4XTRA

Structure of get3 bound to the transmembrane domain of pep12
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
348
structure length
305
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMGALADLTGSIPGIDEALSFMEVMKHIKRQEQGTFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 100
structure length 305
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xtrA00
3WYGA 3AVTA 5JFGA 4OHWA 3A4NA 4FMDB 4G3XA 3MWJA 4QBGB 2W6ID 4MUBA 2D2FA 3GQBA 4WOPA 4BEBA 4DBLC 4CEJB 2ZYWX 2NO9A 3GJ0A 1N5JA 3B9QA 2FX3A 1GFIA 4PQRA 5DIFA 4YQFA 2BDTA 2VP6A 1ZP6A 2IEYA 2ZJAA 2AN9A 4L9SA 1GDDA 4MGIR 2LCFA 4MGKR 2GWHA 1KI9A 1M8PA 4XVRA 1SKYE 4AKIA 2ZS8A 2K5UA 3GLHA 3X1XA 5FOVA 121PA 1KI6A 2CL6X 2NIPA 4JLMA 4HLUA 1Z06A 4JSTA 4FWIB 2ZAOA 1WRBA 5JZVA 3DPUA 3QENA 4HB2A 4PFSA 4PSKA 3EG5A 2ZE6A 3SJAA 4DLVA 1FFHA 2BEKA 2QROA 1ZCBA 2CLCX 3KB2A 4A8JB 5DE3A 2V1XA 1PZNA 4OHYA 2HF9A 1HA3A 4CF7A 1IJEA 2UKDA 3OEHA 4R9UC 2JJ1D 5FI1B 1V43A 3LD9A 2NO6A 5EP3A 3GLHE 1FTSA 2HV8A 4V0ME 4O3MA 1U8YA 3OIVA 4OQLA 2ZI7A 3EZ7A 1E79A 5CDFE 3GJ5A 3ZYCA 1WE2A 2QNRA 3N2EA 2XAUA 3RVBA 1XD2A 1W4AA 4FD2A 4UNRA 2C5LA 3K09C 3L2OB 1D9XA 1E32A 1E1QA 1GWNA 1UKZA 3MAAC 4KYUA 2WSMA 1YZKA 4AC9A 4EPWA 4E07A 3OEHD 2I1VB 1CF4A 2EFDB 2FE4A 2ANBA 3QPUA 4M9SA 3MCAA 2J46A 1CXZA 3H84A 5IK2A 1Y3AA 3DKPA 1YU9A 4ITRC 2CNWD 2J45A 4TYPA 3LLMA 1QF9A 2XEXA 2OZEA 4DLZA 4MRVA 3WP0A 1JJ7A 4TSFD 2YWHA 2ZI3A 5CDFA 4MYUA 5FL7D 5CITA 3A36A 1EESA 4NMMA 2A78A 2RB4A 2F55A 4MYCA 3QVVA 1ZUNB 2C9YA 3O8BA 4D6PA 4M1KA 2CE2X 2WIBA 1KDPA 4MGZR 4DSUA 1W48A 5EE3A 4AY2A 1ZC4A 1N5LA 1IM2A 4P0TA 3EXAA 1RRGA 3NTUA 1YRAA 2IYVA 3MRSA 1I4TD 2IYQA 3LX8A 5FPYA 3AVUA 3DZDA 5KYKA 1H8EA 4JLBA 3VHLB 2RCNA 5L3RA 1MO4A 1NN1A 1JPNA 3FFAA 4X8LA 3SFZA 2RHMA 1TUIA 2BBSA 1SXJB 1T5IA 2Q3HA 1A1VA 5AJXA 3BH6A 1N5KA 5KHOC 2O0HA 3DOEA 1QHHB 5JJKA 1LW7A 3FWYA 4TYQA 1I4LD 3ECCA 4Q1FA 3HU3A 5KSZA 4B3CA 4QGAA 4DEXA 3S1AB 3B1VA 1KMHB 2QP4A 2QU8A 2FF7A 3WBJA 2ZI4A 4OKSA 3TK1A 4I1VA 1OT3A 1OB2A 2WKRA 2AX4A 2QPTA 4Q66C 2IUSA 3ZVRA 2GILA 4AURA 3TJZA 5K8TA 4K81B 1U98A 3QSYA 3ZD7A 3GJ3A 3DL0A 4F4CA 2GXSA 1NVVQ 4QXAA 2ORIA 3OEED 4TYYA 4LYJA 1TPZA 1GG2A 2W0MA 4Q1CA 2A3RA 5KSPA 2GBLA 2J7PD 1NVWQ 1PJRA 1LNZA 2CL7X 3FMOB 3U4QA 2H92A 4P4SB 3K0FA 3GLIE 1XTRA 2Z6VA 5DN6D 2DFLA 2JLSA 3Q5DA 2HDNB 4LI0A 4PZZA 4AWXA 2HEIA 2Q3FA 2WWHA 3DM5A 3UIEA 2QPAA 2I3BA 3QJYA 1GOTA 4P4TA 3GFOA 1QHXA 1G6OA 4A2QA 3SJCA 3J81k 2NPIA 2VSXA 4HLCA 3RC3A 2PJRA 2AHOA 1P61B 2KE5A 1OH6A 3CIOA 5GJCA 1MKYA 1Q3TA 8OHMA 4BGDA 1NBMA 2V8OA 3DM9B 4POAA 4HB4A 2WVJA 2C03A 1NI3A 4NU0A 4P3YA 3Q9LA 1ZM4A 4B3BA 2HUPA 3K0CA 1KI7A 1Q1ZA 2ZETA 4PHGA 4RZ2A 5F9FA 2WJIA 3G0HA 2WPDD 4JL8A 1R4AA 2VSFA 1XFAA 5BW8A 1NG9A 1P7CA 2O5VA 4IHQA 3TMKA 3FHOA 4BFUA 2JLZA 4FIDA 5JWOA 5IHPA 1ZAKA 4QG7A 2H7VA 2ATVA 2ZVQX 4H9GA 1IONA 4I1SA 2R9VA 1UEJA 4A2WA 1N5IA 3K1JA 1D8TA 2GK6A 1KKMA 3PEWA 5FI0B 1CULC 2XOKA 2OM2A 2IS6A 4ARZA 4BRWA 2XXAB 4URUR 3NVAA 5A0FA 3ZVMA 5EE1A 1A2KC 3VR2A 3DDCA 1NKSA 1S1MA 4L5BA 4W5HA 1W0JD 4GL2A 1U90A 2IYLD 3VX4A 2V6JA 4C2TA 1UDWA 1OYYA 2X8AA 3CNOA 4FN5A 1NY6A 1G1MA 2IS2A 2QAJA 4JKIA 4WAUA 2JLWA 3KKNA 2BEJA 2D74A 3C5CA 3NXSA 1NLFA 1T0HB 1JXOA 4OL0A 2OG2A 4Q4AA 3W6OA 4CT5A 4MRPA 4OQXA 2HT6A 4BWYA 5ELXA 4GPTA 1S0UA 1HUQA 5H1YA 1XNJA 3K09A 1FZQA 2J1LA 4P32A 3K70D 3B9PA 5D3QA 3T1VA 1U81A 3TUIC 3LAWA 2XNDA 1QHHA 1L4UA 3FTQA 4NONA 2PMKA 3ND9A 3B1ZA 3BB1A 3U7GA 2XZLA 1M34E 2O8BA 1Z6XA 2PCLA 3DHWC 5KNDA 1Z2CA 1Q1EA 2ZRJA 3P20A 4B74A 4LC0A 3FE2A 3GJ6A 1ETUA 1RYHA 3IIJA 2ZRMA 1G291 1L2TA 2ZRKA 4NCKA 1N6LA 1GTVA 1P3JA 1UFQA 3CX8A 3SI7A 4AK9A 5K8LA 4DIDA 3THYB 1VCNA 1NNEA 3AUYA 4O2RA 1UBFA 4MQBA 2Q21A 2O8EA 1NY5A 4JJKA 2AKAB 3RS3A 2QBYA 5B57C 3BD9A 3SHFA 3N70A 1ZNYA 4IEEA 4ZPXA 1SKQA 2Z83A 4B2PA 1RJ9B 2OFWA 2RAPA 3WNDA 4GZLA 2WOJA 4BZQA 3CUEF 4BASA 3AF4A 5JWHA 4KHZA 5KSOA 1WXQA 4WZ6A 3B82A 3EZ6A 4RD3A 4HZIA 2L0XA 1E2PA 3HWSA 3NC0C 5JJLA 4HZUB 4AI6A 1S3SA 2NZ8A 3U6KA 1HEIA 3U44A 3AF3A 4N0EA 5L3VA 4ABYA 3T12A 1XPOA 3NIBA 1XZQA 1IXZA 2W6JA 2RHDA 1G17A 5E4FA 1XTKA 1NN3A 3E2IA 4OJKA 1TF2A 2ZRIA 2G6BA 2FV8A 2JGNA 2FSHA 4XOIA 4TL6A 2QMEA 4RD1A 1I4DD 5P21A 1AN0A 1XD9A 3D3QA 4M0LA 4NCJA 4PZYA 2RGBA 5AUPB 3HPRA 5HR5A 1R5OA 1E99A 3HYRA 3JVUA 4EJSC 2ZU0C 4D0LB 1YRBA 5EUQB 3W3ZB 4LUCA 3AKDA 2E87A 3AVXA 4W5JA 4WVFA 2MSDB 2XJ9A 3BORA 3QG5A 4Q4AB 4NYIR 3GEHA 3QXCA 4DLWA 1UBGA 1EWRA 3GJ4A 1G3MA 3D8BA 3V4RA 1E2NA 2WV9A 2RGCA 1VIAA 4R71A 2O8CB 1P2SA 2O0JA 1IN6A 1K5DA 1M6NA 3HPQA 4GRAA 2Y8EA 2WMOB 4MRRA 1MOZA 3NBYC 4KFTA 3W3AA 2R65A 2IEZA 4Q4JB 5L3SB 1F48A 3HU1A 3CNNA 3U7HB 2Q0HA 1W5TA 4HLQB 1OXXK 3CWQA 2B92A 4PPGA 3UWOA 3ZS8A 4BRUA 1F3OA 1PVOA 1VHTA 1XEFA 2QE7D 4JLPA 1EXMA 1X8KA 1EFHA 1XTSA 2R8RA 3LXXA 1MO5A 1Z0FA 1Q20A 2JJ8A 5CLQA 1JB1A 2RKOA 4RKEA 1BYUA 1I2DA 5FFMA 1OE0A 2WJHA 1XD8A 4M1MA 1J70A 1GKUB 4M1YA 4HLUC 2GZDA 4V0OA 1OH7A 5JI2E 2Q6TA 5EZ6B 5KO2A 3EZ9A 4Q19A 4QBFA 1W2GA 2XB2A 4CIDA 4PPQA 4PC3A 1M7BA 3T1QA 3OAAA 3NEYA 5JCPA 3BOSA 3DKVA 4KLZA 2RGXA 3ASZA 4DLSA 1E1RA 1G18A 4ZV4A 1FP6A 3ADDA 1CR0A 5HCIA 1VIYA 3LO5A 4NYJQ 3K9LA 4DDWA 4TTQA 2IL1A 2X2EA 1E9SA 4OBEA 1E0KA 2OV2A 4MDEA 2C77A 2IYTA 4PX9A 1J90A 1E1QD 1XMJA 4B6EA 2ZRCA 4BLTA 2WSSD 4NE2A 1OHHA 4FCWA 4C0SA 3VNUA 1KNQA 2EQBA 1KAOA 3A37A 1PV4A 1VG0B 1YZTA 2WICA 3KX2A 3NHBA 1O3YA 3NKVA 4LBYA 1QG2A 1W36C 1E9AA 2C9CA 2VHJA 2B6HA 3SBDA 2XOKD 3RABA 1CRPA 2OSBA 4MGYR 1ZJ6A 1ELOA 2OCPA 1W36B 1FQJA 3N5CA 3KL4A 1KK3A 4NDZA 2ZRAA 5CM9C 1KI1A 2CVHA 2EWVA 1Z29A 4FMDF 2AD1A 1ZM3A 1FPMA 3CKLA 4HAXA 1WA5A 4LPSA 4TL7A 5GJVC 4AKGA 4QGHA 4OHZA 2ERXA 1XBTA 4BFVA 1XCMA 2VF7A 3EIHA 4URVR 2FZ4A 1DAMA 2OHFA 1N25A 1RJ9A 3SZRA 3TRFA 3UG7A 4B71A 1B0UA 4ZDKA 1T8TA 1VCMA 4DT1B 5JEEA 2QUZA 3BIFA 4F7WA 3TIFA 3AQ4A 1US8B 3UWKA 2P6RA 2PH1A 1DBSA 1E3MA 1ZUHA 1YZLA 5H8WA 4YDSA 2C2HA 4HYYA 2ZR7A 2YC4C 2FEMA 2EYQA 1M1YE 3SC3A 3AM1A 2ZRNA 4IDOA 4EPVA 2GXUA 1R7RA 1CJTC 1D5CA 6Q21A 4F93B 2GDJA 1TMKA 4B43A 3D6TB 3R8CA 3X1WA 1NN5A 2PT5A 1US8A 1SQ5A 1OLOA 2FFAA 2WKPA 3AB3A 4XVUA 1JR3E 2R6GA 3TAHA 1QRAA 3SJBA 4ZCIA 3R9WA 4LJAA 3R8FA 3KJGA 3MWLA 1LTQA 3VKWA 3NHAA 4TMZA 4A8JC 1W47A 2FPLA 1ZRHA 1SXJC 4ZDJA 4QC2A 4TT3A 2OT3B 1RVDA 4PHFA 1ZW6A 4G5GA 2GXAA 4PZLA 2GEUA 3RRZA 2J7PA 3DZ8A 3GJ7A 4LJ8A 2PT7A 2ZSAA 3CH5A 3HYTA 3IO3A 3MUFA 4JLKA 3RDPA 4B6FA 4ERNA 4NTZA 3W8NA 3TKLA 2W00A 5KDDA 5EQTA 4JJZA 3BB3A 5DO9A 3PENA 3AP2A 4GMXA 3PV0A 2GNOA 3B6EA 4V02A 1NG1A 1G7TA 1FQKA 1UKEA 2IF2A 3BH0A 3EPLA 4I99A 4D4MA 4CEIB 2ZEJA 2ORVA 2ZE7A 1KIMA 4G0NA 4C0JA 4C30A 3SE0A 1JEDA 4KVAA 2GBLC 1HE1C 4TL8A 3ICQB 1U2RA 5IRCD 3ADKA 2F43A 4WZAE 2V6IA 1UKVY 5BN5A 3B78A 1RIFA 1N0UA 2D2EA 3JZAA 3RRMA 3UG6A 2BBOA 5JSZA 4HDCA 3THXB 5DLQC 4EFLA 1U94A 1XEXB 1VG8A 4JL5A 1MV5A 3G82C 4Z8YA 2A2ZA 1AGPA 2H5EA 2J0UA 2YJTD 2ZRHA 3WHKA 3KQUA 5E3HA 2ZJZA 3I8SA 2ZE5A 3QE0A 1D2NA 1UAAA 2J0QA 4RFSB 2WPDA 1EX7A 4B34A 4IVPA 1IHUA 4M2LA 4PC7A 3Q3JB 1P6XA 4FW9A 3TVTA 3U5ZB 2WWIA 2BBWA 4OYHA 3BB4A 4O2LA 3P4XA 1T91A 1P60A 2FFHA 4IVRA 4C0HA 1CS4C 1TNDA 4X8MA 1DOAA 3EZ2A 4BFTA 3RS7A 3U60B 2QL6A 4RZUA 2JLXA 3AP3A 1BO6A 2J0SA 2IXGA 3L8ZA 1T5LA 1XEWY 1SZPA 5JRZA 5EE0A 3WMEA 1CEEA 2ZPTX 5A4JA 4EUNA 1DAKA 1QDEA 4KVGA 2R62A 4D4LA 1TQDA 1E98A 3CZQA 5FOWA 4GSYA 3EIQA 4HUQB 3A4MA 1KOFA 3DO6A 1OJLA 3VFDA 4NYMQ 2H1LA 3H2YA 1II9A 2X2FA 4Q4HB 4Q9IA 1N0WA 1N6PA 3AGQA 2XJ4A 5KPDA 1B23P 2FSFA 3ZIAD 3OEEA 1K6MA 4PO9A 5FBRB 3ZVLA 1JR3A 2NPFA 1TTTA 1DELA 4IXNA 1K5GA 2O8FB 3B85A 1GL7A 3MFYA 3QKRA 1W49A 3CPHA 4QHSA 2NMVA 4RVCA 3REFA 2CNWA 5FPTA 1Z6TA 3A1UA 3KUDA 1VG9B 1G64A 2JLUA 3VMFA 1R8SA 3RS2A 1F2TA 1A5TA 2GF0A 4IDPA 1ZU5A 3AP1A 4TLEA 4QKQA 1R8QA 4GDFA 1JPJA 5EJEA 1UBCA 3HJNA 2EFCB 3QBTA 3BGWA 2W2TA 2H8KA 2YOHA 5H68A 4EPXA 1XX6A 1ZBDA 1JALA 2BMFA 2VP5A 1KDTA 4NCIA 1IXSB 1GM5A 1NKTA 1GL6A 2PJZA 1G16A 2CCKA 1L7VC 2GJKA 2QQ0A 2ZJ8A 4CDGA 3FDIA 1YZUA 4W9MC 4Z8XA 4A1FA 1H8ED 4FXPA 2YOGA 4S35A 2HXYA 2IYXA 2AFIE 1KI3A 3IKJA 1IY2A 2JLRA 4TLDA 4Y0AA 5E7MA 1XJQA 3ZQJA 4C0AC 1E4VA 4KBGA 3SOPA 2GEVA 5SZIA 3UK6A 3LQRA 2GRJA 2QORA 4XIGS 2ZAMA 4PQFA 3P26A 4LX0A 2EU8A 1LB1B 2V54A 2JLYA 5F98A 2QSYA 3NG1A 4YXWA 4URXR 4XWOA 5LPNA 5EE9A 4B47A 1N6KA 5AJYA 2G77B 4Q00A 1R5NA 4ZDWA 3U3MA 2GVZC 3B13B 3MMPA 4ACBA 5JHHB 3SN6A 3CO5A 2ONJA 3QKSA 4TQAA 3TW8B 1G5RA 1KI2A 2CCGA 3U3OA 3REGA 2AWNA 1AKEA 2F3RA 2IYUA 2ORWA 2QE7A 4HI0E 3W5IA 4DCUA 5D3MB 1HT2E 2KB0A 2RGNC 2FDCA 1J7KA 1GVNB 1RRPA 2CE7A 2OXRA 4LRWA 2QY9A 2RMKA 4KFRA 1R5BA 3H86A 1C1YA 3KUCA 4KFUA 4C2UA 1KHTA 4TQ9A 2CK3D 2VRWA 2QP9X 4URWR 1YZQA 2YNMA 2R2AA 2VYFA 1A2BA 1OKKD 3KFXA 4LJ9A 3T1TA 4OI4A 1N0VC 2IXEA 4K8OA 1N3BA 3BFKA 2RGGA 2HF8A 2OBNA 4QHYA 1GSIA 2ZSEA 3KZ1E 4RY2A 2QN6A 5FR2A 3CH4B 3MLEA 1QHNA 4NHOA 2WHXA 2XITA 4DDTA 3I1FA 3QIAA 4BFXA 5JS8A 2N42A 1U99A 3RAPR 4DHEA 2QZ4A 3K9HA 3GLFA 1JNYA 3W9YA 1IN8A 3CWZA 1KO7A 3OIYA 1QVAA 1IOZA 1DAHA 2ANCA 1E0AA 4R2HA 2YC2C 1U9IC 4JBYA 3DMDA 1X1RA 4JBXA 4I81A 4RCZA 2IBMA 4LHZA 5DYIA 2CVFA 2HLDD 4RKFA 5TV2A 1RYFA 3TLXA 3K8YA 4DDUA 1GRNA 3AH8A 3A8TA 4G5OA 5EXXA 4BFZA 1MABB 5L3SA 2ZUCA 3U4QB 3NWJA 1HURA 4JT2A 3CLVA 1QHIA 2NOAA 3RSLA 2C99A 4A6XA 1XXHE 1IN5A 1T8UA 4D82A 1CP2A 1DG3A 5BN3A 1AGRA 1DAGA 2FFBA 1Q22A 2VP9A 2AFHE 2QTFA 3BERA 4LC1A 1OXUA 2V7QA 4U5XA 4E5UA 4PANA 3VKGA 1JR6A 4F4JA 4HDOB 1NMXA 5E95A 2OBLA 2ODBA 4URYR 2XTZA 3W8RA 1Z0IA 3RRNA 2HYDA 1IQPA 1P2TA 3QXHA 4JLJA 3PEUA 1AQYA 2GJ9A 2P5SA 1E4YA 2AXPA 3HP1A 5DYGA 3Q8XB 2CK3A 5TY0A 1SHKA 1FW6A 1AZSC 1E2LA 5EUMA 3EA5A 3KJIA 2FMXA 2G83A 4IOMA 3NBFA 4MRSA 5HTKA 1BYIA 4V0NA 4LHYA 4EPYA 1NIJA 1L4YA 2WAXA 3I92A 2VHQA 2OCBA 4II7A 3QG1A 1HY3A 1QG4A 3B1WA 5C46F 5BYKA 2CEAA 1XEWX 3TBKA 4QGGA 3MGCA 2QSZA 1TF5A 5B64A 3K0SA 2QM8A 3L0OA 3JVVA 3OFNA 4X8OA 3R7WA 4EFMA 1G4AE 1VPLA 4HB3A 4QRHA 4FMBB 1F6BA 4BFSA 2QP3A 2O8DA 3THWA 1Z07A 4C7OB 1XP8A 1OH5A 4L16A 4QBHA 5EP2A 3CRQA 4KITB 3IO5A 2GCOB 2ZRDA 1NMYA 1JAHA 1P2VA 3H4MA 2NG1A 2VPPA 2AKYA 1ZNXA 2LWIA 4G01B 4NYMR 3BS4A 2GHIA 1FX0B 1NVUQ 1TU4A 4HB0A 2A5JA 2AR7A 2PX0A 2ZITA 4IOLA 4L15A 5G53C 4AG6A 4JSYA 3F5FA 1P5ZB 1OF1A 1H8HD 5LBIA 3VR3A 1N6RA 3NDPA 4AYWA 1SVIA 5FBLB 1P9NA 2P6UA 2OILA 3FPAA 4LOAA 4DUGD 2IC5A 5SZKB 4F38A 3QY0A 1IN4A 2QAGC 1D9ZA 3AF0A 3AGPA 2KSQA 3CF2A 4EPTA 4DLRA 3AVVA 4KFSA 3I5XA 3WNBA 1TL7C 2QAGB 3FHTA 1MO3A 1NIPA 2AL7A 2C78A 2ODEA 2YZ2A 4R7ZA 4Z54A 4U7DA 2P6NA 3K9GA 2E1RA 3TQFA 1CJMA 4IOJA 1EGAA 3CF0A 1QBKC 3TR5A 1X86B 3NBXX 4MDFA 4I1OA 3C15C 2OAQ1 3QPVA 4PC1A 1G8YA 5KPJA 1XPUA 1X8JA 2XXAA 2F1HA 5BYJA 3LWNA 1Q1BA 2JLVA 1CKEA 5B58C 3VTKA 4UXJA 1KY3A 3T5GA 3NC1C 4HDQB 4A4DA 4TTPA 3EWAA 1RFLA 3GD7A 1Z6AA 4A92A 2GCPA 4M1WA 4WIAA 3IDQA 3LVRE 5CIQA 3C7KA 2IWHA 4KSCA 1Q44A 2VP0A 3VHXA 5JSZB 4I1UA 2QRNA 1XU4A 2CHGA 1HV8A 3A4LA 3FKSD 1S8FA 4W5WA 3EX7C 3SR0A 3VX3A 4QHTA 3LXRA 2C96A 4P31A 3GLHB 4AD8A 2WJVA 1E2FA 4PPFA 2ZYTX 5UKDA 5AJVB 4P33A 5FUYA 3U3KA 3QVUA 3BRWD 4AKEA 5J4KA 4PAQA 4DJTA 1OHHD 4TMVA 1IN7A 1CTQA 4LBWA 1SVMA 1NBME 2HJGA 3AF2A 3SS8A 2CDNA 5CM8B 1Z83A 3K70C 3CRVA 1C4OA 1Z0AA 2BM0A 2Q9BA 1ZNWA 1G9XA 1G7RA 1Z22A 1COWD 1K8RA 4JYBA 3WHLA 3B1XA 4TMXA 4YMUA 1TU3A 2QT1A 1KI4A 2OCYC 2EYUA 1JECA 2GK7A 3ZZTA 4D81A 3IQXA 2F3TA 3LH5A 1AK2A 1OFTA 2CHQA 3L0PA 3M6AA 1DPFA 4OI1A 3I3SR 3PUVA 2QMUA 1XCPA 1II8B 2ZM5A 1FOEB 3GP8A 3RWOA 4IDNA 2ZI6A 5KU1A 4AYTA 3EAQA 3BH7A 3WMGA 1TAGA 3E5HA 1AA9A 3QEOA 1Z47A 3EC2A 3ZH9B 2BC9A 4LJ4A 2A5DA 3FVQA 3KKQA 3AKCA 3H1TA 5FPKA 5G3YA 2R6CA 1TADA 2ONKA 2AXNA 2N46A 2GF9A 4LV6A 2QT0A 1AJEA 1ZM9A 4GOKA 3F8TA 4Q02A 2GAOA 1F60A 3TAUA 5J4HA 3IILA 3LW8A 3T15A 4ON9A 3T34A 1ZIPA 5D3MA 2WJGA 2ZVPX 1KK0A 5FTMA 3KKOA 2GJ8A 4BECA 3GLFE 5CB6A 3SQXA 3LLUA 4MKGA 2BOVA 4KODA 5TB5A 1H8HA 2VEDA 1COWA 2ZI9A 2ZUBA 5DH9A 3QKSB 4A0GA 3WMFA 2G3YA 2G0NA 2BJVA 5JI3E 2O8CA 2XNSA 3H0KA 1WBDA 4CEHA 1GITA 1M7GA 4Q01A 1G41A 4KAXA 3L8YA 1VMAA 4GNKA 3N2IA 2VP4A 3M1IA 4US2R 3TSZA 4D4KA 5IT5A 1TEVA 1JQLB 4D25A 4WBSA 4DIEA 221PA 4NL4H 3EARA 1E96A 1TUEA 4GBMA 3K9NA 5KOYA 1UJ2A 2YHSA 2VL7A 4OK3A 4PAMA 4JMPA 4DLTA 3FB4A 4FMCF 1ZMXA 4B76A 3B60A 2BKUA 3T61A 2B8TA 3QKUA 2W6JD 4RZ3A 3TQCA 5JEDA 5JHGB 5FH9A 3AVOA 5HKKD 5H70A 4B3XA 5C18A 3B8HA 1WF3A 2CXXA 5DI3A 2ZR9A 4GOXA 1KYIA 1XZPA 3OE7A 4DT1A 2ZJYA 3C16C 3UXMA 4D26A 2JIZD 1DARA 1OV4A 2FA9A 1LY1A 4UXIA 3ZS9A 2IS1A 1HE8B 5A5GA 1IY0A 4L8GA 1VHLA 5CIWA 2JCSA 5J47A 3PJRA 2ERYA 2DFTA 3MD0A 5HZHA 1IY1A 1U9IA 4OJQA 1E2EA 4JBWA 4JLDA 3RRYA 3V00A 4BFWA 1Z08A 1G20E 3AUXA 2DCUA 4MYHA 2W0SA 2SHKA 1TF7A 1MO6A 5LB4A 3V9PA 5E7IA 4XD7A 3ZLJA 4NCHA 3KTAA 1AKYA 4QGFA 5AJWA 2QAGA 1KDOA 2VIIA 3B7GA 4LBVA 2A5YB 2JIZA 2V7QD 3I8XA 3SYNA 2GAAA 2YINC 3I5YA 3GLIB 4TZ0A 5CLLA 4ZIRA 1UPTA 2V1UA 3BC1A 3CBQA 4YMWA 5FOSA 4TZ6A 1XB2A 4M9ZA 4NKRA 1Q57A 2BBTA 4MITA 1KO4A 1MR3F 3C14C 2XX3A 4YMTA 2W2VA 3PIRA 4H1VA 4LYAA 4A9AA 1KSGA 2AK2A 1G7CA 3C41J 5FOUA 4JZKA 4HAUA 4JLNA 5G40A 1OXSC 1U0HC 1GRQA 4Q9JA 2HXSA 4OK5A 621PA 1X8LA 1Z28A 1DTSA 2QTHA 1YHNA 5KSYA 2C8VA 3BAFA 2F9LA 1U0LA 3V4FA 1G5PA 3WBKA 1CJUC 3AVWA 4Q47A 3PUYA 2IS4A 5DSZA 2BV3A 2P2LA 4EIWA 4YDHB 5GADl 2C98A 4MA4A 5GVRA 5J40A 4LYFA 1EK0A 4IOKA 2ZSDA 3QF7A 5CB8A 1J8YF 2OXCA 3GJXC 1AS0A 2PZGA 5FBWB 5BN4A 1JBKA 1XWIA 1XTIA 2QMHA 4D4JA 4F91B 2OE2A 2BMDA 4FMCB 1FNNA 2OLJA 5FOTA 3X1ZA 1ZD1A 4PAOA 1YR8A 1SXJD 3O8CA 1Z0JA 3LV8A 3K0AA 1T4GA 4WW0A 3A6PC 4EQ6B 2VHCA 3SJZA 2QEQA 4A2PA 5EZ5A 2CHVA 3W5JA 2PLRA 4EPRA 1M7HA 2PEZA 3SHWA 3CONA 2IX3A 4Q9HA 4GZMA 3P32A 4A0RA 1KMQA 3KKPA 1ONBA 3A1VA 3ADCA 4UNNA 1M74A 4LPKA 1W5SA 3T5DA 1XJ0A 3SU8A 4QM7A 2F7SA 4QM6A 1T3LA 1KNXA 2PX3A 2Q3MA 2YWGA 3SNHA 2Z0MA 2QMOA 3CR7A 1NRJB 2HLDA 1FX0A 4LDJA 2BKEA 4F4IA 2A7QA 1KSFX 2N1BA 2XSZD 5FBQB 2ZRPA 2ZU6A 4PPNA 4DB2A 2V9PA 4A0HA 4YLGA 4DEYA 2CL0X 2QG6A 3CR8A 3K0EA 4JT4A 4M1SA 1LFDB 1GL9B 2D7CA 3EPKA 1VCIA 4EAQA 3THYA 2VLIA 2FN4A 1D2MA 1E94E 2NQ2C 4D80A 2G1JA 3KXKA 1SHZA 4Q9LA 3THWB 5EE5B 2FOLA 2YKGA 1ESNA 1ZUIA 4C0BA 2O8BB 2VQSA 1CU1A 1UEIA 2HJVA 5L8VA 4BFYA 1ZD9A 4RD4A 1ZYUA 2CBZA 2GJSA 4TWZA 1OKKA 1DAFA 1P62B 2W83A 2IHBA 1E79D 4HAZA 3W6NA 1XDBA 2BWJA 1W0KD 1Q3HA 2DY1A 2BJWA 3PUXA 4D2IA 4KSBA 4NH0A 4LJ5A 4RSGA 3DMNA 3IPXA 5K8IA 3IQWA 4HATA 3THXA 1DADA 3HR7A 1R0WA 2ZRFA 3R20A 4PSVA 2F43B 3ICEA 3SYLA 3U3RA 3ONWA 5F3WB 1CRQA 3U6BA 4IEIA 4PXAA 4RZXA 4PC2A 3FOZA 3PR1A 1MRNA 4A82A 5KUTA 1XRJA 3C8UA 1R0YA 1F5NA 1P4SA 2V4ZA 2JATA 4OK6A 1Q21A 3SQWA 4IJMA 3L82B 3FGNA 1KK1A 3P1JA 4RD0A 1VKJA 1E2GA 4UJ3A 1EWQA 4QJ5A 1AQUA 3WYAA 2FFQA 3QUSA 2R6DA 1S2MA 2RGDA 3CF6R 2J3EA 3WRXC 4TN1A 4QBIA 5ANRB 3ZJYA 5AUOB 4FCTA 3LBNA 3U7FB 4WXPA 2PZFA 1GKIA 2YYZA 3IBYA 4JVNA 5HE9A 4AG5A 1KK2A 2D7DA 5F9HA 4WXRA 3ZVNA 2IK8A 2FZLA 1BMFD 4ARZB 1E9EA 2ZJBA 1D2EA 2WTUA 3ZZUA 2H57A 1JI0A 3W6PA 4XSGA 5FUXA 5AUNB 1ZCAA 1UADA 1HQYE 2MSEB 2WWXA 3O47A 2VHUA 4HAYA 4LV8B 1G7SA 4BE7B 1RRCA 3BWDD 1ODFA 4BLPA 1S9HA 1XF9A 4DUGA 3IEVA 4O25A 2WWGA 4M53A 3IGFA 1E2JA 1H65A 2FSGA 4XVQA 1Z6GA 4YONB 3EC1A 1G8GA 3Q5EA 4Q1DA 3QXJA 4RFVA 5TDHA 4LHVA 4DXAA 1FUKA 4B3FX 2BVNA 4PR0A 4TYNA 1Z0DA 4KLNA 4JLVA 1MRSA 1DE0A 4PSAA 5SZJA 2JJ2D 3MJHA 4C0LA 5FBVB 4B33A 2V3CC 3ZIAA 5LD2C 2A9KA 3F3YA 1E2DA 2V55B 2QTVB 4TMTA 521PA 2KWIA 4KV9A 4QJ4A 5BQ5A 1HH4A 1GNQA 1GUAA 2ASEA 4B35A 4DSTA 3PVSA 4MH0R 2W2XA 3LA6A 3QXSA 4PQYA 5FTJA 1XCGB 3QBVA 2QENA 1OYWA 5FPHA 5M04A 3CB4A 5EP1A 821PA 2H16A 2WWYA 2CLDX 4E09A 721PA 1EX6A 3RS0A 1KKLA 5IK2D 3FFBA 2IYWA 2O0KA 4F92B 4LHWA 1W44A 2IT1A 2JLQA 4L4UA 3CX7A 3OZXA 4IVQA 2J7KA 2JASA 3RYTC 1P9RA 2E9SA 1KJYA 3JZMA 1PUJA 5HCNA 4HLDA 4BLQA 4BLRA 1NMZA 2IW3A 2F1JA 3ZGXA 3LX5A 1E2IA 2VP2A 3BXZA 5E7JA 4Q21A 3UANA 2BIFA 3AF1A 3RC8A 1X3SA 2ZSBA 2DPXA 3EWSA 3QPWA 1CJVC 2C95A 1FNMA 1F2UA 1G19A 4DC9A 3LDAA 2GETA 2C04A 4HAWA 3BK7A 1E0JA 3QQ5A 1KMHA 3GFTA 3BE4A 2KBFA 4M4SA 1KGDA 2DWOA 3BBPA 3NH9A 4CVNA 2FPMA 3KFVA 2BCGY 2ZREA 2IHYA 4GP7A 1A4RA 2G9NA 4G5SA 1E2MA 5FL3A 3Q72A 4UKDA 3U7EB 1EFCA 1IAQA 2VTKA 5DN6A 1BKDR 1OFHA 2HCJB 2ZRBA 1S4QA 3QI2A 4U00A 2GJAA 3QKRB 4BPBA 1W4RA 1YE8A 2QGZA 3CPEA 4HZUA 3IEUA 1GNPA 4UXHA 1SVSA 2DWQA 2WJYA 3ZZ0A 3ETLA 1WB9A 1UM8A 1DO2A 4LJYA 3VR6A 3CRW1 1OFUX 2J5XA 3K0FB 1GNRA 2F9MA 3GLGB 1XTJA 4A0FA 3CNLA 4PO1A 1XPRA 4A6PA 2QA5A 5GJWC 4URZR 3R9IA 1KY2A 3UMFA 4OI0A 2J0VA 5CJ2A 2J59A 2JAQA 1VCOA 2B8WA 2BM1A 4Q1EA 2IYYA 5DNYB 3UATA 2BCJQ 4CYMA 1Z3IX 1OXVA 4TT3D 4V03A 2OESA 1QHYA 4L9WA 1WDTA 4MRNA 4MYTA 3U61B 4DCVA 1S3GA 1II8A 4BZXA 4GP6A 1MT0A 2KI5A 4FINA 4OHXA 4RCYA 4EQ6A 2ZJOA 1BMFA 1EFUA 2RGNA 1EFTA 3SYKA 1BIFA 5IDVA 1NVVR 4UNPA 1YR6A 4PHHA 4RD2A 1Z5ZA 1QHGA 5DGXA 3A1SA 5HPYB 1YJ5A 4NZYA 2GESA 4DZZA 3TE6A 1E69A 3LVQE 1RKBA 2DB3A 2QQEA 2IUUA 2O8DB 3GFPA 2XZPA 5SZHB 5EXTA 1PLLA 4DWJA 1UKYA 1Q1QA 1SVOA 3QNUA 3RNLA 4M8NE 4FCVA 3VU9A 3E1SA 2H17A 1ZC3A 4NBSA 1Z6YA 1XEXA 4B2IA 2WWWA 4TTRA 2CCJA 1RRFA 5AK0A 4KI0A 1VYUA 5TVKA 4Q4JA 2JDIA 1GILA 1G3IA 3PEYA 2FH5B 4YXWD 4HSEA 3W34A 4CGZA 1M2OB 3TSWA 1VYTA 3UMRA 3PITA 4UQOA 4ASUD 4IDQA 2G0TA 1RZ3A 2X19A 2I4IA 5G3ZA 1R6BX 4C0KA 1QVRA 2ZYUX 4XWKA 3GPLA 1YZNA 1XMSA 3KXIA 1YR9A 2FWRA 4XSHA 1NP6A 1CIPA 4Q4HA 5FR1A 4LZZA 4CEIA 4KXFB 4QNRA 1E9CA 4HUTA 2P65A 2WKQA 4LHXA 2JA1A 2FSIA 3OF5A 2DFNA 2YOFA 5J4LA 3GLGE 4Q48A 4B32A 5EXPA 4DLUA 3MJRA 2REOA 1SVLA 5AJZA 4DVGA 2Q9AA 3FMPB 3CRRA 4US1R 2WSSA 3RS5A 1XTQA 2IYRA 3EIEA 2FPKA 3RLFA 4UNSA 2JJ1A 3FMFA 4C7OA 1E9DA 1XD2B 1G3QA 1PLJA 3IBGA 3OE7D 3A1TA 4Q5IA 4A15A 2AWOA 4NCNA 3K0AB 3NH6A 3WYFA 4GOJA 1KTVA 3W90A 3OAAD 5TMPA 3AKEA 3B1YA 3TSOA 2P5TB 2O52A 4WZBE 3DVLA 4Q7KA 2KJQA 4Z51A 2MMCA 3VU9B 4LY6A 2XZOA 1ZNZA 4CZ2A 1QHSA 1NSTA 1W0KA 4Q9KA 3OHMA 4BEJA 2DBYA 4D0GA 5FTKA 5HZKA 3KDSE 3X1DA 2ZS9A 3THOA 2NTYC 1N6OA 3Q7QA 4FWTA 5AWFC 2OBMA 1Q12A 1OFIA 3IIMA 1GRRA 4B2LA 3ASYA 2XB4A 4CRWB 1UF9A 1KZGB 2F6RA 1T6NA 2DWPA 4TLBA 5JECA 1NN0A 1JAIA 1Z63A 4TYWA 4Q7JB 1PUIA 3A58B 2J41A 3EASA 4DLYA 1W7AA 1JJVA 4JVLA 4LV5B 1VTKA 2CLSA 5LDDC 1WP9A 2DFKB 2BMEA 3IHWA 4RD6A 3CPJB 4JLOA 1IJFA 2ZI5A 5C4GB 4CEJA 4LBZA 2PL3A 2REBA 1BH2A 1ZM7A 3MWYW 3KQKA 3KB1A 4PTLA 1GKYA 1W2HA 2AD5A 2ZTSA 2HCBA 2I1QA 1SULA 1RE0A 3IHLA 4JS0A 1W4CA 2Z4RA 2REXB 4ILEA 1WMSA 5DI9A 1V5WA 4G1UC 2UVQA 3GMTA 1KDRA 3VAAA 2HYIC 2PEYA 2A30A 1N2CE 1S96A 3M0EA 4XH9B 1HTWA 5FUWA 4OQNA 3CZPA 1G5TA 3PUZA 3KKMA 4LCBA 4M22A 1E2QA 2BHRA 3GJ8A 3PFIA 1N6HA 3SFVA 2PZEA 4Q18A 1EFRA 3TUJC 2UZ3A 4IFEA 4IDHA 4IXMA 3X2SA 4EJSA 3S1AA 1KI8A 3I62A 2QRZA 5BXQC 1LF0A 5FTLA 3ZDQA 4DKXA 1II0A 1NL3A 1KO5A 1ZINA 2OFXA 1JEEA 2VSOA 3OIUA 3RHFA 3TW4A 2CMKA 4DRZA 1OB5A 3R9XA 4NYIQ 1LF5A 1WQ1R 3DOFA 4AYXA 4WA7A 2TMKA 3EZFA 5TXGA 4Q1AA 1P72A 3QF4A 2X77A 5HE8A 1U0JA 1GAJA 1G4UR 5K8UA 3RS4A 1U8ZA 1G8PA 1P73A 4KBFA 5B2ZA 1KO1A 5FOXA 421PA 5L3QA 3AVPA 5FTNA 3GLIA 4A36A 1XMIA 3MSXA 2ATXA 1OPXA 4A8JA 4JIMA 4QFMA 1CR1A 3CM0A 4N1AA 2A5GA 2O8FA 1HYQA 4MKFA 1ANKA 4B48A 2HT1A 4KJZA 4DCSA 2ZRGA 2IXFA 2G88A 2VHTA 5CK5A 5L3QB 5GJBA 1CJKC 4R2IA 4P4SA 3VQTA 4DCTA 5C4MA 1CBUA 3BJIC 1LS1A 2GZAA 4XWAA 4GI7A 3PQCA 2ZSFA 3UKDA 5DI3B 5JBQA 2BMJA 4B3GA 1TQ2A 2OFOA 2ZXUA 1KAGA 3L43A 3AVYA 3ADBA 4J0QA 2QGNA 2G1KA 2ZROA 4NP6A 2RH5A 4IFBA 4M9QA 5EXSA 2GTPA 4TQUS 2ECKA 4D0NA 3O8DA 1E2KA 1P75A 4ZCMA 2NGRA 2ZUDA 4ASUA 4B75A 4G5QA 2EFHB 2ZE8A 4V0MA 5HKKA 2IYSA 2WMNB 4CEHB 1CLUA 1JXMA 3AEZA 1SGWA 3C4JA 2FEOA 2ZIAA 4TMKA 4ZKDA 1G8FA 4GMDA 1KJZA 3WY9A 4BLSA 1VDZA 4YMVA 2XGJA 2WBLC 4CW7A 4DSNA 3PCRB 4EKDA 1EFRD 3U44B 3ZQ6A 2D3WA 5CK4A 2F1RA 3VKHA 3QOFA 1R10A 2J0UB 1GIAA 1J8MF 4TL9A 2FNAA 4H1UA 3EA0A 2J9RA 5JMTA 3LFUA 1YQTA 3HDTA 4TMWA 1OIVA 3TNFA 5DHAA 4XD7D 1NJFA 1QZXA 4B3DA 4AIIA 4C9BA 1E1RD 3UPUA 1DAEA 4U02A 4UNQA 1OIXA 1OIWA 1N6NA 4V0KA 4ZI2A 1DVRA 4R98A 1GZSA 3T35A 3WXMA 2MMGA 1W46A 1WCV1 4ZIRB 1RPZA 2QBYB 1G3UA 3BFVA 2A5FA 5GVSA 3AV0B 2O8EB 5CJPA 2GCOA 2ZS7A 3I61A 1PLKA 2PLFA 4ZKEA 2GZHA 1X6VA 2Q9CA 2VO1A 2ODNA 4LGMA 2OCAA 2GCNA 4JYCA 2MSCB 4JKYA 4LSGA 4N0DA 4LYHA 3DEFA 2GXQA 2Z43A 4LJ6A 2FGJA 2WM9B 2R6FA 1XJCA 1S1CA 3L0IB 1TX4B 1LS6A 4RFSA 1NLYA 3LY5A 3GCGA 1W0JA 3ZD6A 1DEKA 1NSFA 1T0JB 4K46A 2NO0A 1G3RA 1SKYB 5C1BA 2KBEA 1NJGA 1VECA 4TLCA 3QXXA 1E6CA 1A82A 4Y0VA 2GKSA 2X1VA 4NPHA 1YKSA 1GP2A 2OEPA 1MH1A 3FYHA 4QOSA 3X1YA 5TARA 4RJLA 3WRYC 3K0CC 3NDBB 5KDLA 3VR5A 2WZQA 1F2UB 4JVSB 4OQFA 2ZJ5A 1O87A 5JWRA 1RC8A 3K53A 1L8QA 3HR8A 1X1SA 3LRPA 5KNCA 4GFDA 4ZCLA 2ZRLA 4M9XA 2D4HA 2UZIR 2VH5R 2XTMA 4KCGA 4DLXA 2IYZA 3KJHA 3PXGA 3KXLA 3CW2A 1WBBA 4LK2A 5G41A 1FMLA 2DYKA 5DISB 1R2QA 4Q7MB 1OH8A 1SXJE 2GA8A 1FMJA 1NBMD 3LBIA 1T9HA 3MWKA 3I72A 4JLAA 5FL7A 2H18A 2QM7A 3EPHA 1D6JA 4UJ5A 3GLGA 2ODWA 1JQJC 4TSFA 1KO8A 3VNVA 4W7SA 5KDOA 1Z2AA 2WOOA 1FUUA 1VG1A 1S9DA 2ZANA 1HT1E 3TVDA 4MUAA 2IF0A 2EWWA 3BFXA 5CYPA 1C9KA 4QNMA 4Q1BA 1TQ4A 4E22A 3R7WB 2B7CA 1KZ7B 4KU4A 3CX6A 1AZTA 4B73A 2W58A 1XXHA 4BQSA 1ESMA 4C4PA 4GT1A 2IA5A 5J5CA 4TLAA 5B30A 2CJWB 5C2JB 1KSHA 4IKEA 4NYJR 3QEJA 3TUZC 1U8AA 4LJ7A 3SEAA 5JRJA 1TEXA 2D06A 4OI2A 2FGKA 1BOFA 4E03A 1W1WA 3KQHA 3D7MA 1P9WA 3LQQA 4X8HA 1E2HA 3VR1A 3LBHA 1DO0A 2PMDA 2LKDA 3HU2A 2ZYVX 3KJEA 4ZO4A 1YVDA 2EFGA 1AS2A 2XNDD 3AVQA 3M4YA 2VBCA 4M21A 3NEJA 1NF3A 2ZQ5A 1A7JA 5JCZA 1UDXA 1NVXQ 1ZD8A 3I73A 3L0SA 4BUJA 4DB4A 3TGPA 1R0ZA 3B5JA 1AIPA 3C5HA 3GEIA 3P27A 3ND8A 2WJJA 1FP7A 3KTAB 2WIAA 3T06B 4G5RA 3CRMA 4US0R 1DG1G 3FKQA 3I32A 4FI3C 3Q85A 1SVKA 4PHTA 3FKSA 4MKHA 3RSOA 2YVUA 3WNCA 1CR4A 3RWMB 3G5UA 4JL6A 5FUVA 1G6HA 3EPJA 1ZVQA 1MABA 4JVMA 3KQLA 4YMSA 2NZJA 1E9RA 2J87A 2NO1A 5JLJA 1Z0KA 4LWZA 4PC6A 2B7BA 2GEDA 1JR3D 5DHFA 2EW1A 2YWFA 1SVWA 2WAYA 5IF9A 1CR2A 2P67A 1ZIOA 3LNCA 3I4LA 4S2EA 1XMVA 5JJIA 3GLFB 4PO8A 2FG5A 4Q7LA 5J4VA 4MKIA 4IW3B 5FPSA 3RANA 1IXRC 4ESHA 3QF4B 1LV7A 2OO7A 1FL9A 5LB2A 4XTRA 2DR3A 2JEOA 1E9BA 1R0XA 2Z4SA 2PBRA 4C0QC 3OFND 2CJWA 4HEJA 4EJSB 1N6IA 2RGEA 1RW4A 5BWMA 4XJXA 1DAIA 5CYOA 1XXHB 3EW9A 3NBZC 2ZJ2A 1I2MA 1KJWA 2R44A 2QI9C 3FMIA 3QKTA 1E0SA 3PG5A 2D62A 4CT4B 1HQCA 5J4YA 5EP4A 2JDID 3B2EA 1OSNA 3TH5A 3D31A 1TQ6A 3FHCB 3IUYA 3GEEA 2EFEB 4C3ZA 2R6AA 1ZM2A 2YWEA 4P4UA 5LD2B 1F2TB 4EFNA 4XTCS 4QL3A 3TR0A 3SDZA 5KNBA 4BZPA 4M1TA 1NLZA 3MG9A 2P0EA 3P4YA 2Z5FA 1AM4D 4Q03A 2RGAA 3WP1B 1KSJA 3IPYA 4V0LA 1E9FA 4Z1MD 1AS3A 2B21A 2LKCA 4ZI3A 4O0MA 3OIWA 2PCJA 4ESVA 1KI6B 4M1OA 3PUWA 5KTYA 2DHRA 4Z1MA 1T3HA 3A1WA 4HUQA 4HAVA 4YC7A 1ZU4A 1OW3B 2XTNA 2OAP1 4KYIB 1T3SA 2WWFA 4OQMA 3U3JA 1EG7A 2P3SA 3LW7A 2ZR0A 2FU5C 2GVDC 2XSZA 2YV5A 2AK3A 3E70C 4QJ3A 4DSOA 3VR4A 1Z8FA 1G21E 3Q7PA 3F0TA 1Q0UA 4ACAA 4KO8A 3UMSA 4B44A 2OLKA 3KQNA 2JJ2A 1OXTA 3AKYA 1J2JA 2VF8A 3O8RA 4I4LA 1LVGA 1YZGA 3U2QA 3PEVA 2W6IA 4EDHA 1G8HA 2F1IA 4N3NA 1UBEA 1YR7A 3OESA 1Y63A 3K70B 5JS7A 1FTNA 1DS6A 1P2UA 1W36D 2IWRA 1W4BA 4DCNA 3IIKA 4DDVA 1J99A 2QPOA 4Q4LA 2FJUA 5AUQA 1VYVA 3SBEA 5AR1A 1SXJA 2IUTA 3T1OA 2C9OA 5F2EA 1IBRA 2VA8A 1BS1A 2EVWX 4ZDIA 4AKHA 4BLOA 4OHVA 2NO7A 4IRUB 2OUKA
chains in the Genus database with same CATH superfamily
1EM8A 4IJVA 4E31A 4FMDB 5JFGA 2CXQA 3TLGB 3KC2A 2WYOA 4C6RA 2RKBA 3BIJA 2D2FA 2C4UA 3FR7A 3G9ZA 3K0KA 4TTSA 1N5JA 2BGJA 4ZEWA 2E7ZA 4X7BA 4PQRA 4YQFA 2BDTA 4WLUA 2JK0A 2AN9A 4IUDS 1HYBA 1GDDA 1IM8A 4MGKR 1UBOS 1UMCA 2HJ9A 2W2LD 3L46A 5DNDA 2Z5VA 4BIIA 4Z2YA 2ZIEA 1UXOA 3X1XA 4F5EA 3I6YA 5FOVA 5I5EA 2CL6X 3C6QA 1MAWA 2B4TO 5E9AA 3WDSA 1Z06A 1C1XA 2ZAOA 2RI0A 3QFCA 3IJRA 2CXUA 4PFSA 5JG7A 3HZRA 2DPGA 3ROZA 3T4XA 1YVUA 2WY2D 4YAGA 1P0MA 2BEKA 3DZIA 3TXYA 1B1CA 1XKXA 4AN4A 2KHZA 2B3TA 3GARA 5TGDA 3P9NA 3RTBA 1HA3A 5BO5A 4CQJA 3DFUA 4QLBA 3BSSA 1IJEA 1VJ5A 4OHMA 1XN1A 4OHKA 1DJQA 2NO6A 3KAJA 4O3MA 4QOHA 1WHSA 4HQFA 4CN9A 5CLJA 5J2TB 4Z9AA 2E2WA 1CY7A 2AF4C 3EZ7A 3L7AA 4X5OA 4BMDA 5LXTA 5AHWA 4ZRNA 3G0OA 3N2EA 3OEWA 4EF4A 2C2XA 4I55F 3CLTC 3CMMA 3I4CA 2C5LA 2FZKA 1DT3A 2Q99A 1D9XA 1E32A 2ZBRA 1GWNA 2JFNA 2ZYAA 3FROA 5FBZA 3REOA 4AC9A 5A06A 1K7XB 1J5EB 4LKOA 4OU5A 4E07A 1C29B 1C9NA 1MDBA 2G09A 2R6JA 2PO5A 1YL6A 2ODTX 4I50F 4Z3DA 1YFLA 5HKLA 2ANBA 4PRLA 2E4WA 5KQMA 4M9SA 2WE7A 3MCAA 2R6ZA 2FQXA 1CXZA 2I7CA 1FFWA 4NBRA 3VOBA 4JP2A 1S2IA 3LWDA 2PHZA 3HTXA 3EVCA 1W88B 3VGJA 4Y6QA 2R4UA 1W96A 2GYUA 2RBEA 3MINA 1X39A 1JJ7A 3HKEA 4TSFD 5AHKA 5B3JA 1X2BA 5CITA 1RYEA 4UDXX 2ST1A 4FZ3A 1AB6A 1J0XO 3PKJA 3O8OA 1I1HA 5CT8A 5BWCA 3L7KA 5I7WA 4NATA 2D6FA 5IAEA 1VM6A 1NPTO 3QZUA 1PQWA 3NHZA 1LDNA 3A6EA 3O8BA 1A96A 3GR6A 4M1KA 4Y6PA 1HTBA 3MRVA 4O0LA 4DG9A 1ZC4A 1FP4B 1N5LA 2ZSIA 4K86A 3M6XA 1XQ1A 1ORRA 2NSYA 3MRSA 1I4TD 1J49A 3LX8A 4FGSA 1LJ8A 4F7DA 3AF6A 1J00A 3O4GA 5ENVA 1V7QA 5KYKA 1CUZA 2I7TA 1WDMA 3FUTA 2IYAA 3KOUA 2HIHA 4OB8A 5EZYA 1H0HA 1C50A 3QGMA 4XUEA 2B1IA 2R751 2C2WA 2VKQA 4UASA 2VDOB 4LDNA 1CQZA 4B6QA 5MGNA 1A8SA 1KETA 3QU5A 2EZUA 3CKMA 3TIIA 4E08A 2I76A 2JZNA 3OWOA 4G84A 3ECCA 5KSZA 8ABPA 1K63A 1QYXA 4W9NA 5DN9A 3BMCA 3ZJTA 2VSYA 4MIOA 1DUIA 2QP4A 3T5AA 2JHFA 3AETB 1C3OA 2PUTA 1LQTA 2ZI4A 3MT7A 3DEYX 2BHSA 4OKSA 3TK1A 4I1VA 4KH0A 1AF7A 4Q15A 2QPTA 2X22A 3CN7A 2LBPA 4Q66C 3ZVRA 4C6SA 4BX8A 1CYDA 2XVAA 1C5KA 2HHCA 1HYGA 4K81B 5JECA 1PYOA 1Q7CA 1NVVQ 3MB5A 3WL3A 4DIMA 1SN7A 3MJDA 4D5GA 3PS9A 4LYJA 3FNBA 3WWEA 2W0MA 3OZDA 1VLLA 4Q1CA 1JA1A 1KJ8A 1IDN1 4TV8F 4ZO7A 3G7UA 1YONA 5JMPA 1GPJA 6ABPA 2HX1A 1YRWA 3CT6A 3LDFA 4LRXA 3FMOB 3M6LA 1TGYA 2A14A 3S81A 3ZCRA 3A9CA 3DLAA 3TL2A 5KTOA 1G5FA 4DFDA 3OUZA 1ZZEA 4LFAB 5F51A 1RAGA 1KH1A 1XZNA 2EZ4A 5JJCA 3RTGA 1OY1A 3GJYA 2VLBA 2YCLA 3DT8A 3KP1A 4LI0A 4MS3A 3NTOA 4AWXA 2R5WA 2I7XA 5AVSA 3DM5A 5LIPA 4OJMX 1GOTA 4DR5B 4CMGA 3UM9A 3ZWBA 2ZG6A 4XB1A 3NVDA 3QW2A 1NQAO 1YS6A 5AI0A 1CY4A 1QGYA 2IU3A 4HLCA 5DHPA 5IYZF 1C0LA 3SVZA 5JDIC 1PSWA 1N34B 1FBTA 4QBTA 2HXGA 1MKYA 4L6CA 4W7IA 3R3WA 4PZCA 4EGSA 4BGDA 2OZVA 3DM9B 3WYNA 3RNOA 3B1FA 1J1UA 4NU0A 1QG6A 5FJJA 3T9BA 1M0WA 3PC3A 1L7XA 4PFJA 3ZV4A 3VYSB 3GFSA 1KI7A 1H3NA 2GI4A 2ZETA 3LUFA 3NYIA 2H5IA 2WJIA 1IEWA 3P0JA 1XRLA 2R2GA 2Y93A 4KMSA 1URPA 5IKOA 3G0HA 1ULSA 2HV9A 3U40A 1XFAA 2WNIA 3EZNA 4IQFA 4I7EA 3H2GA 3TMKA 3QPAA 3LF2A 2CLOB 4PE5B 2JVKA 5AVZA 2F4NA 1XJWA 2E1PA 1J5PA 2G9QA 1GZHB 1SXPA 1YDHA 4AY4A 3K1AA 1AN9A 2YWBA 3HNRA 4H9GA 1N5OX 4KWEA 4Z0NA 4CHTA 4MR9A 1UEJA 3RSZA 4YJDA 5LLSA 4B31A 4D5EA 5I51A 3BXGA 4GLFA 1KKMA 3WIVA 1ZK1A 4JV5B 3VR6H 4U9HS 2OM2A 2Q6VA 2EIXA 5J5AA 1PBNA 2Y77A 5D2CA 5LZ2A 4MWTA 2RGRA 1E1MA 3C97A 3E3LA 5A0FA 3ID6C 4OUDA 1J97A 2OAEA 2IXBA 3GDHA 2OV1A 3DDCA 2XWPA 1RM0A 1S1MA 4UCQA 2XNHA 3JARB 3SFTA 5I8PA 3ZDFA 1W0JD 4KP7A 2QQFA 1DXQA 1GUFA 5BSWA 4HN2A 2IYLD 3QJGA 1RYMA 3ZBUA 3WXBA 3FFWA 4LXTA 4NMWA 4FN5A 4KO2S 4DCOA 5EMKA 4JKIA 1WTCA 4LVNA 3B6MA 5JMWA 1WPQA 2BEJA 2TRSB 3NXSA 4MDFA 1SUCA 2WD7A 4DV0B 1PNQA 3EVFA 3ONNA 4JUAA 5KTRA 1FB5A 1X1QA 1PFGA 1T0HB 3WKEA 3HB0A 3IQGX 4WCDA 1Z4OA 3JAMA 2ZBGA 3PKIA 2F17A 1O03A 1JU3A 2OZLB 4OQXA 2DCMA 2JK1A 4TTIA 4WACA 1SURA 1TM3E 1P1RA 1X77A 2DPLA 1Z13A 3FOBA 1ZL0A 3R0XA 4G9BA 4JKOA 3KDAA 1GSOA 4G0XA 2PUHA 5IJWA 1FZQA 1LX7A 3T1VA 3FNFA 2WT8A 4FR0A 2E4AA 3CJTA 3TUIC 3CZMA 1XHFA 1L4UA 4PZUA 2FP4A 3FTQA 5E8RA 3P9PA 4H3VA 5H4HA 4RTKA 1JAZA 1FBNA 2P27A 4QDTA 3TFOA 2YFYA 3MTBA 3SZGA 1IVNA 1J2TA 1LSOA 2VYCA 2ZKIA 3ETEA 3MWFA 4XGQA 1AMUA 1MJHA 1M34E 1P7ZA 3E03A 4XZ3A 3H5WA 3H8SA 1N8TA 3P2OA 3LK6A 4DNXA 2ZRJA 1QIKA 4J6FA 4LC0A 1TTPB 3UUFA 5KVCA 3RW9A 1MC5A 2P2DA 4GM0A 5ALSA 4F9GA 5JNWA 1O96A 3RVRA 2XYQA 4V1CB 1E2BA 3U4CA 1IJBA 1G291 3L4BA 4RHFA 3CX8A 3SI7A 1L7NA 4AK9A 3GG2A 4BKRA 5I7OA 5HF6A 1DX6A 3BZBA 1VCNA 4QVGA 4TS9A 1NNEA 4DA6A 4RJJA 5T8KA 4FGWA 3AFHA 3QOWA 1N2CA 2VPWA 4G25A 4DN6A 4EG8A 4G1MB 4YMIA 3RS3A 2AOUB 1ZONA 3FZQA 5B57C 1E1CA 3BD9A 5BV7A 3N70A 4IEEA 1R88A 2WU0A 3Q6NA 4MLDA 5GWXA 1BXGB 4UBOA 4X3OA 3PI7A 4GZLA 2WOJA 5U9CA 1QK4A 4AJJA 3FYTA 3L8EA 3CUEF 3TE7A 4BZQA 5AW7A 4DQKA 2HFKA 4BASA 3O94A 1G21B 2V7VA 3BRWA 3FXAA 4X6YA 3I2FA 4MZDA 3SICE 4AUKA 2FPSA 3IJEB 2JBHA 5EINA 5IH7A 1GQRA 3EZ6A 3SBOA 3KHKA 4D92A 4EKIA 1NQXA 2L0XA 3HWSA 3KPJA 4HZUB 2QD3A 2NZ8A 1EA5A 1BEUB 2FDXA 5H0IA 2C1ZA 2NUTB 3OQIA 4N0EA 2NVWA 1XJ5A 2NYAA 1NJ6A 2ZBPA 2DPYA 3IQDB 4GSLA 1PN3A 1TCUA 2NTNA 2PD4A 2ZT5A 3UCFA 3ZW9A 4E15A 2QZZA 1Q95A 3AONB 3SX0A 1HGXA 4K3VA 1XZQA 3KQTA 4PLWA 2RHDA 4BAGA 3ZJUA 1XTKA 1NN3A 3E2IA 4OJKA 4ZVTA 2X4GA 3A0UA 3LGXA 2G6BA 2D0OB 1V3VA 3JQ9A 1NJ1A 1HZZC 1H6CA 4EBBA 1BMDA 5JY6A 3KV1A 4N6NA 1Y48E 3VVBA 1UR5A 2QMEA 1SK8A 4RD1A 5T3YA 3D3QA 2E6UX 3N0VA 5CGQB 1LKZA 4K6MA 1YI0A 4NK5A 4MV8A 4NEHB 1NVTA 2PSJA 2HNKA 3WQHA 4KH1A 2NVOA 4DNPA 2EDCA 1WIWA 5BR4A 2ZU0C 1AQIA 1J20A 5K2MA 4J0IA 4N7BA 5E4JA 2X7XA 1C7RA 5MHTA 3EPRA 3H13A 2C4MA 4KDCA 2E87A 2A9JA 3DUFB 1I4EB 4IO0A 1FTGA 1N3LA 3D4NA 2P2GA 3VO9A 3LKZA 3NEAA 3PI6A 5A3RA 1P2BA 2GN9A 2G70A 3PRYA 3ZCUA 3V48A 3PGXA 3GEHA 4NECA 5CLHA 1PGQA 1R8XA 3QXCA 4XEUA 2IEDA 4MB6A 3W3AH 2Y2UA 3BG5A 3C3PA 2WD7B 1G3MA 3D8BA 3IDSA 4MA5A 4G1VA 2WV9A 2DPMA 4R71A 3C7TA 4DA9A 3UGTA 1TLFA 3KLOA 4NCXA 5G0WA 5IAJA 3KQOA 4AS1A 5AHRA 4MUGA 2CB0A 1M6NA 1PWZA 3HPQA 5TMBA 4E4TA 4FOLA 1HNNA 4OLFA 5FHQA 4JCCA 1MOZA 2H3HA 3MPOA 3NBYC 1HL3A 1M5UA 3W3AA 2IEZA 1MC1A 4Q4JB 3DVSX 1F48A 4DLWA 4MUIA 2Q0HA 4G8JA 3NYQA 1SHJA 4PINA 2RCYA 1JLHA 4PPGA 2B92A 4NEQA 3UWOA 3ZS8A 1TYEB 4BRUA 1R4ZA 5BV8A 3ZHUA 1FTQA 5L45A 1BEEA 3O92A 5LC1A 5E6RA 3Q2IA 4TKVA 1JLKA 3MTGA 3QRWA 1QV6A 1Q20A 3KJFA 3KO8A 4KIJA 1K5HA 4P81A 3MWEA 1NJ2A 1I2DA 4C3OB 1MGPA 4CTKA 2WJHA 1XD8A 2VHEA 3GA5A 3UMCA 4DE5A 2XBMA 4FOTA 3E3MA 3L1HA 1HL7A 2GZDA 1P7VA 1OH7A 3KSRA 1ABBA 4GIBA 4M49A 3OPVA 2WF7A 3V46A 5THQA 5BV1A 2BJHA 2XB2A 1PR4A 3EEBA 4Y2XA 4CIDA 2HDHA 2M1ZA 3RHSA 1EHYA 3H9QA 1MJGA 1PJ4A 5GINE 1WNTA 4P92A 3SYMA 5HCIA 4CM4A 1VIYA 4NYJQ 1T1IA 4BNHA 4MB0A 3TNYA 3V9AA 2VF5X 4K28A 4TVBA 2C2GA 1NURA 1W0CA 1K06A 4ZZ1A 2RH8A 1HQKA 4EEXA 3FVTA 5IT9A 1KYQA 1Q74A 2CZQA 4C0SA 1QIHA 4ARVA 4QDZA 2D2IA 5JD3A 1PV4A 6YASA 1UC9A 5D85A 5AW2A 3PCTA 1PQPA 4PONA 2Z58A 4REQA 4RQTA 1EXVA 1ONSA 4LWQA 1WX1A 3NBQA 1HDZA 2FDRA 3KLPX 2RHBA 2BI7A 4TXJA 3SC2B 3WGZA 4EHFA 1HYEA 2RI6A 4Y9UA 1FQJA 1QYRA 3C5VA 5HFNA 1KK3A 4KGDA 2W22A 4YVFA 1MHTA 1U7WA 3DV9A 1NZDA 3TW8A 4GEKA 2YWXA 4V38A 2CC2A 1G5QA 4FMDF 4HAXA 3AEUA 3CKLA 4K88A 4LPSA 2Z6AA 1ZXXA 1ORHA 3EIFA 5KJEA 2ERXA 3HG7A 4ZT7A 2INGX 2G6TA 2ZIUB 4INJA 2FZ4A 5BSUA 3ZHBA 3EVEA 3SZRA 2AOTB 2VS1A 1WABA 3FY4A 1B0UA 4GDMA 4OXIA 1G0OA 3BL6A 4ZDKA 1HRDA 3FN4A 2QUZA 4MLPA 4F7WA 1Z6PA 1QFMA 1UIRA 5DGDA 4E0BA 2XYVA 3Q1LA 1DBSA 2X40A 1QCDA 4N01A 5DBIA 4J7AA 2ADFA 3T5CA 2JH8A 4YDSA 5CHEA 5BVHA 2JFBA 2W2LA 4DPMA 1FMTA 3I45A 2YC4C 2FEMA 1P9LA 2EYQA 1PYGA 4F0JA 2C3UA 3SC3A 5BR1A 3C45A 4IDOA 4MW4A 4EPVA 2GXUA 1CJTC 5AIBA 1R74A 5B4TA 1TMKA 2O2IA 3LBYA 1GPYA 1YB6A 2PT5A 1R4MA 1US8A 1OLOA 2WKPA 3AMVA 3EH1A 1HWYA 3KQMA 4EHBA 2G5PA 2GCGA 3WGHA 3USES 2NU6B 3TAHA 1ACJA 1QRAA 2IYPA 3LC1O 2QUBA 4FK8A 1I7SB 3R9WA 2BMVA 4CNBA 4LJAA 1TC1A 1KZ9A 2O2HA 3KQWA 1N4AA 5I8WA 1EH5A 3VKWA 3NHAA 2C07A 2FPLA 3TLAA 1SXJC 2BKXA 4ZDJA 4MULA 3KPWA 2JPDA 2J3JA 1RVDA 3FGOA 4I5FA 1ZW6A 4ID3A 2VNKA 4I8XA 4BN0A 1B93A 1OZFA 4WK4B 1ZJZA 2JAXA 3HSKA 4LJ8A 1I2ZA 3CVOA 3AM3A 5CNMA 4NTZA 3W8NA 4B6FA 3TKLA 1TAQA 4C01A 4KX3A 3WDMA 2UUPA 5AHXA 4FFPA 1CP3A 2XADA 5DO9A 3AP2A 4RIIA 5LP6C 3OCVA 4RY9A 3LGSA 4WCFC 3HL0A 4GI3A 4DIKA 1FQKA 2AZTA 3N07A 5BVGB 4MAFA 5TQJA 2ZE7A 3E2MA 4G0NA 2O19A 4LF5B 5DEIA 1PHRA 3BWVA 5FQOA 4C30A 1JEDA 2FW8A 2F3QA 2GBLC 4QATA 5KHAA 4B09A 1K98A 2DTEA 3E4DA 1GY8A 4DVJA 4UVDA 3PRHA 2WQ6A 4P5EA 1ICIA 4WY8A 2F43A 4WZAE 1PEYA 2V6IA 3KB6A 3TTUA 4CKEA 2QRVB 4Q93A 4H6VA 5BN5A 1FXUA 4IIGA 2V9CA 5GONB 3RRMA 1MVLA 2BBOA 5DHUA 3GB9A 4E2WA 4P1ZA 1BNCA 3ZX5A 4W99A 2PK3A 3D8NA 3NMUF 1VG8A 2V5VA 2YY6A 1JSRA 3OZCA 4Z8YA 3AUJB 5BMVA 1M5RA 2D00A 3OECA 2J0UA 3WHKA 3EG9A 3CUKA 3FRHA 4IGKA 4JGIA 1S2OA 5DHTA 1LPSA 3Q5GA 4U8HA 3ENKA 4J4BA 5KOIA 2II6A 1UAAA 4RFSB 1WUIS 2WPDA 3D4BA 5L7YA 4C6HA 1X7DA 4S04A 1YZFA 4PC7A 4FW9A 2WWIA 3NM4A 1EDOA 3PKZA 5B6JA 4OYHA 1HDOA 4YMHA 3BE8A 2AJLI 2C4KA 2PQMA 2X6TA 1C4KA 1F17A 5KYUA 1K27A 3QELA 4HVLA 4G0ZA 4OYLA 2ILTA 3OCJA 3DLPX 1T91A 2FFHA 1U2EA 3QVSA 1EZ1A 3I9V6 3GBPA 1TNDA 3OM9A 3EZ2A 1SNYA 3LDUA 4BFTA 3PGMA 4ZOAA 3RS7A 2X0DA 2QL6A 4X1KB 1H5NA 4RZUA 2JLXA 1X7YA 1LBIA 4IJWA 3MTDA 4PLTA 4UQLA 2H2IA 4HRYA 1GARA 3EH2A 2WKWA 5EE0A 3QU4A 5HGJA 4KVGA 2R62A 1LPAB 2WHYA 2WJAA 2VNHA 4F97A 3AUAA 5FOWA 4HFMA 4ZVNA 2FW1A 2P2NA 3ISJA 3VPAA 1EIWA 3T4PA 3R74A 1OWOA 3DO6A 3V8NA 2B69A 3R7FA 3SZOA 4HGZA 3TSYA 3TW6A 5ICGA 3T8YA 1P74A 3H2YA 1II9A 2ZB3A 3QOXA 5BQXA 5JNLA 3CZ5A 4IZ6A 4Q9IA 3VC2A 5AD1A 2FSFA 3JD4A 3OEEA 3ZVLA 1JH9A 2ZAIA 2EDAA 5FV4A 2GPSA 4EO4A 4RETA 3W5UA 1ZFNA 1QP0A 3REFA 2DB3A 5FPTA 1Z6TA 4YUWA 5AESA 2JLUA 5H7XA 1ECCA 2C88A 3VMFA 3ZK7A 2BFAA 3R40A 4Y6RA 2BELA 1VIDA 4RV9A 1QO0D 1VRWA 2CFSA 2Y05A 2YS6A 5CA1B 4NS1A 3UJAA 4AMGA 5IAKA 5LJLA 2I8AA 4KPUB 1SQFA 5AI4A 5EJEA 2J4DA 1UBCA 1E3QA 2JCGA 2WV7A 4FYKA 1VJRA 2H8KA 2YOHA 2OCIA 3ZLBA 2O2YA 4NOKA 4DY4A 3NLLA 3WWCA 1IMOA 1IXSB 1OXBB 1SXIA 3EA4A 1Q0SA 3I34X 1MB4A 1T4MA 1D4FA 1WKCA 1ZN9A 1G16A 1Z68A 2ZJ8A 4LZWA 4CDGA 5IVIA 4YAIA 1V1JA 2GFHA 4ZHQF 2X9VA 3AUFA 3NUGA 3TTWA 4Z8XA 2JFQA 4A1FA 1H8ED 4CHGA 3WV4A 1E3SA 2X0IA 4N6GA 2HXYA 2IYXA 4U2KA 3NPMA 3PF9A 2XGOA 4OMDA 2GVNA 4J2TA 1E6EA 4X24A 3COPA 3ZCSA 4DA0A 4CKCB 2ZIGA 4NJEA 4OLAA 1LWOA 4KBGA 2BP7B 3SOPA 1NPDA 3SQOA 3ESXA 4XIGS 4AM8A 2ZAMA 3OVMA 3P26A 3C3AA 2EU8A 4LX0A 1RNLA 5HRUA 3GDOA 2QSYA 4URXR 4HDRA 4YXWA 2GCIA 4G07A 5EE9A 4B47A 4JT8A 3WGYA 5IJ0A 3W1EA 4W9NC 3P19A 2PJUA 4BNNA 1JLRA 3B13B 5TMDA 3MMPA 5JHHB 3L8MA 3HGTA 4UCWA 3CO5A 2ONJA 3ZDEA 2HWKA 2QSUA 4DABA 1KI2A 5JPIA 4AKTA 1WTAA 3OHSX 2QG4A 5C37A 1L6RA 1STOA 4D02A 1AKEA 3TJMA 1ARZA 3KR2A 1RJDA 3K16A 2QE7A 3UVEA 1L5HB 3IA7A 4G0PA 4HI0E 5C8VA 1HXHA 2AVNA 4JI4B 5D3MB 4H0FA 3OOJA 4W1QA 4CLEA 1GVNB 1L1EA 4RF4A 2OD2A 4I6GA 3VPCA 1NDQA 2CE7A 3IDZA 3JTEA 4B3IA 3IBFA 4COOA 4ER6A 4R68A 3HN6A 1R5BA 3O84A 2A0KA 4RA6A 1KZ1A 3GVPA 3HFJA 2YNMA 2ZWPA 3INYA 2WU8A 3SIXA 4B6GA 3T1TA 3G8YA 4TV8B 1IAVA 3OETA 3ZG6A 1AT1A 2FSSA 2IXEA 1N3BA 3BFKA 3G5LA 1DJPA 1M1NA 1OYOA 1RS0A 3M82A 4MA0A 4PNPA 4ZICA 3F5QA 1V8PA 4G65A 2ZSEA 1WXXA 3L1JA 2OG1A 3CH4B 3AR6A 1XDUA 3JRXA 4NHOA 1UJ6A 3DBLB 4G4SP 1O0CA 4U7FA 1L7BA 2BGKA 2RHWA 2E55A 4NNPA 4KXLA 3QIAA 3OQJA 4QG3A 4A26A 1YOBA 2N42A 2WE8A 5EYPA 3LK7A 2QZ4A 5K8CA 2DBQA 1LNQA 1JNYA 4QWMA 5HF5A 2GWRA 3THSA 3W9YA 1KO7A 1QVAA 4DILA 1DAHA 5CFZA 1O6FA 5K4GA 2PG3A 3IT1A 3TG2A 3LDGA 1NAHA 4JBYA 3IVRA 3ZDRA 1OLXA 1JT9A 4LHZA 4F46A 3CISA 4RPKA 2W2MA 3JQGB 4J2HA 1RYFA 3TLXA 2E5WA 3T0GA 4E4YA 3AH8A 1RR6A 5B4VA 4BFZA 3MCUA 4XWGA 4ZVUA 4O4JF 3HBJA 4L72A 4QPCA 3QMVA 4QT0A 3U4QB 3NQ41 2GEBA 4A16A 4WT7A 3TD2A 3RSLA 1B8NA 2C99A 3NGLA 1H2FA 1XXHE 4Q3EA 2O59A 4PGGA 4U7HA 4KLCA 5HZGA 5E3IA 2VBFA 3H6GA 3IUSA 4IV8A 2WWVD 1DG3A 4N3GA 3HCPA 1FA9A 2WYIA 3I9V1 5JVDB 3ZWPA 5AFSA 5HIKA 2FFBA 3F90A 4PYKA 1TM5E 3BERA 3UHJA 4EKNB 2GERA 4GXRA 3BRQA 3UK0A 1AMOA 1JR6A 3ND6A 3WGTA 1A9YA 4XM2A 2WIGA 1HC7A 1Y7PA 3IHTA 1A7KA 1OLSA 4L75A 4RNCA 2WU1A 3W8RA 4B7UA 2BH2A 3QXHA 4CTOA 4Y7DA 1P44A 1UT8A 2W2OA 1FW6A 3CLUC 3Q8XB 4WY2A 5JCXA 3R24A 5CNJA 3TNJA 3H3JA 1QIMA 2G83A 3NBFA 1ZDMA 2QVBA 1QH0A 2VCEA 3WLFA 2CT8A 1Q7RA 4II7A 5DBGA 1PHPA 1YQWA 4A73A 4Z0TA 2YXDA 4E14A 5AKIA 4LA4A 1BGVA 4WN9A 1GGFA 3R7WA 8GPBA 5C51B 3RVDA 4MQMA 4G85A 3T9DA 3T9EA 1HNZB 1ZBQA 2UVDA 1F6BA 1DX4A 1Y9EA 3LFHA 2QP3A 4OHCA 3HBNA 3REQB 4HWOA 3E5RA 1OH5A 2XODA 5M7EA 1YDMA 2OMEA 1C9EA 3QWHA 2BFFA 5L40A 2BFBB 1NMYA 3EF3A 5B55A 1EX9A 3RYIB 2DHQA 4QPNA 3RG8A 1GLGA 3A3YA 1ZNXA 2PKYX 3M3HA 3MK31 4NYMR 2WLSA 3IUQA 1FX0B 4I5DA 3LT0A 8ATCA 4KQEA 4ESEA 1B0AA 2C0CA 2KPOA 3E6AA 2A5JA 4Y8VA 2AR7A 3VAYA 5G53C 2JD2A 4HXYA 2PX6A 5EEHA 2AC2A 3F5FA 1P5ZB 4GKAA 1OF1A 2AG0A 3A2MA 2JIDA 3F6PA 3VKUA 1J2YA 1OBHA 1N6RA 4TM7A 2IX9A 2N3ZA 1SVIA 1TK9A 1YA8A 3VR3A 2NTJA 3FPAA 1K6XA 3OIDA 1CNFA 3DTYA 1FUEA 3W5BA 4TRNA 5EPOA 3QY0A 5MDHA 2QTRA 3RC1A 3CF2A 1R12A 3FSGD 4RTNA 1Y4DE 4KAJA 1HE3A 1YNOA 4KFSA 5U4QA 4EPTA 1PR6A 2DFDA 1EPUA 2YWJA 2YJNA 1XMXA 2AL7A 3GI1A 2J48A 2C78A 1P1JA 1NQVA 2ODEA 3G2QA 3JWJA 4HYTA 4RXMA 2E1RA 1UMDB 2AN1A 1JDJA 1Y7HA 2VWGA 4XWYA 5IN5A 3M4ZA 3TNDA 5A4AA 1ZOOA 4DZRA 3CF0A 3TR5A 1MQAA 2X5OA 3EBOA 2OQRA 1G8YA 3ITEA 4ZODA 3GBSA 1VPEA 2QV0A 1WVMA 3N8DA 1JVNA 3H75A 3LWNA 4AP5A 2PL9A 5JAMA 4KMOA 3IIIA 1QPZA 2I2AA 1H0SA 4IVNA 2FP3A 2J9FB 3HY3A 1OFGA 2R68A 1ODKA 4A4DA 4PZDA 3CLRD 3GD7A 3RBZA 1CC1S 1E3DA 2E0IA 3DBLA 4RTMA 4R1PA 1VKNA 4YCMA 4EUEA 1U0EA 2MINB 3N8GA 5BMVB 4KTTE 5I7VA 1WP4A 3EN0A 1ZRSA 1NUSA 4UM8B 3HLYA 4MKXA 4PSUA 4ZJZA 4V0RA 3IEPA 2VP0A 4OXXA 3DKKA 3CCBA 4QQ8A 4YAFA 2QRNA 2ZUVA 1U3GA 1XU4A 1HV8A 1KAQA 5K5EA 1QR6A 4ETIA 5JZOA 1P7YA 4W5WA 3MAJA 4GPD1 2P2ZA 5AOBA 2J31A 4I36A 1BE0A 3ZXUB 3JYQA 4JQYA 2COUA 1E2FA 2GH1A 2I4MA 2P91A 5UKDA 1U3DA 3A31A 4B80A 1WMFA 3KFLA 4MO9A 4NWIA 1SPXA 5ARBA 4J49A 2OAGA 3DMGA 2Y1WA 1CR6A 3U4HA 1I51A 4YUYA 1IZZA 5MFPA 3H9UA 2QN2A 1CTQA 1HE2A 3L6BA 2EKPA 1EFPB 4N5NA 3O4JA 1K9VF 2EJCA 3FZNA 2F8LA 2ZIZA 4QPJC 2QSJA 3KWLA 5C8YA 1JB9A 3PHBE 4I1IA 1Z0AA 3C6ZA 3RG2A 2Q9BA 1G9XA 1A77A 3C70A 3AB8A 1T2CA 4GX2A 1RT9A 5J2TA 1XMPA 2R84A 5B4UA 3PDWA 2HEGA 2HIGA 2DY0A 1DIRA 4M86A 4OQPA 5EQFA 2UYOA 1I6WA 2V7EA 1TU3A 2OCYC 2HBZA 1JDBC 1OTYA 4MV7A 1B43A 1BFUA 4L8FA 2EYUA 1JECA 3O93A 2PVSA 3CY6A 1PS8A 3IE1A 5EKUA 2HU7A 3O8LA 2CHQA 1JV2B 3HSSA 3PX2A 3L0PA 4KQ2A 1K97A 3TIXB 1GLVA 4L5IA 1TZBA 4W63A 1N0IA 3PUVA 4ER5A 2B2CA 2C7BA 3N28A 3E5NA 5AXAA 3S70A 4J1TC 3SZUA 3BN3A 3FH0A 3PJGA 4GBED 3RFVA 1FOEB 3TD9A 1KWKA 1TGVA 3RWOA 3DBOB 3MN1A 1A5ZA 4QE3A 4DLNA 3EAQA 4IRXA 3O73A 4KQ1A 2AR0A 5CU7A 3W1VA 4BOYA 1P0CA 1Y0BA 3FTDA 1P8AA 3LSYA 3ZH9B 1A2OA 1GA1A 1JVSA 3C39A 2A5DA 2VSQA 4YGXB 5A5FA 4S1VA 1NQTA 1TADA 2RHHA 4G0MA 2HMVA 3FI0A 3O9VA 2BFPA 2N46A 1KJ9A 3IP5A 4X71A 4TN5A 5AM2A 1U0FA 1ZWKA 1AJEA 2AJBA 4GOKA 4JB8A 2PMEA 1F5SA 4OGWA 4Q02A 3EIWA 5J4HA 2OFFA 4UBIA 1PZEA 1EZZA 3VTAA 1U02A 1KK0A 3WK9A 4AZ3A 4IHAA 1RAEA 3H1BA 1GCUA 4FNOA 5CB6A 3GLUA 1J0EA 4P36A 1C9MA 3F1LA 3A6JA 4HHEA 1C9YA 4MW6A 4MVWA 3EQZA 4NULA 3K8QA 4CLOB 4C4OA 3DXFA 4A0GA 3LX6A 3QE2A 2IELA 3ZCQA 4MUFA 3K32A 4UPVA 2XNSA 4ETNA 1NM5A 2BGWA 1WDKA 1CCWA 2WM3A 3NATA 4D8TA 2P30A 3F7OA 4MX8A 1GITA 1M7GA 2Q50A 3DQZA 1PD0A 3FZGA 3QLEA 4YA6A 3SBXA 3RRBA 4DRXA 2O2EA 3VJKA 3EUFA 1TEVA 3CPSA 1JQLB 4FFBB 4NBTA 4UZEA 2B0JA 3PGJA 4WBSA 3WJ2A 4DIEA 3CEMA 3W5AA 3EARA 3L7JA 1ZGHA 1T2FA 3QPBA 3K9NA 1RYDA 4MUHA 1UJ2A 4OK3A 2BR5A 4QOIA 5CMLA 5FA5A 2YV1A 4JMPA 4DL9A 3SQMA 5CVUA 4Y7CA 3FB4A 3QUQA 1PWXA 1ZMXA 3I53A 4B76A 3B60A 4JQSA 3RROA 3QKUA 3RUHA 5JHGB 3AHDA 3B8HA 3G8DA 1E6UA 1F0KA 4HNQA 4GOXA 3V3KA 4DLYA 1XZPA 4DT1A 2GPNA 2HU5A 1EBUA 3N87A 5E9WA 4UBNA 5HMLA 2X1HA 4RFLA 1DARA 1E1YA 1OV4A 4UXIA 1LY1A 3E7XA 3SM9A 5ICMA 1RACA 4JU9A 3MGKA 2JCSA 5J47A 3JAKB 3RUCA 2DFTA 3IE2A 4KZKA 3KKKA 3KSBC 1DCTA 4JBWA 1M5TA 4NPAA 4YJKA 3DPIA 5ALWA 3RRYA 3IVGA 3V00A 1G20E 4X65B 4CR8A 3WRXA 3HH8A 4ZMSA 1T25A 1O2DA 2DCUA 4Q3OA 2F4VB 1EUZA 3CSSA 3GYGA 4YJHB 3A2LA 5E7IA 4ZD6A 3V9PA 4NJMB 5KNDH 3KTAA 4QGFA 1HG0A 5AJWA 5C4IA 2OO3A 2Y6UA 5B6PA 1NNLA 4LBVA 4RDXA 3TX2A 2PRZA 3M6IA 4LOIA 2JIZA 3ZKWB 2AVDA 2V7QD 4CL0A 1U7TA 4XUGB 4BL5A 1ETHA 1Z36A 3PEFA 3U1VA 5C9ZA 1YCHA 3GLIB 4DR3B 4J0DA 2F90A 2QQ5A 4GX1A 2JHAA 3UJ9A 4ZIRA 3BC1A 3T99A 2AS0A 5AP9A 1XB2A 3EGDB 1SBHA 4M9ZA 5DBOA 2CSXA 2P40A 3HKDA 4AL4A 3A27A 4YMTA 2W2VA 3VR5H 3PIRA 3EUAA 4YRPA 4QFDA 1KSGA 3W0LB 2D5IA 4BU1A 3N5KA 4X64B 4H3SA 5FOUA 1UXKA 1N4DA 1ZVJA 2GZ1A 4FILA 3VZSA 1E3EA 2JJYA 1UBJS 4R1TA 5TEVA 4MUNA 4WUVA 2C54A 1G0NA 2Q49A 3MUEA 621PA 1R6DA 1SBYA 2A9QA 3CWCA 1ITZA 2QTHA 5KREA 5KTKA 1AO0A 3TLKA 3EGXB 4ND4A 1CRLA 4HH1A 3KKZA 4OREX 3V4FA 2ZYSA 5EJMA 2O05A 2XNKA 1O4VA 3PUYA 1C7IA 5DSZA 3JYLA 3CVVA 2JFFA 3OPYB 3I83A 3ZEAA 2C98A 3ZY6A 1S4MA 3LBFA 4NS4A 5J40A 1YMVA 4LYFA 3HCWA 4OXYA 4JOQA 1J8YF 2XE8A 4U7JA 4C7XA 1AUOA 1AS0A 2EP5A 2PZGA 4JGBA 2HA2A 4WUTA 5FBWB 3J7AC 3FBWA 3A3KA 4E51A 1YS9A 2UYYA 1PFUA 2OY0A 4UHEA 1Y3FE 2OLJA 3Q0IA 3A05A 3UN1A 2CEKA 4PAOA 2HPVA 4LAFA 1ZCJA 3EODA 3K0AA 4KRYA 3S1LA 2X86A 1ZD2P 2VHCA 3K2BA 1YWGO 2ZJ6A 2PLRA 3QU9A 3S8MA 2VRBA 1M6EX 4EQZA 2IX3A 3QP9A 4GZMA 2O8NA 3P32A 4IILA 4A0RA 5KNLA 1VYHA 5AVQA 2Q5QA 2QTZA 5AXCA 3QE3A 1M74A 5DK6A 4D6XA 4QTXA 4BO7A 4QM7A 1XIVA 1SHTX 4QM6A 3VUEA 2JEYA 1KNXA 3OI7A 3IPAA 2H2GA 4XA8A 2QMOA 5HIAA 4FU0A 1NRJB 1ZA2A 2HLDA 4RXUA 4EZBA 1FX0A 4LDJA 5HX7A 5AW0A 2HBQA 3LCJA 4LOJA 3DCYA 3CNBA 4BP1A 1DKLA 1KSFX 1YVRA 2NSLA 2N1BA 2XSZD 4YRMA 5E6SA 1OU0A 2ZRPA 5FBQB 4BMOB 2DUUA 3PXXA 2HN9A 3L6DA 4PPNA 3JALA 4PM4A 4RHUA 3RYIA 2V9PA 3DOOA 5LZ8A 1I7LA 3DZGA 1M10A 3K0EA 2LVBA 4D4IA 1GZ7A 2O1WA 2NM0A 3LVBA 1EG2A 1GNLA 3QEMA 4C04A 3K9CA 3ROFA 1GL9B 1NM5C 1JDSA 2CVQA 2QYHA 2WHPB 3AZOA 3CG4A 4YACA 4D56A 4DIFA 1UDAA 3IOEA 4WH0A 3VVMA 3JQGA 1H4QA 2JI7A 2MR6A 4BO8A 4XJSA 1NE7A 4DDMA 3THWB 5EE5B 1RWBA 4YR9A 2ATIA 3S44A 3PJEA 3DO8A