4C0WA

The crystal strucuture of native ppazor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
200
structure length
200
Chain Sequence
MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Pseudomonas Putida Azor: The Active Site Revisited.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords FMN-DEPENDENT NADH-AZOREDUCTASE 1
total genus 68
structure length 200
sequence length 200
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c0wA00
3ESYA 3O2NA 1JA0A 5TGZA 2FOXA 1H69A 3NHYA 1YKGA 1DXOA 1JA1A 3L9XA 3NFRA 1DX9A 3NHJA 1WSWA 4CF6A 2V5VA 4DILA 2QX9A 1XT6A 3KLBA 2M6RA 3TE7A 1BVYF 2WC1A 1J9GA 4ICIA 1WSBA 2Z9DA 3B6IA 5FX2A 1D03A 1D04A 2RG1A 1VMEA 3OWXA 2FVXA 2QR2A 4FGLA 3K20A 4ESEA 5LLDA 2HNAA 4XDHA 3UXEA 2Z9BA 3NHKA 3FNIA 3B6KA 1QBGA 1AG9A 1T0IA 3FX2A 4FGKA 3HR4A 5B3KA 4HS4A 3S2YA 4BMPB 3JSXA 2X2PA 1XYVA 3K1YA 4S24A 5LJLA 1F4PA 1AKQA 2B3DA 3QE2A 3NLLA 1FX1A 4LTMA 3B6MA 1BU5A 3KAQA 1YCFA 5EA2A 2MWMA 1FVXA 4QOEA 3NHUA 3W7AA 3N39C 1FLVA 2FCRA 4LAFA 4LTDA 2BN4A 5LBTA 3KAPA 1AKTA 1GG5A 2Q62A 1FLDA 2AMJA 2R97A 2QMZA 3FJOA 1AKWA 3KEGA 3OX3A 5F12A 1CZOA 5FA6A 5FUQA 2GSWA 4QOJA 6NULA 4Y7CA 3GFRA 3NHSA 4YALA 1RCFA 1J9ZA 1XYYA 3NHRA 5EAIA 4XDGA 2KQUA 3OJXA 1CZRA 1D4AA 1AKUA 2OHHA 4N65A 5NULA 4YAUA 1OFVA 4N82A 2FDXA 1ZX1A 2ARKA 3L9WA 4U7FA 1OBOA 1QHEA 2FLVA 5A4KA 1TLLA 1TIKA 3OX1A 1KBOA 1OBVA 1AHNA 2A5LA 1CZLA 2QX8A 3ZHOA 2BMVA 4PTZA 4J8PA 2D5IA 1SQSA 2Z9CA 1KBQA 1YCGA 2BF4A 3HA2A 1FTGA 2FAXA 2ZKIA 4U7GA 5LJIA 5F51A 1RLJA 5ULLA 2FX2A 4NULA 1NNI1 4GQIA 4QOHA 5B3LA 5F4BA 2BZSA 2F1OA 2Z98A 4GR9A 1CZUA 4U7HA 4C14A 1RTTA 3N3BC 4BMOB 2V9CA 4PU0A 2M6SA 1CZHA 3N3AC 1C7EA 1CZKA 3OX2A 2QMYA 5EMNA 3P0RA 3SVLA 3NHPA 1H66A 1FLNA 3RPEA 2MOKA 2MTBA 1B1CA 3FVWA 1YRHA 3HLYA 3R6WA 4CETA 1CZNA 3D7NA 1ZWLA 3NHWA 1T5BA 2OYSA 3GAMA 3OJWA 4H2DA 4M0CA 3TEMA 2Q9UA 3QFRA 4QOFA 4ZVNA 4N9QA 4F8YA 4R81A 5NLLA 1XI2A 4GI5A 4C0WA 4QOGA 2OHJA 3GFSA 4Y9UA 4QOIA 1AKRA 2QWXA 4HEQA 3U7IA 5JROA 4ZVKA 1V4BA 2R96A 4ZVMA 4PTYA 1J9EA 4YAWA 5LBUA 3F90A 5LMCA 1C7FA 4LTNA 2V5UA 4LA4A 2BPOA 3OVMA 2N1MA 2QX4A 3ESZA 5LVAA 1I1OA 3O73A 3NHFA 4FX2A 1X77A 1E5DA 3G5MA 1AZLA 3TZBA 3LCMA 3LT5A 2HPVA 4DY4A 2KLBA 4FGJA 3NHLA 1FLAA 4C0XA 5BUCA 1YOBA 2FZVA 1J8QA 2XOEA 3U7RA 1RLIA 4YQEA 1ZWKA 3ES9A 4D02A 1YDGA 2FZ5A 2X2OA 3OWHA 4H6PA 3W77A 3W78A 4DIKA 3EDOA 3W79A 2QX6A 3F6SA 3QFCA 1YCHA 3F2VA 3F6RA 3UXHA 4QODA 3ESXA 4OXXA 2HNBA 1SG0A 2MT9A 4Y9RA 1DXQA 2W5UA 1QRDA 4YAOA 4YAFA 4ZVLA 4C76A 1AMOA 1FUEA 3B6JA 1AKVA 3FW1A 4NLLA 2XODA 1QR2A 3EYWA 2OHIA 3GFQA
chains in the Genus database with same CATH superfamily
1NXSA 3PQ2A 4KK4A 4F72A 3BJZA 3LVBA 1TM2A 4JASB 3DE1X 1JA1A 4FS3A 2FPOA 4RKQA 5FO1A 1QFMA 5TR9A 3E2MA 3TSCA 5ICGA 5F9FA 1CKEA 4WJKB 1U7DA 3LYLA 3RIYA 3AJEA 5BSMA 1DTWB 1XK6A 4P84A 3UGJA 3AFGA 3THXA 2Z9BA 3MQ2A 4NCJA 3RAEC 3M2PA 4MKXA 16PKA 5BN4A 4CM6A 4J1NA 1GUAA 2CV0A 2HNKA 1RM3A 2REOA 4JBYA 2VDQB 1AQYA 1T15A 3HR4A 2E4ZA 1SGWA 3ED1A 3L84A 3PR3A 4UBOA 1LLFA 4CN8A 2CWWA 4U6QA 3UJBA 4HAOA 1UPBA 1DTWA 5G0UA 1TZJA 1WP4A 1AN0A 3NTUA 4HMQA 4D3SA 2Q1YA 4O4HA 5EKSA 3HSKA 4I08A 2Q5IA 2J6CA 3FJ1A 2A57A 4MB6A 5U4QA 3ZZMA 4B3DA 4EHNA 5E95A 2XYQA 3OT4A 5EWJA 1L5NA 2R97A 3IPLA 4ENSA 4IIHA 1KSFX 4KACA 3VTZA 1XP8A 4O4JB 4LJ4A 3KPYA 4BFCA 1G7CA 2Y1KA 3RJZA 4EO9A 1OGIA 1SBIA 3ZDZB 2VFAA 3S1SA 4PYLA 3K2BA 4B2YA 2CJPA 1VMIA 1N4DA 1I6WA 3K8ZA 1H0RA 2B25A 2D3TA 2NZUG 2VYVD 4PR3A 4YUXA 3GGCA 1Z6ZA 5E3IA 3W2HA 3RWBA 1QC5B 1P1JA 3M9XA 4BKPA 4YMHA 3CXRA 4D6XA 1ZA2A 2QW8A 4JZYA 4ND8B 3TLJA 1BMDA 1IN8A 1URPA 2FYTA 3CX3A 5DWQA 3F6BX 3P0JA 2BDEA 3WLQA 2YYZA 2IELA 4G36A 1HL3A 4N8EA 4NRDA 1SHLA 4JI5B 3JS5A 4MQ5A 4BLTA 4X3PA 9GPBA 3EIXA 4C3VA 4C7OA 5AVWA 3I6IA 4FR5A 4KSBA 2OHFA 3EGXA 4CLOA 3E0QA 1WB4A 2O8BB 1A7KA 3PHJA 4G9GA 3FTNA 4GRAA 4HVAA 5EYPA 1R16A 2PVCA 2Q3MA 1FDOA 1MT0A 3WK6A 3GP8A 3QVGB 2ZWVA 5AFSA 4GKBA 2VK8A 1FDWA 2P78A 1Z0AA 4E08A 3HLYA 1YUNA 1WZUA 3OQOA 1OXKB 1IIBA 4G0QA 4HH0A 3GG2A 3T9DA 3TQTA 1EUCA 2OV6A 2XCUA 4G9BA 2ODTX 2KHZA 4MHOA 3UK1A 2H5EA 1EAMA 2OBLA 2GRAA 5EUBA 3GRCA 2GN0A 1EUYA 1H2HA 1LJUA 2MU1A 3LDHA 5EXXA 3TOCA 4A2CA 3K6RA 1O94C 5COBA 3V48A 3U6KA 5IM4A 4HFMA 5A7FA 4Y1RA 3IP9A 5DOZA 2EL7A 1Z13A 4Y0NA 3WWDA 1ESNA 1JJAA 2BKVA 3CCFA 4X1OA 1G8YA 1CETA 2IITA 4I9HA 3S5UA 3TBFA 1IEWA 4D6PA 1ZISA 5GJBA 1T24A 4WXYB 2P2NA 4Q24A 1CUDA 1LH0A 3IT1A 4ODIA 5C5DA 3TTTA 3SU8A 3L0DA 4DMGA 3E3NA 3RIGA 1U0EA 4I55F 1G21B 2DJ5A 1QH8B 2NVBA 2WWFA 3I9JA 5KO2A 2O0LA 2Q2WA 2GK6A 4GYWA 1PV4A 2GM4A 2FK7A 2N42A 4FU0A 4HNAB 4D4MA 3RUIA 5DTEA 2AJTA 4P3OA 8GPBA 4QYIB 4A0SA 3PDHA 5I45A 3G7UA 4RA6A 5K0GA 3WA7A 1E7SA 2YQZA 2P35A 3GPDG 5ENDA 4O02B 2O8EB 3ANTA 1E3JA 1S96A 2AWNA 3AIMA 3MLAA 4G0ZA 2VWGA 3KRTA 4M4SA 4TQAA 2AQHA 3Q3JB 3IFSA 3QNMA 3OI7A 2IT1A 3HFGA 1GPYA 3NKLA 3GGDA 2IE0A 3C6YA 3CTMA 3FPJA 4KGDA 4MVJD 4EUKA 4AN4A 5A4JA 1XTPA 1DRUA 2FQQA 3UMJA 2IDZA 3IO5A 4KXYA 3GGGA 3PJRA 1F20A 3QHAA 4BVGA 1Y37A 5EE9A 1A27A 1UP6A 3DMYA 3V80A 1B3BA 1O58A 2XOKD 5KYKA 1AX9A 3O3CA 5E9QA 2A4KA 3E4DA 5B6JA 3DVRX 4HNGA 2WM8A 5H80A 4H9GA 4DJDC 5LNK1 3MJEA 1N92A 3EEQA 3JARB 4QBIA 4GOND 1NSFA 4KQJA 1A7JA 3ESDA 3FYTA 4W6QA 1N0UA 3F1KA 3C6MA 4H7KA 1GL9B 2R6CA 4HAUA 3OCCA 4HHEA 4KXXA 3OU7A 4R05A 4G1UC 1HZZC 2QJFA 3VO2A 3ZWPA 4DCNA 1JIIA 1GUZA 4MWCA 5DPMA 5LQKA 4HAYA 1OB5A 2ZI9A 4U39A 4UAUA 1G5PA 1Z37A 3N75A 4I8XA 4LJSA 1T6BY 4Z0PA 3UW1A 1EVZA 4RV4A 1ABFA 3LUJA 1RWVA 5LLTA 2BMVA 3K35A 4IPTA 3U6BA 1HK7A 3PGLA 4JR0A 1KOGA 3EVTA 4DSAA 1DEAA 2JFOA 1J22A 4UTOA 1MRNA 4DANA 2AC4A 2COUA 5HJEA 4WFQA 1GTRA 4BZXA 1BKDR 3MIIA 5AK3A 1IMJA 1RWQA 3K30A 3RJ5A 3QA9A 3IOYA 2BH2A 1PJ2A 2NU7B 1JYSA 4B4WA 4WVFA 5EMMA 2JLQA 4MW1A 5CYPA 5JMOA 4RQTA 2VTDA 4YAKA 5C80A 3W90A 1AGYA 1HNNA 1RHRA 4AKHA 1P73A 3O8OA 5DLDA 5FKJA 3ROTA 1II9A 1NXXA 2H2HA 2Q6KA 2W8BB 2X0KA 2DFDA 3PTAA 2GKSA 2OXEA 2BW0A 4QJ5A 2PGOA 2P75A 3WDSA 4PQGA 3P9CA 5JD6A 1MRZA 4YRBA 2EOAA 4NAUA 3DKKA 1TM3E 1VE7A 1UDBA 1SUCA 5CA1A 3ABSB 4P0QB 1WA5A 2WYVA 2C04A 3DTTA 2HWXA 4DDVA 4GC9A 3GFGA 3T1QA 3TD6A 2GVDC 5TQ0A 1V6SA 2H0AA 3C7CB 3LXXA 4EI7A 3RDPA 2Y3IA 3D8UA 1RI1A 2DC1A 3N74A 4RXTA 3R8CA 4N3GA 5A6SA 3QEAZ 4LJ9A 5F2NA 4FP9A 3UV7A 3QKRA 3ZGZA 3DP9A 4H3SA 4YRKA 3P32A 3S7ZA 4MVJF 2EF0A 3HCFA 4L9WA 1C3OB 3GYGA 1YB6A 2BEWB 1U4NA 3O7WA 5KSOA 3CX7A 1E9AA 1TRKA 4OD0A 1J6UA 1I2ZA 3ZW9A 4QLBA 4FEGA 4OQLA 2WTNA 3CH5A 4DIKA 4NCXA 2X2OA 3MTEA 3IOBA 1PUXA 2NT3A 3VZDA 1PT6A 5AVZA 5IF9A 4D9EA 1JJVA 1EU1A 4RGVA 3E7XA 3L7DA 7GPBA 1X9GA 1N0WA 1R9MA 2PUAA 5EE1A 2FP4A 2GZ2A 3M9LA 2W8ZA 5EKXA 3EXHC 4I50F 2NYRA 4UOQA 3M1LA 4GPBA 1N8TA 4BFVA 1ORDA 4ZU6X 4IJQA 721PA 1CU1A 4KI7A 4DR5B 2FVYA 2GFQA 1Z36A 4ZC8A 1BAPA 3GYBA 2IEBA 2OWDA 4OHRA 3EAGA 3IUJA 4LJLA 4BQFA 4OKNA 3U19A 2EYQA 2G82A 3OLYA 2IIBA 3GELA 4AJLA 5B2FA 2QTCA 3NEPX 4MGEA 3CUTA 4GU5A 4ENQA 3G9QA 5JCPA 5G1PA 4X7MA 1IWPB 1VYVA 2O2XA 5D7BA 4PYRA 1QH1B 3AR7A 3DT6A 3SHQA 3U4AA 2GZAA 4NABA 1I5OA 1T2UA 1T2NA 3FFWA 4G37A 3QTLA 1DJNA 3B3JA 4L16A 4YHBA 4F0JA 2RH4A 2MJLA 4JI2B 2CLCX 1GV0A 2P30A 3LUAA 3QYAA 3VGJA 1JWAB 3Q5DA 4EYOA 5HVNA 1CRWG 5K9ZA 1LK7A 4YMIA 2J0UB 3HM2A 3GLGB 5BXQC 1WLYA 3C39A 1U1FA 1Q19A 4QTTB 5EGNA 4E6PA 3KEGA 1Q1BA 1UJ5A 3DV2A 3GEEA 4ZOQI 1MB2A 2UUPA 3H6KA 3PQ8A 4JN6B 3AL0C 3EBOA 4IX9A 4URUR 2JAHA 2VXCA 1Z88A 2BC9A 1R0RE 1XZAA 2BHSA 4GMDA 3WSTA 1C0EA 4EX6A 2JFHA 5KTKA 4YMTA 3WSVA 3UK0A 2GAIA 4KL8S 3UH0A 2X6RA 1Q3KA 1ZMTA 2VDLB 4RE6A 3RS7A 5HKKA 2LP4Y 2FUKA 4MJ7A 3SE0A 3GCGA 1W0JA 3IMKA 4QPCA 1JKXA 3U0VA 3KYIB 2I3GA 2JI7A 4OYHA 5CHEA 2ZRGA 3RG2A 3WRXA 2XTZA 1RD4A 4J3FA 5KOJB 2QTHA 1FDTA 1KI7A 1L8OA 2ZI5A 3HKCA 3LSTA 2IS1A 4Z0NA 1Q0PA 2BR5A 3N0RA 1IVSA 1EWVA 4TXHA 4R2JA 2IXBA 5AXAA 4DDKA 3OZVA 5FPYA 3IMEA 4EHJA 5A04A 1HDRA 1GITA 1QGED 1RE0A 1XV5A 2Y99A 4IDDA 1RQRA 3R23A 4NF2A 5TGTA 3ADCA 1AHHA 1J39A 4OV6B 1JW9B 1TYEB 4A0RA 1NW4A 4L50A 2G71A 3X2FA 3IPYA 4EA9A 2IYXA 1A76A 1U04A 2N9UA 3HU1A 4OK5A 5EEGA 4MVJI 1QQTA 4G2NA 5JSZB 4POOA 4ID9A 4QL3A 1X14A 2AF4C 2EFYA 3F3MA 1XD2B 4BVLA 4GI5A 4RGYA 3EW7A 1U3DA 1OI7A 1CY7A 1YCDA 1Z39A 4J29A 3PE4A 3S2SA 3VPGA 4EY5A 3DO8A 3RH0A 4XIJA 2NXJA 4WEQA 1CUYA 4QQKA 1OUMA 4F2PA 1KP2A 3KSDO 4OGFA 1G8MA 3NFYA 2QRHA 1QIEA 3OPNA 3A4IA 3EGEA 4GWKA 4MZXA 2BWJA 1NR5A 4UEWA 4UJ5A 4X8LA 3C8HA 1WXFA 3D6UA 3MQFA 3PDCA 3GDOA 4CHGA 5MGNA 1E6MA 4I5DA 4G0VA 5CB0A 4PV7A 4KREA 4W7HA 1RHUA 2ZRMA 1XMJA 1VPEA 1OZFA 4F3CA 3Q7QA 2IXFA 2P3SA 2Q3EA 3VKGA 4LE2A 5CFNA 4MXDA 3ZS9A 2AK2A 3GRFA 3O21A 2NV0A 4EDFA 5IHXA 1L7VC 1U0OC 1XVIA 4FQ5A 1E1QA 3R0IA 4OXRA 1HMYA 4HL6A 4PZZA 4D0RA 2CN1A 1JIVA 4J03A 5HGJA 4LYFA 3TWOA 2UXDB 2XUPA 2FOXA 3D2CA 2E18A 1XZPA 1JL3A 5DF1A 1D2RA 2DPMA 4C21A 1ZIDA 4L74A 2OZVA 4CM7A 2WVAA 2JA2A 2EAUA 2WDZA 5DX8A 1ZN7A 3LU1A 2VOEA 1L5SA 1LK0A 5HS4A 1CY8A 3GA7A 4RH3A 3RVOA 1L3IA 1BX3A 1F6BA 2Y9PB 1IOVA 1YXMA 5DVZA 4CNQA 3R5TA 3U40A 2ORWA 2ZJ1A 5JY1A 1MAAA 4I36A 2O23A 4J16C 4ND1A 2A1IA 1B8NA 4PSVA 5DM0A 1XNJA 3ZYCA 1Q7BA 2XHEA 2RE8A 3G0HA 1FX1A 1H1LA 3GWZA 2FWMX 2O3QA 3DOIA 1DFIA 2GRJA 1X7WB 4TSFA 2XQJA 3DEFA 3RAJA 1JDTA 4C4TA 3WLJA 1MHPA 1UF9A 3JRXA 5CYGA 3DZJA 5ALXA 4RHFA 4XGNA 5A4AA 5L3QB 2ONCA 4B48A 2ZUVA 1P0FA 1V9CA 2PRYA 4GH5A 4X44A 4UZEA 5TX7A 3CG4A 1PNVA 4TLDA 1V3VA 1R88A 1HDZA 1GN9A 1GCUA 1OBOA 3MPUA 4FZ3A 3Q3GE 4KIUA 4XIYA 5CVCA 4YWHA 4BMNA 2QZ9A 2NU7A 4HLUA 4UHCA 2PMDA 1A8PA 1RIIA 2HF9A 2GX6A 4DE5A 2QPLA 5JYBA 1M54A 4QRHA 1Z4QA 4GR5A 5A1TA 5A5GA 5K3FA 1E20A 1O6GA 5E6SA 3ORHA 1EWKA 1YZUA 3ZCPA 4D9CA 4ENRA 4ZCRA 1LTQA 4AMGA 1Y4SA 2V7EA 1E64A 3FOZA 2O8FA 2ZRDA 2TMKA 3KLMX 4NWIA 3BSWA 2HHJA 1I7LA 4C4YA 4WKGA 1DCTA 3IOMA 9ATCA 3HSYA 3M70A 2D00A 4ETWA 4IQ4A 4NKRA 3E4CA 4K9OA 1R9NA 5HZMA 5K0CA 1RHJA 2XYGA 3V7FA 3TXXA 4P38A 3QVXA 4G5SA 3K4QA 4OH7A 4EHBA 3V32A 1XA3A 4YP5A 2VF2A 5F7JA 5IK2D 5TQ2A 3EFBA 1Y3BE 5FWYB 1LFDB 3OZRA 3X1MA 4QYMA 3WLTA 2WJPA 4EB8A 4JUAA 3IMCA 1Y8ZA 3EEBA 4ZVOA 3DKPA 4IBOA 1DBIA 2XA1A 1FU7A 2OILA 4UBNA 2X8JA 1WHTB 4DSUA 3DZFA 3M6IA 5F2OA 2LR0A 3IXQA 2UZAA 3TZEA 7YASA 1W93A 2C2ZA 1T8YA 1NP6A 2QX4A 1GYQA 4NBKA 1E32A 2QNRA 1ZS9A 3QEKA 4QO7A 3G82C 2O3TA 4EJFA 1K27A 4MUJA 4Q4JA 4F8EA 4FJ0A 5BUCA 4BLPA 1NN5A 1BHSA 5FCDA 1GPWB 1T36B 2J5QA 3U7RA 4EMBA 1Y9EA 2M1ZA 3ES9A 1BE6A 4OMCA 5K8JB 1W19A 3BILA 4OLAA 3I9NA 5L3VA 1J99A 3DW1X 4EG6A 2VK1A 1AA9A 4TTRA 5F64A 5I7HA 1HQKA 5C1DA 5I7UA 4GPAA 3S8MA 2PGDA 3MJRA 2QTAA 4AULA 4C0KA 1MH1A 4CV1A 4YVFA 2OAQ1 3KUUA 4NV1A 3JQ7B 4FFOA 3UJ3X 3OM8A 3DKVA 1DAFA 1CYEA 4TV9A 2CLEB 5ER6A 2GPWA 1PX0A 1QH8A 2JAQA 2WUVA 2DECA 4MRVA 3P0EA 4OSOA 2QLTA 1ZCJA 3NJ4A 4DWJA 1SQGA 4HWRA 3N0VA 4XYLA 4AO7A 4WKBA 4HNAA 1L4EA 1QZUA 4ARUA 5CCXA 3RU7A 3S2EA 4O4JF 2HUPA 3F7MA 2MINA 1H8ED 2B4TO 2OAP1 5CH5A 5J63A 3K72B 3F9CA 1E1RD 3O7MA 1G21A 2FWIA 3UUEA 4QGSA 2A78A 2RAUA 2ZREA 3L18A 4V0NA 2G80A 1ADYA 1P3Y1 2X8WA 1X94A 4LMPA 1KYQA 3IC5A 1ZJZA 4OU4A 4RSMA 5J23A 4I4IA 2XVXA 3UHJA 1KI4A 4I1UA 1Z18A 5JNRA 5JS7A 1JPVA 5K0BA 5D6OA 3BAFA 2WABA 3VTKA 2Q62A 3NRJA 3DKRA 3OBBA 4R8RA 1SBYA 3MS7A 4B47A 1AKWA 5FUBA 2QL5A 2QTZA 2C57A 2YHIA 2OECA 3AEQB 2PLRA 2Z6AA 4OBEA 3I73A 1EGVB 3UJCA 1XYYA 3PC7A 4BNIA 5FJJA 4P93A 2DLNA 2FDXA 4PANA 2PX5A 3LFTA 1PL8A 5DO9A 2QRVA 1F2UB 3GAZA 2ZIVB 3KOWA 4PAOA 1TC1A 3RIMA 2H1FA 1VIYA 3MCWA 5K6AC 5EZYA 2OHGA 4QNMA 1ZIOA 5L7YA 3UWMA 4Q15A 1Q74A 2CXSA 4R3NA 1U6KA 1ZOPA 2GTHA 4ZICA 3IV7A 4Y6LA 1VZ2A 5GINE 3KQKA 1J0BA 1YVDA 3L04A 3EODA 4JLVA 4GGOA 2PJZA 3H87A 2D4HA 3B1WA 3SBXA 3R3WA 2OP1A 4DIMA 2JARA 5IXYA 2UV8A 2JW5A 3FVRA 4U7HA 4DVGA 1QSGA 1XP5A 4C7OB 2HTEA 4MUXA 2JDID 1SWWA 2L82A 1YMUA 2NACA 3DLCA 1JBQA 3OPYB 4KQXA 4ARZA 3G5UA 4CR6A 5EE5B 1M6NA 1N5OX 1TUIA 1NBHA 3FNRA 3JWIA 4X8HA 1XFAA 2SCUA 2NUTA 2C92A 2VRCD 1M0TA 3ZC3A 3IGFA 3KM0A 1JBKA 1DMSA 2QTLA 2B5WA 2V4MA 4LDAA 3A06A 1O8BA 4G0UA 4LGYA 4BQPA 1KKUA 4L08A 2R1ZA 1NVWQ 5CA0B 1HO3A 3F49S 1CULC 3DHNA 2DH6A 3MMNA 4I9NA 5BSTA 2HO4A 3SG0A 1XQVA 2E4AA 4MS4A 2ZJ6A 2AI1A 2ZGVA 3RT1A 4B6QA 4HQNA 3VDQA 2XWSA 3UA3A 5GIOE 1AGNA 1ZM2A 1GSAA 2FMUA 4PW0A 4YB8A 3CR8A 2DTEA 1ULSA 2H00A 4MWBA 4UVHA 1GSHA 4FHEA 2HBQA 1I8TA 1E79D 4N03A 3Q8MA 2IV3A 4B7ZA 3A4YA 5DNCA 1XO1A 2Z5GA 4OP2A 1FS4A 5JHGB 5CJJA 1ZI6A 2O2EA 5IKMA 4Q4CA 4NZNA 1ORRA 1HSOA 1W5SA 1JALA 3DFUA 1VECA 1WLSA 1CF2O 2W2KA 3ESXA 1M5RA 2CNBA 1K6JA 3L49A 2G7MC 4RESA 1ESMA 3IXLA 2FWRA 2ZIWB 4HVTA 2H57A 3PHLA 1F4VA 4JV5B 5AUNB 1WXQA 3LUBA 1O0BA 1VJDA 1E1RA 3ZDDA 4CF6A 5KHAA 4EG7A 3ICEA 1NUUA 3CLKA 2W6JD 3PUVA 4JLJA 3ZEIA 3WQRA 2GN9A 3CH4B 4EQ6B 2VJQA 3BGWA 4Z9YA 3W8NA 4RCYA 2BMEA 2VOJA 4RZUA 2YWJA 2WZBA 4DLKA 4JXXA 3STHA 4KQFA 4ERXA 1AIPA 5B3KA 1WZ2A 4PQRA 1TDJA 1WOYA 2F9FA 4NFYA 4TLEA 4CDGA 1LXCA 3PFBA 2ZKLA 4HAIA 2V7XA 5C9ZA 2AZ4A 4WN9B 4LWQA 5FWXB 3JALB 3FIJA 4H3HB 5JHHB 5ECDA 3VR5D 2QR5A 4DCMA 2FW9A 2QTTA 3DE2X 1C7IA 3U26A 2JJ2A 2IEDA 4DG5A 1VLMA 4QAQA 1S02A 1F0YA 1IEXA 3IURA 4G8CA 5AHWA 5AJXA 1G5HA 5M2QA 5B58C 2PEYA 2NZJA 4MJLA 2ZIUB 2IYZA 3L2OB 4L8LA 3RJMA 1SXIA 1Z5GA 3AXTA 4M8IA 3ZHSA 4BMZA 2A92A 2HEGA 1EQAA 1ULTA 1Y1SA 3O4FA 3LWBA 3OE1A 1UQRA 4DV0B 2BFFA 2YJZA 1AJEA 4B33A 2Z5VA 2DX7A 1HDXA 4LQ4A 4A2PA 2AVNA 1WKVA 3O94A 4X1YB 1XQ1A 4JB3A 4Y2HA 4IMPA 4QFMA 2CDNA 3DVAB 4TRMA 3UPUA 2XYRA 1O5OA 3UBTA 4U3JA 2G63A 1G20B 4O33A 4HCJA 4WFKA 2C5EA 1VJCA 5AK0A 5FD8A 5JXGA 3CSDA 4NEHB 3AUJB 4QDJA 2OK8A 4RK4A 1LRLA 1CUUA 1Q6ZA 1U65A 2R84A 1XZHA 2HZ7A 3DDWA 5TSDA 4AS2A 3ZDRA 1ZGBA 2YHSA 1KAHA 2GVZC 3MSCA 4R1SA 3CVVA 4OIMA 1JQJC 2JL1A 1WS6A 4YRZA 1PFVA 1M83A 1NVUQ 3GOQA 4AXXA 4LCEA 4D0SA 4BRWA 1Y42X 1YHNA 2V74B 4YCAA 4BLOA 4WOCA 4OQEA 3JD2A 4JFRA 3KP1A 3IE1A 3WGMA 1KY2A 2AB0A 3P7MA 4RWZA 4RZSA 3GWGA 2RCNA 3L4SO 4QBHA 2PZAA 4K03A 3SQDA 1JU3A 4OJQA 4RVGA 2E87A 2W4QA 2UYQA 5AW1A 1HT2E 2FRVA 1Q5PA 1XTKA 3LUCA 2W8BA 3AUXA 3J7TA 4HDSA 1XR3A 3ABZA 4QYWA 1JILA 5ALWA 4R2KA 1I1OA 5TT1A 3NS7A 1MA3A 1Z8DA 2P9JA 1XK7A 2GESA 2HPVA 3UANA 1MQ8B 3BDVA 2ZTUA 4PSKA 3H19A 4D25A 1IMOA 4ZVQA 3W06A 1C8VB 3ETLA 3HKBA 3BWBA 2O0JA 3HH8A 3HQ4O 3IHTA 4RVOA 3MINB 5EUQB 3SI7A 5KWVA 5CFPA 4CFZA 4MGYR 4QVKA 1XJCA 3SVZA 1N0IA 5KX5F 4RLFA 2J3JA 3EFOB 1S4QA 4IRXA 1THGA 2Y1LA 4G1MB 4MMZB 3UEOA 2H51A 4IIVA 1XWWA 3LMKA 1E94E 2HA3A 1JFRA 1PBNA 1RLMA 2RAVA 3GJYA 4D74A 2R47A 4J6EA 4U2BA 3FI0A 2WYOA 1QG4A 4U2DA 3VRHA 4FOOA 5FLYA 3W1WA 5CNKA 5L3SB 1UQTA 4Q48A 4BKQA 1ZPDA 3CLVA 3F46A 4G81A 2X8LA 1QO7A 1VIAA 2B4KA 2FUCA 3FFXA 4LHWA 4Q66C 5HF6A 4TZTA 3D5EA 5JS2A 4F7DA 1EIWA 2E55A 4W9NA 1ECBA 5AI5A 1JKMA 4BAGA 4CDRA 1LSUA 5HMLA 2WVJA 4AF6A 4BHTA 1E92A 1TZMA 2JAOA 4MVJA 3EA0A 1VFPA 4EF6A 2ACWA 1GVHA 2UVPB 3E23A 3EZ6A 4U9HS 4UDNA 2NVUB 3WWEA 2VP9A 4AX4A 1ADFA 1O94D 3RVMA 2JASA 2IPLA 2CJFA 3RR2A 3DMGA 2XT6A 1VKHA 2NG1A 4CTMA 1DE0A 2WU0A 2HXGA 1P60A 4E88A 3ZVMA 4OVKA 1EE2A 1M34E 4IDQA 1YKFA 2WJHA 2YY6A 1G3IA 1XMSA 1GAWA 2O8VA 3F5MA 3HKCB 4PGHA 2GPBA 3RS2A 4JNCA 4F9GA 4G4SO 5B12A 2O3JA 3PV0A 3DEHA 3MBIA 4OQ4A 3LBYA 3QVKA 3DMFA 4QOJA 4S1WA 1DMRA 4XVRA 3DTYA 2X5JO 1NXWA 4FN4A 4EHKA 2ZIXA 4PG7A 2NW6A 5TEWA 5AVUA 4F04A 1XCPA 3G2OA 2O20A 4QT0A 3RADC 2J8ZA 2HLHA 3NOXA 3PIRA 5K09A 1E9FA 4LOAA 1XBTA 1ZMRA 3TZHA 4IIFA 5T6BA 5ESWA 1RXYA 2XDYA 5LSAA 1VG0B 4RENA 1B23P 1QOZA 3TLYA 3VHRA 5T7BA 3JQ6A 4CZ2A 2A59A 3K73O 3ZHQA 1YI1A 3GLFA 3BPSA 5DN9A 4HLCA 5C7IO 5I9LA 2XHZA 3G0BA 1C80A 1E0AA 3LQKA 3DLTA 1OX4A 4Q4AA 5ALHA 3REQA 4BFYA 1OYOA 5IMBA 3RYFA 2Y05A 2ORVA 3N5KA 1M7HA 1YVUA 1B0PA 2CXNA 1IPHA 1KDZA 1JKIA 5J5CA 3FUVA 1R6AA 3TZCA 5HIAA 4RXUA 4MLDA 4FB5A 4RTJA 1PJ3A 2KI5A 1TAQA 4ALLA 1RPNA 4QPDA 3UK6A 1CUBA 2OVBA 4DIDA 4GDFA 1MGOA 2JGFA 3HJCA 5HK9A 2DCUA 4M0CA 3G6WA 4XVQA 4EL0A 1FUIA 2C1XA 4OOEA 3ETGA 2ZZMA 2BBOA 4IDNA 4Q7JB 4KR0A 2VHWA 4KDRA 2HK6A 2XH8A 5ED0A 4F5ZA 1W49A 2P9FA 3SEFA 1AXEA 2EX1A 2VCYA 3DL2A 3FMGA 1JLRA 1NPTO 3O1HB 5HGXA 1ESZA 2NIPA 4K3VA 4BLWA 4KR7A 4RMNA 3BMXA 1XZIA 3UT5A 2RFLA 3K8QA 1T3TA 4HB3A 4R16A 1PHRA 1M8JA 1EB9A 3KKPA 4TX1A 2OFFA 4HDNB 1E5DA 4J7CA 1WABA 2WY2D 2VSQA 4XTRA 1CRPA 1Q1AA 3T4PA 4IDPA 4BBAA 1E1QD 3UJ6A 2J33A 4G5FA 4BEJA 4W8HA 4H1WA 3PD0A 1Z26A 3E9RA 1JLLA 3JRWA 5IJZA 2I7VA 2GNPA 3QOFA 2HO5A 3LRTA 3RODA 1F7VA 1Y3AA 2ACKA 3K9FC 2D5CA 2B4QA 2D1YA 3PTLA 1ZBQA 3D4OA 4C07A 1NN0A 1W85A 4IQFA 4MHSA 2PT7A 5F77A 4DM3A 5LN1A 2E3JA 1P4RA 2BM0A 3ITKA 4IEEA 4JIGA 4LZWA 1KFBB 1Q1ZA 4REMA 4GKKB 1EGHA 4L7QA 3SBEA 5CVTA 1XJ0A 1XJ5A 4EGAA 4M98A 3AB3A 1G17A 2HA2A 4MQ4A 5E4YA 1WPRA 2V98A 4JK3A 2ZZNA 3RU2A 1WPXA 5TQVA 4JJ4A 3BGDA 4S0ZA 5HTKA 2Z9DA 2W2NA 5JNSA 1QYCA 4NBNA 3IVAA 1E6LA 3WAKA 3ENVA 2C5AA 2P5UA 3WGGA 4CMBA 1P4HA 4FHCA 1T9AA 1EJ0A 2NQ2C 5A6SB 3IHKA 2A5DA 2J6IA 4GLLA 2JI9A 2I6QA 2PUTA 3GVIA 3HRHA 3LWDA 3ME5A 4W7SA 4NNPA 1YS9A 1AXRA 1ZC3A 5HRCA 1D6JA 2GH1A 1G6Q1 1UDRA 2P3LA 1OWOA 2XXJA 4M22A 4ARBA 4CIDA 5YASA 2O5VA 2TMYA 4FGZA 1TVEA 3LJKA 2WKQA 1NJ8A 4L28A 2YCBA 4DZRA 4BO6A 5K0TA 3H2GA 2QSUA 3T3MB 4RGBA 2JFUA 3I1FA 1FLDA 2FPGA 2I62A 4FNMA 4Z4GA 1P6QA 4OLBA 1Z7EA 3DOOA 3ZBPA 4IGAA 1ZVVA 2P0EA 2ZBPA 4IDAA 1DBVO 4RKFA 5GWXA 2H1WA 2XKKA 3SCZA 2B35A 1I3KA 4YPOA 2XLBA 4V38A 1M1YE 1QFZA 3TL2A 3V1KA 4DY6A 3T9FA 2ZQZA 1UKBA 1H5QA 2WT9A 1KBQA 2VF7A 4D96A 1MBZA 2C0QA 4P58A 5JXHA 2V7GA 3C14C 3CKKA 4KH0A 5E6SB 1VJ0A 2EJUA 2QJOA 3N8KA 4U7GA 5I7WA 5KJ6A 1PWYE 2EBFX 2OBBA 5KI6A 2FSUA 4PLZA 4D8YA 4PZ0A 1BCSA 1U28C 1U2SA 4URYR 3H0KA 4F2DA 3S70A 2Z8ZA 4GZ6A 2WTBA 3JQPA 3MC1A 3TJZA 3U3XA 3HPQA 1ECLA 2O2HA 2Q4TA 2G9ZA 2B0JA 1SCAA 2VNIA 3FB1A 4MRSA 4PYJA 1G9SA 5A2GA 5GPBA 4HYTA 1N5IA 1DUVG 1LDBA 1U6JA 4BIIA 2A67A 2DKOA 4UBJA 3JTEA 4D1YA 9LDTA 2N47A 1TK3A 3SC6A 3KU1A 4LC1A 4TRJA 4YX9A 4Q7QA 5JY6A 2O5CA 1P4GA 2VAVA 5H70A 4TRRA 2CFSA 2GLXA 1YT5A 1KZGB 1BXGA 3AF5A 2RMKA 3FNBA 1D2MA 3QF4A 4GNKA 1MV8A 2J6HA 5TDHA 3B5IA 3L1VA 1AQIA 3PQ7A 4FW8A 4F56A 1L5RA 3GQBA 1DT5A 2QUIA 4PBRA 4LE0A 3SOPA 4NY1A 3W6UA 1UPCA 4BMXA 4EW6A 1BEUB 1IN6A 1GNQA 1GFZA 2JFGA 4Z86A 1T4GA 4KMSA 2NUBA 1HA3A 3UJDA 3O92A 4K6FA 2QVYX 2XW6A 4TMFA 5TPZD 4GWLA 2DKFA 1CJUC 5AJTA 5EY5B 4DAOA 1S89A 2ZYHA 3B85A 2AOXA 2FZ5A 3HBJA 4D4IA 3AFOA 2GCGA 2GF9A 2OHOA 4IOKA 1I4EB 2ZRLA 5HJ7A 2EBUA 2RGCA 5K7SA 1V45E 3R6DA 3LQYA 2JS7A 2IHYA 1CVIA 3CF4A 4FHZA 2X4LA 4GGPA 4Y9RA 1J42A 1DTSA 2GR9A 3HDVA 4JT8A 3B70A 4ZA2A 3R7LA 4C20A 2QM3A 4MMXB 3D1VA 2XMBA 3UGTA 1QR2A 2ANBA 4NU0A 2RHOA 2JJ2D 4E7PA 2PU7A 3R3SA 3EVFA 1GCAA 1NURA 2A0YA 3A1EA 2RGBA 1JAYA 3C87A 3VUEA 5A62A 3GJ0A 4YRFA 3BD9A 2WC1A 3OBIA 5ER9A 5IARA 1PCXA 3ZR4B 2X0JA 4DQVA 5AW0A 3UT6A 4L0QA 5CM9C 1XZMA 5KQPA 2JLWA 4C0BA 1K9SA 2QVGA 3VNAA 3ZWBA 1C2YA 1AA6A 3F74A 4JSRA 1KEVA 1YONA 4WW0A 4E32A 2AKEA 4UPVA 4IDBA 2Z2YA 2W2QA 1KOFA 3QU5A 1XB2A 4A15A 1S8NA 5TPWA 10MHA 1IXRC 3IUYA 1MX9A 2VI5A 1TGYA 3BDAA 3DAHA 4MIEA 5FDFA 1SXJB 1FMCA 3C1AA 3U39A 3WJ1A 2PWZA 2LCQA 1X7GA 1I36A 4TUYA 3GLQA 4IWYA 1RJWA 1GJRA 2ENWA 2PSJA 1PS9A 3LKZA 4OATA 3JALA 1LC3A 4ZYTA 3CB4A 3G8BA 4CKXA 1IAQA 1M0EA 5CVVA 4Z0HO 1H1DA 3W5UA 4B32A 5D5PA 3ZIUA 2AN1A 1X8XA 3VHXA 2FLVA 4UM5A 2QT9A 3AZOA 3K4HA 2BJWA 1Y48E 3KX2A 3N8DA 4TS9A 3G79A 1BWPA 1AY0A 2BRUA 1CZLA 2FA9A 2VNSA 3WRVA 4R41A 4MUAA 3H84A 4NJEB 5EHNA 4CM3A 1HLDA 2H0RA 2H1RA 2BFEA 3GLHE 4ER3A 1X1CA 2JDIA 4GIBA 4O4JA 4K88A 4HT3B 1CY1A 1FMLA 4JI1B 1I0ZA 5DYTA 1E5VA 2C9ZA 3FWKA 1JDNA 1F3LA 4K9MA 4L4RA 4QOHA 3WB0A 1C0LA 3ABQB 4S05A 5DZSA 3PNOA 8OHMA 1NA5A 4KU4A 1FVFA 4PTLA 3GAAA 4G01B 1O03A 1A4UA 4ZQEA 3ND5A 3H5NA 1U2PA 2HJHA 2A9QA 3KB6A 3CUSA 3NM5A 1MFZA 1UM8A 3SX2A 1LS1A 2GAFA 2QB5A 3KQOA 5B6IA 3HFRA 4MS4B 4CETA 1O4VA 4MP8A 2XA2A 5DHRA 3JTMA 3IEKA 3GD7A 1JR6A 1NWCA 3VO8A 4CMHA 4KAJA 1FXWF 4QOGA 3V46A 1TX4B 3PVCA 5L3SA 5LP6F 3ETJA 3IP1A 2NVWA 3EGVA 3EUAA 4MVJH 2BISA 4NK4A 4ZJUA 1J9EA 1PP4A 4DA8A 1NLUA 4BBZA 1KYVA 1QH1A 5ECYA 1CR4A 1NQAO 4DMFA 1PQPA 4EATA 1VPWA 1K5PA 3K70B 1M8KA 2H4HA 3TNDA 3PFIA 1ACJA 3B2NA 4DF3A 3Q2KA 4UXHA 2B4AA 5EP4A 1P1IA 3EE6A 3H6HA 1N6RA 1EHYA 4FYVA 5IVIA 3DTVB 3LCVB 3PUYA 4PX3A 5D6NA 1AS3A 3ZZNA 4AJNA 4XKJA 1YZTA 1RPAA 1LDGA 3BD6A 3D4NA 4YH1A 1ZI8A 3F6SA 4JELA 4ZGBA 1Z7GA 1NW5A 3GUHA 2QMEA 2F1JA 4IHQA 3IEMA 2BRUC 1KQFA 4QGHA 4II3A 1TUEA 5F5LA 2XUDA 4LMBA 4C3OB 2AI3A 3PUHA 4FFRA 3NBUA 1TEVA 4NLLA 4R8SA 1NL3A 5T4HA 4AN1A 4XVCA 3A8TA 3ESYA 3OMXA 3ICQB 4CKCB 3BICA 4OEHA 3D64A 3IAUA 3LYHA 5BSUA 3PSHA 3ZN2A 3ZQJA 1SEPA 1B2RA 1KK1A 1W94A 3OWOA 5LOVB 2H18A 2WHPA 1P9NA 3LC0A 3QV1A 4PYMA 1ND6A 3RVRA 2R6R1 5A3JA 4IRUB 3U17A 3HPRA 3HKBB 4CLEA 4YCLA 5ED4A 2UUBB 3T4EA 2A9KA 4XDHA 2FGKA 1PZFA 3HJUA 2J4CA 4DB4A 2XBMA 3H7AA 1SVWA 3S44A 5KS2A 2X9QA 3IE0A 3FETA 3PJEA 1Z4NA 2DB3A 1CRLA 3PDIA 1KQOA 3AJAA 4BNMA 1GZ3A 5GVRA 4I1IA 2WIGA 5IVDA 1NXQA 5KKAA 3I5MA 4QLOA 1QGAA 1UWLA 4CJXA 4R6WA 2JANA 3ZOKA 3CLHA 4L5JA 5DYIA 3SYKA 5A0VA 1LNZA 3FZYA 1W35A 4FFBA 3T3PB 3TQSA 4DWOA 1NJ2A 2ZRFA 1P74A 2VJNA 1P5FA 1XRPA 3OUUA 4Z4FA 4C43A 5IKPA 2GZ3A 1SCKA 2BKXA 2YFKA 4K28A 4IIJB 3TW8B 2B36A 1V71A 2LIPA 4H31A 4FD3A 2XKJE 3OCVA 3DMNA 4A03A 1UXKA 1DAIA 3D7LA 2FPIA 3KETA 4N5DA 2DERA 1S3SA 3BRSA 1RLJA 1YDEA 2OHXA 1GPDG 2IYWA 3H86A 1NHWA 5D87A 4OI1A 1EP1B 3OOHA 2PA0A 1R66A 3KEMA 4JBNA 4WOJA 1LI5A 4MV9A 1T35A 1N7HA 1R2QA 4XSHA 5TVKA 3E1GA 2C2KA 5I7FA 3SM3A 3BERA 1FLNA 4A0QA 5ITZB 4P54A 3ZD6A 2G04A 1PUJA 4WBSA 5PGMA 3G9XA 2DFNA 2HUNA 3UH1A 1HLPA 1UK9A 3AR3A 2A58A 2XRMA 3VZBA 1QOPB 2FUG6 1VB5A 1AH2A 2DUWA 1NF2A 2RKOA 4JT4A 4WESB 5IJ0A 4H77A 4B09A 3U09A 1G9XA 2FN4A 2NSJA 3H13A 3ZVKA 1U2QA 4O0LA 2R9VA 5L4SA 4YCCA 3VZCA 3IAHA 4ZZ3A 4OGLA 3QP9A 3VVLA 5FTKA 1KMNA 2QD2A 2NYUA 4BASA 1ZKDA 5C4IA 4LSZA 5F73A 2OD2A 1MRSA 1DG9A 1T5DX 3V4LA 4EUFA 3CINA 3N2ZB 3BC1A 1SIUA 4D4LA 2XOEA 1PWXA 5P8WA 5EUCA 4F4CA 1LTKA 2YUIA 5JSYA 3AFIA 3B1KA 3PX3A 4CQJA 1UR5A 2XUKA 3BWVA 2PAAA 3M0EA 2XUIA 3WZLA 3MUNA 3EGIA 1Z5OA 3BCUA 4IJ6A 4EECA 1NYQA 2QIPA 2EP8A 2VSNA 1K08A 2ZDGA 4PFQA 1QBKC 2NLOA 2GN2A 1OF1A 4Q34A 1EFPB 1VSTA 4FPXA 5EQDA 3USCS 2DLCX 1P4JA 3IULA 1NE7A 1QYDA 2RGXA 1F8YA 2BLLA 4G41A 1HBJA 3WMXA 4BN4A 2OCLA 5H4GA 2YJGA 2O7QA 3ZDCA 3QELA 3NEJA 2QAJA 4HTAA 4IX1A 1PDOA 2JLCA 2AE2A 1MQ9A 1QYRA 3RS4A 4PG5A 2JFPA 4IIUA 4KHZA 5K0FA 2JIZD 2KS6A 3IVGA 2DTXA 4J2TA 1KI6B 8AT1A 5HIKA 3JR7A 4R0MA 1ZAKA 1L6IA 2XUFA 1BKSB 4YRQA 3O8DA 4D5GA 4V1CI 1ATIA 2V0CA 4RDIA 4BBJA 2VIIA 5FAXA 3MK31 1XZJA 2OCPA 4RJ2A 3C3DA 3CRMA 4TT3D 1VIVA 2AG8A 4ZAZA 5JSUA 4OBXA 1YR1A 1BTOA 4E15A 5DBHX 3C3AA 2YIJA 4QTUB 2REQB 1RWWA 2YBEA 2BN4A 1LLDA 5LQMA 5JWHA 3M4XA 1L7QA 2AMJA 5LZ7A 1O0SA 1PNRA 5CIWA 3F9RA 3TIIA 4MKHA 3WL5A 3EXEA 3R5KA 1KAQA 4OFXA 4E09A 2F2TA 1VBMA 1YUMA 2WTXA 1KZ7B 2AHRA 3DEAA 2QUBA 1FX0A 4X92A 5G0SA 1OZHA 1YVRA 3EZLA 1OFVA 3LPNA 2CKMA 2GUWA 3JD3A 4IUCS 4RPLA 3WB9A 2HKIA 2C97A 2YV4A 3IVCA 3KVYA 4OBBA 4W1RA 1NOJA 1USGA 1AK2A 2J41A 4HWSA 1P7PA 1S2IA 1K92A 1IWOA 2VRBA 3MT7A 3C4QA 3S55A 4BNLA 4BNVA 4NDZA 4UDXX 3KB2A 4WA8A 3IAEA 3V1NA 3ZE7A 1GOTA 2J5BA 1QORA 2IYQA 1SKQA 4KFTA 3VDMA 4GMKA 4UZSA 3AF6A 1XLVA 2ZJYA 4LI3X 4B2PA 2R65A 3Q88A 1N5DA 3NWOA 3SC3A 3T0FA 4DLTA 3H8SA 5G2OA 4EOGA 2YVLA 1CZHA 4GZ5A 4URXR 1KE2A 4OLHA 3CONA 4DSNA 3BWEA 4LFCB 3W4KA 3ZHBA 4IF4A 4AZ0B 2JFBA 2NTNA 1FOEB 4JBWA 4ZN6A 3T3DA 1LLUA 5EJ8A 1WDLA 2MTBA 4M8KA 3F2IA 3VMFA 3B7PA 5EMKA 2YV3A 1DDGA 3E3LA 1T2DA 2AYZA 2ZYUX 5K3BA 3HC7A 1SOAA 3BRWA 2M6KA 2R66A 3FPBA 3VBEA 3AVQA 3EXG2 1V8DA 3WWOA 2W6MA 1EUDB 2WWRA 2CK3A 3KSBC 1KXZA 1OBCA 121PA 1ZG3A 1X1RA 1XTTA 1I2CA 1ZXXA 5HP4A 3PFNA 5ALUA 3S8EA 3FSGA 3BFKA 1HL7A 2GNOA 1IY0A 2HPAA 2VHYA 1C7FA 3A05A 3RSCA 2OR3A 3FPKA 4C1NA 3ASUA 3Q5GA 3WZMA 1SUAA 4WZBA 2JFXA 1TT7A 3A9TA 3CLRC 3ELDA 2WTUA 3LBHA 3V33A 1NFQA 1RYZA 3AETB 3IOCA 4X61A 2VF8A 3EC2A 4JR1A 4KUHA 5I7VA 3THWB 3NV7A 3Q2OA 2DM6A 1PSDA 3V7NA 2WM3A 4BFLA 2PBLA 1JQEA 2CZCA 4AROA 4BU1A 1ONBA 2QT1A 2RB4A 3AONB 1LF5A 3OT1B 2A7XA 2GASA 3TSZA 4DQXA 2D74A 3AEXA 2KMLA 4ATNA 3T1NA 5HR5A 2VQ6A 2YMQA 3EC7A 3O03A 4QDXA 4GQAA 2JCVA 4OL9A 3R7BA 4A2QA 2VZ0A 4AMZA 1N32B 4E94A 3FDZA 3HXQA 5L9AA 2BUAA 1L4BA 4GL2A 1KS9A 2JLBA 3DL0A 1GV1A 5IYZB 3CZRA 1A9SA 1H2AS 4EKYA 1OI4A 1T0UA 1G41A 1N2GA 1Y8QA 3JWHA 4F3YA 4XQ9A 1IBMB 1DCMA 4F2GA 5C2JB 2DQKA 4KR9A 4DNPA 3C45A 3PRJA 2YRXA 5KC8A 4MVCA 4H0CA 1JE0A 1Y8CA 1TKRA 1M66A 1IZ8A 1SUPA 4IEFB 4U7JA 4WLNA 2Y1DA 3S2YA 4KQ9A 4Q19A 5GMOA 1NRXA 3EXIB 1LW7A 4JYPA 4JI3B 1QG2A 1MABA 1UDXA 3I3SR 1QRTA 2ZSKA 2LIVA 1N2CE 1NC3A 3W7AA 4D0GA 5AVRA 4DYVA 2ZT8A 3IJPA 5DCLA 3OMWA 5ERXA 3R3VA 1VL1A 3K2IA 1WB5A 3I1YA 4DA4A 1MJHA 2JH8A 2QY6A 2Z8YM 3RSHA 1JDJA 1R6XA 1DQPA 2V7UA 5BNIA 4ZO4A 1RR6A 3ZLJA 4BJ6A 3KQQA 2KJQA 1N7JA 1OB2A 2D2IA 3DAOA 1TCUA 5EI5A 1I3NA 1V7QA 1XRSB 2XMZA 2H2AA 3L5KA 4BMCA 3JXEA 3WJAA 2O3RA 3U4HA 2I9PA 1K88A 4HFRA 2W6QA 1N6OA 3D6NB 1NUQA 3QEMA 2AN4A 3R5FA 5SZKB 3TW4A 3ZH2A 1CQJA 1ZHHA 4QARA 1YNOA 2PT5A 1HTWA 3MG9A 4COOA 4HV4A 3J80A 4YFYA 4BE7B 2O0MA 2OV4A 3DDOA 5E1DA 5FBLB 4EFLA 2IU4A 4HXGA 2GLUA 3W05A 3KEFA 5ELXA 3WYAA 2H9YA 1PJ4A 3SX4A 1FRZA 2OO7A 1CZKA 1K2VN 2LWIA 3IBGA 4Y2RA 1RI5A 2VDRB 3BXFA 5KJEA 4DLYA 1ZM3A 1T8UA 2RHMA 3FOFC 5CLQA 5TEVA 4JEUA 4R0VA 5EE0A 4H60A 1YB7A 4GFDA 1R64A 2PX0A 1JMYA 4HGOA 2C5FA 1RZRA 3K6JA 2PJDA 4R69A 2PLFA 3BMOA 5JJKA 3M5DA 3SHWA 3I8XA 1IE3A 1VYTA 3L8DA 5FL3A 3VKVA 3K9CA 1I14A 1W5FA 3AJ9A 4L73A 3RC8A 3SQMA 1GSIA 5K6RA 5TPZA 2EKQA 3KQWA 1J8FA 1GNVA 5C31A 2IHBA 4CL8A 3TM5A 3L1IA 2JEZA 5AKGA 2YYYA 5T64A 3T7IA 2HOQA 3BWYA 3PLAE 1RRMA 1N5JA 1O57A 1P44A 1U7UA 3A31A 3QI7A 5FYQA 1UJ4A 3HB7A 1H4QA 5DI3B 3EIUA 4BX9A 1MZVA 2CVFA 2I6XA 2FHPA 1GA4A 3AR4A 3D8SA 4TYMA 5AMXA 3WIEA 3R4VA 4BO1A 1D4OA 5DSZA 2WOOA 5KZMB 2ZSHA 3EEOA 5SYAA 1B6RA 4P31A 4XM0A 3KWMA 5BN3A 3FG9A 3N7AA 3II6X 5IHPA 3AIOA 3CJQA 5BSGA 1V3QE 1E4YA 1ZMXA 3BMCB 3JRNA 2FFRA 3FW1A 3N2GB 2GWRA 3D1LA 2J9RA 1TKCA 2WYIA 3ZCVA 1DAHA 2WFLB 3L4EA 1EFRD 4FMDF 4JVSB 3U7JA 4AQDA 3HR7A 3RRFA 1KK3A 5IDYA 4KLNA 1PIWA 4IKPA 1UK6A 1X9IA 3WWPA 3PR2B 3PYLA 1E9EA 4ICIA 4LEIA 1E18A 3L5OA 1IUKA 1U63A 4TTSA 1NRJB 1CE8A 1IM8A 4KODA 2JGLA 3KJFA 3HR8A 3MAAC 1YA8A 4JUFA 3UMRA 3WBFA 4UAVA 7MDHA 1RIFA 3K1AB 1L5LA 3U56A 1U3WA 2YNMD 5AK6A 2AJLI 3Q41A 4KXNA 2IGBA 4KPUA 4DUPA 3SDSA 1Z34A 3EXIA 2FOIA 1XELA 2H2WA 3EOBI 1CY6A 4C4ZA 5FV4A 1LPNA 4L4ZA 4MGZR 1OVMA 2PUJA 2XMCA 5H16A 4IVQA 4RACA 2R48A 4NCBA 3I62A 2QENA 5LQSA 2I2FA 3OOWA 4ZPXA 1I9GA 4Q9DA 3HGTA 4G1BA 2VYND 4X1IB 4KXWA 3UHPA 4A16A 4XGRA 4D57A 2AZXA 1ZICA 5CFMA 2G09A 3C3CA 3F3KA 4MO2A 4NYIQ 3O8CA 2BHLA 3AP3A 2HZBA 5JS1A 3LOPA 1KY3A 1XVTA 221PA 4RDCA 1THTA 4CCAA 4PYNA 1A8IA 2G9RA 4OXYA 3VSBA 4DTCA 3Q7RA 3EPLA 1JQKA 3K9LA 1EX6A 1FS5A 4KVZA 3DFMA 3UBMA 5FTNA 1LX7A 3LG2A 1M2KA 1NQ5A 3DZ8A 3HN2A 4FLEA 4IVRA 5FFFA 1BGXT 1RAIA 2DFVA 3NNNA 3QTTA 4N5MA 4ALIA 1OX6A 2IP2A 1DAKA 2QNIA 1YE3A 3PKJA 1CQIA 4JHLA 3ASYA 4KBYA 3EZ9A 4W7IA 2HQBA 2HV8A 4AYXA 4EG8A 5L4NA 4JOQA 4X1KB 2MR5A 3IPCA 4R40A 2YVUA 3VZSA 1Q7TA 1CNMA 4MV0A 4QLAA 1LF0A 5AYVA 4J0QA 3EPJA 5C37A 1FP7A 1NPDA 2AFIA 1P2DA 2ODEA 3F47A 3I9V1 4PIVA 1MXHA 4R1UA 5EE3A 5FAKA 4FR2A 1PNTA 1GGMA 1TYCA 1YRYE 2YXBA 4WERA 5HE8A 2A7QA 4J43A 1BJRE 4TVKA 3R74A 3M3DA 3JVEA 4UE2A 1W1WA 3KPJA 3EMKA 4YTEA 3VJLA 5CEEA 3IVMA 3VA7A 3IT2A 3QX9A 3FOAA 3O8QB 2HK9A 3FZNA 2NQ8A 3GRRA 4MRAA 4XTCS 1FYEA 5JYDA 1C0PA 3NZEA 4CF3A 2BMJA 4JLAA 3D4IA 3BTSA 4M0DA 1NN1A 1RLOA 2J85A 2PX4A 1QRAA 1H2FA 3KK0A 3M5PA 1Z5PA 1MX5A 4G1FA 3DC7A 3W1EA 1UWVA 3ZY2A 5JC1A 2CHEA 2CGEA 2GYUA 2O2GA 4PO9A 5LZ5A 3RBZA 5IF3A 4YACA 1GKYA 1ANKA 1K3TA 1YACA 2VPWA 3DHVA 2C61A 3I34X 3PLRA 5DM4A 4CLOB 2XTNA 2P5YA 1H69A 3BRWD 4PZYA 1RJ9B 3Q7SA 1UOEA 2JFNA 1U5BA 2PGJA 1ZH8A 3LT4A 1JG7A 1E1CA 1AKEA 5LP6A 5JALA 1GPMA 1R4NB 2HF2A 3A1VA 1X7XA 1UKZA 1FFDA 3B1VA 3LF2A 1B0ZA 3F67A 4MA5A 3QKSA 4LXXA 4J4BA 2QAIA 1QIIA 1XWFA 1YAJA 5IKEA 2NP6A 2YC4C 2IV7A 5IBRA 3C1UA 3R9IA 2IY7A 2EFJA 4P3YA 4RL6A 4A5OA 1TJ5A 5GADl 4BN0A 3RFUA 2UYCA 1SBZA 2I7TA 4OI2A 4LTMA 5H68A 1B15A 4BO5A 4GMXA 4D2IA 1YIAA 2WSMA 3P2KA 4D41A 4CMJA 1J00A 1OQAA 2KPOA 4JI0B 1OAKA 5GOTA 1GPUA 2P79A 3QJYA 5TQJA 4PZAA 1JIXA 3TIVA 1V16A 3PR1A 5IU6A 4RY2A 3CO5A 5E1MA 4EW3A 2HRQA 5A5VA 2PFKA 2D8MA 4LGCA 2R1TA 3NONA 4CMKA 1XZGA 4FFVA 2JAPA 1ZX1A 1UZAA 2ESRA 5ALZA 3COJA 2P9TA 4BPRA 1N2SA 1E61A 4DG9A 3PUXA 4R98A 4X97A 3VR1A 1T29A 3CNEA 3I64A 1SQSA 1WQ1R 2A14A 2YNMA 1I0LA 5AQEA 1ZVQA 1R6VA 3OA2A 2WNIA 1PO7A 1P33A 1VJ5A 3UV3A 4AF8A 2ZBFA 4KNVA 4GSKA 1AUXA 2F64A 2C9DA 5KCZA 3L7CA 2R6HA 3SPXA 3PUIA 3ANYB 4GR9A 5K8CA 2H4XA 1KP3A 3BVPA 4YK7A 4F6LA 5T3YA 5DHPA 2DRIA 2PWYA 3E5HA 3ONDA 4M89A 5IDXA 2JVJA 4P83A 1L4GA 3I2HA 1Q0UA 2CDAA 4TWAA 4NMWA 3FTDA 1RXIA 2OL4A 4R31A 2ZSFA 4Z2YA 3VDRA 3WK4A 5K0ZA 1BVHA 1NJ5A 2JGDB 1JAZA 5M5BA 2OORC 1ZNXA 2B4YA 3HB1A 2VDVE 1JXAA 2GJ8A 3UMSA 3ER9A 4QHTA 5GVSA 4C6SA 3CZ9A 2VK2A 3ZQUA 5IT4A 1SD2A 3ZCSA 1JX6A 3CB2A 3WZ2A 4QGBA 1Y63A 4LG1A 1T43A 3DOCA 3JARA 4OSEA 1EX7A 4DJFC 3GOHA 5KAPA 1M6HA 1CVLA 1GUYA 1KAEA 1ZY2A 3O31A 3HY4A 4GOKA 4BL5A 1J2YA 1Z68A 3PC6A 3DDZX 4ROTA 4KIWA 3EWSA 1GPBA 1GTVA 4NBTA 1Y6JA 4QBKA 1M2GA 1QHSA 1KFKB 1NOKA 1E1NA 2H3EA 2VRWA 4AD8A 4DJTA 1IQ0A 3A9SA 2J31A 5DIFA 3EJ6A 1NI4B 3AJDA 2WD9A 2YX1A 1ZFNA 3L6BA 3LT1A 4TLMB 4AMVA 2RIPA 4TN1A 1I9CA 3NXSA 4ZAWA 4R9VA 3WTCA 5LQRA 2PBRA 1N9ZA 1GUFA 4N0PA 4RGQA 2XT9A 3SHVA 3WHLA 3WMEA 4MWGA 1QKIA 1GAQA 1JPNA 1JPJA 5FOXA 5KYWA 2FP3A 2R4UA 2YWHA 2ZJ7A 3AVOA 5J2UB 3UV6A 4FR0A 5FB3A 1KP9A 1GEEA 1VGVA 2O7RA 2RIRA 1P9LA 2VA8A 2WIJA 3HCPA 4JLUA 5EJ2A 1KAOA 5EWLB 1GL7A 4BKMA 4C4SA 3IKJA 4B17A 4H7FA 4RIEA 3D5QA 4XQ0A 4ZQHA 4FWTA 4TYNA 2LCIA 4EG5A 1YHYA 1D03A 3OHMA 2MYPA 3I92A 1IWBB 4YRJA 1WXXA 2B37A 3ZU2A 2Q5OA 4LOKA 3LD9A 4MUEA 5K8UA 3AKZA 4BNNA 3SFVA 3GJ3A 1VIMA 4DUGD 5A4FS 1UDAA 1PD1A 2CDRA 2D1SA 2FTKE 2HU8A 2VWPA 2YCLA 5FULA 1IJEA 1GY8A 4IRMA 2IUYA 4B6PA 2P6MA 3PFGA 3IUPA 1YJXA 3K9GA 3AI2A 1LPSA 2GCOB 1VDMA 3OZ7A 4FE3A 4IS2A 1SZJG 1RS0A 2TSYB 4HQFA 1FXWA 4ZEVA 1C1XA 1D2CA 3BMQA 4RMGA 1GG5A 4EB3A 1HV8A 1PNOA 4W8GA 5H3HA 2C2WA 5HBGA 1FP1D 1G5FA 2C3YA 4DDHA 1YU6A 4KRGA 1YTLA 5JT1A 3ROQA 1XYGA 5F52A 1CC1S 1DHRA 2RHRA 2R00A 3IMFA 3NKVA 4V0OA 1PGJA 4YAUA 3B2QA 4FKBA 4REQB 3CN9A 4QUIA 2BHRA 2J59A 3DBLA 1L4UA 1O87A 1TQ2A 2DWUA 2YRWA 1K7XB 3NDRA 4RTQA 3FE2A 4KIJA 3FB4A 4Q4HB 2ZFUA 1J06A 1D2GA 1N78A 4U1RA 3KT8A 1RHKA 2Y0DA 3QGMA 4NZ9A 2JLRA 5G02A 2O8CB 2WP8J 4LJKA 1MC8A 2WKWA 2BCEA 3CVOA 3GVPA 3D6AA 5CX1B 3AC0A 4RHEA 3KBBA 1YK1A 3AWDA 3PD7A 3SKVA 2HMYB 3HM9A 2AMYA 1O9GA 2BEVB 3IXMA 4WUVA 3N3BC 1OWNA 4D56A 3ZJ5A 2BFAA 4EA8A 1R0WA 1DS6A 3C24A 3TIGA 3VKFA 4UFPA 1FP6A 3U49A 4Q1DA 3DWEX 4NAHA 4Z51A 3IP8A 1NT2A 3LYUA 1M1UA 2BKAA 3U7QB 2VDKB 4GPIB 5CGQB 4DZTA 3HXKA 1KC1A 3NDPA 5EMLA 1H2YA 1S8FA 3T9AA 3MWDA 2FLKA 4TYPA 4UOEA 1RFGE 4RJKA 3BB1A 4HC4A 1SK9A 4OCZA 3GEMA 4TKUA 4ZALA 3VNBA 4IOMA 5AVKA 2Y0EA 4ZVKA 4AY4A 3ORRA 4F6RA 4NP6A 3UMMA 3FPSA 4YAWA 5BN4B 1T9HA 3RRXA 4E31A 3VR5H 3RUDA 1EI9A 2A5GA 3ELWA 2XWPA 4ON9A 1XA0A 1MP0A 1GA1A 2X58A 1N2CB 3Q3HA 1S01A 4MR8B 4ZO6A 3HVRA 1J97A 1WZCA 3BGOS 3G2IA 3VOTA 2PS0A 3UAXA 1JDUA 3ZY4A 2BUBA 1NAHA 3N0TA 1VKZA 1ULAA 3QPAA 2C29D 2X0EA 2GAJA 2VXYA 1NR7A 2CMFA 2WM2A 3D4BA 3DUFA 4W5TA 4GR4A 1Y1RA 2HQOA 1OCEA 2VP4A 3HKEB 3JQAA 2MT9A 4J4TA 5JZVA 2C5GA 1XPRA 3HKDA 4GL4A 3AEKB 3UHOA 5DV9A 4US0R 4HAZA 1VHDA 3WIVA 1GGJA 3NVKI 2ZQ5A 3E03A 5DHSA 1HRKA 4O63O 2CHQA 1D5WA 4DLBA 4ZAXA 1IY8A 4F3KA 2V5VA 3R76A 2AFVA 4I3FA 4JCOA 1N3BA 2QYSA 4HN4B 5JQGF 3E84A 1T4BA 2A8YA 2RG1A 3GBVA 4HDQB 4HNHA 4B4VA 1GRCA 5EJIA 2QYTA 2WAYA 5G0TA 3SBOA 3ZNPA 2YY5A 3L7IA 3SNHA 4BC1A 1SC1A 4OB6A 4OJNA 4IHJF 3K53A 4G8DA 3SE7A 2DSNA 3ZHXA 1A5SB 2FH5B 2R6ZA 3JWEA 5EC8A 4UASA 4Y8VA 3W6ZA 3VNUA 3MJHA 1MORA 2R85A 2DAPA 4KAXA 3LQ4A 4HAXA 3QUAA 3ZBUA 2WPDD 4O6VA 5ANRB 3W3AD 5AUPB 2IHJA 4N6GA 1Z4IA 4HGPA 5AM2A 3T38A 3VPCA 5CFLA 3DL4A 2Q0XA 5M3BA 5AVJA 1CZOA 1S2OA 3BTUA 3E5NA 1PV2A 2JD0A 2P4UA 4UQLA 2HWUA 1JG6A 4KUEA 1TJPB 2ASEA 2OQVA 2CVHA 3ZGYA 3OJXA 2FPXA 3LCRA 2I54A 2Q9CA 1JF8A 2WTMA 2IYRA 3CH6A 3WYDA 3X3HA 1K8QA 4URHA 1FK8A 1QIKA 4FMDB 3IIMA 3AHHA 4M49A 2AR7A 3CLUD 4MKZA 2EU8A 2IOQA 5IG2A 1YI0A 1TZ2A 1U9ZA 2WWWA 1GZSA 4LF8B 5GTDA 4DV2B 3M6AA 4KX5A 3PENA 1HDCA 3JAKB 4R5HA 3O1IC 1XUOA 4PNZA 4QUAA 4PPQA 3WGIA 5HCIA 5SY4A 3T7EA 1XVAA 3TOSA 5BPFA 3JQ8B 1CZUA 2LXNA 2RGUA 3S28A 1BGVA 1NLMA 1QYWA 1U3TA 4FYYA 1LSJA 4MS1B 2P41A 5T4FA 5I4BA 1XCGB 3I01A 3R24A 1W4RA 5LZ8A 4FILA 5AW8A 4BECA 2O7VA 3R3ZA 3G8CA 2V1UA 3GH1A 3AVYA 3G9UA 4DSTA 4H7DA 3DBLB 4JL6A 5KWSA 3MUOA 4DSZA 4WCFC 2NT4A 4PGAA 4UVEA 1PSWA 3CU5A 4QSMA 4BNGA 5AIBA 5GJWC 4PQFA 3NAMA 3FCEA 5BOSB 1M2JA 1OW3B 1F2TB 1NJ6A 2BCJQ 2FRDC 1OGYA 3AHDA 2GEJA 4MO9A 4WFJA 3CVUA 2RK3A 2XAUA 1M6VB 1CUGA 4K9KA 2CFRA 1ZH4A 4A8TA 4N7BA 1E1MA 4PTYA 3GEGA 4H6VA 4JUIA 3B51X 4K9SA 1OWLA 5SY6A 2GD1O 2WOJA 4WXMA 2FEMA 3UPDA 4LZPA 2J30A 3K9WA 3TQQA 4G0MA 4DRXB 2NTYC 4FNGA 4IWNA 4J3JA 3FLMA 1R00A 1SY7A 1N2OA 1YR3A 4S0XA 3PT5A 4QECA 2VP5A 3EIEA 4US2R 2M9MA 4N49A 2H29A 2XECA 1ZVJA 3AHEA 4NG5A 2ZJZA 4AUMA 3WGLA 5BVHB 4U6SA 3C8ZA 1ABBA 1U0RA 4BZQA 3F2VA 3DB1A 3EN0A 1E1DA 2QXYA 4A5SA 4PX9A 3Q3IA 4PAQA 5A7GA 3RFTA 1DPGA 4BP3A 1IG0A 821PA 2EGGA 3NATA 4WLUA 2Y0PA 4BEBA 1GPLA 4D0NA 4DW8A 2VZ8A 4KTVE 1MEOA 3OD1A 2ETVA 1L7RA 2OZEA 3IB6A 1UEXC 4PYQA 1JAIA 2JEYA 4UHFA 5FI3A 1KO8A 3HUUA 3VVMA 4QUEA 3I4FA 5EUMA 3LSYA 3KNZA 4GBED 2ODQA 4Y2XA 1QV9A 1JN0A 3G2KA 3UWDA 4WVLA 4YPFA 2ZIFA 3QF7A 4H4EA 5BSVA 2W2VA 2PE5A 1C9MA 1NVKA 4ONEA 2J3QA 1OYVA 3SSOA 1VPLA 2ZVDA 2DPYA 4MJXA 4MVJG 4AY6A 1NQVA 1XSEA 5DHQA 3QW4B 4EENA 2JZNA 1DAEA 2XI4A 3N5CA 4N39A 1M33A 1BXZA 3KDAA 4WCFA 4WK6A 1PUIA 1YO6A 5JTTA 5M29A 2C8KA 2RHBA 5JAUA 2VP0A 2ZYRA 4Z9XA 5C3MA 2GERA 4UD2A 3H0CA 4ZEWA 4YCBA 5MHTA 3RK0A 5JIBA 3CVXA 2PR7A 1NSTA 2IPAB 4I7EA 4BNKA 1W2HA 2A33A 3EVEA 4JSTA 2FUEA 3E3OA 1BN7A 3DPUA 3UCFA 4ZFNA 5FHQA 3VR3D 3MOIA 3ONNA 4QDKA 1SCDA 1TIBA 3UKDA 1E79A 1XZEA 1QCCA 1RJGA 1X1EA 2WG1A 3B89A 4JJZA 2VH5R 3Q2IA 4V3BA 1P72A 3B3AA 2F3RA 2X6QA 4HSEA 4CQMB 4IJWA 4PWZA 1BHQ1 4EVQA 2RSLA 3OAAA 3ZDYB 2PZBA 3VDNB 2O8FB 3TKYA 3WFIA 4E4YA 2IYFA 2UZ3A 2BOVA 3AG5A 5E1OA 4J1TA 3W9BA 1JU9A 2HJWA 2JZOA 1DIHA 2PIDA 4O4LF 2BEUB 3GUCA 1MA0A 4J0EA 2FF7A 4MCIA 1V1RB 4BFUA 4MCJA 4G65A 1OV4A 5LJIA 4G97A 5F76A 4RMHA 3M82A 4UCWA 2WICA 3ICWA 4N4AA 3K0HA 4MX8A 4XD2A 2WG0A 4S12A 1NG1A 1FXSA 4BP8A 4LY3A 3I42A 3DH0A 1S6YA 1YQ9A 1Z73A 4F9FA 2JBWA 3KXKA 2ZXEA 1WMEA 5DTQA 5EXTA 5HQ3A 3GNQA 1XLWA 2VHEA 3L0YA 3IESA 3OFVA 4RVUA 3GJSA 4YDSA 3HV0A 5FOVA 4B83A 2RAFA 5KNLA 2QYHA 1UOOA 2G70A 2IOFA 2QJTA 3E5RA 2XGSA 2FZ4A 1H4SA 1MIOB 4OHUA 1TUBB 3DQZA 3NIWA 3PFKA 1T5BA 3TEMA 4A23A 1IZ0A 5KNCH 2XNDD 3LTEA 4FDVA 4V2IA 5J5AA 2K6GA 5KDLA 3ZZ1A 4YJ3F 2O1WA 1ZM9A 1EBBA 4WLEA 5ALIA 3W6OA 2YN4A 2I78A 1QHXA 3VYTB 3OZWA 3Q11A 2R96A 3FHTA 1G3UA 3SZLA 4MYRA 3CEPB 4FMBB 1KPIA 3OFNA 1ZD8A 1GHTA 2F43B 3AUAA 5DDIP 3WLFA 1WXHA 3GUUA 3TVTA 4FDMA 2ISSD 4UBKA 3MBOA 1XZCA 8ABPA 2EJTA 4KKXB 4B3GA 3CJRA 4UW9A 4RPIA 1I3MA 2B6NA 3T5MA 5EHQA 3N76A 4EITA 3HYSA 3RU9A 5FPKA 1EM8B 3QKSB 3L8GA 2JVIA 1Z0UA 1H2BA 1XAHA 4YJHB 4A26A 2JJYA 2BZGA 4N9WA 1RM5A 2FFHA 1H5UA 2JCXA 1U5BB 1QV6A 3U31A 3LO8A 5G4KB 1XMVA 3N70A 1YASA 1XCJA 3FOBA 3PIDA 5LCXA 1EP9A 2R3SA 5I7EA 2FQ1A 1YQUA 3LYAA 1N6LA 1U7ZA 3GDFA 1E9BA 3S68A 4EA6A 1XDBA 5JZOA 1VSQA 1W73A 5CT4A 2IYOA 4M8NE 1E9DA 1CJBA 3OPYI 2ZRCA 1EVQA 2VAMA 1TZBA 3RAPR 1W85B 4RELA 3T9EA 4D3ZA 3KO8A 3GMTA 1USKA 3LK6A 3QWIA 4N0MA 4XJSA 4QSHA 2XOKA 2BEJA 1YOVB 5KOJA 1ZK1A 4RDXA 3ZIDA 1BW9B 3SHTA 2EW8A 1PL6A 2PH3A 3D6FA 4UXIA 4JVLA 1J70A 2VNKA 3PCRB 1ORHA 2XVYA 3CX4A 5DCUA 3R7WB 1KDTA 3QVVA 4FM9A 4IFIA 3AM5A 2FNAA 4DLAA 2QZSA 3K2EA 1FW8A 3IUBA 2GM9A 3I05A 4KQWA 4ZEXA 4EJMA 1N2BA 1VJTA 4A10A 4YT8A 2OYCA 3FSJX 3OC0A 3TLGA 5CNIA 3ONWA 4JDUA 4YBRA 5BSWA 1IUNA 5EKUA 2CY0A 4I4TB 4IO0A 3D6JA 3PGA1 2P0AA 4U2EA 3BGSA 5KSZA 4JI7B 1E2UA 1HDIA 4JH0A 3EVAA 3HCDA 4B80A 2VYNA 3A6DA 3BRCA 2AX4A 3EEIA 4MRNA 2FEXA 3ADKA 1KMMA 2M2IA 2XNKA 3EVZA 2Z5LA 3IBYA 5DX1A 4RQBA 2LBPA 3OM9A 3MXTA 5JSFA 5H82A 1V11B 2IUEA 4DLPA 1PJSA 2AC7A 2JIMA 5KQGA 2XGMA 3ZHCA 2OO5C 3K4PA 5H83A 2UVDA 3RV4A 4MHTA 1QIHA 3BZBA 4L5CA 3JQGB 3U9SA 4KMMA 3K09A 4M8SA 3RSLA 3C3JA 5K99A 2QRNA 3BORA 1QK5A 2JA1A 5F4BA 3JQQA 5AW3A 1G18A 2IVZA 2OHVA 2R60A 4XLTA 4Q37A 3ZUGA 4K1XA 2NXWA 4W5WA 1MQSA 3MGAA 2VHCA 2ZBRA 3DEKA 3IQWA 1HLFA 1T5HX 4JGIA 4L5IA 2QG9A 2VPTA 4JY7A 1D1TA 2I2AA 2Q45A 4HH1A 3VSAA 3PE6A 3D7NA 4IV5A 4WADA 3CRQA 4ENWA 3T5PA 3K9BA 2Q6VA 1Z4PX 4PAGA 4V2UA 1XCLA 2HWWA 2UZ1B 5DI9A 2QF7A 2WMNB 2YY7A 1TJYA 4XX0B 3FHOA 2HLPA 4OU5A 5MN4A 1G59A 3LECA 1G8JA 2IDMA 3G02A 1H8HA 3N59A 3UOAB 2E9SA 3AL2A 3ETDA 4KYUA 4AB1A 3NALA 3NC1C 4I46A 3T7TA 3CGWA 3RUEA 1F4LA 3KTAB 5AOBA 1VP9A 3LPDA 1NKSA 3P4XA 2CVZA 2FWJA 4LDJA 3AXSA 2DY0A 2G36A 1BC5A 1U0LA 1J8QA 1QIDA 1T6XA 1Q7CA 4JROA 4KMRA 2RK6A 1NBMD 1C30B 3ONEA 3MJDA 3L79A 3QBJA 4ENTA 1DX6A 2B30A 2VRCA 4P81A 1XKLA 4OLJA 3G2QA 2EJVA 4Y2YA 2EEZA 3SYRA 3PHGA 3EK2A 3ZGNA 3PGKA 2XX3A 4A92A 2FSHA 1KZ6A 1W46A 2Q07A 3D4PA 3LDAA 3ESBA 4HGZA 5B4VA 3DFFA 5ABPA 1L8QA 1NVDA 2BFBB 3MTDA 4MV6A 3O8OB 3WHIA 4RTSA 1IBKB 1UXJA 4L6AA 5EIXA 3ILSA 3NDIA 3PCXA 1LX6A 1UC8A 4WLFA 2W93A 3QQ5A 3ZQKA 3KELA 1CEQA 3R75A 2E7ZA 1UFVA 5KMGB 3WO0A 5M04A 2DOKA 2PWBA 3D0OA 1PR0A 3CZCA 3OFJA 5D7NA 4BX2A 2NZ2A 3O8LA 4Z3OA 1TAHA 1CWUA 2ZU0C 2FVXA 5LLDA 5C18A 4R01A 3IAFA 7ABPA 4GP7A 3HLKA 1LVHA 4L2IB 1Y9ZA 3G59A 1P2GA 3UGKA 4YQFA 1GT91 4MW2A 3VYWA 5LD2B 2B8WA 3PGVA 3DEJA 4CEIB 1Z7BA 3B78A 3KV3O 4TLLB 5DCWA 1Z0FA 2GHRA 4EW1A 1VE3A 3NLLA 4OF4A 2ODWA 1MXFA 4KSYA 3VU3A 2G17A 4AZ3B 5KTOA 5LP6C 3B60A 4BEWA 3WKDA 4MS3B 5L45A 5I4IA 1GDHA 1GCGA 5F1PA 1FUKA 2GM3A 3KOYA 1ZJWA 4FOSA 3KUXA 5TXGA 5E0OA 3KYCB 3LQFA 7REQA 4TMYA 4XB2A 3WIBA 3WMGA 3CBQA 3NHSA 1JR2A 4NXNB 5AIAA 3DT8A 4UEKA 1GQ2A 2WYUA 1D4AA 5MFPA 4TMVA 3PFFA 3E2PA 2OZLB 2XQIA 1IXZA 1OD6A 5GQSA 1KO5A 2P9ZA 2ZUDA 1K7CA 2P5TB 4PRLA 4Z4IA 3C5EA 4Q21A 4MI6A 3G5TA 1PLLA 3OE4A 3IP7A 3ODPA 2ZUFA 2QLFA 4G2TA 2IQ5A 2BF4A 1UPFA 2WKRA 3HVIA 5DGHA 1KEKA 5F51A 3PNMA 1ZN9A 1YK0A 1XRMA 3OX4A 5AM1A 2JLVA 3UB4A 1X92A 2RGNA 3GX1A 2ZYSA 5G1NA 4B7UA 2BBTA 5FHRA 3V2HA 2XUHA 1JQAA 3RVQA 2RI6A 2N1BA 2VLIA 3LWNA 3AJ8A 2P9HA 1TMOA 4FZRA 4JXJA 4EX7A 5JJLA 5I9SA 3WIOA 1C81A 3RU3A 4C01A 3RRYA 4UQOA 3O4IA 4ML3A 4YECA 4C4XA 5DSXA 2VNJA 2OGUA 4PHGA 2OP0A 1EDDA 2ZSUA 4LBYA 4MWZA 4ZOLA 3BH6A 4CE6A 2C78A 2QPOA 3UAVA 1T13A 4ZHQB 1JJIA 3E7PA 4PZDA 1LV8A 4JMLA 3UWPA 2JCSA 5HDQA 3L1JA 3OZUA 3GRYA 2PMKA 1UMCB 1W44A 2CJXA 1ZK0A 3E6AA 4NJMA 1Z35A 5B7NA 1ZESA 1ESCA 1TLTA 4TQUS 5AVTA 1SIWA 3RG8A 4O2AA 3F6PA 4FKMA 1ZNYA 3NEYA 4YJFB 3QMMA 1ZN8A 4GE0A 4ZVTA 3TO5A 2OORA 4C6RA 3HBNA 2CVOA 3I9KA 4KH1A 4UUBA 3AF3A 4D26A 3MCAA 4YI5A 1RBQA 4F7WA 3E82A 3H9QA 1JUDA 1W59A 1QGOA 1NVBA 1YR2A 1KVTA 1SELA 1Y5IA 1UOPA 1CUIA 3IDAA 2GJ9A 3RI3A 4DV7B 3GFTA 3M49A 2AG6A 2V03A 1IJFA 1G19A 3GZTB 4B87A 2EZUA 2HJ9A 1V5GA 3S1AA 5KIAA 5CDUA 3BFVA 4YRNA 2WUGA 1Y4ZA 3N7TA 4HDSB 4ZCTA 4ZDKA 1NBIA 4CODB 1A9TA 5TGZA 2MMCA 3S6JA 1Z33A 1HGXA 2XCLA 4D8UA 4LYGA 1BDIA 1JLSA 2R8BA 2IWRA 5KTRA 3FCSB 1BVYF 1GTG1 1LNQA 4ZI5A 1P9RA 4BO0A 1U5CA 1SU4A 3I04M 1A04A 2GK4A 2JPDA 2V7QD 3OWXA 3C5VA 4LRUA 4EJSB 3LA8A 3TB4A 1WIWA 3WLAA 3OCUA 3OQHA 4CR8A 1R5JA 4RSGA 1XROA 3ZE0B 1GDDA 4RKYA 1L7MA 2H85A 4RO0A 4Y6QA 3EYAA 1EWTA 2XSZD 2FN7A 3KEQA 3RC1A 3SSMA 1E9RA 1HH4A 2IZ1A 1KTIA 4D4JA 1VSUA 3A6KA 3ILYA 3NBQA 4N7JA 5CB4A 1CEEA 1J7KA 1UBSB 3L8YA 4JP8A 4WKOA 1WPQA 2CL5A 2I2DA 5AUQA 5CEJA 5L6MB 2ZAOA 3DXYA 5FADA 2FG7C 4K5QA 3VH3A 1VKJA 4C7VA 3BF7A 3C97A 4YJGA 4WZAB 2ZUCA 2QRZA 3JVUA 5DSTA 5CA0A 3FCAA 4UARA 3U62A 1SZDA 3IQXA 3PQCA 1PYGA 1JHUA 3WK8A 2XUJA 2ZUSA 2L19A 1PS0A 2CBGA 1YE8A 1RJFA 5JRDS 1OXBB 4X65B 1XZQA 3F96A 3PZRA 3KYBA 1Y6FA 2WAAA 1FYFA 4GO1A 3ZHOA 1YIOA 5JQGA 5CBKA 4N5IX 3O9MA 5HW0A 1F8XA 1KVSA 2ZKIA 4LXGA 1YBAA 2Z2IA 4P4UA 4LNUA 2FX2A 1UC5B 3KIPA 1L5KA 5HQJA 1NUTA 4JHXA 5HZKA 4HMOA 4L15A 1P19A 2C8VA 5IXSA 3EGOA 1DBSA 3KE8A 1C9NA 5EZ6B 3KR2A 4XASA 2C07A 4KKVA 4NARA 4JKIA 4RZXA 5BW8A 1PR2A 4KX3A 4Z4EA 3QA3E 1TQ6A 2I29A 1RYNA 1U90A 1DKUA 1TNDA 5TS2A 3RPEA 3BEOA 1CR2A 1W9MA 2WWIA 3QU4A 4HZUB 4YP7A 4EUHA 4MR7B 1NJFA 2V6GA 1TW2A 1W25A 2WJ6A 3OETA 3OH8A 5BRAA 1A9XB 3TM4A 3VJMA 4AKIA 3A70A 4X94A 3HB4X 1P1RA 1U02A 3IA2A 3OZXA 4FXPA 3G0OA 1LJ8A 4TWRA 1ZHOA 3HCRA 1Y1KE 1WP9A 2VJMA 3E8XA 2ZJ3A 3CX8A 3HUDA 4MB0A 4MQ6A 4Y1GA 1W88A 3RSOA 1CP2A 1V5IA 4URWR 3RRNA 5KYVA 2Q1SA 4RHYA 1P39A 3U1VA 3UJPA 4KFSA 2ICAA 3IMGA 2NYAA 3T34A 4AUKA 4EAQA 4YCSA 5FORA 1WETA 2QN3A 3UMBA 1GM5A 3QLVC 3QLJA 1TM4E 1A8SA 1QFJA 2D1RA 1H8EA 2PQ2A 3DSRA 4OI0A 3D59A 1B2LA 1YQQA 2EIXA 3NCTA 1C1DB 2C58A 4ZOLB 5AKXA 2H9AA 3UENA 3WADA 3ZGVA 1IHPA 2D1FA 3G5AA 4TYWA 5D1HA 4LYDA 1X1SA 2NU8B 5EJGA 4NPHA 4Z8XA 2GXSA 2WUWE 3ST7A 4MQLA 3ESQA 8ADHA 4ABTA 2XRFA 2C9OA 5JCJD 3EZFA 1TU0A 2NU9B 1RLTA 2JGMA 3ITDA 1EDBA 2IZOA 4GXQA 2QUAA 1SOMA 4G1EB 1F17A 2ACEA 5JSQA 4H17A 4TV9B 3H8VA 5G4LA 1CUXA 1FNNA 4FFNA 4EZBA 1OROA 5B4UA 4MDHA 5AKYA 2OC4A 1T0BA 4IUYA 3H2YA 1E3MA 4F9TA 3KLBA 3W6PA 3OLXA 1NGS