3TRIA

Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
272
Chain Sequence
NTSNITFIGGGNMARNIVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTEQAIKVLESGNLRELFIKALTAAVNRAKELSKTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Oxidoreductase
molecule keywords Pyrroline-5-carboxylate reductase
total genus 98
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 3triA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3triA01
1OZAA 3GGOA 5DT9A 1BW9A 4QX6A 3GPDG 4B7CA 1HWYA 4YQZA 4BQPA 4DMLA 3W4KA 1R4NB 2E6UX 1PR9A 5U1PA 2VYND 1I24A 4KUGA 2NU8A 4JBIA 3CUKA 4UVIA 3WBFA 5GZ6A 3H65A 4EZBA 2GERA 1QYWA 1T1RA 3HB5X 1MC5A 1QYCA 4WLUA 5T8KC 4EUHA 1GUFA 2X86A 3GVCA 4OHUA 2GD1O 4R68A 2O7SA 4JJFA 5GZ3A 3BZUA 3PYXA 5L7YA 2P4QA 5CDUA 4GVLA 4WUVA 1LQUA 2RBEA 3KLPX 3PJEA 2RH8A 1I0ZA 4J1TA 4MP3A 1NHGA 3RFXA 4DRYA 2O4CA 5F1OA 3WQSB 4I9HA 1AHIA 1BTOA 2HMTA 4D3DA 1PJTA 4MVJA 1RYEA 2JCYA 2IEDA 2YQ4A 4B79A 3L07A 3OJOA 5ILGA 3GRKA 1EQ2A 4OM8A 4CUZA 4MINA 3WYCA 4CODB 1NP3A 4L4RA 1UZLA 1BW9B 2AQ8A 2GN4A 3BHJA 4B3JA 4M1QA 2GCGA 3BMCB 1A9ZA 1EUCA 3D3WB 5A3VA 1KEPA 1KVSA 5G0SA 2ZJ1A 4NJMA 2WE7A 4O59O 4BKPA 4U5QA 3HN7A 4W4TA 1GR0A 1M6HA 3V2HA 3H5RA 3NDIA 1KEUA 3IIEA 4ZQGA 1F17A 3RBVA 3ZV5A 1H6DA 2VHZA 3H5NA 3GHYA 3V8BA 4C7JA 3H3FA 2W8ZA 3CMCO 1LLUA 4R41A 3D64A 3WTBA 2Y66A 3D5TA 1VSUA 4Z0TA 4RORA 2EP5A 3GVPA 3W8EA 4MKRA 4CUKA 4CLOA 2Q49A 3VC7A 3RD5A 2EGHA 3LF1A 4CV0A 3GC6A 2ZYAA 3ANMA 3P2OA 4PZDA 2X22A 2H6EA 1V9LA 5F1KA 1YOVB 3O9ZA 3HJAA 2Q1TA 1GUYA 4ONEA 3S1LA 4DPKA 2EJWA 2X0JA 1T25A 3ZU3A 4RVUA 5JMWA 3CZMA 2VZ8A 5CDSA 1E5LA 5EINA 3PEFA 1OFGA 4DYDA 4F46A 3BMOB 2IXAA 1O8CA 5BNTA 1LSSA 1ID1A 1ZXBA 4R5MA 3BTOA 1C1DB 1AXEA 1DIAA 2UUOA 5GY7A 5F5NA 2HMSA 1PZEA 2FOIA 3AFMA 1WZEA 4JCOA 1F0YA 3OIGA 2V65A 1V8BA 2J5KA 4YVFA 1DLJA 1U8XX 1AUPA 3EVNA 5B37A 3NT4A 1YBMA 1B16A 3EY4A 1DC5A 1JN0A 1N9GB 1G0OA 5G2OA 3UUWA 5C7IO 5H83A 1SCUA 4CM3A 4HNHA 4BO4A 1UXIA 5KTKA 3GZNB 4GGPA 1I2BA 2HRZA 2WD8A 3L4BC 4BNJA 2EXXA 1UXJA 2ZQYA 3HB4X 4FJ2A 3KM0A 1JQBA 1NWCA 4RVDA 3RBZA 1KVQA 1B8VA 1JKJA 5IDXA 5HBRA 1E7QA 3DL2A 4AJKA 4ND1A 5EL0A 4IQ8A 4TVOA 1YL5A 1T2CA 2IEBA 3ON5A 1DPGA 1GYPA 4W9NA 5AXBA 3IC5A 1HETA 2NQ8A 2GZ3A 2C29D 3RUHA 4PIVA 4YR9A 2ILTA 4JGBA 4I9NA 1DXYA 3IMFA 4P8RA 3H5AA 3GNTA 3CEAA 4TKLA 5JAQA 2FHSA 4D79A 3GAFA 3R0IA 1LLQA 1IY8A 3GDFA 4IDBA 3WLFA 3X2FA 1ZCJA 3L6DA 4YACA 3PXXA 3H4VA 5JDCC 5KVQA 3F3SA 1HL3A 3L6EA 2C0CA 4PCVA 1QXSA 3A06A 5AOVA 1DFHA 2NVUB 2C7GA 3E5MA 1KVRA 3ENNA 4NBUA 4XQGA 1TT7A 5CFZA 3WSWA 4TRNA 4B4WA 3G49A 1X0VA 3PVZA 2EP7A 5F21A 4JN6B 3ZWXA 4E31A 4EW6A 2PD3A 2CDBA 4KMSA 4BIIA 5THKA 2YZ7A 3LDHA 1RJWA 3ZNNA 3OMLA 4NG5A 4TZTA 4N5LA 1DIRA 2FPPA 3L9WA 4Y6RA 3A9WA 1YDWA 2HJRA 3HADA 2W4QA 3PDJA 4L74A 3TWOA 1VL8A 3H2SA 3KYDB 1OOEA 4DREA 4IMRA 2WDZA 3H9QA 1NFQA 4FFRA 4J0EA 2FMUA 3KB6A 3WIDA 5A06A 3RI3A 3CINA 4NI5A 4DL9A 2HDHA 3PJDA 2G5CA 1Q0HA 2IRWA 3WS7A 3E9QA 3W8FA 1N1EA 1A4UA 1B7GO 1DIGA 2EKLA 2QYSA 1Y81A 1Z73A 2X5OA 4XDZA 1SB9A 4BNYA 3WGZA 4J2HA 1SAYA 1X1EA 4KTTE 1BG6A 2V7PA 1M6WA 1X7DA 4GVXA 1X7GA 4B8WA 5IJZA 2E37A 3UICA 2BF7A 4GX5A 1RM5A 3IJPA 4BNTA 4N54A 1PWZA 3D0OA 5BQFA 4BVAA 2GDZA 4IGEA 4PLFA 2HK8A 5TNXA 2UDPA 2NUAA 1P33A 4Q3DA 3U4IA 5CP8A 2Y99A 4YB8A 5GZ1A 1EK6A 2B69A 3KEQA 1MA0A 4XGKA 4E2WA 1ADFA 3TFQA 4DLBA 1PJBA 4FFNA 4AJNA 4PG5A 2RCYA 4ZA2A 3RASA 5DZSA 1ULSA 3KYBA 4D41A 4UUMA 3WIEA 3KO8A 3FHLA 3WWYA 1ENOA 1N7GA 1ADGA 3UOGA 1R37A 2X0NA 1LI4A 3P5SA 2B83A 4IS3A 3C7AA 4AJIA 4R1SA 4M86A 3VTZA 1HZJA 2HO5A 3FD8A 1LA2A 1Y6JA 4RVGA 3RWBA 4KUHA 2AE1A 4IJWA 1O5IA 4IJVA 3NTRA 1SO8A 3OP4A 4JBGA 5KJEA 3NJ8A 1TVEA 3Q2KA 4KWHA 4BGEA 1Y1PA 4GBJA 4J3FA 1O89A 1V3TA 4F3YA 1NX6A 3G3EA 3NRCA 1WZIA 4O5OA 1PQWA 4BKOA 5TRTA 3B1FA 5MDHA 1ML3A 4M55A 4RDHA 4ZU3A 3IP1A 4I08A 4XIJA 4MVJI 2IODA 4PG4A 3AY6A 2H1SA 2BFOA 4R3WA 3LT2A 1LJ8A 2WEKA 1VLLA 2X0RA 4P4GA 3OFSA 4BO0A 3W4JA 2P5YA 2I65A 2GZ1A 3EVTA 1DJQA 2W98A 4D46A 4L0QA 3VZPA 1ZSVA 3JYLA 4MIEA 5JY6A 5TC4A 2J6IA 4NFSA 2X9VA 5EQDA 3S2GA 4GPD1 2PKRA 1HEUA 4FJ1A 5KKCA 4R5HA 4FB5A 2B4RO 3UXYA 2NVBA 4DVJA 2YHIA 4YRAA 2O50A 2AEJA 4ALLA 1NPYA 4Y6PA 6ADHA 1E5QA 5CG1A 1WW8A 1DC3A 1ZK3A 4WLVA 4XRRA 1BXZA 3AW9A 1S6YA 3PK0A 4Y6SA 7MDHA 3OEWA 1G6KA 2DU8A 1TXGA 4XB1A 4YJDA 4CR8A 4EGFA 5CDTA 1R4MA 1KS9A 3PWSA 4RF4A 5ER6A 1VL6A 4IDFA 4JK3A 3GMSA 1H93A 4E2ZA 3JD4A 4GX1A 4W9NC 3TNLA 5I8WA 2HQ1A 2X6TA 3DOJA 4IDGA 1PGJA 3ST7A 1EE9A 1T2EA 5KVCA 2ZIZA 3Q9NA 1ONNA 4PN3A 2QRJA 4MKZA 1BXKA 4DYVA 1DIBA 1SZJG 3DZHA 3LU1A 3MTGA 3PQDA 3QW2A 3GF4A 4E13A 1NTOA 1UZMA 4E0BA 4WKGA 3QLJA 1AE1A 1QORA 4QXMA 4CMIA 1DFGA 2RHRA 2ET6A 4H15A 5CG2A 5L95A 3HDHA 4DLLA 3NJ4A 4RCVA 2YDYA 1TB4A 3MJVA 2JJYA 1GL3A 1RPNA 4FFPA 3AOEA 1U3VA 2WYUA 4AJ4A 4CLRB 1CERA 3O8QA 2QHXA 4PLHA 3GRPA 3RIHA 3AU9A 1YJQA 4DTIA 3SBOA 3OQ1A 1CYDA 3ZHXA 1PQPA 3LT4A 1BMDA 2V6BA 2VUTA 1W6UA 4UREA 1ZMOA 1HDXA 3KYDA 4J0FA 1VL0A 3RAJA 1U4SA 2NU9A 1R4MB 1TT5A 1M75A 4BV8A 3JYNA 1A72A 1H6CA 4ZRMA 2FRDA 4RV9A 3ZWBA 5U9CA 3ZWWA 4XR4A 1JWAB 4Y98A 1NVGA 3GNQA 3H2ZA 5TX7A 3DQPA 1ZH8A 3F4BA 5BSEA 4KQWA 5T5QA 4ND2A 4GMFA 2ZB8A 3KBOA 3QVOA 2X8LA 4YEDA 1CF2O 4NU5A 1GV1A 4ROSA 3HDYA 2PWZA 1E0DA 3FPCA 2WYVA 1A7AA 1DBVO 4BB5A 2X58A 4YQYA 3RUEA 1VSVA 3ZWPA 2VTDA 4JP2A 4A2CA 3T4EA 3AOGA 8ADHA 2EHDA 4RF5A 2PKQP 5FI5A 3A14A 4P4LA 3CZRA 4CQMA 1LRKA 3IDSA 4CM6A 4P4NA 3ZGYA 1PS8A 5HWSA 1NFFA 5JC1A 2IYPA 1VPDA 1AN9A 1WLYA 1DAOA 4BB6A 4E21A 2NU7A 4LGVA 4CMEA 1E3IA 2LDXA 1F14A 4AJ1A 4BNZA 4PFJA 3QJ5A 5G4KB 3ZHYA 3WYBA 3KSDO 4OL9A 2IYOA 1E1NA 2UUPA 1TA4A 3DB2A 4R3NA 3RUCA 1ENPA 1R0LA 3GMDA 4GAEA 4FC7A 1PZHA 4LMRA 4S1VA 5HTOA 3JYOA 2EERA 1I30A 4ESOA 2DBRA 3L77A 3DHEA 3E9MA 4IJKA 2P68A 2HCTA 3C1OA 3FBTA 4A03A 3DEYX 4BNXA 3H9EO 3I5MA 4PG7A 4UEKA 4B4OA 2NTVA 9LDTA 3DFZA 2VZ9A 2BD0A 4ZQHA 7ADHA 5L9AA 4AJHA 2QZZA 4R69A 4NFYA 2GR9A 3ONDA 5COQA 5L4LA 4OSPA 3DBHA 4WJZA 4YJFB 2R00C 4NR0A 4PRKA 8LDHA 1YL6A 2XPCA 3NYWA 2YYYA 1NVTA 1LLDA 2BI7A 2VHXA 1P0FA 5L40A 1Y9AA 2AEMA 3QWAA 3QRWA 1BGVA 1YRLA 3C1TA 1Q7CA 1Y5RA 5HA5A 3FNGA 4D43A 4AL4A 2QRLA 3BHIA 4YA6A 2Z5LA 5KJCA 4AICA 3DR3A 3HSKA 1KY4A 2YHIB 1GQQA 2XAAA 2CY0A 2VWPA 5ES3A 3ROMA 4FJ0A 2J3JA 2YW9A 1CIVA 1BDBA 3E03A 1ULUA 1H2BA 4DBZA 1SEVA 3K2EA 3Q0EA 1I3LA 4I1IA 3O38A 3I9LA 2VWQA 4IMPA 2D59A 4XQEA 4B3IA 3KOUA 4D44A 2YY7A 2R00A 4KP7A 4S3MA 5EQFA 4CQMB 4GMGA 5H81A 3RSHA 3MEQA 2PZJA 4YJGB 3ASUA 2GLXA 1U8FO 1YGYA 4IQGA 2UV8A 2NV6A 5IXSA 4H3VA 4PVDA 1VJ0A 4D0SA 4CQMD 3F47A 3MCVA 1NASA 1TI7A 3G0OA 1U5AA 1VJTA 3HHPA 3MTJA 4WOJA 4PLYA 1YXMA 3DTTA 4JBHA 2WSBA 2P9GA 3PLNA 3WGHA 3ZWCA 5A04A 2Q50A 1N5DA 5KJ1A 2YFHA 5I9LA 4R1NA 4E5PA 1ZW1A 5C7OO 5CEJA 1EE2A 1GADO 1T4BA 1A4IA 2VTEA 3BMNA 3GEDA 1U2DA 3ZWYA 5KIAA 3HN2A 1JKIA 3WFJA 3INRA 2C54A 1L1FA 1W73A 1DJNA 3JQEA 3WFIA 4XYBA 4RDIA 3WQRA 3NEPX 1V3VA 3JQ9C 3L4SO 4FCCA 1GYQA 3UH1A 3R6DA 4AJEA 2JL1A 1DAPA 3WBBA 3NT5A 2Y1CA 2Q2WA 4HADA 2PZKA 1O9BA 4ZQEA 1H94A 3DZGA 1GYRA 3QSGA 5C3MA 3EMKA 2B0JA 3CXRA 3ICCA 3KLMX 4K6FA 1FK8A 4CQLA 4JP3A 4W7IA 3PQEA 4RZHA 1I2ZA 4BGIA 3IQDB 4UUNA 1NR1A 1HF3A 1GQYA 4BNUA 2Q1UA 3DZFA 5JMPA 5K6AC 3U0BA 4IY1A 4JXKA 5EN4A 4ZGWA 1IL0A 1J4AA 5I8ZA 3ITKA 3EGOA 3ZN2A 4IM7A 1SPXA 4YAKA 4IINA 1QP8A 5F3RA 3GPIA 3TRIA 1UZNA 2J8ZA 1YOVA 3RQSA 3TOZA 4ZN6A 1PEDA 4ALIA 3WXBA 4NK4A 1G0NA 3A4VA 3B6ZA 3H8VA 1I5RA 3NTQA 2DC1A 4Z6KA 4GX2A 1A71A 2E4AA 2JAHA 3GZ4A 4BO5A 3QVTA 1QKIA 4UVDA 3PQFA 3WLEA 3QWHA 1VM6A 3LSYA 1E7SA 3F5QA 1HXHA 5G4LA 4QFDA 3RUFA 4XRGA 1XKQA 4XYLA 4R4JA 4BNIA 4BNGA 4Q39A 1UXKA 1PGQA 1YO6A 3I9NA 1Y8QA 4BNWA 3RUAA 5CAEA 2P9EA 3QWBA 4IBOA 3ZDFA 3TDKA 4CM1A 1ZEJA 3QVWA 2DPGA 3ZHBA 5A9SB 4CV2A 2CD9A 1LNQA 3OJEA 2BHLA 2CNBA 3K31A 4RVFA 4F6LA 3I1JA 4J1NA 1I3NA 3ZW8A 2ZYGA 4IS2A 4WLEA 3BMQA 3WB9A 4Q3EA 1IYZA 1E3LA 3RBXA 4PZCA 2EEZA 1O0SA 5IG2A 2NACA 5ENVA 2X4GA 4EEXA 4LSMA 1CDOA 1YE3A 2B4QA 3HDJA 4ND4A 1SB8A 2OMEA 3FR7A 1GUZA 4PRLA 2D1YA 2PH3A 3TZCA 1ZEMA 2Y0DA 5EMHA 2AXQA 4NZ9A 2Y67A 4QO7A 2VCYA 4WCFB 3V2UA 2JD0A 3PTZA 1E6WA 3OICA 5JS6A 2IZ1A 4FDAA 4NHEA 2PR2A 1PWXA 4XWYA 1EFLA 3F46A 4YT4A 1M76A 4J43A 3W8DA 3TL2A 1DC4A 4BL5A 1LDBA 4E5NA 2Z1NA 2G0TA 3S2EA 4BNKA 5FYDA 3C3XA 1R66A 4W82A 2YV1A 4OKIA 3CE6A 3K2BA 3GN2A 3DC2A 3ULKA 4CL3A 2AQKA 2EJVA 2OXIA 1XWFA 5DNAA 3JV7A 1U4OA 2I76A 5JCXA 1I3MA 5T6BA 3OHSX 2DVMA 4MJLA 1XU9A 3OETA 5JLAA 3U4HA 4YAEA 1DEHA 3EW7A 2BH9A 1EVJA 3JD1A 5B1YA 1CWUA 1X7HA 3JQ8B 2HK9A 2VT2A 4MVJH 1PZGA 3HQ4O 3U62A 3PZRA 3V1UA 3B70A 4QUKA 4TRRA 1BDMA 4LCJA 2D2IA 1C3VA 1H5QA 1YJ8A 1L7DA 2JHFA 1LSJA 3DZKA 2HLPA 3AOEC 4OKNA 3HZZA 1B15A 2DFVA 2X9NA 2SCUA 3LLSA 4KOAA 1ISMA 1KEVA 3FI9A 3FWNA 3F9IA 4OOEA 1HSOA 5C37A 1XIVA 3I6QA 1OC4A 1KC3A 1P1KA 2PGDA 2JFFA 3TF5A 5KNLA 4UULA 5TSDA 3QVXA 1ENZA 3SJUA 4E4YA 2AG5A 2BFPA 1GZ6A 2NLOA 2AW5A 1GTMA 1H6AA 1HE3A 4CPDA 4CMEC 4BNHA 3OA2A 2BKAA 3GT0A 3O03A 3UAGA 2C5AA 2E48A 3HUDA 1EEHA 1M67A 5LDGA 4LISA 3S2IA 1C0PA 3PHLA 5IDYA 5IDWA 1HYHA 3C85A 4OJNA 3UCFA 4DIOA 4NBVA 5COAA 1E77A 3M2PA 2YV2A 1UXHA 1ZZEA 3MWDB 1OC2A 3PDUA 4RPHA 3SEFA 3JYPA 2YFQA 3DAGA 3DDNA 1AXGA 5TIIA 4IZHA 2DAPA 1E7WA 5CDGA 5T67A 1Y7TA 4UAGA 5DCUA 4WNIA 3RROA 2DM6A 6LDHA 2O2SA 3IP3A 4II3A 1DLIA 3F6YA 2VT3A 4IGFA 1Q0QA 1XQ6A 1FDSA 4RO0A 2X23A 1T24A 2CDCA 1PGNA 2J3IA 1BVUA 1R6DA 4O0LA 1LDNA 4IZIA 2Y1EA 5B4VA 5IZ4A 1R0SA 4N18A 4CMCA 1SEPA 1ZK1A 4DPMA 3ZV4A 3O8QB 4CUJA 2IE0A 2HMUA 5IN4A 2GNAA 3RFVA 1Z74A 5DCYA 2GN6A 1ZK4A 1JWBB 3WR5A 2Q46A 3KHUA 4CMAA 4F45A 1E1KA 3FNEA 2GO1A 1U3UA 4Q3AA 3DONA 3HFGA 3TZ6A 1HDOA 3AM5A 3WG9A 4OSOA 5JO0A 3I9JA 3JTMA 2JCXA 1PJQA 4L9RA 3VHRA 4ZQFA 1HLPA 4BS9A 5KJ6A 1E3WB 1D7OA 2R2GA 2I9PA 1ZXLA 5A03A 3LT0A 1WDMA 1P0CA 4YJGA 1E7RA 2JFGA 3H7AA 4CM8B 1E3EA 2OOSA 5GMOA 4I9UA 2CDAA 2NVWA 3JD0A 5JAZA 1NQAO 1WVGA 3GAZA 1ISJA 1ZSNA 5A4DA 2D0IA 1WDLA 2CSUA 1DRUA 1VI2A 2X5JO 1EQUA 3BMQB 4CL8A 3PWKA 4RLSA 2B5WA 4GWKA 2VWGA 1YKFA 2A35A 4Y8VA 1T4DA 3BXXA 3ORFA 5L4SA 5J23A 5DBGA 1JKFA 5C5IA 4YAIA 1X15A 4NQZA 4MIYA 4R9SA 1J0XO 3MJTA 4BO3A 2I67A 4NJOA 1NFRA 5L7TA 5TT1A 3P2YA 1FMCA 4GSLA 5ADHA 4MPDA 4WCFA 3PYMA 4GL4A 4PVCA 1IE3A 1MFPA 3A1NA 4XA8A 2Q1WA 5DN9A 3PIDA 4BO2A 4KDEA 2C07A 1R0KA 1HZZA 4YXFA 1CQIA 3F5SA 4I5GA 3Q3CA 3C24A 4KZPA 4FOOA 1KOLA 2GGSA 1EFKA 2JHGA 4CM4A 4CJXA 3TJRA 4M49A 2I66A 4FFLA 3K6JA 1VRWA 4AJ2A 1HDRA 4EUFA 4F6CA 3QE3A 3VDRA 4B8ZA 2VYVD 2JKVA 3PLRA 5JCJD 4L8VA 4NNJA 1P1JA 4NH4A 3FF4A 3S2FA 2NTJA 2G76A 1J6UA 5F1PA 3VVBA 1P31A 1N9GA 3GGPA 4ND5A 2F1KA 1KERA 4NFHA 4B4UA 2PNFA 4BUCA 1UP4A 1HE2A 1U7TA 4D7AA 4GQAA 5LC1A 4ZQBA 4AJOA 3U5TA 2WD7A 4URFA 3ZI0A 1PJ4A 3ONFA 5TJHA 2O3RA 2J3HA 1FDWA 3JQ9A 1HT0A 1LSUA 3ZWNA 2YHUA 4CM8A 1GZ3A 1C0LA 1Y8RB 3DBLA 3I9OA 5KCZA 4I5EA 1B3RA 2BI8A 2WJPA 3QQPA 3RU9A 2OL4A 1NQ5A 5IXYA 1QR6A 2OZPA 1C0IA 1BVRA 1BWSA 3WICA 2Y1DA 3H6KA 5TLSA 3MJ4A 3ZU5A 5JXWA 2W2KA 3RC1A 1LDEA 3ZU4A 1P1IA 3OSUA 3D4PA 3AUAA 4MVJD 3OA0A 5MGBA 1X1TA 5JNLA 5CPBA 3UHAA 4FN4A 4BNVA 1E3JA 2P2SA 4QTZA 4A10A 2QZ9A 3MJEA 5KKAA 4N5NA 1P1RA 2VRCA 5DBIA 3VH4A 2HAEA 4CMBA 2NU6A 3AY7A 1E1LA 4PGFA 5C7LO 3JQGB 3GDGA 2Q4EA 5L7WA 2R6JA 2Q3EA 3GLQA 2CMDA 3GNSA 4EITA 2UAGA 3VKUA 2JAPA 3DZBA 3K30A 4NJMB 1PL8A 3GFBA 3FN4A 1QLJA 1S7CA 3ETEA 5G0VA 2I5PO 4CLXA 1VE9A 3I9KA 1HLDA 4XB2A 2EG9A 2X5KO 5IAAA 4M87A 1I32A 2Y93A 4WPGA 1ISHA 3U09A 4WECA 1ISGA 4EUEA 4ID9A 4G2NA 4GX0A 3ROQA 3L4BA 1BXGB 4FQ8A 3I9MA 1EVYA 1JU9A 3GUCA 2G17A 3OM9A 3PYLA 1GDHA 4P38A 2DT5A 4HFMA 2EIHA 1SNYA 3I4CA 2VYNA 4XCVA 4EEZA 2DQ4A 4OGWA 2OP1A 3H9UA 4FBGA 3IUSA 1P3DA 4I8XA 3WDSA 3GVHA 5T64A 5JW6A 1FJHA 3GA0A 4MVJF 1LDGA 3OECA 1QMGA 4J2OA 4WLFA 1WMAA 2V6FA 3JQGA 3SJ7A 1EDZA 1J49A 1HYEA 4BKQA 1YQDA 3NTOA 5JY1A 4Q9NA 1RM0A 3DTYA 1LX6A 1X14A 3NGLA 4DUPA 2EV9A 2YJZA 3ONEA 3I3OA 3MJSA 3QWIA 2DLDA 5A05A 1E3WA 3JQ8A 4L73A 1J5PA 3T4XA 2D5CA 4J6FA 1JW9B 2Y0EA 1DB3A 1P45A 3Q11A 4OAQA 4TZKA 5A5FA 3DBHB 1W0CA 4LVCA 5BSHA 3DHNA 4ALKA 2WE8A 3KEOA 1U7HA 4K6CA 3KVOA 4TROA 1NXQA 4O1MA 2NWQA 2ZTLA 3GUYA 3EHEA 4BO6A 2P4HX 3DHYA 2C2XA 4XQ9A 3VDQA 5G0WA 2FZEA 4GKVA 3VAZA 5TT0A 3VH2A 5HRUA 2ZATA 2D3TA 2W2KB 3V1TC 1LTHR 1CQJA 4EJ6A 3ETDA 4ALMA 1LRLA 3OEYA 4GLLA 2JFHA 1H9BA 1E7YA 1NM5A 1WP4A 2WYWA 2Y1GA 5AXAA 4BKRA 5CEEA 5JPIA 3RUIA 4LCEA 1WPQA 4WCFC 1E6EA 2O2YA 3F1LA 4E12A 5A1TA 4UUPA 5H82A 3WNVA 2CF6A 2WTBA 1GQ2A 3KZVA 1WMBA 1ZJZA 5JDIC 1KY5A 2O3JA 1V0JA 2CVQA 1MV8A 4CMKA 1P1HA 4PLZA 4DXHA 2C82A 2OGUA 1IHXA 2C2YA 3MOGA 3T7EA 1HE5A 2O3QA 4RZIA 4ZD6A 4P22A 4PG6A 3CH6A 4YWJA 1XR3A 1DRWA 3A28A 3SXPA 1T2FA 1OBFO 4BGUA 4XYMA 4AFNA 3UKOA 4GLOA 2VOJA 5U4QA 3WQQA 3JQAD 1O94A 4J4BA 5DP1A 5KVSA 3RFTA 4OXYA 3DBVO 1NPTO 4RF2A 1PX0A 3QP9A 3WGTA 4NDNE 3D4NA 1JVSA 2EF1A 2H5LA 4ZRNA 5ITVA 1JAXA 1X13A 2D4AA 3QVSA 4R9RA 4XR9A 4FS3A 2ZYDA 3QV1A 4U7WA 1BRMA 3ZWAA 3AI1A 3INGA 4IJUA 3IS3A 4NMHA 2J3KA 4BO9A 1TEHA 3OQ6A 1AHHA 4UUOA 2WD7B 4DIBA 3WSVA 2FPIA 2ZB3A 3O4RA 2CZCA 4E2XA 4XGIA 1AGNA 1JDJA 5JFOA 2AMFA 4Q3NA 2B37A 3E18A 1MP0A 1QV6A 3GH3A 1GEGA 1FDUA 4J7XA 1YBAA 1T1SA 3ZNPA 2V6GA 3FTPA 2ZJ0A 1OMOA 3GN1A 4CMIB 3DXFA 2WMDA 3PHJA 4U8GA 3LF2A 1HTBA 4YJHA 3RKRA 4CM7A 4WASA 1FF9A 1PJ2A 5A9RA 3V5NA 2UVDA 3COSA 3PGJA 4RQTA 1P9LA 3SC6A 3EDMA 5B4TA 3D4OA 3L9XA 2PLAA 4IIUA 4XDYA 4Z3DA 4K28A 4CR6A 4HY3A 2W90A 3ASVA 1U9JA 3PI7A 1RM3A 2ZK7A 3CMMA 1KVTA 1K6JA 3K5PA 1R12A 2VZ0A 1ONPA 2Z1MA 3U4DA 5JAIA 2ZQZA 1PJCA 5LCXA 1LC3A 3TL3A 3X2EA 1I01A 2RAFA 1FDVA 4YAGA 3AI2A 4B4VA 1A9YA 4WEQA 2H9IA 3NX4A 3OJ0A 2LDBA 4QEDA 3S55A 2DUWA 1ADBA 2Q1SA 4HBGA 3R1IA 3EK2A 3WX0A 1QRRA 4CM4B 2RIRA 4NBRA 3LZ6A 4J91A 4N7RA 2JD2A 1RYDA 3WGIA 3UVEA 3RJ9A 1M2WA 1JVBA 1UAYA 2UYYA 2ZB7A 3WGQA 1V35A 3E1KA 5T8KA 5ICMA 2YV3A 1V3UA 4FD3A 4J4TA 3N7UA 5JCJA 3PRJA 2VQ3A 3KSZO 4X54A 1NAIA 5CPFA 3Q6IA 3DBRA 1PGPA 2P9CA 2EW2A 4BNMA 5BT9A 2DFDA 1YVEI 1K0UA 1Q7BA 3WWZA 5LDHA 3DFUA 2Q2VA 3H9GA 4MVJM 3UGKA 3AJRA 3IKVA 2GPTA 5JDIA 5G0UA 3TFOA 1VJ1A 1LSOA 4NK5A 1ZFNA 2VUSA 2I99A 2DBZA 3IUPA 2B4TO 2IZ0A 2Y68A 3VPHA 3VVCA 2G1UA 3ZCXA 4RPLA 5ILOA 3B20A 1QYXA 2IZZA 1Y8RA 2OUIA 3BIOA 3DBLB 4PLVA 4Q3BA 4C4OA 4YT2A 3DZJA 2A92A 4II2A 1XDWA 2J5QA 2AE2A 1XEAA 2CVOA 1EBUA 1O6ZA 5JE8A 3PFFA 4FC6A 5AVOA 4YT8A 3U9LA 1XSEA 4CMHA 4YAJA 5BR7A 1IHYA 4A5OA 1EBFA 1T26A 4CLOB 2FR8A 4IUYA 3PGXA 3WMWA 1WWKA 2Q45A 5ITWA 1Q0LA 4CMGA 2PH5A 3VPFA 4A0SA 3QY9A 4CMJA 4RQUA 3HFSA 1E1MA 4B7UA 2Z95A 1R16A 3RC9A 4MP8A 1XYGA 4OH1A 2ZTUA 2AEFA 5AXDA 1PJ3A 4YJFA 2VRBA 3JQAA 3JQ7B 5KJFA 2YQ5A 1U28A 1I8TA 4M54A 4MOWA 3BHMA 5CHEA 2DTDA 3BMOA 3VZRA 5EPOA 3PZBA 1LQTA 5KOIA 1HRDA 4BO7A 2QRKA 4RF3A 4OO3A 3JD2A 3FNFA 3EZLA 1D1TA 4BGVA 2EGGA 4E5MA 1D8AA 4H16A 1N1GA 4TMFA 4JNKA 1I10A 4RL6A 5BSGA 4E2YA 4DPLA 3WTCA 3FSRA 1NQTA 4QSMA 4W6ZA 4BMVA 1EK5A 4NBWA 4E33A 5DP2A 1QG6A 3OQBA 2ZTMA 3GGGA 1SMKA 3GZNA 1JLLA 3NT2A 3OJLA 1GV0A 3JQBC 4B3HA 2BRUA 4K1LA 4D45A 5I9NA 3KXDA 3AM4A 3G17A 4ALNA 1KEWA 1PSDA 1H2HA 1GD1O 1DHRA 2OBYA 2QX7A 1A27A 1I33A 5AYVA 3U49A 1LLCA 2RH4A 1VC2A 4U0JA 5EESA 2X1HA 3WMXA 3D7LA 4FGWA 4EJMA 1ZK0A 2X7HA 3AU8A 1MC4A 4R51A 3BTSA 3VZQA 3D3EA 1Z7EA 4DWVA 1G1AA 3V2GA 4CLEA 3RC7A 4WEOA 4J49A 1T2DA 5CEFA 1QSGA 1T2AA 4ZICA 5JYEA 4YDRA 4HWKA 1I3KA 1PJLA 1XGKA 1WAMA 1D3AA 1NPDA 3GG9A 3GY0A 4IQ0A 4RJTA 3NDRA 1K3TA 3HG7A 3JD3A 3PHIA 4IPTA 4ND3A 1KIFA 1XCBA 4TSKA 4G81A 4MVJP 4KWIA 4AJPA 3ZWVA 5L4NA 4AVYA 1SOVA 4CQLB 3NKLA 1IUKA 1V6AA 2TMGA 3DOOA 4RPKA 1EVIA 1YB4A 5B12A 2Y0CA 2QYTA 4YBZA 5IZCC 2HUNA 4TRMA 1ENYA 5COBA 3FR8A 2P91A 2C7VA 2WWRA 5I7FA 2HSDA 3BTUA 3K9QO 3VPGA 2GZ2A 1XLTA 4DC1A 1HDGO 5B4UA 2XF8A 3WOHA 4BQRA 4E6PA 3ROKA 2POQX 1HE4A 1PU2A 1EUDA 3RCBA 4A7PA 2NM0A 3F1KA 1DFIA 1GPDG 2BGLA 4U6SA 3BMNB 4XGNA 2FSSA 3C7CB 3ZHZA 2NQTA 3M6IA 1UDAA 5A5EA 1F8GA 4DA9A 1IB6A 3U3XA 1XU7A 4A73A 4WNCA 4TVBA 4XEHA 2BGMA 2X9GA 3GVIA 1OAAA 3KV3O 4CM9A 1YH3A 2ZCVA 3QA9A 3P7MA 1B8UA 3ITDA 3OH8A 1C14A 3IOYA 3GHHA 2VRCD 4XYEA 3C7DB 1XHLA 4L4XA 5T57A 2FR1A 2NNLD 2Y05A 4FOSA 5JYDA 1DRVA 3IL2A 3TPCA 1GU7A 3H9JA 1B0AA 1QYDA 1UDCA 3JYQA 5CDYA 4DIFA 1PTJA 5I7EA 1E6UA 5AXCA 1ZVMA 1DOHA 4A26A 3TQHA 4IDCA 4L76A 4U0KA 1YL7A 3G1UA 4KUEA 5A9TA 1YDEA 1DSSG 1HSZA 2VHWA 4BMNA 1JAYA 2OBNA 2BELA 1UR5A 2G82A 3Q1LA 5IF3A 3WJAA 3TSCA 3IJRA 4BNNA 3EZYA 3PJFA 4KQXA 5IFLA 1Y5MA 2BFMA 4HNGA 4PLGA 4YYZA 3M1AA 4W7HA 5DULA 4MKXA 1DO8A 3DOCA 2IXBA 3AI3A 3PFWO 4EI2A 5EJ2A 3ENKA 1YWGO 1F8FA 2Q4BA 4UVGA 3E48A 3RKUA 4YTEA 1N92A 5TGDA 1SOWA 3M2TA 1PQUA 3QWFA 4XQCA 4E32A 3VPSA 2DKNA 5I9MA 2FZWA 3ZV3A 1E3SA 3DZIA 4LK3A 3LQFA 4LRTB 1KETA 1W8DA 4HP8A 4QECA 1UP7A 1B3BA 3TOXA 1UH5A 2OO5A 3L0DA 5F5LA 1O95A 5THQA 3SLKA 3ZNOA 3RC2A 2VYVA 4TKMA 1LXCA 4J7CA 1UP6A 3FNHA 2O48X 1X0XA 2B35A 1HDYA 4G65A 4TRJA 5G4KA 3DMTA 3HNPA 2O3UA 2TMDA 4GKBA 4O6VA 4OIMA 5FF9A 1ZMTA 4YCAA 3VPXA 2PD6A 4WOKA 3RJ5A 4NBTA 4MO2A 4HFNA 3GK3A 4ZVVA 2O23A 2GRAA 1MXFA 1PGOA 3ZU2A 3LYLA 4JX8A 1PS0A 4C7KA 3NV9A 2PZLA 4XZ3A 2GSDA 5IZCA 1H0KA 2HJSA 1IULA 3PHGA 1WXDA 3PIIA 1I36A 4HKTA 4KDFA 3JQBA 1LEHA 4Q3CA 1LC0A 3H3JA 4OMUA 1RM4A 1LDMA 4GSKA 3BAZA 3WYEA 3G1TA 2XXJA 5JC8A 1C0KA 3F4LA 4ZHSA 1Y9EA 1Z7BA 4CLDA 5ER9A 1NNUA 1KVUA 1UUFA 2Y1OA 4W99A 1ZUD1 2EW8A 4RPGA 1HYGA 3I4FA 2E49A 2H63A 4DC0A 1MUUA 5EIOA 3BTVA 1MGOA 2IDZA 3JQFA 3LC1O 4J1SA 3LLVA 2FN7A 3OIDA 4J9VA 2C59A 4CM9D 3ZNQA 4Y9DA 3UCEA 3HDQA 5BNFA 1CEQA 5FFFA 3CKYA 2VUUA 1GCOA 3JSAA 4L75A 4ILKA 3MJCA 1I2CA 2Y1FA 2PZMA 4GWGA 2HKIA 2PTGA 1IOLA 3LC7O 1U3WA 2NVUA 2WM3A 3ROPA 2XOXA 4E5YA 4E3ZA 4XKJA 1Z6ZA 1GCUA 1N7HA 4BOYA 4YRDA 3K96A 1PL7A 2GASA 3UW3A 1ISIA 4M89A 1OI7A 1Q1NA 1MXHA 2I3AA 2I6TA 4FFMA 1PZFA 1LUAA 3D1LA 2D8AA 3VOSA 2PGJA 1Z75A 3LK7A 2BMAA 2HRBA 1GEEA 2VOEA 5L51A 3BMCA 1EVZA 3O26A 3EUWA 3AUSA 4RPJA 4E30A 2CFCA 1EMDA 4ZJUA 4RVSA 3ANNA 1RWBA 2W2LD 3OBBA 9LDBA 2HMWA 2XXBA 1TLTA 3KSUA 1NQOA 5I7VA 1ADCA 3AFNA 3EAGA 4GH5A 4OXKA 4QQRA 4FPXA 4JJGA 4B7XA 5TS3A 3AY3A 3ZW9A 1YB5A 3ABIA 3K92A 4FSHA 1GZ4A 3ADOA 4MVJE 4NIMA 4D42A 4YPOA 5FWNA 4JLWA 4BV9A 2O3SA 5A3JA 1NVMB 5KWEA 2QW8A 3AM3A 4Z9FA 3ZH2A 3PHHA 1A5ZA 3PP8A 3Q2IA 4L4SA 1P1FA 1YS4A 3ZWOA 3V1YA 1FDTA 1A7KA 5TJ9A 2DUUA 3W1VA 5L53A 4U6QA 4N5MA 1C1XA 4Z0HO 1XA0A 1E92A 2OFPA 5K6AA 2BLLA 3BA1A 4MVJG 4MDHA 1B14A 2JCVA 1GFSA 3S8MA 4MP6A 4NU6A 4JROA 4WLOA 3UN1A 1EUZA 1Q7GA 4D3FA 1K89A 5DF1A 4O63O 3MZ0A 4PLWA 4DMMA 4OQYA 4RVHA 3I6IA 2VNSA 1QYVA 3AWDA 1P44A 4HUJA 4Z3KA 1EDOA 2V6MA 3BYZA 3U4CA 4OYRA 3SVTA 4AG3A 3GFGA 4OQZA 1KC1A 4UVHA 1W4ZA 3SC4A 4WK6A 5ICSA 3E8XA 2ZB4A 1MG0A 2X0IA 3ZWMA 2DBQA 1LBEA 4DQUA 1C1XB 4PZEA 1GY8A 1PIWA 3ADPA 4INAA 5DOVA 4GI2A 5DOZA 3UFXA 3K73O 2DTXA 2NTNA 4MIOA 3EC7A 3L6OO 3RU7A 3OF2A 3K8ZA 4LN1A 3R3SA 5FI3A 1QLHA 1DDOA 1MFZA 1U1IA 1E7MA 4ALJA 1PL6A 3NAQA 4ITUA 4WE3A 1FXSA 4YRBA 2YUTA 2OHXA 3DWFA 4LRSB 1L7EA 1DIHA 2PKQO 1ZO8A 2FWMX 1HKUA 3OIFA 1PJSA 2C5EA 2Q2QA 1H6BA 2VHVA 4JQCA 2GUGA 3FCOA 3GVXA 5JDCA 2CUKA 3CSDA 4FGSA 1YBVA 3FBGA 2GF2A 4DQVA 4LSWA 3HE3A 2I3GA 1JTVA 1ZJYA 4R1UA 4I5FA 2OP0A 4PG8A 5I7SA 3CPSA 4NPCA 1NYTA 5KVVA 2A4KA 5K9ZA 5HS6A 3VTFA 5HS4A 2EWMA 3Q9UA 5DDIP 1YONA 5HM8A 1NBOA 2O4UX 1YQGA 2A94A 4R01A 2FY8A 1QV7A 4A27A 3LT1A 2J5RA 3JCZA 5K0ZA 3E5RA 4FIZA 1XELA 3WJ7A 3FRJA 4I5DA 2PD4A 3DAFA 4KTVE 1ZSYA 1D1SA 4AJJA 1CETA 4GGOA 3INTA 3JQDA 3JQAB 2A9FA 1WNTA 1N8KA 4UEJA 3VZSA 1PS9A 2HK7A 2FSVA 3KRTA 4R54A 2ZCUA 4HFRA 2VN8A 4XIYA 1PR3A 1YB1A 2HMVA 3KYCB 4IDEA 4CLHA 4XX0A 3PPIA 2QIOA 4XJSA 1MLDA 1WDKA 4DLAA 2GN8A 4XJTA 4IDAA 1NAHA 3I83A 4LVUA 4R1TA 1F06A 1K5HA 3AK4A 1D4FA 2PY6A 4CV3A 4IXWA 3GG2A 3DBRB 5BSFA 4CM5A 4TQGA 3GR6A 1Z82A 3TZQA 4BNFA 4G5HA 4R16A 2EKQA 4YT5A 3FPLA 3E6AA 1GAEO 4XYGA 3TN7A 2DPHA 3AUTA 4M8SA 2AQIA 1MB4A 2GYYA 2O7QA 4Y67A 1LU9A 3SLGA 3T7CA 3ANLA 2NADA 3KTDA 3M1LA 2FPGA 5TF4A 1ZKMA 1XG5A 4BMSA 2O3TA 4HXYA 5A02A 3KYCA 2AHRA 1C1DA 1K6XA 3R3JA 4J7UA 1SBYA 3FWZA 2F00A 1NHWA 4IXTA 3KETA 3W6ZA 1TT5B 2DTEA 4H7PA 4FR5A 1Y8QB 4UEOA 1DC6A 3RVDA 1BXGA 5DCWA 3G79A 4OXNA 4D3SA 3ICPA 5A9SA 4BKUA 5ENDA 1ZBQA 3NGXA 3UF0A 2PV7A 3B1KA 2C20A 3D5QA 1HDCA 4J1QA 1K6IA 1LDYA 2AQHA 2CVZA 2D5AA 4PLTA 4CLRA 1U5CA 3DO5A 1ISFA 5JO9A 1U2GA 4CV1A 3C1AA 2VHYA 3PWZA 4UVEA 4LW8A 3DMTC 2VNAA 4JJIA 1ZIDA 4IIVA 1EZ4A 5EERA 3E82A 2YDXA 1IPEA 4PLCA 3B1JA 4BO1A 4AJLA 2EKPA 3NDJA 3AUUA 2ZTVA 2QQ5A 3SX2A 3DAPA 1UXGA 3E9NA 5L45A 3RUDA 3P19A 4BNLA 1UJMA 3UCXA 2DBVO 4EBFA 4OOFA 2HU2A 2Q99A 4DGSA 5JAMA 1MX3A 4J90A 2PK3A 3CIFA 3IKTA 1UAGA 1BHSA 4DBVO 4EYEA 3TZKA 4IDDA 5L3ZA 3VH3A 3EYWA 2PGLA 4HV4A 5BNIA 1B8PA 4BO8A 4Z9XA 3W4IA 1H9AA 1ZK2A 2B5VA 4QO8A 2B36A 1ORRA 1CJCA 4Z9YA 4YJHB 3GOHA 1Z45A 1K2WA 4J9UE 3W6UA 1Q2XA 3DMYA 1F12A 4QFCA 3LC2O 4XD2A 4QT0A 2AG8A 1MG5A 3TZHA 2FP4A 2JD1A 2ZKLA 2PFGA 3ZZNA 4FFOA 3I23A 3IAHA 3HWRA 1KYQA 3QIVA 5AQ1A 3WNQA 5G0TA 1UDBA 2AA3A 1ARZA 4FW8A 1XQ1A 1B26A 2NSDA 1CRWG 3JQ7A 4TWRA 3MOIA 3WGGA 4BHTA 4CR7A 3I52A 2P5UA 1R15A 3VKVA 1BSVA 1IPFA 3CTMA 4HX5A 1IZ0A 2E82A 3NUGA 3WGYA 3JQFC 3VH1A 3KUXA 4PLPA 4WGGA 1P74A 1R4NA 3GDOA 2BGKA 5IDQA 4HFJA 4RLHA 4K26A 4LMPA 4WLNA 3GEMA 4JIGA 1B2LA 3MWEB 3N58A 3N74A 4RGBA 2PA3A 3GQVA 1VKNA 1HDZA 2CF5A 3C8MA 2RHCA 4E5KA 3ETGA 4DQXA 3WGOA 1N2SA 1U3TA 1YQXA 5JSFA 3FTNA 1IZ9A 2FR0A 3D3WA 5JBIA 4J4HA 3PJGA 1ONOA 4WCDA 1KBZA 3JQ6A 4Z0PA 2OORA 5DBFA 5TQVA 1LRJA 3JQCA 3ZV6A 1DHTA 2QG4A 1RKXA 5FEUA 1NWHA 3GEGA 2W2LA 1NR7A 3STHA 1P77A 1SC6A 3QHAA 1ZNQO 4K9DA 2GN9A 2VWHA 3LVFO 5IN5A 1M66A 1GPJA 1JA9A 4D0RA 4EJ0A 3OJFA 2BFAA 1VKOA 4J16A 4EDFA
chains in the Genus database with same CATH superfamily
2FMHA 1OZAA 1RKVA 3UGTA 1ZMBA 2I4LA 2VJMB 5DT9A 3HCPA 1HWYA 4YIHA 3MT9A 3O2NA 5CNKA 1R4NB 2B7CA 5HIKA 3PLAE 1PR9A 4PRZA 2HXYA 2VJYA 2PQ2A 3VUEA 5LU9A 3ANYB 5F9MA 4E3WA 4YRGA 2AL7A 1W87A 3N0VA 5BWBA 2FPGB 4UVIA 3T99A 4DIMA 3H65A 4K6MA 5ESRA 5DHTA 2GERA 3DE7X 1Y4AE 4G37A 3FCAA 1QYWA 5F2KA 3HB5X 3W2HA 1FQWA 1O95C 1Z0ZA 3FNIA 4WL0A 1N0WA 4OHUA 4PZPA 3GT7A 4Z54A 1KKLA 2XTJA 2CL0X 3GJ3A 1N9KA 5IKPA 3A70A 2WV9A 4HGZA 1PW7A 2MJLA 1WB6A 4GOND 4WUVA 5KBYA 3K9WA 3A32A 4BVGA 3HYTA 3KLPX 3B6KA 3PJEA 3HR4A 1NHGA 1SXHA 2BR5A 3RFXA 1ORHA 3I8XA 1PNTA 5DYYA 1FNCA 1MTOA 4LHYA 4YMTA 3MMPA 4LWPA 4HDNA 3WQSB 4I9HA 4ZAVA 1T5TA 4BE9A 4AZ0B 1BTOA 2XCUA 1G8FA 2BEJA 1RYEA 5A5GA 2IEDA 2YQ4A 4EY3A 3ZHOA 2WZDA 3L07A 3NHLA 1NN1A 3GZJA 2XNSA 3ZJTA 4REQB 3B6MA 1XPJA 4F2GA 2HF8A 3X43A 3ZYCA 4G9GA 5F51A 3O3NB 4V0NA 1U2SA 1RAIA 3WYCA 3CNEA 3D7RA 2BLNA 5H9WA 3V8VA 3ZJ5A 1BFUA 2AQ8A 4LNUA 2Z04A 1C9NA 4QLBA 4AQDA 2DHDA 3PCTA 2IYXA 4D0NA 1EUCA 3D3WB 2JIQA 1OX6A 1C8LA 1AUXA 3IEKA 5AKEA 4RE6A 3MAAC 1SFRA 3UMFA 1GP2A 4NJMA 1PSZA 1UM9A 4M9RA 3GCWA 2FRVA 3BCHA 3Q3VA 4K87A 1ID8A 4GL2A 3N87A 3V34A 2AD5A 4NZZA 1EWTA 1XZKA 3NDIA 1KEUA 4C78A 3ZV5A 4MYUA 5EHQA 4BQEA 1EU1A 1PWYE 1QDLB 2OSVA 2VHZA 3ACCA 3JRWA 3KWJA 3LUBA 4C7JA 4DDKA 2JA2A 4BLRA 2BUBA 1T8YA 4LJ7A 3SICE 3T95A 3KXKA 1E2QA 5ERGB 2VDWA 3UPDA 4UPEA 4X5OA 3D5TA 3DT6A 3CS3A 3KQVA 4MDYA 4Z0TA 4RORA 3R7NA 4QGFA 2ZUEA 3GVPA 2QSJA 3I72A 2VAXA 1O95D 4CFYA 1U8EA 4MKRA 4CUKA 1VKJA 3KZNA 4R98A 3TTSA 3O4IA 4P54A 1R74A 1RC0A 3LRXA 4KKXB 4EKEA 5A2GA 2WSIA 1O08A 1OIXA 5GONB 3GC6A 5JNTA 1OWPA 3AUFA 4GXQA 1SCUB 2YBDA 3TUJC 4OPMA 2X22A 8AT1A 2H6EA 4BPRA 1YOVB 3HJBA 2Q1TA 3B2EA 4ONEA 1AQIA 1T8WA 3GJRA 2X0JA 3N2YA 2A1TS 3O4VA 1ZCAA 3ELWA 1ZPDA 1RLMA 4M6WB 5CDSA 1E1YA 1Y82A 3Q87B 1FFDA 3BMOB 3P9KA 3DKKA 2IXAA 1O8CA 3NPMA 2C5LA 1CNMA 4S1WA 5J1SB 4RK0A 5CB6A 1AXEA 1Z37A 2QD2A 5I4KA 5FCDA 3U61B 3AFMA 2R2AA 3E4DA 4DL9A 2K7FA 2WF9A 3KZCA 5DU2A 4C2BA 4QOEA 4ZEMA 1BCSA 3EPLA 1FP6A 3H1TA 4YRPA 5CNMA 2JHPA 4UNRA 4BAUA 3NT4A 1I1QB 1YBMA 2I34A 4EA8A 1N9GB 5G2OA 4BP9A 3AV0B 3EBPA 1SCUA 4CM3A 2Q7XA 1CUCA 2ZS8A 4P3NA 2IHKA 1O57A 1AB5A 2WD8A 1JR3A 2H51A 5LZ9A 4XGQA 1E18A 3E9EA 1LNSA 2ZQYA 1IEWA 2W2OA 1NWCA 4GC9A 1X80A 1JKJA 2IOQA 4QWWA 3ODGA 4UDNA 4AJKA 1HY3A 3OF3A 2C1ZA 3N5CA 5EMLA 2Q1XA 1AQYA 3QOYA 1W5BA 3M8KA 3ON5A 5BUCA 1JIUA 4DB2A 3PEWA 1HETA 3IIIA 2GZ3A 1GRRA 2C29D 5E4JA 4YR9A 5JWOA 4IUDS 2ILTA 4DMKA 1Y6ZA 5KX5F 1ZR4A 4IGKA 3LBNA 1RQRA 1FFGA 3W5HA 4P8RA 3EG9A 3HKDB 3A9SA 4GEKA 1KOGA 2GB4A 1W94A 2REXB 3WLTA 2EFHB 4QYSA 4WN3A 3TW8A 4M0KA 4D02A 3HK2A 4KCGA 3RTGA 4RD3A 1YIDA 3G9UA 2EX1A 3HCAA 4Q15A 5CW1A 2V9CA 2HB6A 3E7FA 1BXRB 4KODA 2C2OA 4JUCA 4PC6A 4EY6A 2PX0A 3L0YA 3H4VA 4NECA 5JDCC 3VSDA 2F62A 1H2FA 3RSGA 1KI6A 5FHQA 1QBKC 2YZKA 3IAM1 4KYVA 3RVKA 4M1ZA 3K9BA 4ZZ3A 4DC9A 5CX1B 4M98A 1JECA 3DNPA 3ISTA 3OX1A 4MX8A 2EX4A 2LKCA 3TLJA 1KVRA 3ENNA 4KSBA 4XQGA 4ZYLA 1ECPA 3B51X 1M8GA 3D6VA 4B4WA 3VA7A 3G49A 4YCBA 3KKLA 1JR3E 2IH2A 5CA0A 4OHZA 2H7VA 4E31A 4EW6A 4JN6B 2AF3C 3KJFA 4TQ9A 2XE6A 3OUZA 3QMWA 5GJCA 3QUSA 4N5LA 1U7PA 2CE7A 5KINB 4B6OA 1GTG1 2OLJA 4FFSA 4LZWA 3LMKA 2C00A 1FEZA 1VL8A 3S44A 3VHQA 2BEVB 3OHPA 1WD5A 3DJYA 1FFSA 3C45A 3L1HA 3C7KA 4A8JB 3SVZA 4D26A 3H9QA 2QG6A 3A1VA 2QVLA 1FYFA 3AGPA 3KB6A 3MWJA 4LJKA 5A06A 5FA8A 1EE1A 3GP8A 3B9QA 2JC3A 4X6LA 2XWQA 1PQ4A 1Z2PX 1PFWA 3PUYA 2AZMA 4M0CA 3NC0C 3FTDA 4PYOA 2XRYA 4D99A 4EQ6B 1D5WA 3A9TA 4ZYTA 1SXJD 4GSYA 4NULA 1VKHA 1U2RA 2EKLA 2YHAA 3WLIA 1CZOA 1I80A 2X5OA 3Q85A 2QLNA 3ET5A 3R44A 4G4JA 3K6SA 2OV3A 4M46A 1OWMA 3OPNA 3S2ZA 2YCLA 4S05A 2JKZA 4DT1A 5K0LA 1UOPA 4YRIA 5DWVA 2E37A 1QRSA 2BF7A 3V4VB 3REGA 2WKPA 3AETA 1REQA 2W8BA 3HVIA 1AS2A 3O94A 2VQDA 3MWEA 3PNPA 5LXTB 1PWZA 4NAVA 4NONA 5BQFA 4IKPA 3SEAA 3ZE7A 3W6OA 1EVKA 1XTSA 1L4FA 2G1KA 4G0VA 5HIMA 2GAJA 3EAQA 4JI0B 2C3OA 5BUQA 3WKAA 1GNTA 3ADKA 4Q3DA 5ISMA 4S1NA 4CRWB 5CITA 5EZYB 9ABPA 2ZT5A 3OE5A 1MA0A 1TD1A 3TFQA 1UINA 1V9CA 3QF4A 2P30A 3QE0A 1NR5A 2D2XA 4R3UC 1N0HA 2Y6UA 2GD0A 4WXRA 1AKVA 4UBLA 4ZA2A 3BIJA 5DZSA 1Y7IA 1LD3A 3CVJA 3KYBA 3DKPA 4XVCA 4UUMA 1FP2A 3FSGD 3PD1A 4UFOA 4G4SO 1QIGA 2Q6VA 4X1YB 4GKJB 1IXZA 1ZHFA 3MBOA 1LI4A 4PY2A 4K3VA 2B83A 2XHZA 2OAGA 5IT0A 4IS3A 1IN5A 5ULLA 4ND8A 4R1SA 1Z4NA 1QG0A 2YN4A 1AY0A 1HZJA 2HO5A 2IUEA 2HQBA 3FD8A 4Y1RA 3CTPA 2XOKD 4RVGA 2WMNB 4UMEA 5ALDA 5HKKA 2ATCA 4IJVA 2EOAA 5FO0A 3A1UA 1S8FA 2XV1A 4IIEA 4C0AC 1FBTA 4F8YA 2BZ0A 4EB3A 5I7VA 1YS2X 1B8NA 4J3FA 2PS9A 2GCOB 4M1OA 1DP4A 4ZAXA 5LKAA 5GINE 5BVGA 1NX6A 1UOQA 3G3EA 4H4CA 4UM9D 4QM7A 1YIAA 5IPFA 1VG8A 4IIGA 5CIWA 2WZBA 4RHFA 5MDHA 2HIAA 3VNVA 2N3ZA 4YONB 4C04A 3IP1A 2AX3A 4DB4A 5K1ZA 3H42B 4PG4A 2VYFA 2BFOA 4MV4A 2DQYA 1LJ8A 4NCXA 4UHBA 5JS8A 2WEKA 4BY9E 3NG1A 3HM2A 1KR2A 2HWXA 4P4GA 4US2R 3R0QA 4BO0A 3HKBB 4A36A 5A7GA 2Q5HA 2VBGA 3IVCA 1ZW6A 3EVTA 4NOLA 1USKA 4Q9LA 1BNCA 3G89A 1HORA 4MIEA 4LG1A 3VZPA 1WVMA 5TC4A 1YR8A 2X9VA 1ZI8A 3F7NA 2G9RA 1QVWA 1Z2DA 4FJ1A 3GFFA 3N28A 4R5HA 4X8OA 3PQ7A 2D8MA 2B4RO 3UXYA 5E2AA 2IDMA 3NI2A 2JLWA 1J70A 1U6KA 2C7QA 1QK5A 2O2CA 4CIYA 3MGGA 6ADHA 1JJFA 1E5QA 2XKJE 1YR7A 2FPIB 3E81A 3L1VA 4MPPA 5F7XA 1VYTA 5DNCA 1NUTA 1D0VA 1WBBA 1BXZA 16PKA 2OQVA 3H5LA 2GJ9A 3PK0A 4LX8A 4Y6SA 1FFBA 5J9FA 2XCIA 3SM3A 4CR8A 2KWIA 3AZQA 3CONA 1K1EA 3MMZA 5ER6A 1YTUA 3EZXA 1TPZA 3R5JA 4JK3A 3CH5A 1CX9B 1YZTA 1YZFA 3QFHA 4M38A 4N7JA 4W9NC 2J4FA 4X85A 1GZ7A 3TNLA 5I8WA 2X6TA 4IDGA 4QYXA 4WZZA 4ZMBA 1S3FA 1H42A 3OJWA 5GOZA 1ONNA 3ICWA 3OIVA 3USES 2Z58A 4E2FA 3QBJA 5BSVA 5I4BA 2SHKA 3LU1A 2EHJA 4E09A 5AW3A 4WV3A 1TUBB 1PJAA 1Z0IA 3MRXA 4YY3B 4ZOEA 1LX7A 2X4LA 3EIFA 4HQNA 4JOQA 3V1NA 4QGSA 5EZSA 4EIWA 2BY4A 2HMYB 1UZMA 1U2EA 4M1WA 2XECA 2XUDA 5EFOA 1AE1A 4E0BA 7GPBA 5K4GA 1QORA 4QXMA 4Z7NB 2GHIA 3E5HA 3GZTB 4DABA 5HFJA 2RGYA 3K72B 1JEDA 1U0NA 1RPNA 4LXIA 1O0BA 4PGHA 1JIIA 2QMYA 4D57A 3H97A 2P9TA 3TAUA 2PGOA 5EWJB 1OTXA 3GRPA 2FZGA 3SF0A 5IUNC 4QATA 1ZM9A 2YN0A 2I62A 2WUDA 3WADA 3ORQA 4ZVSA 4DNQA 3LT4A 3L7DA 3KIPA 2VUTA 3IV9A 4HJXA 1IQ0A 4LS3A 5A4MS 3K09A 1ZMOA 1E2PA 3GEHA 3QFCA 1DBQA 1HDXA 3HDGA 3EMDA 3EDCA 4TV9A 5FEMA 3DVAA 1VL0A 4F60A 4RTQA 4IIXA 5ITZA 3SHQA 3K05A 3CUTA 2B6HA 3DV0A 1SQ6A 3AKZA 1R4MB 1J33A 5IH7A 2R4TA 5LWQA 3ASYA 4LC0A 1JJAA 4HDRA 4WY8A 3R74A 1FZQA 1VJ5A 3PFCA 5KYWB 2VK8A 5D3ZA 4XR4A 2FHPA 4MV5A 5TX7A 5J40A 4ACAA 2PX4A 5B57C 2HW8A 1E5XA 2VCHA 3DQPA 4KQWA 1JDPA 1NI5A 1ZH8A 4JC0A 4FR0A 4MS3B 1UBRS 3GLFA 1TVCA 2HA0A 3SAJA 1OX4B 4WTOA 3M3DA 5SZHB 3HZHA 3BZWA 1XA4A 3X1MA 3HEBA 5KNCD 3F74A 1Q20A 2ZFUA 2PWZA 3DUWA 1I7QB 4EA9A 4AJ9A 1A7AA 1JEOA 4HZUB 4YQYA 2BTOA 1DAHA 3IPXA 3N0TA 2JGIA 2R751 3QYJA 1IPHA 4IHKA 4ZK6A 3G6KA 2ZBVA 4KITB 1CE8A 1LS6A 1BQEA 4D80A 4W7SA 5KS2A 1KP9A 2NYUA 3A14A 1XFAA 2N1BA 3IDSA 1P7VA 3CRMA 3P9SA 4P4NA 5HIIA 3ZGYA 4ZIRA 3ILYA 5F77A 4I1YA 1GLVA 1JDBB 1DAOA 1Q5PA 1WLYA 2BFCB 2ASVA 2NU7A 5K3FA 3UXEA 2YFKA 3VYUB 5JMOA 2IGTA 2Y9MB 2A9KA 3JVIA 4GR5A 2DMRA 3M6WA 2FEMA 4GLFA 3C48A 4PFJA 4BNZA 4RNCA 2H57A 3OVMA 2WU4A 3T3NA 3NBZC 1QIEA 2EZ8A 4KZKA 4CTKA 3DB2A 4R3NA 1MNQA 1NVBA 4K1XA 3WK7A 3DHVA 2CHFA 4WNAB 1PT8A 5JFGA 1JL3A 4GAEA 4URWR 1PZHA 3LE8A 4S1VA 5IMBA 4QJ3A 3OT4A 2EERA 2PWAA 1OGIA 2RK6A 2WB4A 1CHNA 2IV7A 3TW4A 4ESOA 1DO2A 1UWVA 1G7SA 2GEFA 4KOEC 3EPPA 4W5NA 3PC8A 4I6JA 1QGUB 3F6SA 5AKZA 4BNXA 3JATB 2FJUA 4JWKA 5IKEA 4B4OA 3PNYA 2NTVA 9LDTA 2CMHA 1O9GA 1TTTA 1L5WA 4ZQHA 5L9AA 4EK9A 4UAUA 1Z13A 2XE7A 5IT4A 3U3DA 3WP1B 3W5AA 3I2YX 2GR9A 5TGTA 2IX3A 4CHGA 3QV2A 3DBHA 2QUIA 3WK8A 3KCNA 2QRHA 2R97A 4DLPA 3NOXA 4G67A 5H80A 2EL7A 5BW8A 1IY9A 3RVPA 1RXYA 1YL6A 4NCBA 2PUEA 2ZJ2A 3QQ5A 1P7WA 1KAOA 3OG9A 2IS2A 3B9BA 2IP4A 3KVYA 3M83A 1ZD8A 2H48A 3PKJA 1O87A 1WXEA 1JG2A 1WXQA 4IFBA 1CUDA 3IOBA 1KYWA 2C31A 2H0RA 2AJCA 3DOIA 3QI7A 2H8GA 2C97A 4JB3A 1Y5RA 1A9RA 1R2QA 4D43A 1LV7A 3OIWA 3O9VA 2QRLA 5JSZB 2GJ4A 1A9PA 1NC1A 3TD6A 1NV9A 4KWTA 3MAJA 1TIBA 3NHRA 4A0FA 3K0CA 4REOA 2OB2A 2IYUA 1NW7A 2PMKA 2YHIB 2IC5A 1GQQA 2A9JA 2V03A 2XAAA 4MPJA 4CF4A 1GAXA 3QX3A 2J3JA 1LWOA 4B34A 2Z4TA 3GNLA 1ULUA 5E38A 4DBZA 4NX2A 5AUQA 1A5TA 2DG2A 4KNWA 4P4SB 3K2EA 4PU0A 3SC2A 4D9NA 2V7UA 5JJCA 5ERYA 3COJA 4IMPA 2ZUCA 3UEOA 2N47A 4JNCA 4YDSA 4E07A 4B3IA 1M10A 1SBZA 2QGZA 2YY7A 2R00A 2XHEA 4C4XA 2AJ8A 4FGZA 2UUCB 3IP5A 2PZJA 1DWQA 3FIJA 1TCAA 4FOPA 5D7BA 4IQGA 4YCDA 5LMZA 4FT4A 2FWRA 1QFJA 5A0TA 5BMVA 4H3VA 4PVDA 4WZAA 5K8LA 3OWXA 4OUDB 2IITA 4OUKX 3AEUB 4DDMA 1NASA 2WG2A 4HDCA 3WDLA 1JHZA 3G0OA 1K7SN 3AF6A 1U5AA 1VJTA 3MTJA 2ID4A 1CUIA 1YXMA 5NULA 1PF7E 1W4BA 2P9GA 3PLNA 1TA0A 4JFRA 1IWBB 4M88A 4R1NA 3SMVA 1ZW1A 3AXTA 3LPCA 3UQYS 4E5PA 5C7OO 1XVLA 4XWWA 2Y6VA 3RS8A 1CJMA 1V16B 3BMNA 3GEDA 4ZT6A 3ZWYA 3OAAD 3HN2A 5KNCA 1ZC4A 2G9UA 2JH9A 1EGMB 5H0IA 3RAGA 3UK7A 1WABA 1DJNA 2MU1A 1VZ3A 1JI0A 3CE9A 5BV7A 1DEXA 3SIRA 5CXQA 3PXAA 3NEPX 2OFWA 4GWLA 2I91A 3TOSA 1CUYA 3EC1A 3L4SO 4OK5A 4XDGA 1J2YA 4B35A 4EG8A 4YXWA 2VT6A 5DH9A 5CB8A 4OGKA 1KY2A 2XX3A 3WBBA 4AJEA 4PX5A 4S35A 1Y33E 2WIKA 2WG1A 3ZZ0A 4QJ4A 4LHWA 4XD7D 2GARA 4C4ZA 1KEEA 4HADA 3PC8C 5ALYA 3DZGA 1GYRA 2WTUA 2B0JA 3ICCA 3TNFA 1CJVC 2HA3A 1W36B 2Z6QA 1YCDA 1YBFA 1TM7E 3IBYA 2NSYA 1MX1A 2JLSA 4KAFA 4BGIA 3WLMA 5IKXA 1VBFA 4RHXA 2PH1A 1W5FA 2LXNA 2Q1UA 3ZKWB 5C81A 2OC9A 2QUHA 3K9FC 1K8XB 3DDSA 5JMPA 4F4FA 4WZAB 3SQMA 4OFBA 2R8ZA 4EO7A 4JXKA 2R8RA 4DBLC 1Z9BA 1QFSA 2ZRKA 1G2IA 5H1YA 4W5QA 1Z33A 1LF5A 4L28A 5FBKA 3I0ZA 2C3PA 4QM6A 1NY6A 5ES4B 2ZETA 3GAAA 4F71A 4MGEA 8ATCA 1EP1B 2BSAA 5EWLB 3F8WA 3B89A 3P0IA 5EUBA 2ZWAA 4FYXA 3TW0A 2GEBA 2B94A 3DKRA 3FUVA 3M5DA 4RVNA 3EGCA 3NATA 1HTTA 1ZGHA 3F5MA 3HRKA 4D9JA 1EGVB 3RSCA 2W0SA 5LA6F 3WXBA 5LP6F 2HJ9A 2Y1WA 3A4VA 4NK4A 3EBLA 4W9MC 3G88A 4N12A 3NTLA 4OQNA 4X63A 4GXRA 3NTQA 2BHRA 2CHEA 2CKDA 2DC1A 4J03A 4Z6KA 2N46A 4BTVA 3U1BA 3U6BA 5KYYB 1A71A 1RFGE 1XO1A 2HHLA 4QAQA 1IRXA 2XYHA 4UVDA 3IHLA 1T6NA 2OFXA 3PQFA 3QWHA 2Q5QA 3MF4A 1W5TA 1P39A 4S24A 1AJEA 2J9FA 4EF6A 3RUFA 4GNRA 2PX5A 3A4TA 2Y1XA 4DCSA 3C6BA 1VCIA 2WYOA 2YWEA 4EG4A 5DTEA 4JITA 4X91A 1C30A 4KHPB 1S2GA 1Y8QA 4X61A 4DAOA 2QPAA 3ZBPA 3TRJA 3A10A 2P9EA 1OIWA 1AH2A 1DC8A 4CM1A 2XGMA 4UKDA 1PHPA 3QVWA 4FUTA 1AS3A 1EDEA 2YH2A 4CV2A 1CK4A 2WFLB 4MUIA 2IHUA 3DDCA 4RZQA 1X8KA 2JJ1D 2V7TA 3CGGA 2WAYA 3H5TA 5HMMA 3UWMA 7YASA 3K31A 1GITA 3HHEA 3MMSA 2GLTA 3JPWA 3W3AH 4LZAA 4Q4JA 1IMJA 2FEKA 3ZW8A 4DT1B 3QMVA 4IS2A 2CGEA 4WLEA 5JQGA 1KY3A 3D3QA 4IKOA 4PCUA 3WB9A 3I45A 5FDFA 4Q3EA 4UUAA 3GJ6A 3RBXA 2QAGC 3P0RA 2EEZA 1O0SA 5IG2A 4EPVA 5EHXA 2IOFK 3B1XA 4MQFB 4C87A 1YA4A 2VEOA 3L01A 1BQ3A 1CDOA 1YE3A 3BULA 4JYCA 4ND4A 1SB8A 2ZE7A 4F2WA 1GUZA 4DIEA 5T3UA 2PH3A 2CXTA 2Z1DA 2ZR0A 1ZEMA 1J0AA 4ND7A 3SZLA 2AXQA 4NZ9A 3AJ8A 4F12A 1ZD4A 3HDTA 4YP9A 2VCYA 3CT6A 3DLCA 3PTZA 2G0NA 4NZMA 3L0SA 1DQPA 3E3AA 3K9LA 2GBLA 2IZ1A 4BQNA 5INTA 3EGXB 3HKCA 5JS6A 3F46A 3DP9A 4GQBA 4BMPB 3I1YA 1S8NA 5IKMA 4J43A 2NSJA 2MINA 4R0NA 5K3SA 1DC4A 2WC1A 3CLRC 3ZHRA 4BL5A 2X6QA 1LDBA 2JI8A 2Z1NA 2G0TA 3MA0A 3NBKA 1QS0B 4G4GA 1OHHA 4OYHA 4OKIA 3CE6A 1ZOPA 3GN2A 4PE5B 5AVTA 5JV5A 1SWVA 5DNAA 1VYVA 2YWRA 2CHVA 4ZMRA 1MJGA 2JZOA 1JBQA 3OQPA 1I3MA 5T6BA 4MJLA 5ELMA 4JI7B 1XU9A 3OETA 4EFDA 1RAEA 1B00A 4DSAA 5MGNA 5F23A 1C8KA 2B34A 2CLIB 5JAHA 5A1JA 4W5TA 1DEHA 3EW7A 1RJDA 1X19A 1G3RA 1NLUA 4Z86A 2QQEA 3B85A 1EVJA 5B1YA 3VDMA 1SKUA 3PSAA 2X76A 2VT2A 3DYIA 3NAGA 4LPKA 1Y6FA 5BN4A 2AZDA 2BFDB 5JG7A 3PZRA 3U62A 5I5GA 1TKRA 4DLTA 5EUQB 1C3VA 3CQ9A 4G1CA 1IM5A 1L7DA 4OK3A 3F3MA 3SCZA 3PGKA 4MW6A 1G60A 1HFKA 1NONA 2C04A 2YY6A 3AOEC 3HCCA 4MARA 4YFYA 5FPQA 4PSKA 3OZWA 4AO7A 2O8FA 1PVVA 1ISMA 1OYVA 1NZJA 4MA0A 3FI9A 4YP1A 2PTHA 3F9IA 2G25A 1D03A 2ZYTX 3A4YA 2PGDA 3PS9A 2VJKA 3F6EX 2WQ6A 5KNLA 3COYA 3QVXA 1ENZA 4OQMA 2OT3B 1DINA 1U5BA 2BFPA 4RHUA 4RIFA 1G5FA 1Q22A 4CMEC 4A8JC 5C46F 4ZCRA 1UMBA 3RHSA 3AHEA 3HUDA 2WJAA 3OFJA 3WL4A 3RRFA 4H31A 1C0PA 1QOPB 2JH8A 3K32A 4NFLA 5IDWA 1HYHA 3QHPA 5KDOA 3ZE0B 4DIOA 2OA0A 4DAEA 1E77A 4IV0A 5MHTA 1UXHA 2FWPA 1XBTA 1TCCA 4M9XA 4QLAA 3GL9A 4UNPA 2WP8J 3D7SA 5KTNA 3O75A 1RI2A 1T3LA 2REOA 3B3AA 1E2UA 3H4TA 1RS0A 1XROA 2B8WA 2XIJA 3DAGA 3JYPA 4FDMA 1K4MA 1NVFA 5CDGA 1Z06A 1XJ5A 5HBGA 4IZ6A 5IK2A 1IHOA 3HB7A 3LT5A 2JEYA 5KTYA 1BEEA 1PT5A 4RXTA 1H65A 2R25B 5CYPA 1X2BA 3F6YA 3NYRA 4MI6A 4JL6A 1G5RA 2HGZA 1OT3A 4IGFA 1PR4A 3FTCA 4RO0A 1TYAE 2IWHA 5K4AA 3MS2A 1IZ7A 4FMCB 5G40A 1C2YA 1X7WB 1BYIA 1LDNA 1YZVA 2IPNA 3EWNA 3NIGB 3RT7A 5B4VA 3FOEC 4N18A 2ZPUA 4V03A 5E8RA 4RJLA 3IT3A 3CLVA 5TPWB 4AWXA 3EVEA 4DPMA 1AKQA 3CB4A 2IA5A 3THWA 1Q6ZA 2BJWA 2F3QA 3HB9A 4CF7A 4TS4A 1HDIA 2HMUA 4LY9A 2FSUA 2JLXA 4TPKA 2GNAA 4XJXA 3RFVA 2OENG 4G8BA 3H13A 4L22A 2WWXA 5BOSA 3WR5A 3EGWA 4LF6B 2NZVG 2Q46A 3P32A 3I37X 4HAYA 1E1KA 1KRHA 2F90A 1DZ3A 5F2EA 4ETMA 1RZRA 4FYWA 2J48A 4B3TB 4R2XA 2W6CX 2XUKA 3AM5A 1B0ZA 1BVYF 4TLLB 4JBWA 1U99A 4JAVC 1XDGA 2YW2A 1PJQA 5BSMA 3VHRA 2W48A 1M83A 3P52A 3M82A 4TKZA 4Z7QB 5KJ6A 4HRVA 3EWSA 4D4IA 4Y18A 5IP5A 1VQ1A 3SEQA 3WL5A 3BM5A 2I9PA 1BD4A 4E03A 1ZXLA 3R5XA 4RM2A 3LECA 4L95C 2VDKB 5ELXA 1YUBA 1HX7A 1VRVA 3N8NA 1UANA 4JP5A 1E3EA 4XIIA 1TYCA 2XT9A 3NDBB 2QW0X 4GXNA 1SH7A 1S0UA 3L7YA 2ERYA 2V3WA 2ALJA 3DCIA 3ZIAD 3SSAA 1EAMA 2VQEB 2F8SA 3PFIA 4C3ZA 1ZD3A 1Z6QA 3ANSA 3CPEA 2D0IA 2CSUA 3D4BA 1JLRA 1ZQ9A 1VI2A 1EQUA 2QTMA 2WNSA 2B5WA 3A6KA 3THSA 4CFSA 4L3OA 4JI1B 5IF9A 4Y8VA 2X40A 4FM9A 4LBWA 2DR3A 2IY8A 1PFKA 2ZAIA 2AWNA 2Q0XA 4N1AA 2C2MA 4JR0A 3WISA 1RMYA 1LBTA 1BU5A 1X15A 1T3GA 2CLOB 2FSIA 2G0AA 4TLBA 2IBSA 2XWPA 1P6UA 1NFRA 2MYTA 3D4LA 2G67A 1Z2AA 3MBKA 3R5KA 4U2DA 4AKTA 1TC1A 5L7TA 1JPVA 4LTNA 2OQ2A 1CDZA 4GL4A 1TM1E 1Z5ZA 4IMJB 5FWYA 1XF1A 1L6IA 1QAQA 1K8YB 2Q6IA 1M8KA 4UNQA 4G97A 4L2IA 4BO2A 4BZPA 4FMPA 2C07A 3I28A 4ADSG 1WD7A 2P35A 1U7ZA 3UQZA 1GZ5A 2YJ4A 4I5GA 1IM2A 1JIQA 3VV2A 4FOOA 3ZBUA 1V7ZA 2GGSA 1EFKA 1Z8FA 1GT6A 4C3OB 5EE5B 1XNRB 1O58A 1T36B 1UFOA 2XTZA 4HRAA 4ARIA 3N2EA 4QJIA 1R6XA 2C94A 1VRWA 2CKMA 3CSUA 5JTUA 4CIAA 3DE0X 3UC5A 4B8ZA 4PONA 2A88A 2BBSA 3PX2A 1FSZA 2ODTX 2HX1A 4OHYA 1LPPA 5EQJB 4NNJA 4LXQA 2DPXA 4EYQA 4YRFA 3JAKA 1OREA 2QRUA 4NTZA 4LF8B 3DFFA 1J6UA 2QROA 1N9GA 1O5TA 2ZQ5A 1U0FA 4LRWA 1KERA 3MJRA 3TEMA 2VPTA 4CT5A 2QN8A 2PNFA 2OK8A 2Z5GA 1HE2A 1U7TA 2JDIA 1JQJC 4HNVA 2AUTA 1XQYA 2P40A 3OEEA 4BP8A 3KOXA 2FZCA 1TTPB 1ESEA 2CUZA 5KNBD 2OD7A 3IELA 4MKFA 1U98A 2ZCJA 1ZL0A 4L6IA 1GKYA 2XRMA 3FJOA 3OZEA 4GI5A 3D3NA 4FKBA 4URFA 5A3QA 1ORDA 4FWBA 3U5TA 2O3RA 1FDWA 1IAQA 3TIXB 3PT5A 4PSDA 5BUSA 4P80A 2XB8A 5KCZA 1C0LA 1OFUX 1OBHA 1QZUA 1T6XA 2H59A 2N0SA 2YZMA 2ZTHA 3DBLA 3E3OA 3PUIA 5AWFC 2QJOA 5DBOA 1KFJB 3KALA 2I22A 1NQ5A 1KOJA 1MH9A 2OZPA 1C0IA 4CKCB 3CWCA 1PKXA 4N3CA 1KAHA 2XXAA 5TLSA 3EVFA 3LCJA 5M5BA 3MJ4A 3BRCA 1T9HA 1Q0UA 5EMKA 5JXWA 1KWKA 4UHJA 2B1GA 2XY4A 1JZQA 3PR2B 3NVAA 1P1IA 3OSUA 4QUEA 2PUAA 3LRPA 1WETA 4YMWA 3S2SA 4KVGA 5KAMA 4FN4A 5IYZB 3OQMA 4DARA 1OYWA 4WZ6A 2BFEB 3H2KA 1P1RA 3T61A 2O8CB 2RJNA 3EMVA 4LXGA 2WFMA 3VH4A 1X7ZB 4PGFA 4R9NA 4BECA 4HS9A 5C7LO 2HRDA 2J9GA 1J00A 3ACDA 1UZUA 2RKOA 3B82A 4IH4A 1HQYE 2UZ4A 3DZBA 1PL8A 3GFBA 3FN4A 1S7CA 2WPDA 2I5PO 3U16A 1VE9A 3I9KA 4XB2A 2EG9A 3GFQA 4EO4A 3X1JA 4JJAA 2J08A 1MMFB 1ISHA 4GHWA 4C6TB 3U09A 2XCSB 1ISGA 3RR2A 2ECKA 4EUEA 3RC8A 3ROQA 1KI7A 5LQRA 1OLXB 5JCPA 5A0VA 1V96A 2XJ9A 1ZICA 5JRJA 1ZGZA 3GUCA 2HY7A 3LPNA 1GDHA 2FH5B 1EIZA 2DT5A 3K16A 4G0NA 5JXHA 2EIHA 2H4ZA 2I6GA 2A0XA 1H2XA 3PFKA 2DQ4A 7MHTA 2J3LA 1FTQA 4KAAA 1TIPA 2OP1A 2PR7A 1J0DA 1EP3B 4HF7A 3IUSA 4I8XA 3CEJA 1NUUA 3L41A 3FYUB 3GVHA 3UT0A 3WDSA 4Z1MA 4TSFA 4MVJF 3GA0A 4JUBA 4R0MA 1LDGA 4Y9RA 3OECA 4UAVA 1SUBA 4EY8A 3NONA 1AOXA 1GRQA 1VYHA 4UQPA 4FGLA 3ZJUA 3Q3EA 2GTPA 1IG3A 1K6EA 2HJVA 3LNCA 4B2YA 5JY1A 3C3CA 1RM0A 3R0XA 1XMIA 1K88A 1X14A 2PRIA 4L27A 4QQFA 3R77A 3QTLA 1P61B 2EV9A 2FQYA 2PN1A 2WMOB 4FGUA 5HJ5A 4QTTB 2BMEA 2NQ2C 4Z4GA 1IN1A 4XFKA 3DB1A 5CLFA 1E3WA 1VJRA 5EJ4A 3D9QX 3HY4A 1J5PA 2QNIA 2NAFA 1O6CA 4J6FA 4ZT5A 2Y0EA 1P45A 1PKEA 5A5FA 2B1JA 3ZBQA 1CZLA 2D2VA 1BYUA 4YMSA 5GOTA 2QXYA 5KQPA 1DADA 1ZJJA 3NOVA 3OP1A 1B23P 1RW4A 3KEOA 1RHMA 1B93A 4PNPA 1UQTA 4F8EA 2ZTLA 3GUYA 5FL7A 4BO6A 5FAXA 3CXUA 4XQ9A 2PMFA 4LHVA 1EJ2A 2XYGA 3K9GA 5G0WA 1E9DA 3D81A 2EWVA 4GOLD 3VAZA 2IXTA 3LX4A 3CBGA 3LP6A 4JEUA 1Y9JA 3V1TC 1LTHR 2IKQA 4HN2A 4EJ6A 3PFGA 2R8XA 4RW0A 2IK8A 1TVKA 1RRPA 1V3QE 2QLMA 2VP3A 2IZOA 4FKZA 4MHSA 4AS2A 4LBZA 2JCBA 3OEYA 4GLLA 4YBRA 2GM9A 3ZDBA 5C32A 1RI3A 4CT4B 4NZYA 3R0ZA 4KYTA 5BQOA 3QNWA 4PZAA 4MB0A 4BKRA 1XPOA 2VAVA 3FDZA 4LCEA 3WK4A 4E12A 1N25A 4G1MB 2C4NA 1E1QA 4UUPA 4DMHA 5A1TA 1BDHA 2QTFA 1DTWA 4BDSA 5FL7D 5SICE 3WNVA 2C88A 2Z9BA 121PA 1WMBA 3N0WA 1ZJZA 3V7YA 3H4IA 1T8PA 1XZ8A 4Z99A 5JDIC 1KY5A 1NW3A 3LLUA 3FNRA 4P0QB 2NUBA 2CVQA 2XCQA 2AUNA 3NCHA 3OPYB 4D9IA 4IIJA 1JSCA 3QHQA 3RH0A 1P1HA 1Q21A 2P4UA 1G5PA 4DXHA 2C82A 4F4IA 3ZG6A 3MOGA 3T7EA 1HE5A 1EUDB 1U0GA 5DSTA 4PS1A 4PG6A 3BRWA 3CH6A 1XR3A 4WI1A 5J47A 2C83A 5JS7A 3NBXX 3TI9A 4KDCA 4JR2A 4AFNA 3TLAA 4D9HA 3JASA 4GI1A 3PQ4A 3T8YA 3LUPA 2PVCA 1OXBB 1ODKA 4AKGA 3P9ZA 4Q47A 1NPTO 1PR6A 3LGSA 1JSZA 3O4HA 4MVXA 4DDWA 2VDJA 4NDNE 1E9SA 4Z9AA 2FK8A 4KO4S 5KTTA 1BMQA 2ZYUX 2ZB2A 3E7WA 3ITEA 5FOQA 1D0IA 3LHFA 4N3NA 2VJMA 4QDUA 1ESMA 2I4RA 4YAUA 5FI0B 4HGOA 4LOHA 3EQ2A 3K4PA 5JRZA 3S8YA 4KR9A 1NDHA 3P9IA 2XNCA 2R44A 3IS3A 2VZLA 4K2AA 5L3VA 2P69A 3FFXA 4JEMA 4MCHA 2YICA 1SM4A 1FVOA 1CRLA 2H4YA 3PWTA 2ZZMA 1X1DA 2FPIA 2ZB3A 3CNOA 2QXUA 4OA8A 3TLGB 1E2LA 3LUCA 3EWIA 1ZGCA 3EDQA 1AGNA 1JDJA 5B1SA 4E51A 2B37A 2ZE5A 1AURA 2I8AA 3MPOA 5B3KA 4AYWA 1GL7A 3A4NA 5ALJA 3CRZA 3GX1A 4OI0A 5AI9A 3Q1KA 4N9QA 1M3SA 2V6GA 4TWAA 4UZSA 5TPZA 1F2UB 3AG5A 4Q02A 3TNJA 1GKIA 2YIJA 3L4EA 2WMDA 1TTQB 2EFEB 2B2NA 3LF2A 1I1OA 5K3OA 4BFLA 3RKRA 2R11A 4YHBA 4WASA 1PJ2A 5LP6B 3KXIA 3A3YA 3CB2A 3F49S 2VXBA 1CY2A 2UVDA 3COSA 3QEJA 3E5NA 4CIWA 1TW3A 4QPDA 4E11A 1USGA 1C3EA 2HDWA 1C3OA 5KNBH 4K28A 4CR6A 1WOMA 4OP2A 4B31A 1UPCA 3ZDRA 1A9QA 3N05A 2DHQA 1W52X 4FNGA 1KSGA 3GJ8A 5ARDA 3K9HA 2OORC 1BS1A 1Y4UA 5MFPA 1N3BA 4I1RA 4YUZA 1JB9A 1P4JA 2ZK7A 3A4MA 4KXWA 4ODIA 4ZEOA 1QIMA 4KDRA 1KVTA 4QTYA 3FW1A 2Q9AA 5FA6A 1V26A 2ZR7A 1ONPA 1OXSC 4N9WA 2GH1A 3RBAA 4CBVA 2PBRA 5JAIA 4W8HA 1AU9A 3M4ZA 2ZQZA 2RARA 1KORA 1KJQA 3K5HA 4YO8A 3RSSA 3EA5A 1IUNA 3V9PA 1P1BA 3OEHA 1PO7A 4TZ0A 3ENQA 3PITA 1ZESA 1DTEA 4X6YA 5B3JA 4FINA 1A9YA 1R6TA 3LO8A 1W4AA 3L0BA 1FLNA 2DUWA 2XVXA 1ADBA 3FKSD 5DW0A 3HN6A 5IKOA 1K3FA 2Q1SA 4PTZA 1FFYA 4L78A 1D2HA 2HCBA 4EMBA 5JS2A 1VB5A 1G7TA 1RRGA 4J91A 4D0GA 2B8TA 3ENZA 3W2EA 4BVHA 2QUZA 3UVEA 4F96A 2ZT7A 3RJ9A 3RVNA 1NJ1A 3BREA 2BFBB 3IILA 4GR4A 4UOQA 3NAZA 5KPDA 4OHMA 5FPYA 3HSYA 1X1QA 1IY1A 1V3UA 1WZUA 2GHTA 3N7UA 3PRJA 2VQ3A 3KSZO 4X54A 1NAIA 2EX0A 4JQOA 5KZMB 3OIUA 5CPFA 4FTWA 1R6AA 4QQNA 5AVUA 5LJLA 4WK4B 3R7BA 3M6FA 1R3UA 3SBDA 5AUPB 3VKFA 1M7HA 2J3QA 5E9QA 4HAUA 4QARA 1K0UA 3SHFA 1RT9A 3JARA 3QYFA 3JW8A 4AXXA 3PF8A 5G3ZA 1WUYA 3VR6D 4EOGA 4FEYA 3WWZA 3D6FA 5BURA 2B20A 4LWZA 3KBBA 1W5EA 3I1FA 3A37A 4DXDA 4DV4B 3O3MB 5E9JA 2ZS7A 5G0UA 2PM8A 1QHHB 2O59A 4D8WA 1TZCA 4ZALA 4B2LA 3DGFC 3NB0A 3LWNA 3ESXA 1P72A 1UJNA 2VAWA 2BFWA 3KB2A 2ZRLA 3AEXA 3DH0A 4P7GA 1DDIA 2H08A 3JZIA 2G1UA 4IOMA 1Z2CA 4RZ3A 3VVCA 3ZCXA 5ILOA 4ZI2A 1WZNA 1QYXA 3BIOA 3DBLB