3TRIA

Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
272
Chain Sequence
b'NTSNITFIGGGNMARNIVVGLIANGYDPNRICVTNRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMVCEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVIWVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTEQAIKVLESGNLRELFIKALTAAVNRAKELSKTVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrroline-5-carboxylate reductase
molecule tags Oxidoreductase
source organism Coxiella burnetii
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
total genus 98
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.5.1.2: Pyrroline-5-carboxylate reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 3triA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3triA01
4X54A 1YJQA 4A03A 1BVRA 1HEUA 4GQAA 2YFHA 3M6IA 4A26A 1F17A 3TJRA 4E3ZA 5JXWA 2P91A 1P1HA 5GMOA 3I9OA 2FWMX 3UFXA 3AY6A 4OSOA 4OMUA 3Q6IA 4GWGA 4DLLA 2Y1EA 1QLHA 3WTCA 3OSUA 3I9JA 1V3TA 2XXBA 3IQDB 3JQ6A 3WQSB 5I7FA 3ZNQA 1LRLA 2DTXA 3WJAA 3N7UA 3NTQA 2X0RA 4F3YA 4Q3AA 5JDIA 4KUHA 1A4IA 1SO8A 1MG5A 4PLFA 1MGOA 3JQ8A 2Q1UA 1SCUA 3FPCA 4Z0PA 1NQTA 4JJFA 4PLVA 1CRWG 5C7LO 4BB5A 2VUSA 5A04A 5C7IO 1OC2A 2A92A 2O2YA 3H9QA 1PJ3A 3KHUA 2WYUA 2DKNA 1LSSA 1M66A 3WLEA 2JHFA 4KUGA 4IDAA 1PGQA 4YT8A 4EDFA 3E5RA 3ZWMA 4XR4A 3ROQA 1ZK0A 3K8ZA 2GYYA 3DHYA 5IZCA 2X0JA 4O1MA 2H1SA 4QO7A 3GPDG 1TT7A 4G2NA 1RPNA 5CPFA 4FGWA 4RF5A 3GZNA 1EVIA 4UEKA 3QRWA 1NQAO 3RBZA 1VJ0A 4TSKA 3A1NA 2V6BA 2WE7A 1YOVB 3ANMA 4CUZA 3WBBA 2CF6A 1UDBA 2FSSA 1SB9A 1DOHA 2ZCVA 4BO9A 3GFGA 4CLDA 2CY0A 3IIEA 4BNUA 2EKQA 4AJ2A 1TEHA 2W2KB 3RC2A 3D64A 1Q7CA 3GK3A 4ALLA 4MKXA 4IINA 1I24A 4NMHA 5CDTA 4BKQA 5K6AC 4Y98A 4Q39A 2UDPA 4YWJA 1X0XA 4TVOA 1DLJA 4EI2A 1JN0A 2JL1A 2VZ0A 3WDSA 3FF4A 2I65A 1PL8A 3EUWA 3GNTA 4R9SA 2AEMA 1L7DA 2Y05A 4DMLA 3U4DA 4BNFA 3ICPA 2RIRA 2QG4A 3GNQA 3GGPA 4J91A 1YWGO 5DCUA 1N1EA 1O0SA 1PJLA 3GGOA 4KTVE 5I7VA 4FJ2A 3K6JA 2H5LA 3ZHBA 3RI3A 1MX3A 5KJCA 1W73A 3K5PA 3EHEA 2EP7A 2P9EA 3H5RA 1XQ1A 1RKXA 3DBHA 1NTOA 3TWOA 5G0TA 2DUWA 1R4MA 1BTOA 2HMUA 1X7DA 5A3VA 4CR7A 4I5GA 1NVGA 1Q1NA 4J0FA 2GF2A 4RVGA 4E2YA 1V0JA 1HL3A 3FWNA 4Z9YA 3L77A 2X6TA 1TLTA 3MJEA 1U3UA 4IJKA 1BWSA 1MC4A 3OETA 4M49A 1LNQA 3HHPA 3N58A 1T2DA 1I5RA 4R41A 4WNCA 4GH5A 2GLXA 1N92A 5EINA 1YS4A 2VWGA 3KLMX 5IAAA 3GH3A 1A9YA 1ZSNA 4U7WA 1OMOA 3DBVO 4BGIA 4EBFA 3RFXA 3HDJA 3P19A 3I5MA 3PXXA 4CM8B 2X86A 1H6DA 3AFMA 3TZHA 2EJVA 1O9BA 2JFGA 1XU7A 2NM0A 2QYTA 3KO8A 4IPTA 4WCFB 3ZZNA 3PGXA 1BVUA 4QX6A 1JA9A 4PG8A 1U2GA 2BF7A 2NTVA 5FF9A 3HE3A 1V8BA 4NU6A 1ZMTA 4L9RA 5L4SA 3WGIA 3V2HA 1E3WA 4BNYA 5KOIA 3ROMA 2AQHA 4J4TA 2ZYGA 4LRSB 5IJZA 1UAYA 3P2YA 1RM5A 2OUIA 3S8MA 4CUJA 3DWFA 3KRTA 4E32A 4E31A 1UXIA 5ER9A 5T57A 5KVVA 5L45A 3OQBA 5G2OA 3WOHA 3ZDFA 2EIHA 3PLNA 4CMIA 1DEHA 3GG9A 4II2A 3M1LA 5C5IA 1NPYA 1XQ6A 2WE8A 4C7JA 4HNGA 4BKOA 3W6ZA 1GDHA 5B4TA 5CEFA 1NVTA 4L4RA 1LSOA 3LC2O 4ALMA 2YW9A 4PG4A 5G4LA 2IZ1A 5JAQA 2TMGA 3T4XA 5C3MA 3DBLA 4B4WA 2ZJ1A 1T1RA 4GVLA 1DHRA 2CMDA 2B83A 2X8LA 4CMJA 4XJTA 2PWZA 2JD2A 2V6MA 4UEJA 4DTIA 1H5QA 5AVOA 1H93A 5G4KA 3VZRA 2JCVA 1U28A 4FFNA 4K28A 1SOWA 4UAGA 4BNKA 4IS2A 2FPGA 1FJHA 4Y6RA 2HU2A 3QWAA 3LC7O 1O94A 1F0YA 1S7CA 1U8FO 1IYZA 2FP4A 4B4VA 2D5CA 3ZHZA 2Z5LA 2RHRA 5B4UA 1CETA 4XQCA 1E7WA 2VOJA 1W6UA 4R5MA 3DXFA 3MZ0A 5A9SA 5DCYA 2ZQYA 4YJGA 3VDRA 3JQEA 2HK9A 4XIJA 3L6DA 3UHAA 3RIHA 3JQ7A 2B35A 5KKAA 2CVQA 4L4XA 3RU7A 1Q0QA 3ENNA 4WNIA 3RUDA 1EUDA 1YKFA 4CMKA 4YPOA 3FNGA 4R68A 1GZ3A 3KTDA 4YA6A 1X7HA 2H6EA 5GZ1A 1HZJA 1I8TA 1Y5MA 2VHYA 4J2OA 1SEVA 4LMPA 2C0CA 3NGLA 5JMWA 3DBRA 4DL9A 4U0JA 3V1TC 3DZJA 4PCVA 4YJFA 1P0FA 2NACA 4DIOA 1JAYA 3V2GA 4IIUA 4XIYA 1Y1PA 1E3LA 3VTZA 3C7CB 3KVOA 1KOLA 5HBRA 2DT5A 4FBGA 1HETA 5TGDA 2ZB8A 3NDJA 4CQMB 1NBOA 3PHGA 3E6AA 6ADHA 2GPTA 2IEBA 1GADO 5LC1A 3U4HA 4J7UA 4Z9XA 2FRDA 1JW9B 1QKIA 4MKRA 4XD2A 3K2BA 3RC7A 3DOCA 1JWBB 3PZBA 3KXDA 4BNGA 4CQLA 1C0KA 1UXJA 3NX4A 1NP3A 4ZVVA 1C0LA 2VWHA 5ER6A 4XKJA 4GMGA 5DBGA 1XLTA 4AJ1A 3DBRB 3STHA 3WYCA 2RHCA 2NU7A 1EDOA 3MOIA 2RCYA 1XELA 4NIMA 5THQA 4I8XA 4RVHA 3WSVA 3ONDA 5JY6A 2AQIA 1G1AA 4N18A 1LDNA 4RVDA 1E5LA 2PH5A 3GEDA 4Z9FA 1EVJA 4DLBA 4M55A 1T2EA 1I3LA 3ITKA 3KYDA 2OBYA 1LXCA 2BHLA 3BMNB 2AEJA 2XAAA 1DFHA 5KJEA 3SBOA 4WCDA 4IM7A 3X2EA 3DL2A 4J16A 4DC0A 4BNJA 2YFQA 3R0IA 1VPDA 3PFWO 4IDFA 1B8UA 3PP8A 3DZGA 5FI5A 4DYDA 2CVOA 3TL3A 5DP1A 3JYQA 2HUNA 4D3DA 2DUUA 3IMFA 2BH9A 3LSYA 1SZJG 1VLLA 2BFAA 1YH3A 2CDAA 2JCXA 2OORA 3D3WB 4AICA 1OZAA 3UGKA 3F6YA 4GBJA 1BDBA 1ISHA 4E33A 2A4KA 2FY8A 2ZK7A 3U4IA 4TVBA 2PY6A 1P1RA 4JK3A 2PKRA 4RLHA 1C3VA 1MV8A 3EK2A 3PWSA 1FDWA 4R1TA 2VNSA 2G76A 1GUYA 4A27A 3HDYA 4BNLA 3KOUA 4ZRMA 4LSWA 2Q2WA 3HFSA 3L0DA 2GDZA 1NYTA 3F9IA 1H6CA 4BNHA 5DULA 2R00A 3I1JA 2Q4BA 1KEWA 2I3AA 3O38A 1ULUA 4FPXA 4DYVA 5JDCC 2JKVA 3FCOA 1PWXA 1HDZA 2Y1DA 1E7RA 5F1KA 5IN5A 5B1YA 1O5IA 3K96A 1U7TA 3CZRA 3EC7A 5F1OA 1Y8RB 4O63O 1SOVA 5COBA 4UUMA 5F5NA 1LDMA 4DREA 1KEVA 4J2HA 2GN9A 4JCOA 4WLOA 3GZ4A 3WJ7A 1U3VA 1T25A 4GGOA 2O3RA 3DZKA 3MJCA 3N74A 3RC1A 1UXGA 4AJEA 3ZW8A 4DRYA 4HBGA 3Q11A 4DC1A 4OQYA 3ZWCA 5C7OO 5A1TA 2WMDA 3VPHA 3JD1A 1T2FA 5CDSA 4INAA 1ADGA 1EQ2A 4OKNA 4YJHA 4PRKA 1E1MA 1NQOA 3QSGA 3E8XA 1I36A 3VKUA 3U4CA 5L4NA 1S6YA 1NXQA 1VSUA 2H63A 1LLUA 2J5QA 3BMQA 4B3JA 1TI7A 3WYEA 1PZHA 3V2UA 3I4CA 4HUJA 4XJSA 4OXNA 3OHSX 3ZU2A 3Q0EA 2QQ5A 4LCEA 1TXGA 3GEGA 3WNQA 3WIEA 1EE9A 1M6WA 2DTEA 5L7WA 3MOGA 4IQGA 2O3TA 2QZZA 1U4OA 1E7YA 1U4SA 2PFGA 3H5AA 1I2ZA 5EIOA 2P5YA 3VOSA 1BDMA 3VH4A 4CMHA 3JQFA 1VL8A 3E9QA 3QWIA 4GMFA 1FDSA 4D46A 2BGMA 3NDRA 1R0SA 4R4JA 5TF4A 5JYEA 3F4BA 4NBTA 2XOXA 1H2HA 1HYHA 3FSRA 3DONA 3ZI0A 4WKGA 5FI3A 1C0PA 5DOVA 3AU9A 3PTZA 1YGYA 3BZUA 3F4LA 4AJOA 5F21A 3CINA 3WGZA 2ZTMA 1YRLA 1G0OA 2C07A 4XB1A 2Q2VA 4IZIA 5KJFA 3NKLA 1C1DB 3DOJA 4B4UA 4BOYA 3DDNA 5I9LA 1T4DA 3DC2A 1X1EA 4BNMA 1OAAA 4IBOA 1PR3A 5ITVA 1ADFA 1KC1A 2ZB7A 3HADA 5L3ZA 3V5NA 5A02A 4KWHA 3L6OO 2OZPA 1H9AA 4EUEA 2PR2A 5JPIA 4CMEC 2B4QA 1LX6A 4R3WA 3OIGA 5JBIA 5BQFA 1XG5A 1K0UA 3JQ9C 5JNLA 3JD4A 4DBVO 2JFFA 3INGA 1CIVA 4MVJI 4XQGA 3RUCA 4R51A 4RF4A 5IDWA 4UEOA 4BGVA 4PFJA 3BMCA 1Y7TA 1E3JA 3ZU4A 1P33A 3L4BC 1SPXA 2VQ3A 5TLSA 4F6LA 1D4FA 4QXMA 1X15A 3DOOA 1P74A 2VUUA 3JQGB 4NBRA 3AI1A 3QE3A 4KMSA 1C0IA 2P4QA 3FD8A 2IE0A 4PRLA 4Q3NA 4R1NA 4TWRA 2EKPA 1DJNA 1RWBA 4EYEA 4RJTA 5CEEA 3SVTA 2VTEA 3DZFA 5T8KC 5A3JA 2GZ3A 4HP8A 1MC5A 4KP7A 1RM0A 2ZYAA 1FK8A 5DZSA 5G0UA 3GOHA 4JROA 4PG6A 1PGJA 1R4NA 3HN2A 2FR1A 4JLWA 2OFPA 3LVFO 2GD1O 2PTGA 3LU1A 4KDEA 4LVUA 3ZWAA 5CDUA 1PJBA 1GPJA 1B14A 1NVMB 4ALNA 4CJXA 5KKCA 3MCVA 1IZ9A 1IPFA 3UAGA 5L4LA 3C1OA 1G0NA 1EK5A 2ZYDA 1QLJA 1L1FA 4EEXA 5ICMA 4XGKA 4BMNA 2C20A 3O26A 5KCZA 3UKOA 1NFQA 3ABIA 1Q7BA 2OMEA 1WWKA 4S3MA 1XR3A 3W8EA 2VHWA 3V1UA 1Z73A 4PLCA 4E2WA 2IXAA 4A5OA 3LC1O 3U62A 4R69A 1N7GA 4D3SA 5HWSA 4CMCA 4J0EA 3GVCA 3Q9UA 4YAJA 1A71A 3GDGA 5GZ3A 5U4QA 1F06A 4AL4A 1P9LA 3E1KA 4BMVA 1I3NA 1TB4A 3RKRA 5EMHA 1P3DA 3Q9NA 4CV1A 1NPDA 4CQLB 5EESA 3JQAA 3VZSA 2X7HA 2NVUB 3MWDB 5ADHA 4BQRA 2X0IA 3EW7A 1IHXA 4BNTA 1EEHA 1LLDA 2P68A 1LRKA 3Q1LA 5COQA 4YRDA 1Y9AA 4CL8A 5JSFA 1PEDA 2B37A 4ZU3A 4NJMB 1BG6A 4ZQGA 1FXSA 2IYOA 5DT9A 5AXBA 1HSZA 1XEAA 4JX8A 1GFSA 3B20A 1LC3A 1PJSA 3GAFA 1ARZA 1E5QA 3QW2A 1NNUA 1X13A 3EZLA 3IL2A 5FWNA 4A73A 4AJHA 3RFTA 4E5PA 3TL2A 1PS0A 3H3FA 3JCZA 3LT4A 1KEPA 2YHUA 4J1TA 2QIOA 4OXYA 5COAA 5AXDA 3WYBA 2Y67A 2GO1A 5IG2A 5FFFA 4ZN6A 3LDHA 4FW8A 3GVIA 1CEQA 1OFGA 1R66A 1PZEA 4IIVA 1PR9A 1T2AA 2PH3A 3NTOA 3O8QA 1EBUA 2X23A 1QV6A 2DC1A 1Z7EA 3QVXA 3IOYA 5HS6A 4UVEA 3BHMA 2PZLA 3RBXA 4DQUA 1UDAA 4CM4A 4RZIA 5I9NA 3WR5A 1HE5A 4PLWA 3ZCXA 4Y6PA 5A5FA 1U8XX 1WDLA 4LRTB 4CLEA 5HRUA 2Y1GA 1ENPA 2GZ2A 4NK5A 2X4GA 3FR7A 3TZKA 4P4NA 4ZJUA 3K92A 5ENDA 3PJEA 3HFGA 2HQ1A 1IL0A 1ISGA 2UVDA 5ILGA 2GASA 3NGXA 1H0KA 4Z3KA 1WMBA 4ZQBA 1YVEI 2YHIA 4G65A 1YB1A 2UAGA 4RPLA 5GY7A 1JAXA 4RQTA 2CDCA 2EXXA 1GCUA 4BO0A 1EUZA 3GAZA 1HE4A 2DFVA 3L07A 4IJUA 2B5WA 1ISFA 1HE2A 1LQTA 3ICCA 1B8PA 5HA5A 1B3BA 3JQ9A 1ZXLA 1IPEA 1UJMA 4N5NA 3H9JA 4MIYA 1XIVA 4CR8A 3PWKA 2CF5A 3MJTA 2OOSA 2ZKLA 3NT2A 5JC8A 1PGOA 2PLAA 1O89A 3WFIA 3ZHYA 7ADHA 2O7SA 3JD3A 4NJMA 4F46A 1ZSYA 2JHGA 3PHHA 1VJ1A 3RU9A 4D0SA 3EAGA 1PQWA 3GN1A 3JQCA 1B3RA 1CF2O 1XGKA 4Q3CA 4D7AA 4NBVA 4TKLA 1QXSA 5DF1A 3TSCA 5CG1A 3TNLA 1U3WA 3QLJA 2IDZA 2PD3A 3UCFA 4DQVA 3BYZA 1FDTA 1UR5A 4AFNA 2R6JA 1KVSA 4TRRA 4L0QA 2NQTA 1VE9A 5T5QA 1U5AA 4XX0A 3H4VA 2W2LD 3PYLA 4A10A 1AGNA 4CM3A 1N8KA 1DO8A 3RUHA 5IDXA 2EW8A 1G6KA 2X22A 1H6BA 4CV3A 1A27A 3K31A 2WWRA 4YRBA 4MVJE 1O8CA 1ONOA 3RUAA 4B4OA 4KTTE 3UN1A 1GZ6A 2UYYA 2HK8A 3BHIA 4MVJF 4TZTA 4YAGA 4IZHA 4G5HA 2ILTA 4S1VA 4J1NA 3E48A 4ND3A 5BSEA 3B1KA 3PZRA 4OIMA 4OQZA 3ZWPA 4H7PA 1HLPA 4FFPA 4ND2A 4ZHSA 1EK6A 4UVGA 2HSDA 3SLGA 3W4KA 3DB2A 4YJHB 1NQ5A 2OO5A 3EGOA 1ZUD1 4Y6SA 4R1SA 1R4NB 3F1KA 4B8ZA 4EJ6A 2Q50A 4RVFA 3GG2A 2D0IA 3OEWA 3ZV6A 4YAIA 3K73O 1EMDA 3JYNA 3OQ1A 4BNWA 3LT1A 1JKJA 5CDYA 1PGNA 3PJGA 4AJNA 5TQVA 1YB4A 3OJFA 3VPSA 3G1TA 3F5SA 3OA2A 1I3MA 3HDHA 2Q1TA 2VTDA 2X5OA 1B2LA 2J5RA 3G3EA 3OEYA 1Y8QB 4IMRA 5CP8A 4GAEA 3JTMA 3QWHA 1VSVA 4J9VA 4J90A 4YCAA 1PJQA 5IZCC 2Q99A 4GKVA 2X9NA 4IGEA 1GEEA 2I5PO 4NR0A 3QA9A 4ND1A 4AJ4A 5H83A 3EY4A 2JD0A 2QRKA 1QYVA 4YT4A 6LDHA 3JQBA 1EVYA 4D42A 2JCYA 1P45A 5HM8A 3AM4A 3RUEA 3VC7A 2Y1OA 4XRGA 3ZNOA 4JBGA 1PWZA 3W6UA 4WEQA 2I99A 2PD4A 5JAIA 1XYGA 4I9UA 2DPGA 3O4RA 3FBTA 1ZK2A 5JO9A 3OIFA 4IUYA 4OOFA 4DPKA 1YBAA 2GGSA 2OP1A 3RVDA 2J3KA 1GYRA 4A7PA 1KVUA 2EW2A 3W8DA 4LCJA 4CMBA 4C4OA 2FMUA 4J43A 2PKQP 5AOVA 2XF8A 4BO8A 1IOLA 4MDHA 1ISIA 1GZ4A 4JJIA 5KWEA 4GX1A 1HDCA 1B0AA 2ZJ0A 4YTEA 1W4ZA 1UP4A 3DZBA 4TZKA 1KY5A 3M1AA 1NX6A 4CM9D 2G5CA 5BNTA 1ZBQA 2CSUA 3P5SA 3BIOA 3RWBA 3JQ8B 4B7XA 1EBFA 2IODA 3WIDA 5KVSA 1ZSVA 1LJ8A 2ZTVA 5BNIA 3VPXA 4PVCA 4QECA 1V9LA 2D3TA 4NU5A 3TFQA 3TOZA 2AW5A 4FS3A 4RF2A 2BGLA 1E92A 1I30A 1BHSA 5KJ1A 5IFLA 4E2ZA 4YACA 3DTTA 3E18A 1C14A 3EVNA 4RVUA 4RLSA 1UXKA 3C7DB 3WGQA 4OJNA 4CPDA 1TVEA 4CLHA 4ZICA 4WOJA 3JQAB 5K0ZA 5A9RA 1GUZA 1R15A 4J7XA 2I9PA 1DSSG 3AUAA 4JP3A 1H2BA 3GVPA 4XYMA 1AHIA 1SMKA 4DA9A 4JQCA 2DBVO 4DLAA 3ZV5A 1PGPA 5JYDA 2PKQO 3C1TA 2NWQA 3AY7A 2I6TA 3GRKA 3BTUA 3BAZA 3ORFA 4I5DA 3WICA 3VZPA 1WDMA 4QUKA 4DXHA 4IMPA 1N9GB 3CXRA 3H65A 1H6AA 1TA4A 2EV9A 4ZQFA 4PLHA 4LSMA 2Y1CA 1DC3A 3GRPA 5EL0A 4CM5A 3FRJA 3IP3A 3AI3A 3GC6A 3BTSA 3QHAA 4XDZA 1XWFA 3MWEB 1HZZA 2G17A 3LLSA 4TMFA 4W7IA 4W4TA 2YJZA 3ZWBA 3L4SO 3OIDA 1GTMA 3DQPA 4B3HA 4Z0HO 1AN9A 2CNBA 1DHTA 4BNIA 1TT5B 1MFPA 4K1LA 1R0KA 1KS9A 1YBVA 1NHGA 3FTNA 1B15A 5AQ1A 1YE3A 4U6QA 4Y8VA 3RUIA 4OAQA 3UICA 3PI7A 1EDZA 1P77A 4RPJA 4HFNA 4QQRA 2YDXA 1I33A 3IC5A 3IUSA 5AXCA 1X0VA 2GZ1A 1NR1A 3FNEA 2DFDA 4L76A 5CHEA 1Z82A 3WFJA 2I67A 4MVJA 3E82A 4TROA 4N5LA 1LC0A 5ES3A 2G1UA 2WD8A 2P5UA 4YT2A 1U7HA 3JD0A 2B4RO 4NFYA 1M2WA 3JQGA 4OOEA 4QFCA 3ZW9A 4MP3A 3PJDA 1DRWA 1M75A 4BO5A 3D5QA 4LN1A 4TRJA 3FI9A 1X7GA 3AI2A 1LUAA 4J7CA 3NEPX 2J3HA 3E03A 3ULKA 2E82A 3EZYA 3GDFA 4H3VA 1VJTA 4K26A 3O8QB 1QYDA 3UUWA 3TZ6A 1ENZA 4NJOA 3JQAD 3WLFA 1UDCA 1KVRA 4PZDA 5TS3A 4BS9A 3NT4A 3O03A 4WE3A 4QEDA 4MPDA 5JAZA 2VHVA 3OFSA 2Y99A 4WLVA 1UZLA 1A7AA 2AE2A 4IJVA 5KIAA 4HADA 3ASVA 4UVHA 2QYSA 5TIIA 3H9GA 3LF1A 3LLVA 3BTOA 2ZB3A 3ZWXA 2VYVD 1LDYA 4ZGWA 4OXKA 4I5EA 2AHRA 4QTZA 5L7YA 2A94A 3AM3A 5A9TA 2GN6A 2V6GA 5JDIC 1GPDG 2I3GA 3DHNA 1WDKA 3AY3A 3NAQA 4O59O 3D5TA 1KVTA 3ENKA 3VH3A 3VH2A 3LT2A 4BUCA 1YONA 4GI2A 1I3KA 3A14A 3B1FA 4BV9A 3NYWA 1QG6A 1NPTO 3HB4X 1WAMA 3AOEC 4WCFC 5CPBA 2JAHA 2OL4A 3DFZA 4E30A 4QSMA 4GX2A 3H5NA 2Y93A 2X5KO 2C7VA 3S2GA 2Q3EA 5JW6A 3KSUA 4YAEA 3TPCA 3G79A 2X1HA 4RV9A 4GLOA 2D1YA 4YB8A 3KB6A 4MVJG 4WECA 4BB6A 4FB5A 2HCTA 4BO3A 4M54A 1OBFO 1O6ZA 3DAFA 3BMQB 4NZ9A 5L51A 2WD7A 1DB3A 5EJ2A 5ICSA 1T26A 1JLLA 1E3SA 4HX5A 1A5ZA 1WXDA 3NRCA 5JCJA 1P0CA 4EJ0A 4PG5A 4GVXA 1P1KA 4IDDA 4CM6A 4DGSA 3HJAA 4Y9DA 4CUKA 4B7CA 5IZ4A 1WNTA 2E49A 3RBVA 3JYPA 1DDOA 2BI7A 2EEZA 3DFUA 4NPCA 4E6PA 4IQ0A 5JC1A 1IB6A 3UCEA 3KUXA 4YQZA 2BGKA 2Z1MA 4RDHA 3AUTA 3U49A 3H7AA 4YJGB 3ZWVA 1Y8RA 4WLUA 3VHRA 5K6AA 3F47A 4XWYA 3TDKA 4RDIA 3BHJA 2A35A 2J3JA 3QY9A 1Z75A 2Q45A 2PZKA 3HG7A 5TSDA 3I9NA 3NDIA 2NTJA 2ZATA 4GX5A 4ROSA 2GUGA 1B7GO 3PWZA 4O6VA 4DMMA 1PTJA 1SAYA 3TQHA 3LZ6A 4GSKA 3LF2A 3I4FA 5TNXA 4XYEA 4EJMA 1BGVA 2FN7A 1HDXA 2V7PA 2C54A 1UXHA 1DIGA 3GF4A 4PVDA 2R00C 4BVAA 2YHIB 2QZ9A 4CM4B 5JS6A 1GV1A 4OO3A 3FHLA 4IJWA 1Q0HA 3TOXA 4R5HA 1Z7BA 1YOVA 3D1LA 4MIOA 4F6CA 3ZWOA 5JE8A 5G4KB 1HDOA 5DDIP 4DIBA 2I76A 2JJYA 3I52A 1LDGA 1PS9A 3INRA 1CJCA 2BFOA 1LSJA 1LRJA 1JVBA 4U8GA 5MDHA 4JNKA 1XDWA 5BT9A 3TFOA 2FPIA 4P38A 1NM5A 4PZEA 4EZBA 3PDUA 2F1KA 1WW8A 4PLGA 3PYMA 1XA0A 2RAFA 4RPKA 2NQ8A 3I3OA 1YBMA 1U3TA 1FMCA 3ROKA 2C5AA 4YXFA 3KYDB 3OQ6A 4UVIA 5CFZA 2DLDA 3WWZA 2P9CA 4ITUA 1ZO8A 3OICA 2OGUA 1B26A 1Z6ZA 2AQKA 3RSHA 2O48X 1AXGA 4J3FA 3PK0A 4BKPA 3FBGA 4OHUA 4ZD6A 2Y0EA 4TRNA 4J9UE 4BGUA 2NTNA 1D8AA 4J49A 1MXHA 1QORA 4CV0A 4IS3A 2VCYA 4I08A 2XXJA 3WX0A 1VKNA 4IY1A 4O0LA 5B12A 1ZJZA 3IKVA 4P8RA 4E2XA 3CH6A 3G17A 3BMNA 4LVCA 1ZK3A 3OM9A 3PPIA 4GSLA 3GVXA 3OBBA 2VHZA 2VYNA 3AFNA 3IS3A 4JBHA 1O95A 4PLZA 4XRRA 4EW6A 1LBEA 4WLNA 4MINA 3E9NA 1K3TA 2AQ8A 3ZNPA 3RROA 4CLRA 4EGFA 1GQ2A 4FOOA 2BFPA 2EGGA 4DPLA 1I01A 4W99A 1CDOA 2BD0A 1D3AA 3WXBA 1ZK1A 4AJLA 4KQXA 3GDOA 5A03A 4BKRA 5JCXA 1ZW1A 3JV7A 1PJ4A 1UH5A 2GRAA 5ENVA 1M6HA 2DPHA 4RL6A 2Y1FA 2WTBA 1KERA 4AJPA 1AHHA 2AA3A 3KYCA 4B79A 5DNAA 2NVBA 4UVDA 5IXYA 2O50A 1OI7A 4ZQEA 2HMTA 4PIVA 1HWYA 4YEDA 4WASA 4M89A 3RC9A 3A28A 4W82A 3WGHA 4YT5A 5DP2A 5A05A 2GERA 1ZJYA 2PV7A 2VRBA 1MXFA 3DAPA 1PJ2A 1A9ZA 4FQ8A 1PZGA 4B7UA 3MTJA 4YBZA 5G0WA 1NASA 3DEYX 4IDBA 4PLYA 1A72A 1UUFA 2DVMA 2NU9A 3M2PA 1YQDA 2HAEA 4D44A 1U5CA 1Q0LA 3MJVA 1HKUA 1UZNA 3R1IA 1KEUA 1Y9EA 5LCXA 2X0NA 4XCVA 5DN9A 1HSOA 1R0LA 4G81A 3PIIA 3GHHA 3SJ7A 4RO0A 2O3UA 3AU8A 4XB2A 2J5KA 9LDTA 2OXIA 5I7EA 3VZQA 2SCUA 1ZIDA 4W6ZA 5B37A 1N2SA 4ALKA 1VRWA 2D8AA 8LDHA 4J4BA 3RD5A 1J49A 2O23A 3WS7A 1MFZA 1ID1A 4M1QA 3RJ9A 3S55A 4FJ0A 1YB5A 4BMSA 5JO0A 3JQBC 5KVCA 3KEQA 4OH1A 2DQ4A 1HE3A 3PVZA 1M67A 5JLAA 1KETA 2ZTLA 2BELA 3KSZO 2FHSA 3PRJA 5EN4A 1ZXBA 2VT2A 4AJKA 4NDNE 4E12A 3M2TA 3NV9A 4HFJA 3PHLA 1BXGB 4GWKA 3QVSA 3WMWA 4ALJA 2YV3A 3BA1A 3WGYA 3U3XA 1SBYA 3AW9A 2POQX 3H2ZA 4D79A 2B0JA 4CMEA 1I32A 1WLYA 4E0BA 1WPQA 2IZZA 5CAEA 4HFMA 1FF9A 1VM6A 2YDYA 4RZHA 3C8MA 1EFKA 4NK4A 5F5LA 1PSDA 4XGNA 2FSVA 3IDSA 4OYRA 3BMOB 4ND5A 1E3WB 2WYVA 1OC4A 4PLPA 5EQFA 4E5NA 3DZHA 5IF3A 3CSDA 2P2SA 2Z1NA 1TT5A 3JYOA 3ONFA 1IULA 5L53A 1QMGA 5BR7A 3ZN2A 4WLFA 3KM0A 1PQPA 4XYGA 3WSWA 2NVWA 3ANNA 2VRCA 3U0BA 2PK3A 5LDHA 3FN4A 1LLCA 4FFMA 4R9RA 5KJ6A 4R54A 2C2XA 2P9GA 5TRTA 4E5YA 1W8DA 1DFGA 4MVJP 4RORA 4XYLA 4R1UA 4QO8A 1ZEMA 2O3SA 3SC6A 5H81A 5JMPA 5I8WA 3TZCA 1E1NA 2PD6A 5H82A 2Y0CA 4PLTA 4JJGA 2DAPA 3GNSA 3IKTA 5TJ9A 4BIIA 3O9ZA 1R6DA 3PHIA 1E7MA 3LYLA 3H9EO 1CQJA 1DIRA 9LDBA 1J6UA 1ML3A 1MUUA 2B4TO 2VNAA 4ZQHA 2O3JA 4BNNA 1LSUA 1V6AA 1T1SA 1DC6A 4OM8A 4EITA 1R37A 4WGGA 1NR7A 3GMDA 3I6QA 4XQ9A 2X5JO 2VWPA 4E5KA 2CUKA 1HYEA 2YQ5A 2FZEA 3CEAA 4CMAA 1PJTA 1ONNA 4FSHA 3B70A 1CERA 1XSEA 3R3SA 4R01A 2Q49A 4TKMA 2Y66A 1E1KA 4DBZA 1KYQA 2CDBA 2C5EA 5T67A 4YJFB 1HDGO 4FN4A 3H2SA 2D5AA 4JN6B 4ID9A 4RGBA 5DOZA 3SJUA 4D0RA 4BNVA 2EP5A 2BKAA 3ZHXA 4NBWA 5C37A 3QV1A 1ZNQO 3CE6A 3L9WA 1YL7A 1WZIA 1YDEA 4NHEA 2D4AA 1GQYA 1E3IA 3VPFA 3FTPA 1DIAA 3VDQA 1YQXA 3KETA 2FOIA 2WJPA 2YZ7A 3WNVA 1DRUA 4BNXA 4BO1A 1CWUA 1NWHA 3C85A 4E13A 4ZRNA 4FJ1A 3NUGA 2RH8A 1GU7A 1IHYA 2E6UX 4J1QA 1KY4A 3F1LA 4NFHA 3DO5A 1HYGA 3B6ZA 1ZFNA 2VUTA 5IXSA 3QWFA 1LDBA 1XU9A 3DTYA 2E37A 3HB5X 3RCBA 3V1YA 2EKLA 3SLKA 3VKVA 1QV7A 4J6FA 3ZU3A 2C59A 4IQ8A 3ROPA 1DJQA 1ADBA 3ETDA 1HLDA 3IAHA 3ZU5A 1SNYA 3PLRA 3OMLA 3COSA 3ZWNA 3FNFA 4GX0A 2YQ4A 1MG0A 2G0TA 2RH4A 3NJ4A 5TC4A 3GUCA 3OF2A 5LDGA 1XCBA 2ZTUA 4KOAA 4RPHA 4FC7A 4H15A 5CEJA 2HRBA 2NSDA 5F3RA 2O2SA 4CMIB 4TQGA 4AG3A 1BW9A 2PGDA 4D43A 1P44A 2PZMA 2ZQZA 3CMCO 3L4BA 3HNPA 4P4LA 1N5DA 4HWKA 2WSBA 4Q9NA 4L75A 3TN7A 3SC4A 3X2FA 3AOEA 2ZCUA 4II3A 1LTHR 3EMKA 2B69A 3K30A 1AXEA 4QT0A 5CDGA 3QP9A 2VZ9A 4JBIA 1GAEO 3T4EA 4CODB 8ADHA 5L7TA 4LK3A 3L9XA 1E6UA 1V3VA 1X14A 3ETGA 4E21A 3RKUA 4RVSA 3JYLA 3FNHA 2XPCA 2AXQA 3E9MA 2QRLA 3I6IA 1K6JA 2CZCA 2VT3A 3I83A 3PIDA 1DBVO 5HS4A 2JAPA 1JWAB 1GV0A 2ET6A 4AVYA 2NV6A 2VWQA 5JY1A 1JKFA 5BSGA 1P1FA 4EEZA 3ADOA 4YJDA 3KBOA 4CQMA 2DBQA 1DAOA 1YL6A 3DMYA 1E7QA 1RYEA 3GLQA 4QFDA 1DFIA 3B1JA 4BL5A 1DPGA 7MDHA 2P4HX 4JP2A 3SX2A 4BGEA 2NU6A 1Z45A 4ESOA 2E4AA 4WK6A 4IDEA 3HDQA 3INTA 5IDQA 1E6WA 3PQFA 4KZPA 1LQUA 2J8ZA 5L9AA 1N1GA 4HNHA 2QHXA 3C7AA 3WQRA 2IZ0A 2YYYA 5JCJD 3KV3O 1HT0A 1PS8A 2VRCD 3UF0A 3ZNNA 1YQGA 2C29D 2RBEA 4RPGA 1E0DA 3K9QO 4RQUA 1YO6A 2Q4EA 2HDHA 1L7EA 2EF1A 1W0CA 2JD1A 1F12A 3PQEA 2WEKA 5THKA 2FZWA 4MJLA 2OHXA 3P7MA 1YDWA 5AXAA 2AE1A 4YR9A 1EVZA 1PL7A 4PZCA 4GKBA 1XKQA 2D59A 4MP6A 3SEFA 1E1LA 2B5VA 4NFSA 1V35A 1E77A 2BLLA 5T64A 1GUFA 4U5QA 3D7LA 3I9LA 3HQ4O 3OJLA 4L8VA 3CMMA 2QX7A 3LQFA 4HV4A 3NJ8A 4A2CA 2W2KA 3JQ7B 1QSGA 2DBZA 2LDXA 4MIEA 4NBUA 2Q46A 3ZWYA 3S2IA 2HMSA 4NG5A 5I8ZA 2C82A 3HN7A 4UREA 4LISA 4CMGA 4J1SA 3OJ0A 3QIVA 5F1PA 2ZB4A 4DIFA 4Z6KA 1LLQA 3LT0A 2GCGA 3VTFA 1LI4A 1I2CA 4PN3A 1K6XA 3BMOA 4CLOA 1SB8A 1I0ZA 3GQVA 2Q1SA 4BKUA 4YQYA 4CR6A 3Q2IA 3AWDA 3S2EA 1PJCA 4P4GA 4CLOB 4EUHA 4FCCA 1QRRA 1BXGA 3E5MA 2HJRA 4JXKA 4B8WA 4OGWA 4BO4A 5JDCA 1VKOA 1GR0A 1D1SA 3MTGA 4KWIA 2A9FA 3QVTA 3MJ4A 4YRAA 3AM5A 2VZ8A 1X1TA 2NADA 3BTVA 1WZEA 1QYWA 3P2OA 3VVBA 5L40A 2YV2A 3D4OA 5TX7A 3GFBA 5JAMA 1UP6A 3VH1A 4HY3A 3PFFA 5U1PA 1BRMA 1V3UA 1ZH8A 2X9GA 4DVJA 3Q2KA 1CYDA 3G0OA 3ZH2A 4A0SA 3T7EA 1YJ8A 1GEGA 1Y8QA 2VYVA 2DBRA 1ZCJA 1UP7A 2JFHA 3DHEA 1T2CA 1UAGA 2HMWA 5A5EA 3WG9A 3TZQA 1Z74A 3RAJA 1Y81A 4L74A 4FD3A 1IE3A 2DU8A 4YDRA 3CPSA 5U9CA 3QQPA 4FC6A 4CM8A 5K9ZA 4RCVA 4D3FA 2C7GA 3NT5A 4URFA 2HO5A 3RFVA 4WCFA 2F00A 3LK7A 3GVHA 1MP0A 3PEFA 4FFRA 3ZWWA 3JQFC 4BO2A 1ORRA 4NNJA 1RM3A 2GN4A 4D41A 2G82A 2R2GA 3OA0A 3EYWA 2FR8A 1J0XO 2NLOA 4CM1A 3RASA 4W7HA 3KSDO 2AG5A 3D0OA 1YL5A 4FIZA 3DMTC 5MGBA 2QRJA 1JQBA 2J3IA 1MA0A 2E48A 3G1UA 4MOWA 4XA8A 3KYCB 4IXTA 3D4PA 2EJWA 3DBHB 1GY8A 3PDJA 2CVZA 1ZEJA 2WM3A 2HMVA 3SXPA 1Q2XA 1U9JA 3WGTA 4M86A 4CLRB 1PZFA 3KEOA 1ADCA 4WPGA 1PIWA 1EZ4A 3WTBA 3CZMA 3OJEA 3H3JA 3S2FA 3W1VA 1IZ0A 1F8GA 4E5MA 1B8VA 1FDUA 3PHJA 1GL3A 4ILKA 1DAPA 4L4SA 1C1XB 4CV2A 3OP4A 4EUFA 1U1IA 1NWCA 4XYBA 4Q3DA 3WGGA 2IEDA 4JIGA 4P22A 5DCWA 1GQQA 1QYCA 3DZIA 2VYND 4BV8A 4UUOA 4AJJA 5FEUA 4MKZA 1ULSA 3ZV4A 1DC4A 3FPLA 3GT0A 1F14A 1VL6A 4DPMA 3W4IA 3V8BA 2VN8A 3UW3A 4Z0TA 4UUNA 1QYXA 2LDBA 2IYPA 3WQQA 4CM7A 1RJWA 3UVEA 2VOEA 1HXHA 4H16A 2OP0A 2YY7A 3PGJA 3ON5A 3FR8A 5ILOA 1JVSA 1BW9B 4W9NA 5FYDA 4I9NA 2CFCA 3QVOA 3VAZA 4ONEA 1EE2A 4LW8A 3CTMA 4XZ3A 3H9UA 2UUPA 3GZNB 3OH8A 1A4UA 4Q3EA 3AJRA 3OECA 3HSKA 2HKIA 1ONPA 1KIFA 1PX0A 3GHYA 2NUAA 1YXMA 4RF3A 5G0SA 3W4JA 4XR9A 2GNAA 5T6BA 1Y6JA 1HDYA 5BSFA 5IDYA 1DXYA 3EVTA 4LMRA 1VL0A 2EERA 1KVQA 2AMFA 3K2EA 3BXXA 3KZVA 5TJHA 3U09A 2OBNA 2O7QA 1HRDA 3U9LA 4WUVA 5DBFA 3BMCB 4BO7A 3C3XA 1EQUA 2CD9A 4NQZA 3WWYA 1SEPA 1HDRA 4R3NA 4Q3BA 3UXYA 3AK4A 1JKIA 1LU9A 4OL9A 3WB9A 3D4NA 2NU8A 1MB4A 2Y0DA 1ISMA 1T24A 4F45A 1P1IA 5EPOA 4D45A 1ZVMA 2Z95A 1A7KA 1R12A 1ISJA 3D3WA 3KLPX 3ANLA 1RYDA 1NHWA 3ITDA 2O4CA 5IN4A 4NH4A 1CQIA 1Q7GA 2O3QA 2IRWA 4U0KA 5BNFA 3PJFA 1E3EA 3G49A 5A4DA 1C1DA 1M76A 1QR6A 4HKTA 4K6FA 1NFRA 2PGJA 3HUDA 2W90A 2PNFA 5B4VA 2DM6A 1J5PA 4CM9A 5DBIA 1B16A 3FWZA 4I9HA 3H6KA 4DWVA 4DQXA 1UZMA 1BXKA 1BXZA 3KYBA 4XGIA 3PYXA 1C1XA 4YAKA 1DC5A 2V6FA 2Q1WA 3JD2A 4FR5A 4IDCA 4E4YA 4XDYA 1BSVA 1D1TA 4JGBA 4FDAA 1Y5RA 4GLLA 1PL6A 1GD1O 3L6EA 4PGFA 1IY8A 4K6CA 1ZZEA 3IP1A 3A4VA 4MP8A 3ADPA 3GA0A 4LGVA 3S1LA 3VVCA 4IDGA 3HWRA 1IUKA 1JDJA 3HZZA 1K6IA 4K9DA 4WOKA 2NNLD 3NTRA 4I1IA 2GR9A 2HRZA 3GR6A 2EWMA 4ALIA 1JU9A 2PZJA 4MO2A 4ZA2A 5HTOA 3ETEA 1DIHA 4BQPA 5T8KA 2HLPA 1N7HA 1MLDA 3DR3A 1I2BA 4GGPA 4BHTA 1NFFA 2AEFA 1SC6A 3MJSA 1NAIA 4GL4A 4HXYA 3GUYA 4N7RA 1E7SA 3CIFA 3ZGYA 3VPGA 4AJIA 5A9SB 2TMDA 1ZMOA 4I5FA 3RQSA 5L95A 1P31A 1U2DA 2W2LA 2PGLA 1KBZA 3UH1A 4N5MA 1AUPA 1E6EA 4O5OA 5KTKA 1VI2A 2PA3A 1VC2A 2D2IA 3GPIA 3WMXA 3A06A 1AE1A 3QVWA 4MVJD 4KQWA 2ZIZA 3GY0A 1R16A 2GSDA 2HJSA 4KUEA 4XQEA 3QJ5A 3CKYA 3IJPA 3R6DA 1LA2A 5J23A 5KNLA 3D3EA 3Q3CA 1NAHA 4WJZA 2QW8A 3U5TA 1BMDA 2WYWA 4OKIA 3TF5A 2AG8A 1F8FA 3RUFA 5BSHA 4FGSA 1ZKMA 4CLXA 5I9MA 4W9NC 4GPD1 3W8FA 1WP4A 4M87A 1DRVA 2BFMA 1DLIA 3DBLB 3AUUA 1D7OA 4DUPA 5I7SA 2DTDA 2FPPA 1K2WA 2X58A 3GMSA 1H94A 4OSPA 2X9VA 3PQDA 2EHDA 3AUSA 3T7CA 2W8ZA 3UOGA 2YV1A 2C2YA 4MVJH 3A9WA 3GN2A 1XHLA 4BO6A 2WDZA 4NI5A 1EUCA 2I66A 4C7KA 2EGHA 2FR0A 1H9BA 1J4AA 2IXBA 3GGGA 4XEHA 4R16A 2HK7A 5JFOA 4PG7A 4L73A 4HFRA 3DAGA 5EQDA 4N54A 3F5QA 1JTVA 4WLEA 3I23A 3ONEA 2UUOA 1HTBA 3F46A 1K89A 1LEHA 4IXWA 2UV8A 3GEMA 4FFLA 1T4BA 2VHXA 3WGOA 2YUTA 2J6IA 1FDVA 3ZV3A 1HF3A 3JSAA 3C1AA 1QP8A 4M8SA 4FFOA 3ST7A 1DIBA 4YVFA 5EERA 3C24A 2B36A 4IGFA 1I10A 3QWBA 3UCXA 1ZK4A 5ITWA 3I9MA 1GYPA 3TRIA 3IJRA 5G0VA 2NVUA 5AYVA 1GYQA 3DMTA 2BI8A 2EG9A 1K5HA 1KC3A 1N9GA 2BRUA 1PU2A 5TT0A 3OJOA 4MVJM 3MEQA 3IUPA 4U6SA 1ENOA 2WD7B 5CG2A 1ENYA 2O4UX 2Q2QA 4TRMA 3WBFA 3EDMA 1WVGA 2GN8A 3H8VA 1OOEA 3RJ5A 4KDFA 1P1JA 3F3SA 5GZ6A 4FOSA 4ND4A 1R4MB 1RM4A 5TT1A 1PQUA 4Z3DA 3AOGA 2W4QA 3ASUA 1GCOA 1WMAA 3JQDA 2Y68A 2H9IA 3I9KA 4YYZA 2V65A 4B3IA 3CUKA 4BNZA 1EFLA 4J4HA 4WEOA 3R3JA 2BMAA 4UULA 4UUPA 4Y67A 5A06A 2W98A 5KVQA 4CQMD 4CL3A 1LDEA
chains in the Genus database with same CATH superfamily
1XDSA 4M99A 5FFNA 3DMFA 1XAGA 1NVVQ 1YQ9A 2X77A 2XVYA 1KI8A 2HT6A 1N57A 4DZRA 5IUNC 4POOA 4A26A 4E3ZA 5TDHA 1KRWA 3A1WA 5GMOA 3U7HB 2I8LA 2YWGA 1AQJA 2FWMX 1S3IA 3NR2A 2FMTA 3AVTA 4RIIA 3HFRA 2V59A 1DZ3A 5D3QA 4G4SP 3A70A 4AM8A 2Y1EA 3LVQE 1A98A 4J7AA 1O6BA 2P1RA 2ZAGA 2CLKB 5LQMA 1RAHA 3C0KA 3JQ6A 1TTPB 4O33A 1QZUA 4MV5A 1RCTE 4ETMA 1Z0JA 1HDEA 2FHPA 1SG0A 3SR3A 1Q0RA 2BTOA 1NI4A 5JZVA 5LB2A 3WJAA 4X7RA 3NTQA 5EGNA 5JDIA 3IVXA 3OT1A 4RULA 3RJMA 4PLFA 3UPUA 1QBGA 1SCUA 3FPCA 4NS1A 4ON9A 4Z0PA 3TBKA 4A3SA 3IERA 3U16A 1CRWG 1Z4OA 4B17A 5KQLA 3THWB 1EWTA 4C3VA 1TAHA 5C7IO 4FX5A 2R6DA 4L5BA 3H9QA 2XTAA 4QJ4A 3IVMA 1PJ3A 2GCOB 4JP1A 4TTJA 3EOAI 5T6MA 1FU8A 4GM1A 2V4MA 1SCDA 1ZCZA 3QUBA 3CUVA 1GG2A 3R20A 4JXXA 1A1VA 4IDAA 1V8OA 3BB1A 1A9QA 3PQ4A 1WSAA 2H1IA 2WAOA 3MTAA 1ZK0A 3FLEA 3HUEA 1J06A 1P60A 2JI8A 2WIBA 2WJ3A 2X0JA 4RA9B 3TIXB 4BRUA 3GPDG 4U3JA 3O4VA 4FGWA 4YJ3A 3H1GA 1Q11A 2FW0A 3GZNA 4JUFA 3RK4A 4YALA 4F4DA 3RBZA 2CJWB 4I1PA 1RRMA 3KVRA 3P20A 1SBNE 4NZPA 2BEUA 3NONA 3SHOA 3ANMA 2PWBA 1W5EA 3QNUA 4CUZA 1NATA 1KE2A 2P6UA 2CF6A 2H0RA 2YCBA 2PBFA 4JU9A 2FFAA 1DOHA 2VDRB 5JV5A 3CPHA 4EAQA 4LG1A 4BFTA 4ZI7B 5I6DA 4CLDA 3ZKWA 5M29A 3VV2A 3H8WA 4W9MC 5FPYA 1E2DA 3ENZA 3VUFA 2CY0A 1BX1A 5GV8A 1ZJ4A 5HF6A 3P9QA 4UQPA 3HYRA 3USES 5LYJA 2J3EA 4OQ4A 4RQBA 5JSHA 1ZLYA 4BU0A 4ALLA 1X2EA 2G7ZA 4MKXA 4NMHA 2FDXA 2SECE 2ZI7A 4C4AA 5NLLA 3DCJA 3LA6A 4UAVA 3CEPB 1AG9A 3HCCA 1X0XA 4OHKA 4TVOA 3UH0A 4EI2A 1JN0A 5C5CA 2JL1A 2CEKA 2VP9A 3LNTA 4MWEA 3FF4A 3M3HA 4LF7B 3EUWA 4ZVLA 1S89A 1VHLA 3DAHA 4R9SA 1X1SA 3M33A 1DRKA 1R9NA 5C31A 4BNFA 5T7BA 5H1YA 2RIRA 2QG4A 4UHJA 4BEBA 5DLYA 5DCLA 1YWGO 5DCUA 4EBBA 4V39A 2A0XA 2VI5A 1MAUA 3BB3A 3PC8A 4FJ2A 4IFTA 3K6JA 3L7CA 4LHWA 4OHPA 3WLRA 5IKEA 1E2EA 3REGA 2KQUA 2RH9B 1TUEA 2XUQA 3Q0TA 1W9HA 2JHCA 3EHEA 4RPIA 2C77A 2XECA 1X7YB 5KC8A 3A1VA 3DBHA 1U5BB 4DZTA 5IM5A 5K0LA 3O0TA 1EJBA 2JGIA 1R4MA 2VFAA 3C8DA 4BVKA 2B3DA 1IQRA 3D1JA 4ADSG 4BJ6A 3CU5A 1P4GA 5A7GA 3DG9A 2QVGA 2PX8A 2FUEA 3BDIA 5DHRA 5IJ9A 5ITZA 4QVIA 1HL3A 3P9ZA 1J90A 1AM4D 4AN4A 5JH7F 2C84A 1TLTA 3ILHA 3OWHA 3A3NA 3WBKA 2XCSB 4UOZA 2WG1A 3PNPA 5F9FA 2C2KA 3FYUA 3OETA 4R8MA 4QD3A 1E62A 1U9CA 5FL7A 1SVUA 4IHJB 3HHPA 1T2DA 3WMEA 4R41A 3UJDA 3LQ2A 2QZ4A 1D5CA 5EINA 3B60A 1TU0A 1YS4A 1HE1C 4M9ZA 1LI5A 1A9YA 1MN6A 1ZS9A 1OMOA 2VUIB 4IH9A 3VU1A 3LECA 1T8YA 3K5IA 2WT4A 3P19A 1KL7A 4TTVA 4B3RB 1CZOA 3DVLA 3SJCA 1FRQA 1IC6A 2PWYA 3GP3A 4EZEA 4W8HA 1CY1A 3AFMA 1QS0B 4MS1A 1G8FA 2H7YA 3FNBA 2ONYA 5B1SA 3FPBA 4N47A 3FYHA 4DCMA 2ZEJA 3HU2A 1DCMA 4OHWA 4R71A 1VHJA 2NM0A 1CBUA 4WCFB 1HG1A 1ZGJA 4NJEA 2BF7A 1NIPA 3SFTA 1XFAA 4HC4A 3URMA 3RSOA 4HRYA 5HKKA 4LVNA 4G41A 4FONA 4NU6A 3PLAE 4G01B 4L9RA 4KSBA 5TQJA 2JLCA 3VV3A 4BQOA 5KC9A 1E9RA 3K9NA 3ROMA 3R5JA 4LRSB 4A0HA 2XCQA 2HU8A 3FDZB 4TTQA 1N6NA 4CCSA 1IONA 2XKKA 3DWFA 3KRTA 2ZM5A 5BN1A 1Y3IA 5EWJB 3OQBA 3WOHA 1Y4SA 5I48A 3IUBA 1EFPA 3ORQA 2V58A 1JZQA 2VAMA 2FWJA 2VDKB 3M1LA 4PRYA 1XQ6A 3QBJA 4C7JA 5C5IA 1K3FA 4HNGA 4BKOA 4Z7OB 4DV1B 4ZYTA 1K0FA 4QFMA 4BC1A 2X15A 4JC5A 1FS6A 3KSRA 4L5IA 5B4TA 4GI1A 1NVTA 4L4RA 4ZO4A 1JKMA 1N1MA 1W47A 2QV7A 3G88A 1LSOA 3LC2O 3NI2A 4PG4A 3DEFA 1IM8A 4ZQCB 2PZ8A 2J3DA 2WMNB 5IAOA 2ZJ1A 4GVLA 1DHRA 1OCEA 1TW2A 2B83A 2CMDA 3H2BA 5EJFA 4XJTA 5DM2A 1NQUA 1W93A 1AQIA 2H0QA 2FN3A 1SQ5A 2JD2A 2AFHB 4DVGA 2XNDA 3RREA 4EPVA 1BMQA 2EU8A 2BVNA 3LPCA 5G4KA 4F2GA 3PUVA 3WAGA 1JQAA 2JCVA 5HKAA 3H9BA 1WRBA 2YNMA 3LE8A 4JXZA 5AM4A 1L7QA 1XZMA 5LXTA 5AR1A 3LRTA 3MT0A 2PZEA 5JSYA 3OT4A 1L2TA 4KN9S 2PPVA 1QYRA 3E22B 2RHRA 1JJIA 3GQBB 4DT1A 3K1TA 3VXKA 4XQCA 1E7WA 1H69A 4QVKA 5LUAA 5EKXA 3PL5A 4K0KB 2OC9A 1ZJ5A 3I01M 3MZ0A 5DCYA 2VH1A 4RETA 5DXAA 1Y6ZA 4YJGA 4EB8A 4XFJA 3SZMA 1ZD8A 1YQUA 3JQEA 4GE3A 2F90A 1FCJA 5KKAA 4L4XA 1PFVA 1Y3AA 2K87A 4RTPA 4YPOA 3TVTA 2ZB2A 3BXPA 4Z8YA 3V42A 1NBME 3SM3A 1RXCA 2G4VA 5H4GA 4B6RA 2X7XA 1GZ3A 1ZKDA 3F3YA 2Q5IA 3KTDA 4NCHA 3I30X 4Z99A 1HZJA 4J2OA 1N34B 3PNKA 1SEVA 3IDOA 2F48A 3NGLA 1OXSC 3A36A 1W36B 3ZDDA 2G72A 4U0JA 3V1TC 2XUKA 1K5PA 2NACA 3F90A 1EI9A 1PR1A 4LE0A 1R6VA 4G1MB 1E9EA 4IIUA 3KZNA 3PRHA 3KTFA 5E4JA 4OHYA 2GD2A 3SGLA 1ULZA 2HXSA 3C7CB 3LQRA 3PFCA 4WXYB 5D3MA 2DT5A 5HBRA 4NPAA 2XDQB 2ZB8A 3VISA 1GM5A 5H4HA 2A14A 3OPYI 4HAIA 4K05A 4QLOA 3PHGA 2I6QA 2QPTA 4JAVC 2EZ4A 4Z86A 3LQYA 1XJQA 3W3AA 2F6RA 2IEBA 3TXYA 2O5EA 1KJNA 4Z9XA 1MRZA 1ZNXA 2YJ3A 5B58T 3RC7A 2CLLB 5IHXA 1TUBB 3KXDA 4OK6A 3DCIA 4PR3A 4IOJA 4XX0B 3U4GA 4YP5A 1USWA 3R9WA 4C1NA 1C0KA 3QMPA 1J0CA 1C0LA 1KJ8A 1TUBA 5LMNB 2DUNA 1G17A 3GLSA 2D00A 4PX3A 4N0EA 3FCSB 5A2QA 3X1ZA 3N0VA 1DCFA 2IPXA 4GMGA 2WW8A 3SF0A 1HFJA 3E3AA 2X1LA 4P0PB 1RIFA 2ZJ7A 4C6RA 2Q8NA 3WHIA 3EVDA 1QR2A 5HKOA 1EDOA 1XJWA 2RCYA 2GN0A 3BERA 2J0SA 4RVHA 4EG6A 5EQJB 1VYVA 5GONF 4HWRA 2ZUDA 3BUSA 5AKEA 1R0CA 3QK7A 4AP5A 1UDWA 1G9SA 1JU4A 2PH5A 4Z9FA 3HP1A 1G7RA 2C3PA 4QUIA 3L7DA 4E7PA 1I3LA 3ITKA 2JFQA 4A6DA 3VNSA 2BHLA 2K2WA 2WJ4A 3BMNB 2FEMA 4D9CA 4DDHA 3EIQA 1DFHA 2I6FA 5KJEA 4KLZA 3PRKE 5DNVA 4EGAA 1NKSA 2J5BA 4MUFA 3X2EA 1CUYA 2FUG6 5JD5A 4MDYA 1DG3A 1SZDA 2ZFUA 1VB3A 1KTVA 3N3BC 4TV9B 4B33A 4C3ZA 3K2IA 3N87A 3PFWO 3SDZA 5EG5A 5FI5A 2NO9A 5DYNA 5DP1A 4TWJA 2PH7A 1F2UB 1N2CE 3LA8A 1X19A 1JDZA 3IMFA 3LSYA 3V7YA 1JNYA 4D3DA 4YUAA 5BN3B 1FZQA 3UJNA 1OB5A 3FCAA 4XM0A 5IUKC 4A6EA 2JCXA 1RS0A 5CVDA 1N2BA 2QW1A 3KK0A 1AD2A 1GCAA 1Q74A 4JWKA 1UK9A 5EXTA 4GBJA 3RYFA 1BDBA 1P3JA 1ISHA 1TRHA 4JQYA 1TMYA 2A4KA 2ZK7A 1QCCA 2ZI6A 4TVBA 4X97A 4BEWA 1SOMA 2QWXA 2CMGA 3BGIA 1C3VA 5JYBA 1L4KA 1MV8A 5CX1B 4YMUA 2OC4A 3BWMA 1AXRA 2IV7A 1PLKA 2J48A 3OFKA 1FDWA 3QMMA 1X7XB 5SZJA 3KQNA 1PFGA 2G76A 2ZRCA 2Y6VA 3HDYA 5FR1A 1KAMA 3KOUA 1CUCA 1P81A 3BWDD 3GRUA 2QR2A 5CIQA 4US0R 1UOEA 3O92A 3UAXA 5AUPB 5DULA 2R00A 1DWPA 2Q4BA 3MQ2A 4JIMA 5JIBA 2YWEA 1KEWA 1J42A 3O38A 4BFCA 1QH1B 1TJ3A 2PUVA 2BKUA 3FCOA 1BFUA 3QSYA 5F1KA 1E7RA 4UHEA 2NZVG 4R8VA 4LDQA 1DI0A 2R1UA 2XNSA 4QNRA 5BMOA 4P82A 1D09A 4M7PA 3IT3A 1Q0UA 3OJXA 2NO5A 3IUYA 1DPFA 4WNAB 2GK3A 5J43A 3ROGA 4O63O 2BN4A 5KYVA 3WL8A 1MQ9A 1SVKA 3HR8A 4URWR 2COKA 1P5JA 4LJ8A 5C46F 1XMOB 1LDMA 1Q95A 4DREA 5FXMA 4DA8A 1IN5A 1Z5NA 4AZ3B 4KWTA 3MWEA 1MB3A 1I9GA 1M5RA 4HDNA 1CX9B 1V43A 1U3VA 2F3UA 3E9CA 4LDAA 1T25A 1ODCA 2JGMA 1T0BA 3M34A 2CHGA 3B2EA 3QVUA 4QARA 3N74A 2JIBA 3RC1A 1UXGA 1HMPA 2QN1A 1BQ3A 3BX1A 4GZMA 4HBGA 4BUZA 2OB1A 1ODTC 5DHPA 5C7OO 1PE0A 4LRWA 3KKOA 3JD1A 3O31A 3WNCA 5CBKA 3HFJA 1ADGA 3E9DA 2ZPAA 5C8YB 1E1MA 3O2QB 3QSGA 3E8XA 2QM0A 3PCRB 4IW3B 3ESRA 4ITVA 3KSBC 1DGQA 3FPGA 2FUCA 1NXQA 3SN6A 4TSFD 4FBLA 1WHSA 1V7PC 3OP1A 3AEZA 3E23A 2BIFA 3NWPA 3WYEA 1JZSA 1BS1A 3PBKA 4FQ7A 4QG3A 3EZ2A 1CQPA 1DUVG 2BFFA 4YPFA 5MN6A 2RGBA 4OXNA 5IM4A 5KYGA 4F9FA 2QQ5A 2VJYA 3BF7A 3K0HA 1VPVA 2R11A 4G37A 3FPSA 3MWDA 3R44A 1CR4A 4OLJA 4GPIB 3MAJA 3DGFC 1OT3A 4EYOA 1DC8A 4MW9A 3K4PA 4G1CA 1E7YA 2PFGA 2Q5FA 1I7QB 2F3QA 3QJGA 4GG1A 3GDWA 4NBSA 3ANYB 2P5YA 2ESRA 3VOSA 1NG1A 4TVKA 4GNKA 1AKYA 3PNYA 1TJYA 4JLVA 3E9QA 4NULA 3NVDA 1FDSA 3MUNA 4X20A 5F2NA 3O3NB 1CEYA 4PSKA 3IEMA 5K2MA 3FH0A 3UTCA 2VSQA 1F2DA 3IMCA 2GYVA 4O4IB 3H86A 3NEYA 3QPCA 1BROA 3NCTA 2Z6VA 2FSFA 4NYIR 1O3YA 1C8BA 5K7SA 3ZI0A 4C2UA 3L79A 5ERYA 4L9AA 2QE6A 5FI3A 5CDHA 5EJIA 1YGYA 3ND9A 1Y3BE 4RY2A 5TY0A 5CXQA 3WISA 4RKYA 4TYMA 1MABA 1ZM4A 2QTTA 1YRLA 3ADKA 3DKRA 1QK3A 4QFBA 3LS2A 4U7HA 5SZKB 4XLZA 4PX9A 1N6IA 3VKWA 3RSCA 3C3CA 4HDNB 4B4UA 1KA9H 1G3IA 3DDNA 4BOYA 1JKXA 1KXJA 1REQA 4Z54A 5I9LA 2VDNB 3HS3A 5ALVA 1M1UA 4XEUA 1X1EA 1N0IA 1OAAA 2XQIA 4OXXA 5F3WB 5FOVA 3U56A 3DC7A 1F4LA 5E2BA 2B30A 1N1DA 4QU9A 5DU2A 2NVOA 3UWSA 4TZ0A 1MOPA 5AMXA 3GEIA 4RH3A 2KMLA 4P3PA 4C6SA 5L3ZA 3C8UA 2VTBA 4LC0A 4KWHA 3L6OO 2PR2A 3B5IA 1RI4A 2E0IA 4D6YA 1XXLA 4LJLA 2B6NA 1WBDA 4HXGA 1YFKA 3F4KA 1XG5A 4HNUA 3SMVA 3CEJA 2JFFA 3UXMA 3LX4A 4N0DA 4BLVA 1UQUA 1U0RA 4UEOA 4BGVA 4BCDA 3UMFA 1E3JA 4WFJA 5EZQA 3ZU4A 3W1EA 3DOIA 1P33A 2GEFA 4O2BA 4AAYA 1CVRA 4O1IA 4F6LA 4BTLA 2OCPA 1QH1A 1Q1GA 1TJPB 2Q0QA 4YCJA 3ESBA 3OY2A 4V02A 1WMSA 3JQGB 4HPWA 4DS3A 3V4LA 1KJWA 4HS4A 3NWBA 4FXPA 2Q5EA 4KQFA 3UG6A 3NHRA 1GPAA 4PRLA 4DG9A 1CUWA 5KDOA 1E89A 1BFDA 2AG6A 3IPCA 3NORA 2X6QA 3LQ4A 4FT2A 1I4LD 1RWBA 3DZFA 1RHMA 3U9SA 2GZ3A 2ST1A 3BDVA 3I39X 1SXGA 1RM0A 2ZYAA 5G0UA 5FTLA 1WEHA 3JVEA 3CNNA 1JBEA 2IYRA 2QU8A 1K5GA 4PYKA 4X84A 3W78A 4D4LA 3HEMA 1R6BX 3EF1A 2WUEA 3DKPA 2FN9A 3HVRA 4DQDA 2JBAA 2PTGA 2A9OA 2R8YA 3RFFA 3H1BA 3ZWAA 1XO1A 2ZJ3A 2C92A 1GPJA 4UD2A 1NVMB 1XMXA 1A4XA 5KKCA 2GYWA 2WQ6A 3MCVA 4FE3A 3RTGA 5HX7A 2O7RA 5K0TA 3UY4A 4Q3KA 2VC2B 2GM9A 1L1EA 3C1OA 1KNXA 4HNRA 4BE4A 2I4TA 2IU4A 1QLJA 1ZH6A 2A0KA 2YY6A 2D4HA 3W2EA 4KIWA 3K1ZA 1WSWA 3HB1A 4UARA 2C20A 4XGKA 3VR1A 1D07A 4BMNA 3ZJVA 1Q7BA 3G0CA 3DKKA 3B7WA 2PL1A 3MIIA 1H4QA 1PYOA 5E6RA 3GFQA 4GU5A 2I0FA 2JGAA 2PRJA 4PLCA 4AS2A 3O8BA 4O4IA 2GBLA 2B0CA 5LP6B 1JR3D 2AI2A 1CY0A 1T8UA 3U62A 1VXRA 1NXWA 3AIOA 2HJHA 2GAOA 4D3SA 4CMCA 2XODA 2O7VA 5EUQB 4FE7A 5F7OA 1M8JA 1HMYA 5GZ3A 3TLZA 1O95C 1F06A 3T7IA 4BYGA 1N32B 3DE3X 4AO8A 3TDNA 1AKNA 4FGLA 3TZEA 4BMVA 1I3NA 1GDDA 1TB4A 5TR9A 3C3DA 3PRYA 2XVZA 5EMHA 4KXNA 2ZT6A 1U0LA 3BWCA 4ZT4A 1TEXA 1L6IA 4CV1A 5A4FS 2IHVA 2UZ3A 3JQAA 1D2CA 4PSCA 1QTNA 5DO9A 3DDSA 2NVUB 3MWDB 1ORIA 1BDJA 5ADHA 6YASA 3HO8A 4HDSB 3QH4A 2GHTA 5AI6A 4BNTA 2BMEA 1EEHA 1EM6A 1LRKA 3O9MA 5JSFA 4FDLA 2FMIA 5DSZA 2QX8A 2B37A 4NU0A 4WZ6A 1PUIA 2OG2A 3IQIX 1SCIA 2Q8PA 4GPZA 1XYVA 4RMIA 5DT9A 4ZKDA 1Z4NA 4Q18A 1EFRA 1K8YB 3NANA 1NNUA 2AR0A 3IL2A 1PNRA 2P3SA 3PFBA 4A73A 4U2FA 3OKAA 1R5JA 2VXCA 1OSNA 3G02A 4E5PA 5A5DA 4IKPA 1PS0A 2MR5A 3H3FA 4KWCA 5DSXA 3REOA 5CCEA 3JCZA 1FP1D 1RZUA 3K94A 1KYWA 3FDIA 1KEPA 1YTUA 4DOMA 1G21A 4EG1A 1SR8A 1KJQA 4WKOA 4CQMD 1JDBC 1TUGA 4XVUA 3RAFC 5FFFA 2XQGA 1USIA 1A77A 2VJNA 2PZAA 3CZ4A 1THTA 3GVIA 3L7LA 4HH4A 3TE7A 3UK0A 1CEQA 1Z4PX 4HGZA 4V3CA 1ZRHA 5TB5A 1OAKA 1TE2A 3A9VA 3CRRA 3CPEA 3T52A 3ZKWB 3NHFA 4GBGA 1V8FA 2ZSJA 3HMQA 4GYWA 4JJ4A 5JTTA 3FOZA 1QV6A 1YS9A 4AT1A 1ADJA 1OY1A 3SS9X 3A9UA 1BWPA 4G0ZA 3PC8C 2DWOA 3HLYA 3V4SA 3QKWA 1IQPA 2GCEA 3I37X 3IBYA 3OM0A 4JR0A 3SBXA 2QRMA 5I9NA 3WR5A 1QONA 2CJFA 1P2SA 1JQEA 1LBQA 1YZVA 5A5FA 5F3DA 5KHAA 1U8XX 4LF6B 2QJOA 1VL1A 2PVCA 4LRTB 2AVNA 2QVYX 5AHKA 4RMNA 4D6XA 3IEPA 3P2KA 3JAWB 1VJ5A 1XRSB 2JRCA 1Y80A 3B6IA 5AW9A 1QHHA 10MHA 3TZKA 4ZJUA 3NWEA 4JVMA 3FAZA 2GBIA 3EDOA 4IHKA 5CR9A 2MSNA 1KSGA 1L4NA 1H4VB 2QN6A 2OV6A 2ZIXB 2X40A 3PX3A 2UVDA 2WUFA 4OA5A 2G36A 1OBHA 1T1EA 3BQMB 4OX9B 1ZVVA 3ERCA 3K2QA 3LYAA 4RV5A 1T3SA 1H0KA 3RDPA 1WMBA 4ZQBA 1YVEI 3HUTA 3Q7PA 1V25A 4MUAA 1U2TA 5IP5A 5LD2C 1JAXA 2HHHB 4I4TB 1XVLA 1CULC 1EUZA 1LBTA 2YRFA 2DFVA 3D2BA 4GICA 4IJUA 4J94A 5E4TA 3QKSB 5FL7D 2FN8A 2HJGA 2XT0A 1VG9B 4B5KA 1Q77A 5HA5A 1OV6A 2WWGA 4ARZB 2JFPA 3HCPA 3O9VA 4IDNA 4CR8A 4QELA 1WR8A 2D74A 5FOXA 4Q12A 1IZZA 4CWAA 1V96A 5JC8A 2P3OA 1CU1A 2EZ9A 4DDMA 2F8TA 1IJEA 1B93A 3TI7A 7ADHA 5CD1A 5AW3A 1ZSYA 3H1TA 2C4UA 2E89A 4IQFA 3GN1A 1P5ZB 2A5LA 3WXMA 5JFTA 1TMGE 2Z4SA 1SA0A 3KU1A 1B8OA 3NIFB 3P9CA 5HFJA 1OBVA 3OCYA 4Q02A 4ESHA 2IZ5A 3D2LA 4GC9A 3PQ6A 2EFHB 4FIDA 4FM9A 4OVKA 1P5RA 4NL4H 1YRBA 1T6BY 4H35A 1QVWA 2OWEA 2PBZA 3QEOA 3K32A 5C4MA 2FW1A 1U3WA 2BGGA 3QLJA 4RYLA 1R4ZA 5EJEA 3AV0B 3UCFA 3JALB 1FDTA 1HURA 5FTWA 3AR8A 3DSRA 3QVKA 1G8SA 5K3FB 1KVSA 4AFNA 1S2GA 3I2JA 5AK3A 1CUEA 4UHKA 2FWAA 2CV2A 1ULTA 2OB2A 4LJ4A 4S1OA 1DS6A 2VH2A 4XX0A 3UIEA 4A10A 2OUKA 3SYNA 4OUDB 4LJ7A 3L93A 5SYNA 3VDXA 1AUOA 1DO8A 1N8KA 1JHDA 4MQEB 4NESA 3RUHA 3AM1A 2IXGA 4OBEA 1G6KA 2OCBA 3L0OA 4CV3A 5I8PA 4DWWA 4F5DA 5E38A 2WWRA 2O14A 4YRBA 3NOQA 4BP3A 1JMVA 3G2MA 3L2OB 4G0PA 3IE0A 3UN1A 3MTQA 1QHFA 5JH7B 3QFRA 2HK8A 4TZTA 5I5GA 4AULA 3I6YA 4B85A 3Q3VA 1KDVA 3KQVA 4IZHA 4G5HA 2C95A 1QGED 4Y1EA 1Y89A 1I1OA 1EINA 4RDXA 1I80A 1E0AA 2VDPB 2QPAA 4RMHA 5C8YF 4ZVKA 5BSEA 3B1KA 3E7XA 4LHSA 3L1KA 1HLPA 4RTRA 1T10A 3N8KA 3QU7A 4Y1FA 1O8BA 3G6WA 4DIOA 3W4KA 1W0JA 4YJHB 1JT2A 3MJFA 1BEZA 5J4LA 1J0BA 2XKBA 5HE9A 2Q7OE 5CFQA 1ZUD1 4MW7A 3AKCA 1R4NB 2WG2A 3F1KA 2Q50A 5DGCA 1AKQA 1XTQA 2D0IA 4UEQA 3EH1A 3K73O 2YMMA 3AF4A 1UINA 1ID8A 1JKJA 2NO1A 3L7JA 3PJGA 1JE0A 2UZ1B 3G0GA 4GVPA 4H3KB 3LPLA 5LNK1 4WZZA 2MSDB 1UM8A 4LWQA 3VPSA 3WYDA 1FRNA 1PSZA 2HI0A 3HDHA 3Q2OA 2XRMA 4I55F 4YRRA 5G1OA 3RSGA 3E61A 3EC2A 5L3RA 3JS5A 4QZVA 4YJ2F 3AB3A 2EARA 1JR4A 3G3EA 3OEYA 4FXOA 4XM1A 3HJTA 5EXEA 3ER8A 3L0CA 5TS2A 4EG7A 3JTMA 1QFXA 1EP3B 1H4TA 2AIRA 2ISSD 4J9VA 4RFSB 1K4YA 4F71A 2MYNA 4X41A 1GZHB 2GBFA 3HY3A 1U94A 2X9NA 3HXPA 3OCUA 4GKVA 4N39A 1Y0BA 1M2OA 4NR0A 1YV9A 4ATNA 1BOFA 3HP7A 4BP8A 5DMHA 5EXPA 1LZLA 2WP8J 4I4IA 2J0UA 5IBRA 5H83A 3SF8B 4AJ4A 2BTQA 2JD0A 3AINA 3AZQA 1W6RA 4KLAA 3WRXA 6LDHA 2ZYIA 3TJZA 2DHQA 5PGMA 3JQBA 1EVYA 2W22A 3DF7A 3RE1A 5HM8A 3RUEA 1U1GA 2ROQA 4JWTA 1A9SA 4OAOA 3ANXA 5I9BA 3QF4A 4ZMRA 1V1JA 3ZNOA 4JBGA 1PWZA 3OX1A 4O8CA 2I99A 1VIVA 4XRGA 2XF2A 4QSHA 4RTSA 3P96A 3FBTA 4LE2A 1LWNA 1F2UA 2O6LA 3LLMA 5BXYA 3WIOA 2AXPA 2GGSA 2FK8A 4OJYA 1KVUA 2J3MA 2IYLD 2HSEA 1QIJA 2RCNA 3T1VA 3T5CA 3VTAA 1C9DB 2A0FA 4CCAA 4CMBA 1VPWA 1T9BA 1NR5A 2FMUA 2PKQP 2Z9CA 4CDMA 1DQZA 1E2FA 1TQ4A 5AOVA 1BCSB 1HQYE 1QB8A 1U0JA 2GYUA 4W1QA 1XRPA 4YTEA 3UHPA 5IC6A 3PFGA 2P7IA 3VTKA 3CTPA 4CL0A 2II6A 3Q5EA 3HDGA 1E0JA 1UKVY 3I42A 4ML3A 2XA1A 4O1HA 2A8YA 1AQYA 4BQQA 4CNQA 2HSJA 4WH0A 2G9NA 1EBFA 1IB0A 2HFJA 5CYGA 2HD4A 1TCCA 1NW9B 2QL7A 2ABWA 3ZS9A 2G5GX 3WQHA 3QYJA 4OQLA 1LJ8A 2MIIA 3TW0A 4C04A 4ZANA 3N5CA 3KUCA 5JI3E 4H1WA 4NU5A 1Y63A 1W94A 3TFQA 3TOZA 1XAJA 3CZPA 2J85A 3O8OA 4RF2A 2BGLA 4RYDA 5K3CA 4XIIA 1BHSA 3B7GA 5KJ1A 2WNIA 4YNBA 5LMUB 4E2ZA 1F8XA 2JLVA 4Y1RA 3X1JA 2BZ0A 2DR2A 4TXLA 4NPHA 3B52X 3DTTA 3E18A 3WK6A 4HDMA 5K4AA 3ZTTA 4IOKA 5JCOC 5JNTA 3UPTA 1DT5A 3KFVA 1M7GA 5GPBA 3BBPA 5LSAA 2I87A 4OJNA 1IBKB 1U7PA 1JHXA 3CT4A 3ZU5A 4FKBA 2UVPA 4D02A 4UZSA 3NATA 4HAUA 4OQNA 5EA2A 2IGBA 2R4QA 1QCYA 3VHQA 4ZICA 1UFVA 3ASYA 2HY7A 2Z8YA 5K0ZA 3ZD7A 2W2VA 5D5HA 1JL3A 1PFYA 1RACA 2IY9A 3BGOS 3ORHA 1FFWA 1R15A 2QL9A 4X61A 4Y7CA 5F2EA 3RODA 2I9KA 3ZPXA 5B7QA 1W2GA 2RGNA 3V4PB 5ALOA 1NW6A 1E2LA 4JB3A 3N75A 4KN5A 3OZBA 4JP3A 4LWZA 3GVPA 1R8YA 2FEXA 2FSHA 4DA9A 4DLAA 2DBVO 1JSLA 1NDHA 4KGXA 4L22A 2FZKA 2GPJA 1FMFA 1TGYA 2PKQO 5JCOA 2CHQA 3O4IA 2VPXA 2NU6B 3CJTA 3KWJA 4ZVOA 1G2IA 3RLIA 2EJTA 3V3TA 1WDMA 3D6FA 4HAZA 4IMPA 3NTXA 4PPGA 5U4XA 4C88A 1Z0SA 3EN0A 2KS6A 4ZQFA 4PLHA 4B6QA 4E4TA 1CLEA 5DLQC 2R8RA 1DC3A 3LWBA 1V9CA 5EL0A 3P0RA 1CVIA 5KQRA 3IP3A 3AI3A 2EKBA 3GC6A 4H3HB 1JYEA 7YASA 2IU0A 4L27A 2VDMB 3TLXA 4XDZA 2OILA 2PL5A 2OXTA 2RK3A 4B87A 4EH1A 3KKZA 3MWEB 4PN7A 4ZZIA 3ZDRA 4R40A 4ERNA 4AQYB 2J1LA 3G89A 1DQSA 1HTTA 3L4SO 2R66A 3OIDA 4G1FA 1VSQA 4TWZA 3IQXA 2CNBA 1YS1X 2QN9A 4G4SO 2OGTA 5AK6A 3BGDA 3HYCA 2WKRA 3EPPA 3NHUA 5CLGA 5EAIA 1DV2A 1YBVA 1NURA 1B15A 3IP7A 1ORDA 1QCZA 4U6QA 4Y8VA 3HCBA 1PBTA 2F2TA 2CNWA 3U81A 2D62A 4QUAA 3VAAA 4NAVA 2D2XA 5H7XA 5JZBA 4O2AB 4CXMA 4DCCA 4RPJA 4Q4LA 2JZNA 3H2GA 1GT91 2MWMA 3IMGA 1QWOA 1M8KA 1I33A 1UBEA 3CYFA 3IC5A 3L1IA 2RKWA 5AXCA 5JALA 2CXPA 2BV3A 2QMQA 2WZBA 2YNMC 4PFKA 4F1KA 5CHEA 3WFJA 2FF7A 2QN8A 3L18A 7GPBA 1ODJA 3EY9A 4JYCA 3JATA 1Z26A 3C5CA 5JNRA 4YT2A 4KIFA 1LF5A 1U7HA 1U80A 3BA6A 4KGVA 3T9CA 1QGUA 3AI7A 3JD0A 4UJ3A 1M2WA 2DECA 2Q9AA 3BGSA 1AGYA 1TCBA 4OOEA 2IU3A 3I61A 3PSHA 3P2MA 1ADYA 4CKBB 2PXXA 4BO5A 1CUZA 4FU0A 3EXFB 1JYFA 3Q0IA 3FI9A 2P65A 2J09A 3EEYA 2HHCA 1I51A 1E2HA 3WK7A 4JLDA 2JLQA 1RQ7A 3CVUA 4TS3A 4ZAFA 5BXQC 1NVVR 3OQIB 3RVNA 4RTMA 3TECE 5BWCA 3AFGA 3OTIA 3UYKA 2AN3A 1EGQA 1Z25A 1AKMA 2ON6A 1VCHA 1H8ED 1KEEB 3JQAD 1QHIA 4PTZA 4Z9BA 1E6MA 2GVZC 1KVRA 3VYSB 3NT4A 4NE2A 4P0QB 4MPJA 3AR5A 1W4BA 1Z2DA 4HVAA 2Y99A 2DUJA 3IODA 4RTQA 1A7AA 3WLMA 4DR4B 3LUCA 4FZ5A 5KIAA 1WB9A 4UVHA 3EEBA 2GA9A 4G0OA 5EP2A 2CBXA 2ZB3A 3EGXB 1ZOOA 4HQRA 4HWOA 3ZWXA 4EDHA 2NZWA 4ZGWA 4OXKA 2VAPA 3QLUC 3NNSA 2AHRA 1CS0B 1T3TA 3SXUA 3H1AA 4GPEA 5A9TA 1YT5A 2OPHA 2WF7A 1Z13A 3P9SA 4JEMA 3K0FB 5JDIC 3GLGA 1Z9BA 4IEEA 3RYTC 2I3GA 3NAQA 3AL2A 4CYMA 2P8SA 3AKEA 2I8AA 2ISQA 2OFOA 3DD1A 1OFIA 3E7PA 2I1LA 3LNCA 4GYKA 4KR0A 4RNDB 1S2NA 3DNPA 1YONA 3B9QA 3OZTA 4GI2A 2QX4A 4UUQA 4AKSA 4EHHA 1CUDA 3B1FA 3NYWA 5J1TB 1NW8A 1QG6A 2R7NA 4EY4A 1WAMA 1GPH1 2YXPX 5K8UA 3IDQA 3DT6A 3R23A 1XKTA 3FYDA 3VO8A 3J7AC 2C4KA 2Y93A 4D8UA 5JW6A 4HQOA 4FFDA 3EOZA 4LYEA 2M32A 1X7WB 4OB7A 1YVPA 1IWPB 2EZUA 1PI3A 3KVVA 3G79A 3R8CA 2OKCA 1SU6A 1GSOA 3MCTA 2D1YA 3QG5A 2OFFA 1P3Y1 1YASA 1PEAA 2HWXA 4BB6A 4C0XA 1RJEA 4DV2B 1SVWA 2X2EA 3FIUA 3HU1A 4ZAVA 1ZHOA 1O6ZA 1XTRA 1QF9A 2QDKA 4NZ9A 3H11A 1M2VB 5L51A 2CYCA 4JFRA 1DDGA 1EHCA 4F9TA 5DNWA 3DBOB 1XQXA 3DDUA 2XCUA 4MVCA 1E3SA 1IY2A 4MQ6A 5FAKA 5JCJA 1KDRA 2W8BA 4K9OA 1Z0IA 5SYMA 3FYCA 2PN1A 3I76A 3F7MA 3SEQA 1Z8NA 2FETA 3Q7SA 4Y9DA 1YQWA 4DGSA 5JSUA 2XE8A 1Z6GA 3K1JA 3RBVA 4FCWA 1BZYA 2EEZA 3R7WA 1K66A 1IB6A 2NTYC 2BHTA 2P9BA 4JUIA 1EVLA 4ODIA 1Y8RA 1WV0A 1OWMA 3G5MA 4H7KA 5K6AA 3C98A 3LPDA 2XYPA 4XWYA 3TDKA 5HJ7A 2UYHA 1QCDA 2FUKA 2J3JA 1P4SA 3BHJA 2E9SA 1NKTA 2A9PA 2EWVA 2VF4X 3GQBA 3R6WA 4FR2A 1OGIA 2YFKA 3EDCA 3HG7A 4QOIA 3EE6A 4KO2S 4AIRA 4GI5A 5JNSA 2ZATA 4GX5A 4ROSA 3PWZA 1HKHA 4YJ3B 3VPDA 1Y37A 1GG5A 3E1SA 3H17A 4CL2A 1C41A 1EJ6A 1NOKA 2IYSA 3MGAA 1U1CA 3AYZB 4XYEA 1BGVA 1JFFA 1B8NA 2FN7A 4JY7A 5TNXA 1RYMA 3E1GA 1UXHA 3TSYA 4L8FA 1JQDA 1NLZA 3PEEA 3L5KA 4PVDA 4GLJA 2GM3A 4BVAA 3BCHA 4DF3A 1E60A 2V7XA 2QZ9A 4CM4B 3EXIA 1U9ZA 4OO3A 3CBGA 1EXWA 2GPAA 4D9GA 1Q0HA 4CETA 4ZYXA 4LJRA 3DM5A 5JECA 5LA6B 2XVMA 3DT9A 3ZWOA 4EHKA 1HDOA 4DDWA 1YCDA 3ELYA 3I52A 4CKBA 4I4CA 3IT2A 4BX8A 1V1RB 1CJCA 5A71A 4HYYA 2CB0A 4EA8A 1BYIA 4FDTA 1RHJA 2WYHA 4NP6A 4B35A 1FEZA 2QB5A 5CVCA 2Q3FA 3B38A 4U8GA 2NZJA 4X6XA 3RU2A 3T6KA 5AVTA 4JNKA 1M83A 1T8RA 4AG6A 1E2GA 1PK8A 2GX6A 1I4TD 1EE1A 3PDUA 3WLSA 1VDZA 2Q9BA 2VTKA 2F1KA 4JOBA 1P39A 3PYMA 3LQKA 4PLGA 4WXMA 3T9FA 4CFYA 3I3OA 1W25A 1ZU5A 1ZA1A 1FMCA 1NVUQ 3ROKA 4YMSA 3X0DA 2HNBA 2ENWA 4UVIA 4EJSC 3EA0A 4YXFA 3WWZA 821PA 2P9CA 1ZO8A 3THSA 1XZCA 1Z6ZA 3ROZA 5CH5A 1U2RA 4C0JA 2HWWA 2VJBA 4RIGA 5IJ0A 3K0CC 4J3FA 4BASA 3FBGA 4OHUA 4P3KA 4ZD6A 2Y0EA 4A0QA 1WNFA 2ZYSA 3R8FA 4TMKA 3EIFA 4BGUA 1TA0A 1QORA 1SKMA 4CV0A 3UMGA 4BKMA 1TYZA 3HK2A 2QTHA 2XXJA 1U8UA 1UWKA 1VKNA 4QEZA 1RP7A 1DMRA 4R2KA 4FOPA 1X7ZB 2XWBF 1T0PA 3QLEA 3HXTA 5FTNA 2I7VA 1FX0A 1ZK3A 3FROA 3OM9A 3OBBA 4UHBA 4LDNA 1Z6XA 4WW0A 3FPFA 2DWPA 3LPAA 2IOFK 1O95A 4JGGA 3WOVA 4WLNA 1U8AA 5IXJA 3E9NA 1K3TA 3TB4A 1YU6A 3ZNPA 1UM9B 4WDRA 3ITNA 3DW1X 5LQUA 2F62A 4ZHQF 4EGFA 2BOVA 4CLRA 1WETA 3DTVA 4B8YA 4D8YA 4MYCA 3TM4A 1YSCA 4G09A 2EGGA 1X3SA 4KE9A 1PJAA 4DPLA 4IEFB 4W99A 5BVHB 4D98A 1D3AA 2ZETA 3DPSA 5ITSA 1D0IA 1UANA 3R7LA 4QYXA 5A03A 3D6HA 1S1MA 4BZWA 1VYTA 4Q66C 4XOIA 2ZRGA 3U0VA 2JARA 3JV7A 5ALQA 1BH2A 1PJ4A 3CT6A 1IZ8A 4TS4A 2GRAA 4R2XA 3MS2A 3ZGOA 1FLVA 3P9KA 2NNWB 2Q3CA 4OQFA 3X1MA 1N9ZA 2G88A 1I4EB 2FUG1 1JR6A 1AHHA 5DNUA 3T0FA 4N3CA 4AMZA 3R7NA 3CPJB 3CZ9A 5DNAA 4DLTA 4QREA 4MVWA 2O50A 3IRVA 3WLAA 3FMPB 3WYNA 2VJMB 3T0GA 4PSUA 5DHAA 1AQLA 1HWYA 2IA5A 4GEGA 3TJMA 3G9TA 3VYRB 1P4HA 3N2ZB 3I0NA 4H4CA 2ZRNA 4AF6A 3MELA 1GAJA 4AF8A 1MBZA 5DT2A 1SUWA 2C9BA 2NXEA 4G4GA 2AUMA 3TQSA 1CK4A 1X7ZA 2ADFA 3V4VB 4BMXA 3S6JA 2CUZA 3V6