1PJCA

L-alanine dehydrogenase complexed with nad
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-ALANINE DEHYDROGENASE)
total genus 113
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjcA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjcA02
3EAGA 4NMHA 4CQMD 5EL0A 4IDCA 5L4NA 4RJTA 4P8RA 4PLTA 2HAEA 1VL8A 3TRIA 4IXWA 5ITVA 1Y9AA 3D3WA 4HFRA 2E82A 4XYEA 5AVOA 3LC2O 5FYDA 2VTDA 2W4QA 2ZQZA 4IXTA 5HS6A 3ONFA 3P5SA 5C37A 2I99A 5JDCC 4CV2A 4DPMA 1P1IA 3VH3A 2VUSA 1U3TA 1IOLA 3DTTA 3W8DA 5JAMA 3DHNA 1KEWA 1SMKA 2Q4EA 1ADFA 1P1FA 4MVJM 4YJDA 4ZGWA 1UUFA 3PRJA 4F3YA 4R1TA 2YHIB 1VL6A 3WR5A 3OJLA 4PLZA 3WGOA 4EUFA 4XDZA 3FNHA 3QE3A 4WCFB 2CMDA 4J43A 1C1DA 3GN1A 2VZ9A 3HQ4O 2CDBA 5IZCC 2WD7A 1GCOA 1YDWA 4W7IA 4QUKA 1NHWA 4ONEA 4BKRA 3QLJA 4H15A 1VSVA 4J16A 3QV1A 4J3FA 1SEPA 2ZKLA 1DIRA 3ST7A 3F4LA 3RI3A 1FDTA 1VI2A 2WDZA 1TT7A 1ZK0A 4E5PA 4GWKA 1KVTA 2QRLA 1I3MA 4S3MA 1AE1A 3VPFA 4YAEA 3NGXA 5K0ZA 3ANLA 4BNWA 3EDMA 3L4SO 4KWIA 4NFHA 2C2XA 2BKAA 3FSRA 4PLYA 2I9PA 5BNIA 2ZB3A 4J2HA 1Q0HA 2Q45A 5AYVA 1UDBA 2Y68A 1HF3A 4NZ9A 1NM5A 3ZCXA 2B4RO 1H6DA 3ZW8A 3PK0A 1R4NA 4FCCA 1U3UA 1TT5A 1Q7CA 4BGVA 1KETA 5IJZA 4RV9A 4CM5A 3VZQA 1CYDA 3WWYA 1NYTA 1GY8A 3OJ0A 4C7JA 1SAYA 3GA0A 4UUMA 5EQDA 1DIHA 2D5CA 3DXFA 4AG3A 3GH3A 3H6KA 1IPFA 4P4LA 5A5EA 4ALNA 5MDHA 1YQXA 1JU9A 1R37A 1U3WA 2DBRA 3C1OA 1MG0A 3PWKA 4QO8A 2Z1MA 2CFCA 4BNTA 4L0QA 2FP4A 4WGGA 3ZU2A 1JKFA 2OP0A 1P77A 4O63O 1E92A 2BFMA 1XG5A 1C0LA 5AXDA 3HNPA 3DR3A 1HZJA 3K6JA 3RBXA 4CMCA 2O3TA 5HRUA 1ARZA 3LLVA 1N2SA 2P9CA 4QSMA 2CY0A 1LSUA 5TGDA 3DHYA 2CVZA 2NU8A 3NGLA 1E5LA 4JQCA 1ZJYA 2YUTA 4X54A 3IIEA 1BXGA 1OI7A 3TF5A 2PD3A 1NXQA 5F3RA 4CR8A 4GSLA 1P0FA 4GKVA 5ITWA 1XELA 4FJ1A 2Q49A 3FPLA 3M6IA 1OC4A 4FFLA 2CVQA 1C3VA 3FR8A 3PP8A 2YYYA 3JQCA 4B3JA 4MDHA 3UCFA 3F9IA 4L4XA 3QSGA 5IDWA 3PIIA 4B4UA 1GV1A 3OIDA 3D5TA 2FOIA 3EC7A 3NV9A 1IE3A 1HLDA 4YTEA 4FJ0A 1U4SA 4BO5A 4WLUA 3GEDA 3B6ZA 2EJWA 4RO0A 3P19A 4CL3A 2HQ1A 1DRUA 3AFNA 1D1SA 4G81A 1T25A 2D3TA 4XD2A 3DOJA 2JD1A 4FW8A 1J6UA 1EEHA 1UP6A 1D4FA 3RFVA 3WBFA 4XDYA 5TQVA 1K3TA 3SJ7A 2DU8A 3VTZA 6LDHA 3JQFA 4NH4A 5G0WA 3UCXA 1U28A 2O23A 3EGOA 1GZ3A 3RROA 4YJHB 2POQX 1RM5A 2PK3A 4J49A 5HS4A 1GR0A 2X5OA 3CINA 2Q50A 2YQ4A 2QQ5A 5A03A 2E6UX 3OMLA 3PHGA 2Z5LA 1NR1A 4RQUA 4Z0HO 2P2SA 2O3RA 1Y5RA 1E1NA 2JCVA 2Q3EA 4JCOA 4RVGA 4GMFA 3UOGA 2ZJ1A 4RDHA 5JNLA 2EERA 4YA6A 3GEMA 3WFJA 3ZWNA 3SEFA 4FC7A 3H9GA 2CD9A 3PTZA 2HJRA 1HRDA 3L9XA 4FFNA 1EUCA 4A03A 3C7DB 5BSGA 2HMUA 1HEUA 4S1VA 5JDIA 2PGLA 4C4OA 1LDEA 1PU2A 3ZWBA 3RVDA 1PL6A 1HSOA 1Z7BA 2WD8A 3KYBA 3Q3CA 1TB4A 2O3SA 1C1XB 4J7CA 4NFYA 1PJ3A 2HMTA 5TIIA 3NAQA 5JXWA 4AJKA 1Q2XA 3UFXA 3EHEA 4DIOA 1UXGA 4IIUA 3QQPA 2P4HX 3WYBA 1LLUA 4LSWA 4WEQA 2AQ8A 1IY8A 2GF2A 4XJSA 4FGWA 1LEHA 4HFMA 3PHLA 3ZWXA 4BUCA 5IDXA 1JKIA 1PL8A 2RHRA 1QYDA 4XX0A 1YGYA 3PGJA 2FR8A 3D1LA 1YONA 5EESA 3RKRA 1J0XO 3AUTA 3Q2KA 4PG6A 3T7CA 1WMBA 3JQAA 3QWAA 3KLMX 3KVOA 3PI7A 4U5QA 5GZ1A 1F14A 3WICA 1KVSA 2FN7A 1KOLA 3GRPA 3ZNOA 3VH2A 4CMEC 4XGIA 3MTJA 4R9SA 3RU7A 3W4IA 3V8BA 4ZVVA 3L77A 1ZZEA 4CMKA 1B8UA 3IMFA 4AFNA 3TL3A 1DAPA 4II3A 3PJFA 2PR2A 2E48A 4BNLA 3FR7A 1PGPA 1ML3A 3OA2A 1DFIA 4IQ8A 3BHJA 3OIFA 3VAZA 3M1AA 4ZQBA 3KLPX 2ZB4A 3CMMA 3R6DA 3JD1A 2PA3A 3SBOA 2IZ0A 3ZH2A 3LK7A 3V2GA 2Q46A 3H3JA 3K2EA 1T2AA 1H93A 4IZIA 3PVZA 5JDCA 3DZHA 1DRVA 2FSSA 4GLLA 4JBGA 5CG2A 4Y98A 1DBVO 2YFQA 3BAZA 4ZQHA 3LC7O 3RSHA 4DMMA 4E5MA 1ZXLA 1OOEA 1NQAO 3CZMA 5KIAA 4DQVA 2V6FA 3ROMA 4R1SA 5F1KA 4K26A 5AQ1A 1G6KA 4HUJA 2B0JA 4FFRA 3DZKA 5IN4A 2NWQA 3C7AA 2W98A 5J23A 5G0SA 1XKQA 4GX5A 3T7EA 4D0SA 1FK8A 5KWEA 1HLPA 1KVQA 1BWSA 3JCZA 4YAIA 5A9SA 4BNVA 2PKQO 3IKTA 4R1UA 3SLKA 1PQWA 2GPTA 4F46A 2NLOA 2G5CA 4XZ3A 2EKPA 3LC1O 1YOVA 4BV8A 4CR6A 4BNGA 3L4BA 2HMVA 5A06A 3WYEA 4ALLA 3KSZO 4FPXA 1NR7A 3IP1A 2PGDA 3A9WA 2YQ5A 1ULSA 3NT5A 1I30A 3KEOA 4TRMA 3UKOA 1HDYA 3BZUA 4OKNA 1R66A 1X7GA 2ZCUA 1I10A 2C0CA 2UAGA 3PYLA 4HFNA 1KEVA 4YVFA 3QVWA 2DAPA 1C0IA 4PLCA 1BTOA 5JS6A 2J6IA 4CODB 1GQYA 3FRJA 3UAGA 3GZNB 3L0DA 4YACA 2D2IA 2WSBA 1K6XA 4HFJA 2EW2A 3HDYA 4PZEA 4R9RA 4F6LA 1X14A 1GZ6A 3TZCA 3TZKA 1VRWA 3FTPA 2LDBA 1AHHA 1J4AA 4N5MA 4BHTA 2WYWA 3HDHA 1YH3A 3TZHA 2D59A 2JHFA 3IOYA 2R00A 4ALMA 1B16A 2PZKA 2VUTA 1PQUA 1OBFO 4JBHA 1MB4A 3GZNA 2JAHA 3DC2A 2X86A 3PYMA 3AFMA 4FQ8A 4LRTB 2DUUA 3LT4A 4I9NA 4IDDA 5ADHA 3LT2A 2EW8A 3R3JA 3WS7A 3B20A 3K8ZA 4R41A 2VRCA 5L9AA 2OMEA 4BO1A 2YV3A 3OF2A 4PG4A 2IEBA 3MJCA 5CEEA 2BI8A 5A9RA 1YBAA 4N18A 4Y67A 3W4KA 3NJ8A 2OBNA 1H0KA 3U62A 2FSVA 5DOVA 1HZZA 2QRKA 5EN4A 1U2GA 2X7HA 3WQRA 4DLBA 3GY0A 4IS3A 1PJ4A 1HDOA 1VJ0A 1N9GA 3OEWA 4M8SA 4EJ6A 1I2ZA 3QJ5A 2ILTA 2X9NA 3ZW9A 4B4WA 4I9UA 5L45A 1DIAA 2PWZA 4YEDA 3TOZA 1I01A 1ONPA 2VHXA 2Q2VA 4CMAA 3ZN2A 1HL3A 2DFDA 3PHJA 4AJOA 1AXGA 2Y1OA 3E5MA 4TMFA 5IG2A 2J5RA 3BTUA 4XQCA 1ZNQO 2RHCA 4IJUA 4MP3A 4L4SA 4CV1A 4EZBA 4E2XA 2CZCA 4IMPA 2PKQP 4GSKA 5JCXA 2V7PA 4AJPA 4OOFA 2GNAA 2J3IA 4XJTA 1SEVA 5JCJA 2VHZA 1BW9B 5C3MA 1QYXA 2H63A 3AU8A 1CQIA 3C1TA 4XYGA 3IJRA 2F00A 4Q39A 3PZRA 1EMDA 1YWGO 1I3KA 4XB1A 2X22A 1DIGA 3E5RA 4M87A 1P1KA 3LF2A 4ND5A 3L9WA 4YJFB 3IQDB 1ZFNA 2IE0A 3BHMA 2AG8A 5TC4A 2Y0EA 4AICA 4EJ0A 2O4CA 3GVPA 2HCTA 2D1YA 4HNHA 5HBRA 1E7WA 4NI5A 1M2WA 2PV7A 3I83A 1TLTA 5FWNA 3VZRA 5B4UA 2UYYA 4BNKA 3GRKA 3FWNA 1SB9A 1DIBA 2JD0A 1O89A 3Q6IA 4RLHA 2V65A 1I3LA 4XQ9A 3F47A 5JO9A 1Z73A 2R00C 5JAQA 4WLOA 1AGNA 1LQUA 3E03A 4Z0PA 5JDIC 5BR7A 3ONEA 3E9NA 4MVJF 4MINA 3IJPA 4YXFA 3NTRA 4ILKA 4UREA 5TT0A 3C85A 1UZLA 3K92A 3L07A 3ONDA 3PHHA 5K6AA 3AM3A 4XB2A 3TL2A 1U5CA 4CMGA 1DFHA 1JWBB 3D64A 3QWFA 1B8PA 1QR6A 1PR9A 2NVBA 5EJ2A 1P44A 3GMDA 1ISHA 2IYOA 2J3JA 3EVTA 3TNLA 4GGPA 4PG7A 3U4IA 3HG7A 4U7WA 3B1FA 3MOIA 4ND3A 4BGEA 2X8LA 4NR0A 4ALJA 1B3BA 1BMDA 1R0SA 4MPDA 2DFVA 3L6EA 3LVFO 5F1PA 2QYTA 1EVJA 3DBVO 3M1LA 1E3IA 4XA8A 3VOSA 4KZPA 1CETA 3JQGB 4EUHA 2WD7B 5DBGA 4BO2A 3HUDA 1PEDA 4ZJUA 3WSVA 4AJNA 1H9BA 1BW9A 3Q9NA 2EG9A 4Z9FA 3GOHA 4TRJA 1E1LA 2ZTVA 4JP2A 1X0VA 3AOGA 4DMLA 5TT1A 2ZJ0A 1NPYA 2Y1GA 3I23A 3STHA 2B4QA 1LQTA 3ITKA 3N58A 3CZRA 4KUHA 3O8QA 3C8MA 4BV9A 2I3GA 3F1KA 2HJSA 5HTOA 2C54A 2VRBA 2JAPA 1YB5A 4BNIA 3SX2A 4CLEA 2IRWA 2I66A 1P0CA 4WCFC 4E30A 1DLIA 3RQSA 2O3QA 2WYVA 1T2EA 4JP3A 4CR7A 1PZFA 4E12A 4WUVA 3ZDFA 4ZICA 3DONA 5A04A 2AE1A 3BMQB 2GN6A 2VQ3A 4URFA 5L3ZA 1HYGA 3M2PA 5EIOA 4MJLA 2DKNA 3IDSA 3QHAA 5C7OO 4BO8A 3AU9A 4JROA 5EQFA 1K6IA 2C7VA 1E3LA 2ZB8A 1ENZA 3ZWOA 1DAOA 3ZWVA 3A28A 4UVGA 4BKUA 2ZQYA 2A92A 1R0LA 1W8DA 4WOJA 5I7VA 2F1KA 2Q1WA 1ZEJA 2RH8A 4NQZA 4OXKA 5JE8A 3ZWYA 2GRAA 4A7PA 2CVOA 4M54A 2NU9A 3GVCA 3MOGA 4CQLB 4BS9A 3GR6A 2ZTUA 3DTYA 4PLVA 4Q3DA 4CPDA 2OBYA 3HSKA 3MWEB 4N5NA 1LLQA 5B4TA 2VWHA 1QORA 3K9QO 4RPHA 2AA3A 3NTQA 1WXDA 3CPSA 3NYWA 3HDJA 5KJ6A 3GHHA 1VJ1A 3GDOA 4AJIA 5DOZA 3WDSA 4A10A 3PLRA 3JQGA 1EUDA 1YVEI 3I1JA 3P7MA 4NK4A 4ALIA 3GVXA 3VDRA 3W6UA 4GVLA 5JSFA 4KP7A 4U0JA 4OSOA 3CE6A 3AY6A 4CMIB 1E5QA 3DBRB 3H5AA 3JQ9A 4BNUA 3RKUA 4NBWA 2QYSA 2JKVA 2BI7A 4IQ0A 4AJ1A 1E1MA 2DBVO 2XXBA 4IINA 4DLAA 4GX0A 2D4AA 2BRUA 3MJSA 2AG5A 4JLWA 1DPGA 3OIGA 1CJCA 1A9YA 5G4LA 5LDGA 3ITDA 5CPFA 2AQHA 2H9IA 4AL4A 1JVSA 1PS0A 3ABIA 3BA1A 2DBQA 1KVUA 2Q2QA 4WJZA 4XQEA 3D7LA 3KYCA 4M89A 4CLOB 1N1GA 1E7SA 4A0SA 3KBOA 1JQBA 5ER6A 3I9MA 3ZHBA 4BNMA 3JQBA 2WWRA 4OM8A 4CMIA 1NQTA 3ROQA 4WCFA 3KOUA 2C82A 4J4TA 4PFJA 2NVWA 3S2EA 1Y8RB 4FB5A 5CEFA 3MCVA 1T2FA 2Q4BA 1YB1A 4Y9DA 3D4NA 4BNFA 1WAMA 2EIHA 1B3RA 3ZWCA 2ZYAA 4G5HA 4NIMA 5KVQA 5ER9A 1KY5A 1U5AA 4WNCA 4I5EA 3X2EA 1XYGA 5JAZA 1DO8A 4B8WA 2Y05A 4YQYA 1QP8A 2HSDA 4R4JA 3VH1A 2Y66A 5BNTA 4RF5A 1HDZA 1GU7A 4MO2A 1ZVMA 4HBGA 1X7HA 1X15A 4QO7A 1BXZA 3AI3A 2O2SA 4Z3DA 4B79A 2X58A 2VCYA 1MC5A 4A5OA 4CUJA 4K6FA 1LSSA 4NBUA 4ALKA 3GUCA 2VUUA 3WOHA 4OKIA 1N5DA 1WDLA 2JJYA 3W8EA 1HDRA 3KHUA 2G82A 1DHRA 3GN2A 2HRBA 2EWMA 3GDGA 1C1XA 1X1TA 3QW2A 2OUIA 4I8XA 4BMNA 5CPBA 1BHSA 1Y1PA 3NEPX 2C07A 3WYCA 3JD3A 4GBJA 2Q1SA 3EK2A 2O7SA 4CJXA 1ISMA 1HDCA 1MFPA 4OOEA 1C0KA 1UXHA 1WDKA 2X9VA 3EY4A 2FY8A 5EERA 1WMAA 5KJCA 1IL0A 4OGWA 2H6EA 1MXHA 1QKIA 5T64A 3FD8A 2O4UX 4R16A 1I33A 3FF4A 3GNTA 4WLVA 5I8ZA 4YT2A 3GVIA 1E3SA 5C5IA 1F8FA 2CDAA 2DUWA 2FMUA 4TROA 3DMYA 1TA4A 2W8ZA 1XQ6A 2NACA 3ASVA 4YCAA 2IODA 5B37A 1JLLA 4IDAA 1GQQA 1XEAA 1XSEA 4TZTA 1RYDA 4Q3EA 1E7QA 2GGSA 3EZYA 4YR9A 4YDRA 2CSUA 4NU6A 1V3TA 1P45A 4CUZA 3WJAA 4N54A 1T2CA 1P31A 3K5PA 2RCYA 1VE9A 5C7IO 5CDYA 2RBEA 1PWXA 3PWZA 4B4OA 1ISIA 4HP8A 3LDHA 4ITUA 2XAAA 1N8KA 1ONNA 1B0AA 2G1UA 4GPD1 4PVCA 4CLHA 3H4VA 3LYLA 3N7UA 3UW3A 2P91A 4IMRA 5L7WA 3BTVA 1LSJA 2AMFA 1XU7A 2NTJA 3R0IA 4FR5A 1V3UA 2EEZA 1IHYA 4RL6A 2AEJA 1VKNA 3G79A 4QFDA 3WGIA 5AXAA 1LLDA 4I08A 4RDIA 5T5QA 2PNFA 4YWJA 1NVGA 2JFHA 3HB5X 4NJOA 2FZWA 5GY7A 4E6PA 3PYXA 3RFXA 1T26A 3RC9A 1JAYA 1LC3A 4D45A 1FDVA 3AOEC 3QWHA 2JCXA 1H2HA 2HK7A 2D0IA 2Y93A 3W6ZA 2VZ8A 4IJKA 3OA0A 4UULA 1FF9A 1EVIA 1U7HA 1O0SA 1H6CA 4U8GA 5A05A 1UDCA 4CMBA 4RCVA 1ADCA 1RM3A 4BKQA 1B2LA 2DM6A 2GCGA 2VOJA 2YHIA 5A02A 4NU5A 1EE9A 4D3DA 4E2YA 4B7XA 1LDNA 2Z1NA 3FNGA 4FBGA 4FD3A 4RPLA 1IZ0A 2O3UA 4MKZA 4P22A 4RF4A 2IYPA 3C7CB 3Q9UA 3GMSA 4JN6B 1NTOA 3MJVA 1SB8A 5BQFA 3DBRA 3GUYA 4P4GA 8LDHA 2ZATA 1QYCA 1KC3A 1G0NA 2A4KA 3E48A 3SC6A 5CG1A 3D4OA 3G1UA 2BELA 4UEOA 2FZEA 4W6ZA 3AK4A 1KIFA 4IDBA 4YQZA 4BNNA 2PD6A 1JKJA 4XGKA 1BDBA 1E6EA 1R15A 1NASA 2HKIA 3MTGA 3ROPA 2IEDA 3JQAD 4AJ4A 4PLGA 4CV0A 1YO6A 5IXYA 4YJFA 2B36A 4L8VA 3U4HA 1PZHA 1ZW1A 4M55A 3HFSA 4F6CA 4BO4A 4NDNE 1ENOA 1H5QA 4AJ2A 2HMWA 1E77A 2YHUA 4CM8B 4HXYA 1FMCA 4UVDA 4HKTA 2Y99A 4NBRA 2VTEA 2VNAA 1YQGA 1PTJA 4UVEA 3BTOA 4GGOA 2EGGA 4PIVA 3NDJA 4YRBA 4QTZA 2C5EA 2AEMA 3ZZNA 4O59O 4LRSB 3ZWPA 4OMUA 3C1AA 2Q1TA 3ETDA 3O9ZA 1H9AA 1VLLA 5IZ4A 1PR3A 3I6IA 2FR1A 4W9NA 1ISFA 2XOXA 4OYRA 3K30A 3I3OA 4BVAA 2W2LD 1PGNA 4AJLA 2O3JA 3ZNQA 1A27A 1B15A 4NFSA 3H9UA 4Z0TA 3BTSA 3WGHA 2QW8A 4R5HA 3OQ1A 2YY7A 4CM7A 4RVFA 3DDNA 3DL2A 4E21A 1HE5A 2EHDA 4CM9A 2LDXA 1U1IA 1R4MA 1YQDA 2UUOA 2GSDA 5THKA 5DP1A 2BD0A 1RWBA 4I5FA 1PZGA 4TRRA 3K96A 5LCXA 1WWKA 3OICA 4K6CA 1D7OA 1RJWA 4RVDA 3LSYA 4MVJH 3Q1LA 1YXMA 5KKCA 2G17A 1I36A 2NU6A 1DC4A 3NT4A 3QIVA 3ETEA 5DCUA 1LA2A 4MVJA 1KEPA 2VYNA 5BSEA 3NTOA 2PD4A 4D42A 1EE2A 3P2OA 1P1HA 3ZWWA 3H5RA 1NQ5A 2DLDA 4OJNA 3S2IA 4NJMA 1EZ4A 2QG4A 2CF5A 1ZK3A 2W2KB 4BO3A 3ROKA 5FI3A 4YT5A 3L6DA 3OH8A 1Y81A 2B35A 1BXKA 1UZMA 3P2YA 5JLAA 2PY6A 4KQWA 5EMHA 4NBTA 2FHSA 1A71A 5T6BA 4E5NA 5U9CA 1NBOA 3E9MA 4DQXA 4KUGA 2X1HA 1A72A 1E3WA 1LDGA 1IZ9A 3AY7A 5TNXA 2CNBA 1K2WA 3SXPA 4CM4A 3RUIA 2R2GA 2HU2A 3KM0A 1FXSA 1TXGA 4PGFA 1P1RA 5COBA 4BGIA 1A4UA 1B7GO 3IUSA 1BDMA 4IJVA 1DFGA 2PTGA 4IZHA 3JTMA 4II2A 3Q2IA 1MXFA 1BXGB 2A94A 4JK3A 3F5SA 1PX0A 3G49A 1PS8A 3FBTA 3FHLA 1UXIA 3S2FA 1DEHA 2DPHA 5H82A 5A4DA 1UP7A 5KJEA 1SBYA 3WMXA 4WNIA 2VHWA 4KDEA 4NNJA 4TVBA 4G2NA 4GMGA 1MGOA 4XYBA 4CLRA 2Q2WA 3DB2A 3ENNA 3K73O 4JJFA 2VN8A 3E1KA 1OAAA 3ZU3A 2C29D 4TWRA 1N9GB 3GDFA 3OJOA 3RD5A 5KVVA 4E4YA 1YL5A 4E2ZA 1BRMA 3TQHA 9LDBA 3QVSA 4TKLA 4EYEA 3FBGA 3R1IA 4FFOA 4O1MA 1K5HA 3ZU5A 2C20A 3ZWAA 1WVGA 2J5KA 2YFHA 4GX2A 4P38A 3HZZA 5KKAA 1MA0A 1NHGA 1SC6A 3I4CA 4QECA 1E6WA 5A3JA 1EQ2A 5CFZA 2VYVD 1G1AA 5COQA 5TJHA 5JW6A 1JAXA 2JFFA 3R3SA 3AWDA 1XA0A 4CLRB 1NVTA 4WE3A 1RPNA 3VPGA 3W1VA 5JC8A 1NFFA 1KEUA 2HRZA 3KO8A 4YJHA 1SO8A 2WEKA 3BMOB 3QWIA 3G1TA 2DBZA 1V0JA 3O8QB 5T8KA 1VJTA 1RM0A 1T4BA 2WE8A 1ORRA 4FSHA 2DVMA 3MZ0A 5G0UA 3I9NA 3F3SA 3GEGA 2VWGA 4FFPA 4KMSA 4I9HA 1SZJG 5G2OA 1VPDA 3KXDA 1PJBA 1K89A 4IGFA 4IBOA 5U1PA 1PGJA 4YYZA 4Y8VA 4R54A 1OC2A 1GEGA 3PWSA 4PLHA 1NFRA 5G4KB 1N7HA 4Z6KA 3UH1A 1M67A 3JD4A 2NTVA 1E1KA 1ZMTA 2IDZA 5G0TA 3ANMA 1WP4A 5L7TA 1GQ2A 3GAZA 5DT9A 4YJGA 5ICMA 3TFOA 4BB6A 5CEJA 4CM4B 4E2WA 4DBZA 1MV8A 2FWMX 3B1KA 3T4EA 1PJCA 1HE3A 4H7PA 5ENVA 3RIHA 2OGUA 5JBIA 5IN5A 2GN8A 3HE3A 1A4IA 2UDPA 3CKYA 4M86A 3AOEA 4GI2A 1GADO 2PKRA 3ZHYA 3TSCA 5I7SA 2V6MA 4JBIA 4O6VA 3ZNNA 1Y8QB 1DB3A 2BGLA 4Q3BA 3EZLA 1WZEA 4PLPA 3VVBA 4CQMA 3ON5A 3U5TA 2A9FA 1WLYA 4FDAA 5DBIA 4OH1A 1LSOA 3PHIA 1L7EA 3AY3A 2P9EA 4PRKA 1C14A 2Y0CA 4J4BA 2NQ8A 3DZIA 3AM4A 4H3VA 1JN0A 1GCUA 1UXJA 1T1RA 3JQDA 2JHGA 3D3WB 5F21A 5TLSA 4R3WA 3H2ZA 1B26A 3S1LA 4N7RA 3RUHA 1TVEA 3H5NA 4UEKA 3ZHZA 1O95A 4KQXA 1UAYA 4LSMA 1YS4A 1JW9B 2X9GA 2CDCA 1YOVB 5DBFA 1QG6A 1KERA 3CEAA 4XYLA 4LCEA 3INGA 5DNAA 5TRTA 4J91A 5JCJD 2NQTA 1NWCA 4UAGA 1A5ZA 2HDHA 4RPJA 4WOKA 4H16A 4ID9A 2GERA 4Y6RA 3H65A 3JQ7A 4FGSA 4KTVE 4OSPA 5G4KA 3AI2A 4J2OA 1N7GA 4GVXA 1IPEA 1YB4A 1LDYA 5BSHA 4KTTE 2I3AA 4J9UE 4DBVO 4I5DA 1P3DA 4IIVA 1LRLA 2OORA 3FI9A 3U4DA 2JFGA 3ZHXA 1K0UA 3VTFA 5B4VA 3SLGA 1ISGA 3IC5A 3M2TA 2O50A 2J3HA 3G0OA 4LCJA 1QYWA 4MVJI 2O2YA 1GUYA 4DUPA 3CIFA 5IXSA 1T2DA 1PS9A 2WE7A 4GLOA 1GTMA 1SCUA 2XXJA 5KVCA 1FDSA 2VYND 4W9NC 2A35A 4ZA2A 1Z75A 5L95A 5ILGA 1YE3A 2QIOA 1S6YA 1AUPA 3PIDA 1KYQA 1LU9A 4NBVA 3RUEA 3TZ6A 4IDEA 3QRWA 4CLDA 1JVBA 4YBZA 2X0JA 3A1NA 4U0KA 5F1OA 5JC1A 1PJQA 2XPCA 3H3FA 3ADPA 2NU7A 4K28A 1MLDA 3E18A 5FFFA 4MVJE 4YT8A 4E5YA 4JJGA 2ZYGA 1Y6JA 2IXAA 4J0FA 3UN1A 1H6AA 4C7KA 3KEQA 3OFSA 3JSAA 1R0KA 2AW5A 2PZJA 3VH4A 1C1DB 2D8AA 3F6YA 2GLXA 5CAEA 4WECA 2P4QA 1HDGO 4HADA 4CQLA 1UP4A 4IPTA 2DTXA 3WNQA 4BL5A 5GZ3A 2P9GA 3L4BC 4LVCA 5JYDA 2DPGA 4E13A 3KYDA 1EBFA 3HFGA 4WKGA 1PQPA 4RZHA 3ZI0A 4CL8A 5DZSA 2X23A 3GZ4A 4LN1A 2GO1A 2NV6A 1GUFA 2GN9A 1ZSVA 2FRDA 2NNLD 2ZIZA 3I6QA 2NSDA 4J0EA 4Q3NA 2E37A 3INTA 5FF9A 3WG9A 3JQAB 3KZVA 4BMSA 4DA9A 1F12A 4G65A 3BMQA 4DREA 4B7CA 3DMTA 4HWKA 1XDWA 2J8ZA 1VSUA 3DAPA 3WNVA 1EFLA 1GFSA 4Z9XA 4I1IA 1HE2A 4ND1A 2VNSA 3JQ8B 3BMOA 3LT0A 1ADBA 3UHAA 4DTIA 3U09A 1GYPA 3V5NA 3JYOA 3OJFA 4OIMA 1LX6A 1WNTA 5A9TA 2VT2A 3OSUA 4IS2A 2VYVA 1DC5A 4WLNA 4RVHA 1EFKA 1F17A 4YAGA 1AXEA 2NTNA 1XQ1A 9LDTA 3U0BA 1D8AA 2EKLA 3RUCA 2X4GA 2P68A 3WQQA 3OHSX 1KBZA 4YAKA 3ZV5A 2AXQA 3I5MA 1N92A 3JYPA 3Q11A 2Y0DA 4FJ2A 1WZIA 3VZSA 3H7AA 4J7UA 1DC6A 3TOXA 4RPKA 1GDHA 1LUAA 1ZKMA 4GAEA 3GHYA 5F5LA 1XLTA 3JYNA 4R3NA 4EDFA 3DHEA 4UEJA 4XQGA 1H2BA 1ISJA 4XRGA 5H81A 1LRJA 1VC2A 4N5LA 3I9OA 1VM6A 5KOIA 4YRDA 4ZN6A 2FPIA 3RFTA 1ZO8A 3WGYA 3IP3A 2DTDA 3DZGA 4PVDA 4Y6SA 2GZ2A 1U2DA 3OQ6A 3PDUA 5T57A 1X0XA 5IZCA 1KC1A 4BIIA 3UUWA 1Q0LA 3O03A 1YBVA 1XCBA 3WXBA 1LRKA 2NUAA 2GDZA 3DOCA 1UR5A 2WYUA 4OQYA 4QFCA 1Z82A 3GG2A 2GYYA 4RF3A 1LJ8A 3IUPA 1CIVA 3DQPA 3GAFA 3GK3A 3OP4A 4UUOA 2ZYDA 5DF1A 3KYCB 1B8VA 2TMDA 1CRWG 4J90A 3JYLA 5G0VA 5TJ9A 5CHEA 3TN7A 1YKFA 2VOEA 3JQ9C 3HWRA 2X0IA 5MGBA 3PDJA 4J9VA 4YT4A 1GPDG 4LMRA 4TQGA 1I0ZA 5TF4A 3QP9A 1NAHA 3HB4X 4ZQEA 4EJMA 2C5AA 1BSVA 3Q0EA 4GQAA 3RBZA 4ZQGA 2Y1DA 3JD0A 4BNHA 2BGKA 2R6JA 5JY6A 3DMTC 3JV7A 3U3XA 4ZQFA 2B4TO 4EEXA 4A26A 2BHLA 1B14A 1HETA 4NHEA 2HO5A 3AI1A 2YDXA 2W2KA 3RBVA 3F4BA 1H94A 3COSA 3W8FA 1F06A 3GNSA 2HK9A 3ZU4A 4LW8A 3ZNPA 4FOOA 2XF8A 4L74A 4XR9A 1ENYA 1Z45A 2I5PO 3PJGA 4J1SA 5U4QA 4BKPA 1P1JA 3HHPA 4OXNA 4WK6A 4DC0A 2J5QA 2EF1A 3WTBA 4CM8A 3RC1A 4IDFA 1E3WB 1M76A 2ET6A 1TT5B 1R16A 4L76A 1ADGA 3BMNB 1M75A 1KS9A 3NKLA 1QV6A 3DBHB 2FR0A 3CTMA 4D41A 5KCZA 2UVDA 4DYDA 1NX6A 2C7GA 3EUWA 2JL1A 3DAGA 4DWVA 2O7QA 4B7UA 4WEOA 4B8ZA 1EDZA 5L4LA 4OO3A 3SC4A 3IS3A 1U9JA 2QHXA 3RUDA 3RUFA 5AXBA 3D4PA 3WB9A 1N1EA 2UV8A 5EINA 3I9KA 1MC4A 1EUZA 4OHUA 1CQJA 3PJDA 3WSWA 4EBFA 1PIWA 1M6HA 1BG6A 2BFPA 4XR4A 1ZIDA 2DC1A 2ZTMA 1SOWA 2JD2A 2OZPA 2HUNA 3PLNA 4INAA 4F45A 2RAFA 3EYWA 4TSKA 3HJAA 7ADHA 1QRRA 5LDHA 1A7KA 3U9LA 1JTVA 4QQRA 1CF2O 1FDUA 2WMDA 1GYRA 5GMOA 1ID1A 3SJUA 2YW9A 2HLPA 4FN4A 3BMCB 1JA9A 3VHRA 2OHXA 3GGOA 2YDYA 1DHTA 1WPQA 1CERA 2AQIA 4EUEA 4W7HA 2CUKA 3GC6A 1NPDA 5BSFA 5DULA 3WGGA 4J1NA 5DN9A 4BNXA 2EP7A 4RQTA 1MUUA 1PJTA 2HMSA 3GG9A 1UAGA 3A06A 1GYQA 3GF4A 3ICCA 3NX4A 5T67A 3NJ4A 4BMVA 4R68A 2E49A 1HE4A 3WLFA 4MVJP 3WWZA 1T1SA 1ZJZA 4LGVA 5I9NA 1I3NA 5TX7A 1LI4A 1G0OA 2W90A 5KTKA 1UDAA 3WLEA 3BMCA 4XIYA 4ESOA 3WMWA 1DOHA 1PGOA 3DZJA 3I4FA 1I32A 3TJRA 1QYVA 1SPXA 1UH5A 4M1QA 1R12A 1EDOA 4D3FA 2ZK7A 2PH3A 5ICSA 3DBLB 2C59A 4J4HA 2B37A 4MIEA 4Z9YA 3LU1A 3LT1A 2PFGA 4DPKA 1NVMB 3K31A 3UICA 5HM8A 5TS3A 4DPLA 1ENPA 1EVYA 4AJHA 3AUSA 7MDHA 4XKJA 3D3EA 3TDKA 3KYDB 1ZK4A 1R4MB 1L7DA 2VRCD 2YJZA 3GGGA 4K9DA 3ZV6A 4CM6A 1LLCA 1W6UA 4BNZA 3U49A 2BGMA 5JFOA 5JPIA 4QEDA 3F5QA 2VZ0A 3CMCO 3I9JA 4ZU3A 1DRWA 1TI7A 5KVSA 4A27A 1IUKA 3RC2A 4Q3CA 4O0LA 1WDMA 4Z3KA 3NRCA 4HY3A 1VL0A 4YRAA 3QA9A 4ND2A 4MIOA 2OXIA 1XGKA 4OQZA 3IAHA 4BB5A 5IFLA 2BH9A 3SVTA 1XU9A 2X5JO 5CDTA 1ZEMA 3ASUA 4RVSA 3VKUA 4W4TA 2VWQA 1GAEO 1CWUA 2GR9A 3DWFA 3K2BA 1LDBA 4IDGA 2TMGA 5DCYA 2X0RA 1AN9A 2BFAA 1E7MA 3D5QA 1Q7BA 1V9LA 5F5NA 2UUPA 4BKOA 4PN3A 4B3IA 4ZD6A 1MP0A 1RM4A 2H5LA 4Y6PA 3AJRA 1KY4A 1HTBA 3PXXA 1HYHA 3UCEA 1DLJA 1CEQA 2NM0A 4RORA 1ONOA 4CMJA 4CM1A 3KETA 2PZMA 4EEZA 3PFFA 8ADHA 3QY9A 3QVTA 2HK8A 1U7TA 3MJ4A 3RC7A 3NT2A 1PJSA 4EGFA 1X1EA 4NJMB 4FFMA 3OETA 5L51A 4YB8A 1UZNA 3VDQA 4ZHSA 2YV2A 3CXRA 4IM7A 5IAAA 3V1YA 1O9BA 1PJ2A 3GPIA 1BVUA 3ANNA 2NVUB 4WLFA 2Z95A 1ZBQA 1QV7A 4R1NA 4B4VA 2EJVA 4J1QA 1P74A 4JJIA 4DIFA 3VPXA 2Y1CA 3DBHA 4W82A 2VHYA 5HWSA 1IULA 2PH5A 4D7AA 3OBBA 3OEYA 1Q1NA 3RUAA 1Y7TA 4L73A 2GUGA 4TKMA 2QZZA 3AM5A 4MKRA 4A73A 2BLLA 4FIZA 1KVRA 3DAFA 4UUPA 3E8XA 1R6DA 4J1TA 4BO6A 4DRYA 3H9EO 4ROSA 1LC0A 3CSDA 1O5IA 4L9RA 1VKOA 1ZXBA 1IHXA 4CUKA 5CDUA 2OL4A 1S7CA 4MVJD 1GD1O 3RWBA 3V1TC 4D46A 5JO0A 2Q99A 1PZEA 4MKXA 3NDIA 1OZAA 3HADA 4GKBA 4PLFA 4TZKA 5GZ6A 1V6AA 4YAJA 1Y5MA 3VPHA 5CDGA 2NADA 2FPPA 4YPOA 2Y67A 4L4RA 5DP2A 1E3EA 4MP6A 4PLWA 3ENKA 3DZBA 3HDQA 2GZ1A 1M66A 3L6OO 3VZPA 1U3VA 5DCWA 2VWPA 2Q1UA 1NFQA 1E6UA 4HV4A 4KWHA 1I24A 4MVJG 4ZRMA 1T4DA 3MJTA 3TWOA 1NWHA 1GZ4A 1OMOA 3LQFA 1XIVA 4EI2A 1TEHA 2FPGA 3QVXA 4JGBA 3PPIA 3PJEA 3RJ5A 2RH4A 3MJEA 3WGZA 3PFWO 5BNFA 4DIBA 2OFPA 5KJ1A 4R51A 4R5MA 3E6AA 3I9LA 3PEFA 3X2FA 4JXKA 4RLSA 1NAIA 4JIGA 3V1UA 1E7RA 3F46A 3ZGYA 2ZTLA 4DL9A 3E82A 2D5AA 3GFBA 3W4JA 2AQKA 2OP1A 3GVHA 3CH6A 1P33A 2I65A 3LF1A 4KOAA 2E4AA 2RIRA 4KUEA 5FEUA 3BXXA 2B69A 1V8BA 1W4ZA 5AOVA 5ES3A 1GEEA 4D43A 4DXHA 3FTNA 3RAJA 1NQOA 2NVUA 1W0CA 1C0PA 1W73A 1ZK2A 3DZFA 5H83A 2V6BA 5EPOA 3NUGA 5B12A 1CDOA 3QWBA 4XRRA 4PG8A 2OO5A 2DQ4A 3PGXA 5COAA 1GUZA 4IJWA 3UF0A 5JMWA 3FN4A 5FI5A 5I8WA 4K1LA 4PG5A 4Q9NA 3DBLA 1MG5A 2OOSA 1ZSYA 4BO7A 4IQGA 2J3KA 1M6WA 1V35A 1Y8RA 3EVNA 4E33A 5I9LA 1PJLA 3B1JA 3DEYX 4RPGA 2QRJA 3HN2A 1PGQA 3O4RA 4RVUA 1YRLA 4XCVA 2X0NA 3GFGA 2QZ9A 3AW9A 1PL7A 3INRA 5THQA 1PWZA 1FDWA 4Q3AA 5I9MA 5CDSA 2JCYA 1LTHR 3BHIA 2CF6A 3B70A 3MEQA 3OJEA 4UUNA 1EQUA 1T24A 4HNGA 3MWDB 5JMPA 1U8XX 1QLHA 3QVOA 3JQBC 3UXYA 2C2YA 3OQBA 3ZV3A 1F8GA 1ZSNA 3CUKA 4DQUA 2EV9A 3ICPA 4P4NA 1YJ8A 4J6FA 4DVJA 1NNUA 4OXYA 5I7EA 3VKVA 4U6QA 4RGBA 1DXYA 4PRLA 3C3XA 1YJQA 5JAIA 2GN4A 3GQVA 4I5GA 4PZDA 1H6BA 4J7XA 4O5OA 5JY1A 1IB6A 1HDXA 1YL6A 2BF7A 3KUXA 1D1TA 4UVHA 1EBUA 3WIDA 4CLOA 3RASA 2P5UA 5I7FA 4BGUA 2I6TA 5ILOA 1HSZA 2V6GA 1QSGA 3FCOA 2X5KO 1RYEA 3ETGA 4AJEA 5IDYA 2QX7A 1IYZA 3GLQA 1E0DA 1I5RA 3AUAA 1J5PA 3KB6A 1U4OA 4MOWA 2AE2A 2DTEA 2O48X 5K6AC 3A14A 4JNKA 5AXCA 1MX3A 3UVEA 3ULKA 1QXSA 1ZMOA 4OL9A 2DT5A 5B1YA 5IDQA 1EK5A 4FC6A 1ZK1A 2YZ7A 1E3JA 4AVYA 3EMKA 4XGNA 3O38A 4IUYA 3V2HA 3UGKA 1YDEA 1I2BA 2PZLA 1UXKA 1O94A 3D0OA 3FNFA 3WGQA 3VPSA 4E31A 3FNEA 4HX5A 4R69A 5A3VA 3BYZA 3LLSA 4B3HA 2PGJA 1K6JA 4CMHA 2I76A 1GPJA 5L40A 4E32A 3S2GA 3DO5A 4IGEA 4GL4A 3NDRA 4DLLA 3RU9A 2AHRA 4RZIA 5A9SB 4BO9A 5LC1A 1HT0A 3AUUA 1JDJA 3RJ9A 3VC7A 2IXBA 5A1TA 3F1LA 3RCBA 4BO0A 5BT9A 1ZH8A 4D44A 5L53A 1GL3A 4OAQA 1U8FO 1E7YA 1Z7EA 2IZZA 2X6TA 1BVRA 3GNQA 2EKQA 4WCDA 1DJQA 2GASA 3V2UA 1LXCA 4FS3A 1HKUA 4CM9D 1EK6A 1NPTO 3DOOA 1X13A 1R4NB 5A5FA 3BIOA 3GGPA 1DJNA 4WASA 4MIYA 1I8TA 4E0BA 1HYEA 4BNJA 1NP3A 1QMGA 3JQ8A 4XEHA 2B83A 3E9QA 4W99A 1FJHA 1A7AA 2BMAA 4MP8A 1ULUA 4IY1A 2WJPA 1Z74A 1ZCJA 3TFQA 3A4VA 1D3AA 1WW8A 4ZRNA 2VT3A 3JQEA 5L7YA 4CLXA 5K9ZA 3IKVA 3PZBA 4NK5A 2YV1A 1HWYA 3WIEA 5KNLA 4PZCA 1HXHA 5L4SA 2BFOA 3JQFC 4LMPA 3DFUA 2EGHA 3JQ6A 1L1FA 2ZCVA 1PSDA 1YBMA 4E5KA 3H9QA 4YJGB 3PQDA 4TVOA 3WJ7A 1ZUD1 5ENDA 1QLJA 1J49A 2I67A 3N74A 3KTDA 1OFGA 2VHVA 3GT0A 3I52A 3KSDO 3DFZA 3OM9A 2B5VA 1F0YA 2IZ1A 3WQSB 1DC3A 4BQPA 4BQRA 1Q0QA 4JX8A 1Y8QA 3JD2A 4KDFA 3TPCA 2GD1O 3ZWMA 4XIJA 1SNYA 3JYQA 4R01A 4D3SA 2EP5A 4D0RA 2AEFA 5DDIP 1SOVA 4WPGA 3ZV4A 1V3VA 3ADOA 5KJFA 2ZB7A 3H2SA 3LZ6A 3WFIA 4WLEA 2Y1EA 3WBBA 4DYVA 3HN7A 3O26A 1GV0A 3KRTA 4GH5A 4CV3A 4D79A 1DDOA 1O8CA 2Y1FA 3VVCA 3WGTA 4CQMB 3H8VA 4XYMA 5HA5A 1XHLA 4DGSA 2WM3A 4NG5A 4BNYA 2B5WA 4ND4A 3H9JA 1EVZA 4A2CA 4E3ZA 1Y9EA 4NPCA 2H1SA 4PCVA 3G17A 4U6SA 2GZ3A 2WTBA 4GWGA 4DC1A 5C7LO 1BGVA 4FOSA 4L75A 1X7DA 4QX6A 1P9LA 2PLAA 4TRNA 3PQFA 4AJJA 1UJMA 5T8KC 1Q7GA 3T4XA 2G76A 3WX0A 2EXXA 1I2CA 1LDMA 5TSDA 3FPCA 3FWZA 3GPDG 3JQ7B 3IL2A 4CM3A 2G0TA 4EITA 3C24A 5CP8A 3G3EA 4GX1A 5IF3A 4LVUA 3KV3O 4QXMA 5JYEA 3TZQA 4EW6A 6ADHA 1Z6ZA 1LBEA 4QT0A 4M49A 4LISA 3S55A 1MFZA 3U4CA 4CMEA 1RKXA 1YL7A 1A9ZA 2P5YA 4RF2A 2W2LA 1XR3A 4XWYA 4LK3A 1LNQA 1DSSG 3PQEA 2SCUA 3OECA 1AHIA 1XWFA 3S8MA 1O6ZA 4UVIA 4BOYA 1JWAB 3ORFA 3EW7A 3KSUA 3WTCA 3BMNA
chains in the Genus database with same CATH superfamily
3EAGA 3OZCA 2XOEA 3MRXA 2NZ2A 4JBNA 2V7EA 2FGJA 4B76A 1BYIA 1D2MA 4CQMD 4RAOA 3HXLA 1U1FA 3FSGD 4M0PA 2V59A 1YI8A 4QBFA 4ZI5A 1O96B 3TTSA 2HAEA 2QTZA 5L4NA 1O2DA 1VL8A 3D6UA 3M5PA 3IURA 2FE1A 3VSCA 3PEEA 1UPTA 2ZIEA 4DCVA 2E82A 3KZNA 5AVOA 2ZQZA 1UJ5A 2W4QA 3ONFA 4O5AA 2WIKA 3H9BA 4D82A 1L4UA 2I99A 2F3UA 5JDCC 4CV2A 3CHYA 1P1IA 2WU1A 4KSBA 1DOZA 5JTTA 1FB5A 2J08A 3COVA 4S04A 4C0SA 5GONB 2XE6A 4JI0B 4KE8A 4MVJM 2OLEA 2OZVA 4R1TA 3WR5A 1W2WB 4F3YA 1MX9A 1JG2A 4PLZA 1G66A 1M9NA 3GJRA 3OM0A 4IIJB 4XDZA 5EUCA 4JQYA 1C1DA 2XMZA 3HQ4O 1D09A 1BO6A 2WD7A 1YDWA 4ZO7A 4ONEA 1J2JA 2JEYA 2VP5A 1Q1EA 2VDRB 4WA7A 3JASB 1VTKA 1XK6A 4IIEA 1NY6A 2JBAB 2P6OA 3DEHA 2PSJA 1UBLS 3R8CA 2JJ8A 1XEWX 3FNRA 4F7WA 3VJRA 1YNOA 5H3HA 1FDTA 1L5WA 2G71A 1AV7A 3H4MA 2LD4A 3ZDQA 2VDUE 4GWKA 1KVTA 1T34A 3DXXA 2QRLA 4PSVA 4DBLE 1LNSA 3WRYC 1MJGM 3NGXA 5B3LA 5K0ZA 1JHAA 1JDTA 4OUKX 1IHOA 3EDMA 1P2GA 3ITEA 4H6PA 5ESWA 3V2IA 2PZFA 1V45E 1VCHA 2BFFB 2ZIWB 4PLYA 1SK9A 4O4JF 1SHLA 2BBSA 3GIDA 2FKAA 3OD5A 4J2HA 3SS9X 5C81A 1GIAA 2X4DA 2C4WA 4WT7A 1YJAA 4NZ9A 3TCXB 2B9VA 3EPKA 1H6DA 3LP6A 3ZW8A 1R4NA 3ABZA 4G36A 1L7AA 2YYAA 4K0KB 3F5MA 4PC7A 1K5PA 3IEKA 4O33A 2AC4A 1KU6A 3BF7A 4C0JA 4D9BA 4LRXA 2FOLA 3HXMA 3NMUF 1M5UA 4KBFA 3PR2B 4PYMA 3WRXA 2DLCX 1E32A 3WWYA 1Y3DE 1RXVA 3GLTA 1QIJA 3OJ0A 2TRSB 2WTNA 3HWSA 3A4TA 3FLMA 4P7KA 1DIHA 2P65A 3IXQA 4L27A 1IPFA 3RRFA 3M6VA 1ZNWA 1VXRA 1W76A 2J67A 3HL0A 3VSAA 4ALNA 3OWXA 1U3WA 1AKUA 1F1BA 4BVFA 3PWKA 4N9WA 3VKGA 3DVAA 4FYHA 1G21E 1H0SA 3RS8A 1E2MA 1MPXA 3ZU2A 2H4JA 1JKFA 1EAMA 2OP0A 5GJBA 1A2OA 3RYFB 4O63O 3ESXA 2OM2A 3NHKA 1P5RA 1OY1A 1UC4B 3DR3A 1HZJA 4CMCA 4GHWA 2O3TA 3IGFA 2QI9C 3LLVA 4RS3A 1M0WA 3EQ8A 1JNYA 2IXFA 1P19A 3A3YA 2CVZA 3R9XB 2VK8A 3LUHA 1W46A 4D8VA 3BL5A 3T06B 3GCGA 4GR9A 1I7LA 3CPHA 4WKPA 2A1TS 1T8PA 4F93B 2B8EA 1U7XA 4CR8A 5HOQA 4GSLA 4X41A 4KG7A 1NUPA 3GA7A 2E4UA 5H9VA 5AM0A 1MO5A 1XELA 2OBBA 2R79A 3HJCA 5ITWA 2B9EA 4QLOA 1CV2A 1R0XA 1U2GC 3PP8A 3D02A 3PQ2A 3ACDA 3PGVA 1SG6A 2YYYA 1CUGA 3JQCA 3O8LA 4PQEA 4B3JA 1RCUA 4L2IB 3AM1A 4DANA 3QSGA 3A9RA 2I4OA 1W75A 1GV1A 2H54A 3AKYA 1YQTA 3CRNA 1IE3A 4TMWA 1GT6A 1HLDA 1I2DA 4HDSB 3M82A 2WHXA 4K6GA 1Z63A 4B47A 1FZQA 2BJHA 5BYJA 4PYQA 1C9EA 4OQPA 2EJWA 1NP7A 1T10A 2QIPA 4Q3OA 5B3KA 2CVFA 3C16C 1D1SA 3K6SB 4MA0A 2D3TA 1XVUA 3BBPA 3DOJA 4EHLA 3EWIA 4PO3X 1J6UA 4LYJA 3SQLA 1YZYA 3RFVA 1UPXA 1FOEB 3FOBA 3HWWA 2DU8A 1EVKA 3VTZA 4FWTA 1KMMA 1RI1A 2RI0A 4JBWA 4NH4A 1FDOA 2O23A 4EQ6B 1JYSA 4KGDA 3URKA 1E9VA 3FPAA 2ECFA 4LGYA 3MBIA 4DNFA 4IIJF 4EBBA 3VR1A 3OCYA 2TECE 4NVRA 4YAFA 3V80A 3MS4A 2A5YB 1NU8A 3W7VA 3EZ9A 3K9HA 2H1WA 4UD6A 2QQ5A 3OMLA 4AS2A 3PHGA 3I61A 3WZMA 1RKBA 5GONF 2V7UA 4U7TB 1Y5RA 4YCSA 4B2YA 4X1YB 1JUDA 3PPWA 2JJ2A 2ZJ1A 3L6BA 2FJPA 3AERA 1M6VB 4YA6A 4MUYA 4BN4A 3ESQA 5KQMA 4F8JA 4O1HA 3ZWNA 3TB4A 3MPUA 2P2GA 4QG3A 5JQWA 2DUNA 2QM0A 3UK7A 2MMGA 1EUCA 1RXCA 3JQPA 2P7HA 1NGSA 4HTFA 5DXAA 5JD5A 1PFGA 1TIKA 4GYYA 1HEUA 4N3CA 5IYZB 1VYUA 4HH0A 1RLUA 1XAJA 3PFKA 4C4OA 4DZRA 3ROTA 1N0WA 4LV6A 2ZRHA 2C57A 4PTLA 3IDAA 1TB4A 4IQFA 4UTOA 4NFYA 2HMTA 1A8SA 1HMYA 3AJDA 2GLUA 4JUDX 4QAQA 4GDMA 1T3HA 3NNNA 2JAUA 5JXWA 4DBVO 5JTUA 1Q2XA 2F4VB 3SBXA 5KCMA 5BT8A 4M1TA 4DIOA 3CW2A 2BFBA 3TG2A 2VJKA 3QQPA 3OLQA 1NMEA 1LV8A 3WYBA 4LSWA 4WEQA 3HCDA 1E3QA 1VI5A 2AQ8A 4KIUA 4TSFA 4TXJA 3T7RA 2K7FA 4DB4A 4AF7A 5AHWA 2VF7A 4X64B 4ZDKA 2P9JA 5D3ZA 5CFOA 2YN4A 1WTCA 3KWMA 2CFTA 2J6CA 2DWUA 4TLBA 3V00A 1JKIA 3VSBA 4QARA 3QPDA 3MBOA 4R05A 3HO1A 1UANA 2YJ6A 1YR9A 1H2AS 4K05A 2GXUA 2FR8A 3D1LA 3K6SA 2BGJA 1Y1QA 3NXSA 3N0RA 1M2HA 3Q5GA 2VDKB 4KMOA 4X95A 3WGUA 3MMNA 4PQRA 4IX9A 4P5PA 1WMBA 2G5GX 3EFOA 3JQAA 2IDMA 1EA7A 1O95D 2R87A 3KVOA 3PI7A 5GZ1A 3WICA 3H8WA 3VOAA 1U0GA 2FUG6 2FN7A 2R7MA 5LBTA 3GX1A 4X20B 3PQ6A 3VH2A 2HF8A 4CMEC 1NT4A 3P8ZA 1COWD 1XKXA 1L5VA 2TMKA 2WI8A 3W4IA 2J09A 3LPDA 4X7MA 4ND7A 2H1LA 2HNBA 2PQ0A 4AFNA 1DAPA 3ZD8A 3H18A 4II3A 5IKXA 1W5AA 1TO1E 2E9SA 2IT1A 3EEIA 3M6AA 2PR2A 2E48A 4HN9A 4KW7A 5D6OA 1B6SA 5IC6A 3S27A 4KPUB 4YK7A 3FR7A 3I0MA 2II6A 1PGPA 4G1VA 1ML3A 3OA2A 4IQ8A 1LPNA 4NU0A 4BVBA 3C0KA 4ZQBA 1BMFA 1NRJB 1S8AA 2ZB4A 5IVHA 5HZHA 2EFEB 5JI3E 3FYDA 3R6DA 3NBKA 1H69A 1E6LA 2PA3A 3O2SB 5BXQC 1XN4A 1JHXA 1E5DA 4PNPA 2NAFA 3CZPA 3NAMA 4RMJA 1PL0A 3V2GA 2CYAA 3H3JA 3RC8A 2QX4A 1JJVA 1JIIA 1RWQA 3DW1X 1GNSA 3K0AB 5HVNA 4DQKA 1T9DA 4IVNA 1DRVA 4HWSA 4GLLA 1HI9A 5GM2A 8ABPA 5KHOC 2DWQA 2ZM6B 4JI8B 2YFQA 3BAZA 4ZQHA 3RIXA 4DMMA 4LDNA 2ZDGA 4F84A 1E94E 2L82A 4WZAB 3CZMA 4IDOA 1VE1A 3GP3A 1PP4A 4R1SA 1OZGA 1T2UA 3TIFA 3E5NA 5CVEA 4MUMA 5F64A 3IKLA 2HXSA 2FG7C 3U9TA 5FOQA 2XUFA 5IN4A 2FPIB 2W98A 5EJMA 1TM3E 3NIWA 5DYIA 1XKQA 4D0SA 2CJWB 5AD1A 1DWUA 1FK8A 3BUSA 3EOAI 3UWPA 3VJLA 3MJDA 4EF4A 5K99A 2JRCA 2UYOA 1X7WA 4YAIA 3R7DA 1ZIPA 2JFOA 2GX6A 3FKSA 4ARBA 3OCXA 3EGVA 2IH5A 1CU1A 1KAEA 3WDKA 3O74A 3GGDA 3QUTA 1P75A 2F59A 2FKNA 4F46A 4XZ3A 1Y34E 2EKPA 3HSYA 2XGMA 1XDSA 4BV8A 4CR6A 3DNMA 1BEEA 1TAHA 1ZM9A 2VJOA 4MRNA 3WYEA 3O31A 4A8JA 2X42A 1N6PA 2JANA 2Q2OA 4FPXA 4PXYA 1RE1A 2AOVA 1RI3A 4Y2HA 4LHXA 1R5OA 3F97A 4DN6A 3A9WA 4PZ9A 1EH5A 1I30A 1PG2A 2JDIA 1I1OA 1MEOA 4H3KB 4G24A 4LYAA 3GLGE 1EVQA 1I10A 4GKKB 2UAGA 4Z4EA 2C1ZA 2M32A 2XDWA 1N2CB 1C0IA 4N39A 4PLCA 1BTOA 5JS6A 3ESCA 5LYJF 1GQYA 3HCFA 4GOKA 3VR4H 2FPGB 3FRJA 1Z7YA 3GZNB 1PEYA 2FOXA 3UAGA 4X94A 3K1YA 1Z3IX 2O1WA 4NU8X 3VMFA 3OEED 1T8WA 3ZQJA 3KJNA 4WI1A 1DAIA 1TCVA 1UOPA 2F62A 1R74A 3N8DA 3T3IA 1K6XA 4HFJA 3KYIB 3PUHA 3NOQA 1NBME 2GK6A 4R9RA 4G5OA 1G3UA 3E9DA 4AZ3B 3DLBA 3TZCA 3TZKA 2HHAA 2N1MA 3IYLW 2HNAA 4LY6A 4QEKA 3VM6A 3W1WA 4XGQA 2QRZA 1JE0A 2ZANA 4FEGA 2JLZA 5G1OA 2WMYA 1J4AA 1GTZA 1XU4A 2Q3HA 2SKEA 4N5MA 2AYYA 2P0EA 4BHTA 3NHBA 4BVKA 3D0QA 4EY8A 1NU6A 5D3KA 2OC9A 4DJDC 4ZAWA 5EPEA 1ZOLA 3IOYA 4UHCA 3ROGA 4EG8A 1F4LA 4LX8A 1B16A 1N2JA 3QW4B 5EP4A 2VUTA 3HBJA 3KUCA 1XN1A 1OBFO 4OK5A 3I05A 2QTLA 4JFRA 1MB4A 4WXPA 5AI8A 1TAUA 4DC1A 3PYMA 2FFQA 4HLQB 5E0OA 2DUUA 2Q28A 3LT4A 4C22A 1XXHB 2EX1A 4ZV9A 1ID8A 2EW8A 5LIRA 2HSZA 3V1KA 3K8ZA 4Q9IA 4MPRA 4CCAA 1I94B 4EY4A 5G1PA 5C8ZA 2P2CA 3MCTA 1X2BA 3VI4B 4L9AA 1BE8A 2BI8A 3MOSA 4N18A 3NJ8A 3UUGA 4P5EA 1G8GA 1FZTA 2H1RA 4EY3A 4ZKDA 2FSVA 5EHQA 1HZZA 3RRXA 5A6VA 1WPRA 3TMYA 2JZNA 2QUBA 3GELA 1PJ4A 1HDOA 4KLRA 3FXAA 5CLIA 1QQBA 4PO9A 3H2HA 4EJ6A 1V7CA 2FQQA 4JB3A 5JROA 2Y0BA 4YC7A 3EIQA 5DT2A 2XHZA 4O2BA 5H02A 3GLFB 1GJRA 2X9NA 4C7MA 4F71A 1G3IA 3T5TA 1J0DA 5L45A 4CEJB 4RPIA 3P9KA 1CVRA 1ONPA 2Q2VA 1ABBA 4FGJA 4CMAA 3ZN2A 1HL3A 3CRRA 3PHJA 3QXHA 2PL5A 4C03A 4YX9A 2X9LA 1AXGA 2CVHA 1GN9A 3CLTD 2Q3DA 2R8YA 3CUUA 1YR7A 2IEAA 2RHCA 3OPMA 4E2XA 1CUDA 3A58B 1TEZA 5I9TA 2H1CA 4XJTA 2ZRDA 2ZU0C 4FYPA 5EA2A 1QYXA 4D8XA 5K2MA 1QKKA 2P1DA 4O4HB 4A0HA 4QGHA 3NHUA 1OHHA 3O8CA 3IJRA 4RY0A 5B1IA 5LMUB 1M6EX 4ZYLA 3BK1A 4H4CA 3PZRA 1EMDA 4QGAA 2W9XA 1YKGA 3QOWA 4XB1A 2X22A 1EG7A 5G3YA 4M87A 4U7DA 2FU5C 1RPJA 3L9WA 1WCXA 1ZJ6A 3OIVA 3CF0A 1ZFNA 2WFLB 2IE0A 3H1FA 3ETHA 1L7VC 1CY8A 3WGKA 1X9IA 2O8FA 4XDHA 1RXIA 1A96A 1E7WA 1DKPA 1M2WA 2CBXA 3N2YA 1TLTA 4G86A 4NI5A 5DWQA 4BVLA 3VI3B 3K05A 4MQ4A 4WADA 3DYIA 4BQEA 1WZ2A 4N3GA 3FWNA 1X87A 3BREA 2G9QA 1OBHA 4BQFA 3N86A 3E81A 1OF1A 2WABA 3Q6IA 3RVBA 3OVMA 4PX5A 4Q12A 4XQ9A 5FNZA 2Z6AA 2PJRA 2RHDA 5JAQA 1OLUA 5H3CA 1DV1A 1YMQA 3CH4B 4ZAYA 2JJ1D 3E9NA 1JFTA 2JKZA 3IJPA 4MINA 1G5IA 6CHYA 3NIGB 4FX2A 1FUYB 4UREA 1YRYE 4EJFA 4CKEA 3C85A 3MELA 3OQPA 1EM8B 4E11A 1YBFA 3L07A 4X63A 1QRSA 4XB2A 3TL2A 4C08A 3D64A 4XUDA 3F0TA 1BHJA 1QR6A 1KARA 4AP5A 3B3JA 4ZFNA 1SXPA 1L9XA 1QAMA 1PNVA 2KI5A 2OPBA 3A2KA 2KLHA 4PG7A 1Y4DE 2G3YA 3F71A 4KAJA 2V58A 5EG5A 2PVSA 3M83A 2OQVA 2ZKIA 1O7JA 2GZRA 3ANTA 5I9IA 2IOFK 1GZ7A 1YQQA 3B7PA 3C5HA 1EWTA 4ALJA 1SXQA 2PS0A 1JG7A 2AX3A 3HC7A 3MLAA 4H35A 1D03A 2HW8A 3NV7A 3G9QA 4FD2A 1GTVA 1EVJA 1QZ3A 3OC6A 3VOSA 5JZ9A 2HMAA 4Z9BA 4IR7A 3PFHA 3WK8A 4GP7A 2GQ0A 3RS5A 3L41A 4BO2A 4ZOAA 4ZJUA 3PQCA 1OH8A 3WSVA 3SQMA 1R9MA 1YRWA 4YRZA 5HJ5A 4D3XA 5LZ8A 4COKA 2OHHA 3OZGA 1RXWA 2EG9A 2L69A 4Z9FA 1IN4A 1Y42X 4JP2A 4H77A 3AOGA 4ND8A 5CLQA 3DJFA 4PC6A 1UPFA 2Y1GA 1KR5A 4OPMA 4F5EA 5LP6B 1GWNA 3I23A 5G3ZA 4MDEA 4YCLA 1TIPA 1XLWA 3N58A 3GGSA 2Z57A 3Q3GE 5IFKA 2VJLA 3B5EA 2Z5VA 3OQHA 4Z1MA 4BV9A 4YLEA 2WICA 3IB6A 3G8AA 4POAA 3EF3A 2JAPA 4XYLA 1JEOA 4HGYA 1Y33E 3I34X 3MMZA 4G0VA 5H8WA 4FQ7A 4WCFC 3ZGYA 4E30A 3WGLA 3LW7A 3E23A 1GZVA 4XWGA 4EW2A 3CYFA 4JP3A 5BN5A 2EGUA 3HEMA 3ILXA 1V16A 1PZFA 3HO8A 1WVMA 1KMHB 1W35A 4WUVA 4ZICA 2FLVA 4M0FA 5EVJA 3BMQB 2VQ3A 1JKJB 1XZFA 4JC0A 4MJLA 2PGOA 4Z8XA 4DJAA 1I0LA 4QDKA 3QE9Y 4UCWA 1BJTA 1WDTA 4H7IA 5CFRA 4LDQA 5LP6A 5NLLA 5AI4A 1PLLA 1TVCA 2YIJA 3LQRA 1T6YA 5EQFA 2GESA 4JJAA 2VTBA 3WB0A 3A28A 1VHDA 1V5GA 1N2CE 1L5OA 1UJBA 1U2RA 2ZQYA 2A92A 4II7A 1TRHA 1R0LA 4K3VA 4LZWA 2F1KA 1J07A 2G6BA 4AUEA 1N57A 4KQFA 4JP1A 2GRAA 4BFXA 3O1HB 2NU9A 1RAIA 3GVCA 2K87A 3GR6A 4HAVA 4RC9A 4QYSA 2OBYA 3DW3X 4N5NA 3AW8A 3EVBA 2Q3BA 3K9QO 1LVUA 2WTXA 3SHQA 4N5DA 4F4FA 3CPSA 1Y7IA 5ALMA 2YZNA 2CJWA 2X77A 4LGMA 4Q00A 4JI7B 2A0UA 1XO1A 1HFWA 1KYTA 3F8SA 4YP5A 1DNPA 3F7TA 1TUGA 3T5AA 3GDOA 1ZGCA 2NUPA 3KDAA 5K3EA 3WKDA 3WIBA 4NAHA 7AT1A 4KGXA 2N75A 4I6JA 1EUDA 1US8B 1YVEI 3DXYA 4LWZA 3VFDA 1H2FA 3AVOA 4ZCMA 2FLWA 4GVLA 1Z25A 1P61B 2XEDA 4EUKA 4EFDA 1ZL0A 1O97C 4OSOA 3AY6A 3L8GA 4CMIB 1XYYA 1H4VB 2BP7B 4YRJA 1SBCA 1UBMS 1NW5A 2ANBA 4BNUA 4FR2A 1P1BA 1XXHE 3IMKA 4RMGA 1E1MA 2DBVO 4HFNA 4D8WA 4YQFA 1GFIA 4DLAA 5KBYA 1MNQA 4B74A 2D4AA 4UQLA 4OREX 5EP1A 1WOYA 2ZR7A 2AG5A 4I55F 1CJCA 2IOFA 2VK2A 2KBFA 4X7BA 1FEZA 4EPVA 5IJ9A 1DMRA 1H2EA 2FEMA 2QN9A 3QBEA 3WLSA 5ALEA 4GKAA 1KWKA 3OU2A 1MO3A 1EUQA 1I0IA 1S8OA 3KYCA 4ZZ0A 4YN3A 1N1GA 1WXXA 5CK4A 4A0SA 2WK1A 4EB6B 5LVAA 3M6FA 1NA5A 4ZVMA 5C1BA 5ALQA 4BNMA 5CM9C 5GQSA 3CZ4A 5AK5A 2P9FA 1NQTA 4CMIA 3U61B 1OX4A 3KOUA 1BCRB 4J4TA 4PFJA 4IAOA 1RCTE 2O2JA 3R9WA 1Y8RB 4KR3A 2ZRBA 1K98A 2OXEA 2QQFA 1QHEA 3MCVA 5ADUS 3UWKA 1KRWA 4OFBA 3KPUA 4OQEA 1L8QA 1W5EA 1T2FA 5ENZA 1IXZA 5FXMA 2C83A 5KC9A 2EQ5A 2QVGA 3D4NA 1A50B 4Q24A 5FI1B 3GCDA 2ZYAA 1PK8A 4IYRA 1E9RA 1R4ZA 3OFKA 4RE6A 5FLXA 1KAMA 3LLCA 1KY5A 5K3DA 4I5EA 3K5IA 3PXCX 3X2EA 4ZI7A 1ACLA 3BH7A 6AT1A 3KQWA 1GL7A 4R4JA 4NDAA 5CJJA 1HDZA 4MO2A 3LUFA 3MWGA 4RD2A 2BGGA 5C1IA 2D2EA 2LWIA 5JSUA 1SR8A 4MRRA 1CULC 1BXZA 4B79A 2X58A 4TLDA 1MC5A 4QU8A 4EDHA 5EZ5A 4N8EA 4U2KA 4CUJA 4ALKA 1Z8HA 4QDUA 4OXIA 3T3HA 1WDLA 1Z4KA 2EWVA 4QEZA 2BCJQ 3CUWA 4X65B 3DCIA 5SYMA 5DN6D 3G9UA 1EI9A 2G82A 2VK4A 1IOZA 2JFPA 2NTEA 2G9VA 4ENPA 4GRIA 4JB8A 4RY8A 3WGMA 2FPWA 3PA6A 2AF3C 3I72A 1PW7A 3PENA 4FHEA 2O8NA 4LQ4A 4X5OA 4XEUA 4PO8A 3EGWA 5J63A 3V6MA 3UPUA 1TCAA 1J9EA 3T4UA 1MJGA 1QDLB 2CGEA 2O7SA 2I03A 5D7NA 3TEMA 1MFPA 1B1CA 3HR8A 1ZP6A 1G9SA 2CLHB 1E9AA 4IDNA 4ZZ1A 2X9VA 2A9OA 5BSWA 4FZ5A 2FY8A 5EERA 1WMAA 1CQWA 2FMXA 5KJCA 1E2BA 1QKIA 3QUCA 1T36A 5T64A 2O4UX 4C7BA 1KP9A 2R85A 3ZDDA 2JLBA 3BZWA 3I2HA 3QX8A 2GDJA 4H60A 4R16A 4TWAA 2P8SA 2HU7A 2ZVDA 3GNTA 4L6IA 1Q77A 3TSYA 1OE0A 3T3OA 1E2HA 2H1VA 4X60A 1UZUA 1F8FA 1VE5A 2DUWA 4PFKA 5C5IA 2RGDA 1FA9A 2ZITA 2OXTA 3I64A 4DR3B 3HLKA 1PF7E 5L3RA 4DLSA 4QTTB 3SX4A 4B6RA 3EBPA 3UMVA 1LFDB 3B78A 3ZJTA 1LJLA 1H5UA 2PUVA 1CQZA 3L6RA 2NW6A 2UZ3A 3CPJB 4MW2A 4CCYB 1G8KA 1O9HA 4DHWA 1A8IA 1GQQA 1XEAA 1XSEA 1KK2A 4Q3EA 3C8ZA 2GGSA 2OBMA 3AQIA 4C0BA 4HD8A 4OHOA 4NU6A 2ZRMA 4LSGA 2I78A 2YRXA 3L1HA 3UWSA 2OGWA 4JQSA 1T2CA 3WJAA 5IHPA 3DR5A 4MV7A 3VJKA 1O97D 1VE9A 3Q7PA 1QH0A 3TM5A 3EPHA 1PWXA 1QGED 5CB4F 5CX1A 1GUAA 3PWZA 2F55A 4B4OA 2FW1A 2IEGA 4YMUA 3HJTA 4IDPA 4K9QA 4Y6OA 1L4EA 2BKLA 2R1ZA 2XAAA 1N8KA 2FCAA 3N2IA 4HDKA 1ONNA 4PCAA 4Q4CA 3PJRA 3PNVA 4O4IA 1L6IA 3KJZA 2RB5A 1Y0BA 4RETA 5FR1A 3C4VA 2PXAA 3UW3A 4ZCPA 2P91A 1VJGA 5I01A 5L7WA 5DHPA 3OZTA 4FR5A 1V3UA 1A2QA 4FEEA 3WMGA 2EEZA 3AY0A 4M7OA 4RL6A 3G79A 3BDIA 1QKJA 2H2IA 1JQEA 2PZBA 5AXAA 4C87A 1XZEA 4I08A 1NP6A 1NVKA 4RDIA 3CBGA 2APJA 4U7PB 3W04A 5A4FS 4HRXA 2PNFA 3P9YA 1K3UB 2JFHA 1CJKC 2ASVA 3HB5X 4K9OA 4QICA 5GM1A 1UMDB 4B4KA 4E6PA 3E7PA 4UE2A 4NEGA 3SMQA 1E6MA 2H4HA 2O2ZA 1FDVA 2W37A 3PHCA 3CWQA 2GZDA 4N49A 1D2EA 4PHTA 1A8PA 5JR3A 4G1EB 4ENTA 1U8YA 2QRVA 4NF2A 4TQUS 4LGCA 4QYIB 4LQDA 1YZ3A 2VZ8A 3S1SA 3HY4A 4EPRA 3EZ2A 4L6CA 4MPTA 4UULA 2IUUA 4PZLA 1XWWA 1O0SA 3JX9A 4M9ZA 5A05A 5CA0A 4RCVA 3OX2A 4G0OA 1O6CA 3UYKA 1RM3A 3CZQA 4BKQA 4XUEA 1B2LA 1UT8A 2WAXA 2ZUVA 4BCDA 4NU5A 1KMCA 3X1MA 1U8ZA 2Q5EA 1JIQA 4B7XA 4E2YA 1UM9B 1U90A 1IZ0A 2O3UA 1K4MA 3B6IA 4MKZA 4P22A 4RF4A 2IYPA 3WNZA 5IABA 3C7CB 4RD4A 3IR7A 5JD3A 5E7QA 1PK9A 2OUKA 3U7JA 1SB8A 2V0GA 3EARA 4Q48A 3CVJA 3OPYA 3HJBA 5B5SA 1DGQA 2H52A 1G0NA 5FTNA 1EDEA 1XEXA 4WGFA 5CG1A 1Y8CA 2QY9A 3D4OA 3G1UA 4RXTA 2FZEA 3IUYA 3ELYA 2CHQA 2ZWIA 3AK4A 5JBQA 3FJ1A 4YMWA 4YQZA 3AGPA 2NXJA 5DWDA 2F17A 1JSLA 2P1ZA 3V8NA 4PZYA 5GGYA 1E6EA 3HGTA 4PYJA 3MTGA 2HC9A 3RS9A 4TYYA 3OOYA 4CV0A 1CJMA 1I5OA 4G4GA 3WO1A 4KNVA 5IXYA 3EUFA 4W5WA 1ZW1A 3HFSA 2HGSA 4F6CA 2QDKA 1VLMA 4LHYA 5B58T 1TGVA 1UQRA 5K09A 1TQ8A 5LA6B 5IKOA 2H2DA 1ENOA 1UBNA 3WIOA 3D54D 3FMOB 4JYMA 4S2EA 4AJ2A 4KSYA 2BR4A 1X3LA 2YHUA 4DY4A 2FMTA 3G6KA 2FF5A 1IQUA 4I1OA 5K3BA 4N65A 1W0JD 2D3WA 4JUAA 3TLJA 2VNAA 4DUZB 3SE0A 4PIVA 2EGGA 3WV4A 4F4CA 4Z3OA 1V41E 3TG8A 3QUAA 4BZQA 1YV9A 4LRSB 3ZWPA 4DWWA 3C1AA 2EX0A 2FZ5A 2YTZA 1VLLA 5IZ4A 4HWPA 3QMWA 3I6IA 4OLAA 3N2KA 4W9NA 4OYHA 1F0PA 2IOHA 1VLZA 2W5UA 3CX3A 1XEWY 3G5AA 4TMTA 4AJLA 5BQXA 4BVGA 2H9AA 1RABA 4NFSA 4Z0TA 3BTSA 1GPAA 2GD0A 3MTQA 4V24A 2WNIA 3INYA 1GITA 3CRZA 2I34A 4R5HA 5F3DA 3AUFA 3O82A 2VJNA 2CJFA 2Z43A 5EJ9A 3BA6A 2EHDA 2HIHA 3BFPA 3F3KA 4N03A 2J9FB 3OJXA 2FEWB 2GSDA 3QVJA 2X76A 1VL5A 1V37A 2BD0A 3KBBA 4J0IA 1QNFA 2YOHA 5H9WA 5KSWB 3AHIA 1PZGA 4I5FA 4B6JA 3DG9A 4F04A 1U1DA 3MIIA 3AF1A 4K6CA 2V7TA 3WK9A 4BYGA 3M9LA 1DQZA 3DE5X 3LSYA 3Q1LA 1I2AA 2D7CA 4HDRA 2G17A 3ODGA 5TARA 2P62A 4M9UA 4JYAB 4FGKA 4KB5A 3NT4A 3F6SA 3PEVA 1P18A 4JLMA 3GRYA 1LA2A 1EWYA 3HI6A 4KI0A 4RIIA 3W9BA 4DWOA 5L3QB 4DLVA 1NJFA 2RAPA 3KFVA 2F8LA 2H06A 2NZJA 1TMYA 2GTHA 2VYNA 2ZR0A 5I47A 2IXGA 1WABA 4KO4S 5FB3A 2O2GA 1NW4A 4MUXA 1JQAA 2QV0A 2V54A 2HXYA 3I32A 3LPNA 3NORA 4R2WA 5I4CA 4KR2A 3ELWA 3KJHA 3OE7A 3PE3A 4IH9A 3JVUA 4LOLA 5FV7A 1ZR2A 4WA8A 1UAAA 1N25A 1S3SA 3SQOA 4OJNA 1UDXA 5IS2A 3F73A 2GXQA 4NJMA 3BRCA 3LUBA 1EZ4A 1L8AA 4PY2A 4B34A 2W2KB 2B4YA 1QTRA 5DYNA 5FI3A 1S3IA 3HP4A 2NZVG 4YT5A 5JLAA 2B35A 1JQDA 1UZMA 5KSPA 4GL2A 1R7RA 1L8XA 1HYBA 4MEAA 1GFZA 4GT1A 2FHSA 1A71A 3KZOA 4XVRA 5FNVF 5T6BA 4B09A 5U9CA 3HXOA 3FPSA 5CYPA 5I7UA 1MABB 1E3WA 1A1SA 2QD5A 821PA 1FFCA 3AY7A 3PQ8A 5FA6A 1YK1A 2GZSA 5J2UF 2BUBA 1KI6B 2GF9A 2ZJ3A 4CM4A 4PBTA 1NI5A 1QK4A 4G85A 2HU2A 3KZCA 1TXGA 1Y4ZA 3U56A 1G5HA 1U7WA 1YFJA 1RBMA 3QNUA 1A4UA 2GOYA 5ESRA 3W2HA 2PLFA 3FPGA 2C2HA 2OAQ1 1D4AA 1F38A 3Q2IA 3QVLA 1O6GA 1BXGB 5E4TA 2DCMA 3NHMA 5TMPA 1XTBA 4KO2S 4R9VA 4RHEA 4F38A 3FCAA 2CVPA 1BD4A 1N6IA 3UIEA 1EWQA 5H82A 4TTTS 1BE6A 3VR4D 5A4DA 4Y2GA 3WMXA 4BJHB 4WNIA 2VHWA 5K0NA 4RH3A 3RJZA 3V48A 3HV0A 4G2NA 3SHWA 1OPXA 4EHBA 3K70D 1YE8A 2WUVA 5JBNA 2B7LA 1GO2A 1J56A 2PRKA 2ZRPA 3NLLA 3G59A 1OAAA 1OFVA 1V4NA 5EHZA 5ELMA 2I4TA 2QLNA 4KCGA 1G8PA 4WY2A 3MRTA 4E4YA 4YCMA 2IYWA 3OE1A 5A4JA 2CV2A 1CUWA 4FEYA 3TQHA 2VKQA 1YR1A 3QVSA 3IJEB 1OGJA 4GG1A 3RABA 1E1RD 1II9A 3R1IA 4X91A 3T7TA 4OI0A 4MRVA 1ZKDA 3MTIA 1K5HA 3JSXA 3ZWAA 1ZQ9A 1NATA 2J5KA 3H1GA 1UFRA 4GX2A 4RTLA 3LX5A 2HWYA 2W6JA 1XWIA 3BJRA 3I4CA 3IBGA 1N6LA 3MA0A 4QECA 4BLUA 5HRCA 2ID9A 1E6WA 1N2EA 1EQ2A 4QDJA 5CFZA 5TJHA 1ZHOA 5COQA 1R0WA 3JARA 5JPDA 1HOXA 3DOFA 2R1UA 1JAXA 3L06A 1SBQA 2R47A 2XYQA 3L8YA 5L8VA 1KI1A 1T8TA 3Q3JB 2EZTA 2WP8J 4DUYB 2XZTA 3CV3A 1POXA 2WNHA 4OH7A 4F2PA 2IV2X 1KEUA 1SO8A 2WEKA 1KDYA 3PNMA 4CKWB 721PA 3QWIA 2BEKA 4C9BA 1V0JA 5SZKB 4HNTA 3LYAA 1VJTA 3O3NB 3B3FA 2TMYA 1DS6A 1Z6QA 1W48A 2WE8A 4LNUA 4MWTA 3U39A 1G60A 1RAEA 1ZQ1A 3L40A 3MZ0A 3QKSB 5C8YF 1XI2A 4EAAA 2I9KA 1E3MA 3GRRA 3I9NA 4RABA 2VHTA 4TWJA 4I9HA 2PGAA 3H99A 1CUJA 3FFXA 3D6JA 3PTLA 1UBTS 4KXYA 4XW2A 5G2OA 4QGBA 4BDTA 2V7QD 3MWJA 1PJBA 1U0FA 2WAOA 4XDGA 1WA5A 2O19A 5U1PA 2BE9A 2Z3VA 4K8OA 3WHIA 4YYZA 5J4KA 1NFRA 4UNRA 1N7HA 1N5KA 4Z6KA 3BXFA 3UGTA 4N76A 4KO3S 1NNSA 2R96A 5L7TA 3JAKB 4K9MA 2Z0MA 4XVUA 4UBMA 4CKWA 5BR8B 5DT9A 3BWVA 5ICMA 4DQ0A 5K03A 1W52X 3TR0A 3ZKWA 3NZEA 4UFPA 1AKTA 3F2IA 1EFDN 3T4EA 2Q5JA 1P9RA 2RHOA 2QSYA 2Q1YA 5IN5A 1G7SA 5JJIA 4EY5A 1A4IA 1CY2A 1N5LA 4LJLA 2UDPA 3BD6A 4M86A 2G1KA 1DKOA 4M83A 1HQKA 2PKRA 3R7WB 3ZHYA 3TSCA 1Q16A 4MV8A 1DRJA 4BLRA 1Y8QB 4EL0A 3IOEA 4E15A 1SC3A 1G8HA 2QMUA 3EZLA 4AP9A 3U7GA 1NNEA 1Z7WA 4ZIRB 5AP9A 4AULA 2QR2A 3RSZA 3NOXA 4OHWA 4PLPA 3IEUA 4TTJA 4CQMA 4N41A 1DE0A 3PDHA 3IVCA 2PKEA 5JH7F 5DBIA 1CYEA 2PKWA 5EP3A 3GWGA 3RRBA 1TCBA 1JJAA 3RNLA 1JP7A 3IHLA 1JWLA 3WYNA 2K6GA 3AY3A 2P9EA 2VP2A 1EP1B 2Y0CA 4OF4A 1Z2CA 5KPJA 3AKCA 2WUWE 4TS1A 2Z4TA 3N76A 5CVUA 3H16A 3U16A 1GCUA 2FH5B 3A26A 3HU5A 5F21A 1EFUA 3I8XA 1A69A 3O4GA 5I9NA 1B26A 2WFAA 2KLBA 2V3WA 4M36A 3KL2A 3GIWA 1F3LA 4KQXA 4HQRA 1UAYA 1EK0A 1RRKA 1W2HA 3CLRC 1M33A 3OFND 5HJ7A 1MR3F 4Q4DA 4YFYA 3CEAA 2XNKA 1T36B 3M4NA 3PFBA 4IWXA 4IIHA 3H5OA 3CNQS 2E4XA 1NOJA 3SN6A 3K1AA 4AQDA 1ISRA 2PQMA 2B2NA 5DBOA 4B2IA 2FETA 3L1VA 3KQVA 1S1CA 3D8TA 2J33A 1QIIA 3D6TB 2HDHA 3HS3A 3LQYA 1XTUA 2ZRAA 3PFIA 4H16A 3TH5A 3H65A 2O7NA 3JQ7A 3HCWA 4H1VA 4MGHA 5HMLA 3T3DA 3TQQA 2D2VA 1DXHA 3RK4A 5ED4A 2QI9F 2VDWA 4OBBA 4R31A 4GVXA 2ZLBA 1UBJS 1Z0DA 2W2VA 3B2NA 1VRVA 2CV0A 2PCJA 1A9SA 4XH9B 4ZT2A 3LUCA 1BNCA 2ZIFA 4CCSA 3VTFA 5B4VA 4LHSA 4TYPA 3UC5A 3B13B 3G0OA 1C30B 3M4XA 1ELOA 1DV2A 2O2YA 4DUPA 3CIFA 1DEXA 3D3JA 3D6MA 4XIGS 5JZBA 1CUFA 4OLJA 5IM4A 1B8OA 4F91B 1N9KA 2BHNA 1FDSA 4NBNA 4M9SA 4OQMA 4FCVA 2O54A 1KJ8A 2A35A 3GV0A 5KOHB 3UGJA 2DFLA 5L95A 2JFXA 1YE3A 5ILGA 3PIDA 1UMCA 4MR9B 1LU9A 2FMFA 3WB2A 4IDEA 2A1IA 2J3MA 3PCTA 5J4YA 1AY0A 3AESB 4JOQA 5AW9A 1Q5PA 1E66A 3A1NA 4MRMA 3RVLA 1KAHA 1R8YA 1EXNA 2JFVA 4PZ0A 2B30A 2WJYA 1PJQA 3H3FA 3VYVA 2ACVA 5B64A 3I37X 1J33A 4B3XA 3PICA 4EAQA 3Q8MA 2EZ9A 1W5SA 3Q1KA 2NU7A 4J0CA 3E18A 1N5OX 1QGDA 4MVJE 4X90A 1R5NA 3U3KA 3P97A 1N32B 3AHGA 3QENA 1KSHA 4BC0A 3GNLA 4QREA 3KEQA 2AUMA 5CA0F 4CDRA 2ST1A 3QBTA 4YAOA 2D8AA 3OE5A 3ROEA 3PS9A 1JBEA 2W4IA 3IBFA 4I1SA 2IIPA 4WECA 5CA0B 5E95A 3VU8A 1OLXA 4NENA 4RA9B 4B8YA 1QUFA 5CITA 3WGNA 1N2GA 2FPOA 5IJWA 1T2NA 5INTA 4R2XA 5CMLA 2Q3JA 1S9DA 4FW9A 2P3QA 4P4UA 2DPGA 1EBFA 1RQPA 3Q6MA 1TMOA 3LVBA 2R8BA 4WKGA 4RZHA 1OWOA 1RYYA 2XNCA 3DTVB 1E6KA 1QB8A 2ZBFA 1S8NA 2PH7A 3GZ4A 5EUQB 4LN1A 3U81A 5GIOE 1Z5WA 4KC0A 1GUFA 4NOLA 5E7MA 2IHKA 1C7QA 2FRDA 2NNLD 3I6QA 4MCJA 3T1QA 3K70B 1MQAA 4Q16A 3F9RA 3KZVA 4DREA 1F12A 3G6WA 4K40A 4B2LA 2P4SA 4B7CA 2XCOA 3U7EB 4HAZA 1ODTC 1EK2A 5DK6A 3WNVA 3FI0A 4G4SO 3BXGA 3U17A 3D4LA 4RD1A 1RU3A 4ZC1A 1OFTA 4O4LA 1S3FA 5KC8A 2E4WA 2VT2A 1FCJA 4O4HA 5JT1A 3OF5A 1SUWA 2QU8A 3OX3A 2GCOA 4IX1A 1Z08A 1DC5A 3OY7A 3A6EA 2CJYA 3GLIB 4B4DA 1F17A 2IW1A 3D7KA 2RGGA 1RLMA 1IU9A 2NTNA 3V3KA 1WF6A 2OCLA 1KKUA 5AM1A 2P68A 2FWAA 1SCUB 5F9HA 4PTZA 2GNPA 2RG1A 1KRHA 1XQYA 2PLWA 5J1TB 2AXQA 1CCWA 3T9FA 3DVAB 3JYPA 3CVOA 3Q11A 4FJ2A 5TS2A 1Q84A 3V46A 1L8LA 4NCXA 1DX9A 1LUAA 3MS7A 1ZS9A 1ZKMA 1UBCA 1E2UA 1IY1A 5GP1A 2D0DA 1QIHA