4C0WA

The crystal strucuture of native ppazor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
200
structure length
200
Chain Sequence
MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-DEPENDENT NADH-AZOREDUCTASE 1
publication title The Crystal Structure of Pseudomonas Putida Azor: The Active Site Revisited.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 68
structure length 200
sequence length 200
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c0wA00
1CZLA 3GFRA 3KEGA 1DXOA 3FVWA 2KQUA 2MWMA 5EA2A 2BZSA 1C7EA 4ICIA 4M0CA 5EAIA 4XDGA 5LJIA 3GFSA 4GR9A 1FLDA 3K1YA 4H2DA 4ZVNA 4BMPB 4H6PA 4LA4A 2BN4A 1XT6A 3TZBA 3OVMA 3G5MA 4C0XA 1RLIA 1V4BA 2MTBA 4F8YA 1BU5A 2QR2A 1ZWLA 1T0IA 2HNAA 4C0WA 1QR2A 4U7HA 1YDGA 2MOKA 3B6JA 3KAQA 3NHSA 3NHUA 3HLYA 5NLLA 1QHEA 2F1OA 1TIKA 4Y7CA 3OX2A 1YRHA 1C7FA 4J8PA 1FUEA 1KBQA 1AKRA 3NHFA 1CZKA 2ARKA 2XOEA 1RCFA 5NULA 4HEQA 2QMZA 4FX2A 2Z98A 2WC1A 2X2OA 5F51A 3NHWA 3U7IA 4ZVMA 2FLVA 2M6SA 6NULA 4YAOA 4GQIA 4FGKA 4S24A 2Z9CA 4FGLA 3L9WA 1H69A 2FOXA 3LCMA 4Y9UA 3UXEA 3U7RA 4N9QA 4QOIA 2D5IA 1J9EA 2W5UA 3P0RA 1AKQA 2GSWA 2QX9A 3O2NA 3UXHA 2Z9DA 5LBTA 4HS4A 2FVXA 3ESXA 1FLAA 4N82A 5ULLA 1AHNA 2V5UA 3OX1A 4LTMA 1DX9A 2ZKIA 2X2PA 4NULA 3QFRA 4N65A 1X77A 2R97A 3F2VA 1F4PA 3NHYA 1GG5A 1SG0A 4DIKA 3EDOA 2HPVA 3W77A 5LJLA 1CZUA 1D03A 5LVAA 4QOFA 1AKWA 1ZWKA 1J8QA 3N39C 1AKVA 2OYSA 3W78A 2QMYA 1E5DA 4QODA 4PU0A 3NLLA 1DXQA 4LAFA 3O73A 2KLBA 3S2YA 1RTTA 4FGJA 1ZX1A 3ESZA 3KAPA 1TLLA 1FTGA 3QE2A 1WSWA 4LTDA 2RG1A 3OWXA 2Q62A 5B3KA 4PTYA 2OHHA 1XI2A 5LLDA 5LMCA 3F6RA 1AZLA 1FX1A 5F12A 4BMOB 1AKUA 1OBOA 4PTZA 3B6MA 3ES9A 3GAMA 3OX3A 1OBVA 1YCHA 2FZ5A 3B6KA 4DILA 5LBUA 1FLVA 3OJXA 5B3LA 3N3AC 1WSBA 4YAWA 3D7NA 1OFVA 1CZNA 2BPOA 2BF4A 4QOHA 3NHKA 3SVLA 2QX4A 3K20A 1FVXA 2FX2A 3N3BC 3R6WA 2Q9UA 2V5VA 3TEMA 3TE7A 4NLLA 5TGZA 4Y9RA 2FCRA 3QFCA 1D4AA 4OXXA 5FA6A 1JA1A 1J9ZA 1VMEA 3W79A 1QRDA 4CF6A 1CZRA 3FNIA 4DY4A 4U7FA 2A5LA 1D04A 3B6IA 4U7GA 1JA0A 5EMNA 2QX6A 3HR4A 4YALA 3ESYA 5A4KA 1XYVA 2B3DA 1FLNA 4QOGA 4XDHA 3GFQA 2BMVA 1T5BA 4YQEA 1BVYF 2FZVA 5FUQA 3OJWA 1AG9A 4C76A 2N1MA 4ZVKA 2FDXA 2MT9A 3NHPA 3ZHOA 5JROA 4YAUA 3EYWA 3F90A 1QBGA 1B1CA 1AMOA 1YCGA 3NFRA 2OHJA 5FX2A 4QOEA 2FAXA 1XYYA 1CZOA 3OWHA 1I1OA 3NHJA 1KBOA 4GI5A 3L9XA 2QX8A 3NHRA 2XODA 3FJOA 3FW1A 2M6RA 1AKTA 4LTNA 1CZHA 1H66A 1YKGA 3FX2A 4QOJA 2QWXA 5F4BA 5BUCA 4CETA 3NHLA 2Z9BA 4YAFA 3F6SA 1YCFA 2AMJA 1SQSA 4ESEA 3HA2A 1YOBA 3JSXA 4C14A 2OHIA 3W7AA 2HNBA 2V9CA 1RLJA 3RPEA 4ZVLA 1J9GA 3LT5A 4D02A 2R96A 4R81A 3KLBA 1NNI1
chains in the Genus database with same CATH superfamily
4YNBA 3NKFA 1EG7A 3LM8A 2GB4A 3E9YA 2Y8EA 1TLTA 3B51X 4BNGA 5HKOA 1J0BA 2FMXA 3B52X 3QU9A 3C48A 1XD2B 4GYJA 2EKLA 1J2TA 1WBBA 5E6UB 4UVIA 3QTTA 2WYIA 3LQFA 4L85A 4RACA 1SKAA 2NO7A 2IXEA 4F5EA 1SCBA 5KMGB 3Q3JB 1QHNA 2G5GX 2XMZA 2Q6OA 1EXWA 3L0YA 1JJFA 3CBQA 4LMAA 3RYIA 5ELLA 3ZNNA 1J6UA 2ZIGA 2WIKA 4BFTA 2VTKA 2ZJOA 4ZOAA 1MC5A 2DTEA 2FLWA 4EYEA 4JP1A 1QPZA 5I8ZA 3BE6A 3MS7A 4G0OA 4EKNB 4KFSA 5EMHA 4UM9B 1ISJA 1NZJA 3LQRA 4QEKA 1FDRA 5IEBA 1LPBB 2P40A 4R7ZA 3QRWA 4Y1GA 2ZXFA 1S4QA 4KRYA 1HDOA 2YN4A 2GCNA 4P5EA 3DQQA 2QTFA 3PT9A 2YS7A 4YBZA 5P21A 3T9CA 5DLPA 3ZI7A 2DJIA 2BN4A 1DLJA 1JQEA 3ADKA 1I4OA 4Y2JA 1A96A 4OQMA 1AO0A 2AE1A 3G13A 5L95A 2OECA 2VHQA 3PQDA 3OPYB 4PWZA 5IW8A 4L4YA 1TCCA 3SNKA 3W8NA 4R9SA 5FJJA 1TW3A 3ZWOA 4BKOA 5A4IS 4O4HF 4YV7A 1JG3A 5J9FA 1XJWA 3ANNA 1CUDA 2P4SA 2NW6A 4HDSB 1Y3HA 4OXQA 1EQAA 1PR1A 3O21A 3PQFA 1WVMA 2F62A 3TTYA 1L8OA 1ZD8A 2ZYAA 1TA9A 3TQRA 1PJLA 2BI4A 3GCDA 4EW3A 1K0UA 4KMMA 4PLHA 4E51A 1JIIA 1QR2A 2HLHA 2ZITA 4C6HA 4F92B 1EDEA 3TTUA 2YV4A 1UPFA 2Q5LA 2WWXA 3FPFA 3G17A 3FD8A 4ZTUB 1S02A 7MDHA 1G8MA 2WSLA 2XTNA 3COVA 2EX4A 3MF4A 4DADA 2O3JA 4UQLA 1YZUA 1HDCA 2JGMA 3HLYA 4O1HA 3WLFA 3ZTTA 5KNCH 2J87A 3UXYA 5K05A 2V4ZA 3UW3A 4MITA 2YJZA 3E22B 3PF8A 5C8YA 4RPCA 8LDHA 1QGAA 4ZCMA 3UJ6A 1U28A 4HGRA 1R9JA 3LHDA 2VBCA 3VO2A 1US8B 2W6PA 3RV3A 3WYDA 4B46A 4CVNA 1CUBA 4JB3A 5C18A 3ETEA 5LZ9A 4DJJA 3ID6C 1QHYA 4OHVA 3WNQA 3O92A 3JD2A 4M89A 2LCQA 1TDJA 2GAJA 4OH7A 5EQFA 3A4TA 2AZMA 2Y0DA 3WV4A 5F73A 3ZLTA 1M1YB 2QGZA 1TMYA 1BA2A 1WW2A 2QDKA 3G5LA 4P22A 3R9WA 1HYEA 3G79A 3M6AA 2BMDA 5G53C 1AURA 2GAIA 3DBIA 3I0ZA 4A73A 2AG8A 2JPDA 2QNRA 3EBLA 2I2XB 3JZAA 3I5XA 3O4HA 4XWKA 5AOAA 1T91A 3JQ9C 2OY0A 4ZTZB 1VIYA 4R71A 1CJUC 4V1CB 4E31A 1IBLB 1WDTA 3CLSD 3FNRA 1CD5A 1MB3A 3DMDA 3BL8A 3ER6A 4MAFA 3EEIA 5JMWA 4KDFA 1BN7A 3DW1X 2VF8A 3AHJA 4RYLA 7YASA 4B35A 3ZE0B 1M74A 3HDGA 3HNRA 1YV9A 5LB4A 4KXNA 5FFNA 1OLUA 2OKGA 4QOIA 4N5IX 5CIWA 3WHPA 2Z1DA 3OTQA 4MQFB 4GZ6A 2J5RA 2CUZA 1CQZA 1GGMA 4QIHA 1N6KA 3X2EA 5F9MA 4YRIA 3HZRA 2BGIA 2FJ0A 3H65A 5JCJD 4MJXA 3H5WA 1NVDA 3AC0A 4BCCA 1MEOA 2C5GA 4HH1A 1PLJA 3AM4A 2DPGA 4BYMA 3LIPA 4H6WA 2NQ8A 4LWZA 1LJLA 2WR8A 4MQBA 3FAZA 2X0IA 2QTCA 2V9PA 3P71T 1WV1A 3CSUA 1QIKA 3K8ZA 3MRTA 4MV8A 1ZC4A 4BNDB 3C6MA 1NFRA 2DG2A 2IXGA 2PS1A 4F60A 1DJNA 4PZYA 3I2JA 3HV2A 1X92A 2WHPB 4GW3A 3D8TA 3STVA 1UJ4A 4RPGA 2CHVA 2ZKIA 1IBSA 5LDGA 3AW8A 4L4RA 5EGSA 3TOCA 4CLOB 3DR3A 3DB1A 3HXMA 2BGLA 3AFOA 5I7FA 3FOBA 1D4ZA 4KLRA 4L50A 4QVGA 1EX9A 2B7CA 2W71A 2XB9A 4KR0A 1KK1A 1ECCA 4EFNA 1XR3A 3ZQUA 4A5OA 3SCZA 4AMUA 2FOIA 5IARA 5D84A 3L5KA 2F9FA 1KI7A 2QUHA 5EYPA 2A1UB 3FLBA 1FMCA 3AUAA 1ISHA 4RESA 3ZH2A 1FMFA 3AUUA 1OTYA 1JBEA 4I4CA 4WXMA 4MA0A 1U0LA 3HJCA 1E6LA 2Y05A 1SD1A 4WFQA 3NNDA 1LPMA 1PL6A 4DMMA 3G1UA 4I46A 3K0FB 3GFFA 1E9CA 1M2NA 1SPBS 2X13A 3D2AA 2GZ3A 4D0LB 3SEFA 2Q07A 1J22A 3JZMA 3A25A 1R4AA 2XYVA 3IVRA 1M5TA 4ZVSA 4Z9FA 1A9XB 2YFQA 3QH4A 4L8VA 5FLEX 1CUYA 1XZIA 4CNQA 2ECKA 4PC1A 2XRZA 1G6HA 2VDQB 3PFFA 3CJTA 3M5DA 3D8BA 2CF5A 4PU0A 2R6HA 3C24A 2N1BA 3CISA 4L6IA 4C43A 2HFKA 4EDHA 4Q47A 5G0TA 2BE9A 3MYYA 1J5XA 5LA6B 3V33A 2P7IA 3COPA 2YZMA 3D02A 4HFRA 4YHHB 4KSBA 2FN4A 3UT5B 3ANMA 3HJFA 3EVBA 5LN1A 1XVAA 4PBTA 5LKAA 3PGJA 3JR3A 3EODA 4R8MA 2PYZA 2P3OA 2UVPA 4BPRA 4Z8YA 2JLXA 3IUSA 1J25A 1JHDA 2C58A 3OWXA 2JVKA 3R0IA 1ODFA 4XYBA 3HKCA 4GZMA 5EE5B 4BNIA 3EZ9A 3IYLW 3WSWA 1AGPA 1QOQB 4PPQA 5IYZF 4B6GA 4EVSA 4D3DA 1PEYA 3AERB 1EI9A 1ZG3A 2WWWA 1UXHA 1EWQA 1XMQB 5EUBA 1N5RA 3FLAA 1XLVA 2R1TB 1XTPA 2ISSD 4OLAA 3GV0A 1KZ1A 1XFDA 4DIMA 1NVFA 4KQHA 4QEDA 5JV5A 3T35A 4EFLA 4OFBA 2IIVA 4X9XA 1P39A 4YXWA 3NRJA 3UHFA 3KYDB 2C9OA 3V97A 4Q9LA 1FNCA 1C4KA 3HXQA 5K3OA 2PH1A 3D6HA 3I58A 4AMZA 2PLNA 1K5HA 4CM8A 2CLMB 1GCGA 2RHWA 5KSWB 4OF4A 4BO7A 4KQ2A 1SQGA 4RTRA 3BK1A 4G85A 2V7PA 4NHOA 1MJHA 1IDOA 2G1KA 3FVTA 4KGDA 4ZCPA 3TSOA 4L2IA 5JBIA 3NDBB 5BWBA 5EESA 3WBBA 3V80A 4D81A 2GXQA 3VZQA 4A26A 1NOKA 1JZSA 2WLSA 5KOHB 3THYA 1ZZGA 2O2GA 3N7TA 1T2DA 3C7TA 2Q3FA 3KU1A 3U7JA 2P8JA 3S8YA 3ZWKA 1OU0A 1FFGA 1KJZA 2IHYA 4WEQA 3UJCA 3WGYA 4BECA 5FEUA 2GEFA 3N3AC 3T7AA 1MG0A 3ECSA 4YMVA 1FRNA 2CXOA 1P4AA 2VHUA 3MERA 2O0HA 2OWDA 1X7WA 3IJRA 4HGOA 2PSDA 5GONF 1S4MA 5I7HA 5ITSA 3PNVA 2E4UA 4HNRA 1F0YA 2IUEA 2QZ9A 1UXIA 1ZBDA 1QHFA 3MGGA 4M1WA 4BX9A 2AHRA 1SWVA 2VH1A 3AY3A 2FMFA 3KSMA 3C3PA 4HI0E 4IF4A 1EFVA 2D06A 1SCKA 2DHEA 2GJ9A 3GFPA 4NMWA 1E5LA 3ROQA 3JQ8A 5I48A 2X0EA 5COBA 1E2IA 1Z15A 1O9GA 2BI7A 2PCJA 1MT3A 3L7BA 4WSOA 2YX1A 5BSRA 3FH0A 5EXTA 4CQMA 4AN4A 1I3CA 1NHGA 1M8JA 2VTVA 3EZFA 4ZVTA 3R9IA 4UM8B 1KEUA 4UHJA 1BQ4A 3FNBA 4P80A 2C5FA 2W98A 5PGMA 1U0HC 1B15A 1G3IA 1VFPA 1BQ3A 2Q6TA 3MWYW 1WTAA 4OHPA 5E9AA 5GZ6A 3CLTD 4NE9A 1M8FA 4FVTA 1YQEA 1SFRA 1OJ7A 2I2BA 1YAJA 2A9OA 1ZJZA 2JFPA 3IJEB 2XHEA 3B7PA 3L7IA 3FPKA 2QUZA 2HXSA 3KL4A 3A4VA 4PM4A 1O7JA 3LNCA 3D3WB 4MPRA 3N87A 4IGIA 3STYA 1J9ZA 3WB2A 1VRCA 2NSDA 2CLLB 3BILA 4JH0A 1A7JA 1E4OA 1KIFA 3R75A 1FXWA 2QG6A 1E69A 1LK0A 4F3KA 2Q9BA 1BH6A 4HDNA 2JVIA 2Z8ZA 2ADMA 2WKQA 3CU5A 1TUGA 1KZYC 3HDHA 2O19A 4L75A 4MW4A 3SLGA 1SXJB 2XLBA 4R83A 2XZPA 3IMCA 3SG0A 3DTYA 3IGFA 1HYGA 1KO4A 1Z62A 2EG5A 3PUXA 1IBRA 2P9HA 4MB2A 5AW0A 1JTVA 3A8TA 3P1JA 1SU4A 1EX7A 5AVWA 5TF0A 4QYTA 2VQEB 2JAOA 4U7GA 3KRTA 2CJWA 2HPZA 3ND5A 2JBWA 1SXQA 1DWOA 9ABPA 3I2GA 1Q83A 2JC3A 3RS2A 1TOAA 2I4MA 3BD7A 3F3YA 3MMPA 1PG5A 2P78A 1Y1LA 3D3NA 3BMCB 4Q7EA 4TT8A 3RKRA 3WAJA 2FEMA 2YWEA 1Q95A 1BHSA 4LDQA 5GOZA 3O4IA 1ELOA 1ENYA 2DPHA 3O90A 5TE9A 2ZI6A 4BZQA 1NUQA 5IWAB 1MW9X 3PRJA 2R4UA 1PT6A 5CB8A 4D97A 3T61A 1AE1A 1WAMA 4EUKA 3UAOA 1U9CA 1OOEA 3D6MA 5FULA 4L15A 3KSDO 1BVRA 3WZMA 1SUDA 2X0KA 1QO7A 1U4NA 2PL5A 1GNQA 3G8AA 1TM2A 5AXDA 5KTSA 1FTWA 3G0HA 4D0NA 5JO0A 3QEKA 4D4LA 2QHXA 3CX3A 3A31A 5DDIP 2IJGX 3VR4A 1YK1A 1XLTA 1OXXK 1GXSB 1U7PA 4MW7A 4S0ZA 4CDMA 3WIUA 4OP3A 1N77A 9MHTA 3A1FA 1IEXA 2CHQA 3PYLA 2EQ5A 5T6MA 5KC9A 4KWEA 2ZS9A 1G55A 1SQFA 1WEKA 4XH9B 4PCLA 1WB6A 2E55A 3HA5A 1ZNZA 2P67A 3FKSA 3TVDA 2VHYA 4WCFB 2XNHA 3AI3A 1K97A 1OZHA 4WBNF 5FI5A 1OAAA 3BK2A 5I7AA 4LMBA 5AD1A 1ZVQA 2B5WA 5ALEA 2I6UA 1GLGA 1XJCA 4O2AB 3GNSA 2WTMA 1Z17A 4ZEOA 5DIFA 5HRUA 1RMYA 4FXOA 1CETA 1QUEA 1U4OA 1TUBA 4QOEA 4HEJA 4ZAFA 2E87A 1W0KA 3UJAA 2R7LA 3GBPA 3T1VA 1S1CA 1JEEA 4IS2A 1IIBA 3DZ8A 2Q5JA 3Q2KA 3SIPA 2VS1A 1R16A 4AC9A 3ZU3A 3NHJA 1YQDA 3OZTA 4PC7A 3AETA 1JXMA 3T1TA 1Z5VA 4OSOA 4D82A 3VHQA 3ZCTA 4K8RB 3P9QA 1FNDA 4EO4A 3PXAA 1OI4A 1VE6A 1K9VF 2RGBA 3IDFA 4JLWA 5KDLA 3L8DA 3ZHUA 4M1YA 2CVHA 3QE4A 3DVAA 3A3OA 3JATA 3FZQA 1GRQA 3EVEA 4FZRA 4NZMA 1X14A 3F47A 3MW8A 2A5FA 4LTNA 4ZZ2A 2DWQA 1ML4A 2Q1TA 1P3Y1 4QNNA 4UARA 1TZMA 1NUPA 4D0GA 2P62A 2XDQA 1TYDE 3JR7A 2HSEA 1IN5A 1NXQA 1E1CB 2C95A 1BH2A 1JHZA 3QKIA 4UMFA 5FNVA 4ZEMA 3IMFA 2M1XA 2OAQ1 4YUVA 1DO2A 3KTAB 3R2JA 3RBVA 5MFPA 2AN9A 1GAXA 3RROA 1D2NA 2QWXA 5F4BA 5LXTF 1QO9A 1Q0QA 3EISA 3LJKA 3F6CA 4GRAA 4KIWA 4QSHA 3UMRA 2NU8B 1UWLA 1WCV1 1GSHA 1HF3A 1RWBA 2I4TA 1LBSA 3QVTA 4RY9A 3C4VA 4WQMA 3UYLA 4BATA 1BU8A 1UUFA 3ZY4A 5DM70 3OPNA 4HZUB 2XYGA 4PFQA 2R6GA 4DAOA 1CBUA 1J8MF 4X1IB 4Y0VA 3LYAA 1E6MA 3MUOA 1EDDA 2O20A 1FW6A 2LCIA 1A5AB 1Z36A 1Z73A 1SGWA 1VLVA 3L7DA 3N86A 1R0BA 2OO3A 1V6SA 5IRCD 3JVVA 3WZ2A 3EGOA 1QHXA 1ZIXA 3W9SA 4BU0A 3FCEA 4U4AA 3TJZA 2YMLA 4NFYA 4PZDA 1YAHA 3A7DA 5KNDH 4QUKA 4NMXB 4LJ8A 3AP2A 2PL3A 2YN2A 3VGJA 1JIXA 1BE8A 5LDHA 3L02A 3LUFA 1F9AA 4BEVA 1Z4JA 1Y3BE 2ZRDA 4ECAA 3D8NA 3VHXB 1C3XA 4ENPA 1UJNA 4X85A 4ZJPA 1CZLA 3BN3A 4L4XA 2PKQP 2G71A 3QJGA 2EFCB 4J1TC 2EQAA 5H68A 1YGYA 2AMLA 4Q4JB 2F00A 2QPOA 4H59A 3SJBA 4GPD1 4F4DA 4TROA 2IYPA 4UHEA 1R64A 3IVAA 1ODTC 1VL6A 2X1LA 2DBQA 1J39A 2QT9A 2GCGA 5LMZA 3GUZA 1L7AA 2DTXA 4FHCA 1IQ0A 1RP7A 2MWMA 4G89A 3U7HB 3R23A 5BVGA 4MCAA 4DBVO 1TTPB 2D1FA 2G0AA 5L4NA 3VVLA 1G38A 1N36B 2IL1A 4M0CA 4TM7A 1IVSA 3AINA 1NN0A 2F1IA 3NOVA 4RA6B 2GHIA 2Z8XA 3SI7A 5IUNC 5CA1A 4MI1A 2VHWA 1ZO8A 3EHDA 1MPXA 3HYRA 5C1BA 1N6LA 2JIDA 1XGKA 3EULA 1V8DA 2D1QA 1CUEA 2FJPA 4XGNA 1MB0A 4CMAA 5TPZD 4EEXA 2OZLA 4DQDA 3HJHA 1NATA 1A76A 2HCRA 1PQUA 1QFXA 3K8OE 2I55A 1GPH1 1OW3B 2VWQA 4TTSA 4UHFA 3UG7A 3T1YB 5AVSA 4LVCA 3CM0A 1GZ7A 1UEIA 4BFVA 3CZPA 4MQ4A 4EEKA 2ZANA 3ANSA 3WGNA 1GFWA 3MCVA 4M9SA 5LUBA 3IR7A 1Q0LA 1N2ZA 4PZPA 3GU3A 4PW0A 2OB2A 4ZHSA 3P2MA 1PZMA 1JR2A 2FW0A 2C4TA 2FFJA 3L84A 1BEZA 3OVMA 4XSGA 3E9DA 2DBYA 1C14A 3PHLA 1GPDG 3SX2A 5LQJA 5B2EA 3U48A 3DS8A 4FZ3A 2BFNA 5DWQA 5K8CA 1XZJA 5DN6A 3KEFA 4MWEA 2KBFA 4QLAA 3LRXA 1M6EX 2OD7A 1ZISA 4AZ3B 1CU1A 2BYTA 3ZD7A 3GRYA 2G4CA 1E1QA 3OE7D 1A9YA 4MP3A 4CIDA 4UTXA 3N75A 1EP2B 1KQPA 1NY5A 3V32A 1G20B 4F4HA 4JL6A 1G2OA 4U7HA 5E9QA 3ZHYA 4C89A 1OVMA 1IPHA 1ABEA 1DQRA 1SM4A 2LDBA 2Q0SA 3OFSA 2XI4A 2X2FA 2VSQA 1GD1O 2AMYA 3BGDA 4GZ3A 3RLIA 5ADHA 2VPQA 2NZ2A 2ZTSA 2WP8J 5KTTA 3KAQA 4OHXA 1MO3A 1Y1SA 3QVXA 4ZAYA 1DRUA 1IZYA 2WD8A 2NUPB 2ZS8A 3DVQX 3QOYA 1CP3A 4RVFA 5AKEA 5FYQA 4ND6A 3BULA 1DEAA 3O1HB 2QUIA 3GVCA 5IK2A 4Y7CA 2J0UB 1UXGA 4HJXA 2VDMB 3HR7A 3R0JA 1LPPA 1KYWA 1O6FA 3Q40A 1P4HA 4HGYA 4RPKA 5DOVA 5GWXA 2PX8A 4CMIA 4JEUA 3INTA 3R09A 5FH9A 1IEWA 1K63A 5HHTA 2AN5A 1J99A 3GL9A 4S35A 3DKRA 4LN1A 3G0IA 1YONA 2YS6A 1XRPA 3LUJA 3M8KA 5DCWA 3G3EA 1KPGA 4PPYA 4TTVA 4I8DA 4V0SA 1M66A 2D4HA 3EIFA 4CXMA 3O8NA 3NC1C 4UEWA 3MTEA 4JJ7A 2C7VA 1BCRA 4IKEA 1I0LA 1CEQA 3S27A 5KKNB 1WCWA 4JDPA 2AW5A 2EP7A 1FX0A 2PT7A 4C0AC 3WICA 5KDDA 1Y8QA 4DR1B 2O54A 2WC1A 2JFZA 5AIAA 4BMSA 4QXMA 1H2EA 4JMPA 3M6MD 5JZVA 1LA2A 4Y0NA 4ALJA 2ZYVX 3NTLA 2FLVA 2AB0A 2RJOA 4IIJB 4P4NA 2WSIA 3U7QA 5ES4B 4TQAA 3IUJA 2R84A 1UM9A 4GQIA 2J31A 1GL3A 5AOCA 3T8YA 4DAEA 4FGLA 3SE0A 4RMJA 1G7SA 2DERA 2A58A 3ZHBA 5B1YA 4R2HA 2QY6A 1ESDA 2R25B 4GU5A 4FMDF 4TVKA 4PG5A 2HMTA 3QA3E 4WZBA 3VVMA 4EYGA 2P9FA 2YIJA 2O8BB 1BWSA 2JKZA 2JIOA 5K0SA 3WBFA 3DKIA 3ZDQA 2GYVA 2GFHA 2P2GA 4M1KA 1C50A 1CRPA 3NPAA 3L7YA 4NV3A 2NO5A 4P31A 3BB4A 2R79A 5B4TA 4TYNA 1KETA 4JR2A 1LS1A 1C30B 2CVOA 3DXXA 3LT0A 3O2NA 3QXGA 1XMOB 3DDHA 4FD3A 3WLTA 1G5PA 1EXDA 1V16B 3OQPA 5CFMA 1CUVA 2XNDD 4D9FA 5HIKA 3K0KA 5H59A 5JISA 1SO8A 1FU7A 4DCPA 1SRQA 4N82A 2EW1A 4IHQA 2JH3A 1WHTA 2PX2A 4TM8A 3SJUA 2X19A 1F6WA 1IRIA 1VSTA 1KI4A 4G5YA 3WV5A 4NJOA 2V6BA 3VR2D 1L7VC 2ZT8A 4A6EA 3N2ZB 1IIRA 3HM2A 3TBKA 4PX9A 4IMJB 4E2ZA 4C0HA 4K9RA 3V8PA 3LYUA 3BRCA 3ZWWA 1L4KA 1VLLA 1I8TA 1LRLA 1J90A 2VOJA 4OEHA 4UHKA 3RYFA 2HQOA 3P9KA 3G5UA 3LUDA 4F84A 2Z5VA 3DFMA 3VYUB 3ZQJA 2XB4A 4NCNA 3DDSA 2FPOA 5EJ9A 2BMFA 1MG5A 1SG6A 2FMIA 3AKDA 4R7TA 5I9SA 2IS6A 3EDOA 3M0EA 4M9QA 1JR3E 4ML3A 4Q4HB 4P35A 2ZIEA 3OZUA 2NSLA 4HXEB 5JNRA 3MMNA 3RRXA 4Y7DA 5K4GA 1DGQA 3K9LA 1EUDB 2Z2JA 4PZ9A 3W8DA 4B79A 5LVAA 1CQJB 1U7OA 4OMDA 3OM9A 3ZDYB 3SM3A 4EHAA 3H5NA 3G6KA 4HZIA 1EK2A 5FQNA 3WO0A 4YUXA 3N8NA 3ANTA 2AZTA 2EARA 2GUWA 4XPIB 1TKAA 2VAWA 2XPCA 1H3EA 3O73A 5EJFA 1DADA 4J0IA 2H7YA 2VJKA 4MQEA 5FL7A 1LDYA 2AMFA 4G65A 1JDBC 4YVFA 3K2QA 3A2MA 3HI6A 2ONKA 1JGTA 1RQ7A 1M72A 4A6DA 4W5NA 4RSGA 1PK7A 1P77A 1TLLA 1V8BA 4JJAA 3GEBA 4JEHA 2BKAA 2CMDA 2VA9A 3QE2A 4WH0A 3DOUA 4ZV7A 4FOOA 4XUGB 3ZEIA 4JQCA 3UFXB 2UYHA 2W70A 4DQLA 2VUHB 2Q6LA 4EHDA 3OJOA 2FXVA 4NRDA 5GVSA 1SQ0A 2OHVA 4IG4A 5CYOA 3KHTA 3JYLA 3PNLA 4J0HA 1KIMA 4PEVA 5IBPA 2OHHA 4OQQA 5E7MA 3IV9A 1U3TA 221PA 3OZSA 1LWOA 4BLTA 2ZAYA 3Q0IA 1Y1RA 4LOKA 1RBMA 1VL8A 4HMOA 2D1RA 2QZZA 3ZK9A 4PPNA 1MB9A 1KPHA 3OEYA 3NV9A 1MA3A 5L6MB 4BFUA 2SCUA 4YJFB 5B7QA 2WD9A 2IPOA 4DJTA 2H4FA 2XDAA 5DTJA 3BD8A 3GQBB 3QOFA 4DCMA 4NG5A 4QM6A 2MR6A 2HIGA 2QP3A 1YJAA 1EWKA 3LC0A 4HWTA 3CVUA 4BV3A 3ZWVA 3KC2A 2I8CA 5FI1B 3JYQA 4P4SB 4Y1FA 1WVIA 1KO8A 4NV0A 1P7YA 2LVBA 2H2FA 5H3CA 4GI3A 1KORA 3LPAA 1U9IC 4ND3A 3P96A 1OE0A 3MJSA 1ZA2A 2EJVA 3FMPB 3R7WB 2PZJA 4US1R 2NP7A 1GNSA 1UT6A 3ICVA 1XLWA 3IOCA 3NONA 1VMKA 4KXXA 5LKRA 4RPLA 3T7RA 1EUYA 3V3KA 3O26A 2PMBA 3CG4A 4HG2A 3SF0A 1PUIA 5KQRA 2GYUA 2XTZA 1GN9A 5E1DA 2ZB3A 3QFSA 2HU8A 4QFMA 1YR3A 5F7ZA 5B3LA 5E6SB 1B0ZA 1UQUA 2CN1A 3H4VA 1WM1A 4FFBB 5KNCA 1W4BA 2XGMA 3RYFB 2R4QA 5HA5A 1K75A 1LFDB 3SC4A 3CB2A 1T5TA 3BH0A 4FSXA 5HIIA 4PHTA 4INPA 4MUIA 4DA9A 4GVXA 2OPBA 5A0TA 2WTUA 1KK2A 2DP4E 1W49A 2OENG 2IV2X 1SXHA 2JGRA 3NHKA 2X0DA 3U17A 1I30A 2QN3A 3FDZB 5K0GA 2P41A 1ILWA 2HQSA 3IJ5A 1MQ8B 2OCLA 2NUAB 5H70A 4L22A 3MQ4A 4WK6A 4N8DA 1XDWA 3LK7A 4YMSA 1P2TA 2PK3A 2PSSA 3H2KA 4ZC1A 4U0JA 2XGJA 2Y1FA 2KMLA 2VNIA 1FQOA 1CEYA 3GLFA 3FMOB 3VU9A 4IQGA 1SZCA 1I01A 1TAHA 1SCAA 4RJIA 2FCRA 5L40A 3N2KA 4X91A 2EJCA 3HJRA 1L7OA 1V9LA 3I1JA 1ZR4A 5ALZA 3P9NA 2ZJ8A 2J9XB 1GCOA 2KM1A 3AUTA 3HXKA 4KO2S 5TT0A 1B0AA 4EG5A 3PZRA 4KP7A 3MGKA 4OXXA 2OYRA 3U49A 4NEQA 5IAOA 4OSEA 2H5LA 5HFNA 1IAVA 2WA2A 5BT9A 3TB4A 3K05A 3JVEA 2X7HA 4YB8A 3W79A 3NVAA 3L7JA 5BW8A 1K7SN 2WIBA 3AI1A 4MQ6A 3G8BA 3VC7A 1JHQA 4H17A 4G5HA 4O4IF 4Q7KA 4QSMA 3PC7A 4OAQA 2D4AA 2B21A 2GZ1A 1Z82A 2I91A 4M83A 1ZH4A 1RKVA 1SELA 2BE7A 3OT1A 4JC4A 4LYYA 4XARA 5EWMB 4BO3A 2G5PA 4BE4A 4MA5A 4EG7A 2BJWA 2XCSB 4H7KA 5JFGA 2W6ID 4RZUA 2J6IA 1T29A 3UZUA 3QLJA 1AF7A 2LD4A 3W5BA 1A2BA 3B1YA 2Q99A 3DE7X 2CYBA 3M1YA 4J94A 2EJTA 1F0PA 3G2KA 2HQBA 2RGNA 4RVOA 2JGNA 1Z18A 4OGFA 1P8AA 5ADWA 1Z4KA 2WFMA 1JI0A 1JL3A 1PGJA 2XCUA 5BPHA 4D6XA 1NDUA 2VJNA 4EA7A 1N75A 2ZJ3A 3Q85A 1YFLA 3KVYA 5GIOE 1NX6A 2YNMC 1AUOA 3G88A 4NOKA 3E18A 3NAZA 1Z7WA 2XWPA 3Q7EA 4KIJA 4YP5A 4F2WA 4E70A 4M49A 4O4LB 3QEJA 3KKLA 3KHSA 4IRUB 1J2EA 1HDGO 4J76A 5CCDA 2VCEA 4CCAA 4LDRA 2PX4A 3EX7C 2VTEA 4DV5B 1TJNA 5HGJA 1UXKA 1B76A 1Y34E 1KC3A 1JR3A 2J9YB 2N1MA 4GHWA 1UOPA 2XMQA 2AG5A 4FYWA 4TTPA 3MG9A 3ZOKA 2PGIA 4OBWA 4LXTA 1E8NA 2FPPA 3B3AA 2V7QD 1WABA 1KL7A 1MXHA 4HDMA 2BSAA 4N0PA 1A3CA 1K98A 4QELA 2ZE7A 4IZOA 1JSLA 1I0ZA 1YI1A 1FRQA 4QDZA 2ZVQX 4IL5A 1EP3B 1VB3A 1YMUA 2FPKA 3L8YA 5KVVA 4K8OA 3L0DA 1ISPA 1W5FA 1LS6A 1VMIA 1GL7A 2EDCA 2JFXA 3G0GA 3N2GA 1FSGA 2F3QA 2ZM6B 1TL7C 4ZVVA 4YY3B 1KP3A 2JEZA 3NG1A 2IS1A 1QPGA 1H0RA 1DS6A 1PR6A 2WIFA 3F5SA 5BWMA 4JUBA 1M1XB 4Y2SA 5AKJA 1CQIB 3H84A 2IOQA 5J2TA 1KRWA 5J1SB 4QGHA 1YFJA 1CHDA 3THXB 3H9QA 1PJ3A 4AN1A 3WOVA 3QTLA 1XU4A 4HDKA 5FA5A 2V6GA 1ORHA 1XXHE 2B8NA 3LWDA 4FN4A 4BRWA 4M8NE 1ZRNA 4P8RA 3UCXA 1QH1B 1NBMA 2PSJA 2XEXA 3EA0A 3QF7A 1QONA 2WKSA 2WWRA 4OBEA 3K7EA 1O5IA 3HB9A 4R1OA 3TX2A 2HSJA 4CF4A 1NUUA 4YA6A 2O2JA 4H9GA 4K3UA 3ZUGA 3CNEA 3NGLA 1JECA 4OHUA 3T6KA 2OSBA 4HDRA 1S2NA 3KE8A 3ENZA 3U9LA 5JE8A 4BLPA 2PXCA 1NQAO 4RZ2A 4DR6B 2O0LA 3EGDA 2DBVO 2ZDHA 5A06A 4YUYA 1FMTA 1I7NA 4D8UA 3CVVA 1NC1A 2FNAA 3EGEA 2IF0A 3KQSA 4KMOA 4QHSA 4V0RA 3TIVA 1FW8A 4RS4A 1GYPA 3FFXA 1F0KA 4OUKX 2E4VA 3H3FA 3QK7A 3CH4B 4OYHA 1EZZA 3S28A 1NURA 1MIOB 3AYZB 3IOMA 4F5WA 1V25A 4MCIA 4E22A 4B7XA 2PFKA 4KBFA 5FB3A 2VF7A 1C7RA 3HCRA 4CKBA 4ESEA 2Q4TA 2WUFA 3HA2A 2Y1CA 2ZE8A 2DH6A 3EGWA 3UJ9A 1F8YA 1LSUA 2QTVA 4HF7A 4UE6A 2PXXA 2ENWA 3ETNA 2P8SA 3JQGB 5HQ3B 5IH7A 3PPVA 3BGVA 2BGUA 5KSYA 1RJGA 4DARA 3CLKA 4EQ6A 1I1HA 2TMDA 2JI9A 2Z43A 3Q12A 2ES4A 4DCCA 3JZFA 3U19A 3K9FC 4M53A 2H3HA 3WYBA 4UCWA 1GOTA 4FI3F 4ZOEA 5D6OA 1HMYA 1Z7EA 3C39A 4Q66C 3DO6A 4Z9YA 2B25A 2RMKA 4RKQA 4YAGA 1AV7A 5EJEA 1Y7IA 1VQ1A 1XTBA 2E21A 3AOEA 1ZK2A 4QREA 1QWSA 4R1TA 4TLEA 5DASA 4CM7A 2F1KA 2P11A 2XOXA 3VAYA 3RYTC 4R9NA 1NW6A 2F2TA 2GZMA 2WWGA 3C7CB 1X0VA 1CE8B 5AO9A 4AFNA 3BE5A 4TWAA 1BEEA 2A30A 4I9NA 1AXRA 1YZGA 4N5HX 2YIVX 1N9ZA 1R6UA 1MO6A 1U8FO 2RJNA 4LJSA 4JV5B 3R3XA 2E0IA 1Y63A 4LI0A 4EB6B 1NGSA 4PZEA 1U7XA 1V1MB 4L4ZA 3AV0B 3A1CA 3ZJYA 1KQGA 3JQ7A 5LJIA 3TGPA 3OOJA 5FR1A 4X3PA 2JJ2D 2O3UA 2PGDA 3K09C 1E4EA 4MR7B 3A9VA 4PLTA 3ZK8A 4E14A 4E6EA 2F3SA 2DHDA 1W36D 4WKNA 5J2TF 5K3FA 4UMVA 2J45A 5EUCA 2CNOA 3FHOA 5LFAA 2IUYA 1MEJA 2XB6A 5F5XA 2BD0A 2Y1KA 3H5AA 5JS6A 1W36C 2F64A 4LJLA 3HJUA 2CLOB 3AM3A 2DF8A 1EQUA 2FHSA 5DGXA 3SQOA 3UHPA 4BBJA 4D79A 2IUSA 2PCLA 2B5VA 3I5AA 1A4XA 1L5RA 1QYVA 2H65A 3B6ZA 2ACKA 3TIGA 1RPAA 1CF2O 1FYDA 2W58A 2C5SA 2ZVPX 1EE9A 4BJ3A 4PPGA 3LGAA 4UKDA 1KJ8A 1OH7A 5A6SA 2G67A 2IYUA 1F8FA 5CNIA 3MRXA 1KMCA 4B6RA 1QG0A 4D3ZA 1MN6A 4RUKA 4HPXB 1OSNA 4CRWB 1GZVA 1V4BA 4HAXA 2O23A 1RYEA 1Z2OX 1ZWLA 4GQBA 4DVJA 4ZPXA 3WWEA 4H08A 4BKPA 2UUBB 2VF2A 3LCRA 4C0WA 4R2IA 5EJ4A 5F5LA 2J4CA 1L1RA 4PYLA 3RIEA 5D00A 1UAAA 2GLUA 3CX4A 3LXUX 3O4RA 5DXFA 4RD4A 3TKYA 2PUHA 4CYMA 5KYNA 4UTNA 3WBKA 3ADBA 2OAGA 1GM5A 4ND8B 4WMLA 3H1TA 4JI7B 4FS8A 4QX6A 3UEOA 1NZFA 2F17A 4O25A 5IJ0A 4ZDWA 1S7GA 1YRYE 4ZRDA 2FRDC 2QJFA 1L5HA 4GC5A 4IFBA 3SDBA 4Y2PA 2IZ0A 5A7GA 4KQXA 2IW3A 3G0DA 3MWDA 5AUQA 2VJBA 4XM0A 5TMBA 3TZKA 2FFQA 4R9RA 3WGHA 4P53A 2QK4A 2EBWA 2ZRGA 1RWVA 2QD2A 4LNHA 3WRXC 4G97A 3S1AA 1YQ9A 3RNOA 1DTSA 1X7GA 3HY6A 4MMXB 3UCFA 2ORIA 2OZEA 5F7XA 4URWR 4BNFA 2FSSA 2A4MA 2Q27A 3JYHA 2ANCA 2IZ6A 5L3RA 4AG3A 4HGZA 1O6BA 4JI8B 5B1SA 4W99A 3D54D 2LGJA 1ZGBA 3JZIA 2R5NA 4EJ6A 1YQXA 2CMKA 9GPBA 2X2OA 3HJAA 5HCNA 4HLUC 1FJ2A 4IJVA 4U7TB 5G4KB 1E0KA 1EVJA 3LH5A 4IHJF 4KBYA 6NULA 4PZZA 3F7TA 4HFJA 4ZVQA 8ABPA 4QARA 4G1EB 3DTTA 4F6RA 3JAWB 1HLPA 1KFKB 2WEKA 3M33A 5I9TA 4RU1A 4TN5A 4B3TB 1QIMA 1YDFA 4GM1A 2D59A 3REFA 4BQRA 3JVDA 1U9JA 1ZOSA 4B84A 5ENZA 2A0KA 2GN6A 1SIBE 1LBHA 3PQCA 5HF6A 2XT6A 1JFRA 1N5MA 3WAGA 3FMIA 4GUAA 4ZVPA 4MW1A 5KINB 2SHKA 2OBBA 3C8UA 3FTEA 3OTWA 4LE0A 4IFEA 4MJLA 1AY0A 1M2HA 4TL6A 3DBRA 2Q3EA 2C3MA 2ZSHA 4L0DA 5TGTA 1K8XB 3I9V6 2GMWA 2ALJA 2VQ6A 3LGXA 3OTIA 1EE2A 4WKGA 3U81A 2AGVA 2UYYA 4JLUA 2I34A 4P4GA 3BCHA 4YP0A 4YXWD 1JQ5A 1UMDA 2RH4A 2X4LA 2XUPA 4ZZIA 2Q3MA 5BQXA 2JDID 4EI7A 2DWUA 3FOWA 3QQ5A 1MTOA 3R6DA 4QPDA 1SKYE 5EPUA 3TN7A 1X1EA 3TOVA 5KTPA 1P62B 3UPUA 5FHRA 3BCRA 2V7WA 3LOUA 1HZZC 1XWWA 4LDZA 4UUMA 1WCIA 2Z6VA 1HOTA 1MVOA 1N2OA 1RI3A 3OLZA 3JARA 2JL1A 3QELA 4DRZA 5ITZA 4H60A 1T0UA 3JQAA 3U4MA 4DMFA 1MENA 3MUEA 4JBHA 1RI1A 4LTMA 4E3WA 5AW3A 4TKVA 5BYKA 4K05A 2G9QA 2IZZA 3AOGA 3GJQA 4TMVA 4NCIA 3BYZA 3LRPA 1SAYA 2XSZA 2ZTUA 3DOEA 3GGOA 4NJEB 2NTVA 1GPYA 3KV3O 3KXIA 1FFHA 3Q0EA 4OHWA 1XMVA 5I7RA 3QX3A 3I30X 3LBYA 2OVFA 3O1IC 4PSDA 4HAWA 4GMKA 3HMQA 4JELA 1BO6A 4MXDA 3LKBA 2HJ9A 2Z0MA 1P73A 4FYMA 5ESRA 4ZJZA 4DLSA 5FTWA 4D1YA 4DIKA 2WG2A 4HO1X 2B94A 4LQ4A 2HPVA 1USGA 3D7RA 4I9HA 5KYXB 4PO1A 4ZYVA 3F5QA 5IPFA 2R6DA 3MM4A 4XXHA 3G1TA 3EOBI 3I04A 3AM5A 1OWMA 2JLSA 1YRWA 1JJBA 1N2CA 5CPBA 5DMHA 5T3UA 1T0PA 1TTQB 3H8VA 2C4KA 4AJNA 2C99A 4K6GA 4CQMD 4FNGA 3U56A 2AZXA 3AH8A 5JQGB 2AKEA 2IEBA 3E9RA 3M2PA 1UK7A 4HAOA 1EX1A 4MMZB 1WXWA 1CIJA 2AYYA 4W8HA 1T9GS 3H7IA 3LXRA 4JODA 1C9MA 1HQDA 2HH9A 3EPRA 1N3BA 5DXAA 4B87A 4S1VA 3S2YA 3BXOA 4I14A 4QPNA 1BMFD 2L69A 2QRZA 1EWYA 1ZK1A 2DFLA 2V03A 2Y1DA 3DGEC 2BY4A 5TT1A 4B40A 4XM2A 5CURA 4F4UA 8ADHA 2GPAA 1NQVA 1ZK3A 2W4MA 5KPJA 2R7KA 1Z8DA 1JG1A 1RZ3A 4XWWA 2JHAA 3FSEA 5KWJA 4XQCA 1J8VA 2VP5A 5LOVF 3KFXA 3FYUA 1SB9A 1XZDA 1WBJB 4JT8A 3O3OB 3TOZA 1IL0A 1NNEA 2CCKA 5K0EA 4Z86A 3TS1A 1CFJA 1R9GA 1KQOA 2VXCA 1I10A 2MSNA 3OP1A 1U99A 4KFTA 4PTYA 5G0UA 3I09A 1CV2A 4D4JA 1PW5A 4NK4A 4RGQA 2JLYA 3QENA 1QHHB 4L6AA 1UOEA 4BAZA 1T36B 2RARA 4FEEA 1RZVA 1Z4PX 3AJEA 5BO5A 3EXIB 1SU7A 2FPLA 2JFGA 1MX1A 2OD9A 1BDJA 2HRCA 3G9XA 3UGJA 1AZLA 1MGPA 4Q0MA 5I5EA 5K8UA 1PNRA 1U7WA 4FNAA 3HDJA 3PWKA 3OZAA 1Z8HA 4N54A 2WT9A 3AONB 1MU0A 1N6IA 4P2BA 1FFAA 5JXIA 4CEJA 3NC4A 1I3NA 2M1ZA 3IHKA 4G09A 3OZFA 3IMKA 5C4IA 5J4HA 1ZL0A 5AW7A 3NUZA 3VR3D 1G5QA 4RKFA 1FDWA 4XR4A 4ZT6A 4AZ0B 1Q1GA 1NJ5A 4DDTA 4OQNA 2NGRA 2QMOA 4ALNA 4ER6A 4POOA 1PFVA 4DW8A 3BERA 3CUTA 3UM9A 1J1UA 1FFCA 3T12A 1A69A 2NUAA 2O8FB 1V48A 2FKNA 1KDRA 5I7OA 3RJ5A 2X8WA 1ICIA 2INGX 3AW9A 4OTZA 1XDSA 4DQKA 5HIAA 4RTNA 1NI4B 1WR8A 4ZKDA 3T99A 1XKXA 1RKQA 3FFBA 2Z4SA 2VT6A 1E99A 4RHEA 5JZMA 1X80B 1RNLA 2DLNA 1UXOA 3LHSA 5I7VA 2X76A 3HJNA 1SVNA 1QQ7A 2B8TA 2QD5A 3GZNB 3PSHA 4KREA 4X8MA 1OY1A 3JQCA 4KCGA 4CKXA 3HL4A 3FKSD 5U9CA 3DKPA 3GG9A 1GTRA 2V0GA 3OF2A 1P6UA 2DPXA 1UBKS 1CS0B 2E2WA 4EELA 2BTQA 2UXCB 3NTUA 2UVQA 1W2GA 1H0SA 3KJZA 1BWQA 1TZCA 1L5GB 4ENVA 4ARCA 3DEYX 1CUWA 1Z0KA 3WOHA 2X15A 3AO0B 3U9SA 5BORA 1DC4A 2XRFA 1ESNA 4BWGA 1UKVY 3JYPA 1LDGA 1RXYA 3WKCA 1KY5A 1O03A 4U7PB 3R6WA 2ASEA 2QJTA 3CO5A 1W0KD 2Q0XA 3JTMA 4QJ5A 1LF0A 4BKRA 1OX4A 3ONEA 5AICA 4Y9RA 2RK3A 1U4SA 4P3NA 4ZQHA 2XT9A 4BO2A 1DKQA 1PZFA 1UAYA 2ZU0C 3CLVA 3H75A 1L7RA 4LBVA 1GL6A 4TS1A 2YVQA 4LPSA 3TBFA 2BH2A 1K7EB 3E0XA 1ACJA 2FZ4A 4G0MA 4HDAA 1P31A 1EAMA 1RYMA 4MA4A 5EQDA 3DYVA 4RHYA 4U39A 2CZQA 1JU9A 4DLUA 4RETA 5DM60 3JASA 3PG5A 1ADCA 1XEXB 3F74A 3MELA 1AHPA 5FBLB 5KYWA 1SCUA 3NANA 3KR2A 3PC2A 2OCKA 1KDYA 3R9KA 3U3OA 3AVYA 2FETA 1NR1A 2EFDB 5BOSA 4JQSA 5FKJA 3SKYA 1MAAA 1VKNA 1ZOOA 2PR7A 1KHHA 3SR3A 5B12A 3RV4A 2VHZA 3ITNA 4KACA 1QCZA 4M88A 2NU6A 3NBXX 2CMGA 4NCAA 4U7FA 1CEEA 4D6PA 3MBIA 3M9WA 2WPNA 1M6HA 2X0JA 5K3BA 4CMBA 2HHJA 5JCPA 1DT5A 3MGCA 1DRWA 4KYTA 2V8OA 4YP6A 5P8WA 1Y4SA 1T8RA 1HDXA 4LC1A 3EAQA 4TSFD 1GYQA 2VT7A 3NC0C 3UT0A 2BBSA 1GZ6A 1D6JA 1ZLYA 5F23A 3HR4A 1NT2A 4BX8A 4YALA 3Q10A 4O08A 3RVJA 1T10A 2B8WA 1EFTA 2EVWX 1DU4A 1DDOA 1ODCA 1EXVA 1N6HA 2B3TA 2HF8A 4FHEA 4M1EA 2GXAA 3WLKX 1OWOA 3GLHA 1C7JA 5C80A 4R1MA 4GRIA 1IHYA 5K0FA 4DV1B 1YB4A 4QU0A 1NKVA 1IQPA 5F7JA 3K3PA 4MMYB 4EYSA 1TQDA 2G5CA 4ZT4A 1Z0DA 5EWJB 3EA4A 1NDQA 2ZFUA 4L57A 2BT4A 2PEZA 4DMKA 3L5OA 1T8UA 3PITA 2Z4TA 4QTTB 1ESEA 3RKUA 1SK9A 4D9GA 1B42A 1XE3A 3BEOA 1L5FA 3VKWA 1L5QA 2MT9A 3AY0A 3AFIA 2UZAA 1I6WA 2CLKB 3OKFA 4MQ5A 5JZBA 5AM4A 4W5RA 1M0EA 3CRW1 5T5QA 4Q1BA 5BR8B 4YN3A 3KX2A 3CURA 3E9QA 3LPMA 4IIBA 3OCCA 3WYEA 1L8QA 1K4MA 2SKEA 1AMOA 5AJZA 4ZYTA 1JXQA 1O89A 3WISA 5HZHA 1THGA 3AU8A 3OPYI 1IE3A 3NFRA 1DUVG 3OAAA 1H6AA 1MQSA 2FRXA 2P9GA 3CX7A 4H3HB 4TL7A 1AGYA 4MRRA 4NQRA 5B58T 3TXAA 3V8VA 1LQ2A 1NBAA 2FLKA 5EZSA 2O2EA 1UC8A 4TWJA 4Q1AA 2WMYA 4TMYA 4MRMB 2H1VA 3E1SA 3VYRB 3VYTB 3AL3A 2VJCA 3F6BX 5TY0A 4NCXA 1IXSB 1ULBA 4GI5A 4BBZA 3PDUA 2J3JA 4P7KA 3DPSA 4C0QC 3G5TA 2AKYA 2AEFA 1EB8A 3CR3C 5EKUA 4DLXA 3EWAA 2R6AA 2YDYA 5DI3A 3TVTA 3OLYA 2F8MA 2VPPA 1ZW6A 2AZ4A 2H1IA 2R65A 3MMSA 4U3JB 2YUTA 3HNOA 5AM3A 4RTJA 4HAYA 4X1KA 3RVLA 3CA8A 3KQWA 3S70A 1D1PA 1H66A 1ZL2A 1RYHA 1LQTA 2E3JA 4TV8A 4Y6SA 4MKIA 3RI3A 3T5MA 2HX1A 4EGFA 1A8IA 3T9AA 4X66B 5KIAA 4Q82A 4D9KA 3ROZA 2C2ZA 1J0AA 3D0QA 3W5IA 2QL6A 1XMXA 1UBUS 3WYNA 4FHFA 1NYTA 13PKA 4IWXA 4E03A 1V7ZA 1Z7YA 3QKRB 2J3QA 3TLZA 3K6SB 1RXWA 3OCXA 5DF1A 5CEJA 3LO8A 3GJSA 4XEUA 3F6SA 3IVXA 5IJ9B 3F3KA 4HBZA 1AH2A 2Q5OA 1YCFA 5KTYA 4BO8A 3G2PA 1IJBA 3WL4A 3K1AA 1AA9A 3T4PA 2HI0A 1VHDA 3SFTA 5LP6A 2IYOA 1UBGA 3K9BA 4IG9A 1YOBA 4FYJA 2AOTB 3JSXA 1NXTA 5BURA 2ZBPA 3OX4A 4KQ6A 4LE1A 1G18A 5TPWB 4MWSA 2Q7DA 1O94A 2R87A 1CFZA 4V1CI 2OHIA 4MHOA 2BEKA 3LVBA 4N1AA 4CCYB 1P2BA 2BEVA 5MF6A 1W87A 3DEAA 1U0JA 5EWLB 3ACCA 3CNHA 2HJVA 5CT8A 1L4EA 1R50A 2N42A 4MP8A 4CLOA 3WBJA 2VYFA 4XGKA 1SNYA 4LRUA 1X87A 3A7EA 3IHLA 4IYRA 4CTMA 1OX5A 3OICA 4DE5A 2EX1A 4DMLA 3WK8A 2JZCA 5A3JA 3TL3A 1Y89A 3ZS9A 3OQOA 2DWOA 1PNTA 4O1MA 5SY9A 4BLVA 6REQA 3FOFC 5AKHA 4LWPA 3ET4A 3RTAA 2GN1A 3A6EA 2WAOA 2OO5A 1I4EB 2VPTA 1SK8A 1U3GA 3KQPA 1DAPA 5JJBA 1CUIA 2VXYA 1M6WA 2ZRLA 3IP3A 4GL4A 4N01A 4JI6B 3RTCA 4UEQA 4ESOA 4YJHA 1PIWA 3QNMA 2MMCA 1L3IA 4D3FA 3EGCA 3WIOA 1G64A 1C7EA 2X1HA 4LXGA 2XUAA 1G7RA 2H1LA 1FK8A 2VDPB 4GGPA 4XX1A 2EZTA 4JB2A 1BE6A 2CXQA 2IHKA 3AHIA 5JCOA 3RVSA 3H9GA 1OAOA 4Z7OB 2D1SA 1GSIA 2J4DA 3TW8B 1FYFA 3U44A 3WWPA 5JOQA 5DYTA 4YMIA 2E6KA 3A04A 3OD1A 1L2TA 3JRXA 2JBHA 4TQ9A 3SSAA 2VF4X 5CVDA 3HA7A 4HWOA 3ITEA 1ZRSA 1DRVA 3CTMA 4DM3A 3IVCA 5CX1A 1K08A 2ET6A 3K35A 1ZLXA 4Q1CA 3D7SA 3HUTA 1S96A 3OETA 2O2HA 5ETJA 2G72A 4L4SA 2O8CB 3M6XA 1L4MA 5E3IA 4U7JA 4PQRA 4HXYA 4C2AA 3VR6D 5B7PA 1N9GB 3EPJA 4AY6A 2LE0A 5LYJA 4CKYA 2V0NA 2VRBA 2WFLA 3HG7A 3X3HA 3ZV6A 5C5IA 5AOVA 4UNQA 1X1AA 3UT6A 1H2XA 1O5TA 2ZYGA 3CHYA 1JV2B 3DE5X 3EG5A 4C21A 4RTPA 3MUNA 5F2KA 2A88A 3KTDA 1NMZA 1SUSA 4K0RA 3L77A 2E5WA 4HUTA 5DBFA 1Q0RA 1M8GA 4MQUA 4ZV4A 1WMBA 3LF2A 4XW2A 1IOZA 4URFA 5I8PA 3KQNA 2QE6A 4NMMA 4Q19A 4UBOA 3S2GA 4RM2A 3ZXYA 4TXMA 2O7NA 1JMYA 3E3LA 4MPJA 5G0SA 3VZPA 1H0HA 2AFHB 1PGNA 3V1KA 4UNIA 3ZVKA 5JALA 4LFCB 3UV3A 3CV3A 3V8MA 1RR6A 2H5EA 2Q4RA 4K6FA 4IJMA 5TV2A 1XTIA 4N3AA 4WA8A 4UOQA 2EGHA 1NPTO 4FZJA 2OFXA 4J49A 2ZSDA 1R0CA 2OFOA 2J33A 3IELA 1X1BA 3MCUA 1ZXXA 2FZWA 1KMMA 1YB5A 2I9PA 2WB2A 4ZHQF 5TNXA 2PN1A 2QF7A 3TB6A 5CH5A 2REQA 3SHWA 2MIIA 4N40A 1YVUA 3CT4A 1M67A 4ROSA 3QUAA 1BA3A 1WHSB 3P9CA 4DC0A 5IM5A 5JEEA 1TI7A 1WXIA 2YL2A 3EQ8A 1QNFA 2I3AA 2QRUA 4AROA 2H1FA 5AW6A 1N2XA 1YA6A 2XEDA 1FSFA 1UDAA 1KNXA 1T6YA 3Q88A 4FDVA 4PAGA 3ODGA 4DG8A 3V4OA 4YRMA 2WDZA 1X1QA 3E5RA 1Q0SA 4OJNA 5JSUA 4Z4QA 4NBVA 3WL7A 4P92A 4EKYA 2PXHA 5FL7D 1NQUA 2JCSA 4FX2A 3TKAA 1BKYA 1MAHA 1YE8A 4RK7A 3WKEA 3ZCSA 1TK3A 2H06A 2A5YB 5L3VA 3WMFA 3MWEB 1H3FA 4X7MA 1DRKA 4EHKA 2EEZA 1P81A 2BFEA 3RC7A 4QUBA 5FYDA 4GP6A 2ZE5A 3KYIB 1TJPB 2OHOA 3PDHA 1R1DA 3WADA 3SN6A 4NG4A 3LGSA 3NHMA 1C3OB 4MLZA 1C2YA 3SMVA 2NQTA 4ZQFA 4DLKA 1UZUA 2GI4A 4NJMA 3VAAA 4DV6B 4UM5A 1CLEA 2GCOB 2BBWA 3HEMA 2HQRA 4LSZA 1UPAA 3LAWA 4AQYB 1Y80A 3MK31 5JNUA 1FS4A 4I1VA 4O2LA 4G1BA 5CLQA 1ND6A 4EKIA 5K8TA 3R6TA 4IOJA 2HMWA 3A0RB 5FBRB 3WRVA 4LKRA 3GCWA 4C07A 2HBYA 4AO7A 3OQIB 5K6TA 3KOWA 4EOGA 3DEJA 1U8YA 1JDPA 4GH5A 3PUVA 3H6HA 4GP7A 4TZKA 4WY5A 4F91B 5ILOA 1NHWA 2I87A 3CQ9A 4LHSA 1OVGA 2IYVA 4QU9A 3ZGLA 1J2JA 3R8CA 1IB6A 1NI3A 3SQNA 1CF4A 3FYSA 4UE2A 3QXSA 3HBAA 3KJQA 5C5DA 1G59A 1A82A 4FR2A 4I4LA 1A2OA 5KI6A 5DLQC 3JD1A 4L74A 4EO7A 5ULLA 4DL9A 4OLFA 2FSVC 1AHNA 4QAQA 1C1DB 1D2MA 4XPZA 3WGLA 3W6OA 3VOAA 1X1RA 4ZQIA 5FWNA 4RL6A 3WGVA 5JWHA 4G26A 4KW7A 3PUWA 3ZDRA 1CSEE 2VDUE 2DCUA 3GDGA 4WLUA 2CE7A 3PXBA 3R4VA 4X6XA 1I2MA 5A0VA 1I3KA 2PZKA 1Q1NA 3EGXA 1SBTA 3JPWA 3PJDA 5B3JC 1FTNA 3RYHB 4P32A 4OATA 3T9EA 5BXQC 1NQTA 4DCOA 2HSWA 1JT9A 5HSGA 3PBKA 5KX5A 4ZKEA 1WXEA 1UKAA 3W6ZA 2P9BA 3G9TA 4TKLA 3BMOB 5K03A 4IHKA 4MSUA 4UXHA 4ZZ0A 2DY0A 1CCWA 4JP3A 4NNPA 4RNCA 1QE5A 3MT0A 2QUAA 2A92A 3KWJA 3UMYA 1XKTA 4YO8A 5MN6A 1ZP6A 5DTRA 5HZKA 5FUMA 3IQGX 3IRUA 4E15A 3FYDA 5A71A 3C3DA 1SU6A 4HBGA 1DX6A 1SHKA 2QMYA 5ILQA 4WCFC 1N5DA 3TEJA 4CL0A 3TF5A 1F2TA 3ILHA 9LDTA 1OIVA 1TQ8A 3IQDB 2W8ZA 4DWVA 3K9CA 1UJMA 1COWD 2D13A 2W6JA 1NOJA 1T6XA 2ZYRA 3FJYA 4U1RA 2FMTA 2P90A 3DXZA 2AKAB 3BL5A 1FNSA 3OZDA 4RY8A 2JGLA 1XD2A 2JJ1A 1VKZA 3LY9A 1TC2A 2Z09A 4L6CA 3V4SA 2BCEA 1DC3A 5E6UA 1FBNA 1NW9B 1N4AA 3R5XA 2FX3A 4R1NA 5KTKA 3SZ3A 3ZWYA 1NM5C 2AN4A 5KMGA 4WTOA 1YS2X 1A88A 1GRRA 2L18A 5ALKA 1K66A 4NP6A 5IJWA 1GQSA 1HMPA 1DFHA 1WUKS 2ADFA 2BMEA 3IAS6 4J7CA 4EUSA 4C7OB 1VKOA 3KXPA 3VR0A 4F97A 4MH0R 5ITWA 3H9JA 4M0UA 1P2SA 2P9YA 1SCIA 5EIBD 1TTTA 2QXYA 3CUWA 2P9TA 3NV7A 5JPDA 1MCZA 3LUCA 5A2GA 2ACEA 5AP9A 3AVVA 3NJ4A 2D3WA 3LPDA 4C4XA 4C3ZA 3HCNA 1P1IA 3ABIA 4QG3A 5JYDA 2XTAA 5CFNA 1T9AA 4Y2GA 3PHJA 4OJMX 5EIBC 4PBSA 2IXAA 4KDEA 2Q5HA 4G01B 1X7HA 4LSWA 3R74A 3AEXA 4V2UA 1QX3A 3RE1A 3EUAA 3C3JA 4LYDA 1W8IA 2XADA 2CCGA 3PEVA 4CIBA 1ZS9A 2GVDC 1JG2A 3I23A 3FWPA 3MJHA 5ICGA 1XD8A 3ES9A 2D8AA 3CVWA 1ORDA 5JECA 2WZDA 1ODLA 1OR8A 1R6XA 1XVLA 3HY4A 3M5WA 3OX3A 4P38A 4B7ZA 4EPXA 4EY6A 2BMJA 4DNFA 2WILA 3DBLB 5IASA 1V39A 2UZ3A 3WDMA 4HDSA 2R7NA 4INJA 1NAIA 4DA4A 3BFVA 2QL5A 3KLOA 1G17A 1Q14A 3NVMB 3H8SA 1IU9A 3S8EA 4PRLA 3UAWA 2B37A 3WO1A 4IDEA 1XK6A 2WM9B 5E2BA 5C2JB 1FLVA 1IC6A 2AR7A 1XQXA 2H4ZA 2OLJA 4FI3C 4ZEWA 2V9ZA 3L3BA 2VZ8A 4ZK2A 1ITZA 1R6TA 4KR6A 3D7NA 4FB4A 2GZDA 2X5NA 1HZJA 4JVMA 1AQNA 3RLFA 2IUTA 1CYDA 1X7ZA 1JEOA 2VJOA 2VPZA 3I6QA 3IVGA 3QYAA 4WFKA 3UOWA 1PJ8A 2VI5A 4V3CA 2QUBA 2VDLB 3EIWA 1GPLA 3DNFA 3IKVA 3RRYA 3E22A 3I53A 2WNHA 3M6LA 3SHOA 3L4JA 1GYRA 2YJNA 5SYNA 2HA4A 3HSSA 5CU7A 2IV7A 2C00A 4IKOA 1R6DA 1VC2A 3PPIA 2ZUFA 4C7MA 1X1SA 1T0HB 3C1AA 1BW9B 1EBBA 3A58B 3HBLA 4KK3A 1J42A 2FFHA 5GIPE 4BBPA 1VGRA 2FWAA 4V0NA 2FQYA 3A6DA 1U3DA 5C4MA 1JIVA 3LECA 1EGQA 2PU5A 4M9RA 3NRCA 5CTJA 5DHUA 1D4AA 1T5IA 3ONWA 5EY5B 2BGWA 5K0JA 1M1YA 5LZ4A 4URVR 5T41A 5B6JA 2NN3C 5HEKA 4NECA 3WJ1A 4ZI7B 4GT1A 1IXRC 3Q87B 4F1JA 1JDJA 2ZCVA 5KKCA 2DR2A 2JNWA 5CM8B 4RXUA 1E2LA 2PPLA 1SURA 4A9AA 4TVSA 4H7PA 3CZ9A 1XB2A 5L3ZA 1ESCA 3A6JA 4RZSA 2RAUA 2ZRAA 2R751 2CUKA 3JV7A 4HWRA 4LV8B 1ZCBA 4JVOA 4V1CA 2R8PA 1T9ZA 1E9SA 3FNIA 1P8JA 2J6HA 3PWZA 4UNSA 1U94A 4QBFA 3T0IA 4AZSA 3C7KA 4C78A 2E1RA 3O3NB 4FC7A 2FPUA 4AD8A 2A5LA 2WSYB 3WLJA 1D04A 3B6IA 3O4FA 2ADOA 2P77A 3BGWA 2I7VA 1Z0FA 1JHVA 1VIDA 4IIGA 4LCEA 4XGIA 2ZSFA 4MQFA 1ORIA 1GR1A 5IP5A 3STWA 1UT5A 2OVBA 3VBCA 3TIXB 3F46A 4D9BA 1UC4B 1JAHA 2BVNA 5K9ZA 2I54A 2CVZA 3DC2A 1JYFA 1QAQA 4OKNA 3RW9A 5DHFA 5MN4A 5FLXA 2DFDA 4CM9A 4Q15A 3IDSA 2J1LA 2C5HA 2MDTA 5HM6A 5KCZA 3BMQB 2J5BA 3J7TA 4IEFB 4QOGA 3ZE8A 5A4DA 5JLJA 1EFRA 3GFQA 4PC3A 4IFIA 1U98A 3FZGA 2RGAA 1E1DA 5EIFA 4BNDA 1E7SA 3FE2A 1NX9A 3JY6A 4N7BA 2NO1A 3A2KA 2AQIA 5AVJA 1SXGA 4G5FA 1Y8CA 2WHPA 2CXXA 4IXDA 3ILYA 4RF3A 2H6EA 2B9VA 4WACA 5AI0A 4IEEA 5H02A 4RIEA 5FOSA 3FRHA 3ZHCA 4AB1A 4ZYYA 3MBKA 1E3SA 4DC1A 1P0MA 2MSCB 3FYHA 4GF5A 4GICA 3A28A 4HRYA 4TSKA 1GLNA 5B3AA 1X8XA 1KZ4A 1U2EA 2LV8A 3WJ2A 3CO0S 3ZBUA 1PJ2A 3EEQA 5FFMA 1M6NA 1KNQA 1OXBB 2OAEA 4I6EA 2WW8A 3H5IA 2A1UA 4RKEA 4JUFA 1RACA 2HFJA 1QC5B 2FP4B 3BBPA 5IXSA 2GASA 1Y1TA 2HO4A 1X3LA 3ELUA 2KBEA 2O2DA 2TS1A 4YRRA 1CRWG 2PAAA 3WSTA 1YB7A 3RRFA 3K0FA 1ZN2A 3DB2A 3FSJX 2OORC 4E5VA 3OJLA 4FK8A 4EB3A 1OXSC 4KYVA 5DLYA 4OHKA 3UN1A 1NVAA 2QTRA 4UHHA 4NEGA 4XJSA 2QZSA 1A9XA 2XUIA 2PTHA 1VG8A 3V8QA 3RUEA 4EGCB 4RDXA 1XYYA 2CWWA 3BSFA 5EKDA 1NVMB 3BTVA 4JHXA 4BRUA 3P20A 4FUTA 1JFSA 3O83A 1VB5A 1MOPA 3MBOA 4HOYA 1DAIA 2EOAA 3BKXA 3V8BA 2JCBA 4KMRA 4DFDA 1E20A 1ZH6A 3TMAA 3AZQA 4B9EA 3WXMA 1PJAA 3JWEA 4K46A 1PVVA 3UT5A 5IZCA 3FI0A 2XODA 1EHIA 1E7MA 4I4TA 4DDUA 4Z7JA 3T5PA 5E0KB 1EVEA 1LPSA 3FPAA 5COQA 4P08A 1UBEA 1Q6ZA 4HRAA 3MD0A 5EE9A 2Y0EA 3ILSA 2CY0A 4Y30A 2IX3A 4NL4H 3P32A 4V3BA 4IDDA 4Q1DA 4DWOA 1NPDA 3FAKA 4CN8A 4D0RA 1SOMA 2GD1O 2HUNA 2BC9A 3NDJA 4G9EA 2CD7A 4WCDA 3H2BA 3AERA 4B6JA 4DVGA 1OKKD 2IYFA 2AD5A 4EFDA 4MRAA 3IPCA 4FNOA 2R1TA 5D3ZA 4TRMA 3MQ2A 4BVBA 3SXJA 3ZW9A 3BXHA 4E4TA 5LNK6 3ZDBA 5FUXA 5CDTA 4TS3A 1U02A 3Q6NA 3UWMA 2CBXA 2PD3A 3FZYA 1W581 4FLEA 2JAHA 2CZGA 3BL6A 4J2HA 5ICMA 2PGJA 3GUYA 1WWKA 3KYDA 2FH5B 1U0BB 4ZREA 1I5EA 1VBFA 5AJTA 4LXHA 2PX6A 3L8MA 4WNIA 4BFXA 1R9NA 1XDGA 3MS4A 1MRZA 3VV3A 3G7SA 4UBIA 3NX4A 3TSZA 2EP8A 3N2EA 4BXOB 3BFKA 1SQ5A 4LSMA 4M22A 4R8VA 2OO7A 3VTZA 4BGDA 4P7GA 2PJRA 4KNYA 3W7AA 3OIGA 5EZYB 5EOVA 2QRHA 4QG7A 5H3LA 1RLJA 5IFLA 1XO1A 3IAFA 5BWCA 5IM4F 4MB6A 2VK4A 3AKZA 1Q77A 4JK3A 2QBYB 5KOHA 1KWGA 5BSUA 3PD7A 2P35A 1G19A 3PU6A 3RFCA 1MV8A 1RIIA 2V0CA 1X9IA 3LIIA 2QP4A 2ZWVA 2FPIB 1DIRA 1EFKA 1LW7A 2X22A 1U8TA 3KB2A 2JCYA 3MMXA 1NF8A 3O2SB 3PUYA 4EA8A 2II6A 3KYJB 3I5YA 1KE2A 1BOOA 1VPDA 2HZ7A 5M04A 1F6BA 1PFWA 4KH1A 2F8SA 1TFUA 1M1ZA 2A4KA 2A94A 1V47A 2AFIE 3QSGA 4FEAA 2TMKA 2VPYA 3R7DA 4XYLA 1F8XA 4GX0A 4ICIA 2RFLA 1T24A 1RWKA 2FZKA 2VCYA 4NYMR 1HFEL 2ZB7A 3ISJA 3RVBA 3UK6A 4EI9A 1CRLA 2Y2VA 5HS4A 5DYIA 2EWVA 3TRKA 5IJXA 1VZ2A 3AL2A 1UBFA 2H54A 4GR9A 3IP9A 2F8LA 2O2SA 1IZ8A 2WZCA 2X4IA 3EMBA 2ZSIA 4WZ6A 2UYCA 5MGBA 3VMFA 1E0SA 2WFZA 1PBNA 1X7YB 2C57A 5CH8A 5KJCA 2QRPA 1PZHA 1RFLA 2J59A 4L5IA 5BSKA 1H94A 2O3RA 4U2FA 3D3WA 3ZX5A 4QO7A 2WF9A 3K0CC 5J5CA 1TU4A 3K5IA 2DFPA 2C2KA 2D1YA 4Y9DA 5F2EA 5HQJA 4ZYWA 3K1ZA 2H9AA 2OHFA 4TYMA 2WP0A 3TZEA 4LXUA 4M0DA 4ENUA 2R00C 1U5AA 1GG8A 3R24A 5EXXA 2X7XA 4MNTA 2FQ1A 1SCDA 4H7HA 4JLNA 2YVUA 1SXJA 3B13B 3GGJA 5ALQA 3A1NA 2RHOA 2X1MA 1IM8A 5KU7A 3W4IA 3CPJB 3L4SO 4XUCA 4QATA 1BMDA 2JAXA 2JD1A 4LJAA 4C08A 2ZTMA 3VPCA 4JXJA 3NVKI 1EB9A 3IRVA 2FEAA 3ZE6A 4I50B 3EWNA 5H0IA 3RC1A 4B71A 2XSZD 3IT2A 5CBPB 4ZT3A 2PVSA 1EUQA 1KXZA 2J3KA 3DT8A 5IVHA 1ZD5A 2FSVA 3KT6A 4BO9A 4DIUA 2MOKA 2PWAA 2YHUA 3GB9A 1PV1A 2HMVA 1AB6A 4KN5A 1CVIA 3DV0B 4DM7A 3KB6A 2VP4A 3HKEB 2R8XA 3NDIA 4JQOA 1U0RA 3UMVA 3L92A 4KRFA 3GH1A 3NHUA 3ROTA 1VBNA 2H2DA 3KPWA 2QN8A 3NT5A 1TQ6A 4ZK6A 2VQDA 4Z54A 2H0AA 4WPGA 1GPJA 3ZU4A 2XKBA 3KQOA 1I3OA 4N12A 3VPXA 4OG2A 1B8PA 2LP4Y 5CCXA 1M9NA 1D2GA 5BNIA 4GVPA 2JIZA 3H3JA 1FJGB 5K99A 1TA0A 1YUNA 2K2WA 4HB4A 1U5CA 4ZALA 1T4CB 2VK2A 3NH6A 3AVTA 1U80A 4XSHA 4CG0A 3L7CA 2GVZC 3NKVA 4TMWA 4O5OA 4YYEA 1NF2A 3HB7A 3G02A 1W4AA 5KJEA 1GXSA 4Q9DA 3IBTA 2D5LA 1SOUA 4OQZA 4EW6A 1JWBB 3DL7A 3GCGA 3GZ4A 4HWPA 2OSVA 1HDEA 2QMZA 3HXLA 5CJJA 3TE6A 1WSDA 2BBOA 1IMJA 1PNQA 3STHA 1LNSA 5F51A 3K5WA 1ZESA 4WXPA 4NFHA 3OQNA 1U2GA 3EY9A 4MOWA 2ZETA 2GLXA 5BNTA 1G9XA 3I64A 1P1JA 3HDQA 1XIVA 1E2DA 1GZHB 4V0OA 3KJFA 2D7JA 5CLHA 4F3RA 4O1IA 2OCGA 2WKRA 3EA5A 3F9RA 3IB3A 4O2AA 2XLCA 5TEVA 2QTGA 4OHOA 3M49A 2MJLA 1HE2A 3ZV7A 2XH8A 4PCVA 3V4PB 2RBGA 4ZICA 3I8OA 3JAMA 1HA3A 1QYXA 1U7DA 1WW3A 3DCNA 4R2JA 2D8MA 3MTAA 5GQSA 5KTOA 2VJAA 1ICEA 1IEQA 1O0SA 3F96A 1QFMA 2W5UA 3R7LA 3BQNB 3U4AA 3UW1A 1KI2A 1XALA 6AT1A 2JLBA 1QSGA 4YDSA 3WHLA 2QX9A 1VPVA 3D6VA 3AVPA 5ECYA 3TLMA 5G1PA 2MSKA 3RHTA 2XUOA 2ZJYA 5GZ1A 2C1XA 4DLWA 2HK9A 5J59A 2VSFA 3V1TC 1VRVA 4O63O 1CY2A 3KKPA 2JLUA 3PI7A 2ZIVB 3CR8A 3DL4A 1CDOA 3ZQ6A 4BQPA 5IKOA 5E1OA 1E1CA 4D6YA 3QUBA 2Q0HA 1H4QA 1LJUA 3KTAA 3Q2IA 2VEOA 4ILEA 1QH8B 4KKVA 3RAEC 1TIBA 3AI7A 4P86A 4AWBA 2BFAA 4FEGA 4OUDB 2NU8A 2IPMA 2JGIA 4QYIB 3GYBA 1ZN9A 2I66A 1DMSA 3GUHA 3FBGA 2PKRA 1SULA 1Y6ZA 1K4YA 3E61A 1M7HA 1RBZA 3GLRA 1REQB 2DWPA 4HZUA 4EI2A 4X1IA 4XVHA 5AI8A 3RAJA 1L5MA 1UQRA 3LCJA 1P1HA 4V02A 1B74A 3LY8A 4ZCQA 4D5EA 4M9UA 4PNEA 2IPLA 5EJGA 1G8FA 1WU7A 2W6ZA 3BXZA 1H6BA 3EUWA 2F3UA 3KR9A 2PQ6A 1XFAA 3K73O 4UQOA 4KX3A 4URZR 5F77A 3CWZA 3MB5A 3FBWA 2B83A 1LV7A 3RVOA 3GRAA 4N7MA 4FGWA 2IU0A 5HP4A 2XYHA 4PO9A 1ZWKA 3N39C 4K81B 2OYSA 5CLGA 3X1MA 1H85A 1XTJA 2NUBA 2VKTA 4FCWA 5IAEA 1YU6A 2ZI7A 3CINA 3G1WA 4LY6A 3VHXA 2XE7A 2E4WA 2W22A 5FF9A 3GVIA 1QMPA 5FI0B 4NZNA 4LAFA 1RZRD 3B78A 3QI2A 5KVAA 4HEA6 4AUEA 3UAVA 4QUJA 1OGJA 4UCQA 5J5AA 1G8JA 4Q4JA 2YQZA 1ZX1A 2Q7XA 3E5NA 1DWPA 3OQBA 1JJ7A 2FR8A 3OMLA 2X8LA 4MAMA 1NULA 5EXSA 5JUWA 3Q8XB 3GNQA 1L7DA 4LECA 4IXNA 3EVNA 4G84A 3K4QA 3W34A 2I71A 3USZA 2C8KA 3BIOA 3FHJA 2YJTD 5FUBA 4AG6A 4RA6A 2VBFA 3DHVA 2QTLA 5C7LO 1AHHA 2V7BA 3JALB 3LYLA 4BZWA 1NUAA 4ILKA 1HLDA 1DC8A 3QZUA 3ZU6A 4QGGA 4RCVA 4JNKA 3D59A 3FCXA 2WUEA 4JLPA 3ND9A 1U63A 3SS9X 1PLLA 5THXA 3DSRA 1U1FA 3COZA 2ZI9A 2ORVA 3N6XA 1FDVA 4J2TA 3W5SA 1H2ZA 1FFXB 3PXDA 1HORA 3H83A 3UENA 2EL7A 3AHEA 3AR6A 4GO1A 1FPMA 1OASA 2AVDA 3FA2A 2CNLA 4OYYA 5AK6A 2R66A 1O97D 1E9DA 3OEEA 1FFWA 3SMQA 4BLRA 2MINB 4HLDA 1KYQA 4TX1A 2GTPA 1OBOA 2GJ4A 1TZ2A 3OJEA 5AXCA 3DE6X 2FMUA 1O97C 1TEVA 2AW3A 3NBZC 2YZNA 2J09A 3LMKA 1RWOA 4G24A 4JLBA 4HNQA 4QWWA 5EJ8A 3LP5A 1WLSA 4DCSA 3LX8A 1GO2A 4MAAA 5LBIA 1MEEA 3F67A 3GGSA 3T34A 2WTXA 1R8SA 3GEIA 3ZXSA 1RMQA 1ZQ1A 4AZ3A 4UZEA 2I6FA 3T1HB 2B34A 4UD2A 4A1OA 2GYYA 3CONA 1LK5A 3VV2A 1FQKA 3T1NA 4C0JA 3RAPR 3HNPA 3GP3A 4Y6LA 1G20A 1YACA 4N0DA 4CQNA 2RGXA 3DMRA 2UXBB 4X60A 4X20A 3EXEB 3U39A 3ELYA 4HP8A 1IN8A 3LBNA 1L5KA 3VMMA 3IAXA 1U7UA 1P2VA 3WKBA 4PN7A 4LNUB 1OFVA 4WBSA 3VOBA 1CULC 3HSKA 1L9KA 3I01M 3K1TA 1DBWA 5ALIA 1CUFA 2X0NA 1Z16A 4RQUA 2NUPA 2VPIA 2BBTA 5FBZA 4R68A 3VC3A 4TUYF 3UJPA 1P4GA 2YBDA 2J0UA 1RM3A 2QX4A 1RYBA 1FDOA 1E2BA 2MR5A 2PBFA 2XWSA 1BG6A 2R11A 1AZTA 3KLNA 4TMFA 4HK4A 1S2IA 1SVSA 2EGUA 3F8WA 1DVRA 4XSVA 4YRCA 4G5SA 1P17A 3ZGZA 1R3DA 3LL7A 3TEFA 1XQ6A 1ZMTA 3SIRA 3S3TA 2OLKA 4CM3A 2A1IA 1THTA 1W4RA 2FHPA 1JLRA 3E48A 2OORA 3KVRA 4RIIA 3IILA 1PK8A 1UBHS 3HGQA 3FWZA 1E6EA 1YRQA 2BFDB 3ICPA 1R6BX 1W76A 2O3SA 3INYA 4GECA 3V4RA 2GJAA 2BFBB 3FETA 5L3QB 1D4OA 5EP3A 4CKWA 1R0YA 3NNSA 2CLDX 2XZLA 1KGDA 3QFHA 4IIJA 1BMTA 2V54A 3PX2A 4EMBA 3GLIE 3CWCA 2VNAA 2BGKA 2PMFA 1HETA 4WJKB 4CF6A 1QP4A 5AT1A 5K2OA 2XNSA 2OV4A 4O2BB 4RDHA 2X7JA 4KE6A 1JQKA 5SYMA 1N7HA 4K6MA 3UICA 1OH5A 1IJFA 1V7PC 2AJCA 3EDQA 1FQJA 1V8PA 4OGKA 5A4JA 2YZ7A 3NIDB 5BW4A 3SBOA 3RVDA 1MC4A 4WLFA 3ICEA 2EYQA 3GNLA 4GM0A 4E07A 2BDTA 2O8BA 1R0RE 1M33A 3EXHB 1XD9A 2QPTA 1JLLB 3IX7A 3NHBA 4UASA 2RIRA 5JVDB 3T3GA 3ANLA 3K4HA 4LYAA 1XNQB 2DFTA 4II2A 1N1GA 4HYEA 4LKOA 4LSGA 3MAGA 2HJSA 3WL5A 5BQPA 2AG6A 3NIBA 1C30A 4NNJA 4YTEA 5FOXA 4YRDA 3UKJA 1H22A 1HRDA 1PEAA 3HCFA 3OBBA 2FFRA 3PNBA 4I1YA 2FWNA 4XWTA 4MUHA 5AK3A 1V16A 1EWRA 4EMSA 2Z8YM 4J9VA 3G9QA 5IH3A 3WGKA 4O3FA 4FYXA 5DBIA 3G7NA 3M6UA 2ZE6A 1KZHA 2XE6A 3DLCA 4KGZA 3NKLA 2WVGA 4KJXA 4WW0A 5D51S 1O95C 1X94A 2PS0A 1JG6A 1QK3A 2OAP1 1V2GA 4CLRB 4CW7A 5F76A 3GEPA 5TQ2B 1B2RA 1N7JA 4ER5A 1A1SA 4AWXA 5IBCA 1H6CA 5JAZA 4C76A 3O9VA 1P0FA 2XRMA 4LBWA 4QGSA 3QVVA 4OD0A 4B31A 3KSZO 2QIOA 3C70A 3DXFA 5ALXA 1PU2A 3D6AA 3DOIA 4MINA 2XUFA 3BS4A 5BV1A 4XM1A 1FUKA 3T94A 2PGOA 3CLRC 2MSLA 1UDBA 1UOOA 2IDMA 4RD1A 2QGFA 2OFPA 2ZRCA 2ZJAA 1EK1A 1C1HA 1ONOA 4B3HA 3SBXA 4UTVA 4HQ6A 5CDHA 3MHPA 3N0WA 2IXFA 4Q4HA 3KEOA 2Q4BA 1AQUA 3DONA 4BP3A 1D09A 3HB0A 4KVFA 4PYJA 4MGIR 4MUFA 2YHBA 1VRWA 1EUDA 4J03A 1N7IA 4KSYA 4YRNA 1CQJA 4O8CA 4D96A 4WOCA 1P4RA 5LQAA 1ZU5A 2OZPA 3UMBA 5JS7A 2PX5A 2ECPA 3EVAA 3ZV5A 3E6AA 3RJZA 5EMKA 5TQ0B 1WMEA 4IX1A 1T9GR 4XPIA 2E5FA 1CZOA 1Z8NA 3ESCA 3M83A 2APJA 3OWHA 2HU2A 4NK5A 1CC1S 5IVDA 1OGIA 1I32A 2GK7A 4JEMA 1IFXA 4H18A 1DB3A 1Y37A 2R8OA 2BGRA 4GR5A 4MUJA 5EJMA 4I8XA 3T0GA 4H1VA 4B5KA 2AOVA 4C2UA 3ZQ4A 4EITA 1QVAA 3RS3A 1VZ3A 3L8GA 5CVEA 4BLSA 2OV2A 4XIJA 1BWRA 2XXAB 1R3UA 1YS7A 2CNWD 2HO5A 2VXBA 3NBFA 4KE7A 5M29A 2CSUA 4GZLA 3FNQA 3AXTA 4UZFA 4F4FA 2FUEA 2OC9A 4XYGA 4E5NA 3OG9A 3QV2A 4AJ4A 4DUYB 4S0XA 4JFAA 4ZYXA 2C7GA 2BV3A 3ZHZA 3UFXA 5B64A 1V2HE 2DUWA 2OQRA 3BD6A 2QUJA 4L8LA 4Z1MA 1NP3A 4HD8A 4AKGA 4ZVOA 3PL5A 3C85A 2H2WA 3R5HA 4UU8A 3HUUA 3RSFA 5DGCA 2QM3A 4QUAA 1HNXB 4H7DA 3G2LA 1DDGA 1H5QA 4JUIA 3U40A 2GVNA 1N8TA 2FA9A 2YWGA 2O1EA 3NHLA 4C3VA 5C32A 4WD3A 3UOGA 5BR1A 4CETA 1VJ5A 3P27A 3K31A 1M6VB 1SRRA 2WTAA 3PR1A 2AXQA 1YC2A 5EGNA 5HOEA 3DLPX 3F9CA 5LMNB 1XHLA 2QE7A 3KNZA 4O6VA 4CV0A 2Y1OA 1N8NA 2PH7A 3IQHX 4Q34A 4IOMA 4YJFA 2VQSA 4L5JA 4CF5A 4XB6B 4Z4EA 2YN0A 1FZTA 3GQBA 4WLOA 4AY5A 1Q44A 1IHXA 4K6KA 4PZUA 5E8RA 2PRYA 2QVBA 2ZR8A 2EGGA 5JSKA 2YC2C 2AQHA 3MWKA 4I2VA 2WAXA 4M0KA 1JEQB 4P4SA 2BKXA 2OHGA 2VC2B 3Q4GA 3GI1A 4FTWA 2W2NA 1PKXA 2HNBA 4UNPA 1SHLA 4OYRA 1IZ9A 4UC0A 3R7WA 4KHZA