3TRIA

Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
272
Chain Sequence
NTSNITFIGGGNMARNIVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTEQAIKVLESGNLRELFIKALTAAVNRAKELSKTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pyrroline-5-carboxylate reductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 98
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 3triA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3triA01
3FD8A 3U4IA 1PGOA 2B83A 1GDHA 3QSGA 4YRBA 4Z9FA 5JFOA 1ENZA 1Z45A 3GGPA 1ZMOA 3KYBA 2X58A 4CLRA 3BZUA 3U0BA 3WOHA 2OMEA 3UF0A 1U5CA 3W1VA 1PTJA 1Q0QA 1JW9B 2NM0A 3FR7A 3MJ4A 2BELA 4C7KA 3F1KA 3K6JA 2DKNA 1LDEA 2EERA 2X9GA 3ZN2A 4NNJA 4F45A 4FFPA 4IMPA 1CF2O 4HNHA 2V6GA 1MLDA 5TLSA 3ZHBA 3DEYX 3GHHA 1P1KA 3GMDA 6ADHA 1GPDG 1MUUA 4R16A 5IG2A 1ZK1A 3IC5A 3MCVA 2Q2QA 3NEPX 4FFLA 2HMVA 1ADFA 5K0ZA 4II2A 3CUKA 3O03A 4XIYA 1C1XB 4XDYA 1EVJA 3NDRA 4IUYA 4PZDA 3DAFA 4KOAA 3ON5A 1PWXA 4HFRA 4RV9A 1FF9A 1I2ZA 3TRIA 2DTXA 4GL4A 3LYLA 2CSUA 3CMMA 3PK0A 2D5AA 1K6JA 2EGHA 1GADO 1IE3A 1Z6ZA 2CMDA 8ADHA 4XIJA 1DHRA 1QP8A 1YE3A 4J4TA 3WGOA 4MIEA 2B35A 3MTGA 3TSCA 2HMSA 3HJAA 4WLFA 1DIAA 5F1PA 4RZIA 4UVGA 3FHLA 5KIAA 2OBYA 1RWBA 2P4HX 3EW7A 1LX6A 1PJSA 4GX5A 4Q9NA 1PS8A 2EKPA 3Q2KA 1LLQA 3SJ7A 3RKRA 4MPDA 1U5AA 4B4OA 1IOLA 5CPFA 3WSVA 3ITKA 4WK6A 2VOEA 5F1KA 3WICA 4N5NA 4EI2A 3I9NA 5A03A 4LISA 3WIDA 1PJQA 5A9RA 1BTOA 2HK9A 3QP9A 5B37A 1GFSA 1P3DA 1SMKA 2DU8A 3ADPA 3KV3O 2C5EA 2E37A 3FNFA 4IGFA 5G0UA 3PFWO 4OGWA 1BW9B 1GQYA 1MA0A 3U4DA 1UZMA 3KYDA 4MKZA 3H4VA 4FPXA 3M1AA 3LC2O 4D79A 4ID9A 2JL1A 4XDZA 5K6AA 3I4FA 4ND2A 2OHXA 1ISHA 5A5EA 1WAMA 4Y67A 4I9HA 3ZDFA 3R1IA 5GZ1A 1OC4A 3QWIA 4L75A 3L4BA 1FK8A 4WLUA 1ZSYA 5THQA 4AJ1A 4BNLA 1YB1A 3PHHA 3DTTA 3ZU5A 3A28A 2VHZA 1LC3A 4CM8A 3LF1A 4JX8A 2JCXA 3NRCA 3L9WA 4FW8A 3TL2A 2VNAA 1D1SA 5TNXA 3I23A 3QWAA 4WKGA 3GDGA 4XQEA 4QUKA 3Q2IA 3ZWCA 4DLBA 2O3TA 1HF3A 2QRJA 3JYQA 4JBIA 5I7EA 4DRYA 3I9MA 4LVCA 3TOZA 4ZHSA 4FJ1A 4DYDA 1UR5A 4IQ0A 3WBBA 5I7VA 4QX6A 1A4IA 1DIRA 4M87A 3Q3CA 1Q0LA 4WEOA 1T2CA 4K6CA 4DPKA 1KC1A 4XQ9A 1LQUA 4NMHA 2BMAA 1Y81A 2JD2A 4L4RA 1SOWA 4TVBA 3RUFA 3NJ8A 1HZZA 2BH9A 3P5SA 2GZ3A 3D5QA 3PJGA 2Y66A 3BMQA 2X86A 1UZLA 1N9GA 5CDGA 4WPGA 3L0DA 1E1MA 3BTOA 4I5GA 2UUPA 2DFVA 5F5LA 3C3XA 5EQFA 5CEFA 3NTOA 4URFA 1KY4A 5A05A 2PZKA 3FWNA 4BVAA 1P1HA 1EQ2A 1UUFA 3RQSA 3ZWXA 1H9BA 4WCFB 4DBZA 1ORRA 1UXJA 1WMBA 2VHVA 4RVHA 2OFPA 4W82A 1M6WA 2OBNA 2GR9A 1SNYA 2NVWA 4HXYA 3WGZA 1FDSA 5A3VA 4MVJI 3GUYA 2WDZA 3TNLA 4U8GA 3OQ6A 3WYEA 1I32A 4MP6A 4DC1A 4FC6A 2VHWA 3OJLA 1PS0A 4TKMA 3K2EA 3O4RA 2DC1A 2C2XA 3P7MA 3PQEA 3SX2A 1OMOA 1DOHA 4J49A 2YHUA 1VLLA 1X14A 2G5CA 4IIVA 1EVZA 4CQMD 2PV7A 3TN7A 4RVDA 1LEHA 1FMCA 2I6TA 3I6QA 4A73A 4LCEA 3KSZO 1EZ4A 3DMTC 4DQUA 4PVCA 1ZKMA 4D45A 1BMDA 5KJ1A 2NQ8A 1UXHA 5DCUA 4GAEA 1P0FA 3HZZA 1XA0A 4E5MA 3RUEA 1Y8QA 1KERA 4YAKA 2AG8A 2HDHA 4E6PA 3F4BA 4BIIA 3I83A 4J3FA 4CMGA 1RYDA 4OXKA 4YWJA 1HSZA 1T1RA 3HUDA 2UUOA 3JQAD 4D44A 4FIZA 2EXXA 3W4IA 1YS4A 1I30A 3I9JA 2I99A 2WM3A 1ZXBA 4E4YA 1VI2A 2FRDA 3QHAA 3VKUA 4CV0A 4TVOA 3ZHYA 3OQBA 3WGGA 3WB9A 4XYLA 1JKFA 1DXYA 1K6XA 5DN9A 4EUEA 1X15A 1DRVA 3FTPA 2NADA 4LN1A 3LLVA 2FY8A 3VZRA 1O95A 5DOVA 1MGOA 4FOSA 4CM3A 1Y5RA 2Y93A 1PR3A 4U7WA 1BXZA 3DBVO 1A27A 2ZCUA 3U62A 3QVXA 2EJWA 4E12A 3JQEA 1GCOA 4YAEA 4TSKA 2BGLA 3EYWA 3DC2A 2Q50A 1JDJA 1A71A 2NU6A 4K28A 4DUPA 4WOJA 3OEWA 3WXBA 2VHXA 4OM8A 3TZCA 1GYPA 4L74A 2AG5A 1T1SA 3G1TA 4GX0A 1ZZEA 4Q3NA 2GLXA 2I66A 3GEGA 1OZAA 3MJTA 4ZN6A 3ONDA 1L7EA 2SCUA 1CJCA 1EFLA 4CMEA 5AQ1A 4XCVA 1KOLA 1KVTA 5HA5A 1QYDA 4LGVA 5TS3A 4I9UA 1SBYA 4ALMA 1O0SA 2JFFA 3GG9A 1LDYA 4J7CA 3PI7A 5I9MA 2PA3A 2E82A 3HG7A 3TZ6A 2ZJ0A 1D1TA 3JQ9A 2YDXA 1E1NA 1S7CA 1PR9A 4JP3A 4Z6KA 1I8TA 2DPHA 1LQTA 5ITWA 5BSEA 1QR6A 1IUKA 5BNFA 3O8QA 1NYTA 4RPHA 4YT5A 3LF2A 5L95A 3IS3A 2C54A 5KTKA 3S2FA 1VL6A 3O26A 1CWUA 4DL9A 3R6DA 3LC7O 3D4OA 1DHTA 1GU7A 3PDJA 4OQYA 5BQFA 1V3TA 3LLSA 1YQXA 4BNYA 2EF1A 2YYYA 3JQ8B 3GMSA 2EWMA 1B15A 4PLYA 3FNGA 1I24A 1F12A 1K3TA 2EJVA 3QJ5A 1PJ3A 3JD4A 1BG6A 3D0OA 4YT4A 3GZNB 1LXCA 2DUUA 2EG9A 2GSDA 3IQDB 1ZCJA 3H5RA 4J9UE 3RAJA 4RPJA 1TI7A 4OHUA 2GO1A 3EAGA 5H83A 4R5MA 2GERA 3F1LA 2NLOA 3N74A 3S2IA 4D46A 2EIHA 1IB6A 1VJ1A 3HDQA 1CERA 4UAGA 3JQ7A 2W2KA 3QIVA 1E3JA 3ABIA 2FP4A 4GVLA 1A72A 1S6YA 3KM0A 4CQLB 4OQZA 5DBIA 3UXYA 2E4AA 5U1PA 3ORFA 4JJIA 4ZJUA 1I3LA 1DC4A 1U4OA 2CNBA 9LDBA 1SPXA 4MIYA 3L6DA 1JTVA 4IXTA 4FB5A 4BNKA 2OOSA 2D1YA 4TRJA 3GGGA 1PL8A 4B8WA 5EERA 1YVEI 1C0PA 1IHXA 1WZIA 5H82A 5T8KA 3PQDA 3IUSA 1PGJA 1M6HA 3RBXA 4BNZA 3X2FA 2UAGA 4P4NA 4R41A 3AK4A 4XGIA 4GPD1 4A2CA 2BLLA 4PLGA 2PK3A 5T5QA 3E5MA 4BMVA 1RKXA 1GQ2A 2BD0A 3JQ6A 4NBWA 3UGKA 7MDHA 2WSBA 1PS9A 1RM3A 3RJ5A 3VOSA 2ZQZA 2B4TO 1Y1PA 2DAPA 4NFSA 3N7UA 4F3YA 1LDMA 3K96A 4ZGWA 5EJ2A 4B7XA 4CM9A 1ZBQA 4RVFA 3KSDO 3GF4A 2JD0A 1EDZA 2Q1TA 3I3OA 3PGJA 3QVWA 4HADA 4N7RA 3KEOA 1NQAO 1XCBA 1YBVA 2XAAA 3GVXA 4DMMA 2ZKLA 5JAQA 1ONNA 3OJ0A 4RF3A 1NHGA 3MEQA 3GVIA 3Q6IA 1JWAB 4XRRA 4BO2A 5CDSA 3Q11A 4EZBA 4PVDA 1U3WA 4RORA 1T25A 2Y1OA 1MB4A 2VQ3A 6LDHA 2EV9A 3FF4A 3FBTA 4Q3DA 1XELA 4J1QA 1V6AA 2NTVA 1E3EA 1U9JA 5IZCC 3TQHA 4BV8A 1ZXLA 3C7DB 3SEFA 3NAQA 3ZWNA 4TKLA 4KTVE 5AVOA 4IM7A 5JCJA 3VH1A 3CMCO 4I08A 1D3AA 1YL5A 3G79A 4JBHA 3D1LA 4Q3AA 4TZKA 3EY4A 5KKCA 1FDVA 3MOIA 4MVJA 4J91A 2FMUA 1I33A 1VL0A 5H81A 4NBTA 2X1HA 4HP8A 4LK3A 3ADOA 1XSEA 5GY7A 3GNSA 1LI4A 3H9GA 5G4KA 5CHEA 5IDQA 1ZJYA 4PLVA 5KKAA 2R00C 2TMDA 3H2ZA 3EC7A 3KVOA 1O94A 2O3SA 1QYVA 5KJCA 4IMRA 1KVRA 5ES3A 3ZWOA 4BNMA 1QORA 4PGFA 3RFXA 3V2UA 2Y67A 1DB3A 1U8FO 5JYDA 1Q0HA 3H6KA 1TXGA 1VRWA 3JD2A 4N5MA 3JD1A 1LLUA 3ONEA 2ILTA 1YQDA 1NR1A 3KHUA 1Z75A 2NVUA 4CM4A 2PD6A 2ZYDA 4MKXA 3BMOA 4R54A 3KLPX 3S8MA 4PIVA 1U7HA 2Z1NA 4QXMA 3BA1A 4Y6RA 3OQ1A 1QXSA 1YWGO 1ZK0A 3JD3A 4B3JA 1IHYA 1M66A 4CLDA 3DBHA 3GOHA 2D3TA 3LT1A 1LJ8A 1JAXA 1LBEA 2JKVA 3T4XA 4II3A 3RC1A 1HLDA 7ADHA 2VYND 3UAGA 1VSUA 3IMFA 5KOIA 3IKTA 4A10A 2HK8A 3ROKA 4KUHA 2UYYA 2W2LD 4XRGA 1PU2A 2TMGA 3JSAA 4UULA 3HFGA 4RDIA 1B7GO 1GUYA 3T7CA 2O50A 2DVMA 4GVXA 4WECA 2HO5A 1HDOA 4CODB 4ALNA 5B1YA 1SB9A 5GZ3A 1E0DA 3GZNA 3RJ9A 5A9SA 1EMDA 1GYRA 3WGTA 4YXFA 4RLSA 2X5JO 4BNNA 1E7MA 4DVJA 5EMHA 5L51A 4NU6A 2P9CA 4UVDA 4Z9YA 2O4UX 1L1FA 1YBAA 2EGGA 3RD5A 3GVCA 1X7HA 5KVVA 3SVTA 1RM5A 4PLHA 1HE5A 3K30A 1E6WA 3PLNA 3TPCA 5T57A 4O0LA 5ADHA 5JDIA 4NDNE 3MOGA 3AFMA 1HYHA 2NTNA 3RFTA 1QLJA 2I67A 1M2WA 4ALKA 3HDYA 4BQRA 2OO5A 1IPFA 1OOEA 1C1DB 2QQ5A 1ONPA 3HFSA 5GZ6A 4BO6A 1E5QA 1F17A 5CAEA 1EE9A 3H3JA 1NAIA 4N5LA 2YUTA 1CYDA 4RVGA 5HTOA 4LSWA 4C4OA 4J2OA 4W6ZA 5L4SA 1HYEA 2ZJ1A 1KS9A 3O9ZA 3UUWA 4DIOA 3WGYA 4EW6A 3WDSA 2GRAA 3FNHA 3ST7A 1X0XA 3SLKA 3AY7A 3WJAA 4JN6B 3AUSA 4DYVA 3AI2A 4R69A 2O23A 3AUTA 3LT2A 3PXXA 2A35A 1O9BA 1Z82A 4MVJP 4BGEA 3U3XA 1BGVA 4U6SA 3TZKA 3RCBA 2H1SA 3HDHA 3R3SA 1DIGA 4I5DA 1CEQA 2Q3EA 1CETA 2PKQP 3ROQA 3R3JA 4JJFA 1EBUA 3GA0A 4P8RA 5T64A 4EUHA 1HDZA 3IKVA 1EDOA 4GMFA 1HE4A 5JNLA 4FFOA 3JYNA 5G4LA 3FCOA 3IUPA 4NH4A 4PLFA 1PIWA 1QV6A 4BHTA 1I36A 5COAA 1QLHA 3GN2A 2C0CA 4YBZA 1GV0A 2GN4A 3V1TC 2W4QA 4XX0A 4LRSB 1VE9A 3QLJA 4HFMA 3TZQA 3EVTA 4N54A 3WNVA 3NTQA 4MINA 2GZ2A 4U0KA 3RUHA 1LLCA 1ZIDA 2PFGA 2AE2A 1YL7A 3MJSA 3NDJA 1BRMA 4R4JA 1C14A 4HFNA 4NG5A 1LDNA 4E2XA 1N7GA 1I3MA 1YJ8A 2UV8A 3S1LA 3H9QA 4QO8A 5AOVA 4Z0PA 4BKPA 5IFLA 3W8FA 4CM7A 3L07A 4W7IA 1LDBA 3K8ZA 1EK5A 1PEDA 1UZNA 2XXJA 4MKRA 3WFIA 4W9NA 1UDAA 4RZHA 2PR2A 3GG2A 4NJMB 1DPGA 4R68A 3RFVA 4BNFA 2CY0A 3PHIA 1R66A 1A9YA 1UP7A 4MVJG 3HN2A 2VHYA 5G0SA 1YDWA 4MO2A 4M8SA 3S2EA 5A3JA 4Z0HO 1R6DA 1N5DA 5JDCC 3Q0EA 1F14A 3B1JA 4R1SA 3HSKA 3JYOA 2NSDA 3RASA 5JC1A 1PZHA 3BAZA 1V9LA 2R2GA 1KIFA 2B4QA 1NX6A 1E3WB 1VPDA 3DWFA 5DF1A 3VPHA 1ISJA 4YJFB 1H0KA 1C0LA 2Q1WA 2BGKA 1VJ0A 5DCYA 3Q1LA 4IZIA 4WUVA 2FR8A 3UICA 5IF3A 3RUIA 3GZ4A 3F47A 2Y0DA 4RO0A 5A02A 2G1UA 1XKQA 3H7AA 3AM4A 4OO3A 5DOZA 1QRRA 5BR7A 1QKIA 5HWSA 2HJSA 3OETA 4ND3A 4IJVA 5IAAA 1Q7BA 3M2TA 1IPEA 3OA2A 4IDDA 1I01A 2QRKA 5BSHA 1MXHA 5JO9A 3GR6A 1R0KA 4DQVA 4S1VA 3WMXA 1LSUA 1DFIA 4FGWA 2YQ4A 4NR0A 3ZV3A 3ROMA 1BXGB 3LVFO 2OORA 4GSLA 5KWEA 1BDBA 2HU2A 5TGDA 2CDCA 2GN8A 2QHXA 1XDWA 4IDCA 2QZZA 1M75A 5DNAA 1GCUA 2IZ0A 2CVQA 2O3JA 5ER6A 2GZ1A 3AM5A 3KB6A 3VTFA 4DMLA 2WYWA 3PYXA 4KDFA 2Z1MA 1SOVA 3DZKA 2AEMA 4NIMA 3GQVA 3QWHA 3VPGA 4NBRA 2ZB4A 4Q39A 3KBOA 4DIFA 5HRUA 4KWIA 4A27A 1GZ6A 3OHSX 5KVQA 1E3LA 3AOGA 3BMCA 1PZFA 1KVUA 1Y9AA 4PLTA 2DTEA 3ZCXA 3LQFA 4B7UA 2G0TA 1K6IA 2EEZA 4JNKA 4Y98A 1XLTA 1A9ZA 1GAEO 1PQPA 5CDYA 1SCUA 1WPQA 3D3WB 2WYUA 4UVIA 4Y6SA 3DBRB 2O7QA 4NZ9A 3ZV4A 5B12A 4YAGA 1DBVO 1WWKA 2XF8A 2G82A 1H5QA 1NAHA 1UDCA 1V0JA 4JK3A 1E6UA 4IIUA 3DBLB 3JQAB 3ZI0A 5HBRA 5JW6A 3GGOA 2CVZA 1X1TA 2CD9A 4A0SA 3PP8A 4OKNA 4Y8VA 1NPDA 3ZWPA 5G2OA 1C1DA 1Y6JA 1R0SA 4XQCA 2VT3A 4E21A 4O63O 2Q99A 1ADGA 2HCTA 4IY1A 3WMWA 4BB5A 5U4QA 3PYLA 4YRAA 3HDJA 3IOYA 5K6AC 3CEAA 4MIOA 4AJPA 2BFOA 1VM6A 2FPGA 4X54A 4K9DA 3DXFA 2J3JA 4XB1A 4M86A 3WWZA 1JA9A 3E1KA 3L4BC 4J16A 1DLJA 2CDAA 1KVQA 3NJ4A 3RU7A 3NT4A 4OIMA 4L0QA 3E18A 3JQCA 4FR5A 2RH8A 5IZ4A 2IXBA 4I5FA 3VH2A 2C07A 3GAZA 1IL0A 1KEPA 1HZJA 3ITDA 5CDTA 4YACA 3V1YA 1WNTA 3JQGB 1HXHA 2HSDA 2PKQO 2P91A 3DDNA 3A06A 3HB5X 3OH8A 3GT0A 2PKRA 1ISGA 3PJFA 4FOOA 5COQA 2J5KA 1Q7CA 4PG7A 8LDHA 5ENDA 3JYLA 4Q3EA 2IZZA 2IEDA 3IIEA 2WMDA 3M1LA 3S2GA 2HRBA 3NX4A 4JP2A 2CDBA 1CQJA 3QW2A 4NU5A 1V35A 5CP8A 1PGQA 4RLHA 4BO8A 4E5YA 4OKIA 4E5KA 3QVOA 5AXBA 3ZW9A 2FOIA 4Y9DA 5ICMA 2Q46A 1E7WA 4F46A 4M55A 4M54A 5TJ9A 5HS6A 5C7IO 3WX0A 4Z3KA 4WNCA 3D4PA 1QV7A 4B79A 2Y1FA 2WD8A 2B37A 2FPPA 1WP4A 4WLOA 4EJMA 5KJEA 4D0SA 4ROSA 3ENKA 4YJGB 4RVUA 2Y1DA 3TL3A 4WGGA 3G49A 4J7XA 3I52A 4XA8A 3LC1O 2GNAA 4ESOA 1GUZA 4HKTA 1GZ4A 1PZGA 1DJNA 2HLPA 4XB2A 2OXIA 3ZWYA 1YONA 2JHFA 5FF9A 5TC4A 2O2SA 5TX7A 2BHLA 4GWGA 2VZ8A 4HV4A 2HMUA 3V2GA 4E5PA 3B6ZA 3JTMA 1C1XA 2NU8A 3QRWA 1PJTA 2OZPA 3WG9A 1FDUA 1PSDA 4E2WA 5DULA 3CTMA 1DIBA 1R4MB 1KETA 1T26A 2C59A 5L45A 1HSOA 1YRLA 3A1NA 2DBRA 3ANMA 5EN4A 4XD2A 4BKOA 3L4SO 3CE6A 1KC3A 4CV1A 3ZW8A 2VNSA 3G0OA 3OIFA 4CMCA 4O6VA 2RHCA 3WTCA 1XU7A 4ALLA 1V8BA 5CEJA 2EW2A 3Q9UA 4IGEA 4OYRA 3ZGYA 1ZH8A 2X4GA 3B1KA 1F8GA 1P31A 3WIEA 1GPJA 5U9CA 4ZQBA 5A4DA 2DUWA 3AU8A 5CPBA 1JKJA 3JYPA 5BSGA 3PIDA 2PTGA 4J4BA 5JAIA 1BW9A 4AJLA 3H8VA 3LT0A 3AY6A 1WDLA 4FDAA 4AVYA 1MC5A 3AOEA 5COBA 3BTVA 3C7AA 1HWYA 3EZYA 4BO7A 3NV9A 1DJQA 1R15A 2BFPA 1LRLA 2YHIB 3V8BA 2J3KA 5C7OO 1D4FA 1U28A 2C7VA 5IDWA 4YJHB 4CMAA 3NTRA 3LDHA 3BYZA 3IJRA 5AXAA 1ID1A 4BO5A 4E13A 2X9VA 4QFDA 4BV9A 2NQTA 2P5YA 2GD1O 2RAFA 4RL6A 1X13A 4K1LA 5IDXA 1I10A 1P1FA 3HWRA 3JQFA 3MZ0A 4M89A 3KXDA 3WGIA 1I3KA 4EJ6A 3ZNQA 2VYVA 3JQDA 2H9IA 3ONFA 3D3WA 4TRNA 1PGPA 1EVYA 3NYWA 4RPGA 1ADBA 3KTDA 1Q1NA 4RCVA 5LDGA 3TDKA 1P74A 4AJ4A 3EDMA 2BF7A 3BIOA 1P45A 4CR6A 1DSSG 1EUZA 3GEDA 4CM9D 2EHDA 1VKNA 2NNLD 3WFJA 4YAJA 3KEQA 4LVUA 1QYCA 4FSHA 2EKQA 4CMEC 5GMOA 3BXXA 4QT0A 4WNIA 2A94A 1ENYA 4IINA 5L4NA 1T2EA 3CIFA 2WE8A 4TRMA 1M76A 2VWPA 2V6BA 4PZCA 2Z5LA 2X6TA 3C1AA 3E9QA 3AOEC 3GPIA 2IE0A 4INAA 3UCFA 3MJVA 1XGKA 3JQ9C 4NK4A 3TOXA 1IULA 2BRUA 2I76A 3OICA 1WDMA 4YR9A 1H6DA 1DC5A 4N18A 1FJHA 4LSMA 4YEDA 2LDBA 4AJKA 4XZ3A 3VVBA 3WNQA 2O2YA 3G3EA 1ZNQO 4UEJA 2O3QA 3GUCA 2C2YA 2VZ9A 1L7DA 2BFAA 4RVSA 3SC4A 5JCJD 1E7SA 2VZ0A 1VC2A 1AHHA 3N58A 4OXYA 3KYCB 5A04A 1KEWA 2FR0A 1TT5B 3T4EA 5FWNA 3JQGA 4MVJD 3DFZA 5A5FA 3B1FA 1YB5A 4WCFA 3UCXA 3ICCA 5JY1A 4BNIA 4CMIB 2H6EA 2PGDA 3PWSA 4IJKA 2YY7A 1BVUA 3ZWWA 4CM5A 4QFCA 2WE7A 4AG3A 1HDRA 2P68A 3WJ7A 3CSDA 1ZEJA 3AW9A 1NQTA 2C7GA 3L6OO 3TJRA 3UCEA 2QIOA 1NP3A 1LNQA 1B2LA 3U4HA 4FJ2A 2FHSA 3NGXA 3V5NA 4J90A 1TT7A 1UAGA 3FN4A 4U5QA 2ZCVA 3I9OA 2WD7B 3GY0A 3D5TA 3ANNA 4I8XA 3BHJA 3RBZA 3PFFA 1E3IA 2FSVA 4CJXA 3ROPA 2NUAA 1Y9EA 1DRWA 3H5NA 4TWRA 3GEMA 3WLEA 2QRLA 3LT4A 3RC9A 4P4GA 1EK6A 2QZ9A 4FGSA 1DAOA 4DIBA 4ZQEA 5IJZA 1W4ZA 1Z7EA 1GQQA 4GBJA 5LCXA 3WQSB 2WWRA 5ER9A 4BO9A 2DBVO 1W6UA 1B16A 4HFJA 4XYMA 1PGNA 4YTEA 4DXHA 2J6IA 3RU9A 2AQKA 1JKIA 3TWOA 2O7SA 5I8ZA 1GYQA 1UXKA 3AJRA 2VTEA 1B26A 3FBGA 4JLWA 4JXKA 2D2IA 3E03A 4WLNA 4CV2A 2XXBA 2ZB8A 5T8KC 4E3ZA 1U2GA 3INGA 4DC0A 1UXGA 2JCYA 1R4MA 3C85A 4PLPA 4EDFA 3M6IA 1PJLA 5CEEA 5AXDA 4IDFA 3WYBA 3PQFA 2BI8A 2ZQYA 3ULKA 4PFJA 4CLRB 1U8XX 1DC6A 3KO8A 1BVRA 1NPTO 4LW8A 3VZPA 4M49A 1PX0A 2AE1A 2YDYA 4ZU3A 3NKLA 4E5NA 1HDGO 2EW8A 2A9FA 3JCZA 3K73O 4R9RA 4TMFA 1AE1A 2E6UX 3VPXA 3GRKA 4H15A 5A9TA 3QVSA 3PTZA 2PZMA 4ILKA 4OSPA 2AQIA 1DAPA 3RUDA 3DL2A 4ZQGA 1R16A 1WMAA 3SBOA 3CINA 3W4KA 1NXQA 3ASUA 3OJEA 4FS3A 1OBFO 3W4JA 1NVGA 5JMPA 2NTJA 3HADA 1UAYA 4TZTA 4ZICA 3W8EA 1HTBA 1HT0A 3ZNPA 1ZVMA 2JAPA 5B4UA 5KNLA 3WGQA 1W0CA 1TEHA 3OA0A 2HMWA 3JV7A 3DZFA 1XG5A 4M1QA 4ZQHA 1EFKA 1NFQA 3AI3A 4BL5A 1X0VA 1BXKA 1CQIA 3ETDA 5F21A 2JFHA 4GLOA 3U9LA 1DFGA 4E33A 1U4SA 4IQ8A 3WQQA 3JQBA 4GWKA 3V1UA 3PJDA 5EESA 3VDQA 1SEPA 4Z0TA 4BNGA 2FN7A 3K2BA 1P1IA 4R5HA 2X8LA 4RDHA 3U09A 4CM6A 1LSOA 2BKAA 2VTDA 3PHLA 3U5TA 3EUWA 3VTZA 4JCOA 3I1JA 5IN4A 2I3AA 3CXRA 3JQ8A 4XJTA 1WXDA 1PJ2A 2PH5A 3CKYA 3SLGA 1A5ZA 4DQXA 1ZSNA 4MOWA 4F6CA 4RJTA 5JYEA 1HDXA 4KDEA 2PD3A 4XYBA 4CLHA 4GI2A 1OI7A 4OJNA 3PEFA 1ULSA 3D4NA 1N1EA 2CFCA 1NFRA 4RF2A 5JAZA 3MJCA 4WASA 3GLQA 3KYDB 5MDHA 4BNWA 4AFNA 1H93A 3PZBA 3AWDA 2Q1SA 1U3VA 3FPCA 1H6CA 2X5OA 4XR4A 3LK7A 3W8DA 3ZNOA 4D0RA 1E3SA 3I9KA 1HE3A 2DFDA 1GTMA 2V65A 2Y1CA 3DR3A 5DP1A 1J4AA 2CZCA 3HE3A 2PZLA 1PQUA 4ND1A 3RWBA 4B4WA 2B5WA 4IDEA 3C24A 1I0ZA 3ZWVA 2Y99A 2P9EA 3VZSA 4CQLA 4QTZA 4CM8B 1K2WA 2X9NA 2B0JA 4I9NA 3H9JA 3KLMX 1UXIA 3ZNNA 2GYYA 1GR0A 2IODA 5DT9A 2GASA 4CL8A 5KVSA 1HDCA 1AHIA 1K0UA 1TT5A 4FC7A 2J5QA 5TT0A 5JSFA 1GEGA 4WLEA 4AJHA 1EUDA 2FZEA 3DFUA 4KUGA 3CPSA 1GD1O 1EVIA 1P9LA 3UKOA 3DONA 3ZU4A 4XWYA 2BI7A 3E48A 4WOKA 2YV3A 3SXPA 3ZWBA 2CF5A 4GMGA 1HETA 4G65A 4UVEA 1DFHA 3CZMA 3VHRA 3W6UA 1B8PA 2AQ8A 1UP6A 2GCGA 5L7WA 1RPNA 3LSYA 4I1IA 1GZ3A 2PZJA 3WQRA 1YL6A 4PLWA 3SC6A 3NGLA 1NQ5A 1QYWA 4BGVA 1AN9A 4CUJA 1KYQA 5JLAA 2B4RO 3BMQB 2WD7A 3DAGA 1N9GB 2C82A 2Y0EA 4HUJA 5IXSA 4MJLA 4EYEA 2Q1UA 4EGFA 3WWYA 4BS9A 4UEOA 1WLYA 1T2DA 3X2EA 1ENOA 1NNUA 4R3NA 5FYDA 3QA9A 1JLLA 1H2BA 1LRJA 1VL8A 2HMTA 3ANLA 4IS3A 4WCDA 4ND4A 2CF6A 2RBEA 3K31A 3INRA 2I5PO 1E1LA 1ISMA 4CUKA 2QYSA 4ND5A 4IJUA 2PNFA 1PJCA 3LU1A 1HRDA 3IL2A 4CMBA 2VWHA 2JAHA 3DZIA 4L76A 1G0NA 4YQYA 5DBGA 1PJBA 2VOJA 4FN4A 5JE8A 2QW8A 4BMSA 1YOVB 3DOCA 1I3NA 1QSGA 2AEFA 2ZYAA 4EEXA 1UJMA 4FQ8A 3V2HA 2JFGA 1B8UA 5L7TA 2VRCA 3PZRA 1DLIA 2J8ZA 1UDBA 2GN9A 2D4AA 3FR8A 1P44A 4HX5A 1ZK2A 2NU7A 4GH5A 4XEHA 3PPIA 5HM8A 5MGBA 3DTYA 4P22A 1E92A 1C0KA 1NBOA 2X0IA 4J1SA 4MDHA 4DPMA 5JCXA 4PCVA 3K92A 4PG6A 4BO3A 5JY6A 5KCZA 4EBFA 3GAFA 1SZJG 1E7RA 1Y8QB 2I65A 3RVDA 5CDUA 4ALIA 4CPDA 2HK7A 4BNVA 3GNTA 4E0BA 3DZJA 1R37A 3G1UA 5C5IA 3WS7A 3GHYA 2RH4A 3GH3A 2IEBA 4IS2A 1RM4A 2CVOA 2FWMX 4JJGA 4PLZA 4QSMA 2Y05A 2X5KO 1RM0A 4DTIA 3S55A 1HLPA 2ZATA 3QY9A 3DQPA 1IYZA 4YT2A 1NPYA 3QV1A 1A4UA 5JC8A 3UW3A 5DBFA 1PWZA 2DT5A 3BMNB 3E6AA 1TA4A 4J4HA 4WJZA 5DDIP 3SJUA 1PL7A 5A1TA 3PJEA 2AMFA 2IXAA 3DZGA 2WEKA 4UREA 3PRJA 3AUUA 4PLCA 1LTHR 4W9NC 1HDYA 3W6ZA 4ALJA 1EBFA 2WTBA 1T24A 3MJEA 2X23A 5I9LA 3RSHA 4NPCA 4YRDA 2VCYA 3ETEA 4XQGA 4YB8A 2BFMA 5BNTA 4CL3A 1QMGA 1T4BA 3COSA 5TF4A 1Y7TA 2YFHA 1FDTA 3I9LA 5BSFA 3CZRA 3GVHA 4CMHA 1D7OA 3ZV5A 4D7AA 2GPTA 4D41A 2EKLA 5JMWA 5FI3A 2A92A 3HQ4O 3HB4X 4CQMB 1SC6A 1ML3A 2PGJA 3ZWAA 1W8DA 4PRLA 4RGBA 4OMUA 4B7CA 4IQGA 1G1AA 5ILGA 3WR5A 3MTJA 1H6BA 3FI9A 4E32A 4XGNA 3ETGA 1CDOA 1O5IA 3DOOA 4FFNA 4LMRA 2NACA 1SAYA 3ZU3A 1P77A 3BTSA 1J49A 5F3RA 1E7QA 2Q45A 5G0TA 4B8ZA 1MX3A 1HEUA 4RF4A 4A5OA 2O48X 4W99A 3Q9NA 3E9NA 1YQGA 1P33A 2CUKA 3FPLA 4ZRNA 1F0YA 1NR7A 1AXGA 3O8QB 4MP8A 4OSOA 5EL0A 4IJWA 1FDWA 4E30A 1LU9A 3F4LA 2VUSA 2D8AA 1ENPA 2YV1A 1E5LA 4H7PA 3F5QA 2IZ1A 4AJIA 5HS4A 1QG6A 1PJ4A 3DHYA 3H2SA 2DLDA 1BWSA 4MVJM 5ICSA 1JN0A 1BSVA 1U1IA 3I5MA 1B14A 2WJPA 5JXWA 1LC0A 4L8VA 4ZVVA 1Q7GA 4Z9XA 4HY3A 5TT1A 2JCVA 5BT9A 3M2PA 3ZZNA 1YKFA 3H5AA 3OJOA 1XHLA 5G0VA 4XJSA 4YPOA 5ITVA 1B3BA 1LLDA 3QVTA 4ZRMA 1H6AA 3O38A 2X0NA 4EEZA 1YJQA 4R01A 2B69A 2X0JA 1NWCA 4BOYA 3HHPA 1M67A 4K6FA 5L4LA 3IJPA 3DMTA 4BMNA 3I6IA 3DB2A 1MG0A 3FNEA 3DHNA 2ZTLA 2NV6A 4OOEA 3JQ7B 2W2KB 4RQUA 1F8FA 2C5AA 2JHGA 1R0LA 4J9VA 2Y0CA 5T6BA 4BGIA 3LZ6A 2DQ4A 4GGPA 4L4SA 1MG5A 4XYEA 1DRUA 3G17A 1E1KA 3UVEA 1KEVA 2B5VA 5IDYA 5EQDA 4AJEA 4WLVA 2PLAA 2ZTVA 4FCCA 4CR7A 2DTDA 2P2SA 3TZHA 4K26A 1KBZA 4J2HA 4DLAA 2X7HA 2E49A 2R6JA 2Q4EA 4MVJH 4J7UA 5L3ZA 5I8WA 5L40A 1JQBA 1SB8A 4NFHA 3VDRA 3AU9A 2VT2A 4I5EA 1BDMA 1W73A 1YOVA 1ISIA 3L6EA 3KSUA 4BQPA 3ZU2A 4NFYA 4BNTA 1XR3A 3AY3A 4AJJA 1JWBB 1CRWG 2YV2A 5B4TA 2UDPA 1AXEA 3D64A 1C0IA 4G5HA 1P1JA 3GDFA 3PIIA 4MVJE 2GF2A 3GPDG 1B0AA 3D3EA 2QYTA 4NJMA 2XOXA 4FD3A 3INTA 4J1NA 3PHJA 5EIOA 3DZHA 1XEAA 1T2FA 5LC1A 4D43A 4IPTA 2H63A 1X1EA 2FR1A 2OL4A 1ZK4A 3FWZA 4DLLA 3P19A 2AA3A 4UUOA 1H94A 4RQTA 1ZJZA 2PD4A 2VYVD 4B3IA 2Q49A 4XKJA 2PWZA 5T67A 3OM9A 3NUGA 3GC6A 2C20A 4J6FA 1U3TA 3C1OA 3EVNA 4UUNA 2Y68A 2Y1GA 2YZ7A 4UUPA 1E3WA 2HRZA 1YXMA 4YJFA 4E31A 4A03A 4W4TA 1E6EA 1O89A 4O59O 5JS6A 3I4CA 1MFPA 4J0EA 3ZH2A 1NVTA 2DBQA 4AICA 4D3FA 2D59A 4MP3A 2J5RA 3F9IA 4J0FA 5EPOA 1JAYA 5CG2A 4GSKA 3GRPA 4IDAA 4NJOA 1GEEA 3EZLA 3GVPA 1J0XO 3HNPA 2NU9A 4BNJA 1DO8A 1IZ9A 2I9PA 3BHIA 2Z95A 4OXNA 4J1TA 1HL3A 3BMNA 2XPCA 4BO4A 3KETA 2ZB3A 1OFGA 4NI5A 3C8MA 1YBMA 4CLOB 1OC2A 5G0WA 4BNHA 2Q2VA 1NVMB 4HNGA 4AJ2A 4YJDA 3OMLA 1BXGA 3E5RA 4JROA 5G4KB 1P1RA 1B8VA 1LSJA 1P0CA 3C1TA 1GY8A 4UUMA 5F1OA 4BKQA 1R12A 1XYGA 4OAQA 1LSSA 1XWFA 3QWFA 1KVSA 1EEHA 1G0OA 3EK2A 1NM5A 4KWHA 3E82A 2HQ1A 5TJHA 4NK5A 4BGUA 1AUPA 4CQMA 3FSRA 5CG1A 3RUCA 4WEQA 2OUIA 1Z73A 3GNQA 2V7PA 1RYEA 3OIDA 4U0JA 2QG4A 3VKVA 4IDGA 1NQOA 4R1UA 1U7TA 2F1KA 1O8CA 2O4CA 3FRJA 3WTBA 2VRBA 2O3UA 2NVUB 1EE2A 4CM4B 3AM3A 3OFSA 3BHMA 3BMOB 3DBRA 2VWQA 5KJFA 5KVCA 1R4NB 3MWEB 3OBBA 4KP7A 4EUFA 1K5HA 1ZUD1 2OP1A 2ET6A 3DBHB 4QECA 4TQGA 3U4CA 2BGMA 3DBLA 5ENVA 4H3VA 3JQAA 2HKIA 2NWQA 4PRKA 2W8ZA 4IDBA 1YDEA 2G76A 3ASVA 4KZPA 4YAIA 1XQ1A 3ZV6A 2AHRA 2UVDA 4PN3A 4L4XA 3C7CB 2VN8A 4G81A 1Y8RB 4GX2A 2FPIA 1ZK3A 4PZEA 4B3HA 2A4KA 1J5PA 5L9AA 1A7AA 3B20A 4OL9A 2RHRA 3WSWA 1N2SA 3PHGA 5A9SB 5C7LO 4EJ0A 3RROA 3RUAA 1O6ZA 4J43A 4DBVO 1X7DA 2P9GA 4HBGA 4YQZA 4DA9A 3GN1A 3JQFC 4QO7A 3F5SA 1Z74A 4AJNA 5A06A 1YO6A 1XIVA 1NTOA 1ZMTA 3VVCA 4JBGA 4CR8A 4JIGA 4ITUA 5C3MA 4XYGA 1MXFA 4DREA 2P5UA 1PL6A 5JO0A 2YFQA 2V6MA 3PDUA 4KMSA 1I2BA 5EINA 1DEHA 4JGBA 2RCYA 1XQ6A 2VUUA 3IDSA 1A7KA 3A14A 4P38A 3L9XA 1ZEMA 4CMJA 2H5LA 2X22A 3VAZA 3PWKA 1N8KA 4R51A 1HE2A 3VC7A 2AEJA 3P2YA 4TRRA 2FSSA 2ZTUA 4A26A 3OJFA 1LA2A 5IZCA 5KJ6A 1ZW1A 4GGOA 1F06A 3UH1A 5JBIA 4B4UA 3H65A 1WW8A 1Q2XA 3ENNA 4KQWA 3DHEA 3GK3A 1GL3A 4Y6PA 5IXYA 2GGSA 4RPLA 4YJGA 2EP7A 4B4VA 4D3SA 4RPKA 1I2CA 4CM1A 5I7SA 4W7HA 1EQUA 4GX1A 4LCJA 1LRKA 4CLXA 1JU9A 3F3SA 1JVSA 5L7YA 3WGHA 4E2ZA 2ZTMA 3A4VA 1H9AA 1KY5A 1UH5A 3A9WA 3H9EO 1X7GA 2PGLA 3QWBA 4WCFC 2R00A 1DC3A 4XR9A 4D42A 2VUTA 4FJ0A 2W98A 4NBVA 4S3MA 4ZD6A 2GDZA 3AI1A 4TROA 2AQHA 2ZIZA 4DWVA 4KTTE 3L77A 5DP2A 1K89A 3RI3A 3ZHZA 5JPIA 3TF5A 3EHEA 2EP5A 2NVBA 2QX7A 1WVGA 3UHAA 5F5NA 4C7JA 3BTUA 1VKOA 1WDKA 3DAPA 4E2YA 3RC7A 2AW5A 2YJZA 2ZB7A 2OP0A 2DM6A 1N1GA 5I7FA 1NWHA 4NHEA 1MV8A 1NFFA 1N7HA 4MVJF 2J3HA 1DIHA 3PGXA 1MP0A 5THKA 2ZK7A 4O5OA 3OSUA 4Q3CA 4BKRA 3WYCA 4OOFA 1TB4A 4FBGA 5DZSA 4A7PA 4DPLA 2Q2WA 5TIIA 1J6UA 5IN5A 3EMKA 5AXCA 3UN1A 5ILOA 4YA6A 2PH3A 4CLOA 3QQPA 1ZFNA 4Q3BA 2D0IA 3IAHA 2LDXA 4NQZA 5L53A 4IBOA 3AUAA 2YW9A 3E8XA 3VPSA 3PWZA 1U3UA 1ONOA 3B70A 2V6FA 1ZO8A 2YHIA 1V3UA 3RC2A 4BO0A 4CV3A 3KOUA 4YVFA 2JJYA 4GKBA 1E7YA 4LMPA 4YJHA 4ZA2A 3TFQA 2GN6A 1ARZA 1PZEA 1B3RA 3VH3A 2G17A 2IRWA 3FTNA 1MFZA 3DZBA 1ULUA 4BKUA 2I3GA 4ZQFA 5JAMA 4AL4A 1D8AA 4O1MA 4FFRA 4WE3A 3ICPA 4CUZA 2FZWA 4CMKA 1Z7BA 4UVHA 3F6YA 1ZSVA 2ZYGA 4OH1A 3RBVA 2GUGA 3EGOA 1R4NA 1U2DA 2DPGA 1N92A 4KQXA 1I5RA 4R1NA 5TRTA 2HAEA 3NT5A 5C37A 1IZ0A 1LUAA 2HJRA 2JD1A 2W90A 3T7EA 4YDRA 4XGKA 3GDOA 3VPFA 4BUCA 3UOGA 3WLFA 4ONEA 1V3VA 3R0IA 4KUEA 4JQCA 3STHA 1TVEA 3F46A 1Y8RA 4QQRA 2C29D 5K9ZA 2Y1EA 3OEYA 3DMYA 4PG4A 3ZWMA 1VSVA 2IDZA 5AYVA 5I9NA 5JDIC 4U6QA 1T4DA 1HKUA 4BO1A 4YYZA 4L73A 1YB4A 1QYXA 4NBUA 4YCAA 1XU9A 1YGYA 4BNUA 3BMCB 4IZHA 3VH4A 4YT8A 5LDHA 1FXSA 3K5PA 2VRCD 3PVZA 4GLLA 3OECA 1HYGA 3JQBC 1SEVA 4LRTB 1BHSA 2YQ5A 3KYCA 1SO8A 1Y5MA 4P4LA 1T2AA 2X0RA 1JVBA 3H9UA 3AFNA 1TLTA 4CMIA 3CH6A 5FFFA 2B36A 3RKUA 4PG5A 2D5CA 4Z3DA 5B4VA 3KRTA 3WBFA 2OGUA 5J23A 5FEUA 4AJOA 4R1TA 1CIVA 4L9RA 9LDTA 1KEUA 3RIHA 3E9MA 3OF2A 1G6KA 1WZEA 1AGNA 3VZQA 3D7LA 1VJTA 4BB6A 1C3VA 4CLEA 1E77A 3H3FA 1ADCA 1DDOA 2J3IA 1NASA 2Q4BA 3OIGA 3PYMA 3NDIA 3QE3A 5TQVA 4F6LA 3TFOA 2DBZA 3OP4A 2AXQA 3U49A 1GV1A 3IP3A 5FI5A 3DO5A 5TSDA 4BNXA 2PY6A 1IY8A 5DCWA 2VWGA 3HN7A 3P2OA 4GQAA 4DGSA 1GUFA 5CFZA 1OAAA 2RIRA 1EUCA 4D3DA 2IYOA 1H2HA 2VYNA 4EITA 3NT2A 1ISFA 3DOJA 2POQX 1UP4A 2W2LA 4HWKA 4GKVA 1PQWA 3UFXA 3IP1A 2P4QA 4PG8A 5JDCA 3KUXA 3JD0A 2HUNA 3GFBA 2F00A 4RF5A 2IYPA 4G2NA 5BNIA 1RJWA 2E48A 3GFGA 1NHWA 4FFMA 1YH3A 1LDGA 4R3WA 3KZVA 3PLRA 3K9QO 4IXWA 1MC4A 2WYVA 4QEDA 4R9SA 3MWDB 3ZHXA 2O3RA 4H16A 4UEKA
chains in the Genus database with same CATH superfamily
3A04A 4DIDA 1LB1B 1PGOA 2C0PA 1ITZA 3JVUA 4TLDA 5DXAA 1C7JA 1ENZA 3STXA 3KYBA 2H2AA 2X58A 2VHCA 4GS5A 1DEAA 4X8LA 1T9HA 2LD4A 5FOTA 2H7VA 1RLTA 2XTNA 5JG7A 3C3MA 1WXGA 5TMBA 3VJLA 4O2BB 3W1VA 1SHLA 2XMRA 1OWMA 3SOZA 3HLKA 3AVXA 2BELA 2OV8A 1KYVA 5EGNA 2R8OA 4RA6B 2O2DA 1DX9A 2ZRCA 2W2VA 3WYAA 1T36A 2DKNA 1USIA 5JHHB 5HPYB 1S0UA 4NAHA 1C3JA 3FDZA 3C6KA 2P2DA 4JBWA 1DINA 4XUGB 3X1KA 1CF2O 3CH4B 3KKPA 4G37A 3T9CA 2QUJA 5CT4A 4EYSA 2FK8A 4G1BA 1QU2A 2MU1A 3L2OB 1ABBA 4YUAA 1J1UA 5FTNA 1MQSA 3DEYX 3GHHA 4RNCA 4INPA 1GPDG 5FA6A 3BGDA 3D8RA 1Y6QA 3IC5A 1Q84A 1YV9A 3J7TA 5IM5A 2IWHA 4M0KA 4C1NA 3NEPX 4KIGA 1JKXA 2I6XA 2I2CA 3G6KA 4GVPA 3U4QB 4H3SA 4II2A 1A5SB 1U7WA 5IABA 1BHO1 1UFQA 3AR8A 4B6JA 2PJRA 4XDYA 3ZR4B 4JUDX 4DM3A 5IYZB 2VQEB 4IJQA 1S5PA 3DAFA 3GLKA 4KOAA 3AJEA 1PWXA 3UMBA 4LQ4A 2WW8A 1BWRA 3VR5D 3QOXA 4D81A 1FF9A 1I2ZA 3TRIA 2OV3A 3SBXA 3PXDA 2CSUA 2VP3A 3JAWB 3ZVLA 1K6JA 2EGHA 2JGMA 1ICIA 1Z6ZA 2G08A 4G0PA 4HMPA 3EZ6A 3R7NA 2QN3A 8ADHA 1QS0B 5DEIA 1GVHA 3LXUX 5DHFA 1ORDA 1U3CA 2WT4A 4MIEA 1QK4A 3WGOA 2OR3A 2OAGA 2DHRA 2FWRA 3AB7A 1BFDA 3HJAA 3I0NA 3IHWA 3OZSA 4EOGA 3FYCA 1TNDA 2P62A 4P2GA 4JC8A 4PYLA 4YP7A 1RWBA 2HQSA 2P4HX 2P8SA 2VL7A 3EW7A 4YN3A 4D8XA 1XQ9A 4NYIR 4GX5A 2A9RA 2D54A 3HYNA 4J2TA 4Y6OA 1HL7A 1IMOA 1PKEA 1WNFA 3R7AA 2UKDA 3SJ7A 5C5EA 3C6BA 3E4DA 1U5AA 4CU5A 1U2SA 4P2BA 5CPFA 4RKWA 4M0MA 4EY8A 1DEKA 3PGA1 1Q5PA 4H7FA 4FDTA 1GCIA 2GS9A 4UEWA 4TTAA 1E1YA 1JTFA 3TJZA 2HK9A 1WQ3A 5DBEX 3MHPA 5ADWA 1GFSA 1AF7A 3HUUA 2DU8A 2RG1A 2ZWIA 2E37A 4Q24A 5G0UA 3NR2A 1YU6A 1SUEA 4HQLA 2PBZA 3BB4A 5EJGA 1MEEA 2QP4A 1A9OA 1UZMA 3WL6A 2ZT6A 4MKZA 3I09A 4RZUA 1VP9A 1CUEA 2YZKA 2Q9AA 1D2CA 3L8GA 3LC2O 4N39A 3HKBB 4PEVA 4LMAA 4QYMA 5IJAA 2FWAA 2W37A 3PENA 4A8JA 4XDZA 1ESCA 1ZJ5A 2C00A 3I4FA 3IT3A 5K6AA 4MUNA 5IC6A 3NBYC 1P8JA 5E7QA 4EG6A 5A5EA 1UOQA 2I2AA 3GFOA 3I5UA 1H8ED 2OECA 2PWYA 5DLPA 3ENWA 1OC4A 3QWIA 4QE3A 4ZMSA 3L4BA 1QRDA 3LCVB 1ZSYA 2C7BA 2C97A 1KU0A 2N47A 2JW5A 2JDIA 3C3JA 3Q98A 1BXRB 3CZCA 4KXLA 4TMZA 5B1SA 3WKBA 3AFGA 4LZAA 3DTTA 3WIVA 3ZU5A 5LQDA 1RU3A 2OKCA 4D9KA 2I2WA 3O4VA 2IY9A 2IPXA 4YRFA 4EMUA 2ZI5A 3HGMA 3QBTA 3FXAA 3NRCA 1H5NA 4B75A 1GPMA 3TL2A 2VNAA 2B8EA 5TNXA 2K7FA 4BFVA 3W5VA 4YROA 3GDGA 4F2PA 4N3CA 4QUKA 2PZFA 1K0FA 1NN5A 3ET4A 4LVCA 3TOZA 1A2BA 4FJ1A 4PIPA 3HBLA 5I7VA 1R8JA 4QX6A 1A4IA 1QIKA 4F85A 1E2GA 4R0MA 3IAM6 3FOWA 4EY7A 4X1IA 3LX4A 3OF5A 1RBYA 2P3QA 3HI6A 1BRTA 2J4FA 3NIDB 1UXOA 2CLEB 3HO6A 4TQAA 2ZR9A 2HBRA 4DPKA 4ZAXA 3EW9A 2BIFA 1UF9A 5JJBA 2O2IA 4MO9A 1V11A 3C4QA 4LHVA 2ARKA 1SOWA 1CB0A 1T5BA 2ATIA 2BEJA 2G25A 2J67A 2NQ2C 4KAFA 3RUFA 3SQOA 4CTMA 3DW3X 1G8FA 3TRHA 3UJ8A 1FL9A 3WHLA 4DVGA 1DC7A 3MMSA 3D5QA 3N28A 2GBLA 5FX2A 3WWEA 3HABA 2R65A 2Y66A 2WYIA 3BMQA 3T3EA 1NDQA 2C99A 4N8DA 3THYB 2NP6A 2GETA 5I4IA 4R8SA 2QG6A 5A2QA 4GOND 4NOJA 4A1FA 1HE1C 3DL7A 2DHQA 1E1MA 2O0MA 2PAFA 1O6GA 4I5GA 4ZC1A 3KQQA 4GIBA 3V6MA 4AIRA 4B3XA 4E5SA 3G0CA 1MH1A 4OQFA 2FXVA 5FUYA 3L8HA 1MAWA 2WKPA 1B93A 3RHFA 3AVPA 1JPNA 4DNPA 2PRYA 4YCSA 5F9MA 1KYXA 5KTOA 5J47A 2AJDA 1S8OA 3NOXA 5BY2A 1FSPA 1NE2A 3CVOA 1UUFA 3FYUB 5D01A 4DMFA 4FWIB 2XZDA 5BVHA 4EMTA 2DPYA 1U3DA 1WMBA 2OFPA 3BWVA 4EGCB 3BRWA 3OTIA 1FTWA 4O2RA 1Q44A 3IBGA 2NVWA 4M1KA 5H3CA 4X0EA 3I76A 2PWPA 2ZRIA 5I7HA 3H5TA 2WDZA 2JJ1A 3DWEX 3OF3A 4U8GA 2J9GA 3WYEA 2IPOA 2WA1A 5BQ5A 4ETMA 1Q6YA 3C3CA 5U4XA 1MAAA 3D8TA 3OJLA 4H4DA 4TKMA 3K2EA 3IPXA 3B1ZA 4K9OA 4W8OA 1OV6A 4QPZA 1U7ZA 5DX8A 1OMOA 2C2HA 2QD1A 3SX2A 1A76A 1ZITA 1ZA2A 3KSRA 4Z49A 5JXJA 4AY2A 4CQMD 1MHTA 3DKRA 4RVDA 4QPPA 2BVNA 3I6QA 4CT0A 4TMKA 1EZ4A 3L7BA 5MGNA 4PVCA 1DG1G 4D45A 1CQPA 3QMVA 2NUAB 2H07A 2FFHA 4X91A 3RQIA 3UXEA 3VO1A 4B32A 3THWB 2H1CA 4ZO9A 5DW0A 2IYUA 4M1OA 1H0SA 1E89A 3NWPA 2FZ5A 3RUEA 1V5EA 2HDHA 3GAAA 3I83A 3C5VA 4M1ZA 3UK1A 2J9RA 1J33A 3MINB 3DOIA 5KOYA 1S2NA 4OXKA 5DU2A 4YWJA 2XCOA 5IYZF 2BW0A 3K05A 3BDAA 3RO7A 2A0XA 2MT9A 5AMXA 2UUOA 1ZJ4A 4X00A 5GIPE 4FIZA 4P3KA 2EXXA 3DZ8A 3EJWA 1I30A 4CCYB 5K8JB 1ZXBA 3GLUA 1VI2A 4KNVA 1FPQA 1GGFA 3CNNA 3LY8A 5JANA 3LUBA 1QOPB 5AW8A 2P78A 4Q7LA 1SVNA 1X7WB 2QX4A 3DGEC 1KIAA 4ZJPA 5PNTA 1M7BA 2AG6A 2CCJA 1I80A 1AM4D 2O8BA 2FW7A 5DM60 3SR3A 3HFJA 2C96A 1XKTA 5D3QA 5SY9A 1DV2A 3BJEA 1MGOA 4FOSA 1Y5RA 2Y93A 1PR3A 2Y1LA 1M8JA 2BCEA 4EA8A 1KHHA 2GN0A 2IYQA 1F6WA 3SYKA 2EJWA 3PPYA 4R40A 2Y76A 2BGLA 1QHGA 4E1VA 1P5HA 4OQLA 4EUKA 2BP7B 1HT3A 1RMQA 1X8KA 2XX3A 3ISVA 3OC6A 1JDJA 2NU6A 4K28A 2J3DA 5EWMA 1U2ZA 4BATA 1SC1A 5AI0A 2VHXA 1M2GA 1F3LA 3V8VA 4IG9A 2R8EA 3EVEA 3WOVA 1SKMA 2JIZD 3RSFA 1H1LB 2ZWMA 4KIUA 1Q7TA 2ZZMA 2W6ZA 2Y92A 1ZZEA 2ZOSA 3OIVA 3OLQA 3R09A 2I66A 1FCJA 2OC9A 3GEGA 3GQBB 2WHEA 2WF6A 5DM1A 1ZOIA 2HA6A 2PSFA 4ZCMA 2J6CA 4FGZA 3T1YB 4QYIA 4XCVA 4FEGA 3AHCA 1W88A 1KVTA 3C6YA 2VHEA 1D04A 3PCXA 1SBYA 4HSGA 4ALMA 4ZZ0A 1G5PA 5AVJA 1BEEA 4RKYA 3URMA 1LDYA 3TUJC 2D0PB 1YCFA 3D0RA 5I9MA 1U0HC 2PA3A 3EZ9A 3ZVRA 4XIFA 1ORIA 2P9JA 4B6GA 2ZJ0A 3JQ9A 3HKBA 5JS1A 5CH8A 3VHQA 4CQNA 3NHBA 2XE8A 2RI6A 4JP3A 4K81B 4Z6KA 3LPCA 3DAHA 1GCAA 4RY9A 1FSZA 4Q7MB 4TWZA 2RGRA 4TVSA 5C81A 1QR6A 2K87A 2GM3A 3OY7A 4F5WA 1UMBA 2DPLA 4P6VF 3O82A 1Q19A 1YVRA 3FIJA 1NYTA 4F60A 2QT1A 2HI0A 1ZD1A 1QOQB 3U5ZB 3S2FA 1JHUA 1VL6A 2HXSA 4DXAA 2BR4A 3ED5A 1QX3A 3ZH9B 3M5CA 1EGHA 3G5TA 1P7WA 1IXYA 4W5QA 1ZWLA 3WZLA 1QJ4A 5AK4A 1UMDB 4G67A 3AR6A 2JHCA 2HDNB 1U0EA 2JEYA 1B15A 2EBFX 2O5RA 3GMIA 3TDNA 2EDAA 1AX9A 1FYEA 1I24A 2GYUA 4EB0A 1K3TA 1DPFA 1YASA 2W70A 4ARUA 1NM5C 3A9SA 2ZUCA 1O97C 1BG6A 3LHSA 3H2GA 4KQ1A 4Y7DA 1LXCA 2DUUA 2YXLA 3EFBA 2GSDA 1ZCJA 4OEHA 4J9UE 4HCJA 5JZOA 2G40A 3A4LA 4HXEB 3Q5GA 4OHUA 4RQBA 4TMVA 4MULA 1N3LA 5JMTA 4R5MA 2DXIA 2QJFA 5LP6C 3VU0A 1NUAA 5EXTA 3AL2A 3GFSA 4D46A 1IB6A 1P72A 1T34A 3KUUA 3MBOA 2XV1A 3NZEA 4IVPA 1LVGA 2ZUVA 4AWBA 5A6SB 4FXPA 4DB2A 1R6VA 2V9ZA 1YCGA 3UWOA 5I4CA 3WKDA 4UAGA 5KQMA 2W2KA 3K09A 1QDLB 1IDN1 2FP4A 3IO5A 4NLLA 3RWMB 5CBPB 4GVLA 4IDOA 1A72A 4DCNA 4LCBA 3RG2A 1ZKDA 3UXYA 3N6RA 3ZDXB 2VRNA 3SK0A 5GIOE 1XDBA 4C7BA 1C8BA 2Q2NA 4F4JA 3DFFA 4JJIA 2FSIA 2QDXA 1I3LA 1EA5A 4AF6A 1Z5UA 4M1YA 2ZJ7A 3L6UA 4DCPA 1G8KA 3QSYA 1U4OA 9LDBA 1ML4A 1MO4A 3FYUA 1SPXA 4EO4A 4EPVA 4C2UA 4B3SB 2CZGA 4YK7A 4YRPA 1R6AA 2OOSA 2D1YA 4E5UA 3HYRA 4U63A 1I2DA 1PL8A 1K4YA 4B8WA 4MAMA 1C0PA 2K4MA 1RHQA 4LXUA 4H1UA 3VHXA 4RKRA 5C4MA 5AUOB 2RDMA 3IUSA 3KQWA 2JGJA 2DWPA 1WB4A 2UAGA 2OMKA 2ZAGA 5LZ2A 3QYPA 4RTJA 4NZMA 4ACBA 1TTQB 1U31A 5ALTA 4QD3A 4MWBA 3QY0A 3H17A 3TRJA 1EWTA 3WK7A 1YA4A 1RKXA 2B25A 1GQ2A 3UGKA 3JQ6A 4UTZA 1SBNE 2WSBA 3ABRB 1JE0A 1RM3A 3PEEA 1RP7A 2F1IA 4RV4A 3E22A 2B4TO 3L7NA 4ILEA 4RACA 4W5RA 4LJ6A 1CUCA 4IHJB 4FINA 3K96A 1IU9A 2K7ZA 3W06A 4RVFA 3RHZA 3C16C 1RVDA 3KSDO 1E2IA 4CJXA 3SDZA 4JUBA 5GONB 3IQGX 1EDZA 2Q1TA 5KOHB 5AKJA 1RWQA 1CVRA 2Y2UA 1Y3AA 3KEOA 4OATA 1PUXA 4Y2UA 2NSHA 1C7QA 2V7EA 2XAAA 4C0BA 2QLJA 4H0CA 4DMMA 1Q1QA 1X3LA 2C4UA 2Z2KA 3NB0A 5H3HA 1SHZA 2ZYUX 4DBLC 1YZKA 2CLKB 4OGKA 4CKWA 3AP1A 1JWAB 5KYGA 3DNPA 2H8KA 4BO2A 2G0AA 3PXCX 2QMYA 4J3NA 3KK0A 3MGBA 1MB4A 4KQGA 2CNWD 3FTDA 4ZK2A 2FX3A 2OCPA 2Q3FA 3FF4A 4YP5A 4CCYA 3AEXA 2D0OB 1W5EA 1RAHA 1DUIA 2OBLA 3H5IA 3D7RA 1V6AA 4TS9A 4U7HA 3VYUB 1YFJA 4X92A 1VMEA 3OQIA 3TQHA 3VOAA 3ZX4A 5FTLA 2GBPA 5I5EA 1KZ1A 4R2IA 1IG0A 1X7WA 2XR1A 3NAQA 1AURA 3L05A 4H17A 4TKLA 4QU9A 5D1HA 5P21A 4P0TA 3BA6A 4MAAA 5JCJA 3R4VA 2JLUA 3GLIA 5EUCA 3VH1A 3VBEA 2NO9A 3ND6A 4M8KA 3PQ5A 3G2HA 3G79A 4TZKA 2I4OA 3MFQA 1Q83A 2BSXA 3L5KA 1OBHA 3A8TA 1FDRA 2ZBFA 4P93A 5KKCA 1QIMA 4D80A 1DKMA 1J2EA 3DFKA 1WB9A 1Y3CE 4LE1A 3LCJA 1X1DA 2X1HA 1C4XA 5ARDA 4WY2A 2XMCA 5FV7A 1HEIA 4MPPA 2Z4TA 3K6RA 4MV7A 1M2NA 2H0QA 3GNSA 4AXBA 1VJRA 2YBDA 1T0BA 4FP9A 5IDQA 2VSFA 521PA 4PLVA 5K51A 1PD1A 4NAVA 3F6PA 1JFRA 2WWXA 4L78A 2HQRA 4F3NA 3EEOA 1TO2E 2ZAOA 1APBA 3BSFA 3ROFA 3REQA 5KJCA 3U7IA 3AZQA 2IIPA 4IMRA 1PBTA 3ZTWA 1ADJA 1POWA 3DMGA 1OAKA 1EFVB 2PMFA 3LKBA 2ZXFA 4U7PB 1XZ8A 3QFHA 4N3GA 2P90A 4B87A 1XB2A 3TBFA 1YFKA 3C8HA 1DB3A 1ESDA 2CNKA 2PRIA 2WNHA 4IRMA 3SFVA 2GZRA 1OJLA 1Q0HA 4KYIB 5JSYA 2QTBA 2OC4A 4HT3B 3EZXA 3JALB 2MYUA 4QU0A 3M4NA 3EAQA 1V48A 1JPVA 4N5MA 4V2UA 4NV3A 3ONEA 3T94A 2ILTA 2HF9A 2ZI9A 3UK6A 5UKDA 3BULA 1Z75A 5JFGA 4KPYA 4J3JA 4YMTA 4HTFB 4Z0NA 2GK4A 1FP4B 1ZMXA 2PD6A 4MKXA 2RGXA 2ICAA 5KMGA 5ADVA 2IXDA 3SG0A 3V00A 3BA1A 3KTFA 4KFCA 1QBKC 1W7AA 1YWGO 5AI8A 1TVCA 4DHWA 1M66A 1E79D 3DBHA 4HDQB 4Q1VA 3IPCA 2H11A 4ZYTA 1LJ8A 1JAXA 2L18A 1M0SA 4BQNA 1DAIA 5T3YA 4A0GA 4J0HA 3T15A 3B3GA 1M6NA 3SF8A 2NO5A 2JGLA 2QUKA 7ADHA 2WB4A 1Z5ZA 2OSBA 4RY2A 3THSA 4HXFB 3WGUA 1US8A 1NXWA 1S3SA 2HK8A 4R6WA 3Q8KA 3ABZA 3DR5A 1NIJA 1SGWA 4PRYA 1C7ZA 1NLYA 4HZGA 2ETXA 4B40A 1PU2A 2TMGA 1J23A 4M1MA 3HFGA 3H2BA 2QN9A 4BVGA 5IVPA 1GZ5A 1U1DA 1PT5A 3IOMA 3OTQA 4B1FA 2O50A 3O75A 1ESNA 2MCFA 3GBSA 4CG1A 2G06A 4CODB 5B1YA 1SB9A 4YP1A 3SSOA 2OVFA 4BYMA 4TLEA 3PDCA 4BNLA 3AVWA 5A9SA 4LY0A 2AN4A 1JU3A 5E3JA 3WGTA 2X5JO 1G38A 1W30A 3GLHB 4B5LA 5F7OA 3N8IA 4DVJA 5EMHA 5DW3A 2HM7A 3HZRA 2FN9A 3P0EA 4JD5A 5E1MA 5J5VA 1Q17A 2P65A 2QR5A 1KFKB 3ND7A 1RQNA 2CLFB 3K0KA 1NW4A 4HAUA 1QO0A 1YBAA 1X7HA 3R5SA 2ZJFA 1ID8A 2O8VA 1T9KA 3PXGA 5M5BA 4Z9AA 4BNYA 2YICA 3CUYA 1P80A 4D6PA 2PUJA 4W1SA 3UC9A 5C5DA 3E7WA 4K2HA 1KI9A 2D3WA 2ZBRA 4O0LA 4NDNE 3MOGA 4XARA 2NTNA 1KJNA 4PHGA 5BXYA 3C4JA 5JJKA 1AKNA 1FUYB 3RIEA 4AUMA 1QLJA 4YJ2A 2M98A 1TTTA 1QJCA 2RB5A 1DJPA 4GBGA 3TSZA 2OO5A 5ESWA 1C1DB 2QQ5A 1N75A 5GZ6A 5I3ZA 2QUIA 4MW4A 1UPXA 1EE9A 3CHYA 3W6NA 5FLXA 3H3JA 4N5LA 3RRJA 1V6SA 1JHYA 1ZAKA 1FFSA 5DX0A 4C4OA 3EBPA 1XVTA 2BFWA 2ZQ5A 1Z6GA 2EKZA 4DSZA 1Q1AA 2GCEA 3SZUA 5IC4A 1XL0A 4BP3A 4EVQA 1XHFA 2FSPA 3NVMB 4FGUA 2HZBA 3EASA 4M22A 3WGYA 1UEJA 1XEXB 4DGSA 4KLRA 2E1RA 3FNHA 3PNPA 5LDDC 2NTYC 1SC3A 4F04A 1X0XA 1XYVA 2HPHA 4WZBA 1AMUA 2VZEA 3WJAA 4BE7B 1C8VB 1MOZA 1RHRA 4IHJF 4E22A 2Q4DA 1E9RA 2O23A 2R86A 3B7PA 1KI6A 1L3IA 1O9BA 1Z82A 1U11A 2WJAA 1YQTA 3DYBA 5ALZA 3TZKA 5GONF 3HDHA 3R3SA 4FLEA 2O8EB 3CT6A 5HIAA 5IFKA 2IX9A 1GG8A 4ABYA 3C87A 2ZJ2A 3MFYA 1GOTA 2JAQA 4XVUA 2PKQP 3WAKA 4B3CA 3R3JA 3QBDA 2P4UA 2PTHA 4CN9A 4P8RA 4Q47A 3RADC 4EUHA 2Q5HA 3M9XA 4GMFA 2Q28A 4G8CA 4KQKA 4OY3A 5JNLA 1OE0A 1OVGA 1MNAA 3LQKA 2DG2A 4LWPA 4JEIA 3AF4A 5JBQA 5KOHA 4P54A 1C2YA 2B9EA 4P0PB 3IPAA 3IJEB 4DCCA 4N03A 4BHTA 1I36A 1KP9A 5BV7A 2XIJA 2C0CA 4ZREA 1MA3A 1RABA 1UM9B 5L3QA 3LVBA 3V1TC 2R8RA 4QM7A 3JQPA 3IIMA 5F5XA 4JVOA 3EVTA 5J3JA 3NTQA 1U2EA 2A5YB 3O8OA 5G0SA 1KY2A 4ECAA 3OPNA 4CTJA 2F3PA 2PFGA 5JNUA 4V1CI 3OIYA 1TMGE 1YL7A 7REQB 4W5JA 1C14A 4NG5A 2QWXA 2H1HA 2I71A 1Z8HA 4D4GA 2QVYX 5LB2A 2HGSA 1Z28A 3BCRA 2O52A 5LZ5A 1KZHA 3S1LA 3V3KA 1NLZA 4HN2A 2QXUA 1T5TA 3CZ9A 4JWKA 4NDZA 3T7JA 3K8ZA 4CNBA 1TMYA 3FMPB 1J25A 2PL9A 5EIBD 2ATEA 2JVIA 1O03A 3BSSA 3GEHA 1UZNA 2R11A 2VT6A 5EA2A 4ZVPA 2Q5QA 1UDAA 4RZHA 3SDSA 4RPCA 2AV6A 3FHOA 2JDID 5H3LA 3HP7A 3V4RA 3PHIA 1R66A 1A9YA 1L1RA 1M1UA 4KE8A 2GCPA 4PZLA 4DRZA 2TMYA 1JXQA 4FFBB 3QG5A 3S2EA 3L49A 5A3JA 1P4JA 1K7CA 5LD2B 4JV5B 1CP2A 1A9TA 1WABA 1WO8A 1F14A 4HDCA 1ZH2A 2Q0HA 3TRFA 2PMWB 2VJDA 3O93A 1SQGA 3ZCVA 3RASA 1EP1B 2H5JA 4GOMD 2GUWA 4Q6BA 1KIFA 2DFPA 1VPDA 1SHKA 1YIDA 2KLHA 3EDQA 3K1YA 3K0AB 5DF1A 3P20A 3L0OA 2Q3BA 1EU1A 2JAXA 3A3YA 1EFVA 2XCLA 3IHKA 4YJFB 1H0KA 1U9IA 2AT1A 4HQNA 4KI0A 2RGCA 1QIFA 1UMCB 1SR8A 2NO7A 3Q1LA 3Q5EA 5DCYA 2XTJA 1OFVA 3PGLA 1NOJA 5IF3A 2M1ZA 3N2LA 3GZ4A 2RKBA 1GPKA 2XUAA 3UATA 2DH6A 4UEQA 1XKQA 4H0FA 4OO3A 5DOZA 4DQDA 5K09A 3F0TA 3FRHA 3MUNA 1DU4A 1XMVA 4NYMQ 4R83A 2HJVA 3VR4H 3VYWA 1PTJC 5BW4A 3SIPA 1FP4A 3ID6C 1IPEA 3VFDA 1QTNA 3PRYA 3D02A 1J99A 4IDDA 1XNRB 2QRKA 5BSHA 1JR2A 1WV1A 5JO9A 4DQVA 4S1VA 1UJ6A 2FW1A 5DO9A 3WMXA 4RTKA 4FGWA 4DMHA 3LGSA 5HP4A 2BZGA 1LNZA 3LZDA 2PQ2A 1R0BA 4MRNA 3P71T 1E2NA 2TS1A 5LZ7A 4EGQA 2ZRPA 1USWA 1LFDB 2CKDA 1Z0KA 1BXGB 2O7VA 3PXBA 4RK4A 3ROMA 4PS0A 4HS4A 1DAMA 2Z56A 3ZCPA 2OORA 5KWEA 3NOQA 1BDBA 3IT1A 4Y7CA 3O2SB 3N2KB 4PCLA 1PFQA 2JRCA 4IDCA 1DT3A 1E2LA 3CVUA 2O8DA 1GWNA 4X1YA 5ER6A 3AM5A 4EPXA 4PC2A 3PYXA 5YASA 1BE8A 1SOVA 1VMDA 1BWPA 1WUTA 4B73A 2P77A 1Z6PA 1WUKS 4F1KA 4ZI7A 4QKQA 1YI8A 1Q1ZA 2PL1A 3BRWD 4LXGA 5E3IA 5MFZA 4L85A 1XWWA 2ZRKA 1T8YA 4FT4A 1TFUA 4DIFA 1E8MA 4QDUA 3JYHA 1A95A 3OHSX 2JJ1D 5REQB 4F4HA 1BU8A 2PBLA 5EJ7A 4YRQA 2OBMA 2DTEA 1UL1X 1HG1A 4P4UA 1MX9A 2C8VA 3GEBA 4B7UA 1NJ6A 1K6IA 1QHIA 2R4UA 4LOLA 1PQPA 2G5TA 1SCUA 4ASUA 2P1RA 3IB6A 2XA1A 4RGQA 3RW9A 1SUIA 1VGRA 4RLFA 4ND6A 2PZ8A 1KH2A 3M33A 1DBVO 2VPTA 3CPHA 2ZG6A 4AYWA 1NAHA 1UDCA 3TG2A 4LXYA 1DUSA 1LBSA 1TCCA 4AM8A 1V0JA 4JK3A 4BIMA 2GEVA 1E6UA 3AVQA 3AGQA 3EIUA 4IIUA 2OFFA 1T0PA 3ZI0A 5JW6A 3UPUA 1QGZA 1EZZA 4I36A 4AMGA 1N2CE 3UPTA 3CX8A 1XCJA 3KWJA 3PP8A 1G21B 4OKNA 4TLAA 4Y8VA 2CXUA 1Q7RA 5ECWA 1W75A 5J4YA 1YNOA 4OREX 2OV6A 2ZUWA 4QQ8A 3ZWPA 2IXGA 3L6RA 1C1DA 2A1IA 2QTAA 1R0SA 4QFBA 3R7FA 4D0LB 3WLKX 1CQZA 2Q99A 2XB4A 2HCTA 5JT1A 2DYKA 3GJ0A 3GZJA 1FS5A 3P2IA 3ER6A 4BC0A 1NBHA 4CVNA 3A3NA 5SYNA 1K2VN 1VYTA 1VM6A 2B94A 3IX7A 3GJ7A 4JUFA 3QG1A 1HLFA 1NLUA 1XEXA 2J3JA 5CUQA 1NXPA 2WVGA 3BFPA 4M86A 3W04A 2GFQA 4PSAA 2FPLA 3C7KA 1DLJA 2CDAA 3P2EA 4Y2QA 5EY5B 1ZR2A 1YZFA 4KQJA 1CY4A 1L5NA 2CB9A 3JQCA 1KO5A 4S1OA 4WERA 3HNRA 1OZ0A 2YVUA 1F6BA 4KE9A 2QPLA 5AI6A 4NHOA 2YN0A 2JLCA 2JI9A 3QUAA 5E4FA 1HZJA 2ZROA 3ITDA 3PT9A 4AN0A 2CLDX 2VJNA 4PAGA 5LN1A 1BE6A 2HSDA 2H2GA 4XPIA 3EVFA 3E7PA 2XKAA 3OH8A 2PKRA 3DTVB 1ISGA 1XX6A 4FOOA 4XCXA 3PUHA 4CYMA 2NV0A 2VF4X 1Q7CA 2FKAA 1PG5A 2OZLB 1ULBA 1TEXA 3MM4A 3OX1A 4FMPA 4PG7A 2IZZA 5ENDA 2IEDA 3LFUA 4ZU1X 2WMDA 2PVCA 3GFFA 5NULA 1CQJA 1DEOA 1STOA 1V35A 1PGQA 3LYUA 5AKLA 2DECA 1F20A 5IAEA 5K0FA 5JJ5A 1L4GA 1QH1A 4MKFA 4EZEA 4Y6GB 3DE7X 4E5KA 2J07A 1K86A 2FOIA 3V7WA 4EY4A 5ALIA 2Q46A 1V45E 5IM4A 1ORVA 5KNBH 4J8PA 4UU0A 1L7RA 4WNCA 3D4PA 4B79A 4F5EA 2AOWA 2Y1FA 4YBRA 2CNNA 1PLLA 4GC5A 1SVUA 3FH0A 1TJYA 3Q3JB 3EGWA 4A82A 3V32A 3PBKA 2E5WA 2R1ZA 1B6RA 1CJBA 3ENKA 2VJCA 5ALJA 2G77B 4DSAA 4YJGB 2IHNA 2IZOA 3LCUA 3PC6A 3OY2A 4RVUA 3TL3A 1GKYA 3AG5A 4J7XA 1HYBA 1AZLA 1TVMA 5F2NA 4PSCA 2OD9A 4J7AA 1NQWA 1HM5A 3SWWA 1AB6A 1RAGA 1ZP6A 1PZGA 1V3QE 3GCZA 4LHZA 1I3OA 2VAMA 4PFSA 5GADl 1NJ2A 3EFOB 1QO9A 4F3TA 1Y98A 2XTZA 2P9TA 5EMMA 2A57A 5TX7A 1P2TA 1HNNA 2BHLA 3V1NA 3CW2A 3H13A 1FVFA 5EJEA 5BN4A 4HV4A 2HMUA 1O0CA 1E4VA 3JTMA 1J2YA 1EKXA 4MNTA 2JGRA 3PPXA 2X5XA 1PJTA 2NU8A 4O3MA 1Y89A 1MT3A 1XJCA 4H2DA 4JLOA 1N32B 2JI4A 1WXHA 1ZYUA 2GAFA 3CTMA 3WC4A 1ODFA 1QHEA 1R4MB 1FNBA 5CW2A 1HSOA 1YRLA 2O0LA 2RHWA 2GKGA 4EG8A 1KI1A 3KSBC 4DSUA 1SXIA 4BKOA 1IUPA 4Z4CA 1T6YA 3KR0A 3L4SO 4I9GA 4P4TA 3UV7A 3QHQA 1OAOA 4CV1A 4G0VA 3WGKA 2VXYA 2VPYA 3ZGNA 1JP7A 2I54A 2RHJA 4XOUA 1HFWA 2M2IA 2X13A 3O4JA 2W4IA 1XU7A 1V8BA 2CZQA 2CYCA 2BZ1A 2JHAA 3OPQA 5KNDH 1TC1A 4JX9A 3IPLA 5BPFA 4IGEA 1KSHA 1ZI9A 3U19A 4JVMA 5LOVA 2GK6A 2VTBB 1AVTA 3LI2A 2D62A 2X4GA 2WWTA 5TS2A 2M32A 3B9BA 1FXWA 5A3SA 5U9CA 1KGSA 4NARA 4RHEA 4WZAB 4ZT4A 5G1NA 5A4DA 2GM4A 2QBYB 2KX7A 2A7QA 4UNRA 3FVWA 1EXMA 1LW6E 1JKJA 2HNAA 3M8KA 5BSGA 4DCOA 1TRHA 1QC5B 2R97A 4J4BA 2WUFA 4AY6A 4FHGA 2VTVA 5LXTA 2ZR8A 1B23P 1QHHA 2Z98A 3AY6A 4QU5A 1YCDA 3ZU6A 2WG2A 3ZZUA 3DV0B 4HUTA 5BN3B 4DR1B 4JLUA 3BTVA 4IW3B 2PCLA 4B3GA 3EUFA 1JR3E 4NE2A 2YHIB 3T9DA 5D3ZA 3V8BA 2J3KA 2IUUA 4KYUA 1U28A 1JQ5A 1ZN7A 2NZYA 2OXCA 2EG5A 1Z6AA 3JASA 3L8DA 4YJHB 4OMFG 3RTCA 5A4JA 2O2GA 3RGWS 2LZ0A 1Z4JA 3A1VA 3LDHA 2PLWA 3IJRA 1XD2A 1P1CA 4QFDA 3T3OA 2WM9B 3MGGA 1GAWA 2OTCA 1DKUA 2HRCA 1GP2A 2XWQA 3PNBA 2RAFA 3HMQA 3KUCA 4JEMA 3I0ZA 4PC3A 2XD9A 3A1SA 3LHKA 5FPKA 1I3KA 3AXTA 4WXYB 4EJ6A 2CEKA 2VYVA 3ZNQA 3KJIA 4N6NA 2I4RA 1F8UA 4TRNA 5HEKA 2WTXA 4ZAWA 1ADBA 1CS4C 3ZDBA 1QH9A 1WHTB 4N7BA 3HDGA 2O7RA 2CYBA 1P74A 5D5QA 1UIMA 3WLQA 4ENTA 4Z4IA 3SZRA 3KR1A 1Q6ZA 1P45A 4HRVA 5CTAA 1RJDA 2CNDA 1EUZA 1TAUA 4P58A 5FHQA 1VKNA 2CHFA 5IEJA 4DRXB 4YAJA 5JSZA 4LVUA 6YASA 4M3NA 1EPUA 5GMOA 4JP8A 3TZBA 2IIBA 2VK8A 4K88A 4YUVA 3S7TA 4QT0A 3JRWA 2J7KA 1W9MA 4IINA 1VYUA 2FW0A 1E6MA 2AJTA 3C3WA 4B82A 4YJ3B 1YQQA 2GDJA 2V6BA 2WVHA 2TYSB 4PZCA 3ZXXA 2REXB 1DS6A 1WBDA 4JU8A 3AOEC 4V0KA 5C3UA 3UCFA 5EHIA 1XGKA 3N7AA 3ZCUA 5A0FA 4TWJA 3TOXA 1UWLA 4AKHA 3OICA 2I76A 4R2WA 4YR9A 4BX0A 1R27A 4MYSA 3RYFB 3TZLA 3CZAA 1R8YA 5J2UA 2LDBA 4YUZA 2GD0A 3EGVA 3PDWA 4MMXB 4G3XA 2O2YA 2SNIE 2NG1A 2FG7C 4Z2YA 4F97A 2O3QA 1P2DA 1TEVA 1TVKB 2C31A 2DBYA 2VZ9A 1L7DA 4Y1RB 4L8FA 4C4YA 5JCJD 1PP4A 2IOFK 3P26A 5THXA 3TXAA 1Z2OX 4XUCA 4ZCLA 3V8QA 3DD5A 2I3DA 3RYIB 3LCCA 4L4UA 1YOBA 3O0DA 3UJHA 4QJIA 3W5BA 2HQOA 3OCWA 1TT5B 1SIOA 3T4EA 3W79A 4JENA 5H80A 4G5SA 2V7BA 2EFYA 4NE7A 1XBTA 2O2XA 3LXXA 1EJ6A 4NCAA 1VP3A 5IEBA 1CT9A 2H6EA 2PGDA 2Q4RA 5JQWA 2MSDB 5FUQA 2OZLA 2YY7A 3UB3A 2F8SA 4CM5A 5A6VA 4QFCA 4PHCA 4QA9A 1I7QB 2WE7A 2O20A 4UXHA 2ZSFA 2JA2A 3DVAB 4INZA 4OX9B 5DWQA 3WJ7A 3ZOKA 4JXZA 4J07A 1MHPA 3AW9A 3Q3EA 2C1EA 2H16A 2J48A 3ICVA 4HYTA 4S24A 3UCEA 4D92A 5AD1A 2B6NA 4X20B 1LNQA 1UKEA 2PJUA 3AXSA 3VMMA 1CR2A 2FE1A 4YMVA 3EGDA 3IAAA 2FHSA 3P9XA 3NGXA 4O4HB 4AO8A 1MJGM 1W5AA 4D6YA 4I4NA 4NAUA 4J90A 5TQ2A 3FN4A 5LWHA 1ZW6A 4JA0A 1W9HA 2D1SA 4LYAA 1FZQA 1FB5A 3RBZA 2CL6X 2BRUC 2YL2A 4IIXA 2EQAA 2XCQA 2QRHA 2XE4A 2OUKA 3EOBI 3P45A 5A5VA 4DV7B 2DUJA 3GNLA 1EUCB 3RC9A 1AKYA 2OVBA 1EUYA 2QW1A 4LEIA 3BCUA 3KXIA 4FGSA 4QTTB 1DBWA 2REBA 5JZMA 5J2TA 4ZQEA 2I91A 1RMYA 4DCJA 1OPRA 3HCNA 1Z7EA 1JJFA 3Q87B 1DX6A 1QCZA 4MS1A 4Q21A 3T95A 3VA7A 5ER9A 5F73A 2ASEA 1NATA 3KR9A 4B4DA 4BO9A 4C6HA 2BGIA 3FPJA 3D4LA 1SXJC 2SBTA 2B7LA 3MCWA 3RU9A 3EWAA 3NHUA 2O7SA 4UHFA 2XQKA 1EG2A 1GYQA 1T9DA 1UBTS 4UCWA 3T41A 4D9JA 4DEXA 5C31A 2X76A 2FPUA 2QRGA 3FBGA 5C51B 4KHPB 1L4BA 4CV2A 4HAVA 1D5CA 3O4GA 2X3YA 1E62A 1V9SA 2R47A 2X9LA 3INGA 4F3RA 4DC0A 1UXGA 1BMFA 1R4MA 5E4JA 2YS6A 3C85A 4AU1A 4EPRA 4OB8A 5E6UB 4IDFA 5AXDA 4TYQA 3WB0A 821PA 3HR7A 3PQFA 1GGMA 1FE8A 4AZ0B 3INYA 1UADA 2ZQYA 3ULKA 2R3SA 3RAEC 1E4EB 3N0VA 2JF0A 2EWWA 4CLRB 2EX0A 2E21A 2OPHA 5LYJB 2KPOA 2XDQB 3DEAA 3IAS6 4RTMA 2ZU0C 4L5JA 1KAOA 4JLDA 4LW8A 3MTIA 3LUPA 4M49A 4NBLA 2X7XA 1YRQA 4BMXA 3C45A 4ZU3A 1MVOA 4O33A 1OXVA 4BE9A 1HDGO 3FZGA 4E5NA 2A9FA 3JCZA 3K73O 3VPXA 5A3QA 5GV7A 3TLMA 3P9KA 2H18A 1Q0PA 4A91A 4H15A 2FWIA 1R5BA 4TXMA 3CM0A 5A9TA 3DA8A 4BLOA 2PZMA 1M2JA 3RUDA 5AM2A 1QO0D 5DNCA 5EE5B 5HKBA 1YFLA 3R8FA 2IBMA 1RKVA 1WVMA 1E2DA 3DL2A 3K0EA 1EM8B 1XRNA 2A14A 3CS3A 3H04A 3SXJA 5INTA 4BP1A 1XNHA 5AKZA 3K20A 3ZDDA 1SHUX 3NCHA 1XKXA 5D7NA 3ASUA 3K5IA 2XF2A 1QC5A 4I46A 5BN5A 5G41A 1BE1A 2HT6A 3W4JA 1BCRA 5DWVA 1PNTA 5JI2E 1XTUA 1WZ2A 1MPTA 3VYTB 2IUSA 1E2FA 2GEBA 3HADA 1PK9A 5A71A 1UAYA 4TZTA 1AKWA 2C5HA 4G26A 4JOQA 4ZICA 1HT0A 5F52A 1ZVMA 3DBIA 1ESZA 4H7JA 3WGQA 1NDHA 3BEDA 3JAKB 4B7AA 1KE1A 4NCHA 1TEHA 3OA0A 4JKOA 1B4DA 3AT1A 2I2XB 1V8FA 2V4ZA 1E9AA 2HDOA 3DZFA 3JSXA 3CONA 4EY5A 5AW0A 4BL5A 3ETDA 1II0A 3L7LA 3OHMA 5H59A 2Q62A 4QOIA 5B57C 1D7AA 1U4SA 2Q3DA 2N9UA 2L17A 1X8XA 4N9WA 2P79A 4YRMA 2P5SA 3V1UA 5C1OA 4Z0TA 3JWGA 2FN7A 4R5HA 2X8LA 4RDHA 2C1XA 5TEVA 3RGGA 3ZK9A 3IE1A 3ZX5A 1CX9B 1OASA 2VTDA 2C4MA 5C18A 1PR4A 1SKBA 2INGX 1YKSA 2M6LA 3U5TA 1FXUA 5IN4A 5HR5A 2QT0A 1T8SA 5DSXA 4D8VA 3EXIB 4XJTA 1PJ2A 2PH5A 1A5ZA 2RHBA 3ETCA 3JPYA 4MOWA 4KPEC 2GEJA 3CV3A 2C8KA 1Q1EA 2VNHA 1Y48E 3TBKA </