3ILXA

Crystal structure of first orf in transposon isc1904 from sulfolobus solfataricus p2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
140
Chain Sequence
AKVILYARVSSNTKDDLANQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVITAYPDRLVRFGFEILEEVCKAHNCEIVVLNQEDKTPEEELVEDLATILVSFSGKLHGMRSQKYEKVKKCAEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords First ORF in transposon ISC1904
publication title Crystal structure of First ORF in transposon ISC1904 from Sulfolobus solfataricus P2
rcsb
source organism Sulfolobus solfataricus
total genus 49
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilxA01
2R0QC 3PKZA 2GM5A 5C32A 3G13A 3BVPA 1GDTA 3GUVA 1HX7A 5C31A 1GHTA 3LHKA 5C34B 5C35A 2RSLA 1ZR2A 3ILXA 4BQQA 2GM4A 3UJ3X 2MHCA 3LHFA 1ZR4A
chains in the Genus database with same CATH superfamily
4YRQA 3NHPA 1DO8A 4GYYA 3WKCA 1G0NA 2IE0A 3CVJA 1K7YA 3HXKA 3TRDA 5LIRA 2OZVA 1BDBA 1CJVC 2EKQA 3QRWA 3WGHA 5BUZA 1GDTA 3HCEA 2KI5A 3FTPA 2HQOA 1DEKA 2G76A 5COAA 2OHJA 3RUCA 4ZO7A 3HS3A 1VECA 4DCUA 1Z37A 2O8EB 2OCKA 1XA4A 3DPUA 3OKFA 4JT8A 3LZCA 4DJ5X 2UYOA 2HT6A 3GIWA 1VPWA 3T99A 1GNTA 3FKSA 1BXGB 1A95A 4HO1X 4HOYA 5HQJA 3T9BA 4CIXA 4PQYA 4L22A 1A2BA 1NHWA 3CLTC 5ADUS 1MO4A 1V45E 3C6XA 4JXXA 2EJVA 2DSTA 1ECLA 3GUCA 5KNDA 1QKJA 1KF0A 3S44A 2NW6A 4ZI7B 5C3MA 5CT8A 2O2CA 4DCOA 1V5WA 2YXBA 1VI6A 3IESA 4GMGA 4PLYA 2EW1A 4TV8A 5ELMA 1VTKA 4OEHA 3ETHA 4PZAA 5BN3B 5J3JA 2YJ3A 4FYHA 1SB9A 2WUDA 1EQUA 3PNPA 4TXMA 1GJRA 1UJ4A 4NFSA 4OJQA 1ENYA 5LZ9A 1PL8A 4BO9A 1H4QA 2RBGA 3DFUA 3U7EB 3L7NA 4G4IA 4C7JA 4BB5A 2AZXA 3I9V6 1CNFA 1QONA 3WLTA 3TQCA 3WL8A 4B34A 2X8WA 1ADYA 3SE0A 4AY4A 3O92A 4GOKA 2CL7X 4MMYB 3JQPA 3HNOA 3L9WA 3ROQA 1XRQA 2JFWA 3AU9A 4EX7A 1NMQA 3M4NA 1ESNA 1NXSA 3IDOA 4HWOA 2DMRA 1B23P 3KUUA 4IYJA 3ICPA 4MUBA 2AN3A 1MJNA 3IKVA 4TMFA 5D3ZA 1R18A 1NP3A 3HUFA 4ZI2A 4U00A 5AQ1A 5AM1A 3B70A 4GKVA 3HGTA 1NVKA 2C95A 3GLGA 3L07A 2OWDA 2EFYA 4K6HA 5E3JA 5IMBA 3DFFA 1SUIA 1Z38A 5SV2A 3NBUA 3L7DA 2VAXA 2YW9A 3ZTTA 3MFYA 4LJ4A 4Y6SA 1SC1A 2ZDHA 3GPCA 3TSOA 4BNHA 6CHYA 1W4LA 1HEIA 1I6KA 2XDWA 2W6MA 1VIDA 2QVXX 1SBQA 3KQLA 1ZMXA 5GM2A 2BGJA 3V4FA 2FGKA 4TYQA 3G9QA 3IO5A 4JJAA 4EW2A 4TMKA 5JJKA 4S1WA 1W35A 4LMRA 3HUTA 2A4MA 4P3YA 3ESZA 4PWZA 1A5AB 2GD6A 2VVTA 1A8QA 3TUZC 3MB8A 1L4NA 3KB2A 2B3DA 2ID7A 1UPXA 4AJEA 3UT0A 3BGSA 2GEJA 2A0KA 1MCZA 2KLBA 4PZ0A 3ZG6A 2H1HA 4FZVA 1TECE 3AHHA 4IOLA 1M83A 1DPFA 2GZRA 5HIIA 2A9JA 2VS1A 3OZSA 5DLDA 3DZIA 1GNQA 1ESMA 3UUFA 2PT9A 5DWQA 4EEKA 2HREA 2IH5A 1TM5E 2F3RA 1DX9A 1USGA 5JXGA 1W94A 1X9IA 1YDHA 2CY0A 2VR1A 5J2UB 3MD9A 1ISHA 1FS6A 4DA8A 3HM9A 4CQNA 4PE5B 1QRDA 2BRUC 3NTUA 4DLUA 3RFFA 3WLHA 3FAKA 1SOWA 4QFDA 4HRYA 4TQUS 4DM3A 1HKHA 5AUPB 4XEHA 3WYCA 5CXQA 1C8VB 2ZTHA 6AT1A 2JEOA 1GGNA 4JIGA 3IJ5A 4LJLA 1QUFA 5HILA 2HZBA 2JGDB 2PPVA 1SVIA 2P75A 1U9CA 5IAJA 3EDMA 3H5NA 3JASA 1I7SB 3BH0A 2FRVA 5HQTA 4YAJA 3SOZA 3RQIA 3G2IA 5KNLA 2HNAA 1PJ2A 3AF4A 4W8HA 3JQ7B 5JS7A 4NBVA 5K3DA 1E8MA 2Q9BA 2V65A 1Z83A 2DRIA 3I83A 3PKJA 4HTAA 1V8BA 3LNCA 1PF7E 3I5XA 4UNRA 1JR6A 2V6FA 1N2IA 4YRGA 1UMBB 1XPUA 3JYHA 3LFTA 2V7UA 3A1EA 3RVNA 1G8AA 1D2NA 4FYWA 1E1NA 4MEBA 4U8GA 3W9YA 4HL6A 3WMFA 5K8TA 2HNBA 4P0PB 4F06A 2PY6A 4JX9A 3JR3A 1STOA 2CKDA 2ZRQA 2XVMA 4JZYA 4BRZA 1Q1AA 4IHAA 4XQGA 2WJJA 2ZPTX 3T06B 5BV7A 1U6KA 3UB4A 3VOBA 4ILEA 5DX0A 1PFKA 3GMSA 5JSUA 3WJ2A 2PGLA 2WIFA 2BFEB 3GVXA 4DC0A 4M9SA 1SKYB 4G0NA 3EHDA 2DLDA 2HX1A 1ENPA 3QMVA 3PKZA 5TRTA 3DWIA 4F3TA 1QPGA 4EGSA 4LDQA 2I4MA 1Y3HA 2OQ2A 3H2ZA 3EF1A 1JA9A 4YCMA 1UKYA 1P1IA 1E20A 1JFFB 4V1CI 1KOGA 3I6IA 2O6LA 1O94C 2J1LA 2QAGB 4QHYA 1PT8A 2JEYA 4KQ1A 4BLPA 5J58A 3PPVA 5KINB 4FQ7A 2ZSKA 3HJRA 1V2GA 4C0KA 2WM9B 2G82A 5JQGA 1A8UA 1KI1A 3W2EA 3H99A 3KLOA 1I4WA 5JTUA 3G0CA 3I23A 3HLKA 4JGGA 2E5FA 4TMZA 1N5KA 1PR5A 2CVZA 2NQ2C 2CVFA 2ORVA 4EMBA 1XDZA 2A1IA 4WZBA 3OT4A 2NYAA 3R5FA 2DFVA 4YJGB 3RTEA 1P5FA 5A6VA 2FPGB 3D0RA 1R5NA 3O0TA 1TUBA 2XRYA 4HEA6 1Z4MA 3RYFA 1EUCA 2MU1A 1Y98A 2IW1A 3LOQA 3DE4X 4H6WA 4UNIA 3U4CA 1B00A 1D4OA 3PDIA 1T8UA 4M8LA 4AJOA 3AM1A 3BSYA 3T12A 5FA5A 1VA5A 4RZXA 3WLQA 2WTAA 4ZYWA 3TGPA 3SZMA 1PZGA 2DULA 2W8ZA 4QBFA 2C3UA 2J3MA 1X14A 3P27A 4PONA 2H4YA 2C9MA 4M1ZA 3I9FA 3B20A 3CVXA 4HDSA 3UC5A 3L8YA 4GXRA 4OI0A 2C9YA 3F3SA 1V8FA 1R5OA 4PO9A 3U19A 1ZM3A 2ZUWA 1V47A 2ID8A 2G04A 3DFMA 3IAEA 4ARSA 3GLIB 2BFFB 1OAKA 2ZS9A 3C7DB 3EDOA 4HX2A 3ENWA 3D8BA 3DVAB 3JD1A 1ZVQA 4NQRA 4QPCA 2CHQA 2CHGA 1B8OA 4JJ6A 3KD3A 1GG2A 2BVNA 4CFZA 3JD3A 2WZQA 1GO2A 4BNNA 4EHKA 4F5DA 3O9VA 2A1UB 4HH0A 4CM9A 1U7HA 2VT2A 3HN2A 2PX4A 5HKKA 3RYHA 4D1YA 1QZ3A 3T9AA 3T1OA 1GZUA 3C8ZA 1TCCA 1GPUA 3OQOA 4KRGA 5CVDA 3UG6A 3V1KA 2Z6UA 1HNXB 1LNQA 4C6RA 5HMLA 8ATCA 1UK6A 4EB8A 3GLFB 2QRKA 3JQ8A 5F3DA 3S3TA 1QYWA 2BMVA 3F5MA 5DULA 5GQSA 4BB6A 1CIJA 3EE6A 4FONA 3O8NA 1FUKA 3LSYA 3JVUA 2G1PA 3K6KA 3T7CA 2HM7A 3ME5A 5F98A 2CSXA 4Y30A 2OO3A 2VXCA 5FWXA 1ITZA 3GJZA 2PRIA 5CNKA 2GTPA 4MJ3A 3TJMA 1Z06A 2JI8A 3JW8A 1I33A 2VPYA 2X1VA 2XJ9A 1HC7A 3DJYA 4JP8A 3SMVA 1ODFA 1O7JA 4DTCA 1XMOB 1PWYE 1I3KA 1TW3A 5F35A 1TA4A 3UVEA 2ZSBA 4KQJA 1DJMA 2QYHA 2FX5A 4V0LA 1N9ZA 5EKTA 5EMLA 3RBVA 5E3IA 2QAJA 1RBYA 5AJZA 5FBQB 4MS1B 1BSVA 1KZYC 1Q95A 2ZIWB 4ES6A 1S7GA 2AMYA 1KI8A 1XCOA 4PG5A 5BMVA 3MLAA 1V7QA 1DWQA 3AR6A 1TJPB 3UMVA 3K0KA 4QOFA 5FA8A 2VEDA 4EGQA 3B60A 3W5JA 2WHPA 2FVYA 3HL4A 3FN4A 1IJKA 1YZHA 1T1GA 3HA5A 4UOZA 5TQ2B 2IODA 2WIJA 1ETUA 1F5NA 1QK3A 3PF9A 4O2BF 5I48A 2PWAA 3AJDA 1ID1A 4F2DA 3PEFA 4OKNA 4EP1A 2A0WA 3AR8A 3P2EA 2ODTX 3H2IA 1L7NA 4Z54A 2H07A 3RIMA 4BJ6A 1JZSA 3CIFA 4IDQA 2L82A 2WSIA 4HG2A 2O4UX 2VAVA 3BWBA 1PT6A 1WULS 2FN9A 1NI5A 4J43A 2OPHA 4RELA 1ZK2A 5HEKA 5A4DA 1UWCA 4X6UA 3KR9A 3UXYA 1NJ2A 2GRUA 2P0EA 5GZ3A 1REQA 3WFJA 3ZBTA 3MS2A 3ONDA 3OM0A 3K15A 1H4TA 4D3ZA 5BV2P 1DIHA 5JAZA 2WF5A 2P9ZA 3GDGA 1H2ZA 3BM5A 4WT7A 4J94A 4JLSA 4HDRA 5DSZA 1QFSA 5KSWB 3HXQA 2WVAA 3O90A 2E6KA 1KVTA 2VPXA 3LQ1A 2ZYSA 3ILVA 4EW3A 3G5MA 2NTEA 3DB2A 4RIIA 4KPUB 3TRIA 3JQ9A 1ZMRA 1E6MA 2AC7A 2D2VA 3FDFA 5AIAA 4YRAA 1FSPA 1XZAA 5JZMA 5ILGA 5LIPA 1AKRA 3TQRA 2OLKA 1GRVA 1ZN8A 2WHEA 4X44A 5EXXA 4BOYA 2BT4A 3B1XA 3E53A 2EXXA 4CF3A 3LBHA 1I9GA 5IMSA 2J0UA 4BIIA 5CB4F 5ALFA 4D79A 5AKKA 2ZXFA 3CLRC 5SY9A 3KZOA 2AD1A 4GU5A 4TZTA 1YQWA 3HXMA 4UUMA 1GSOA 1PS9A 1XRMA 3V2HA 3ZHTA 4H3HB 2R25B 3U39A 3K30A 4AC9A 1COWA 4URHA 1QQAA 4B17A 2HPVA 4RU1A 4IBOA 5BQFA 1H8HD 2QZSA 1ZBDA 3E9NA 5DNAA 2PKCA 1W2GA 3H9EO 3WOVA 1WHTB 1YCGA 3QPCA 2EFDB 3OJLA 5DM2A 3N6VA 3T1TA 1JQJC 1MO5A 1Q0HA 3HV0A 4RJLA 1IBRA 4FGJA 1UKEA 4QT4A 4RTLA 3HVRA 1DLIA 2J3DA 5CFRA 3BMCA 2N3ZA 5AM4A 1SIUA 5ELLA 2GAFA 4RTMA 2C9OA 2YOHA 3I72A 2DWUA 1DX4A 3TTSA 3YASA 4KR7A 1J4AA 5MN5A 3SICE 5HUQA 5A3VA 3LIIA 3V42A 3ZU5A 4I1SA 5DNWA 4P3XA 1JPNA 2I34A 5DWVA 4CF7A 3QFSA 2N42A 2ZR7A 2OCAA 2BMEA 5C1IA 2Q4EA 4E5DA 5LYJF 1FVHA 3FZEA 3P9CA 3QX9A 4C7OB 1RJWA 4RA6A 3A4VA 1U2ZA 1JG2A 2FEKA 3GJYA 1IHYA 3NNNA 3O8QA 2J6IA 2G71A 3VTKA 3FTCA 4AWAA 4D3YA 3J80A 1P3DA 1OJLA 3PZBA 3ZLBA 1TEZA 4BLWA 5AVKA 2IYLD 1N1GA 3HVKA 4C3ZA 3KJFA 2IUUA 5KTYA 1SCNE 3SG0A 2QN3A 2N75A 3OIUA 4LDPA 3U7FB 1AZWA 3GJXC 3W6OA 3AQIA 2GR9A 4FZ3A 3E7FA 3MBOA 2VTBB 4D99A 2PX0A 4J49A 2Z4TA 5FEUA 1GN8A 1HFKA 4RZUA 2W58A 2J41A 2WIBA 4Z8YA 3QHPA 1NPTO 1ZK3A 3AKEA 5CR9A 3G7SA 4F5YA 1KI4A 3ZDEA 1OAOC 4EJ0A 1CUSA 2I3GA 1Y5NA 5AR1A 5K6RA 2W0MA 1Y3AA 4GKKB 2F43A 3K6JA 1M2JA 2X8LA 1N8SA 3LZ6A 4JT9A 2FI1A 1T5SA 3H1PA 4NS1A 2YMLA 4FMPA 2WB4A 2Z2ZA 5FOVA 2XVZA 4GAEA 2YCBA 3TZKA 4R8SA 5JISA 2Q41A 1FJXA 2BDUA 2C96A 3A4NA 1OLSB 3GGPA 1B0ZA 4DG9A 2FW0A 5I51A 3P20A 3SIWA 4N01A 1HETA 1WP9A 3AVOA 3RYIB 2YJNA 3DTVA 1QIIA 1MIHA 1MB9A 1GPWB 2BW0A 3N8IA 3ZIUA 1L7OA 5AESA 3S8EA 5BP7A 1JSZA 1U3DA 4IDBA 3ISVA 2H1IA 1XRSB 4HGNA 4AZTA 5JROA 3GO4A 2PGNA 2JI7A 5KQLA 5LXTB 1IJBA 1Z5UA 3TD2A 3OZDA 3BZUA 1F17A 4XE5A 2Q1YA 4FOSA 4C2BA 4ZK2A 2PGJA 2CK3D 4KKXB 3RJZA 1Z4LA 2Q27A 3CLVA 4BO0A 3C8DA 3WLLA 5ABPA 1RYBA 3TSWA 2RH5A 3NHBA 3WGOA 2V7XA 4GEKA 5KJEA 3QKRA 4JP2A 1CZRA 2HF7A 4LNAA 3H75A 4MCHA 2WU3A 3VU8A 4U3JA 1IDOA 5BWCA 5F9HA 4KIWA 3HKDB 1QMGA 4PX2A 2XPCA 2PH1A 4WGGA 5T3YA 5ICCA 1FNBA 3HZOA 2JC3A 3IMEA 3SBXA 2UVDA 4FCVA 1B26A 4M1QA 1JHUA 1MA3A 4Z0PA 1MEEA 2J85A 2ANCA 3QVXA 1NOIA 1WVGA 1WXDA 2L18A 4JR2A 4O2LA 1MT3A 3QJGA 4RSRA 3ZOZA 5B1YA 1GG8A 1CZHA 2PX5A 5CXXA 3H05A 4FZRA 4E1BA 3PJRA 2CZQA 3ZTWA 1CR2A 3TEMA 4YT2A 4FN5A 4D5GA 3THOA 5IJZA 1NVGA 1FDTA 1R8JA 4ZMSA 2OV4A 2HWWA 3OLVA 1W85B 1ZS9A 3WSTA 4LXGA 1UAGA 4C07A 4RA9A 2FQYA 3H6KA 1Z2PX 3PA8A 1BQ4A 4CLRB 1XPRA 2RKOA 2JG3A 3WLOA 4M1WA 3DWEX 4M0PA 1SCIA 2PA3A 5BSKA 1G3QA 3BMNA 1YU6A 1JHVA 5SY4A 3ZHRA 1XTSA 4U8HA 4Z4FA 5M7EA 2R86A 1FDRA 3FWHA 3GRVA 2B4KA 4JI7B 3R9XA 4K9OA 1SMKA 4RSHA 5KTOA 4OH7A 2R1ZA 3ID6C 1Z73A 4HATA 1P4AA 4WJKB 1XPOA 3UIEA 1XROA 4JOCA 1NXOA 2NO9A 2NZ8A 4D3DA 3OY7A 1RAGA 1SULA 4F5EA 4HGRA 2D00A 2RG7A 1XD2B 3HGQA 5L95A 3FJOA 1GPLA 1M8GA 1J8FA 2PBFA 3NEYA 4WEQA 1H93A 4C7MA 5CEEA 4H60A 3DGEC 5EJMA 1P7WA 4F96A 4BVKA 4D42A 4G3XA 4KLZA 4DMKA 1Q1EA 1RQLA 4FBLA 1RXEA 2BGMA 1YVEI 1O08A 3BF7A 4M0DA 3GEGA 4PHTA 1ZIYA 1VMKA 4R2JA 1GN9A 4MDHA 5KSPA 4LHEA 1CUYA 4BC0A 1PJTA 1O3YA 1B15A 1U1GA 1U94A 2XIQA 3ZCPA 3SQMA 3UMGA 1RYMA 3K6RA 4HXYA 1QYIA 4R5HA 4PY2A 1QAOA 3TR5A 2D1TA 1NJSA 1T4CB 5ALKA 4GBJA 5PNTA 1XZNA 2FUG6 2DPMA 1WSBA 1FZQA 1R4MA 2F1IA 3H18A 2I03A 2OGZA 5A7FA 2PZEA 4BE7B 4MS4A 3AO0B 2WKRA 1PR1A 3C6MA 2FFHA 3IKJA 1PG2A 5D87A 3WB2A 1CRPA 4X84A 4PHCA 1V8ZA 2D0IA 5K3OA 2GM4A 3UY4A 4L0CA 5LQNA 1CY4A 4JJ8A 1EWKA 1JAHA 3D54D 2E82A 2QUZA 3GG2A 1S2GA 1KU6A 2BZ0A 4G1VA 5E95A 3C6BA 5A9TA 4F3YA 1YIAA 3M6XA 4PM4A 2QRQA 4CI0B 4RC9A 2K7FA 2CXOA 5A1JA 2EIHA 4OFBA 4GXNA 1XUOA 2A2ZA 2I22A 2XODA 1MAAA 4FE7A 1MB4A 1ISSA 1NN5A 1RWOA 1ZKDA 2D2XA 1N2SA 1A7JA 2C4MA 2QN8A 2WUEA 4WECA 3OEHD 1OLUA 3IP3A 3L05A 3O95A 4RDXA 3EYWA 1R50A 3VFDA 1W88B 4B2PA 3OLXA 3GWZA 3QVGA 3U2QA 2BI8A 3O8LA 3CRQA 5DOZA 2GILA 5ALZA 5IC6A 3ZCQA 3SYNA 3AY0A 2X0DA 4ZZ3A 1YL5A 3HGMA 2G88A 3U62A 1CZLA 4LCJA 1U3CA 4F4DA 3BK7A 3LQ2A 4KSBA 4BGIA 2GD1O 4Z86A 3IUSA 1C5KA 3ODPA 4ERNA 1JXOA 4G63A 4B4KA 1MENA 2B1GA 1ZUIA 2WJ6A 3EFBA 3M4XA 4OSEA 2I2WA 4CR6A 4TTIA 8LDHA 2FLWA 3EUAA 1Y3IA 3D5TA 2VSFA 3KKKA 4WKNA 4U9HS 4COKA 2NXNA 4YRMA 1TJ3A 4HCJA 1LI7A 1G16A 2GBGA 2Q5CA 3HJNA 4HFNA 3V7FA 1PJZA 4DNFA 4H4CA 5D84A 4BQSA 1ZM2A 5K0SA 4BKUA 1L5YA 3FB4A 4L5BA 2QX4A 3NDBB 3FCEA 1L7AA 1NMZA 3VYWA 3RADC 3G2MA 2GA8A 2V4MA 4IKPA 4DN6A 3IULA 4XB1A 3PVCA 3WJ1A 3QUCA 1NW4A 4TLCA 1ZD4A 1WZIA 2C9DA 2NPIA 1A8IA 4GXQA 2P0AA 3MEQA 2XJ4A 3QKWA 1GTRA 3E9DA 5HK9A 2F8TA 1TQDA 3VKGA 1H6AA 1A5SB 2FTKE 4KQFA 3DC7A 4QUKA 2Q62A 2HH9A 1AMUA 1M2VA 2IYUA 2GM5A 2Z30A 4FOLA 4C06A 4TV9A 1HMPA 2A57A 5DHRA 3QI7A 3W05A 2J4DA 3GLTA 4EA7A 1MBZA 4GOXA 4OLAA 1X1DA 3LXRA 2JFZA 4I81A 5AXBA 4EGJA 3QKIA 4NCKA 1L5SA 1DAPA 1SHTX 3GF4A 3N6XA 3QUAA 4QOEA 3U44A 1SXGA 4J6EA 1PGJA 1ZZGA 4BXOB 4Y2RA 2FUCA 3UOAB 1PFQA 3E9EA 1VMDA 1TZKA 5IABA 2XGJA 4AXBA 4KXVA 1J09A 1TVEA 1F48A 2AG0A 5KX5A 4Y1RA 4HRAA 3A9WA 5B7GA 4W9MC 3O8RA 4GGMX 1ECPA 3JAWB 4PPFA 3FE2A 3KPJA 4HLNA 5K9ZA 5F1KA 1X77A 4OYYA 5BUQA 3IKMB 4ZU1X 4CDMA 4IPTA 1H42A 4J7AA 4EOGA 3LUKA 1PR4A 3LGAA 1PKXA 3OIVA 2Y76A 4PYNA 3UJ8A 5EWJA 4B4UA 2W6ID 1U4OA 4EB6A 2O19A 4G8JA 4HTFA 3I2YX 4IUYA 3MA0A 3RUAA 3WI7A 1E1MA 4ZHQF 1G7CA 1XRNA 4X1YB 1TCUA 3PFIA 2AV6A 4ZT6A 4I5FA 4AU1A 2VZ8A 2UU9B 2YHBA 1XJWA 4B35A 4E3ZA 3CR8A 3TLZA 1YNOA 3E7XA 3FR8A 4N54A 1J8YF 2YV1A 3MMNA 1XNQB 1BMFD 4Z9XA 3B38A 1EVQA 1HA3A 5HF6A 5CNIA 2HA0A 2W7TA 2GDJA 3L8DA 1AD2A 1XPJA 1TLTA 2I62A 2L0XA 2ZIZA 2G7MC 2WC1A 1P2DA 2WK1A 3AK4A 3H0KA 3HDTA 4G56A 1NVUQ 4HI0E 4P84A 4RO0A 3WB1A 1ZVJA 2PT6A 5F3RA 5CBPB 2UYCA 3BMOB 4O1MA 1KC3A 1OU0A 3SDSA 3ZHCA 2QRUA 4ZYTA 4G0OA 3RNLA 3ZCRA 4W5RA 3FWZA 3FCCA 1KVRA 4GM0A 4L27A 1W29A 5D85A 4KCGA 3SJUA 1LH0A 2HRRA 4UEOA 4C4TA 4QODA 3QNMA 1SEVA 2YH2A 1PJRA 2C5EA 2O20A 4CHGA 5D5QA 4AJ1A 1PJCA 2H9IA 3FF4A 4JVNA 4MW1A 1NX9A 1EFPA 1WPXA 1HI9A 1NY5A 1OAAA 2R4QA 5AKXA 2FRDC 2A1TS 2P6OA 1PEYA 2YQ5A 4MO9A 4E2ZA 1N75A 4K2AA 1UK7A 1CDOA 2CNBA 2Q2QA 1NRWA 2ZJ8A 4AUMA 4CV0A 4WMLA 3AL0C 4GYJA 3MGCA 1BH6A 1Z7YA 5K2MA 2MMCA 2AG6A 3AUUA 5DPMA 2Q2NA 2CC2A 2AW5A 1FYVA 2O7VA 2NUPB 3M6IA 5EHQA 2NU9A 4IX1A 2V7VA 1COZA 5EWLA 3IJEB 4WBNA 1OH5A 1KAQA 3C1OA 3EIHA 4QTXA 4QXQA 1GM5A 4OHZA 1GNPA 4GWKA 4CKEB 4JJ4A 3II6X 2VPZA 3F6SA 5CXUA 1MEJA 1A3CA 2BL4A 4MRRA 4J29A 5CLHA 5HYVA 1G7SA 3CKYA 5G0TA 3SHTA 4E3WA 5BSFA 1K08A 4B75A 6REQA 1YQQA 3ZQ6A 4MVJH 3KTFA 3IO3A 3U9LA 4H6PA 1MOZA 1MU0A 3FPSA 4LSMA 3W1WA 4OY3A 1CJMA 5LR6A 3L4KA 1MQ8B 2CL5A 4DR5B 2QK4A 2AHRA 1DKUA 4BV3A 4KJXA 3CF6R 3LXMA 4MGHA 3B82A 1XXHE 4CL0A 5JZSA 3UPTA 4ZEXA 2QGZA 3PENA 2OBLA 2QM8A 3K16A 1U1CA 3WJ7A 5FIUA 1XYYA 1BE6A 1CLEA 2IUSA 1UPCA 3JAKA 4HDOB 1VBNA 4Q1FA 5LCXA 4DMRA 1ZI8A 5ISMA 2YASA 3A4YA 3O7MA 3E35A 2D8MA 1JR3E 1ZJ4A 1A9QA 2BGUA 2OAEA 3H9QA 3NHYA 4IL5A 4P36A 4WLNA 4E2WA 2CBZA 4TTPA 2O3TA 2IHVA 1LK7A 2WD7B 3KDPA 1RCUA 2AB0A 4YUZA 2YZ2A 4N4AA 2XY4A 1PQWA 1HDXA 2EKPA 4Q1CA 5IAOA 1UJMA 3AFHA 1WOYA 4DDMA 4JB3A 5CK5A 3UWDA 2NXCA 4XCVA 1WQ3A 5IK2D 1H3NA 2Z8YA 4XGNA 1E64A 4JENA 4QGHA 1GILA 4D02A 1BVHA 3GN1A 2PN1A 4TX1A 2GKOA 1B76A 4TXHA 1AQ6A 2BP7B 3GCWA 3H4MA 4QDKA 3M9WA 4MR7B 1IY2A 1ZU4A 1XQ1A 2FHSA 2FR8A 3FNIA 4FGUA 3GAFA 1GAQA 1TGYA 5JNSA 1T2EA 1RXWA 4O8ZA 3L92A 4DG8A 4LNHA 4RFLA 4DC1A 1D2GA 3AVYA 3DOUA 3ICWA 2C9BA 2AI1A 3L6CA 3N2EA 3TTWA 5B6JA 2X9VA 1RIFA 3SF8B 2YYZA 3C2QA 1BW9B 2MJLA 4IF4A 1PR0A 5AHRA 4NEQA 4Z6KA 3UWPA 4MVJM 1K4YA 2AG8A 3G0IA 5B57C 2EIXA 1USVA 1KYYA 1AKMA 1I10A 2KLHA 2EBHX 1FU8A 3H13A 3RVSA 1JSXA 4AX8A 2QU7A 5GINE 3ZVRA 1LSUA 4URYR 2JKZA 3OQ1A 5I9NA 4LWPA 2QJRA 2HDHA 1II0A 4Y2UA 4B33A 1EUQA 3CKMA 3OD1A 3SHWA 4D2IA 2WJWA 3C41J 3TAHA 3MS7A 5KTRA 1YZFA 3RYCA 1DC5A 1MD9A 4L1KA 1RJGA 2WHQA 1VHLA 3M7IA 5H7XA 1Z6GA 3PICA 3QH4A 4X00A 4B3HA 2BIFA 1P2FA 1ZN2A 3ANTA 1D6MA 3K20A 4K0RA 4ZQCB 1XTUA 4J2TA 2JI6A 3HB1A 4KDEA 1JQLB 4A8HA 3AERB 4HADA 1V1JA 3DMTA 4JVSB 3DDHA 4BO7A 2V5VA 3W04A 1HPLA 4O2AA 2C7OA 4AMZA 2RC6A 1IH8A 1TZ2A 2PD3A 3JQCA 1Q0RA 2NYVA 1NU6A 1FU4A 4L0MA 3WHLA 4B4OA 1VCIA 1UMCA 1FYFA 2OXFA 1ZNQO 2H59A 1M6WA 1R0BA 5GP1A 1MFZA 5JXJA 1G6OA 3CVUA 4HAUA 1Z0DA 2V7EA 1FPMA 2H1CA 3NALA 1YBVA 1F0NA 3T35A 2YWGA 2IQ5A 4RCYA 4RHXA 4YMIA 2J5BA 1U5CA 2UZAA 4QYWA 4YP9A 2J9YB 5H3HA 4PC6A 3L0DA 5EZYF 4LXYA 2UAGA 4GE3A 4HB2A 4EDHA 1KKLA 3NHJA 3WMWA 4DHWA 8ADHA 2LZ0A 5BN4B 3C5EA 1W36D 4R81A 4II2A 2RJNA 1GV1A 4IIDA 1V16B 2Q4OA 1MTOA 5EI5A 4XX0A 1IB0A 5IM5A 3RUFA 2C57A 4WEOA 1I2DA 4D92A 2QPAA 4F5WA 4Y2PA 3MWYW 3UWOA 2ZYDA 4CKZA 1I0LA 4KO1S 1AZTA 1TRKA 2IPLA 3K9BA 5IT0A 3HTXA 4YMGA 3H2YA 3VZQA 1Y34E 4JNKA 2MTBA 3ZS8A 2ZRIA 2IUTA 4KSCA 3OZFA 3CY6A 2WWYA 1PVOA 2X2FA 3MCAA 2YR0A 4UU0A 4RANA 5FHRA 3IHKA 4RADA 4B3BA 1H2AS 3GPLA 2ZSDA 2SCUB 5A62A 3OECA 2C1EA 2D13A 3ADOA 4WESB 4C0BA 1G9SA 4YFVA 4XCQA 1B0PA 1F1JA 4US1R 2GXAA 1K9SA 2CHVA 4Q16A 2II6A 2Y2VA 3MTBA 1EH5A 3ZWOA 1GU1A 1VJ5A 3EXG1 4WKBA 3FUVA 4PXSA 2ZIVB 3R44A 1Y1TA 3TLMA 1HY3A 1E7SA 4FDMA 5M2QA 1DEOA 3Q3EA 4K9DA 5JLJA 3CEHA 1XEXA 4Q18A 4UUNA 3ANLA 2OECA 3NNDA 1X1AA 5FR1A 4DJEC 2FG7C 3QW4B 2M6LA 2Q3JA 4L9WA 4QAQA 1OBHA 3QYJA 2WTMA 2C7GA 2V0NA 4RCVA 4A0HA 1PZHA 4BEJA 1F8YA 2R1TB 3KM0A 4LXIA 3INTA 3OZIA 4O4JB 4Z4CA 1DE0A 2H0QA 3OZWA 5LXTA 1HK7A 5IYZF 4BX8A 3M1YA 4YGYA 4DZTA 4I5DA 4TSKA 4E4TA 3C3EA 4OJNA 3A36A 4ASUD 5CHEA 1C1HA 3FPHA 4CLHA 3IOMA 2DHRA 2D74A 4PPYA 2ATIA 4P54A 1YKSA 3HQ4O 3TQOA 3ZK9A 1I4LD 2FAXA 2F9FA 4L16A 1DDOA 1P7VA 2Y71A 5IZ4A 1M2GA 3WBKA 1E99A 2OV6A 4JLKA 1XZLA 4TWBA 4LNUA 1PD0A 2Q9UA 4NKRA 1DQZA 1YS1X 1Y1KE 3LYLA 3S2GA 1XAHA 3TLGA 1UADA 2DR0A 2VNHA 1X7WA 1LJUA 2GK3A 2G72A 2QNRA 1MXFA 2X15A 4GZMA 4NNOA 2YZ7A 1EJ2A 5KHLB 2XQVA 3TIGA 3U7HB 5BSMA 3ROTA 4YS6A 3V8RA 4TUYB 2NQTA 4TRRA 1IXKA 4DCJA 1GPBA 4C05A 3K8OE 1VQ1A 4GC9A 1QTQA 2QL7A 4FYYA 5YASA 1XZKA 2HV9A 2IEAA 3DYIA 1VXOA 1R4NA 3S1AA 2AJTA 4EEZA 1ZL0A 3NPAA 5DGXA 2WFLB 4D9HA 4GP6A 1CRWG 2I4NA 1IFXA 4AUNA 5IJ0B 1R9MA 4C9BA 1BMTA 3LPMA 3P9QA 2CNDA 1CE8B 2LPMA 2XSZD 3Q2OA 5AKEA 4KYVA 5DEIA 1M6HA 4ZVQA 3VR6A 721PA 4TTAA 5TR9A 5LB4A 3TNDA 3COWA 1NI4A 4H4EA 3E70C 3JQFA 3MWFA 2VDVE 3VBEA 3X0DA 3SWWA 2CBXA 2AC2A 3IBFA 1T9ZA 2Y4NA 4O4IB 4YQYA 4MAAA 5CX1B 4C04A 2P4UA 1V3UA 1E69A 3IOBA 2DU8A 5F4BA 3T9EA 1AKUA 5CT5A 3MCUA 1XNJA 3A58B 1CS0A 4XYBA 4X7MA 1K66A 4DA4A 3R24A 1BXZA 2D06A 5L3VA 4OHYA 3F8TA 4QFCA 2ILVA 3P2JA 3SFZA 4DJDC 1DOAA 1E6WA 2QX9A 1S7CA 3AM5A 4QGAA 2W70A 2A78A 4QOSA 1UOQA 3IT0A 4DLWA 3EH1A 3L8MA 5HF8A 3W9UA 5A5VA 3VC3A 2GWRA 2R7AA 4G23A 4CW7A 3REQA 3KYDB 1DWOA 2I6FA 1JSLA 2XE6A 1FX0B 3A0UA 4IIGA 2N9UA 2WAAA 3OM8A 4ZQHA 1JJBA 1IATA 2VUHB 2XQKA 1DKOA 1H5UA 2O0MA 3OU7A 3TNJA 5BWOA 1HRKA 2D1YA 4HT3B 1EP3B 1QUEA 5DB4A 3VKWA 2ISSD 4BZWA 3NGLA 4LMAA 3E05A 1HNWB 2IDJA 3DSRA 3P4YA 1EFCA 1G5PA 1ZEMA 2NU6B 3DE2X 1PV1A 5DYIA 1KQ3A 4GM1A 1U4SA 1QKIA 4F4JA 2CNWD 2GAJA 3OT1A 1M7BA 1GXSB 2GCPA 3HKCB 4HSEA 1IWPB 4GUDA 3GHHA 3K8QA 3R0QA 4O8CA 3TE7A 2UYQA 4TL6A 5IEJA 1X7YA 2IZOA 3G2HA 3MBIA 4JQOA 1GNSA 3U09A 1W96A 3CH7A 4KDRA 3LCJA 2OM2A 3LO5A 3QBTA 3WNQA 4AY3A 1N0UA 3QMPA 3ABRB 3BL6A 4CCSA 4BFTA 1DIGA 5TF4A 4RJTA 1W0CA 4JU8A 3AHFA 3W5HA 5BORA 3AVTA 4AUKA 3BF8A 3ZNOA 1PJSA 1ZKMA 3ONWA 4W5HA 1IEVA 1ZXLA 4Q1EA 5AW2A 4NENB 1VL5A 2G4LA 1I0IA 2NVWA 5E7MA 4DGQA 4FFMA 1L3BA 2PLRA 2VDWA 3CMCO 1G5FA 1QGOA 1XTQA 5EJAA 5EIBC 4RTJA 2CMFA 1AC5A 1F0YA 2PT5A 2IBMA 1G5IA 1PJ4A 4JUFA 1BX0A 3EGIA 4LMPA 5HJ2A 4A1OA 4BB0A 3ZN2A 2QUBA 1LVHA 3ESQA 3HEBA 5JEDA 1Z8HA 3KAJA 2PGOA 1V95A 2IUYA 3S7ZA 2Y0PA 4JYCA 4B2LA 1PFUA 2AEFA 3EMVA 4ALNA 8OHMA 2O14A 2OGUA 1JKMA 1R0LA 4L8LA 4BRUA 3ZJUA 1CUXA 3I5MA 3TLAA 2ZXEA 1WBDA 1Q7CA 4RHCA 4RMNA 4IIVA 1FQOA 5K51A 3MJCA 1KY3A 5K3EA 2ZS7A 2JIRA 2LRHA 1D07A 5BSHA 4L9AA 3LT5A 4BLQA 1T1SA 4EI9A 3G8DA 1KRHA 1W1WA 2Q7OE 1JPJA 4DIEA 4E4YA 4Q7QA 1NZFA 1FUUA 5K8UA 1WS6A 4TV8F 3T5PA 4G9BA 3L1JA 5HKOA 2OAP1 1C0IA 4FXPA 4Y18A 5JH7A 4Q3NA 1L4MA 3LC0A 3RROA 2BEWB 2GEUA 1YS9A 3PP8A 2AOUA 2E89A 2OOKA 3EVAA 3OQVA 4V3BA 4DCGA 4NWIA 2NO7A 3VPSA 1Y7HA 1BIFA 3EZYA 3REOA 1N3BA 2EW2A 2XTNA 3U48A 3SR0A 3FMVA 3VH4A 1US8A 3SHQA 3I1YA 2V8OA 1S3IA 1TYAE 2FFBA 1FMJA 2RHWA 1U8ZA 1EFRA 5A05A 3HFSA 3PQFA 4Z9FA 2YC4C 3E81A 3HEMA 3PXEA 4JB2A 3WYGA 1NR1A 3IQXA 3QKUA 3AFOA 5ALVA 3GUUA 3FYHA 1V7ZA 3OQIA 1E3DA 1DXQA 1PT5A 2H00A 3QEKA 1RXVA 1UKCA 2XMGA 3CZAA 3HJGA 4FJ1A 3PYMA 2YHAA 4PYQA 2QTVA 1G3IA 5DYTA 1PL7A 3AETB 4NBNA 1JXQA 3G3EA 4A2PA 4G6ZA 3RDPA 2P65A 4B4DA 2VK4A 4NPHA 1J6UA 1SFRA 2OUIA 3NIDB 4LTNA 4N6OA 4AXXA 1CBUA 1SUSA 1UC4B 2Z0MA 1DS6A 2ZI5A 1I8TA 3PC7A 4LRSB 1JJ7A 2VHYA 3BS4A 1H94A 2ZTUA 3D31A 2EWWA 1ZD5A 2XMZA 4G4SO 4HYYA 4K1XA 3ZTYA 3LBNA 4EKYA 2C0QA 5TS3A 2Z08A 1HMYA 4S1OA 5FQNA 4CMEA 3ETDA 5CA0B 4JIMA 4BEVA 2G80A 1VIYA 4MHSA 2JL1A 2FFAA 4F8YA 2NU7B 3RHFA 3QFRA 4R01A 1JEQA 4FE3A 4FDVA 4JP5A 4B3MB 1ABFA 3OCYA 4NEGA 3FTQA 2WNSA 4N3NA 4GGOA 5KS2A 4KOAA 4G09A 2OCLA 5CW1A 4EZEA 1GRQA 3A27A 4ETNA 4ZYXA 3LSTA 4EI7A 4JHLA 4Y9SA 1TCAA 4LHWA 4HQNA 2DBQA 5L3QB 5HTOA 2FN7A 3NWBA 4RQBA 4X9XA 4IV5A 2BN4A 2JBWA 2WYOA 4AO7A 2E55A 1CUAA 2OZPA 2B83A 2RHGB 2XUGA 4AFNA 3BFJA 1VYVA 3FA2A 2V54A 5BQXA 4AN1A 4NX2A 4MRVA 3FW1A 3JSAA 2XR1A 4L15A 4QXPA 4TT8A 4CMAA 3LYUA 4HP8A 5J43A 2J48A 1GPKA 4GZ6A 4JBLA 1WZEA 4F2PA 3AI1A 4S04A 1BHJA 4N3CA 2IOQA 3AB8A 4Q9DA 1IBLB 1KK2A 4MCIA 4YRFA 4MIKA 2VJNA 5AI8A 1V96A 3S55A 1EFKA 1XXHA 3V4LA 1XELA 3HV2A 4NE2A 4KX3A 5ALIA 1RYZA 1NVXQ 3O2JA 1SBTA 3CCBA 3X1DA 1HYBA 1W6UA 4WZ6A 3T95A 5CHYA 1K5PA 2J32A 4RFSA 2SECE 4FHDA 4QIHA 4ZQIA 4PCVA 5B1HA 3OX3A 1YBAA 4XWAA 1W76A 2FMIA 1LBTA 3AY3A 1PEAA 2ZWMA 3B5JA 3COSA 3K2EA 2HNKA 1JR3A 2XLCA 4H9GA 4ZAFA 2IYAA 1N5MA 1CP2A 3B5EA 4F4CA 2G3YA 2REXB 4EYOA 3CPSA 1DRVA 1RM3A 3A6PC 3NHKA 1DLJA 2ZU0C 3ZY6A 3NORA 5AH0A 4IG4A 5K0ZA 1Z7GA 2BEJA 2JD1A 3VPAA 5JDCC 3DXXA 4HEQA 2VPTA 4CVNA 4BMSA 2RHOA 1KAMA 5B58T 3BXFA 1DIBA 1P0PA 1XDWA 5FEMA 3TTVA 4ESEA 3VU1A 1EG2A 2QY6A 3UJ6A 5AVXA 2V3VA 2BOVA 2PMFA 2PRJA 3QXGA 2ZB2A 2QJFA 3KTDA 2V8BA 1QGZA 3ZU6A 4FUQA 2AKYA 2ATXA 2XCQA 4FILA 3MJ4A 4TL7A 4EB0A 4NHOA 3OHMA 2FDXA 4R1PA 4YMHA 5JAMA 1FBTA 3C3KA 3FYCA 3PC2A 4Y2HA 3EQ7A 1FTSA 3DBLA 4HYTA 2XUIA 4ZGWA 3NTLA 1GZHB 1KJJA 4JC8A 4QNNA 4JLUA 1J22A 1EZ1A 4Z0HO 4BL5A 5BVGB 3KT3A 5DFAA 1VMEA 4BFVA 5AKGA 3KZXA 5ESRA 3ZHOA 1WY5A 2BI4A 1GAXA 1E2NA 2ZBEA 1T8TA 3N9IA 1E3WA 1K5DA 3E22A 3Q9LA 1ONSA 2GGSA 3N8DA 1DFHA 4KNYA 4ND1A 1XJQA 1YVPA 3UMRA 2WMDA 3OE7A 3A4LA 1FFCA 1HG0A 3QLUA 4QYTA 3UT5B 3GMDA 1M1XB 2GPBA 4ENRA 1RXUA 4W6QA 2IW3A 1ZIDA 3T5CA 5ALTA 3P52A 4PZUA 2HPAA 2FWMX 3UJNA 1MX5A 1UM9A 2FEXA 1UT8A 2HIAA 4HWTA 3PC3A 4AJ4A 1JG4A 1HDZA 1NTRA 1OTHA 4H1WA 4LJ8A 5AM3A 5JQGF 2DH5A 5DHTA 2X58A 4RSMA 3FTEA 3IA2A 1Q5PA 1G4UR 1OWPA 3Q98A 3B9BA 1SCDA 3DMYA 1M0SA 4BVHA 1H2EA 1GPNA 4R8VA 2ZIXA 5ENZA 3WL5A 1M67A 2JK1A 4FVTA 1EM8B 2OO7A 3EWIA 4IHQA 2YNMC 2NSJA 3GEHA 3OUUA 4MHOA 3IGFA 4WK0B 4G25A 3FMGA 3FIJA 5BNIA 4FFOA 3ZWXA 4S12A 4D9EA 2IIVA 4I14A 2EYUA 1Y1SA 1Z6TA 3DW1X 4ZVVA 4C14A 2BBOA 3CF4G 3RBXA 4IDFA 4Q5IA 1S89A 2ZB3A 1OB5A 3OFNA 3PV0A 1TIPA 2W6PA 3RB8A 4QWMA 4OHFA 1X7GA 5ED4A 1I2MA 2H9AA 1SWVA 1UJCA 1KVQA 5LMNB 3HN7A 2ZAGA 2DHCA 4KFCA 3RD5A 2G1UA 2IF0A 3F78A 3AW8A 3I6BA 5K6AA 1VXRA 3Q3GE 5FTNA 3ANMA 1VIVA 3IILA 3MT0A 4QJ4A 2P3LA 4PLZA 1U2TA 3TF5A 3NYWA 4HVCA 3I2GA 3MILA 2DFPA 1G9TA 1DCKA 1NUQA 3ET4A 1JA1A 1HT2E 1Q91A 2PWYA 2QMEA 4HDKA 4XWGA 2W90A 4D6XA 2OHVA 1CVIA 1JEYB 1K88A 2WDPA 2ZBQA 3ROZA 4CIVA 5KSZA 1NC3A 4P2GA 2PDAA 3OKPA 4M53A 1BFUA 1Z74A 3O9MA 4IYRA 3AOEC 4M60A 1Z6ZA 1Z68A 2WUWE 5C1PA 4JI0B 2AW3A 3JS5A 2VSNA 1X1EA 3B1YA 3D6TB 1Z6XA 4DZZA 3QKSA 2QNIA 3F7OA 4RQAA 2ZT6A 4LUCA 2Z57A 4A8JB 3SDZA 4X3PA 4WE3A 3DOEA 1ACMA 3JQEA 1Y33E 2JJMA 4CM3A 5LD2B 1XRJA 4U7DA 2VHXA 2ZUEA 5LP6B 1EXWA 2ZRMA 1WP4A 4ABYA 2ZYRA 3TSYA 3VRHA 4M0CA 4PQFA 3OESA 4KUGA 4GI2A 5GJBA 3HXOA 1W5AA 4UVHA 5EMMA 3KALA 2ZK7A 4BUCA 4DV5B 3I9KA 3IIIA 3P2IA 4K03A 3QUQA 2Q1UA 4WCFB 4CCWA 4XD7D 3TINA 2WIDA 3HA2A 1P6UA 4U2CA 4DSAA 4GPZA 4OHKA 4LBVA 4UFOA 5CTAA 5JZ9A 4PGFA 2BWJA 4IJVA 1QQ6A 2QXUA 1JVNA 3D0QA 3MXOA 2HJGA 4KI7A 4RZSA 1MV5A 1P77A 5EHXA 1C4KA 2H51A 3ZWPA 5LDHA 1H5NA 5KVSA 2V6IA 4QZVA 5L45A 4FSDA 5A2GA 1KAGA 2C4HA 3HHPA 1FU7A 3WYBA 4BGEA 5K8VA 5CPFA 3QTTA 2Q07A 1V3VA 5DDIP 4P7GA 3KRTA 2WEKA 3LUGA 4J16A 4UCXA 4LFCB 4BX2A 5DCYA 3ICOA 4QDXA 5CM9C 3V4SA 2TMDA 2H8KA 2EEPA 4RNDB 4UM8B 2AGVA 2R6CA 2AUNA 3EIXA 4BFZA 3T7DA 2E1PA 1XAGA 4A5OA 2BFPA 2C07A 3EVTA 3IE0A 3JVVA 4IEIA 4F93B 5KOIA 4RTKA 3PGVA 4G0XA 2O7RA 4FS8A 3CUTA 3GFRA 4HSGA 4MRMA 5AVQA 5HF9A 1N1DA 5IF9A 5G02A 2H63A 3TLJA 3UO8B 3V7WA 2DFDA 5AVVA 5LU9A 1JXAA 1Y4ZA 3B3FA 3PEEA 3FB1A 4JEIA 3V46A 2RAVA 2QMZA 3UHFA 4RIGA 4I6EA 3D4OA 1TUEA 3CEJA 4K6MA 2P9GA 3S8MA 2WYWA 3P9PA 2AK2A 1G4AE 5KYWB 3E9RA 5BVHB 5HOEA 2QTRA 3U26A 1LJLA 5G0SA 4QBKA 3FUTA 1GPAA 3WKEA 2RCYA 5HJEA 3CT4A 2NACA 5B3LA 4RL4A 1RWMA 2GVNA 4OSPA 5DRTA 1WB9A 1JP7A 1H5QA 2ODNA 2PQ0A 4BPBA 4CQLB 3NDJA 4Y2QA 1YTUA 2E4XA 5A5DA 4JEHA 1O97D 1W8DA 2DP4E 2B8WA 3A1UA 3N0WA 2YL2A 3KSAC 1RRMA 2HMUA 2WM8A 1G0OA 2QE7A 3BJZA 4C4YA 3OX1A 2BFBB 2P8JA 4ZAWA 1XLTC 1YQXA 4K8RB 4R71A 3D64A 5ETJA 4XUDA 4Z3OA 2XKAA 5L9AA 2W8BA 3NAQA 4RMJA 3WOHA 2REQB 3H9CA 3EH2A 1F6DA 1J8QA 4M9UA 5LNK6 4FMCF 2FMHA 3K9NA 4IXMA 1BMQA 3HB4X 1U2GC 2CBGA 1VC2A 1RFGE 5I9IA 1WV1A 3AEXA 4EVRA 1QG4A 2ES4A 2GJ4A 4A8JC 1CNEA 1EVEA 2IOYA 5KYVA 5DBEX 2V7GA 2VTKA 3IPAA 1Q44A 5LD2C 3OE1A 1TO2E 1L1QA 5LP6C 2R8ZA 3HPQA 4XUGB 1FJGB 3AR4A 3CRZA 3U56A 1T9GR 4YWHA 4B8WA 2VJKA 3EOBI 1HNZB 1EDBA 1KDTA 2V7QA 4KPGA 3MJHA 3QSGA 2XMCA 3PTAA 7REQB 4PLFA 2VCHA 4OQQA 3C4QA 4WCFC 1KJNA 1E1KA 3NYIA 2PM8A 3TK1A 2W9XA 2RGWA 1WZNA 3HPRA 1OI7A 4CDGA 3RVDA 4QBGB 2HU8A 4UXJA 2WJYA 3GEEA 4OQDA 3L7OA 4MR8B 1U7TA 2XQFA 1W581 2R8OA 1NDHA 3ZOKA 4NNJA 1MX3A 5KYUB 4ID3A 2Z6AA 1RWVA 4FK8A 1DKNA 4HNHA 4X91A 1FFXB 3T34A 3EXHA 4EA6A 1IN6A 1UBRS 3AEKA 1J5PA 1L5FA 4OQEA 5JNWA 3RRZA 3R5HA 1ZUWA 3JAMA 1ISMA 2QNBA 2K2WA 3T3MB 3UV3A 1P7ZA 4V0QA 2I7VA 5L53A 4OHPA 2R9VA 5TMBA 3T5AA 3NHRA 4UPVA 4YUYA 1P60A 4CCYA 1OE0A 2YX1A 1LBQA 5LBTA 1CDDA 1VSVA 2OC9A 1XCBA 3E9ZA 2ZRNA 1IZYA 5KYYB 1I01A 4RQUA 3BXPA 3EIWA 1CP3A 2FQWA 1PG5A 2I2AA 1OBVA 2Q4BA 2IUFA 3K2QA 3G8BA 2EZ8A 4CLOB 1R12A 3L3BA 3T1YB 3AXTA 3HADA 3V1MA 1N6PA 4L78A 2BF7A 1NLMA 4Y98A 5F23A 1QFZA 1RHMA 1KI7A 2QVLA 2XVYA 4QFBA 4RMIA 1SM4A 4INPA 2CZCA 5FF9A 3U1BA 3TLEA 5HBRA 1IUKA 1I7LA 3EW7A 4LKRA 5NLLA 1YS2X 4LOHA 3AILA 1LDNA 2GD0A 2IGTA 2B2NA 2HOQA 2JEZA 2C2WA 3HY6A 2B8EA 2JAOA 3M49A 1G5TA 4IXDA 3W3AH 1Z4JA 5IFLA 2O54A 4DCSA 3U3JA 4EK9A 4IUCS 2FR1A 1T8PA 1OWOA 1NBEA 1Z25A 3AX6A 3N58A 3QFCA 4XASA 3H16A 5H70A 4N5DA 4BQOA 1PG0A 4D9JA 3IP1A 4Z3KA 4X65B 3I6QA 5FH9A 3W34A 3H1AA 1UWVA 2JAUA 2XXAA 2YVUA 3N7TA 1G21E 1L9KA 1MRSA 6Q21A 2P41A 2IEBA 4BZXA 4V0NA 4MAFA 1DIAA 5GJVC 4D45A 2C5HA 4EWLA 2G17A 4KR0A 1R8YA 1O57A 2QDKA 1E3IA 1P0MA 5BQOA 3ZXSA 5GONB 4DRXB 5JALA 2HHLA 3DE3X 3QKTA 3MOGA 2TYSB 1RABA 1SQ5A 4O1HA 5TQ0B 1XRRA 1WV0A 4EG1A 3WHPA 4X8OA 4ALIA 2YW2A 1KK1A 1L7RA 3VC2A 3LP5A 1APBA 4K86A 4UPDA 2J0SA 2WJPA 1ORDA 3R7FA 2BSQA 1SBYA 2J5RA 5K0EA 1IIBA 1MVLA 3ANSA 4Q3BA 3DNFA 4R16A 4REOA 5E2AA 1ZMOA 4IH9A 1U80A 4NYMR 5P8WA 1AXEA 1WD5A 3NBAA 4YA6A 3B1JA 3DBVO 1SUEA 2F9LA 2ZQZA 3PUJA 3K9FC 1EVJA 2WZDA 4OMFG 2O8DA 4GL2A 1DEXA 1YO6A 1NUSA 4Q9HA 2XNKA 4TGLA 3RK4A 3WGJA 4FJ2A 5FTWA 2ODWA 1VE6A 3ER9A 3P9SA 1H9CA 1PHPA 1DJQA 2AT1A 2FW8A 1KFKB 2PWZA 3ETCA 3GK3A 1W7AA 2H2DA 4Y2XA 3R5TA 3GEDA 3O31A 1AGPA 3ZV7A 1E9CA 1X15A 3PIDA 1QORA 2C7VA 3EB9A 3OJEA 3ZNPA 2AMFA 4MQ6A 3JZMA 2RAFA 4UJ3A 4B84A 1PK7A 3I04A 5HS6A 1NW3A 3KLNA 2C78A 1XMSA 2PKRA 3ZI4A 2I9KA 4YK7A 3SKXA 3VHXA 1NJ6A 1QZXA 1L6IA 4HQFA 5FB3A 5G53C 3ORQA 3STHA 1BGXT 4RY9A 2GS9A 2VLIA 1QCDA 4HAIA 4I5IA 1KTIA 1DARA 3FWNA 3H8VA 1E9VA 2OCXA 2XTAA 4HLDA 1TQ8A 3RW9A 1ZUHA 4QVKA 2A6PA 3ZC3A 1ACJA 3CSSA 3FVTA 4K88A 1V1RB 3BBPA 4ZJYA 5HQ3B 3CF0A 2FSIA 4D96A 2OV8A 4P58A 1QNFA 1SCBA 4TVBA 1M1UA 1Q1GA 1BWQA 1WIWA 2JLUA 4LI0A 2PGIA 3HH8A 4FNAA 4QGFA 4V0RA 3ZLVA 4D9IA 2OFFA 2VDMB 1Y63A 4DQXA 3PUHA 4H31A 2H65A 1USIA 3B6IA 3RK0A 1A9RA 1A9XB 4TTSA 3FRJA 1Q50A 3L4EA 4DRYA 5AFSA 1CR1A 1VM6A 2VDOB 3QHAA 3KVYA 2SNIE 3O5AA 1S9HA 1D1TA 4ZEVA 4O33A 1PNOA 1DV2A 4FFRA 2CUNA 3DWFA 5T8KC 3RC3A 2F1KA 2HCTA 4QJIA 2XMBA 1Y6RA 1FUIA 2H18A 1KYVA 3C97A 1CQWA 2G9ZA 2XKJE 1DDGA 3JQQA 1O95A 1Z6PA 3QEMB 4QSMA 3SYMA 3CH5A 3RIXA 3CS3A 4A5SA 1GYPA 2AS0A 4R69A 4JN6B 2YDXA 2RGBA 2Y05A 1QFXA 3R3VA 4F6RB 1X8XA 1YFKA 4MW9A 2HMSA 2WQZA 4BN4A 3C6YA 3IIJA 3R2JA 4UXIA 1CRLA 2IKQA 1PE0A 2PE5A 2E4ZA 1EFDN 2GYVA 2M1XA 1TK2A 4Y9TA 3I8OA 4ANFA 1Q77A 2HA3A 3N28A 1WU7A 4N7BA 5JHHB 2I2CA 3RRFA 4EHLA 4EYGA 2GEFA 5IF3A 4N0QA 2Q5EA 1W5BA 4L2IA 1P7CA 1X0VA 5I7OA 2HHCA 2IS2A 3FUUA 2V74B 4CMEC 2AOTA 2JJ1A 3Q0EA 4GLFA 3GJ6A 4YIKA 3WQBA 2PJZA 1GRNA 3BE6A 4BMOB 1XMJA 4P81A 5BN5B 1E77A 2YDYA 2XDAA 2ZI6A 2XCUA 4YJKA 4ZCRA 3U4AA 3K72B 1PGOA 3KC2A 3D2LA 5IVPA 1QIKA 1PCXA 4UVEA 4AZ0A 4ZVNA 1KQNA 2OB2A 4C7XA 2E6UX 1VL8A 1VKRA 3EW9A 3K1YA 2ENUA 4QKQA 1MZPA 1U0SY 1OY1A 4C08A 1XALA 2AXPA 2A0YA 2IS1A 1FK8A 4V0ME 4RKQA 2AN5A 3H04A 5F2EA 4E12A 3LUJA 4DPMA 1M9NA 4G8CA 1D2HA 5EYPB 3RC2A 4BU1A 3P2KA 4YO8A 2B2XA 1A71A 4CCYB 3A3NA 1Y80A 3W77A 1KP3A 3UJBA 2A5DA 3D0OA 3L0OA 1I2BA 3W4JA 1ZDMA 2HIHA 2QQFA 1P45A 3FZYA 4BNZA 2OHHA 2F7SA 3EEYA 4TV9F 1RQ2A 3GMIA 2JBAA 4FLMA 1VIMA 4COOA 3IUJA 1ZIXA 2VJDA 1PFYA 3R23A 4MR9B 4PZDA 2HK8A 3B48A 5KU7A 3UPUA 2E0IA 4II3A 2G0AA 5FAKA 2GN0A 1ABEA 4L4UA 1E1RA 2OO5A 2Z1MA 4RY8A 1TKCA 2YWHA 2OCYC 2PMDA 1QSGA 2LP4Y 4ER5A 4BAUA 3Q6IA 2G1KA 3O8OA 3ZXXA 4DIMA 1Z2CA 3MWDB 5JNRA 1KETA 1A8PA 2HEIA 3T1VA 1NATA 2V59A 2BGGA 1ESCA 4ZFNA 2W2KA 3AJAA 1QMPA 5KX5F 3FWYA 2ZBVA 1Y48E 3VR1A 4UMVA 1QHEA 2BGLA 3LWBA 3GJQA 3AUTA 4YECA 4YY3B 1JVSA 2PBRA 1SZJG 3CURA 4CRWB 3DV0A 2NSHA 1A4UA 2F67A 2OOSA 1NASA 3AOGA 3GZ4A 1Y7LA 5I45A 3DMFA 3RJTA 4RXMA 3UXEA 1II8A 3KSMA 1JIXA 2BKXA 4KFRA 4EMUA 4YUWA 3GN2A 1BH2A 3NJRA 1R3DA 5AKYA 3H83A 4MKGA 5IAAA 3KLPX 1ZOOA 4D8YA 2AR7A 4QPDA 5CVCA 3TBKA 5F77A 2FP4A 1ZMTA 2VH2A 2JGLA 2W2XA 3CINA 4A0SA 5AUNB 2IHNA 3ASZA 1MIOA 2C04A 1E94E 3LECA 4O3MA 4EHIA 2YHIA 4JH0A 4MP8A 4WXHA 3RS8A 3CTPA 3FY4A 4DLKA 5K2OA 1YC5A 3DM9B 4FFPA 1E79D 4MW7A 1EE9A 2EX4A 3W2HA 4RK5A 2IUEA 3SY8A 4BS9A 2XT6A 4CT0A 4XEUA 1ODCA 1U81A 1UFKA 1XU4A 3KUDA 4G0QA 3AWDA 1KYIA 5TEWA 1E5DA 2XF2A 4WXRA 3SBDA 4CU2A 5REQA 2C8VA 1MP0A 4CM4B 2HUNA 3GVHA 4H0FA 2JCVA 1E8NA 1VRCA 5DIFA 1WHSB 3KQKA 3LX8A 1QVRA 5KMGB 5JEEA 2PVCA 3TR6A 5IUKC 1P1CA 3ENKA 3N5KA 2VBFA 2XT9A 2P5YA 5I7SA 3SSNA 4B3JA 5BUCA 2FWJA 3ZUGA 4E6PA 2BAGA 3GEPA 5FUQA 1FVFA 2NZYA 4QDZA 4JI4B 3RU7A 4L8YA 3OM9A 2R62A 4EYSA 4X71A 4DMCA 4D4LA 4G1CA 4KIGA 4Q9JA 3RR2A 1M10A 2JD0A 4EI8A 2YINC 3WA6A 4B6QA 2JIQA 4XPZA 5CK4A 3MWJA 1C3LA 1TT5B 2GZDA 4JFAA 2ZDGA 2GN8A 1DT5A 4P31A 4RZIA 5CW2A 4BLVA 4FWTA 2XB2A 1M2KA 1PK8A 3UB3A 3FPKA 3HWWA 4WVLA 3VR3A 1X80B 4WBNF 1ILEA 4FC6A 3UG7A 1YQUA 2AJ8A 2IH4A 3LRPA 3MMXA 4QEDA 3HE3A 1LQ2A 4HDAA 4MLDA 3U7JA 1ODTC 1KL7A 3ZS9A 1IM8A 1Z34A 3FYUA 3KQOA 5DBGA 1UODA 4BKRA 1NF9A 1ST2A 1H2XA 3CUVA 4LISA 2PUEA 1Y5LA 1ELOA 3GH1A 2PRZA 3M6UA 3SKVA 3HBJA 3RHZA 4JDPA 2WF7A 2CDRA 2MSNA 3TCXB 2HR1A 1UKAA 2QLLA 1ZCFA 3F97A 4UU1A 4KDCA 1X42A 1O94D 1FP4A 4Q7EA 5ALXA 4ZT4A 3FNEA 4RTSA 1CUEA 4H3VA 5ITZA 2Q5JA 4KIFA 4WA7A 1WMEA 4LX0A 3L7IA 4PLPA 4CKCA 3CLKA 4OJMX 1Z62A 1P0QA 2PT7A 1Y42X 2CMGA 2EKDA 3PWKA 4ALMA 1NBMD 2ZANA 3AQ4A 3HI4A 4GOND 4CHTA 1GDHA 1N2OA 1SRRA 1Y3DE 3HXTA 3CNLA 4LDJA 4E1VA 5KNBD 5GAJA 4C7OA 1JLRA 1TO1E 3LXUX 4X1OA 1VBMA 1QBKC 1VDMA 1WRBA 4IDAA 4DR4B 2OD2A 3HDQA 3PVZA 2ONZA 4M0EA 2ORYA 1CVRA 1G41A 3AVXA 1KQFA 1CQIB 3GZJA 2Y2UA 1U04A 1K4KA 4PXYA 3MHPA 5ER6A 2XUAA 4AO6A 1TZMA 3N8GA 1Y1LA 2A86A 3QVLA 1UMKA 4P7FA 2GF0A 3ZBQA 3PFNA 2FPSA 3ZIAD 2FZVA 1SQ0A 4M1SA 4QJ5A 4W1RA 1KYZA 3ML1A 4CLXA 2E5LB 4EJ2A 1RPNA 4N18A 4IQFA 4RTOA 4HXFB 4MWEA 2GNPA 1KEEB 1E1CB 3N53A 3MAGA 4MW4A 5KVCA 1EUDA 3NWEA 1A2KC 1MNQA 1RC1A 2J46A 2WG0A 5FOUA 1QPZA 5L3SB 1GGFA 4MV4A 2LBPA 4RKRA 2I76A 4E33A 5H80A 4R40A 3GIDA 4JBXA 3MK31 1TRHA 3B12A 3EGOA 3R76A 2F00A 4FWIB 3MTIA 3KPWA 4OXQA 4H1TA 1RXCA 2FWBA 2CXTA 1L5WA 5CD9A 2X0RA 1OXMA 3I28A 3R6WA 3BIWA 4HAZA 4IFTA 3PE4A 4FGKA 3CBQA 2OXTA 5DGHA 3M9LA 4EA8A 2VOJA 2BEVB 2XZTA 1E4VA 5ILQA 4EMTA 5E2IA 1G7TA 4CN9A 4U39A 1DOHA 3Q0TA 4IIHA 4DLYA 1YVRA 1I7NA 2F3TA 1N1EA 1QO0A 1YCHA 2ZTSA 1X7ZA 3VGJA 3PHCA 2HADA 3K0BA 4MV8A 1W5EA 3RIYA 4C0AC 3QE9Y 2B5OA 2Y6UA 2XYQA 4LV8B 4CLDA 2PIAA 3RFVA 1NNEA 1C1XB 4LZLA 2PAFA 5D1HA 3NIBA 2JCGA 5H3CA 4D4MA 1SXJE 1C41A 1XZGA 4XRGA 5IBCA 5AI6A 4O02B 4O2AF 4ZDJA 4PS1A 2R44A 3UHAA 3KHSA 1JGTA 3L0YA 3VNAA 1VSUA 3KOUA 3IQFA 2HSDA 4MRNA 3CFYA 2J7PA 1RKXA 5DTRA 4CMCA 4X90A 1FRNA 1J7KA 1UBLS 2JATA 2NOAA 2X6RA 2XA2A 2HFKA 5JWHA 5JS8A 4XOUA 3H4IA 5T4EA 1CFJA 3HB7A 4I55B 2RH9B 3QTBA 3FBGA 1E18A 1GRRA 3DEIA 4IJWA 1ANKA 4KLRA 2ZI9A 5DM1A 5EE0A 3KL2A 3MM4A 4TVOA 4CIWA 1BWPA 1M33A 1U0NA 2VRWA 3P9ZA 4NCJA 3QMWA 4P6VF 5DHFA 3PX7A 1XEWY 4AJLA 2ZJ4A 4WLFA 4H0CA 2ZQYA 3VKVA 5EUBA 1ZD8A 3WKDA 5IVHA 2XOXA 5ITVA 1IOZA 2EQAA 4OV6B 3U3ZA 3WQRA 2ZR8A 3PXXA 2J6CA 2PS0A 2JLRA 2ZUBA 2GLTA 4PHHA 4F45A 2HMVA 3TL3A 2PUFA 3IUNA 2ZE8A 2P6MA 4IFEA 4QQFA 4F2WA 5G0WA 4O4HB 1MQAA 4DMGA 2BC9A 4RD1A 4TWJA 1BAPA 5IKEA 4XDHA 2NZVG 2GVDC 1TX4B 1LSSA 3AF5A 3ESXA 5EE3A 3KPUA 3LPDA 1FNNA 4LTDA 1J0DA 3OZRA 2W71A 3KVVA 4U9UA 3GXOA 1U0HC 1G21A 2NXWA 4WGFA 1F8UA 1SELA 5DHUA 3RVPA 2IX3A 1PQYA 2HA7A 5A4KA 2J3QA 2PXCA 5GJWC 2DJIA 2PMEA 1SGWA 1T6ZA 3P2MA 5IULC 1WX1A 4UVGA 3O73A 1SG9A 4LYYA 3SHOA 3VOAA 2V9ZA 3NYQA 3V6MA 1BOOA 2POQX 3L1IA 5E7JA 2O8CB 1CQJB 1R6UA 3CZ9A 4OM7A 3C1TA 3DUWA 3WBJA 1M34B 3DEZA 4V02A 3OPYI 3H9BA 1NLYA 2ZI3A 2VBCA 1SBZA 4AP6A 5C53B 4R9RA 1J2EA 4DQ0A 1YC2A 1BNCA 5AMXA 4EI2A 1R10A 3BJRA 3R4CA 1F8FA 3PR1A 1PLJA 1TYCA 2O0KA 5CT9A 5DW0A 1YB5A 3MWEA 5AI9A 4U2BA 4EF6A 1J0CA 1X7HA 2P4EA 3IXMA 1E32A 2D5AA 3THYB 2H4JA 1BD4A 1CCWA 3L6BA 3RJ5A 5AYVA 3VMMA 4YDSA 1G20E 4U0KA 4OXNA 3LO8A 1UZUA 4FYIA 4RF4A 2RGEA 1IBSA 4X92A 5BSVA 2R97A 2HQ1A 2NZ2A 3G82C 4GYKA 5K03A 2I6XA 3NHUA 3JATA 2YICA 2QRGA 5JVDA 1GQYA 1C30A 4MLPA 1M2OB 1AQNA 4WV3A 5F33A 1VHWA 4OB6A 2PZ8A 4QJ3A 3Q3HA 2IYOA 3VUEA 3G5AA 1SBNE 4K1LA 3TEJA 3IQZA 2IV7A 2PRKA 3ES9A 2BKAA 1ESEA 3I64A 4HLUA 2R7KA 1GGJA 3D9QX 3A6GA 5J2TB 2WHXA 4QVGA 4P0QB 2ZAIA 1GCAA 3KYJB 1P17A 3MGGA 1GL6A 2RGGA 4MWBA 2B69A 1VYHA 3Q72A 4ZKEA 3U17A 5KJ1A 2FR0A 2GBFA 2Z8XA 4TYWA 4AZVA 5JTTA 2Q50A 3O4FA 1BJTA 2GKGA 1HFWA 4G67A 2X5KO 4TKUA 3W1VA 1L5HA 1ZVKA 1XOIA 2IDKA 2ZP1A 3B85A 3BOSA 4R1UA 2NGRA 2WKQA 3BJIC 3CNBA 4BE9A 1Z35A 2IELA 3MQ2A 2ZVPX 2J33A 2VZEA 4UZSA 1EKXA 4ACAA 5HWSA 1QGUA 1GTL1 3DYBA 3IAFA 5FUYA 1K63A 2PFKA 5D51S 4LF9B 2CL6X 2ISCA 1H22A 5E0KB 3UN1A 5K0BA 4YT4A 1G66A 1H8ED 1W9MA 2EQBA 2LNDA 3LLVA 1QHFA 2L42A 3IEIA 4O59O 5DE3A 1TLLA 3SM3A 3ZW9A 3ERCA 3FI0A 1JZQA 2EDAA 4WXMA 2GUWA 2R4TA 4TMYA 1NJFA 3K3PA 2PL3A 1AQUA 3I01M 5BR8B 4NZ9A 3N2KA 4DWJA 4EY8A 4RJJA 3EXIB 4CNQA 1C7EA 3WRYC 4AYWA 5C8YB 1N4DA 1U02A 5K0CA 1SXQA 4EZIA 3VI3B 2UV8A 4L8VA 2CLSA 1Z2DA 1N2XA 3B3JA 5CYFA 3PJEA 1DQNA 4YP0A 4XH9B 3CMMA 4LVNA 2YYAA 3MJEA 2Z2KA 4LXQA 3VBCA 1U28A 1XZDA 2C2YA 2X3FA 3JY6A 4BEWA 3SLGA 1N32B 3AC0A 5B3JC 1N2CB 3FKQA 3T7IA 3TX2A 1HFJA 3QOYA 3GFOA 3SZUA 1N3LA 3EVDA 1KYQA 3DBOB 2QW0X 4K0KB 1PVVA 2Y99A 3OZ7A 2XNJA 3FD8A 3QEAZ 2HA5A 3BVPA 3KEQA 4Y9RA 4RTQA 5CA1B 2H3HA 4I66A 4I1YA 1G38A 3NVAA 4FEYA 3PQ2A 4MZDA 1KZ6A 2BDTA 4A3SA 1T4DA 3TRJA 1R8XA 5THKA 1RDFA 4CEHA 3T1QA 1J97A 2FN8A 2HLDA 4C1BA 3MCTA 2Q3HA 4CMJA 4MP6A 3ADDA 4K9RA 2PV0A 2NG1A 1X7DA 2F64A 3HCRA 1A4IA 3QX8A 4QYMA 2FKAA 1O9BA 3JCZA 3L0IB 3WISA 5KNDD 1PTJC 1U11A 3AWIA 4RZ3A 2GHIA 2N1MA 3OPQA 3S2SA 3S2IA 1V41E 3N3BC 4LRUA 1ORRA 1O5TA 1Z13A 2EHJA 2ZS8A 3BPSA 4V0MA 1GITA 3WL7A 2CNLA 3KLBA 1TVMA 3ZCSA 4D8UA 4CV1A 1RAAA 4QICA 4KGZA 4BMVA 1GR0A 3N5CA 1SQ6A 2FMFA 2NTVA 3Q40A 4RVOA 1N36B 3ZJTA 5A9RA 1RWNA 2XOKD 3A6KA 3ACCA 3TMKA 2VP3A 4CFSA 2RBKA 1Y89A 5SZKB 3Q8XB 4IJQA 1NXTA 3V33A 1A7UA 1RZVA 3AJEA 3FVVA 3A6JA 3UYKA 5J4VA 1UBKS 4ZCPA 3R8XA 3ROMA 4YLGA 2RI0A 4LJ6A 3VTAA 3WHKA 2JIPA 4V0OA 3I53A 1HSZA 4S35A 1H1LA 4JA0A 5J40A 2ZCJA 2DQYA 5JDIA 2EF1A 5IH3A 3REFA 2YZMA 3TDMA 4X1KA 4PGHA 3D6UA 5DHPA 2ST1A 2VRCA 421PA 3IAS6 3ONFA 1CF4A 3RV3A 1WB5A 3D4LA 4KC0A 3K0AA 2IPOA 1E2JA 3GJ7A 3I0ZA 3A3YA 4FHGA 1GQRA 4BJHB 4WN9A 3TFWA 2Y1WA 3P9NA 3O6VA 3ZR4B 3TZEA 1EUZA 3G2OA 4E5NA 1P1HA 5IJXA 4D41A 2OILA 1ZVVA 3PEYA 5T5QA 1FDSA 1RMYA 3W2TA 1XP8A 4OUDB 8GPBA 3RGGA 2R751 1CUWA 3MOSA 4LBZA 3VISA 4F6LA 3LIPA 2G09A 1O87A 1YVUA 2FWNA 2ZE7A 5JH7F 4FJ0A 2CSUA 3LA6A 3VDXA 1SKBA 4G1MB 4ZCMA 5BN1A 4EL5A 1AHPA 4DJTA 4D74A 1BZYA 4YRBA 2WU4A 1IRIA 5F76A 5J1TB 2WE8A 3RU9A 5L4NA 1LF0A 1D3AA 1YK0A 2VHVA 3FKSD 2XWQA 1QU3A 1X8JA 4ZOLB 1F2TB 1G1MA 1I14A 1LPAB 4N76A 1GLGA 2DH6A 3FNQA 2ZVQX 5ALDA 5JCOC 4YCBA 4TM8A 4OYRA 4IDEA 3WBFA 1LX6A 2HBZA 2PLWA 1ZN7A 2HMTA 4WNAA 4JS0A 2J5KA 4KN6A 3NBZC 1FA9A 5AP9A 3HBFA 1E3LA 2QN2A 4Y2YA 2NT3A 3NWJA 4WUTA 1TVKA 1H05A 2H5JA 2QBYB 3HY3A 2UXBB 2NXJA 4R0VA 4XVRA 2C84A 5DYWA 1Z6QA 5EA2A 2CLEB 2JFUA 5LZ8A 2WSYB 3PE3A 4U2EA 1T3GA 3D2CA 3PGMA 4TVKA 1Z5NA 4L6IA 5HRAA 1CW2B 1EB9A 1EP1B 5IX8A 1QIMA 3ILHA 2JGJA 1SKQA 3E8MA 3MRSA 3QV1A 4QG3A 5JRJA 9MHTA 1TZJA 2O5EA 3TCKA 1M2EA 4RF3A 3TTYA 3CO0S 3SC2B 1JI3A 3ZWDA 2OQRA 4AJKA 5KDDA 2IXFA 3BORA 3UK2A 4EF5A 3IIMA 4XIGS 1BWSA 2FXVA 2QRVB 3TKAA 4F38A 1U0BB 1XTVA 2P67A 3F5SA 1Y8RA 3OFKA 4Q3LA 3B6ZA 3QFFA 3LX6A 2JLCA 4DRZA 1MW9X 3GRRA 4L6AA 4DUZB 3PHBE 1VJGA 1D9ZA 4L4RA 3WA7A 2KW5A 3NOVA 1XWFA 1L7BA 3RBAA 3V7UA 3L40A 7REQA 3OJXA 2EKLA 1OZAA 4WASA 1ZNZA 2H2WA 2XD4A 2IP2A 4FZJA 3WO1A 4N1AA 4W5TA 4OHCA 1LS6A 1U2QA 3LCMA 4E5MA 3SGLA 3LQFA 3D4NA 3WYEA 2I3BA 5HZHA 2PX3A 4GLJA 1XZFA 5K4AA 5A9SA 4BQRA 3BFVA 2OO5C 4BNDB 2O2EA 1RWPA 2P2DA 4ZVSA 2GPAA 5A3JA 1T1EA 2QRMA 3GYGA 3LW8A 3MG9A 4IP0A 3BXHA 4TKMA 3W5IA 2JIZA 2C7QA 1K3FA 5HZMA 2FOXA 2KBFA 4AS2A 1L4HA 1T15A 1DWPA 1XGKA 3IVXA 4KRXA 4UKDA 1Q0PA 3AYXB 3E2MA 5AQEA 4GP7A 2VK8A 2UVPB 3IP6A 1GNVA 1U1EA 2IEIA 4NV0A 4XDZA 1CUDA 1KFBB 1MGOA 1VKJA 3SJZA 2PZFA 2CLCX 3VZPA 7AT1A 2ICAA 3ZJVA 2GCIA 1EHIA 3NRJA 3RSQA 3HCNA 5LLDA 1XCPA 3G1TA 1P2BA 1YR7A 5EXEA 1KORA 2OGTA 4MWDA 4PYOA 5EIEA 1J33A 2IXTA 1NU8A 2ZYWX 1QZZA 2HDNB 1LVGA 1VLLA 2HL6A 3KV3O 2OHIA 3NIWA 4K9NA 3U49A 2WAMA 1FSZA 2IPMA 1TCBA 2A9OA 3C98A 4CL3A 1MRNA 4G81A 5D7NA 2RD2A 1T26A 1VSTA 3QVSA 3RRMA 1F14A 2OZLA 2JKVA 3OIWA 4PO1A 4TM7A 2ZITA 1PK9A 3HR8A 2Y0BA 4F3CA 1HLPA 4GOJA 3ZGYA 4J1SA 4L3OA 3KU4A 3L2OB 4KVAA 2H5LA 2WSMA 1XZ8A 3KJZA 2NX2A 5FORA 3ZQ4A 1ODLA 2YVAA 5FBRB 1FLVA 1EHYA 2YJ5A 1JDUA 2G08A 2Z3WA 2VDNB 4Q4HB 3R3SA 3TR0A 3CEMA 4E7OA 1NPDA 4NP6A 1V35A 3EQZA 4G9GA 1OILA 1Z3CA 2VRBA 3CRW1 4NBUA 3WLMA 5JASA 3RSOA 4HWGA 2CJWA 1PJLA 1WCWA 2W2TA 3P0HA 3GGSA 3I9JA 4NYMQ 2YVQA 3ESAA 4FFBA 4ZVLA 4H0NA 1YS4A 1IMJA 2REQA 2FDCA 5HOQA 3HUEA 3T3DA 4QLBA 1FW8A 3LLMA 4FR5A 5G41A 3ROXA 4L8FA 4HNUA 1I3OA 1EGQA 1XMPA 3EF3A 1RMTA 4ARUA 1JDSA 2WB2A 1AXRA 1YRBA 2NV2B 1QLJA 2Q29A 1QHSA 2ORIA 4D26A 1YJQA 3E23A 4JI2B 1WXEA 3E9QA 2RONA 4ETIA 5AM0A 3WIUA 1CEYA 1NSTA 4F8EA 3UHJA 3G9XA 4LY3A 5GTDA 2AMLA 2Y1KA 4KQMA 3G5UA 1V4VA 1NGSA 2XWPA 2XZDA 3ONEA 4P92A 2FRXA 3NMUF 3QFHA 4KMMA 4JUBA 5ECYA 3GD7A 1VMIA 3MUOA 4BX0A 1FCJA 4Q0MA 4YUVA 3TJRA 4HVLA 5F9FA 5KWSA 3VPBA 5JSZA 3U4QA 1I30A 4TN1A 5CLJA 3FYUC 4B7XA 1C3EA 2H9YA 2R60A 1P8AA 3ZDZB 1JG7A 2H31A 1D1PA 4Y2GA 2HHJA 1SUAA 2OQVA 1SXJA 5F1OA 1VGVA 5CBKA 5K05A 2P69A 4UHDA 2YIMA 1K5GA 4HAXA 1ZM7A 2QV0A 4OQFA 3PLAE 3AEUA 4ITRC 3IMGA 3I62A 1V11B 2BHRA 4B7UA 4NCNA 2V6GA 3FMFA 4W63A 1JJVA 1R27A 4WKGA 4B2IA 5IDWA 4AKTA 2X0NA 1QIFA 1EM6A 5BNZA 2GT1A 1SCUA 4YJ3B 4OK5A 2PVSA 2E3JA 2ATCA 2QL6A 4PAQA 1M1YB 4BBJA 1HKUA 4TYYA 1G5RA 1KJWA 4A6PA 3PFCA 2VHJA 5BPHA 3JX9A 1GY8A 2PTGA 1WLYA 3GLHE 3FUWA 3NC1C 3JWIA 4GMFA 3HB5X 4NFHA 3G79A 4QOGA 1GOTA 1L0BA 3GNTA 1JILA 2J3EA 2YZNA 2COUA 2DY0A 1W36B 2BKEA 2GBCA 2WZBA 3OEWA 2LR0A 2OBYA 2BFAA 1P31A 4FLEA 2YRFA 1QFJA 4FBGA 4IIJA 4M6WA 3HVUA 4L7QA 4R1SA 3D1VA 5AJUA 5C81A 1G8MA 1YJAA 2VBIA 2VTDA 3Q7SA 3AY7A 3A3PA 3IAM1 3LDHA 4BQPA 3OTOB 2I33A 4O4LA 1ONPA 2ODEA 3BWVA 2GK7A 3L7JA 4PGAA 4H08A 3OQ6A 5HK8A 3ZGZA 2P1ZA 5BNTA 2GLUA 5AKLA 2OENG 1NG1A 3OJCA 4GL4A 4TPKA 1UZMA 2VNJA 1QVVA 3DH0A 3IT2A 1UEIA 1YR8A 3TTXA 1PHRA 4UD6A 1N57A 1Q7GA 2NAFA 5EPUA 5KQSA 1TPYA 2GEKA 3PC4A 4HUQA 4TRMA 1TD9A 1H9BA 1NYRA 1OPRA 1UFRA 1JSCA 3PNBA 2NO4A 3R3JA 4FD3A 1C0EA 2EEZA 4J4TA 3RSSA 2QX8A 2O8NA 1T4MA 1BGVA 4MUIA 1KMMA 1NBHA 1NQAO 4PGGA 4BFUA 5ARBA 1OR8A 5A4FS 5HKKD 5EC8A 2A14A 1WMBA 3OU6A 3L6RA 4YB8A 2CNNA 3UMFA 5GJCA 4PW0A 5E1MA 2H54A 4JI3B 1G8GA 2DZDA 1YBFA 1K2VN 1BS9A 3W1EA 4CM1A 4BLTA 4DY4A 4XLTA 3RC8A 2NO5A 5A5GA 2Z5GA 2QSZA 2NZWA 1OC4A 4Q93A 1VZ3A 5KOHA 3LUBA 1C9KA 5GOZA 3WWDA 1TEVA 5HE8A 5B2ZA 1IY1A 1NPYA 1P9WA 5K3SA 1SKAA 4XOIA 4U1RA 3ZKWB 1CQZA 2HDWA 1E0SA 2G67A 1QHXA 3Q7TA 4NARA 5DI3A 1G20A 1R0ZA 1KO1A 2VF7A 4LHYA 2I6TA 2A9RA 3ETGA 5E6UB 4E2FA 2BFCB 2KHZA 1E3TA 2PRSA 4UU7A 3DMDA 4J8PA 1WE2A 5KC9A 2DC1A 4PU0A 4MCJA 3NX4A 3UMCA 3BIFA 3L79A 3IXLA 4QOIA 3WLFA 2R1VA 5CT6A 3OZGA 1T10A 3D7LA 3GLVA 3T3NA 3PVSA 1N9GB 1X0XA 4EVQA 1UBOS 4KO2S 4KVZA 3A4IA 4N9QA 4LZJA 4XR9A 3EAFA 2VK1A 2Z95A 2WFAA 3VO2A 4ZOBA 3ZGXA 4XYLA 3QVMA 2QOEA 4XD2A 5CAEB 3PXGA 4F60A 4RWZA 4ZCIA 2DWQA 3S8YA 4G0VA 3JD4A 1G18A 3A6FA 1AGYA 2XUOA 1BA2A 4F1WA 1PUIA 2BFDB 3KKMA 1PEDA 2GN6A 4LTMA 4C1NA 5CITA 4X85A 2AFIE 1PLLA 3HKBA 2XBMA 1E7MA 2XTMA 1KBZA 5ICGA 1EK2A 3TSZA 2CJPA 3BC1A 3FZGA 4XIYA 2CNKA 3OJOA 4FIDA 3QWAA 3G2NA 1QRUA 4CEJB 1WZCA 1Z4QA 2Q21A 3ASYA 3ZJ4A 1PAUA 2H4WA 5JAHA 5TY0A 1ATIA 2F6RA 3N87A 3K9LA 1HYGA 3A10A 4MV5A 1KEPA 1CD5A 4JP1A 4L4ZA 3IBTA 3AF1A 3ZPXA 4CGYA 2JW5A 4ZP1A 1RYNA 3G2PA 4WNIA 4Y6PA 2EFJA 4M37A 3UFXA 4F9FA 1PT9A 5FAXA 5KDLA 4C0HA 3DV9A 3HBAA 3AHEA 2WDZA 3JYNA 2QI9F 1V1MB 1XTIA 4GX5A 1TF2A 2X0IA 4J2HA 4RGVA 5DXFA 2CV2A 1X74A 4GICA 3R3HA 4BRWA 2NV6A 1UJNA 5LKRA 4JT2A 5CYOA 3TI7A 5B37A 3PFWO 4OAOA 3OF3A 2IHYA 1S4MA 3O47A 3HCBA 3K0CC 5EMNA 3UTDA 1CC1S 1P1RA 1ZCJA 5K20A 1BU8A 3C3YA 4C4XA 4JY7A 1IB6A 4DXHA 1NBWB 4GLOA 1N5JA 1YIDA 2FWRA 1U7OA 3ADPA 3T7SA 2QRLA 2HJSA 4LXXA 2WYVA 1EFAA 1IN7A 2GM9A 2NNWB 3CNNA 1DQYA 2ZI4A 2WF9A 3PHGA 1OIVA 2QYOA 3KT6A 1AS2A 1JHQA 1LK0A 3G2JA 3IYLW 2GOYA 1WW8A 1T9KA 1W0JA 1GRCA 2Y0CA 3WNCA 2AFRA 1SVOA 3FGNA 3OWHA 3CEPB 3HCFA 3NAZA 1Q3KA 2XNHA 1YE5A 4X63A 4ARZB 1QGED 2HLHA 5C18A 2QW8A 4ICIA 4XUEA 3CIOA 3ITNA 3ENVA 2Q3LA 3K35A 3MPUA 4R0NA 5TT1A 1KMNA 3NC0C 4DA7A 1OXBB 1FVOA 2Z56A 4DCTA 5EJ2A 4MQMA 1X2BA 3USZA 1K6MA 2EGHA 4RXTA 3HM2A 1KGDA 1NVWQ 3MWGA 3V4OA 2JDIA 1CUHA 4B32A 2J4FA 3CRRA 4MQEA 4BNYA 3KJHA 3PDUA 4DY6A 5IFKA 5LWHA 4JC0A 1AB5A 2JLYA 3D6NB 3PD0A 1GZ3A 1TAHA 1Y6QA 1QX3A 1F0KA 1O89A 1U0EA 3CPHA 4GPEA 4B0PA 1ECBA 3INRA 1D0VA 5LQDA 1YI1A 1KH3A 3P94A 3F73A 1H2RS 3JWJA 3M1LA 1SHLA <