3ILXA

Crystal structure of first orf in transposon isc1904 from sulfolobus solfataricus p2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
140
Chain Sequence
b'AKVILYARVSSNTKDDLANQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVITAYPDRLVRFGFEILEEVCKAHNCEIVVLNQEDKTPEEELVEDLATILVSFSGKLHGMRSQKYEKVKKCAEELKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords First ORF in transposon ISC1904
publication title Crystal structure of First ORF in transposon ISC1904 from Sulfolobus solfataricus P2
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 49
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilxA01
3ILXA 3G13A 1GDTA 2GM5A 2RSLA 3PKZA 4BQQA 5C35A 1ZR2A 5C31A 2GM4A 3BVPA 3LHKA 1GHTA 1ZR4A 1HX7A 3LHFA 2R0QC 5C32A 2MHCA 3UJ3X 3GUVA 5C34B
chains in the Genus database with same CATH superfamily
1EWTA 1IPFA 3A9WA 1GGHA 3V80A 2Z5LA 4EPRA 3IVRA 4X5OA 3FDIA 2EZUA 3RC1A 2UYYA 5EQJB 4L72A 4QJBA 1OVMA 2HJSA 2X7HA 3QX9A 3M89A 3QU5A 5KI6A 4C4SA 2OGZA 2BFFB 4BGUA 2IX3A 3QHQA 1F4VA 4CUKA 1HMPA 2HA5A 2XMDA 4I1SA 1M1UA 3P9IA 5AKHA 4CUJA 3TF5A 3SF0A 1ADJA 2FMTA 3EF3A 5AKGA 2R8XA 1GHTA 3BEOA 4XJSA 3JQ7A 1EP9A 4W63A 5HIMA 3MD0A 4ZV7A 4DZZA 2EP7A 1D9XA 2C5SA 3F4KA 3OCJA 4K81B 2CL5A 3PITA 2WNIA 5DPMA 1I6MA 3IIMA 3UC5A 1ZY2A 2EZ4A 3CCFA 2NPFA 5CFRA 4AS1A 1ULTA 4GX0A 3KYBA 4KQJA 4XIFA 5EVJA 3RJTA 4HOYA 3RKSA 1TO2E 4ZGWA 1DX4A 2ATVA 2Q5IA 2C3OA 3H05A 1G1AA 4UM7A 1W1WA 5BSMA 1XCGB 2BDTA 1LS6A 4FCCA 4H6VA 3A0RB 4M1OA 2A14A 5CK4A 4FGWA 7YASA 3IRVA 4R1PA 5HMMA 5DBOA 4MQLA 5HF9A 1RM0A 3FMIA 1KP3A 2PA0A 4NNPA 4J0QA 2G82A 4JOSA 3VR5A 1J2JA 7REQA 4DCSA 3IAM1 3AJ9A 1UZMA 2Y3IA 1O3YA 1OC4A 4FT2A 4UE2A 5ICCA 2AYYA 4J1TA 1KQNA 4RL4A 2Q7XA 5J43A 2WVHA 1YOVA 4GKBA 5B6PA 1BWSA 1N57A 3M5WA 1TO6A 2HYIC 1FXUA 4MAFA 1ORRA 1UMBB 5EJ7A 2FMHA 3QQ5A 2YXNA 2ZWPA 5ISMA 1TTPB 1ZK3A 4GDMA 4O2LA 4XA8A 5DRTA 1MD9A 1W96A 1JKFA 3MM4A 3T38A 3NRJA 3TLCA 3V2UA 2X5KO 3CSDA 4DAOA 4RSHA 4POAA 2QEQA 4DVJA 4KBFA 5D7BA 2PO5A 4EELA 4Z4HA 3CZ9A 1T0IA 2ZRHA 3EJ6A 1GUDA 3FYSA 2A9PA 2CXQA 2NU8B 1T2UA 4EHFA 4CIXA 4KFSA 3DEIA 7GPBA 4UAGA 1M6VB 3KJQA 4B9EA 3F6RA 2FPIB 3DZGA 3H1GA 3L0PA 3X44A 5IEBA 4EG7A 5LKRA 3MOSA 2VDWA 3Q6NA 4L8VA 2G9QA 1W5BA 4LJYA 3X2FA 3PEEA 1NVXQ 2X0JA 3DVQX 3MIZA 3MRVA 3O2NA 4OXRA 1YI1A 2JRLA 3EGVA 5DTIA 4RJLA 5ALYA 1DC5A 2OB1A 2NUTB 3RVJA 3SJBA 1U4NA 4E2FA 4YMIA 3E2PA 5F4BA 1T6YA 1NP7A 1N36B 2FAXA 3ZDFA 3HKCB 4JZKA 1W34A 3GU3A 3JWPA 3V8NA 4D81A 2IXFA 2HUNA 2VSXA 8MHTA 1S1MA 4R2WA 1IQ0A 1E0JA 1Z5OA 2GX6A 1MNQA 2NSDA 4ASUD 4PN7A 1ZNZA 2ZI3A 5LQSA 2FEXA 3I5UA 4DC9A 1BX1A 3B3FA 1RM5A 2P9ZA 4D3FA 4XFKA 3DVLA 3EDMA 4W5OA 3DLBA 2AZXA 1YZ3A 1O96A 1IOWA 1BWQA 1LBQA 1MMFB 2BM0A 2FF7A 4ME6A 2BGUA 3LRXA 1KZ4A 4ND5A 5AP9A 1ISHA 2PJZA 3NYRA 1A27A 4OHPA 5B2ZA 4MW9A 1VG8A 1BRMA 2FSVA 4PAGA 3N8KA 2VYVD 1LDBA 3G9TA 3VO8A 4ZYWA 1PYGA 3T94A 3X1ZA 2ENWA 5E6SA 4DSAA 3B6KA 3A4IA 4PYMA 4NYMR 4BFSA 3ZWQA 3WIVA 3UW3A 1RDFA 2D13A 1X3SA 3I61A 1FX1A 1TK2A 3IUMA 2D1FA 3VNUA 3BXZA 4EA8A 3F47A 4IEFB 1L5HA 2H4JA 4J0KA 4TPKA 2HDWA 3QG5A 2K4MA 2ZJOA 4TXNA 1TT5A 4NENB 2WJYA 3SYKA 4BQOA 5HIKA 2IHZA 3C4JA 2EFEB 4WHMA 1WL8A 1M2HA 3RKRA 4KMOA 3KT3A 4LKOA 5D84A 1U98A 5LOVA 2XXAA 4EGJA 3OLVA 1SC4A 3KR1A 4EYSA 4JT8A 4R2HA 1Z0JA 1Z88A 1PDWA 3E3OA 2EKPA 2H2IA 3H9QA 2TMKA 4V0SA 1CZRA 4I50A 1YRQA 1JFFB 4X7PA 4CL3A 1VPDA 2AFHA 1Z0IA 2IBMA 3GRVA 2G25A 4MRMB 5DRYA 3TKAA 3FTFA 5BYKA 5FTKA 4UNNA 4NHOA 1HDEA 4MQFB 1MVLA 3MGKA 4OJQA 3I23A 4NATA 3IAAA 5CA1A 3K70D 3WB2A 2DQZA 4MYUA 1FTNA 1C1YA 3RW9A 2F43A 2ZM6B 4RY0A 3NDPA 3LHKA 4CMEA 3CVWA 1JG2A 2OXFA 4TRJA 2PNFA 1ES9A 2ZYSA 4TKUA 5J59A 5LXTA 2G80A 2O2DA 3QEMB 1GM5A 2VJOA 3AUAA 4H7PA 5JVDF 1NJFA 3UHFA 5D5HA 3VR4H 3ZWYA 3BMXA 4N5MA 1X7ZB 3W2IA 1ODCA 3VH4A 3TL6A 2D2IA 3FRJA 4AFNA 3C6MA 4ZARA 4D0SA 4L78A 2Q3CA 3RPEA 3VPSA 3IDSA 3OFVA 4UE3S 1IVYA 2C5EA 4HNTA 1OWPA 2P4EA 3VZBA 4DM3A 3VC1A 1BHQ1 4JMLA 1C8LA 2C82A 3HVHA 4S1WA 4HLCA 4ZCTA 3RAPR 4PHGA 2YWJA 1CIPA 1R3DA 4PNZA 3CINA 1QGUA 2FFJA 4CKWA 3C8HA 2PAAA 2AVDA 2P4SA 2NO5A 4YQYA 2ECPA 2RH8A 5TQ0A 3RADC 4AZTA 2Q5FA 3CKYA 3TXYA 1IMJA 4RD1A 1YR9A 1TIKA 4H7IA 4RDCA 1O8CA 3G1TA 2XUQA 3KELA 2DMRA 5HZMA 4C5CA 1YI8A 1JU9A 4N7JA 4A15A 2QJRA 2QVYX 2C88A 2Q27A 1EPUA 1W75A 4ND2A 4PQFA 3HDTA 3PC8C 4OHBA 4UHKA 5EUBA 2Y0PA 5ELMA 2ZRQA 3BHJA 4KE9A 2ODBA 2X1MA 4H31A 5H3CA 1GDDA 1HKUA 3U48A 1I7SB 4JLUA 1OGYA 3Q7PA 4I1OA 2YJ6A 5MFZA 3WL6A 3DDOA 1PFWA 2GAJA 4BO8A 1RJWA 2EIXA 1CK4A 3BMOB 4IZIA 3FVTA 4TVBA 5GJWC 3ZGLA 1OZFA 2WHPA 3W2TA 4B8YA 4WNCA 1OI3A 3AR9A 1QB8A 4WOBA 3TTUA 3HEMA 5L3RA 2ZWMA 1QFMA 1EK0A 1X1BA 1DXQA 5CFOA 3QEBZ 5B55A 1FXWA 3GX1A 4ZMSA 1A4XA 1P4RA 1Z74A 3MNFA 5FO0A 5EP4A 1BU5A 1GPLA 1PNTA 3QU4A 2OP0A 4E5KA 1UODA 2J0EA 2YV1A 3E9DA 1VRVA 4EY5A 2XEXA 3QUQA 4GOLD 1HWYA 4HTFA 1QQ7A 1Z68A 2HCBA 2QT0A 2AB0A 3BZBA 1OBCA 3NFYA 3SPXA 1QVAA 4ZVNA 4QVKA 3ASVA 3B52X 9LDBA 1RFGE 2VJAA 4C08A 3COSA 4EMBA 4RVDA 2C94A 2D7DA 2BFEB 1Y8AA 2WAAA 4WZBE 5KZMB 2B8TA 1B8OA 1L3BA 4WNYA 2DFLA 3F8SA 3I1IA 1AK2A 4JEHA 1LVUA 1E1RD 1TIBA 2FA9A 1S9HA 3OUZA 4ZREA 2DFTA 2PKQO 5EE1A 3E5RA 5KYGA 3IUYA 2XZOA 2CNLA 1DEXA 3KSAC 5FNVA 1OOEA 2QS9A 3A28A 4O0MA 3W34A 2SCUB 1OH5A 1TVKB 4Y2QA 2PL9A 3BSYA 5LPNA 3B7GA 1Z4IA 4O2AB 1WXEA 1EVEA 3PTLA 1AKMA 4OJMX 1CJBA 2P5SA 4K26A 3ZU5A 2WEKA 4DWVA 1GZ3A 1O94D 4MR7A 4AN0A 5CG2A 1TC1A 2YICA 1QH1A 3I8SA 2WYOA 5LBTA 3HHEA 1HGXA 3HPRA 3W6ZA 3WNVA 2HR1A 4BEJA 4P4SA 1N6PA 1JS1X 3SMVA 5CBPA 3EZ7A 2GBLA 2BISA 1HLGA 2QZJA 2RHBA 5DYNA 5DYIA 2B6HA 3BH0A 4QDUA 4YJKA 3QTBA 3WDKA 2YWXA 3JQCA 2FZEA 3MMZA 4WFJA 3KYCA 2OM6A 2VQDA 4ZO6A 3IXQA 4C2TA 3H42B 4NCBA 3V7UA 2G7ZA 3D7SA 1DAHA 3OQIA 2OCKA 4RJIA 5DTRA 5AUQA 2WQ6A 2JJ2D 5KB3A 5LBUA 2P2LA 3SXUA 3HN6A 3QXCA 1AC5A 4NDNE 1QRTA 3PHGA 2OZKA 1QPGA 4BJ3A 2CHEA 3BE5A 4TM8A 1W7AA 2VEOA 1R64A 4BQFA 1V3VA 4M9RA 1NE7A 3G2LA 1N6OA 1UQRA 2WSSA 2A9OA 4FE3A 1M1NA 1Y4ZA 2FY8A 3ZE9A 1JQLB 4FD3A 4WA8A 1VHJA 2G09A 5MN6A 1O5TA 4GGPA 2B30A 3RVNA 5DX8A 4WNAA 1XRSB 4GQIA 2IYFA 3EGXA 4ZYTA 2Y1DA 3PQFA 3SC3A 1PR0A 3DNMA 2QBYA 3L7BA 4BX0A 5M7EA 1ICEA 3ZE2B 5KSZA 5FWYB 3TZQA 2WG2A 4HZIA 4DCTA 1G9XA 3GFSA 2XLCA 4R8VA 3Q8KA 2OAP1 2OCIA 3BWYA 3CE6A 3BIXA 2CDAA 1EBBA 4IRXA 4M55A 3HN2A 3R75A 5U4XA 1U9IA 2PYZA 2PNJA 3C45A 1PL7A 4AWAA 2J1LA 4MS3A 4EB6A 3AFGA 4FFPA 2V8BA 3HJGA 3LA6A 3CRVA 3U39A 3L6CA 4OAOA 2GD6A 5BXQC 2ABWA 3ZQJA 1VSQA 3VR3D 4HDMB 1BYIA 1T9HA 2CEKA 1N2IA 4JL5A 4JI8B 2J9ZB 3A6PC 3GBSA 2HEIA 3BDAA 3TLGB 3PL1A 3PR1A 3GAAA 2BEUA 1CUYA 3OJOA 1VSBA 4F3NA 3CZPA 1KEVA 1DTSA 1ZQ9A 2C4MA 3EWSA 2GO7A 5AVWA 3OQOA 1VYUA 3ENNA 5FA5A 2ZDQA 3LWZA 4DAEA 3O5AA 3T34A 1JJVA 1FDTA 1ESCA 2H63A 2UZ1B 3BRCA 4I5IA 4MW1A 1EVJA 4NMHA 1YE5A 3VTAA 3SG0A 1JQDA 1CR0A 2P9GA 5DTQA 4Y2YA 2DUMA 3SSOA 3R9WA 3EW9A 4OHFA 1QV9A 1ZIXA 3MMNA 5JMPA 1JHOA 4NCHA 3RAFC 4QM6A 2CC2A 5A1TA 2HWYA 3GFBA 3QFSA 3UMYA 4KI7A 1E18A 3O4HA 1C3LA 1J07A 4BAGA 3ZK9A 2O9JA 1KYIA 3EUAA 3G8CA 5AJYA 5BN4B 2LE0A 2HREA 2YHAA 1WDLA 1IPHA 1RRMA 4QUAA 3FNIA 1Q20A 3IBGA 3TIGA 2C1ZA 2OZLA 2ZUFA 1MC4A 2PYDA 3G3EA 2ERYA 1AKYA 4PLCA 2BEVB 3D02A 3PCXA 2EEZA 4QDXA 4FW9A 3RU2A 3V46A 4KE7A 1AD2A 4AO6A 2BP7A 2R6GA 1LKZA 2F90A 3JR3A 3ZGYA 1SKYE 5ALOA 1NRWA 3D4BA 1CY7A 3JATB 4Q00A 3SXUB 1D1PA 4IL5A 3KZKA 3ZX4A 5EJEA 3HDJA 5K0SA 1DINA 3TTWA 4WBSA 3V7YA 3LHFA 2R1TA 1BE6A 1OUMA 1PS0A 2AD1A 4V39A 1V1MB 4Y1FA 1RMQA 4KK4A 5G0VA 1DDOA 4AJLA 5ITWA 2I33A 5F77A 1XU4A 3A7DA 5H7XA 4H27A 3AETA 2CYBA 2C4WA 3AV3A 1XZDA 5ENVA 4DEYA 3HY4A 2HH9A 1FNSA 2FR1A 4XPIB 3DAPA 5CVJA 2Q5QA 3E0XA 3D9QX 4L7QA 3S2YA 4TV9A 1ULSA 4XH9B 3RIMA 1CQZA 1MOQA 1X3LA 2BGJA 3QX7A 5LDDC 2DKFA 2ZZKA 3WKDA 1ILEA 2JGNA 1FSSA 1I8TA 5L6LB 1Q84A 3M4YA 3SK0A 3GEGA 2WA2A 1P2UA 5EXSA 3YASA 3AINA 4LYGA 1YQUA 4LRQA 1TQ2A 2FX2A 4LQ4A 5FWXA 2NO1A 5J5CA 2ZYAA 5AR1A 3TKLA 4E14A 4F85A 3Q0IA 2WT9A 3MAGA 3SZ3A 4P5EA 4JEIA 1FQWA 4QATA 5A4JA 5JNTA 2X19A 1YR2A 3DV0A 1W4RA 1Z5ZA 2PVCA 3DW1X 1HNNA 4MGYR 4QWMA 2VWPA 3T3PB 4DR7B 4PFKA 3OX2A 4A6EA 3DZBA 2BKXA 3AYZB 3CS3A 4KWCA 4ATNA 5C3MA 5ADWA 5K4GA 4C3UA 4PGGA 3OETA 1UP7A 2CD9A 1L1QA 3FMFA 2ZT8A 3M1YA 3I5AA 5IJZA 5K01A 3ESYA 1OX5A 4B79A 3KTAB 1U8UA 2O8BB 5BV2P 4MUFA 1H9BA 1BX0A 3M9LA 5TSDA 2A4MA 5B4TA 4ARCA 1WD5A 1BDMA 3QBEA 4TYQA 3AP3A 1O54A 3NBQA 4IFIA 1MV5A 2EIHA 1PEKE 1XRPA 2WWTA 1WPQA 2X22A 2XMCA 4BZWA 3TTTA 4B45A 1DFHA 2Z5VA 2OSBA 2YMLA 2R0QC 4DDVA 3GGPA 2IZ0A 2PUFA 3WO0A 5BW4A 1TK3A 2E49A 3CVJA 5FPPA 1QUEA 1J99A 1S2OA 1VJRA 2A0KA 2ZRIA 1N2SA 3GDOA 2WTMA 4TMKA 1SC3A 1N1DA 2JEOA 4MGHA 5FBKA 2PT9A 4HVCA 2F55A 3UQYS 2DGDA 3NDRA 1N2CB 2PZAA 3VDXA 5EC8A 2EW8A 2FDXA 1FCJA 1ELOA 3NNDA 2Z6AA 4PFQA 3IVGA 1QR6A 4ISCA 3V8RA 2P6MA 2YW9A 4TKLA 4AJJA 4N8EA 5G0UA 5C1BA 1NZJA 2VAMA 1GIAA 2DUUA 2QKYA 4KO8A 1FQJA 4GMGA 3WBFA 2B8EA 2YWCA 1F1BA 2OYCA 3WGMA 4MUMA 5E7MA 1MT0A 3RYCB 3AB3A 2VF7A 3ZCQA 1KPHA 4TLCA 2I76A 1SBHA 3D8TA 2B5OA 5TVKA 4V02A 5CAEA 1FFXA 5IP5A 2H08A 3PENA 3G0HA 3N0WA 1G3QA 1XMJA 1CUDA 4F4UA 3QKTA 1TQ8A 1LJUA 1A9TA 1T2AA 1HE2A 1WMAA 3PNMA 4LZOA 2HJ9A 3TL2A 4CLOB 3O9ZA 1JPNA 5DXFA 3WIUA 3EOBI 4C0KA 4EWLA 7ABPA 3KPWA 2PN1A 4L73A 4LDRA 4I99A 4YASA 1JQBA 2J9FA 3HHPA 5FAXA 4QYSA 4R1MA 3ROKA 5AH0A 4ALLA 3F6EX 1XAJA 3K5HA 1E7YA 2BLLA 2C2YA 3F71A 3HCCA 1NG9A 1Z4OA 1QGED 4D0LB 1GTSA 2QD5A 3IR6A 3THYA 3LJKA 3FZEA 2QJWA 1XD2B 1FW8A 2ZUEA 1IZ0A 3VZQA 4IVPA 3U1VA 3O1JC 1M7HA 2DUJA 5CVVA 1SZDA 3C3YA 3CNQS 3HJNA 5C81A 3PDJA 5B3JA 2C9CA 2ILTA 2NADA 3JD1A 1TJPB 3K70C 1XZQA 3PXAA 4L4UA 4S24A 2VDPB 4ZEXA 3SLGA 4MIYA 4O4HB 2Q4TA 2M2IA 2ZSKA 2X0IA 3A2MA 3LX5A 5FUBA 3AHJA 4FDLA 4FTWA 3VSDA 1Y0BA 3HRKA 1Z35A 4KAJA 4YWHA 1YNOA 3L8YA 4UNIA 4G5SA 1N2HA 1T6NA 2IDMA 2DR0A 2YX1A 1TTHA 4HN4B 3TAXA 2VHTA 3IXMA 4HRVA 1Z82A 2HLPA 3ROFA 2YN4A 4RGVA 5EIBC 5LDHA 3KQQA 3TQTA 5FPKA 2YJZA 2ZE7A 3PUXA 1SEPA 2AC4A 4PR0A 3TZKA 3T7RA 4IXWA 1T5IA 3HGTA 3Q7SA 1U8YA 3NCTA 4PAOA 2WFLA 5AKEA 3B2QA 3RFFA 5JHHB 3MN1A 1H4TA 4IQ0A 5SYMA 1NV8A 3N2ZB 1I94B 1ZUNB 4XGNA 1RPAA 1M8KA 1R2QA 4MVJA 4MGIR 3G5MA 1QU2A 2PE5A 2VJBA 2QQ0A 1NKVA 5KX5F 4D4JA 1V1JA 3TJZA 5EZ5A 2MWMA 1K6MA 2HJRA 4B82A 4C7OA 3LVQE 2HCTA 5BWBA 3CVYA 4JT2A 3DP7A 3GLTA 4CKBA 3WIDA 4TTRA 4UPEA 1BG6A 1UANA 5LYJA 1E9VA 1REQB 1DKOA 1KZ7B 2VNSA 4LJAA 5FL7A 2VIIA 4K9MA 4FGZA 1K8XB 5ERYA 1E79A 3ISJA 1V4NA 2P1RA 2ZSJA 4R2XA 3S55A 3SR3A 2D2XA 2VUSA 1S2LA 2GDZA 4OU5A 3DTTA 4LYHA 5IKEA 2O8CA 1S96A 1N78A 1PD1A 4Y9TA 4KRXA 4G1FA 5CURA 4BECA 1XEWY 2QVXX 3RG8A 4AM8A 3PQDA 2OE2A 4IX1A 3L7NA 3QPCA 3LUCA 4XCQA 1V2GA 2XRZA 1VYTA 3DGFC 3DBOB 3KZ1E 1KVSA 3RVRA 5B57C 3EUWA 4TVSA 3RS4A 5JYCA 1G7TA 2IZ1A 3B1KA 5LP6B 2HMVA 1QHEA 1G8JA 5E95A 3V8MA 1B3RA 2JLXA 1UDBA 1QHHA 4HADA 1X7WA 2P2SA 1A8PA 2VZ8A 1TFUA 3KP1A 3KL2A 3MWEB 4AJHA 5KNBA 4HJRA 2YWHA 3BAFA 4K6GA 5E4TA 5GZ6A 2A0FA 3IVXA 1XCOA 2XX3A 1CUIA 2NXWA 2AJTA 2FEOA 1K0UA 4QODA 1PHRA 2FZ4A 2C5FA 2N9UA 4C6TB 1W36B 4YJGA 1L7NA 4L0QA 1PJTA 4Z4FA 3S2EA 3WGOA 1H8HA 1W4LA 2WJGA 3PC4A 5BXYA 2OFFA 3D43A 5BSFA 2RHCA 3IP8A 1E2BA 2PY6A 3HU2A 1ZH2A 2H2HA 2PV7A 3MWKA 1SHKA 3O03A 1QV7A 3BXXA 4N6OA 3S2GA 5CFNA 3OE4A 4UZEA 1EFKA 2ZYRA 4CF6A 4BO7A 5L6MB 2VF8A 3D7NA 4CCSA 3HGQA 1ETHA 1Y33E 2CB0A 2QUHA 3JQAD 4PW0A 4JVOA 1CUVA 3LXXA 3W2FA 2BGWA 2WA1A 4IDAA 5LUBA 2C9YA 4OUKX 1Q2XA 4OEHA 3HYRA 3W3AA 1RT9A 1ZOIA 3LBYA 4FU0A 4KSYA 2Y99A 3BK1A 4ZWNA 1ZBQA 4FBLA 1ZOLA 4MLCA 1COWA 1DKPA 3UF0A 4D8YA 5A4MS 3TTXA 4OSOA 1XDGA 2BSAA 1GR0A 3T7DA 1T4GA 4L9SA 4HV4A 1GY8A 3H19A 2XYVA 4KDCA 4W7IA 3I4CA 2SHKA 4QYWA 1H69A 5IXYA 5JARA 1E89A 1VFPA 2IZ5A 5H1YA 5JXJA 1G5QA 3IHTA 3MGCA 4KQFA 3KIPA 5C3UA 5A6VA 1OF1A 2VR1A 3RARA 5BYAA 2BUAA 3GB9A 2EWVA 3FSRA 1JHRA 2CXUA 4G2NA 5FKJA 2W11A 5DNWA 1BDIA 4C5BA 1EDOA 1E2IA 1YRBA 4NPHA 3M4NA 5G41A 1LUAA 4MV6A 3OLWA 3CW8X 5F1KA 3HKDA 1OZHA 5EHNA 2UZ4A 1LDGA 3PFFA 4US2R 2H8GA 3SZMA 3ILYA 3LP5A 4X95A 5C7IO 5IZCC 2C8KA 2CXPA 3GVPA 3EPJA 1H2FA 4NE7A 3VI3B 3P9QA 4KQHA 3EXG2 4LHYA 4K9LA 1AX9A 4HQ6A 1E1NA 1UAGA 1XGKA 2O4UX 4MPRA 4N3AA 4ZPJA 3ZOKA 2WIJA 2OBXA 1P1RA 5KKNB 1VKOA 2PSSA 2XE7A 3M0EA 3ZZMA 3QX3A 3Q2KA 5CPBA 5DOVA 1Y4AE 4J0GA 5BUSA 3MPOA 3EUEA 3UB2A 4JXKA 4RE5A 4WXMA 3F1LA 3K0HA 3ZHVA 4JV5B 2OAEA 5J2UF 1ZW6A 4QTTB 4FOPA 1E7QA 4CQMB 3E9YA 1PK9A 4E30A 3MMSA 1F14A 1OJLA 4B6RA 5LYJF 5AFSA 3KG2A 3E9MA 2QRVA 1YHNA 4LF6B 2C31A 4B33A 1DBQA 4RZQA 2HCJB 1JHPA 4Z51A 5JY6A 1S02A 2ZSUA 2AN5A 4F71A 1KAEA 4CGYA 4CM7A 2JK0A 3GPDG 2AQKA 3A70A 1G9SA 3HEAA 3MVEA 2YFKA 4Q4HB 2V7TA 4D4HA 2MINA 1ZD1A 1A88A 2DSTA 5GTDA 1RQXA 1NULA 3VNQA 2C2XA 1CVLA 1FDSA 1P1CA 2FWBA 3HU3A 3NBMA 4IGFA 5DM2A 2KYRA 4B2YA 1QPZA 1O5OA 3KJGA 4BN4A 5TV2A 3VPDA 1WHSB 4FDTA 4GOOD 5FOQA 3FGNA 2PIAA 2X2PA 2H00A 1HDRA 4DABA 3CH6A 3EZFA 3N8GA 3TB6A 2C20A 3S7ZA 1DAMA 4INAA 2OZPA 4XJVA 1E0DA 3R3WA 4REQB 3QE9Y 4OB6A 3WJ1A 4EGCB 2BUCA 3FNBA 5KAMA 1T1EA 4DFDA 1S5PA 4IJQA 1NW5A 2IOYA 1U1FA 4UC0A 1AHHA 1UBHS 3HBJA 3M6IA 3M82A 4N4AA 1JF8A 3I6IA 2WG0A 1IUNA 4RTPA 1PW5A 1Z63A 2QMOA 4FB5A 2RGCA 3G2OA 1A9ZA 2PL3A 2WP8J 2JBHA 1V9CA 1AMNA 3OY7A 5JXWA 4YRJA 2ZJ7A 4HFRA 5FH9A 4CLHA 1WP4A 4K03A 3R3JA 5FJJA 1VPTA 4GD3Q 1A9XB 3NJRA 5LQNA 4FK8A 3T7EA 3FJOA 3L6RA 4PGAA 3FMPB 3ZJYA 3LC0A 1Q3HA 3HUUA 4FFDA 1ECJA 1CDDA 1IHDA 3MJEA 4RLFA 3I2KA 4JXXA 3RYHA 4YUVA 1Z7EA 2DPHA 3KB1A 3NOOA 3I4FA 2AEJA 4IS2A 4LJ7A 3REGA 3W6UA 2O06A 1L7PA 1P33A 2ODWA 3RFUA 3QA3E 3MTEA 3HYLA 2JLVA 4P32A 1KH1A 1D1SA 1UFKA 4OQEA 1R66A 2H2WA 1RXVA 1XT6A 4CF5A 5M2QA 4B8WA 3ESDA 2O7SA 2GAFA 5KCMA 2X1VA 2VDQB 3TFWA 2EX4A 3ND9A 1UEJA 4MAMA 3UTDA 3W8RA 5G0WA 2QD4A 3GLRA 1AZTA 1U7XA 2A1TR 3KV3O 4FQ8A 4QGGA 3Q5GA 2ZSBA 3OCXA 2X6RA 3DOHA 4ZCIA 4QGAA 4GPBA 3I1JA 4F1JA 1NNI1 4CU2A 3OIVA 1UPFA 3TEJA 5HUJA 1G5FA 2WIKA 1MT3A 3I2IA 4MWEA 4PLWA 1Z06A 1D5WA 4Q3OA 5F3DA 1GAQA 1JN0A 1CYDA 1GDHA 2GN9A 2HRQA 2I3GA 1C0KA 2R44A 3IEIA 1KFBB 3ODGA 4ZI7B 2IU6A 5K8LA 3FPLA 5I5EA 1GNRA 3QNMA 5FB3A 1F5NA 1T9GR 4EEXA 4ZTZB 1FDIA 2A2ZA 4Q9HA 3NMUF 3UUWA 4AS3A 4Q48A 3GRYA 1AQ6A 4A03A 3THXB 3BUSA 3ZNPA 1BGXT 1J9ZA 4IQGA 4P38A 4BNJA 2VXYA 4NESA 1W52X 1YZHA 4AY2A 1JSCA 1X19A 1JW9B 3DAYA 3PVSA 4P54A 4RAOA 5UKDA 3HBFA 4IYRA 2R2GA 4XCXA 3MT9A 3QEOA 2ZI5A 1KO4A 1P6QA 3DMHA 4I2NA 5KJ6A 3E5MA 3H9CA 2V7EA 4IIYA 1XTQA 5KYWB 1NIPA 4P53A 3EPHA 521PA 1L7QA 4Y6RA 1HT0A 3AW8A 3NQ41 1YZQA 4OUDA 1WDKA 2RK6A 2GJ9A 4WMLA 3FHJA 3GMIA 1E5VA 5KQLA 2ZJ1A 5F5LA 1G18A 4CLDA 4YJ2F 3WGJA 3A4MA 4MRVA 5CXQA 1CJSA 3OZCA 1QBKC 1E1LA 3LYUA 4HQLA 4YX9A 1L8AA 2A59A 4IHQA 2WM8A 4PY2A 2HL6A 3I64A 3GOQA 3KE9A 1RYFA 3M9WA 4PNEA 2OFXA 4CV2A 2Q1SA 1K88A 1D7AA 2XMSA 2ZANA 3I0MA 3QWHA 5E9AA 4H59A 4YRFA 5TNXA 1XZEA 4ER5A 3EEYA 1Q7CA 4JLKA 3ER6A 3IP5A 4Q24A 2BD0A 1JTVA 2GK3A 4J2OA 5EMKA 2I03A 3KFLA 2YOGA 3GQBA 4FZJA 3CRZA 5C52B 1WAMA 1PJLA 4JB0A 2GF9A 4RZUA 1E8DA 5JALA 4S1TA 1YR6A 1YGYA 3RVLA 5L3SB 3NIWA 1MQ8B 2GCIA 2QD1A 2PSDA 4QU9A 1UJMA 3VTFA 4I1PA 1LPSA 3LO8A 1ZGHA 4IIEA 1JSLA 4URFA 4KPFC 1TRHA 3TDNA 5FI0B 3G0GA 4CW7A 1LPNA 1EBUA 1DRVA 1JX6A 3SEFA 4BMOB 4C0AC 2Q4RA 2H1CA 4A1OA 2V3VA 3I2HA 2DPMA 1EXDA 3GGJA 4EPTA 3BQ9A 3G2MA 4DLXA 1LSUA 2LCFA 4IDBA 2Q2NA 2RDMA 2YHUA 4UHHA 4R9VA 5TEVA 4BN5A 3MW8A 3F78A 1JEYB 5A62A 1X15A 2XV1A 4BCDA 3LECA 3OKPA 1W4CA 3L46A 2BE7A 4X20A 3ETDA 5DLYA 1CUJA 1YJAA 4MLZA 3U16A 3B1VA 3D3QA 3JSXA 1ENYA 3N07A 3OPYA 5JS2A 3DEYX 2JFHA 1H3FA 3C39A 3DWIA 3ZHOA 5I8PA 2MYPA 3Q11A 2NMVA 1YVUA 2B78A 1KOFA 3DKKA 3ZOZA 1J0AA 4AP6A 4IJUA 1M2WA 3WICA 3D2BA 5K0JA 1BH6A 1DDIA 5ALHA 2PVSA 2JFQA 4EY8A 1BXZA 1ZNYA 3OT5A 2MMCA 1F0YA 5L3ZA 1JFVA 1RJFA 2UYOA 4TTTS 3P4YA 3DLTA 2VATA 2VDMB 4X9XA 4BNUA 2Y0CA 4Z7OB 3L8HA 4ZYZA 3COZA 5AD1A 5AWFC 1XDSA 4QOJA 2QQ5A 3QVVA 4PVDA 1A2BA 5I3CA 3ITDA 2C8VA 3RVKA 5JPIA 4TROA 4JI5B 1M5RA 2E48A 3QJYA 1SVIA 2XRFA 4B7XA 1KI6B 1ND5A 1U8ZA 1OX4A 1G17A 2XKJE 2IYYA 3AM4A 2E6UX 2ZS7A 4HXYA 1N9GA 3MD9A 4L3OA 3I6MA 1P4GA 5CA0B 5JZBA 1GAXA 3CZMA 1AKWA 4B3RB 3DE7X 3QMVA 2NSYA 2CMGA 4RPIA 3FDZB 1SBIA 3LUKA 4OLJA 4LGYA 1F51E 1ONBA 4YFYA 4YMWA 3PGKA 1GGJA 2JLQA 4HYQA 4WXEA 3OIDA 4QBIA 5CVDA 5LA6B 2FDRA 4YMTA 2W48A 5JZMA 2Y92A 3MRSA 3A9UA 1T8PA 1GPJA 2EJCA 3H5RA 5IJXA 1H8EA 1AGYA 3MJ4A 2H57A 4DIDA 1P81A 1YC2A 4Y0NA 3P4XA 1W4ZA 3GT4A 1KTIA 3JD2A 4RGQA 4N8SA 3ZTYA 5LP1A 5H3LA 1N7GA 3F7NA 1BAPA 4M88A 3DH0A 1JB9A 3S70A 4KMSA 1IHUA 4QXPA 2GN4A 5JS7A 1MZVA 2GILA 3FI9A 3MG9A 2VXBA 3LF1A 4EKDA 1AQNA 5KVAA 2JGRA 1E9CA 2KSQA 3VR4A 2X6QA 5LDGA 3RK4A 2PBLA 2C9BA 1KO1A 3LZ6A 2IS4A 2OG1A 3TJMA 3RS5A 5LIPA 4R40A 3W9YA 5F51A 3WK7A 2C7OA 3BIOA 4XZ3A 2HT1A 3LUBA 1M2OA 3IPXA 4KVGA 4P80A 5J2TF 2XLBA 2QTGA 4GBJA 4K40A 3W06A 4AJEA 4AMGA 1NLFA 1MENA 1O9BA 3BGVA 4MICA 3C97A 3PG5A 4KN9S 4PF1A 4ALMA 1MDBA 5K0CA 2H18A 1JQKA 3NGXA 3SN6A 3CX8A 2AJDA 4YMHA 4RTNA 3SX0A 2A3RA 1MC1A 1UXHA 1XL0A 3GJXC 2C97A 3NHFA 2VWGA 2FWNA 3LT5A 3TW0A 4DBZA 2Z3WA 3WNCA 4EB3A 4ZCPA 2AQIA 2MJLA 4QJ5A 1AS2A 4ND8A 3NWBA 3K0SA 1COZA 3WNZA 1P1JA 1RAIA 1ZUIA 3HP4A 5EWMB 3JAWB 2BEWA 2JKVA 3MAJA 3CNBA 5IVIA 4DTCA 1G21B 6NULA 1B8PA 4PNHA 4REOA 4PQEA 5KWJA 3AVXA 1XJ5A 3BE4A 1W93A 2VPWA 3WBBA 1QH0A 2G9NA 1TQ4A 2B61A 1QYXA 1CSEE 3HLKA 4U00A 4QSHA 4AZVA 1OXUA 3PHHA 4UMDA 3S3TA 4YHHB 4QULA 2PFSA 5A06A 5FUMA 1YUMA 3GG9A 3RAJA 3EXAA 3T8YA 1OWOA 2HJVA 3UGQA 5KWIA 1XMVA 2AJBA 2OOKA 3K09A 1Q6YA 4R41A 5E6UB 2I8LA 2CUKA 2Q07A 4ZT4A 1O0BA 3R3HA 4P2GA 4ENWA 4MRRA 4XWTA 4FN5A 1O8BA 4MW2A 3NKFA 3SLRA 3GELA 1FPQA 2IPLA 3PHLA 3MT7A 3PX3A 5IU6A 4OSEA 1F2UA 1Q0ZA 1H2YA 1FMFA 4N6NA 4CV0A 1E6UA 3VH1A 1XG5A 4K86A 5DNDA 3V1KA 1I5RA 3WQBA 5A9SB 3NHJA 2V1UA 1FU7A 3PUWA 3FVVA 5K3BA 3RV3A 4C78A 1LRJA 1A95A 2F2TA 2W4MA 1R0LA 3BKWA 2RHDA 3L49A 4L2IB 1APBA 5TPZD 3QELB 4YMUA 1GZ6A 1J2RA 4NH4A 1R9NA 4ZJUA 2OCAA 3GV0A 3B6MA 3QEAZ 1U0LA 3AVQA 1TUGA 4GU5A 2ZPUA 4E2YA 4QYIA 3U4DA 3VU0A 2J6IA 4F6RA 2PZGA 4GR4A 4G25A 4D41A 4E03A 1Q44A 5KOYA 4IDGA 1WCIB 3N2KB 4X61A 1KDVA 3SAJA 5KTRA 3WWEA 1EFVA 5AJHA 3DHVA 3TR6A 4JJ8A 4GE0A 4RLSA 2WDPA 1FFBA 3N2GA 3PGMA 1XQWA 4FINA 3F96A 4OB8A 1ECFA 3RVDA 5FLYA 3N39C 1N0UA 1CV2A 2JCSA 4RTLA 1TMKA 1YS1X 4Y2GA 4YRSA 3LC7O 4OXIA 3NOXA 5DCUA 5JHGB 1H0KA 5IKMA 3CBQA 4LV5B 1WXXA 2BRUC 1K6JA 1XX6A 2YYSA 2OBLA 2CHQA 3I6ZA 3IKJA 3UC9A 4EFDA 5DNCA 2V74B 4HWGA 5GVRA 4HC4A 4PRKA 2QV7A 4TZKA 3T9EA 1P6UA 2Z9CA 5A4FS 3GLGA 3QMMA 3HY6A 2J9YB 3LVFO 2FN9A 2XW6A 2QTBA 1E7MA 2NT3A 4LFAB 1FVXA 2GZHA 4TMWA 3E35A 4EVRA 1V96A 1BVYF 3NBFA 4M1YA 3RLFA 3DTVA 3L0OA 1CF4A 4XQ0A 4FIDA 3Q4GA 1JSXA 4BO2A 3CH4B 5I9MA 4BQPA 3OEYA 1CYEA 5JXHA 3DBRB 1ZESA 3GDFA 2E1RA 3I52A 4OVKA 1B6TA 1J6UA 1DI0A 5A02A 2B4AA 5K4AA 3SU8A 2RMKA 5I48A 2P67A 5K3SA 3TFQA 5JSHA 1P80A 1VOTA 4YLGA 2I65A 3PGLA 5IHXA 1PTJC 2UZ3A 3RRFA 4YT2A 5E4JA 3C6YA 4A9AA 1PJ4A 1EHYA 1JVSA 2B5WA 4OJKA 4QO7A 5LLTA 2OY0A 3L4EA 1SCIA 4FSDA 1CQJB 1IB6A 2QYHA 1VL8A 2XH8A 3A1NA 5A3SA 3G88A 4DMGA 4GRIA 2PLAA 3ULKA 3K2EA 5AI0A 2D5IA 2JI6A 2YRFA 3VO9A 4CU5A 1IZ9A 5A2QA 1CEQA 3UJHA 2Y68A 1EB9A 2PJUA 1Q0SA 3AL3A 4QXAA 4YXWD 3G13A 1UEIA 4HB4A 1D07A 2DHCA 4PYOA 2H7YA 2GDJA 3GRCA 1VB3A 4LCJA 3R7BA 2ORWA 4DS3A 1E8MA 2VTBB 3PSAA 4O3FA 2P35A 4ZAYA 2OUIA 5BW5A 1OBOA 2PKWA 2CVQA 1LPBB 1I36A 4R8KA 1DV1A 5C5IA 3ZE6A 3WRYA 3G2NA 4E51A 1TYEB 4L27A 5AM5A 4EI7A 2JJ8A 4TMZA 1L5YA 2H4FA 3EXFA 1LBSA 1RYNA 3KV1A 4H4DA 1M6HA 4A16A 5LQCA 3FNFA 1U2QA 3CBGA 5JQGA 2PRSA 2DKOA 3JTEA 2WYUA 3NC0C 4I4NA 4OQZA 4PCVA 4BKOA 5LQJA 1Y1PA 1OPRA 2GLTA 2XUIA 4PFJA 2GSWA 3SP1A 3TLEA 2IYOA 3IO5A 1JI3A 2BGIA 3W79A 5IHPA 3G8DA 4DCUA 4EHDA 4QDKA 2J5QA 4KFTA 4LZPA 2GETA 1TK9A 2QV0A 2WWXA 1FLVA 4HSGA 1KYXA 1SBTA 3TAHA 1Z17A 3KQWA 4ENTA 2OLJA 2PZJA 3MINA 3UFXB 1FFSA 3IP1A 3HZZA 4O4LF 3VR2A 4O2BA 2ODPA 1XVIA 1SQ6A 4NK4A 1X7XA 2FUKA 5JVDB 3C1TA 4PX5A 4JBIA 4CM9A 5EP2A 1J0BA 1ORWA 1W94A 3O1HB 3DZHA 2GVDC 3ETGA 2V45A 1H9CA 2NYRA 1OR8A 2GRJA 1Z73A 2Z83A 3FWHA 3M6MD 2IHTA 5JS1A 5C8DA 3O4FA 1R9GA 3ZPXA 3O82A 1KMQA 2YXEA 5H9VA 2P9HA 3I2YX 1NMEA 5FBRB 3GPLA 4NCIA 4M8SA 4LUCA 2JL1A 3O4RA 5HVNA 1VMDA 4V0RA 3ITNA 2ZDGA 1VB5A 1NBME 1QTRA 2AHRA 1LW7A 1EI9A 3F9CA 1ILWA 3GLHB 3ONFA 2PBFA 3L93A 4KFUA 1VRCA 1JEEA 3CSSA 2GCEA 3KQOA 5AQEA 3H1BA 3K8OE 4L15A 1ONOA 3EVAA 3K5PA 1SIBE 3AW9A 5F7XA 3VV3A 4EJSB 5A6SA 5AVRA 5JD5A 1KMNA 4MYCA 4L8FA 1JRLA 4MUGA 1M10A 1W46A 1ZK1A 1U8EA 3MWGA 4HB2A 5GGXA 3W5JA 2AN1A 3H2KA 5A7FA 4IMIB 5B3KA 1U7TA 4PM4A 3KJNA 5IAKA 3P2MA 4EPWA 4AMZA 2DCUA 5D6NA 3CVOA 4OBWA 3S99A 2OGWA 2Y1FA 3GRRA 2Y0EA 5AK4A 3H4IA 1MX9A 4MJXA 2MU1A 3KUCA 4D45A 5AICA 3AKDA 3A9RA 1G41A 2A67A 4WCFC 1MB0A 3FFTA 2VCHA 4J76A 4MS4A 1E3IA 5HWSA 1RE0A 1JR3E 1Q12A 3JRWA 2YW2A 4M21A 4WK6A 1VL1A 4MQ5A 4J3NA 3VISA 4BHTA 2ZJFA 3GWZA 2AEMA 4F4HA 2GJ4A 3HKBB 2FSPA 3RQSA 3U7FB 4QQKA 3U6BA 1VCNA 3WY9A 2LUOA 5F78A 3ICQB 4RZ3A 2O5RA 4CVNA 4RY2A 3EXIB 5CX1A 1M75A 4F5YA 1R4MA 2AHOA 3UCEA 3KR2A 5CDFE 2R8OA 3DO8A 1MO6A 1J2EA 2E89A 3GI1A 1ESEA 1LD3A 2PRIA 1QC5A 4PC6A 3O3NB 3UV6A 4DA0A 5IBQA 5FWAA 4LTNA 4YECA 4MKIA 4PO9A 1T1SA 3FMVA 1Y81A 3CXUA 5IJ0B 1U90A 3RD5A 3CWQA 1J1UA 1K5GA 1S1CA 3LAWA 3W6NA 1RPJA 3B3QA 4RFLA 4BNDA 4J91A 1PGPA 3S0JA 1NMQA 2YBEA 5JCXA 3V1TC 2J0QA 3QKSB 1Z8DA 1QYVA 3H5AA 3ZWNA 2NTYC 4PINA 4N5DA 2V3CC 1JKJB 4KODA 3VHXA 2J3MA 4L8YA 1XRQA 5ESXA 1QF6A 3Q3IA 1TA4A 2VAVA 3VO1A 4CMIB 4EFNA 2YRXA 1V7QA 3DFUA 3M8KA 1QQ6A 3OCWA 4LNUB 4Z9FA 1EESA 4TS9A 5J1TB 1M5TA 1OXBB 3UMRA 2Q6KA 3GJ8A 3K20A 3QTTA 4BNIA 5IT0A 2B20A 1FS4A 2AFHB 2P27A 2XNKA 4DLZA 2AZTA 2XVMA 4WFQA 1JE0A 1J9GA 3OIGA 1NU8A 2Q3MA 3JQGA 1JE1A 1MOPA 5FA6A 3SHVA 2G5CA 2R6ZA 3OSZA 2FHPA 3WLFA 1IIRA 8ADHA 4GG1A 1IM5A 3L7IA 2ZM5A 4PSUA 1TCAA 3BCRA 3AF0A 3L8ZA 2FFAA 4MMXB 2H6EA 5C7LO 3WJ2A 2NO0A 3E9CA 1OLUB 4JBNA 1NMXA 1YCGA 3D4IA 8ATCA 1MW8X 3G89A 1RRPA 2YN0A 4JS0A 4FC6A 5H5JA 3SIRA 1P2VA 4IO0A 1CUBA 3I32A 4ZQHA 4B7UA 3V2IA 5LSAA 4CEIB 3UM9A 4JI3B 1QKKA 5AW7A 1MO2A 2XWJI 4LY6A 1GARA 3I2FA 1TYBE 3KJXA 2D7JA 3E9ZA 3JPYA 3LV8A 2E6KA 1VM6A 3IOCA 4IO1A 2W98A 4OU4A 4P9NA 2X8JB 4A8JC 4DGQA 4G4JA 1SD5A 4X00A 1J2UA 2M32A 2XB6A 2FQ1A 3HJBA 1DAGA 1CUXA 2VSNA 5CX4A 1V16B 3NBUA 1KYQA 4MDYA 3P1JA 2PD3A 2NX2A 2R6JA 2X4LA 5H4HA 3MB8A 4OHRA 4M3NA 5DSXA 3X43A 1ZWLA 1NN1A 2W6ZA 4HNUA 1Z5WA 2WABA 3MTQA 2NZUG 3C3WA 2A8YA 1K5PA 1X80B 5F21A 5ENZA 1SK9A 2X4DA 1X92A 2C9ZA 2NXNA 5C32A 3TUIC 4CEHB 4Y18A 2Q5CA 1U28A 1JA0A 4RV4A 4G24A 3WP1B 1JLHA 1RLJA 1L5ZA 2G06A 4ARIA 4YQZA 4G8CA 1D4FA 2YMQA 5JECA 2BMAA 3ORRA 4KN5A 4R0VA 4Y7CA 4RMIA 2C7QA 1X74A 1T5LA 4RTMA 1Q1NA 3M4ZA 1OWMA 3IR5A 2NTNA 4HEA1 4WRRA 4D74A 5I47A 2A4KA 3N8IA 2UDPA 1U8AA 5JSZB 3G1WA 1U99A 3TZLA 1QK5A 1WG8A 3CUSA 4JASB 1P3JA 3ZQKA 5FX2A 2EV9A 3GBPA 4BS9A 3OTQA 1T6BY 3B7PA 5DF1A 5DLPA 3HXKA 1W73A 1O6CA 1RWWA 4G1VA 3QY0A 3EOZA 1B74A 1MJHA 2I7DA 4M0UA 3SQWA 3B3AA 3BCSA 3WFZA 1R8QA 4NU5A 4TYMA 3EMKA 1HZJA 1O89A 1UXIA 4Q66C 4RHYA 1AK1A 4UKDA 3PC8A 4KO3S 2WJJA 3GGSA 3RAEC 2P6RA 4PZUA 5BWMA 2GVNA 4BRWA 3THOA 1GOTA 4Q4AA 3LZCA 3DAHA 2BKUA 4YAKA 1CWUA 4FYVA 4OFXA 3QU9A 8AT1A 2WSLA 3WX0A 3E3NA 1SUCA 3AR7A 4YYEA 3EPRA 5EXEA 1CLUA 1HT2E 2BBOA 3JAKA 4JYMA 1PL6A 1XD8A 1PT5A 1AM4D 1M0TA 1P4AA 4PSCA 3UTCA 1NX9A 4QEKA 3JZIA 3MTBA 2YWFA 4ML3A 5D3QA 4ZHQF 1D2MA 2ZWOA 3GJQA 3IOYA 4U2FA 1YS9A 2QN2A 1BHO1 3BL8A 2PCJA 3DXYA 2BGTA 2OLKA 2VAPA 4YH1A 1Y89A 1TZKA 1E3SA 1NC1A 2RCNA 1GGMA 2VTDA 2XXJA 3QK7A 3TAUA 1WULS 5CD9A 4TS4A 1BS9A 4MVJG 1Y1RA 4WK4B 4CZ2A 1C9MA 4OHOA 3GLIA 3AY7A 4NIMA 4HAVA 2YKGA 2OK8A 2AD5A 2VT3A 2W58A 3SGLA 2VYND 4O25A 1FFWA 2NVWA 2P41A 3AG5A 4P86A 5TPWA 3PQ4A 3WGQA 4DJJA 2GKOA 3KSRA 4PZEA 1DE0A 3CLKA 1J97A 3LHDA 1J0CA 4K6CA 3DZKA 3JWEA 3G0CA 3RC3A 2AE2A 4DADA 1A98A 2Y77A 2WI8A 3CT6A 4O6VA 4EYEA 3E23A 3MJVA 3WWOA 4N01A 3QHAA 1U0FA 3PUVA 2XTJA 4RQTA 2IXBA 1IZ8A 1N9KA 4OHXA 3WBJA 3BCUA 4Q16A 1JDUA 4XLZA 1J7JA 3TTVA 1UC9A 3BJIC 3DB2A 4XVUA 4K6HA 2X7JA 5ITVA 3JR7A 2AF4C 2XUPA 4LZJA 1ZLYA 3OQIB 2CNWA 2MSLA 4N3BA 3WMRA 5BWCA 1UBFA 4CIWA 1KKMA 1WVGA 4YCLA 1P77A 1UWLA 1M8GA 3KZCA 3BWDD 1LC3A 1PDVA 4G0YA 4HDCA 3INYA 3M70A 2PXCA 1C7FA 4M7PA 1KI9A 2GVZC 2XSZD 4KUHA 5AKJA 4A2PA 5I7OA 1JDPA 1D2GA 4KQXA 5ABPA 3F73A 1A0OA 1KO5A 4LBZA 3T1VA 1NR7A 3OOHA 1VKNA 1JECA 2FRXA 1E9RA 1MUUA 1ZJYA 3PPYA 3CNLA 2IH2A 1BQ4A 2COKA 4WERA 4QRDA 4OPMA 4BNXA 4PQGA 3TLMA 3WXMA 3MCWA 2GZRA 4ZCQA 4DUGD 1NFFA 2QF7A 4MGZR 5JW6A 2O6LA 1NLZA 1IN8A 2G36A 1GQSA 3ZHRA 2HFJA 2JAXA 3HE3A 2Z8XA 3K16A 3V7FA 1UFRA 1WY5A 4G8DA 2I22A 4HLUA 4D9HA 4RD2A 1TFRA 1E63A 4PICA 3BSWA 3C43A 2RGNA 2X15A 4P7FA 5AKYA 2ZQZA 1GRVA 3RVOA 3WLLA 4HX5A 3OTOB 4LDNA 4IGEA 2EFDB 2IITA 4NFLA 4A8TA 4IAOA 2CL6X 4MITA 3OHMA 4E33A 3OU2A 3V34A 4ENVA 2RHOA 1Q1BA 2ZWVA 3LKDA 2W83A 1YCDA 5IDYA 1X7YB 2EHJA 2PLWA 1AKUA 2B8NA 3VU1A 2JH8A 3P0EA 5ALUA 3EGDA 1SU8A 5KYXA 1I10A 4KG7A 3TPFA 1A7AA 4FYKA 4ZT6A 4FYMA 1PLKA 1XDWA 2F8MA 4MTLA 3WVNA 4C0XA 4JEUA 4E5VA 1M5UA 1ZD5A 3AVTA 3PD1A 3D4OA 1LVGA 5HS4A 1NAHA 1CB7A 3ABOB 2CV1A 5D01A 2QYSA 3DUFB 4K9SA 2P3LA 3QVTA 4JD5A 4KXFB 4GYJA 1AUQA 2W22A 2ZE6A 3O91A 4XM1A 1QJCA 4DBLC 2XUJA 3U3DA 1R0XA 3N0RA 4BNWA 5CITA 3CMCO 4IS3A 3TQIA 4L9RA 4LCBA 2NU7B 3DE3X 1Y6JA 2F1JA 1N8SA 4K9OA 1PZMA 4RMHA 5EZYF 1VI6A 1IATA 1L4GA 1MOSA 2Z1DA 4M49A 3JRXA 4IH4A 3ZGVA 2Z98A 3W0LB 1JQEA 4OSPA 4LBWA 4BFWA 1PR9A 1E4VA 2E37A 3DKPA 3FTQA 4K3VA 3S1AB 1NBIA 1NQTA 2X2FA 3C74A 4B3CA 5ALVA 1TM4E 4P36A 3LX8A 2QENA 2HBZA 5I3ZA 4A5SA 2AKAB 4BE9A 4KQMA 5JAPA 4B3MB 1RBZA 4BV3A 4FUTA 4BNHA 3LQ1A 2QPTA 3DE4X 2HK8A 1E6WA 3KQUA 1LTKA 4LTDA 1EUDA 2W5UA 4JBYA 4N9WA 4F4FA 4MEJA 4OJYA 4KQGA 3OURA 3BRWA 4YCSA 1ATZA 3LRPA 5G4LA 4WECA 1QH9A 4U6QA 2ZJ4A 3KOUA 3NNSA 4OL0A 4Y9SA 1QGYA 1WVMA 1CZUA 1H2ZA 1V25A 1YE8A 3C5HA 3D3EA 3L5KA 4JQZA 5EUQB 5LU9A 1H1LA 4DV6B 4N65A 1XZNA 3EIOA 2FCRA 4HXEB 1OXVA 2HIGA 1UKAA 4OHYA 3FZYA 1U2DC 2AFIA 2JGDA 3VR1A 2QB5A 1KERA 2BGLA 4DEVA 1K4YA 2R1TB 4GGMX 4DM7A 3OVMA 3HXTA 1CIVA 1BMTA 3ZI7A 4UOZA 4KGZA 3ZZNA 1BJKA 1TCVA 2QUBA 4RDHA 1IIBA 2G9ZA 1WP9A 3ZUPA 1OFVA 2IW1A 4CMHA 5LD2C 1JEQB 4XOUA 1E9DA 1GZSA 3ZV5A 5DM60 3QF7A 821PA 3KD2A 1H6DA 1UBTS 1W8DA 3DC7A 2IPXA 3PFBA 1JWBB 1VE7A 5ERXA 2MYTA 2FG7C 4A1FA 3UK1A 4B7ZA 3OZVA 2XD4A 2IPOA 4ZFNA 4NHEA 5CK5A 3TPZA 4RTOA 3AR8A 1VPEA 3ZHBA 2H8KA 1V0JA 3DSRA 5FP0A 2W43A 4GNKA 3WLSA 4MH0R 4A6XA 1RKVA 3F6SA 1OLSA 5EQDA 4P0PB 3QVJA 3KPYA 4TWAA 5ADHA 3SJUA 3N2EA 3RSQA 3WIOA 1S0UA 4RWZA 1ZCBA 3R0QA 3T06B 3ND6A 3RWMB 5CH8A 2B2NA 1OWLA 4JJ6A 4LC9A 5KX5B 1GRNA 4XE5A 1B7GO 3K70B 1B6GA 1KEUA 3KSDO 4W1QA 2W00A 1XD9A 1P2DA 3GARA 1IG3A 2WY2D 4PC1A 4B5LA 2AC2A 4FJ1A 1U8CB 4LDJA 4QTXA 4EABA 4EJ2A 4U7GA 5F33A 1ID1A 3E58A 5LYYA 3WRXA 4GKJB 4JYBA 4D4MA 2CZQA 5KOJB 3F6BX 2IU4A 1N1MA 1I4WA 3PPVA 3CKKA 1ZSNA 1WCV1 2CXNA 3GJ5A 3KO8A 4C0BA 4MSUA 4AJ4A 4F3TA 4R84A 4GOKA 3DLAA 4G63A 4C7JA 1ZA1A 9ABPA 3SC4A 3QMPA 5LIRA 2FWJA 2H9IA 3D8UA 3FUXA 1G1MA 4GOND 2VSYA 3SYRA 5EXPA 5B2EA 1JWLA 3AV0B 4ZOLA 2C5HA 5HK8A 1LI4A 2DBRA 4FC7A 3RHTA 3UZUA 3ZZUA 2VT7A 4B8ZA 3COYA 3ONDA 5CU7A 4CIAA 3VPGA 4MAAA 2JKZA 4XR9A 3IAS1 3O31A 2FSFA 3H1PA 3T99A 1GZ5A 3GRPA 2Z1MA 4HWTA 4G5FA 4NPCA 3ZWBA 4B6EA 3GA7A 4CKYA 4Y2HA 5ALPA 1XJQA 2PO7A 4WEOA 5DX1A 3ZNQA 4MKHA 3RV4A 3V33A 4YMVA 3LZDA 3CA8A 3JY6A 2VTEA 4A6DA 5PNTA 3FOZA 4CXMA 3NDJA 1E92A 1MQAA 4RACA 4QELA 1QWOA 4QBFA 5EL0A 5A4DA 1XDUA 5EKXA 1AGXA 5K0ZA 3G23A 1N6HA 5CAEB 4MK4A 1N75A 3P2YA 4L5BA 5E0KB 1KR5A 4HH3C 4TV8F 5ALLA 4C7MA 4EG3A 4H7EA 2E5LB 1QCCA 4E31A 4PHHA 3RUIA 5IRCD 4D42A 1SCUB 1P4HA 1RWOA 1Z0UA 5L7TA 2CMHA 3CRRA 4RANA 1PSZA 3M6XA 2Q9AA 1CZNA 1U5BB 2B1GA 5U4QA 3THRA 2QRNA 1ZS9A 1UBGA 3EXHA 4M7RA 1T0UA 4GIBA 1BXRA 2R66A 3DQPA 3I3OA 4OYYA 1QIMA 4M22A 2PJRA 4Z0PA 5L40A 2DQYA 5LFAA 2A7QA 2G1UA 2OV1A 2ONYA 3FOWA 3P5BA 3U3OA 3N8DA 1TXGA 1C1XA 3I5MA 1QONA 4P6VF 3VGJA 4YR9A 4MJLA 1AQJA 1CW2B 2OKGA 3BREA 3N2IA 3ACDA 4Q7MB 3GVHA 3RC9A 3B1YA 3LVRE 4FLMA 3A58B 3RG2A 2GN1A 2YHSA 4IHKA 5KKCA 4FSHA 1TEZA 2IUUA 3U7QA 1IEQA 1XDDA 1XP5A 2QVZX 3KKEA 2CZGA 3IVAA 4CPDA 3LLSA 2R3SA 2Q28A 3C7TA 3NBKA 1YDGA 2UYQA 1KDTA 4W5WA 1YA4A 1NP6A 3P2IA 1RAHA 3R5HA 2Q1UA 2PL5A 1UJCA 3R3XA 4Z1MA 2BM8A 2D0IA 2YUTA 4FOLA 2KBEA 1ZM3A 4RM2A 1QYWA 4OBEA 1DX9A 3ZBPA 4C76A 4DLLA 2O54A 3C15C 2NVOA 4ZU3A 3SYLA 5DW3A 1RXWA 2F8TA 1NXQA 3QVKA 1DV2A 1WQ4A 2VS1A 4J0HA 2AQ8A 3EBLA 5GZ1A 2ZULA 4OQMA 3AERA 1Y7HA 4BV9A 2E4UA 5CW2A 1DKNA 1Z4QA 5DISB 2H54A 1L4HA 5BVHA 4UNPA 4R7TA 3SFTA 4KXXA 3PV0A 4XQGA 1WU8A 1CC1S 3H5WA 3KHUA 4CMGA 1VLLA 1NJGA 1E0KA 3UIEA 1CHNA 3SVLA 2N46A 3ZE8A 1GTRA 2QP9X 4NZMA 3VU8A 1GV1A 4UMEA 2J0UB 5TS2A 2M6KA 4AMYA 3EBPA 1XHLA 3WL7A 5J2UB 5CCXA 1NR5A 1C9KA 4YREA 2O2XA 1L8LA 1AIPA 3REQB 1IE3A 2RKBA 5T41A 4RHTA 5LYJB 1KORA 2GEUA 1DC8A 1TU3A 2OXRA 2VH5R 2YY6A 4Q01A 4KSCA 4UCQA 5AM4A 8LDHA 3OTIA 2LV8A 1D2RA 4HH4A 4QYTA 2R1VB 3SQNA 3TWOA 4MV5A 3UMSA 4DMKA 5TRTA 5C7YA 3B5JA 2WJZB 1BCSA 2X8BA 2X2EA 3E7XA 5DHFA 4EEZA 2OHOA 3QX8A 1QWSA 3EZLA 2DY1A 2UZAA 4MTCA 1BS2A 1DAIA 2LTAA 4GBMA 4TT3D 3R77A 4ZOLF 5BQ3A 2WG1A 3RFCA 1Y4DE 2NZVG 3I9MA 2PUTA 1SBNE 1K7EB 3ML1A 4WXPA 4X6UA 3H5OA 3OOSA 1YFZA 4BMCA 3PUZA 3EVDA 4TN1A 5THXA 4CLXA 3BD9A 3PDCA 1A96A 2AEFA 2W6QA 4QEDA 1KY3A 5D3KA 1OB5A 2O6HA 5J4LA 4GPEA 3URKA 3B6JA 4BQIA 1VYVA 3ZLVA 1OFUX 4IDOA 2IZ6A 1AS0A 1L4UA 3DDHA 5I8WA 1DFGA 2MSKA 2HSZA 4KX5A 2IYUA 2Z2XA 3QUTA 1FLAA 3H5IA 1E1YA 1DBRA 3EDQA 3GEPA 3OMWA 4WOKA 5SZKB 4A73A 3LY9A 1GNSA 4V1CA 1C7EA 1E32A 2COUA 2PR7A 2QRGA 3PYXA 2JA1A 3PFCA 4WKCA 1MX1A 5G53C 3SD7A 4DLTA 2AI1A 1IZ7A 3D4NA 1P44A 2W8ZA 3TLZA 3TNLA 4AULA 1TL7C 3H7IA 1TW3A 3JQFA 4L8GA 4ER3A 4W5HA 2BHRA 5DNAA 4FKBA 3PRJA 5F9HA 1NVEA 5JRZA 3IQGX 3T95A 2JGFA 4JGGA 4CHTA 2GK7A 3ZJVA 2AG0A 4HSEA 5M29A 3N28A 2FMXA 2OHXA 2IGBA 3FMGA 3ADPA 4NPAA 3R1IA 1VJCA 4LE2A 4A0FA 3IV7A 1TMGE 1N9ZA 1DBVO 3NH9A 1KQOA 1B41A 1IBSA 4LXQA 2ODNA 2VWQA 1Z6GA 4OYLA 5JCZA 1E1MA 1FA9A 4F11A 1C1DB 4R51A 4BXOA 3R23A 1MKYA 1O6BA 1ZI6A 1Y9DA 1NUAA 3OU7A 5DYGA 2XAAA 3GXOA 1P9RA 4GLFA 1VJ5A 1E1QA 2Z09A 2NUPA 3M5PA 3K6KA 2NO4A 4LW8A 1JIKA 2F3QA 3Q5EA 3SEAA 3ONWA 5LLDA 3WFJA 2ZIXA 1OAOA 5BT9A 1RLUA 1DJQA 4EAQA 2QAGC 1OW3B 1O94A 2V6MA 5MN5A 1GSHA 1AUOA 1KGDA 2BAGA 1UQUA 5AHRA 1I4LD 1SHJA 3P94A 4U2EA 4Y7DA 4ND1A 5FULA 4D99A 2IHVA 1K3UB 3SM9A 4CEJB 1HE8B 2F59A 1GEGA 4Q3AA 1ZUHA 4DWWA 2XQKA 4G0VA 1WE2A 3D7RA 4Q34A 5KTOA 1E2MA 5CB6A 1A4UA 4JI2B 2FPLA 2J6HA 2CJPA 1N0VC 2OBFA 2QL7A 4GP7A 3PE6A 4R8SA 3L6DA 4MCJA 4TRNA 1I7QB 2HI0A 4MDFA 5H4GA 2IXAA 1L0BA 4JUAA 2Z2KA 4XKJA 4E0BA 3S1SA 4Q4CA 4QUHA 1NXOA 2FZCA 3ETEA 2VBIA 1MHPA 3Q88A 4GICA 4JC8A 3RSSA 2IX9A 4DJ5X 2JJ2A 3OA0A 2W6ID 1SHLA 3DNPA 2C03A 1QG0A 2H07A 2QQGA 3L82B 1L5QA 2NVUB 3UGTA 5U9CA 4RTJA 1PFYA 1NTRA 3GNSA 3OD1A 4JKIA 2BFWA 4LE1A 4P82A 1KIMA 2QVCA 3SR0A 4B9AA 1X42A 3ZD9A 3D7KA 1U2GC 5AKXA 4D9KA 4L4SA 5KYUB 2OG2A 1J0XO 4I81A 2FWPA 3ZWMA 5IZCA 1OH8A 3JYLA 4L02A 3DNFA 3RAGA 3A3NA 5I9IA 1XV5A 1SHTX 2HDHA 1U8XX 2WHQA 5A9TA 3NAMA 4PU0A 1PKXA 4YJ2B 2QRVB 1NXVA 3RGGA 5KPJA 3B9BA 1ZJZA 3CZ4A 3PNOA 4GP9A 2Y1OA 1VLHA 3E2MA 4JJGA 1L7EA 3CB4A 4RX1A 2Q8NA 1YZUA 2GEKA 2F17A 5EE5B 3B1FA 1QAOA 3W2GA 1S8FA 2WSIA 2HV8A 3HCAA 1TLFA 1JTEA 1U1DA 1DARA 1HSOA 3GF4A 3P4UA 3P45A 1CDOA 4M9QA 4W9RA 5AVJA 3DFMA 4LEIA 5IAGA 3QUAA 3WJ7A 2J09A 4CG3A 4AURA 4QBKA 3QENA 1SUAA 4TSRA 2QTVA 3E8MA 1KQPA 2GM9A 4F2GA 3EEBA 3SDBA 3GFTA 3HEBA 5DBGA 3OX1A 2IOHA 3OTGA 3FOCA 1KAHA 4OM8A 3QU7A 5AK6A 2WT8A 2P2ZA 2FKAA 4OGFA 1KZ1A 2H31A 3LYAA 1PG2A 1CQIA 1GG2A 1Y48E 4LXUA 3OECA 1Z3CA 2VHEA 3PHBE 1VA5A 1E5DA 1T1JA 4IIUA 5BT8A 4BEWA 3L8EA 1QVRA 3TOVA 2FV8A 1EA5A 3WGYA 4M8LA 2VFAA 1SOVA 4XYLA 2C99A 3ZLJA 3SS8A 3VR3A 3D6MA 1X70A 4Q9LA 2WD7B 1E3QA 3N3BC 3B6IA 5H59A 3NT4A 2N0SA 4LWQA 3VNAA 3NDBB 1M2EA 3NBZC 4UVDA 4EMUA 2LVBA 1CJKC 4JBXA 3KDPA 2QSUA 4G0XA 4KIJA 4L5JA 4R9UC 1Y1KE 2AFHE 3C4QA 4U7HA 5EIHA 4YQEA 4D5GA 2JJQA 3I45A 1G60A 3L8DA 3WBKA 3O2JA 3QY9A 4XVRA 3ZCVA 4K9RA 5AI5A 1RZ3A 3M3PA 5AJTA 3ZHUA 4ALIA 3OMLA 4ZHSA 1RABA 4ZRDA 4I46A 2Y2VA 3RC7A 1WM1A 1DEAA 1Z2AA 3LPCA 1GO2A 1O95D 1DWUA 3JRNA 4DREA 3PEVA 3DE0X 1JNYA 1TAQA 2ICAA 4QOSA 2GN8A 4R9SA 4LHVA 1QFYA 5KBYA 1UM9A 4M0MA 4M86A 4NG4A 1I6WA 4QYXA 4U2DA 1I6LA 3WQHA 6AT1A 4WESA 2AUMA 2CD7A 3RSOA 2JAUA 2VHCA 2Z2ZA 4HAYA 2OD9A 4AKEA 3OP4A 2MSEB 1CR2A 1HFJA 4TS1A 2ZVPX 1KSHA 1TNDA 2VUIB 1XSEA 4G4SO 3STVA 4ZI2A 1OLXA 4HCJA 2Q2QA 2EVWX 4YAGA 3N87A 1UDAA 3LFUA 1ISSA 1PNVA 1ZBDA 1ZNXA 4UUNA 4N54A 4PYLA 4UPVA 1IEVA 1X6VA 1RWNA 1T8UA 3L9WA 4B6FA 5KCZA 3I9JA 2Z6QA 2PT7A 4WL0A 1BN6A 3CR8A 1V6AA 3I04A 3ZDEA 1EDZA 4EG5A 3E7DA 3KTDA 4CF4A 1AA6A 4BFCA 3A9CA 2GBPA 3OM9A 5AJWA 1PS9A 3FF1A 3VR6H 2GJAA 4I4LA 4DR4B 2JD1A 4WLFA 4HDNA 2IP2A 1U2EA 4M98A 2QJTA 1WB6A 3ZHYA 4A6PA 4WK0B 4ALKA 3BA1A 2OPHA 4TSFD 3VX3A 1IQUA 3LT4A 1QPBA 3N5CA 5ECGC 3HLTA 1TF2A 1VCMA 4H0CA 1TT7A 4TLMB 1ESMA 3ELYA 2H1FA 5I7EA 2I4OA 3AUUA 1DHTA 4OBBA 4PC7A 5AW3A 4WKOA 2VPYA 5JASA 3DF9A 2CF6A 4X3CA 1S89A 4AX4A 1HYBA 1L5RA 4B2IA 3IELA 3P2OA 2HU7A 1UIMA 3A3KA 1OXSC 2EWWA 1BCRB 2XA9A 3QA9A 2OPBA 1MJNA 2FUG1 4HGRA 1YL5A 1Z36A 4IINA 5P21A 3DQZA 4RORA 4ESOA 5BQXA 1NY6A 5JH7F 1ZH0A 2I34A 3VKVA 3EMVA 2WHYA 4MWTA 1P0QA 4MRAA 2VJPA 2I3BA 2FNAA 1EE1A 2GOYA 2IK8A 5LVAA 1SA0B 4BNLA 1JH8A 3I58A 4UVGA 2RHMA 4REMA 4PGFA 1XAGA 3RTCA 1KJIA 2OV2A 5J2TB 1B0ZA 1T13A 3LM8A 1HETA 2J0SA 4XJXA 5DNYB 1GRCA 4F5DA 1CVIA 2JAPA 3RF6A 2ZSDA 3VYSB 4AO8A 1MHTA 1QP7A 2A1UA 3LQYA 1DJMA 1GKIA 3IL2A 5KKAA 3KOOA 4KTTE 4DCPA 5CVCA 1T2EA 3PEWA 1RAAA 1IUPA 1ZK2A 1VBKA 3OZGA 4EFKA 3K30A 2ZRKA 2I87A 3N0TA 5LNK1 1AV6A 4R1LA 1H6BA 2OESA 5KQSA 3WC4A 1DJLA 1H2EA 1GPUA 1ZN7A 1SZPA 3NV9A 2LBPA 3L2OB 4PXSA 5AVUA 4S2EA 4DKJA 2QL6A 4OI0A 1E3DA 1NXTA 1P7CA 3RTGA 1P4JA 3ROMA 1DKRA 4MR8A 2F62A 3WAKA 1FFHA 2HA7A 1ZC3A 3IEMA 2FWRA 1ESZA 1R4NA 2WZDA 5BNFA 5SYNA 3SY8A 3UV3A 4Q4JA 1RXSA 4INJA 4WE3A 1BQ3A 3K1YA 2NTVA 4NZOA 4C7XA 5MDHA 1XPRA 5FLKA 3BK7A 2C61A 3GUCA 3U5ZB 3KE8A 4CF3A 3D6NB 4YACA 4YCAA 2OQVA 2J6CA 2O2SA 3QIVA 3H2ZA 2QMHA 4BFUA 2AMLA 4EUFA 3O7WA 3GRKA 3H86A 3U44B 3H84A 1KO8A 3B78A 3PXCX 2A94A 4B3SB 4LJSA 4MDHA 1HEYA 1KF0A 3AVOA 4JKOA 1DVRA 3ZC3A 1OB2A 1G2OA 1WS6A 1R1DA 1CUHA 1R8JA 2YNMA 4OP2A 3KYDA 3WP0A 2Q3FA 2R11A 4BU1A 5JJKA 1LLUA 4KGDA 2QSZA 2NPIA 2GHRA 2FLWA 2GZMA 2ENUA 1ZKDA 4DANA 2Q0SA 2GEJA 5EHXA 1SXIA 2CXXA 1XNHA 3QV2A 3DMDA 1QYIA 4H3KB 1ZMTA 2PH5A 1UQTA 1Q1GA 3GEBA 1Q5PA 5IT5A 4KP7A 1ZLXA 2JIQA 5CH5A 1FBTA 2PRZA 1P9LA 5DB4A 2I2CA 2IP4A 4ZANA 3UHAA 3IQFA 2C7BA 3A26A 4TOIA 3L18A 3UMBA 5FA8A 1IVNA 3H3XA 3KKZA 4CDGA 2Q62A 2ZAMA 3PC3A 4UZSA 1TD1A 3JQAB 3EWNA 4JGBA 1UZNA 2ORYA 3ASUA 4UOEA 5ICSA 1EUYA 2GKGA 3B8EA 3MLAA 1U2SA 1STOA 4F21A 2LD4A 4QBGB 2Q4EA 4HDRA 1AN0A 2MOKA 5D3MB 1A76A 1TM5E 4KWIA 4PONA 3N7TA 1FP2A 1LX6A 1RWKA 2XGMA 3MAAC 2ZVQX 2OO5C 4JLDA 4P31A 2EKDA 3CR3C 4RKQA 1K7CA 1A5AB 2WZQA 5IM4F 2ZB7A 1Y5IA 3CEHA 2Q0XA 2BR5A 1AZSC 1EG7A 3G82C 4P3KA 2SKCA 1E6KA 4KNVA 4G8BA 1ULHA 4NE9A 4JB2A 4OFZA 4PZAA 1I32A 1DS6A 2G9UA 1X1AA 1I7NA 2IS2A 2AJ8A 3EIUA 4X44A 3IDFA 3QEJA 4AUNA 1UXKA 1TX4B 1L5OA 2OCPA 4YC7A 4I14A 2QUZA 3S1LA 2K87A 3HYNA 1XCMA 1QIHA 1Y9EA 3LUFA 3O0TA 3GA0A 4MPPA 2VJMB 4B46A 1I4OA 1G6KA 3PHCA 4NONA 2BHTA 2Q50A 1KY5A 2VHXA 4OHUA 1LXCA 3FW1A 5ICFA 1JV2B 1U0HC 2H0QA 3LC1O 4JJIA 5JAZA 2ZJ6A 2ZUBA 5EINA 3IIIA 3SBEA 3VSEA 4JLAA 5IFLA 2WP0A 4BPBA 3RDPA 2LRHA 4H18A 4XUDA 1C3JA 3COWA 3X1WA 1DQPA 4IV0A 5CB4F 2IS1A 2EFJA 1ZXBA 5ADUS 2FR8C 1TEVA 4I2VA 3GJ4A 4OHKA 2EWMA 2VDNB 2SECE 2J8ZA 4TTIA 1CUZA 1YMQA 3PZBA 5K5EA 1NQ5A 5CXUA 1KFEB 2H65A 1GRRA 2R1ZA 2WD9A 5DV9A 2IUEA 4ZCMA 2F6RA 3WHKA 1VCOA 1OKKA 3DW3X 3V2GA 2J7KA 3TSWA 1DOHA 1KMHA 3Q9SA 3EODA 3S2UA 5AIBA 5FFFA 5HCNA 5C5DA 3AHDA 2CN1A 3KKOA 4CBVA 2PKCA 1U3VA 4XCVA 4ZQEA 4IH9A 1O4VA 2PD6A 5FIUA 5FTMA 1YXMA 1QM5A 3MPUA 3EZNA 3A9VA 2ALJA 4ARZA 4HNSA 3O75A 1H2RS 5FPTA 2PMDA 4BWYA 4M1MA 5ILOA 4M9CA 4L6AA 1ODSA 1Y7PA 3V8VA 1DT3A 3FLEA 3OTWA 4UPDA 4H3VA 1CNEA 5IC5A 1RBYA 3UPDA 1MP0A 5EERA 2R96A 1BXKA 1Y3FE 3A10A 3ORQA 1O57A 4WZAA 1LU9A 3S2FA 1SUFA 3GXBA 3IKMB 1C3OA 5CDGA 5HRAA 3A6DA 4WOJA 2JIOA 3G7NA 3ICOA 3U0BA 3VYWA 1M34B 4DYVA 1NPYA 1UPCA 3VFDA 4HDKA 2V54A 4B3XA 1XO1A 1CUUA 4CQJA 4O4IA 3C8DA 3TUZC 2W4IA 9GPBA 3X2SA 3N75A 1CP3A 3CG4A 3RSCA 2IUTA 1E2JA 1FQOA 3OY2A 5DULA 3WLEA 1M67A 1IUKA 1W2WB 3SKVA 1BMFD 5LQRA 4KR6A 5AJXA 4MI6A 5LMZA 2WM3A 3ADOA 3J81k 1R18A 2WWYA 4O4LB 1O4WA 2YR0A 5JATA 2QR5A 3GJZA 1NURA 4YGYA 1Z33A 2VK8A 4NP6A 1Y7TA 2RKOA 4MR9A 4S1NA 1SG0A 2ADMA 3AUXA 4FX5A 4IRMA 5F5NA 3M3DA 4WBNA 4Z54A 1B1CA 1IXRC 3NP7A 1HLPA 4YMSA 4BB0A 4KXWA 1TUBA 3ZV6A 4I55A 3BCHA 4B84A 3CYFA 3P27A 2ZIGA 4YO8A 4ZC8A 1WLYA 2VJCA 2YS6A 2AH5A 4CFSA 1Z4MA 5JLJA 1LFDB 2OO7A 2V7PA 2F1HA 3GUZA 1MZPA 5KYTA 1GKKA 3W04A 5K7SA 1NJ1A 2NV2B 4DIFA 3UGJA 5CNIA 1M83A 2CNNA 4CDRA 5AESA 1HH4A 2QNRA 2C0PA 2X0RA 5KNDH 3L0DA 5CDYA 4JLPA 4OGKA 2VSQA 3IAXA 4RKRA 3RBZA 3S2SA 4EPYA 3GPBA 4DV2B 3BMQB 4KNWA 2Q49A 4IWXA 1VSVA 4WXRA 1K27A 2M1ZA 5JIBA 2O2HA 3LBFA 4YJFB 4DR6B 4J2HA 2ZB8A 2IW3A 2L82A 1J4AA 2CE7A 5EZSA 1GSOA 4QU5A 4Z9BA 4KDFA 1NVGA 3L8GA 5HXAA 4GMDA 4HDQB 4R2LA 1KKUA 1YMVA 2H59A 5CFPA 2DTXA 5JDCC 1PNQA 4YUWA 4XSHA 2ETXA 3IXLA 2J9GA 3IMCA 2UAGA 3EBOA 4ZOCA 4NV0A 4TLDA 1V6SA 4MVXA 2VHQA 1ENZA 1CZKA 1P0MA 3RIHA 5GIPE 1VI2A 4DIBA 1C3EA 1XF9A 3EXEA 2W93A 1U0SY 3FR7A 3HCBA 1VHTA 2RB4A 3VV2A 4DV7B 3QBDA 5K6AA 1WSBA 2HMYB 3A1WA 4D8TA 3OO0A 1QG2A 3FG9A 1EFDN 1EZ4A 2ILVA 3QI2A 1H3EA 4BQNA 1JXMA 4O29A 3EW7A 3WGKA 5K2MA 4F8EA 5KDOA 3OMXA 3TIXB 3I9V6 2R4UA 4F6LA 4BO3A 4LDQA 3VVCA 2IIVA 4F06A 2FPRA 2YDYA 4TKVA 1L5WA 1UJNA 1Q74A 1H3NA 4FOTA 5DN6A 5JE8A 2QLFA 5JRDS 1JFLA 1OTXA 3GUHA 3KB8A 4LMRA 2EXXA 4QSMA 1SVUA 4F2PA 1RXEA 1JG7A 3FTNA 4OMCA 4NFSA 3WWCA 4F97A 3A6JA 4XGKA 2PPLA 5CLGA 5SYAA 1CJVC 1SQFA 3VPAA 2CLSA 3ZD7A 2Q5LA 1PTJA 4WCFB 5CG1A 2WUEA 2DEUA 4PS0A 1RXIA 3ACCA 4X1OA 5IYZA 2WJ3A 4DT1B 4XWWA 2B4KA 2IDJA 3EMBA 5KTMA 3J80A 2FW1A 1U31A 4LY9A 1RHKA 2B98A 3QE2A 2IDZA 4X1KB 3ZJTA 2P9CA 2EKZA 2VUUA 2O5EA 3LMKA 2V6IA 2AJCA 1QNFA 1Z12A 1SQ0A 4XX0A 3L1UA 4R9RA 3O92A 5DI9A 1KE1A 4KQ2A 1N6IA 1SUBA 3DMNA 2IYSA 3AO0B 2C58A 3KK0A 4QRHA 5CIWA 5I7HA 4HD8A 4BX2A 1FW6A 1L9KA 4JP8A 5K3DA 1CRZA 4N1AA 4YJ3F 4Q03A 2C0CA 1D0VA 1GTG1 2R97A 4F5EA 5LZ7A 4ZJZA 2QY6A 3ZD6A 2D5CA 1FP4B 3LPNA 4GT1A 5B4UA 1X1DA 5KVSA 3CG0A 1YWGO 2FVXA 4RC9A 1R0CA 2AKYA 3W8DA 4DJAA 4EW6A 4KN6A 4YRGA 5ITZB 3F9IA 3VH2A 1NBAA 5HJ5A 2PZLA 2QLNA 4TQ9A 5HFAA 6PFKA 1ENOA 2HV9A 4LX0A 4WI1A 5B6JA 2W6MA 3A1DA 2JI8A 2WUWE 3UXYA 3V1LA 1B76A 4JOCA 3V4LA 1XCBA 1TMOA 2RH5A 4JCOA 1NJ8A 4GNRA 4MVJE 4WLVA 5EIOA 1NQWA 1QE3A 1Y42X 4KACA 3W8NA 4CTOA 1IVSA 3FYUC 3NO4A 2PR2A 3H2HA 3ZX5A 4CLRB 1KY4A 3TSOA 4CUZA 1OTHA 4HEQA 5BVGB 2EP8A 1PWEA 4MVWA 2JFPA 5B1HA 1FDWA 4I4TF 4QTUB 3GJSA 2AS0A 4R01A 3H11A 3TSYA 3P0HA 2O8DB 4NBUA 1L4FA 2HPHA 2WVAA 1I1NA 1OI7A 1SUPA 3AP1A 1SOAA 1SVSA 3AFNA 4G0NA 3T0IA 1NBMD 3UH1A 1JR2A 5EIWA 1IM2A 2XNSA 1EX6A 3FHLA 4KCGA 5T6MA 1PVVA 2I3DA 1JBQA 4EARA 2PKRA 1Q1AA 2DLDA 3A31A 1OU0A 4QPJC 2OENG 3MUNA 4RABA 1Q0PA 4LI3X 2WTBA 1UJBA 2D2VA 3QPWA 3CWZA 4LRWA 4XM0A 1BFUA 3ZKWB 3HVKA 4HUTA 4JVNA 3WDMA 2ACKA 1ODIA 2XBUA 4RVGA 1RACA 4A8JB 2AG5A 1U5AA 3WI7A 3V5NA 1WR8A 1ESNA 1FU8A 3H18A 2C9OA 4FGSA 1D4OA 2FMKA 4RFVA 2CL7X 1E94E 1KS9A 3KXPA 4MUNA 2DLNA 2OQ2A 3EFOA 4QQ8A 4RS3A 1KSJA 2VP0A 4OTZA 5AUPB 4AG5A 4FMCF 5B7QA 1R6VA 2I7VA 4CN8A 5EQFA 3SXPA 1NP3A 3V9PA 1ID8A 4R69A 4MS1A 4DLAA 1TUIA 2ZAGA 1JR3D 5DU2A 4M1WA 3EFBA 1SG6A 3HADA 3UB4A 3EVGA 3CX4A 4Q47A 4WFIA 2GNPA 4YR7A 4G1CA 2HO4A 1P0CA 2J7PD 2O7RA 2WJIA 3IIJA 3QP9A 3W2HA 2O0JA 3R09A 4NI5A 4IJ6A 1TA9A 1SPXA 5CM9C 4GMHA 1W19A 3MTAA 1T5TA 4NNOA 4HS4A 1W1UA 3PQCA 3L0YA 5ENDA 1Y9ZA 4EPVA 3NM4A 4Z4CA 1M1XB 1QF9A 4MLPA 4WLUA 4DRXB 4TRRA 2GYYA 1DIRA 2DAPA 2XKBA 3ZIAA 4B3HA 1JZSA 5EZQA 4BNDB 4E32A 4NICA 3W8EA 2IYLD 2DPXA 4US0R 4CETA 1PJZA 3UJ9A 2BEJA 3VAAA 4S2UA 4DUZB 5HQTA 2BMFA 2JVIA 2O4CA 4QUBA 4C20A 4CL0A 2LPMA 5BNWA 1HTBA 2ZI7A 4KYTA 5KS2A 3RNOA 4P3PA 4CMKA 2CVHA 3ZH2A 3UG6A 1SOWA 2Q45A 3KVOA 5DEIA 4ITRC 2BM9A 1I0ZA 1W2GA 2RD2A 4X90A 4K88A 1TADA 3E5HA 1SKBA 2DY0A 2F3TA 5A3QA 2O8FB 3DDCA 3X1YA 2ZRJA 2XDQA 3GYGA 3AZOA 1Z0DA 4ILEA 3JCZA 1UK7A 4F0JA 1BVHA 1IK4A 1UR5A 3OH8A 4YAIA 3WL4A 3GJ3A 5KNCD 1LQTA 1NN5A 1UL1X 4UHEA 3GNLA 4B75A 4JWKA 5TF0A 5FQNA 4ADSG 2I8AA 4UBLA 4B81A 3LCCA 2YXPX 1W5SA 2BT4A 4DW8A 4F2HA 5KQGA 5IDWA 1IOZA 1I3CA 1LLDA 1MA0A 4Q3EA 3SCZA 2C92A 2QAJA 2PMBA 3VR5H 3QYAA 1TCUA 3C6XA 4QQRA 5KMGB 4EB0A 3K1ZA 2XYHA 2TMDA 1YIOA 2WHRA 1XZGA 3IQIX 4D8VA 3KLPX 5BN5A 1NT4A 4XUEA 5PGMA 4X6XA 3ZS9A 1RQ2A 3FD8A 3FCSB 1YZFA 4ACAA 5EJ4A 5EIAA 1IMOA 4QJIA 3L6UA 3L79A 4K6MA 1OREA 1TLTA 2IIBA 3ZJ4A 3T9BA 1WMEA 2D62A 2O07A 4DV5B 2GM3A 2WU4A 3IB6A 4RVSA 1E7RA 1PE0A 4JI7B 3NWPA 2BMVA 4KGXA 4UREA 1N5OX 3OFJA 4LZLA 1F9AA 2BFOA 2OBMA 4QL3A 2O3QA 3OPMA 1RKUA 4YBRA 1V8PA 5DT2A 4C0QC 4PN3A 4ODIA 4LXHA 4NJMA 4Q0MA 1QU3A 1ODTC 5T5QA 3VYRB 4RY8A 4ZU6X 2G08A 4ZCRA 3I2JA 5DMXA 4CQMD 1G63A 3CF4A 3KBOA 1ISRA 1F2TB 3IP9A 3L40A 2D0DA 5J4KA 5A0FA 4CI9A 1KNQA 2Y1XA 4DWJA 3UAXA 3MJHA 5IVHA 1NJ5A 2V5UA 4HO1X 4Y6OA 5SZHB 1NPTO 1MFPA 4C04A 2BZGA 3MZ0A 2ZJ8A 2HA0A 2WRZA 4FFLA 3GD7A 1QBGA 4FQ5A 1Z75A 2R7KA 3AF6A 5LZ4A 1KP9A 2V3WA