3TRIA

Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
272
Chain Sequence
NTSNITFIGGGNMARNIVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTEQAIKVLESGNLRELFIKALTAAVNRAKELSKTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrroline-5-carboxylate reductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Oxidoreductase
total genus 98
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 3triA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3triA01
4YT5A 4LISA 1O95A 2OP1A 1CYDA 1KEVA 4JIGA 4XEHA 5CPFA 1LNQA 1Y8RB 3E9MA 3MTJA 3ROMA 4IJVA 4OHUA 3JQFC 2DTEA 3FF4A 1MC4A 2X1HA 2B4RO 4YVFA 4A27A 1HRDA 4XWYA 3H2SA 4BO9A 2CVOA 2OO5A 2X8LA 3JYQA 2I67A 2A9FA 3O9ZA 4R9SA 3E03A 3NGXA 3OJFA 3GNQA 4AFNA 3F5SA 3QWBA 3BIOA 1DC3A 2VQ3A 1GQ2A 1U9JA 3SBOA 3TNLA 3KBOA 1NVTA 3GGGA 3DMTA 4DRYA 2VZ8A 2D1YA 3NUGA 2DTXA 4BL5A 4NG5A 4BNWA 3RFVA 4JROA 4BO0A 2P9GA 1LC3A 1MLDA 2FPPA 1LLDA 4YA6A 2NVUA 3ZNOA 5HTOA 3JQBA 1XQ1A 5F3RA 2Y1GA 1LX6A 2CUKA 1E7QA 1D8AA 3BHIA 1BXZA 1PGPA 3PPIA 2WTBA 3WMWA 3ZU4A 1NYTA 1VKNA 1AE1A 4YXFA 1BGVA 4CUJA 2Q3EA 2IZ0A 2XPCA 2FZWA 3H9GA 1GD1O 4PG5A 3COSA 1CQIA 4MVJM 2DBRA 4E13A 1LXCA 2CVQA 1IE3A 3AUTA 3O38A 1ZXLA 2BLLA 3I9OA 2YFHA 4Z0PA 3WIEA 2HJSA 2AE2A 3JQGB 3M2PA 3UOGA 2VOJA 2Y0DA 3STHA 1MG0A 3TFQA 3UGKA 3H9UA 1BVUA 5A06A 5G4LA 1LDBA 3VPGA 2FHSA 3IQDB 1GV0A 3OP4A 5K6AA 4RQUA 1M76A 3VZPA 5JYDA 3A28A 1PJ3A 1Y5RA 3EAGA 5BNTA 1U5CA 4QT0A 2D5AA 4DQXA 1I3LA 1XIVA 2Y1DA 1XCBA 1ZSYA 1HDXA 1IB6A 2VUTA 1Z6ZA 3DL2A 2HRBA 3MJ4A 1T1RA 4XGIA 3WQQA 2PY6A 1FF9A 4CLHA 3PHLA 5JDIC 3WGIA 3MJEA 4OOEA 4TQGA 3K30A 4TKLA 4CR7A 1ADFA 4A26A 4MOWA 1V9LA 3CEAA 3JQ6A 3TZQA 4IJWA 3BMOB 4R3WA 4MDHA 1K0UA 2V6FA 4YRDA 2VRCA 3FWNA 1H2HA 1GZ3A 1UP7A 3JD1A 4Z9YA 4ZHSA 5ADHA 3ZNNA 2IDZA 3QWHA 3BXXA 2Q2VA 3H5NA 3NX4A 3JD4A 3E8XA 3ZWOA 4YAEA 4J49A 5L3ZA 3VZQA 4XD2A 5KOIA 1P1IA 3ST7A 3WFJA 3KUXA 4BGEA 3VZRA 4MVJF 1UDCA 1ZNQO 3KLPX 5KJEA 2B0JA 4Y6RA 1U28A 1LQTA 3AK4A 1GFSA 5A9TA 3RASA 4QECA 3WLEA 4F45A 3FRJA 4J1TA 5GZ6A 3ZCXA 4QSMA 1CRWG 1Q7GA 4RLSA 1P3DA 2BFAA 2H1SA 3GY0A 1HWYA 3C1OA 4RPLA 4YACA 2JL1A 5ICMA 5EIOA 1U1IA 4OO3A 2B35A 3LVFO 5ENVA 2PD4A 1O6ZA 3ONFA 3P2YA 1HYHA 2C29D 5LC1A 2O7SA 4GX5A 4CLRA 3ZWAA 1H2BA 4NK4A 4B7XA 1PZEA 1P77A 1IHYA 2ET6A 4FW8A 1U3TA 3ZV4A 3K8ZA 2DT5A 2X9VA 3U3XA 3IOYA 4IIVA 1UAGA 4OXYA 3UKOA 1ISJA 1M67A 2GZ2A 3DAPA 3G1UA 3OIFA 4YRAA 5KVSA 2WE7A 2NUAA 3V2HA 4B3IA 4CM4B 3DEYX 1MP0A 1GAEO 1NTOA 3WMXA 2Q49A 3HQ4O 3LT1A 3KEQA 3GNSA 3OMLA 5DBIA 4DIBA 4QO7A 5EL0A 1ONOA 2VHZA 5AVOA 2H6EA 2IRWA 1XU7A 1TI7A 3RJ9A 4U0JA 2YV2A 4BO5A 4ZN6A 3ULKA 1FMCA 4LMRA 3ZZNA 4YEDA 4HNHA 5LDHA 1U8XX 4FC6A 3GF4A 1NR1A 3GN1A 3N58A 5L4NA 2C0CA 4TMFA 2NWQA 1UXGA 1VRWA 4W6ZA 5G0WA 2OP0A 2VTEA 1QP8A 2PTGA 4IQ0A 1BWSA 1Y8RA 4NR0A 4WEQA 4ZICA 1V3VA 1PGOA 1QKIA 3QWIA 4ALJA 3NTOA 1WAMA 3W1VA 5I9MA 4ZU3A 1IL0A 6ADHA 3E48A 3GVPA 3LQFA 4M1QA 3ZWMA 1DLIA 3FI9A 3GDFA 5I7FA 5IAAA 4CM7A 2GN4A 4HX5A 4OSOA 3RUFA 4CMEC 2NU7A 3B1KA 4JLWA 2C2YA 4HNGA 5CDTA 1HZZA 3DDNA 4DPMA 3VPSA 5GMOA 3LC2O 3SX2A 5IN5A 5COBA 4PCVA 1EFKA 1UJMA 4JJIA 1F8GA 3GMSA 5DULA 2Q99A 3HSKA 5L7WA 3BA1A 1T24A 3EVTA 3BHMA 3GPIA 4FPXA 3S2EA 4ND2A 3I9KA 4G2NA 5KWEA 2NU6A 3AU9A 1F8FA 1DIHA 1PS9A 4DMLA 2NSDA 4B4VA 2NTJA 3JD0A 3CH6A 2PK3A 4X54A 1LU9A 1E7RA 2EEZA 1BDBA 5KJ1A 1H9AA 3F5QA 3JQ9A 3JQGA 1DO8A 1H9BA 3AJRA 1CERA 4ONEA 1D4FA 5EJ2A 1LRJA 4XX0A 2GERA 4E2ZA 4XYMA 1P31A 1SCUA 4Y6PA 1C0LA 1LRLA 4U8GA 1KC1A 4H7PA 2BMAA 2AQIA 3CZRA 4I9NA 2YQ4A 5ER9A 1PGJA 3G79A 3LYLA 4ZRMA 4EITA 2EKLA 3CKYA 5TJHA 3ROQA 3W4IA 4WCFB 4NH4A 3GGPA 2D5CA 3RU9A 3ASUA 4OMUA 5G4KB 2JAPA 5EPOA 3GHYA 4E2YA 1LDMA 1TB4A 1EVZA 1I01A 1WZEA 2Y05A 1LSJA 4FOOA 1I3KA 4F6LA 3FN4A 1BW9B 4IDCA 4XRGA 5G0UA 3BMOA 4Z6KA 4GBJA 4U6SA 1TEHA 4CQMD 3D3WB 3R6DA 5A9SB 1IULA 1E1NA 4EBFA 3KO8A 3W4JA 1XG5A 2ZQZA 2PZKA 3UH1A 1KVTA 4OYRA 1ZXBA 3ZWVA 4XQCA 3ZGYA 4BO2A 1IPEA 1XU9A 1BDMA 4XZ3A 2NTVA 1VL0A 1ZK2A 3QVOA 4OH1A 5JAMA 4J7XA 4RDHA 4DWVA 4J0EA 4L74A 4CR6A 2PFGA 1UH5A 3AFNA 1B3BA 3P2OA 3WYBA 2P4QA 4NU6A 1HF3A 1R4NB 1EK5A 1DXYA 3GNTA 4Q3NA 4XB1A 4D3DA 1AGNA 4HWKA 4ZVVA 4TRNA 5L4LA 1DFIA 3F4LA 3TZKA 2GSDA 1YQXA 1OMOA 3W4KA 1G0NA 3S8MA 4CL8A 2EWMA 3EW7A 2GN9A 3H65A 2CF5A 3C1AA 4L76A 1I2BA 5TLSA 2HK7A 1IZ0A 1UXKA 1EUCA 1KEUA 1ADBA 3DOOA 5DF1A 4L4RA 4CLEA 2AHRA 3GQVA 1MFZA 3QSGA 4R69A 5IF3A 1HDOA 2XXBA 3QQPA 5F1OA 2VWQA 3PLNA 1H0KA 5L7TA 4RPGA 2JHGA 2PLAA 3U4IA 5U1PA 2EHDA 4CM4A 2ZB7A 4M87A 3FNGA 5TC4A 4KWIA 4E21A 3PGXA 5C3MA 4J2HA 4RCVA 2J3HA 2YZ7A 3DZBA 2WEKA 2Z5LA 1ORRA 2O3SA 3NGLA 2EF1A 3TL3A 1OI7A 3U9LA 3UN1A 2GGSA 1EDOA 5JDIA 5EQFA 4KMSA 1LDNA 1HDZA 2DPHA 3VHRA 1XEAA 3WGTA 1PSDA 4WLVA 1HT0A 4L73A 1N9GA 1E3SA 3AM5A 2Y0CA 1X14A 2D59A 1BXKA 1EBFA 4RPHA 1Y81A 1HDCA 3OIGA 5CG2A 1NAHA 4ZQFA 1NVGA 1BG6A 2VHXA 2X6TA 4IM7A 2W98A 3RC1A 3GUYA 3V1UA 4R54A 3PJGA 1U4SA 5ITWA 5DP2A 2OHXA 4IBOA 2GDZA 3ZWYA 4D41A 3A4VA 5JYEA 4KQWA 4HFJA 4E2XA 3DZGA 4PG8A 1I8TA 2C7VA 3RU7A 4PLTA 3U09A 1Y8QB 3ZHBA 4AJ2A 1QSGA 4E12A 1HZJA 3QY9A 2I9PA 4XGKA 1JN0A 4CODB 1BXGB 4H3VA 2O2SA 3OFSA 1EUZA 3WNVA 1PZFA 1SBYA 1SO8A 4AG3A 5G0TA 5C5IA 3DC2A 6LDHA 3V1TC 2ZTLA 3GZNB 1HE4A 1KY5A 1O8CA 3CZMA 5A05A 1FDUA 4OL9A 1KVSA 2DFVA 1CWUA 1EUDA 4MKZA 2AE1A 3NRCA 2EG9A 3H8VA 3DONA 3U4CA 3AFMA 4WASA 1DBVO 2RHRA 3ADOA 4PLCA 2D2IA 3ZU5A 3GR6A 3JQEA 3ZU3A 2Q1TA 2P5YA 4CV1A 1UDAA 4NPCA 3JYOA 1BHSA 3PYXA 4NBTA 2VRBA 1N5DA 4L75A 4U5QA 3FD8A 2O7QA 1ZSNA 3C7AA 4ND1A 3WGHA 3EY4A 4GGOA 3VVCA 2PH5A 3RVDA 3ZWXA 4YT2A 2X5JO 4NK5A 1DC5A 2BF7A 1UZMA 1VL6A 4FQ8A 2A94A 3F9IA 3I4CA 4XYGA 2VWPA 3C1TA 3NEPX 3WDSA 2ZCUA 4GH5A 1XKQA 1M2WA 2DBZA 1UZLA 4M54A 4JGBA 4JJFA 3FPCA 4XB2A 4DIFA 2WD8A 4K26A 3BMNA 4WCFA 4DC1A 1VSVA 1GZ6A 5G4KA 1WWKA 2WM3A 1TVEA 1X1TA 5DCWA 4DC0A 5KJ6A 3QJ5A 2HK8A 2HUNA 3PWZA 3FPLA 5T67A 1BW9A 1ISIA 3QHAA 5JDCC 4EUEA 1ML3A 3EYWA 4ID9A 2BELA 2HAEA 4K6FA 1PQUA 4BGVA 1DFGA 5L7YA 3FR8A 3ORFA 5HBRA 1SNYA 3D3WA 3KV3O 5A9SA 3ZI0A 5AOVA 5L45A 3U5TA 3GA0A 4EI2A 1DIGA 1EE9A 2QHXA 3DBHB 4LCJA 1GADO 1SMKA 4UAGA 2V65A 5BSEA 4EEZA 2OUIA 2PWZA 4BGUA 1E6UA 3ZH2A 2PNFA 4WCDA 4B7CA 2IXBA 4CLDA 2VHYA 1PL6A 1C0IA 1SEPA 3PI7A 4TROA 4P4GA 1E3JA 3MJVA 2AQ8A 1PJCA 3HDJA 1GUFA 5JAQA 3A06A 3CMCO 5DT9A 4XJTA 4IQ8A 4L8VA 3DXFA 1KS9A 1R4NA 2P2SA 4R1NA 4JK3A 4BV8A 4CMJA 5L40A 3NT2A 3CPSA 4MPDA 3RUIA 2ZB4A 4I9HA 3JQAD 2JKVA 3DHEA 1RM0A 3GOHA 4LGVA 2FR8A 3JCZA 2P9EA 4KUGA 3TZHA 3PDUA 4Y98A 2G76A 4MVJP 3UHAA 4B8WA 9LDBA 4II3A 1WZIA 4QQRA 2B5VA 3RWBA 4BQRA 4S3MA 4PIVA 2JD0A 1N8KA 1X7GA 5A9RA 1UUFA 3RBXA 4FFPA 2E49A 2GO1A 3GK3A 5B1YA 2C54A 4PLYA 3MCVA 1LTHR 1R16A 1Z75A 3PYMA 3WYCA 1MXHA 5TX7A 2HU2A 5IG2A 5ICSA 1HSOA 1WDMA 5JSFA 4R51A 3DZIA 1OOEA 4WLFA 3B6ZA 4Q3AA 1U7HA 3PQEA 4HFMA 3KETA 3IP1A 4O63O 1HE5A 5IJZA 4DBVO 3AI3A 3DFZA 4PRKA 2ZTMA 4R1SA 4OGWA 5CFZA 3KYDB 2ZJ0A 1L7DA 3RKUA 1P9LA 5ILOA 3ETGA 3IAHA 4I08A 1E6WA 3KSUA 4TWRA 3WTBA 4GI2A 5I7EA 5L9AA 4GX0A 3HB5X 3BTOA 5DP1A 1ZK0A 4RQTA 5MDHA 2AQKA 1YL7A 3WYEA 2WSBA 1QV7A 2WJPA 1PJ4A 3PJFA 5F5NA 4DYVA 5BQFA 4TRMA 2W2LA 3ZDFA 2JD2A 2GN8A 1B8VA 3QV1A 1LJ8A 2Y66A 3JQ9C 3FBTA 1NXQA 1BMDA 1F0YA 1JKJA 3JSAA 2VHWA 2CD9A 3TOZA 4XYLA 1NQAO 3ITKA 4D79A 1S7CA 3UCFA 2AEFA 4IDAA 4PRLA 5B12A 3AUSA 3LC7O 3H7AA 3OQ6A 4CJXA 3DBRB 3ETDA 4W9NC 1O0SA 2Y93A 3KVOA 1Y8QA 3L6OO 4XYEA 5EINA 2HLPA 2CZCA 2DFDA 3IJPA 1HDRA 4UVIA 4BNVA 1P1JA 4OJNA 1Q0LA 3PGJA 1Z7EA 1Y9EA 4LW8A 3INRA 1V6AA 2XAAA 1K89A 2P5UA 3E1KA 3G1TA 2X9NA 1GQYA 3ICCA 5T6BA 3GZNA 5FI5A 1C1XB 2HRZA 5GZ1A 1EBUA 1RYEA 3RUAA 1GU7A 3EZYA 1AXGA 3C7CB 1TLTA 4BGIA 5CEJA 1FJHA 3F1LA 3RJ5A 5TNXA 3F46A 4WK6A 4JJGA 4LRSB 5KKCA 1S6YA 3A14A 4MINA 2YY7A 5I7VA 2PGLA 2NTNA 2JCVA 2O3QA 4QTZA 4UUNA 1ZZEA 2CMDA 3JQ8B 3WX0A 4MKRA 2POQX 1OFGA 4H16A 5JO9A 1V35A 4D0RA 1ZSVA 2RAFA 4LSWA 1H6AA 4RPKA 2VYND 1LSSA 4MJLA 1TA4A 1ZK1A 2FPGA 3HDQA 4J9UE 4OXKA 2PKQP 2VRCD 2VWHA 3BHJA 8ADHA 1HYEA 3K31A 4ZGWA 1R12A 3CSDA 2F1KA 4O1MA 2Y68A 3DO5A 4WNIA 4MIOA 3VH2A 1ENZA 2J5RA 4PG6A 5IXYA 3F6YA 3OECA 4PLPA 3K92A 1T4DA 1W73A 1U4OA 1DJQA 1YOVB 2ILTA 2QIOA 2FY8A 4CPDA 3ZWBA 3F47A 1GTMA 1Y9AA 5JE8A 2DC1A 3RCBA 2OFPA 4LMPA 3MWDB 3NDJA 1WMBA 2XOXA 3TFOA 3FTNA 4HXYA 3UVEA 3O03A 3ABIA 1P0FA 2GR9A 3E5RA 4Q3EA 3PXXA 1VM6A 3GG9A 3RC7A 1R37A 1P44A 4Z0HO 2B4TO 1QV6A 3LLVA 1CJCA 4K6CA 1ENPA 5DCUA 3FWZA 3G0OA 2A35A 2RHCA 4IDFA 3JYLA 5IZCC 4CMBA 5MGBA 4BO8A 4E5NA 4IJUA 1RJWA 5BNIA 4URFA 4MVJH 3TWOA 2QW8A 4GMFA 3VPHA 3OA0A 4GVLA 2CDAA 3OIDA 3ONEA 4J3FA 1KC3A 3WBBA 3EHEA 3WGZA 4PZCA 2C82A 3AY6A 3O8QA 3T4EA 4CR8A 2VYNA 3ZNPA 1P0CA 5FI3A 2QZ9A 5JBIA 3BMCA 3KOUA 2BD0A 1ZK4A 5F5LA 4A7PA 2WYUA 2UYYA 5A1TA 1HKUA 3H9QA 3GT0A 4D3SA 2HDHA 5KVVA 1B7GO 2JFFA 5F21A 5THKA 1Z45A 1VJ0A 3HWRA 1F06A 1NQTA 1BSVA 4R01A 2AMFA 3WXBA 1QMGA 2DUUA 3I83A 2VUSA 1PZGA 1WDLA 3K96A 4WLNA 3VC7A 2FSSA 3ETEA 1JVBA 3VH3A 4CM8B 1ZMTA 2J6IA 1PL7A 3WG9A 2OXIA 4BMVA 1Q7BA 1XGKA 1CEQA 1T2FA 1GY8A 1LLQA 4MO2A 3H4VA 3VZSA 2GF2A 1I33A 1DHRA 3Q6IA 4TKMA 4ALKA 2V6GA 1R0KA 2DU8A 4NJMB 3GH3A 3AY7A 4WJZA 2DVMA 3KYDA 2QG4A 5H82A 4EGFA 3GDGA 3E9QA 4XQGA 4YJDA 5H81A 1Q2XA 2PH3A 1HLPA 4IQGA 5B4VA 4KQXA 5JFOA 4YJHB 4XYBA 1R0LA 4J2OA 3R3JA 4BNZA 4R1UA 2TMGA 3C8MA 4J91A 3P7MA 1I3NA 4WLUA 2FN7A 4D43A 3GAFA 4IMPA 3I1JA 3FNHA 3BAZA 2BI7A 1JLLA 5AQ1A 4A2CA 5JDCA 1A71A 2Z1NA 4Q3BA 1CF2O 5DCYA 3WGGA 1AXEA 1K6XA 1O89A 3BTVA 3M1AA 3S2FA 4NBRA 1U7TA 3R1IA 1MA0A 4KZPA 4J1QA 5K6AC 4IZIA 4AJNA 3WTCA 4BIIA 1NFQA 1E3EA 1E5QA 2QQ5A 1PJSA 1HETA 1ZVMA 5IDWA 1IYZA 4I5DA 4WCFC 2E4AA 4XIJA 3JQDA 1KETA 1E3IA 4XDYA 1YBAA 1L1FA 1YL6A 1PZHA 2J5QA 3L6DA 3RIHA 4G81A 3INGA 4ZQGA 7MDHA 1LLUA 1WVGA 1PWZA 2D0IA 4XDZA 4DVJA 2CDBA 4W7HA 2GPTA 4ITUA 3V5NA 4DGSA 2J8ZA 1C1XA 2BI8A 3M2TA 3MWEB 5TGDA 2NV6A 3ANLA 2X7HA 4FB5A 3S1LA 4EJ0A 2EERA 3PRJA 4Y8VA 3RKRA 4KP7A 5JY6A 3Q9NA 5U4QA 1EQ2A 2TMDA 5L51A 1XELA 3I4FA 4AVYA 4I8XA 5BSFA 1EE2A 3DZJA 3JQ8A 1PEDA 3K9QO 3DZKA 2CY0A 1SPXA 2X5OA 3S55A 2NQTA 1AN9A 4NIMA 3WR5A 2VN8A 1SZJG 3LZ6A 3L0DA 5JCXA 2PD6A 2IZ1A 3LK7A 5L4SA 1X7DA 4CMHA 5JS6A 2I6TA 3WB9A 1ENYA 3K2BA 4BKRA 3PLRA 1KVRA 4GX2A 3Q2IA 3GRPA 1PS0A 5DBGA 3ZHYA 4IDDA 2X9GA 3X2FA 5ITVA 4IMRA 4AICA 1PL8A 2W8ZA 3QVWA 2PA3A 1DSSG 4EZBA 1A5ZA 5DN9A 3I9NA 5C7LO 5A04A 2VOEA 4GX1A 2DAPA 2WDZA 1YOVA 4LSMA 2PZJA 2BHLA 3GG2A 3DHYA 1E1KA 3R3SA 2GRAA 3TN7A 1NQ5A 1IOLA 2CDCA 4WLEA 5J23A 1C0PA 4L9RA 2C59A 3QVXA 5BR7A 1RYDA 4UEJA 4I5GA 4DYDA 3TSCA 4BB6A 4FBGA 3NDRA 5I9NA 4O59O 1QYCA 1ADGA 4FFOA 2E82A 5EQDA 3K2EA 1I30A 4N5LA 3H9EO 5DOVA 1MFPA 4BNXA 2A92A 1DRVA 3TPCA 1U3VA 3DZFA 1DAPA 3IUSA 4KTVE 2UV8A 2DBVO 5I8ZA 4BNUA 3GAZA 1XSEA 2HCTA 4W9NA 2JAHA 2HJRA 5FF9A 3WICA 4QXMA 4EEXA 4C7JA 3GVHA 1VC2A 1NPDA 2IE0A 2VWGA 4LRTB 3MJSA 5K9ZA 3JD3A 1HDYA 1F17A 3RUDA 2EP7A 2O50A 4CMIB 1AHIA 3EDMA 4IS3A 4U0KA 3VH4A 3HN2A 3AI2A 5JC8A 3PYLA 4JQCA 1NWCA 1GYRA 4E6PA 5JNLA 1DPGA 4GPD1 4QUKA 5KNLA 5AXDA 1X1EA 1C1DB 3TRIA 1PS8A 1YDWA 1JAYA 1E7WA 4R4JA 5DDIP 4ALLA 4BQPA 1AUPA 3DFUA 1YE3A 3ZN2A 1H6CA 2RH8A 1WDKA 1LDGA 3SLKA 4QO8A 3T4XA 4CMKA 4UVHA 1NQOA 4YAIA 2O3UA 1H6DA 3Q2KA 2EKPA 2Y99A 4CM8A 2O23A 4Z0TA 3K5PA 1K3TA 1UDBA 2GASA 2JFGA 1NASA 4YJFB 1BRMA 1DRWA 5G2OA 3B20A 3PVZA 1FDVA 4QX6A 2D4AA 3LU1A 3DTYA 4CM9A 4N54A 2PZMA 4EJ6A 2C7GA 2PKRA 3AOEC 4E30A 3H2ZA 3VPXA 4R1TA 5JPIA 4JP2A 3GFBA 3HUDA 5BT9A 5BSGA 4OKIA 2VYVD 2QRLA 1T2CA 4YJHA 4EUFA 2H63A 5GZ3A 4ZA2A 4YQYA 5H83A 3MJTA 4W4TA 2WD7B 3ZWPA 3K6JA 1FDWA 3V2UA 2EP5A 3I9JA 1DC6A 3HHPA 3FR7A 5ES3A 4CUZA 1PJLA 1ISMA 1MXFA 4I1IA 1Y5MA 3W8FA 1GQQA 2EW8A 3NT5A 4FCCA 4EYEA 1ONPA 3EVNA 5IZCA 1T2AA 4RZIA 3LT0A 2BFOA 4Z9XA 5TJ9A 4F46A 4CUKA 4XJSA 1DB3A 3AY3A 4RORA 3OJ0A 1B0AA 3D1LA 1PJBA 3CTMA 3BMQB 3H5RA 2R00A 3C3XA 3HDYA 5EERA 1TT5B 4BB5A 2Q1SA 4XQEA 3LLSA 4U7WA 3TJRA 1VPDA 3WIDA 4UUOA 1ADCA 1JKIA 1T25A 2NNLD 4FC7A 5KCZA 4Z3KA 1JWBB 4J4BA 2Y1EA 4NZ9A 1T2DA 4UVDA 1MUUA 3H9JA 4M8SA 5TSDA 3O26A 3FHLA 5CDYA 1AHHA 4RVHA 1VSUA 2D3TA 3VVBA 4GKVA 1WLYA 3IDSA 4BNKA 3F3SA 1A72A 4ZJUA 2IEBA 3PDJA 2ZYGA 3D5TA 2X23A 2IZZA 3QE3A 4IPTA 5TIIA 3OEWA 2HMVA 3QA9A 1YDEA 2VYVA 2V6MA 2NQ8A 1YO6A 3JD2A 1UZNA 2ZJ1A 3UCXA 4E3ZA 3QWAA 2YHUA 4FS3A 3X2EA 4MVJE 1KEPA 2DPGA 1D1TA 1Q0QA 3WQSB 1I3MA 3PHGA 3KZVA 4B8ZA 2RIRA 4W7IA 1GZ4A 1NPYA 5A03A 2Q2QA 3D3EA 3GGOA 3WJAA 1R15A 4PLGA 4KUEA 3RSHA 1NFRA 3TF5A 1VKOA 2CFCA 1YJ8A 1EK6A 2I76A 2P4HX 1C14A 1HYGA 4LVUA 4GMGA 3I3OA 3ENNA 2OOSA 4XQ9A 2QZZA 1B16A 1DJNA 3I23A 2QRJA 4RF2A 2BGMA 2HMUA 3GEGA 3HG7A 3NKLA 5F1PA 3LC1O 2BFPA 5CHEA 4XGNA 3CXRA 1QLHA 2Z1MA 5HS4A 2QYSA 1LBEA 4ALNA 2HQ1A 3AUAA 4CMGA 4M55A 1XWFA 5T8KC 4YAKA 5A4DA 3QWFA 1M66A 5C7IO 3I6IA 5IXSA 4RVSA 4IUYA 5BSHA 4OOFA 3E9NA 4J9VA 4MP6A 3NTQA 2EJVA 1LA2A 2Q4BA 3CIFA 4HADA 2I5PO 1A9YA 1BVRA 4KWHA 3OBBA 3A9WA 5G0SA 1Y6JA 1C0KA 1NNUA 2Q46A 4P4NA 5CPBA 4G5HA 3OICA 4E33A 1P1HA 4R5HA 3U0BA 5HWSA 2G1UA 4Q3DA 4DLLA 2ZB3A 1A4IA 4P22A 1A9ZA 5IDQA 2DTDA 1VJTA 2BRUA 3RBVA 1R0SA 3M6IA 5L53A 2IODA 4UVGA 4ZQHA 2FOIA 2JCYA 1Z74A 4DA9A 3INTA 1FDSA 2X22A 1YONA 4N5NA 4B4UA 3GVXA 1C1DA 1X15A 2E6UX 4AJJA 3ADPA 3AM4A 3W8EA 1ZW1A 5JLAA 1A7AA 1EZ4A 3PWKA 3OJLA 4RVGA 2YHIB 1OAAA 2Q50A 2VT3A 3AOGA 3ROPA 1YQDA 3KTDA 1Q0HA 2W2LD 3I9MA 5A5EA 4ND4A 2FSVA 5KVCA 5COQA 1ZK3A 3B1FA 3HFSA 4ALIA 4K28A 4DQVA 4EW6A 3TZCA 4MP8A 4YJFA 2P68A 3NYWA 1GR0A 5CDGA 3ZW9A 1LUAA 2YW9A 5B37A 4TRJA 2UUOA 3FNFA 3GFGA 2WMDA 5IDYA 1I32A 5JW6A 4JN6B 1E3WB 4JP3A 1O5IA 1T4BA 5T5QA 5ENDA 4GLOA 3IKTA 1ZMOA 2BGKA 2IYOA 4PGFA 1LLCA 2ZYDA 4BNNA 2ZK7A 3DBLB 1SEVA 1KVUA 2NLOA 2FMUA 1PIWA 2WD7A 4BMNA 1XYGA 2GN6A 4UVEA 2AQHA 4J6FA 3I5MA 3LT2A 4B79A 1KVQA 2NU8A 5I7SA 3Q9UA 2OBYA 1EVIA 4WKGA 3W6UA 4AJ4A 1K5HA 4NBWA 4E31A 2H9IA 1WXDA 3LF2A 4Y9DA 3WWZA 4UEOA 4IGFA 1Z73A 2I66A 1KIFA 1N1EA 2O3TA 3VTFA 4L4SA 4FD3A 4QFDA 1VJ1A 1ZCJA 2O3RA 5AXAA 1GYPA 3OQBA 4K1LA 4UEKA 4DREA 1VL8A 1X7HA 4FFLA 1N92A 3BMQA 1TT5A 2DM6A 4RVFA 1RKXA 1YQGA 3GN2A 2B5WA 3ZV6A 5A3VA 4E0BA 1YWGO 4MVJA 1SOVA 2B83A 2C5AA 1OBFO 2HSDA 3DBVO 5EESA 3DR3A 4GL4A 3A1NA 1V8BA 2GCGA 3HB4X 1DEHA 2EJWA 2IYPA 3HNPA 4CLRB 3WWYA 1MG5A 4NNJA 5JC1A 4PN3A 3B1JA 2G0TA 1CDOA 1CQJA 4PLHA 2A4KA 3L4BC 2NACA 3WLFA 3E82A 4BNTA 4EJMA 3RROA 4GSKA 4BKUA 1I5RA 4CV0A 4Y67A 5G0VA 1E77A 1PWXA 4R5MA 3UUWA 4BKOA 1BXGA 1GCUA 1QG6A 4HP8A 1B2LA 4WEOA 1YB4A 4N5MA 4A10A 5CDUA 3KSZO 1GPDG 3SC4A 1F12A 4Q3CA 2WWRA 4YWJA 3LT4A 2UAGA 1N2SA 3GVCA 2O3JA 2P91A 3KLMX 3EZLA 3GEMA 4OM8A 4BNGA 5KJFA 1DIAA 3AOEA 4CM1A 4R3NA 3D7LA 3E6AA 3V8BA 2JJYA 2X0NA 3P19A 4FOSA 4TZTA 1U8FO 5TT0A 3UCEA 2G17A 2OMEA 1XDWA 2YDYA 1C3VA 1NVMB 3EC7A 3PEFA 5LDGA 4MVJI 4EDFA 4FR5A 1R4MB 1PGQA 3C24A 4P38A 4MIEA 9LDTA 3IIEA 4N18A 4OQYA 3U49A 3WQRA 4AJHA 3NAQA 1YBMA 1D7OA 4J1SA 4RZHA 2ZIZA 1MC5A 1T2EA 2ZQYA 3ZHZA 1LSUA 3EMKA 3GUCA 4IXWA 2FWMX 3HN7A 2R6JA 2UVDA 3OJEA 4PLVA 2Y1FA 2EW2A 1EFLA 4HFRA 4G65A 3RUEA 1D3AA 4ALMA 1DFHA 2Y1OA 2CF6A 2Q1UA 1VI2A 1QLJA 1RWBA 1UXHA 1ZUD1 1DOHA 4IDEA 5T64A 1XHLA 2EIHA 4WUVA 3TZ6A 2ZTUA 3D4PA 3ZWCA 4AJKA 4MVJG 2RCYA 1JTVA 2Q2WA 4WOKA 4YT4A 3QIVA 1MV8A 4CL3A 1NHWA 2VTDA 1HLDA 3H5AA 1W4ZA 3RUCA 5B4TA 1ZFNA 3ROKA 2X0RA 5JCJA 2C2XA 1MGOA 4HV4A 5AYVA 3DBHA 3ZHXA 4B7UA 4I9UA 4OQZA 4W99A 4FIZA 1GYQA 2H5LA 3UW3A 5K0ZA 3PZRA 1RPNA 2YHIA 4JXKA 3AM3A 2VZ9A 3H6KA 3OQ1A 2R00C 5LCXA 1FK8A 1BTOA 2VHVA 1IY8A 1J6UA 4DLAA 1GCOA 4FFMA 3PQFA 2CNBA 1ISHA 4WE3A 4HBGA 3L6EA 1W8DA 5ER6A 2J5KA 1G6KA 5C7OO 2BFMA 1ZEMA 1O9BA 3BYZA 2GD1O 3ENKA 3ONDA 1SC6A 4CV3A 1K2WA 1E3WA 1JW9B 1HEUA 2IXAA 2XF8A 3GRKA 4LVCA 3PK0A 4YAGA 2QYTA 4CMAA 2Q45A 1DAOA 1EDZA 2BKAA 3VPFA 3ICPA 3EGOA 4NI5A 5CG1A 3MOGA 1E7YA 3ZV3A 1YB5A 2VT2A 4F3YA 3CE6A 3DBLA 3OF2A 3HADA 5T8KA 1Y1PA 1X0VA 2X4GA 3WFIA 2Y1CA 1GPJA 4YAJA 2X58A 3IUPA 3GMDA 1U3WA 2UDPA 1IUKA 4KOAA 2F00A 3JYNA 4RVDA 1UXJA 1E0DA 1G0OA 1FXSA 1YRLA 2JFHA 2X5KO 4Z9FA 3WSWA 1EVJA 1Z7BA 4DUPA 1P1KA 2IEDA 1ULUA 2OZPA 3IC5A 3MZ0A 1NPTO 1E92A 2DLDA 4AJLA 4GKBA 5DBFA 4J7UA 1XQ6A 3WS7A 4NMHA 2VZ0A 5TRTA 4MP3A 3U4DA 1KYQA 4E2WA 1J0XO 1B26A 3WJ7A 2O2YA 1LI4A 4A73A 3HFGA 3ASVA 2YV1A 4BO6A 4OAQA 4CM6A 2AXQA 3L4SO 4ILKA 5IDXA 4PFJA 5CEFA 3VTZA 3PJEA 3L9WA 3PHHA 4RL6A 3DQPA 3D5QA 4FJ2A 1KERA 1JWAB 1L7EA 4RDIA 3KB6A 2D8AA 2SCUA 5IFLA 2ZYAA 3UICA 5TF4A 2EXXA 2YUTA 3MEQA 5AXBA 1SOWA 4IDBA 3DBRA 5HS6A 3S2GA 4II2A 2NVWA 2WYWA 4RO0A 2VUUA 4BNIA 4CM5A 4D45A 3NT4A 4M89A 1M75A 4GLLA 4UUPA 5DZSA 5EN4A 4E5MA 2UUPA 1PQWA 1NP3A 3LF1A 5BNFA 4BNLA 1GEEA 1SB8A 4YT8A 1JU9A 2FRDA 4D44A 4CQMB 4PZDA 2EGHA 4B4WA 3EK2A 4YTEA 4XRRA 3RC9A 3DTTA 4QEDA 4AJOA 4BVAA 1DDOA 1U3UA 1F14A 4NBVA 3BTUA 4B3HA 4RF5A 2OGUA 5JAIA 2EKQA 1YVEI 2GUGA 4M49A 1RM3A 4FJ1A 1PR9A 2FR1A 2WYVA 2VNSA 5JXWA 1WW8A 2Q4EA 4YJGB 4ZD6A 3UF0A 1N9GB 4YDRA 3PHIA 3LSYA 5EMHA 4MKXA 2FR0A 4BNYA 1JKFA 1I10A 1PGNA 4LN1A 4Z3DA 3DAFA 4HUJA 5TQVA 4DIOA 1R4MA 4HKTA 3TQHA 3PWSA 3SJUA 5JMPA 4CMCA 1ZKMA 1V3UA 2LDXA 4NFYA 3DOCA 4BNFA 1Z82A 3C85A 1H6BA 1QORA 1KBZA 1VE9A 1HE3A 1EQUA 1I24A 4PLFA 4PG7A 1GUYA 2O4UX 4JX8A 1NBOA 4R16A 3R0IA 4BO1A 1EMDA 2AEMA 1LDEA 3D0OA 4UUMA 3ZNQA 4NHEA 1G1AA 3IMFA 3ON5A 1DLJA 1NHGA 4BS9A 3SXPA 5HM8A 3O4RA 1B3RA 3GDOA 1H93A 3TOXA 4BO4A 3F1KA 4ND3A 1K6JA 1J5PA 4JBHA 5I9LA 4BUCA 5A02A 2YDXA 2DBQA 3C7DB 3RAJA 1ISGA 2C07A 4A0SA 4FDAA 1QRRA 4CLOB 1WP4A 4K9DA 4CM9D 4AJIA 3K73O 3RBZA 1SB9A 4TVBA 2ZKLA 3JTMA 1GEGA 5KKAA 2OBNA 4WPGA 1HTBA 3NJ8A 5DNAA 3KYCB 4RJTA 3L4BA 3E5MA 2X86A 3HE3A 4KDFA 4NQZA 1WNTA 3AI1A 1GUZA 2JHFA 3QLJA 4RVUA 1JA9A 4BKPA 4D3FA 3PTZA 4YBZA 4INAA 4GSLA 4CQLB 2NU9A 4E5YA 1CETA 3PHJA 1DIRA 4OSPA 4JNKA 4R68A 2V6BA 2GZ3A 3KXDA 5JMWA 3SVTA 3EUWA 3DAGA 1M6HA 1ZEJA 5A5FA 4J1NA 2QX7A 1LC0A 5FFFA 5CAEA 1HSZA 1DC4A 4E5KA 1B8UA 4WLOA 3BMNB 4NBUA 1PJQA 2W4QA 5IZ4A 3GC6A 1ONNA 3RI3A 4KDEA 4LK3A 3JQ7B 3D64A 4BO3A 5HRUA 1GL3A 4W82A 1UXIA 2C5EA 3DMYA 3U62A 1PJ2A 2OORA 4L0QA 4WGGA 3KHUA 3PZBA 4J0FA 4F6CA 4IDGA 4DBZA 1CIVA 3JQFA 2P9CA 3KSDO 4JBIA 4QFCA 4NU5A 5F1KA 3T7EA 3WOHA 1EEHA 4B3JA 1QYVA 3L77A 4DLBA 3KEOA 2W2KB 1HDGO 7ADHA 1T26A 3DB2A 1N1GA 1YXMA 1ARZA 3E18A 4RLHA 1ZIDA 2I99A 4NJMA 3RFTA 3ZU2A 4J7CA 1QYDA 3TL2A 5KJCA 4GGPA 3RQSA 3WGYA 1P74A 4BNJA 1A7KA 1NFFA 1WMAA 4ESOA 4UULA 1OZAA 2J3IA 3MOIA 2PKQO 3NV9A 2ZB8A 1V3TA 2B4QA 2RBEA 4OXNA 3W8DA 3VH1A 1IZ9A 2X0IA 2XXJA 4Q39A 4WNCA 3WNQA 3UFXA 4O6VA 5CEEA 1H5QA 4FFRA 2I65A 3QP9A 4S1VA 5C37A 2NADA 2QRKA 2B37A 3L07A 4FGWA 3MJCA 5A3JA 1ZH8A 5ILGA 2J3JA 5CP8A 1Y7TA 2CSUA 2AEJA 1XA0A 2ZCVA 1VLLA 2DKNA 4YRBA 3QVTA 4DQUA 3DHNA 1EVYA 3AUUA 5FWNA 1IPFA 2J3KA 1N7GA 3B70A 5IN4A 3DMTC 3IL2A 4BNMA 2I3GA 3HDHA 5KIAA 4FN4A 2Y0EA 3OHSX 3Q11A 3ANMA 1I2ZA 3JQBC 1U2GA 2PGJA 5AXCA 1LEHA 1NR7A 1YH3A 3S2IA 5TT1A 1HL3A 1E3LA 3QW2A 3VOSA 1KY4A 1A4UA 1UAYA 1JQBA 2PD3A 4A03A 4CQMA 1J49A 3OETA 4I5FA 4R41A 4FSHA 2YJZA 4DTIA 1E1MA 1O94A 3V2GA 3KM0A 3L9XA 4IGEA 2AG5A 1ZBQA 3WSVA 1I2CA 5TS3A 2AW5A 4XCVA 1ZJZA 3M1LA 3DZHA 4E5PA 3SJ7A 2RH4A 3PP8A 2LDBA 1P1RA 4IY1A 1DIBA 4NJOA 4NFSA 4YCAA 4YJGA 4IIUA 4TVOA 4P8RA 4KUHA 3WGOA 3FCOA 1LDYA 3H3JA 2C20A 4B4OA 5JO0A 3G49A 4RF3A 1DRUA 1YJQA 1B15A 2YQ5A 3TDKA 4D42A 3PIDA 1JAXA 1OC2A 1V0JA 2Z95A 3PFFA 1UR5A 2HKIA 2E48A 3AWDA 3JQAB 3OH8A 4IINA 4YQZA 5FYDA 3IS3A 3ZWNA 1P45A 4IZHA 4DL9A 2PR2A 4LCEA 1P1FA 4YR9A 4D46A 2EGGA 1T1SA 2GLXA 3ANNA 4J43A 3UAGA 4AJ1A 4FJ0A 2CVZA 3PJDA 1IHXA 3GVIA 3AU8A 4E4YA 5FEUA 4WOJA 4IJKA 1D1SA 1YGYA 1U2DA 1W6UA 3CUKA 1PU2A 4DPKA 4TRRA 1PR3A 3IKVA 4TZKA 1P33A 3T7CA 4A5OA 3P5SA 1W0CA 3GHHA 2GYYA 4Y6SA 3ZW8A 3OJOA 2YV3A 4FGSA 4P4LA 4ZRNA 2ZATA 5B4UA 3F4BA 1FDTA 2EV9A 2FPIA 4ZQEA 4DPLA 2PZLA 4O0LA 1J4AA 1QXSA 3N7UA 2NM0A 4CLOA 3NJ4A 4FFNA 1U5AA 3HJAA 1YL5A 3CMMA 1R6DA 3FNEA 1NWHA 1ENOA 1QR6A 1N7HA 3N74A 4XR9A 4KTTE 4E32A 1YS4A 3RD5A 2NVBA 3KYCA 3Q1LA 1PJTA 2NVUB 3JV7A 4J4HA 4MIYA 3U4HA 3VDQA 2Y67A 4BKQA 2AG8A 4NDNE 1NX6A 4BHTA 4ND5A 1E6EA 1JDJA 2O48X 3CINA 5GY7A 4CQLA 3VDRA 2DUWA 2B69A 3ITDA 2V7PA 4NFHA 2YFQA 4CMIA 2HMSA 3D4NA 4CLXA 3PFWO 4RF4A 3ZWWA 1Q7CA 4OIMA 2X0JA 4ROSA 3JQ7A 4RPJA 1NAIA 4PZEA 2O4CA 2GZ1A 1DHTA 1HE2A 3AW9A 3DWFA 3HZZA 2WE8A 2PV7A 3GZ4A 4GWGA 3IJRA 8LDHA 3I52A 1QYXA 3MTGA 2W90A 4PVCA 3ZV5A 1UP4A 4MVJD 4BO7A 3GLQA 1PTJA 4UREA 1YBVA 1SAYA 3RFXA 2I3AA 1E5LA 4PG4A 2W2KA 1E1LA 1LQUA 4IXTA 5COAA 4DXHA 1MX3A 3FBGA 4EUHA 4PVDA 4IS2A 3BTSA 1ULSA 4CMEA 4BOYA 4Q9NA 3VKUA 1X13A 5HA5A 2VNAA 5JY1A 1K6IA 3O8QB 3QRWA 4BV9A 1PQPA 3RC2A 5L95A 1LRKA 2AA3A 4D0SA 3BMCB 4J4TA 5THQA 3OM9A 1OC4A 3PIIA 3VKVA 2HMWA 4J16A 3FSRA 4D7AA 3NDIA 2R2GA 4PLWA 3Q3CA 4HY3A 4AJEA 1XR3A 1RM4A 5KTKA 1B8PA 1H94A 3G17A 3NTRA 3DOJA 1HXHA 4YPOA 3KYBA 3OEYA 4M86A 4DMMA 1TT7A 2BGLA 2G5CA 1WPQA 4YB8A 4RV9A 4OKNA 2YYYA 3SLGA 5T57A 1KOLA 2Q1WA 1ISFA 1RM5A 1B14A 2HO5A 1MB4A 4GWKA 4WECA 4CM3A 4CV2A 3I9LA 3PQDA 2FZEA 4YYZA 4U6QA 2VCYA 1I0ZA 4XKJA 3SC6A 1M6WA 3W6ZA 2E37A 2DQ4A 3OA2A 1JVSA 4PLZA 3SEFA 1TXGA 3V1YA 3WGQA 3GEDA 4H15A 2GNAA 4O5OA 4BMSA 4HFNA 4AJPA 3JQCA 3QVSA 4AL4A 3OSUA 1Q1NA 2PGDA 5KVQA 1YKFA 3VAZA 3Q0EA 3GPDG 2OL4A 3D4OA 3KRTA 4ZQBA 2B36A 4XA8A 3JYPA 3I6QA 1E7SA 2BH9A 3UXYA 3LDHA 4I5EA 4TSKA 2HMTA 1ZJYA 4XR4A 4RGBA 2FP4A 2JD1A 2G82A 3FTPA 2HK9A 1YB1A 4GQAA 3WBFA 4L4XA 4JBGA 2ZTVA 3IP3A 3JQAA 4JCOA 1PX0A 4XIYA 5JCJD 1R66A 1XLTA 1ZO8A 4BNHA 4GVXA 4GAEA 4R9RA 5CDSA 5I8WA 1UP6A 4N7RA 4C4OA 3H3FA 1ID1A 4J90A 1GDHA 3BZUA 1A27A 1KEWA 3G3EA 1X0XA 2JCXA 3RUHA 1QYWA 1GV1A 5U9CA 1LSOA 1I36A 5DOZA 1E7MA 5JAZA 4C7KA 1NM5A
chains in the Genus database with same CATH superfamily
1NMSA 3BEDA 4LISA 4QKQA 3NNNA 2OP1A 3GXOA 1KEVA 3ZZUA 2HJHA 5CPFA 4Q4AA 3FOZA 1LNQA 2FNAA 2GHIA 1TJ4A 2XCIA 3MTJA 3QPBA 4Z9BA 5HKBA 1Z29A 2Q5EA 3FCCA 4IIJF 4OHUA 5A6SA 4YVFA 1MC4A 2B4RO 2Z8ZA 3H2SA 2WJHA 2CVOA 2X8LA 3NIFB 4MQFB 4ZFNA 1CZKA 4JI2B 3X0DA 3EOAI 3ZD9A 4BP9A 3EGDA 3OJFA 2CXTA 4U7JA 3KV1A 2X8WA 2I1VB 1QFZA 1XMXA 3F5SA 3MINA 2V5AA 4EABA 4HYYA 2O1EA 2HT6A 5LD2B 1XYVA 4IFTA 1NVEA 3ROTA 1U9JA 1UT8A 2OHFA 3PHBE 1BCSA 1QCZA 1TJ3A 1TIPA 2JIZA 4UNIA 5TPWA 2V6JA 3TNLA 3DMTA 4UZFA 1H3EA 1CY4A 1UPBA 4WX2B 4R8LA 4EL5A 4ZYVA 4C7MA 2D62A 3TZEA 2N9UA 2V0CA 2XRZA 4J8PA 1Y3DE 3OM1A 2P9GA 1GA4A 2D1RA 2PWAA 3IBGA 4RHYA 5I5GA 3U7HB 1R6UA 3ZOKA 1FFCA 1YUBA 3JQBA 2SKDA 2C3MA 2Y1GA 2R1VB 2IV3A 4HX2A 2PUGA 2UVQA 1D8AA 3VO2A 3W78A 1XPOA 3P9ZA 3MQ2A 1P7WA 1DAEA 1Z8NA 5PGMA 2WTBA 3V34A 3WMWA 3HWSA 3ZU4A 3O9VA 4PICA 1CE8A 1N2IA 3RSGA 1OVMA 4C04A 2B21A 3RS5A 5D3ZA 2R66A 1QK5A 4OK3A 4PC7A 1P6XA 2HWKA 3IEIA 2JA2A 2QE7D 1Z4QA 1YVUA 2JLSA 2P40A 2RHHA 3PDIB 1E4EA 1S2DA 2FZWA 2IZ0A 2XPCA 2YL2A 4PG5A 4ZEVA 1JDPA 1CQIA 5L3VA 4ARIA 3O8LA 2DBRA 3FLAA 5LVAA 4GS5A 1NVXQ 3O38A 1G21B 1ZXLA 2BLLA 5FLYA 2YFHA 2QQGA 3VI4B 3RYTC 3VDNB 2AE2A 1TVMA 3JQGB 2QVGA 4HNTA 1IBMB 3K7EA 2ZTSA 2XB2A 3UOGA 2BGGA 1VB5A 1TIKA 2Y0DA 1MG0A 3HJGA 3UGKA 4IEEA 3TW6A 1UPUA 4YRNA 1POWA 2QPLA 4LJYA 4EGCB 1J2TA 3WB1A 1LBQA 2R5NA 4RQUA 5JYDA 3OLCX 3UC5A 1YQQA 2DP4E 2EF0A 4K87A 4LF7B 1J06A 3MFYA 1PSWA 4K5QA 3V7WA 2FN8A 3A9RA 1XIVA 1GAQA 2BV3A 4NECA 4KO3S 2CLCX 2YHAA 4LZWA 4P32A 3MJ4A 4U9UA 4FUTA 4XGIA 5AKIA 4ZZ1A 1YGPA 2XV1A 3T06B 2C31A 3AV3A 4CLHA 5LYJB 2O8NA 1ZGCA 1COWA 3O1LA 4OOEA 1PUIA 3HB1A 1KI2A 1T0HB 2W9XA 2UZ3A 1G8GA 1SVIA 4LDNA 5BWBA 2J5XA 2WICA 3F5FA 3IAM6 5JWRA 3S6JA 1K08A 3BXHA 4PRYA 4LY9A 3BMOB 3RRZA 1NI4B 2P2NA 1DJLA 3EZ9A 4MW4A 4GKKB 2I33A 1EFCA 3FYDA 4UU0A 1K0FA 2PUWA 2HV9A 4LE0A 4AX4A 1PR6A 5EHZA 3MWYW 3TRJA 1ZGZA 3FWNA 5KO2A 1DCMA 1TU3A 3ZNNA 1HG1A 1XBTA 2O20A 2XQVA 3OP1A 5DSTA 3KB1A 4C14A 3NX4A 3JD4A 2OB1A 4YAEA 5L3ZA 4DC9A 2PIDA 3C6MA 2IU3A 5KOIA 5LMNB 2DXIA 3ST7A 2NAFA 2NO4A 3KUXA 5WRFA 1YR2A 1CJUC 4JLBA 4MVJF 2V4UA 1FFXA 1XNHA 3KYIB 1ZNQO 1NQUA 2ATIA 4MYTA 3WY9A 5A4KA 2B0JA 1NVDA 1THTA 2GXAA 4Y6RA 3HZHA 3LMKA 4BWFB 1GFSA 3RASA 1OFIA 3D7KA 4WXHA 4FT4A 4NYMR 3E58A 4QPZA 4BFCA 4F45A 4J1TA 3E7XA 3TE6A 3ILVA 1URPA 2IYSA 1P3DA 2GZMA 1M1NB 1IM8A 3PRYA 2BFAA 4FFDA 4JGGA 2I7DA 2WJ3A 2P3LA 3ZJVA 4LF9B 1RRPA 4LVOA 1UJ5A 2GHQA 2B8WA 3B3AA 4ENVA 1E2FA 2AT1A 3ORRA 3DMDA 1BVHA 3RU3A 1Q44A 5FOQA 3P2YA 1ZOSA 4IIYA 4GX5A 4KE8A 3F9RA 1XLWA 1ZOLA 4MKHA 3M82A 1F2DA 1M5UA 1EUCB 1G64A 1GVHA 2ET6A 2ZJYA 3UATA 3UB3A 4R31A 3CE9A 3MA0A 4C0XA 5JNUA 1PT5A 2AJLI 3TPFA 7MHTA 2ZYSA 1DQNA 2OM6A 2JFZA 2HLNA 2NAPA 3AB3A 3IOYA 1RKVA 3I42A 3DAPA 2E18A 3KJFA 1V43A 1J24A 1T0JB 1U2EA 2ONYA 4L6IA 4UXHA 1J1ZA 2EZ8A 3CZ9A 4DIMA 4J0JA 4Q00A 3RG8A 1NP6A 2QX9A 3B6KA 4GEKA 1SCAA 3V2HA 4B3IA 4DQKA 1ACLA 3U6BA 1WBDA 3TW4A 3T4PA 1RWMA 2Y8EA 4V0OA 1GAEO 3WMXA 2Q49A 5BN4A 1WOYA 5JI3E 3IIJA 4X1YA 2J7PA 4XFDA 1A69A 5KVAA 2O0MA 5EL0A 4OJMX 1F6WA 3Q3HA 2XUOA 4BVLA 3EBLA 2Z2JA 3LUCA 4HUQB 5AVOA 2H6EA 1NF3A 1G2QA 3ZE6A 4M0UA 2I6UA 4R83A 1Y4SA 3EEIA 1WMFA 2YV2A 4BO5A 4ZN6A 5CLGA 3ZZNA 4G86A 4U7TB 3GCDA 4W5OA 5GVRA 1YU9A 1JXOA 2IYXA 5LDHA 2XMCA 3NVDA 4LJ5A 3OLXA 1NR1A 2IW3A 4OFXA 4CDGA 2C0CA 4GD3Q 4LC0A 5CNJA 4YV2A 3K70C 4H7FA 2BM8A 2NWQA 2Z4SA 1ZD1A 3DYVA 3VC2A 5IJAA 4B6PA 1CLEA 4OF4A 1GUDA 1QP8A 2PTGA 2YWEA 4WEQA 4TYWA 3W6NA 1PGOA 3QWIA 3EXHC 3MWGA 2R5WA 2BDTA 2YC2C 3B13B 3MUNA 4FKMA 4HLQB 5BOVA 3UK0A 1JG2A 2G72A 5K3CA 3B9PA 3STWA 3C5HA 3A2MA 3SLRA 1JSLA 2DY0A 4DS3A 3QOFA 2I4IA 2IYAA 3C0KA 1UKYA 3ZDYB 2FX2A 1SCJA 1M2VB 2WT8A 3CNLA 3GVPA 5JPCA 1JJIA 1KXJA 3ZWMA 1DLIA 1TEVA 4KU4A 1SUBA 4CM7A 3Q6NA 4HWGA 2PT7A 2ZULA 3HVHA 3RUFA 3VNQA 1WCIB 3NVMB 1K6EA 1DDIA 2HWXA 1YC2A 3CF2A 1GZSA 1HZZA 2A0XA 2XOKA 3H11B 3K1ZA 4ZCLA 5J43A 5JRJA 4Y30A 3KYJB 4AECA 1NJGA 1L1RA 4G1EB 2FWPA 3AHDA 3EEBA 3KVRA 5KAMA 3SHTA 2Q99A 3YASA 3F7NA 3RR2A 1KFCB 1HBJA 3ZGNA 1NUSA 1NW8A 1R4ZA 5I7UA 1J2RA 1KMNA 5KNBH 5L7WA 3D4LA 4RXTA 1BD4A 3IIKA 1TEZA 4F11A 1W5FA 3EVTA 4HK4A 3PF9A 4DZTA 3JW8A 1N8NA 4G37A 3UWPA 4ND2A 4EOGA 5B7NA 4DSNA 2AMYA 1JU3A 1QLWA 4HLUC 5C32A 3CN7A 3RVOA 1RWVA 3HM2A 3MT7A 2B1JA 2R4TA 1M8KA 1CUFA 1U6JA 1DIHA 1PS9A 1XZFA 2DWCA 2HREA 1ZNXA 3PDIA 2NTJA 3Q0TA 4NWIA 3RYHA 3TEJA 4B4VA 4YRGA 5JH7F 4JITA 4BQQA 2HCJB 4CL0A 2W42A 2PK3A 4TTJA 1ADJA 3KUDA 5TMEA 4DUZB 1G21A 5KJ1A 1Q92A 1RAAA 2AKYA 1PG0A 1I1NA 1ZN7A 2H0AA 2LVBA 3JQGA 5FI1B 4JXZA 4ONEA 4IEFB 2VT7A 4GICA 1XX6A 4N5DA 4XX0A 2GERA 4FHGA 2TSYB 3I5UA 4C1NA 5A4FS 1J2EA 5IM4A 4U8GA 3GO4A 2ERCA 1QBKC 3H84A 1Y7IA 1NU6A 4TLMB 4ANFA 3DH0A 2VP9A 4ZVTA 4EITA 1A88A 1TQHA 2EKLA 5CCEA 2UZ1B 4NH4A 1ZIXA 1NBIA 1OY1A 2X8BA 3IQFA 1E1RD 4G0QA 5EPOA 1T29A 4OUDB 4BJ1A 4B7AA 3AYZB 4DIUA 1EVZA 1R0BA 3ZKAA 5JMOA 5LYJA 4D8WA 4PO3X 2Y05A 3A7DA 3ZY5A 1VKJA 2B8JA 1LSJA 1I3KA 2ZBGA 3QOYA 2R1TB 2YINC 4MEJA 4EFNA 1BW9B 5SZKB 2OHGA 5AI6A 3BMOA 3QX9A 4TTQA 3PRHA 5EP1A 3VJLA 1NI4A 4Z6KA 1DO0A 1T8PA 1Z39A 2EFGA 2JFUA 1TEHA 3EQ2A 4ZV9A 1XDZA 2OMKA 2MCFA 3R6DA 1I0IA 4F5ZA 3R6WA 4XIIA 4EBFA 2X6QA 3CXUA 1E64A 4J0DA 5HHTA 5HZMA 1XG5A 3M3DA 1GKKA 1V48A 1J33A 3AJDA 2LV8A 3Q88A 4JFAA 1JXAA 4KN8A 4OJQA 3UH1A 1ZXBA 4MVWA 4M38A 5L3QB 5JZVA 3BXFA 4PU0A 4W6QA 2ZJ3A 3C3WA 1YCFA 1YFKA 2VTVA 4TWAA 1BDMA 5JBNA 1VL0A 1U0GA 3ITEA 1GTL1 1YBHA 2K6GA 4J7XA 2NX2A 4RDHA 5ABPA 3SR0A 1W5TA 2XA9A 4J0EA 4LOLA 2W2PA 3GLFB 4BFYA 2PFGA 3OX3A 3I01M 3T9CA 1O0CA 2M9MA 3R0JA 3W0LB 4ZHQF 1BQ3A 2PPLA 4YCLA 1SD2A 2P4QA 3CEHA 4NU6A 5DM1A 2Y0BA 5KTSA 1EK5A 4JODA 1VIYA 4D3DA 1GZHB 2XZDA 2X8JB 3GRZA 4HWKA 3SJAA 1M1NA 1G9TA 1QDUA 4KMMA 1ISPA 2BDUA 1OLSA 1QMPA 3II6X 1V5WA 5KB3A 3A4NA 3CKKA 4L27A 1RMYA 4TTAA 3O4VA 4YASA 4CL8A 1C29B 3V4VB 1NBWB 1WQ4A 4GDMA 4RVCA 4K9RA 2ZZMA 3G9XA 4RZSA 4CIVA 1Y6ZA 4PONA 3R3YA 3H65A 5JALA 1Q12A 1KMMA 3C98A 2ACEA 1I2BA 3JWIA 2P41A 3DT9A 1EUCA 1KEUA 4Q1DA 4GGMX 1U2TA 1VMDA 4B47A 2AHRA 4CLEA 1A4XA 4CIYA 3CUYA 1IEVA 4R69A 5EJEA 4FHDA 5H80A 5FV4A 3QQPA 1N6NA 2XXBA 4FDUA 4EZEA 1DKRA 3GLGB 1KYYA 2FETA 4PC1A 2YS6A 1OXXK 5JCPA 4RPGA 5LSAA 1BMQA 1XZKA 4MUNA 2WLSA 3IP8A 5E2AA 4ZMBA 2AUMA 2EHDA 3A9UA 1XF1A 4DR5B 2R4QA 2ZB7A 3DXZA 4G5XA 13PKA 2G9ZA 4UTNA 5EPUA 1OREA 4J2HA 3TLBA 4PHFA 4BVFA 2NUPB 3DZBA 5FA5A 4AYXA 1E9SA 3TL3A 3T41A 4PIMA 3SICE 4NBNA 1PFWA 1XEAA 3TNYA 4BLUA 1JE1A 1PSDA 1AVTA 1YRYE 1UBTS 5T6MA 4A2QA 2QDXA 4PFSA 1SVNA 3F8WA 2IIBA 4ZGBA 2YIMA 3S40A 2F3PA 1SIBE 1TQ2A 3OAAD 5KEIA 1HNZB 3AM5A 3ZGLA 4AKSA 2Y0CA 3QU9A 4EHBA 1BXKA 1QOQB 4BX9A 5AUNB 3IYLW 1Y81A 3QEMB 4QARA 1PFVA 4ZOBA 1MQ9A 2ZJ8A 5IKOA 3H4IA 2ZJZA 1OIWA 3RC1A 1X92A 2ZTHA 3GUYA 3L7OA 3V4OA 3PJGA 1U4SA 4PZPA 3RTBA 1QTIA 3G2PA 3OURA 5E4FA 1AZTA 1DAKA 4PGAA 4YXWA 3A4VA 1C2TA 5P21A 1P2GA 4E2XA 3B78A 4LJ6A 1I8TA 5D6NA 3IOMA 3BERA 2GK4A 3GRCA 1SVUA 5A5GA 2GCEA 1K8YB 2QENA 4R40A 1TCUA 2WIKA 2HR1A 2G83A 3FVWA 4H3HB 3B51X 1JN0A 1IBLB 4CODB 1BXGB 4V0SA 1WCIA 3BE6A 4KL8S 1WE2A 2F8LA 5BWCA 2PUAA 2BJWA 3CZCA 4MNTA 1L5RA 3H11A 4M0KA 4XFKA 3WQBA 3W3AD 2ZTLA 1PK7A 4P92A 3SGLA 1HE4A 3DDHA 1M1UA 1FDUA 2FF7A 2H7VA 1WV0A 2XKKA 1CWUA 1QH9A 1KO4A 5ICGA 3RHFA 3ZHRA 2AE1A 3NRCA 5C8ZA 2EG9A 3LC0A 3I04A 2PBFA 3SDSA 4F7DA 3IVMA 3GRAA 3D2BA 1XD2B 3Q9LA 3U4CA 2RHRA 1IRXA 2G1AA 1X3LA 1IEXA 3C97A 2ZPAA 1X9IA 3EG9B 4PLCA 4X8LA 1PFYA 2YWCA 1YS7A 4X97A 3ZU5A 2E3JA 2Y2VA 3PCXA 4CV1A 4NATA 1FEZA 4V0ME 3K94A 4MQMA 1JHPA 1QAMA 3KFXA 3JYOA 3L92A 2UUAB 4H7KA 3I0ZA 4V2IA 7GPBA 3PG5A 4TL6A 1NRWA 4P58A 2HWWA 2WWTA 1PO7A 1ZSNA 2YJ6A 4MARA 5CW2A 4CTOA 3BVPA 2FPGB 3RYCB 2E5FA 1E2GA 3D1VA 3VVCA 4BLWA 2GJAA 3KL2A 5KNCD 2QT9A 3BCRA 5EIBD 3QEOA 2JLYA 4L5IA 4FQ8A 4DNPA 2J9FB 4AZ3B 3F9IA 4XYGA 3NCHA 3C1TA 3NEPX 4PSKA 4O4HF 4GH5A 1XKQA 1UZLA 2QUIA 2DPYA 2RB4A 4RJKA 1XRMA 3D4IA 1JHDA 5F35A 1TPYA 3FPJA 1JECA 3I9FA 4RKRA 1N2ZA 5JJIA 4DIFA 1J8DA 1PD1A 2O0LA 2UZ1A 3BMNA 3SOZA 3O90A 2JHPA 4QYWA 4MWOA 3UW1A 3HV2A 4OUDA 1UIRA 4RE6A 5EJ4A 1TVEA 1WW3A 4N12A 4Q4HB 5CU7A 3SFVA 3WAKA 5DCWA 3RK0A 5KJ6A 4IDNA 3PNSA 2DJIA 1GPAA 1OZHA 4MS1B 4WZZA 3ABRB 2R1TA 5HMLA 4UNNA 1BW9A 1ISIA 1U63A 2CBZA 3R44A 4QEZA 4B3RB 2C3OA 2OHIA 4ID9A 2BELA 5C80A 3LCMA 1DFGA 4FMPA 4DCTA 3NP9A 3ER9A 4H18A 1Z07A 2QRPA 3KV3O 3WVNA 1USIA 1N75A 1Z5VA 3U5TA 1FQKA 2ZB2A 4EI2A 3SNHA 1W9MA 1RLJA 1UT6A 1FNBA 2V9ZA 4LCJA 4K3UA 4KO1S 5TMDA 4HEA6 3RIMA 4EEZA 5L3QA 2W37A 2C2MA 2F67A 2PWZA 4ICIA 5DT2A 3ZH2A 4BGUA 3ESDA 2PNFA 3RC3A 1N5JA 1JRLA 4D8YA 2F3RA 2IXBA 5IJ9B 2A88A 2VHYA 2WVJA 2INGX 1K97A 1XK7A 3DE2X 4FSDA 3L43A 3MJVA 2VS1A 4GPZA 4IYJA 5IVIA 3HDJA 4ENUA 1GUFA 4R1MA 1Q14A 3GLFA 2PSEA 5EJMA 5AW6A 3H1TA 3O1HB 2WK1A 3LKVA 4L8VA 3GD5A 2P2SA 1NBMA 5DMHA 4JK3A 5TVKA 2FTKE 3NT2A 3STVA 2A0KA 3WL3A 2X8JA 1HUQA 2CMHA 3G59A 4PBRA 4AN0A 1U0RA 2FR8A 2HBQA 3DM9B 2PJDA 3PDUA 4Y98A 2QJFA 3ZIUA 3TE7A 4ZP1A 2IXTA 2MU1A 3SZRA 4N3GA 3L04A 4BQRA 1US8B 4EAAA 1N8KA 1X7GA 3NP7A 2JK0A 4U00A 1CB7A 4XTCS 3GK3A 1I5EA 4JUAA 1WW2A 3GJQA 3KQSA 3T3EA 1LTHR 4BZPA 1IK4A 2Z1DA 1K9VF 5HKLA 3KAQA 1CY6A 5EQTA 4D5GA 2HSEA 3PEUA 1O95D 4F4IA 5IG2A 1GRNA 5JSFA 3S2ZA 1ANKA 3N70A 4WLFA 4C30A 3FDXA 3WAGA 1OAOA 4Q3AA 3PQEA 3ZXUB 3ZCSA 3KETA 3GLGA 3RVPA 1J56A 1X7XB 1HE5A 3DE7X 4TT3A 3LA6A 1RWXA 4U2EA 1VPLA 2BBSA 4R1SA 5CFZA 3KYDB 2ZJ0A 3RKUA 3K9NA 3IBTA 1VHDA 1P9LA 2KQUA 3O8DA 3T0GA 4DJEC 2Z2YA 1TU4A 3KSUA 3CONA 5CFPA 2NUPA 1KFKB 2FQ1A 1IHPA 3BC1A 5I7EA 5KYGA 2D7JA 3CNHA 4GX0A 4HAWA 2HMYB 4KE7A 2YN2A 3U80A 2G28A 3PCTA 5MDHA 1LPOA 5CGZA 3BJZA 1KF0A 2QLFA 2X6RA 2OSBA 4ARZB 2I71A 2PMCA 2W2LA 3ZDFA 1AV6A 3T3DA 2A33A 2BR3A 1ID8A 3HCBA 3JR7A 2Y66A 4WESB 2C92A 4RY9A 4UAUA 2WV7A 3GPBA 4DCGA 1VYHA 1GLNA 1QG0A 1D2HA 5AVRA 3QEMA 2VHWA 3VZBA 4XYLA 1KKLA 4JLDA 3PENA 3UXMA 4HWOA 2ZI7A 2GXSA 1T5BA 2PDAA 1S7CA 2H8GA 3FX2A 5CJPA 4IDAA 4PRLA 3UWKA 4BMZA 3JWPA 4QSHA 2PWPA 5J47A 4HDRB 3P2EA 2C9MA 5F1YA 4ASUA 2GCOB 1W2GA 2L19A 1P7VA 4KQHA 2NZUG 3IPRA 4F4HA 2AYYA 3CF0A 3U48A 1LCIA 4Q6WA 4MO9A 2CZCA 4HQFA 3E0XA 3HUEA 2PUVA 1HDRA 2HDOA 1G291 2CBXA 2H1IA 3AFIA 3IJPA 2OCGA 4M37A 5DHQA 4BUJA 2XGJA 3T52A 2IA5A 5FORA 4Q7MB 3ICCA 4E7OA 3G1TA 2X9NA 1X7WB 3LQ2A 5DHAA 1E0KA 3FDIA 4R81A 5FPPA 2XCTB 2BL4A 5AJVB 2HA7A 2CLSA 1GU7A 2QZJA 3C7CB 1AK2A 2VXOA 1FJHA 2CXPA 5TNXA 3F46A 1EFPB 3KHKA 4JJGA 1H0HA 5EIEA 1LGYA 2Y1LA 4RK6A 2V4ZA 4LRSB 1XD2A 4HNQA 1K7XB 1DKPA 2KM1A 2YY7A 2IIVA 2YYSA 2NTNA 3R9IA 2JCVA 3RRBA 1CRQA 1L7VC 3ZDQA 5CVVA 1YJXA 2ZBEA 3EG9A 3QI2A 3V7NA 3JQ8B 3W2HA 3DL0A 3B12A 3WX0A 3X3HA 1V35A 3E9CA 4WGFA 1ZSVA 4DFDA 2QR2A 4GRAA 3HJRA 4D9HA 4IIGA 3ME5A 4HJRA 4UPVA 4LSWA 3BREA 5EJ5A 4RPKA 5EZ6B 4BTVA 1CQXA 4JYMA 2VYND 4MJLA 3DHVA 4JAVC 1EG2A 2FPGA 4N3NA 5DEIA 1RAIA 2VRCD 2VWHA 3D7MA 4W1PA 2I2XB 4CYMA 5JNWA 1HH4A 4B80A 3K31A 3D6UA 5AJYA 4DQLA 1K8QA 2GEDA 3CSDA 3NUZA 2B94A 3T1VA 5I51A 1U3GA 2OT3B 2Y68A 2J07A 2VHTA 4AZ3A 5B3JC 2II6A 4EPTA 1UOQA 6NULA 2ZVQX 3AR8A 1VYUA 2NXNA 2XUFA 4JOQA 5IXYA 2H5IA 2OHOA 3F6YA 4BMDA 3JTEA 2VIIA 1L5MA 1CRPA 5TDHA 3NMUF 2C00A 2I2DA 3JWGA 4XX1A 1YVRA 4DLRA 4FNAA 1OI2A 3THYB 1XCGB 5JSKA 2JZOA 2WWFA 1QFYA 1Y9AA 5JE8A 1WUTA 4Q4HA 4ZMRA 2OFPA 4UFPA 5KQLA 1HNWB 1RJDA 4B6SA 4I7EA 5BN3A 4MS1A 1WMBA 2RJOA 2XOXA 1N2CB 4QHSA 3G5MA 2Q41A 3FTNA 3MXTA 2B6NA 1RRGA 2EQBA 3ABIA 4P7KA 4A6EA 2BSQA 2GN1A 3QFHA 3PXXA 1RPAA 3ZWDA 4IG4A 3EMDA 1YS9A 3RC7A 1F48A 5FWXB 4F93B 4ZO7A 1NSFA 1QV6A 2ZYTX 4HGZA 5HIJA 1YULA 3MWKA 3FWZA 1JB1A 2XMGA 3UG6A 1L4HA 3L46A 2I9KA 5IZCC 1UZAA 1RC1A 1HYBA 3IT2A 3PC8C 2WFLB 2RKOA 4NZOA 4JD5A 3UYKA 1XZIA 3MAAC 3HYTA 1S9HA 4H77A 4MVJH 2WA1A 2O14A 4MPRA 2BLNA 2P90A 2QW8A 3ZUGA 4BEJA 4D9JA 5JS7A 5CB6A 4IHAA 4J3FA 2R9VA 2EVWX 3EHEA 4WNAA 1VRVA 2ZWAA 1G20E 5GADl 1U2QA 3AHCA 2C82A 4PW0A 3K2IA 3PR1A 5TEWA 1D4OA 2HA2A 4TGLA 4X6UA 4KPUB 1UC5B 2QL7A 2VYNA 3ZNPA 1OHHD 1KYVA 3IA7A 4FHCA 1P0CA 5KQPA 1VLVA 3HB0A 4QVGA 2R1UA 4UXJA 3RTGA 3BXGA 1V5FA 3QEJA 1N6OA 3WFZA 2BD0A 1ZK4A 4RHFA 5A1TA 3FUWA 3H9QA 5DBHX 4FLMA 4P1ZA 5D00A 4LBZA 1B7GO 3TOSA 5KVVA 1IHDA 3VNUA 4F2WA 1F06A 4R01A 2F55A 2ZPTX 2QW0X 2XR1A 4WQMA 2GZRA 5KNBA 3I83A 2VUSA 3IODA 3N86A 1PZGA 1US8A 3AXTA 4DLZA 3K96A 5C1IA 1LF5A 1VKHA 4BMCA 2FSSA 3EC1A 5I7AA 3Q3GE 3UJ9A 1GZ7A 2PMFA 4H4CA 3IQIX 3VH3A 2NZVG 4ZDJA 3UFBA 4KAFA 3KWMA 3SI7A 1T2FA 1GY8A 3HI6A 3ND7A 4R8MA 4RW0A 4X1KB 2GF2A 1U9IC 3VHLB 1I33A 3VZSA 4LI3X 5LA6B 1X7XA 2V6GA 4M8NE 1H9CA 3V97A 4JI5B 2QVYX 2ZBVA 4MWDA 4YV7A 4NJMB 2H1HA 4EG7A 2A2ZA 2P79A 4WJZA 1E6MA 1SRRA 3KYDA 1ZY2A 5IJXA 3CNEA 3U3JA 3DFMA 3B36A 4EGFA 1OWLA 3E4DA 1WO8A 3E9QA 1TK3A 2IYFA 5AJUA 1J8VA 1OXUA 5DTIA 3P0JA 5H81A 4KHPB 5KYWB 4RH3A 5T41A 4EECA 5JFOA 3C41J 1F9AA 1R0LA 1NQVA 3OY2A 1U8EA 5EJ7A 2LWIA 1OBCA 1XZDA 3C8MA 3R5XA 4MLDA 4TMXA 2I8LA 1N5LA 4ENWA 3O94A 1MZVA 2FN7A 1WUIS 3GAFA 2CLHB 3FNHA 3IQEA 1ZIYA 1LVGA 3BGDA 5AQ1A 2YICA 4LAFA 4ZYXA 4LE1A 2F1OA 4GUAA 4WESA 3S4YA 4F38A 2ETXA 3M1AA 3S2FA 4B3CA 4NCBA 2YCLA 4YP0A 3HMQA 3NHRA 4NBRA 4ADSG 2GEUA 2O0JA 3WLNA 2VF8A 4J1QA 4IZIA 4M9ZA 3DOEA 4URZR 4E51A 1J7JA 4HT3B 3FWYA 1QHXA 1QOPB 3MPOA 2QQ5A 1PJSA 3CRW1 2Z3ZA 1CQZA 1ZVMA 4I5DA 4WCFC 3JQDA 3H5OA 1J00A 1KETA 4HDRA 1E3IA 3LAWA 5IUJC 3ZD6A 4DZRA 1V8FA 3AFOA 3GFQA 2XNDD 2GCOA 5IF9A 1PZHA 2J5QA 2WJ6A 4QUIA 4QVKA 4G81A 2QMQA 5JAIA 4JP1A 2FZLA 4UDNA 4ZQGA 2ATVA 2AFRA 4DDWA 1TO2E 1MJ5A 1WKBA 4ISBA 1PWZA 1U3CA 4MGZR 4Z5XA 4W5TA 3IUBA 1RQPA 1TTTA 5C1PA 4IR7A 1ZCAA 2GPTA 1X7WA 5DK4A 1VBKA 4DGSA 1NRIA 1RQ7A 2JGRA 3ANLA 2X7HA 5GJVC 4G8BA 3IPAA 4Y8VA 2XD4A 4CDRA 2QY9A 2LGJA 1NL3A 1EQ2A 3IBSA 2I80A 1SXIA 5FBVB 1QTNA 3WL5A 1MIOB 1SQFA 4C05A 4X61A 1EE2A 4DDTA 1RI4A 4ENQA 2AN3A 3SIXA 5EVJA 2C4KA 4FUQA 1AQYA 3JQ8A 4B33A 3M83A 4G24A 1UPFA 2CY0A 3NYRA 2PX8A 2O54A 3LIPA 1A97A 3IAAA 5JNSA 1JDSA 1E2UA 4H1VA 2ZS9A 5EJ9A 1SWWA 3UKDA 3W04A 3THRA 3WKCA 2I6TA 4J0HA 1N32B 1P2UA 2WJIA 2Z6QA 2Q3FA 3GRPA 3SKXA 4PEVA 1WCV1 2X9GA 1NC1A 2JJ1D 3X2FA 4BEBA 4K9OA 5KTRA 1X74A 2V74B 3CJRA 4RSRA 1PL0A 2VSQA 4UD2A 5JISA 2XT6A 4MQUA 5EFZA 1OTYA 3H1PA 3HSSA 3CN9A 4QBFA 1B6SA 5CLJA 5LDDC 3RRNA 3THYA 3DEFA 5F4BA 5AO9A 3WRVA 3TMAA 3KJIA 4OQMA 1ZGHA 2CDCA 2XNDA 4TKVA 4LJ8A 4K9PA 1YASA 1R50A 3DOIA 4K7JA 2D5IA 2AUNA 4I5GA 3WLQA 4DYDA 1N2CA 3TSCA 4KLAA 4JP5A 4N6OA 2XYPA 1ZUNB 2LXNA 1SKAA 2IWRA 3GGSA 4FFOA 3NXKA 1IZ7A 2Z57A 2MTBA 3QPVA 3PNQA 2W2VA 4P2BA 2PT5A 2QDKA 3TVTA 5BV8A 3G2MA 3ICEA 1MFPA 2ZI9A 3DO8A 3IUSA 3T1TA 1DMRA 5I8ZA 3GAZA 5JUWA 2HCTA 4W9NA 1Q6ZA 1L7NA 1LJLA 5FTJA 2B7CA 4BLOA 2HJRA 3LT5A 5FF9A 3WICA 4UUQA 1U94A 3CCFA 2WFLA 3AIIA 3G2HA 4BC1A 2IE0A 4LRTB 1N3LA 3BOSA 5K9ZA 3JD3A 2AZXA 1L9KA 1P5ZB 3VYWA 1RJ9B 3C5WP 4Q3KA 5DI9A 4EUNA 2YJGA 3DXYA 3P20A 3R5FA 4IS3A 1GPH1 3VH4A 4L8WB 3HSYA 5BMVB 2WIDA 3AI2A 3HYCA 3MUFA 4Y6OA 4M0LA 1TU0A 4KPUA 5TVGA 1ZH4A 5IVPA 5K20A 1NWCA 1OBHA 1DPGA 3NBQA 2J0VA 1EDEA 3L1UA 2Z56A 1F7VA 1YS2X 5DDIP 2OAGA 1YDWA 3LNTA 1E7WA 3HXMA 3DE3X 4Y2VA 1JQEA 1N7IA 1LPMA 1SXJD 4P3OA 1RQ2A 1AUPA 2C83A 1Y33E 2GB4A 4UMDA 3ZN2A 5EJ6A 5GJCA 3PNLA 4EY3A 2RH8A 1WDKA 1SVKA 2WU0A 1LDGA 4TV8F 1JEQB 3ETJA 1VB3A 1WVIA 2REXB 2QRMA 5FKJA 4EPRA 4F21A 1RHKA 1S1MA 3Q2KA 1AQNA 3QLVA 1E6LA 1CNFA 3PNPA 5AW4A 3AX6A 3GP3A 4DY6A 2GX6A 2OR3A 4Q9HA 1YZYA 4US2R 5FEMA 1TQDA 5EC8A 3GYBA 2H4HA 1QIGA 1JDBB 2ZXFA 1K3TA 4JFRA 2R8PA 3PWTA 1L5WA 1AZSC 1BRMA 1OZ0A 1JHRA 3LY7A 1SCQA 4KGDA 3ROFA 3RSOA 4Z54A 5LA6A 4GM1A 2WSYB 3LWZA 3MHPA 3PVZA 5AKKA 4EW2A 4QX6A 2VDQB 5REQB 2PX5A 3CM0A 3U4AA 3F71A 2PZMA 4EJ6A 2DUNA 4QATA 3K71B 2DFLA 5FADA 4IWNA 5LQKA 4OY3A 3H2ZA 3VPXA 5BPHA 5D01A 4JLSA 1D5CA 2KS6A 3BICA 2A0FA 3GFBA 4X3CA 5BT9A 4BC0A 4MUIA 5KYWA 4OKIA 2V7QD 2P65A 2VYVD 3DFFA 2QRLA 2RAVA 2WU3A 4UD6A 5GM2A 1T9KA 2IPLA 5KSZA 1E2HA 1R74A 4YNBA 5H83A 5JSUA 2HXYA 3NYIA 2R79A 3E61A 3VKHA 1P81A 4A8JB 2FZKA 3GRFA 2PX6A 1IATA 1YR7A 4KODA 4DLKA 3FOAA 4E88A 2OZLB 4O8CA 2RD2A 1T0BA 3U56A 2NU8B 5A4IS 4K81B 3WRWA 4CUZA 4GQBA 1PJLA 2PUCA 2A84A 3SIPA 5LMZA 1VE6A 4XM2A 4DV2B 4LRXA 4ML3A 4I1IA 1DZIA 3E2IA 3AESB 3JRNA 1Y5MA 2HJ9A 3GL9A 2GTHA 4KJZA 1GQQA 1J8MF 4FCCA 2Y4NA 4JC8A 3TDNA 4EYEA 3A04A 5BV7A 1J0CA 2R60A 1OASA 5TB5A 3LT0A 4K2AA 2LBPA 3JPYA 4Z9XA 5LBIA 5TJ9A 5TS2A 3ZU6A 1CR1A 4F46A 1NR5A 4Q1BA 3VNAA 4PX9A 5F2OA 1XI2A 3AY3A 3W79A 1PFGA 3D1LA 1UDXA 3VTKA 5TLSA 3H5RA 4TSRA 2R00A 2W6ZA 4BB5A 2OENG 1TT5B 5CIQA 5K0SA 3QMWA 5CITA 4XQEA 2DPMA 4JA2A 4U7WA 3TJRA 5BSKA 1FCJA 4UUOA 3ZYZA 3S3TA 1GGHA 2I34A 1VZ2A 1EU1A 2PS3A 5AKXA 3QFCA 5JS2A 4R9VA 5LNK1 3UT0A 4L5JA 4J4BA 1T2DA 2AI1A 3AUFA 3IALA 4DEYA 1GPUA 4RACA 1XRJA 3OTWA 4C0KA 1D09A 5CDYA 4Y2HA 2DEUA 4RVHA 3DNFA 1Y8CA 1CQJB 1XCLA 3R09A 5IK2A 2JEZA 2D74A 3HWX1 1N6HA 1ZIOA 1WLYA 4G8DA 2VEDA 5IUNC 1MIOA 3OO0A 1OJ7A 2ZANA 2ZYGA 2R5FA 2X23A 2IZZA 1OFUA 3OT1A 4HD8A 4ZVRA 5C8YB 2FQYA 2MYUA 3QA9A 4I2NA 5FBLB 2VYVA 1BDHA 1T0UA 2V6MA 2WZQA 3WLMA 1H66A 1TKRA 1JQAA 4PE5B 2VF2A 4D26A 2GZSA 3RIGA 1Y1RA 4AWBA 3O8BA 1D1TA 3UMCA 3QX3A 4PHHA 2GA8A 1I3MA 2Z2IA 4RTSA 2NYVA 3REGA 1UEXC 1NPYA 4LXHA 2C84A 2O1SA 4B84A 5FO1A 2Q2QA 4Q02A 2EATA 3FW1A 3D3EA 3G1WA 3OZAA 1R15A 4D0LB 3SHVA 4DMKA 3FUVA 2J7KA 4E1AA 1YJ8A 1EK6A 1HOXA 4LA4A 3UB4A 1HYGA 1U2RA 3BL5A 3PXEA 4GMGA 4A8TA 3O8OB 4S12A 3ENNA 1G19A 1RXIA 2J08A 3L93A 2HQRA 4XQ9A 1G55A 5HF6A 1B16A 3RBAA 3ROEA 1JXQA 2QRJA 2FVYA 4OQFA 3WRXA 3HG7A 5GVSA 5IWCA 3EGCA 4CXMA 4XGNA 4G0PA 1KRHA 2OCIA 3MMXA 1SWVA 3NBAA 3Q8LA 2Z1MA 2ZUTA 5KSOA 2QYSA 1LBEA 2RAPA 1KHHA 4GP9A 4BFTA 3B82A 2XTMA 3E23A 1QKKA 3GGJA 4HAVA 4QGBA 5AMXA 1XWFA 4CMGA 4H4DA 4FB4A 1EYZA 2ORWA 5K0BA 1M66A 1V8PA 1XZAA 2OO3A 4A5SA 4Q12A 4NXMB 1VOTA 3I6IA 1W0KA 3V7UA 3VMMA 4BAGA 1ZUNA 5JIBA 1SCBA 4XVQA 3VPDA 3UJNA 3NYQA 4AMUA 2DLCX 1FSFA 4A2PA 1CULC 3S1SA 3DLTA 4MP6A 1U0NA 3H9CA 4HADA 3C8ZA 1ONBA 5DVZA 2I5PO 3LXXA 1BVRA 5BUZA 3OBBA 3RGWS 3R9KA 2VJPA 3R8FA 1C0KA 1NNUA 4R7GA 1AGXA 2VNIA 3M7IA 4GP7A 4P4NA 4DAOA 1MO4A 2QSJA 3GMTA 2J3DA 3PGLA 3U0BA 2G4LA 5KIAA 1JVNA 2BMJA 5KU7A 3D31A 4Y7CA 2ZIVB 4NZNA 1E60A 4R84A 3JYHA 1E6CA 4M1OA 4P22A 1A9ZA 1CZNA 2GPWA 1VJTA 4YRSA 1RJ9A 1UWCA 4RIHA 4HN9A 2E1RA 1Y82A 5CBKA 2MINB 1R0SA 1Q74A 3E7PA 3IAFA 5AVWA 1JA1A 5FBRB 4WFJA 3NVKI 1ZIPA 1Z74A 2NN3C 4DA9A 1SC9A 1JNXX 4L85A 1TF7A 2AX3A 4HGYA 4J0IA 1KL7A 4YRJA 3GVXA 4J3JA 4RMHA 2ZAIA 2QLMA 2E6UX 4FEEA 1M2OB 3TZLA 3ZZ0A 2GPBA 3L8GA 1W96A 3AM4A 4ILEA 4LOKA 5JLAA 1A7AA 1EZ4A 1FPQA 1Z2CA 3D6NB 3PT9A 3HCAA 1EWYA 4MPTA 2OHHA 4MVYA 2R751 4MV1A 2P6MA 4ZVOA 5HXAA 2Q50A 1M34A 4JKOA 2CNDA 5BOSB 1XZNA 1W87A 4NFLA 2ZUBA 3I9MA 2OC4A 3VTAA 3ZE8A 4ND4A 5KVCA 4ODIA 3SSNA 3W2EA 1PZNA 2ECKA 3GZTB 3HFSA 1IY0A 4K28A 4RL4A 3LVBA 4KRYA 4MS4B 4BJ5A 5IMBA 3PUIA 3TZCA 4P5DA 3RSZA 2G08A 4HLDA 1DE0A 2WJGA 3VSDA 5JH7B 1BO6A 1DAMA 2IS2A 4QXAA 3AFHA 1LUAA 3L06A 3ZW9A 2EFYA 2XUHA 1YA8A 1E1QA 2YW9A 3DP7A 1JIXA 2ZKIA 5IKPA 2HJWA 3OE4A 4LRWA 2WMDA 3NORA 1DKQA 3UJHA 1E3WB 4OHKA 4WZBE 2DY1A 5REQA 5EKDA 5KPDA 5E4JA 3I8SA 1D6NA 3QELB 4A36A 2XZPA 3IURA 4BECA 1RZRD 3B5IA 2P3OA 3BWDD 3RHTA 3K3PA 2WWWA 4UM7A 2BGKA 4EENA 4M0CA 2XDAA 3DP9A 3TECE 4IRXA 1O2DA 4LRQA 1D2NA 4MVXA 4PGFA 2ZYDA 1ZOIA 2YRWA 2ANBA 2PFKA 1AB6A 2ZK7A 2AC7A 3MILA 1MO6A 3QXXA 4JR0A 3U3RA 1KVUA 2C03A 2FMUA 2NLOA 2PBLA 2XCUA 4I1SA 1P1CA 4M1WA 1XEXB 3VHQA 1GP2A 2IKSA 4BMNA 5AUPB 4UVEA 2OZLA 1FSSA 3I5MA 4ZO4A 1GZ5A 2XMSA 5EP2A 3TXXA 4B79A 3LDFA</