA 4QO8A 1BW9A 1Q0HA 3I9OA 3L6DA 3H9EO 4W6ZA 4E31A 1BXGB 1MGOA 2O3QA 3GNSA 3PHHA 5JC1A 4DPLA 1QYVA 3I1JA 5IN5A 2GR9A 1L7DA 4F3YA 2VT3A 1UXGA 4JXKA 4QFCA 3CSDA 1XU9A 4BO6A 5MDHA 3V5NA 5EQFA 1WDLA 1H9AA 3VKUA 4UAGA 5CPBA 1FF9A 1VKOA 3OH8A 4I9UA 1P45A 2VZ8A 2WYVA 2I65A 2NQ8A 2VHWA 4CQMB 2C5EA 4DLBA 3I9NA 5JYEA 4PLZA 3F5SA 3RUDA 2QQ5A 2Q2WA 3PJGA 5TQVA 4EJMA 4R1TA 5DBGA 3JQCA 1WP4A 2NADA 2G0TA 4RL6A 3DAFA 4GAEA 1GAEO 4OSOA 4PLHA 3DB2A 1DC4A 4PIVA 1LQUA 1H9BA 4UVDA 2BGMA 1KVSA 3G79A 2PNFA 2FWMX 4ALKA 3GOHA 1XSEA 3NKLA 3FN4A 2YYYA 4ZQBA 2XOXA 4BVAA 1ID1A 5H83A 1D1TA 1WZIA 2GLXA 4LMRA 4OQZA 1PJBA 1XDWA 3U4DA 3UICA 3OJ0A 4BO7A 1XQ6A 1ZEMA 3GF4A 4OMUA 5A3VA 4LRTB 3AUUA 1A72A 2X5OA 1V35A 1H5QA 2JHGA 3JD1A 4U6SA 3TDKA 4FOSA 2JFFA 1K6XA 4GLOA 1DLIA 1CWUA 1BMDA 1HXHA 1U8XX 3I3OA 4MVJA 4EUHA 4TRNA 4E12A 4W9NC 4E2XA 3H9UA 4XRRA 1PTJA 4U6QA 4CMJA 3OECA 4E2WA 2B4TO 1YO6A 4PLGA 4XJSA 3V2UA 2OOSA 1UXHA 5T8KA 1YE3A 3DZFA 2VWQA 1I3KA 3NT4A 2OMEA 1WMAA 3WOHA 3KEQA 1EBUA 1YBVA 5JMPA 3UKOA 4YYZA 2WSBA 2I3AA 1GZ3A 3NTQA 1TLTA 3U4HA 1YONA 2GSDA 5KKAA 5B4VA 4DIOA 3GZNA 1EUZA 3GPIA 1ZK0A 4IPTA 5A3JA 3QVTA 4HXYA 4YAJA 5TGDA 4HBGA 5DZSA 1I5RA 1EDOA 2YHIA 2HRZA 4E5PA 2VUSA 2OUIA 2Z1MA 2VHVA 4I1IA 2PKQO 3A1NA 3F47A 3W4JA 5DCYA 1PJSA 3Q3CA 4Q3BA 5B4TA 1ADCA 4D3DA 4ZRNA 1NQ5A 1EQ2A 1E1NA 4XYEA 5I8WA 4TZTA 3HDQA 4XX0A 1BXKA 3O03A 1VKNA 3PJDA 1XA0A 3GAFA 4NFSA 3K9QO 4WECA 4WUVA 1JVSA 1G6KA 3KRTA 4LW8A 1CIVA 2AG5A 4C4OA 4CM8B 5AXAA 1QKIA 2VTDA 1KEWA 2H1SA 4ALMA 5JW6A 3K73O 1U4OA 2P4QA 4TROA 4CLOB 2WE8A 3TZCA 4CMHA 4Z3KA 3VH1A 2NM0A 4RF5A 4CV3A 2X6TA 1YDEA 2Y1OA 4NZ9A 2WEKA 1PEDA 1Z73A 3X2EA 2GGSA 3PYXA 4KUEA 2H5LA 3UCFA 4DLAA 3R6DA 4LN1A 2Q2QA 4LK3A 4CL3A 2VYNA 1DRUA 2D3TA 4NFYA 3LSYA 1FMCA 1QV7A 5DOVA 1EEHA 2YFHA 4EZBA 4HADA 5U1PA 3FI9A 2NVUA 4JJFA 1E3WB 1NQOA 4F45A 1ULSA 1NTOA 1CDOA 1LUAA 2R00A 4JQCA 4Q3DA 4QEDA 4MOWA 2Y1CA 3GR6A 2X0NA 1ZXLA 1OFGA 2FSSA 4BNTA 5CEJA 1BRMA 3BMNA 3GGGA 3DTYA 3M2PA 3MCVA 3ZWVA 3OICA 1OMOA 4MVJD 1B7GO 4MVJG 4B7UA 3MTJA 1GU7A 3QHAA 3F46A 1E77A 3HE3A 4CPDA 1D7OA 3PRJA 1MB4A 2B83A 1X1TA 3F1KA 3QRWA 4LSWA 3WQSB 2DUWA 1GR0A 2HRBA 3PZRA 2JFGA 1LDYA 1LTHR 3O4RA 3HFGA 1ZW1A 1O94A 3MJTA 4IS3A 4GVLA 3VKVA 4J4HA 4ZVVA 4NH4A 4TMFA 2Q45A 2VNAA 3TZ6A 1PZHA 5FI3A 1HRDA 1EE2A 1YL6A 3GAZA 4M8SA 3UUWA 1DC6A 5IF3A 4NHEA 1HDCA 3CH6A 4IUYA 4GBJA 1X13A 4I9NA 3TJRA 4Q3AA 4B3IA 3INRA 2HDHA 3FF4A 1T2DA 4B4WA 2EKPA 4GWGA 4UVEA 4OM8A 3ZWXA 1E6EA 1P1JA 3ST7A 4L4SA 4G65A 2O23A 5CFZA 5L3ZA 5HS4A 4J7UA 3GG9A 3GLQA 3O38A 4XQEA 3JQ9A 1PU2A 4HNGA 3ADOA 4WCFB 1BHSA 2Y99A 3K2BA 3QWAA 4L73A 3L9XA 4LISA 4YB8A 3S55A 3K96A 2Y0EA 3G0OA 3UHAA 2AEMA 3CINA 4S1VA 4XEHA 5THQA 5EJ2A 4YXFA 1K6IA 4R41A 3EC7A 4XQCA 1PWXA 4DIBA 1M6HA 2E37A 3F3SA 3IC5A 2DQ4A 4PLCA 1B3RA 4K26A 4O1MA 4J3FA 3ZU5A 4ZHSA 2IXAA 2DLDA 3O8QB 4U0JA 1U4SA 1YL7A 4RGBA 4LSMA 4WCFC 2VYND 3SXPA 1LI4A 3RUCA 4A7PA 3L6OO 3DWFA 3G1TA 2I9PA 4E0BA 1EBFA 2NU8A 1UAGA 2VRBA 3RC7A 3L9WA 1MXFA 2F1KA 1ZH8A 4OQYA 4TQGA 1Y81A 5A9TA 2ZK7A 1TT5A 2JHFA 3E6AA 4BQRA 1BGVA 4K9DA 1IOLA 3IP3A 3DXFA 2X0RA 2VWHA 3E82A 1E3SA 2PZJA 3CE6A 3JYQA 4PLWA 3UXYA 4PG7A 3ZV5A 4KDFA 3ANNA 2A9FA 3PFFA 3WJAA 4BNYA 4CLHA 4IQ8A 3JYLA 4D0SA 1ZXBA 3JQ8B 4Y6PA 4PZCA 4P38A 4PRKA 5K6AA 3AI3A 5JLAA 4C7KA 1K5HA 1B15A 2RCYA 4W4TA 1NWCA 2UDPA 2VYVA 4NQZA 3GRKA 1PGQA 3GVCA 3FPCA 3AI1A 3D3WB 5DP1A 2O2YA 3IJPA 2JJYA 4B4OA 2ZKLA 1NYTA 4DPKA 2HCTA 4FFNA 1Y8QB 5CAEA 3I9JA 1ISGA 1DEHA 2CVOA 4CR8A 5JAIA 3GVIA 2VQ3A 1I2ZA 2WMDA 3BMOB 5COQA 3ZNPA 5I7FA 4J16A 1BSVA 1WPQA 3DR3A 4D41A 3RSHA 4GX5A 1LC0A 1Q7BA 4E13A 1MG5A 4BO1A 1WLYA 1QYWA 5JFOA 2R2GA 1T24A 5C37A 4ESOA 3UF0A 5IJZA 2GZ3A 2NUAA 3I83A 4L76A 3QVWA 1F8FA 2Y1FA 3I23A 2WD7A 4JBIA 1PJ4A 2HUNA 3D5TA 5HWSA 1S7CA 3GHYA 2JAHA 1R15A 2V6BA 1U8FO 2ZYGA 3L4SO 2CY0A 3WSVA 4R3WA 3ASUA 4RORA 5FEUA 4OIMA 3HN2A 1LA2A 2HMTA 5B37A 5FI5A 4RPLA 2RHCA 4YTEA 1MXHA 1L7EA 3SBOA 5AXCA 2FP4A 4GSKA 2Y1GA 3M1AA 4ND3A 3D4NA 2C0CA 2DVMA 4D7AA 2FPPA 1HKUA 3ROMA 4YACA 3R3SA 1G0NA 3PWZA 4BO0A 1ADBA 3WDSA 4RVHA 2O48X 1XELA 4R1NA 5U4QA 2FR0A 3ROKA 3OEWA 5L51A 3WBBA 5BQFA 1DB3A 1ENPA 1RWBA 5AQ1A 2Q1TA 3GVHA 5DP2A 4JX8A 2BELA 4M1QA 5LDHA 3ENNA 2Y93A 1JN0A 2OORA 2Q49A 2IZ1A 4J9UE 3VDQA 2X23A 2QW8A 4PVCA 1QG6A 3AJRA 4I9HA 4XCVA 2E4AA 1LDGA 1R4MA 3GEGA 4NJOA 5BNTA 3DMTA 4BNJA 5KVQA 2Y0CA 3D0OA 2QIOA 4BO9A 3ZWBA 1LC3A 1MV8A 3GEMA 5TS3A 3WYCA 4BNMA 4I8XA 1NXQA 4DL9A 4RVDA 4YAGA 2AQKA 5L7WA 2VYVD 5KJCA 2BKAA 1U2DA 3P5SA 1N2SA 2XAAA 1YWGO 3P7MA 1V0JA 4KUGA 1CQJA 5BT9A 4WPGA 3GHHA 3Q11A 4Z9XA 4UUOA 1E6UA 4Y98A 3EW7A 1C1DA 3B6ZA 4BNXA 4FCCA 4ZD6A 3OHSX 4OKNA 4BMVA 1Z45A 5HBRA 2BGLA 4AJ1A 3ONFA 3LC7O 4AJKA 3E9QA 3WWYA 4ALIA 5JY6A 3WBFA 3PDUA 1W8DA 3OF2A 2AE1A 4GSLA 3H9JA 5C7IO 1IYZA 3QIVA 4YBZA 3C1TA 5C3MA 3IJRA 1LEHA 3OQ1A 4OKIA 3ZV6A 1BDMA 4CQLB 2JCYA 2ZCUA 4NG5A 5FF9A 3VVBA 2V6MA 1D4FA 1YL5A 3BIOA 3HQ4O 4Z3DA 1AHIA 4RF4A 2EV9A 1JWBB 2VZ0A 4YCAA 1VRWA 2O4UX 1GV0A 1JA9A 2PR2A 3GUYA 4FS3A 3JQEA 4L74A 1YB1A 5BSGA 1R0SA 5B12A 3JQFA 5G4KA 4TKLA 5DBIA 3H5NA 3ZCXA 3LQFA 3CMMA 3SC4A 2I76A 3B1FA 3ZHBA 3JSAA 2NU6A 4PFJA 1KY4A 2Q1WA 3LT0A 3HSKA 4OXNA 1WW8A 3F1LA 4L9RA 5HRUA 1OZAA 2J3IA 3L6EA 4B7CA 1R4NB 1VSVA 1ZVMA 1F8GA 1YJQA 3L0DA 3PIDA 3PJEA 1I2BA 3K31A 5KJEA 2VOJA 4PLTA 1DPGA 5JXWA 3DL2A 5BSFA 1FK8A 1Y5MA 4OOEA 4KZPA 4K6CA 1GD1O 4JNKA 8ADHA 3T7EA 1T4DA 3H8VA 4BV8A 3OJLA 4ZQFA 3TN7A 3V2HA 3HUDA 3S8MA 1NAIA 2CDCA 3JQDA 4EYEA 5A9SA 2CF5A 2CUKA 4Y8VA 2C20A 5JCJA 1KEUA 1XCBA 4GL4A 3RUIA 4BO2A 3VTFA 2IODA 1X7HA 1AHHA 1G1AA 3AUTA 1NFRA 2WTBA 3RD5A 4HX5A 1IHXA 1UZLA 1X7GA 5A5FA 2JAPA 3OP4A 1M6WA 3UFXA 3A06A 1PJCA 3ZI0A 1ISIA 3ZU3A 4RPKA 1PJ3A 4KQXA 3RUAA 3MJCA 3G3EA 2ET6A 1OC2A 3R0IA 2Q4BA 3BAZA 4BKQA 4R1UA 3HJAA 1NPDA 2W2KB 1YOVB 3ZU4A 1MC5A 1HE5A 1ORRA 4GMGA 3JD2A 2EEZA 1AN9A 1YGYA 3C1AA 4YPOA 2P9EA 1R0KA 3V2GA 3RUFA 5F3RA 5AXDA 3BMQB 3S2FA 4OO3A 1LLQA 2Y68A 4QX6A 2B4RO 3FHLA 3OA2A 2EKQA 1M75A 2GN9A 2H63A 4OOFA 4U5QA 3I6QA 9LDBA 2X5KO 5DOZA 5TJHA 1PQPA 2QHXA 1N8KA 3E5MA 3OIDA 2CNBA 4MKXA 4CJXA 3I6IA 4JLWA 4LGVA 1GADO 4GI2A 1ZSVA 3F9IA 3ICCA 4RO0A 3TZKA 5DT9A 4J6FA 4WKGA 3V1TC 4IDAA 3H7AA 4I08A 3JQAA 1BDBA 4II3A 2PD4A 9LDTA 2NWQA 1AUPA 2HKIA 2WE7A 5GZ1A 1DO8A 3P2YA 3VPHA 1KC3A 4RVGA 4D3SA 2BF7A 4MVJF 4CV2A 4CMBA 1AE1A 4TRMA 1LBEA 2C2YA 1T25A 4J43A 2HAEA 3KXDA 3BTOA 3I9LA 1HYHA 4AFNA 3U3XA 4DQXA 4IQGA 4UVGA 1YB5A 1ULUA 3AOEA 2VTEA 5IDQA 2DFDA 2UUPA 4R1SA 3E48A 1I2CA 2D4AA 2NV6A 4XR4A 4NK5A 1QYDA 5IXSA 3UH1A 3D1LA 3ANMA 3C8MA 4TVBA 3G49A 3RASA 1T1SA 3PHLA 3H5AA 3PLNA 4XB2A 3WWZA 4O0LA 3I5MA 3DZIA 4LVCA 1HWYA 2VZ9A 1DSSG 3N74A 1ONPA 1PS0A 1ZJZA 3RKUA 1QLJA 5JCJD 4XYBA 4OGWA 4UEOA 3S2IA 3BMCA 2OBNA 1BW9B 1V6AA 4XJTA 1W6UA 2DBRA 4RVFA 1FDSA 2Z1NA 4RF3A 5I9NA 2CD9A 2W2LA 1U3TA 1QMGA 5L53A 4J1NA 4YJFA 3TRIA 3PHJA 2PGJA 1IULA 1I01A 3CEAA 4IGEA 2IYPA 3ZW8A 3GT0A 3H6KA 2AG8A 4FSHA 2BGKA 4GH5A 3OBBA 1X14A 2GD1O 3TZQA 1KVTA 1P0CA 3I4FA 2DT5A 2C5AA 2EKLA 3ZDFA 4YT2A 4BKOA 3DFUA 1OOEA 2BFAA 3S2GA 3ZU2A 2ZQYA 3TSCA 5U9CA 2E49A 1RKXA 3Q1LA 4R01A 4YDRA 1KEPA 3EHEA 3FNGA 1JKFA 2FRDA 4FC6A 1M66A 4KTVE 5L7YA 4A0SA 1VLLA 1PL6A 1E7WA 3AK4A 3EUWA 4J9VA 4MVJP 3MWEB 1BG6A 1A9ZA 1XKQA 1A5ZA 1K0UA 3BTVA 2WWRA 3DZJA 1EVYA 3WQRA 1ZO8A 1IL0A 3DQPA 3JQAD 1R0LA 3Q9NA 3GRPA 4DMLA 1QV6A 4ITUA 4RVSA 3NYWA 4FPXA 1DHRA 3L4BA 4IMRA 3DDNA 4TWRA 2Y66A 4EI2A 4TZKA 4ZQGA 4CLEA 3DBHA 2PH3A 1EE9A 4HKTA 5LC1A 1JKJA 3NEPX 2G17A 1GUYA 4DXHA 3JQGA 1N1EA 1ZFNA 1VI2A 5TT0A 4NJMA 1U3UA 2UV8A 4R68A 2DBVO 5COBA 5JAMA 5KWEA 4JROA 2IE0A 1I24A 4MIYA 4F46A 1GL3A 3LDHA 4Q3NA 3ORFA 3PYLA 4U0KA 1YDWA 2VHZA 2NVBA 3H4VA 3WG9A 5G2OA 4WLEA 4MVJI 3RIHA 1O0SA 5F21A 2NTVA 3NGLA 3X2FA 2ZYDA 2AQIA 3QV1A 4OAQA 3D64A 4PG6A 4A2CA 3N58A 3OJFA 1MUUA 1NP3A 1NBOA 1Z7BA 2X1HA 3GGOA 4MJLA 2RHRA 3OFSA 3EYWA 1VJ0A 3PQEA 2OBYA 4MKZA 1DFGA 3KYDA 4AJLA 2X9GA 4BV9A 4WLOA 2HJSA 4FFOA 3GZNB 4LVUA 1EUCA 3I4CA 2SCUA 1VL8A 1DHTA 1P0FA 1RYDA 1ZK2A 3F4LA 2D2IA 5KCZA 1EVJA 2YHIB 3PI7A 5ER9A 4N5NA 3PWSA 3U0BA 3HADA 4EUEA 4GKVA 4J2HA 4NI5A 5T8KC 5KNLA 3PIIA 3FR7A 3VAZA 1H2HA 2O2SA 1XIVA 5ES3A 3QE3A 2W2LD 5A02A 4XDZA 1J0XO 1UP7A 2PZLA 3Q0EA 4E2ZA 4EUFA 5L40A 4N7RA 1FDTA 1YBAA 3QVXA 1KYQA 4PG8A 3U62A 1Y6JA 4CLXA 4RZHA 1F12A 1ML3A 2G76A 5IDWA 2EG9A 2FOIA 5JPIA 2RH4A 3AY3A 4DA9A 1YKFA 2PFGA 5IZCC 5TJ9A 1GPJA 5F1PA 4CM3A 2X58A 1P1FA 3EZLA 1UH5A 1HDOA 3DAPA 1XU7A 3HDJA 1YH3A 2JKVA 4ALLA 1P31A 4BGVA 3FWZA 4BGUA 5MGBA 1B8VA 1YB4A 1F06A 3NT2A 2QRJA 1P1RA 1PWZA 4MINA 3ZNOA 3E1KA 2W90A 1A71A 2X8LA 4K28A 3GK3A 4WE3A 2A92A 4AICA 3B70A 1EK6A 3GG2A 1SPXA 2EGHA 4BO8A 1B0AA 5L95A 3EK2A 1G0OA 5JDIA 4EJ6A 4M55A 2RAFA 4P4LA 1KY5A 3AM4A 4MO2A 2D8AA 2Q2VA 4NDNE 3KBOA 4XKJA 1GEGA 3DHEA 3KB6A 2DM6A 2BRUA 2P2SA 4R5MA 2NVUB 2AEJA 4QO7A 1DBVO 2GF2A 4W7IA 1JDJA 1IPEA 3JD4A 1ISMA 1W0CA 1LSSA 5CEEA 1TB4A 1O5IA 4OXKA 4E5YA 1PZGA 3GNQA 3DEYX 4YAIA 3BMNB 4IJVA 5JYDA 1VM6A 1O8CA 1A4UA 1RJWA 4CQMD 1WDKA 2J3JA 1PS8A 2BMAA 2P91A 1L1FA 3DZHA 2HJRA 4Z9YA 4D43A 3KLMX 1E3EA 3JTMA 1DIAA 1N5DA 3K8ZA 2I66A 3VZSA 4CMEA 5ILOA 5DF1A 3TPCA 5L9AA 2OZPA 4BNVA 3PVZA 5CDGA 2DU8A 3AU9A 3E8XA 2ZJ0A 4J7CA 5AOVA 4N5MA 3TOXA 5A03A 4NIMA 3ZV4A 1Q1NA 2P5UA 5CDSA 3SLKA 4NBUA 3RVDA 2X5JO 4I5DA 4EJ0A 2WYWA 4ID9A 1LXCA 5DULA 1F17A 4JBHA 1NPYA 4KUHA 2VOEA 1Z6ZA 2Y1EA 1I3MA 1UDCA 3OJEA 1UXKA 3H3FA 3CUKA 1LLUA 1YS4A 3EDMA 3WGHA 3INTA 1SCUA 4R9SA 1JAYA 3A4VA 4J4TA 1H94A 2DKNA 3DBLA 1Z75A 1U1IA 3RQSA 2I3GA 4BO4A 1Y9EA 3CXRA 1C0KA 4E6PA 3QVSA 3AFNA 2OHXA 1Q7GA 2ZB4A 2DFVA 5EL0A 1Y1PA 1H6CA 4KDEA 1PL8A 1R37A 4BB5A 4JP3A 1U2GA 2IEDA 3PEFA 4J0FA 2J5RA 2YY7A 5ENDA 4EGFA 3QWHA 1KEVA 1MX3A 1C1XA 1Y8RA 1QORA 2DTEA 4RQUA 5JC8A 3WS7A 1PGPA 2Q3EA 1VPDA 2BFMA 3HB5X 1FDWA 3KV3O 1U28A 3OEYA 4UVIA 4WLUA 3PP8A 2E6UX 2Q1SA 1LSJA 3RFXA 1A7AA 1HTBA 3LT4A 4WOJA 1E1LA 3JQ9C 5F1OA 2Q1UA 1Y7TA 2BFPA 5TC4A 2QG4A 1YBMA 3GMSA 5IDYA 2VN8A 3VDRA 4IJWA 3SC6A 1H6AA 4D3FA 1HLDA 3FD8A 1GZ4A 2GUGA 3C7DB 2HK9A 2BI8A 1CF2O 4GVXA 4BKUA 5C7OO 1FDUA 1TT5B 4XZ3A 3ZWAA 1GQYA 1UP4A 1KETA 2EERA 4U7WA 2VHXA 2DC1A 4FW8A 3W4IA 2XF8A 2EIHA 3KETA 5KJ1A 2P9GA 2DTDA 3I9KA 5ITVA 4O6VA 1NAHA 4XRGA 5T5QA 4GWKA 5G0VA 4IJUA 4MVJH 1NFQA 5TF4A 3NJ8A 1JWAB 5AXBA 4AJIA 1ENOA 5EIOA 3U9LA 4Z0TA 3GA0A 4FGWA 2DBZA 2ZB7A 4A73A 1JLLA 1K6JA 2I5PO 4J0EA 2PK3A 3ZW9A 3U09A 1M2WA 1K3TA 1E7MA 3VH4A 2CMDA 1Q7CA 4Y67A 3WFIA 4YRAA 4MVJE 4IZHA 4BIIA 2B4QA 3NTRA 4R51A 4Z0PA 3Q6IA 3GVPA 2AA3A 1NNUA 2OFPA 3KO8A 4L4XA 5GZ3A 1ZMOA 4U8GA 2WD8A 1IY8A 3B20A 3AUSA 1J6UA 3ZWMA 5K6AC 3U5TA 2IXBA 2CF6A 5EPOA 4M49A 4CR6A 5CG2A 1SB9A 1YXMA 2VNSA 3DO5A 3WTCA 2PZKA 1PJLA 4TRJA 1HE3A 3CTMA 2IEBA 3JCZA 1HZZA 3S1LA 5JO9A 1N9GA 5C5IA 4HWKA 1X7DA 3QW2A 1GQQA 4A26A 4CM5A 4H3VA 2LDBA 1X15A 3LZ6A 4M87A 1RM5A 2WD7B 4BGIA 4MP6A 4IZIA 1H6BA 1BVRA 3OSUA 4WGGA 1Q0LA 5JS6A 2VHYA 4L4RA 4ND1A 5A4DA 3STHA 5JDCC 2NU9A 3HZZA 4BNKA 1DDOA 1GEEA 4ZQEA 3MWDB 3E5RA 1RYEA 5IFLA 4BNHA 5FFFA 3DMYA 3DOCA 1QLHA 1I32A 2DBQA 2VRCD 4NK4A 3CIFA 1ISHA 1UR5A 3G1UA 3NTOA 4BHTA 3GC6A 5G4LA 3L07A 4MKRA 1HDZA 1YQGA 1IZ9A 5CDTA 4NFHA 3GQVA 1SEVA 3BXXA 3F4BA 1E3JA 1P77A 5B4UA 4GMFA 4ALNA 1QR6A 3VH3A 3HWRA 5HA5A 4GLLA 5ICSA 1LSOA 4CMGA 4S3MA 1ISJA 1E92A 3KSZO 4LMPA 5GZ6A 1O89A 3PFWO 5TIIA 2V65A 1WNTA 3IAHA 4YJGB 3VHRA 1XHLA 3PJFA 3HN7A 1ZCJA 4GX1A 1JW9B 1JQBA 2CSUA 3T7CA 1R66A 1WWKA 3MTGA 2W8ZA 1D1SA 3BTSA 5F5NA 5L4NA 1DC5A 1PQWA 3HHPA 3KHUA 4R3NA 5DDIP 3WX0A 1A27A 1ADFA 1QXSA 1TI7A 3GN2A 2PTGA 1MLDA 1R16A 2OO5A 3C85A 4FBGA 4FDAA 1JKIA 2J5QA 1AGNA 4D0RA 3ZWCA 4DVJA 3RUHA 4DYDA 1IPFA 1ZZEA 4OXYA 4LCJA 3RCBA 4B79A 4RPHA 1T2AA 4XYMA 2J3KA 2VWGA 1C1DB 4B8ZA 1HEUA 1SZJG 3ZWOA 1FXSA 3TZHA 3GFGA 4B4VA 2W4QA
chains in the Genus database with same CATH superfamily
2YJ6A 3JQBC 3RVKA 3LX4A 1LTKA 1USWA 3FZGA 5TMBA 2ZSDA 4L75A 3LTEA 4KBFA 2XT9A 4ENRA 1QIGA 2FW7A 2IXFA 3SBEA 3B3FA 3DDSA 1JH9A 1YZUA 2EJBA 1L9KA 3KUCA 5CD9A 2G77B 1Z4LA 1IQPA 2IOQA 3C7AA 4H7PA 1SBIA 3OCUA 4MYSA 5KWVA 5HTOA 4P80A 5JAHA 4ZJZA 4E07A 4YRIA 3FPSA 3C7TA 3TB4A 2QLJA 4YY3B 2LCIA 1E9EA 5EJ6A 5KIAA 2OV3A 3QX9A 5DNWA 3OX3A 1EFRA 3EEFA 3LBIA 4OXIA 4BX0A 1UKCA 2XV1A 3BCSA 4NR0A 3T95A 3T1HB 1SHLA 1TXGA 4XUDA 3RFCA 1QAMA 1EGAA 2V7PA 2VA9A 1L7QA 4ER3A 1SUSA 1W1IA 1Z0UA 2BDUA 4II2A 4CETA 3JATB 1G5HA 1T3GA 1WB4A 4MX8A 1ZBDA 1ZN8A 4NMHA 4R1QA 4CG3A 4GBED 3REQA 3ED1A 3QF7A 5KYXA 4DMKA 4BKRA 9MHTA 1AS2A 3LVRE 3FOFC 1XDBA 1FYEA 1RKVA 4K3UA 4X85A 3A4YA 2FFJA 3ZBTA 4HVTA 1SZPA 1MEJA 1TVEA 2FSPA 4DDTA 4F4CA 5KOHA 1ZGGA 1HNNA 2OV8A 2ZJ5A 3N8NA 4S12A 2RHGB 4H7DA 3QEBZ 4CE6A 4L0DA 2AVNA 3E3OA 5LNK1 2RC6A 2AE2A 2XVAA 1VE3A 2YWDA 3LXRA 4J94A 4PGAA 4LJ6A 3SYTA 3QSGA 5JD4A 5A9SB 3OJXA 4R81A 2P6UA 4RGQA 5J2UF 4KYUA 5A0FA 2BMDA 4UUPA 5L45A 4UBLA 4TUYA 4ARBA 4C4ZA 2I99A 2GAOA 1UBGA 3GJ4A 4RCYA 1EWVA 3NDIA 1C9NA 1SG9A 1P6QA 2J0SA 3IOEA 2XITA 1M72A 3VAAA 4O59O 2GCGA 3FCYA 1V4VA 1FX0A 1MH9A 2WFLA 5HF5A 1PGNA 4JI6B 2EKDA 3UFXB 2QMUA 3LQKA 3DQZA 4WNIA 5EINA 1B8PA 4M46A 4TS4A 3C41J 5TNXA 3IDQA 4LV5B 2APJA 5JH7B 3ME5A 1TAGA 4D0NA 1I6WA 1O5OA 4YJHA 5AKIA 5H16A 4QT0A 4JYCA 1ID8A 2V7XA 2RBEA 3W0LB 3M9WA 3HKEA 1S6YA 2MYPA 3R7DA 4Q16A 4IZ6A 1L6RA 1X0XA 2CFTA 3EA5A 3FDZA 4HS9A 1GV1A 3GP3A 1DIGA 2W93A 3AYXB 4KWTA 1NJFA 1PS9A 4GBGA 2IHVA 1XF9A 1DZIA 1E66A 2BD0A 2ENWA 3BIFA 2F67A 1TCVA 1W85B 1OASA 1VYHA 2H6EA 2W6CX 7MHTA 4HN4B 5AHRA 1CRZA 1S2OA 5FI1B 2GXAA 4IJKA 4JX9A 2V59A 2IKQA 4NBVA 4RGYA 4EO9A 4G5XA 4DM4A 4UZSA 2AUTA 3ITNA 3LWBA 2CZQA 2E1PA 4GPEA 3FDXA 2IJGX 3QF4A 5DPMA 3PWKA 3RW9A 3AHFA 3H8JA 5HXAA 2HFJA 4V1CB 1B2LA 4AJJA 2QPLA 4HQRA 3DP7A 4LQLA 3FYSA 2JD2A 4L5YA 3MOSA 2VDJA 1D3AA 4DJJA 3H6HA 3N5CA 4GD3Q 4F6RB 1RS0A 2BM1A 2OGZA 3N2EA 1Z12A 1CDDA 3EFOA 1U8AA 1SVMA 4ZQIA 3BHMA 1KC1A 5TGZA 2JGJA 4ZZ1A 4LOJA 4B3MB 6PFKA 2VS1A 2ZATA 4KAXA 1D4AA 1ZKMA 2QA5A 3FZNA 4GRAA 1U4NA 3NDPA 4JFAA 4PQEA 3ADCA 5EWLB 3HKBA 2ZXUA 1UOEA 2ERYA 2JD1A 3TECE 2DFPA 5KYYB 4G1EB 3RODA 2OZLB 4PYOA 1H42A 4W5TA 3LC2O 5I9MA 1WY7A 3E3MA 4XGRA 4ZV7A 4EMTA 3LUGA 1Q1QA 1KPGA 1Y4DE 3I76A 3OOSA 1RXWA 1XRNA 4GXQA 1J39A 1BMFD 4LY9A 5CGZA 1SFRA 1OYVA 2R60A 3ZHUA 1ZVQA 1V3TA 4UFOA 4B74A 4M9XA 1IM2A 3KD2A 1R8XA 4FI3F 2D0OB 1AZLA 1J2YA 4NNOA 2Z2ZA 3P4UA 3U7JA 1GUAA 2IF2A 2E82A 3FDIA 3JPWA 4HYYA 3D6FA 5JWOA 3E7XA 3MW8A 4Z0NA 2BI7A 1IATA 1G8AA 4ZOLF 1T8YA 4C6HA 1M2KA 1D6JA 3U3DA 1ZEJA 3OTIA 2V4MA 1HF3A 1W5SA 1SO8A 4CMCA 1SMKA 3JW8A 2YS6A 1Q3KA 2BTOA 3F8TA 5EFOA 3SOZA 2ECKA 5BW5A 3OA0A 3EF0A 3RRJA 4ZOAA 1UBLS 2VSFA 3PYMA 1SAYA 5K3AA 1L8LA 4P98A 1RI3A 1HC7A 3E53A 3JVDA 2HLPA 1W35A 3ZG6A 3ZIAD 4D8VA 1H4SA 4GXTA 4RL4A 2VA8A 4TMKA 1QKJA 3HJHA 1HFKA 3N6VA 3RUEA 1USKA 1CJVC 4DCMA 4W5OA 2FMHA 3UK2A 1XB2A 4I5EA 1ZWLA 4P92A 2FGKA 2IVZA 3IVXA 1UKEA 3MG9A 3MXTA 3PUYA 3HJUA 1OTHA 3VYSB 5AW2A 5G1NA 3KFVA 4GT1A 5JG7A 1GN9A 2GCPA 2VDNB 1O95A 3ILYA 3C24A 5K7SA 1MN6A 1ZBQA 1ZXXA 2JBAB 4I50B 4JCOA 2NXCA 3WO1A 4HNAB 1EVLA 5DM0A 2GZMA 3AR4A 3UXMA 3ERCA 1GNRA 3FTPA 3O8NA 4IEIA 4IDGA 1Z7GA 3DBRA 3INNA 3W4KA 2UYYA 3K71B 1DJLA 4EEZA 1NRIA 2CLKB 3CKLA 1ZM9A 1UBKS 3OFJA 4QQFA 3JR7A 4ARCA 3OIVA 2C03A 2ADMA 1Y4ZA 4PBSA 2IS4A 3K1YA 5KQSA 4QFDA 1K5DA 4BZPA 5IJXA 1Z8NA 4HFNA 2G72A 3QPBA 4XGNA 2ZXEA 5ES4B 4RK5A 3S1AB 5IWAB 3B1JA 1W94A 4XD7D 4HZIA 5FKJA 4RANA 2OV1A 2P5YA 4GGPA 1SU6A 3DCIA 5C2JB 3DKVA 3LQ2A 1AKNA 4PIPA 3T5MA 5I8PA 2AFIE 3U7HB 3P2OA 5KVSA 4NBKA 4RX1A 1RQRA 3KL2A 5CH3A 3R6GA 3Q98A 2QR5A 3DBHB 4KYVA 3ZV7A 1IHUA 1G59A 1U65A 4BMSA 2CXUA 1JKJB 1SBYA 5FWXB 1R8YA 4DMRA 3WNDA 2BP7B 4LRSB 1XDGA 1VBMA 1NXOA 2X1MA 4NJMB 3PQ8A 4F2DA 1JL3A 2J4DA 2PY6A 3NDRA 4J49A 3ROGA 3WL8A 4BQIA 5JPDA 4GX0A 5FYDA 4ZO8A 2CYAA 3G9XA 4R16A 1ADYA 4DR1B 4NATA 2CEKA 4E2YA 3CKMA 3UW1A 5HYVA 4X54A 3GD7A 3F6RA 5AJWA 2ZOSA 3HKDB 1YRHA 1XCMA 1FUEA 4MUXA 2ZS8A 2GT1A 4HAXA 3HBLA 1P0IA 1H2XA 4CNBA 3F74A 5B1YA 2Z3ZA 1K89A 4TKMA 3W9UA 1E0DA 1U7WA 3FPBA 1X6VA 2OXTA 1FIUA 1E6WA 1JHDA 1YI0A 2BHNA 3MSXA 4LBVA 4O2RA 3EPJA 4XIYA 4PFSA 3GY0A 1F2UA 2ZJOA 3W8DA 4YT4A 2HT1A 4TKVB 2C88A 1I30A 2VL7A 1KDTA 1WAMA 2W8BB 4JOBA 1HDRA 5FNZA 1KVUA 4ZRMA 4E08A 4W9NA 1QVZA 3TNLA 1AKWA 2D1QA 1QE5A 4HLCA 2JBHA 1ZSYA 1I36A 2DBYA 1R2QA 1KI7A 2H92A 1HURA 4B3JA 2G80A 1PV2A 3K1TA 5EI5A 1KMCA 1MAHA 2UZAA 5HFNA 3ZCVA 4DQKA 5E1BA 2ZI4A 2CMGA 5GTDA 4LJRA 3BFPA 3RJ9A 2G9RA 2Q6KA 4R5HA 4C07A 4HGPA 2ZR7A 4RZUA 4B0PA 2G9QA 3N7TA 4AZ0B 2C57A 4QTUB 3WNBA 4DV7B 1FU8A 2JLSA 3LPCA 3LAWA 3R3ZA 4IIVA 4M99A 5ARDA 4FI3C 5T64A 3ZQUA 3BICA 3V8NA 2LD4A 2RI0A 3A9WA 2GRAA 3V8PA 4WOKA 3IHLA 4BMXA 2BGUA 4KW7A 3LQ1A 1RVDA 4ARAA 4LHXA 2C4VA 4PR3A 3A3YA 3FNQA 5H9VA 4K40A 5ER6A 4EW2A 4N4AA 5KNDD 2VF2A 3ENWA 3TS1A 2OD2A 2AJBA 4BS9A 4JC4A 1JV2B 4RIFA 4CFZA 1WKVA 1VSTA 1HZJA 4Q9AA 2ZI7A 4LCEA 4N5IX 1RAAA 5AIBA 5G3ZA 4CN9A 2ZRMA 4IIUA 4M1MA 3S2SA 2TRSB 1YKSA 3SVLA 1OE0A 3TNFA 3ZR4B 5IZCA 4MR9A 3WICA 1B6RA 4AUNA 1QANA 2R6CA 5A4IS 3PGKA 2VT2A 3PQFA 4US0R 4KQCA 4N3AA 5DCLA 3KSBC 1ZJWA 2IZ7A 5IW8A 3I1YA 4XW2A 2X4GA 3OFNA 2L0XA 1UODA 3PC6A 2XDAA 4IHAA 3EAFA 1M9NA 3HO6A 3TD9A 4HDNA 1I7PA 1OI2A 2H1LA 3MCWA 2QSZA 3LC1O 2IYUA 3O31A 4TTJA 4MYRA 3QNMA 3EF1A 1ZNYA 4JSTA 1I7NA 5I7EA 4PNZA 3DZGA 2PVCA 3ZPXA 4MRRA 4Q39A 1QQAA 2YBEA 5C1OA 1V25A 4YQYA 4P8RA 1KL7A 1YQDA 2C54A 3T4EA 4HO1X 3LXMA 3EG5A 3LT2A 4JC0A 5ALNA 4W6QA 5AM2A 1TO6A 4BNGA 5CDUA 4IKPA 2YWCA 4UPVA 2PG3A 5JDIC 2CLFB 4Z4CA 5FBHA 1RLIA 4QRHA 1BXZA 4MGKR 1V48A 5JSFA 2Z83A 3A1WA 4OUDB 3OIGA 1TO1E 1WV1A 2H2WA 2XB6A 3F6YA 4PGFA 4CUZA 5FUWA 3FYUA 5BSEA 3BRQA 5L4SA 1SJ9A 2VF4X 4ZDKA 4G5FA 4IXTA 1M3SA 4CHGA 3WMGA 2G5TA 4HAIA 4X95A 5EKDA 3LC0A 3D6JA 5CU7A 3GMTA 1OPXA 1REQB 5EZQA 2ZETA 1E18A 1F6BA 1DJPA 4BRZA 2QMZA 1U04A 4CIAA 2ZJ1A 2ORVA 4RLHA 1KMHB 3C3EA 1MO3A 4RIIA 1RBMA 2YZ7A 2WR8A 3V4VB 5BVGB 3ANXA 3X1WA 4GKJB 1QIHA 4J2TA 4MP3A 1B8UA 1R0ZA 2AN1A 4B3GA 2ZWVA 4D44A 1JDUA 4IICA 3LL4A 4KMMA 2JFXA 5BMVF 4TMWA 4I0WB 2VPIA 3HDGA 2GN4A 3G9UA 1B41A 2GNAA 1CJSA 2G9VA 3NIFB 1R5OA 4LSGA 2WWHA 4JJ8A 1C8VB 2RKWA 3A4TA 4ME6A 1L7RA 3R5KA 2IZ0A 4CMEC 4EUKA 1KYXA 5B1HA 3WDKA 5JYCA 2F3PA 1CUWA 2QLFA 1WTAA 3UJ9A 1Y6FA 3B8EA 1Z0DA 5B3KA 5BR4A 5FJJA 4NEQA 4WWHA 1Q19A 3JYPA 3JU3A 2C4HA 4MZDA 1QO7A 3H18A 1GT6A 5FR1A 1DKOA 5IF9A 1E8DA 2H31A 2UAGA 3DBLB 3RIMA 3I73A 2QW0X 2ZRJA 1B14A 5G41A 5IM5A 3C3YA 4F3KA 4UTRA 3S28A 1XEWX 3NXKA 2E5WA 1K1EA 4EIWA 1ZH4A 4WV3A 1P4SA 5K5EA 4IVNA 3SLGA 2EQBA 2QRMA 3K0BA 3VPDA 3D4PA 1Y4SA 1ZRNA 4YP0A 3WNZA 3UJDA 1T5HX 1G6OA 3PQDA 4LX0A 3AESA 4OKSA 2HLHA 2VDWA 3OHMA 4Y30A 1OY1A 3T9EA 5IG2A 3ISJA 3FTQA 2H0RA 2D13A 1Z4JA 4ER6A 4QTZA 1EZ4A 1PP4A 2INGX 3BZBA 1RE0A 3MOIA 1AGRA 4KHZA 5CA0A 4BUCA 3BGWA 2XYVA 3T0IA 4A0QA 1ST3A 2J5BA 1AXGA 3C0KA 3R6LA 4EW6A 3SZ3A 1VSQA 3NWPA 4QUKA 3DFIA 3VU3A 1PJQA 1RWNA 2E2WA 3G1WA 4Q03A 3ZHSA 2PXHA 4FR5A 1VTKA 1CY8A 4IQ0A 2FF5A 3PTAA 3H16A 1W34A 4PG4A 3EZ9A 2PPLA 1X80A 5J23A 5DM4A 1LX6A 1NPTO 1XR3A 3IJEB 2QRZA 4UREA 2VO1A 4JLBA 1K8QA 4RVCA 4DCJA 3PHBE 4LUCA 1SIOA 2BR5A 2Y0BA 4EA7A 4MMYB 1UMBB 4P33A 3IEIA 3MT7A 3KTAA 2XB4A 3ZLJA 1R88A 3OKAA 3CH7A 1A4XA 3NIBA 5KTKA 2AXNA 1U3WA 4IIDA 3M6IA 4UQLA 3OCYA 4GDFA 2JGDB 3Q87B 3LMKA 4WZBA 3TMAA 3AJEA 4ITRC 4YBRA 1XMSA 2Y27A 4U7FA 4CCAA 2O5VA 4CG1A 5COAA 4ZAZA 4CKEA 2W83A 3HR8A 5F98A 2I6SA 4LXGA 4AWBA 2GX6A 1PGJA 2GZ2A 4WCFA 5G53C 3GZTB 1ZR2A 2DCUA 3KFXA 5FD8A 4QUEA 1L5OA 3ORHA 5LYJF 1APBA 1Z2OX 1J21A 2HU8A 2IEAA 2DCMA 2PV7A 2Z2JA 1ONOA 3BD9A 3CNQS 3I5UA 3QVGA 5CVDA 3SEFA 4EHAA 1JHQA 2GAAA 2I6UA 3B78A 5DHFA 5AVKA 1JJBA 1VFNA 1ZHHA 4WN9A 1Z4MA 1WKCA 1WXXA 2IUEA 3T1OA 3A1VA 4GQIA 4PAQA 5KOIA 2Y3IA 3RAPR 3QNUA 4B8YA 5LM3A 2G06A 1BCSA 2DRIA 1EK5A 4JKYA 5BYAA 2Y92A 4BX2A 1E7QA 2LWIA 1DFHA 3I5AA 3H5WA 3LP8A 3CXUA 3SPXA 3SWWA 3BILA 3RU9A 3LWNA 1M8KA 5A5EA 2X9LA 3PZBA 4H0FA 2WIAA 1JJVA 4KI0A 4X62B 4R9RA 4LC0A 1ZMTA 1VG0B 2IYZA 2GYVA 5BMVB 2GN2A 1TKBA 3I92A 1NW4A 2PU7A 2ZZKA 3TD6A 1M54A 4BUZA 3A8TA 3DE3X 4DV6B 3AEYA 1YGPA 2ORWA 3COPA 1I0ZA 1UM9B 2WI8A 5D6NA 2QE7D 6Q21A 4KXFB 5FULA 4FNOA 4QRDA 3ZK7A 3ZS9A 1JFFA 2R7MA 5DK4A 4ZVLA 4CV1A 1Z74A 2WT8A 4N6GA 1AURA 3IUBA 3I9MA 3PS9A 2YW9A 4JLUA 3T8YA 4BYMA 3LJKA 3RS2A 2H4ZA 1J8VA 4P4TA 3JQ8A 4ZVQA 2J6IA 4D9IA 3WLJA 1I10A 5L7TA 4BKPA 3NGMA 4YI3A 4YUVA 1QB7A 1TF2A 4HRAA 2XYQA 4NBRA 3EZXA 2B82A 1J4AA 1HZZC 3GW8A 5H80A 4IIJA 3L8EA 4KNWA 2GCOB 1TU3A 2YMMA 4KO2S 3TLCA 3ZXXA 4DJEC 4UM9B 5JS6A 1SBQA 5H4HA 4V0MA 5HNKA 1UADA 2OM2A 4NU6A 1WB5A 3LCVB 4MV9A 4XSHA 1ENZA 3MJ4A 5JFTA 2F48A 3OY2A 5A2GA 3TCKA 1CUJA 3WIUA 4PZUA 4RULA 3KKMA 2R6DA 3E15A 5IAEA 1II0A 2JRLA 1AKEA 2XQJA 3CRQA 4Q21A 2X6RA 4EJSB 3KQKA 1MC1A 1SVIA 1G8FA 1F14A 1W8IA 1WVIA 2D1YA 3GJRA 3HVHA 3QUQA 4H08A 4NVRA 5IEJA 2X0KA 1RIFA 3B1KA 3RYIA 4KSCA 5KNBH 2YJ5A 2BFBA 2EJWA 3MBKA 3OUTA 2WZBA 5G0SA 1Z62A 1IN1A 2ZGVA 1H1LB 3FVVA 1T9HA 2RIRA 2B35A 2AOUB 4MRNA 1H2EA 4PLFA 5HSGA 4Z7QB 1H69A 1V8BA 4RHCA 3K15A 1CY0A 1N0WA 1UDAA 1ENYA 2VF7A 1E4OA 3AM3A 5JO0A 3RVJA 3FLEA 1NQAO 3GBSA 2NSDA 2QRVA 4JP1A 4IWNA 5F1YA 5IT9A 3CCCA 2D5CA 1E2JA 3RRMA 1UFRA 3H86A 1T36A 3MOGA 2X86A 3EN0A 1JH8A 3QTBA 4TS9A 2WWVD 5KZMB 1MQAA 4TN5A 5LQDA 1YVPA 1QX3A 2OQ2A 1LJUA 2Y76A 4JQOA 4OFZA 1QTQA 1MVNA 2X22A 2CLLB 4J1TA 5LKAA 2GETA 2QF7A 1JHPA 2ZTUA 5A3SA 3JAWB 1V3UA 5DNYB 5LYJB 1Z0AA 3L41A 2PLRA 2PT9A 3QJGA 1NBHA 1YJ5A 1PZMA 2F3SA 1GFIA 5IAOA 1S3SA 1SOAA 3TQOA 1TA4A 3BA6A 1E7RA 5IVDA 2IV7A 1DTWB 5AM1A 4G2TA 4UBJA 1C30B 2V9ZA 5FOWA 4GPD1 3ETDA 4GMDA 5DXJA 3W34A 1QHEA 3P0EA 3TRDA 1JXMA 1P1HA 5ALLA 1NKSA 1ORIA 2BHTA 2QLLA 3F2VA 2HU5A 4HFRA 1BWSA 1CRWG 4IDEA 4JP5A 1P6XA 4LS3A 4RXMA 3RNLA 3V42A 3QOXA 4QG3A 4ES6A 1G6HA 4XLLA 2A1IA 2QAIA 1XPUA 1OFUX 1U8YA 2ORIA 2ZRAA 2ZU0C 1MW8X 4LTMA 4AP9A 5LQKA 2UYCA 5KBYA 2BMEA 4GWLA 3WR5A 4FFWA 3N8IA 5EOVA 2FMFA 5E9QA 3JQBA 4FS8A 3EPRA 2JASA 3K30A 3AWDA 3L5KA 1JQAA 2J32A 3LYLA 3M5PA 4EG8A 1HNZB 2C7BA 3O26A 1NR1A 3L7AA 4L8GA 4XEUA 4YP9A 2V7UA 5BQPA 3DH0A 2C2HA 5HJ5A 1YKGA 2JD0A 4FFRA 4CT4B 3I6MA 3WNVA 4JYAB 4M1KA 2YUTA 1OKKD 3CJRA 2QUJA 4TXJA 3O8LA 1DOAA 2D7JA 2ZRIA 3LP6A 1NXXA 3HYLA 3RS5A 1K4YA 1PO7A 3MHPA 4IZOA 1KSHA 1MOZA 1Q95A 2BWJA 5T3YA 1T1RA 2XQFA 5FV4A 5JAUA 3UV3A 3CF4G 1GYQA 1KDVA 3I9FA 1U90A 1FNBA 4EHHA 4XFJA 4AJNA 1QK4A 4DSTA 2DOKA 4H35A 2XEXA 2WA1A 1CUDA 3PDWA 4JOCA 3E7DA 4ZT7A 2P3SA 3RVMA 3FKSD 5H81A 4D5GA 4A6DA 3V4RA 3CVXA 1JQ5A 5EN4A 3WGOA 4IKEA 4BEBA 4LY3A 2BKVA 3CO5A 4DUZB 4X1IB 4DN6A 1ZJYA 3BOSA 4RMNA 4ON9A 1FVHA 4BGEA 1AHNA 1RR6A 3RJ5A 1VIVA 3VSEA 1VE1A 5DNAA 1G20B 4BBAA 3UFBA 1OZFA 3UJ7A 4DCVA 5CW2A 5J4YA 1G21B 4WNYA 4ZEWA 1HDXA 3N7UA 1IH8A 1GPLA 3EMKA 3LDUA 4M4SA 3VX4A 3W1VA 4CMIB 5CITA 1NRWA 2GJ8A 2HWWA 3C87A 2BFFA 3AM5A 3LV8A 2PGLA 4OH1A 2JK1A 1E1QD 1OVGA 4MDFA 4JJEA 2B5VA 3RK4A 3FTNA 2IBMA 1X74A 1BXRA 1G17A 2O1SA 3H1GA 3RVLA 2Q3BA 3ZTWA 3E9ZA 2PRZA 3GLVA 1PT6A 5H3CA 1RZRD 4FNMA 1Q77A 2BLLA 3R5TA 5TPZD 4ZFNA 4XA8A 1X0VA 3EZFA 4DBZA 1OAAA 2VNIA 4B7XA 1XC7A 1IG3A 3GDOA 3H5RA 4OQ4A 2PS1A 4Z5XA 5I4IA 3GPCA 1QSGA 4M21A 4YVFA 3P94A 1UBEA 4DJTA 5ERXA 1CRPA 2PUTA 4BBPA 2N3ZA 3DLHA 2C00A 3IVRA 4P08A 2H7VA 3GH3A 2EL9A 2GERA 2BCEA 2W2NA 4ZWNA 2CE7A 1Y1SA 2IHKA 3RROA 3TK1A 5I7RA 1H6DA 3UAYA 2PU5A 3D8UA 3T52A 3GFBA 1EQUA 3EXHB 3ETHA 2OD9A 4E3ZA 5CVJA 1RYMA 4RMGA 2V45A 3AY0A 4MIEA 1NF8A 4OMDA 3U4CA 2O7NA 4BCDA 3RYCB 2BTQB 4F4IA 3SIWA 1KI6B 1XTVA 2PT6A 5IKEA 4DJAA 1Q1ZA 5IAKA 3X44A 4E5NA 1YU6A 3DE1X 1V4NA 3QXGA 1MAVA 4CKWB 3MAGA 4X6UA 1U0GA 4PEVA 5DLQC 2CN1A 3HG7A 1ZY2A 3VNUA 5IFKA 5BN4A 5K4GA 1NL3A 1T34A 1U5CA 2XXBA 3GRRA 1K3UB 2PH5A 3PDHA 1E2IA 1FTGA 1Z34A 4KGDA 2NU7A 5BV0A 2MTBA 2G9ZA 3E84A 2D0PB 4MQ4A 4NNPA 1M76A 2VHJA 3PDIA 2W5UA 2C4WA 5FQNA 3HZHA 3EXHC 5TSDA 1P5JA 4G0YA 4I81A 1TEXA 2W2KA 4DNPA 3BG5A 5CLFA 1J06A 2IPMA 3TIIA 2ZYTX 5AK3A 3BGOS 4GZ6A 2Z6AA 1E9DA 1M10A 3NV7A 3Q0IA 4ZU3A 4ASUD 2IXDA 1TZMA 5LMCA 3BK7A 2BEJA 4UHHA 3BH7A 2Q7DA 3RG8A 2YRWA 4CM4B 4JI0B 4FOLA 4P4GA 3NT5A 1H85A 2N0SA 1LNSA 3QOWA 4B9AA 4LZPA 2AC4A 1HQCA 2W2QA 3KYBA 2R5WA 1NQTA 4IEEA 1VMDA 3FHJA 2Q5EA 5AOCA 3EEIA 2OFOA 1D2NA 1ZN2A 2AFHE 3I2IA 4C4AA 2FZVA 2I1QA 5ECYA 3C4QA 3B2NA 5KJ6A 3KHTA 3T7RA 3GV0A 3FPHA 5FWNA 5LJLA 1LSUA 4JJKA 5DIFA 1EE1A 4KGXA 1MHTA 4B2IA 1OIXA 2BHSA 1JIJA 1JDTA 4R1MA 3Q7IA 2F7SA 2W00A 1ORDA 1KYIA 4E32A 2M6RA 1TJPB 4UQOA 1DBPA 3BRSA 1M6VA 2X4IA 2R1TB 1LW6E 3DBVO 4M7RA 4LWZA 5IABA 2QZ9A 2ODQA 2UVPB 4PZEA 1GXSA 4MWCA 3U4IA 3SQXA 3AZOA 4F6LA 2OQIA 3E18A 1ISFA 1CULC 4Q1EA 2QX7A 1Y9ZA 1AK2A 4R8SA 2MSDB 1OXBB 2QRLA 4Q3CA 1WSAA 4IJ5A 4M0KA 2XWPA 4I1SA 1TYBE 1USVA 2NZWA 3C5CA 2XPCA 3RSSA 3TM4A 1JT9A 1Z06A 2A94A 3IKTA 3M3PA 2Z6QA 3KZCA 4FHGA 4XM1A 1V8OA 3T99A 1KORA 1LRKA 4G3XA 1OBFO 1A8PA 4RHFA 3LFTA 4R54A 5HIMA 3USZA 5DBEX 3DTVB 4YRBA 1H4QA 3QKUA 2WNSA 1QG0A 2OD7A 4D45A 1C7ZA 2GO7A 3OPYI 4LWOA 5CR9A 1GKKA 2CDAA 2OZKA 1K6EA 4B09A 1GILA 3D3QA 1XFDA 3EZ2A 4HFJA 2NN3C 4LY6A 4NZMA 2J08A 4TRRA 5JAQA 3KSDO 4BCBA 3L46A 4QQKA 3OVMA 5G0WA 4DR7B 3BA1A 3QBJA 4UD2A 1ZA2A 4IS2A 4EKEA 2JJ2D 3MWYW 5JEDA 3H97A 2ZB2A 5B2EA 2FMXA 4IMPA 5ITZA 5DE3A 1RXSA 2DSTA 3BSWA 5AK0A 3TDMA 1D2MA 4BVHA 2O5EA 1J22A 2JIZD 4X84A 4N03A 1FDIA 4A03A 1W0KD 4JOQA 3COYA 1G8SA 2WOOA 1BJTA 3IPRA 1QUFA 2XUZA 3Q2KA 4N8DA 3C6QA 1MZVA 1JB1A 2WAAA 5FI0B 3GRVA 4C30A 3ZX5A 4QO8A 2JJ1A 4LJAA 1BW9A 1Q0HA 4L5BA 3L6DA 2ZIWB 2IHUA 3TCNA 4E31A 2JF0A 3A6PC 3OZFA 2O8EA 2ES4A 4A6EA 1QYVA 1NOIA 1JR3D 3I1JA 1S4QA 1L7DA 2OY0A 1RI2A 1ZMBA 2KJQA 1IXRC 1IBMB 3KBBA 4M37A 5FA8A 3P9SA 2CXTA 5LN1A 3BCUA 4QFCA 1XU9A 2QTVB 3V8VA 4HQOA 2XWQA 3LW7A 1N2GA 3QI2A 4LDQA 4YRKA 1WDLA 2Z3WA 5CPBA 4LOKA 3MUFA 2ZSIA 2ONZA 5AW8A 5CB4A 3O4GA 2B8JA 4IFBA 1BX3A 2HHJA 5FTMA 4EHLA 1P45A 3M6XA 2JI8A 4PONA 4B34A 2WYVA 1E61A 2C7RA 1OCEA 1YE8A 2VHWA 2FWPA 2C5EA 2CT8A 2C5FA 3GO4A 3BWYA 4G23A 3AZQA 5DNEA 3WYGA 4PLZA 2HSJA 4GI5A 3IOCA 3LVQE 2Q2WA 3PR2B 4FYWA 4DS3A 1WIWA 1S3FA 1Y3IA 2H4HA 3IQFA 3JQCA 1FFXB 5CURA 3S1AA 1ODLA 1L5QA 1FTQA 3OIYA 2CD7A 3C1UA 2OOKA 2CL0X 1GVNB 3FFTA 1IMJA 3MWEA 1XEXA 2I6QA 3DE7X 4ANFA 1P60A 1DC4A 1LQUA 3TD2A 2GPNA 1F1BA 1KVSA 1IQ0A 1JR2A 1RW4A 3DGEC 4JODA 2HSEA 3GOHA 1P4AA 3HP7A 4IDPA 5TDHA 3REFA 1XSEA 1TCUA 2O9JA 2YYYA 5AVWA 3G5AA 2JDID 4V0SA 5KYWB 4OQZA 1E1YA 2GLXA 3SJBA 4F12A 1PJBA 4AKHA 2C92A 4MQ6A 2H51A 1XQ6A 2ZKIA 3KDPA 3PNBA 3G02A 3NBXX 3K8OE 1V35A 2I4OA 3LLMA 2XE4A 2OCGA 1UBUS 4TLLB 4U6SA 3TDKA 1W0JA 3TZLA 4AUKA 1K6XA 1BMDA 4MVJA 4UJ5A 2HB6A 1TQDA 3HY4A 2WJVA 3TKLA 1CLUA 3EDYA 4RUKA 1G20E 4Z8YA 1ECLA 4MW0A 1VPTA 3PNKA 4Q93A 2A0KA 2QG6A 4OP3A 3OECA 4ATNA 5LR6A 1G21E 2BKUA 3K35A 3V2UA 3GU3A 3Q40A 5J9FA 3JALA 3D4LA 3W5IA 1UXHA 5T8KA 3R3VA 4BVBA 4BLRA 3HVUA 3LPDA 1MOSA 1WU7A 4HPWA 1E6CA 1G2OA 1WCV1 1F2TB 1AMOA 3LOQA 4GYWA 3KEQA 1U3CA 4HN9A 1JQDA 1EBUA 1OU4A 4O4IB 5TPWA 3U4AA 3LUKA 1N2BA 2I3AA 3NTQA 4OHRA 4YYZA 1TLTA 4Q1VA 1NV8A 3U4HA 3IAUA 4CTNA 4HNTA 4GR5A 3GZNA 4IPTA 5TB5A 3AB3A 4YRSA 1YR3A 4MEBA 4JSYA 5C4MA 1ZQ9A 4N7MA 1V45E 4KIJA 1WPRA 1KU6A 3U9TA 1RABA 3UTDA 3KQNA 3UMCA 3LQRA 3DA8A 4QM7A 4OHKA 2R8OA 3CFYA 4D57A 2VUSA 2O6HA 1EHYA 2VJQA 4X00A 4ZCLA 1FRFS 5AW7A 4D8XA 3A1NA 3F47A 3GQBA 3W4JA 3TDNA 3Q3CA 4HVLA 2G71A 4AXXA 5BXYA 2B2XA 5FWYA 5SZJA 4ZRNA 4QOJA 4XX0A 3HDQA 5GM2A 2ATXA 2XUFA 4NYJQ 3MN1A 5BN5B 4F4FA 1VGQA 4DR5B 3RAFC 3IEPA 3I45A 1WTCA 2BSQA 4HDMB 2G09A 1E0SA 1W88B 2GYUA 4WUVA 1HTTA 1TVCA 1IK4A 4R9UC 5HUQA 5KPDA 1W5TA 3OOYA 3PUXA 3ABQB 4QBHA 3U7RA 4CM8B 4ZCTA 3GUUA 3JAKA 3R9XA 2P40A 1UFKA 5JI2E 3RYFA 1QKIA 4KMOA 3GZJA 4U7TB 1KEWA 4ALMA 5I7WA 2UYQA 2V0NA 3GLHB 1AB6A 3AGPA 1OLXB 4OB8A 1YRQA 2I2XB 3U13A 2WE8A 2XZTA 4CMHA 1A2KC 3FETA 4CV3A 4S24A 1YDEA 2X7JA 3QW4B 1K6MA 2FUKA 5AOBA 3CY6A 1Z73A 3S5UA 2IHZA 2HSGA 4DLAA 3R6DA 5DHPA 4CIDA 4Z54A 5JS8A 2ZWMA 1GSOA 4NFYA 3MBOA 2QRHA 1QV7A 4KR7A 2A7XA 1HFEL 4PXAA 1FMLA 3H5IA 1V5FA 2V7BA 4HADA 2I2CA 4PPGA 5AHWA 5HCUA 4JVLA 2XMZA 5CFPA 1NQOA 3L2OB 4YLEA 4F45A 2EFCB 1EPUA 1TQ4A 3OU2A 4QFMA 1KSGA 2YJNA 1LUAA 2H4FA 3PD7A 3FJYA 2XE6A 3COZA 4QEDA 3QVVA 2Y1CA 4L08A 4ZYYA 1ZXLA 1M2VB 2FCRA 5K3FA 4WBNF 1R6UA 5IJ9B 1NBAA 3GGGA 4JEUA 1I4LD 4EHIA 3UWOA 4QUIA 4GXNA 4B3TB 1W5AA 3OICA 1OMOA 1B7GO 3WHKA 2YWHA 4B7UA 1TVKA 4IRUB 1HE1C 3OT1B 4UAJA 5FCDA 1C3EA 4ND8B 4JT2A 3ELWA 4CPDA 5C8YF 5AVVA 4Q00A 3ICWA 2QY9A 1ZJ4A 3NYRA 4EGAA 3PC8C 4WKPA 2C1XA 3QRWA 1X1TA 5CVUA 3O73A 1SBCA 621PA 4QDJA 3VU1A 4YUWA 2DUWA 2EX1A 2HRBA 2ZBGA 4KKVA 3SQDA 2YVLA 1N2CE 1L8XA 1Z2DA 1VYVA 1Z5UA 4G0NA 4FDMA 4IS3A 2XWSA 3VKVA 2J45A 1PK9A 4J4HA 5DYIA 1MORA 4ZU1X 2VNAA 4MLPA 4QHSA 3DE6X 2YN2A 3LT5A 4L7QA 3WGMA 2C2OA 3CVWA 2ECFA 3BF8A 4WIAA 4X9XA 4AF6A 3LPNA 5AVZA 1QP4A 2V74B 1L4UA 2JIMA 2O2IA 2PAFA 3KQSA 1M7HA 3NPMA 3QKWA 4QNMA 4IUYA 5FDFA 2I4TA 1FXWA 3WGKA 1CPYA 2QGZA 1V1RA 1U2GC 3BDAA 2HDHA 5IH3A 3ZBPA 1T2DA 5FBZA 3HN6A 4MQUA 3QENA 1RHJA 3IVAA 5REQB 3WQBA 4Y6OA 2CVPA 521PA 3IAS6 4MNTA 1CQWA 1KYYA 2GD2A 2O23A 3M9LA 2GCNA 4WQMA 5D6OA 1LBQA 5L3ZA 4DWOA 3RC8A 1TZBA 2WFAA 4RELA 1J2RA 2HLDD 2SICE 1SVUA 1E5XA 9GPBA 2V4ZA 5K0GA 1C8KA 3LK6A 3SM9A 1JQ3A 1NMZA 4V0OA 3V4ZA 3EIQA 4ERNA 2FMTA 2QP9X 1QRTA 4QGHA 1ONSA 4HNGA 3ADOA 5AW4A 1YQQA 4K6OA 5K0TA 3K70C 4G0XA 2NAPA 1PFVA 2GM3A 2R79A 3S55A 4OHZA 3DT6A 3K4QA 3TM5A 1TPYA 1X77A 4YJ3F 2GB4A 2YIDA 5EMNA 1TYAE 1SHTX 2I91A 3W3AH 1D2GA 1Y1LA 4XEHA 3HUEA 4MRSA 5AM0A 1VHJA 5THQA 5EJ2A 4YXFA 2FPLA 3EC7A 2XQIA 3NEYA 3ZDCA 3K0AA 4KLRA 3IC5A 1EFTA 1SBZA 1P2FA 1TRHA 3IKLA 3KK0A 4LNHA 2BKEA 4K26A 4O1MA 4OF4A 2PBRA 3LCCA 3VHXB 1U4SA 2Q28A 5A1TA 1O6FA 1LI4A 1FYWA 4A7PA 1TM7E 3G1TA 1LPOA 3HP4A 1AT1A 3KX2A 2QBYB 2FXIA 1S2GA 4OQNA 1CP2A 3RC7A 3L9WA 1MXFA 2AX3A 4WK2B 4WXMA 5EIWA 2C8JA 4TQGA 1E1DA 1R0CA 1Y81A 2ZK7A 1S1CA 1ZUWA 1BGVA 2LBPA 1YS9A 2Q1YA 2Z2IA 3DXFA 5J59A 2VWHA 3G8CA 3CE6A 3GRFA 1CR1A 3JYQA 1DBIA 2B9VA 2P9YA 2P69A 3AHHA 1WUTA 4UM5A 2F9LA 4OBBA 4U8HA 3SZOA 4DWWA 3ZOKA 3TKYA 3KB1A 4ZCPA 4KDFA 4PGGA 3ANNA 2A9FA 2CHFA 1J20A 1GU1A 3PFFA 4RAQA 2ZJ3A 4CLHA 3WHLA 4MJ3A 1MEOA 4IQ8A 1EAYA 4XDGA 5CYFA 1TU0A 4HC4A 3DLIA 4Y6PA 3W1EA 3A10A 5CA1A 1IY2A 3BIXA 5K6AA 2EP8A 1FS4A 1SELA 1B15A 2NGRA 3QHQA 4JNCA 4NYIQ 5AD1A 2UDPA 2VYVA 1TL7C 4PHTA 1GSHA 2YN0A 3GRKA 3KZKA 3EF3A 3ZLBA 3DV0B 5C8YB 1CJMA 4G56A 3AI1A 3D3WB 4WKCA 2O2YA 2VATA 3IJPA 2HCRA 4W1RA 1SKUA 4NCIA 4D25A 4K2HA 1JILA 1KBOA 2DFLA 3QLUA 2XJ4A 4Q15A 4Z1MD 2VXBA 2OHHA 4IV8A 4LAFA 4X7RA 2E0IA 3R5JA 3R41A 4ARVA 2MCFA 4OX9B 3EMBA 4YDSA 1YSCA 2FFAA 1M34A 3UJHA 1E6MA 3GJ3A 3I09A 1QH8B 4R2HA 1PZXA 4D41A 5SZKB 1G42A 1R1DA 1Q7BA 4E13A 5IANA 4U7HA 1GPNA 4ZODA 3CLVA 3KE9A 3UJCA 1T24A 5DSXA 3HEBA 5C37A 4OQLA 3LLCA 5AK6A 4K9OA 2C0QA 2ZT8A 4KQGA 4NONA 3WZLA 3GRZA 4AY4A 3RVPA 1WUIS 2E21A 2PUJA 4TT3D 3CVVA 4AQ7A 1BX1A 3B6JA 4DDWA 3GB9A 3O83A 5ESRA 1S96A 3BWBA 4M7OA 4KB5A 2VH1A 2D74A 2WD7A 1NVFA 3T1VA 2HUNA 4LI3X 1S7CA 4MS3B 5K8UA 2DJ5A 2ZJYA 4GICA 3ABZA 4EHNA 2JLXA 3EXG1 3HXOA 4GMKA 4LBZA 4N5HX 1UFQA 2VKTA 2AOWA 3Q3GE 2AJTA 3WSVA 3IFSA 4BQOA 4EG6A 3BFXA 7YASA 1LVUA 2H8GA 3MWDA 1J0AA 4HR7A 3FG9A 4H1UA 5KMGB 4OIMA 4AKEA 3HN2A 2A0YA 1FFYA 3R3XA 4JLKA 1EHCA 3P97A 5AVTA 4KREA 3HR7A 4RPLA 2QQ0A 1F9EA 1YR9A 4I66A 3VVMA 1SC1A 4DCSA 1KO8A 3SBOA 2PZGA 3K9NA 3EGXB 3LU