4C0WA

The crystal strucuture of native ppazor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
200
structure length
200
Chain Sequence
MKLLHIDSSILGDNSASRQLSREVVEAWKAADPSVEVVYRDLAADAIAHFSAATLVAAGTPEDVRDAAQAFEAKLSAETLEEFLAADAVVIGAPMYNFTVPTQLKAWIDRVAVAGKTFRYTEAGPQGLCGNKKVVLVSTAGGLHAGQPTGAGHEDFLKVFLGFIGITDLEIVRAHGLAYGPEQRSQAIDAAQAQIASELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FMN-DEPENDENT NADH-AZOREDUCTASE 1
publication title The Crystal Structure of Pseudomonas Putida Azor: The Active Site Revisited.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 68
structure length 200
sequence length 200
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c0wA00
2A5LA 2D5IA 3W7AA 3JSXA 1QBGA 1T0IA 1CZKA 1V4BA 5EA2A 3W79A 2Z9BA 4ICIA 1AKQA 3HA2A 3TE7A 3B6KA 4DY4A 4Y7CA 4N82A 4FX2A 3OX2A 5LVAA 2Z9DA 1SG0A 2Z98A 3GAMA 5NULA 1XT6A 1FVXA 1D04A 5LBUA 4F8YA 2M6SA 3O73A 3FNIA 4N65A 5BUCA 1I1OA 3EYWA 4Y9UA 3P0RA 1T5BA 2HPVA 4U7FA 2FCRA 4GI5A 2HNAA 4C0XA 2MT9A 1XYYA 3GFRA 1DX9A 1QR2A 4U7GA 4D02A 3NHYA 5A4KA 5B3LA 1RLIA 3KLBA 1AKTA 1VMEA 4ZVLA 3G5MA 1YCHA 2Q62A 4YAFA 1F4PA 4BMOB 4YQEA 3FVWA 3OX1A 3F6RA 1ZX1A 2F1OA 2FDXA 1YDGA 3ESYA 5FX2A 3HR4A 2V9CA 1XYVA 3NLLA 2Q9UA 1X77A 3NHFA 3NHJA 3OWHA 1CZUA 1YCFA 3ESZA 1AKUA 1ZWLA 1D03A 2M6RA 3N3AC 3NHPA 4H6PA 4U7HA 3D7NA 4FGJA 5F12A 2BZSA 3LCMA 1KBOA 2QX8A 3EDOA 2W5UA 1CZOA 1YKGA 2QWXA 2KLBA 4R81A 1AMOA 1AZLA 3R6WA 3B6JA 3ZHOA 3NHRA 3RPEA 2BN4A 3F6SA 3K1YA 3OJWA 4GR9A 4LTNA 1FLNA 1E5DA 3F90A 2Z9CA 3K20A 1JA0A 4QOFA 2OHHA 3S2YA 1FLAA 6NULA 1C7EA 3NHUA 5B3KA 4CF6A 1FTGA 1H69A 1RLJA 5LMCA 4HS4A 2QMYA 4GQIA 2BF4A 2MTBA 5NLLA 1SQSA 2MOKA 4C14A 4FGLA 1FUEA 3F2VA 4N9QA 1WSBA 2X2OA 2KQUA 2FZ5A 2OHIA 4LA4A 3B6MA 3OJXA 3L9XA 3U7RA 1D4AA 3FX2A 3N3BC 4LTMA 1CZHA 2FZVA 4YAUA 4NULA 1FLVA 1RCFA 1C7FA 3TZBA 3KEGA 4PTZA 4FGKA 4ZVMA 4PTYA 4M0CA 5LBTA 3B6IA 3N39C 2BMVA 4C76A 4BMPB 4QOIA 4DIKA 4J8PA 3NHLA 2R97A 3OVMA 2QR2A 1XI2A 3OWXA 3L9WA 3QFRA 3TEMA 4YAWA 1GG5A 4QODA 2XOEA 1FX1A 4XDGA 1NNI1 5F51A 1DXOA 3UXEA 2OHJA 1ZWKA 2MWMA 3ES9A 4NLLA 1OBVA 3W78A 3GFQA 3NHKA 2BPOA 2N1MA 1FLDA 1BVYF 1RTTA 1J9EA 1WSWA 3W77A 2GSWA 1QRDA 2ZKIA 3FW1A 3QFCA 1CZLA 3HLYA 4C0WA 4CETA 2B3DA 3GFSA 5EAIA 2R96A 3KAPA 4ESEA 1J8QA 1DXQA 1CZNA 3NHSA 5ULLA 2FAXA 5EMNA 1J9GA 2HNBA 2FLVA 4ZVKA 1JA1A 3FJOA 5JROA 1AKVA 2AMJA 4OXXA 1YOBA 1OBOA 3NFRA 4YALA 4H2DA 1YCGA 1OFVA 2RG1A 3SVLA 4HEQA 3U7IA 2QX4A 4XDHA 5FA6A 3LT5A 2XODA 3NHWA 1YRHA 1AKWA 2QX9A 5FUQA 4DILA 2ARKA 1J9ZA 3ESXA 5F4BA 1AHNA 2QMZA 3UXHA 5LJIA 3KAQA 1CZRA 4S24A 2OYSA 4QOEA 4PU0A 5TGZA 4ZVNA 4LTDA 2V5UA 1TIKA 4QOHA 3QE2A 2WC1A 2V5VA 2QX6A 1TLLA 4LAFA 4QOGA 1H66A 1AG9A 1BU5A 1QHEA 2FX2A 3O2NA 1B1CA 1AKRA 2X2PA 1KBQA 2FOXA 4Y9RA 5LLDA 5LJLA 4YAOA 4QOJA 3OX3A 2FVXA
chains in the Genus database with same CATH superfamily
1P5HA 2PLWA 5C1OA 2D5IA 3PBKA 2B1IA 1AHIA 3JQ9A 2WYOA 7REQB 1RIIA 1TTHA 3VZQA 2WEKA 2NAFA 3NH9A 4P7BA 2CBGA 2NT3A 4G5QA 4HNHA 4R68A 3LS2A 2X8AA 3EODA 5LCXA 1XPRA 2A84A 3CEAA 3OQJA 4HWSA 1E9SA 3PNQA 3CF0A 2CNOA 4PLHA 3RAFC 1AD2A 4H7PA 1AKQA 5PGMA 1CVLA 2JFVA 3OPNA 1N7JA 2HL6A 3DCNA 1NZJA 4JOQA 4JV5B 1M1UA 1YE8A 4LY6A 4OMUA 4EUHA 2AUTA 4QXRA 2WB2A 1QVAA 4EI8A 3DNPA 3ZYCA 2H06A 3NGXA 1UP7A 2WJ4A 5BW5A 4CW7A 1CUIA 2NNLD 1SM4A 2P4HX 4C08A 2DBZA 4NMMA 3FNHA 5H3CA 5IVDA 2ZI3A 5JNRA 5DK6A 1XN4A 1PNRA 421PA 3RVKA 2QRHA 3CU5A 5EP3A 2DSTA 4KCGA 4JY7A 3S2FA 1XVAA 3DFZA 3LO8A 4M9ZA 5I9IA 1U94A 2JEYA 3JWHA 1JU4A 3OU7A 5LBUA 3S28A 2HDHA 4KO2S 1SA0B 1Y4UA 3I9OA 4F8YA 4PPNA 4Q15A 5FOVA 3DKKA 2FQYA 3LUGA 4S05A 2XXJA 5TNXA 4AWXA 4C0QC 3SF8A 5A4DA 2Y0CA 1RACA 1ZOPA 1NWHA 1XCJA 3DOJA 4WZAB 3TB6A 2RGRA 2TMKA 1B2LA 4D4HA 3MIZA 3ZGVA 1Y8ZA 5BSWA 5L3QB 3AF6A 5BSVA 4F3RA 3IIKA 1EVYA 3BGOS 1H23A 2OSBA 3LXRA 4GI5A 3ONVA 5DW0A 4CIAA 4FR5A 1FDWA 3GFRA 4DPLA 4B46A 4EUNA 4MGZR 2AKYA 2P1ZA 7ABPA 4HGPA 4R98A 1JIJA 5JPCA 2D2XA 4Q18A 5MN6A 2C8VA 2BDUA 1A82A 2D1SA 4O02B 4CEIA 1PLKA 1ZFNA 2V55B 3L7KA 4DUPA 2AEEA 4X61A 5FTJA 4IIJF 2H1RA 3KZCA 3L49A 3QELB 3OQHA 4QDUA 3WLAA 5C4GB 2VPTA 1GCAA 3V48A 5D3ZA 4KWIA 4LJ5A 1T1JA 3P1JA 4YIHA 3RC7A 3UYLA 1E9VA 4BLTA 1RHJA 2QL7A 4E11A 1CX9B 2DG2A 2Q62A 3N7TA 4RVOA 3I04A 1WXDA 2O7QA 3STHA 4WADA 1KY2A 1OXBB 2VAWA 2DKFA 2B1JA 4KG7A 5JVDB 4EW6A 2ONZA 4A92A 3IEMA 1FQJA 4HG2A 2Z8YA 3TQHA 1S4QA 4Z99A 2OZVA 4G5FA 3IVRA 3OU6A 5JSUA 1ZHOA 1ZAKA 3ORSA 3IAHA 4DVJA 3EIHA 3P9NA 2QENA 1OAOC 5ERYA 3U40A 4D45A 1IXZA 1ZX1A 3JQFA 2ZIEA 1ZMOA 1Z0JA 3VO1A 4QA9A 4HJXA 1UKEA 3ND9A 3ZXXA 4AKSA 1R0YA 1JHZA 4TS1A 1Z3IX 4PHHA 3T9DA 1JFRA 2V0CA 2SKCA 3DNFA 3KZVA 4Z9AA 3DEIA 5IWAB 1A50B 4LV8B 1KRHA 1ICIA 1RJFA 2FSFA 4YS6A 4ZXPA 2ZI4A 3EQ2A 4GGOA 1QKKA 3AB7A 4BS9A 4F1KA 2PNJA 3RVLA 3N75A 1AKUA 2X0DA 3SDZA 2PGDA 3MEQA 1LPOA 3NEJA 3A7DA 1Y9DA 5DEOA 4DCVA 1F2VA 2RE8A 2OYRA 2C7PA 5LPNA 1DDOA 4M0DA 1NX6A 2ODAA 6REQB 4NH0A 4E3ZA 3NAZA 2PRSA 1MP0A 1X1CA 1OD6A 3GP5A 3ISJA 4TSFD 2GCOB 4DDHA 4EABA 1NE7A 4FYMA 3UK0A 4Z1OA 2A9VA 1EXVA 1DUIA 2XF2A 5FNZA 4JBYA 2WTUA 1T1SA 4IHQA 1E1MA 1Q19A 2QZJA 1UQTA 2OAP1 3VR4H 2IXBA 5DCUA 3PEYA 3ANMA 4WOBA 1HE1C 1RE0A 5IT5A 3ZD6A 2NZWA 3CWQA 4NESA 3ROXA 3LCMA 1BRTA 3GJTA 1RC8A 3C3XA 5CA1A 1L6IA 2JLWA 4KPYA 1MQSA 1MX5A 1A3CA 1ZNYA 1XRQA 4P5PA 3ULKA 2HA6A 1AA6A 1CZOA 3T8YA 2C77A 4A8JA 3TUJC 4BGEA 4CV3A 3CLTD 3UMBA 2H4ZA 1TD1A 4G81A 4TYQA 5EYPB 1RBMA 2JDIA 3SBEA 2RGBA 3HJRA 4OXYA 1IOZA 5JV5A 1NY6A 3R6WA 5JMOA 5LB4A 1C7ZA 1P4AA 2ISCA 1EUYA 3RS4A 5EGSA 1V1MB 3ITEA 4RYDA 3MRVA 3D3WA 1NULA 1SY7A 2J3MA 1WULS 5JLAA 4RKEA 1RWQA 5AKXA 1PHPA 1X7XA 1SHJA 2BKXA 4I9UA 4ATNA 4EVQA 1V5IA 1LB1B 5TGDA 4FFLA 4B43A 5DGCA 2OV4A 4EJMA 5T4BA 1NVUQ 2ZG6A 1ZCFA 1P2GA 1CQWA 3UXYA 1TCCA 3WLKX 4D3DA 5T64A 3JR3A 4OHBA 1E5DA 1PZFA 3KO8A 5T6MA 1BHJA 1RWBA 2DH6A 4JJ6A 4V0RA 5HRUA 1FDIA 4LRYA 1NRWA 2CVHA 3WX0A 3D2AA 1B23P 2C5GA 3KSMA 3L0BA 5AVSA 2QZ4A 1JMVA 2OUIA 5EQDA 2N9UA 1VBFA 4QYMA 3SQMA 6NULA 5JHGB 1UAYA 3A9UA 4KRXA 4GD3Q 3WL5A 3EZFA 1OAOA 2EL9A 1GY8A 3CIOA 4JBIA 2XADA 1J7KA 3TTVA 4HEHA 5A6SB 2J5XA 4QGGA 3B60A 1A72A 3LLMA 1J5PA 5JS6A 1IBRA 1OXXK 3DMGA 3FKSD 4LOLA 3T4XA 4EO4A 2GXQA 3K0HA 3KKQA 3OCWA 4NC9A 1H69A 3DQPA 2WVHA 1VSQA 3JQRA 4KQ1A 4AULA 3OC6A 2V6FA 5CXSA 2O2XA 4MHSA 4QFBA 2CVPA 2FLWA 4KC0A 3RUPA 5FWYA 3BRQA 2PMFA 1JKFA 3D8NA 2IUYA 2GO7A 2O5RA 3P9YA 4MVJA 5BWOA 5I8WA 3E15A 3K9BA 4B6JA 4CCYB 1AGNA 1K89A 2QYTA 4UXIA 3DLCA 5GVSA 5DSZA 4YK7A 2FZ4A 4G0QA 2YY6A 2DUJA 4QVIA 2JFGA 3ICEA 1BEUB 1QLWA 1M0TA 2I7TA 5EIBC 4PPYA 3T9FA 4BNGA 4EG8A 4B6OA 2P2DA 2G40A 1QVRA 2ORWA 3AV3A 3TCKA 2L42A 3TLZA 3UUFA 5LMNB 2HB6A 1T6BY 5CVEA 4N9QA 5T4HA 4HAYA 4PBRA 3E18A 1NQTA 4E4RA 4X65B 1FZTA 1B0AA 2BM8A 3UCFA 1I2DA 1KZ4A 3J7TA 2CNWA 4W6QA 4AQDA 2PZ8A 2ECOA 1L5ZA 1ZO8A 2HTEA 2WJAA 3TCXB 3BYZA 1EGQA 2ESRA 3OE7D 2D06A 4PAMA 1Y8RA 5I8ZA 5EEHA 3WISA 1DU4A 1ZS9A 4IDQA 1IN6A 3GCXA 2MDTA 1XV5A 3MD0A 4QEDA 4O4JF 1B14A 1Z0KA 1QG6A 2PSJA 1C7QA 2VSQA 1Z39A 3DHEA 4HH1A 2J5BA 4JL5A 4L0DA 4ARSA 4GVXA 4O25A 4X97A 2V54A 3FOCA 1CFJA 1DAFA 1Z5WA 1U9IC 3TSWA 4HYEA 3MWDA 4IJKA 2BVNA 2JGKA 2XJ4A 4J4HA 1CB0A 4YAJA 1AN0A 4MVJE 4N9WA 1G2QA 5KREA 4LHYA 3WYDA 1JDTA 3G2QA 5JW6A 2OKCA 2BAGA 1GTVA 1E1CB 2VTKA 5AHXA 5IZ4A 3HP1A 2HMVA 3H5LA 2ZS9A 1UXJA 3KTDA 4Q9LA 5DHQA 2OHOA 1EXDA 1A9OA 3D31A 5EHIA 2ACKA 4YPOA 3AESA 4MQFB 4OP2A 2PUGA 3I9NA 3ETNA 2WJWA 2YXLA 3KETA 3OA0A 3PGLA 2ORIA 2QRGA 4JR0A 3N39C 4FDAA 4QJIA 3VTAA 5IKMA 2C7GA 3LK6A 1NJGA 1QHIA 4UJ5A 1C50A 3CVJA 1SU7A 3IBGA 5EL0A 4BO8A 5JAMA 1H8ED 4DLPA 5IZCA 1UMDB 3W5UA 1K92A 2PNFA 3DHNA 3A31A 1OH6A 2ZWMA 4G5RA 4OJMX 1AOXA 3IC5A 4E7OA 5MN5A 2V8BA 1R6AA 3G02A 3OD5A 2BM1A 2AD5A 2N0SA 3K72B 4FS3A 5JSYA 3ZBUA 3VNRA 1SMKA 3GC6A 2HZ7A 2KSQA 3OF5A 1N3YA 1WMDA 4FW9A 1IEWA 4MV8A 4P1ZA 3CNBA 3T3EA 3WRXC 3ZV4A 4ADSG 4CYMA 3RVSA 4HDCA 3D8BA 3TJRA 1J90A 1QP8A 2QTLA 1NN5A 3MA0A 4Z4GA 1RVDA 1WMFA 1HOTA 1XEXA 3U49A 2CFCA 1L3BA 1UOEA 4AJ9A 1W34A 3BFVA 2DFLA 3R0VA 4QHSA 5G2OA 1N2HA 5KMGA 1TMYA 1BS1A 1RXIA 2ZJBA 4O2BA 4HDKB 4YMTA 4ZJYA 4RQAA 4IKOA 3CT6A 3ZTTA 4E2WA 1G63A 4JHXA 4OHUA 5JZMA 5E38A 2JCXA 4X00A 2UZIR 2MWMA 1QU2A 1RPNA 2LBPA 1SCAA 4OGWA 5D3MB 3QLTA 5EN4A 3AEUA 3BF8A 1KK3A 1OBVA 2IJGX 3HC7A 1PV1A 1VYUA 1NW5A 3R5TA 4G1EB 2NPIA 4RS4A 3ILSA 5C5DA 1OROA 1ZN2A 4ECAA 1NF3A 3F9IA 2A4KA 2WWFA 3OMWA 1ODIA 4JXZA 3IAS1 2O23A 3HY6A 3KUDA 5L4SA 3KEMA 4RVGA 1T8WA 4ZD6A 3WNQA 3V2IA 1ZGGA 3N2NA 5TXGA 3EF1A 3QPAA 1TUBB 4YASA 3WAKA 2PSSA 4ZOQI 3G2HA 1ZEMA 3M1YA 4KXXA 5BQ3A 5KNBH 1SD1A 1GKUB 4OI2A 1M8PA 1OU0A 2GBLA 1PQPA 1GTL1 3GG2A 1U9IA 2AMFA 4M53A 2PXHA 1OIVA 3S27A 2WE7A 1XDDA 3RHSA 2FRVA 1E6KA 2ONYA 5B57C 2RCNA 5AP9A 1DPFA 3K6RA 1HE3A 1AGRA 2M6KA 3HCWA 1GFSA 1WV1A 2DOKA 2FW6A 3O0TA 5CDFA 3ZE1B 2BMWA 2CXRA 2XOKA 1BKSB 2D7JA 2XT6A 1Y7IA 3FCSB 3GQVA 5DGTA 1U7UA 2OWDA 4ETWA 1A8PA 1GEEA 4GR5A 2Q0QA 3O4HA 1UBUS 4B74A 4G9EA 4GKKB 5JZVA 1ZIXA 3UJ7A 4HNUA 2P3QA 3LUPA 3T3PB 4D9KA 2EKBA 5FBWB 3BTOA 5AH0A 2R25B 1RTKA 3BSWA 4DBLE 3LT1A 5M7EA 1A1SA 1T1EA 4Q3KA 4RD3A 4L0MA 1P45A 3EAGA 3JQGA 1QIEA 2WNHA 3LT4A 4O4HB 4H7FA 1PL0A 2GTHA 4GWKA 1X94A 2HGZA 4XAQA 2H59A 4R2IA 5H83A 4CIVA 1GSAA 3MZ0A 5EKSA 4DRXB 1M74A 3FPEA 2D2EA 3CZPA 1M5UA 1N57A 3IUBA 1KZ1A 3LPNA 2Y8EA 3LUBA 3NJ8A 4JJ8A 2IBTA 4KODA 3I32A 1N2GA 1UK7A 2NP7A 2Z5GA 3IHLA 1PG5A 1XMQB 2GF9A 4H1WA 1KYVA 3MUEA 4FFVA 3MS7A 3DOHA 4IWYA 1AN9A 3RV3A 1EH5A 3RSLA 4CMGA 3WWCA 3UW1A 1US8A 1XA0A 3ZGYA 3DD1A 2OFOA 2IP4A 2Z2ZA 1CC1S 1NIJA 3SVLA 3GX1A 2BUBA 2Y4NA 3NETA 2I2FA 5CDFE 3UPDA 4N0MA 1U7HA 5EPOA 5IT0A 1NW9B 3WJ2A 3H4TA 1YBVA 2E0IA 2XODA 3IUNA 3Q3EA 1ZA1A 1BKYA 5D00A 3ROZA 1CDDA 3S8MA 3TQQA 5LWHA 3VR4D 3ITDA 1MR3F 1AKWA 1W47A 3ZXSA 4BGUA 1L5QA 3EVBA 3WL6A 1A2OA 3NBFA 3ESXA 4PWZA 4YLGA 3G13A 1COWD 4LK2A 5E8JA 1GQQA 1XJQA 5JDCC 5L95A 5KKAA 1G5TA 1J09A 2EATA 1VMKA 3N2YA 2C9OA 3D3EA 2XVMA 3R7BA 2BR4A 4KO3S 5C18A 4CIYA 1QZXA 3MMNA 3WWOA 5IJ0B 4AKGA 2WJPA 4DG5A 3N87A 1ULAA 5BR4A 1ZBDA 4UM9B 4RGBA 1U8FO 2VFAA 4RLQA 4ZOLA 5LZ7A 3DUFB 2WAAA 3IP6A 3K15A 1K8XB 1G4AE 4JLKA 4AYTA 5FLXA 2XA1A 5EZQA 4OXKA 2ZR8A 4TS3A 4ZQEA 1SHZA 3T4EA 5C7IO 3R9XA 2BF7A 3PDJA 4X8HA 5ESRA 1IUKA 3LZ6A 1TIKA 1SBYA 2BGKA 2C4KA 3FYTA 3MOGA 4ZALA 1WXGA 4EPXA 4JYMA 3EMDA 1B8VA 1HE2A 1N2CA 4O4IF 4JQCA 1EP2B 1QHYA 1XJWA 1Y6ZA 821PA 4URXR 4HYQA 4V0NA 4HWPA 4M36A 4TTQA 3HJNA 1ZJWA 2VYCA 3MT9A 4HFJA 1YQQA 3UGJA 3OTHA 5EPEA 1KOJA 4CKBB 1Q20A 2QJWA 3QXJA 3EF3A 1UC9A 3HFSA 3HB0A 2H1IA 5T41A 3GH3A 2P2YA 4XI9A 3RIYA 3SSNA 1D2NA 4RK5A 2OHFA 4MVJP 3CW8X 3ZU6A 1XZNA 3NAGA 5EPUA 5JCJA 4Z4QA 1GA1A 2VT6A 1U90A 3JARA 3A3YA 5LLDA 3FDZB 3FFWA 2BL4A 2G9VA 2WIJA 1JG1A 2APJA 4PAWA 2D1RA 4TGLA 2QTBA 1SUAA 3G2IA 2QM7A 3BQMB 3GD7A 4GKBA 4JBXA 4W5HA 4UVHA 5DNEA 3FYCA 1XK6A 2H2HA 1GQ2A 3JQAD 4GH5A 2QJRA 4FP9A 4L16A 1MT3A 2A5LA 3RHTA 4EY7A 4WBNA 4DNXA 1II9A 3P5BA 2WUDA 4J0IA 2VDWB 1WDLA 3T5GA 1UODA 5K51A 1AU9A 4MQBA 5HYVA 2WWYA 2HF8A 1N2CE 1UOQA 3DAFA 1MBZA 2FDRA 4C0SA 1ZRSA 1K3TA 4P5DA 2XHZA 2ZTSA 1KU0A 2QKYA 3O9VA 3B6KA 4DY4A 1S9DA 3R24A 4KE8A 4GLJA 3S6JA 2Y1OA 1B0ZA 3TRJA 3STXA 4QUGA 1XTZA 2KE5A 3KZKA 3WGHA 2QG6A 1DBIA 4UHKA 4N3NA 3SXJA 1I7LA 4MTCA 3UHOA 1BMTA 1JQAA 1YNOA 2C00A 2VYVA 3GJSA 2X15A 2ZREA 1PR0A 2P2SA 1TJ4A 1TK3A 4CT4B 2PXCA 4JOSA 3T5PA 2VH5R 2Z98A 4O0LA 3IUSA 1XMIA 4WV3A 3R3XA 5CPFA 4CTMA 3QGMA 4MMXB 1PJAA 3GV0A 1UM9A 2NTYC 4EYGA 2BTEA 1L4NA 1F5SA 2GK6A 1DQRA 1RI1A 2XMGA 1KMIY 1UXOA 2QD5A 1XQXA 3H5IA 4HOYA 4QUHA 3NCHA 2A86A 4MVJF 1QGED 1EDEA 3W9UA 4GLLA 4KUEA 4UM7A 1GUFA 2RHBA 3CLRD 4LY9A 4B33A 3D3JA 5FBLB 3ZVRA 5I9NA 3KX2A 2RGWA 4B48A 4ZHQA 5JNWA 4HXYA 4UFNA 1R74A 2HNAA 3BRWA 3N2LA 3O1LA 1XCPA 3S1AA 4ND8B 3N2KB 4CXMA 4RTMA 8ADHA 2WSSA 2H92A 3AI7A 3CUUA 3TLAA 1Z4MA 4XVHA 5GY7A 3CVXA 4HDMA 4R8KA 1OI3A 3B9PA 4BCCA 3SDBA 3UT0A 2YH2A 4TLDA 3E9YA 3GUCA 4K0RA 5DXFA 3IT0A 2G8LA 3T7TA 5K8LA 3DLAA 1Y5IA 3PEUA 2CZGA 4KIGA 3WJAA 2RK6A 4ZT4A 3ECSA 3DTVA 1SXHA 1VJ1A 1YQTA 2DY0A 5CT6A 3V7FA 2P9JA 1D6NA 1Q95A 4LYFA 1CP2A 4LZLA 2OBMA 1JVNA 2A5FA 5DF1A 4YO7A 4D0SA 1YCHA 4GFDA 5BYKA 2WJJA 2O1SA 1SZJG 1H2FA 1W1WA 3FSJX 2VDKB 1C9JA 2I78A 3A9WA 2HZBA 2DUWA 4LGVA 1JRLA 1ODKA 1VFNA 1YGYA 5A4FS 1C4WA 3P4UA 2R1UA 1U8UA 2KI5A 2W2NA 1LW7A 5LIPA 4UPEA 3F6RA 4ZODA 1Q14A 3EK2A 3P4XA 2FDXA 3K4QA 1JB1A 2WG0A 3BIFA 4TV8B 3ESDA 1YRQA 2DWUA 1EUZA 3ZVNA 1FA9A 3C1TA 3HR4A 1EEHA 1F0PA 3ZX4A 3LKZA 2VDVE 4WJKB 3BMNA 3QVLA 3K6JA 3P9ZA 4G4IA 1CJVC 5HEKA 4D25A 2H1FA 2WFAA 2FSVC 4G0PA 1J0DA 4RZXA 5JH7B 4IJUA 3UCXA 4W1RA 3H7IA 2N42A 5FPSA 2ZCJA 1SK8A 2P9FA 3GJ5A 3KAJA 2YQ5A 1RAFA 5J2TA 1LBEA 3DPUA 3NATA 3CMMA 1DC7A 1PVOA 1KFBB 2XUPA 2NADA 3ON5A 4HLQB 4XPZA 3OSZA 3AFNA 2PSEA 1YZQA 5CCDA 4CMBA 1I4EB 2PIDA 4GI1A 3DMPA 1EMDA 2C5HA 5KNBD 2IP2A 1SD2A 3IP3A 3O94A 3RK1A 2Q6LA 3MTBA 1Q7CA 3WK4A 1SUBA 1VB3A 3GGSA 1KDTA 3DW3X 3OEWA 2NM0A 3IUEA 3O2QB 4I50F 1T8PA 1ISFA 1M2NA 4Q6BA 4I55F 2NSHA 4XB6B 2DWQA 2J6IA 1Z0DA 3VFDA 1W0KD 5KOHB 3HWSA 3AI2A 5C81A 1G2IA 1P1KA 3CW2A 1SCBA 1I3KA 2R6GA 2IDKA 4KXLA 1L8XA 3R23A 4UEWA 5EWJB 5IAEA 4A0SA 2BEVA 3ZI7A 1GPLA 1R3DA 1JEOA 1NW8A 1CVIA 4KAAA 3EBPA 4Y2GA 2OT3B 1Q74A 3RF6A 4JUAA 3ZJVA 2LKCA 4JVMA 4QX6A 3F67A 4V24A 3ABZA 3L1KA 3E5RA 2MHCA 5JC1A 5FPKA 1F5NA 3T9BA 2C3UA 3RPEA 3OJEA 3W6OA 2AOUA 4NQZA 2FG5A 1P1CA 4F5EA 1EJBA 4OQDA 1FLNA 2WF5A 1P4GA 1SH7A 4WPGA 3TMYA 1ND5A 2BWJA 2AI2A 1REQB 1NBEA 4E09A 1YB6A 3JWPA 1FTSA 4JLVA 4F2GA 3FM9A 2VTBA 1KWGA 2B4YA 5EUMA 1WDKA 2VDMB 4DYVA 1IUNA 3R5KA 1R0SA 3DW1X 4QWMA 4C21A 3IAM1 2V7BA 3IMFA 2H4XA 4Q0MA 3V4PB 4MDYA 1I4LD 2VZEA 4A8PA 1IY2A 2FEAA 1FSSA 1VHDA 4ZTUB 1C7EA 2NACA 2YZ7A 1W44A 1HEUA 3K7EA 4KXYA 4PZLA 2ORED 2JLUA 2O2HA 1UK8A 3ANLA 4YONB 5EERA 3TMKA 1R0KA 3W2IA 1WZNA 3WKAA 4NARA 2DKOA 3O26A 3C8DA 3FGOA 3BJRA 3GLTA 3IAEA 1UOPA 3KC2A 3KT8A 5HF9A 4DCUA 5ARBA 2WJGA 1Z56C 5GONB 3DE5X 3V55A 1XTSA 4PC1A 3SNKA 1CUYA 2QP3A 1ACJA 2OLEA 3OZXA 4C0HA 2Y2UA 4NXNB 2CXUA 4G9GA 4D79A 4R1UA 1KERA 4JX8A 4LNAA 2FSVA 3BMQB 3HI4A 4P82A 5EE1A 4BCDA 3U5ZB 4FMDF 3I53A 1RWOA 4QD3A 5I9SA 3VXKA 2C9MA 1E9AA 5DU2A 3P9PA 2QMEA 1Z4LA 4GQIA 1O95C 5JJIA 3CNLA 4PO9A 1A95A 1RWVA 4C3OB 5I7OA 5JXGA 4E5NA 1EXNA 1U8CB 1N2XA 1DT3A 4Z86A 1C9KA 1OC2A 1SK9A 1V11B 4JR2A 3D6HA 1FEZA 4UUMA 3HDYA 3GL9A 1WB5A 1YS1X 4O3MA 4WCFC 2H5JA 4XZ3A 4Y1RB 5F3RA 4I2NA 2CLCX 3AUFA 2CYBA 4YV0A 4MV7A 2EV9A 2OTCA 1FXSA 2ATCA 2ZYIA 1ILEA 1L5FA 4WNCA 4EZIA 4HH3C 4UHBA 1VL5A 4UU7A 2WVGA 5KDLA 4EDFA 2YOHA 2E5WA 3I1IA 4LA4A 4P92A 1E1QA 1IPEA 1TT5B 3DMDA 4ZOEA 1MB0A 1VCNA 1QIKA 2P2GA 4J3JA 2C4VA 3MJRA 4GZ6A 1DCMA 3PNLA 1YKSA 1Z4PX 1MTOA 2GAAA 3IKMB 5C37A 1E59A 1Z33A 2YL2A 4J3FA 3L02A 3JVIA 1LEHA 3FBTA 1H0KA 3L9XA 4M1SA 2RAFA 4JP1A 3TZEA 5KWEA 3OF2A 2PZMA 4Z4CA 2OR3A 2ECQA 2NPFA 2PANA 3KFVA 1ZNWA 5FTLA 1YDEA 2IS6A 3VC3A 1W8IA 3GF4A 1OXSC 1HKUA 4URHA 1BE8A 4YAUA 4P0PB 5FO1A 3O21A 3ORQA 3QWAA 1E0SA 4PGAA 3TD2A 4C7VA 3GLSA 3O03A 2Z6UA 4S3MA 5I9LA 3IIJA 4IZOA 2OBNA 4LBZA 4AAYA 4K6FA 3DDOA 3HU5A 4HRXA 4IXWA 2G83A 4C01A 3IP9A 4RMNA 4Q21A 1QE3A 2X9QA 3JW8A 1RVV1 1CY1A 3CXRA 4BNLA 4TMFA 1NG1A 2PBZA 2GD1O 3GDOA 2PZAA 3J81k 3WWDA 3DZIA 5C9ZA 3G82C 1U3FA 4MQUA 4YAGA 1GRQA 4EJSC 4ZAZA 1BDMA 2QBYA 5TQ0B 3ZQ6A 1P8AA 4HNAB 2PDAA 4QOIA 1JDPA 4Q1CA 4QJBA 3H9QA 1GQSA 1PFKA 4E5VA 5IRCD 1DBQA 4OLBA 5LP6A 1JWBB 3TEJA 1RCUA 2CK3A 2VK2A 1YQ9A 2BFPA 1MQ8B 3ZZNA 4Y67A 2PWBA 1D2GA 1J8VA 3MB5A 1U1FA 3NRBA 4GMKA 3VVCA 3HUEA 1TCBA 2OO5C 3WFIA 4CDMA 4DANA 2FDCA 3QMWA 1P75A 3BIJA 4MVWA 3TRHA 5C2JB 1I6MA 1QK5A 4G1FA 5GV7A 2X13A 4DS3A 4URZR 1NKTA 3A1VA 4MMZB 1V16B 4YRGA 3KFLA 4XARA 1JXQA 2B5OA 2DRIA 3FBGA 3CGGA 1ES9A 2UUAB 3LOQA 1E20A 4HNSA 3KWLA 5AVQA 2VG8A 1O95A 1ACMA 4P81A 4M1WA 1UH5A 3NXSA 1U28C 3BQ9A 3UXEA 3CEMA 2B0JA 2JHPA 1T15A 4JQSA 3W5IA 2I5PO 2XYVA 1R9JA 1RDFA 4UU1A 2ZIFA 4AG3A 4V0SA 4CN8A 2RMKA 5KYXB 4HN9A 3PB3A 2I2BA 3I28A 4ZZ0A 4JLMA 2IGBA 1FLDA 4IFTA 4OLHA 4TKUA 1M0EA 4TMTA 3AKDA 4BLPA 2GSWA 1DBWA 2RAVA 1IHOA 1EXWA 4M22A 4G9BA 4ZCIA 3TPCA 3UBTA 3OEEA 3IB3A 1DCFA 3PUVA 4R7GA 3TLEA 2G4LA 4KNVA 3I34X 4RM2A 4KVZA 2DAPA 4CKWB 4YJDA 4ZREA 4ZDKA 1M2VB 5B36A 1DADA 3QFCA 5CIWA 3QMMA 4TRNA 1W35A 2AW3A 4JC4A 3C4JA 3ZHTA 2AEJA 3LQ2A 1W4CA 2Q4OA 1KO7A 3EIFA 4I19A 4KR7A 2DB3A 1OTXA 5HCIA 1K2VN 1HM5A 3G2NA 3F5QA 3K0KA 3TI9A 1I3NA 5JCPA 1HK7A 3B13B 3K0CC 2X8JB 3OC0A 1V7ZA 1FZQA 1UQRA 3EGXB 1UBGA 1E9FA 4CTKA 3QPDA 5CAEB 3IP7A 3LDUA 3GY0A 1K63A 1VG1A 1IB6A 2QX7A 4YRJA 1AF4A 2BCJQ 1AE1A 2I3GA 3AFMA 5EIOA 4YUZA 3I8XA 2CCJA 4NF2A 3FZEA 4R1OA 2F8LA 3WLFA 2BKAA 3LBFA 3SEZA 4WXHA 4F38A 4DR5B 2CXSA 3ZVKA 5E0OA 4BGDA 4F6LA 4OX9Y 3GEEA 3ETCA 5H4HA 3AINA 4YREA 4O3FA 5K6RA 4ZHQF 3AB3A 2QF7A 4FGUA 4Z7NB 2GASA 3A6GA 5C4IA 1QH8B 5E1DA 4RZSA 3L0SA 1N2OA 1JKIA 2I3AA 4PICA 5ED0A 5EJIA 1QIHA 2WJYA 3JWGA 2GXSA 5KDOA 3H8WA 4O5OA 1KOLA 2AI3A 3EXAA 4K8OA 5JROA 3PZRA 2C84A 4O2AB 2V3WA 3DEZA 4XWOA 1HURA 1MRZA 5K0CA 2QMHA 1EA7A 1GUAA 4YRCA 4DV3B 5ETJA 4HTAA 1V5WA 3P2JA 3VR1A 3L04A 1U4NA 4QQRA 5KO2A 4YRBA 4H35A 5IDVA 4LZJA 4A16A 1Y1RA 4GI2A 1F1JA 5LZ9A 3ICQB 4RIIA 1L4GA 1ZM3A 2DFPA 2Q21A 2Q7DA 2A0UA 1UT6A 2G28A 4GR4A 3JALB 3QEMA 4HMPA 1PR3A 4H2DA 4B3CA 1OFVA 3ZCVA 4CR8A 3JTEA 3PUYA 3G89A 1W5TA 2DUNA 3PJFA 4LDJA 4HEQA 1IN7A 1FDUA 4QNMA 3FZGA 3Q0IA 3C7KA 4R0NA 5G3YA 3Q8WA 4NS4A 2XKAA 1HL7A 3ZLVA 3E23A 2ZSBA 3DD5A 2CB9A 3FI9A 3FN4A 2QN2A 3R40A 3ER6A 3SYTA 5F7ZA 1J1UA 3CJTA 3M82A 1GDDA 2C1EA 2YVAA 4FDUA 1VYHA 4TRMA 3LMKA 5EZYB 1NPTO 2HA2A 3WNCA 1HNNA 1FOEB 4MR9B 1U28A 1R64A 2FHSA 3SIXA 3THYB 1N9KA 1O2DA 1L7AA 3EGCA 4KLNA 1U1EA 4GBGA 1DKRA 4HGQA 4CLOA 1E66A 1AV6A 2Z04A 3PPVA 2X4DA 1ODCA 2ZOSA 3QEBZ 3DHVA 1MB3A 2OFPA 3IVXA 3KR9A 5SYNA 5REQA 5A3RA 3MJVA 1CP3A 4NG5A 4WKNA 1QRSA 2JK1A 5JR3A 3SY8A 1BU8A 1DX4A 4PX3A 4ZC1A 3HN7A 8ATCA 4K1LA 1ZM2A 4MKIA 2FMXA 3UYKA 4ARCA 1M6VA 4MAMA 1XN1A 4B3DA 1PJZA 4L4XA 4KACA 3UTCA 4HVLA 2BFBB 4AMGA 3ZJYA 4KUHA 3UEOA 4BTVA 1IAVA 2IZ0A 2EARA 5IFLA 5LNK6 1XAGA 2JCVA 1K6MA 1E61A 1U8ZA 2OESA 3PHHA 4JCOA 2FPRA 4C06A 2UZ0A 1X15A 2X9LA 5DGDA 2QR5A 3GPIA 5EG5A 2WC1A 1XD8A 3CNHA 4LC1A 4A0QA 4NCHA 1IG0A 4OQZA 4CF7A 1IHUA 1LSSA 4WXRA 1M7GA 3FNQA 4QULA 4UQLA 1JJ7A 2HIMA 1YDFA 2UYQA 5LUBA 2WUVA 2ODQA 2XCIA 4GXRA 2H4FA 4EAAA 3V80A 3OH8A 4MKHA 3UBMA 3RVOA 3Q2KA 1Z3CA 2IYQA 2O3UA 2W2KB 4UHFA 2IOQA 3CLVA 2YOFA 8AT1A 4DNOA 1GDTA 4UDYX 2B4RO 4OGLA 3J7AC 1TD9A 2R7LA 3ETJA 2DFTA 3UW3A 3UA3A 4XE5A 3MELA 2FLKA 3DMRA 3EIQA 3H0EA 5C7YA 1N0WA 1W5FA 4C3ZA 3U1BA 1R27A 1QVWA 3VPSA 2OG2A 2FF5A 4OHXA 3X2SA 5JQGA 3GLFA 3OCZA 4I5EA 4R7ZA 3TRIA 1A7KA 1T2EA 4QGBA 1E8DA 3I58A 5JNLA 5K7SA 1AZSC 1W2GA 3RO7A 3ZE0B 3AVUA 3HWX1 2I67A 2OZLB 1TX4B 2J0UB 5KWJA 1U81A 3T06B 4C4XA 3I5AA 4IVPA 4H1TA 2H85A 2L19A 4YMHA 3EWAA 4LPKA 4B47A 1KI3A 2GS9A 4NV0A 3OCUA 4UD6A 5ERXA 2IXAA 4Y2PA 3VU3A 4MWTA 1MDFA 1C5KA 3M5DA 3LBAA 4YIKA 2R8ZA 3O93A 4HXFB 3RJZA 3W5DA 1JEYB 4BIIA 2C2GA 4ZC8A 4FNOA 5EQFA 2Y27A 2GCEA 3FMVA 2I7XA 3R5HA 3VV3A 4HHEA 4D9JA 1ZH2A 1M5TA 2ZE7A 2XRZA 2XXBA 2O8CB 4FR0A 4KJZA 4CQNA 2Z9DA 4MJXA 1SG0A 1JDVA 2ZBVA 3HG7A 4YJ2B 1E2MA 3QSGA 1GHTA 4NE2A 2VKTA 3COJA 2WRZA 2ODEA 1A9TA 2FFAA 4CF5A 5BO5A 3GLFE 2BSXA 1D04A 3ZDAA 3MGAA 4TXMA 1O0BA 4ISCA 2CJPA 2PX5A 3IR6A 4DXDA 1IRXA 4PN3A 2YNMA 4UOQA 3OPMA 4NOMA 3L6DA 2GQ0A 1RC0A 2VRCD 2DBRA 1E0KA 2XQVA 4OA8A 4WKBA 1HI9A 2QSJA 5CU7A 2X40A 1IQRA 3UG6A 4MWDA 4EH1A 3HSSA 2ODPA 5KNCH 5K0SA 4M83A 1JHDA 3ICVA 2WOJA 2GPAA 1TM3E 4ETNA 3UK2A 4R2WA 4TVBA 3PA8A 1LLCA 1O57A 2I29A 1L8OA 2PGNA 2WT4A 3HKDA 1RPZA 2J59A 1KEZA 4TWJA 1FMJA 4A5OA 4U7GA 1G3RA 4OEHA 2AB0A 2PWZA 5FAXA 2OQRA 5AVKA 1S5PA 3DOUA 3NHYA 1TW3A 5A4KA 4FOTA 4WK2B 1Y6JA 1MOSA 4TMWA 3JX9A 1SQGA 4ILEA 1LRJA 2FJ0A 2QAGC 5JD5A 4EGFA 5KVCA 1UWLA 2AJLI 3C14C 2XZPA 3BXZA 1SBHA 5AHOA 4M9XA 4WCFB 1EK1A 1JIIA 1CY0A 5GP1A 3SGLA 1AZWA 2HLDD 4XJTA 1PJLA 2ZU6A 4MW1A 3VVLA 5L3SA 2E48A 1K7XB 1A2QA 4OP3A 3CW9A 3QITA 4Y2UA 4XPIA 3BVPA 3T95A 4FSXA 3V2HA 2JCGA 4HYTA 4UE2A 4YV7A 4K2HA 2GZDA 4ES6A 4PYKA 4F3CA 5CBPB 4R16A 1YTUA 3D5EA 2H1SA 3EXG2 2FK7A 4UDNA 4DQVA 1H8HA 5I3CA 3LA6A 1A5ZA 5IEJA 3B3FA 3RBAA 2ZVPX 1TAUA 4FZ3A 4NYMR 4OHCA 3MWKA 2QR3A 4ZQFA 4UD2A 2ZLBA 2VNIA 2NGRA 1TXGA 1MJ5A 2QRVA 1XYVA 2AWOA 4NYIR 4ISBA 4CEHA 1CERA 4TZKA 5HDQA 4CEJA 4F5DA 4JI5B 3QX8A 4HDQB 4LJYA 1JU3A 2E18A 3H04A 3OECA 4MCAA 5BN5A 2GI4A 4BX3A 3KQUA 1RLOA 3QE3A 3LZCA 1E9DA 4OB7A 4W9NA 1ZWLA 5ALNA 4PM4A 3PEEA 5L3RA 5T57A 3SJCA 4DSUA 1JE1A 2YRXA 2IS4A 1V35A 4DYDA 1GWNA 9LDTA 5LP6F 2I03A 5G4LA 5HM8A 3O8CA 4S1PA 1A5BB 2FRXA 2NSLA 4P2GA 1FVHA 2WT9A 1Y89A 1FNMA 5LOVF 4J0QA 1YBHA 3DV9A 4TPKA 2DR2A 1DXHA 4XH9B 5KSPA 3U4HA 4BX2A 4F93B 2BIFA 1QFMA 3AR6A 4H9GA 4EJSB 1RYBA 1FJ2A 1KAOA 1CVRA 4QNRA 3VDNB 1ZIPA 3BA1A 4F2WA 5FHQA 5CB4B 13PKA 1ZI6A 4KI0A 5THXA 3UT6A 3WNZA 1YSCA 4RENA 1NRJB 1XBTA 1WCIA 1BNCA 5C3UA 1GZ3A 1KDOA 1RFGE 2ZBQA 4MVJH 1KQNA 2CLIB 2V6BA 2CVQA 2FR0A 5LDDC 4HY3A 4B6GA 1ADYA 4BMVA 1SZCA 4XWGA 2GOYA 2ZTHA 4R81A 4X20A 1ZUIA 4TV9B 3WA6A 2Q5EA 4FZVA 4HUTA 4LRXA 4MR8B 2QVZX 4RJTA 3STUA 3KJHA 1WL8A 2XRMA 2FMTA 4ZGGA 4O8ZA 4PO8A 3KKPA 3PDUA 4L4UA 4PZYA 5L3ZA 4NJMA 3UHAA 1EJ0A 3ML1A 3FPCA 3HR7A 1U0SY 4WUTA 1DFHA 4MJ7A 4RLHA 1PGPA 2C7QA 1QZUA 2CT8A 2NYUA 4MW5A 1WXHA 4L8VA 4EUFA 2HOQA 4LOHA 3V4RA 3JRWA 4CU2A 4GOMD 2B8NA 5K0FA 1LF5A 4XQCA 2RI6A 3UUWA 3STTA 4UQOA 2Z9CA 3RKUA 5J5VA 5ILOA 3K20A 1XDWA 1IY9A 3OQ6A 3PHBE 4N5HX 3HNOA 3GMIA 4C7BA 4NNOA 2A6PA 1EK0A 1AF7A 4FN5A 3WOHA 1CQXA 2YV1A 1J2UA 3HB9A 3MMXA 2G4CA 4EY6A 1Y9AA 4PAQA 2X86A 2VVTA 2VSXA 5BSEA 4AWBA 1P2UA 2NO7A 1ZGCA 2YXPX 5EP1A 4FDTA 4WA8A 4WFJA 1BX0A 4Q4DA 3MTJA 3HCOA 3WYFA 1AQYA 1VQ1A 1YRWA 1BW9A 4WLUA 2PD3A 2EFYA 1DAIA 1BYUA 2OLKA 2QUBA 3UF0A 5IHPA 1I8TA 1WRBA 4HTFB 4KIFA 1JLLB 4NNJA 4YBZA 3VPGA 1ID1A 3WC4A 4RTQA 3NBQA 3HBFA 1J6UA 2BJVA 3H0CA 4FUTA 5CK4A 3E7PA 3GRVA 3I2HA 3WHKA 4YPVA 1OI2A 2IS2A 2DY1A 2I76A 2QOEA 4RIGA 5SZKB 4YDQA 2YHIA 1P2VA 1G0NA 1KY3A 5C8YF 3K6SB 2FEPA 1HDYA 3N0RA 3OU2A 2VNAA 3D02A 2P9GA 3DYVA 4TOIA 4OQFA 3FUTA 1GAXA 4CNBA 5B4UA 3MIIA 1N5RA 3EEIA 5EEGA 5EXPA 1PNOA 1EDBA 1T43A 2EJVA 3DKPA 4JBNA 4RY0A 4WMLA 5A0FA 1YS6A 3L0CA 3S29A 3E2IA 3IP8A 4XGNA 1U4SA 4DCJA 4M0LA 4X6LA 1OH8A 4BB0A 5IKXA 3U31A 1X80A 3RYCA 2YMMA 2BR5A 2BSAA 3EEFA 3AUJB 1H2XA 1OJ7A 3E9MA 3KOWA 3DBRA 3A4TA 1ZM7A 5BMVB 1B15A 3LPLA 4MA5A 1YASA 3IRVA 3OLZA 1USGA 5A5VA 5BV2P 1GN8A 1IN4A 4IIGA 3KLMX 1YL6A 5FUWA 3OZ7A 1HO3A 5K6AC 3BREA 1E60A 3QUBA 4FMPA 4J6EA 5DRYA 4WVFA 4AY3A 5I7EA 3BMCB 4C3UA 1FSPA 2XW6A 2OLJA 2IBSA 4EOGA 3ZVLA 5D1HA 3GOHA 4AF7A 3IS3A 4PIMA 5CX4A 2ZUVA 3ZS9A 2PUAA 3LBNA 3OZVA 2VDJA 4XOIA 1ZDMA 4HYYA 3KPWA 1L4EA 1Q7GA 4RDXA 3MYYA 4R3UC 1NZFA 3TZHA 2HSEA 4TZ0A 1DVRA 1GR0A 2OYCA 5CP8A 3KEGA 5CLLA 1C9MA 1NUHA 4B79A 1AJEA 1NQAO 1SXJC 4F21A 2N47A 2DPLA 2FPMA 1MG5A 3M8KA 5IM4A 1KPIA 3GO4A 3SJBA 1NX9A 4NY1A 3CH6A 1ORTA 3LP5A 5EJ2A 3LG2A 4HB2A 4QYXA 2BKUA 1PR4A 2QRMA 1FFHA 2VYFA 3AEQB 4QEKA 3BK2A 3R09A 3UJ9A 4B17A 5HNKA 4EX7A 3NEAA 2HXSA 2XUOA 3GMDA 4QSMA 4YJKA 2PZKA 1SBNE 3RS7A 2R8XA 3S2EA 3FXAA 2WZDA 3W3AA 4MI6A 3WGGA 3GFBA 1AXGA 5CITA 3LVBA 3QHAA 3O84A 3C7DB 3LZDA 3KQVA 3H9CA 4MS4A 4XD7A 3IAXA 1A04A 4J8PA 1G8PA 2J3HA 1WUYA 1XXHB 1PR9A 2RGGA 3PRYA 4PSUA 4HDRA 5TEWA 3TFWA 2O2CA 3D3NA 2BEKA 3QNWA 2NZXA 3ACCA 1XI2A 1Z2AA 1XMSA 2GFQA 2J4DA 3N7AA 2XT9A 4YLYA 3K2QA 3QX7A 4PONA 3S40A 2ZSFA 3FMOB 3OESA 3TEMA 4YWHA 2VPIA 3F3YA 1YDWA 2LDBA 2IYSA 5JWHA 1MD9A 3C3CA 2G9NA 4PNHA 3ZD7A 1J2YA 3VOTA 1EESA 5H3LA 1OLXA 5LL6P 3S8YA 1J97A 3PE3A 3K4HA 5IAGA 1GCGA 5AI4A 5E7QA 3DE6X 4PVDA 8OHMA 4LYHA 5LZ8A 1JR4A 4N0QA 4BNDA 1XFDA 2RGDA 1HQDA 2X1HA 4CVNA 2IOHA 4JLDA 4UTNA 1WS6A 2XUDA 2I80A 5KNCD 2AOWA 3RIXA 4ARIA 1U7XA 1FBTA 3LYLA 1B6RA 2XBLA 4GPD1 1TCUA 4CL2A 4F3TA 1V7CA 3BILA 4JZKA 4MA0A 3K53A 3SLGA 1EFKA 2JAOA 3ZU5A 1EZ4A 3EOAI 4II3A 4NBSA 1RYHA 2QGFA 4V0OA 3IUJA 4AC9A 2M1XA 1RBZA 1TPYA 4MROA 1Z5UA 3K1TA 2ZR0A 5DYYA 5A4JA 2ZYSA 2XWPA 3E05A 3HLYA 4BO5A 4ZKDA 2WKPA 3H6KA 4U2BA 4XCXA 5K6AA 4XCVA 1BS9A 4HB3A 1TUEA 5DBEX 4ZXFA 3WBKA 5C1BA 1YVPA 3MJSA 3F3KA 2AOTB 5K4AA 1CUGA 4G07A 1HLPA 1E9EA 3FCXA 1KFEB 2E6KA 3A1UA 4C2AA 2YV5A 5BW4A 3L82B 2F1JA 4TUYB 3TSZA 4ON9A 4UUAA 4X90A 4DWVA 4ZEMA 5IBCA 1OB2A 1XJ5A 2Y1DA 4IHJF 1Z9BA 3M6VA 4O1MA 2BMAA 4RTNA 1G55A 1FDOA 1CXZA 1BSVA 2JBAA 3INYA 2AMLA 2PX2A 1JR3A 5K0NA 2NU9B 3ZN2A 1SJ9A 2RBEA 3MK31 4RFSB 1EFHA 5ALWA 1CT9A 2JFNA 1NVMB 4OO3A 2OAEA 2JDID 5E6RA 1R4MB 1R6VA 3KYCA 1VJGA 5A4IS 2HNBA 1G66A 2FLVA 3PI6A 4FD2A 3LNCA 1DO0A 2EF0A 4YVFA 1KMHA 3USZA 1N6PA 2C97A 3M5CA 4J1TC 1Y3AA 3AO0B 2O4UX 2QB5A 3CZMA 2OPHA 5EESA 4WESB 4HV4A 2ZAIA 1MH1A 3AG6A 2QPLA 1A8SA 5FV4A 3BN3A 3I73A 4W5OA 1ONSA 2R1TB 1M5RA 2PUWA 4JFRA 1TRKA 2VAXA 3AIIA 1BEEA 3FPFA 3VOSA 1X0VA 4M99A 1SKQA 4NBUA 1OBHA 4OQ4A 5G0WA 1JB9A 4M8NE 4B3BA 4OH7A 2XKJE 2HADA 3PT9A 4EA8A 3NPAA 5CNMA 1YOBA 3QSYA 4UUBA 3PJDA 1S3IA 3QF4B 2P0EA 3VTFA 3KWFA 3M6MD 3G0GA 1DB3A 1PWHA 2V4ZA 1PGOA 2ERYA 3GCGA 4ESHA 4NFSA 5IJZA 4J0CA 5L7WA 4LF4B 1E1LA 1QGZA 1UJMA 2XDQA 4CGZA 1B42A 3BZUA 3MF4A 2B61A 1ZVJA 1EFDN 1JR3E 1O3YA 4J75A 3P5SA 4MR7B 4RXMA 1TZ2A 5HQ3B 4KV9A 4X41A 2DHCA 4XUGB 2E4UA 2QAGB 3G0IA 5CUQA 5FYDA 1VC2A 4QQFA 2J4CA 3KYIB 3WSWA 3ZHUA 2REQB 1CBUA 3PU6A 2ST1A 1RD4A 2ID4A 2CNKA 1U7OA 3JQBC 3D4OA 4NH4A 3TGPA 3SZMA 5E9JA 4GW3A 2QVCA 1NMXA 3ND5A 1JIUA 2PD6A 3RYHA 1QH1B 3ETLA 4I1YA 4KIJA 4MVJD 4Q1BA 3DS8A 3IHWA 4PC3A 2B6NA 4ZEWA 2Q7OE 4AMYA 4D42A 1NN1A 2JI8A 1ZUNA 1EWQA 4UBMA 4DDWA 5LJIA 1NNEA 2GBGA 2KM1A 2R9VA 2IT1A 2X2FA 4BAUA 3N8DA 4QOEA 1QHNA 4AJ2A 4CCAA 3VKHA 3C16C 5IBRA 1XPUA 1C8BA 3DZFA 2LDXA 3AUYA 1Z4JA 2P5YA 3I9LA 5AOCA 3SZ3A 3UKOA 2VL7A 4TWRA 3U7GA 1E1YA 1X7WB 3ZDRA 3RYIB 3DVSX 1MKYA 1K66A 4G1MB 4MXDA 2LPMA 2MSDB 1DTEA 2IWRA 1AT1A 3STVA 4ESOA 1ZD8A 3UT5A 5A4MS 5THKA 3FMPB 4J07A 3O8RA 2NSDA 2ODWA 3AZQA 4RKWA 2CNWD 1MA0A 2WHRA 4IJMA 4X8LA 4MYUA 4EQZA 1W36C 2YVKA 2P9QA 2NQ2C 3WJ7A 3SSOA 4UEJA 1KOFA 4K8RB 4QDOA 5KVQA 5JARA 2A5YB 4G26A 4FFOA 1G5RA 4KZKA 1Q16A 2ZFUA 2GEVA 1XTPA 2FW1A 2P6OA 3HDVA 4M0UA 4WOCA 4XQ9A 5TVGA 4C1BA 5TIIA 3LHKA 5C35A 1C9EA 1CJUC 1SKUA 1UANA 3PNBA 3TTUA 3DONA 1F2UA 2XCUA 3AK4A 5AUOB 1DO2A 1YBAA 2FX3A 3SI7A 4DJFC 3GPBA 4NOKA 5LQUA 5IDXA 2PK3A 4Q3LA 3DVAB 4QKQA 2NU7A 1ZGZA 3F6YA 5JVDF 1LK0A 1XTIA 2WKWA 1E9RA 5F77A 2QDXA 5L3VA 4QWWA 1Z5GA 2Q6IA 3HCDA 4MKRA 2GPJA 4HWOA 1E4EB 1WOMA 2G09A 3DL7A 4HQRA 4B5LA 3H86A 1NGSA 1Z4NA 3NC0C 4CMAA 3RSHA 3GT0A 3C45A 4TLAA 1ZOIA 1ONNA 2EGHA 4R54A 3HRIA 3NBXX 1FSFA 5AXAA 1IJFA 1P4HA 3JSXA 3HL4A 4WI1A 3GLHA 1ML3A 1JJBA 4N6OA 4QGSA 1FFCA 4KN5A 3WMWA 2R6CA 4AICA 3DFIA 3KRTA 1JQ3A 3QXHA 5K2MA 2C92A 3RDPA 5EA2A 1V4BA 3N5CA 3RVDA 4CDNA 1TCAA 3B3AA 4MWBA 1L1QA 2FW9A 3DE2X 1BJTA 1XWWA 4Y6QA 1JZSA 1CUZA 4KDCA 2OCGA 1YL5A 1EHYA 1QIDA 1PV2A 3IVMA 3A6FA 4NZOA 4MUIA 1P2DA 2GM4A 2WHQA 2RGUA 1CULC 1SBZA 3WZLA 2DLCX 2NZJA 4UNNA 3GGGA 1FFEA 3NVMB 5BN4B 1PR6A 2EKDA 4RIHA 2WSBA 3GG9A 1YZLA 4P4SA 1MORA 3FTNA 3CN9A 3WGOA 4OYRA 4XSGA 1OI7A 2QAIA 5A5FA 2XYHA 4BUZA 4AUMA 2PSDA 2VRNA 3GRFA 1YXMA 1H3NA 3LT2A 4LXQA 3WMFA 2BP7A 2XE4A 1GAJA 1HXHA 5B6JA 7YASA 2XRFA 2XCRB 2P4UA 4MKFA 4LFBB 1QGYA 4E31A 4OHMA 2BKVA 2ZWIA 3HCAA 1XQ6A 4E5DA 2RHMA 4F1WA 3OZRA 4ZZ2A 3MWFA 3ENWA 3ZW7A 1QS0A 3IRUA 1JWLA 3HB1A 4BJ3A 4EVRA 1Y6QA 3GLHE 2FSPA 3SIPA 1M1NA 3A6JA 4E1VA 2EBUA 3LH5A 2VHXA 3K0EA 1GNTA 2GJ8A 4J2OA 1T5BA 2CFIA 3P8ZA 4JLJA 5JBQA 2GJAA 3FYUA 4U7FA 3CRNA 1JFFB 2AKAB 2Z08A 4H6XA 1UPCA 2KJQA 2RFLA 3AKYA 3K8YA 1XD2B 5COQA 1W5EA 3AM5A 3DZCA 4LX8A 5DVZA 1SHUX 5CCBA 1L1RA 2Z4SA 3M34A 2Y1KA 1GM5A 2EJTA 3V9PA 2CGEA 2D3WA 4BP3A 3GVXA 1F3LA 2G08A 3ZK9A 5I7WA 1E7MA 2AJ8A 2WM3A 3ZH9B 3SXUA 3PLAE 2IYLD 1BCRB 1GO2A 1MO5A 3A10A 1YVEI 4W6ZA 1W93A 2ZR7A 1VFPA 1C3LA 2WM8A 1Y5NA 1J1IA 2XGGA 3BXEA 3PC3A 4AZ3A 3Q9SA 4BO1A 3D64A 1CHNA 4DADA 4OG2A 4DJTA 2B1GA 4U6NA 1NVDA 1NQXA 1QV7A 5JAOA 1I0IA 2FK8A 5ALXA 5FPYA 3SJAA 2OM2A 4KE9A 3V6LA 1LVGA 1Y5MA 2FV8A 2Q3MA 4RF4A 4GLFA 1RAAA 2XOKD 1NI5A 3VOAA 3NDRA 2NX2A 1BHQ1 1RMYA 2P0AA 1RQXA 3WDLA 3B5EA 3RC1A 4LYGA 4BUJA 1SC1A 4Q7KA 1ONOA 3PQ7A 2ASEA 2PV7A 2V98A 4OK6A 1JSZA 1JN0A 2ZRHA 5EJMA 3NVDA 3ZWBA 4HGNA 4BE4A 4BRSA 4IJVA 5COAA 1U0BB 1PDWA 1I7QB 2O8BB 3IMCA 3KUUA 4Q4CA 3UB4A 3LYUA 5IM4F 4ZEVA 1NOJA 1ETHA 3CZCA 3S2UA 4MGKR 1WY7A 2YZMA 5JCZA 3OWHA 4BWYA 3KQTA 5B58T 4L72A 4C0BA 1XNRB 3GRKA 2X76A 2JGEA 3K2EA 4YJFB 3ST7A 5LQSA 3GRRA 2OVFA 1FFYA 2R8PA 3IPYA 4ZPXA 5K3CA 3OCJA 1D03A 3UHPA 1SXJB 3C6YA 4I08A 4CG3A 4D57A 1C0EA 1QK3A 3VM6A 1KZHA 4B85A 3HPRA 2Z57A 4X1OA 2M6RA 2PBRA 3U26A 3PNVA 3I4CA 4J43A 2ANCA 5DWQA 3H4MA 4X7MA 3ZHQA 5C80A 4AYWA 5K3DA 4XLLA 2JAPA 3VZBA 3UFBA 5JSZA 2REOA 4YAEA 4N3CA 4M55A 4N8EA 1UR5A 2P77A 2X8LA 3B82A 3L0DA 4AJNA 4BVLA 2CSUA 3PGKA 1E7RA 1P62B 2H8GA 3DBOB 5JZBA 1UWVA 1YF3A 3TRDA 1QGUA 2Q8PA 3U2QA 4PZ0A 4RADA 4GXTA 3KR0A 4QXPA 4ZK6A 5K0GA 2OV1A 3U81A 1EFAA 1WHSA 2QL9A 4DV0B 1YOVA 2RG7A 1UJNA 2ERCA 2W2PA 2HBQA 3BWEA 4GDFA 4ED9A 4MPTA 1I3CA 4MS3B 4ND3A 1GXSB 4PXSA 3OFNA 1KJIA 4PNZA 1GKYA 1E3MA 4F7DA 4MWSA 5L53A 3U62A 4ZT5A 3IEPA 2HYDA 2ES4A 4UPVA 4E15A 1BVRA 3W05A 3TIIA 3LUFA 3RGWS 5AQ1A 1H5NA 3K5WA 3KPVA 1MU0A 1IN8A 4NPAA 3I9MA 1ANKA 5LBIA 2FPOA 5A9RA 3PL1A 4TKMA 5HPYB 3ZR4B 1X38A 2H65A 2OCXA 4BCBA 3PNYA 2Q8QA 1K4KA 1VP3A 4FQ5A 3UG7A 4E12A 4XVUA 4YV2A 5CDGA 2ZIXA 1CQIA 1QJ4A 2QLBA 4D41A 3BGIA 5EKTA 5IS2A 3ASUA 1AGXA 3CZAA 4LZNA 3Q8MA 2CMHA 3KTFA 4P3OA 3H87A 5GZ3A 1Z6XA 2WSYB 3ZQJA 4AQYB 2CUTA 1I10A 4GM0A 4NAVA 5B30A 5IF9A 3IL2A 2XXAB 1E5QA 2XUHA 1MJHA 2P9EA 5IVIA 5JCJD 5LFAA 1AB6A 2O05A 3OCCA 4N40A 4CMJA 1JLSA 2H5IA 4MPDA 4TLMB 4NZNA 2VP5A 2XUAA 3CRQA 4CQJA 4MAFA 5DXAA 4C43A 2QP4A 3PYMA 1RLJA 3IOCA 4BU0A 5JUWA 3DPSA 3Q7PA 4TSKA 3ZQUA 3BUSA 4YMSA 1RXVA 2VAMA 1IB0A 2Y66A 4LDQA 2JJ2A 2ZYTX 5LDHA 2GN4A 1PT7A 2P3SA 2QSYA 3V97A 2VSOA 4WXPA 3TK1A 1KJQA 3WLIA 2A9PA 1PBTA 1KAMA 2MTBA 4F84A 1NVVQ 4C29A 1JGTA 2P6RA 1PW5A 3BKXA 2QY6A 2P5UA 1U9ZA 1E7SA 1NP6A 1EQUA 1VKOA 2G6TA 2HIGA 4QOSA 1Z08A 1POWA 1N1MA 1NUQA 3QVVA 1SCNE 3EFBA 3INRA 1I24A 4F11A 4QTUB 1VLHA 1UZNA 1HZJA 2I6UA 2PZBA 1MDBA 3B1KA 2POQX 4K87A 1ATIA 4EPTA 3I6QA 2G7ZA 2OPBA 4ZAGA 3P2OA 1TKCA 4GE3A 3K0FA 4MDFA 3NEPX 1D1QA 2OY0A 4IZ6A 1GD1O 3C3KA 2VYVD 3CV3A 3QZUA 1B76A 1KEWA 1NQVA 2OC9A 4RH3A 5LA6A 2QYHA 3T3NA 1IWBB 1Y1SA 3ND8A 3ZQ4A 2DT8A 2UDPA 4DR3B 2HX1A 3SDSA 4BNVA 1IOWA 2H52A 4TXHA 2GCNA 5A3JA 1ICEA 4FJ0A 4UMVA 5FOWA 1WD7A 1BN6A 5KSOA 1ENYA 3VR0A 3V2GA 1IMOA 2QTVA 2R2GA 3JAKB 2HHAA 2CMFA 2BTQA 1RMTA 2GTPA 4DPKA 1RJEA 3IE0A 1W9MA 3F3MA 1E6LA 3RD5A 2Z3WA 4YJHB 1ZMBA 4M54A 5E3IA 1FLVA 2EGUA 1KEPA 2PZGA 1FMLA 1NIPA 5J58A 3L4BA 1BEZA 1SUWA 3BRWD 5CJ2A 2OWEA 3E03A 3TOSA 1JG2A 3D8TA 1K3FA 1OT5A 4HX2A 4B75A 5L40A 3IV7A 4NMWA 1WA5A 2WSSD 4M0CA 4LY0A 4KGXA 3C6KA 4YCJA 2IU0A 3MJDA 3D6UA 2QT0A 1C1DB 1RBQA 3OBIA 4GSLA 4ANFA 4W9MC 3CX8A 3Q3GE 3U60B 2DKNA 2IIPA 3CEHA 2O8DB 2ZQ5A 3E5MA 4P80A 4BAGA 1NU8A 1U7DA 1W2HA 2A9FA 4IGKA 4O4HF 3UCEA 3K96A 1V2HE 4W5QA 1YUMA 3SX0A 1NXTA 1QONA 1XCMA 3DTVD 4HF7A 4AJPA 1MVLA 2FMIA 1O96A 4U3JA 3G7SA 1NVFA 2OG1A 1OLUB 4GMHA 2C9DA 2A0KA 4JVLA 4K0KB 3F5MA 2WHPB 3NUGA 4EITA 2GPWA 3DDHA 1KQPA 4NU5A 4WDQA 1T36B 3WDKA 3NPMA 3QLJA 3PKZA 4ETIA 1YIAA 1PX0A 1EX1A 1Z0ZA 3JQQA 2YWRA 1W36B 3TB4A 3CNEA 4NR0A 3HA7A 3M70A 3QFRA 1P18A 3N8KA 3MCUA 1SKYB 6AT1A 2B6HA 5AKLA 1GZ5A 1V7PC 2VA8A 4Z4FA 1U9CA 5CFRA 1N0VC 3ECAA 4IZIA 5TMEA 2I4MA 1AA9A 2VHEA 5TJHA 3SKVA 2FMUA 3DV2A 2IHNA 4U5QA 4LI0A 4J3NA 4CLXA 3R8XA 5FWXB 3GNTA 4AFNA 2R00C 4CL8A 1QIMA 2JKVA 4YCBA 3W8FA 3ZWPA 2FPIA 5DOVA 4EHFA 1ZGAA 1NXSA 3M89A 1N2BA 5FT9A 2CZCA 3VJRA 3N2ZB 4BLQA 4YWJA 4P5EA 2O0KA 3VTKA 3H4VA 4IV5A 3VA7A 3E1GA 3IILA 3OTOB 5D85A 4F91B 5L4NA 4FPXA 4JS0A 2O3RA 5ALQA 3HYNA 1LV8A 1X1QA 3ROFA 4B9EA 5HFNA 3R0IA 3SC4A 3PLNA 4G8BA 4EUEA 1DDGA 1A8HA 3KOYA 1OMOA 1E79A 2IKSA 4XYLA 2OXIA 4DM3A 3AG5A 5LNK1 2R96A 3G2MA 1EFPB 5FNVA 1MAUA 3WB2A 1TCVA 1DAKA 5KQGA 5JTTA 4IJ5A 1T5TA 4EB6B 4PC2A 2YYSA 3WHLA 2P41A 1DZIA 3EIWA 1XHFA 1LJUA 3BD8A 4L22A 3L0ZA 1R4AA 3D4PA 4MCHA 1HYHA 4M8KA 1P0PA 1PK7A 3DC7A 1QNLA 4UHJA 3CLKA 3T0GA 1ZM4A 2KYRA 5HG0A 4NCBA 1T1IA 4BQPA 2QS9A 4N6NA 1LD3A 3DL4A 4OAPA 3ZV3A 1K7SN 1MB4A 2WMDA 3EDYA 4KTVE 5JOQA 1LVUA 3KVOA 5ICFA 2XEXA 2XCQA 1LFAA 3ONEA 4PCAA 3USCS 4BQEA 1EB8A 5EMJA 3BE4A 1YI8A 2PL5A 1ORVA 2BFOA 2GNPA 2HC9A 5FPQA 4I1VA 4ROTA 4HD8A 4YP9A 3RS2A 5BSHA 4FWTA 1NRIA 3NQ41 3MFYA 4KMOA 3BIXA 1TYDE 5FJJA 4ZTZB 1I30A 2H00A 1OAKA 4DSAA 5AMXA 3V4VB 4BVGA 2D2VA 2PRKA 1KSFX 4RV5A 5AHWA 2XCLA 3B9RA 4KWCA 4IGEA 4OQPA 1NP3A 3ELBA 3TSAA 5KYNA 4NSNA 1DRVA 4HEJA 4YRDA 1NF8A 4BO9A 3UHFA 5CMLA 1YO6A 4WKOA 3S68A 4BNUA 3RC8A 2JFBA 1GZVA 1TQ8A 1R4ZA 1FL9A 1EP3B 2NAPA 3P2EA 3UMSA 1F3OA 1XPOA 2OVBA 1WB9A 3GDHA 3I2YX 2Z56A 1RAIA 1PYOA 3NJRA 4RKQA 3I0MA 1ZNQO 2EBHX 4B2PA 3I1JA 1XCOA 1OQAA 4CKCA 1PLLA 3JXEA 4R05A 1DRKA 2XRYA 3QM1A 4INPA 2Q5OA 2AEMA 3GJ6A 3ZDXB 4KO8A 1XZDA 3GJXC 2OBXA 3SJZA 4B4DA 4IMJB 2IYTA 3O31A 4B4OA 3QG5A 3I23A 3HXMA 2HV8A 5KYYB 2H48A 3IKTA 4MYRA 4C4YA 1BAPA 4MMYB 3MOIA 1IK6A 2VBFA 1AQUA 4P3KA 4YRSA 5SY9A 1VG9B 1P1IA 1E18A 4RJKA 3WGIA 1SCJA 5TLSA 3KFXA 1CF9A 3WYAA 2QTTA 4LZWA 3C97A 5JI2E 3E6AA 1RQ2A 1XVUA 1Y4SA 1EVZA 4CNQA 3B85A 5I48A 4E1BA 2C2BA 1W4LA 3G2LA 1Z38A 2WF8A 3R3JA 5A2QA 3UUEA 2EG5A 3LBIA 1KOGA 2FP4B 4OMDA 5EXEA 3QE2A 5IM5A 4MP8A 3CN7A 4YO8A 3R7WA 5FV7A 3IUQA 2V5VA 1E1QD 1HX7A 1NI4A 3ICWA 1KKLA 1KIMA 2FWIA 1VLJA 2WI8A 1FY2A 2NOAA 1T8TA 2KB0A 4PVCA 1G291 3SOZA 5I45A 3KYJB 1I4WA 1TF2A 3JSAA 2W2MA 1CS0A 4MPRA 3OPYA 4RZIA 5TARA 4QO8A 5F5XA 1GYRA 4G0MA 4NMHA 2W00A 1BS2A 1GZUA 2BFWA 3A4MA 1A8UA 3Q10A 1GPWB 3KZNA 3EOBI 4V0QA 1ZICA 5CGZA 5C31A 3V4ZA 3CUVA 4FJ1A 3R5JA 3OTWA 4IY1A 4AY2A 4Q4HA 5DB4A 4ZV9A 1ZD9A 3TUZC 3ZHVA 1KXJA 3U16A 3R5SA 1SZPA 2PTGA 3EXHC 4WCVA 3EJWA 2EZTA 3PFBA 3WG9A 2P2CA 5JYEA 1VB5A 1X8XA 2X5NA 4FFDA 4DR7B 3IEUA 3ZU4A 1QBGA 4TV8F 5C32A 4II7A 1T4DA 2DCUA 3G5LA 4Q7LA 5HE8A 3ZHRA 1YWGO 3ZGLA 4MWZA 4DR4B 4BY9E 3KQPA 3PXXA 3SVTA 3HN2A 5JY6A 1XNQB 1PEAA 1L4LA 3H8VA 3TBFA 4CKXA 1VKJA 2HH9A 4MUNA 4FE7A 3MAGA 1Z6TA 4DLUA 4IDDA 4K86A 5JH7F 1UBLS 3N8GA 2CLMB 3H13A 2VTEA 1P91A 1R2QA 3C41J 4LECA 1SGWA 4RPJA 4LN1A 3IX7A 2CK3D 3GEBA 4AP9A 2ZBRA 3H2BA 3MTIA 5KYKA 5BW6B 3FNEA 1XEWX 4ML3A 3HYCA 3KQOA 2UAGA 1DEXA 4EUKA 1ELOA 1NVAA 1R0ZA 2H18A 2DF8A 5FA5A 2FR1A 5NULA 1BE6A 1R0WA 2OOSA 2RGCA 3MTAA 4LE2A 1NATA 3T99A 3B1VA 3U44A 5E9WA 4LNUA 3PPIA 1Q12A 1JFVA 1O95D 1TM2A 2HMSA 2VHZA 5DPMA 1YR7A 2FYTA 4RTKA 4FD3A 1P2TA 3PUWA 3FDIA 4RC9A 1K8ZB 3FPKA 3SP1A 3L7JA 5BUCA 1TZJA 4NE7A 5DJ5A 3O9ZA 3EYWA 4Y9UA 1BWPA 2QTRA 5EY5B 1W6UA 4HRAA 3M1IA 3SS7X 2IE0A 2DWPA 2W6PA 4EARA 2IXGA 3KHKA 4BRZA 1QR2A 1R6BX 2HCBA 3H2YA 2QQ5A 4I36A 4OQEA 1E7YA 3QFHA 3BJIC 2J9GA 3NWPA 1YFKA 3OEED 2I4TA 4P98A 4DLSA 1EGVB 2IEZA 3HKBB 3L7DA 2WY2D 2OV2A 3ESBA 3X2EA 5K09A 2R5FA 1JA9A 2I54A 3O38A 1X9GA 4ND4A 5DN6A 5AO9A 5JG7A 1WZUA 3SK0A 5AI9A 1GCIA 1A7UA 3WP1B 1PJ3A 3K9HA 4JL6A 1MEOA 4X63A 1KEUA 5LA6F 3G9UA 5H70A 1OX6A 4GC5A 5CDTA 4YCMA 1QPGA 4BFLA 3OZUA 1D2CA 2QUKA 1MX1A 3T34A 2J33A 2O0HA 4N7MA 1IM2A 4NYMQ 1N5OX 1I4DD 3C98A 2AGVA 3BULA 4U4AA 2I62A 5C8VA 4G0VA 1H42A 1B6SA 1IJKA 3EXIA 4PLGA 4BMOB 1W0JA 1U5BB 2EZ9A 1X1BA 2P6UA 2QM3A 4FCVA 1A7AA 3PFFA 4MP6A 3DMYA 2R62A 4MQLA 4OJKA 4RD0A 2IDJA 2OXTA 4MHOA 4QYIA 4Q03A 3S44A 4MIYA 2HHLA 3G79A 1ZR2A 1KK0A 3INTA 2J48A 4YRNA 1RRCA 4H7DA 5ALSA 4KNYA 1N6LA 2W43A 3HCFA 1U1GA 4R4JA 2DSNA 3RRYA 4DLBA 1Q0RA 4H18A 1G21B 5CDUA 2G67A 1PYDA 1IATA 4DC9A 5HQ3A 3QHQA 1CRZA 3DWFA 4H1VA 4EMSA 3PT5A 4EQ6B 4ERNA 4FEYA 5B55A 3PD0A 5JPIA 1M2GA 3EWSA 5CFMA 4C7OA 2I2XB 3CNNA 3OJLA 4ZI7A 4LKOA 3MUNA 5SV2A 2DHEA 3JCZA 4WH0A 2X5KO 3EVGA 4ZVOA 4G67A 3FMGA 5TMDA 4AMBA 2B21A 2J9FB 4EL0A 4KREA 2JA1A 2XQGA 3AEYA 1SC3A 2IOYA 3LQQA 4IDEA 4XX0A 4Z2YA 1T9GS 3F1KA 2YS7A 1O6GA 2RHHA 3GI1A 4KWHA 4KYVA 4OX9B 3EQ7A 1PSZA 4JN6B 4R2HA 2PYIA 5ER9A 4N01A 3U56A 1TO1E 1S8AA 1DP4A 2HU5A 2K2QB 3AJ9A 4IX1A 3PJGA 4GGMX 4RDIA 3ZDFA 4DCMA 7ADHA 2UXBB 1IZZA 4DBZA 2Y1EA 1PG0A 2GRJA 3GLGB 1NUTA 4QICA 1JMKC 4OFBA 4AO6A 3ETGA 1JT2A 5F1PA 3BXXA 5TMBA 5KKCA 2EC5A 1FXUA 1F8XA 4GKAA 1RJ9A 2WA2A 3BGVA 1O94A 3IERA 4S1TA 4N5DA 1D7AA 4RSHA 1A9ZA 3EVZA 1U0EA 2A9OA 5CT5A 3P2MA 2W37A 3NM6B 1BWQA 3R6DA 1FDVA 1Z7GA 2KHZA 2KLBA 1OPRA 1QSGA 1UBMS 1Y7PA 2PCLA 1RWMA 3AM4A 4B7UA 2XDWA 3IDOA 4R51A 3S8EA 4X1KA 1AZLA 3QE9Y 3ENQA 1Y3BE 3KJZA 4B4UA 4XIGS 1JHOA 4NZMA 2VRWA 5ECDA 1N7GA 2F1RA 5MFZA 1OWLA 3G5TA 1PEYA 4OUDB 1YQDA 4M1ZA 5I4KA 4UEOA 4DR2B 2D00A 2I22A 2O6HA 4LJ7A 4F56A 4JB0A 1WDWB 4M0PA 2WTBA 4KAJA 4TKLA 1KI4A 4S1NA 1LZKA 3ZY4A 1H65A 4EX6A 4D80A 3CLTC 4CT0A 3NIWA 4BN4A 1RZVA 1U11A 4XDYA 3WK6A 4B6EA 4YRPA 3D4LA 3ZCTA 2B5WA 2C29D 1H2YA 1GPNA 1U0TA 2PRJA 1QH9A 4IQ8A 4OIFA 2JIOA 4ZVUA 5ECWA 1A4XA 2CE2X 1FQKA 2YFYA 4BVHA 1R8YA 2YJNA 3U1TA 3WGZA 4C6RA 1DKMA 2PKXA 3AR7A 4PCVA 4HQOA 1E2QA 3DSRA 1GU7A 2VH1A 4YHBA 1V9SA 3K1AB 4JASB 3K05A 1Z6PA 2AH5A 2VDUE 2XWSA 3JD1A 2YX1A 2Z2IA 4GF5A 4PLCA 1GT91 4M6WB 3UANA 4GX2A 5IAOA 1U0OC 5IXJA 4CF6A 3D6JA 2ORYA 5IFKA 2LIVA 4PE5B 3AVOA 3S2GA 3SBXA 3WWYA 2I8AA 4A3SA 1JDBC 1TO2E 3FKJA 1AO3A 1ECBA 2WP0A 3OA2A 2QGNA 2EKQA 4IHAA 4HS4A 4EZBA 1UZLA 4Y6OA 5J1TB 3DOIA 1Q2UA 1RZUA 3K1JA 2YN4A 3FTQA 4YNBA 5HZKA 2IDZA 3H9GA 3TVTA 2GZHA 2HJGA 2R7NA 2O8EA 2CUZA 2ZTVA 5EIWA 1X92A 1G8JA 3THOA 3TW4A 4NZPA 4IVQA 5D86A 5TDHA 4C14A 1GTZA 2R1VA 3C3YA 3DF9A 3QY9A 3W3AH 4DA7A 5BUSA 4N7RA 1SRQA 3HACA 3EISA 4NBVA 3IIMA 2C2KA 4PY2A 2DFKB 4MW2A 5TS3A 3UK7A 1RKBA 5EE9A 5DHAA 2KQUA 1GTRA 1M6HA 5AW3A 3P0IA 4QQKA 1J2RA 1OLSB 3KQQA 4YBRA 5FP0A 1SUPA 4ARUA 1PP4A 1Y8QB 3PC6A 3A25A 4M88A 3HVHA 2BMDA 3RTBA 2AD1A 5IAJA 2YXNA 1STOA 1F17A 3LXMA 5LN1A 2H63A 4TYNA 1WMBA 2J0VA 3E7FA 3I6ZA 3MXOA 2ORVA 2JI4A 4LMPA 4RSRA 5C1DA 4YX9A 3I2GA 3AY3A 2Z6QA 4FHCA 3HCEA 2WYIA 5I7UA 5JISA 3HXLA 4IM7A 1SG6A 2G9RA 1QE0A 2YNMD 3FOBA 1PUIA 4Y6LA 1TA0A 9ATCA 3H9UA 2ZAGA 1CZHA 3KZMA 3EXEA 4YRAA 3KZOA 5CTJA 3O75A 3S5JA 1YC2A 2FMHA 4NU8X 5G3ZA 3FHTA 1AMUA 4KQHA 4PX5A 3IMGA 1NAIA 4M49A 5E6UA 3RU7A 1RJGA 3QXCA 4P8RA 1T3TA 2FU5C 3C3EA 3LHFA 4BC0A 2EIXA 5HSGA 1NDQA 2AUMA 3C6XA 2YW2A 3TCNA 3M83A 2FW8A 1EWRA 1RFLA 4LQ4A 2BFDB 3Q0TA 3ZV6A 4FKMA 1GILA 1XLUA 4DDTA 3VU9A 1SUDA 3CA8A 4REOA 1P3Y1 5MDHA 4GUAA 4O2AF 1E96A 3F1LA 3H11B 3Q6NA 4HDSB 1UK9A 5FI5A 1IY0A 1WETA 1SC4A 3OQIB 3WMRA 3ZNQA 2F2TA 1Z88A 5A9SA 1B4DA 1I6WA 2C96A 2ZU0C 3MWGA 1TJNA 4FZ5A 4RVSA 5MGNA 3AVTA 5GINE 4N7BA 2X0JA 4KNWA 1OAAA 4FWBA 1PDOA 4P4LA 3RTEA 3GA7A 4P7FA 2WK1A 1ST2A 4EA6A 4EG6A 2IUTA 4X62B 4CM8A 1GLNA 4US0R 4WY5A 5GM1A 1X42A 3QUTA 3AL3A 3E8MA 4BMYA 1NN3A 1H2AS 2IODA 2Y76A 2BDEA 4IQ0A 4MNTA 5FL7A 5F21A 2Z2KA 3WLJA 4YMVA 5BPFA 2QQ0A 6CHYA 3L3BA 3MW8A 4FB4A 1H8HD 5EZYF 1R5BA 5AT1A 4YCNA 3U3JA 1QB7A 2G17A 1VCHA 2C42A 1JUDA 2CF5A 3F47A 1FFDA 3FMIA 3OOYA 5F51A 2CV0A 5CJPA 3A8TA 5DI9A 2B7CA 4P3YA 1M1YA 1BC5A 4LSGA 1DKQA 2X3YA 3A9RA 3CNQS 4ZO8A 3L1JA 5ECGC 5G0VA 1DWUA 1DJMA 4LSZA 1ZXBA 1DIHA 2IZOA 4DVGA 1BGVA 1IXKA 2FWJA 2NQ8A 2QN7A 2VQ3A 3EXHB 3ONFA 4MCJA 1J9EA 1UBJS 3R2JA 4EFNA 5JS8A 3HEAA 1KBZA 2QUIA 1QF9A 5J2UF 2Q5LA 3I92A 1J06A 1QRDA 1ZC3A 1F9EA 5CFLA 1EDOA 2FWRA 3GQBB 1I1QB 3NP9A 1Y8AA 5CM8B 1IZ0A 4GOKA 2YZGA 3IBYA 1E7WA 2A59A 4UEKA 2OGZA 4E21A 1RQ7A 2DJIA 3TNYA 2CJYA 3Q6MA 1PSDA 1D2EA 5KJCA 4BNWA 3KNZA 1LBIA 2GWRA 3U09A 1DXQA 3F3SA 4NJOA 3TLCA 1AXRA 2HT1A 4FYKA 3IT2A 4IV8A 4KBGA 1KAHA 3V1YA 4YQZA 3RC2A 1L2TA 4HADA 2DERA 1HLGA 2WHXA 3PC2A 4KK3A 1JTVA 3T7IA 2ATEA 4B1FA 1CIVA 1KEEB 3NBKA 3MN1A 2FAXA 2OGTA 4WRRA 1M1YE 1J22A 2W8ZA 2JJMA 3FTPA 4V03A 4I46A 5AKYA 3MG9A 1MW8X 4GMGA 3RIHA 2Q46A 3KPJA 2JASA 4H17A 5G1OA 2NU8A 1MCZA 4ENUA 4H15A 1HGXA 4PHFA 4BVFA 3ANYB 3EXFB 3D0KA 2WABA 4D8WA 3MMZA 5HOEA 3GDWA 2ZVJA 1YFJA 3AERA 5EHNA 3FLBA 3IQIX 5F2OA 1Y33E 3DLHA 2G8NA 1PG2A 5E3JA 2JEOA 1U5AA 1OSNA 3NJ4A 4N7JA 4QPCA 2AMJA 3AF1A 3V8NA 2ZWAA 3F8TA 2A35A 3B1JA 3JU3A 5KAPA 4CKEA 3BD7A 3KQMA 2VHTA 5T6BA 3SJ7A 4F3NA 3HBMA 3RK0A 4OXQA 5AK0A 4KR3A 3QRWA 3UICA 3PE6A 2XECA 1QC5B 3B1FA 2RH8A 5JMPA 3U37A 2FJUA 3WOVA 3I83A 3TO5A 2C2WA 5BRNA 521PA 3UB2A 4YJ3A 3IAAA 4EP1A 5DCLA 4GS5A 4QQNA 1YCDA 2XDAA 3E22B 3Q41A 3Q9LA 2QTGA 1RKQA 4N5MA 2FUG6 2PUTA 2QX4A 4DRYA 2NZVG 3AKZA 3S2ZA 4OBXA 2WF7A 4I6EA 2NVWA 2XMQA 4U2EA 5KQLA 2EBFX 1P81A 1B2RA 1BCSB 5CYFA 5H81A 2PKEA 4F2HA 3DE7X 3JATA 2AG1A 3QIVA 3SFVA 1GTJ1 3FUXA 4KSCA 2P8JA 1XTUA 2FRDA 4H31A 4YJ2F 2Z3ZA 1MABA 3TPFA 1M8GA 1O0CA 1R8XA 2WILA 4DDMA 3X1ZA 3I30X 1GPH1 3GPCA 4JUDX 4U2CA 4G8JA 2YWHA 2BLNA 4M98A 2Q5HA 1JKJB 1XAHA 1OFHA 4G97A 1NN0A 3HJBA 1B6TA 4QECA 2R86A 3K92A 4ZJZA 1EB9A 1CZRA 4ZI7F 4AS3A 3VHQA 4XM2A 4EI9A 2WW8A 4XUDA 2VJMA 4QDXA 2W2LA 2HJHA 1CU1A 5BWBA 5K8TA 2QMQA 2DBQA 1UFOA 5B4TA 1T9AA 4N76A 4XUCA 1Q0UA 2A4MA 2WUWE 2IFTA 3TE6A 3F8WA 3COVA 3NVAA 1HEIA 3TMAA 5EFOA 4QOHA 4L8FA 3SQDA 4BP8A 4F12A 2BRUC 4RTSA 1QQBA 3V8VA 1ZC4A 3MT7A 4X84A 2KBFA 5CYPA 1EWKA 3O3MB 4U0KA 3WKEA 2CXOA 4ZJUA 2AN9A 1ZSYA 3ZNNA 1EFVB 1C4OA 3TLGB 4ZO4A 1XCBA 3TOVA 3G68A 1OFUA 3DOFA 1BU5A 4LE1A 4M0FA 1NM5A 4N0DA 4UNPA 3SMQA 3VO9A 4UTPA 2GLTA 1ENOA 4NBNA 2R11A 5CK5A 4D99A 2Y6UA 2CWWA