1PJCA

L-alanine dehydrogenase complexed with nad
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-ALANINE DEHYDROGENASE)
total genus 113
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjcA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjcA02
3KO8A 1PL7A 4Q3BA 2DC1A 3OFSA 3S1LA 1QV7A 1O5IA 2H6EA 3GT0A 4A10A 2D1YA 1JDJA 4CODB 1J6UA 1PS9A 2W4QA 4FR5A 2GN6A 4XJTA 2HRBA 4FS3A 2BF7A 2Y0EA 3KZVA 3FNEA 2D0IA 2HK7A 4IGFA 4RF4A 3PYLA 3JD2A 5L51A 1MB4A 4OQYA 3RSHA 1LLDA 2YDXA 3PWSA 5THKA 1F12A 1LSJA 1H6BA 4OAQA 3A1NA 2P68A 4MO2A 2NTJA 3VOSA 3JQFA 4HNHA 3ZCXA 3AY7A 1PJBA 2FY8A 2VYVD 4ALNA 1PTJA 5T67A 4RDHA 1MC5A 5DP1A 3K6JA 2C0CA 2CF6A 5A5EA 1LXCA 1GZ4A 3DZBA 3KSDO 1U7TA 5IZCA 4DL9A 5I7FA 4E4YA 3AJRA 4OIMA 1R4MB 1F17A 1EFKA 3U62A 4BKQA 2W90A 5LDHA 5G0WA 1BXZA 2X58A 5L7YA 4FOSA 3WGOA 3KSZO 3OJEA 5I9LA 2IXBA 4OSOA 4CMEC 3NKLA 3PDJA 2BFOA 1E5QA 3TZKA 3I6IA 4UEOA 1DFIA 1U8XX 3LC1O 7MDHA 1XWFA 3F1LA 1CRWG 2I3AA 1D4FA 3KTDA 4CQLB 1N9GA 3CUKA 3I4CA 4AJ1A 1KC1A 3I83A 2PFGA 2GZ2A 3B70A 3GH3A 1SPXA 5KJCA 1AXEA 3DHNA 1BSVA 2ZQYA 1BW9B 4FFMA 4ZRMA 1HSZA 1WNTA 4DPKA 2WYUA 1E1MA 3PLNA 4A0SA 1YDEA 2D5CA 1X7DA 1LLUA 1PQWA 2BFMA 2BI7A 3LC2O 5DBFA 1IE3A 3VPXA 4F6CA 3I9JA 5B1YA 1CF2O 1J5PA 3WWZA 1U2DA 2NADA 4DBVO 1QORA 5AVOA 1LLQA 3MWEB 3UW3A 5I7VA 1HZJA 2P9CA 3H2SA 1IL0A 3IS3A 3FNFA 4WKGA 5AYVA 1QR6A 1OC4A 5L4SA 2O3JA 3A06A 3DC2A 2O48X 1DRUA 1PJCA 1EK5A 1QKIA 3VVBA 3TL3A 1CQIA 4IDEA 4JBIA 2Z1NA 4R5HA 4R5MA 4BV8A 5ENDA 2PKRA 3RFXA 1JKFA 5T6BA 3RJ5A 1HE2A 3WQRA 5TT0A 1D3AA 4BMNA 4TRNA 2OBNA 3ROPA 1EBUA 1S6YA 4N18A 1KVSA 4CUZA 3ADOA 3L4BA 1QYVA 1ZZEA 1QG6A 1VKNA 2Y99A 2DVMA 3KBOA 2BMAA 3AFMA 3JYQA 1JKIA 2XOXA 1ZMOA 2QG4A 4NIMA 2G82A 4YJDA 5I8WA 2X9VA 4XQCA 3L6OO 3PK0A 4WLUA 2BH9A 3JQ7B 5KJFA 3FPLA 2WM3A 1EFLA 5G4LA 4KTTE 2ZTMA 3GHHA 1ULSA 4HWKA 3OH8A 2B37A 4OOFA 2H5LA 1EVYA 4K9DA 3NT4A 3PHIA 2B0JA 4YT4A 4RPJA 2ZYDA 3RROA 3HDHA 5FWNA 1UDAA 2UAGA 3I52A 3RC1A 1P31A 4R1SA 5CFZA 4WPGA 4OO3A 2V7PA 4M54A 4YQYA 1AGNA 1YBMA 1I3NA 3IJRA 3GGPA 1C0IA 4EUHA 3UKOA 3X2EA 2PZKA 1Q7BA 1HT0A 4RPKA 4XIYA 4ZQBA 4BMVA 5BSHA 1GYPA 1JAXA 1XR3A 4NG5A 2Z95A 5JO0A 1DC4A 2IZ0A 1H9BA 4J1NA 3RC7A 3O8QB 4OGWA 3WJ7A 4D46A 3QV1A 2W8ZA 2PKQP 4IJWA 4TZKA 3W6UA 3FD8A 4CMKA 4NBVA 3CIFA 4E5MA 4YAKA 3KXDA 1QV6A 1N2SA 1ISIA 1JU9A 4IZHA 1NWCA 3QVSA 4J16A 2OZPA 3VH3A 1E1NA 2PA3A 3KB6A 2WD8A 3PZBA 4FOOA 2GD1O 2VWGA 1GPJA 4UREA 3O03A 1GV0A 5TGDA 4CV2A 4J9VA 4WOKA 3R6DA 1UUFA 4DLAA 4DQXA 3OETA 3BHJA 3NT5A 1U4OA 5G2OA 3WX0A 2X86A 1YONA 2R2GA 1ID1A 2G1UA 1U28A 3GN2A 1WMBA 4PG8A 4RPHA 5CDGA 4O63O 3OICA 5KIAA 1A27A 3S8MA 4X54A 5GMOA 4CLEA 2HMVA 2CFCA 4B8ZA 1KOLA 1Q0LA 5A5FA 1D1TA 2VUSA 1TT5A 5CDYA 3UF0A 5C7IO 3HB5X 2JFFA 1I24A 1TVEA 1VSUA 4Z3KA 4M87A 2IRWA 4QQRA 2PR2A 4CLXA 3OECA 3NDRA 4JJGA 1UDBA 1V9LA 3H5RA 1NPYA 3IKTA 5BNIA 3UH1A 4LK3A 1NVMB 3CSDA 5BSGA 5EPOA 5C37A 3GZ4A 1P33A 2C82A 1R16A 1JA9A 3JQ9A 5JY6A 3GVHA 1ZEJA 3O4RA 3EAGA 2XAAA 3FTPA 4L4XA 4MVJD 3WDSA 4RQTA 4IS2A 5EERA 5F5LA 2D3TA 5BSEA 4B4WA 2OOSA 1DC5A 4XRRA 5DBGA 4BO3A 1XCBA 4U7WA 2RBEA 1AHHA 2DTXA 4XEHA 4BNLA 4TKMA 4ZJUA 2EG9A 1PIWA 5ER6A 1QYDA 3H3JA 1NQ5A 3ASVA 1E0DA 5TRTA 2X1HA 4E2YA 4FDAA 1RKXA 4BNYA 1Z82A 3RQSA 4AL4A 3EMKA 3KYCB 3PQDA 1T2EA 1PR3A 5ICSA 4UVDA 2E4AA 1YB4A 2V6MA 4EEZA 1LDGA 4MPDA 3AWDA 2I6TA 3H9EO 1K6IA 5DN9A 5A9SB 3ETGA 1V3TA 4IMPA 1EVIA 1GZ3A 3WLFA 3I9MA 2IXAA 3KVOA 4ALKA 4GWKA 2V6GA 3ZWCA 5BNFA 4A27A 2DAPA 4YQZA 1B8UA 1GCOA 2ILTA 1GAEO 2YV2A 3HN2A 4WLEA 1KS9A 1X0XA 3AK4A 3WIEA 1LSUA 4NK5A 4ZN6A 1T2DA 1I2CA 2LDXA 1NYTA 4HFNA 4QXMA 3RBVA 1PWZA 4DVJA 1RWBA 4MKXA 5A02A 2AQ8A 3VPFA 2Y05A 5F1OA 3EW7A 1R0KA 4XZ3A 5JC8A 3MWDB 3ZHZA 5C7OO 2EJWA 2TMDA 2GRAA 4TRJA 4DPMA 2AW5A 1MXFA 3QVXA 3WSWA 1XQ6A 5CG1A 5DCUA 3OA2A 1ZK2A 1GV1A 1SMKA 4WLVA 1LNQA 2XXJA 3BTVA 1IOLA 3RFVA 3JD3A 4WLNA 4B3HA 4LSMA 1I36A 4PCVA 5CEJA 3H65A 1KETA 4ESOA 1T2CA 2PZLA 1Z7EA 3DZFA 3KEOA 4GVXA 4RVUA 4AG3A 1E7YA 2QIOA 3LDHA 4BB5A 1XHLA 1BHSA 4L9RA 3MJEA 3UICA 4B4VA 3IIEA 3TDKA 5FF9A 1E3LA 1GUFA 1X15A 1N7GA 5F1PA 4DTIA 4YRDA 2I3GA 4NQZA 1MX3A 3ANLA 4XDYA 3DR3A 4U5QA 4CLDA 4CUKA 4MIOA 1P44A 5FI3A 4H15A 5IN5A 2DBQA 1T4DA 4CMHA 3QLJA 3BXXA 4NBRA 4R9SA 1P1RA 1IYZA 2DTEA 5JCXA 3GN1A 3FBGA 1LSOA 1JLLA 1Y5RA 4NBTA 4W9NC 3DWFA 3JQBA 3GVPA 3UXYA 3LSYA 1MC4A 1H2BA 1JWAB 1ZSNA 3N58A 1DC6A 2YFHA 1PJQA 4XWYA 1IUKA 3ZHBA 4BNHA 3OJFA 5DP2A 5B37A 1HDXA 1DOHA 2B4RO 4MP8A 4EJ0A 3FNGA 1DIHA 1SEPA 2UYYA 3ZHYA 2POQX 1A9YA 3LT0A 4R16A 4NJMB 1ADFA 1VJ1A 4TVBA 4BQRA 4FD3A 2NQ8A 3INTA 4E12A 1GTMA 2PD4A 4M8SA 4I08A 5IDXA 3CPSA 4WCFC 2HK8A 4L8VA 4IQGA 4W82A 1E3EA 3EGOA 4Q3DA 4U6QA 5T64A 1U3UA 3LYLA 4CM7A 4RJTA 3TSCA 1MFPA 1QRRA 1FF9A 1L7EA 2W2KA 3INRA 4GL4A 3AUTA 5KVVA 2DBRA 3RASA 2RH4A 1PGOA 2QRJA 3HFSA 5F3RA 1MFZA 4AJJA 3K96A 2JCYA 3C85A 2A92A 4LRTB 5AXBA 3F9IA 3HUDA 2ZB8A 1XU7A 3ZH2A 2C2YA 4DIBA 2VTDA 4WK6A 4GX0A 3S2FA 2Y1FA 3BHMA 4KDFA 2GNAA 3PQEA 4PLZA 3SBOA 1B3BA 4OH1A 5JW6A 3OBBA 1M6WA 4YYZA 5DCYA 2NU6A 5A05A 4B4OA 4BNWA 1WVGA 4Y6RA 3DBRA 5CDSA 1CDOA 2X8LA 3IDSA 2E49A 4CL3A 3V2HA 1XA0A 1UXHA 1KEWA 3GQVA 3FN4A 4HXYA 1WWKA 2BGKA 4R01A 1ISMA 4XRGA 1ZW1A 3DQPA 4DMLA 5CEFA 2A4KA 2A9FA 4R69A 4C7KA 4XQ9A 1I3LA 1ZSYA 2Y68A 1CIVA 3FWNA 2Q3EA 1Y8RB 3ONEA 1PS8A 5JAIA 4JNKA 1KVRA 1NQTA 2GERA 4OXKA 4WEOA 5DOVA 4DYDA 3U9LA 3F5SA 4DIOA 5KVSA 1WLYA 1H0KA 1X7GA 1M67A 1NPTO 3H6KA 1MP0A 2X5KO 4II3A 1EMDA 3AFNA 4NBWA 4CR7A 4MOWA 3VKUA 3AY6A 3H2ZA 2VWQA 2P5YA 1BGVA 3L4SO 5THQA 1YQXA 4M89A 5KNLA 3VTFA 4ALJA 3NAQA 2GUGA 3BMOB 3DXFA 3GY0A 3GDFA 2J3IA 1GQYA 3ZV6A 2DFDA 1DJNA 2W2LA 4U0KA 2SCUA 3NRCA 2B5VA 4E5NA 4DXHA 1PR9A 3I5MA 4PG4A 2P9EA 3EHEA 2X0JA 2EERA 3DTTA 3K92A 3KHUA 4RLSA 1PJ2A 5IZCC 1HWYA 1Q2XA 3AI3A 1N92A 3D4NA 4B3JA 4IMRA 4L74A 4MDHA 4N5NA 5KJ6A 3ABIA 3PHHA 5EMHA 1M66A 3WBFA 1FDTA 1KC3A 3C1AA 5DT9A 3BMNB 4JP3A 1U8FO 2AE2A 3D7LA 3X2FA 2QRLA 2EW8A 1IHXA 3QWAA 2RHCA 3HNPA 4EDFA 1P9LA 2RHRA 1HL3A 5JBIA 1H93A 1DFHA 3QVOA 3GMSA 3W8EA 4IJUA 4U8GA 1C0LA 3K8ZA 3QSGA 3GVCA 3PZRA 4RGBA 5T57A 4YAEA 1E6WA 3ZDFA 1SBYA 5I8ZA 4XYGA 1CETA 3KLMX 9LDBA 4FN4A 3JQ6A 5KKCA 4FQ8A 3H5NA 1VI2A 2AQIA 2NTNA 3QRWA 2HMUA 3D5TA 3LT4A 4IDBA 2I65A 3WOHA 4BKOA 5HS6A 3TF5A 4XD2A 3AUUA 3L4BC 3O8QA 3BTOA 4CM3A 4CMGA 5L45A 3PTZA 4JXKA 4YR9A 4F45A 1QP8A 3WICA 3JYNA 5C5IA 2JCXA 3VZQA 1N7HA 4R54A 2I76A 3SXPA 5IZ4A 4XA8A 4YT5A 1HDRA 1YOVA 2HU2A 1DAPA 1RM5A 3WGHA 4IBOA 4S1VA 1NR1A 4IUYA 3GPDG 1PJLA 1U3TA 3QVWA 3PEFA 2C59A 3CE6A 3ZWNA 4RVDA 1NASA 4F46A 1YVEI 2DUWA 1PJ3A 2WD7A 2EKQA 1E6EA 4CM9D 4K1LA 1LRKA 4KUHA 1N1EA 3ENKA 3FBTA 1L1FA 1E3JA 2FRDA 4L0QA 3JYLA 3TFOA 3WFIA 3JSAA 5AXCA 4ID9A 4P4NA 4R1TA 4BO9A 5DF1A 1E92A 2ZIZA 5T8KA 1W4ZA 1D1SA 2CSUA 8ADHA 4N5MA 3ZGYA 1H6DA 3UCEA 4RVGA 2ZB3A 3IL2A 3JD1A 1G1AA 3WQSB 2PTGA 4D3SA 3IAHA 3ZV3A 4UUPA 4QT0A 3CMMA 3JQGB 3ZW8A 3GG9A 3ZI0A 4BO4A 4BGIA 1F0YA 5IN4A 2DFVA 3QWBA 4K28A 2CY0A 2O2SA 3JYPA 3A4VA 2D5AA 3UGKA 4Q39A 3D64A 3AM5A 1OFGA 3C24A 4LSWA 3TN7A 4IINA 5L7WA 1PL6A 5BSFA 2GDZA 4FFOA 4CLOB 4IXTA 4QO8A 1RPNA 4WASA 3GZNA 4CR6A 2Q46A 2GYYA 3DONA 3ZU4A 4KZPA 2AQHA 2B35A 3K9QO 2IEBA 3W8DA 3AOEC 4HUJA 3PJEA 3LT2A 3P5SA 3ZV5A 1EUDA 1HEUA 4MVJE 1V6AA 3DAGA 3JYOA 2WJPA 1E7WA 3FHLA 1BVRA 1DPGA 1WPQA 2HJRA 4ND1A 3C7CB 5GY7A 3WLEA 3FR7A 2X5JO 3C3XA 2FR1A 4H16A 4KWIA 4TQGA 4J6FA 3MJSA 4RCVA 3JQFC 1LBEA 1F14A 3T4EA 1SAYA 2NACA 4L4RA 3GG2A 4AICA 1FJHA 4BMSA 3DTYA 1YS4A 4YAIA 2GF2A 3LU1A 3RFTA 4EUEA 1ZFNA 1HDYA 4Y8VA 4IDFA 1A71A 4OOEA 4JCOA 3E9MA 4YTEA 1GU7A 1HYEA 3F3SA 1HE3A 3LQFA 3V8BA 4BKRA 5HM8A 2B83A 3L6DA 3FPCA 2J5QA 1M2WA 4GI2A 2OFPA 1TEHA 2IYOA 2NVWA 4IJKA 1A7KA 1ML3A 2JCVA 3KSUA 3HFGA 2Q1SA 1UP4A 4CMBA 1I3KA 4RL6A 1IZ0A 2VUUA 1R0LA 1P0FA 3ITKA 9LDTA 2JAHA 4J90A 3U0BA 1JN0A 2Y0DA 5I7SA 3D4PA 2YFQA 1P1JA 4J4BA 1K6JA 1EUZA 4UVGA 3CTMA 3H8VA 3JQDA 3OA0A 5JXWA 4N54A 4BO7A 3PP8A 3I9LA 3WIDA 5T8KC 3LF2A 2YDYA 3G3EA 3IKVA 4J1SA 3H9QA 4YJGB 3JQ9C 3MCVA 1NQAO 4NR0A 3U09A 3VH4A 4A03A 3B20A 3R3JA 1SB8A 4ILKA 3PJFA 4P4GA 1EQUA 3VZSA 1RM0A 3V1YA 1YQDA 4D44A 3DMTC 5H81A 1E7SA 1B7GO 1NXQA 4WNCA 2NTVA 5FI5A 1HSOA 4OXNA 5JFOA 3DZGA 3DB2A 2OGUA 1V0JA 3ITDA 2ZTLA 3CINA 1TA4A 4N7RA 3DBVO 1ZO8A 4BHTA 2UV8A 2JFGA 4XYBA 3GUCA 3W4IA 3NDJA 4D7AA 4YAGA 3F1KA 4C7JA 1FDUA 1O6ZA 2GO1A 3T4XA 2Y1CA 3SX2A 3LK7A 1Q0HA 1BRMA 1YQGA 4GX1A 2EWMA 2O7SA 2ZQZA 4WLOA 2EV9A 1E5LA 1B3RA 2AE1A 5KCZA 2FP4A 4WECA 2NNLD 1K6XA 3S55A 4RORA 1AUPA 3DAPA 2NV6A 2WYWA 2FOIA 3DFUA 2VYND 4XYLA 1EZ4A 1J0XO 1B16A 2BD0A 2YW9A 1HF3A 4ZD6A 3EVNA 2JHFA 4G65A 1E3WA 4TKLA 1Z45A 3JD4A 1P3DA 4JN6B 4PZEA 3O26A 1DAOA 4YA6A 1IHYA 1CJCA 4RZIA 3AM3A 4FFNA 3W6ZA 3OQ6A 4FBGA 3W1VA 3D3WB 4NU6A 4OJNA 4ZGWA 3HDYA 3TZ6A 4EBFA 4MVJM 3RUHA 3HE3A 1YBAA 3B6ZA 1GPDG 1KY4A 1TI7A 2FPIA 1LEHA 1HE4A 1GQQA 2QX7A 3NTOA 3ON5A 4CM8B 1Q7GA 3I23A 1V35A 4PLVA 3OF2A 2VT2A 1HDCA 4BKPA 1ZCJA 3ZWPA 4BGEA 5T5QA 3HSKA 1MV8A 3LC7O 2BRUA 3S2GA 2PGJA 4CLHA 1SOWA 4ZVVA 2JD2A 5L53A 5LC1A 1UH5A 3KRTA 3MJ4A 3T7CA 1YBVA 2O3SA 4LRSB 2E48A 4R51A 3C7DB 2NU8A 1HDZA 1I32A 4HX5A 3PIDA 5CDUA 1H9AA 3F46A 4PLTA 2GZ3A 5I7EA 2R6JA 1QXSA 4IS3A 5ITWA 1SNYA 4WNIA 2EIHA 5LCXA 1EDOA 3DBRB 4GKVA 4B7CA 3ORFA 1U3WA 5FEUA 4P38A 3VZRA 4BOYA 5CAEA 1CEQA 3A28A 3WTCA 4ALIA 5KJ1A 4O1MA 2QYTA 1HETA 2OHXA 5IG2A 2X0RA 3RC2A 5DULA 1WZIA 5TS3A 2XXBA 1NNUA 4YPOA 3U4HA 4I1IA 2FR0A 2FSVA 2NVUA 1ADBA 3DBHB 5JNLA 3DMTA 1W0CA 1YO6A 1ZKMA 2IZ1A 3ETEA 2IYPA 1LI4A 5G4KB 3STHA 1QMGA 4ZICA 3K2EA 2WE8A 2RAFA 2AA3A 4ZRNA 4DQVA 1P1HA 3ENNA 1YB1A 1ZXLA 1YE3A 3OEWA 3VVCA 1FDSA 2NQTA 4NI5A 4JP2A 3D3EA 4DUPA 1ZK0A 4CQMB 1WDLA 4NNJA 3TRIA 5JDIC 1KYQA 3IUPA 4NMHA 1B2LA 4EEXA 4NJMA 2AMFA 2X7HA 4JBHA 4HKTA 1T1SA 1TLTA 2OP1A 5AQ1A 1W6UA 2C2XA 4KDEA 2YV3A 5JMPA 4IDDA 4AJNA 4BO6A 3QIVA 4E2ZA 1U5CA 2GPTA 4CM1A 1BWSA 3DFZA 2O7QA 3GRKA 3OEYA 4R3WA 1ARZA 3DEYX 1QSGA 3NTRA 4Q3CA 1YKFA 5A4DA 5U9CA 2FHSA 4B8WA 2G17A 2GSDA 2VRCD 1T25A 4WUVA 3TQHA 2CVOA 4ROSA 3GGGA 1WMAA 1PQPA 3BMCB 4FJ2A 4MKRA 2IODA 8LDHA 1PGNA 5H83A 1U1IA 2GZ1A 1R37A 2BGLA 5DCWA 3VC7A 5F21A 4EJMA 3M2PA 2YUTA 4TWRA 5BNTA 2QHXA 3GHYA 3E48A 3RUFA 1P45A 2ZYAA 4AJKA 5KVCA 2JKVA 4WE3A 4WJZA 4QEDA 3KETA 1E7MA 1T2AA 5A3JA 1ADGA 2UUOA 4AJIA 3WBBA 4XQGA 2RCYA 5FYDA 2P5UA 3EZYA 2CDBA 3H3FA 4YRAA 1XGKA 1XDWA 1U2GA 1V8BA 1ZUD1 1B26A 4L76A 2Q45A 5ILOA 3ZNQA 3O38A 4GVLA 4J0EA 1A5ZA 5AOVA 1P1FA 5ES3A 1NR7A 4PVDA 3Q9NA 3HADA 4DPLA 5GZ6A 4BNZA 1C1DA 4ZQFA 4Z0TA 1PU2A 3M1AA 4CQMA 3S2EA 3OJ0A 3KOUA 4L4SA 1KVTA 4PZDA 4EGFA 1JWBB 3C8MA 2F1KA 4KMSA 3IUSA 3K31A 4GLLA 4CQMD 4PLPA 1WDKA 2P2SA 2H1SA 4YT2A 4YB8A 1NAHA 5DDIP 1NFFA 3VPHA 4CMCA 2AG8A 2V6FA 3TOZA 3TWOA 3GK3A 5JE8A 2BFPA 3TPCA 3GEMA 2VCYA 2Q4BA 1DIGA 1NP3A 2PLAA 5I9NA 1V3UA 4MVJA 4Y9DA 1UZMA 1GD1O 3HHPA 3IMFA 2HK9A 2XF8A 1H6CA 4EZBA 3UHAA 2C7VA 4O0LA 1YH3A 4DREA 3RVDA 4J7XA 2AHRA 4NJOA 3IP3A 5TC4A 1JW9B 3VKVA 4GPD1 1PS0A 4PFJA 3ONFA 2R00C 2IZZA 3RU9A 3MOIA 1WZEA 1VJ0A 4QECA 2X0NA 2C5AA 1DEHA 1ZVMA 3DZKA 1QLJA 2YYYA 2QYSA 3KYCA 1N1GA 1FDWA 1KEVA 1PQUA 2DLDA 1VKOA 1YXMA 1WDMA 3P2OA 1BXGA 1UR5A 3WGTA 4BO5A 3H7AA 4UVHA 4LCJA 1G0NA 5H82A 4OHUA 5K6AA 4XGNA 2HRZA 2VOEA 3ICPA 2JAPA 4E5PA 3RUIA 3VDRA 1M76A 4QFDA 1UXGA 4NFHA 1GZ6A 2OORA 4DA9A 4RF3A 1A4UA 4ZA2A 4XKJA 3RBXA 1Y1PA 4YT8A 3I9NA 4O6VA 4R41A 3OM9A 3EDMA 1RJWA 1M6HA 3SLKA 3I6QA 2PNFA 2VUTA 3I4FA 1JVBA 1P0CA 4DIFA 2VWPA 5B4UA 4BNGA 4NK4A 5K0ZA 1FMCA 4I9UA 1PZHA 1EVJA 2VHVA 1LJ8A 3TZCA 1H94A 4E2WA 3MTGA 2Q2VA 2O3QA 3NTQA 1S7CA 3AUSA 2VZ0A 4GSLA 4GGOA 5JY1A 2OL4A 4FPXA 4FIZA 3AM4A 1K0UA 1GY8A 5A9TA 1C0PA 3JQ8A 1R15A 1HZZA 4XQEA 5HS4A 1R0SA 5COQA 2YQ5A 2FN7A 4UUNA 4IDAA 5MGBA 3AU8A 5EESA 5BT9A 4JIGA 4A73A 4U0JA 2Y67A 2FR8A 2Y1GA 3ANMA 5JYEA 1PGPA 3OSUA 2VRCA 2Q1UA 5MDHA 2HCTA 2VZ9A 3R0IA 3AOEA 1I3MA 4KOAA 1U7HA 2VWHA 5HWSA 5TJ9A 3GNSA 3RC9A 4HFRA 4JLWA 3LF1A 3ZN2A 1UXKA 2DKNA 4JK3A 4XJSA 4MJLA 3W4JA 1SC6A 2CD9A 1IULA 1A72A 2YJZA 4IIVA 3A14A 3WNVA 3PGXA 2ZK7A 3E82A 4I5FA 4EJ6A 1M75A 2WTBA 5G0UA 1LA2A 1GL3A 3AUAA 4D79A 3GR6A 4CL8A 3G1TA 3VPGA 1SZJG 5CHEA 2HLPA 1GQ2A 4P22A 5HA5A 3WNQA 4D43A 4YBZA 1DDOA 1R66A 2NU7A 5FFFA 3T7EA 3BAZA 4C4OA 2Y1DA 2ZTUA 4IXWA 5KVQA 4WLFA 1MUUA 2NWQA 4ND3A 3GMDA 2X0IA 4J3FA 3BTUA 4GX2A 1T24A 4E21A 2CNBA 2WWRA 5HTOA 3TZHA 3UUWA 1Y6JA 5BR7A 2A35A 1I0ZA 1DHRA 3ZWVA 5A1TA 1E7QA 1HLPA 1GEEA 4GAEA 2FPGA 1PL8A 4M1QA 3HZZA 2J6IA 3BA1A 3MEQA 1GYRA 1EVZA 5L95A 1HXHA 4FFLA 2DPGA 4RF5A 3BMNA 1XELA 2B5WA 3ZNNA 1NQOA 3UAGA 1F8FA 3VDQA 1AN9A 3WGQA 3JCZA 1VE9A 1OBFO 1E1LA 3WFJA 1YL7A 1U9JA 1K3TA 3BZUA 3Q2IA 4B79A 4NPCA 1C1DB 2UDPA 4O5OA 5B4VA 1B8VA 2C54A 5IJZA 1ENZA 3HDQA 3UOGA 1DC3A 3WMXA 1YDWA 4E3ZA 3KM0A 1NHGA 5CDTA 4TVOA 1JAYA 5TLSA 2X9NA 3L07A 5G0VA 1DIAA 2Q49A 3PVZA 2YHIB 3JD0A 2F00A 5A03A 2Q50A 4OYRA 2HMSA 4UVEA 4BGUA 4WCFA 4AJLA 3U4DA 4TRRA 4S3MA 3I3OA 2DUUA 4IM7A 1ONOA 4CM6A 5JYDA 3IOYA 2AEJA 2ZB4A 1J4AA 1KBZA 3BYZA 3NGLA 1YJ8A 3PYXA 4AJHA 3FNHA 4ZHSA 2GLXA 4KUGA 4XIJA 4YCAA 6ADHA 2O4CA 2VHWA 3VTZA 4J1TA 4DLLA 2WE7A 3PWKA 3G17A 1P74A 1ZJYA 1CYDA 4B4UA 3AI2A 3Q2KA 3DHYA 4LN1A 3SLGA 4I9NA 2FPPA 3PQFA 1BW9A 4FW8A 3WJAA 3DZJA 3DBLB 4PN3A 3K2BA 1P1IA 2IE0A 4I8XA 4FCCA 3RAJA 4Z0PA 2J5RA 4BNTA 5CG2A 1MXHA 4ZU3A 4RV9A 4CQLA 1PZGA 1HTBA 4MKZA 4FB5A 3TL2A 3V1TC 3PPIA 5B4TA 3EZLA 4K6FA 3KLPX 2OP0A 3GC6A 2J8ZA 4BNMA 3H4VA 5L3ZA 4E5KA 3W8FA 5TSDA 1DBVO 2PY6A 4BO8A 4CJXA 4XGIA 1VL0A 1DSSG 1E3WB 1X1TA 1VPDA 3FCOA 3NYWA 3GNTA 1E77A 2OO5A 2W2LD 1UP7A 1C0KA 4HBGA 1EK6A 3ZWYA 1Y7TA 5KWEA 4RVFA 1NM5A 3E8XA 5JCJA 3DZHA 3GGOA 3QA9A 3RUAA 1TT7A 3M6IA 3V5NA 2NVUB 4A2CA 1HYGA 3QW2A 1A9ZA 2BFAA 2WD7B 3RUCA 1R4MA 1B0AA 1PSDA 3GDOA 5JCJD 2OUIA 3E5MA 4I5GA 1K5HA 4L73A 4NFSA 1MG0A 4YAJA 4Z6KA 1RM3A 3G79A 3NJ4A 3K5PA 4MVJI 4BNFA 3NJ8A 2YHUA 4NZ9A 1P77A 1BTOA 1LLCA 1AE1A 4YJHB 1HE5A 1EUCA 1AXGA 1HRDA 1QYWA 4UEKA 1YOVB 5TX7A 3CH6A 4JX8A 3PFWO 5IAAA 4UULA 2OBYA 3L6EA 2WDZA 3WYBA 3GZNB 4DC0A 3WQQA 3Q11A 1P1KA 2Z5LA 2BKAA 3HWRA 3PRJA 2EKPA 2HUNA 3CZRA 1BG6A 4IQ8A 5ILGA 3V1UA 3VAZA 3ZNOA 3JTMA 4OM8A 1LRJA 2AEFA 3WXBA 3HJAA 4AFNA 1U5AA 2DBZA 1DXYA 2X9GA 4ND4A 2Y66A 4K6CA 3TOXA 4FC6A 1ENPA 1G0OA 3H5AA 2PK3A 2Y93A 1XIVA 3NX4A 3GFBA 4Q3AA 4R4JA 4GKBA 1NFRA 3M2TA 1GCUA 4PIVA 4WCFB 3IQDB 3EUWA 4PLFA 1JKJA 3DOOA 4FJ0A 4E33A 5BQFA 4RPLA 2UVDA 1VLLA 2Q4EA 4Q9NA 3ZU3A 3ZWBA 1KERA 2J3JA 5JDCC 1OMOA 5EJ2A 5A3VA 3LLVA 3V2GA 2Q1TA 1J49A 2EKLA 3OP4A 3ZWWA 1VL6A 4AJEA 5TF4A 1LC0A 5A9RA 2PGLA 4FFRA 4MVJP 2X5OA 3C1OA 1RYEA 4XB2A 4D3FA 4JROA 1YRLA 1YB5A 2JHGA 4CMAA 5K9ZA 2O3RA 6LDHA 2CMDA 5EN4A 3EY4A 3VH1A 4HV4A 4CMJA 3IJPA 4OQZA 3ZNPA 4BNUA 3PGJA 4ZQHA 3RD5A 4XR9A 4E2XA 2WSBA 4I5EA 5EINA 2QZZA 1HKUA 2ZB7A 2AEMA 1JVSA 4YWJA 1PJSA 2I5PO 3K73O 3UFXA 3PI7A 2DQ4A 3LLSA 1U3VA 3GPIA 1ZK1A 3G49A 1LUAA 4MINA 4Y98A 4NFYA 1IB6A 2P4HX 3K30A 4QTZA 4DLBA 1KVUA 1B8PA 2GN9A 2VHXA 3Q9UA 2CVZA 2IEDA 4IJVA 3CKYA 2B69A 1ISGA 2P9GA 2JJYA 4LCEA 2C5EA 4NDNE 4IZIA 1SB9A 3GA0A 1ZH8A 3I1JA 2H63A 5L40A 4JQCA 4BB6A 2O23A 1ISJA 3HN7A 2ET6A 1DHTA 4QX6A 4BNIA 4RPGA 1Y8RA 2A94A 1TB4A 4F6LA 4NBUA 1BXGB 4YJHA 1MG5A 3PJGA 1R4NA 1Y8QA 3N74A 4Q3EA 3UN1A 4OKNA 4PLYA 4E5YA 4Q3NA 1GEGA 2UUPA 3AU9A 3C1TA 4GGPA 4XR4A 1NAIA 2NM0A 1G6KA 4J2OA 1I2ZA 2PGDA 3G1UA 4EI2A 3MOGA 5JO9A 3JQCA 3VH2A 3BHIA 2VN8A 2JD1A 4BGVA 3R3SA 1X13A 3ZW9A 4R68A 1WXDA 3P19A 3M1LA 1BDMA 1QLHA 3JQGA 4FFPA 4I5DA 3MJVA 4YJFB 3GOHA 5HRUA 3L9WA 1NBOA 3WYEA 4YRBA 1XU9A 2WMDA 4E32A 5COAA 3RUDA 4ND2A 1I8TA 1A7AA 4D0SA 3BIOA 4W6ZA 3A9WA 2E82A 3ANNA 4DBZA 4A5OA 4K26A 1K89A 3ROKA 2Z1MA 1W73A 4AJOA 1T2FA 4AJPA 2E6UX 3QE3A 5TQVA 1UZNA 1OOEA 4HFMA 2EGHA 3EC7A 3IP1A 5ITVA 4BNXA 4YJFA 2X4GA 4O59O 1PWXA 1ULUA 3PLRA 2O2YA 5G0SA 4B7XA 1C14A 4QO7A 4TROA 5EQDA 4E6PA 2H9IA 4YDRA 4J7UA 1JTVA 2C7GA 5JDCA 2V6BA 4H3VA 4ZQEA 1PX0A 3DBLA 1NX6A 1O89A 2YV1A 2DTDA 5TIIA 2BHLA 4PLWA 3QY9A 1ISHA 2HO5A 2PD3A 5L4NA 1FXSA 3ROQA 1BVUA 1LQTA 2WYVA 5TJHA 3E18A 1O9BA 3UVEA 3DAFA 1DFGA 1W8DA 4NH4A 2RH8A 2PH5A 2Q2WA 3DOJA 1SEVA 2VNAA 4NU5A 1VC2A 3DDNA 1FDVA 4RZHA 5IDQA 3OQ1A 2ZJ0A 4PLCA 4W9NA 3FTNA 4OMUA 5L9AA 4W4TA 4HY3A 1DRVA 1IPEA 2EF1A 1YL5A 4Y67A 4Z9YA 4CM4A 5B12A 3F47A 3NGXA 4Z0HO 2NVBA 2B4QA 2EGGA 3H9UA 2NLOA 3SJ7A 1PEDA 3RCBA 4FSHA 5I9MA 3BMCA 2Q2QA 2AXQA 5JAMA 2I99A 3H9JA 4A26A 3OJOA 1QYXA 3PHJA 3L77A 3KUXA 3OMLA 1UXIA 4AJ2A 2D8AA 5JAQA 3I9OA 4D41A 2O3TA 4N5LA 3UCXA 1N5DA 2GR9A 2HKIA 4CPDA 4DWVA 1T4BA 1C3VA 1TXGA 4LISA 4UVIA 2CVQA 4E30A 1C1XA 1O8CA 4ALLA 2VOJA 5DOZA 1VL8A 3FI9A 1SO8A 2VYNA 4J0FA 3BMQA 2Y1EA 1Y81A 4LMRA 1E3SA 3Q6IA 3HB4X 1T1RA 2GN4A 2IDZA 2EHDA 2VTEA 4OXYA 2YZ7A 2EEZA 3DOCA 5CPBA 4PG7A 1NVGA 2Y1OA 4RVHA 5AXDA 1AHIA 2VHZA 2W2KB 1SOVA 1XSEA 4IY1A 3RKRA 1GDHA 2W98A 4J4HA 4D45A 2CF5A 4QUKA 4BIIA 1PJ4A 4G5HA 2P4QA 3DMYA 3U4IA 2HAEA 4TMFA 3PYMA 3AY3A 3H9GA 1MGOA 2BGMA 2OMEA 3WGIA 3GLQA 4JJIA 1ZK3A 4P8RA 4OSPA 3VHRA 2ZKLA 3GFGA 3RUEA 1NVTA 3GEGA 1Q1NA 4J9UE 4YXFA 1D7OA 4IDGA 1ZIDA 4II2A 1ORRA 5F5NA 5KKAA 1O95A 4R3NA 1E1KA 3SJUA 1F06A 2CDAA 3ULKA 5C7LO 3PFFA 2EP7A 1FK8A 4IIUA 4GBJA 1NTOA 2FZEA 4WEQA 4R9RA 4WOJA 2DM6A 3W4KA 2Q1WA 1ONPA 4WCDA 4BS9A 2NUAA 2ZCVA 4KP7A 2JL1A 1ZBQA 1ZSVA 3Q1LA 4PLGA 5EIOA 4DMMA 5GZ3A 1PJTA 3E9NA 3EK2A 4DRYA 4HP8A 2Y0CA 1DJQA 4I9HA 5A9SA 1I33A 5GZ1A 1OI7A 4FJ1A 4KQXA 4CM4B 2EJVA 2V65A 4BVAA 1VSVA 2X22A 1B14A 4YVFA 1GYQA 1O0SA 1R6DA 3ZWXA 3B1KA 2D4AA 1LDBA 1V3VA 2X23A 4PG6A 1KVQA 4CR8A 2HQ1A 3QHAA 2QQ5A 3INGA 3PIIA 5DZSA 1GFSA 1XKQA 2PKQO 2HJSA 4A7PA 4LW8A 1K2WA 2FSSA 3N7UA 4YACA 1UAYA 2VQ3A 3F4BA 3KYBA 1EEHA 5J23A 3EYWA 3VPSA 4PLHA 3HDJA 4H7PA 1Q0QA 1YGYA 3TFQA 4ZQGA 3QQPA 1ZEMA 1YWGO 3IC5A 3ICCA 3TNLA 3NUGA 5TNXA 4ALMA 3OJLA 2DT5A 3FF4A 4DQUA 4QFCA 4G2NA 1CWUA 2BLLA 4KTVE 1XYGA 3HQ4O 5IXYA 1CERA 1GADO 4R1UA 4TSKA 2WEKA 2ZCUA 1H5QA 2D2IA 5L4LA 3ZWOA 4CLRB 4OKIA 4BO1A 3GEDA 5CP8A 3RWBA 5DNAA 1ZMTA 1E6UA 4INAA 4XCVA 1WW8A 1TT5B 2PZMA 3RJ9A 3P7MA 1Z6ZA 4RVSA 1CQJA 2PZJA 4HADA 3WYCA 1L7DA 3GRPA 5LDGA 4BKUA 2ZTVA 2EW2A 2HDHA 4BNKA 1NWHA 3JV7A 2Q99A 5KJEA 2CZCA 2FWMX 2HSDA 3O9ZA 4E0BA 1DIRA 3ADPA 3ONDA 4TRMA 2VT3A 3UCFA 3GVXA 5DBIA 7ADHA 4UAGA 3MJTA 3L0DA 2PD6A 4NHEA 4CUJA 2VRBA 1U4SA 3DO5A 3CEAA 1UXJA 1PGJA 1R4NB 1Y8QB 1QYCA 2JFHA 4MIYA 2DPHA 1HDGO 3ETDA 2YHIA 4E31A 2B36A 4LMPA 4PZCA 1YL6A 1LX6A 3RU7A 3Q3CA 1BXKA 5JS6A 1LTHR 1LU9A 1ZXBA 1KIFA 3GF4A 5HBRA 5F1KA 4BNVA 3QWHA 2TMGA 4MVJG 3FSRA 4J7CA 5U1PA 3ZWMA 3GDGA 3RI3A 4EITA 2QW8A 1LC3A 5TT1A 3RIHA 3OQBA 2I67A 1WAMA 1WP4A 3MJCA 2I9PA 1B15A 4J43A 4Z9XA 1NPDA 1RM4A 3WS7A 1X1EA 4KUEA 1D8AA 3ZHXA 2YY7A 2X6TA 5JSFA 5JC1A 2GN8A 4BL5A 1PZFA 4U6SA 3ZZNA 3D5QA 3NV9A 4XB1A 1RYDA 3LVFO 4KWHA 1UAGA 1Q7CA 1I2BA 3PXXA 2O3UA 4RDIA 3BMQB 2J5KA 3WGYA 4AVYA 5G4KA 1LQUA 1LDNA 4LVCA 1JQBA 4LVUA 2C07A 3JQ7A 4OL9A 1Z75A 2YQ4A 3DBHA 4B3IA 4HFJA 3SC6A 4GQAA 3R1IA 1GUYA 4P4LA 1Y9EA 4FGSA 3GAFA 4B7UA 1N8KA 3E5RA 2D59A 4LGVA 2VNSA 2QZ9A 2GCGA 3NDIA 4XGKA 5U4QA 3PHGA 4GSKA 3SEFA 2BELA 4HNGA 3P2YA 5KOIA 5CPFA 3KYDA 2GASA 2PH3A 1EDZA 4BNNA 1OAAA 3V2UA 3KEQA 5A06A 1XG5A 2EXXA 2NSDA 4UUMA 2G5CA 1EE9A 2ZJ1A 4G81A 2PV7A 1X0VA 3ASUA 3SVTA 2J3KA 1IPFA 1ENYA 1X7HA 3DZIA 1ZJZA 5EQFA 3E1KA 3CMCO 3I9KA 2FMUA 4M86A 3CZMA 2HMWA 4RQUA 4GX5A 2E37A 4UUOA 1I01A 3F5QA 1LRLA 1XEAA 1VJTA 4YJGA 1F8GA 3D1LA 3DL2A 1E7RA 4J4TA 1UZLA 3PWZA 4CM8A 1KEPA 2DBVO 1E3IA 1VRWA 4CLRA 3FRJA 4XYEA 1T26A 3PJDA 2OXIA 3OHSX 3JQ8B 3OIGA 3JQBC 3D3WA 4M55A 4RLHA 5JPIA 5CEEA 3ST7A 2AG5A 5JDIA 1ADCA 3AI1A 3Q0EA 1EQ2A 3WGGA 1DB3A 3WB9A 3WMWA 4BUCA 4JGBA 1LSSA 1DO8A 4JBGA 2DU8A 4ITUA 4FC7A 4IDCA 1IY8A 5IF3A 5JAZA 1KEUA 1UDCA 2VYVA 4Y6PA 1BDBA 4CM9A 4BV9A 3WSVA 3U49A 3KV3O 4R1NA 3ZV4A 4DGSA 5ADHA 3COSA 1DLJA 3G0OA 1HYHA 3QWFA 3WTBA 1Z7BA 3GAZA 3GUYA 1GR0A 3F4LA 4QSMA 1I5RA 3U5TA 1OZAA 4PRKA 3U3XA 3FR8A 1YJQA 1H6AA 1MA0A 3OIDA 1VM6A 2VHYA 3QVTA 4EYEA 1UP6A 3QP9A 4GH5A 4GWGA 4CV1A 4RO0A 1XQ1A 3DHEA 4GLOA 1EE2A 4AJ4A 2P91A 4EW6A 1NFQA 1O94A 2C20A 1EBFA 2CUKA 3C7AA 2AQKA 3GNQA 2B4TO 3QJ5A 4PG5A 5IDWA 3CXRA 4IQ0A 5IFLA 3NEPX 2G76A 3SC4A 3WGZA 1HLDA 4MP3A 3ZU5A 3QWIA 4BO0A 5IXSA 5JMWA 4D42A 3E6AA 3NT2A 2RIRA 1Z73A 1PGQA 4XDZA 4RF2A 2O4UX 3L9XA 4DYVA 1NHWA 5COBA 4CV0A 1GUZA 2JD0A 3LZ6A 4XYMA 4WGGA 3OIFA 3F6YA 2LDBA 2J3HA 5IDYA 4E13A 3PHLA 4CLOA 2CDCA 3B1JA 5G0TA 1DLIA 1ZNQO 2HMTA 3GVIA 4FGWA 1LDEA 1DIBA 4EUFA 2VZ8A 2I66A 2PWZA 4J91A 1H2HA 3ROMA 1Z74A 3FWZA 4BO2A 4W7HA 4UEJA 3JQAD 4Z9FA 4MP6A 4W7IA 3AW9A 3MTJA 4CMEA 4CV3A 1DRWA 2GGSA 4ONEA 3D0OA 3JQAA 1N9GB 3ZWAA 4D0RA 3KYDB 4IPTA 1UJMA 2BI8A 4XX0A 1I10A 1ONNA 3U4CA 5KTKA 3S2IA 4JJFA 5JLAA 3D4OA 3TJRA 1ENOA 3B1FA 5L7TA 2XPCA 4J1QA 4MVJH 1HDOA 4ND5A 3VZPA 2C29D 4L75A 4CMIA 2ZYGA 5ER9A 1XLTA 4PRLA 3E9QA 4F3YA 2NU9A 1ISFA 1I30A 2G0TA 3RBZA 4MVJF 1C1XB 3RKUA 3HG7A 4IGEA 4M49A 3E03A 4W99A 1A4IA 4Z3DA 4BNJA 3BMOA 4KQWA 4YEDA 3ZU2A 1SCUA 3TZQA 2O50A 2ZATA 4MIEA 5AXAA 4CM5A 5ENVA 3WR5A 3WWYA 1MLDA 5A04A 5ICMA 4DC1A 2EP5A 3MZ0A 4CMIB 4PGFA 5K6AC 2QRKA 3BTSA 1X14A 4J2HA 3AOGA 4PVCA 1KY5A 3JQEA 4D3DA 5C3MA 4URFA 1PZEA 4J49A 1R12A 1Y5MA 4Y6SA 1BMDA 3JQAB 1ZK4A 1LDYA 1Y9AA 1LDMA 4GMFA 2FZWA 3EVTA 2R00A 4GMGA 5EL0A 4TZTA 4BQPA 3LT1A 3PDUA 1IZ9A 3WG9A 1OC2A
chains in the Genus database with same CATH superfamily
3I37X 4Q3BA 2DC1A 3FWHA 3OFSA 3GEEA 2H6EA 3GT0A 1A2KC 4A10A 2PS9A 2AD5A 2WAMA 4H7KA 1WMFA 4Q21A 3WC4A 5FPTA 1AMUA 3LC0A 1ZOSA 1KMCA 4KKVA 4X7RA 4CODB 5KTPA 2CXXA 3CW2A 4J0CA 4YCLA 2GN6A 1FFGA 4CT4B 5IXJA 3EPJA 1NOIA 1JHRA 2H2FA 1PUIA 3CIOA 2FW0A 2FFAA 4RHUA 1N3IA 2WG0A 4U3JA 4PF1A 2VJCA 4BZXA 1RVDA 3C5EA 1V6SA 5L51A 4TQUS 3VZBA 5EXPA 4CTMA 4GICA 5FQNA 1LSJA 5GGYA 4W5QA 5TR9A 2W58A 3VQTA 4IXMA 2HGSA 4DLWA 2DFTA 1XT6A 4LHWA 3R0XA 2VDOB 4TKLA 3QFSA 1PTJA 3QU2A 4NMXB 3HKEB 3EZ2A 2DHQA 3NWEA 4L95C 2WMNB 4YGYA 4K9QA 4B5LA 2C0CA 2G3YA 2QZSA 4MYDA 2V45A 5H80A 2WJAA 1F2UA 1Z16A 2PCJA 1LXCA 2O1WA 4WFQA 1U7TA 2ZYSA 4DL9A 5I7FA 5IZCA 4E4YA 3FSGA 4PZAA 7REQB 1E3DA 2W2TA 2J09A 4WADA 4RA9B 1A9RA 5AVVA 5F9FA 3RYCB 5CVCA 2W90A 1NLMA 5G0WA 3ZV7A 4DT1B 1FQOA 1NW8A 3WGOA 5I9LA 3OJEA 3R3ZA 5TQ2A 4OSOA 3H2BA 4YECA 4CMEC 3OFVA 4HNUA 1VDMA 2ECPA 5EJEA 1MOQA 2BFOA 1E5QA 3EQ8A 1NI5A 2W0SA 3CJTA 1SM4A 1QVAA 2ZDHA 4LF5B 1MRSA 2RI6A 3TIFA 3EBOA 8GPBA 3B53X 3QE9Y 1EWQA 3KTDA 3DDUA 2HA2A 1WUIS 2NZ8A 3I4CA 1UMCA 3FDFA 2CCGA 3N9IA 2OWDA 2PFGA 2GZ2A 2JJ1A 2ZI3A 3F71A 2L2QA 4OK3A 2E1RA 1X1CA 1QPBA 1SPXA 2RKBA 3PT9A 1JLSA 4K9RA 3VR4D 4LSGA 5CX1B 3W7VA 4ZRMA 2IEIA 1Z38A 3ME5A 4HRXA 3HP4A 2XUIA 1N3LA 1E1MA 4LHZA 4A0SA 1YDEA 4I1VA 4WOPA 2H2DA 3W8RA 3WNDA 2WKWA 1GRVA 5DBFA 2VXBA 1PR0A 1Z68A 2W2QA 3OBIA 4F6CA 1L7NA 1FA9A 4HNAA 4A0RA 2IYTA 1TZMA 3FLEA 4YC7A 3K6SB 2GO7A 3KQVA 3OMXA 4ARAA 1YR8A 2ZJ4A 4JP5A 4K6MA 4NMLA 4DE5A 2ZCJA 1QORA 3Q12A 4GECA 1ODIA 5AVOA 3S68A 3UT5A 4V0SA 3UW3A 1XQWA 3CU5A 1HZJA 1VLHA 2NYAA 3AO0B 2ZJ8A 1IL0A 1M8PA 1OA0A 3DUWA 4KMRA 4L15A 3H75A 2DHDA 2ONJA 1HBJA 3IPXA 5CNIA 3ZXIA 1T0BA 2O48X 1DRUA 1NBHA 1X7XB 1EK5A 1Y6RA 2JFOA 2WVJA 4J16C 5KHOC 2GHQA 4IDEA 2O2GA 4JBIA 2IYZA 2DFPA 4YH1A 2UVPB 3L43A 4R5MA 3RFXA 2PKRA 1HE2A 2RFLA 1MJ5A 2Q5IA 3D6AA 4U2DA 5JSKA 4O8CA 5HFJA 1GPAA 5CA1A 1TVKA 4BMNA 4XTCS 2OBNA 1UKCA 3T3NA 3E23A 3ZG6A 4A8JC 4ZMRA 3KPWA 4NV3A 2XI4A 3MF4A 4N18A 3AFGA 3L79A 5ESRA 3JAWB 5AHXA 2EZ8A 2FPXA 1HA3A 5M3BA 2P41A 1IBMB 2I2DA 1QYVA 4D9MA 3MJHA 4Q4CA 2DVMA 1RQ2A 2BMAA 5FT9A 4ZEOA 2WG2A 2FE4A 2BM1A 3R5SA 5C5DA 4N4AA 5JZOA 1R5JA 3VR6D 2CBGA 2FVXA 2XDAA 2H4ZA 1N6PA 3GJ3A 1L4LA 1L5OA 3QPDA 3JQ7B 2RHOA 2PVCA 2WM3A 3FPLA 4GMXA 4OHPA 1J42A 4TSRA 3R75A 2HCJB 2V7QD 3GHHA 4IXNA 3PVCA 1HURA 1XTVA 4JYBA 2H54A 4LV6A 4GF5A 4W7SA 1JKJB 3N8DA 2G9QA 3PNBA 1TPZA 4PYQA 4D82A 2IITA 1K7CA 3BD9A 5FWNA 5AT1A 1WV0A 1UDAA 3B2QA 3I52A 3A0RB 1GRNA 2AJDA 2H4XA 4UHBA 4EKIA 1AQYA 2C1ZA 4KAFA 5E8JA 2MHCA 2C5GA 5CFZA 4OO3A 4X8MA 4MICA 5K2MA 4M54A 3UPTA 2WAAA 3LVQE 1YBMA 2W6ID 3K1YA 4GGMX 4URXR 3GFPA 3T7TA 1LV7A 4D9FA 3LL7A 4UBLA 3RQIA 4B75A 5LP6F 2PZKA 1Q7BA 4F3KA 2UYOA 4R1MA 1TLLA 4BMVA 4IG4A 2HSJA 3CWZA 4NG5A 2Z95A 3EIHA 1CG6A 3W6OA 3R0ZA 2PX6A 4JC8A 4ZV7A 5JO0A 5DI3B 4D46A 1IEWA 2W8ZA 3JAKA 4K87A 5DIFA 5HTKA 3TG8A 1C3JA 3FHTA 1EX9A 1G6HA 4NBVA 2EFEB 2WNHA 3E7PA 1E6MA 4E5MA 3T1YB 3T3PB 4X8LA 3EGXB 3EGIA 1AU9A 1ISIA 1EKXA 4IZHA 3QVSA 4J16A 3UGJA 1KDVA 2GBCA 1VLQA 3EUFA 2B30A 1AGXA 4QNRA 4JI4B 1S1CA 1REQA 1MB3A 3V8VA 4Z4IA 1DQNA 3KB6A 2WD8A 5A4FS 1FSGA 4M3NA 2HJHA 2GD1O 4IDNA 5A6SA 3BGDA 5TF0A 3O03A 1VMAA 2RC6A 1GV0A 5TGDA 4DQXA 2PV0A 4WOKA 2PDAA 2WKPA 3V7UA 4ERXA 2YWEA 1X7ZB 4YO8A 3TLEA 2PRZA 3NT5A 1W87A 3L0IB 1J07A 2R2GA 2GFQA 3CF4G 2BWJA 4MB2A 3LZCA 4H7JA 1U28A 3EE6A 3OZVA 4P32A 4WA8A 2BYTA 1KEKA 1SQ6A 4I19A 4INJA 4O63O 4ZAYA 5CDGA 3CURA 1XTIA 3WLTA 1A27A 2O9JA 4R8SA 3WA7A 4OGGA 1XUOA 1TPYA 1AZWA 2F6RA 2G0AA 2A1UB 1P9OA 1TT5A 5CDYA 2I4RA 2BZGA 3CF4A 2CL6X 2JFFA 3USZA 1I24A 1G1MA 4RJIA 4IF4A 1KQPA 2IRWA 1CLEA 4W1PA 4C0QC 5JXHA 4LFCB 1ZISA 1ZCFA 3C8DA 3NDRA 3RVNA 1V9LA 1LK5A 3IKTA 5B5SA 5JLJA 3ND7A 2ZE7A 1NJ6A 3H1TA 4ZCQA 3GRFA 3P9YA 3CSDA 3TTVA 5C37A 2P6RA 1CZUA 4Q6WA 1JALA 1WDTA 3Q9LA 1PBTA 2R1UA 4HDAA 4CN8A 2C82A 1R16A 2E0IA 3FOAA 3GRAA 3JQ9A 3MWDA 4X63A 4DDKA 4YPVA 3GVHA 3KU1A 4X20A 3DP9A 5CFMA 3DOEA 4MR8A 1FSFA 1OKKA 4NCHA 3EIQA 5INTA 4MVJD 1PNOA 3A9UA 3OE4A 1FS5A 3AERA 1FYVA 4RQTA 3LFTA 3RT9A 4FNMA 3HJNA 3A1WA 5BXQC 2I1QA 1M33A 2R87A 4B4WA 1Q2UA 1QO0D 1DC5A 2WP0A 4D8UA 2IHYA 3EA0A 4U7WA 4HDSB 1OQAA 3DPIA 1AHHA 4MARA 1Z5PA 2DTXA 1AF4A 3E5NA 3M3DA 3S7ZA 2VF8A 4BNLA 1KI8A 1Z7GA 2XQFA 3B6EA 4TKZA 5TRTA 3MTBA 4FDAA 3JS5A 4BNYA 4KZKA 4UNNA 4N76A 4LYDA 5FUQA 3TOSA 1TUEA 2BUBA 2E3JA 3K71B 4IIXA 1C4KA 4R1PA 1E2PA 3I6BA 3KPJA 5ICSA 1KOGA 4EEZA 4IICA 1LDGA 1ZA2A 4QQ8A 5SYNA 3ZPXA 4LF4B 4OX9Y 1ML4A 3OFND 4BQIA 1QG4A 5AI5A 1N5IA 3V55A 5DN9A 5HF6A 1FP7A 2GB4A 2HZBA 1V3TA 3AXTA 4MI3A 2JLVA 4IMPA 4K9KA 5DRTA 1GZ3A 1QH1B 2GRJA 4B32A 4C78A 2HCBA 3WLFA 3UJCA 4EYOA 3KVOA 5K4HA 1LI7A 3NWPA 1FDOA 2CEKA 3R6TA 2DAPA 5DW0A 2YS7A 4L8GA 1GCOA 4UXHA 5CB4A 3HN2A 4I6EA 3LDGA 5BV7A 3L4JA 4WY2A 1LSUA 5HIIA 3WIEA 3VTAA 4NK5A 3OLXA 4BLWA 3LPMA 3T9AA 4Z54A 4ZI7F 4ZN6A 4LWPA 4CIWA 3ER9A 1T9ZA 3I42A 4FW9A 3W1WA 5IANA 4PYIA 3RBVA 1IY1A 1PWZA 1RWBA 4WOCA 4LV8B 1JG7A 5FO1A 1OWNA 3ZOZA 4X3CA 3B7PA 5CUQA 2GPNA 1K2VN 1R0KA 1UM9A 3EW7A 3LKZA 4XZ3A 2XCRB 3ZE9A 5ES4B 3HSSA 2J3MA 2K7FA 1X2BA 2GRAA 1VP3A 3OQIB 1RE1A 4LMAA 3TEJA 1N3YA 2W71A 4WDRA 1VL2A 3LIPA 4YV7A 3ZJTA 4DPMA 3LP5A 4BPRA 4LZWA 4DMKA 5CG1A 2ZE8A 4HDOB 4MUAA 3EF0A 2JLRA 3SNKA 2XKKA 4V0NA 1SMKA 4WLVA 2XXJA 3BTVA 1DC8A 1Z8HA 1K75A 3JD3A 4B3HA 2IHZA 4LSMA 3HABA 2Q3LA 3VHXA 3W6NA 3RVMA 3QU4A 4YHHB 4Z4GA 5FUWA 4RESA 1D6MA 4M36A 2PZLA 1VCNA 4YJ3A 4MQMA 5KWVA 1JHMA 1B6TA 1NULA 3HB1A 3DLBA 3P71T 4I1SA 3LDHA 4ZHQB 4L9RA 3MJEA 3PWTA 4ZI7B 5IYZA 3A6HA 4OU4A 3PNMA 4F8YA 1GUBA 1B1CA 5JPCA 2VDMB 2VPTA 3G82C 3P5BA 1H0SA 1MB0A 1P2GA 4OYLA 4Z8YA 4M0UA 1KO7A 1MENA 2AOTB 2JRCA 3E0XA 4GI5A 5F1PA 3SR3A 4NQZA 1EUYA 1MX3A 3THXA 3ZDDA 5J4LA 2GVZC 4XDYA 1TAQA 2PLFA 2IUEA 2PT9A 4ODIA 3PRHA 2CZGA 3JAMA 2VHEA 5FI3A 5IN5A 3CNHA 5HKKA 2DBQA 4QVIA 4CMHA 3NAMA 3RBAA 4UHCA 3LXXA 1P1RA 4URWR 3N8NA 1CUUA 3HJGA 4J75A 3UA3A 2DR2A 1C7JA 1K7XB 3ZBTA 3U7GA 3FJ1A 3RT7A 3AZPA 2PMEA 5C53B 4NBTA 1Y5RA 1G2OA 4WKCA 3JQBA 4JOBA 5HX7A 1HNWB 2O1XA 4UBKA 2H1LA 2PJDA 1ZUNB 1P19A 3VV2A 2AN4A 4UBJA 1CS0A 3BK1A 3V8RA 1ZSNA 3RPEA 2FN8A 3G9TA 3ZHBA 3IO5A 1FDIA 1ULZA 4OYYA 3ZYZA 5DP2A 4MP8A 3N0RA 1FTQA 1OT5A 3KKOA 1ES9A 3EODA 3ZHYA 3KC2A 1M7BA 1A9YA 1KKUA 2POQX 2WFLB 3DE4X 4IRUB 4OA8A 2JBAA 2ZRDA 5FWXA 1WCWA 3PD1A 4E12A 1U02A 2LTAA 1E6KA 2X8WA 4O2AB 3UMFA 4D4HA 4P98A 3OM8A 5SZHB 4C3OB 5JS7A 2FKAA 3VHXB 2F90A 2HK8A 3H8JA 4IQGA 5SZIA 1L7VC 4OGLA 2ISCA 2OFXA 1D04A 2QYOA 1H9CA 3PLAE 4PC3A 1MABB 3LYLA 2RKWA 4PYNA 1CRLA 1NXXA 4ZAFA 2VP6A 4IEEA 4RJTA 4ZZ1A 3X1WA 1MFPA 3H84A 1L7EA 1I2MA 1IQUA 2AYXA 3DTVB 3CR3C 4LFBB 1E9DA 2B3DA 2VEDA 4B34A 2RH4A 4GOOD 4N6NA 3U60B 4X7PA 2ZKIA 3OAAA 4YFYA 2FQQA 2ZBDA 2A92A 1P17A 2E7ZA 1G7TA 1V5EA 2F59A 2LWIA 3F9IA 1DNPA 2PT6A 5AXBA 5F7OA 5EZYF 2POCA 2L18A 4IFBA 4N1AA 5DKFA 4RU1A 1C7EA 2PG3A 3V3TA 1D5WA 4DNXA 2WOJA 3S2FA 1QHHA 1U1DA 1V25A 2Y1FA 1D03A 3V4SA 1X7YB 1N2XA 2ZT8A 1B3BA 4OH1A 4ZQIA 1CVIA 3SBOA 4E08A 4HEA1 1M6WA 3IAS1 1X7WB 2XADA 4KW7A 3AVQA 2NU6A 5CM9C 3ZDZB 1BJRE 4MQFA 4OUDA 1H2FA 1VPWA 1YD7A 2H85A 3ND6A 1QH1A 1CDOA 2IZ7A 1GZUA 5KHAA 4D9BA 3HDVA 1Q16A 1RIIA 4CL3A 1RTKA 5DGHA 4AX4A 2GPSA 1RI1A 4J03A 1KEWA 4RMGA 1JHXA 2VK2A 4UHJA 3I32A 1O96A 3TM4A 3IEKA 1QOQB 1ZW1A 1X7YA 3BK7A 4B6JA 4DMLA 4B3MB 1N7IA 1NBAA 2HYIC 1KNQA 1Y5IA 2WHPA 3NM5A 3WIUA 4PGMA 4XQ9A 1H3NA 4IQFA 1ZSYA 4Y0AA 1LF0A 3FWNA 2DEUA 3TMAA 5EIEA 3FDXA 2IU0A 4F5EA 1FLAA 2BIFA 2AW3A 1G5RA 3QUCA 2KMLA 2FSGA 4I3GA 4R1QA 1CQJB 3G0HA 4FILA 1NQTA 1TJYA 3L8CA 1MT0A 2V7VA 3LX4A 4UTZA 5DOVA 5FNVF 3E4DA 1FP1D 3F5SA 4U00A 4GI7A 1NP6A 1H0KA 3RYHA 3SC3A 1M67A 1X7GA 4KQEA 1AMNA 1ETHA 2NZYA 5CB6A 3K0FB 1EMDA 2OCGA 3DPSA 2Z8XA 2ZRGA 2QQGA 3ILSA 5JROA 3L7BA 2XMQA 4OD0A 3VKUA 3QE4A 3SSAA 4BAUA 4B7ZA 4CG3A 4GXNA 2IYYA 4DILA 2VWQA 1BGVA 3OUZA 3L4SO 3OD1A 3R5FA 5EVJA 4BCCA 1LLFA 4MKGA 1AA6A 1TFUA 3L8MA 4I9FA 4I55B 1CUHA 2QAGA 1VIDA 2PRYA 4CFZA 1LJLA 1NT4A 1JILA 5IVIA 4KXLA 1XN4A 3ZV6A 4BUZA 4I36A 1DJNA 5ARDA 3U16A 2ERYA 1N77A 2W2LA 4U0KA 2B5VA 2JBAB 2W6NA 1TA0A 4KO8A 4MGKR 3I01A 4YJ2A 1JP7A 1NUSA 1G7RA 4JQYA 3IESA 1UDXA 3G23A 2XQKA 3KHUA 1ONBA 1NU6A 2KLBA 1RJ9A 4G84A 5IZCC 4JEMA 3AI3A 4B3JA 5BV8A 2R0QC 5IAKA 4GM0A 2QTCA 3OESA 2HM7A 4GE0A 3PHHA 3SZLA 1D2RA 1ZUNA 4UCWA 3WBFA 2WTEA 3JALA 1H42A 3DDOA 1JLLB 1N4AA 3ZK9A 2TMKA 1COZA 4G09A 1L7XA 3D7LA 3T8YA 4TMWA 4EB6A 1E2BA 1IHXA 1YCHA 2RHCA 3ZE0B 3HNPA 1P9LA 3NVDA 7YASA 5JBIA 3QVOA 1Z18A 3W8EA 3VR5D 2QUBA 2XF2A 4IP0A 1I0LA 4IJUA 2L69A 1HRKA 1C0LA 3K8ZA 3GX1A 3M3PA 4NZZA 4DJ5X 3GVCA 5JFTA 2GEDA 2ISQA 1K3UB 2X6RA 3I2IA 4LBWA 5EJ4A 3VGPA 1O9GA 1CETA 1YGPA 4XYGA 2GRUA 1NT2A 3DDZX 1LPAB 5JATA 5AHOA 1KZYC 2V3WA 4ZC1A 5J9FA 5FV4A 5KKCA 4LGMA 3B8EA 4IDBA 2B78A 1CUXA 4DNFA 1Z5NA 5IAJA 5CA1F 3OQPA 1C29B 3AUUA 3L4BC 1IHDA 3TF5A 4CM3A 1UC5B 1FFWA 3KZOA 4WBSA 2O2JA 5ALXA 1MJHA 4JXKA 4S2EA 3UIEA 3JWGA 3JYNA 1M2HA 4NSNA 5C5IA 4B44A 2WZBA 221PA 5LPNA 4Q5IA 2ORED 4YT5A 4OTZA 4L5YA 4C6TB 1OB2A 5DMHA 3AF5A 1QGOA 4OHKA 4V02A 4BAGA 4K9MA 1QTQA 3GJQA 1W75A 3OLWA 2ZUSA 5C35A 4PIPA 1PJLA 3CVJA 4BXOB 1MQAA 4J76A 2R8PA 4F46A 3K1JA 2GK3A 2WD7A 3A7EA 4BE9A 1DUIA 2OWEA 1E6EA 4OQDA 1LRKA 4KUHA 1MT3A 5B7PA 2FNAA 2VPYA 1T9HA 3ENKA 3FBTA 3O84A 1UOOA 5CLGA 4AECA 4L0QA 3JYLA 2BC9A 5FLYA 1C30A 4P4NA 2AL7A 2ZU6A 2H2HA 3IQFA 3TW0A 4BZPA 4ENWA 2ZIZA 2NYRA 3G2QA 1XEWX 2PH7A 3CX3A 4QBIA 4M22A 2J7PA 3Q8KA 5CK5A 2A33A 3LXRA 2NZJA 1S3IA 1YVUA 3JD1A 4DJEC 5JEEA 3MELA 3NOQA 3FTDA 3O3CA 5K45A 3PUJA 3WO0A 4QD3A 3QVVA 1MPTA 4HRYA 3TNFA 3T3HA 1P4HA 1XFAA 3FZNA 4QT0A 3JAWA 3KIPA 3GG9A 1JLMA 2VJQA 1IUOA 3RVKA 1T5HX 1JTEA 4MV1A 1UANA 4MRRA 3IBCA 3RTCA 4E1AA 2GM9A 4ZTZB 2FSFA 2RGRA 3JYPA 3LWDA 3PTAA 1WB4A 3UGKA 1ICIA 2NUTB 3STYA 4DV1B 1X7XA 2GS9A 2ZJ5A 4OHOA 1OU0A 1EX7A 3TN7A 4IINA 4QYMA 1R4ZA 2FQYA 3E3AA 4MV7A 4MW7A 4KPEC 2WFMA 2PHZA 1OFHA 4CLOB 3IAAA 5HUQA 1RPNA 3GLKA 3HB9A 4B6FA 2NYVA 4XD7A 3TG2A 1D2GA 2AVDA 1Y6ZA 2B35A 3G5MA 1RI3A 5C0OE 1SKYE 3Q1KA 2IEBA 1XCPA 4Z4QA 3AOEC 2A9VA 3B78A 4HQ6A 3OCXA 3TNDA 1H8HA 5DLQC 4B3GA 1EUDA 1UJ4A 2DZDA 4AIIA 3VNAA 4MVJE 2OXRA 2DJ5A 3EA5A 4H1VA 5IT5A 1XCOA 1OFIA 2X8BA 4JKYA 3DXZA 1WHSA 4AMYA 3IEMA 3W6UA 5GY7A 4EAAA 3ZWDA 1UCFA 2HJRA 1WPQA 3WGMA 2PKEA 3FR7A 2WB4A 4A8TA 2QEQA 3PITA 3T0IA 2IPMA 4P2BA 4PZ0A 1YT5A 3T95A 1NW3A 3HP7A 3RVRA 2A6PA 2ZI9A 4Z9AA 3BBLA 3QYAA 4TQGA 3K94A 4J6FA 4RCVA 1ECPA 5D6OA 3JQFC 1LBEA 2ZJ6A 5F33A 2XECA 4V38A 4YN3A 4XVCA 2CXTA 2DSNA 2XTJA 4LJ9A 3DLIA 3Q3VA 4UPVA 2GF2A 3GEHA 4AZTA 5C46F 2C9OA 4WN9A 3BRWD 4Y8VA 3L0YA 4UEWA 3WLQA 1VCIA 1A71A 3LUBA 1QIJA 4Q4HA 5JTTA 1DKPA 1HYEA 3F3SA 1HE3A 3LQFA 4V0ME 3TLJA 4BB9A 1N25A 1RC1A 1XJQA 3LD9A 3WLAA 2IS1A 2WVGA 2V03A 2YZGA 3JATA 1UPCA 1ZVKA 2J5QA 4GI2A 4ITRC 1RXEA 1WXWA 1ND6A 1ZD3A 3JTEA 4Q9KA 2IYOA 5JH7F 1FFAA 1TVCA 3X1DA 4IJKA 3D43A 4RSHA 2EJTA 1PQ4A 2B8NA 3KSUA 4DNOA 1JEAA 3B3JA 4ZAZA 3NBMA 5FLXA 4RV5A 3HFRA 4FYPA 1E2MA 5AK3A 1WUYA 1IZ0A 2GFHA 3R8CA 5BQ3A 1QH0A 2EFHB 1WD5A 4MWDA 2XV1A 3RNLA 1IMOA 4BFLA 4PO8A 4AF6A 2ZRBA 4EUKA 1SVNA 1MB9A 1Q1GA 1RRVA 4O2AF 5GAJA 4UNRA 4AY6A 1MX9A 5AKZA 1REQB 2W5UA 2XA9A 4TWAA 2WKQA 2VS1A 2YZMA 1EUZA 1SU6A 2FFJA 1V9SA 3BE5A 3H8VA 5GQSA 3TLYA 3CVWA 2P8SA 3GAAA 1NLUA 3ADDA 3EGXA 3EJ6A 1GGNA 4R2LA 5CR9A 1ZRMA 3I9LA 2XMBA 1GNTA 1RRGA 3HU3A 3LF2A 4ZU1X 5T8KC 3CV3A 4A0HA 4J1SA 3CVYA 3MCVA 1NQAO 1IY0A 1J2RA 4DIMA 1UPUA 1TM7E 2NUBA 3RANA 4A03A 4N7BA 1QX3A 2PMFA 3QKRA 1M34A 2SKEA 1YAJA 1JJIA 1OI4A 1V5FA 3G13A 1SB8A 9GPBA 3C98A 4P4GA 2GX6A 1YAHA 1Z26A 4FTWA 1EFPB 1RM0A 4AU1A 4KO3S 3KQTA 4BQQA 1E96A 1E7SA 5H81A 2K7ZA 4WNCA 4TT3A 5FI5A 1J0EA 2QOEA 1J2EA 4ACAA 3N7TA 3PQ2A 2JS7A 2HA4A 2ZTLA 3OE7D 4IVNA 1G291 4GRAA 3RH0A 3DBVO 3QKTA 2RKOA 1ZO8A 2I55A 3P9SA 4XX1A 2VJYA 5H3CA 4MEAA 1TK3A 4BJHB 2IHJA 4DJFC 2D6FA 1G8YA 2UV8A 3FJYA 1CZLA 2FPLA 3IBYA 4TM7A 4KRGA 2ZUTA 3SVZA 4HC4A 4YAGA 4C7JA 1FNDA 1W581 2FPWA 2ODTX 3L1UA 3Q10A 2B9EA 1AGRA 2Y1CA 1SA0A 3P45A 1Q0HA 4X24A 4GX1A 4W6QA 2QE6A 2V8BA 1CQPA 2ZQZA 4PBRA 3EASA 3IPRA 3SDZA 2NNLD 4BX9A 3S55A 3U7QA 2YKGA 2P5TB 2BKLA 2NV6A 2W6PA 3DAPA 3DFUA 4G97A 5TMEA 2VH2A 5ALYA 4XYLA 1PL0A 2RAVA 2YW9A 1W5FA 4RA6A 2NZ2A 1ZN9A 2WYHA 2Y3IA 5EMLA 4ZD6A 2PX8A 3RT1A 4B83A 4DM4A 5AVYA 4B81A 5KQRA 4HB3A 5ANRB 4HLNA 1YS2X 2IHNA 5BSUA 2CB9A 5BWMA 3S29A 1P3DA 1CY4A 2VSXA 1JLKA 4CKWA 1M0TA 2Q5OA 3MTIA 2VIIA 4HPWA 1JIJA 1L5YA 1KDOA 1OREA 4PZEA 4X85A 5IW8A 3NGMA 5IH3A 3F3KA 2HPVA 2VQ6A 1FC0A 3FOCA 1QB8A 2ADFA 1N8NA 1OAOA 3AM3A 1QOZA 3HCCA 2JGNA 3NHUA 1M1YE 3TO5A 3WLSA 1QYIA 4RGQA 3OQ6A 5FKJA 1OLUB 1E2LA 5KSPA 4FBGA 3E7WA 4NX2A 3L40A 4OAPA 4AROA 3D3WB 4D9EA 4YGXB 1S8FA 1KNXA 2UUAB 4DZTA 3BJZA 1D09A 1KY4A 2WUGA 3UGTA 1D2MA 3UJBA 3VO2A 1LEHA 821PA 2P77A 1FNSA 2YN4A 4KSCA 4KRXA 4L7VA 1Q7GA 1ONSA 5F98A 1EFRD 2QR5A 4BN5A 5HCNA 3IIIA 3TIIA 1V37A 3STTA 3DEIA 3VAYA 3ZWPA 5L3VA 1USKA 2HA7A 5AI8A 5KYTA 4DVGA 4YBRA 3U3OA 3HSKA 4PN7A 3A10A 3HEMA 1XL0A 3SBDA 1CK4A 1ESCA 2V4UA 5HCUA 2PGJA 1KH1A 4CLHA 1SOWA 1PTJC 2G5PA 5L53A 3QFCA 4FZ3A 3PKIA 4KJZA 2C1EA 5CX1A 4QEZA 1AGYA 1Y8AA 4MXDA 5AKKA 4R51A 3T1OA 5FWYA 3MRTA 3G9ZA 1P0IA 2WA1A 5E2AA 5CFOA 1TTPB 3IURA 1M8FA 2YZ2A 5K8VA 1DP4A 5CJJA 4QDZA 1T1EA 5LB4A 3ZGNA 1FX0A 3LGSA 1ACJA 3U56A 1J5EB 1SXQA 1X1QA 2GZ3A 4AF7A 5I7EA 1QJ4A 1QXSA 1JDUA 1SCDA 2D0DA 2C4MA 1GZ7A 1SNYA 4B2YA 1U9YA 2EIHA 4WNIA 1EDOA 2F1JA 5HJ7A 4GKVA 5IVKA 3LIIA 4FN5A 2PQ0A 1GLNA 3FKSD 3V6MA 1U3WA 2HHCA 1BVYF 3HUFA 4ZZ2A 5TQJA 3NNNA 3A28A 4Y0NA 2I6SA 4BIMA 1KJQA 1YKSA 4ALIA 2IOHA 1HETA 1DKOA 1X2EA 2ARKA 2J67A 5LIPA 2YXPX 5TS3A 2HWWA 5JXGA 3HSYA 1YDMA 1ZJ6A 4F7DA 3E22A 3ITEA 4KIGA 2YINC 3KELA 2FSVA 4LX0A 1XDZA 4R2JA 4MLCA 1W0CA 4RHCA 3KQKA 2ZAOA 3C45A 1A9QA 3ETEA 5AKJA 2FOLA 1IBSA 1VIVA 1CJVC 4UD2A 4MQ5A 4ZXFA 4K9NA 4ZICA 3K2EA 1NGSA 5HHTA 4ZEWA 5LIRA 1P1HA 1DADA 4YMIA 1X8XA 2ZSKA 5EJ6A 1JXOA 4R9NA 3TRHA 1W36B 1EB9A 2JGLA 5GV8A 1PNVA 1PKEA 2AFIA 3D3EA 1W4LA 4C0BA 4DUPA 1A8IA 1Y8ZA 1WDLA 3BPSA 3EWNA 1AB6A 2XYQA 2EKZA 4RZSA 1GSAA 1LWNA 1U8TA 3DWGA 3IUPA 4NMHA 4DDVA 1B2LA 4AO8A 3ET4A 1ZAYA 5KTTA 4AURA 5JYCA 4W9RA 1ZCZA 4HKTA 5CT9A 3NHBA 1T1SA 1TLTA 3G0CA 4WZZA 1ULAA 5AQ1A 3IMKA 4KDEA 5JMPA 4L57A 5KPJA 4YPFA 2OFOA 5HOQA 1G63A 2XRMA 1BS2A 2YHAA 2Z08A 4OKSA 3OEYA 4EWLA 4C2TA 5AW6A 1N6RA 2ZWVA 3TXXA 3AL2A 1ZJ4A 2B2NA 1T9KA 3AJAA 2GBFA 2FHSA 5JAPA 4B8WA 3MLAA 4W63A 4D0LB 2HIHA 1V16B 2GD6A 5E4TA 3TPZA 2ECKA 5E6UB 1DZIA 3GGGA 1L6RA 5DYNA 3UJ3X 3CLRD 3HO6A 1N8SA 2GF0A 2HU8A 3L0ZA 5AK6A 1JJFA 4KXVA 4UBNA 4RTNA 3QFHA 1JLHA 4MKRA 4RFVA 2OEPA 1HFKA 1VA4A 2A4MA 2FHPA 1Z4PX 4GPTA 8LDHA 5DTRA 4JVNA 5BYJA 1U1IA 1WE2A 3BGWA 2CV2A 3IP9A 5TE9A 4J6EA 3MPOA 4XW2A 5BNTA 3KHTA 1QS0B 4Z8XA 1E4YA 3RUFA 4BVHA 2ZYAA 5IBPA 5GOTA 1BX0A 3HPRA 5FHRA 2A0YA 2P7IA 3GLUA 5THXA 1KSFX 3CHYA 5A3JA 4EPTA 2ZR7A 2E4ZA 4HG2A 4AMZA 3OUTA 2UUOA 2EQAA 3KB1A 3UMBA 3X2SA 4L8WB 1XV5A 3WE7A 1OLXA 2ZM6B 3D7SA 5ADWA 1SG0A 2CDBA 3NTVA 3TR6A 3TMKA 1XGKA 1YQEA 2ID4A 1SUFA 1Z3IX 1KO5A 1JNYA 4KGDA 4NBSA 1U81A 3ZE7A 1L7MA 4F93B 3LPCA 1P9RA 4IDQA 3RJTA 1THTA 4J0KA 2G9NA 1XROA 3MBKA 4YT2A 5ILOA 2ADMA 2ZSAA 3O8OB 4Q1AA 4ZCLA 2HA0A 2DFNA 1P1FA 3V1KA 4L5JA 5E9QA 3Q9NA 4D9KA 4DPLA 5GZ6A 1NUQA 2P27A 3EVEA 4ZQFA 3T52A 1ABBA 2Q3HA 4CQMA 3EIUA 5MN5A 3FFBA 3WV4A 4TSFD 3C0KA 1SUBA 1TQHA 4EGFA 3ZQUA 1XWIA 2E21A 1JWBB 4KMSA 3IUSA 2DWPA 2ZDQA 1CRZA 1U2SA 3K31A 2JGDB 3KOWA 3BFPA 4XPIA 3TTWA 1L4KA 4XM2A 4IMIB 1M6VB 3V4RA 4F2WA 1WD7A 4LTMA 1EP2B 5DDIP 5G02A 2CDNA 1B41A 1ESZA 3HVJA 3MT8A 2RJ3A 1T10A 3Q5DA 1MA3A 3AHHA 1ZH0A 1Z22A 2PLAA 1NP3A 4CDGA 1V3UA 3CR7A 4EMSA 3KOYA 5BOSA 1UZMA 5LQUA 4ER5A 1GD1O 3T1NA 2GJAA 4MZXA 1QZ3A 2HK9A 2XF8A 3GJXC 1FXWF 4RKFA 2GARA 3LHIA 2PR7A 4LHSA 2FUKA 4CW7A 4E7PA 2HQSA 4ACBA 1PFYA 3UHAA 2LNDA 1TC2A 3NRBA 4LHVA 1WOMA 3U3ZA 2ZJ2A 1YH3A 2QG9A 1W4BA 3V3KA 3PNSA 1N7JA 3PQ4A 3O4JA 3RVDA 3KFVA 3TB6A 2YVQA 1LBSA 5KTMA 1ZLXA 3HYRA 4QSHA 3VKVA 5ALHA 2C2KA 3NFRA 4EBBA 2PXAA 4JASB 2FX5A 2EFCB 3GJ5A 4BU0A 1YZQA 1VJ0A 3LK6A 2X0NA 3L4KA 2Z6AA 3A32A 2Q62A 3DZKA 1NA5A 2C4UA 3JWJA 5D84A 3KYCA 1N1GA 1FDWA 4Q4DA 2DLDA 3KSRA 3P2OA 1WDMA 3T7SA 3WGTA 4F60A 4L2IB 5E7IA 5CU7A 5BPFA 1L5WA 1E0SA 2TYSB 4NENA 5H82A 2BFWA 3GEIA 4OHUA 1Q15A 2W8BA 2HRZA 3KE9A 4KYIB 3X1YA 2C9MA 2H3EA 3KLOA 1V4BA 4U7TB 1FP6A 4Y6LA 1YE8A 1ZU5A 3RUIA 3GARA 3VR6H 4E5VA 3E84A 3VDRA 2JZCA 3AX6A 5D87A 4LJ7A 2PT5A 4ZYTA 2CMHA 4C0WA 1C4XA 1GQOA 1S3GA 1YZHA 2HYDA 2PYZA 4XUCA 4JB2A 5CYPA 4ZA2A 2I91A 1W44A 2FZVA 1Y1PA 1VZ3A 5G1PA 4WZ6A 5KI6A 4JDUA 4R41A 1NMEA 1RJWA 4QG7A 3SLKA 1JDVA 3I6QA 1QG2A 2PNFA 3BG5A 2D1QA 4M1YA 1GAQA 3K0EA 2FW7A 3I4FA 5HIAA 1WETA 1JF8A 4NC9A 3ZZMA 1XTKA 2C57A 1NI4A 3I72A 3EW9A 5K0ZA 3GJRA 4XLLA 4ZZIA 1ZY2A 2VHVA 4F2DA 5CDFE 1TW2A 1YRQA 1H94A 3ZS9A 5FBWB 5LOVA 2QTMA 2O3QA 3NTQA 1CR6A 1HMYA 3HY6A 4ENTA 4D8WA 1IEVA 1VE6A 3K0CA 2HNBA 2OL4A 4Q47A 4KNYA 1L8QA 1DDGA 3BE6A 5JJBA 2H59A 1SN7A 5A9TA 1SIBE 2G5GX 3AHJA 1R0SA 3V2IA 1Z8FA 2CT8A 5COQA 1TF7A 4R2XA 3ISJA 2FN7A 4OYHA 3R7AA 1NP7A 2ES4A 2XITA 3PNVA 4PU0A 2GXAA 1SU7A 2IXFA 3AU8A 4TX1A 4M7WA 4EKDA 2OTCA 1YZUA 3GEBA 3I53A 3ZDAA 4JZYA 4OX9B 4C6RA 1CU1A 2HRCA 3D7NA 3IUEA 1QIDA 3PXUA 2VRCA 4S1PA 1K27A 2FG5A 2G40A 2ZUCA 2HCTA 4IR7A 3TS1A 3CEMA 3U7EB 1KRWA 1XF9A 1FJGB 4WY8A 2WIFA 1I3MA 3CISA 4KOAA 2R25B 2WJZB 4NMMA 3NS7A 2ZE5A 3CO5A 4DBLE 4PPYA 3URKA 4RDXA 4DA8A 3A37A 3M81A 3KWFA 4EF6A 2CNWD 1GIAA 1P73A 2WJVA 3LY8A 4D3XA 1L9XA 4ROTA 5A7HA 4CEJA 2I33A 1SC6A 1P29A 4TS9A 1NLFA 1T2UA 4TTVA 4U9UA 1M72A 1O7JA 2PXXA 5LL6P 4I5FA 3ZUPA 4EJ6A 2R5WA 1QK5A 3GA7A 4JUIA 4BVFA 1GL6A 2G4CA 2VLIA 4AYXA 1GL3A 4ETIA 4AK9A 1KZ1A 2G88A 3HBNA 5P8WA 3ZWKA 4N03A 4U63A 3QTBA 4BLTA 3TD2A 4F1KA 2ZR8A 2VP2A 2ZW9A 2D00A 3H97A 1OVMA 2AI1A 5FFFA 4V0OA 1OAKA 1QGED 4IXWA 3S70A 1M2KA 4EFMA 1AV7A 1UJ5A 1QO7A 4G8JA 3S44A 4EJFA 1NZJA 3BTUA 3LBAA 4F96A 4HUTA 3N87A 2GK6A 3DKKA 3A9TA 2RBGA 3U2QA 1BH2A 3GJ7A 3UUWA 1Y6JA 3OIVA 1CZNA 1P7VA 1DHRA 2OPBA 3N1UA 3O21A 3ZWVA 1HLPA 4M1QA 3PR3A 4Q3DA 1PL8A 1NMXA 3AR5A 3QXJA 2WF7A 5KDDA 1EVZA 1QV9A 3DULA 5DI9A 3WK7A 4FFLA 1T8RA 4L5CA 4IILA 2DPGA 2R86A 2WILA 1N2ZA 1Z0AA 3FNQA 3BMNA 3NNDA 4RF5A 2B5WA 2C4TA 1ZL0A 3HLKA 3VDQA 4AC9A 1YA4A 2XNSA 3LO5A 2UZ0A 1HG0A 1TEXA 4ISCA 3WFJA 3DEJA 4BEWA 4G23A 1U7DA 1K3TA 3QG1A 1U0BB 1Z4LA 2Z56A 5JBQA 1NXWA 3O9VA 2MU1A 3EBLA 4NPCA 3T15A 3UXEA 2F8TA 1E0AA 1B8VA 4F0JA 3KKEA 1BCRB 5HBGA 3UOGA 2D7CA 3K8QA 4G1EB 2ZVQX 2IYLD 2VP0A 3O2SB 5J5VA 5CDTA 4BFSA 4XB6B 1A9TA 2P9ZA 2Y0PA 3SOPA 1RAEA 1WABA 2O57A 1Y4SA 4I55F 2F00A 3RE1A 4B2IA 4UM9B 1K8ZB 2IOFA 2C2GA 5IDVA 4UVEA 3H0CA 3UV7A 2H29A 1GKKA 1YA6A 3CEHA 4GZMA 1PX2A 3KD2A 3O8DA 3QVGA 4JU8A 4S3MA 3OZWA 1DG3A 2DUUA 3BJMA 1IN4A 5JYDA 1GKLA 3QEMB 3NH9A 1KK3A 1GDDA 3NGLA 4ZAWA 3GA5A 4KIFA 3TD9A 1F0KA 2A67A 2ZPTX 4AJHA 3ORHA 5KOHB 4NCAA 1E1RD 1M1ZA 6ADHA 2ONKA 5EHZA 2E4YA 2A59A 4J1TA 5E4FA 2WE7A 1E8NA 3PWKA 1TKRA 3RFCA 1E1RA 3AHDA 3RYTC 1CYDA 1RKQA 2B9VA 1GNQA 1V5IA 3L7CA 3DHYA 4LN1A 3KALA 4HDSA 3UJDA 1UEXC 1F3OA 1O9HA 2B61A 2RGAA 1AH2A 2YV5A 4OQLA 2BY4A 4FW8A 1SURA 3CR8A 3DZJA 3BJIC 2H1IA 4A82A 2IE0A 3NC0C 1G3QA 3RAJA 3TLCA 4C14A 2PZEA 4M1KA 1HI9A 4OLHA 3SMQA 2RE8A 2KE5A 4BNTA 4AUNA 5CG2A 2YRWA 5HCIA 3K9WA 1W5SA 4DRXA 1UT6A 4FT2A 5B6IA 2H0AA 4MKZA 2NMVA 1O6CA 1U6JA 3TL2A 3V1TC 5EG5A 3JW8A 4KQHA 3NNSA 3EZLA 4K6FA