4XTRA

Structure of get3 bound to the transmembrane domain of pep12
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
348
structure length
305
Chain Sequence
b'VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMGALADLTGSIPGIDEALSFMEVMKHIKRQEQGTFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
molecule tags Hydrolase/transport protein
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
total genus 100
structure length 305
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xtrA00
5AUPB 3PITA 3P20A 1KSGA 4HDOB 3B6EA 4A2PA 5IHPA 1GNQA 1M7HA 3VQTA 1IAQA 2MMCA 3KJEA 3SEAA 5LB2A 1N6HA 4EPXA 4V0LA 2RB4A 2XB4A 2OAQ1 1FUKA 2H5EA 2QSYA 3O8CA 1AZSC 2FPLA 1SVMA 1M7BA 4MYCA 1YRAA 1RJ9A 2IYRA 2JJ2A 3CPHA 3SJZA 4MUAA 5EZ6B 4W9MC 1GDDA 2QMUA 4RD2A 2PEZA 4XVQA 2BHRA 5HCNA 1Z6AA 2H1LA 3B7GA 4EKDA 3KQKA 2W2TA 4L8GA 1ZIOA 4Q4AA 4EFLA 5SZHB 1LVGA 1XF9A 2GEVA 1N0UA 4LV8B 1TX4B 1WP9A 3GLIB 1R2QA 1Z3IX 1IONA 2R44A 3UWKA 2WAXA 2HLDD 2RGGA 3AF1A 2ZYUX 1XTIA 5JEDA 3GLGA 3UKDA 4JJKA 2B8WA 2WMOB 3UIEA 1P2VA 1G291 3AH8A 4LDJA 1DAGA 5FPSA 3KJHA 1E2IA 3AM1A 1G9XA 4US0R 3I5YA 2J7PA 4HLQB 5KSPA 4C0QC 2VHUA 2O8DB 2QGZA 1R4AA 4BECA 4OI4A 3DOFA 1FPMA 3PV0A 2CEAA 3WBKA 4B3DA 2H7VA 1KK3A 4TTRA 1TF5A 1SVSA 1XRJA 3W6PA 4U02A 1ZRHA 4QNRA 5SZJA 3T34A 3K0AA 4K8OA 4B76A 4ZCLA 1JQLB 1GRNA 4W5HA 1D9ZA 3TUIC 4BLTA 3LQRA 3A4NA 1KY3A 4KLZA 4Q66C 1PJRA 2W2VA 1OV4A 2ZEJA 3FHTA 4TTQA 2UZIR 3PR1A 2X2FA 4ZCIA 1YE8A 2OV2A 2X19A 4B74A 4RZ3A 3NEJA 4BFVA 4DCTA 5LD2B 3GFPA 2GXAA 4C7OB 1TNDA 4B34A 2QTVB 4Z8YA 3X1WA 2AXPA 3A1UA 5DYIA 4FCTA 1Z2AA 3A6PC 3K0FB 4LJ7A 1TQ6A 4LBVA 1FX0B 3Q7PA 5L3QA 2ZI3A 2HDNB 3TLXA 1AQYA 2WAYA 3GFOA 2ZYWX 4QGAA 2FSFA 3K0AB 1XPRA 2XXAA 1VIYA 2GVZC 5JBQA 2EFHB 3MGCA 1GNRA 1RZ3A 4R9UC 2ZRNA 1XEXA 1FP7A 3K8YA 5FPYA 3KQLA 4HAXA 3FMPB 3O47A 5DHAA 3SR0A 4G0NA 2AKYA 4OHYA 5DLQC 4PPGA 3JVUA 2IYQA 3GLIE 1H8EA 3FPAA 5D3MB 3KXKA 1Q1EA 2C8VA 1WQ1R 1GAJA 2D4HA 1E2KA 4HZIA 1ZP6A 2REOA 2YV5A 1II8B 2W0SA 4XD7D 3GD7A 4TZ6A 1O3YA 1C4OA 2FF7A 2YOGA 2B7CA 2EWVA 1NVUQ 2ZRLA 1KI1A 4KBFA 3MJRA 4JMPA 2JLVA 5HKKA 3K1JA 3K0SA 2A7QA 1E0AA 1OIXA 1GVNB 4D4KA 1NVXQ 4ESHA 4M9XA 2ZI6A 1NLFA 4HB3A 1RRCA 3AP2A 2PZEA 4HB2A 3PIRA 1ESMA 5JJIA 3ADCA 2RCNA 1RIFA 1WE2A 2WTUA 2VRWA 3EPJA 3FDIA 4IEEA 4PPFA 2VSOA 3L0IB 4FW9A 5TDHA 2CHVA 4IKEA 4PHHA 2J0UB 4CEJA 2V9PA 4M1KA 4EJSB 2HT1A 1AZTA 2J7PD 1P4SA 2BMEA 1P75A 2ZQ5A 5E7IA 4D81A 5EE9A 3IQWA 1P9NA 2JJ2D 1NY5A 6Q21A 2OILA 2CK3D 4FCVA 1FUUA 4JLPA 2E87A 2WSSA 4UXIA 2GTPA 2A5DA 1IN8A 4LSGA 5BW8A 5E95A 3EIEA 2AR7A 4HUQA 1K5GA 5BYKA 1I4DD 1YZQA 4IEIA 4M21A 2BMDA 1Z28A 4IVRA 1GZSA 1XXHE 2WWGA 2ZJ8A 3GLHB 3WRYC 3QXJA 2XTNA 2R65A 2XGJA 4TQAA 2C95A 4QC2A 1NVWQ 4LJ4A 4EFMA 2O0KA 4PANA 1W0KA 3QXSA 1ELOA 4M8NE 1NBMA 4LHWA 4NP6A 4JBWA 2ZE6A 1HT1E 3Q8XB 4OI2A 5BYJA 1N5LA 3RS2A 4JLAA 4P4UA 3SOPA 1FW6A 2QM8A 3CF6R 4LHZA 1UPTA 4Q4JB 3THYB 2W00A 1KO5A 2GRJA 4JBXA 3NC0C 2XSZA 4LHXA 4TYWA 1RYFA 4QBGB 2ZR9A 4JLVA 3PCRB 4Q9LA 2IYSA 4D80A 2ZJ2A 3CX8A 2D06A 2F3TA 1PZNA 2R9VA 1OXUA 1Q22A 2ZPTX 2W58A 3TVTA 1F2TA 1UFQA 1MT0A 1IXSB 1U90A 4C2UA 5B30A 4BEJA 4FMDF 1YR9A 4LJYA 3WXMA 3UATA 4Q1CA 2FPMA 4GRAA 3EAQA 2QP9X 3AGQA 1UKEA 4KFTA 2G0TA 2KJQA 1CU1A 4PR0A 4G01B 4R2IA 3TVDA 3L0PA 5KDOA 4DLRA 2F9MA 2JLUA 3NC1C 2ONKA 3FOZA 2C5LA 3NBFA 5CB8A 2BJVA 2AKAB 1JAIA 2C9CA 2CJWA 2QEQA 3CH5A 3OIWA 3PUVA 4ITRC 5DI3B 3RWMB 3CR7A 1IN4A 5A0FA 3W34A 2QT0A 1ZUIA 4D0LB 3ZIAD 2RGDA 1KGDA 2AWNA 1NVVQ 2AD1A 4DLZA 2FU5C 4CDGA 2EQBA 3CX6A 5JJKA 4NYJR 1OH7A 2PMDA 2CL7X 1KI2A 2FWRA 2J7KA 2ZI4A 1QG2A 4ZO4A 1OFUX 4PAQA 4YLGA 4NYIR 5J4HA 2QENA 3H86A 1XWIA 4PQYA 2ZYTX 2NOAA 3FMOB 1E9EA 2N1BA 4KBGA 1E2GA 2IXFA 3LH5A 1GOTA 2Q6TA 4MYUA 1KMHA 2IYZA 2X77A 5GJWC 4C4PA 1QVAA 4D4MA 1WBDA 2WSSD 1NSTA 1GM5A 2D62A 1KI6A 1QG4A 3B9PA 5HKKD 3EIQA 1U8YA 1MABA 3QQ5A 1SKQA 1R5NA 5L3VA 2IYUA 1Q3TA 3C5CA 4OK6A 3R9XA 3AVXA 4HATA 2IWRA 3TQCA 4RD0A 1Z47A 4C0HA 1OH8A 1Q21A 5DGXA 1GRQA 3N70A 5GVSA 5AUNB 4EPWA 1ZU4A 3BWDD 1XD2B 1KO4A 1KKLA 2P2LA 3EPHA 4MGZR 1XCPA 4V0NA 3R20A 3AVVA 2GKSA 1UM8A 3NDBB 4N0EA 1FX0A 1QHGA 3THOA 3EZ9A 2QTFA 5TVKA 3HPQA 5HTKA 3S1AB 3H1TA 5JWHA 1DO2A 5F9FA 2FV8A 3LNCA 3D6TB 1KOFA 3BIFA 3FFBA 3KTAB 4Q1EA 5B57C 1N6RA 1AS0A 4C0SA 2IYWA 1JALA 5FI1B 1SGWA 5FOWA 5JEEA 3IUYA 4PHGA 2QAJA 3DMNA 4GPTA 3D7MA 3TMKA 4KAXA 2CLCX 3T5GA 5EP4A 3U6BA 5EXSA 1KO7A 3Q3JB 1E2JA 4URYR 1EX6A 3BH0A 1OFHA 1GITA 1VCOA 2FMXA 2W6IA 3SZRA 1KK0A 2IBMA 3NIBA 1MRNA 3JZMA 2JIZA 2ODEA 2QTHA 4LBYA 2X2EA 4E09A 4YQFA 2P6RA 4A36A 3AF3A 2JASA 1LY1A 2ZUDA 4MKHA 4TMVA 1FMLA 2ZI7A 4MH0R 3NHAA 4A15A 2FG5A 2QSZA 2JA1A 1D8TA 2I3BA 2ZVQX 4G3XA 5G40A 4EQ6B 4YMUA 1Z0DA 2CMKA 4QKQA 2FEOA 3EA0A 2IS6A 1UBFA 5HCIA 1T8TA 4DCUA 4QHYA 3RS3A 1SHKA 5FOTA 2ZI9A 5FTNA 1NY6A 4Q00A 5J4YA 4HAVA 1SXJB 3BXZA 1NMZA 4F4CA 2J0SA 3QXXA 2I1VB 3I72A 1TQDA 4O0MA 3U44B 4MKGA 3D8BA 3GJ6A 4DLTA 3FKSD 3KKNA 3I62A 3PENA 1LF5A 3X1DA 3BFVA 1XJ0A 4PO9A 2WWFA 5FPTA 3OEED 1CTQA 4DKXA 4YDSA 2O8CA 5FPHA 2HF8A 4S35A 1F48A 3KXLA 4QGHA 3K0EA 1EFRA 4DLVA 3CNNA 4FCWA 3P1JA 1LS6A 3VHXA 1JEDA 2WJJA 4W7SA 1G4AE 2TMKA 2J59A 3OE7D 2O52A 1M1YE 2QMHA 1KNQA 3I92A 2EW1A 4EFNA 1VIAA 1E2DA 2FZLA 2HJVA 1DS6A 3NBXX 4HAUA 4KHZA 2ZE8A 1XFAA 3VHLB 3VNUA 4BFYA 3QXCA 3QF7A 1BMFA 2WOOA 3PUYA 2CLSA 5KO2A 4U7DA 1F2UB 5CB6A 1KAGA 3RWOA 3PEWA 3AF0A 3ONWA 4ERNA 4DLSA 2EFCB 2MSDB 3PXGA 4NCHA 4A0GA 4R2HA 3SS8A 5H1YA 5GJVC 1G7TA 1P2TA 2J46A 3AUYA 3IBYA 2FFHA 5DNYB 1KJWA 2PCLA 4GZLA 4Q7JB 3MWKA 3EIHA 1NKSA 4OHVA 1SXJD 2WM9B 4QRHA 3BBPA 3KDSE 3A37A 3T1OA 5DN6D 2XJ9A 1TEVA 1NN1A 2ZI5A 2IHBA 4MGKR 1ZM9A 2B8TA 4ZI2A 2H92A 4TLDA 1W0JA 1YKSA 2ZU0C 4TN1A 1W1WA 3Q85A 2IEYA 4Q19A 1FL9A 4OHZA 5KTYA 2G77B 4I99A 3MMPA 2KI5A 5FR1A 3R9IA 5H8WA 3RYTC 1E1QD 3A58B 3LWNA 1BKDR 3LVRE 4OK5A 1BS1A 2BM0A 1N5KA 2WKPA 1P9RA 3CPEA 1UF9A 3TKLA 3UMSA 3CLVA 3BB4A 4XOIA 3THXB 2IXEA 4IOKA 5TMPA 1DG3A 3R7WB 4B2PA 3A1VA 4MGYR 2KSQA 2XJ4A 1VHLA 4B3FX 1UBGA 4L9WA 3THYA 4B73A 4GOKA 3O8BA 3QF4A 4B33A 1PVOA 4PAMA 1SXJA 1W4AA 1E9SA 2GAAA 4RD1A 2PBRA 1CULC 4BQSA 3GFTA 3U60B 2PEYA 3W8RA 3CKLA 3QG1A 4RY2A 1HEIA 2VPPA 2JLYA 2Q21A 4M1WA 5FTKA 2ATXA 3O8RA 2G1JA 4A2QA 5FH9A 4ZDKA 1IJFA 1SVWA 1Q44A 1QHHA 2V54A 1X8LA 4OL0A 1KMQA 3KUCA 1MH1A 4P31A 5CJPA 5A4JA 1XD9A 5JI3E 1FNMA 4UQOA 3T1VA 1ZVQA 2JDID 4D4LA 3I61A 2XEXA 4U00A 3X1ZA 1U0HC 2GJ9A 4GZMA 4HAZA 4Q7LA 5JHGB 4AYTA 5G3ZA 4QL3A 3Q5DA 1OXXK 3ADBA 2FNAA 2GZAA 4M22A 4KJZA 3GJ7A 5LD2C 3KJGA 3WMFA 1I4LD 4HUQB 4URXR 1XXHA 1XTQA 5KSYA 4DWJA 4TMZA 2NTYC 3LY5A 3KUDA 1GRRA 5L3SA 4BFSA 2VHTA 1CJMA 2X1VA 4C0JA 3OFND 1BIFA 1OXSC 2I1QA 3TSOA 3TSWA 4XVUA 3FTQA 3BE4A 4RJLA 1QHHB 5AK0A 1WB9A 4LGMA 1KKMA 4LJ5A 2Q0HA 1E2LA 421PA 5FI0B 3K70B 3MSXA 4XD7A 1G8PA 2QORA 3QI2A 4BLSA 1I2DA 1Q1ZA 4OI0A 1AQUA 4GMDA 2GXSA 1QRAA 4F7WA 1XMIA 3FHCB 4JVMA 3FHOA 3QXHA 3R9WA 4AI6A 2ASEA 3MFYA 5GADl 1UBCA 1IBRA 2WBLC 1N6IA 2JJ1A 4BFXA 1G6OA 1TU3A 1RFLA 3QUSA 1GG2A 1XNJA 5KU1A 2C9OA 3EXAA 2PJRA 4GOXA 2KBFA 2JLZA 1F6BA 5CLLA 2FX3A 2ZE7A 3VAAA 1M6NA 1UKYA 2WIBA 1AS3A 1Z6XA 1I2MA 4JT4A 2NO7A 1XPOA 4TYYA 4Q4HB 3VR1A 3R7WA 1T8UA 2D2EA 2OFOA 4ZV4A 4C30A 4URUR 1RKBA 8OHMA 3THWA 4QGGA 4O3MA 1Z22A 3EC1A 3HU3A 2G9NA 2XB2A 3QKSA 1GKUB 2ATVA 2ERYA 1E2EA 4WA7A 2O8FA 4H1UA 4D2IA 4P3YA 3EA5A 1E9RA 4D25A 1DOAA 3P26A 4FWIB 3SN6A 1Z6YA 1E2FA 1QHNA 4DIDA 1SKYE 4DCVA 5EE5B 4IFEA 1VG9B 4ABYA 4IW3B 2QP3A 4CEIA 5KUTA 4KITB 1SXJC 1S9HA 1MRSA 2DFKB 1ZM7A 3NTUA 4GP7A 2J41A 4B71A 5CDFA 2VF8A 3CNOA 4HAYA 4MRNA 4JL8A 2J1LA 4ZKDA 3RS0A 1E9AA 1OLOA 3S1AA 4MGIR 2YVUA 4NH0A 3A8TA 1XEFA 4B6EA 1VCMA 3IIKA 4MYTA 3I5XA 1TAGA 2RH5A 2Z5FA 4EPVA 4E07A 2VF7A 2YJTD 3DM9B 3PQCA 2UZ3A 3KKPA 4KXFB 2IX3A 4ZPXA 5KNDA 3W6NA 1C9KA 1NJFA 2ZTSA 4IFBA 3CIOA 4FMBB 1GP2A 2CCKA 4QBHA 4A0FA 2HLDA 2ZSFA 3F3YA 4BRUA 3FYHA 2ZSBA 4M4SA 3CONA 3PFIA 1E0KA 2Q9BA 3IILA 4TT3A 1OT3A 4HDCA 5KDLA 4F4IA 3MJHA 3GLGE 5AUOB 1KTVA 1OHHD 1GFIA 2GF9A 4TMKA 4A4DA 4QG7A 5J5CA 3MUFA 1KO1A 2CK3A 2IYXA 1N25A 2GJKA 4AKIA 2RGXA 2XNSA 1YZLA 1CLUA 2A2ZA 2XNDA 4EQ6A 3OIUA 2GCOB 1S3GA 4XVRA 1IHUA 2R6FA 1OW3B 1JXOA 1A2BA 2V7QA 5EXPA 1NG9A 5FL7A 5JZVA 3KQUA 1T3HA 2XX3A 1YRBA 2FOLA 3QNUA 4AURA 1JNYA 4AY2A 4IDQA 3BFKA 5FUXA 1ZIPA 1AN0A 4DB4A 3LXXA 1OB2A 3CZQA 1VECA 2ZSAA 3LD9A 4NCKA 1XMSA 3Q9LA 5C4GB 3V00A 3B5JA 1ZC4A 2YHSA 2CE7A 1H8HA 2FN4A 4JYBA 4M1TA 2ZRIA 1B23P 5DO9A 3MWLA 2C9YA 2HXYA 1YHNA 2BWJA 4UJ5A 4RZXA 4EJSA 2YC2C 3QOFA 3H0KA 1KSFX 4ZDWA 4OQFA 2ZJYA 1S3SA 2BOVA 3GMTA 3NBYC 1PUJA 4W5JA 4TTPA 1EK0A 3E2IA 4BZXA 2QA5A 1XJQA 4Q9JA 1P61B 2FH5B 3QVUA 4BRWA 5CM8B 4NKRA 1TQ4A 1BH2A 3BAFA 2VL7A 5E4FA 1XD8A 2FZ4A 3SJAA 4WZBE 4B3CA 2B6HA 1U8ZA 2P5TB 1A5TA 2FFQA 1Q1BA 1CR1A 1Y3AA 5CIWA 2QNRA 2DWPA 1HUQA 1YZUA 3E70C 2D2FA 1SVKA 1F2TB 1HYQA 3JZAA 5D3MA 1IM2A 1RE0A 4DSOA 1OH6A 1R5BA 1RYHA 4JLDA 5C46F 1NN5A 1N2CE 1R6BX 2EWWA 1XBTA 4QJ4A 2GESA 2GEDA 4WOPA 1BOFA 1KYIA 2ORVA 3ZVMA 4JL5A 2GHIA 3MWYW 2VYFA 5FBVB 3PEYA 4C0LA 4Q4LA 1NF3A 3GJ4A 3H84A 4M9QA 4Q4JA 1LFDB 5EP3A 1OIWA 1ZW6A 2OLKA 1G8HA 1S9DA 1UJ2A 2P5SA 2ZREA 3CUEF 2V7QD 4DSUA 4DT1B 1JR6A 2YWEA 1E1RD 1NN0A 2FE4A 1ZU5A 3A4LA 3N2IA 3NEYA 1NIPA 4Q1BA 4ASUD 3BRWD 4US1R 1ZM4A 1D2EA 3QSYA 4GDFA 1JPNA 3ECCA 3FE2A 2RGNA 1T5LA 4NTZA 2XZOA 2J3EA 2YZ2A 4DVGA 4JLMA 4P4TA 2OCBA 1MR3F 5KSZA 4BFWA 5JMTA 4GI7A 4LCBA 3WYGA 4CYMA 2Z43A 1CRQA 3U4QB 2BBWA 2G83A 2QG6A 3EASA 3SNHA 4FIDA 3QKRA 1X3SA 4XWKA 3THXA 2QAGA 5FTMA 2ZVPX 2OXRA 2IYVA 4A0RA 4TMWA 4KFUA 3W9YA 2K5UA 3KFXA 3GLHE 1HQCA 4URVR 4POAA 1G5PA 1G8YA 2H16A 2FGJA 3CWZA 1E6CA 1LV7A 1Z2CA 1N6LA 3MG9A 1W47A 4OYHA 4ASUA 1IN5A 3KFVA 5AJVB 3TH5A 3ZIAA 1N3BA 2AN9A 3ZQ6A 1E1RA 5HZKA 3OFNA 1VTKA 3RABA 721PA 3IKJA 4C2TA 4KSBA 4AKHA 1KAOA 3B2EA 1Q57A 1OIVA 4LRWA 5TARA 3AF2A 2GXQA 4DJTA 2IXGA 5DI9A 1II9A 4YMTA 3B82A 4F92B 1E2PA 3OZXA 2P6UA 1MO3A 3CRRA 2P0EA 5FUWA 3RS7A 3BB1A 5FUVA 1T6NA 4HUTA 1Z6GA 1OKKD 3SQWA 2V6IA 4AK9A 3HPRA 1EFUA 4M1OA 5LBIA 1M2OB 2P65A 4LYFA 4R7ZA 4YMWA 4GP6A 1N0WA 4FMDB 3FMFA 5EE0A 1KI6B 5UKDA 2IHYA 3DVLA 1P62B 2Q3FA 2VLIA 1SHZA 1JECA 4Q03A 1CR4A 3U3MA 4MQBA 3T06B 1ODFA 3E1SA 3REGA 1JR3A 1G3UA 3UMFA 3RRZA 2QRNA 4NYJQ 2XTZA 2EVWX 4I1SA 4YDHB 2QPAA 2BM1A 1EWRA 3E5HA 4OJQA 1JJ7A 3KJIA 3SJCA 3GLFE 3NWJA 5CK4A 4QXAA 2OT3B 3TUJC 2GETA 2DFTA 4BGDA 2BBOA 3ZJYA 1KMHB 2AK3A 4II7A 2JIZD 1Q12A 4LOAA 1IJEA 2PT5A 1M7GA 4M53A 1G3MA 1XX6A 3LW7A 4PTLA 2F55A 4FMCF 2E1RA 2V1UA 4RCZA 1A82A 4TMTA 4HB4A 2ZJBA 4BUJA 4L4UA 1CKEA 4GSYA 2WWHA 2PJZA 2CNWD 1KI9A 3CBQA 4HAWA 1IOZA 4JLJA 4BZPA 4DSTA 4PQFA 2VA8A 4RFSA 3SQXA 1E99A 5FL7D 3REFA 1ZD1A 4N3NA 2FDCA 2D3WA 2WV9A 3QBTA 2BCGY 1TQ2A 4LK2A 1DAHA 2QQ0A 2JLWA 1NBMD 2ZRDA 3T35A 3GLFA 1AK2A 1WCV1 3I73A 3OAAD 3AVTA 4RD4A 4X8MA 3ND9A 3GLFB 4RD3A 1YR7A 1H8HD 1N0VC 4PZZA 1SULA 3UPUA 1LB1B 4Q5IA 2FFBA 2FSIA 1N5IA 1J8MF 2WJHA 4EAQA 3CX7A 4LYHA 3TQFA 2CJWB 2G3YA 5DI3A 4D0NA 3B9QA 2XOKD 2GJ8A 5K8UA 3GLIA 1WF3A 2IC5A 5H70A 4Q9KA 4QFMA 3GJXC 3GCGA 1E2QA 1R8QA 3MD0A 4CT4B 3CRMA 4MUBA 4OHXA 1Z5ZA 3ZZ0A 2FEMA 3W3ZB 2A5GA 4TL9A 2FJUA 1NBME 3GLGB 3F0TA 1E79A 3GP8A 5K8TA 1XJCA 2BJWA 1C1YA 4G5SA 4A6PA 4C9BA 4ARZB 1PUIA 4XTRA 3DO6A 3QIAA 2CL0X 4TL6A 3V9PA 3GEIA 5EE1A 4CGZA 2JAQA 3TSZA 4B3GA 1YZGA 3KKQA 2YC4C 3AVPA 3RANA 3U7HB 2QBYB 1ZUHA 3W5IA 5F3WB 5P21A 1L7VC 4Q1FA 4HB0A 5KNBA 3PEVA 4NONA 2RAPA 2ZRMA 1CEEA 1RC8A 3DKPA 3QE0A 1IN7A 2W83A 4OJKA 1RW4A 1U0LA 5J4VA 2VP4A 4CVNA 3CR8A 4Q02A 3K9GA 1E2HA 1E94E 4UNNA 3P32A 3W3AA 4LJ8A 4TYPA 3GLHA 4LZZA 2QPTA 3SJBA 1G18A 4H1VA 1Z29A 1GL6A 2KB0A 1DAFA 1TL7C 2A5FA 2IYLD 1FMJA 2ZR0A 1X86B 1DEKA 2GWHA 4D0GA 1Z0FA 2WKQA 2G1KA 3I4LA 121PA 1ZYUA 3T5DA 1KI7A 3DPUA 2AFIE 1HV8A 2PLFA 1PLJA 1DG1G 5IT5A 2FSHA 1KI3A 2XITA 3BOSA 5LDDC 4JVNA 3UWOA 2Q9CA 4R71A 1DE0A 2BKUA 2NO9A 3LW8A 4JLNA 1GUAA 3WBJA 3DOEA 5H68A 2OBLA 2F9LA 1VPLA 1S1CA 2RMKA 3NDPA 4KLNA 4RD6A 4D82A 4FI3C 2ZS7A 4O2LA 1G3IA 1XD2A 2NZ8A 1W2GA 4FN5A 3U7FB 2GILA 2DR3A 1QHYA 1TF2A 5EXTA 1T0HB 2PX0A 4Q01A 5F2EA 4MDEA 4PO1A 1U9IA 2FPKA 5FTLA 5TY0A 3QG5A 3U2QA 3AVUA 1G17A 1UEIA 4NDZA 2CDNA 4Q47A 4UNQA 4M0LA 4TMXA 1OSNA 2VTKA 4K81B 4WVFA 5FR2A 1JBKA 3QEJA 1BO6A 2GCOA 3SU8A 4M1MA 2D7CA 1DBSA 4LUCA 4MRRA 5G41A 2ONJA 1NNEA 4B75A 4Q21A 1X8JA 4QJ3A 2ZAMA 1XMVA 2GJAA 2OXCA 4ACBA 4DDUA 5FBQB 3TRFA 2C03A 2ODBA 4B3BA 4Z1MD 1RPZA 2ZXUA 2C78A 1E9DA 3W90A 4F38A 1RRFA 2CL6X 4WZ6A 5DYGA 1KIMA 1BMFD 2N42A 3IPYA 1KZGB 3GPLA 3F8TA 4HLCA 5EP2A 1F60A 1OXVA 4FD2A 4G5QA 3GJ0A 4NYMR 3CF2A 4M1SA 3A36A 5C18A 2WJVA 5CYOA 2ZS8A 2GAOA 4GMXA 4CF7A 2EFDB 4LWZA 2GK7A 3LBIA 4XWOA 1Z6TA 4TLCA 2OEPA 5AJXA 4YXWA 2NPFA 3RC3A 3SHWA 4D6PA 3LAWA 3ZD7A 1DPFA 3Q72A 5JFGA 4PPQA 4XH9B 4JL6A 3EZ2A 3AKDA 2XAUA 5FBRB 2B7BA 4N0DA 2R6CA 4IOMA 2GA8A 4LHVA 3EPKA 2P67A 3C5HA 1GILA 1NMYA 4JLBA 2WICA 3U7GA 2C98A 2ZS9A 3CH4B 2P6NA 4LX0A 3QKUA 4Q1DA 1CR0A 3WYFA 2LKCA 1DAEA 2IUUA 1HH4A 2DCUA 3BB3A 3LLMA 3AP3A 2QM7A 4KV9A 3B85A 4QBFA 4ZI3A 1HE1C 1TPZA 1Z8FA 3PUXA 3UG6A 1Z0KA 3G0HA 2VHQA 1IY1A 1T9HA 1XMJA 2IL1A 2R6GA 2R6AA 2IUTA 3NH9A 4DIEA 4RVCA 2GXUA 1P2SA 4A6XA 3OIVA 3NBZC 4D4JA 1SZPA 3PUZA 1W49A 4Q4AB 1A1VA 3BJIC 3TUZC 3VR5A 1EXMA 4DUGD 3HU2A 1Z63A 3GJ5A 2F43A 3KQNA 2IYTA 1G3QA 4PPNA 2GCNA 5HPYB 2NO0A 4BLQA 3SFVA 2ZSEA 5ELXA 4X8HA 2BVNA 4WBSA 5LB4A 2DWOA 2ZRCA 4RZUA 3K70D 2Q9AA 2QU8A 1E4VA 3IIJA 2ODNA 5E7MA 3ICQB 1EWQA 5L3QB 4KVAA 1FP6A 4S2EA 1W36D 3B78A 5JECA 3IO5A 4KYUA 3IO3A 2KWIA 4A8JA 4E5UA 2OZEA 5L3SB 1KY2A 1Q20A 2F43B 2J45A 1IXZA 1ZAKA 2REXB 5FOSA 1SVLA 1X1SA 2RGNC 1JEEA 1ZCBA 1XU4A 2OM2A 4NHOA 4NU0A 3X1YA 5A5GA 2PL3A 1TEXA 4DLYA 1AA9A 1LS1A 3WHLA 1G64A 3B1ZA 4P32A 4TL8A 2O8BB 2DWQA 4QJ5A 1W5TA 1ZINA 2IUSA 3AB3A 1CJTC 2WOJA 3LX5A 1EFRD 4LC1A 2Z83A 4DB2A 1W7AA 4WW0A 1YR6A 4G5OA 4KU4A 4BASA 5JHHB 1K6MA 1M8PA 3G82C 3VTKA 4B2LA 1BYUA 2Z6VA 1ZNXA 4KVGA 4O25A 3RRNA 1U94A 2V8OA 5FOXA 4DDTA 2YYZA 2OCPA 2F3RA 5G3YA 2YKGA 5EJEA 4EUNA 4LYJA 3VKHA 1D2NA 2ZRAA 3WMEA 1T3SA 4V0KA 1FOEB 1U8AA 3TNFA 2EYQA 3TJZA 3U61B 2RKOA 2C99A 1TADA 2XZPA 3VU9B 2NZJA 2G6BA 4AC9A 1QZXA 3RRMA 3TR0A 2GJSA 4ZDIA 4CEHB 2F7SA 1F5NA 4QHSA 4AYWA 4HZUA 3AF4A 2A5YB 3QPUA 2HT6A 2O8DA 2JDIA 4ZCMA 2DPXA 2IT1A 1G8FA 3MLEA 3TK1A 1T0JB 2HCJB 1ETUA 1VMAA 2ZETA 3OEHD 1VCNA 3NG1A 3THWB 1PV4A 3RC8A 2J9RA 3KXIA 4H9GA 2WWIA 2F6RA 3EZ6A 4IDHA 4JKYA 4LJAA 2F1RA 3RVBA 1YZKA 1ZNWA 2HCBA 4NCIA 4P4SA 2HV8A 3HDTA 5JS8A 2XXAB 2NG1A 1E4YA 1S4QA 4GNKA 4WIAA 2XZLA 3H4MA 3T61A 5CJ2A 5CM9C 2VEDA 2DBYA 4TLBA 5KSOA 2PLRA 3EWSA 5TXGA 5JWOA 4JVLA 1XEXB 5SZIA 1W0JD 2BBTA 2OBMA 4UNSA 3I1FA 4DCNA 4CEHA 2IS4A 5J40A 4F93B 4ARZA 821PA 3R8FA 5JS7A 3DDCA 1R0WA 3F5FA 2DY1A 4PC7A 4XWAA 1EESA 2HUPA 3ZVLA 3TAUA 5B2ZA 3LVQE 2W6ID 3TE6A 2GVDC 1E32A 2VSFA 2HYIC 1RJ9B 4D26A 1NL3A 2C77A 2ZJ5A 3BERA 3ICEA 1J99A 5CLQA 2W6JA 2JATA 2EFEB 3GQBA 2P3SA 3ASYA 5JCPA 2QUZA 1W36B 3IIMA 3VKWA 5FUYA 1HURA 1Z83A 4V0MA 1KJZA 2W0MA 4US2R 1KI8A 1M34E 3I32A 4TYQA 1Z0IA 3M6AA 2ZRPA 5AR1A 4KYIB 2PT7A 4B6FA 4C3ZA 1M74A 1S0UA 1JB1A 2A78A 4JKIA 2ZM5A 1HT2E 3UMRA 4URZR 1S1MA 1R10A 5GJBA 3N2EA 2B92A 3WNBA 2EFGA 3L8YA 4DLUA 5KDDA 3KKOA 4YMVA 2LKDA 2AWOA 5DISB 1J90A 2QT1A 4Q48A 4M9SA 1XEWY 4L9SA 3RS4A 3RSOA 1P9WA 2CVFA 3GEEA 2RGBA 1FQKA 1DAIA 4G5GA 1OFTA 3WYAA 2UVQA 1Z0AA 3BS4A 2QGNA 5EQTA 3EWAA 3I3SR 1YJ5A 1LW7A 1AKEA 3K9NA 4I1VA 4LYAA 3P27A 3A1SA 1MO5A 2IK8A 4Z1MA 4LHYA 5AJYA 1NLYA 4TT3D 4ZKEA 5EE3A 2C96A 1I4TD 5KOYA 4TLAA 1T5IA 1TMKA 2LCFA 4A9AA 2WPDA 2NMVA 3K9HA 1A2KC 2F1HA 1J70A 3SHFA 1ONBA 3QY0A 1ZBDA 5B58C 2OFWA 3HR7A 2OFXA 2Y8EA 3ZS9A 1V43A 1FQJA 2JLRA 2QY9A 3IHWA 2QL6A 1P6XA 4OQLA 1XXHB 4JIMA 1G5RA 1VG1A 4NMMA 4OK3A 4TLEA 2MSCB 2IWHA 1JR3D 4ON9A 5CYPA 4JLKA 3HYRA 3LBNA 4A1FA 4Q9HA 4RFSB 2PCJA 3MCAA 5C2JB 3AVYA 1CJUC 3P4XA 5BQ5A 3K9LA 4HI0E 4TQ9A 1JI0A 1YR8A 3U3KA 1L4YA 3GJ8A 2A5JA 1US8B 3BGWA 5L3RA 3I8SA 2BCJQ 1K8RA 4KFSA 3EARA 1GKIA 2WJGA 2JGNA 3FB4A 1OFIA 2NO6A 1GKYA 2GK6A 2BDTA 3LBHA 4DSNA 3V4FA 4JLOA 1AM4D 3DHWC 4IXMA 4IRUB 4LJ6A 4NE2A 3ADKA 2FFAA 3L82B 1KK1A 4RZ2A 4BLPA 4NCJA 2GCPA 2Z4SA 1KSHA 1R0XA 2HXSA 2ORIA 2ZJAA 3LRPA 521PA 4BPBA 2OCYC 3CB4A 3M0EA 4LY6A 5FOUA 1HA3A 3KKMA 1XZQA 4RCYA 3K09C 3U5ZB 1W4CA 2Z0MA 1R5OA 1VG8A 1W0KD 2IF2A 4XJXA 2JLQA 3C14C 1Q1QA 4A0HA 3T1TA 2ZRGA 1UDWA 2KBEA 1LF0A 1L4UA 3C8UA 3WHKA 5IDVA 4PC6A 1N6PA 2VO1A 4B43A 1P60A 3FKQA 3CO5A 3DMDA 3RRYA 3LFUA 5HE8A 4DRZA 4YXWD 5C4MA 1COWA 3ZZTA 2ZIAA 4CW7A 2ZYVX 3ASZA 3B8HA 3LDAA 4PX9A 1G7RA 3VFDA 2ZU6A 3NKVA 4LPKA 1UAAA 4ILEA 2CCGA 3L0OA 3ZYCA 2IS1A 1Z07A 3SDZA 1ZJ6A 2OUKA 5C1BA 5JSZB 3WP0A 4B35A 4BLRA 1DTSA 2QPOA 4LBZA 1VG0B 2C04A 3ZLJA 1W44A 5DSZA 1LTQA 2OAP1 4UKDA 1MKYA 1AGRA 1T3LA 1QVRA 4A8JC 5E7JA 4MRPA 2W2XA 3KB2A 2ZR7A 3UG7A 4UXHA 1D5CA 1E0JA 4JBYA 4OQNA 4MYHA 1W48A 4UXJA 3LLUA 2GDJA 2ZRKA 1EFCA 3LX8A 4CZ2A 4ZDJA 3FMIA 3D31A 3CNLA 4BWYA 4P33A 4MKIA 4X8OA 4Q18A 3NXSA 1W4BA 1G20E 3AVWA 4C0AC 4LBWA 1U9IC 3U3RA 4AG6A 1VCIA 4G5RA 1CR2A 2RGCA 1N5JA 5AJWA 4Y0VA 3FKSA 3VR6A 1G8GA 4JYCA 3ZVNA 2AXNA 2YWFA 3SYLA 4NYMQ 5JWRA 2F1IA 1W4RA 3LA6A 3CM0A 3CWQA 3ETLA 2VBCA 3SYKA 1GNPA 1G7CA 1E1QA 1XEWX 2BC9A 2GZDA 3DKVA 3K0CC 4GOJA 4GL2A 2QE7A 1H8ED 4M1YA 2CLDX 4PZYA 1UBEA 4M9ZA 1P73A 4B2IA 2JLSA 3U6KA 1KZ7B 3CW2A 4OQXA 2VIIA 5L8VA 2QMEA 1QF9A 2VH5R 4C0KA 4DUGA 3BC1A 3IEUA 4TSFA 5DN6A 3NVAA 1IQPA 4TL7A 1XTSA 1NIJA 5CIQA 4ACAA 2HJGA 3NHBA 5FPKA 4FMCB 1X8KA 1CP2A 3C7KA 3FVQA 2ZRBA 3LV8A 5FBWB 3CRQA 4JSYA 1CRPA 3K70C 4V0OA 2VP5A 1JAHA 1AS2A 1FNNA 1O87A 3T12A 4RKFA 1XDBA 1VYUA 2YINC 3PUWA 3M4YA 4LV6A 3HYTA 4MRSA 1IY2A 4PZLA 1NLZA 3DZDA 4BFZA 4C7OA 2GBLA 4YC7A 1OE0A 3SBEA 4QNMA 4E22A 3ZD6A 5DHFA 4QM6A 2WJYA 1S2MA 1OPXA 2NO1A 4PC1A 4ZIRB 2GF0A 1ZUNB 2JCSA 4PC3A 3EZFA 4OBEA 2IEZA 1G6HA 1PLLA 1CBUA 3J81k 5EP1A 5F98A 3KQHA 2FSGA 1GIAA 2JJ1D 3OF5A 4RFVA 2O8FB 2XOKA 3C15C 1N6OA 2BKEA 2ZUCA 4BEBA 4WXPA 2V6JA 1NSFA 5D3QA 4DBLC 3EPLA 3CRW1 1SVOA 2AFHE 2D7DA 1XTKA 2O0JA 4LC0A 4TQUS 4CEIB 1JJVA 4LV5B 2ZUBA 3N5CA 1Q0UA 2YOHA 3RSLA 3W8NA 5BXQC 4CEJB 1OH5A 1FZQA 4M2LA 1ZD8A 1XCMA 2QBYA 2QAGB 1IXRC 2NGRA 2ODWA 2R2AA 1WA5A 2VP6A 4KSCA 4C0BA 3HWSA 4PHFA 1QBKC 2CNWA 3HR8A 4R98A 3AQ4A 2ZRJA 3WP1B 3RS5A 5JJLA 1KDPA 4A92A 1WXQA 2EU8A 4DDVA 4HLUC 1HTWA 1QHIA 4FWTA 1AGPA 1XZPA 1UADA 5BN4A 4EPRA 4AIIA 2V4ZA 4DXAA 5DE3A 3U44A 2V55B 3PG5A 3OEEA 1G16A 4YONB 1U99A 1ZM2A 1KDRA 3UK6A 2REBA 3O8DA 3RHFA 1GWNA 2VP0A 4UJ3A 2V3CC 3NH6A 3QKTA 4XSGA 1ZNZA 4BFUA 3LO5A 3L0SA 4TYNA 2EYUA 3MWJA 4PO8A 4DCSA 1P2UA 4Z51A 2ZITA 3EZ7A 3PVSA 5HR5A 2QE7D 1YQTA 1DAKA 4GBMA 1OYWA 3AKEA 3DEFA 2VHCA 4IVPA 4TZ0A 4I1UA 2OO7A 1HY3A 2E9SA 3BH6A 1VYTA 3GEHA 3IGFA 4V0ME 3MRSA 1NG1A 4URWR 1Z0JA 5JLJA 1KO8A 1KI4A 2V1XA 3WMGA 1NRJB 4IDNA 1YU9A 1XP8A 2DFNA 4L16A 4Q7MB 1SVIA 5KPJA 1EFHA 3IEVA 3BK7A 2A9KA 2BEKA 4B47A 2AL7A 4AKEA 1ZM3A 4L15A 1P5ZB 1HQYE 1CF4A 5K8IA 4ESVA 3C4JA 3U3JA 1JQJC 1T91A 2NQ2C 3SBDA 2J5XA 3AKCA 4HLUA 4ZIRA 5FOVA 2XTMA 3RNLA 3B13B 3QENA 2WJIA 4U5XA 2CHQA 2BIFA 4N1AA 4CT5A 2MSEB 2NPIA 2YOFA 2ZRFA 3UXMA 5FL3A 1CIPA 2FGKA 3OEHA 1MOZA 4PC2A 5KHOC 5KPDA 3C16C 3B1YA 4HEJA 4DT1A 1P3JA 3AKYA 3IPXA 4CIDA 1MO6A 1XTRA 3ZVRA 3VR2A 3KTAA 2QQEA 3Q7QA 4A8JB 1VHTA 4DLXA 2BMJA 5J47A 2QAGC 3R8CA 4IVQA 3CRVA 3A1TA 2JEOA 4IHQA 3D3QA 2ZE5A 4IOJA 3BH7A 3T15A 4RSGA 4IJMA 3ADDA 2CHGA 3VU9A 1X6VA 3AV0B 3H2YA 4J0QA 1DARA 1MO4A 4AWXA 2BV3A 3B1WA 3BORA 4KCGA 1W46A 3QPWA 3BD9A 3BFXA 5DH9A 5GJCA 3WRXC 4AG5A 2A30A 2PZFA 2WKRA 4I4LA 2ZJZA 3KZ1E 1F3OA 2XNDD 4IDPA 4FINA 3KB1A 4JSTA 4A82A 1GSIA 5IRCD 3AP1A 3SE0A 2JLXA 5CK5A 2H57A 1D6JA 1E9BA 2WVJA 2OCAA 2O0HA 1WBBA 2PH1A 1KDOA 3ZH9B 2PZGA 1COWD 3OHMA 2FA9A 4PSVA 2CVHA 4NZYA 4GT1A 1J2JA 4QBIA 2ANBA 1KDTA 2O8BA 4IOLA 4KFRA 4Z8XA 2Q3HA 1OYYA 4MITA 1UKZA 3QPVA 2J0QA 5E3HA 1PLKA 3OAAA 1JPJA 2GBLC 3AUXA 1Q3HA 5AUQA 2ZAOA 1E96A 1KK2A 3MAAC 2KE5A 1L8QA 5EUQB 1H65A 1IY0A 5J4LA 2IA5A 5BWMA 1XPUA 1G19A 1J8YF 4EPYA 4LPSA 3AEZA 1D9XA 1RRGA 2L0XA 2RGEA 2A3RA 4HLDA 4PHTA 4BFTA 4WXRA 2MMGA 4B44A 1G41A 3DL0A 3QKSB 1OB5A 3KL4A 4DHEA 2H18A 1DVRA 3W5JA 621PA 2ANCA 2OLJA 1P72A 1WRBA 4KODA 3EX7C 3IHLA 1TTTA 3VNVA 2RHDA 4V03A 1E9FA 5DIFA 5JSZA 4QHTA 2WWXA 3Q5EA 3ZDQA 3B60A 3TGPA 1E98A 3IDQA 2OG2A 2OE2A 4P0TA 3FGNA 2BEJA 2UKDA 4RKEA 5FFMA 1ESNA 4QOSA 1G4UR 1GL7A 4OQMA 2IW3A 1T4GA 1FFHA 2WPDD 3EC2A 5BN5A 1VDZA 1CS4C 3LQQA 4GFDA 4PXAA 5AWFC 4B3XA 5HE9A 5JCZA 4Q4HA 4BLOA 4DDWA 3CPJB 4I1OA 3TR5A 1TUIA 4A2WA 3WNDA 1SQ5A 3L8ZA 1GTVA 1VYVA 1MABB 1XB2A 2HF9A 4G1UC 3K09A 3V4RA 2O8EB 1R8SA 4IXNA 1QDEA 2AK2A 4P4SB 2C2HA 2B21A 4WZAE 5B64A 1ZCAA 1DO0A 4JVSB 4WAUA 3AVQA 1EX7A 4OKSA 4DEXA 1NVVR 2GZHA 3X1XA 4QM7A 1EG7A 2WHXA 4O2RA 1QHSA 3IBGA 3FFAA 3TAHA 5EZ5A 1G5TA 221PA 4HZUB 4DC9A 2HEIA 1UDXA 3K0FA 4JT2A 4PSKA 3JVVA 1U81A 4PSAA 4AKGA 1YVDA 4HDQB 2I4IA 1G1MA 2R8RA 2H17A 3ZZUA 1EGAA 4DZZA 1J7KA 3IQXA 1ZC3A 4F91B 3TW8B 1S96A 3U3OA 2HYDA 4BE7B 2YNMA 3ZGXA 5LPNA 2QROA 1DADA 1KJYA 2PX3A 3L2OB 4Q1AA 1AJEA 5CITA 1QHXA 1AIPA 2QP4A 2DYKA 2ECKA 3L43A 1W2HA 1G7SA 3ZS8A 3A1WA 5TB5A 1XCGB 1NJGA 2DB3A 2R6DA 2ZSDA 3ZQJA 3CZPA 1KNXA 1UEJA 1N6KA 4JJZA 1AKYA 3W6OA 2IF0A 2WIAA 2WMNB 4UNRA 4K46A 1DAMA 3SC3A 5KYKA 3KX2A 1KSJA 3TBKA 1R7RA 4NL4H 2R62A 1FTNA 4MA4A 4Z54A 3B1XA 4DLWA 2WWYA 3RDPA 2H8KA 1SXJE 2Z4RA 3VX3A 1CJKC 4YMSA 4KI0A 1U2RA 4Q7KA 3SFZA 2OHFA 1P7CA 3P4YA 4L5BA 3EG5A 4MDFA 1XTJA 1EFTA 1Y63A 5FTJA 1VKJA 4PAOA 4FXPA 4XTCS 1WDTA 4PQRA 3RLFA 4EPTA 1RRPA 1OKKA 3VX4A 3I8XA 4JS0A 1ZMXA 2BMFA 4EDHA 1CXZA 4OHWA 2J0VA 1YZTA 2VSXA 4NYIQ 3VMFA 3VR3A 3OESA 3ND8A 4BZQA 4E03A 4UNPA 4I81A 1S8FA 1D2MA 1DELA 1ZD9A 2GEUA 1MV5A 1A7JA 2XSZD 3VR4A 5TV2A 3RAPR 2GNOA 1NI3A 2IS2A 3VKGA 5IF9A 2OESA 2RGAA 5IK2D 2OSBA 3DZ8A 2CCJA 3U7EB 2QI9C 3T1QA 1E79D 3GJ3A 1F2UA 2J0UA 4B48A 3EW9A 2SHKA 3A4MA 2VP9A 3QJYA 2CE2X 1YZNA 1TF7A 1LNZA 3HJNA 2IYYA 1CJVC 5JRZA 3QKRB 4HSEA 4MRVA 5EUMA 1W5SA 3OE7A 3PJRA 1NP6A 1FTSA 1JXMA 3OIYA 3WNCA 5CDFE 1TU4A 1RVDA 1SKYB 2WSMA 3B1VA 1E0SA 3K53A 1GL9B 2BBSA 4LI0A 3QF4B 4QGFA 4DEYA 2F1JA 2DFLA 5JI2E 1WMSA 1OXTA 4AYXA 1G21E 1Z08A 2PMKA 3UANA 3SI7A 3LXRA 5M04A 1A4RA 1OJLA 3C41J 5GVRA 1E2MA 1V5WA 2ZJOA 1NKTA 3CF0A 2O8CB 2CBZA 4TWZA 2NIPA 2G0NA 2DHRA 3QVVA 1OHHA 2WZQA 4NPHA 2WWWA 1B0UA 1N6NA 1U98A 2VHJA 3TIFA 1Z06A 2AHOA 4B32A 5KNCA 3U4QA 1II8A 2W6JD 4JZKA 1OF1A 1NN3A 1U0JA 4CRWB 1ANKA 4X8LA 5ANRB 3M1IA 4Y0AA 4KO8A 3TW4A 1JR3E 3K0CA 5SZKB 1E2NA 1W36C 2RHMA 4XIGS 2QN6A 2VP2A 5AJZA 5G53C 1E3MA 5F9HA 5BN3A 2O8EA 1ZNYA 3DM5A 3AVOA 3PEUA 4HYYA 4W5WA 4EIWA 5J4KA 2QZ4A 1II0A 2YWHA 1NMXA 5IK2A 2O5VA 3SYNA 1E69A 2QMOA 4V02A 2N46A 1G3RA 2AD5A 2X8AA 1R0YA 4AD8A 1US8A 5JRJA 1K5DA 2VQSA 2ZANA 4NBSA 2QRZA 5K8LA 4PFSA 2ERXA 2ZRHA 3HU1A 4LJ9A 3AGPA 3G5UA 4OI1A 1L2TA 1X1RA 1BYIA 2G88A 5HZHA 1IN6A 2JJ8A 2YWGA 2AX4A 1UKVY 2CXXA 2OBNA 3FWYA 4XSHA 2J87A 3HP1A 4NCNA 4TSFD 5EXXA 1E9CA 1TUEA 2ZROA 2ORWA 4F4JA 1HE8B 3QBVA 4EJSC 1R0ZA 2Q3MA 3QEOA 2D74A 2LWIA 4Q9IA 5FBLB 3X2SA 3WY9A 1KHTA 4MKFA 4IDOA
chains in the Genus database with same CATH superfamily
3NIGB 1O4VA 3P20A 2FPWA 4HDOB 5JPIA 3B6EA 5IHPA 2OL4A 4UFOA 2A84A 1AHIA 3AOGA 3VZDA 1J0DA 3KHTA 3HZHA 2RB4A 3N28A 5DNWA 2WU4A 4RHCA 1A5BB 1NUHA 2O20A 3MUOA 4RGQA 2OAQ1 5D00A 3UK7A 1L4BA 4DGSA 4DG9A 1LCIA 2CN1A 1CUDA 1SVMA 2WNSA 2YV4A 1YRAA 3E18A 2QD3A 2IYRA 2JJ2A 3DWFA 1BAPA 2IY9A 2P5UA 3D1VA 1ISPA 3S44A 2B2NA 3U4AA 2PEZA 2WTBA 3JVEA 2AZDA 5HCNA 1Z6AA 2H1LA 2JCVA 3B7GA 2OHXA 3PNOA 1N1MA 4NEQA 2W2TA 5D7BA 1JBEA 3KQKA 3G0IA 3PQ5A 2RHTA 2CKDA 2DR2A 5HKOA 1QJCA 4GVXA 3TNYA 2HA7A 1EU1A 4TKVB 1OXBB 3BL8A 5JU6A 5CX1B 5EZYF 3N7UA 5CX1A 2PRYA 2DQ4A 2IX9A 3H3JA 2JAOA 2YMQA 2ZYUX 2C3YA 2QIPA 3W8EA 1P0CA 4LCJA 5JEDA 1OA1A 3MK31 3P9XA 4JBIA 2CXNA 2O3QA 4JJKA 3WV5A 1NTRA 4HNHA 1E3JA 2EBHX 2TMDA 3SS9X 3MCUA 3PPWA 4RXUA 2WMOB 3AHFA 3UIEA 4WY2A 4YT8A 2QZZA 2CMGA 1DEXA 3AH8A 3IJPA 4LDJA 4NBWA 1Q1AA 3KJHA 1FJ2A 1G9XA 3PB3A 4RADA 4N7RA 2H1OA 3LHSA 2YN0A 3MS2A 1R4AA 3WGOA 4OI4A 1E59A 3LGSA 1RWNA 3PV0A 1X7ZA 1J07A 1CDEA 1VSVA 1Z74A 3ORQA 4B3DA 5A4KA 4TTRA 1RKQA 2UUOA 4FE7A 1QTRA 1ZRHA 4QNRA 5SV2A 5SZJA 2NU9B 3CBGA 2DP4E 3K0AA 2HHAA 3T34A 1P80A 1LA2A 2LR0A 1E62A 3QWHA 1Z5NA 5E2IA 2ACEA 3O3MB 4LRYA 3PHIA 5ALDA 4CKZA 3PPYA 1T4BA 1YA6A 1ZVJA 1K3FA 4RGVA 4D3XA 5IFLA 1F7UA 2V7PA 1XPJA 2PTGA 3A4NA 1OU0A 3CA8A 3I9V1 1KY3A 5AVQA 2K2QB 1KXJA 3ZE9A 5FV7A 3Q7TA 4YH1A 1ORVA 4A8HA 4QBTA 3PR1A 3A28A 2X2FA 4BAUA 3I01M 1BQ3A 5DJ5A 4B74A 4C7OB 1JN0A 3NEJA 4MP3A 2GXAA 1TNDA 4DAOA 3QLJA 3ZX5A 5EQDA 5DYIA 3IAS6 1TJNA 4LSWA 4U7WA 1NQWA 4WBNA 3Q7PA 2C84A 3EG9A 4K6GA 5L3QA 2OZVA 1EM8A 1P19A 3JY6A 1LVUA 1AQLA 4AO7A 3KOWA 4A73A 3DLHA 1XPRA 4ZQIA 2W71A 4R3UC 2XXAA 2GVZC 3FCUB 4HJRA 4G0UA 4MAAA 5JBQA 3FNEA 4F21A 1GNRA 3EQ8A 4R9UC 2OD7A 5ERGB 5KWVA 1XEXA 3PC8C 5HM6A 3KQLA 3BMQA 3TPFA 4HAXA 5IAKA 4ALJA 5IJ0B 3O47A 3LPLA 2CUTA 5DLQC 4HNVA 3E6AA 3GUHA 1IN1A 3GLIE 1O5OA 4NU8X 5D3MB 3KXKA 1N77A 1Q1EA 2O3TA 3CLKA 1U1GA 3U7QB 2ZIVB 2A0FA 4D92A 5JD4A 2O4UX 2JLWA 2GNAA 1GAJA 1V71A 4WT7A 1E2KA 2BUAA 3IPAA 5AMXA 4HZIA 1ZP6A 1AHPA 4XWGA 4TXHA 1VL1A 3WLQA 5JBNA 1E6WA 3EC7A 4XD7D 2VI5A 4TZ6A 1O3YA 4G1VA 2OCXA 5K0GA 4MVJA 1H4VB 1P91A 4HDMB 2H11A 4IR7A 4F12A 1HDGO 2WR8A 1GNVA 2GBGA 4I9NA 1HYEA 3KD2A 3K0SA 2A7QA 2MSNA 4ESHA 1NVXQ 3MT7A 2XV1A 4M9XA 1NLFA 4HB3A 3ZDYB 4NECA 2QRUA 3MSCA 2VQ6A 1CUVA 1EDBA 3PIRA 1XZGA 1I10A 1LSJA 3C85A 3DUFB 4OL9A 5FOQA 5CCXA 4UPVA 5JJIA 3SX0A 1K7YA 3UB2A 1WE2A 1TEHA 3V4PB 4LISA 2WTUA 2FWPA 4GC9A 1Z8HA 5H59A 3NNDA 3RC7A 4FX5A 3L0IB 4QPCA 4FW9A 4HXEB 5TDHA 2QZ9A 1GTSA 4LE2A 2QW0X 4YP9A 5HTOA 2ZZMA 1LSOA 4MDHA 4EGCB 4LF8B 2HT1A 2VSYA 2J7PD 3PC2A 4HDRA 4MVCA 3OVMA 2ZIXB 5E7IA 5ILQA 3GJQA 1VBNA 2J32A 2J5RA 2XW6A 3IQWA 4OVKA 2FSPA 3SZMA 4QIHA 3VDQA 5BMVA 1K3UB 1GZ6A 5I7EA 3U56A 1GN9A 6Q21A 5DYTA 3H8WA 4FCVA 2HCTA 3GFBA 3E3AA 1FRFS 4I55F 3E61A 2OC9A 1LBIA 4TM8A 2GTPA 4ZVOA 3WVNA 1IN8A 5ICGA 4LSGA 4TUYA 1KGSA 1VE9A 1DFHA 2AR7A 2C83A 1GEGA 4IEIA 4KDFA 4ZJPA 4M21A 4Y18A 1GZSA 2JHAA 3ORHA 3WRYC 2WWGA 5IHXA 3NHRA 2HPVA 3ETGA 3LT2A 3QXJA 4H59A 3L4KA 5I7OA 2IODA 2C95A 4QC2A 3HRHA 4EFMA 5IASA 2O0KA 4IHAA 3U7IA 1UJMA 4RY0A 1U0NA 1RT9A 3QXSA 4M8NE 2VYQA 5D6OA 2I1LA 2XODA 3O8QB 1TT5A 3P9PA 5B53A 1HT1E 1YMVA 3OX3A 2C5AA 3GLSA 4ITVA 5BYJA 1HF3A 1OLUA 1N5LA 3MB8A 2RSLA 3PRHA 4JLAA 4MTCA 3SOPA 3VR0A 2QM8A 3TTXA 3ROFA 5LU9A 1GLVA 4PZPA 1B6TA 3H8SA 2AUNA 3OA2A 2JBHA 2W00A 4PS1A 3N6RA 2J09A 2BGNA 1ZCFA 4JBXA 5JXJA 1P5JA 1U0RA 4QU5A 1QHFA 4LHXA 1EK5A 1NLUA 3W3AH 1RYFA 4QWMA 1WDWB 2D1SA 2P5YA 4PLHA 3Q0TA 1L5KA 3UJNA 4UATA 1EUQA 2I2DA 2JANA 2R9VA 1OXUA 2VNJA 1PQPA 1EXWA 3K9QO 3QH4A 4G63A 4QASA 4OGFA 1KZ1A 2ES4A 3WIUA 3ZHXA 1JHRA 1IXSB 1XO1A 5KAMA 1MLDA 2I3AA 5JAIA 2JFFA 4FMDF 2VDKB 4QT4A 2VOEA 4PLFA 3DCNA 4R69A 2HWYA 3PTLA 2EW8A 1MF7A 2C4HA 2VJNA 4PCVA 4Q1CA 1I5OA 3EAQA 2QP9X 1WPQA 3AGQA 2QRQA 4LI3X 1NVMB 3DC7A 2GBIA 2KJQA 3NEAA 4G1BA 2VWHA 4UFPA 4G01B 3KSAC 4RM3A 2ACKA 4C01A 2JLUA 3NC1C 5EWMA 1R6AA 3R3HA 1Z45A 4JJ4A 3TTTA 3DAFA 1ZN9A 2BJVA 4GKVA 2JKZA 5DI3B 3CH5A 4XQ9A 2F90A 4LNAA 2EERA 1YO6A 1T9DA 4B46A 2MCFA 4U8HA 3W2HA 4JEUA 1ZUIA 1WS6A 1PI3A 2OO3A 3DWIA 4D0LB 1FDWA 2RGDA 1KGDA 4MS1B 2UYQA 2VTBA 2X76A 4HGRA 3KJFA 5JJKA 3ENVA 3EODA 2BY4A 4NYJR 4WASA 2PMDA 2CL7X 1KI2A 1P77A 2J7KA 4WK2B 4UOZA 3ME5A 4ZO4A 1OFUX 3Q9SA 2CYBA 4MRMA 1K63A 2EP7A 4NYIR 5J4HA 3LI2A 4P5DA 3DO8A 3I0MA 5HF9A 1Z34A 5DWDA 1IDOA 1ISJA 3GIWA 2O2DA 2QVYX 2GZ3A 2R4TA 3R3SA 1PAUA 4NS4A 5EWLB 4EGAA 3NTQA 2NVUB 5AKZA 5A3RA 3NWOA 2IYZA 2PSFA 4NV0A 3GLQA 1K6XA 4FB4A 5GJWC 3WI7A 1WBDA 3AV3A 2ON6A 3UXYA 3NHPA 3T1HB 4LOJA 1QORA 4L5YA 1T2AA 3B9PA 1TVEA 3DEKA 5FPPA 3NJRA 4E3WA 2QV7A 1AD2A 4YRBA 2HQSA 2PMFA 2QJFA 3CURA 5DASA 2QF7A 1RHJA 1R5NA 4PU0A 1QYCA 5L3VA 2EEPA 1Q3TA 3C5CA 4JI3B 2IYOA 1V1MB 3AVXA 3KEFA 1SUBA 4BCBA 3TQCA 1TZKA 3B3JA 2GH1A 3KT0A 4PBSA 3WGMA 5BOSA 1AGYA 1X1AA 3UVEA 1VIMA 1Z47A 4RD0A 4KSYA 5F33A 4C0HA 2Z2XA 5DGXA 1XTZA 2JJYA 1QVVA 1HT0A 4B84A 3BWDD 3CUKA 3KTDA 4FKBA 1RQ2A 1KKLA 3SSOA 1LD3A 3WGTA 3EPHA 2I65A 1NBEA 3FYSA 4MGZR 3HKBA 2VUTA 1XCPA 4G0ZA 4V0NA 4CQNA 2XWBF 3DZKA 2BEVB 3AVVA 1UM8A 3A27A 4LSZA 2HNAA 2X15A 2CNOA 3NQ41 3GFSA 3HFGA 3O74A 3GJYA 5HTKA 3S1AB 2F4NA 1C9JA 1XWFA 3JCZA 3PHGA 4KGDA 5JWHA 3V2UA 3LNCA 1SR8A 4CMKA 4DIKA 2FP4A 3C4VA 1GZ5A 3MIIA 2MSLA 4KHPB 1GTMA 1QIMA 2V7GA 1KL7A 3IL2A 2IYWA 2HA6A 3Q5GA 4IO0A 4M87A 4QU8A 5IKEA 5GP1A 3AHHA 2WVGA 1TMYA 1PR6A 1TPYA 3HV2A 4YEDA 4PXAA 3E0QA 2CLCX 2NU6B 3T5GA 3LJKA 1N9ZA 3WS7A 4BN4A 4IV8A 3BDAA 5LQUA 4UVGA 3QWBA 3U6BA 3FPFA 1YDFA 4MJLA 5F5LA 1YGYA 5DSXA 6REQB 3BH0A 1IHPA 5G4KB 1VCOA 1KYQA 3QUCA 1QOPB 4AZSA 3NIBA 1MRNA 3PK0A 2JIZA 4MW0A 1VE1A 4RV4A 3SM9A 4LBYA 2VNIA 3HGQA 4D74A 1JWLA 1L7AA 3IA7A 4YQFA 2KM1A 3T9BA 2KPOA 2EP5A 4MKHA 4TMVA 2BE7A 4KQIA 2ZI7A 4Q37A 1VHJA 4JNKA 5EWMB 4KDRA 3WGIA 2CMKA 1JKJA 4ZV7A 4JI0B 3MCVA 2PWAA 1K7FB 4H7EA 3VYVA 1EP3B 5JRDS 4ER6A 5HCIA 1T8TA 3BXOA 3OOYA 1SHKA 3HMQA 4ZQEA 3INNA 2OM6A 4J7CA 3ZTYA 3HEAA 4TS1A 1IBMB 4LF6B 4Q00A 1ZD4A 4UE3S 2P9HA 4F4CA 1DOZA 3ZUGA 3A9SA 3QXXA 1RWMA 2I1VB 3LDFA 4JB8A 4L8LA 1U8TA 5EWJA 4C6RA 4F06A 2YJ5A 1U7DA 1H1LA 5IJAA 4YRSA 4ZXPA 3I62A 1IZYA 3TL3A 3C5VA 1SBIA 3OEED 1CTQA 4RVGA 4Y2QA 3E84A 3NHFA 2AJLI 1SUEA 3JQ6A 3ZCXA 1GR1A 3BREA 3N2KB 4QOGA 5C51B 3K0EA 2EF0A 3CU5A 3OZUA 4GGPA 4R8RA 5KQPA 1BJTA 3EG9B 5ECDA 4DLVA 2Z2JA 3UJCA 3O38A 3CVXA 4LIPD 2DLNA 1N33B 5KTTA 5ICCA 1IEWA 1LS6A 2I7TA 4CN9A 2B82A 4PZUA 5WRFA 4JXZA 1YZFA 4F60A 4Z4EA 3OQPA 3UAOA 3AXTA 2J59A 2CBGA 3K94A 3OJCA 1W5EA 3V5NA 4H17A 2Z2KA 4NC9A 3WNQA 4RPKA 1Z2PX 2G28A 2EW1A 1T13A 1DS6A 1I5RA 2QRVB 4HH1A 4QICA 4MR9A 5F52A 3B1KA 3RJTA 5AI8A 1JYFA 1N2SA 1XFAA 1THTA 3GU3A 3AEYA 4IIEA 5G4LA 5EMKA 4TYMA 5SY6A 4BFYA 1U0BB 1BMFA 1OFGA 3VNUA 3E27A 3WGJA 5KO2A 1D0VA 3OUZA 4BMSA 4U7DA 4KPYA 1FMCA 1FFWA 5CB6A 1BEEA 2YFQA 1Y7HA 5HRCA 2D5BA 3VC3A 3AF0A 2FUEA 4LZNA 2AOXA 4JX8A 3DOCA 3LUBA 4MK4A 4FR2A 5AOVA 4DOMA 4YJ3F 5ECGC 3TBHA 4N47A 2WQ6A 4R2HA 5BUSA 3MBOA 3SS8A 2J46A 2WWVD 3AUYA 3IBYA 5DNYB 3CLTC 3OH8A 5LC1A 3KU4A 2PCLA 4S1WA 5HSGA 3J80A 4GZLA 3H5VA 4W4TA 1NKSA 4TUYF 3SIXA 1FSGA 1PW7A 2A86A 3HZRA 3PQFA 4GMGA 2AG6A 3U49A 3V8MA 4HPJB 5M29A 4QRHA 3NTXA 1PEYA 3BBPA 5DN6D 3OI7A 3KT8A 3D2BA 3OPYB 1RKUA 1TEVA 1NN1A 3QELB 4CR8A 1QO0D 1YRLA 2QW1A 1C81A 1J22A 1NQ5A 2DHCA 4LCEA 2B8TA 2V0GA 3OE4A 2EKPA 2H92A 3BIJA 5COBA 1W0JA 5JAHA 2ZU0C 4GXQA 3F4BA 3Q85A 3OUTA 4RZHA 2EX4A 4LW8A 3MMPA 2KI5A 4RMNA 4BE4A 4N48A 1CS0B 1E1QD 1SBCA 1U9JA 4JNCA 4XYEA 2ZT5A 2NPOA 1MQSA 2ZWPA 3AT1A 5KSWB 3CH6A 3TKLA 1P9RA 3H2JA 3X2EA 1O95C 1T9KA 3CLVA 1M6WA 3M3HA 4PSUA 4PVDA 5FD8A 4M38A 2IXEA 1TYEB 3B12A 3ZY4A 1R15A 3WO0A 4NBUA 2KSQA 2JJQA 2O0LA 2XJ4A 1L7DA 3PWTA 1UDAA 2I99A 2W6NA 1V3VA 4D9IA 1YCDA 2YW2A 4DUPA 3UOGA 2DWUA 1PVOA 4HMOA 4PAMA 1U7ZA 5E2AA 3V4VB 1M2EA 4WINA 3KT6A 3D6MA 4RD1A 1XTTA 1B42A 1BWPA 1DRWA 1HMYA 3QX7A 4XJVA 4AJJA 4EL0A 2C2ZA 3BFPA 2X0FA 3ZI7A 1O8BA 1YNOA 1QBGA 1VL0A 3QW2A 4GLLA 5HUQA 1TYAE 1MJHA 2VPPA 2Q21A 5FTKA 4WERA 2G1JA 2BR5A 3O4RA 2BH9A 3EIOA 2GBCA 5AKXA 3N6VA 4XE5A 4RTQA 4D4HA 1T9AA 3IMKA 4ZDKA 1SVWA 1ZMBA 1QHHA 1T1IA 4GZ3A 5JXHA 4P31A 1MH1A 1K6IA 4YJKA 3L77A 1VI2A 3RIEA 4BKUA 6NULA 5M2QA 2ZAIA 1EAYA 1P8JA 1E7RA 3WIEA 1UZAA 4IWNA 1DWPA 5T57A 5FX2A 5AOBA 5EMLA 2XEXA 1R16A 3I61A 1BMQA 4HAZA 4PGMA 5LIRA 3WBBA 4AYTA 3K6JA 5THKA 1EVIA 3ADBA 3WGLA 5DM70 1NYQA 2I71A 1AHNA 3BGOS 3IUNA 2QVGA 2WF6A 4N0MA 1M2NA 1NF9A 3KJGA 4IWXA 2FX5A 1Y6ZA 3N2NA 3FR7A 4URXR 4GE0A 5DNCA 2BEWA 3KLPX 1IBKB 2G07A 5A02A 2YXNA 1HFKA 2X1VA 1FSPA 4C0JA 3SFTA 2C7VA 1X70A 1ZZEA 3NAGA 4K6CA 2GNPA 3OFND 2ZBVA 1YGPA 2C4NA 4PIPA 4RK5A 2ZT7A 2NTVA 1OXSC 1FLDA 4XVUA 3BBLA 2Q1TA 3BE4A 4NMWA 1T5TA 4ZZ0A 4RPCA 1B7GO 3CUWA 5K0CA 1JAXA 1YQUA 5GAJA 2WQ7A 3ABSB 1KKMA 4YWHA 1SPBS 2Q6VA 4FGLA 4I5GA 4QLAA 5DMXA 4BAZA 5K0SA 4WXEA 3PJDA 3GGJA 4WLOA 4XD7A 3KBBA 4M8KA 5J23A 1DKNA 4XIYA 4BLSA 1VLJA 2GFHA 1I2DA 4Q0MA 5E8RA 4MPDA 5KCMA 4ARVA 5CNJA 5KYTA 1BWRA 2GD6A 4OI0A 4XWWA 2WY2D 4N49A 1XMIA 3S29A 2JG3A 2YFYA 3FHCB 1GYQA 4K9PA 3A04A 3FHOA 4C21A 3R9WA 4J7UA 5GADl 1UBCA 1HL7A 1NVFA 3BTUA 1D2HA 5I3ZA 4EYGA 3FHLA 4C4OA 2PV0A 3GGGA 3BJZA 3LLSA 3VPXA 2HIGA 1RFLA 2JEYA 3IR6A 3DEYX 3CLSC 3RVKA 2VZLA 2FQQA 3USZA 3U4MA 1JFRA 2I2XB 5DRTA 1GZ4A 4I3GA 2QD5A 3AIKA 2M6KA 2ZE7A 3PJFA 1AS3A 1DHTA 2EZTA 3BE8A 3LXUX 5HGXA 3TFOA 2NO7A 2TSYB 1PF7E 3VPAA 1XPOA 4U9HS 3VR1A 3R7WA 5EZYA 1U6IA 1QYWA 3H2ZA 3QM1A 4U7HA 1BNCA 4ZVPA 4GR5A 3THWA 4TS3A 2Q4OA 4X7PA 2D2VA 2PZBA 3ICPA 2NUPA 3HU3A 3GDHA 4YMHA 3EVAA 4PYKA 1FC0A 3G49A 2XB2A 4GM1A 3EXHC 5GM1A 1D03A 2W5UA 2GAJA 4FNGA 4MUIA 2A9RA 5LUBA 1QVWA 3ZV7A 1E2EA 1R66A 2B1GA 3MTEA 8ABPA 3AL0C 5EFOA 2YS6A 2PGAA 3PQDA 3EA5A 3NOXA 4URFA 3VZRA 4WCDA 1DOAA 4QVGA 2O5EA 3B7WA 1V95A 4DCOA 3G1WA 1E2FA 1G5FA 4JELA 4YNBA 3AUTA 1JDVA 3JSAA 4IHKA 1JWAB 4DCVA 3PKZA 4U2KA 5ICFA 3ROKA 4IW3B 1DQPA 4IIBA 1SXJC 2AFIB 4EHKA 4CM9A 5A7HA 1ZM7A 2FK8A 3NTUA 4QDUA 2VF8A 4RJ2A 5BW6B 1KIFA 4INAA 2IPMA 1XN4A 2W8BA 3FPEA 3RS0A 3NBQA 4MGIR 4W99A 5L4NA 1XEFA 4RHXA 1VCMA 4GMFA 4MULA 1U04A 5AQEA 3P45A 4YO8A 5DU2A 3WL8A 4EPVA 1TUBA 3RI3A 4C07A 3GAMA 1VJ1A 2FR1A 2H51A 1DJQA 4ZPXA 3QFCA 5NULA 2ZTSA 3GDWA 1T24A 3CIOA 2RH9B 1WSWA 1B8UA 4PGGA 4FMBB 2C07A 1C14A 3A6KA 2FEKA 2Q7XA 3F3YA 3OICA 5AKIA 1PS0A 4OU5A 3WL3A 2PRSA 3G88A 3KUXA 1V5FA 1TRHA 3L5OA 3PFIA 1R9NA 1X2EA 3T7RA 1P1IA 4BDSA 4XX0A 5AVKA 5JD6A 1XMOB 2O59A 3UH1A 1T0UA 1MH9A 5AVWA 3GLGE 5AUOB 3BEDA 4OX9B 1U3WA 4NPAA 1JS1X 4AW9A 3G9ZA 1KPGA 4QG7A 3BHMA 4OB8A 3FVWA 2BRUC 3MUFA 1ITZA 1XQWA 4WACA 1N25A 2H06A 5SYMA 3RVJA 3C7CB 2P27A 1ZJJA 2A2ZA 3DA8A 5DDIP 4BZWA 2Q4BA 4K9OA 3OIUA 2GEFA 3U3DA 4P6VF 2Z3ZA 1F5SA 1MJGA 3T9AA 5JSUA 4Q3AA 3TTUA 1XZJA 2O05A 5GONF 1OW3B 5BV0A 4EGFA 2PL1A 3AI7A 5JZVA 1FXWA 2XX3A 4P38A 4AWBA 3HGMA 3ZE2B 4G4JA 5K0ZA 2FPIA 3FH0A 3O2NA 2QWXA 4CWAA 1SQ6A 2FOLA 3QNUA 4FK8A 5H0IA 3EAGA 3ZGZA 1SK9A 2PANA 3A32A 5IARA 3A4YA 5JYBA 2ZSAA 3D64A 2WF7A 4NCKA 5C4GB 2Q3BA 3V00A 3GZNB 1VE5A 2YHSA 2CE7A 1H8HA 2FN4A 4XGRA 1P7PA 1XXLA 1T2DA 2HEGA 4JWKA 1VP9A 4PLVA 5CM2Z 1B23P 1TM5E 1YHNA 1GZ3A 4RZXA 4DNXA 2YC2C 3QOFA 1Y8RA 1KSFX 1OXMA 3NHJA 3FBTA 4OQFA 1SA0B 2BONA 4ZDWA 3L0BA 4ALIA 2I2FA 4NG4A 4KACA 4EH1A 1VHQA 1U1DA 1ZH6A 2PSEA 2ZCJA 4BZXA 2G82A 4FMPA 5JZSA 2QA5A 3DVAA 3COJA 3ZDEA 4Q9JA 1JH9A 3L9WA 4MQEA 2D1RA 3ZW7A 4BRWA 3E7WA 4NKRA 1U7WA 1J0AA 1BH2A 1Z5GA 2QOEA 3OFKA 4KXXA 2RONA 5ALFA 2Y9MB 3Q4GA 3TECE 2VJBA 3D8RA 2C4TA 1A5TA 1Q15A 2FFQA 1CR1A 2Y6UA 4OJNA 5TQ0B 2PS9A 3F5SA 3EOAI 4FZ3A 1XLUA 2DWPA 1YZUA 4N7JA 2D2FA 1UPBA 4HNAA 4S1PA 3D7KA 1VA5A 3K1AB 4PNZA 1IM2A 1SPXA 3G0BA 4DSOA 3R77A 1CX9B 1BX3A 5KYVA 4IICA 1V35A 5DEOA 4NFSA 3VNRA 4Y3UA 4P7JA 1H85A 5TJ9A 2GESA 5IX8A 4BNMA 4N5NA 4DM3A 1BOFA 3J7TA 2YRXA 3MWYW 5FBVB 2VYFA 3GT3A 2BP7A 3HU5A 4NG5A 1WCIA 2AE1A 4RY8A 4D41A 4DL9A 3GJ4A 3TQIA 1H6CA 1J8DA 3AZOA 2QYHA 4J1NA 2R751 4MLCA 1LFDB 1OIWA 4PYIA 4K86A 1JHZA 4BGEA 3QVOA 2WAMA 2JCYA 4N8SA 1UJ2A 4B9AA 2P5SA 3JR3A 4HRAA 1R0CA 1UJBA 1MAAA 2VDOB 3L7LA 1KEZA 2YWEA 3OD1A 3ANMA 4KXQA 5K03A 6LDHA 2FE4A 1X42A 4LFCB 3T52A 1Z0UA 4KGXA 4ASUD 4US1R 4UEWA 3OTOB 5I7HA 3QSYA 2ODAA 1VJCA 3IFSA 2XZOA 3QBDA 1VFNA 1WTAA 1P39A 4TLLB 1MR3F 1I1QB 4BFWA 5FUQA 4LCBA 3CNHA 4L0MA 4CYMA 3T3OA 1MDFA 4KGVA 3M9WA 2QG6A 1I4EB 4FIDA 3PVCA 4D9MA 2XGOA 3IOCA 2QAGA 3FTPA 2ZVPX 2EWMA 3ORRA 3SYRA 5C81A 3TLZA 2F00A 4A16A 1T36A 3QOYA 1FZTA 3KFXA 4PBTA 2GKOA 4ROSA 1G8YA 3CWZA 1LLCA 1WVGA 2JAPA 2DF8A 2XYVA 2EZUA 2VDNB 3BD7A 1N6LA 4NZOA 4QTXA 1O2DA 1TCCA 1W47A 3JWIA 5CW2A 2AXQA 3N3AC 5L95A 2Y76A 4PQEA 3TLJA 5GIPE 5MN5A 3PRJA 1E1RA 3BJEA 4PYJA 1FTYA 4BX3A 4HFRA 1X7XA 1EJ0A 1MAWA 4KSBA 4PLTA 2OWEA 3M70A 4C4RA 3B2EA 1DWQA 1Q57A 2H65A 3E0XA 3HN6A 3AF2A 1MOSA 3JQ8A 3CCCA 4MS3B 3D8HA 4Z0PA 1C7EA 3BCUA 2IXGA 1S7GA 1E3IA 4YRJA 1C1XB 4KQJA 4NBKA 2N9UA 5F3DA 1KDZA 4YMTA 5JJBA 1EDOA 1BMDA 1EZZA 2P6UA 3OZXA 4AVYA 3C3XA 1K4MA 1U0SY 4W82A 1GADO 1C1DB 1MG0A 1EBBA 2V74B 3QV2A 4G0YA 4IKOA 4R01A 1VSUA 2DULA 5E4FA 1KFCB 4XVCA 5DX8A 2EATA 1KEWA 2JFOA 2OFFA 5KOIA 1M1YA 2O54A 3NRBA 4WDRA 3MWEA 2JLBA 2PX5A 2V6IA 4EY4A 1UZMA 1R8JA 4DA7A 1M2OB 2LVBA 4O2AA 5HMMA 4R1OA 1L1QA 1PS9A 3F7TA 5ALYA 3W8FA 3LQ4A 8ADHA 4A0QA 3QEMB 2VRBA 1N0WA 4HQOA 4N4AA 3SKVA 1UBMS 4FFLA 1EK1A 3H1AA 4RGBA 5AJHA 2XRFA 1LSSA 2CUNA 1SHZA 4INZA 4Q03A 1BXRA 3VOTA 4MQBA 4JC0A 1ODFA 4TMYA 2H1WA 4ZQHA 2HSDA 5KOJB 3REGA 1G3UA 4NYJQ 4TN5A 2XTZA 3MLAA 5L40A 3PFWO 2EVWX 3R0QA 4M46A 4U2DA 1WIWA 3LX4A 4EW2A 3W2GA 3C45A 3IHTA 3ICCA 3B6IA 1JA0A 2JFGA 1IZ9A 3C2QA 3KJIA 3SJCA 4D8YA 2PUTA 4OHUA 4DJJA 1CYEA 1FXSA 2V6FA 1ECCA 4GI2A 4UCWA 2BBOA 3GPBA 2NVUA 3ROXA 1V37A 2XCOA 1A72A 4BZZA 3TKYA 5LZ4A 4LOAA 4DVJA 3CF4A 3ITKA 1E4OA 4C6SA 1G3MA 1XX6A 2XUJA 1BC5A 1U5BA 2VFAA 1C9MA 4FMCF 3CZ5A 5CVCA 5AYVA 3DV2A 2X42A 5A3QA 2WTEA 3ZGLA 1JDNA 2O2YA 1QYDA 2VYVD 1RJDA 2D5LA 1JG4A 2H9AA 1CKEA 1RU3A 4L4UA 1JT2A 4RU1A 3VTAA 1XHFA 3H5RA 5CHYA 3F4KA 5EPEA 5HBRA 1WG8A 5E0OA 1KI9A 4RK1A 4L3WA 3OSZA 3TFWA 3CJRA 2XXBA 5FO0A 4JI1B 1SCUB 4KI7A 3REFA 4N3NA 2GO1A 2JGIA 3Q3HA 5KJFA 4XJTA 3RVLA 4KYVA 3HKCA 5LJLA 2CNLA 1DAHA 2QQ0A 1LLFA 1T0BA 1Z5WA 4IY1A 4ZAYA 4BNUA 1AK2A 3I73A 4U1RA 2XBUA 3WIDA 3VA7A 1G21A 1X2BA 4PZZA 5K0EA 2A4KA 1IG3A 3KUKA 2FSIA 4HQRA 4U2GA 5EFZA 4L85A 3KOZA 1GCAA 3SR4A 3H99A 4CMIB 4OKIA 5IWCA 1O57A 4M1EA 4EG8A 1C7IA 2QTWB 3MJEA 3RK1A 4ZV9A 4MV6A 4M54A 1E2UA 5H70A 2IC5A 4ARUA 1SD5A 4OHKA 4Q9KA 3JQ9A 4MW7A 3ZD8A 3E7XA 4ZT7A 1E2QA 2HI0A 3CRMA 3R7BA 3EBLA 4K9DA 1EKXA 2QR3A 3W3ZB 2Z5LA 2D0DA 2FJUA 1NBME 2WSLA 5DTEA 4P93A 1E79A 5DT9A 1WJGA 2XCRB 4YI3A 2XNCA 1XJCA 4M1ZA 2BJWA 1C1YA 4G5SA 1KVUA 1T2CA 3CLUC 3Q3IA 2X40A 1HSOA 3LSTA 3RBZA 3RSSA 4ARZB 4WN9B 1PUIA 4GVPA 3DO6A 4XTRA 2XQVA 2VAMA 2XWJI 4JFRA 2QVBA 1LUAA 1XVTA 1A9RA 2A33A 3BSYA 3GEIA 1HETA 3NS7A 4M99A 3GIDA 2F3QA 2V0CA 2RHCA 2UVPB 4IIVA 2KHZA 4MO9A 3BCRA 1DZ3A 5C5EA 4M0CA 1L5HB 2YC4C 3C3BA 1L7VC 4Y2YA 2F9FA 2Y0BA 3NASA 5H02A 5AVYA 2ZRMA 4JHXA 1CEEA 2PGDA 5KNLA 2OK8A 4ZO8A 3VTZA 3HE3A 3V7UA 3BRWA 1RW4A 4EEXA 5LUAA 3GLGA 1EBFA 2GAIA 5HRAA 3DYBA 2JIBA 2DFPA 1W2WB 1GPLA 2NSHA 4JUBA 3DQPA 3ABOB 5ITSA 4LJ8A 3W3AA 4PGAA 1AF4A 1K06A 2J3MA 2OBYA 1W85B 3BCSA 3DMTC 2HU8A 4Y1FA 1EFVB 1GL6A 3L7NA 3FZYA 5A4IS 1DAFA 1JA1A 2OKCA 1RBQA 3L7MA 4LMBA 1T6ZA 1ECJA 4FOOA 4OO3A 3G2OA 4PCLA 4MR8B 1NW3A 2X58A 3JQFC 5G1PA 4AO6A 5EPUA 3QFSA 5IAAA 1Z0FA 2HIAA 121PA 1ZYUA 3Q3GE 3T5DA 4CV3A 3QA9A 4A5SA 3P9KA 4EUHA 1HV8A 4FR0A 1SCNE 1MPTA 3MCZA 1U5CA 2PBLA 4HQKA 1YA8A 4Q3LA 2FSHA 3ERCA 4FT2A 2O2SA 3V1TC 3DQQA 5JTUA 1Z12A 2R48A 2HWXA 3GCDA 3HJRA 3MD9A 4Y1EA 4CKBB 5K5EA 4CUZA 3X44A 3MT8A 1PR3A 2X0DA 4M7RA 1ZXXA 1I2ZA 3RBVA 3RB8A 3ZY3A 3AOEA 2EGGA 3U48A 2IBTA 2JGDB 5H3CA 2OPHA 2HHHB 3DOEA 2OBLA 2DMRA 2F9LA 1VPLA 5F7ZA 4KP7A 2RMKA 1CFJA 3FTDA 4KLNA 4D82A 3K4QA 1DBIA 1G3IA 5BOVA 4CQLB 5IYZB 1X7YB 1CUEA 2GILA 2DR3A 1YQEA 2CGEA 1QHYA 1G42A 2AF3C 2PRZA 2RH4A 1CYDA 2ZUVA 5F2EA 5B1HA 1J9EA 3U7QA 4PO1A 3ZWMA 4EX7A 4BNTA 1ZD5A 3AVUA 3QG5A 1G17A 2X8JB 4NDZA 2CDNA 2GQ0A 1BGWA 4M0LA 3I4FA 4MMYB 4Q47A 4QOEA 4TMXA 2ONYA 4K81B 4UNQA 5FR2A 1YF3A 4NXMB 3QEJA 4G36A 4YV0A 1KYVA 1MG5A 2GCOA 2VK8A 4YRRA 2FHPA 3LUPA 1XZAA 5BURA 2X13A 1UPFA 2D7CA 4MRRA 1TKBA 4O4IB 2NZ2A 5C7LO 2Q1UA 3OT4A 5C32A 3CINA 1UT8A 1ESEA 1EFLA 4CL3A 5BRJA 2ECPA 1UOQA 3DEZA 2ZAMA 1XMVA 3A31A 1EQ2A 1GCGA 2OXCA 4KWHA 3VPHA 3L0ZA 4DDUA 5DWQA 5FBQB 3TRFA 2ODBA 4UE6A 5LMZA 3R0VA 3WWDA 5IDWA 2C78A 4P92A 3PHLA 3SAJA 1LRJA 2GLUA 3HJFA 2CUKA 4F38A 1J24A 1RRFA 2CL6X 1Q3KA 4MVXA 4PZEA 1TD1A 1W4ZA 5DYGA 3UO8B 4ZZ1A 2N42A 2Q41A 3SLGA 1KZGB 2H4YA 3GPLA 2XVZA 2TS1A 1OZFA 1OAOC 1OXVA 3PGLA 1WUIS 2FLVA 3CX4A 4G5QA 3HA7A 4NYMR 1Z33A 3DZCA 4P7GA 4XUDA 3V9AA 2JJMA 2B4QA 2YXLA 4X63A 3MAGA 3MNFA 2AJ8A 3DGEC 5CYOA 4DWWA 1N2CA 3HCAA 5F7OA 3S2SA 1K08A 2OV3A 1A9PA 4YXWA 4LXGA 3RC3A 5AJXA 2A9FA 4X5OA 5ARDA 2AS0A 3SHWA 4D6PA 5HHTA 1JVSA 3ZJ5A 3ZHVA 2VYVA 5JFGA 3PHBE 1EI9A 3KLNA 1HPLA 4EI7A 4AL4A 1I3OA 2QHXA 2I6XA 4FE3A 4O4LF 5FBRB 5DBEX 2PXAA 2R6CA 1M6HA 5EKDA 3EPKA 5AVXA 4FEYA 4OXXA 2JZOA 4YIKA 1GILA 4AZ0A 4U6NA 2RGWA 2VUUA 4JLBA 3AU9A 4UCXA 3W5AA 3D6HA 3CH4B 4KUEA 3ENZA 4EW3A 3QKUA 4JOQA 4EY7A 4QARA 3FR8A 1S3FA 1DAEA 4C06A 5TGTA 2IUUA 3SQMA 3ZEAA 2P1RA 2DCUA 3TQTA 3BB3A 3ZNPA 2ZIXA 1ADBA 1CY6A 2Y66A 3DF9A 4ZOAA 4CLRA 3AP3A 2JK1A 4V38A 1L5FA 4MI9A 4EZBA 2IL1A 2R6GA 1L7NA 3D6JA 5JSYA 1ZMTA 2WKSA 3F2IA 1K6JA 3IQIX 4A8PA 3NBUA 4L0DA 4O8ZA 4A23A 1P2SA 4A6XA 2H5LA 4QDXA 1K88A 3B53X 5DNVA 1SZPA 4D4JA 5L51A 2BF4A 1A1VA 3NHUA 5H3HA 4DUGD 2FQWA 2YUTA 3F6EX 3GYGA 3N2GB 1DRJA 3Q98A 4OPMA 4B79A 1RACA 5HPYB 4K2HA 5I7AA 2W4IA 3G8CA 2X22A 1ULBA 4Q4DA 4X8HA 3WSWA 4WBSA 4BPRA 4BNKA 5C5IA 5K4AA 3PBKA 4RZUA 5D5QA 3VBEA 2Q9AA 1ILEA 3SZGA 1TA0A 2WIKA 3RUIA 4WPGA 1E61A 4L2IB 4K9QA 4RVHA 1TK9A 1Y8AA 1A77A 3MT9A 4ENRA 3ZXYA 5TE9A 1EWQA 1G8SA 2AE2A 2J8ZA 2KX7A 3EBPA 4UE2A