4C0WA

The crystal strucuture of native ppazor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
200
structure length
200
Chain Sequence
b'MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-DEPENDENT NADH-AZOREDUCTASE 1
publication title The Crystal Structure of Pseudomonas Putida Azor: The Active Site Revisited.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 68
structure length 200
sequence length 200
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c0wA00
1AZLA 4FGLA 1CZNA 1OBOA 1XI2A 5F51A 3TE7A 4QOFA 2QMZA 3NFRA 5ULLA 1XYYA 5TGZA 3QE2A 1CZHA 4QOEA 5FA6A 3FX2A 1AG9A 3O2NA 4QODA 3HLYA 1D03A 1D4AA 1RCFA 1T5BA 1RLJA 2A5LA 2F1OA 3D7NA 1JA0A 4CETA 2FZ5A 4LAFA 2Z9CA 3F6RA 1CZKA 1ZWKA 3OX3A 2QWXA 1YDGA 2WC1A 2M6SA 1AKRA 1CZUA 3GFSA 4PU0A 2FLVA 1SG0A 4ESEA 2QR2A 1KBOA 2FVXA 5LBUA 4DY4A 5B3KA 2M6RA 3LT5A 3NLLA 5LVAA 2RG1A 4C0WA 4FGJA 3QFCA 2V5VA 2MT9A 1CZRA 4D02A 3OVMA 2BZSA 4BMOB 2X2PA 3B6MA 3JSXA 4YAWA 4OXXA 1QHEA 1X77A 5EA2A 3EDOA 4U7HA 5LMCA 4PTZA 3FW1A 3S2YA 3W7AA 2FX2A 6NULA 1OFVA 1YRHA 3W77A 4NULA 5FUQA 4GR9A 2BF4A 4XDGA 3B6KA 3F6SA 1T0IA 3L9WA 3NHWA 4FX2A 4S24A 4C0XA 3NHPA 1DXQA 1E5DA 1CZOA 4Y9RA 4GI5A 2XODA 2Q9UA 3HR4A 5FX2A 4H2DA 1FVXA 4C14A 1D04A 3NHSA 2FAXA 3U7RA 1AKTA 4YAFA 4Y7CA 1FX1A 3NHKA 5EAIA 4PTYA 3NHJA 4FGKA 1XYVA 3NHYA 1YKGA 4NLLA 5LBTA 1RLIA 3O73A 1B1CA 1TIKA 5F12A 2HNBA 1F4PA 2B3DA 1H69A 1AKQA 2D5IA 1ZWLA 3N3BC 3OJXA 1C7EA 2Q62A 4ZVKA 1AKWA 1FLNA 4ZVMA 5JROA 1FLDA 4N9QA 3TEMA 2BMVA 2X2OA 4N82A 3B6JA 5NULA 3UXHA 4U7FA 1KBQA 3L9XA 2OHJA 2BPOA 5LLDA 2R96A 2ARKA 2W5UA 2ZKIA 3OJWA 1I1OA 1YCHA 2QX9A 3KLBA 3ESXA 2FCRA 2R97A 3ESYA 1BU5A 2XOEA 4GQIA 1FLVA 1YOBA 1J9EA 5NLLA 1QR2A 4QOHA 4YAUA 3GFRA 2MTBA 1RTTA 2HPVA 1SQSA 4QOJA 3ESZA 3LCMA 1BVYF 1V4BA 3FNIA 4H6PA 2MWMA 4C76A 1C7FA 4J8PA 4ICIA 5LJIA 3NHRA 3B6IA 4DILA 2OHIA 1DXOA 2Z9DA 5EMNA 3OX2A 4BMPB 2V9CA 3K1YA 1WSBA 4LA4A 3NHUA 4ZVLA 3K20A 3TZBA 2Z98A 2MOKA 2FZVA 3N39C 3OWHA 3R6WA 4XDHA 4LTDA 1OBVA 5BUCA 3W78A 3F90A 1AHNA 3ZHOA 2QMYA 5B3LA 4ZVNA 1YCGA 3QFRA 4M0CA 5A4KA 1AKVA 4N65A 4QOGA 3W79A 1ZX1A 5F4BA 2N1MA 1CZLA 3HA2A 3U7IA 3FJOA 3F2VA 1H66A 1VMEA 2FOXA 1AKUA 2QX6A 1TLLA 2QX4A 4HEQA 1FTGA 4YAOA 3OWXA 3SVLA 1GG5A 3GFQA 1QBGA 3N3AC 3ES9A 2GSWA 4HS4A 1J9ZA 4R81A 4CF6A 2AMJA 1AMOA 1FLAA 2V5UA 1J9GA 2OHHA 1JA1A 1YCFA 1WSWA 3RPEA 2HNAA 3GAMA 3KAQA 4YQEA 4QOIA 3KAPA 1QRDA 5LJLA 2BN4A 3G5MA 4LTMA 1FUEA 2KQUA 2OYSA 2FDXA 4YALA 1NNI1 3NHFA 4Y9UA 4F8YA 4U7GA 3NHLA 1J8QA 1DX9A 4DIKA 3P0RA 4LTNA 2Z9BA 2KLBA 3FVWA 3KEGA 3OX1A 3EYWA 2QX8A 3UXEA 1XT6A
chains in the Genus database with same CATH superfamily
1PTKA 2BUCA 1UZMA 4JLDA 3U9SA 5H4GA 2L82A 3TGPA 5GONB 3WXMA 3U80A 1NJSA 4TV9B 4LPKA 3NC0C 3G8DA 5EOVA 3X1YA 2O2GA 1SOVA 1N2OA 2MYNA 2OXRA 2P2LA 3THOA 5J4LA 4KVAA 5FADA 5AQ1A 1PZEA 2VCYA 1JDPA 2BDTA 5CM8B 4ER7A 3E4DA 4UOEA 2Q5IA 5EWMB 3JYOA 2DM6A 1MQ8B 1G4AE 4G23A 2NO6A 1J06A 3CM0A 1I7SB 2L42A 1U2SA 3JAMA 2DH6A 3DT6A 5ALZA 5JECA 3ROQA 4MP8A 3L7IA 2OMKA 3LWNA 4ZYZA 3LW7A 1JKMA 5KU7A 1NDQA 2X86A 1JIVA 3PUWA 2WG0A 3RS7A 3OM9A 3R3JA 4XD7D 3NBYC 3I76A 3PFCA 3PRHA 3O2SB 5LP6C 4MIKA 3SHOA 1GZVA 2XJ9A 3QVMA 1XUOA 2QNBA 5LZ5A 2D8MA 1GQYA 3GLSA 2VHZA 5CDHA 3U9LA 3ZZUA 2JIBA 1IVNA 3KOYA 3WGHA 2PJDA 5HHTA 4BGIA 4UMDA 3VJRA 2YJ6A 3H42B 4HH3C 3R9WA 2RE8A 1AC5A 2ECPA 2YRWA 3HLYA 1JFLA 4HQ0A 5JPCA 1L5ZA 2V55B 3P9ZA 1HLDA 4NMHA 1EDOA 3FNBA 4KLRA 3I04A 3QVTA 3GK3A 1PYOA 4JYPA 3RW9A 4C6HA 4E5NA 4GGPA 1NYLA 4QVKA 3ANMA 4EFDA 5DCLA 4QUJA 2CSXA 1LFAA 2H07A 3F6RA 1K4MA 3PDWA 2G0AA 1V1MA 1G9SA 3LUGA 3G82C 4OHWA 3KQUA 1T6ZA 3ZIAD 3K8QA 4RELA 1WPXA 3RAFC 5CAEA 1YDGA 2YKGA 2PVSA 4ZARA 4FUQA 3KKPA 1CNMA 4Q9AA 3GMIA 5K8CA 1LKZA 2QOEA 2YNMC 1RAEA 4OLAA 3KOMA 2QUKA 1OHHA 4MTCA 3AY3A 3LQFA 4UUOA 2OQVA 3BWEA 4S1OA 4BWGA 3K2BA 4E14A 3O8CA 2VT6A 3R0QA 3ONNA 1Q0ZA 2GN0A 7MDHA 3DKPA 4N0EA 4JC5A 3TTSA 3CMCO 4TSRA 3TRKA 1QHYA 2M2IA 2XBLA 1ISFA 3C4VA 4O0LA 4ZREA 1JT2A 2I6SA 2JIRA 4MUHA 4W6ZA 5D3KA 3WBKA 4QULA 1RHRA 1PCXA 1TA0A 2NVOA 2DBVO 2J0EA 1X6VA 1ZUNB 1FPMA 4YGXB 3QBDA 3HP4A 3OQIB 2XVXA 4NNPA 1WB6A 1KH3A 3NUQA 4O2AA 1DTSA 1YQEA 1JAYA 1Z7WA 3IAM6 1HNWB 5J2UB 1QB7A 4P86A 5K0FA 2G06A 4K03A 4AKEA 2BZ1A 2TMYA 3FHCB 2YHSA 3KEOA 3Q3GE 2ZTMA 5CLGA 5A9RA 2C2OA 1DBVO 1EUCA 3FOZA 3SX2A 3AESA 5AVRA 4PX5A 3TW4A 1C29B 4QC2A 4WK2B 3T54A 4FBLA 2PL9A 2EFDB 1SC3A 3T7TA 3A6KA 1EBBA 5JJIA 4YAJA 2FX5A 3GJ7A 4XKJA 4D9JA 4ETIA 2QY9A 5BW6B 5I7RA 4OXXA 4PNEA 1FQWA 1WWKA 1KK3A 1ZBDA 3D3KA 2V45A 1GU7A 4EG5A 5JDIC 1F14A 4C20A 3EWNA 4UBJA 4JI5B 3VNSA 4P22A 3UV3A 5ADHA 1OILA 3IR5A 2FQYA 1CIVA 4FUTA 4P7FA 4Q34A 5K0TA 2XGGA 1T1JA 2MMGA 2HQBA 3AUAA 4WI1A 2C3MA 1B6TA 2WIJA 4MVYA 2VJMB 4RZQA 3H16A 4FYXA 3PXGA 2CMKA 2M98A 4PLTA 3IP5A 2GAFA 4QZVA 3AEYA 1M1UA 2HSGA 3GOQA 4U6NA 4C06A 4ZCIA 1U0NA 3WLMA 1K98A 1N1EA 3UCEA 1RXUA 4J29A 5T8KA 3A6EA 4LMBA 3M82A 1Q84A 4MI3A 4L0DA 5EKTA 5LOVB 4OHOA 4DJDC 1Z8NA 1LU9A 3MSXA 1D1TA 3CBGA 1UKVY 2QRGA 4TV9A 1SVLA 2CJFA 5FTJA 3TLGA 1M5UA 4BN0A 4CT0A 4DDMA 1JMKC 1NQAO 2PBRA 1W5SA 4CTJA 5CA1A 4IQ8A 2WM2A 1HZZC 1KOFA 1EWRA 1ZU5A 3B1YA 5EWMA 4LRXA 4PN7A 3LM8A 1MNAA 2QYTA 5G1NA 1USWA 4P8RA 1VBNA 3A28A 3ED1A 5JS6A 4CLEA 4NONA 2BGUA 4KR0A 1UMDB 1E3IA 2C1EA 3JQRA 5BWBA 1QIDA 1QRSA 2QBYB 2RI1A 4HEHA 1HF3A 3ETEA 4E1VA 1CUEA 1R16A 2YC2C 2R8YA 2O8BA 1C1DB 2GCEA 4P3XA 3K9NA 5AUOB 1M6VB 5HJ7A 3ZWNA 4HDCA 1SCBA 1JG2A 2IWRA 1M2JA 2X5KO 5KVVA 2E85A 3NS7A 1RAAA 1B93A 4KCGA 3H0KA 2YV5A 2B0CA 3TK1A 5BQ5A 4BMXA 3CPSA 5CA0A 5FTLA 4XDZA 3T95A 2OVFA 5KYGA 1P5HA 3FH0A 3NX4A 3SE7A 5MFZA 3HGQA 2CJPA 3JYNA 3NVMB 4FILA 4K9OA 2A67A 1XHEA 1DX4A 4RQTA 3ETNA 1MG0A 3MWYW 1DBWA 3CQ9A 4BC0A 4QTUB 1G18A 1HE2A 3IOMA 1XNJA 3EWSA 4P3KA 1E1MA 3B52X 5AVTA 3FMOB 4K8OA 1E2IA 1O77A 4KDEA 2C8LA 1R0LA 2G67A 2UZIR 1Y3FE 3DDWA 3SFTA 3ZGZA 4HRVA 3IEKA 1E5LA 2PYZA 5IN4A 1KZHA 4JEUA 5DLPA 4RE6A 1KJNA 3NEPX 3SXUB 4O2LA 5JASA 4NXNB 2H7YA 4R3WA 4WA8A 5DRTA 2B92A 2CDAA 3P0EA 5BSVA 3C7AA 2EG5A 5AXDA 4G0XA 2QT1A 4LS3A 4YGYA 2VYFA 3KOOA 3O74A 4PFJA 5ALKA 3HB7A 1MB9A 5E4JA 2FUG1 4B6RA 2B35A 4CN9A 1I24A 5JRDS 2BM9A 1PWXA 3BM5A 3U61B 5CB4F 4PFQA 1AS2A 2BFWA 5JBNA 3WV5A 1TUBB 1MUUA 1X8LA 2W6JD 1P2DA 5JPDA 1FSPA 1P2SA 3N7TA 3ZH9B 4DQVA 1U5CA 2A4KA 2RC5A 1OWLA 1GLNA 3MS4A 4KG7A 4BIMA 4DNOA 5EKUA 2DCUA 1LNSA 2PR2A 4R9VA 2W6ZA 1PQUA 1XCLA 3FPJA 1T4GA 5J63A 4BV3A 1SPBS 4MLCA 3AUJB 1VHQA 4OHMA 5ALSA 4AJ4A 4BZPA 2QYOA 3RABA 2A5GA 1IY1A 1MXFA 4WA7A 4F9TA 1WBBA 3KV1A 2DH5A 3L04A 3PHLA 4U2BA 2IEZA 1UKEA 1E2NA 1KU6A 1Y6GA 1R27A 3PV0A 2H2GA 3SR3A 5HTKA 2MSEB 2AEMA 1Z06A 1DQPA 1RFLA 3F6CA 1E66A 2PD4A 2WJGA 3B51X 3OPNA 5FWXB 1IUNA 1GHTA 2ZP1A 4L8GA 1RSZA 2PG3A 2WICA 1K9VF 3VRHA 2ZBEA 4NZZA 3W2FA 3EZNA 1R8QA 3W8RA 4B73A 5LLDA 3C2QA 1WHTA 1J21A 1IUKA 5FIUA 4UHJA 1OZGA 2DTEA 2IOFK 3IUBA 1YWGO 3F9RA 3WDKA 4MVJP 3IKMB 3IBYA 2ZQYA 3VR6D 3CEPB 1W4AA 4L3OA 3QKUA 1SIUA 2ZYRA 3VPHA 2IYLD 3DTNA 2NO1A 4O2RA 4D57A 2IZ6A 1VIDA 3HJHA 3I1YA 4O4LF 3R9KA 4JR1A 4DT1A 3K72B 4OHFA 1YT5A 2G08A 1JKIA 3HR7A 3PGA1 4OH7A 4E0BA 2O6HA 2VJMA 3KXIA 1O1YA 2WYVA 1NW8A 4MGYR 4QRHA 3S5UA 5FCDA 5JJBA 1Y5LA 4E5UA 1ISMA 3GJ5A 3LKZA 2ZBFA 1YRYE 5THKA 1AF4A 3HEMA 2PUTA 4MITA 3TBHA 4DM7A 3HU3A 1NXQA 1GKLA 1UFOA 3Q0EA 5DM60 3TCNA 1DQRA 3LD9A 1UP7A 1WDLA 3LHDA 4RF3A 3UBMA 3QLEA 3RVMA 3UMJA 4A6EA 4WEOA 4HWPA 3CV3A 5LQKA 2JFVA 4IEEA 5K8VA 4D6XA 1RHQA 3NRBA 5DX8A 1PNTA 2ZWPA 5LN1A 2OZEA 1OXMA 1RE1A 2H4YA 2NACA 1LDNA 1FYDA 4NAVA 1NI3A 2G70A 4G0ZA 2QBYA 3O9VA 1LNQA 4LNUA 5MGNA 3FCSB 4HADA 4TV8A 2IVFA 5I3ZA 2WJJA 2YV2A 5CG1A 1LTKA 3CWQA 4TGLA 4WBNF 1C1DA 2BRUC 2JI9A 3IPCA 5CYOA 1WD7A 1CIPA 2L17A 5KQMA 4GC9A 4NPAA 4DRXA 3NTUA 3IB3A 4FD3A 2HIGA 1FTYA 3LDGA 1COWA 4DUYB 3IQZA 1PIWA 3DCYA 3JALA 3SK0A 3W8EA 1QDUA 1TA9A 4ZGWA 4AICA 3BSYA 4BX2A 5CXUA 4KEAA 2C9MA 1DAOA 5DM70 2ZRNA 4L72A 4DILA 2ERCA 1DC5A 2ATIA 3E6AA 4UU7A 1EZ1A 1F60A 3BH0A 1KC1A 3DBIA 5COQA 1A77A 2G36A 5AM2A 3W5DA 4UEWA 3RYCA 5ESWA 2HJWA 4X9XA 2QRJA 3EE6A 4W5RA 3RJMA 3QH4A 1GA6A 4XLLA 4PO9A 4JJGA 5TQ0B 1R9JA 2WV9A 2O0JA 4HOYA 4O4JA 5ALRA 3EIEA 3LCRA 2VRCD 1UBEA 2W0MA 3J7TA 3CNLA 3MGCA 1SXQA 3PPXA 2BM0A 2XT9A 1H65A 3A6ZA 5HS6A 4XIIA 4MSUA 2FZVA 4R68A 4FGZA 3QLVA 5EE9A 1U81A 3UFBA 4ETNA 5J40A 2PPVA 3NBKA 2BI8A 1P4JA 3AC0A 2YICA 4O29A 3GIDA 1R6XA 2WSBA 3GHYA 4Q9LA 2F00A 2UV8A 4PO8A 4II7A 5E3IA 5F1YA 1Y3CE 5GY7A 1QTQA 4F5DA 4F9FA 3G13A 2OMEA 1XO1A 5EHGA 3RG2A 1Y7LA 2I67A 1DKMA 1CVIA 4TKVB 4M7OA 2CFSA 1NXSA 1AHNA 3KJIA 1GDDA 1TT5B 1HTTA 4DB4A 1TAQA 2Y6UA 5CT4A 3M6LA 5DHAA 3SQOA 3UJBA 2G25A 3PJFA 4YMSA 5LP6A 5EZQA 3HJUA 5CU7A 1IHUA 2PT7A 3C74A 1LCIA 2FZ4A 1VPTA 1W5BA 3NXSA 4G67A 4YY3B 2IP4A 1EVEA 2HXSA 2NPIA 2I2BA 2C4MA 4UCQA 4QOGA 1XRMA 2JBAA 5CVVA 5HRCA 3EXIB 3E8XA 1HL3A 1U2RA 4KXMA 2PRIA 1KA9H 4HX5A 1ZGJA 1DEXA 1N2CA 3TGWA 5I4IA 2A9QA 3M49A 4HWTA 2GLXA 2GRUA 1YZ3A 4S2UA 5EN4A 4B6GA 4GDMA 1T5OA 2X41A 3TPCA 3U7IA 4PZ0A 1GTRA 4IJ6A 1VTKA 3TFOA 1E6MA 2VF2A 3L6UA 4MYTA 4OIFA 2NUBA 2RHRA 4UPDA 5T4FA 2BFCB 3TM4A 1OWMA 5JSQA 4EQZA 4GP6A 3H13A 3LT1A 2QX6A 3F5FA 3LXUX 3QENA 2X6QA 3V5NA 5DK4A 3WWOA 1FNMA 5JOQA 2GF9A 1OLSB 3L43A 2PSEA 4JLPA 5E7IA 2YNMA 1OA0A 3DNPA 4NV0A 4K6KA 2O7RA 2F59A 1FS6A 1KDRA 4KVFA 5F7ZA 2ZSKA 1Z0DA 3D43A 3KCQA 4BCDA 2HAEA 4YH1A 1FFXA 3SC3A 5DWVA 3VHRA 1B42A 2BKAA 1OW3B 3FMFA 3P4YA 4KI7A 2Z4RA 5CDTA 1D6SA 2GSWA 1NQUA 4YJ2B 1VKOA 2EZUA 3EIFA 1RI1A 4M9UA 1FP7A 1Z7BA 1KIMA 4NPCA 2BE7A 5JXGA 1ISGA 1LS6A 4IF4A 2ZREA 2BKUA 4KB5A 3PGKA 3Q3HA 4PLGA 4R4JA 3RVSA 1L7RA 1XZ8A 2FPMA 5CLFA 1HXHA 3QOFA 5A62A 4E7OA 5DV9A 3DAOA 3E3MA 1EBFA 4KX5A 1ZOSA 1RQGA 4DSOA 3S81A 2HSJA 3TBFA 1X9IA 5BN5B 1Z2DA 1CUAA 3RFCA 4LRQA 2XE4A 2Q7DA 3K73O 4EFNA 2GCIA 3OJ0A 3E8SA 2ZXEA 3KAQA 2C96A 3B3GA 1L1FA 1LPSA 4IJ5A 3V6MA 4WMLA 3KRTA 3ZE0B 1LRLA 3LOUA 1V8DA 1E5TA 3OEHD 5K8IA 3WGOA 3R3WA 1OWNA 2BKLA 4XUGB 4CM9D 4V0LA 2F1RA 1TE2A 2EJTA 3CR8A 2ZIZA 2ZU0C 5DXJA 3UW1A 2XGJA 3WB2A 2XRFA 1GUYA 2LTAA 3RIHA 4A8PA 5J58A 1M5RA 1UJBA 3R9XB 3KDPA 2FW0A 3D4BA 2HMVA 1NUAA 1E77A 1Y1LA 4JLMA 4QJ4A 2RARA 1CVRA 3HDHA 1JN0A 1M67A 1XC7A 1B16A 2DOKA 3NHLA 3OJEA 1GR1A 4U7GA 3UWOA 5JDIA 1BE8A 2XRYA 4YRLA 4DIKA 1WCIB 1DEAA 2GHTA 2IHUA 2WVHA 1W6UA 1Z47A 3K2EA 4ZQEA 1Q0UA 1Q0SA 3DE7X 5B3JC 1OT5A 4LTNA 4NJOA 3LWBA 3KJZA 1GQ2A 4KN9S 3D0QA 1QAQA 3W2EA 4DPLA 1NUPA 5BVGA 2O2JA 3FVWA 5TS3A 4ZYTA 1YUBA 2NU7B 4JLSA 3TNYA 1PUJA 5DN9A 3TAUA 3AKYA 3OUTA 2GO7A 4Q3BA 4YJDA 3WYGA 4JBWA 3GDOA 3B48A 4BLSA 1PDWA 3PNBA 3ZG6A 4R5HA 5LYJB 3FCUB 3SQXA 4JH0A 4GPZA 3AR9A 3W2TA 1P2TA 2OENG 3DDOA 5IBPA 3JD2A 2X19A 3PA6A 4L6IA 3OKAA 5DHFA 1A27A 3BD7A 5EUMA 4DR4B 3GN1A 3LVBA 3UMRA 3A3PA 3OECA 4OI1A 4D42A 4E12A 4WD3A 1VE9A 2H4WA 3DPUA 3TE7A 3WLKX 1QH1B 2I2FA 3HLKA 4JBNA 4YJGA 4E09A 1RQ2A 2WIGA 4LECA 4ZC1A 4AJ2A 4K1XA 1BVUA 5F76A 4M0EA 3ZZTA 5JD5A 2XUOA 1CV2A 1NKVA 4G2TA 1POWA 1I30A 4QEKA 4RDCA 2WVAA 5EIEA 3HYNA 4WFKA 3TINA 1KPIA 3ZHBA 3II6X 4EECA 1NY5A 3LQ4A 1NV8A 1KY5A 2ADMA 2NYRA 3RF6A 2JAQA 3KQLA 4P4SA 5JZBA 3CCFA 2PHZA 1PNVA 3IOYA 1QYRA 4QOEA 4Q9IA 4DBLE 1R4MB 4P34A 1QP8A 3RU2A 3T3GA 4J7AA 3EF3A 1ECLA 1YE3A 3IV7A 2XWSA 3TX6A 2IYUA 3ZVRA 4Z51A 3TFWA 2ZRCA 4L5JA 4KQGA 2A86A 3ICQB 1T5BA 5BQ3A 1JQLB 3CLSC 3HDQA 3VNVA 1OFTA 2DWOA 2K7ZA 1XDSA 3HVIA 1DWUA 1JU4A 3KOXA 4NE2A 3T0FA 3ORFA 3UAOA 3PEUA 4C01A 4CCAA 2E49A 4RXTA 4XXHA 4F8JA 4C0SA 1E94E 1RWXA 1AU9A 4G8DA 2XHZA 1FUIA 1CZKA 1YV9A 2YWGA 2HHAA 3EY4A 3E3AA 3TNLA 4PM4A 2B1JA 4QU5A 2BZ0A 4OCZA 1ZY2A 3VC1A 3VNRA 2GEFA 4NK5A 3IEIA 2AMFA 1KWKA 2OP0A 4XJTA 4ANFA 1N7HA 4PU0A 1ESMA 1XEXB 3AP3A 2WE7A 3NIBA 4U7WA 1XK6A 2YXPX 5KHOC 3UPUA 4FYWA 1PEKE 2JCBA 3NANA 2C57A 1SG0A 2JLVA 1BXKA 2NQTA 2DPHA 5KYWB 4OBEA 1XNGA 1IZ8A 4KSCA 1SCIA 2SCUB 1QDEA 2AK2A 3BRSA 1XLTC 2ODAA 4F4JA 1RXVA 4TKMA 5FA8A 1EG2A 2EARA 2QT0A 3CEHA 4MUYA 4Z7NB 3BRWD 5JJKA 4E31A 1E8NA 3OE7D 4Y2RA 4G6ZA 3B1WA 1XWWA 2P9GA 3IUSA 5B3KA 3AINA 1NBIA 5E8JA 4KREA 3MERA 2O8VA 5JSYA 4DCVA 3KHTA 3RV3A 5B55A 1FXWF 1JHDA 2HOQA 1RIIA 4A15A 2VPWA 4KXLA 2O2CA 4C0WA 3ADDA 3ASYA 4J0DA 4I4TB 3TJMA 3RI3A 3ZCXA 1JQBA 4RUKA 1H1TA 1I2ZA 4GPIB 4P4LA 4IVPA 3CKKA 3P9YA 3WNDA 2MSLA 1MRSA 3LY8A 1GKKA 5FRDA 2C7RA 1E8DA 1BCSB 3OLYA 1CR0A 4KAJA 3VU1A 5KSOA 2WYOA 3B6MA 1IAQA 3W8FA 1NZDA 1NBOA 3SJZA 2CMDA 3V2GA 3RREA 3FBGA 1E62A 1SZCA 3ENVA 3IAUA 1FEZA 3O26A 3X1XA 1NTRA 2C61A 5JNSA 3KQWA 3PEWA 2A0XA 3R9XA 4KIUA 3IAFA 4TLBA 3HJRA 3GT3A 1CWUA 1OFHA 5BMVF 3TVTA 1DG3A 1Z75A 2ZE8A 3GYBA 5E9JA 4YRGA 2XUAA 1KZ6A 3KE8A 3WGKA 1B6SA 4MGIR 1UPBA 4OB7A 4URVR 3DO6A 2RAFA 2J41A 1N0UA 5CG2A 1GPH1 3HABA 4JB2A 1U4NA 3R9IA 4Z4CA 1NF3A 2V7UA 4HQLA 4LJ7A 2PRJA 4CIVA 3S2YA 4JC8A 2ZUFA 1FQJA 2XYHA 3ANXA 4JBGA 1H6AA 4HGQA 4IDQA 3SQWA 2MIIA 1IPHA 4RKEA 3CNHA 3PCRB 3G3EA 1V95A 2B4AA 4KPGA 3RUCA 2NU7A 5BY2A 1GA4A 3I8XA 5IFLA 1IJBA 4JEMA 3VYRB 1AK2A 1M1NA 4OP3A 1LBIA 3VUFA 1NVVQ 1XRJA 1W47A 1OLOA 2QXYA 4GT1A 4LG1A 2E21A 1GPMA 2H1IA 3D7RA 3VH2A 1S2OA 1ODKA 4FFLA 4N39A 1Z63A 1MG5A 3WS7A 2WPDD 2R7MA 3F98A 5ALGA 1GUZA 4DMMA 2GA8A 2FY8A 4DJFC 2CXHA 1QO0D 3HUDA 3G85A 3OD5A 5KOHA 5EIHA 3RTEA 3QWIA 1RKBA 3H3JA 4RZ2A 4XGRA 4Y1RB 3CH5A 4UVHA 4WGGA 3ZZMA 4CKEB 4PZYA 1E3WB 1GLGA 1XZEA 4WVFA 3TX2A 4B6PA 4GOXA 4JXJA 5FBWB 3WDMA 1TM3E 1RPZA 3UKJA 5HKKD 4KXXA 1T4CB 2BRUA 2FSSA 2WLTA 4CMGA 1FOEB 2J4DA 5IULC 1R4MA 1CS4C 4Z0PA 5DXAA 4QECA 5H3LA 2PJRA 2GXSA 1AA6A 1UIMA 2P3OA 4DLWA 1OD6A 2N3ZA 2PIAA 3DULA 3KPVA 4IDDA 4MARA 4Y0AA 2X1HA 3K09A 3ZPXA 3NH9A 3GBVA 3D5EA 3AM5A 1Q20A 1XMIA 1HDEA 4FZ5A 2B5OA 4ZXFA 4XB1A 3F0TA 3UHJA 3RANA 1BYIA 3ELYA 3AF6A 2DWUA 2V9ZA 1A0OA 1H93A 1RZ3A 3DLIA 4MUNA 5LQRA 2XIQA 4RWEA 3UYKA 2J33A 3VBCA 5C7LO 1YR8A 4KQ6A 1J2UA 2Y68A 3VM6A 4D9MA 3EPKA 4BKRA 2XH8A 1B3BA 2HUNA 2Q3LA 4GMKA 4MICA 5IXJA 1VOTA 4LGYA 3LUPA 1TC2A 1FNBA 1MJHA 3VX3A 4D44A 4BO2A 2HWUA 5BWLA 2WU3A 2JGRA 4LCJA 4LKOA 2VP0A 2EC5A 5D01A 5K9ZA 1XEXA 5AKHA 2V58A 1OKKA 1FMLA 5K3DA 2J46A 2GBCA 1RW4A 1V96A 1JYEA 3QUCA 4A4DA 3C0KA 1FZQA 4WOCA 3GW8A 4QDXA 2SCUA 1KQPA 2F90A 2Q4EA 2XMQA 3OTQA 1OI7A 1P4HA 5DHRA 2D00A 3IDAA 2GN1A 2K4MA 3DBHB 2ADOA 3DVAA 3QHPA 4IXNA 3RC9A 3ZHZA 2BW0A 4ALMA 1I6MA 1DP4A 1HTWA 4RY8A 3WAKA 2WYHA 3JRXA 3TNDA 3ZR4B 5LNK6 1GNSA 3SN6A 4LE0A 2R2AA 2JKVA 4WT7A 4ER5A 1U7XA 3A26A 5BSKA 4ZOQI 4G1EB 3SPXA 4AN0A 1DADA 1K4YA 2ATVA 3ABQB 1KTVA 1KYIA 4IHJF 3IPLA 3A6GA 4AIRA 4B7AA 1X70A 3DOIA 4CLOB 2LIPA 1ATZA 2PQ6A 1J49A 2JZCA 3TIXB 3I39X 4JLAA 1DJQA 2DRIA 2OEPA 2WIDA 1FMFA 1CUHA 1NUSA 3MWGA 4PBRA 4FB4A 1JEYB 1BFUA 3L5KA 4E13A 1EJ0A 1G8PA 1Z8DA 1G63A 1BCSA 1ORTA 3JYHA 4V0MA 5D7NA 3D0KA 3X2FA 1JE1A 2RKBA 3ETDA 4CPDA 2I1LA 3DHWC 3OZUA 4MEBA 1OH8A 4FJ0A 3WK8A 2HK6A 2J6IA 2FSVC 2LPMA 4C08A 4EPVA 3E48A 3G9UA 3FPKA 2Q4RA 3ELUA 3NJ8A 5FT9A 4BZZA 1A4UA 3DC2A 3R3ZA 2FZGA 4AIIA 2FR8C 4I9HA 4AS2A 1SU7A 4YREA 2GDZA 3ESQA 4UCWA 3OJWA 3FGOA 3TECE 5AJVB 1UBNA 1V41E 1WUTA 1M0SA 3AHJA 3DJFA 1CHNA 4U2CA 3KLBA 1ELOA 1E3TA 1PVOA 2FCRA 3R3YA 1A8QA 4QAQA 2O8EB 2I65A 4ZZ3A 4ETMA 2BHRA 2EIXA 2RONA 2Q8PA 2XOEA 3AEXA 3M9WA 4G0NA 4P98A 1YJCA 1YMVA 3R24A 4XVCA 1NW6A 3H6KA 1FFAA 4UNIA 2OV1A 4J1SA 1PSDA 4DA0A 5A5EA 3CSUA 3ADPA 4FWIB 1U6KA 3PJEA 3I9KA 4OKSA 2VKTA 1NC3A 5AT1A 1PF7E 3A1DA 1DHTA 2DJ5A 5E1DA 5F3DA 3VYSB 5JZMA 2D3WA 2WUWE 4E5PA 3EW7A 3BGVA 1UZLA 2CXNA 3V80A 1XVUA 1SVMA 1VE7A 3N8NA 1N6PA 2KI5A 4OFXA 4C5AA 3SHWA 4RCVA 3LCMA 2W2TA 5F78A 4TZKA 3U3JA 3V6LA 1EHCA 4KH1A 5BW4A 2I4MA 2FVYA 2LVBA 3OFNA 3G9TA 1Y7TA 3AX6A 5SZJA 2QDKA 1SG9A 2CFCA 2OA0A 4BMCA 5JO0A 2PUGA 1RKUA 3FNIA 5FBVB 1OI3A 1T4CA 3LHSA 4OJNA 1U2GC 1DAIA 3TLMA 4B34A 4LXTA 3U3DA 4W9MC 3TQTA 1V8FA 4JWTA 1GITA 2JFYA 3MGBA 4H4EA 4Z99A 3W2HA 4L95C 1MO2A 3IUJA 4J1TC 4OHXA 2QTLA 1UMCA 4PCLA 2EFCB 3HZHA 3HJBA 3TD9A 1E89A 4CTMA 5BXQC 4RA9A 5DIFA 5B3JA 1XPOA 1YNOA 3K5WA 3I5MA 2FZCA 4P4GA 5D86A 3T9DA 3BMQB 4AN1A 4BUJA 4HFMA 5GADl 2XTJA 3EA0A 2UAGA 1ZC4A 2IYYA 1ZH6A 4FQ7A 1ZM9A 5HZHA 2FFBA 3MRVA 2Z9DA 4O59O 1VHJA 3EX7C 3EIOA 4FR2A 1DELA 1TVKB 2CHFA 3RRFA 3UMMA 3MJVA 4U9HS 4QATA 4CMCA 2H1LA 2I87A 1URPA 1Q44A 3F8WA 3QNUA 4CM1A 1NUHA 1AO3A 3AOEA 1X1TA 3VPCA 4CE6A 3G0DA 3KO8A 1Z88A 4TRJA 2QLNA 3FCXA 3M0EA 1QF6A 1F5NA 4ZO8A 5TPZD 4FFOA 1Q7BA 1G6KA 2EDCA 2FRDC 1C50A 2MOKA 1DEKA 2FEOA 3AYXB 2CUZA 3BDIA 3LBIA 4L8VA 4AMZA 4URUR 3WMFA 4JB0A 2CLCX 3AL3A 4ZYXA 3AFIA 4RXUA 2BFDB 4F1JA 3SFVA 3DBHA 1KR2A 1QKKA 4GOMD 4C7VA 2PUHA 1CIJA 2BGJA 1ECPA 5L3QA 3NTLA 1YHNA 4KITB 3BYZA 3HM2A 5KYKA 4DLXA 2YYSA 1OTHA 3ZHOA 2GF2A 5D8DA 4ZAWA 1DUVG 2NTVA 3P4UA 3T41A 3UJ9A 1EB8A 2G0TA 3I0NA 4BFWA 3PBKA 5BUSA 1QG2A 2VHVA 5KYXA 2V0NA 4OL0A 4Q1EA 5ER9A 4TMVA 1Q22A 4G1CA 2O3UA 2VQ3A 5HILA 5B37A 5JH7F 3L4JA 4V02A 4CG3A 3NXKA 1EPUA 3N2IA 1WDWB 1ESEA 1ZM3A 4F84A 5KVSA 1T1EA 1BN7A 1L7XA 2O5RA 1ST2A 3OFND 4JEIA 1QIEA 2J7PD 2P79A 3Q12A 3IPYA 3U4MA 5LC1A 3HA2A 1HDGO 2A33A 2AHOA 4Q0MA 1QIJA 5C4MA 5FH9A 3V8QA 3F2VA 3LBYA 3TR0A 3FCCA 3AT1A 2BY4A 2OR3A 1UQUA 1HMYA 3B60A 2W6CX 2Y1CA 5JQGF 5SV2A 1JIUA 3M3DA 5GINE 2YBDA 1Z29A 1FTGA 1CJCA 1M2KA 1ZA1A 1ZIDA 2QUHA 4GNKA 5ADWA 1OZFA 1XB2A 3NOQA 4JDUA 1IEQA 4ARUA 3GCZA 1CT9A 2CUTA 2C5SA 3HJNA 2XGMA 1X92A 1XEWY 3OCZA 3PEEA 2RIRA 3TWOA 1U8YA 4HEJA 2D5BA 1HT2E 1YBHA 1PNRA 1OXUA 1TPYA 2PD6A 4X60A 1K7XB 1XLTA 3ES9A 1RHKA 1WW3A 3U44A 3RRBA 1O08A 3T3MB 2YMQA 4R81A 1GL9B 4X1KA 1ZK3A 2MCFA 1A97A 2I4RA 3ZZ0A 3DKIA 2BMJA 4CT4B 5IVKA 4JLBA 1AD2A 2GPJA 3IA2A 2FMKA 1N25A 3PQEA 1DOZA 2P6PA 1LDYA 3ACCA 3LY5A 1J9GA 1K88A 3AIMA 3V8VA 3W3AH 4ENPA 4KLNA 1HX7A 1JA1A 1H22A 4PRKA 3FM9A 4KL8S 1NR7A 2ORIA 3A1WA 2ETVA 1DJMA 2AUNA 4JODA 3H5WA 1YJ5A 3ZDZB 5BN1A 2QX7A 4NDZA 1SXPA 3B8EA 5CFLA 4RORA 2C2BA 1P2GA 1DDOA 1ZRNA 1E6EA 2IH4A 3C5VA 3L05A 3ZLUA 5CXQA 4FJ2A 1NDHA 1E98A 3SX4A 3I2KA 3KXLA 4IIJF 4INPA 4MUXA 4NICA 3EVBA 1W0JD 4MJ3A 4MWZA 3T7SA 3EFBA 4DVGA 5JMOA 4B8YA 2SECE 3HB5X 3DOCA 4CQLB 3KJGA 3D9QX 3O2JA 4F56A 1NNI1 2O59A 4CLDA 4Z6KA 2R6CA 4BV9A 1AH2A 2DU8A 1ZM7A 5DP1A 2Y1KA 4K86A 1Y3DE 4EYOA 4LIPD 4ZO4A 3ZEIA 4UQOA 2I71A 3ZKAA 3U56A 2VOJA 4IUDS 3W6OA 3O4HA 2VBCA 4Z8YA 3JQFA 1JR4A 1XTVA 2PK3A 3HN6A 3QKWA 5KWEA 3GJYA 2ZZMA 1GV1A 1WD5A 1X0VA 4IEIA 4CGYA 4LX0A 1QP4A 1KVSA 1O6CA 1KERA 1ONBA 3LCUA 1VLHA 3UXEA 3V4FA 1NIJA 4WACA 4DGSA 5LUBA 4AYWA 2ZWMA 3RIEA 3JZMA 1JG6A 2FUEA 3EG5A 5A0VA 1MIOB 4JQCA 1YE8A 4P53A 2I4OA 4G4SP 2OBXA 3KHUA 3OHMA 1QONA 4EMBA 2ATEA 4HGPA 2BJHA 1IY0A 1EVYA 5JE8A 4GQBA 3HWRA 5BWCA 4EL5A 1EHYA 3CMMA 1CF4A 1S2DA 2MSNA 4IQ4A 4II2A 1A82A 1H2XA 3VA7A 4BQQA 4KZKA 1WXQA 2E82A 2KHZA 1QE3A 4I8XA 1BE6A 4X7PA 4ZZ2A 3H4IA 3L7JA 5LDGA 3TTVA 5IKOA 3CEMA 3EVFA 4AVYA 2J6HA 4L0MA 3UGTA 3IVGA 3S2SA 2ZYDA 3QW2A 2WKSA 4UDNA 1E0KA 1XJ5A 5BQFA 2GETA 3Q7SA 4EG0A 5K3OA 4B3JA 2JB9A 4K0KB 4Q6WA 4L27A 3MJTA 1EWKA 2PIDA 3ENZA 1OIVA 4RGYA 5EGSA 5LKAA 1LEHA 1K97A 1BDMA 2ISQA 1GNRA 2ECFA 2IYSA 2VPXA 5CURA 4YP6A 4EKIA 2Q2VA 4TTPA 2X2EA 5DF1A 3DDNA 4Q39A 1ODJA 3NDBB 2R60A 4KFRA 1SIWA 4MV6A 3N0VA 4DIOA 4PRYA 3TTWA 2H2WA 2A5LA 3ANLA 5CX1A 1F4VA 5DSXA 2HC9A 4Z3DA 5TGDA 2YJ3A 4D6YA 5KWVA 3Q40A 4H7JA 2WG1A 4WDRA 2EJVA 1E2QA 1UPFA 1Y3AA 1GT6A 4W8OA 2LW7A 4ZCQA 3FTCA 1AS3A 4BWYA 4NFHA 1SXIA 3HCEA 5BOVA 1FRQA 3VPXA 2PLFA 4PVCA 4S1VA 1PWZA 3PTLA 1E4EA 4LJRA 3IODA 1KXJA 4D74A 1B0AA 5JRJA 3UUWA 2CLOB 4TXJA 1UJNA 4UHFA 1PV4A 1NTOA 1JQ3A 3VH3A 4C4OA 3PFNA 3VU9B 3P20A 1ULBA 4N8EA 1BW9A 5I7UA 1RJWA 4M99A 4XIGS 2BGNA 4HKTA 4BVEA 4CF7A 2C4NA 3KBOA 4YLGA 4QE3A 1VP9A 1I4DD 1TCAA 4ZN6A 1E4YA 1ZI8A 2NT3A 3FFTA 3UV7A 3ZJ5A 1YL6A 4L6CA 1TOAA 2IW1A 1PT6A 4NDAA 1TTPB 1Z68A 2E55A 5EHZA 1T2DA 2JLRA 1AQYA 3ETGA 3KQMA 5LVAA 3H8JA 3QEBZ 1S3SA 1N92A 1T1RA 1TO6A 3LT2A 2OT3B 4DADA 4EATA 5BORA 3LA8A 4WFIA 4UDXX 5CJPA 5DHUA 3O8OB 5D5PA 5IW8A 3LFHA 4M0KA 4HL6A 1R1DA 3W34A 1G5RA 5A3VA 1Z4MA 2V5VA 1I7DA 1PSZA 4KGZA 1MGPA 5L3SB 2WI8A 1HK7A 2ZRGA 2VVTA 4M9CA 4OHBA 1SVSA 2VJLA 2IKSA 2SICE 3NBZC 5MFPA 2Z0MA 2OPHA 2XYQA 2AHRA 1KVTA 3DCIA 4ACAA 1AV7A 1LY1A 1SIOA 2FSVA 1ATIA 3V1KA 4YAWA 4LJ8A 2Y27A 1VXOA 3HR8A 5LQSA 1LSOA 3B9QA 4RK4A 1FFEA 4BBPA 5H9WA 1CUYA 2E9SA 1W581 4ZYYA 1DPGA 2JFXA 4ZI7F 4BFXA 1MBZA 4UTVA 2MDTA 1ZH4A 2GJAA 2PO5A 2Y1GA 3U1BA 1A76A 4C7BA 1O3YA 3DEJA 5TMEA 4GE0A 2CV0A 4ITUA 1ZM4A 2RG7A 2NZUG 2A58A 5TJ9A 3VHXB 1LI4A 3W2GA 3MHPA 4AYTA 1KFKB 1JZSA 4DJTA 1UT6A 3LL7A 1PG0A 3AYZB 1BQ4A 1G0NA 4ND8B 1DUSA 5DWQA 1GAWA 1C1HA 3MGGA 2PTHA 2WWWA 3VSAA 3D1VA 2P90A 1RMYA 2FF7A 3P9SA 3UK6A 4EG1A 2GNPA 3HY4A 3B6EA 4G3XA 1BRTA 4NULA 4RENA 5K2MA 3S2EA 1KAQA 5KEIA 5KJCA 4DHEA 3FBWA 1IY9A 1NYTA 2JLSA 5J5VA 4A5SA 4D4LA 2I3DA 3JY6A 2RCNA 4YFVA 2AN5A 5DKFA 4G0MA 3RYIB 3V9PA 2JFPA 2RDMA 3PDHA 4MV0A 3B9RA 2VJCA 3WGIA 4PYIA 1CDZA 5C8YA 1ZHOA 1GG9A 3FUCA 1OJ7A 4YROA 1BDIA 1VIMA 3VOAA 5ITZB 2FPIB 4ALIA 4MGKR 5AW5A 1K3FA 1GNPA 1MP0A 3CLRC 2WJ6A 2FPWA 5CVDA 3UFXB 2XODA 2IU3A 4KO2S 2F3QA 2LDBA 3Q87B 1G4UR 5JFGA 2QAGC 4YP9A 1C5KA 5ISMA 3GR6A 4XFJA 5G4LA 4J4HA 1ZD9A 4R5MA 1DXYA 5IKXA 2JGFA 2A7XA 3GO4A 3O1JC 4C14A 2HA4A 2GJKA 4M0PA 1GYPA 2PD3A 4PZUA 2M6KA 4MUAA 5JSZB 2JGMA 4J1TA 4Q66C 1RWBA 1MR3F 2WSIA 3QPWA 3B7PA 2PMFA 5CXXA 3IVRA 3IPXA 3G2OA 2CEKA 1KFJB 2C7GA 4X97A 4CLRB 5KOJA 2I78A 1DKRA 4MP6A 2DPXA 2HSZA 4MV3A 1DBQA 3JTMA 1Y7IA 1XG5A 1VMDA 4ZAVA 1MEJA 4B6JA 3GLFA 3BA1A 3NWJA 2EYQA 5TEWA 1UKBA 2VJKA 3GVXA 3K15A 4KPUB 2UYYA 2XQFA 3FPBA 2RH9B 3R6LA 4LZPA 4O4IF 4QFBA 5EJIA 3KSBC 1RWKA 4KRXA 2KBEA 4MWDA 1SNYA 2E2WA 1JZQA 2PUJA 2QTTA 1SU6A 2WEKA 3HXMA 4GPBA 1TIKA 2IXFA 5ALIA 4DTIA 2G9ZA 2CNOA 3FCAA 2Q4DA 2OECA 3B3JA 4CLHA 1UBOS 4KNVA 5HIJA 1VLVA 2FSPA 1YIOA 1KDPA 4AYXA 3JQCA 3VU9A 5C7YA 1A2KC 4BMVA 2GZRA 4U3JB 2XRZA 4BN5A 5AM4A 1CQIA 2OE2A 1N0IA 4OU5A 4FHGA 1H69A 1X7XA 1ZMTA 2ZR9A 4FE7A 2JLBA 4PG4A 5DGCA 1NI5A 1P1KA 4HDRB 4L5BA 4NC9A 2B1IA 4BLUA 1WNTA 2X8AA 5BVHA 1Z4OA 4URXR 4WK0B 1AE1A 3T3IA 2JLYA 4NAUA 2H4XA 2ZI5A 2V98A 3OUUA 4BQNA 4QOSA 1N5DA 3C1TA 3ZGYA 1ZIXA 3CLTC 3AKZA 2ZVDA 2HU7A 2WMNB 2BEVB 4X8MA 4EVQA 5AVXA 5TPWB 1FYXA 1HZJA 4X1IB 1JDVA 2IZ1A 3EEYA 3HP7A 4I50B 5HX7A 2ST1A 3MYYA 1ZICA 1HE1C 4OL9A 2A5DA 1U4SA 4U0JA 4CR8A 1QC5A 3AKCA 1NNUA 2ZUEA 2INGX 2QMOA 3NT4A 3DR5A 3L7NA 2JPDA 2J6BA 3ZW7A 1V3VA 3O3NB 1CD5A 4FE4A 4DR2B 4RZSA 1H6CA 4LBYA 3MLAA 5CT9A 1JXAA 3X3HA 1IHXA 1QV9A 4YB8A 1XALA 3U2QA 1GGVA 5K5EA 2C94A 1R37A 5C3UA 2PA3A 3ZXUB 3ZXSA 2YVKA 3VH1A 1E1YA 2JEYA 8LDHA 3R77A 2FFHA 2ZYAA 5TDHA 3WGNA 5IMSA 3EZ7A 3VR4H 3KZVA 5LDHA 3TUIC 1SKMA 1TT7A 4Y6SA 5ANRB 1QYXA 2XF8A 1H4VB 2JIZA 4ZZIA 2WAMA 2WNIA 4BLWA 3KLOA 3B2QA 1F9EA 1PGJA 4F5EA 2LNDA 2EFHB 1V5FA 4WOBA 4RF4A 3TQQA 3OY2A 3SYRA 5HQTA 1WUHS 4NCKA 4D3DA 1CQZA 3OAAA 3BXOA 4UNQA 3I09A 1IVYA 1A8UA 5GIPE 4IJUA 2UUAB 4UPVA 3ZCVA 3QY9A 3U3MA 2MTBA 3W7VA 3KALA 4BQFA 1VI2A 1ZGCA 2AFVA 3DDZX 3UG6A 3K9QO 1IHDA 3OEED 4YONB 4BEWA 5ICEA 2H85A 1HDXA 3GVCA 3WA6A 5T4EA 3VVMA 2FPIA 4QOJA 5JTTA 3WYFA 1I6KA 5C1BA 3SX0A 3PUXA 4FI3C 4BJ3A 3UFXA 4INAA 2QXUA 4C43A 4EHFA 1IATA 3PJGA 3PTZA 1V6AA 3QVKA 5AI9A 3RVRA 2PV7A 5EGNA 1YZVA 1ZK1A 3HM9A 2A9KA 1K4KA 4ARAA 5JAPA 3B1FA 1NW4A 4XPIA 4TMFA 3AF2A 2JA1A 5JSZA 2NV0A 3PFWO 4J8PA 2VXOA 3DZFA 1Q74A 4FYHA 4NQZA 2NQ8A 3DDHA 1X1AA 5KQGA 2Q5LA 1KYTA 3PGLA 5IRCD 3CEAA 2AMYA 5EKDA 4BFLA 4AMGA 5F73A 1BX1A 2QRMA 4UEOA 1W88B 4OH1A 5TEVA 4CLRA 2V54A 4B6SA 3V9AA 4B3GA 1J8FA 5A9SB 5AW4A 1XEAA 1PL8A 1DXOA 2C8VA 2R1ZA 3H2KA 3L4BC 2CCKA 4OQQA 4RY0A 2R7KA 3A3NA 4XIFA 1HDRA 4QPPA 3LFTA 3SHFA 3OCJA 3BAFA 1GPYA 1OI4A 1Z9BA 2WHQA 1SIBE 1WSBA 2H3HA 4DLKA 2HSEA 4YRKA 2M9MA 3VVBA 2UU9B 3DLTA 1PQPA 2PZMA 2O4CA 1OBFO 2OORC 4LZWA 3NVDA 1AKMA 2ODEA 3X1DA 1R4AA 1U3TA 3RU9A 3TOCA 1UC5B 6ADHA 4FMPA 5AKJA 5H5JA 3Q0TA 3M4JA 2FUKA 3RFXA 2C2ZA 3RFVA 3RK1A 3V4VB 3UBTA 3CE6A 4FDAA 3OM0A 2WPNA 2A9PA 3DH0A 4WXYB 1PYGA 2QSJA 4J3FA 2YN4A 1HKUA 5K8TA 1VRWA 3BE5A 3RHZA 2RBKA 4MV8A 1BGVA 1L5KA 4L4SA 5JCOC 4GKVA 4FHDA 4HDRA 3ZZNA 1CE8A 2W6ID 5CDYA 3C7CB 4H16A 4BTVA 5B3LA 4WXEA 3SG0A 4TLEA 1UUFA 2Z1NA 2GN4A 4NESA 2NXJA 1C30B 3K5PA 4TTSA 4BO6A 3SC2A 4BDTA 3MUEA 4EIWA 1E1NA 2BEVA 3HBLA 1FDRA 1RAFA 2P30A 4FKZA 4QDTA 4IDEA 3PX3A 4JUDX 4OQNA 5ED4A 3E58A 3L01A 1RBZA 1XVTA 1RTKA 2JAPA 2HWKA 2JHFA 1H6BA 5F64A 4BRWA 1TTHA 2ZXFA 3M1LA 3MRXA 4EARA 3AMVA 2XZDA 4FXPA 1CNEA 3OU6A 1KU0A 3NOVA 4H7DA 5I9SA 1EFPA 3AH8A 2ZJ6A 3D6HA 3KYJB 3LO8A 4L57A 4XB2A 5G0SA 5BRJA 1M2WA 3TW8A 5JVDF 1LF0A 2ONJA 5LR6A 2F8LA 2P9TA 2W4MA 4ND3A 4TX1A 1L7EA 1PQWA 2IXGA 3O2QB 3SHQA 4DIEA 5KSZA 3QX3A 1G3UA 2FN4A 2OILA 3H1EA 2JVKA 1PR6A 2NQ2C 3OQVA 4LYDA 2K7FA 5CYGA 3RGGA 2WM3A 4G26A 4Z9AA 1KTIA 2PSHA 3AZPA 3FNGA 3AG6A 1Q15A 2O8NA 1ZO8A 4HCJA 5LMZA 3D0RA 4ABTA 1O6ZA 4KKVA 4B7CA 4O6VA 3S2FA 1BROA 2FUNB 1OXBB 1FU4A 1TIPA 3VDQA 3NHAA 1TDJA 4DLBA 4A0SA 2ZDGA 2NOAA 3GPDG 4RQBA 3RU3A 4UMEA 2IZOA 1N8KA 1RQRA 2OGUA 3FLAA 5D3MB 4DC1A 5C9ZA 1D6MA 5J59A 4LJSA 4QUEA 3DAGA 3PPYA 1VBMA 4KRFA 3PNPA 3EEOA 4FSXA 3PRYA 2F1IA 4XWYA 3R7BA 4DV0B 2WT9A 4C87A 1WP9A 4BKMA 1KBZA 2H18A 3E8MA 4WHMA 1YCFA 1VSUA 2YWDA 4OPMA 1VJTA 2QUJA 1GDTA 1A96A 2R1TB 2NXCA 1KSHA 3EGVA 4HATA 1A2OA 4E88A 3GZTB 2I76A 4ZWNA 2RK4A 3DCJA 1SKQA 4BLTA 2GI4A 3ZY2A 4UXHA 1ZK4A 3VMFA 2WHRA 1PAUA 3AM1A 1IULA 3ONEA 1IUOA 1L5OA 2VA8A 3S1AA 2B37A 2XLCA 3K9HA 1YR3A 3M6IA 3AHGA 3RIXA 1IWBB 4K8RB 3UAVA 3RS0A 3KR1A 4CHGA 2XSZD 2J09A 2H8GA 1ML3A 1RP1A 4JCOA 1LGYA 3H2JA 5ENDA 4BNVA 4KUHA 4PSKA 1FSFA 3UK2A 4H27A 4LRSB 1GWNA 4EW2A 4HAOA 1Z6GA 1Z4JA 3DOOA 2CKMA 3PDUA 2DZDA 2F1KA 2R1VB 1XCMA 2VJAA 1N0WA 3TW0A 8ATCA 1V37A 1JLKA 4YO8A 3WVNA 5IDWA 4LQLA 1E5XA 3HV2A 5F3WB 1L4GA 4GECA 2QVBA 4DEXA 4CTNA 4MPDA 1ABBA 3H4VA 1QPBA 4PO1A 3WYDA 4KQWA 3HO1A 3EYAA 4OXRA 3BS4A 1I4LD 1KYVA 1V1JA 1YB2A 2PCLA 3IQXA 2ODTX 3HRHA 3L41A 1UPXA 5KYNA 4OUKX 3D3WB 1AVTA 3I64A 4UD6A 3GQVA 5TQJA 1UOQA 2I0FA 3TTTA 5I9IA 1NW7A 3K53A 3ZV4A 4LKRA 5A2QA 5ALLA 5AVYA 1L7VC 2QD4A 3KTAA 4YJFA 3VC2A 3VQTA 4ZCPA 1OAOC 5B6JA 2G9NA 3V46A 1J0DA 2R84A 1G5FA 4FFMA 2VNHA 2WJIA 3RT7A 3PI6A 1SVUA 3G2IA 1KMHA 1U1DA 2O3SA 2ZKLA 1XQYA 1EFHA 2C04A 2AB0A 2EF0A 4H3KB 2I7CA 3NWOA 4D3SA 3L4EA 5I7VA 2QAGA 4TMXA 3ZOZA 2EWWA 2NTYC 2L18A 3HO6A 3RRNA 1XDUA 1B8NA 1YIDA 3LQYA 1FSZA 5JS2A 5I4KA 2FR0A 4A6XA 1BN6A 4ZI2A 3UXMA 4PICA 5KTTA 5EZSA 4EGCB 1ONSA 2BR5A 4E08A 1DAHA 4DCMA 1MFZA 3ZD6A 4K7JA 3S44A 3T4EA 1CQJB 5ETJA 1Y6RA 3BXFA 3AEUA 4HAZA 1RJDA 1MX5A 3L3BA 3M6VA 5F7JA 4AJOA 3HP1A 1ZONA 3OZIA 5BOSB 1TM1E 5B3AA 4TS1A 1YI0A 1MAHA 5DTIA 4LFBB 1F51E 4Z1MD 2PSSA 3QXJA 4P7BA 3RSGA 2Z5VA 4ARZB 5FAKA 4DV1B 5LDDC 4R2KA 5IC4A 1QR6A 4EHBA 1ZN2A 3ND9A 1J5PA 3MZ0A 4GLOA 3UJHA 5JYEA 3J7AC 1SFRA 5EE0A 1CB7A 4AT1A 3CKLA 2PR7A 1KYXA 5K99A 2WTUA 1DV1A 5DTMA 1QV6A 1AKRA 1C3OB 1I51A 1Q1ZA 3TR6A 2V96A 4UJ5A 4GDFA 1YUMA 3D6VA 1II8A 1FK8A 2QTHA 1QG0A 4TXHA 3IOEA 4Z0HO 1UK6A 4JUCA 5ESDA 1LPBB 2AE2A 3S40A 2C0PA 2P67A 4IHKA 3RLIA 1YJ8A 3HJAA 3UATA 4TYWA 1QWSA 1B8PA 3E2MA 1S8FA 2PA0A 1QRTA 3TXYA 3KQQA 2GMWA 4EJFA 3EXFB 2Z8YM 5L40A 3PEFA 1EXNA 1PFYA 3QX9A 4O2BF 2OZKA 4RSGA 3O4JA 2EYUA 3BGOS 2HJHA 3ZUGA 3AUTA 2H51A 4EO7A 4HI0E 2NT4A 2OO5A 1NMEA 3BWCA 1WLYA 3EDQA 3PP8A 3TZEA 4LOLA 2Y0CA 5GM2A 2O7NA 4N5HX 3RVJA 1BKYA 3JQ7A 1FFSA 1O2DA 1XZNA 2L2QA 1NA5A 1WABA 1ZK2A 3P9CA 5BSTA 3NIGB 4JI8B 4M53A 2YOFA 3SJBA 3OFVA 4OQYA 5A4MS 1X8KA 3W0LB 2V3CC 4HLDA 7YASA 1Q0TA 3DD1A 1AKNA 1FYVA 1WLSA 1Z0IA 2AJCA 3O8QA 2AE1A 2B7LA 1XA0A 3CRZA 4CM6A 4ML3A 2XGSA 2ZZKA 3AUKA 3I92A 4XGQA 4D02A 3MJSA 1HA3A 1OZAA 3G7UA 4KODA 3JU3A 4MK4A 1GKYA 4Y8VA 1ZD2P 2X22A 3MCWA 2EL9A 3GJQA 5EEGA 3GRPA 2FWAA 2OZLB 1E0DA 3ISTA 3OM1A 5I9LA 3KFLA 4LHVA 2UYOA 1EE9A 4HNRA 1M1XB 4LSWA 4F7WA 2Y6VA 2GILA 1K1EA 2XDAA 3C6XA 3OZVA 2YJ5A 1KAOA 5T3YA 3T4UA 1IHYA 1MH1A 1VHDA 3GJ3A 4R6WA 4CEHB 1IN1A 1HO3A 2R1VA 3L2OB 4HGYA 5TT1A 1SHLA 3NTOA 4BOYA 1F2UB 3ESBA 2XKAA 3SZRA 1T9ZA 1I0IA 3A1SA 3L82B 2FX2A 5E1BA 3NP7A 1R7RA 2XWPA 3TZQA 1YB6A 1EMDA 3IV6A 4WOPA 1RAGA 3TI7A 1W0CA 1Z28A 3EZFA 2YQ4A 2I5PO 3PNQA 2F17A 1Q5PA 3UJNA 2O8CB 2J0UA 1F5SA 1QG6A 1TB4A 4PYMA 4V38A 3QKSA 5D51S 3W77A 5ALFA 1MO5A 3N0TA 3V7UA 4DSZA 2AC2A 1JPVA 4RTRA 1Y37A 1XJCA 2GFQA 3Q41A 3RSFA 3VC7A 1KQOA 3IILA 1CTQA 1V35A 4MJ7A 5FLEX 4KIGA 1BMTA 1ORWA 2F6RA 4LHXA 4RKQA 1YCDA 2HBZA 4WZAB 3S55A 1LBSA 4MUEA 3SYNA 3JQ8A 3F6SA 4A0RA 4ARCA 4R1OA 1DKNA 2V7VA 5B64A 2R6AA 4Y1FA 4TZ0A 2QRUA 1X3SA 5KIAA 3FSJX 1FFDA 1OC4A 3T6KA 2QQEA 1X2EA 1DKPA 3EZYA 4WECA 4IOMA 4BAZA 1OB5A 5EIWA 5M7EA 5DCYA 4FNMA 3VKHA 4R1QA 5EZ5A 1TEXA 1O5OA 2HWYA 5AKEA 1YRQA 1T5SA 1NASA 1WCYA 4GI3A 3CLTD 3FGPA 4MV7A 1E2GA 4U0KA 4EAAA 1GSIA 3CNOA 3OMXA 4KGDA 4DV2B 3GGCA 5E6SA 5FTKA 2GEDA 1R3DA 3AETA 5DB4A 8ADHA 1OH6A 1USKA 3DQPA 2P5TB 3QQPA 4Y9SA 4ZT4A 5C80A 5MN5A 3LLMA 1TJYA 3GEGA 3U4HA 4JLWA 5COAA 1QIGA 3FDJA 4NFSA 1G9XA 1PJQA 1CQPA 1CUBA 3PR2B 2ZQ5A 4MKGA 4WXHA 5LXTB 2Q1WA 1HOXA 1XAJA 3K92A 4DWOA 4BUCA 4C29A 1X7DA 3DTVA 2BUAA 4NBSA 4ARZA 4OK6A 4D8YA 2NZVG 3BTOA 4C0LA 5AKGA 4DLTA 4FGKA 1U0LA 2G9RA 2PNJA 3OQ1A 1P5RA 2Z2IA 6YASA 3TLBA 1KEKA 2TMDA 2WB4A 2WZBA 3ONDA 1V6SA 3ONFA 4OLHA 4P0PB 1JDUA 1A4XA 3GT0A 4PYRA 1DFGA 2BM1A 4GYYA 1D0IA 1O94D 1WZEA 3GZ4A 4M0UA 4P80A 4ZT6A 1BXRA 1RWOA 4RTJA 5FBQB 4JVMA 3LPAA 3T12A 1Z0AA 2Q41A 4LI0A 3K9FC 5LA6F 4DYVA 2GZDA 5EPEA 5C5DA 4W5OA 4NABA 2X8JA 1ZJYA 1TKCA 3MGKA 1QB8A 4N5NA 3DONA 3EXFA 2VP4A 4W9NC 1A9SA 4JR0A 5JCOA 4B3MB 1HYHA 1M2GA 3USES 3A9VA 2CSUA 1N7IA 2R2GA 4J91A 3EXG1 1KAGA 3K4QA 2VFAA 4MX8A 4MUGA 3FDXA 2B20A 2CVZA 3ETLA 2GEVA 1XVIA 2W2VA 2AG6A 4C0JA 3RH0A 3IIEA 1RHMA 4JQSA 3MW8A 4R7ZA 1XNRB 1W93A 1O0BA 3B12A 1OZ0A 3IALA 3IV9A 4TMTA 2W9XA 3C3WA 3GEMA 3WNZA 3L40A 5B4TA 1GKIA 4WINA 1AO0A 3U3XA 1P4RA 3HCDA 3KJNA 4NCXA 2VQ6A 2OD2A 4NKRA 2QG6A 4NYJR 3WGUA 3GJ6A 3H86A 1W73A 3A32A 3LV8A 2IEYA 4U7FA 1J23A 5I4CA 4YMWA 1HSZA 3RQIA 1BS2A 2YJ4A 3C3CA 5K4HA 3VR1A 2ANBA 1BS1A 1PQ4A 1T4DA 3HRKA 3QW4B 4F0JA 2ZBQA 4AZWA 1OGYA 3PF9A 3EWIA 4DV3B 3ZBPA 1Z2CA 2VBFA 3KU4A 3Q9SA 3V42A 1U1GA 4CEHA 2OK7A 3FHTA 3RVNA 2CMFA 4ZI3A 4GE3A 4BO0A 5EWJB 4NZNA 1I7LA 3EAFA 3HSYA 4ALNA 4JOSA 1AY0A 1XDDA 1Z3IX 1I13A 2FN9A 3KE9A 4LCEA 4P3OA 5C8DA 2ODQA 1V45E 2WP0A 3H5VA 2O8CA 5BYKA 4EA9A 3ZI7A 4D97A 3MPOA 4DL9A 3G2MA 1R0KA 3ID6C 5KTYA 1BCRB 2IXAA 4MVJF 1QR2A 1TU4A 1NI4A 1GYQA 3GH3A 1N2EA 1Z0UA 3G5UA 4RMNA 1M72A 1NVVR 4WJKB 3UUFA 3RSSA 4DWVA 1QH8A 2HCTA 4KW7A 3R5TA 3ZDQA 1EFAA 1TECE 4ETWA 1DWPA 1U02A 1OAKA 4PE5B 4EO4A 3OIVA 4MPJA 2DAPA 2FQQA 4Y6QA 1NQVA 5IYZB 3T61A 4WNAA 4FPXA 1I3MA 2OGSA 5JAMA 2R6HA 1L6IA 2O0LA 3ESZA 3A6DA 2A92A 2H0RA 3RWBA 4AUKA 3MC1A 3WHLA 4F93B 2F64A 1QQAA 1KGSA 2O7QA 3FFWA 3HKDB 1GL3A 1K8QA 4M0FA 4FZJA 4OAQA 4EJMA 4G5HA 2ZU6A 3GRUA 5IEBA 1GD1O 2BBSA 3OZGA 5MHTA 2Y77A 3BWVA 2ZCVA 4CMEA 5CR9A 2NVBA 1CJTC 2H6EA 2NPOA 2PQ2A 3OZXA 2VTDA 1JV2B 1VIVA 3V2IA 4EG3A 1MQ9A 3HG7A 4R9NA 2J48A 4RMIA 1Z26A 1GAXA 2G7MC 3RVPA 5LJIA 3KT3A 3CVXA 3VO1A 2AA3A 4L7QA 3U19A 4CDNA 1L4EA 3U4DA 3WSVA 3F73A 3RUEA 4CV1A 1T1IA 1W25A 3IBFA 4G0PA 3SJ7A 1ZZGA 3C43A 3PIDA 1GZSA 5I45A 2YTZA 4M7RA 3FWHA 3LGXA 2AF4C 1R4NA 3HU2A 4IXMA 4IR7A 1FYFA 5GV7A 1J6UA 1EE2A 3KQVA 4EG8A 3TKYA 2VYND 3VJMA 2YHUA 2QY6A 4LJ5A 2Z2ZA 4XSVA 5DO9A 1BDHA 2DFKB 3QYPA 3L8EA 3L77A 1WX1A 3TD6A 2E37A 4LQDA 4ODIA 4Q9JA 4W1RA 2BM8A 1R0WA 3GJ8A 2Z98A 3LOPA 4WL0A 1OAOA 3P94A 2AZ4A 3QWBA 2GYYA 3WFJA 3WMEA 3R6WA 4TWRA 3PNOA 4PHGA 3RSQA 2VK8A 5CNMA 2XUIA 3BWDD 1UFKA 2I1VB 3KX2A 3VVCA 1Y8RA 1W36C 3S7ZA 2XDYA 1IMJA 4JGBA 3ZOKA 4GOKA 4BP3A 1E3DA 2IYNA 2CZGA 2D74A 2RHMA 3TTUA 4C3UA 4EH1A 2E0IA 2G76A 1LLCA 1CF2O 3GLRA 1EDEA 2QPTA 4IZHA 1JL3A 3C3EA 4M8KA 4QGBA 3L18A 4B1FA 1AK9A 4EO9A 4JI2B 4Q9DA 1G8SA 2AW3A 3ZQJA 1EP9A 1E2EA 1LD3A 1PJCA 4I9UA 4Q7MB 3G02A 4EG4A 1G291 4G85A 2AKEA 3BWXA 3KETA 4N6OA 2QQ5A 1XQ6A 3V1YA 4PNHA 2QRVA 4P93A 1OF1A 1L9XA 3GLHA 1YI8A 2B4YA 1E7MA 1XA4A 2N9UA 2UYQA 4ZT2A 4W7SA 3L1VA 5F4BA 5IDXA 5JS8A 1M7BA 1EDBA 1M1ZA 3KUDA 5I7EA 4ZTBA 4YXFA 2Y8EA 1QZXA 1Y4AE 5BNTA 2ZI7A 2BOVA 2CUNA 2AQHA 1CJMA 3CZQA 1TPZA 4H9GA 2QE7D 2PXXA 1VCHA 1GZHB 3NBQA 4LSMA 3KQYA 8ABPA 2WQ7A 4D4MA 1EGQA 3HN2A 1ZH0A 1ZVJA 4J16C 1Z6TA 4MQ4A 2BT4A 1AKUA 2I2AA 2G5GX 2DUJA 5CK5A 4QJ3A 5KNBA 5DWDA 4CQJA 5IS2A 3PDCA 2WOJA 5EXEA 1C3JA 5FBHA 1EFRD 2GTIA 4AG5A 2P77A 1ZVQA 1NF9A 3I52A 5GGYA 1IQPA 1OXKB 3JYLA 1NXPA 1ZUD1 2AN9A 1M6EX 1RJ9A 3RARA 3QE4A 4JU9A 1U8XX 1NKTA 3QVUA 4WZZA 2D5LA 1JHYA 5E3JA 1ECBA 3QEMB 1TL7C 4RSHA 4GVXA 1KNXA 2O14A 4IWNA 2Q4OA 2OG2A 2I7XA 5DDIP 2OV2A 4LMAA 4X0EA 1TIBA 2NO9A 1GCAA 2R68A 4LXHA 5KINB 3IXMA 1FLAA 4Y2UA 1WE2A 4ENVA 4RDHA 1VG1A 2V7EA 3BF8A 2GN6A 2IZ5A 3DPIA 4MH0R 4DQUA 4YAIA 1OVMA 4BNUA 2H1VA 3C6KA 5KJEA 5LB2A 2PKYX 2XZPA 1LUAA 3NBUA 3RS3A 2BFBB 3CX8A 2Y71A 2OWDA 3NVAA 5DZSA 3DJYA 4ZOLA 4FQ5A 1P39A 5EIOA 3MJRA 1UK8A 3A9SA 3G89A 3G1WA 5FOWA 3MG9A 2O3JA 4P36A 4PBSA 5AHWA 5IYZA 1PJ8A 2P91A 5H83A 5JCZA 4Q37A 1ADBA 1U1CA 3GT7A 4FW8A 4QUHA 3WI7A 5AFSA 1O7JA 2BDEA 5AK3A 4A6DA 1R8JA 1TW3A 2X40A 2I2WA 2EP7A 3JWHA 3L4SO 4C21A 4E33A 1AQNA 3E1GA 1QHXA 3UM9A 5CB4B 2ZIEA 4HN9A 5T4HA 3L1HA 5EP2A 3DZKA 3FWNA 3NHFA 4TN5A 4DB2A 5J2TF 1DO0A 2NZWA 1NNEA 3MS7A 3NJ4A 1T3LA 1OIWA 2OL4A 4LOKA 4UVGA 4F3KA 5AM3A 2XA2A 3JXEA 4GLJA 3KYDA 5AK4A 1V6CA 3KAJA 3BHMA 4QKQA 4A82A 3S27A 1V8PA 3A4IA 3B1JA 2QKYA 2SNIE 4HO1X 1KMMA 3WLPA 1MHTA 2AD5A 4DCUA 4RZ3A 3W8DA 2PLWA 4EYQA 2FU5C 2ZS9A 4NEGA 1ND6A 1ZR2A 1E59A 3ZU5A 4BLPA 4IFTA 3TSWA 5ITSA 4R8LA 1DBPA 1NBMD 2B8NA 2AJBA 2FDRA 4OUDB 4FN5A 1JEQB 3MJ4A 2YXEA 4TTIA 4RPGA 2DLCX 1A98A 2QLFA 1H0KA 5T6BA 4REQA 1G6HA 4Q3OA 4UBNA 4DLPA 1TM7E 5G0UA 1JSRA 3ROXA 3NHBA 1UZNA 4FGLA 1UAYA 3CO5A 4NHOA 4K46A 5J3JA 1CZNA 2ZT7A 3AIIA 4KMSA 2H4JA 4EB6A 4WLVA 1JHZA 4NBLA 3T3PB 5JFOA 4MKXA 3A7EA 2VQDA 3B70A 4E6PA 2FPPA 1FP2A 1RYHA 4P5DA 4DIUA 3LLUA 4O4LB 3EVEA 2GOYA 3GNTA 2XMPA 4WCDA 3K96A 1BQ3A 2EX0A 1ZH2A 2A9RA 4JJZA 1MGOA 5AKKA 1NU6A 2FPKA 2JAXA 3EEIA 5EKSA 3U26A 4ZGBA 6GPBA 1ZXXA 1Q92A 1S89A 4BNDB 4CM8B 2RD2A 4O4HF 4KX3A 1UXIA 1L1EA 3HFRA 3N58A 1UM8A 5B6IA 3L4KA 4YMUA 1PFUA 3DBLB 2Q27A 2V7QD 4Q3DA 4ZCLA 2OXIA 4US0R 1HWYA 1KPHA 1T29A 2AOUA 3C14C 4CI9A 4RDXA 4HB2A 2NXEA 5FV4A 2NU9B 2W93A 5CTJA 4YRNA 1TM2A 1JXQA 1IG0A 1TZBA 3RT1A 3STYA 4CKXA 1L5GB 1IG3A 2AZTA 2VJOA 1MLDA 4IIVA 4WZAE 3UF0A 4EHHA 1QHGA 3E23A 1AOXA 3GEEA 2OG1A 4HYTA 2HF9A 4HT3B 4P83A 4UMVA 4XVQA 2QN6A 4ZHSA 1PEAA 4R40A 2H65A 4NAHA 2AIRA 3CEJA 3LHFA 4PIVA 3NC1C 3KHKA 2ZYSA 1LS1A 1E2PA 3C6YA 1ENPA 1TEVA 4I4CA 1LK5A 1RQ7A 2QWXA 1N6KA 2ZIAA 4FX5A 1XZAA 4WBNB 3AVTA 2CFOA 2O50A 4MW9A 2QZPA 3BFXA 5H68A 2HCFA 4JBYA 4KU4A 3E81A 4ILEA 4FNAA 5DT2A 3QI2A 5HZMA 3WX0A 1ANKA 4X65B 3KJXA 2EKQA 1U5AA 3W3AD 2QM8A 1ECCA 1TF7A 2HEGA 1C4KA 1TTQB 2GZ1A 4G9BA 4Q4CA 4PSDA 1G9TA 4YBRA 1ZAYA 3BK2A 2C3UA 2VYQA 2I7TA 1JAHA 1WTCA 2V5AA 3ZDEA 9GPBA 1NULA 3OLXA 1RYEA 4KXNA 4W9NA 4DG5A 1X80B 4MQMA 1ESDA 1GARA 3TMAA 5FQNA 4JL8A 2GN9A 3RTDA 4G5YA 1XZPA 1F12A 1V43A 3NWEA 4KMMA 4YN3A 1ZZEA 3KTDA 1PZFA 3FN4A 2G09A 4G25A 5DM2A 4Z2AA 2C54A 1N78A 2BFBA 4U2FA 3WHPA 2IKQA 4B4DA 1RI2A 3IAS1 2E4ZA 2YV1A 4QNMA 1PQYA 2O1XA 2I6TA 3BREA 1A69A 4LN1A 4NOMA 5JI2E 3JWIA 2F4VB 1USVA 3A9WA 1D8TA 1SQ6A 3BHIA 3TQHA 5A03A 4Y6OA 2P62A 1TVEA 2WAOA 1HGXA 2A1UB 2IX3A 1GSOA 4QM7A 1A71A 4RANA 1U0SY 2XYRA 3D3NA 2CEAA 4OFZA 4U7PB 3WIDA 4AG6A 2WWYA 1VJDA 4QT0A 1NW9B 4HYEA 2H92A 1PDOA 4JYBA 4BO1A 4RTOA 4NBRA 1IN7A 4GX5A 4WY5A 2O54A 3DP7A 2DHDA 5EHIA 1XDBA 5BV7A 4Y9TA 1F1JA 2IU4A 1NAHA 3DL2A 3QYFA 4LYYA 4XARA 2FE4A 4YNBA 2IHKA 4MI9A 4XX0A 5F5LA 4ZI5A 4CLXA 3B5IA 5T7BA 4XQEA 1QO7A 4AO7A 3VR3D 1RZRD 3V2UA 2PGIA 3FPGA 1BIFA 5B7QA 1WQ1R 2LUOA 5IASA 2CJWA 4TN1A 1QGAA 1KI8A 5AW8A 4LVCA 1J4AA 2LIVA 3IQIX 2FN3A 4COKA 1KJYA 5AYVA 3DZIA 1MOPA 4ZTUB 4OJYA 1ECGA 3UB2A 2YHBA 4Q7LA 1YRHA 3QVXA 1C0PA 1M3SA 2J3MA 1GGHA 1PV2A 5CB8A 3T7EA 1HG0A 4B7ZA 1E7WA 3BGDA 3Q98A 3H1FA 4ERNA 4RAOA 1P0CA 1X7WB 4YT4A 2F43B 2EV9A 3AF3A 1EK1A 2JBWA 3SS7X 4FIDA 2ZRDA 3WHKA 2PJZA 2ODWA 1NBME 1R6BX 2BEJA 1B8VA 2DUWA 4HTFB 2AG5A 1GTZA 2H17A 2YZ2A 3DCNA 3K2QA 4FOTA 1CRWG 4L74A 4C0XA 5KBYA 1X42A 2O7VA 3MINB 3TSZA 4PGMA 1DWOA 2CXPA 1KZ1A 3P26A 4MMYB 1ABEA 1DXHA 1E69A 2VUSA 2Q9UA 3HVUA 2I7DA 1XRNA 4RTMA 1JBEA 1EX9A 1WF6A 2AKAB 3HR4A 5KDDA 5GIOE 1KPGA 5IDVA 4BVHA 3DZGA 1G2OA 3DFKA 1UBFA 2GUWA 3ANYB 4PR3A 3FOEC 2XDWA 3C70A 5BR7A 1P31A 1XZCA 2TRSB 4C03A 2P9QA 2PWAA 1FDOA 3CU5A 1JDJA 2IOFA 2P11A 2OCXA 4HVTA 4Y6LA 2I3BA 1QANA 1J8VA 2PGAA 3ND6A 1OLUB 1VDMA 1ZCAA 4UFNA 5CH5A 3RSOA 4YAKA 4NBUA 3U5ZB 3AZQA 4CTOA 2FPUA 4O1MA 1A7UA 1Y3BE 3IDSA 4YDRA 1OQAA 1KOGA 4KWIA 1O4WA 1PWEA 3M81A 3QG1A 3R6DA 4FDVA 1JKJB 2ZAOA 3H9JA 1VJGA 3GA0A 4PLWA 4MV4A 1HG1A 2Q7XA 3O83A 5FPSA 3CVUA 1DQYA 3LX4A 3MUOA 4I1IA 3ZWAA 5K09A 2OCIA 2R44A 3SXJA 4EUHA 4WESA 3F4KA 4XWAA 4XEUA 1NE7A 2NUPA 5EMKA 2AEEA 2V6MA 3U37A 1RNLA 1XMSA 1NMXA 1PSWA 2X3UA 1G7RA 3BN3A 3HZRA 4CJXA 4YRAA 4UZSA 2REBA 3MT7A 3EVCA 5JCPA 3GLQA 4LVOA 5AP9A 4B4KA 721PA 2QTWB 3O75A 1E3QA 2HHLA 4PC6A 4B82A 4I1YA 3U09A 2QU7A 3HCFA 1NWCA 1JP7A 1MTOA 3TDKA 3LZ6A 1EK2A 4K87A 5B4VA 5JYBA 1NQ5A 2VAVA 4WUTA 3M4ZA 4WE3A 1OMOA 1UKZA 4K6FA 1Z4LA 4U2EA 5JAQA 4BB0A 5BP7A 3O47A 5DHSA 3N3BC 5FUMA 2WA1A 4OTZA 2JI7A 3WQRA 4DCSA 4QQNA 4UU0A 4CL8A 3WK4A 2QE6A 4I6EA 4LHWA 2NSDA 1G3QA 4R9SA 4ZVTA 5AVVA 5H3HA 3CCCA 1V39A 1N8SA 2BH2A 1LW7A 3P9IA 1KQ3A 2PAFA 1PR9A 1Y48E 5JSHA 3KQKA 1YUNA 1JR2A 4C3VA 4WLFA 3RRMA 4FSDA 2QTVB 2A1UA 1Q0PA 1QCDA 4EJ6A 1VYTA 4J9VA 5JSFA 1NF2A 3GROA 3NBFA 4BZXA 2OQ2A 4GMHA 3GCDA 1IDOA 3WY9A 1YDEA 3AUUA 5DBOA 3R7DA 3T9EA 3WIUA 1P77A 4AZ0B 4AKHA 3V32A 4CG2A 2PZBA 2BCEA 1L5SA 2BPOA 4UE3S 4OAPA 1CR6A 1QV7A 1TZKA 1WSDA 2COEA 4I9GA 1AQIA 2FJUA 4RKFA 5F7XA 1JJVA 3NV7A 5E2AA 1LB1B 1I5EA 1B73A 4PNPA 5JW6A 2Q6LA 3ZNPA 1MO4A 3F9IA 1FFHA 1QH9A 3L7YA 1I1OA 3I9MA 4DW8A 1SKBA 2AH5A 1RM0A 3JZFA 4MDHA 4EQ6B 4KPEC 2IIVA 4NTZA 5AKLA 1GPLA 3QHQA 4LC1A 5BN3A 3DUWA 4KR7A 4BB6A 1CETA 3C87A 5JCJA 5JJCA 4HNSA 4R98A 4NLLA 3R1IA 2OZPA 4FMCF 3KJEA 4EP1A 1H8ED 3MK31 2D2XA 2VP2A 3WGTA 3D4NA 5FWYB 1P91A 3NGXA 3RF7A 2VCHA 1K6EA 2FEPA 3QEJA 2WVGA 4RETA 3T1HB 4CEJB 1X14A 3IHTA 3GC6A 3IEXA 3N7UA 1HYEA 1YZHA 4NBKA 1NJFA 3TG8A 4EDHA 2H2HA 3L92A 3UT5A 5KNCA 3QSYA 2FA9A 2HSDA 5EZYF 3ON5A 3P1JA 1N34B 3HGMA 4QVIA 5KOHB 2HPVA 2GAIA 1QFYA 3HYSA 3R0ZA 4V3CA 4C4SA 2P3SA 4GOOD 2C7QA 2ZEJA 3DUFB 5FXMA 2ORED 4DAOA 4RD2A 1P1HA 3MHTA 3MQ2A 1RCTE 3EVNA 1JB1A 4G63A 5B6PA 1B8OA 3TB6A 1XFDA 1DT3A 1T5HX 1VL0A 2QW8A 1HOTA 3F49S 2GD1O 2O2IA 3MILA 3LQ2A 4MA4A 3ZI0A 1Y1SA 2CLDX 4IO1A 4EBBA 2HMWA 4IG9A 2ZE7A 3AJAA 3OBBA 4MPRA 3VU8A 1HI9A 5FORA 5TQ2B 2TECE 3DC7A 4ICIA 2X0FA 5ITZA 2GQ0A 2YHIA 4D9BA 5THXA 3IR7A 2X5OA 4QEDA 2BHSA 3PVCA 2W8BA 3BC1A 2BZGA 1XTIA 4K2AA 2IYAA 5P8WA 1S4QA 3WKDA 2R5WA 4BMPB 1F8UA 2JVJA 4EEZA 4LFCB 1ADFA 3DW1X 3TAXA 1Q11A 2FZEA 6LDHA 1WO8A 2YMMA 3P9RA 3W90A 5J4VA 2ZZNA 2ACWA 2ILVA 3N2GA 3W5BA 4RJTA 1EBUA 3GLUA 4P2GA 4ZQCB 2NP7A 2GPNA 1QP7A 5FBZA 3GDGA 2ZJAA 2HCBA 2X2FA 1PBNA 4PONA 4TL8A 4U6SA 4DDWA 5BMVB 3MT0A 4JQYA 1E1LA 3K6SA 2X3FA 4B4OA 4BTEA 4X8HA 2C2GA 4E5KA 1V5GA 3DL0A 3P96A 5JCJD 4DA8A 4EHDA 3E2IA 221PA 4DQKA 1XXHB 3COWA 4BEJA 4XRGA 3SKYA 1J42A 2XCIA 2XMDA 3AEQB 1IBSA 2P3QA 3JAKA 3LUJA 3HU5A 5B5SA 4IKEA 3HXLA 4GZ3A 1K6JA 4M36A 1EFDN 1Z34A 4JKOA 4A92A 4DNXA 1DIRA 3H9BA 4L5CA 2MR5A 2XX3A 4FDUA 1TEZA 3REGA 2P65A 4QUIA 2H1OA 2Q3FA 3E9RA 3ZDAA 2A9VA 4X44A 3FPEA 5HF8A 2VXYA 4YQFA 4NOLA 3H04A 4IDBA 4QPJC 1JPUA 2VZ0A 1Z5VA 2P2ZA 1YJAA 1PO7A 4BZWA 1HT0A 5KX5F 1ACLA 5TE9A 3ZXXA 5I5EA 1JLHA 4N4AA 4O02B 4OJQA 1UKCA 2G5CA 3D7MA 2ZPTX 1WDTA 3CLUC 3LRTA 1P81A 5BURA 2VDWA 1VL5A 1ZCBA 1CUGA 4QIHA 2ZUCA 1U80A 1SKUA 3H18A 5IVDA 1HV8A 1OREA 1P33A 3CLHA 3PC8C 4FK8A 4MUIA 4KLAA 1F17A 2YRFA 3GGGA 1QFSA 4Y98A 5HP4A 5KNLA 1KI9A 1GXSB 3F67A 3NC4A 1X8XA 3PX2A 3F7TA 4E4TA 4ZQBA 2IITA 4YMGA 3VR4D 1H66A 2VXBA 1UXGA 2ODNA 3SY8A 4NQRA 4FHCA 1GILA 2QL9A 3ZU4A 1MOQA 5FOUA 3OFSA 4L5AA 4O3FA 3GQBA 1BFDA 5F35A 4F60A 2I66A 4R2MA 5AXAA 1XZMA 4HPWA 3JWGA 4PR0A 4DPKA 4YCLA 1Q3HA 2GBLC 1WUIS 3D6TB 4V0SA 3T3DA 3SVLA 3QTTA 3QU2A 3P2OA 5FB3A 2LKDA 1QRAA 4HX2A 2YCBA 4CTKA 1XP8A 4HWGA 2B34A 5IN5A 2ZYVX 4YT2A 2EAUA 1YONA 3THXA 3PI7A 1J0AA 2DPMA 2GKSA 1U2ZA 3BH6A 1TQ4A 3HRIA 3Q9NA 4G97A 5IZCC 4HQFA 3FOCA 3NEJA 4I81A 5CEJA 5IX8A 1CUVA 1VKZA 3MS2A 1FJGB 3LO5A 1VGVA 4C7XA 4BVGA 1WMBA 1W8DA 1LLFA 1S96A 3X2SA 2JKZA 3IX7A 3LP6A 4R8RA 4UBIA 4N03A 3OTWA 4RH0A 1GG8A 2A0YA 1E20A 4UAUA 4GR4A 1NY6A 4N47A 2PANA 2ZJ5A 1I32A 3AVQA 2GRAA 2OQRA 4J2HA 3HDTA 2ZRQA 1HT3A 2VR1A 2CL0X 3L8HA 2OHFA 4E2WA 3DUFA 1LV8A 1SM4A 5I7HA 1CSEE 2VDMB 3WLEA 3NUGA 4R2WA 2BBOA 4D0NA 1O9GA 1REQB 1QLWA 4P84A 4YIHA 4RPIA 1KHTA 2FDXA 2IYPA 4HAYA 4UZEA 2YWCA 2MINA 3IVAA 2HX1A 2YIJA 121PA 2VYVD 3OZWA 3PQ8A 3D2CA 1LPMA 4JENA 4MLPA 4MRSA 1XEFA 3ZD9A 3OC0A 1L0BA 1W4BA 1U7DA 3CX6A 4HGOA 1U0RA 3NIFB 4OBXA 5K6RA 3DO5A 4BAUA 3OTOB 1MD9A 1LW6E 2CKDA 4Y2SA 3CJRA 3G0OA 4EEKA 2C92A 5TMBA 3PA8A 4IHJB 4J90A 4NCJA 3AB3A 2DQ4A 5TQ2A 4E5DA 1Y8AA 5DFAA 1U90A 5E7MA 3TO5A 3HEAA 1ZHFA 3C3KA 2UZ1A 1ZMOA 3TLAA 1T1SA