4C0WA

The crystal strucuture of native ppazor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
200
structure length
200
Chain Sequence
MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Pseudomonas Putida Azor: The Active Site Revisited.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords FMN-DEPENDENT NADH-AZOREDUCTASE 1
total genus 68
structure length 200
sequence length 200
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c0wA00
1F4PA 4LAFA 3NHSA 4LTDA 1YCGA 4N65A 4Y9RA 1SG0A 5LBUA 5EMNA 4ICIA 3KAQA 2RG1A 5TGZA 2R97A 3TZBA 4H6PA 1CZKA 2QWXA 2QX9A 4LTMA 4CF6A 1JA1A 2BPOA 4PU0A 5LJLA 1VMEA 2QX6A 3KLBA 5JROA 5FA6A 3SVLA 1C7EA 4GI5A 2QX4A 2AMJA 2D5IA 3HLYA 1AKVA 2N1MA 2QMZA 2X2OA 1AZLA 1QRDA 1RLIA 2FCRA 1XYVA 3FJOA 1DXQA 2FDXA 1YDGA 4M0CA 3W79A 4DY4A 6NULA 4OXXA 3RPEA 4YAOA 3EYWA 2Z9CA 3K20A 2FOXA 1DXOA 3W78A 1J9GA 1AKRA 3NHUA 3KEGA 3NHFA 3ESYA 2HPVA 2OYSA 4C76A 1CZUA 1J9ZA 1YKGA 1OBOA 2WC1A 4QOJA 3NHKA 1XI2A 2R96A 2Z9BA 1KBOA 2B3DA 3N3BC 4QODA 3OX1A 1RTTA 2FVXA 4HS4A 1FUEA 4N9QA 2Q9UA 4F8YA 1D03A 3ESZA 4C0XA 4ESEA 1OFVA 3O2NA 4R81A 2MOKA 1ZWKA 2MT9A 2QX8A 4YAUA 5LJIA 4N82A 4BMPB 4YALA 1ZWLA 4D02A 5A4KA 3U7IA 2MWMA 3D7NA 3GFSA 3B6KA 2V5UA 3W7AA 5LBTA 2FZVA 2BF4A 5EA2A 3HA2A 2FLVA 1J9EA 1FLNA 3F90A 3F6SA 1AHNA 2X2PA 1CZNA 3TE7A 4XDHA 3ZHOA 1AKTA 1J8QA 2HNBA 1TIKA 2KLBA 1FX1A 2MTBA 2W5UA 2V5VA 3HR4A 2QR2A 1YCFA 4HEQA 5B3KA 4CETA 3GFRA 3F2VA 5LLDA 4Y7CA 1B1CA 3QFRA 4GR9A 1CZRA 3GFQA 4XDGA 3L9XA 5LVAA 1YCHA 4ZVLA 3NFRA 2BN4A 1X77A 5F51A 1CZLA 2BMVA 2OHIA 1T0IA 1NNI1 2A5LA 5ULLA 1H66A 1QR2A 4J8PA 4GQIA 4QOIA 1SQSA 3NHYA 4ZVNA 3N3AC 3U7RA 1V4BA 2F1OA 3UXHA 4DIKA 5NLLA 2OHHA 3OJWA 3KAPA 3B6JA 4NULA 1C7FA 2FZ5A 3GAMA 1QBGA 3NHLA 5F12A 4NLLA 4YAWA 3W77A 2M6RA 4QOEA 3OWHA 3NHJA 1D04A 4Y9UA 4DILA 3LT5A 1CZHA 4FGLA 1WSBA 5LMCA 1OBVA 3FNIA 4BMOB 3NHPA 1RLJA 1BU5A 2ARKA 1E5DA 1FLAA 2XOEA 3JSXA 3K1YA 3NHWA 3NHRA 1FLDA 3OWXA 1FVXA 1DX9A 1H69A 2FAXA 1WSWA 1FLVA 1FTGA 3FX2A 1RCFA 2GSWA 4U7GA 4LTNA 1XYYA 2QMYA 4FGKA 3OX3A 4S24A 3NLLA 1BVYF 1YOBA 3QE2A 1I1OA 5FUQA 3QFCA 2BZSA 5NULA 1CZOA 3TEMA 1AKWA 2XODA 3OJXA 3P0RA 3N39C 4YAFA 4PTZA 1AG9A 1XT6A 3FW1A 2FX2A 2Q62A 2ZKIA 3L9WA 1KBQA 1AKQA 2KQUA 1T5BA 4QOFA 5EAIA 4ZVMA 3S2YA 4C14A 5B3LA 4H2DA 4U7FA 3OVMA 5FX2A 4QOGA 2Z98A 1QHEA 1YRHA 1ZX1A 3OX2A 4FX2A 1TLLA 1AKUA 5F4BA 4QOHA 4FGJA 1D4AA 3B6MA 3ESXA 2V9CA 3R6WA 2OHJA 3G5MA 4ZVKA 2M6SA 3UXEA 1JA0A 3LCMA 3B6IA 3O73A 1GG5A 3ES9A 1AMOA 4U7HA 4C0WA 3FVWA 2HNAA 4LA4A 4YQEA 3EDOA 5BUCA 2Z9DA 3F6RA 4PTYA
chains in the Genus database with same CATH superfamily
4PXSA 4FE4A 5FFFA 4CTKA 4A0SA 3CLTD 3KXPA 5AQ1A 1FBTA 1N9ZA 2GN8A 2CJFA 1SC4A 3B9BA 3EEQA 1JIUA 3NTLA 1H0RA 3ODPA 4R5HA 4UTRA 3CH5A 4KQEA 2Q0HA 2ZBDA 4HB3A 5JPDA 1ETHA 3HG7A 4DG9A 2I4RA 2IDKA 1KI8A 1JX6A 2V6JA 3TMYA 2YMQA 4UOQA 3ZW7A 4AU1A 1DJPA 4IDFA 4K9PA 5DLDA 4JBHA 3DMPA 4HVTA 2J0UB 1SHUX 2A0UA 3TECE 4KL8S 5KO2A 2C3PA 2YXNA 4FGZA 4UVEA 5H80A 3AVXA 1XHEA 3O0DA 2ENUA 3FB4A 3GRZA 4PZYA 3ROGA 4PZ0A 2CJWB 3TVDA 1UJ4A 1Z2NX 4P54A 4MXDA 4JXXA 3ORYA 1UADA 3AYXB 1JEAA 2CXPA 4YJHB 2EW2A 4TWJA 1FFSA 4CR6A 2M1XA 2DU8A 3PQCA 1IEWA 4UFOA 1KDRA 1SMKA 4AF6A 4JXZA 2VYQA 4RD6A 4RZHA 1M6EX 4MVJI 4WOCA 3UMSA 1W93A 5LWHA 4HAZA 5HE9A 3PITA 5FIUA 1ISJA 2NVOA 4XZ3A 4LK3A 2ZSDA 4EI8A 3I8SA 4PO8A 1BEEA 3PFFA 1DBRA 2IT1A 4PCUA 3IP5A 2ZAMA 3PC7A 3HP1A 5LBTA 4X60A 1W2WB 4P32A 5JDCC 4ZKEA 3LW7A 2FLVA 1EUYA 2EVWX 2X2PA 1YT5A 3PVZA 4G36A 4CQLB 3C6BA 1J56A 2VNHA 2EFEB 4Z4CA 5LYJB 4J0QA 1HETA 3WLEA 4Q1AA 1MDFA 4MULA 5CW2A 5FP0A 4C4ZA 2WWWA 3FE2A 2GZDA 5E4FA 2ZUDA 5CH3A 1W88A 5F51A 1NQAO 4J1TA 1TEVA 1K97A 2EJCA 5JBIA 5A7FA 1QMPA 3N3AC 4KYUA 1GQ2A 1T2UA 2G06A 4DKXA 4ETMA 5ILGA 3VISA 2BFCA 4PG8A 2CL6X 1HZJA 1G20B 1N33B 1HDGO 1HYQA 1ZIYA 1TM1E 2EKBA 5CXXA 1Q1GA 2QDKA 1P9OA 1SZCA 3LPAA 4QDKA 5I45A 2BGLA 5KZMB 1G3UA 2LW7A 4IW3B 2R1ZA 5CFMA 1ADGA 4QJ4A 2H2HA 3U56A 4JY7A 3ZDCA 3NRCA 4G9GA 2IZ7A 3PPVA 3DAYA 3L43A 2GTHA 5KNBD 1NM5A 2V4UA 3O8QB 5CUQA 2QU8A 3HY3A 1OC4A 2BHTA 2QL7A 4PYQA 3W6UA 3M6VA 1VRCA 1AVTA 5B7GA 1MB3A 1B43A 5CVCA 2QK4A 3SVTA 3FTPA 2QQEA 3E5NA 4ZVTA 1TCUA 2BONA 2BUBA 2G77B 1ULZA 4IIJB 4GGMX 1W96A 4ARZB 2BFDB 1EZ4A 1JQJC 2CHFA 2Z2JA 1Z22A 1YU6A 3F9IA 4RSRA 5B5SA 3REQB 5CH5A 4R9UC 3W5DA 2HI0A 3OC6A 2VYNA 3G1TA 1YZUA 2Q4TA 1ZKMA 4XOUA 2LCFA 5AJWA 5A3SA 3B3JA 5HQ3A 1GEEA 2QRPA 1E6MA 3Q7EA 4BO4A 4NU5A 1MEOA 3F6RA 3KL4A 2VA8A 2I2AA 3OPVA 5TQ0A 2CXRA 3RRJA 4F6RA 1ZYUA 1BWQA 1T9BA 3LXRA 4JKIA 1PNQA 3GFGA 3IMKA 3R5TA 4BEVA 1YXMA 3OZBA 2OZLA 3D2BA 3TQRA 1ZICA 4WXPA 3UHFA 2ONZA 3E2IA 4UHHA 3SJCA 4Y9TA 5IUJC 4YJ2B 4ZTUB 3N28A 1CUVA 3PLNA 4IPTA 5ARBA 3BEOA 1QH8B 3GPBA 4PQEA 1AXEA 1OA0A 2DBQA 4IFTA 2VDRB 4I6GA 4ER0A 5HJ2A 2ZM5A 3HCAA 2QMUA 4XQGA 3R7AA 4LFCB 1T5DX 1PQWA 1G21E 2WSLA 2D2FA 4FYXA 3DEIA 2BYTA 4GWLA 3Q11A 4QBIA 1DIOB 3JQ9C 5G53C 3MUFA 4QOJA 3OBBA 3U9SA 1Z6AA 2PIAA 3JASA 3K2QA 4RHTA 3WHIA 1P61B 4OJNA 4KWTA 4R1OA 1GRVA 2DBRA 3S0JA 1CLEA 3ZQJA 4MQUA 3T61A 1KEKA 3ORFA 1PTJA 4QTUB 3HJFA 3VKHA 5KJFA 4QUKA 1SBZA 3ZE2B 1ODJA 1FBNA 2PUEA 3LP5A 5HKBA 2XCRB 2QX8A 5LJIA 3D4BA 3GFFA 2WY2D 2O5EA 2G1JA 3DOFA 5EJ6A 3KQNA 4RXUA 4WN9B 5E8JA 4D44A 5EUMA 2ZSJA 2V5AA 4OK6A 1R4ZA 2WQ7A 3RVSA 5GM2A 4FYKA 2C7BA 1E2PA 1NGSA 3IIIA 1GAQA 5E7MA 3IR5A 3HA5A 4IQFA 4JODA 1WKBA 2XNSA 5T4HA 4Z51A 4WA8A 5JT1A 5JBQA 1VXRA 1V11B 2ZI6A 1ZSNA 3ET5A 4D9KA 4NE2A 3IP9A 3TKAA 1OILA 2YV4A 5JMWA 5JFTA 1QDLB 3BZUA 4FTWA 2F1OA 2ZJ7A 4UUOA 3HGQA 4V2UA 3ZXXA 2CXHA 3M6UA 3RJTA 3M34A 2G0NA 5F33A 4CFYA 1YK0A 3E53A 1AUOA 2FUKA 2XXJA 4RD3A 3HBJA 5KYTA 7YASA 4WIAA 2GBLC 2XHEA 4MCIA 3G1WA 4TT3A 3EXHA 4CQMD 4LJ5A 3WGVA 2BCEA 2I2WA 2ILVA 2P3QA 4DMCA 1JHXA 1MGOA 2G71A 1QLWA 1GTVA 1VKOA 3L1VA 4FLEA 3GW8A 5D7BA 5J58A 1L6IA 3QBDA 3K53A 2WUEA 2Z57A 2O4CA 5ALKA 5JIBA 3DV9A 1DX9A 1P4RA 5TC4A 1T0UA 1P4JA 4W99A 3K2IA 3T3HA 5CD1A 4KPEC 4LOAA 4UE6A 3T7CA 3BMXA 1DQRA 2V74B 1XXHA 4L74A 5MFZA 4DIEA 3GLGB 5KKAA 1U90A 3TDKA 3PQ2A 3VJLA 1P2UA 2CBZA 2Y0CA 3G0GA 3OU2A 5LQMA 3VJRA 4F9FA 2CT8A 2FPGB 2NUPB 3EEBA 1QU3A 4HEHA 2FWAA 721PA 1UQUA 2VHYA 4KN9S 4YCDA 1U0LA 3UMCA 2O48X 4X84A 3EGXA 3CF2A 3CPHA 1JMKC 2AZTA 3FI0A 5EE9A 3S2FA 3SYLA 4F5YA 3D5EA 1F4LA 2CK3D 2XH8A 3HNOA 4G37A 1B14A 2A3NA 4MA4A 5CX1A 4BVFA 2O50A 3EA0A 1WMSA 2O3UA 4ZTZB 1G16A 2IYTA 2SCUB 1HYGA 2LR0A 1W36D 1QC5A 3UJ9A 3VKWA 1MAAA 1IG3A 4TWZA 3VFDA 3A1UA 3CF6R 4CM7A 4N6OA 1ENYA 5EP1A 3T41A 4DCNA 5A3QA 4PYLA 1HO3A 2P0EA 2ID8A 2FMKA 3TLXA 1R9MA 2H9AA 2XUZA 3TF5A 1ZUD1 2J0EA 4DKJA 1Z7WA 3DMDA 3EIUA 3EUWA 2JLYA 2IYXA 4QXAA 4HXYA 5AWFC 1HK7A 1WZCA 2I99A 3CJRA 3JQAA 3TTXA 3DPSA 3WICA 4DTIA 4JOSA 3BREA 4CE6A 4F1JA 3BHJA 4BZPA 1XQYA 2BHNA 3ZDRA 2JI9A 2PZMA 3KEFA 3KYBA 3CWQA 4YCJA 1TM5E 2WC1A 3ONWA 3PA8A 3SZLA 3ZVRA 2YMLA 3HCRA 4M0KA 4J0IA 3W2TA 4RFVA 3K9NA 3DOOA 3H5NA 4M8NE 5BSVA 2DR0A 4ZCTA 3GGDA 1DBWA 1L4MA 5IPFA 3I3SR 2ZWVA 3ELYA 4MB2A 5FL3A 4CKZA 3JR7A 3TQHA 2A9OA 3P45A 5AFSA 4R7GA 2Y92A 3A0RB 2PFKA 1AY0A 2C4MA 2XZDA 1QYXA 3LZDA 4LX0A 2X0DA 3ZD9A 1YA4A 3HRIA 3WGKA 1CZNA 4MVJE 4G0MA 4EG0A 4GQBA 5A9RA 1R50A 1DGQA 2QRNA 5KYVA 3N8IA 4FJ1A 1N4AA 4RH1A 1UWKA 3O9VA 1H22A 4JI2B 1DJNA 4TRRA 1QIJA 1KYXA 1TKRA 1G9SA 2X9GA 1S9HA 1LVHA 3FJ1A 4QAQA 3ZI7A 5BXYA 2C5AA 2RHGB 3V7FA 1FPMA 2VAWA 3OOJA 1M75A 2XVAA 3H8WA 1JYEA 1IAVA 3IE2A 2PT7A 4MWSA 1NI3A 3L1KA 3BRSA 3FOBA 4D4LA 2C8JA 4B3BA 1G7CA 5H83A 2GTPA 4CIVA 3U0VA 4NHEA 3BJIC 4NBUA 5I7UA 1Z12A 4X7PA 5I7WA 4GMFA 4WUVA 1JFLA 4ZKDA 5KS2A 1KQPA 1CRZA 2NVUA 2C07A 3G9TA 3VTAA 2M9MA 3B7WA 4CMIB 3DYVA 3QVKA 3W8EA 1JQKA 3BPSA 4BJ6A 4RCVA 4ER5A 4NDZA 2P4QA 3LX5A 3Q41A 3VV3A 4RPGA 4BOYA 3VR6A 2OVBA 4N5NA 4OQEA 1U7XA 1I4WA 2OB2A 2YWFA 3P1JA 2OV4A 1ND5A 1X42A 3TOSA 2YINC 5NULA 3GT4A 4KXLA 4NMXB 2F90A 5DCYA 4HMPA 1IVYA 3Q6NA 1RM4A 2D3TA 1VDMA 1GFWA 2FX2A 3OU6A 3GUZA 2V1XA 4RD4A 4PLVA 2PS3A 4RK4A 3G0HA 4H2DA 3LCVB 1XXLA 1FDOA 1T2NA 3NH9A 1A88A 4MLCA 3UHPA 4R2MA 4DCSA 4CIWA 4B44A 3CVUA 3RSFA 3CURA 1XLUA 3KR9A 4L6IA 1O58A 2MIIA 4AWXA 3L8GA 1VIDA 4H7KA 4QKQA 2KE5A 1ATZA 5FLYA 1FRNA 2F43A 3O4JA 4BEWA 2DH6A 4FUQA 3ZY5A 2JAHA 5JYBA 3GJ5A 1U7OA 3B8HA 4LAFA 1U8CB 2NXWA 4G5HA 1I2DA 1DINA 3CUKA 3TJRA 1KYQA 3I6BA 3WGUA 4JC5A 3BWBA 2AJTA 5B7PA 1ZJJA 1IXZA 2PM8A 4XJTA 4XD2A 2F67A 1M33A 3DE1X 1FCJA 2LP4Y 2QJRA 3AEXA 4RD0A 3GVPA 2CXQA 5SZJA 1VMEA 5FADA 1SXIA 1CJMA 3OLYA 4EB6B 1W85A 4HWRA 4FHCA 4YCAA 3ROKA 2FOIA 3P26A 1QIKA 4CNQA 4TMZA 5B3JC 2PT5A 1WW2A 5AK0A 4MCAA 4J1NA 3VGPA 5I7AA 4WZBA 1L1FA 1RM3A 4B43A 5BP7A 1I7QB 1PTKA 1QRTA 2IBTA 3G2LA 3T06B 1HTBA 1EK1A 2CBXA 2VEDA 4DREA 3THOA 4IX9A 4OXNA 3CPJB 1DKUA 3MW8A 2FX3A 2NV6A 1TYBE 5AXAA 1YAHA 2WM8A 3IYLW 4G9BA 1UKZA 2FEXA 2WLSA 3PX2A 2OK7A 3N76A 5CFNA 4J7XA 3WG9A 2ZIXA 5TIIA 4ARIA 1Z29A 1FFEA 3JRNA 4YAJA 1QV6A 3ZGXA 4OF4A 3LW8A 3S5UA 4C6HA 3P9RA 4E51A 4OGLA 3I1YA 4BNKA 2PX2A 4WZBE 3UAVA 2D4AA 5FV4A 2FPPA 4K5QA 4N76A 2FZCA 3FA2A 4N5MA 4B81A 1Z6XA 3ZC3A 1P5HA 1OIVA 1TK2A 3CO0S 4CV3A 2IV3A 1JFSA 3LUPA 3KD2A 5HS4A 2R7AA 2I80A 4LXGA 1O96A 2GXAA 3R3WA 3VUFA 3IDQA 4Y1FA 3FF1A 4Y67A 1CR1A 1H4TA 1E6UA 3C7AA 4M22A 1IY1A 5HQJA 2V5VA 2R751 3EWSA 1ICEA 3MM4A 5AP9A 1A9ZA 1QORA 1GPDG 1SC6A 4Z0PA 5CB4A 3I28A 3UC5A 1NG9A 3ER8A 4MWOA 1S3SA 2BIFA 2Q4OA 3A1EA 3F0TA 3KUDA 3FUTA 5A4MS 1SXQA 3VI3B 2CEAA 3OF5A 4OH7A 3P9NA 2JFBA 2H1VA 1OU0A 1A4IA 1R0ZA 2JCXA 2QL9A 4KLCA 4M55A 4AKEA 3BHIA 3EGCA 3NO4A 1RXYA 2C98A 2GEBA 3DB2A 2X0RA 4PVCA 1P44A 5C1DA 1AJEA 1SUFA 3KSMA 1Y8QB 3IB3A 3QLVA 1D0VA 3ZJTA 1ZSVA 1IHPA 1NU6A 1NVAA 5ALMA 3PDIA 1S3FA 1CEQA 1G41A 1DEKA 1FQWA 3NHPA 2IEDA 2WTEA 1OTXA 1PYOA 2XOEA 2YHUA 1AKNA 3AY0A 4BFXA 1OH7A 1FVXA 1RQPA 4DB2A 3EA4A 4MLZA 4FSXA 4P2GA 1PFQA 3A31A 5DWVA 3VDMA 1Z4LA 3OQPA 4RQBA 5G1PA 2LTAA 4NXNB 4F9EA 3N07A 4NFLA 1BDBA 1XZEA 1SVIA 2JGIA 1Z6TA 3FYSA 3FPGA 3KB8A 4J7AA 5FXMA 1QRSA 2WIAA 1GO2A 1RWVA 1RWMA 2P77A 2BY4A 4L8WB 5FLKA 5JYDA 1JDTA 4HV4A 2X2FA 4P81A 3N9IA 5HRAA 3S68A 2WK1A 3V55A 3NC4A 2WTXA 4B4UA 3PLRA 1T2CA 4YQYA 2P1ZA 4D6XA 1HQYE 1DJMA 1GU1A 1N6NA 4IRMA 5E6UB 4MRMB 3RTCA 4YP7A 1HDEA 5CK5A 3SNKA 1HT0A 5K3AA 1RQLA 4IUBS 4RACA 4LBVA 3L92A 3ZBUA 5B4UA 5HTOA 2VLBA 1EAMA 2IY8A 2VDVE 3D6AA 3M1AA 1QJCA 5EQJB 3WBFA 4PSDA 3U1BA 4KAJA 1FYWA 4DV1B 1U2TA 2WYOA 3GP3A 1HKUA 1GGEA 5BT9A 3UMJA 1NJ8A 3NMUF 1Y6FA 3WADA 2GZAA 3ZWAA 5EWJA 2QAGC 2JJ8A 4WN3A 4LY9A 3FSJX 3QFSA 4ITVA 3E9RA 1BX3A 3DL4A 4D7AA 1KAEA 1ZD5A 4L16A 4G01B 3HDYA 4DV5B 1K8XB 2XBLA 2XRFA 1E2UA 1V3TA 4PLCA 4W5JA 5CGQB 5JSYA 3A27A 3NI2A 2A78A 1ZITA 1U2ZA 3KEMA 5A62A 4MUJA 2I87A 2AXPA 4P31A 4DMLA 1YKGA 5IK2A 4HGZA 4Q37A 5B58T 2B1GA 1W25A 4BP9A 2G5CA 2O7SA 4BAGA 1A95A 3VKVA 2BHSA 2PFSA 2GFIA 4KLRA 4ZOLF 3WISA 1JFRA 5J2TA 1GITA 4WBNF 2OCKA 2B1QA 3R9XA 4LF8B 5GGYA 1N6IA 1Q2UA 1QRAA 1L7AA 3LO8A 1JLKA 2W48A 1P5ZB 1BMTA 4M0FA 3RSLA 3V9AA 4F92B 2JL1A 3FTFA 1K7YA 3NBQA 4CLOA 1BE6A 1L7QA 4H4CA 3KOYA 4V2IA 2ZYTX 4AJ1A 3OUTA 3W3ZB 4FSHA 1TTPB 5A06A 4W8OA 2B8EA 1KC3A 1UMKA 1M2NA 2IIQA 3BXGA 2WJWA 4BAUA 3THYB 3VZQA 4LS3A 2AEFA 3FNEA 2XHZA 3KYDA 2P91A 4XIFA 5CT6A 1EESA 3E6AA 3GI1A 2IX9A 4NTZA 4P4NA 1QAMA 2I2DA 4YREA 2PJDA 3GMDA 4OM8A 1PT8A 2QY9A 4G56A 1GL6A 2R2GA 5JDIA 3IQIX 5KREA 4W5WA 3TJMA 1SU7A 4EVIA 4MI6A 3VAAA 3OZWA 3LBFA 1T1EA 3M83A 5EPUA 3U81A 3GDHA 4DQVA 3L7LA 4RTNA 3NBFA 4O4HF 3TWOA 2FZWA 2ACKA 3T3DA 1DDIA 2YYSA 1SKYB 2H92A 3EPPA 4B80A 1LK5A 3DHEA 4D0NA 4S05A 5E9QA 1Q44A 3N58A 3V2GA 5JMTA 4UEKA 3CUEF 3EULA 1XTSA 4G84A 3UPTA 1ZLXA 2G72A 3OEYA 5K6AA 4EFLA 4FDLA 4HJXA 1D6JA 3WGTA 2OM6A 4ILKA 1RXEA 1PUJA 1U2GA 2CD9A 5AVTA 1V95A 4IH1A 5AMXA 1FLVA 1S9DA 2UXDB 1HURA 2DWCA 3E18A 1JQ5A 3AT1A 2I7VA 3BRWD 3PL1A 3QUBA 3FLEA 4GSYA 4LXQA 3A3OA 4ZT4A 2PNJA 1V41E 4GP6A 3DE3X 2GK7A 3DZDA 1L8LA 2UUPA 4JELA 4LJ9A 2E3JA 4BQQA 4FYJA 2GD6A 3ABRB 2EWVA 3AIOA 3FW1A 4JJ8A 1TO2E 3C14C 1AHIA 4AS3A 4MB0A 1RBYA 1DQNA 2F64A 3MFYA 2PRYA 3CB2A 1QHEA 5EJ4A 3H18A 4ZDIA 3R6GA 5C52B 1RE0A 1CJBA 1VZ2A 1X8JA 1JJIA 1D4AA 1YBMA 1M54A 3HWWA 3A1CA 4MQLA 5P21A 1F8YA 3G5MA 4MJLA 1KFEB 3S81A 4H08A 1SBQA 3CVJA 1F0PA 1ML3A 1SCIA 2EFYA 3KEOA 1T2AA 4KIGA 1YC5A 2PL1A 3MELA 5EMKA 2Z9DA 3DEYX 1I0LA 3ON5A 3ZBTA 4O8ZA 2WSSA 2OE2A 1FU4A 3KHKA 1YCGA 1V6AA 4H27A 1I8TA 3LWDA 2NN3C 3A0UA 1K66A 4ZV9A 4OB7A 5SYNA 5KHOC 5LJLA 2YY5A 3IQEA 1NVVQ 1DRJA 1A5SB 3RVPA 5CT4A 1XQ6A 5AD1A 3COJA 1RM5A 4DJAA 5J4VA 2F3TA 1SG9A 3I09A 4PQRA 4WD3A 1N1MA 1OVGA 2R79A 3LPMA 4MB6A 4UHFA 3WLPA 1T4BA 5J5VA 3UTCA 3BH6A 4J0CA 1MPXA 3ID6C 3KYIB 3SKXA 3NM6B 5DOZA 5HP4A 4RVDA 2ZB2A 3HU5A 4NF2A 1MRSA 3QV1A 1W9HA 1E2HA 3BRQA 4UUBA 2QTBA 1DEHA 2QVYX 5KNLA 2J48A 2HQ1A 3EWAA 1T9DA 3AI7A 3QLUC 2A1TS 5ICFA 5JG7A 1L5HA 2B0JA 4NABA 4Q9DA 3BMCA 1KP9A 5CR9A 2MYUA 2YXEA 3H1BA 1NXXA 4X71A 3NVDA 2OQVA 5IULC 1ZJWA 2B3TA 3GEPA 1AM4D 3E23A 1QFMA 2HV9A 4FZVA 2GT1A 1SVLA 2Y2VA 3R3UA 4IQ8A 4K2HA 2OGSA 3THSA 3RS7A 2WVAA 4QULA 5LQUA 2QUHA 3SEQA 2NPFA 4HMQA 3BGWA 1JWBB 3KT0A 5D51S 3I58A 2B69A 2QM3A 1THZA 1XZMA 3L7MA 3VZSA 1GRQA 3M4XA 4PC1A 1V47A 2J87A 5FR1A 5AOVA 4CG3A 3L8FA 2C00A 3BWMA 5FI1B 3DTNA 4YIHA 1QQAA 1V5EA 4HWTA 2QM8A 3IKTA 4HRYA 3Q7RA 2VSFA 3UV6A 1A5AB 1EB8A 3HBMA 4WCFA 3D0RA 3PDHA 3AWIA 1VBMA 2AXQA 3HDJA 4I1SA 3HJHA 1D1PA 3EY4A 3KXKA 1LRLA 2BFAA 1CS4C 3HKBA 4A0GA 4HUQA 1R8YA 1EDDA 4YJGA 5IM5A 4MRPA 4LJRA 1UDAA 5CEFA 4CLRB 3AHJA 4LRSB 3HLTA 2HMVA 2RC5A 1TJ4A 3FSRA 1XNQB 1LTKA 4P86A 4NCKA 4H1WA 4FOPA 4UHCA 3N7AA 4FOOA 1WVMA 2WT4A 1FP1D 2DFDA 3F5FA 3LUJA 4Z86A 3S7TA 3WGLA 4Q4CA 4AKHA 2IYLD 2X4IA 1QZZA 3V4OA 2BMJA 2ZJ5A 1U80A 2RGWA 4B45A 2UYYA 1XJ5A 4AF7A 2RGYA 1EM8A 1SC3A 3IQZA 4FMPA 5EP2A 1POXA 1U3CA 1X7XB 1OF1A 1XJWA 5EEHA 3D2LA 5ENVA 2JARA 3MBOA 3O8DA 5CYFA 3FAKA 1Z56C 4MUHA 1D7OA 2FSVC 3IERA 3HEBA 3VV2A 3PX7A 5AVYA 2PVPA 4LQCA 2PWPA 4N3NA 1Z5ZA 4P93A 3ZLVA 4EHFA 3SF8A 4TTRA 4ARSA 1GNPA 4ZOAA 1SURA 4WCVA 2VHCA 3RYIB 4CEIA 5DNYB 2JEOA 1KZ7B 1E1RA 1G4HA 1U8YA 3IT2A 4QDTA 4E6PA 3MTGA 2R6R1 4I9HA 4LQLA 1M2OA 4HPJB 4E2YA 1XMPA 3ETNA 4MIKA 1HQCA 4WKCA 1HI9A 3I9OA 1JH9A 4C04A 1FRVA 2O3RA 4HZUB 1E5XA 1L5LA 2IIPA 4G41A 3JZFA 4M9SA 3R76A 3SSMA 1DUVG 1FSFA 3C3EA 4H9GA 2QZJA 4QDUA 3CMMA 2WSMA 3IAAA 4QT0A 5IAEA 1P2DA 2X86A 5SYAA 4ZZIA 5JS7A 5AJUA 5IVKA 1E61A 1RWNA 3U62A 4DLLA 2FWRA 1XZNA 1PJ2A 1SVKA 3ETLA 2IP2A 2AL7A 3F7MA 4R1MA 1WDLA 3SVLA 1BHQ1 2KB0A 3ORSA 2CBGA 4EJSC 4MYSA 3GPCA 2Y9PB 3EF0A 3FOZA 2N0SA 4DY4A 3CV3A 5KPJA 3U44B 1K2WA 3IBGA 4OHZA 3K0AB 1ORTA 4R2WA 3C87A 5CHEA 1W0KA 3KWLA 5AJVB 2AVDA 3CO5A 5DH9A 4DLYA 2C2GA 3SDSA 4DSZA 1GEGA 4O5AA 1RSZA 3K6KA 1WZNA 4ZRNA 2AEMA 1TYAE 4S1VA 1R00A 4HGNA 2I6QA 3CRNA 4MQEB 4PG7A 1RXWA 3KUUA 2FYTA 1ISRA 1QGED 4J49A 4JNKA 1YKFA 3OC0A 1IDN1 1LWOA 2N75A 4LCBA 4HS4A 5ARDA 2DWPA 1AS3A 1ST2A 2WJZB 2FRXA 1EDOA 4M0PA 4IX1A 4MSUA 2YQZA 4KQHA 4V0LA 4YP0A 3V1KA 4EUKA 1L5SA 1Y8ZA 1ISGA 1YB6A 5H9WA 1BRMA 4MUFA 1LPPA 3EUAA 4EFKA 2FNAA 1OFUA 5ELMA 5GADl 4G1BA 5K2OA 2G28A 3GYGA 2DHCA 4DAOA 1E94E 3EHEA 4ZO8A 2R60A 1N2HA 5CVDA 1Z7GA 4NV0A 5BW6B 1JG2A 4NCHA 4S0XA 4XRGA 5HQ3B 2IPOA 3R20A 4XB6B 5ER9A 4B6GA 1TRHA 2VPTA 3OCVA 1PHRA 1I6KA 3AR2A 3H99A 4I4NA 5DNAA 3W5SA 1YHYA 2C58A 2HH9A 2QV7A 3FWZA 1ZEJA 3OX4A 4LOKA 3RH0A 4D1YA 5GTDA 1TUGA 5KTMA 1SR8A 4DXHA 3UJBA 1MQSA 5HZHA 2JS7A 3CEMA 3D8SA 4YWJA 3W5HA 1VPEA 3DULA 3ND5A 1PN3A 3PBKA 4DRYA 1XRQA 3NRBA 3H0CA 4GOJA 2V3CC 2VJBA 1HFKA 5K7SA 3PNSA 2NTEA 3PNVA 4RF5A 5KVSA 5AI8A 1P4GA 2OMKA 4TL7A 4MVWA 5DEIA 4HWOA 2LKCA 3SIRA 1RFLA 2BBOA 1H65A 2I8LA 2XUJA 1EJ2A 1Z36A 3NOOA 3UJPA 4AX4A 3L7OA 1NP3A 4Q05A 1Y82A 1L1QA 1VHDA 4ZYLA 1RLJA 4QNNA 3IPCA 4J0KA 2GWHA 3OMWA 4PZZA 4XGIA 5LD2B 3THYA 1F06A 3R77A 5FQOA 4BN0A 1B73A 5JLAA 3WWZA 5G0SA 2Z09A 1JZSA 2QLJA 2HBRA 3FDZB 4WSOA 3SMVA 4AJLA 1DAEA 4D3DA 2XB2A 1GUZA 2QE7D 4OHFA 5AI5A 5TS3A 2H8GA 5CBKA 1PV2A 2C9YA 1P2VA 2VPQA 2Q1TA 3T7AA 1F6WA 1QGUB 2HLHA 5IZCA 2ZSIA 1ZQ9A 4OU4A 4FBMA 5JRDS 1G19A 5K8JB 1VCMA 1M2FA 1IJEA 2BCJQ 2OSBA 3GO4A 4D2IA 4ZGWA 1X1RA 4Y9SA 3Q1KA 2OHJA 5T67A 2C94A 2FRVA 2HRDA 4KGDA 2ODBA 4P4SA 2FR8C 4HH0A 4Q3OA 1P6UA 3I04A 4GEKA 4KR9A 3SQMA 2MINB 4DWJA 4WKBA 3O1LA 1QIFA 1UBFA 2Y1DA 3Q4GA 5EOVA 3UVEA 1KFKB 4KX5A 4B7CA 4LSWA 1YC2A 4DQDA 3SHVA 4PQGA 5T3YA 3QMMA 3TK1A 1JFTA 1NR1A 3FHCB 2JCGA 1XDUA 4HOYA 2MHCA 4KE8A 2BF7A 1POWA 2ATIA 3DLIA 3LDFA 3SF8B 4E15A 1FP7A 2Y1FA 1V45E 3JRXA 3HR8A 5D7NA 1PRYA 1XROA 4PV7A 1Q1BA 3I1JA 4ZEOA 2J9YB 4UKDA 1XUOA 3NUZA 3JAKB 3V97A 4AYWA 4CI0B 4EW2A 4KR7A 1JR6A 4EJ0A 5AKYA 3B9QA 3WLTA 4YJ3A 4DSNA 2FW1A 1DFHA 1E98A 1N2CE 3GV0A 4R01A 5IFLA 1J9ZA 1UZLA 3DO5A 2BEWA 4GOLD 1RAFA 3I01A 3UMVA 5LQJA 4ENTA 2IODA 3D64A 2QUJA 2X8JB 3PTZA 4NEGA 3GDFA 4M1YA 3L8HA 4IM7A 1YDEA 4KLNA 3DZJA 3IUBA 2WIDA 4WJLA 4HWSA 3OMXA 3C4QA 4Z6KA 2Z6AA 4NZ9A 4JQOA 3CLUD 3RAPR 2B20A 2VTKA 4RZIA 6PFKA 1Z4OA 2IZZA 2OFOA 2ZJ2A 1ZWLA 3H11B 3LRTA 5LYJF 4QZVA 3MOGA 1M1YB 2W2PA 1W5EA 5L53A 1WLYA 4QTTB 4EZEA 3DWGA 3AVYA 9GPBA 3WGMA 4NZPA 1A7KA 2P2CA 4MP3A 4OGGA 4E5UA 2ZETA 3AR7A 2D5CA 3SEAA 5HIAA 3QNUA 4KDFA 3EMDA 4IKPA 1IZYA 4KQKA 5BURA 4M8LA 1XZDA 4TWIA 3RTAA 3BQ9A 3GMTA 1JWLA 4YRTA 5G0WA 2YVAA 2G1PA 4DNXA 4A6PA 1I9CA 1TCCA 3CZPA 3PB3A 3Q98A 2C0CA 1DWPA 3PCXA 3PIIA 5NLLA 4Q9HA 3VR2A 2QJOA 4ZEWA 4U6SA 5K6AC 2YZ2A 3AEZA 3RRYA 2HJHA 1P39A 1P62B 1OAAA 2JJQA 3GVXA 1L6RA 2M6RA 4LYGA 3U2QA 5KUTA 1IL0A 2D1SA 4YI5A 2FUEA 3TTUA 3A6EA 3IAUA 1OZGA 1EUCA 2JHFA 2Q2OA 3D6MA 3B2QA 5DJ5A 4QFBA 1NBOA 2I6GA 4GBMA 8ATCA 1U31A 3FDFA 3GPLA 4ZI3A 1ZD4A 5ICCA 2Q5CA 1E9SA 5CVUA 2JFXA 3IHLA 4BX8A 4NPAA 1EG7A 4H16A 1GKKA 3KSZO 1R10A 2X9VA 2CY0A 3ZZMA 4DIDA 2VJYA 1JN0A 3R5FA 1H2XA 2VRCD 1W1WA 1FMLA 2P3OA 3N39C 4FZRA 3L9WA 1E18A 3S70A 1YZVA 4ZJYA 4LYDA 1CY0A 2WDZA 4JP3A 3ROEA 2AQIA 5EC8A 4Y6PA 3GJTA 1FL9A 1CE8A 1ZSYA 2Z2ZA 4Q9NA 2XE7A 1P0CA 2RAFA 2BGKA 4E1VA 1NX9A 1L7XA 2VDMB 2AE1A 1DOAA 2WINI 3C4JA 3DWIA 2Q6IA 2FMIA 2NZUG 1ZHFA 1QZ3A 2ZATA 3L5KA 4KN8A 1KE1A 5IXJA 4XLLA 2GLTA 1YDMA 3AUYA 1WPRA 1YS9A 2D8MA 5EE3A 3U9LA 1PNRA 1X92A 1U9IA 3ZIAD 1EA7A 4W8GA 4KO1S 2GESA 5C51B 2R6JA 5ADVA 1NNEA 1FNMA 5JAPA 4ISCA 2XQGA 4GSKA 3PI7A 5C1OA 3Q8LA 2J9GA 2W98A 1EFRD 4R7ZA 3TFQA 5FPKA 1NE7A 3IV9A 2IXDA 3IUSA 3RBAA 1DC7A 1C8KA 2SECE 2V4ZA 1PW7A 4KXVA 4X1IB 3SSOA 4DVJA 2HAEA 4ZIRB 1FF9A 3WGQA 2FMFA 2WJIA 4X3OA 1CSEE 5ERYA 4KQCA 5LCXA 4A82A 4C1BA 2EBFX 3HKEA 4TTJA 1N7HA 3R3HA 4ZODA 1S02A 3NOQA 3HJCA 1KRHA 4XH9B 3TVTA 3ZE0B 1HDCA 3P97A 4KDEA 3ZS8A 2D1FA 5I4BA 2FE1A 1HMPA 3OLVA 4RZ2A 3VKFA 1B26A 3NTRA 4ZO4A 1SM4A 2VF8A 1PBNA 4EKIA 2IVZA 1WY7A 3PIRA 4HB2A 4R2KA 1SXHA 3SMQA 4XTCS 3K1JA 4IVRA 1TEHA 1P31A 1V1MB 2XNKA 2KS6A 4RORA 2EC5A 4N5DA 2BUCA 4YALA 3WO1A 4IJKA 5CRIA 2AXEA 5TRTA 3A4TA 4OD0A 1OWPA 4N8SA 4F96A 1OZHA 3N5CA 3BGIA 1U3GA 4IMJB 5EIHA 3RGGA 1AQNA 2ZG6A 2OC4A 5FKJA 5JARA 2OO7A 3EVGA 1BW9A 1E79A 1IAQA 3A1WA 3WWPA 1NVEA 2YWEA 2PUAA 4KFSA 4DAEA 2W2KB 2PO7A 4YBZA 1NPDA 5T5QA 5I9MA 1OSNA 3HMKA 3ORHA 3WYAA 1CYEA 3CT6A 1G2OA 2WIKA 1F7VA 3BCUA 1V9CA 1QHYA 1Y7IA 3LT1A 4HAUA 4WDRA 3KAPA 2IA5A 1M73E 4QFDA 4UEQA 2QN1A 2ZJ4A 2ADOA 3AHEA 1XEAA 3AHDA 4U3JB 5LQRA 1F3OA 2W4MA 3R23A 3IEPA 2EFDB 5BVHA 5B1HA 3M6LA 3CLSD 3AR8A 3LU1A 1B6RA 3JWHA 4H31A 4LJ7A 1N2BA 3NIBA 5EZ6B 4NZZA 3DMRA 4MKGA 2ZR7A 1RCFA 1X94A 5D6OA 2AI1A 3GLHA 1IHDA 3RAJA 1SKAA 4D3ZA 4K1LA 5MGBA 1SUEA 1DBVO 3U4CA 2BZSA 4GECA 2Q1SA 3OE1A 3QEOA 3ZD7A 2R7KA 3H1AA 3TSAA 1T24A 4YX9A 2JGRA 1PVOA 2BMDA 3TD9A 1NW9B 3KOXA 4L4ZA 4NCNA 3P2KA 3ZVNA 1LLDA 4N8EA 4C7VA 2J9RA 4BTEA 3PXDA 3TD6A 4JN6B 4DW8A 2H7CA 1CDOA 1RC8A 1ZG3A 4HQOA 4IWNA 2BEKA 1VCHA 3GP5A 4KSYA 3V4SA 1IOWA 4R2JA 1Z34A 4TV8B 4CL8A 3BDVA 1TA4A 4CM8A 2R2AA 5L7TA 4D02A 5JC8A 3U4GA 4XE5A 3LLMA 2IE0A 2R97A 1P9NA 3CPSA 2AOVA 2RK4A 1EZZA 4Q66C 4Q3CA 1E2LA 4EQ6B 3B5JA 1YRAA 3QBJA 4AKIA 2GVZC 3VZCA 2P9ZA 3E3NA 4NIMA 4Z7JA 4R2XA 4R5MA 4MVJP 1KY4A 5A0VA 3EC2A 4HEJA 5SYMA 2QMZA 2XGSA 3L2OB 4OJQA 1SQGA 3LLUA 3MCVA 2PG3A 4YAOA 4M49A 1FX0A 1RZVA 1V6SA 1YBVA 2CFIA 4D9GA 3FOAA 4X93A 1II8A 1CUWA 1XRJA 2H59A 1F6BA 2YJ3A 1S2IA 4P3YA 3I61A 2I54A 5EHNA 3FDJA 2B98A 3QPWA 2V7BA 3JAWB 4NOLA 1KBOA 3WB0A 3WMRA 3AFHA 3GJ3A 4D3YA 3TCKA 3WQQA 4NY1A 3EEFA 3HSYA 3UC9A 3I6YA 1TKAA 1VGVA 4G5GA 5AW9A 4OK3A 1HLGA 1MJNA 3LO5A 3TINA 3PEYA 1XF9A 1QANA 1ANKA 1PLJA 1PR9A 4JI0B 1F9AA 4BO5A 4UULA 2ZWIA 1Z4IA 3FSGD 3WB1A 3I0MA 3JYNA 1YIOA 4HTAA 1ISMA 4BUCA 1KSFX 2VJAA 4GF5A 1QHXA 1E9EA 4KUHA 4EUFA 3FB1A 4D4KA 5JNSA 3MXOA 1EP3B 1H6DA 4WTOA 4NOJA 1JPUA 1UXHA 3KKQA 5TSDA 4FK8A 3V46A 3C74A 4LN1A 3PUWA 3C0KA 2VP9A 4WKGA 5BR8B 1NYQA 3I2JA 4Z5XA 6AT1A 1ZC4A 5SY4A 3RVRA 1GNQA 2NP7A 4HRVA 2C2WA 5HNKA 2OR3A 2QZPA 2G88A 4KGZA 2RFLA 3ENKA 2WOOA 1VCIA 1M72A 5AVUA 5EYPB 1OI7A 3T7JA 1XNRB 3RG2A 1Y0BA 2ZZKA 4IILA 2PUCA 1M8PA 1UZMA 3GNQA 5IM4A 1BFKA 2I4OA 1GSIA 1HSZA 1WOMA 2RK6A 3QRWA 3CLUC 3H4MA 3N2KA 3H7IA 1TU3A 2COUA 3OWXA 1Z2DA 2H1CA 1ORHA 1H2HA 1S5PA 1JVNA 1TK9A 2IZ1A 4L8LA 5CYOA 4NBLA 1LD3A 1T10A 4DOMA 4HVCA 1PDVA 421PA 4IIFA 4MPPA 3FHLA 3SXPA 2F62A 1OU4A 2HFJA 4U7FA 4W9RA 3ZCSA 3ANYB 2AFHB 3NAZA 3QVMA 4HNAB 4BWGA 4AS2A 2B4QA 2W43A 3AU9A 4FMBB 4YRAA 1XB2A 3OQBA 3LQ1A 3G13A 2NO9A 2H7YA 3EXEA 5JCXA 1QIDA 4E2ZA 1WZIA 4INAA 4L85A 3ZBPA 4PEVA 4XOIA 1SBTA 2FZEA 2OBMA 5CG2A 4DA8A 4LKRA 2AFIB 3R74A 5EMNA 4ZK6A 3OT5A 5HZMA 5A4FS 4F9GA 4G0YA 3BQNB 2YFHA 1RHKA 3WMWA 5LL6P 4UZEA 1RI1A 1IIRA 1TYDE 1KZHA 3RFFA 2CVPA 3W8NA 1Z4JA 1R6XA 5E3HA 5J3JA 1OT3A 3OPYI 1LXCA 4F56A 2RJOA 5LKRA 4MUXA 3ROXA 4DA4A 5E4YA 4ZPXA 1CC1S 5EUBA 2X2EA 4MW0A 1QHHA 5BW4A 3K20A 1PT9A 4HH4A 3P94A 4YUWA 2OY0A 4EJFA 3MOSA 3DLHA 4E5DA 1U0GA 1WXIA 3GLVA 4FPXA 2JGMA 5JSHA 2ALJA 1XEXB 3IEVA 5AKXA 3AK4A 3K7EA 2ZI3A 4Q4HA 1MBZA 4YGXB 2P1DA 2B3DA 2H52A 4C88A 4D8VA 3VKGA 3UHOA 2PUHA 2Q41A 5LMNB 3DLTA 3O4IA 3O5AA 2OCAA 4MR9B 1KFBB 1AQYA 1IQUA 1GZHB 4V1CB 3GG2A 1HBJA 3DP9A 5GWXA 3O9ZA 3R3XA 3T3GA 1XL0A 5AK6A 1SD1A 4KMRA 2HUNA 3SZOA 3H2SA 1YBFA 1XVAA 1T8SA 3FD8A 4D80A 5IKPA 2I29A 2PUGA 4JD5A 4BMYA 1IY8A 3L8EA 3JYOA 4LJ6A 1P0PA 5LXTF 4ALIA 4B3XA 4K0KB 4JLKA 4O2AA 3B51X 4H0CA 4CMHA 1EFHA 1UZUA 2B25A 3DZKA 4L57A 5DHSA 3OTOB 2P9JA 5LLDA 4DR7B 3T9EA 1E2MA 3LWBA 5DIFA 1VL5A 4PG5A 3JAWA 5UKDA 4MUIA 1NZDA 2VG8A 4OQXA 2YH2A 2DMRA 2MSLA 2C3YA 3BIWA 1VQ1A 1PU2A 4YP1A 4JLDA 2QTAA 4MWCA 1EXMA 1YQGA 4LZWA 4UEJA 1H3EA 3IDOA 4TLCA 3GX1A 2HLDD 1QZUA 3H2KA 2GR9A 4LGMA 4P3XA 1IM5A 3FY4A 5F5NA 3V6MA 3G2IA 3TBKA 2NVUB 1UBJS 1ZKDA 4UNRA 1J7KA 2CB0A 2CHVA 3B1VA 2ERYA 3GCGA 1EFKA 1IY9A 3ELBA 4PQYA 5FUVA 4L8FA 4WL0A 2O2ZA 1II0A 2BKEA 3PSHA 4QEDA 3RM3A 4R40A 2QTMA 3ZJ4A 3K9FC 3AF0A 4OHVA 1BO6A 3JSXA 4JLNA 3VNUA 1RXIA 1NJFA 2LPMA 2QNRA 3ZY6A 4H7HA 3ISTA 4QPJC 1WQ3A 1SKYE 5HIMA 4TXHA 4CKWA 3U7JA 3SLGA 5IKMA 2CNLA 2JGAA 2AWOA 5K6RA 1JQBA 4M53A 3NOXA 5JCJD 4R1PA 5F9MA 1T6XA 2E82A 4QRHA 5H1YA 3GT7A 2QM7A 2ZYRA 2VJPA 3C24A 1KYVA 1XZHA 1LUAA 4FFMA 4GYWA 4OUDA 4OJKA 5AM1A 4J3FA 2DKNA 3U3OA 3AUSA 5C35A 3MWJA 1RPTA 4CQLA 1PDOA 5IWAB 3DS8A 4RHEA 2BEWB 4H7IA 3CEAA 1IDOA 1NVXQ 5A05A 3PGVA 2VSQA 4YXWA 4MS3B 4N7BA 1MN6A 2WAXA 1LFDB 1SELA 4HWGA 2QRVB 3OTIA 4JQCA 5J4LA 1F2UA 4OMFG 2ZRPA 1K0UA 3C5CA 4F3KA 5KNCD 5IG2A 2WT8A 1Z18A 1AQUA 2JKYA 3OO0A 3DVAA 4KW7A 3TSYA 3KZNA 4MWDA 1RI4A 4GL4A 1NN5A 4RPKA 4Y30A 4YDRA 5DNVA 2PGIA 2QG9A 4Z9AA 3SF0A 4JNCA 4HY3A 1NQWA 3TNFA 2WJJA 2QLNA 1FMFA 1JIIA 1CUZA 2BMWA 2VCYA 4DS3A 2FUG1 2JDIA 1RMTA 4YUXA 1QTRA 2REXB 3S5JA 4CF7A 1RBMA 3MPOA 4RMHA 1ECPA 4P53A 4L73A 4M9XA 3VC3A 1K6EA 3FFXA 1XJQA 3ED1A 3GEMA 1YUMA 2P2ZA 2GEUA 3HKDA 1UIMA 5BR4A 3U3ZA 1WL8A 2JBWA 4HNGA 4QO7A 5EXPA 4E5PA 1IRIA 1O1YA 2R84A 1C9JA 2CHEA 3LK7A 5TNXA 1HE4A 4YT2A 3QSGA 5U1PA 1O94C 4XWWA 2OUIA 1PQYA 3DTVB 3H8SA 2Q5LA 4WRRA 2F9FA 2MT9A 5JWRA 1XZPA 4GNKA 1XTIA 2C29D 3DD5A 3MVEA 1RVV1 4L5AA 4EFDA 4Z2YA 1XTZA 5CB4F 1P4SA 1J8FA 4LV6A 2FPIB 3AVTA 3EQ8A 1LX7A 5LDGA 1WBBA 1XHLA 4MUKA 1QO7A 4N5HX 2Z4SA 4UW9A 3KNZA 2Y6UA 5TT0A 3F3MA 1L8AA 1C0EA 1M2GA 1MC8A 5LMCA 4C4OA 1II8B 2PU7A 3AR3A 3KK0A 1JF8A 3ZZTA 3UAWA 2PHZA 3UIEA 4NZOA 1C3JA 1I0ZA 3P27A 3UM9A 1BZYA 4HXEB 2CV1A 1M2KA 1EVEA 1ESDA 2O57A 2XMDA 5IH3A 3OPXA 2DBVO 3PNYA 3MINB 4OI1A 3JARB 3D9QX 1NURA 4KPUB 1CBUA 4XYGA 1ZH8A 1T9HA 1ZI6A 4O63O 1BYIA 1U98A 5KNDH 1TUBA 1TAUA 4NATA 2ZRMA 3LY9A 3GOHA 1NUPA 4TUYA 1RC1A 7MDHA 1NVVR 3FVVA 4REMA 2P27A 3DWFA 4J43A 3WK4A 4FLMA 5KKNB 1XRNA 1KI4A 4GX1A 3FPHA 3W6NA 1C3LA 1N3BA 4KREA 2VWPA 1RQ7A 2MSKA 3ITKA 3FMOB 4BFUA 1Z3IX 2GBIA 3QUSA 4M1OA 4OIFA 3LY8A 4Q03A 3WK9A 1N78A 5F5LA 4ZI5A 2VPZA 3BB4A 2I55A 4N3BA 3W9BA 4DSAA 1N5MA 1C3VA 4K6HA 2IEAA 2FEMA 2XUOA 1NVKA 3C3YA 4JLJA 5SZKB 5KDLA 3F73A 2BMFA 2LIVA 2BLLA 4L5CA 1J0BA 4Y1GA 4BU0A 4FT2A 2UUBB 2FFQA 3U61B 3HTXA 3RVLA 1IH8A 1QXSA 5TB5A 3V9PA 4M87A 5EQDA 4ES6A 3HACA 4Q1FA 3S27A 1E2JA 2QSYA 4OQYA 2Y6VA 1XVVA 2C57A 2BE7A 4W6ZA 2HV8A 3K31A 2PSDA 4LISA 1GXSA 2CEKA 4NH4A 5LPNA 1MX9A 2VH5R 3AM4A 1EFUA 3C6QA 3LCMA 1KPHA 2AQHA 2P9FA 3N8HA 5KYUA 2HNAA 4YV0A 1XTRA 3ONDA 2WNSA 1FTSA 1YBAA 3OAAD 4S1NA 2ZYGA 1NR7A 2JH3A 3T9CA 3H5RA 3UPDA 2BGRA 1KDTA 1KVSA 2XD4A 3G6KA 2A0WA 2XLCA 3P2MA 4NS4A 5ADHA 2FW0A 4PIPA 4QVGA 3NCTA 2JGLA 4X8OA 5D86A 1W4LA 4CQMB 2PZ8A 4LV5B 2GRAA 2JZNA 5EIBD 3TIVA 4H77A 4MIOA 4FB5A 4E1AA 2G04A 3NKLA 4CKYA 1C8VB 4YUAA 2X2OA 1H6CA 2XYQA 4ZT2A 1RLIA 1E64A 1Y8CA 2YOFA 4UUAA 4FXPA 1F6DA 4AZ3A 4BWVA 2FSFA 3FETA 4OHPA 3SZRA 5FOVA 4F7DA 1V2HE 1A04A 3B52X 3PUYA 3M2TA 4LDPA 4AJOA 5LOVB 3DMYA 1VSQA 3B7GA 2QW0X 4XASA 4GDMA 4RJLA 5ALNA 3K6SB 4YUVA 3Q9SA 1MEEA 4ZALA 2FI1A 2NU8A 1IBRA 3W90A 4AZ0B 2IQIA 4TMYA 1L5RA 4JLAA 5JQWA 1U7WA 4TSRA 3H4IA 1K68A 1USGA 5H3CA 1E5TA 3QEMA 4QQFA 2R1TA 3MQ4A 3GDOA 1G8HA 5I9NA 1KK1A 2PR2A 4RS3A 1Y3IA 1D2NA 2PKYX 3DUWA 4QYWA 1DMSA 3ZUGA 2XDAA 3RJMA 1JJ7A 3WFZA 1KIAA 3PICA 2VJKA 3BMOB 1KOLA 3KPWA 3O47A 4KC0A 2KWIA 3HJTA 4GRIA 3RU2A 2Q6TA 1TVEA 3NAGA 1ID8A 4BVLA 2YOHA 1YE8A 2WIBA 3VXKA 4EJMA 4WLFA 4XB1A 1SKUA 4P4LA 4LE1A 3GOQA 1QOPB 1E9AA 3T0IA 3OLWA 4BMCA 3PI6A 4C4SA 3G2KA 5KYWA 3PTLA 1J23A 2K6GA 3ANMA 4TKUB 5IWCA 4BJ1A 1Q20A 2PNFA 3AUTA 3B85A 2ORVA 5EMMA 3U37A 4DIKA 5JNVA 1O2DA 2GM9A 5A7GA 4UTNA 1E2QA 2QJTA 2V98A 2AFIE 1KAMA 3B6JA 1KY2A 2EHJA 2A0KA 3EGDA 3Q6IA 1E58A 3D02A 3HCFA 2F3RA 2EZ8A 4LJ8A 1R66A 1RBQA 2JVKA 2QD1A 3F9RA 4M21A 1OWMA 4RV5A 4Y6RA 2A4MA 3WX0A 1ZOIA 4EA8A 5ED4A 4DILA 2OAEA 1A82A 5JADA 1ZGAA 2XQFA 3FMIA 1MF7A 5KNDA 1J5XA 1HUQA 4TT8A 1TM2A 4NJEB 1AXGA 1QE5A 3W4JA 4JR0A 3NYQA 5J23A 4ZANA 3L0CA 2V4MA 2NTJA 3UAZA 1GAJA 2F1HA 2VPIA 3MRVA 4DMFA 1KO1A 1MQ8B 2GM4A 5DFAA 1ES9A 2XBMA 3EQ6A 3UJ6A 3FZGA 5B4TA 1O6ZA 1BU8A 1I3LA 1CPYA 4V3BA 1WS6A 1BQ4A 2NU6B 2WPDD 3CHYA 3OBIA 2OAQ1 3B6ZA 1QIEA 3OQIB 4XARA 1LF5A 3CUSA 5DSTA 3DEJA 1EIZA 1L7OA 4M6WA 2I9KA 1ULBA 4UHDA 2B8NA 2JBHA 2Z1DA 1NMYA 4WY2A 1CS0B 4BRWA 2CDCA 3OVMA 4JIGA 3O4RA 4KIJA 1EE2A 1L1RA 1F9EA 2GLXA 3P5SA 4J76A 3GEHA 4OYLA 4R83A 1XQVA 5IXSA 1NJ6A 4DXDA 2VXOA 1EHCA 2G9UA 3TRKA 5EWLA 1PJRA 3ZWOA 4Q19A 1TU0A 3ZR4B 4V1CI 1VPLA 3V4VB 3AUXA 3GGOA 3INRA 2QN2A 3GNLA 4V3CA 4W6QA 1XDBA 1KAQA 2D1YA 4LHWA 2DVMA 1RKUA 3RS3A 4BFSA 5C5EA 4DV7B 1KDZA 1R18A 3EH1A 1VOTA 2VWHA 1XMXA 3JAMA 2ZU6A 3PNBA 2BC9A 4JUCA 4Q39A 5E2AA 1OWLA 5IJ9B 2QVXX 3B38A 3I62A 1CETA 5CXUA 4MMZB 1MV5A 3C1OA 4EF4A 3RTBA 4KFTA 4ZQCB 4KR2A 3AJAA 1PEYA 3ODGA 1EFRA 1KK3A 1X1SA 3KUKA 1JAXA 2JLSA 3V4ZA 1HT1E 4UU0A 3EGWA 2PJUA 1EB9A 1X80B 3DQZA 1Q7TA 1DO2A 3LA8A 4AG5A 2RONA 1PGPA 1VGRA 4JSTA 4ZOLB 2NYRA 2PQMA 2Q6KA 3OO1A 1HG1A 2YC4C 3FUUA 5BNIA 1YIDA 3KB1A 2QMEA 2RSLA 2XVXA 1SK8A 1ZOOA 5LDDC 1YZYA 1VSUA 3JTMA 4Q93A 3Q9LA 1HX7A 2PH5A 4PANA 1JQ3A 3K72B 3Q1LA 1K6XA 3IGFA 4FFDA 1GRCA 1KJJA 2QTCA 1P2GA 3FRHA 2UU9B 1RPAA 1ZGJA 2KPOA 2A9VA 2AEEA 1VIMA 4QWMA 2HZ7A 7AT1A 4UNQA 3D7NA 3MWGA 1L4UA 1D1QA 5I4KA 3BFXA 2Y1EA 4RH0A 5SY9A 2RB5A 2QD5A 4GI2A 4P38A 2LGJA 3KOZA 3ETDA 4A5OA 3KL2A 1JEYB 3N2KB 1VFPA 3N0WA 3ZZUA 4YCNA 3DAGA 3I39X 3LDAA 4NU0A 1TLFA 3QXXA 1U0SY 3QHQA 4M2LA 4C43A 4PHHA 4UUPA 4XJXA 5ERGB 2WSSD 3NWEA 3O1JC 4FZ3A 4HPXB 4N0PA 4PBRA 1XAHA 2FKAA 2JCVA 5DXAA 2RHDA 3BB3A 1JW9B 3WGYA 3L8YA 1BE1A 4DZZA 2TRSB 2DY1A 4OQNA 1QR2A 5IUNC 2I91A 1R64A 1WHTA 1PV1A 2ZJBA 3I6QA 2PSEA 1EFPB 2ZQZA 5K6TA 2HLDA 4C6SA 2R1TB 1MU0A 2RGDA 1Z8HA 3L7NA 1SG6A 1D0IA 1A76A 1XDSA 3GWZA 3LK6A 1KP2A 4U5XA 1SXGA 5BW5A 5LKAA 5IX8A 5C3MA 2D6FA 2FPIA 1V43A 1GGNA 2ZS7A 1KARA 1BGVA 3NQ41 5HW0A 4ZI7F 4NRDA 1DKLA 2A59A 2CE2X 3B3FA 4NBSA 2CVZA 2HR1A 4QBTA 3EOAI 1SUDA 2PGNA 3OX3A 2HJWA 1XALA 5GIOE 1DG3A 1MFZA 2OFXA 2OQRA 2B94A 2Q3HA 2Z5FA 3SXUA 4L9SA 4D0GA 2WJGA 1Y6GA 1Q22A 3C8ZA 2ORIA 3GN2A 4I4TA 4KDRA 5JSZB 5TARA 4EHDA 5AW1A 2Q49A 1YMUA 2J85A 2VTEA 3IBYA 3FZEA 1QHSA 1Z8FA 3MJ4A 1JHUA 1XTJA 3K9HA 4M54A 1SHJA 4IHQA 4WADA 5IAKA 3U3KA 1U1CA 4TWAA 3THWB 4LC0A 2ZM6B 3FLMA 3UUFA 5IC6A 3ZIDA 5C0OE 3A6PC 2VNIA 2VZLA 3RK4A 2Z2YA 3HEAA 4U7HA 5DBFA 3PFHA 1EX7A 1FTNA 4DLAA 2ZR8A 4YMIA 1EUZA 3IAM6 1NX6A 3RUFA 1FW6A 5C5DA 1K8ZB 2Y77A 5LBUA 2R8BA 3PUVA 4QGGA 3Q3IA 5ITZA 2PUBA 3JQPA 2QGZA 5FPPA 2GEJA 5MHTA 1U0FA 1VLZA 3RYFB 2LDXA 1GZ4A 2AN3A 4H6XA 5FA6A 1J22A 1G3IA 1U2DC 2QX4A 4P4GA 2HPAA 4Y6GB 1C30B 2DPHA 3ZWDA 3ZZ0A 4DLSA 1AKVA 1JP7A 2DUJA 3JVVA 5K0ZA 3HUTA 3VOSA 2JDID 1C7JA 2ZE6A 5JO9A 1G3MA 1OREA 4WE3A 3IC5A 3FDIA 4S2UA 2XSZA 2ZVQX 3P8ZA 4ZN6A 1Q3TA 3O8BA 1R0CA 4G4JA 1MKYA 4J6EA 4EH1A 4PNEA 2E4VA 5L8VA 4KXMA 7ADHA 1FDIA 4FINA 2YJ5A 3EODA 4LJLA 2G1KA 2C2OA 4XPZA 2EBHX 1HGXA 2K5UA 3EDMA 4MARA 1M7BA 3GY0A 1GL3A 3I4CA 5A2QA 3DVRX 5JFGA 3LFUA 3ZCRA 1OLUA 4C3ZA 3IT0A 4P1ZA 4PHCA 1UOPA 1JPJA 2VVTA 3DBRB 3OPMA 1ARZA 3A6DA 1UOOA 3F8WA 4JJFA 3HCOA 3PRKE 4ND2A 2MOKA 3AY6A 4MEAA 4KHPB 1R15A 2VYND 1Q84A 3A28A 4ZQEA 2G7MC 4M98A 4OHRA 3SY8A 1T3TA 5HUHA 4O33A 1TYCA 3R3SA 4OQLA 3SYKA 3O8OB 3ZU3A 4GKVA 2UVPB 4QQNA 5IZ4A 1Y6JA 5F76A 3WB9A 4F4IA 3UQYS 5EESA 1PWEA 2YTZA 3V8EA 2QV0A 1OHHD 3NXSA 4KGXA 2OPHA 1OGYA 5KWJA 4CKWB 3D8TA 3GRAA 1LTHR 4ZJZA 1RHUA 2GUGA 3JWJA 3FGPA 2Q0SA 3CSDA 1I94B 3V34A 1KS9A 4FXOA 2PAAA 5CCBA 1RHMA 5JMPA 4HX5A 1YL5A 2DM6A 5K20A 3HB0A 4B3GA 1D2MA 2FR1A 3LLVA 4FDVA 4LJKA 1EE1A 3WL7A 3ZCVA 3GAMA 3AF2A 4Q1VA 3UGTA 2PWYA 5C4MA 2JLWA 1FFCA 4CEJB 4GIBA 1E1QA 1NRJB 2WMYA 2EJTA 2FPXA 1L8QA 2FUCA 1P2FA 2FLWA 4BU1A 4OP1A 4NBTA 4AZWA 5FLEX 1EVQA 2ARKA 2NQ2C 3UT6A 3WBKA 1E0DA 1HOTA 2BE9A 4TLEA 1NW5A 3IQXA 4EF5A 3EZ6A 1L4KA 2QBYA 5IARA 4PN7A 1JTFA 1J06A 1RI5A 3H9QA 3OZIA 2ODEA 2WIFA 1VIYA 3KWFA 1VKJA 1Z9BA 2YV2A 2ETXA 3RU3A 1YQXA 2XADA 1UP4A 1EFPA 2RIRA 3A32A 2NZYA 3NBKA 3PNMA 5HIJA 4NFYA 1Z4KA 4EHLA 8OHMA 3PDJA 2WDPA 4F4DA 5JAQA 1JDBC 1QHHB 3DKKA 2OXCA 4KXXA 2C88A 4RIEA 3W5BA 5DLEA 4BNJA 5EFOA 3R3VA 4REQB 4RTSA 1UM8A 2YWJA 2JJ1D 2V7UA 3FVWA 1L0BA 3I6ZA 4F6RB 3CF0A 3EFHA 3WLHA 3JYQA 1J00A 1YJQA 5EIOA 2QZ9A 2OCIA 3IQDB 2WAOA 5FUMA 3BICA 4LZNA 5EJMA 2WSYB 2AOUA 5ILQA 5JJBA 5I7SA 1KC1A 4XAQA 4BATA 1TGYA 1DX6A 3AVVA 2ODQA 4JU8A 3HB4X 1DO0A 4BKRA 4BIIA 3T3OA 1IN7A 2GZ2A 1PFUA 3JW8A 3ETCA 4PC7A 4PAWA 5LUBA 3UWOA 4J2HA 3F5DA 4FWTA 1JTEA 2JA2A 5FUXA 4K3VA 4G63A 3RNOA 5CXQA 1HE8B 4CM1A 1BXZA 2D00A 4MUGA 1U3DA 2ZQYA 3NHFA 1C9DB 2C3MA 1LDMA 2BZ0A 3PR3A 3QJ5A 1O8BA 2Y2UA 4QE3A 4B40A 3T94A 4R2IA 2W2QA 3HVJA 1VKZA 4O0MA 3JQFC 3FVQA 2DR3A 1GPUA 2VT7A 4IQGA 1HT2E 3L8MA 5FBKA 1DPFA 2ZB8A 2BSAA 2W00A 2FMXA 2AQ8A 1LNZA 1PT7A 4KNVA 4CTOA 1Z83A 3ABIA 3H65A 5LZ9A 1MT0A 3HBLA 5FH9A 3RSOA 1ZNXA 1ZWKA 4C6RA 5ALLA 2J6BA 3QEKA 1RKXA 4MKRA 1B93A 2Q6OA 5SV2A 2E21A 2AFHA 4WWHA 1B0ZA 4OJYA 3QH4A 3T5CA 2I1QA 3E9QA 4BYMA 4G0VA 3SJAA 2W6JA 3F8TA 2KBFA 2E4XA 3E05A 3X44A 1PX2A 4E2FA 5M5BA 4FR0A 1OQAA 4LKOA 4HEQA 4N0MA 4OI2A 4X90A 2FGJA 2W42A 1KK0A 1GG9A 3QNWA 1M1UA 2H4FA 1O8CA 3CLRD 4A6XA 4BB9A 1SHTX 3KZMA 4KRFA 4E94A 2CUNA 1IK6A 4ID9A 1YRQA 5D8DA 1T2DA 1DI0A 3DBRA 3L6RA 1PJAA 2EJWA 2HJRA 4DHEA 4OKIA 4RY0A 5AW6A 2I66A 4RXTA 1J1UA 4JGGA 2BHLA 2WYHA 1EAYA 1RLUA 4NCJA 4CMGA 2JAQA 3L0IB 4FYPA 2YFYA 3PQ4A 1DS6A 3FAZA 4M86A 4R51A 1Y4SA 3TRIA 3B5EA 1KKLA 5FWYB 2GVDC 5BNFA 1V5GA 5AI9A 5JH7A 2J32A 4ZYZA 4UMEA 4BGIA 5J5AA 2H11A 1RPJA 3EVBA 3SX2A 3VTZA 3FX2A 1OB2A 3F96A 2E5FA 5AM3A 5FL7A 2E9SA 4IIDA 4AJNA 2H29A 4ZGBA 4HEA6 1XCLA 2PZFA 1G9XA 3BDIA 3H84A 3PXEA 3GAFA 3LVQE 3QE2A 3KFLA 4GSLA 4C20A 3K1TA 1YRYE 4I81A 4UHKA 3CIOA 4N0DA 3K0KA 1AS0A 5IAJA 4K6FA 4JYZA 4B82A 1P18A 2NAPA 3AR9A 1PO7A 1SZDA 2BZ1A 3GD7A 4P84A 4PE5B 2D2EA 5FUQA 2DFPA 5B3LA 2GA9A 3PU6A 4XSVA 4DBLE 3B1XA 3OX2A 1ZISA 3A4LA 3AM5A 5CX1B 4LEIA 1PT5A 5FBWB 1DX4A 3WBJA 3NWPA 4BNDA 4BUJA 2JK1A 5JD5A 1ORVA 1THTA 1IXSB 4MINA 4J0DA 2P9YA 1HYHA 4C7OA 4E22A 3GN1A 4BX2A 2ZBUA 4GFDA 1OXUA 2OZVA 3Q3EA 1WAMA 1X19A 3OEED 4UBNA 4ZAXA 1DBIA 2E7ZA 2BV3A 4TTSA 3MWYW 4UVHA 4ZU3A 3N53A 4L08A 2X77A 2XTJA 5EJEA 1XTVA 3G8AA 3GJ8A 5EPEA 3SXUB 3WMFA 4OHYA 3VZPA 2FPGA 2NUPA 5LFAA 3ZKAA 3KAKA 4DJDC 1KVUA 6NULA 1QLHA 3OM8A 2EQBA 2IF2A 2WUDA 4MGIR 1FJ2A 3I5AA 4R9VA 1W5FA 4JLUA 2FWIA 2YKGA 5I3CA 5ILOA 1E2EA 3I83A 3A2NA 4CF3A 2JIZA 4HVAA 1TT7A 3VSDA 3RC2A 3ZG6A 2C4KA 1EVKA 3CSUA 4MUAA 2ZBRA 2QTRA 3HXTA 3UNXA 2IYSA 3HK2A 1VA5A 1U7HA 3WA6A 5CFOA 4A10A 3JATA 1IPEA 3D7SA 1RFGE 3GU3A 2JANA 3LOPA 4NDAA 3ZVMA 3P0EA 4OLBA 1GZ5A 3RAFC 3SYMA 3UPUA 4KRYA 2AK2A 16PKA 3LX8A 2N46A 4QXPA 4DA9A 4Q9JA 1EX1A 5BMVF 1G2QA 4OBWA 4DL9A 4A3SA 1GAWA 1NI4A 1LW6E 2GM3A 5J4YA 3GPDG 4A26A 1G64A 2NZXA 4MS3A 4EYSA 1T8UA 4M1WA 4WNYA 4UASA 2BN4A 3RS0A 1SOUA 3G02A 4A2WA 5KJCA 2C20A 3E22B 3KTFA 4U63A 4DNQA 1FUIA 1UK8A 3V3KA 1EGMB 4AMGA 3K30A 1EP1B 4CQMA 5AVOA 3PR1A 4ECAA 5IABA 3PEEA 1CDDA 3DEHA 2HNKA 1RQXA 2X7XA 3D31A 4QJIA 5IVIA 1Z5NA 5KNCH 2E5LB 4ER6A 3V1YA 2EKLA 3EDQA 1NOJA 3EZXA 1OT5A 3BBLA 1PWZA 2XKBA 1THMA 4A16A 2A5FA 2X9NA 3AFOA 3IEIA 3PFGA 4J94A 4D9FA 3T52A 3WRWA 3K0AA 3GBVA 4QQRA 1IB6A 1AGRA 5DRYA 1UPTA 1GZ3A 2FW9A 4MPTA 5KYUB 4A4DA 4UUQA 5FHRA 4EMTA 2J5RA 3GLFB 3R8FA 2VSXA 3M4JA 1Y3CE 3IOCA 3B1KA 3CRRA 4HLNA 5FTKA 5A1JA 1JAHA 2IHJA 2MSCB 2YOGA 2GB4A 1DG1G 4MTCA 4QXOA 5EPOA 1G5PA 1GJRA 2EL9A 4QDZA 4EUHA 4R7TA 5TDHA 3RT9A 5D87A 1IXKA 1VJRA 4G8DA 5HF5A 1WKVA 1JFFB 4WOPA 4P6VF 3RLIA 2WB4A 5HEKA 3T7EA 4EL0A 2Q21A 1C3OB 1TQDA 5ECWA 5IFKA 3EK2A 1BD3A 2YJTD 4LI0A 3W2GA 2JBAA 3BZBA 4WK2B 3X1DA 2V7GA 4XUCA 2BBSA 1L4GA 3IIJA 4ML3A 1INLA 4AW9A 2D2IA 2VUTA 3KDPA 2Q3LA 2Y99A 4MPDA 2ZWAA 3A9RA 1BDJA 3WNQA 2HGSA 4EDFA 5LNK6 2RGGA 2WJAA 3B1ZA 1FVHA 5ALGA 5KSZA 3CS3A 1Z5PA 4B7ZA 5AVXA 3FSGA 5BNWA 1KQGA 3VHXB 1GPJA 4DJJA 4BE4A 1LI7A 1EWKA 3R5KA 2Y4OA 1FS5A 4MYCA 3LY7A 5E4JA 4NBWA 4NDNE 3NTOA 4TKUA 7REQA 1JA1A 1ST3A 3I0NA 3X2FA 3ELDA 1FMJA 4PR3A 3QU4A 4BDSA 2ADFA 4O2AF 3N74A 5IDQA 2XQKA 1JHZA 2YVQA 3GUVA 1PJTA 1M6YA 3RYHA 2DFLA 5DHAA 4M0UA 3W78A 1Z63A 2J0SA 1S8NA 2GN9A 4RJTA 5BORA 3GNTA 4KPGA 3RVMA 5HKAA 1EVLA 1M1YE 5C34B 5J2UB 3TMAA 3QVJA 1EP2B 2PIDA 3OOSA 4O8CA 1N57A 5K3DA 3ILYA 3LT0A 4Z8YA 2D3WA 2MSEB 5CAEB 2QR3A 1OAOA 4JAVC 1EKXA 2VJLA 3UMMA 3CKKA 1ID1A 3PDWA 3V8MA 1PL8A 2R00A 5B57C 4FBLA 2WUWE 3I76A 1CIVA 3FLBA 4X24A 1P77A 4BLRA 4TM7A 5KYXB 1N4DA 2PKWA 3WOVA 2Y0DA 3W5IA 4CCSA 4H7JA 2YHSA 3OJOA 4FU0A 2EF0A 5JATA 2Q6LA 3ZHBA 2QD3A 1DT5A 4YFYA 3ZHOA 2YICA 2R1VA 1LI5A 2I6FA 1O95D 2NT3A 4KX3A 3RV3A 4BCCA 5EJ5A 4YP6A 5FX2A 2BH2A 3JWPA 1F1JA 2E89A 1UUFA 2J09A 4IS3A 4QUIA 4EG7A 4EP1A 1U0BB 2G8LA 2HDNB 2AD1A 5SZHB 1IJBA 3TLJA 4X20B 4JJEA 2HZBA 1G42A 2BW0A 4Y2XA 2PBFA 4DARA 2JGKA 5LM3A 3U7RA 1U5BA 1MABB 3WL3A 4ZV4A 4NFSA 1WZUA 3HFRA 1QFYA 2Z08A 3NTXA 1ML4A 4IZ6A 3UXHA 2XT6A 1I01A 1Y7LA 2CMKA 2FQYA 2Z3WA 1ZHHA 3VYTB 2AUTA 5EUQB 2ZRNA 1EDBA 2HA0A 3GCWA 1X0VA 2NVBA 3QK7A 3C3AA 1ZD1A 4WVLA 2NV0A 4D57A 1PG0A 4KRGA 1HSOA 4ZHQB 5J43A 1VKHA 3EGDB 3NXKA 2D4HA 4J4BA 2IYZA 4EPXA 4WHMA 1CJUC 5DN9A 4AO7A 1UWVA 1Z7EA 2VNAA 3FR8A 3HSKA 3CKYA 3FI9A 1I4OA 1R0XA 3M33A 3KSUA 4OXXA 1DOZA 1JQAA 4DM7A 4B85A 4OTZA 1W73A 3N8DA 5F7ZA 3E5HA 2RI1A 4JYBA 1L5OA 4XD7A 4B5KA 3IA2A 3NTUA 3BJMA 1QQ5A 1BXRA 4PLZA 3M8KA 4X41A 4BO3A 3L3BA 1JU4A 4L2IA 4DLXA 3DLBA 2RGRA 2C8LA 3KFVA 3QEAZ 2PLRA 3U4HA 1DCTA 3GFVA 3WGIA 2LV8A 2FUG6 3SHQA 4U2GA 2Z04A 1MAHA 3NKVA 3LYUA 2E55A 2ZIGA 3LP6A 2QPAA 2Q5IA 1TLLA 1HLPA 1W581 4DR1B 4HNRA 1SD2A 2CYBA 2XRYA 2BCGY 5AT1A 3RKRA 4RHFA 1L5VA 5IMBA 2ZULA 3PHBE 1D0SA 3QX9A 2AFVA 1XWFA 3FR7A 3C5WP 1Y9EA 3KTAB 4L6AA 4CL0A 1I7DA 1JR3A 3AQIA 2J0QA 4EPVA 3INYA 4LMRA 1AKYA 4Y6OA 4EZBA 5FOQA 4ND6A 2P0AA 3IJRA 1QIMA 3O2QB 1TVKA 2YY6A 4H0NA 4AMVA 4LWZA 4MYUA 1Q1AA 1SNYA 1IVNA 2OG2A 4BNYA 5KWIA 3ZE7A 2DT8A 3NALA 1EUDA 1P91A 3GD5A 4ZJPA 1Y9DA 4KHZA 2MJLA 4QFCA 1U5CA 1E4OA 1OXMA 2H1LA 4X7RA 2V7VA 5FBHA 3TNYA 1Z47A 2C2HA 2NSLA 3UWKA 3NBMA 3ZY4A 4D9IA 3REFA 1N5OX 2QT1A 1U81A 2JCYA 4LC9A 1H8ED 2H51A 4FHDA 4KQ6A 2QVGA 1GUYA 1TO6A 1T8PA 1D4OA 1SCUB 3H6GA 1JKIA 1H1LB 3DKPA 3PX3A 1RLOA 4KG7A 4DJ5X 1KVTA 2UZ0A 4FIDA 4MQBA 4OJMX 3SHWA 4B48A 2OM2A 2YV5A 4PS0A 4TVBA 4MDYA 3ZE1B 4DYVA 3ZWMA 5K3SA 4H6WA 3UYKA 4R16A 5IT9A 2FN9A 4N82A 3X1MA 4PC2A 2NLOA 2J3IA 5ESRA 2V9PA 3GJ0A 1BVUA 3JPWA 4YJFA 1XVLA 3UCXA 2FW6A 1ABBA 1FFBA 3BFKA 5EJIA 2C9CA 3KQPA 1WUIS 3K0CC 4Q16A 2NM0A 1J0XO 3C1UA 4IRXA 5E3JA 1E79D 3G7SA 5KX5A 1OBCA 4KJXA 1ZCAA 1WA5A 5WRFA 4E46A 2CK3A 1KZ1A 3DGFC 4MVJF 5L3VA 1AOXA 2HIMA 2QS9A 1WY5A 3O21A 5H3HA 5JAHA 2WNHA 4YRDA 1I4EB 1B3RA 2D7CA 3E9DA 1HRDA 5IS2A 4BBZA 1A8SA 4U02A 1KGSA 1BX0A 3DLCA 4F4JA 1X3SA 4MW6A 4UNIA 5EXSA 2WWIA 3OG9A 3HBNA 1XZAA 4TSFD 3PJEA 1S2GA 3H17A 1DWUA 2FQWA 1HDYA 1K0FA 2JFQA 1GZDA 1C7FA 2F9LA 1W5AA 1Z0DA 2ZRGA 3LKZA 1BWPA 5BYKA 3VZBA 5JXIA 2QTZA 1QYCA 4RQTA 3AI3A 3BHMA 4OUKX 3VX3A 1G5FA 3L77A 2XE6A 3CRMA 3QITA 4KKXB 5IJXA 3L8ZA 1E7YA 4F1WA 4KI7A 3BGDA 3EEYA 2PDAA 4B3TB 1KI3A 1JLLB 1H05A 5ADWA 4GLOA 1KPIA 4S24A 3PA6A 1GTJ1 3IXMA 3QMWA 3ERCA 3QUQA 3L40A 2D74A 1SJ9A 4QUJA 3ZWWA 2QRHA 2O2HA 5FOUA 4DSOA 5CDHA 1P4HA 2C8KA 3EHDA 3ZU2A 4Y1EA 5KWEA 5DSZA 1YZLA 3NOVA 5HOEA 1CYDA 2HSWA 2SBTA 2JFHA 5JTUA 1P1CA 4HFNA 3FJYA 2C4NA 1WZEA 2HGZA 4NI5A 4JP1A 5DX1A 3OQVA 1NF2A 2IPLA 1VHLA 3EZNA 3AKDA 1JHOA 4G0NA 2P90A 5E7IA 3LXMA 1PJ4A 2YVUA 4KAFA 4M7WA 4XQCA 3H5AA 1QZXA 4HNVA 1X7WA 2OAP1 3JQEA 2O8FB 2YJNA 3HJNA 1RR6A 4WUTA 1ZONA 1T3LA 3OZEA 1QUFA 3CBQA 4YCSA 3TGPA 2BKVA 5TEWA 1PW5A 2R66A 1QU2A 4Y9RA 3U7FB 3KKOA 4EYOA 2D1QA 2RG1A 1L4FA 3DL7A 1V8FA 3DTVD 3KT3A 4Y9DA 5CYGA 1EWRA 4LDRA 1T35A 5KQRA 5FI3A 2IIVA 4X1YB 1ABEA 3VU3A 3S55A 1GV1A 4KO2S 3W2IA 4JUDX 2WP8J 4EGFA 1WHTB 3BD9A 4PO9A 4HDSA 4AJPA 3RABA 5J4HA 1XXHE 4HFMA 2AC4A 1H2ZA 3WWOA 2NO4A 4M0CA 1CR2A 2I4IA 4GM1A 1EUQA 2HWYA 4UTPA 4RTQA 2MSWA 1UKYA 1MHPA 1Y3FE 3IEMA 2IUYA 5DBHX 5F3DA 2VHJA 1G5TA 1FQJA 2AKYA 2X15A 3KEGA 5E2BA 3WLQA 1XDGA 4BJ3A 1QH1A 1OUMA 3HKDB 2LKDA 1EEXB 1OBOA 2DX7A 1DBSA 2XUQA 3Q0TA 1A4XA 4FD2A 4X6UA 3ZDYB 2O8DA 5FB3A 4N41A 1S3IA 1XQ1A 3F67A 5FFNA 2BM8A 2QIOA 3WLFA 1TUEA 4JCCA 4A8TA 1NHGA 4O1HA 2VDLB 4N5LA 4N9QA 5HA5A 1UIRA 4PLHA 2EDAA 4AZSA 4N0EA 4X44A 1CXZA 1RS0A 3G2HA 2AG5A 2O2SA 3LBYA 4F2PA 4BMPB 4PX3A 1GGHA 2GZ3A 3OE4A 3RJZA 1R7RA 2AHOA 4AB1A 4B3RB 2IL1A 1LV7A 2WA2A 4HUJA 3OFNA 2HYDA 5DYIA 5C1IA 1KIFA 1SC9A 4X8MA 3TX6A 2O8BA 1I33A 1CE8B 1LCIA 2LZ0A 2ADMA 2B82A 2HQOA 2I34A 2OCXA 3M1LA 3MTDA 4QEKA 3UOAB 3G2MA 4CFSA 2VO1A 5EI5A 2V58A 3EFBA 4FYIA 3NCHA 2G9ZA 2UZ1B 3AKCA 2Z4RA 1ZK2A 2XZPA 1ZUNA 1RYEA 2J4DA 3FNFA 1UZAA 3DFUA 4KDCA 1VSBA 4M9RA 4F84A 1KP3A 2JAPA 4NULA 2NOAA 1IOVA 2XF2A 3O8NA 2XCSB 1P74A 1PVVA 5JYEA 2OBXA 5C4IA 1QSGA 4R71A 4ZCLA 3FHOA 1Q0SA 5K45A 5JEEA 2MSDB 1DEXA 1ZRNA 4DIFA 1IQPA 1U6KA 3IHKA 4YA6A 5AXCA 1FDSA 3NHWA 2CW5A 2HEIA 1I3OA 4O2AB 4RK1A 2QMQA 2R87A 4G4GA 2IYNA 2A84A 4HRXA 2R00C 5HFNA 4MI9A 2QSUA 2PX0A 5TEVA 1DQYA 3HRKA 5TPWA 2Y1OA 3E2MA 4QYXA 4RTLA 3AL3A 3PUIA 3K96A 2ZJ1A 3VNQA 3RHFA 1JHAA 2RGBA 1XR3A 2QHXA 2ZAGA 3I9V1 5JYCA 3AJ8A 1FNDA 1UCFA 1LC0A 3BDAA 5KBYA 4OHUA 4MUYA 3E82A 1CUIA 1N92A 1V4VA 2WFZA 4PONA 1JHDA 1TCVA 3CXUA 4G1MB 4TKMA 3TL3A 5JWHA 3RVQA 2CWWA 3VNRA 4WCFC 3E7PA 1SD5A 3TFWA 3TD2A 4B46A 1SPXA 2Q0QA 4F2DA 4CKCB 2O54A 2O7RA 1FEZA 3P4YA 1L5HB 4N12A 2ZSAA 1GZSA 4RK6A 4I3HA 1ZEMA 3VC1A 4AYTA 2GJ9A 1Z4NA 2YWBA 3KV1A 5B6JA 4MR7A 3KQTA 2DCMA 1N5KA 2LUOA 4CM3A 4IXMA 2EFCB 5AUPB 5CDSA 1G7RA 3JZIA 1DQPA 1RJ9B 2QX6A 4EJ6A 5HJEA 3KKKA 1E9CA 3ORRA 3EPJA 1G59A 3TKYA 2Z5GA 3HJUA 1I5RA 1JJAA 1J5EB 1CUHA 3GZNB 4ZVUA 4CEJA 1RU3A 3NIWA 4PYNA 5D00A 1R4MA 5DRTA 3WHPA 1WV1A 4ZDKA 1WXXA 3DHWC 3L6EA 3CFYA 2PGJA 3PRHA 2B8JA 5GMOA 3DA8A 1KE2A 4ASUD 3K6SA 2R4UA 3SHFA 4X1OA 1BX1A 5E9WA 3GRVA 2CCKA 4KPFC 3RSGA 3DBLA 1E6EA 1P29A 1M5RA 1O3YA 2VOJA 3QLUA 2GEFA 4UTXA 4E5SA 1WTCA 1L7PA 4P80A 2NO6A 2VZ9A 3ZK8A 4DC1A 2W4QA 3QMPA 4OLFA 3FWNA 3OCCA 1IONA 2POQX 3OZ7A 1IHOA 3R6TA 4PN3A 3GARA 4REOA 3HKBB 1WMFA 4YT4A 4B79A 2XMGA 3CEPB 2WABA 4YRLA 1QGOA 1RYNA 1TPZA 2IPAB 2M1ZA 1NYRA 1ZN8A 2GN4A 2QD4A 2G7ZA 3VR5A 4DR4B 2OO5A 2P62A 5JPCA 3NANA 1FP2A 4RK5A 4UM5A 1EI9A 5HBGA 4X8LA 2HL6A 4XB2A 2HNBA 1TIKA 2IEGA 2VBFA 4YV2A 3OEWA 2X8WA 4ZT5A 1EMDA 4B4DA 2F3UA 2CMHA 1QC5B 2Z8ZA 1YI0A 2MR6A 3U4AA 3BMNA 2DAPA 3H5LA 3KQQA 4WXYB 1GCUA 4Y2TA 3V1NA 1KJQ