3ILXA

Crystal structure of first orf in transposon isc1904 from sulfolobus solfataricus p2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
140
Chain Sequence
AKVILYARVSSNTKDDLANQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVITAYPDRLVRFGFEILEEVCKAHNCEIVVLNQEDKTPEEELVEDLATILVSFSGKLHGMRSQKYEKVKKCAEELKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords First ORF in transposon ISC1904
publication title Crystal structure of First ORF in transposon ISC1904 from Sulfolobus solfataricus P2
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 49
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilxA01
5C35A 1HX7A 3ILXA 3PKZA 2MHCA 3BVPA 2GM5A 1GDTA 5C31A 3LHKA 5C32A 3LHFA 3UJ3X 1ZR4A 2RSLA 1GHTA 1ZR2A 2R0QC 3GUVA 3G13A 5C34B 2GM4A 4BQQA
chains in the Genus database with same CATH superfamily
3ZWPA 4TLAA 1MOQA 3P27A 3Q2IA 4JEIA 1GTSA 1C0PA 4Q9HA 3U4QA 4WNAB 1NX6A 3BGIA 3CZAA 3G6WA 2P5TB 4J0GA 3RC1A 1S2OA 1Z37A 2W2MA 3SDZA 1RWPA 5CLGA 5IX8A 16PKA 4CHTA 2CHUA 2P2DA 3WJAA 1TB4A 5IDWA 1J7JA 1QF9A 3B6MA 2QUAA 3QVGB 2KX7A 2AEMA 4LWZA 2I7DA 4DXHA 5U4QA 5ALWA 1EWTA 1G21E 2F2TA 1WRBA 4G1BA 3JARB 4CQMA 3MB8A 1Z7EA 3H9CA 3O6VA 4ER5A 1XMXA 2WQ6A 2DWOA 2WNHA 1ZNYA 1I5EA 1Y80A 2PA3A 1YR8A 1ZRNA 1F2TB 2VTDA 3O1JC 4LQDA 5HIKA 3OJCA 1C7EA 1Z2PX 4IV5A 1SCUA 4DC1A 2NMVA 2OQRA 2I2BA 2Y1DA 1ARZA 3LUCA 4MH0R 3TZQA 3MGKA 1SOMA 1P77A 2H9AA 2HPZA 2Q9BA 4D9NA 1ZJ5A 2HLDA 4G8JA 1NN0A 4KSYA 2SBTA 4TTSA 5DYGA 3B1YA 1VHWA 1KORA 1T8YA 1A2OA 4M87A 3REGA 1N75A 1X1QA 3V6MA 1YRBA 4HBGA 4Z5XA 3SWWA 3E2PA 1ZRMA 3VYSB 2PRKA 4QQRA 1FDOA 1XDWA 3OLWA 5JEEA 1JAZA 1ND5A 1ZM2A 3EVGA 4BV3A 2B6HA 1JSRA 1T5IA 2ODAA 2GKOA 2I0FA 4LMPA 1IBKB 4IDNA 1YQQA 5ECWA 4MQ4A 4K9KA 1I80A 4WACA 4JBNA 1GGMA 1QCZA 1LV7A 5FBHA 2EJCA 4FWBA 2BEKA 2HBZA 4MV6A 3SQMA 3E8XA 1UIMA 3D8UA 3FWPA 3QJYA 4KMMA 2RJNA 2FCAA 5CNMA 2QR3A 3KTDA 3LYLA 4LF4B 4FHCA 1RM3A 2OK8A 4IFTA 4FQ8A 5LMUB 4NSNA 4JT4A 1UT5A 1VYUA 5EFZA 1Z82A 4RF5A 2QZSA 1E4OA 1AD2A 1E4EB 1BC5A 1NBIA 3NNNA 4Z4IA 3VDXA 4AICA 1B0ZA 1NGSA 3EUEA 1MB4A 1AOXA 2VZ0A 4NE9A 2QE6A 4OGGA 4ZU6X 5FOUA 3IEMA 2I3ZA 2PZJA 2P40A 3BMQB 2O4UX 3FSJX 1VJ1A 3HDGA 4U5XA 4FCVA 1NA5A 5BWOA 2VPPA 4AL4A 1Q3HA 3QKSB 2OHJA 1A2KC 1SQFA 3F6CA 4XYMA 4QO8A 3AKZA 1LDNA 1LWOA 1RXEA 2CKDA 4HWKA 1ZW1A 5IJ0A 4B7CA 4BWFB 1HYHA 3RT7A 4JDUA 3UGKA 2UVPB 3IV9A 2G9RA 5HRCA 5FIUA 5DTJA 3G2OA 1FUYB 4U1RA 3RAEC 4LQLA 2YUTA 4AMGA 1VL2A 1CVLA 2CLLB 4CGZA 4KLCA 3FDIA 3ONEA 3JASB 3ESQA 4C5CA 5LDGA 1FE8A 3JYLA 4HDOB 5L3SB 1UXOA 1LDYA 2VDQB 2DHQA 2FSGA 1EWQA 3WGVA 2J6CA 3URMA 4EJFA 2PMDA 1XAJA 1YK1A 4JUAA 5DB4A 3W7AA 3ZHYA 5BRAA 4B3BA 6ABPA 1W5FA 4TWRA 4EW3A 2CZQA 1ACJA 2F3RA 2NUPA 4L5BA 4PPGA 4UARA 1XF1A 3LP5A 1CP3A 1IQ0A 3EIUA 5CH5A 1BVRA 2B8EA 5IZCA 4G36A 4YH1A 2AOTA 2GM5A 5AM5A 3SMVA 3GUCA 4C08A 1ISGA 2GZDA 2OR3A 4HFNA 3E9DA 4IS3A 2F43A 2YMLA 4KOAA 4FLEA 4PVDA 4K6HA 4PSKA 2GBLC 4JUBA 1CFJA 1QU3A 4YXFA 3F6BX 3NVMB 2J1LA 5LQDA 1I6LA 4DR7B 2FF5A 1NX9A 1AA6A 4N4AA 4PYOA 3N70A 1DXQA 3LCUA 3F2IA 4O2AA 4RAOA 5F2OA 2NU8A 2VHCA 1W2WB 1AIPA 2YZGA 4BEJA 4D9KA 3LPNA 1IVNA 5L7WA 1DCTA 2W6IA 2GO7A 2YYAA 4IIVA 2NO5A 3DZJA 2IYTA 4YT4A 1U1IA 3P0FA 3ENKA 5AVRA 4RSGA 2YVKA 3GAMA 2HD4A 3B1WA 4Q47A 3RK4A 2IPMA 1K6IA 2QUZA 3FYUB 4JLAA 4P92A 1W30A 1IZZA 4CF3A 3A7DA 1L7AA 1UZNA 2I8CA 3STUA 5G0UA 2VI5A 1GNRA 4ATNA 5AUPB 1G3RA 4ME6A 5HJ2A 2DUMA 1E8DA 4RCZA 3T5DA 3ZIUA 3NFYA 3RYIB 2BJHA 3ZVKA 3H11B 4RIFA 4DMHA 4BE7B 1F12A 3OEHD 2I29A 5F33A 2ZXEA 3EIEA 4NNJA 3GP5A 4ZCPA 2W8BB 3KKEA 4Z7QB 1UEIA 4YMHA 3M1YA 4IQ4A 1KP2A 2ZI5A 4F3KA 4UM9B 5B6JA 5B58C 2V97A 3CSDA 3NTUA 3WWPA 2PWBA 4DANA 3L07A 4P4UA 5AI0A 4DZTA 4CTMA 4PGGA 1LVGA 3WGTA 1XTUA 4W7IA 4MWDA 2NPIA 2WAYA 3PDJA 1OA1A 4MHOA 3S4YA 5HKKD 4BLPA 1WE2A 5F7ZA 4PLGA 1PGJA 3HLYA 4GS5A 4CF5A 1RZRA 2H2WA 1MB0A 3NAGA 1RFGE 1KJNA 1T3LA 2EFHB 1WETA 4QKQA 2RHTA 3OOWA 3PNOA 4XFKA 5I51A 2YXBA 1JH8A 3L06A 3QFTA 3HZRA 3T1NA 5SZJA 2Q3BA 1R6UA 2GJKA 4UAUA 5HA5A 4HJRA 2C4TA 2ZYTX 1MGPA 3NBKA 4KQHA 1EUCA 4KRXA 3RHFA 2ZBEA 1DX6A 1M6YA 1SBTA 2HMUA 2JFZA 4AB1A 4D6XA 4F38A 4KMOA 3ZS9A 4ITVA 4RZSA 4WZBA 5IBPA 3BRCA 2CLCX 5KYYB 3FX2A 4B3JA 1OASA 4XGNA 2ZR8A 1KRHA 4AS1A 4HDSA 5AW7A 1W4ZA 3H42B 2Q0QA 3U4QB 1A95A 3MT8A 4ZMSA 1QOZA 4BQOA 2IBMA 4R84A 1YFKA 1U3CA 4YCDA 2TRSB 1JVNA 2W2NA 4RJTA 4GBED 1OLXB 4AAYA 4Q7JB 4QGSA 7AT1A 3BMNA 3MTDA 3H0EA 2M1XA 2I9PA 2F9LA 3SVTA 1D6NA 5TC4A 4PG6A 1X7WB 5D84A 4CCSA 4RD3A 4CQMB 5BUCA 3U7FB 3A2KA 3CX3A 4RGBA 1SCKA 1GOTA 4JKOA 3P4XA 4HAZA 4R8LA 5C81A 4MPRA 3CVWA 1ZUWA 3AFNA 2RJOA 2ZUSA 1SCUB 3NONA 3QX7A 1QRRA 2G83A 3HPQA 4LNAA 1Q50A 4MB6A 4MWCA 5BYBA 4DQKA 3KFVA 1BIFA 2JAPA 1SXGA 2XUZA 3L9XA 4YAEA 2GF0A 4EYGA 2L69A 3MRTA 3G9QA 4JVOA 5LZ8A 3IAAA 3M3HA 5LZ5A 2XDYA 1KIMA 1NRWA 3NM4A 4LTDA 4RHCA 3QM1A 3LT0A 2P2ZA 1O9GA 5DPMA 1GJRA 4WFKA 5DTIA 1J0BA 4FEAA 4FMDF 5IN4A 3T5TA 1GKYA 1XROA 3C7KA 1I94B 2QBYB 1DDGA 2PMBA 4J6EA 3OF5A 5JASA 1ITZA 5B1IA 3V4FA 4BO1A 4MJ3A 4EUHA 2QVCA 4BUCA 1N0VC 3F78A 3O0TA 5FPYA 4AROA 1P31A 4I9FA 1NNUA 2CJXA 4JJIA 2B0JA 2JJ8A 2QTMA 3NTXA 4XPIB 4PEVA 2LRHA 5TVGA 2OMEA 3K2EA 4EUFA 2ZJ2A 4CLRA 3T8YA 4UU1A 3MHPA 5JH7A 1XLVA 5GINE 5A3RA 3VI3B 1PL0A 3FUUA 3HKDA 1N2OA 4TVSA 1DKLA 2Q0XA 3H17A 3IP1A 1G4AE 3OPYI 2Z8ZA 3THWB 5GOTA 5GMOA 4U6QA 3SDBA 3WBJA 1W4AA 1ODKA 2YWDA 4ARVA 1R8YA 1JJ7A 2YQZA 5KPJA 2XD4A 1HLPA 1YNSA 3M4JA 1OFTA 1AKEA 4FSDA 3PC4A 4YGXB 3IDSA 1PSWA 2PGXA 5HM6A 2IUSA 1XYYA 1DHTA 1YBFA 1F0KA 3NU1A 1IBRA 1NOJA 3DMTA 4LEIA 4XSHA 2FDXA 3IOCA 5IM5A 5BNWA 2IBTA 1NAHA 3FAZA 4FS8A 4P0TA 4LI3X 2G67A 2CNBA 2V1XA 2QIPA 4GE3A 4ZVRA 3S29A 1T9CA 2WJWA 3W5BA 5CIQA 4C6SA 3KLBA 2COEA 5F2KA 3SBDA 1QANA 3X1WA 1NQVA 1YI8A 3PUJA 5IJ0B 3EQ7A 3MS4A 4TXNA 4D5GA 3IA2A 4CM3A 3GOHA 1HYGA 1XTRA 3DF9A 4L9AA 4BPRA 4YVFA 5IT5A 3ZW8A 1E9BA 1SVSA 3AH8A 4ZCIA 3GO4A 1NVKA 4M6WA 2IPNA 1SD1A 1KQPA 3OIVA 3AM1A 1ZM4A 3SS9X 2Q1WA 1YE8A 4LSZA 2P65A 1I7SB 2I03A 4QODA 3C6XA 3WC4A 3M6UA 1JQ5A 2B25A 2QTRA 3OO1A 4ZOQI 1YFLA 4JI7B 1P19A 3PQCA 4X1KB 2IT1A 7ADHA 5MN6A 4CMGA 3FUCA 3H5NA 4ESHA 1SKYE 1SWVA 2EERA 3DLCA 3KAQA 4ACAA 3D8SA 2C7QA 2RGBA 1M3SA 4LOIA 4WH0A 2AJCA 1OH6A 1VCMA 1F6BA 3EUAA 2V96A 4RF2A 2AOTB 4P3NA 5JJKA 2JRCA 1SFRA 3OZEA 1K86A 2J59A 4OJQA 5E3JA 2QN1A 5TY0A 2AJLI 2OESA 2F43B 2E85A 1WEHA 3LHSA 2X3UA 3HE3A 4LOLA 4LFAB 1EZ4A 1E8NA 4HLQB 3JQ8A 1N92A 2HJWA 2H1IA 2XX3A 2FLVA 2Z04A 3E7WA 4JNCA 4K5QA 1X8XA 1U8AA 2NU8B 3R6DA 4QSMA 3DHNA 3ZY3A 4B73A 4EJSA 1DCKA 3O82A 1AE1A 4NONA 5BXQC 5IVKA 5HDQA 3QVKA 3ZDCA 1ODLA 2C0QA 5BMVA 4PS0A 1B15A 3D3WA 2EJUA 5AKKA 4COKA 2WMOB 1T5TA 1Z2DA 2XY4A 3BWVA 5G4LA 3STYA 4KQ1A 1T26A 2P75A 3L7LA 2VNJA 3LA6A 2NQ2C 4QYIA 4D5EA 3PNLA 5T5QA 3D3KA 1V9LA 3VYVA 4GU5A 1EEXB 2FWJA 4JT8A 3GHYA 5CEEA 1AQNA 3ADBA 3K9CA 3ZK7A 1OZ0A 5JSHA 1EMDA 3NEPX 4WK2B 3WNZA 5A4IS 3I73A 3VR6H 3Q87B 3GJ7A 3SC2A 4U5QA 4PX2A 1MKYA 4O4JF 4L8YA 3JD1A 1P1HA 5JPDA 3IPRA 4PIVA 1JDZA 4UU7A 2O2HA 1JR3A 3PC2A 2WYIA 2J0EA 4NZ9A 5EVJA 2XE7A 5A9RA 1ZPDA 2VTEA 3F2VA 2H65A 3FD8A 2LCFA 3PL5A 5EJMA 2ZAYA 1JHZA 3EDMA 1D9XA 2J6IA 4DNQA 4BMXA 3CS3A 3RHZA 4J76A 4FDTA 3CU5A 2H3EA 1PIWA 1VLMA 2B36A 3E84A 3ZYZA 1BE0A 4O02B 1DT3A 3ETJA 2L18A 2CMGA 3IP3A 4MQLA 1HZJA 1QVWA 1T5DX 2Z5FA 1XAHA 3JYNA 4CQJA 1XI2A 4NEHB 2O7QA 1X7YA 3I28A 5FFFA 2CK3A 3EDQA 5E6UA 4Z4FA 2VSXA 3E27A 2B5OA 3WGGA 4F0JA 1NKSA 2WDPA 2ZPAA 3UBMA 4AN4A 4UVDA 3IUQA 1GCAA 4A0RA 1OJ7A 2NIPA 1T4BA 3HUDA 3O4HA 2IK8A 1Z4OA 4I4LA 3CX8A 3LIIA 5E7MA 2V4MA 4XI9A 2ZRJA 2OCDA 1XZKA 5IAAA 5IN5A 2Y4NA 1U7ZA 4GNKA 3NNSA 1P7WA 1EUCB 4N0DA 3OZSA 2DUNA 3V5NA 3B8HA 3EE6A 4WZBB 4DCVA 1A04A 2BF4A 2H07A 1TFRA 4CR7A 2IHUA 2OHVA 2P2GA 1OI7A 2PMWB 3CIFA 4HDSB 1TYBE 2PS0A 3VVMA 4BQEA 3R7FA 1ZH0A 1JHDA 2K4MA 5JD3A 1GXSB 2ZJ8A 4OQLA 5DVZA 2WTNA 2JJQA 3WYCA 1A50B 2GEJA 2ILTA 3BMNB 3QFHA 4ZQEA 1EH5A 3HMQA 4YB8A 1KQGA 3IEKA 5T4BA 3TECE 4WMLA 1B0UA 1U9ZA 3PT9A 2EF1A 2L2QA 1AQYA 5ARDA 3SZLA 1IUOA 1DJLA 1H0SA 1CJTC 3CNNA 3ZW7A 1NM5C 2Q1UA 1OX5A 2W00A 4GUDA 2D0IA 2BEVA 5DMHA 3ZZMA 4DLTA 4RKFA 4E32A 2FZLA 4G6ZA 3WLHA 5EJ5A 2JEYA 2Q8QA 2UUPA 3I2GA 5CURA 3EPLA 3IT0A 1A4RA 2Z9CA 1IUKA 1LK5A 4R68A 1G3MA 1ENZA 1AUOA 4IIUA 1EZZA 3WSWA 4OQZA 2OCBA 4PICA 4RWEA 4ZAYA 3T94A 1DUVG 1G1AA 1OCEA 3AL3A 3GJQA 4P58A 3DOUA 1NJ6A 1O6BA 1ZD9A 3EIHA 4OAQA 4OXNA 5FXMA 2RKBA 4XR9A 3V2GA 2QL5A 4QICA 4G0XA 4F8YA 1COZA 3H2SA 4OXRA 1J0EA 2Y9MB 3JPYA 2DERA 5ICMA 4JJGA 3PFHA 3DTVA 1J09A 1DG9A 1G7SA 3AO0B 4L8VA 2HV8A 1CJCA 2ZSIA 2C2HA 3KUDA 4CLRB 4DSNA 4RTNA 4F3TA 2F8LA 2NXCA 1DC8A 2XMQA 4LI0A 4EYEA 1BHJA 1PRYA 5IUKC 1EFKA 4ZYYA 5KO2A 2HZ7A 1PD0A 3HKDB 3U4HA 2VRWA 5TXGA 4BVKA 4HNSA 4DLSA 1NXXA 2PZFA 3ZOKA 4QATA 2X5JO 3FHOA 3TB6A 4IIXA 2RHDA 2VDRB 1EVYA 5DCUA 4CV1A 1YUNA 3R7AA 2WWXA 2NSJA 1SM4A 4EEZA 1LDBA 1GEEA 1GG2A 1GARA 2VVTA 4JCOA 3FXAA 1U04A 2JHPA 1D3AA 1GCGA 3OKPA 2Q6KA 1IG3A 3D8BA 4B2IA 2RHBA 3M3PA 1RYYA 3DFUA 1IG0A 5HKBA 1NRIA 3WLRA 5KNCA 4R8SA 1IHOA 2R85A 4HQNA 4JQYA 4I3FA 3WIBA 3PVCA 1D6MA 1KEKA 1JBQA 2II6A 5IH7A 2C7VA 3OAAD 4YV2A 2CVZA 2BM9A 1JHUA 3NBXX 4LISA 1OH8A 2IZ7A 3GROA 2HYIC 1VHQA 2RC6A 4IFEA 4AWAA 4MAAA 3OCJA 2LDXA 2PH3A 1N9ZA 2WRZA 4Y2UA 5LD2C 5EQDA 3ZWCA 1GT6A 3K72B 1XQ9A 4UU0A 4Y2YA 2ATCA 3BJMA 3FUWA 2C96A 4F85A 1F8YA 1W5SA 5IKOA 1LCIA 4WGGA 4M6WB 4KIWA 3ORFA 4X8HA 3VISA 1ZH4A 4YJ2B 3WL8A 5GPBA 4AZ3A 4Z2AA 3AX6A 5JECA 1JHPA 4OLBA 4RD2A 3S5UA 1TMOA 3UATA 3MRSA 4LYDA 4RABA 3CUVA 4X85A 1K1EA 1KFBB 5FUYA 2ZCUA 1T8SA 3GVCA 4WXYB 3TXYA 2UXDB 2OGWA 2ZE6A 1IRIA 4UMEA 5KYVA 2BFBA 1IZYA 1I32A 1EJ0A 1Q44A 1UPUA 3QGMA 1ODIA 4J03A 3NJ8A 1L1FA 1UJMA 3KVYA 4U7JA 3G2MA 3RFVA 1VBNA 4J29A 4MSUA 5BURA 2ZVJA 3WDKA 1BKSB 4Y9SA 3GMIA 2XYVA 1ZEMA 1Z8NA 3FCEA 2GQ0A 2PGIA 3GG9A 4PAWA 5G1OA 4UAGA 3NMUF 4BUJA 1Z5UA 4Y8VA 2WKWA 4HD8A 1USGA 3L43A 2XGJA 2YN0A 4UEJA 1IN6A 3KQPA 2A5DA 4W1QA 2O4CA 3PJDA 3JQ8B 1QQ6A 3AEYA 3A1EA 2I4OA 3UPTA 5K4GA 2VNHA 2OC4A 2FUG6 4N82A 1JIXA 2UVDA 2E37A 1A5BB 4TZKA 4ETWA 2GRUA 1O95C 1JJIA 5HX7A 4FDUA 5KNCH 1KRXA 1SUPA 3LP8A 3OMLA 4GWKA 4UNRA 3D3WB 5BMVB 1ZSYA 2BRUC 4FBMA 1XDDA 4MQMA 2XCIA 4NPCA 4QTXA 5JDCC 4DV6B 2PSFA 4OF4A 1G66A 1VXRA 4NCNA 5ER9A 4QYIB 2XKKA 1Y3CE 3QX3A 1UWKA 1DADA 5T67A 3L6UA 1E7WA 4QGBA 3I30X 3SC2B 2ZSEA 3BSFA 4QPJC 3O1HB 3JR7A 2VRCD 4FR5A 4CZ2A 3ZH9B 4YYEA 1I7NA 2D2IA 5KINB 5CDGA 4I1IA 4PZEA 1GL6A 2BGTA 2IQ5A 1FQOA 2XLCA 2GDJA 3HFGA 3DXXA 2OXIA 1TUBA 2W70A 2GB4A 4C89A 2GETA 4WFJA 3EZ9A 4C9BA 4R7ZA 4CWAA 2B8JA 3FJ1A 2XVXA 1DKMA 1TGYA 2EKDA 2QN7A 5F1OA 3W2EA 1CEEA 4BWVA 5ALHA 3PFBA 2CHEA 1A5SB 2P4EA 3E9EA 4MVJE 4MKIA 2CB0A 2GZ3A 3E1KA 4NECA 1NVVR 3WL4A 1ETHA 4UM8B 3WYNA 4ZJZA 3UHFA 5HUJA 3HI6A 4FHDA 1NVUQ 1USUA 2X14A 4ZU3A 3RUEA 4K88A 1XCBA 3UQYS 1HGXA 1X7YB 3U9TA 5E6UB 3TDKA 4J49A 1PP4A 2ZB4A 4ALIA 1SXQA 2JJ1D 3T3OA 2HRDA 4CKBB 2ZRFA 5DCYA 5J43A 1E1NA 3A28A 4K03A 3BGWA 5KEIA 5NULA 1U7WA 4PRKA 1VSUA 5DIZA 3TKLA 4DM7A 1Y9ZA 4WL0A 2XMGA 4PPFA 1RRKA 4C4YA 2PUEA 4N3GA 2D5LA 4B83A 2WA1A 3PXGA 3R0QA 4Q3CA 3KWFA 2G6TA 3IBTA 2CXQA 5JZSA 5K0ZA 5HUHA 1Y5MA 3A3NA 3D3EA 4RPCA 3U37A 1APBA 2XUKA 2FRXA 1OUMA 1XPRA 2BHLA 2PV7A 1RWQA 4XDGA 5IW8A 1T3SA 1FTQA 2XGOA 4LX8A 5DSZA 5I48A 4RJJA 3UTCA 1SIUA 1Y8QA 2C9DA 1NMQA 2CDCA 3J7TA 3NBMA 4B5LA 4HH4A 4CCYA 3KXDA 4MARA 5CTAA 1IM2A 2BWJA 2PR7A 1YL5A 3H0CA 5CYGA 2H4HA 2XYQA 3DMDA 4XQGA 5DEIA 4U4AA 3ZQ4A 3I72A 2YX1A 5DYYA 1PV2A 4F9GA 3AU8A 2A0FA 3HBFA 4XDYA 3O9MA 3H2ZA 4J4BA 2BEVB 4XYBA 2D1FA 2QJOA 2NSHA 4O4IA 5BQOA 4ZHQF 1XEAA 2HEIA 1A0OA 3R3VA 1RJEA 5J5AA 4MLZA 3RV3A 3SNHA 2BI4A 1PK7A 5I9LA 4TSRA 3A2MA 4U7GA 3BWBA 2W4IA 1CT9A 3JALA 2VF2A 4RDIA 4DY4A 4O2AF 2CV1A 4YJFB 3TF5A 1ORWA 2Y27A 4MWGA 2AFHE 1IUNA 5DNVA 3OPNA 5DBHX 4RPGA 4WK4B 3S2ZA 1N0IA 5I9TA 3H05A 2EWVA 2OFPA 4FVTA 3G68A 3RC8A 3KYIB 4WVFA 3TOZA 1IOWA 2H7VA 4DXDA 1BD4A 2IUUA 1LBQA 2HQSA 1DC3A 5I7EA 2YH2A 1ZXBA 2ODBA 1FFCA 3F96A 4OHWA 1J39A 4L72A 1RXVA 1SWWA 3G2HA 2OG1A 1ZU4A 2VPIA 2IUEA 3MINA 1O0SA 3S2EA 3QXJA 1R0BA 3V7UA 4PQFA 2YIMA 1VHJA 2C78A 4I4TA 3PNYA 3VO2A 4DRYA 3KSZO 3G5MA 1ZISA 1IFXA 1XTJA 2QOEA 1XZLA 4PBRA 2IGTA 2CB9A 5SY6A 4LRWA 1RXIA 1GITA 3EARA 1AGXA 4I50F 4KJZA 4EHKA 4Z4HA 5K6TA 1R4AA 4L5CA 4BASA 4E7OA 1QRTA 1XNRB 4TUYF 2GBIA 1OLOA 1Y4DE 2WJAA 2XA2A 4J1QA 1BEZA 2WHPB 3OECA 3I2JA 3P52A 3L7DA 1HDEA 3C6KA 4MW0A 4NDAA 5F77A 2VNAA 1OWOA 3DDNA 5AW1A 1TAUA 5CNIA 3ZNNA 1IXYA 2BPOA 4WEOA 1G8YA 3RWMB 5KTOA 3FOAA 3MGBA 3N2NA 4RZIA 4NR0A 1QVAA 1UFQA 5FLYA 1P6QA 3HCCA 3ZV5A 2WMDA 1G64A 4HNAA 1YUMA 1XSEA 4XJTA 1X9HA 4B43A 4NIMA 1M8FA 1QIEA 3D5QA 3LWDA 4K2AA 3TSYA 2FXVA 4B8ZA 2JIQA 2AHRA 3ODPA 4YECA 2VJKA 5CRIA 1GQ2A 3Q8LA 5F5NA 1YDGA 1WW3A 2IKSA 3KS9A 4KO8A 4YA6A 3HBAA 4KE9A 3V8VA 2ENUA 3GCXA 4V02A 5NLLA 4AZ3B 3QVJA 1G7CA 3CWCA 4YLYA 2X0EA 3I04M 3QHPA 1X86B 2IY7A 2QVXX 4L4ZA 5KNBH 3IQIX 3KQYA 2FP4B 1NN5A 2A30A 1O8CA 5E38A 1B3BA 4GVXA 4RZUA 4QM6A 2HUPA 2PFKA 4FYWA 1QB8A 5CFQA 1WZ2A 4IFBA 3R4VA 4BGEA 1ZD1A 3EGXA 2WWTA 4EKDA 3UGTA 4HFRA 1B76A 3ND5A 3FDZA 3CXRA 2G8NA 3H1GA 5C5IA 5DO9A 1GZHB 3ORSA 4R5HA 3DO8A 3LPDA 1CUCA 1UBHS 4EP1A 5EUQB 5GZ6A 3SC6A 2WR8A 4LMBA 1JFVA 3WIUA 1TEHA 2EX1A 3BXXA 1FXUA 3E1SA 3T3EA 5KTNA 1RXYA 3KU1A 1Q7TA 5K03A 2HBYA 4JASB 4U7PB 1GCUA 3I4FA 4LCBA 4NZPA 4HPWA 1EGAA 1FNNA 3MGGA 4XM0A 4F4JA 1A9YA 4ZCLA 2C3YA 1V3VA 4NV1A 2V7WA 1V3UA 2VP9A 3GFTA 3NP9A 4R8KA 3EF3A 4FFSA 2Z3WA 4V0RA 3SDSA 4ABTA 1FUIA 2DTDA 2AA3A 3LVQE 3OP1A 1JS1X 4PYLA 1ZGCA 3SJ7A 3LGXA 4YWHA 2RAVA 1FUEA 4JMLA 1LW6E 1BKYA 1GTRA 1NVGA 1M83A 1W96A 1I6WA 4ADSG 3AWIA 1ADFA 1ENPA 2ZI3A 3UAYA 3DLTA 1TRKA 2Y1FA 1CUDA 2C3MA 2LUOA 3OC6A 4MTLA 1ZH8A 3P9PA 1EWRA 2YWGA 4GD3Q 3EZLA 5GVRA 5FV7A 2O5VA 4R31A 3SZUA 1PL8A 2FP3A 5K8TA 3C4VA 2YFQA 3OE4A 1C4XA 1QSGA 1U31A 5TR9A 3RANA 3FFWA 1YRQA 2A6PA 2V9ZA 4QXMA 5JH7F 1YQ9A 4PBTA 2NUBA 1U8YA 2PD6A 1E9DA 3JD0A 3NM5A 4YXWA 3L1KA 3A05A 2VK1A 1C4WA 3HG7A 4J8PA 3CGGA 2OGZA 3QP9A 4M36A 1JI0A 1V1MA 5IBCA 1MT0A 1E6UA 2JH3A 1GR0A 3U1BA 2A3NA 2FN8A 2Q3LA 1BDHA 5KQRA 1PG5A 4AF8A 3GXBA 4DR5B 2P0AA 3OKCA 1CUSA 3C87A 4M86A 3K0HA 1P4GA 2IODA 1VDMA 2IOYA 4LJ6A 4I9GA 5AHRA 4DRZA 5DI9A 4J2OA 4DCGA 3D6MA 2AD5A 2QVYX 2ZYVX 3PDWA 5B2ZA 3ZDRA 4CKXA 2XDQB 1DZ3A 2FR8A 1V8DA 1CDOA 4GI3A 4Q3KA 2AXQA 3HU5A 3UMVA 2VPYA 3UK1A 3LAWA 1RTTA 1Z6AA 4DOMA 3TQCA 4OUKX 4BFUA 1PF7E 2B4YA 3L18A 1ECCA 3ZU5A 2B1JA 2PBRA 2WV9A 3MWJA 4EO4A 3RSZA 2OO3A 4TLMB 1YFZA 2RGEA 1OYVA 5KQSA 4HFMA 3K0CC 3F8SA 1A27A 3G23A 3KSUA 1U6JA 4J3FA 4P5EA 1JILA 5GGYA 2FZ5A 5B37A 5IULC 3NATA 3ZCVA 4YPOA 5CFLA 1M6NA 3BWXA 5C3UA 3BXFA 1SVIA 2HKIA 4IQ8A 3PXBA 4TN5A 3MMNA 3NBYC 4HSGA 421PA 1P1FA 2HY7A 4EH1A 3T7EA 3JPWA 3V6LA 2ECQA 1E2PA 2I7TA 1Y89A 1Y8QB 4CV3A 2WW8A 2GBPA 4BXOB 1D8TA 4D57A 2ZR0A 4CCYB 1ZBQA 4DLRA 4Z7OB 3QTBA 1L8QA 1MD9A 3PHHA 4LDNA 3TTSA 1HE3A 2JK0A 1PKEA 2VJCA 3IQWA 1UXIA 1AN0A 4MROA 1HDRA 4FOLA 4BNYA 3QLUA 1TIPA 1ZM9A 3KE8A 3KHTA 6YASA 1KFEB 1M2VA 4W99A 1GTZA 1JDBC 4KNVA 5FUXA 4A26A 3KPUA 3U31A 4D6YA 1H4QA 2V4ZA 2ZRHA 5CB0A 3DW3X 3EY9A 4MUHA 4MVJM 4EENA 2HT1A 2G71A 2G9QA 1LB1B 2WPDA 2GZ2A 1C81A 2QGNA 3ETCA 3EQ9A 3N86A 3GMSA 5BSKA 3BL6A 4F93B 5C5EA 1V4NA 1LF0A 5LQSA 5CFZA 1O95A 1F6DA 1SIOA 1T1JA 2ZZNA 3JALB 4C5BA 3O4IA 1FS4A 5FNZA 2VQSA 1TD9A 4OY3A 4QQNA 4LF8B 3FUVA 3GPIA 4JSYA 5JDCA 5F7OA 3AR2A 1O0BA 1AHIA 1CLUA 1QHIA 2JZNA 2W2TA 2H0AA 4PAMA 8ATCA 2X0NA 4IVNA 1G41A 4NZOA 4LGYA 1ZHOA 4L2IA 3QA9A 2C58A 1JPVA 3X2SA 2YQ5A 1N77A 5KB3A 4K9OA 4YRCA 2QLTA 3G8YA 2VYVA 3IQHX 1EIZA 3GRKA 1J6UA 1ECLA 3K4QA 4QBHA 3TJMA 4YAUA 3ECAA 5A6SA 4K0KB 2NXWA 5EIAA 4ROSA 2VKQA 4AF6A 2D1SA 2HNBA 3A4TA 4NU6A 4BZQA 4PHCA 4BO8A 1FTSA 1MQAA 2XSZD 3BH6A 3AM3A 3EAFA 3MINB 3SF0A 3FLEA 4TV9B 2JZOA 3M49A 4I4TB 1Z16A 2ZKLA 1KPHA 4U0JA 1X1BA 3CTMA 4YMVA 4YRQA 1LA2A 2WSSA 1E66A 1ZI8A 3GNSA 3GLQA 2H1HA 3LWZA 3N39C 4H7KA 3IUNA 3WKAA 4BO5A 1W7AA 4NXNB 1N0UA 3ZTTA 1ZSNA 1E63A 1UL1X 1XDUA 4AXBA 1JSZA 2IRWA 4YAJA 3O2SB 2C31A 4II2A 3MGCA 4ZYTA 4OK3A 2GCOA 3U60B 2VHTA 4TMXA 4RY0A 1OH5A 1J0AA 1TYZA 4FKZA 1N3YA 2Q3DA 5JATA 1TYDE 3ZR4B 3GEBA 1WQ4A 4RMJA 3SOZA 1E94E 1Z28A 3MTBA 1XDSA 2QRUA 1WEKA 3OM0A 3TZKA 4F4IA 1F8UA 1DBIA 2OD7A 4V3BA 3RRJA 3UFXA 2AJBA 3JS5A 2AOUA 1YVUA 2X86A 2IFTA 4EECA 2RGYA 4UTOA 1CR4A 2EGHA 3DKPA 2FG5A 4JHXA 1E99A 4UNNA 2IXFA 1LPOA 3GWGA 1WDWB 3O3OB 3ESBA 4JV5B 5EMLA 4E0BA 3WDMA 2MYTA 1WUHS 1F4PA 1MPTA 1A2BA 3VJMA 4DLNA 4UVEA 5DWVA 2P9TA 3EGXB 3HRKA 3OOJA 1FLVA 4IUYA 4KKXB 2AYZA 3FDZB 4L3OA 2JCGA 2EHDA 2B2XA 3BILA 3VPDA 2RAPA 4E11A 5HXAA 2E0IA 1PGNA 1C80A 1RJ9A 4UXHA 5AKGA 4FYKA 2CLDX 3VI4B 5AXBA 2VK2A 4AI6A 5EPOA 2J9GA 2O07A 1M33A 1N2CE 1XV5A 2VKTA 2XB9A 1L5YA 3DZKA 3Q3HA 4MK4A 4N0EA 4BQRA 3K5WA 5IAJA 4AJ1A 5KOIA 3GGOA 2WFLA 5TT0A 2R11A 1CR0A 2Y1KA 3CW2A 5IC4A 4IJUA 1WBJB 3D2CA 1WIWA 2H2HA 1HE1C 3ENWA 3GPDG 4EY4A 4E51A 4HNQA 1TT7A 3IL2A 3FPSA 3F97A 1N2SA 1HKHA 2VDKB 4HN4B 2WUGA 2R8EA 3CZ5A 1O97C 4Q1VA 1QRSA 5I7VA 1ZUD1 1FFGA 2NZUG 4GXNA 5KC8A 3ONDA 3QU9A 2OPBA 4M21A 4ASUA 4DRXB 2WNSA 2QRVB 3A6GA 3DPIA 4MRSA 1T1RA 4DG5A 4EIWA 1WF6A 2WM3A 2R8XA 2ZETA 1ZX1A 4MS1A 4PX3A 4Z9XA 2AG0A 3O03A 4ZQIA 4GECA 1HFWA 1L8LA 1C8LA 4YRMA 1XMVA 2EU8A 3A7EA 1X0VA 2CF6A 3GD7A 4BQPA 4E7PA 5L3QA 3TI7A 2RMKA 3MTQA 5FPPA 1K4MA 5L4NA 3GJ8A 4FYJA 1EUDB 1ZA1A 2P6PA 5JANA 4LV8B 2QYTA 3C1AA 1T2CA 4E1VA 1TM5E 4Y3UA 1XPOA 1PVVA 1E1CB 3RSSA 1ZR2A 2HA0A 2IPAB 3GJ6A 3NT2A 4TVKA 4BNUA 4TROA 1J1IA 4EKEA 1P6UA 2I66A 1V1MB 5B1YA 4JLDA 4M0FA 3RE1A 4JU8A 4X8LA 5TF0A 1FW6A 721PA 3UKDA 3ORQA 3A9TA 4BN4A 2B21A 2RHCA 2OD2A 2V3WA 4HN9A 4GF5A 4JQZA 1IDN1 1CQJB 1Z7BA 3BB3A 3SFVA 2A9RA 4U6SA 2GXUA 4B35A 4D0NA 1XD9A 3CRQA 3LF2A 3P9ZA 2JVIA 4L0MA 2FMTA 1J4AA 3LLCA 3H83A 1L3CA 4QDUA 3DV0A 1NMSA 1RIIA 2GWHA 3W7VA 2ISSD 1YZKA 2OC9A 2QLMA 4UC0A 3TQSA 1XAGA 1Z34A 5K8LA 2M6LA 3WB2A 4JR2A 5IWAB 4GW3A 2J5QA 1NUSA 5CVEA 5JYCA 2A0WA 2EEZA 1WM1A 2OPHA 3HYSA 5CAEA 5A9TA 4MS4A 5EE5B 2B2NA 1JHRA 3HN2A 3JD2A 2GAJA 4AY2A 1SQ5A 2MT9A 2ZTSA 1FVFA 1IOZA 5IEBA 4KPFC 1AZTA 3VYWA 3WKEA 4BQQA 4W9MC 2Z1MA 4OL0A 3VR4A 4RGYA 4MWEA 2WT4A 1M7BA 1N5DA 2QLBA 3KFLA 3KD2A 1VECA 1Z45A 2V6FA 4IBOA 5CJPA 1F0YA 4YAOA 3ROEA 1IB0A 3K2BA 4EITA 1GZ5A 5EXSA 2AQIA 5HF8A 4FFPA 4FNMA 4QU0A 2VSYA 3ADCA 4FONA 2QDKA 5KVCA 4M53A 4AULA 2G4LA 2QUIA 3Q2KA 4ZT3A 3T12A 2IH4A 5LBTA 1DMSA 3HADA 2WM9B 4B32A 5KYXA 4DIBA 1OWLA 2OORA 4YRFA 2YIDA 3ZWBA 2G72A 1Q21A 2OBLA 3A9CA 3QY9A 1Y3DE 2L42A 2W6JD 2SKEA 1IC6A 2Q0HA 1Z7GA 2FWNA 2ZRLA 3B1JA 3B3QA 3D4BA 4X7MA 5FADA 3TR6A 4JUCA 4OYYA 1GTVA 3K05A 1DEKA 1W0KD 4BQFA 3F6EX 1VMAA 4PFJA 4QOJA 3UTDA 4V03A 3Q85A 2Q2QA 1U98A 1Q0UA 2V7QA 3WJ7A 3BXPA 1JR2A 2XVMA 4BDTA 1U65A 2OZPA 5K8CA 5KDOA 3H13A 5AMXA 4DQ0A 4L2IB 1KYIA 4DABA 2QTWB 3EC2A 4KI7A 1OAKA 4Q66C 4RIEA 3TX6A 5GGXA 1QZZA 1P4AA 2XUQA 3NWOA 2ZE8A 2PZ8A 3GFVA 3RSLA 1R27A 4XGRA 5JE8A 4XEUA 4US1R 5A6SB 5JC1A 4C03A 5LQUA 1ENOA 3FHLA 4P5PA 1KJQA 1QK4A 1CUUA 2HA5A 4R81A 1H69A 4PQEA 4PONA 1L5OA 4XYEA 3DEFA 3Q40A 4ZDJA 1F7UA 2UUAB 3HDJA 1NNI1 4L08A 1Z3IX 5KNLA 3C4QA 4J1SA 3DAGA 4KXNA 2WJHA 2WJPA 4MB0A 1ECPA 3TEJA 1GTG1 2GNPA 1HMPA 3DE4X 4KITB 4Q5IA 4LUCA 3HZOA 4L7VA 3RIYA 2JGEA 4TS4A 3HJUA 2IZ5A 4LC1A 1U7DA 5M3BA 1J8YF 2GO1A 1K3FA 2ZRKA 4UQPA 2CNOA 3M1AA 3PQ4A 2GCOB 3JSXA 4Q82A 4DUGD 1W5TA 1KHTA 2X19A 4LJ8A 3ICEA 1VLHA 3H9EO 1DPGA 1Y1SA 4C0HA 5E95A 4RK4A 1ZA2A 1EFVA 2YS7A 4AKTA 3W1EA 1Y4SA 1IM8A 5EJAA 1YMUA 1T9GS 3MN1A 4KN8A 4X1YA 5EXPA 5M04A 5G3YA 4M54A 5IDQA 3RTCA 5A7HA 3S2IA 4D25A 5F21A 4HLDA 1ZOSA 5LUBA 3UFXB 1T2UA 3NVDA 3ND7A 4B48A 1ZC4A 4IOMA 1WUTA 1L4FA 1BWPA 3W4JA 4I9HA 2OA0A 3TZEA 3F8WA 5TX7A 2OAGA 1MAHA 2X3YA 3QE0A 3WMGA 3BF8A 1UPTA 2CFTA 1GY8A 2HCFA 4P38A 2R5WA 3NDPA 3UMJA 2BBWA 4CI0B 3HCRA 4KO2S 2AX4A 2XQJA 5BVHB 4F04A 4H2DA 1KI3A 1KI7A 4C3ZA 2VHVA 2P9QA 1XK6A 2AXNA 1NF3A 1RJ9B 2JLQA 4IG4A 4LRTB 4KE8A 3SSNA 2VDMB 4GAEA 2OV1A 3HXMA 3HK2A 1VE3A 2FU5C 2WEKA 1GKUB 5D2CA 4E6EA 1PT8A 1WKVA 3WICA 3KVVA 3CLTD 2VJQA 4NP6A 5CGQB 1KYTA 4MUFA 1S3SA 2K87A 2JATA 2PY6A 2BAGA 4X62B 3D59A 2JNWA 2GLXA 2PSJA 3VZQA 3EZXA 2CDAA 3RGWS 2FOIA 5ADHA 2X5NA 5DNWA 3U62A 2ZI6A 3HYTA 2PUDA 2M32A 3BE8A 4AJ4A 1S1CA 2QRQA 1KVRA 1YQGA 4F3YA 4RE5A 4O4IF 4KV7A 4BYGA 1HDXA 4PLCA 1O4VA 4K40A 1ZMOA 2MSKA 1NG9A 1RHJA 3MJDA 2IX3A 4EYSA 4KO1S 3PXDA 4E5PA 3GYBA 1UBSB 2P41A 3EXHA 2QE7D 2QLJA 3FNRA 3DUWA 5IT4A 4F45A 4OHXA 3L4SO 4AZ0A 4YRSA 4FYPA 1H05A 2YMMA 3DFFA 4FW8A 4L4SA 3TXXA 3ZNPA 2YJ6A 1M2KA 4AJLA 4XWTA 3NIWA 3U3ZA 2PYDA 5L8VA 2J5RA 3F7TA 2OBBA 3KXLA 5JJBA 5K0TA 1EDBA 2ODQA 4R7TA 2VS1A 5HJ7A 4LK2A 5DYIA 1C7RA 1JWAB 2WG0A 4GRAA 2HXYA 3ZG6A 2BH9A 5LCXA 3I09A 1NPYA 3NC4A 2P9HA 3KSMA 4L28A 4X65B 5GOZA 4AJNA 4GUAA 3K16A 2O5RA 2W98A 3W5SA 3IPYA 1XTTA 3OQNA 5TDHA 1NW5A 2QRMA 1TW3A 4GLFA 3I9V6 4A2QA 4PCVA 4RTOA 3OOYA 1FXWA 1LLUA 2WC1A 2IZ0A 4KLAA 4Z9AA 3O92A 4UJ5A 5BVHA 3F5MA 4FEGA 5LQKA 2WKSA 3ZHOA 3OQJA 1OBVA 4K9MA 2NSLA 4NMHA 4U8HA 3CO5A 2XYRA 3IH5A 3ONFA 4BX9A 4KAAA 1R18A 1BN6A 1ULHA 2FZWA 4CJXA 5ITZA 5K6AC 3E58A 1UBEA 2DR3A 2PJDA 4UDXX 5A4AA 4JYZA 2QF7A 4J7XA 4KR7A 2P9ZA 1BAPA 1OHHA 3GLIE 3NH9A 4YHHB 4AZVA 4DMKA 1YWGO 2H08A 2EJBA 3AHEA 4LVOA 1Q20A 1POWA 3AETB 1MRSA 5CT9A 3RJ5A 3WK5A 4EBFA 4F84A 4NE7A 5BWNA 4BU0A 1VSTA 1QV7A 3A25A 5EKTA 1W4RA 2R8YA 4MS4B 2OP1A 5IAEA 5CAEB 3RREA 3PX7A 4B6GA 1JYEA 5KPDA 2WA2A 3WAKA 1O94C 4I36A 1FNBA 4G41A 2EFYA 2Z2JA 3KJGA 2CNWA 2ZBUA 5L7TA 2B8TA 3HTXA 1XZJA 3TI9A 1QGYA 1LD3A 1JZTA 1PG2A 3EDYA 5E8JA 5C0OE 4B3SB 2O19A 4U7HA 4CM9A 1NP3A 1PO7A 4Q1BA 1EFTA 1JNXX 3G2JA 3HV0A 2EOAA 1HR0B 1X39A 1ZI9A 2F1HA 4CKWA 5E4YA 3S0JA 4ON9A 1YB5A 4G56A 4DVJA 1D8AA 3E7XA 2PKQP 3TYXA 2X5KO 2FFRA 4DIMA 4F2PA 3JQRA 2YW9A 3BERA 2EP7A 3DZGA 3F90A 4E09A 5EZYF 1P91A 5G41A 4MVWA 2P8JA 2ETVA 2JI9A 5TGDA 1ABBA 2I6GA 3Q88A 1GPKA 3EJ6A 3HN7A 4S05A 2DT5A 2ZWVA 1VKZA 1HNNA 2PMKA 1FPQA 1R66A 3RSOA 1QIJA 5FHQA 1FYDA 1K9SA 3FDFA 3HVIA 5HNKA 4HG2A 1DJOA 1A7UA 3FBWA 5EOVA 3M9LA 1IIBA 2YV4A 4BB0A 1EU1A 2PH5A 5FO0A 3CXUA 3PRYA 4YDRA 2AFVA 1I2AA 3VSCA 1KBZA 3CPSA 4FYIA 5CA1A 2GHRA 5KQLA 1VHLA 1M1UA 2AD1A 2VK8A 3NT4A 4NHEA 3JATB 3DB1A 4EUNA 4UBJA 1L1QA 2VHZA 1FTNA 3BFXA 2WVAA 2HLNA 2XDWA 3G7SA 3N6RA 3UQZA 1Y8AA 4JROA 3Q6IA 1LJ8A 4CT0A 4F3CA 1W0JD 3DO5A 1UDRA 3PE4A 1E5XA 3H16A 2QZ4A 3OFNA 4QDXA 4LMRA 4V38A 4G0WA 2HO5A 3KXKA 4PVCA 2ES4A 1P1RA 3G85A 3QI2A 1J42A 5CEJA 3NDBB 3GIWA 1RWBA 1KWGA 2QSUA 3EZYA 9ABPA 3CLKA 1U1EA 2AJTA 1YJ8A 2IDJA 3IAXA 4N5NA 4DBZA 3G2QA 3RC9A 4EZBA 2Y1EA 5LNK1 1SUIA 4R3WA 1UBRS 2BHTA 1GYQA 2GZSA 3FCYA 3MILA 3P0IA 2G1UA 1T35A 3EMKA 1E6WA 3P2OA 3SU8A 5I3CA 2OQIA 1LC0A 1TVKA 4D2IA 3KWMA 4KKVA 5A2QA 1BKDR 2D54A 3NAQA 3PPXA 2OEPA 5D01A 1MC8A 2AG5A 1WKCA 2BZSA 2ZWPA 4RVGA 3ST7A 3X1XA 1U5CA 4C06A 5M5BA 4C4XA 4EI7A 4X1YB 2JG3A 3L8ZA 1ZDMA 3BBLA 4MX8A 3V1MA 3ICWA 3IVRA 1ESCA 4O59O 1HE5A 3H8WA 4CL0A 4J75A 4JI2B 3ZQ6A 3U9SA 2WSBA 4E07A 2EEPA 2Q6IA 3U7RA 4MI1A 1IJFA 2AR7A 1CHDA 1DG3A 3B1VA 3DDOA 2OCAA 4UVGA 4ZREA 5JV5A 2H63A 5TIIA 1NZJA 5BSMA 3Q8WA 5KNDD 1RI1A 1WR8A 3TM4A 2HRBA 2UYYA 1YA4A 2JEOA 1QQBA 3AFMA 4AX8A 3OIGA 1MJ5A 4TYWA 2VYCA 4HDMA 3H65A 5GM1A 5GADl 2PT9A 4EHHA 1KJ9A 1RKQA 4GR4A 2YWEA 4AG5A 2EFGA 1TAGA 3AHCA 3CZRA 2WD8A 4ARUA 2CFCA 2GPSA 3ZIAA 1XP8A 1WXXA 2P9YA 3E18A 3KB2A 2WUEA 2DHDA 3C7AA 4NVRA 5G0VA 3FYDA 4HYQA 3VRHA 4TRRA 4BU1A 1A9QA 1RRMA 1W581 4Q7LA 4CUJA 1PWXA 4JN6B 1JDBB 2XMSA 4OA8A 3ECCA 4FZJA 1CUXA 3KG2A 4L4YA 4YAKA 3H75A 4U9UA 4FYVA 3C7TA 3UT6A 1P2TA 1E5TA 1CBUA 1ORTA 4HX5A 4TT3A 1XTBA 5DISB 4AMYA 4WKPA 2I71A 1JKXA 1P1IA 1P4SA 3INGA 1A1VA 1VRWA 1QFXA 5B1EA 3EIOA 3T9CA 3G1TA 1NNSA 4I5IA 3IQXA 1QC5B 3TIVA 4ILKA 4DBVO 3H5WA 5FJIA 1QWSA 3D6TB 2IVZA 1B14A 1E6EA 3EXHB 1JWLA 4DLYA 1ML4A 3DOOA 4Q1EA 1SBNE 1Y9JA 4QASA 3I5UA 4GQAA 3UICA 1L3BA 4Q9NA 2O2SA 2HIHA 2JD1A 4EW2A 3UXEA 2R9VA 5DBFA 4DMFA 3JV7A 4EA6A 1PEAA 3LPLA 1VFPA 5E7IA 3ITDA 3LFTA 4RQTA 1G5IA 1VE9A 4EUSA 4MI3A 1R15A 2A1UA 1ST2A 3CV3A 4M76B 4Q3NA 5FPHA 1E1RA 4N39A 4G63A 4R40A 3KYBA 4DTCA 5CCXA 3R8XA 5HEKA 2Q4EA 3S1AA 1Z0KA 1JAIA 1B6SA 3QFSA 3HGQA 3R5JA 4PLVA 1P5HA 1FSPA 1JQBA 1T0UA 1WLYA 4Y1RA 3UGQA 4E4RA 1EDZA 3SE7A 2ZBGA 1RRPA 1EX7A 3V48A 4BNHA 3P26A 1AXGA 2OHIA 1WHSB 4TKVA 1S0UA 1VB5A 3B2EA 3BGDA 3KQMA 2I91A 1P1CA 4GM1A 1FTYA 5HZGA 1OH7A 4DQDA 1DU4A 5ENZA 2I6FA 1BHQ1 2XNDA 4PYRA 5C1BA 1QMPA 5IH3A 4BEWA 4K0RA 5CFOA 2QP9X 4QUBA 2ZQYA 1IM5A 4GRDA 2VHXA 3GCWA 3QBJA 3ZE7A 5ITZB 4AY4A 4XUDA 5CJ2A 5BOVA 4NYJR 2A88A 3LHIA 4L9RA 5IAGA 1L7EA 2BFEA 5CB4A 1K5DA 2DQYA 3TD9A 3U3JA 3DKVA 2WZCA 3K5IA 3NEYA 3U1TA 5BXYA 1KH2A 1Q0HA 1ZOPA 3FWNA 1H2BA 4GSKA 2CYBA 4XWOA 4KIGA 3N28A 1I7LA 1M1ZA 4ER6A 1P81A 1FUKA 1ZMBA 2R2AA 1O1YA 4KW7A 2AF4C 3VJKA 5AW3A 2ZXUA 2AI1A 4Q18A 5H8WA 4NK4A 3ZCPA 2NV6A 3E5RA 1FJHA 4JJEA 5L6LB 1PFKA 1R6AA 5BQPA 4BNFA 2Q1XA 1HURA 2X13A 1KYZA 4BO7A 4ALMA 3P2KA 3AP1A 4HBZA 4RVNA 2FMUA 3ILSA 4AFNA 2WAAA 1GNQA 4ZEVA 5BSUA 1T0PA 3QVTA 2PIDA 9LDBA 3BDVA 1FVXA 4URHA 3AVYA 2IEZA 4KBYA 2TMDA 2ZRMA 3K20A 3L9WA 3SKXA 4GZ3A 5KIAA 1R74A 1H2YA 4CKWB 1WP9A 4DDWA 1V6CA 2JCVA 3QMWA 4UQOA 2ZYWX 2H4ZA 3CH4B 2FFBA 4OYLA 5JUWA 1P1JA 4G5HA 5TS3A 2Q4DA 3LBNA 4XGKA 2WFAA 1I3CA 1P0QA 4WBNA 1M72A 4QU5A 3ZXYA 2Q3JA 5KX5A 1SVLA 2JGRA 3QOWA 2XRYA 3WLIA 3LYAA 3A1CA 4UE6A 4DNOA 1E1LA 1U7UA 1JTEA 3R7DA 5M7EA 4LK3A 5AVJA 1W1IA 5MDHA 4TRMA 3WOHA 1EB8A 4BMVA 4ND5A 4UHJA 3B48A 3RTBA 4CQMD 2RDMA 1ZIXA 4Q7MB 4RQBA 1KI2A 3D64A 4HKTA 3PUVA 2O05A 2QXUA 1Q0ZA 3FHCB 2G1KA 1GQSA 1YZ3A 3UANA 2DECA 3MS2A 3THXB 1QH9A 2HOQA 5F2NA 3GLHA 5CA1B 1TTQB 1JEJA 2ZTMA 4FHEA 3B1ZA 2HLDD 3OTHA 1Y9DA 4DMCA 4KX5A 2AJ8A 4XB6B 2J0VA 3F74A 1KAQA 3C45A 1QAOA 2FLKA 1UK9A 2CMHA 2OHHA 1CS0A 1VKOA 2P9BA 4BFYA 2DX7A 2HU2A 1LPPA 2O3UA 3PFNA 4ND3A 2AKAB 2DC1A 2E5FA 2FOLA 1JXAA 1VGRA 2R1ZA 1ADJA 4X71A 3P2JA 1DINA 1XTSA 2HSEA 2CUZA 4MJ7A 2Q49A 1XB2A 3BORA 5EWJA 4B3XA 5BNTA 3H1PA 2V7PA 4ZA2A 3RVKA 4B4OA 6REQA 2GEVA 1FYVA 4NWIA 3TLAA 5J2TA 5D00A 3UC5A 2D5BA 5C46F 4F86A 2F9MA 2C7GA 4C0AC 2B8WA 3BIJA 1YKGA 1S2DA 1DCFA 2F4NA 4G9BA 1KY2A 1M6EX 1TVKB 4JMPA 3BQNB 4CETA 3SQWA 3AFOA 3OPQA 3HY4A 4OPMA 1EP1B 1AHPA 3ILVA 2XWSA 4PAQA 1OJLA 1Z75A 2RAFA 1BN7A 4F06A 4X92A 4TTAA 6NULA 1DBVO 2IYLD 3R3HA 1UQUA 2I2AA 1DE0A 1UAGA 2YR0A 1CJVC 2OZVA 3ELYA 2V6IA 2WHRA 2ZJYA 3STWA 4TL9A 1PT5A 4CN8A 4KUGA 2GHTA 2PZMA 4EDHA 4FFDA 4LXXA 1C8VB 4KPUA 4EARA 4N7JA 4B74A 4ZT4A 1VG1A 3LK7A 2CXSA 1O94A 2ZB8A 1XQ6A 3GU3A 1ZMTA 2ZVPX 3OESA 1KI8A 1A8SA 4XVHA 4E2ZA 1AC5A 3DL0A 5JJ5A 4HDMB 1FFWA 1NE2A 3ZY2A 2HU8A 3ESZA 3TTXA 5B7NA 4DJFC 3F7NA 3Q7RA 4KU4A 1CLEA 3KWLA 4PYMA 2C92A 4CT4B 5LVAA 4KMRA 3QKRA 5EE1A 1TADA 4J0KA 3ZKWA 1KVSA 4JQCA 3PEFA 4JT2A 2IP2A 4QYWA 1X94A 2BN4A 3P9YA 4BBZA 1FS6A 5FQNA 2V6JA 4TPKA 3JWEA 4XLZA 3DOJA 4C0QC 1CETA 4H7HA 5T6BA 4WZ6A 1G8MA 2XQFA 4QPZA 3WI7A 1XFDA 5MHTA 1K8ZB 3MB5A 2AXPA 1XP5A 1P2FA 2AMLA 4TQ9A 3UJ9A 2C59A 3KR1A 4WX2B 2IH5A 1TU4A 2AMFA 4AO6A 1I0LA 1ZIOA 3H4VA 3V1UA 4L4XA 3WGYA 5ES4B 4EVSA 2XLBA 2Y6UA 4GMHA 4R7GA 3EG9A 1PFWA 1VL5A 4RYDA 4QUKA 3OTWA 1FPMA 3HYCA 1YHYA 4Q34A 1XWWA 1FRNA 5FWYA 1BXRB 1TA4A 4YP0A 1W8DA 2A8YA 2RHRA 3CH7A 5JSZA 3WJ2A 2W6ID 1Z83A 5EMKA 2VP2A 4KZKA 2C9MA 1MV8A 3GN2A 4IGFA 1W87A 2DPLA 3C6BA 3OQIA 4NBVA 4ZYXA 3OWXA 4G4SO 5A1TA 5KSYA 3PTAA 2AWOA 3DUFA 2HADA 3B20A 3LU1A 1TM3E 1XVLA 3AF3A 3TTUA 4D44A 2AKYA 3LQ1A 1Y1LA 4D41A 4PR0A 1CEQA 1E2EA 4BNVA 5B7PA 1LLQA 1Q77A 2BUBA 4CIWA 2WWYA 1MP0A 4R9RA 5AKYA 2JLAA 1MFZA 2IHJA 2KBFA 3DFKA 4D4MA 5T8KC 2H4YA 2JFQA 3IXMA 2GVDC 3JQEA 4PWZA 5IAOA 4RXMA 2ZAOA 1IU9A 4TKVB 3W5HA 2WLSA 2PS3A 1LNZA 3AEUA 1OVGA 4PSAA 3W2TA 4DQLA 1FZTA 1XEWY 3FGNA 2WI8A 1GUAA 4JFRA 1UH5A 3WIVA 3DGEC 4H1VA 4CXMA 1ZGGA 4RM2A 4CNBA 4MGZR 1RNLA 3BL5A 4M1SA 3O94A 1JR3E 3IIMA 1NT2A 4Y6PA 2LZ0A 3ZC3A 4BLUA 3Q3EA 4MP6A 4EFDA 5KU1A 4AWBA 5CB4B 4HQFA 2BFEB 4P7KA 1H1DA 3MYRA 5G40A 1IY0A 5JCOA 3CEHA 2E5WA 2G06A 1PK8A 1EK1A 3A8TA 3MT7A 1B8NA 1A7KA 1O8BA 2VA9A 3TE6A 4IYJA 2ZWOA 3ZWDA 1GGHA 4TTVA 3VTAA 1EE9A 1FFAA 2NYUA 2E4WA 2Y92A 4R71A 1Y7TA 4DN6A 3FNIA 4QL3A 2YZ2A 3V1NA 4G0PA 2GCNA 2BMAA 2I6QA 2X58A 4I0WB 1RZRD 1CR1A 1YQUA 2X1VA 4ZQFA 3E9ZA 1X1RA 4FGUA 4UTZA 3R0JA 1T8WA 2HU7A 4XM1A 3D5TA 4ZV7A 2BUCA 2JFBA 1FP2A 3GZ4A 4OHKA 4TKUA 1B8OA 1Z4QA 3DLIA 3GEGA 4JOQA 5ED0A 1RXWA 3O83A 3F0TA 1QDLB 2GZMA 1J1ZA 2RAUA 1M7GA 3L4BC 3LSTA 3MEQA 4HCJA 4AO8A 4AYXA 3GDHA 5K8UA 1WKBA 4JJKA 3FVRA 2QRGA 1BRTA 3GOQA 5J47A 1LX6A 2H0RA 3KDAA 1Z47A 2PDAA 2VHWA 4MV4A 1E7MA 3SZ3A 3FHJA 2VH1A 2VDLB 5LYJB 2EWMA 3A36A 4MJLA 4IG9A 1ADGA 1YDWA 4U63A 4D79A 5JNTA 3SZMA 4WBNB 5JXJA 1FLNA 1XZMA 2DFLA 4ZVQA 3R20A 2QSYA 4A82A 5M29A 5KX5B 3Q3CA 3EYAA 5K01A 1JLHA 4GL2A 3KYDA 1MGOA 4UD6A 4C3UA 3N53A 1FX0A 3SE0A 4HNRA 5C5CA 2O0KA 1Y82A 4MWTA 5FPQA 1G6KA 5A04A 1OXMA 3JQ6A 3C7CB 2NVBA 1DDOA 2Q5LA 1GLNA 4LHVA 1L7NA 1M6HA 4N1AA 5BN5A 3FYSA 3S2FA 3WMRA 2DM6A 2LCQA 2E7ZA 1ZZGA 1S2NA 1C9KA 1XA0A 1NW3A 3G49A 4D02A 3G02A 4CR6A 2XUFA 4Q7KA 3NPAA 4L8WB 2FHSA 3OZVA 4US0R 2CJWA 2R97A 4EGSA 3M7IA 5GIOE 4MQFB 2PGLA 3RLIA 4N5LA 4Q3OA 5JAUA 4PO9A 3AFGA 4R4JA 1NHWA 2PD4A 5I01A 4CEIB 5I4IA 1F2UA 3TVYA 4BCDA 1DWOA 2DLNA 1CS0B 3IMGA 4IVQA 1ZD4A 2GSDA 2IEBA 3WADA 4A10A 1K89A 3VKWA 3RRYA 1L4KA 1QIDA 3EVTA 2R3SA 4XIJA 3F6YA 2AEEA 1IMJA 4GSLA 1HT3A 1DP4A 2H7YA 1NNEA 4R54A 3JYPA 1CSEE 1M1YA 2CFIA 3DJFA 3G89A 3G82C 4UCWA 6REQB 2OBFA 2WNIA 4R9VA 3L0PA 4OBWA 5BSRA 5DTEA 2ECKA 5J2TB 1DAFA 4EKIA 1U0BB 3WQRA 1WD5A 2ZSUA 4DSAA 2J3KA 2IEAA 4I19A 3VH3A 4DBLE 5L4LA 4M7OA 3WLLA 4EF5A 3BGVA 2HDNB 3T7TA 3AVTA 3HR4A 4MIYA 3UCXA 3BK1A 2P35A 4HEJA 2JKYA 3ZXXA 5CLQA 4TWAA 1HQDA 4WOKA 3AUAA 1ENYA 1Z0IA 4IJKA 4O1MA 4ZVPA 5L51A 3WWZA 2EQ5A 4IUDS 1XCJA 1OROA 2FMKA 3PQFA 4YUXA 4KQJA 2JCBA 2O2EA 3IQEA 5ARCA 1CB7A 3TFOA 3MOSA 3O8DA 3ORHA 3MAGA 2GZHA 3KFXA 1N0HA 3H9UA 4HGOA 4IMRA 3HL0A 4JJ8A 4IGIA 4OKNA 1NQTA 3CF0A 1XZAA 3K0FB 3ZE2B 4EPVA 4F4HA 5IKMA 4BGIA 2XECA 3KSAC 1I3OA 2OCKA 2YJGA 4AO7A 4KPUB 2KB0A 3BHJA 2AFIE 4CM7A 3U48A 3A3PA 5E9WA 5D7NA 1YTUA 3VU0A 2GZ1A 3ND8A 3PHIA 4WY2A 1QGDA 2X42A 3C1OA 1CNEA 3BWMA 4B1FA 2DUJA 2R7LA 1XT6A 2EC5A 4P84A 5C31A 2C4HA 2EGGA 2I5PO 1DAEA 1NLUA 2DBRA 4RLHA 3SSMA 2PL9A 2Z4TA 5A5EA 4RJKA 2PGOA 2GR9A 1J5PA 1G16A 1FP1D 3QKRB 3TPFA 5JAMA 1Q19A 2R00A 3ZKWB 4K86A 1HY3A 5H3LA 1LRJA 1EGQA 3Q2OA 4MQUA 3F7OA 3R3JA 1ABEA 2A35A 1ZLXA 2BKUA 3T0GA 3ASYA 2QTZA 1XU7A 1DB3A 1ZN9A 1QGAA 2VT6A 4Q1AA 3X1YA 3EGEA 1N1MA 4TVOA 2ZRCA 2DFDA 3ILXA 2V3VA 1GTL1 3D9QX 4FFMA 2X9QA 4JOBA 1GZDA 2ZGVA 2IIVA 1KAOA 3N5CA 1QS0A 3PGXA 3A26A 1MJHA 1N6RA 2J46A 3Q10A 1THGA 2WTUA 2RHJA 1PTJC 2R86A 2ZDHA 4H0FA 5CX1A 5IAKA 5JQGF 2QMOA 1J2JA 2UZAA 4JLSA 5FWDA 5H16A 3VU8A 3V9AA 3I6BA 2GZAA 2ACEA 2HJVA 5FBWB 1KC1A 2FVXA 3EG9B 4Y6SA 5YASA 4LDAA 1XXLA 2FSUA 4M9XA 3KALA 5DBIA 4U39A 3IHLA 4F2WA 1H9CA 2GOYA 4HQ6A 4LZOA 4KVGA 1LJUA 1VTKA 2Z43A 3A6PC 2V6GA 2V8BA 4AKHA 4CIAA 2CY0A 4ZVOA 3TBHA 2X2OA 2B4KA 2LBPA 3SHTA 2RI6A 1K0FA 5HOQA 3OQIB 3WNBA 3RUPA 3RS7A 4CM6A 3ADKA 1SHZA 3O5AA 1HFKA 1QHFA 1X7DA 1P75A 3IVGA 1CKEA 2G1AA 2FSIA 3W9UA 4AW9A 1VCHA 3IVMA 1G7TA 1D04A 2XUIA 4EZIA 1PJLA 1BDJA 3HUEA 5A5FA 5TJHA 2ZIFA 1P9LA 4IVRA 3U7GA 1A96A 4WXPA 3REQB 1NV9A 1WXHA 4BWGA 4F4FA 2XRZA 1PJTA 2CLEB 3DKRA 4WNCA 1PJCA 2BOVA 1AY0A 1SN7A 3ZVMA 4LZLA 3AEUB 2JLSA 2FKNA 4BP8A 4I1YA 4WZAA 3O9VA 1M34E 1JR3D 1Y7IA 2D62A 4JEUA 5IM4F 1UK6A 4L6AA 4M1YA 1ORRA 4LV5B 1OC4A 3VO9A 3GLFA 4MQ5A 1OWPA 3MHTA 3T5BA 2JVJA 4PYKA 1V5IA 3MFYA 2VUTA 4YCSA 2NXJA 3FLBA 5C51B 2CNLA 1I4LD 3S1LA 4BOYA 2NU6A 2IDZA 4MA5A 5AI5A 1AO0A 4N0MA 2QX6A 3JWIA 3OA0A 3OJOA 1PR4A 1DO0A 2Z2KA 1U0RA 2JGKA 4A16A 3AOGA 3EEQA 1L5FA 2CK3D 4RGVA 2HDWA 5CNKA 1A9ZA 3G9XA 2NP6A 3FCCA 3S6JA 3P0EA 1KNQA 1X19A 4YUVA 1Q0RA 2X4LA 1WX1A 3O8CA 1RAEA 3HXOA 3P9IA 3Q3IA 4RPKA 3QH4A 2O5CA 1YHNA 2FWMX 3ZWNA 4TKUB 5DBEX 4C2BA 5CLIA 3RUHA 1PL7A 4PX5A 4GI7A 3V4LA 3I3SR 1T5BA 1UBLS 1QIKA 1MFPA 3HCNA 2JB9A 1QCYA 1QYIA 3F8TA 5ALYA 4O8CA 4UASA 1WMSA 4EHIA 1VYTA 3H5IA 2A9VA 4XIYA 1B6TA 4DZRA 3HQ4O 1VBKA 4M9CA 3J81k 3LUBA 2XT0A 4X93A 2CLIB 4UTRA 2BZ1A 1J56A 1I2ZA 3CLHA 3T9EA 2FPOA 4CE6A 1E59A 1XEFA 2CCGA 3RM3A 4ED9A 3ZWXA 1YVDA 4F7DA 1CZNA 3L93A 4JQSA 3A2LA 1WW8A 3M8KA 3JQ7A 3IAFA 3ROPA 3W77A 4E03A 1ZVVA 4ZI5A 3W5AA 3ZNQA 4A8JC 3BE4A 3RABA 5CLFA 3KYDB 1RAAA 3N2EA 1SZDA 3FBTA 2FW8A 1FX0B 3DTTA 1FC0A 2IIPA 4D26A 2V45A 3QBVA 3DL7A 4BRWA 2PKWA 3B70A 1JA0A 2V54A 3I0MA 4BEBA 4QZVA 3KQNA 1JDVA 3M89A 3DYIA 4ZI7A 5BN5B 1FQKA 2O1EA 2XTMA 2BCGY 2JJMA 2MHCA 2YRWA 1TE2A 5JSYA 5KCMA 2AYYA 2HK9A 3DMPA 5CCDA 3T1TA 2K2WA 4J4HA 1S89A 3PDIB 2EJVA 4QQ8A 4IS2A 3NHJA 3CB2A 3DPSA 3N87A 1RWMA 2CJWB 1VPTA 4NJEB 4PO8A 3ZD8A 3QVLA 3KU4A 1EINA 1F2UB 2IXGA 4QOEA 1HXHA 1LSJA 1ZUHA 3WHKA 2VJBA 1YB1A 4MHTA 1NW6A 1IZ0A 4MR8A 4F1JA 2BGWA 4WCDA 3B53X 4OJTA 4DWJA 3UWSA 2Q4OA 3FF1A 2QAIA 3DTVD 1TUGA 2C5SA 1P33A 2H2DA 1I4DD 3OI7A 3QXCA 4FFBA 1M1NA 1ZD5A 1M1YB 4O1HA 4BCCA 4GMFA 2EF0A 2PX6A 2IZ6A 2W2QA 3GT4A 3BK7A 4FDVA 3L3BA 3DGFC 1MA3A 4LOKA 1ESDA 4R8VA 4UMFA 1YDFA 4J7CA 3R8FA 1CY1A 1JAHA 2KWIA 2VAVA 2VT3A 3O3NB 3UJ3X 1X9GA 4DQUA 1SXHA 1W76A 1C2YA 4PC1A 3ZGZA 5L95A 1ZK1A 4KGZA 3O8OA 3CF4A 4JUDX 3F7MA 4J43A 4MCAA 4MUKA 2OENG 1AUPA 4MZDA 3TZCA 2V8OA 3ZN2A 2WJGA 4HUTA 1RWWA 4S35A 4E94A 1Z4KA 1P80A 1GZ6A 4IHAA 5EHGA 3JQGA 2ZSKA 5IANA 5KNCD 3EX7C 2G36A 5HILA 3IE1A 3NXSA 3CISA 1UC4B 3PV0A 4ZT2A 3ZHXA 3HV2A 3K6SB 4UUPA 4OFXA 4ZO7A 4N6OA 2GKGA 1R9MA 3L7CA 5HM8A 1HZZA 1WTAA 2R7KA 3WNCA 2PXXA 1TUIA 4TWJA 3O4VA 4NEQA 2GARA 4DDUA 5CIWA 1YJXA 2I4LA 2ZVDA 4B3DA 2Q21A 2QU7A 3WB0A 3L4BA 1ZZEA 3T3DA 5FPKA 5KQMA 1NVFA 4ISBA 4K9RA 4PIMA 2FN3A 4BVGA 1JMYA 3IIKA 5F7XA 2Z5VA 3JW8A 1W44A 1UBTS 3EZ6A 1EA7A 1P8AA 1UBUS 3IT3A 4DVGA 2G7MC 3E4DA 2A5FA 3HKCA 2A9PA 2MJLA 1ONNA 2ASEA 4WQMA 4R0VA 1DQZA 1W52X 3W6ZA 1DBQA 3NXKA 3FCSB 3P2YA 3Q7SA 4I1SA 2HCBA 3GL9A 1WULS 3W1VA 4RPHA 2XHEA 5AM3A 3GB9A 3DDWA 4JXKA 1KVUA 2FRDA 1EESA 4DMMA 3FTNA 1QS0B 4AKEA 4V1CA 1GPYA 3DMNA 5CCBA 3PVSA 2D3TA 5CX1B 4UHDA 1M8KA 4MCIA 4LYAA 3EQ6A 2ZLBA 1UT6A 3FTDA 3W2FA 2PVPA 1G2IA 3RAGA 5AKIA 5BORA 3IT2A 1KS9A 4O4HA 3GFFA 1GAXA 1K6MA 1ZOIA 3NTRA 4ZEOA 1CNMA 5GQSA 4F21A 1F1JA 1J7KA 2KYRA 1Y6FA 3AYXB 5F98A 1MV5A 3S68A 2XIQA 2HTEA 3DMFA 1Z18A 3JWGA 2GPTA 4M0LA 1YDHA 4LYEA 4C4PA 1CPYA 1YBVA 2ZT6A 2PRYA 1F8XA 2FFHA 3A11A 2F1RA 4RFSB 5IZ4A 1BNCA 4P08A 1JPJA 2PL3A 2FEPA 2C8JA 4HWGA 4DSOA 1JRLA 3DWIA 1JHAA 3I8SA 2PZAA 5DP2A 3D4IA 1DC6A 4DNFA 4LHSA 3VKHA 4DQXA 4B2LA 1XYGA 1ODTC 2LCIA 1YOBA 4I4CA 3T3IA 4WOBA 5K0EA 3F1KA 2PL1A 2Q4BA 5F35A 4XRRA 3TL2A 1QKJA 5D7BA 2WAOA 2IDKA 2OGUA 4WZAB 3HL4A 3VQTA 1PJ4A 2K5UA 2QIOA 3UN1A 4C29A 4CLXA 2NQTA 3I34X 4QLOA 5FWXA 2IS1A 1R8SA 1T1EA 3VC2A 3RFXA 1B00A 2OCYC 3H1EA 1IRXA 3WTBA 1VFNA 2A0KA 1PBNA 4C7VA 3QU4A 3AHIA 4YRLA 2EYQA 5FRDA 2QTTA 1BMFA 1JQKA 4RBNA 5LDDC 1SIWA 3S8EA 3ZK8A 1K7SN 4I8DA 4DS3A 3DZFA 4EPXA 4DCMA 3JWHA 1L5HA 3VYTB 3VOAA 3ULKA 2XA1A 1E64A 3COYA 1ZJ4A 3WNVA 1SH7A 4HYYA 1YCDA 1GQFA 3CZPA 1YE3A 4JI5B 2EBWA 2PA0A 1YS9A 3JQQA 4QUDA 5GONA 4NPHA 3MMSA 4ZVVA 1L5QA 4V0KA 4FI3F 1YCHA 4IHJF 4DJJA 3ASVA 1F0NA 4RIHA 4BX2A 4HOYA 3WE7A 5B7QA 1CFZA 3NBZC 1NV8A 5D5HA 2IF2A 3K9BA 2FPLA 4G1EB 2WF8A 4U6NA 2VQFB 2WU1A 3CH5A 1QHSA 1NJ2A 1Z56C 4G89A 2XCQA 4YGYA 5AM0A 2VXOA 4E21A 4J3JA 1GRVA 2FF7A 4Y9UA 1E2BA 3KT3A 2OWEA 4HZUA 2DLDA 3GUZA 4MICA 2ZM6B 1L4EA 4I7EA 3K4HA 5KZMB 1HI9A 4YUAA 1FVHA 3Q3GE 1QR2A 1QHYA 1OAOC 1JDUA 3AF5A 2PNFA 2PAFA 3E9YA 3H2JA 3V3TA 5BV7A 2GFIA 4RV4A 5HE8A 1QYWA 4YS6A 1EUYA 2HM7A 1PTJA 3MD9A 3L0CA 5L4SA 3KOOA 4Q4LA 2DVMA 3UK7A 2RKOA 3QKTA 2GXAA 2H31A 3L8DA 4GOOD 2I99A 4P53A 1I9CA 3WOVA 3KEFA 5C2JB 2XQGA 2Q27A 3O31A 1LBEA 1NR5A 2GN4A 4FMBB 3FRHA 4OLJA 1H4TA 4G1MB 2JGFA 3WB9A 1E7RA 4V2UA 1DOAA 1J8DA 3KKZA 4KNWA 3FETA 4PC2A 2VQ3A 4D0GA 2XKAA 2Y99A 4IDCA 4CLDA 1F38A 4JX9A 4IILA 4E1BA 2QQFA 3KB8A 3KQQA 1DJPA 1YSCA 4LXIA 5IHPA 3I9FA 4JX8A 1GL9B 1IZ9A 2CMDA 2EJTA 4G0OA 1A4XA 1U7PA 4MR8B 4EGAA 4BLTA 1N0WA 2V6BA 2VJAA 3IB3A 1GYPA 1T9GR 3X0DA 4FSHA 2ZRQA 2ZIZA 1WOMA 1M1NB 2FSPA 1TJPB 4FFBB 3MM4A 4A8PA 1ZXLA 4G0YA 1NQ5A 4KLZA 3P5SA 5GTDA 3EZNA 4BRUA 3WIEA 3W9YA 4W9NC 2FRVA 5I4BA 1GUBA 4OSPA 1JW9B 1KK2A 4A8TA 3BULA 2BFWA 2Z6VA 4QDOA 3IOYA 3RJMA 3BB1A 2ZTVA 4WBSA 4UTNA 5JEDA 3G0CA 2RK4A 2WP0A 3FZEA 5H7XA 1FRVA 1RWKA 1AQLA 1V8BA 1YS4A 3O8OB 4IINA 4XGQA 1RQRA 3HEMA 1LJLA 5A71A 1ZRSA 1LSUA 3KKLA 3PXAA 2Z6QA 1R0ZA 3H5AA 1ISSA 1E4VA 1XG5A 2DFKB 2O2CA 5A03A 4FS3A 4GGMX 2JF0A 1KC3A 2CHVA 3BCHA 3JQGB 1WU8A 1JG6A 1WUIS 1ZHHA 2MOKA 3Q0IA 1L7DA 2QLFA 4H0CA 4KR0A 4LVCA 5DULA 1KR5A 1QP8A 1QYCA 4REOA 2ZW9A 3P5BA 3W7BA 1RVV1 2ZUFA 1M9NA 2CDRA 3P71T 2DTXA 3SYRA 3CEPB 3QVXA 3DMGA 3CINA 2BVNA 2CXTA 5JFOA 4KYVA 2ZRNA 4HLUC 1F3LA 1U0OC 1H85A 1SXIA 3LT4A 3VPFA 1XMIA 3A4MA 3IBGA 3D1JA 4LY3A 4KQFA 5SYAA 1J0XO 2P4UA 2ZE7A 3IDQA 4NULA 1HDOA 5D51S 4BGVA 2YNMA 4OQDA 1WW2A 4E3ZA 1DTWA 1EFPA 1PQPA 1L6RA 4FE7A 4PSVA 2PT6A 3SGLA 1WNTA 3K2IA 2VLBA 3K7EA 3WMWA 3GRUA 1XDGA 4EUKA 2QUBA 3LQYA 1KIFA 4CF4A 4S1OA 4LF6B 1IWOA 1FFBA 2UYQA 3DOEA 3NJ4A 4CKEA 1UEJA 2WB2A 4Q9KA 1YU6A 3LC1O 1OIWA 4HO1X 2ZJ7A 4OI2A 1QJ4A 2QL9A 4J3NA 3MWGA 2XB8A 3C3MA 1YQWA 2GDZA 4PYNA 4PWYA 1GP2A 2B9VA 1SCDA 2W2XA 2ZIAA 4OXQA 3QOFA 4UM7A 4AURA 1VHDA 3B2NA 1ECGA 4IDHA 3BAFA 1ISMA 3E15A 3H6HA 4A8JA 1TTTA 2FWAA 2PX5A 2OHGA 2VP5A 1Y34E 2XE4A 4MPTA 4B2YA 5KTKA 3BXEA 2JLWA 4D7AA 3PITA 1L5SA 5EERA 3RWBA 1DQSA 3VH2A 3JQDA 4CCAA 1USWA 1G9XA 2IP1A 3V4OA 1LPNA 1SU8A 2QQEA 4D96A 1OX4A 4FFOA 2IU0A 1M74A 4TX1A 4OSEA 1V11A 4ARAA 3FZGA 4QBIA 1L5VA 2ZIEA 3Q12A 4ZEMA 2VHEA 3AFHA 3STVA 3FTCA 1PDVA 4R1OA 4HWTA 1NBMA 5C1IA 3PGMA 4FPXA 4B71A 2QPAA 4BVJA 5BWMA 1ZI6A 3IBFA 1C9MA 3CKKA 1KZ7B 5AJTA 3UWPA 2AE2A 3CONA 3G8BA 1IN8A 3K0AB 3T35A 1AZWA 1V16A 3PI7A 4X44A 2X41A 5LIRA 1SBIA 5KOYA 1NW7A 1Q7GA 3IP5A 4IJQA 1X8KA 3DQZA 3D7KA 3HLTA 1NJGA 4M9QA 1CZUA 3ZCUA 2BSAA 5AK6A 1G60A 3REOA 3THOA 4ZOLB 3WA6A 1T9BA 1UAYA 3ODGA 1Z0JA 3R3ZA 5K45A 1MCZA 1U8CB 2H2AA 2VBIA 3ZZUA 3I05A 4F2DA 3GRFA 2BFAA 3ZHZA 5CVJA 3CRMA 3KOXA 2WAXA 3ZXIA 2PSDA 2FPPA 1CZLA 2DPGA 5ETJA 5KVAA 2PUFA 3PFGA 1W35A 4OJYA 3R5TA 2FX2A 5EFOA 3E3LA 4IH4A 1XNGA 5KJEA 3ZK9A 4E5KA 3ICCA 1E89A 1NVXQ 3PQ7A 1XRQA 3T95A 5KREA 3HY3A 3TX2A 3QLVC 1JKIA 2XOKA 4OI0A 5FWXB 1TDJA 4XJSA 4GEKA 5E1BA 4YXWD 5EXEA 2AVDA 5DW3A 2D8AA 1RAHA 3KQWA 4B4KA 1O96B 4CIVA 4POOA 4NCKA 1Z06A 5ALZA 4EPRA 3CE9A 1OC2A 4AY6A 3B1KA 2ANBA 3G0DA 1ZH2A 2I7VA 2P4QA 3ZWOA 3ELWA 3JY6A 1LBTA 1KDPA 1WXDA 4LBZA 1T2DA 2HA6A 4G81A 4KRGA 1L5HB 5DYNA 3KPYA 3LX8A 3SHOA 3I04A 2E4XA 3B38A 4XD7A 4NHOA 1QUFA 3HEBA 4RANA 4YJGA 1ECFA 5LQMA 1CUIA 5EQJB 1KDTA 3D8TA 5A1JA 1RW4A 3ED5A 4C7OA 2ZBVA 3MUEA 3NDIA 5E6RA 3UEOA 3QEJA 4LC0A 1BVYF 3NWJA 4Z99A 2NO0A 3SEZA 2Y76A 5JVDA 4BQNA 4B6EA 2HF2A 4ZVSA 5CFMA 3T9DA 2RK3A 3IEIA 1GPJA 3W3AA 4HZUB 3ZWVA 1DI0A 3D31A 1H5NA 4RH1A 1D2HA 4DDVA 3IP8A 1A8UA 1R0YA 1V6SA 1Y4UA 2YJNA 4MMZB 4OQMA 3LIPA 3EK2A 2FR0A 4LJ7A 4RIGA 1WSAA 4RFLA 2IOHA 3W04A 3WYGA 4H1HA 3TLKA 2ICAA 4K81B 1ODCA 4ARIA 1ZRHA 1XWFA 2P2LA 4NBKA 4ARZB 3IPXA 2VJMA 3FPHA 1CX9B 4D3YA 4DJDC 3R7BA 4YAWA 1S4QA 3A3OA 4QDTA 4CN9A 2IEDA 3AMVA 5DZSA 3DBRA 5CYPA 1N36B 4R1QA 1T8TA 1E6LA 1W75A 3N1UA 4KVZA 1PR5A 1N9GA 3HSYA 2HCTA 3HXKA 4RTLA 1NVAA 1WY5A 2JCXA 3SBOA 3H4MA 4U0KA 2IH2A 4F6RB 5F3DA 3AVQA 2WPDD 1OV4A 3OBBA 2FYTA 3ZV7A 2HJ9A 3DZ8A 4MYUA 3NAZA 4IF4A 1V45E 1KY4A 4D4IA 2QZ9A 1O95D 2YHSA 1QFMA 2Q9CA 2P6UA 3L02A 3UMYA 3KXPA 5AWFC 1IHXA 3FCUB 2VP4A 4CIBA 4WFIA 3H5VA 1CUJA 4L15A 3OC0A 4I4NA 3EDOA 3V4VB 2FMXA 3NASA 1MQ8B 2QD5A 2GTHA 4OKIA 1YB4A 1SKYB 1Q16A 1YJAA 2AOWA 4HY3A 4Y2XA 4YRTA 2VYVD 4W4TA 2AI3A 5DP1A 5B1SA 1PEKE 4Z1MA 4MUXA 3CUWA 3GJYA 1RWNA 4HAOA 4PRZA 4GX1A 1C1YA 1RSZA 4W5WA 1UC9A 1GNPA 1IEWA 1HF3A 1KXJA 1GNVA 4LCEA 3WGIA 2QVBA 1KYXA 3NS7A 1AF4A 3L4EA 1QGUA 4M1EA 2GAIA 5IT0A 1FJGB 4IDPA 3I9OA 1FMFA 2WSSD 3BFPA 3JQBC 3QPBA 1SG9A 5AVXA 4JYPA 2XADA 3LGSA 3PSAA 4E2WA 2R6DA 4LV6A 5F5XA 2XXAB 2A5LA 2IYAA 2ZS9A 4C2UA 2PRZA 5B1DA 4D9CA 1LTKA 4FN5A 5BY2A 2QORA 4YRGA 1KQ3A 3U6KA 2Y1WA 1N9KA 3NTLA 1UOPA 5JY1A 1R0SA 4CNQA 1KOGA 1Q5PA 3KEOA 3VU1A 1EB9A 5EPEA 1GDHA 4EF6A 4PS1A 5JG7A 4RF4A 3ZHCA 3GJ5A 3UUGA 3KQLA 3Q5GA 5ICSA 3D2AA 4XPZA 2GILA 4DLUA 5CDYA 1O0CA 1UFVA 3IKTA 1R0XA 2JD0A 3HA5A 4XFDA 4JC5A 1G8AA 4PG4A 3SS8A 1DTWB 1EFPB 4UU8A 5AXDA 3J7AC 3KIPA 4OKSA 3PCTA 2B82A 4MW4A 4NOMA 2ARKA 1IYZA 3O8QA 2ATVA 1SNYA 3EBPA 3FPAA 4BIIA 4UPEA 2C2OA 2DH6A 1KZ4A 3FPEA 4NBUA 4ENQA 1X8JA 4GHWA 1LI7A 2PTGA 4FZ5A 2C5LA 4HF7A 2TMYA 1NQUA 2CL0X 3IVAA 1AF7A 3A1VA 5AVOA 3SR3A 3VOTA 2Z2XA 3X1KA 2F9FA 5JNUA 4N0PA 4MVJA 4YDHB 5DMXA 5C18A 1TXGA 1ZAYA 1Z08A 3C5VA 5CT6A 3GFBA 1Z6PA 4OHFA 1OAOA 2PV0A 1UDAA 4HAIA 3X1JA 4A8JB 3WLFA 1JR6A 4BPBA 1VRCA 1N7GA 3C6ZA 4IX9A 3PHJA 3UHJA 4F1KA 4AZWA 2P1RA 3FOEC 5KU7A 3WRYA 3A70A 3P19A 1SKMA 1JU9A 1TGVA 4M22A 4RTJA 1NQOA 4KFUA 1OX4B 3IMKA 3BSSA 3QKWA 3BHMA 3M6XA 4KMSA 1V11B 1PFGA 1BQEA 1Z6XA 1SB8A 3GFGA 3NOOA 3EGOA 3OPXA 3QMMA 4I14A 4LDZA 4LIPD 5IVPA 5BUQA 4GZMA 3BQ9A 4NZNA 2DBZA 2VTVA 4UUMA 5ALMA 5TMEA 4YV1A 1G20E 1KQFA 4RAQA 3KPVA 1Y1QA 4DIDA 4RD6A 4ZI7F 3VSBA 2W2OA 4BX8A