4XTRA

Structure of get3 bound to the transmembrane domain of pep12
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
348
structure length
305
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMGALADLTGSIPGIDEALSFMEVMKHIKRQEQGTFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 100
structure length 305
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xtrA00
3NXSA 3OFNA 2ZRLA 3KXIA 3NDPA 1OB2A 1T0JB 2OO7A 3AKCA 2GCNA 3QKUA 2HV8A 2D7DA 2ODNA 3L8ZA 2J0SA 5FUVA 1NP6A 1XTKA 1C9KA 5CIQA 3ADDA 4ZCLA 3ADCA 1A2KC 1U94A 4KSCA 2WPDA 4BGDA 4ZV4A 2CE2X 3K9LA 2ODBA 2IUTA 4PHTA 4M0LA 4C0JA 1W4RA 2FEMA 1Q3HA 1S4QA 2JLQA 1AM4D 1W0KA 5DYGA 3QVUA 3CUEF 5TARA 2Q3FA 4D26A 2X19A 2WOOA 4JLKA 2KE5A 3HR8A 3UWOA 3NKVA 1KSFX 4M4SA 2XSZD 2QSYA 2CVHA 3X1YA 4TMKA 4UNNA 3TBKA 3TW8B 1BIFA 2G3YA 1NVWQ 2QPTA 2YWGA 5DI9A 3FMPB 4MRNA 4LJYA 1G4AE 1NVUQ 3L0SA 3T35A 3R9XA 4GRAA 4M9ZA 1YZUA 4RZ2A 1B0UA 3SJBA 1WXQA 1UKYA 1ZYUA 5DHFA 4B3CA 4TLCA 5B2ZA 3W6PA 4PAMA 1N6IA 3DZ8A 3LFUA 1C1YA 1MABA 3SNHA 2FOLA 1JEEA 2R65A 4PAOA 5AJYA 4CEHA 1Z28A 1AZSC 5FTLA 1Q0UA 1G6HA 1GRQA 2FA9A 3PV0A 3ZVLA 1YR7A 1VG1A 4OL0A 8OHMA 4ZPXA 2J87A 2JLZA 1DBSA 1SQ5A 4BLTA 3BFVA 2CCKA 2CL7X 4IVPA 1ZINA 3UMFA 5JSZB 2VP4A 2MSCB 4P32A 4C2TA 1GRNA 5HE9A 1DAFA 4OJKA 1TF7A 4MYHA 3LW8A 1TU3A 1XP8A 3DZDA 2GETA 3CLVA 2IYYA 1I4DD 4LJ4A 4TT3D 3K9NA 1E0AA 1FNNA 4QXAA 1JI0A 2GESA 3AP1A 3GLIE 1P3JA 4BLQA 3FMIA 1AGPA 5EXSA 4C0BA 5C2JB 4IHQA 1X6VA 4YONB 3PEUA 4HAZA 3RHFA 4EFLA 1ODFA 1ZW6A 2BOVA 1R0ZA 2G6BA 1VPLA 2P3SA 4KFRA 5CK4A 4TL9A 3W8NA 3EPKA 3BIFA 5FOWA 3Q72A 3WYFA 2C78A 2ERXA 2FZLA 1G7TA 2OEPA 3I8XA 4AURA 4DJTA 2V6JA 3QQ5A 2IXEA 1DO0A 2VL7A 2WJVA 3NEYA 5HCNA 3W34A 3SU8A 2XTNA 1G7RA 1RYFA 5FOXA 1WBDA 2OBMA 2BIFA 5AUQA 4TMZA 1AZTA 1H8HD 4UKDA 4CEJB 2RMKA 4TL8A 3W6NA 3REGA 4IXNA 5A4JA 1MO4A 2BEJA 3GLFE 2GEDA 1AS0A 4G5QA 2ZS8A 3SJAA 4X8MA 3TLXA 4O3MA 1U8AA 1OKKD 1W44A 4B76A 4US1R 1G3QA 4QOSA 4ZDKA 1CU1A 2IC5A 1XTQA 2VEDA 1AKYA 2EVWX 1W2HA 1OFTA 1XCPA 4TT3A 2H7VA 2H5EA 3QPUA 1OHHA 1CJTC 2FJUA 3IBGA 1ESMA 1NG9A 1DAHA 3LXXA 4LBVA 1RJ9A 5C18A 1SXJA 2W58A 5DISB 3BH7A 3OIWA 3TSWA 1Q20A 4HUQB 1WDTA 4L8GA 4B75A 4A9AA 4TN1A 4BEJA 2R6DA 4DB4A 3U44A 4WBSA 4GOXA 4EJSA 5GVSA 4G0NA 3UKDA 2WWXA 4Z1MD 4BLSA 1VG8A 2JDIA 1NF3A 3QEJA 1NBME 4NTZA 2QG6A 1NJFA 1NVXQ 4KO8A 2D7CA 3FFAA 2IHYA 4TMVA 1NY5A 3D7MA 2YKGA 2WM9B 1E9SA 4MGKR 2BWJA 5DI3A 1Z0FA 3OEHA 1XRJA 2RGNC 2VQSA 2JCSA 3I72A 2QMUA 4LHVA 4K46A 2IW3A 3CF0A 3VR1A 2A5FA 1ZJ6A 3MGCA 2EYQA 4I1OA 4D2IA 3VR2A 2J0UA 2NPFA 2ZE7A 4KFUA 3PENA 1BH2A 1PLLA 1OKKA 1O3YA 4R7ZA 2QENA 3EARA 4CEIB 2QORA 3U4QA 5FOTA 4IEEA 3VKWA 2EFHB 3GLHE 1JBKA 5EXPA 2FSIA 1GL9B 2AXNA 1VCOA 2ZUDA 4MUBA 4JKYA 3N5CA 1VYVA 3A1UA 3FHTA 4GZMA 3K0AA 1G3RA 4LRWA 3TK1A 1DTSA 3WYAA 2B8TA 1NI3A 2FMXA 3SN6A 3EC2A 2R62A 2XZOA 2GNOA 1XXHA 1IQPA 4XH9B 3BBPA 4AKEA 2NO7A 2OESA 3IEUA 3VNUA 3R8FA 1XNJA 1DPFA 1KZ7B 4IVRA 2WVJA 2O8EA 1G3IA 2A5GA 1TTTA 2BJVA 4QHTA 2GF0A 2ZE5A 4HYYA 3X1DA 2CK3A 2FZ4A 5J5CA 2G0TA 2ZR0A 1A5TA 1VCNA 4IDPA 4A2WA 3TKLA 1E69A 1E1RA 3ZZTA 3AH8A 3AVTA 4D0NA 4QM6A 1BYIA 1KJZA 3W3ZB 1II0A 1IXRC 4O2LA 4MGIR 5CLQA 2H92A 2ZJZA 1KSHA 2PT7A 3SBEA 1D9ZA 2ZETA 4JLVA 1MKYA 5L3QA 4L9SA 2BV3A 2VSXA 4HB3A 4ON9A 1R8SA 2ZVPX 3KJEA 4C0AC 4I81A 2CLCX 4D81A 4PFSA 3BD9A 3CRVA 3SOPA 1ZNWA 4C0KA 2ZE8A 5TMPA 2F43B 5JS8A 4D4KA 3FDIA 4GT1A 5FTMA 2JIZD 3Q7PA 1G3UA 1FPMA 1L4YA 4FCVA 3SHWA 5IK2D 4D0GA 4DCUA 3LW7A 1XMSA 3CX8A 3EPHA 3DOFA 3H86A 4JLMA 5DNYB 1T5IA 2ZITA 4OHVA 2G88A 1EXMA 3AV0B 4NZYA 1J70A 1JR3E 2LKCA 2VRWA 2V4ZA 3RNLA 1OIXA 2O5VA 3S1AB 3KKNA 5TY0A 1K8RA 1VCIA 2WAXA 4I99A 1KJYA 2RCNA 3CO5A 1HV8A 2OXCA 1MO5A 4C0QC 2GJ9A 1E2FA 2CHGA 1GFIA 4LCBA 5KNDA 3CZQA 3DPUA 5L3VA 1JAHA 5L3RA 1XJQA 2V7QD 3AQ4A 3BFKA 5DHAA 2PZGA 3TAUA 4IVQA 3MG9A 4OQNA 3QF4B 3L0PA 1KOFA 1E2PA 4DUGA 4DIEA 1YZKA 2A30A 4P4SA 4PC3A 2BCJQ 4AKHA 1K6MA 5JI2E 5CYOA 3MJRA 3BS4A 2BMJA 2O0HA 3K0CA 5EE5B 3SR0A 2FSGA 3QBVA 3LLMA 4BUJA 4NE2A 2ZAOA 3SI7A 1E1QA 3GJXC 2VHCA 4QJ5A 1SHZA 2X8AA 4Q1EA 1SVSA 1W4AA 2GJKA 5AWFC 2IS1A 4WZ6A 4AI6A 3BORA 4LSGA 2ZI9A 4Q7KA 4HLQB 3MD0A 2F9MA 3X2SA 1X86B 2GJAA 3BXZA 5JMTA 4Q1FA 2ZSDA 1OW3B 2WWHA 4J0QA 4AG5A 2PT5A 3WP1B 1FUUA 4GSYA 3TQCA 3O8CA 3CF6R 3PVSA 2BHRA 3N2IA 2QTVB 4HAXA 1DEKA 4LI0A 4B48A 3FHCB 3QIAA 3QVVA 4CIDA 4Q7LA 4JSYA 4WIAA 1GITA 3SHFA 1TEXA 4BWYA 2PZFA 1IJFA 4A0RA 4D4JA 3O8RA 2WMOB 1Q1ZA 5JHGB 1QHHA 2V7QA 1CR0A 2OCYC 4A2QA 1N25A 2ZJ8A 2EFDB 1P9NA 3GJ4A 4JSTA 1P9WA 5IT5A 1Z63A 2IYWA 1G64A 4LBWA 4V0LA 4PSAA 1IHUA 2DWQA 5E7MA 4Q66C 1K5GA 4DDUA 3AVWA 2RGEA 1UBGA 1KK0A 1MABB 4R2IA 1X8KA 2P6NA 3K9HA 1KSGA 4D4MA 4OI4A 3I5XA 4CW7A 1SKYE 1JEDA 1KYIA 4A8JA 2JLXA 3NG1A 4L9WA 3IDQA 4A82A 4MKIA 2WOJA 3EA0A 3VX4A 3AVVA 1G17A 1ZC3A 4XWOA 2ANCA 1UBCA 1G8YA 2VSFA 1CR4A 4DB2A 621PA 2PMDA 4NYIR 4YXWD 2YVUA 1P60A 5J4VA 3QXHA 4DSOA 5HZHA 1EFHA 1ZM4A 2V55B 1J90A 4GMXA 4LJ7A 4U00A 1NBMD 3N2EA 1OXTA 1QG4A 2WJJA 2ZJ5A 1AA9A 1VIYA 2R9VA 3VR3A 2GTPA 4DZZA 3NBYC 4TSFD 1E0JA 2OG2A 2B92A 3A36A 3K0FA 1WBBA 1KGDA 1D5CA 3BRWD 2KI5A 1XDBA 4DLSA 3GJ6A 2B7BA 3V00A 3ND9A 4JL5A 1CEEA 4Q47A 1OYWA 1OIVA 1Q44A 3QNUA 4TQAA 3LDAA 5AR1A 1U8YA 4RD6A 1GSIA 1MO3A 3U3JA 3K0SA 4DCSA 1RKBA 3GLGE 3I92A 1XB2A 1E9BA 2ZRCA 4Q1AA 1DE0A 3EAQA 3TAHA 4B6FA 5FL7D 1A4RA 3FYHA 4KJZA 4KLZA 1AJEA 1M34E 4OHWA 3FE2A 4ACAA 5EP2A 2ONKA 3RS2A 2V1XA 2C95A 2EW1A 3U3OA 1UKZA 4TTRA 3TNFA 1QDEA 3P4YA 1ESNA 3LBHA 2OBNA 3WNCA 3CX7A 2WSSD 4YXWA 2V1UA 5CK5A 3R9WA 1L7VC 3UK6A 4MYUA 3O47A 2BEKA 1LS6A 2WSMA 2RHDA 2DFNA 1RYHA 1CKEA 1VG9B 3FMOB 3EPLA 3I1FA 1UKVY 3THYB 1UEJA 2FEOA 3A1WA 3DHWC 3GJ5A 4Q21A 1EWQA 4PX9A 2AK2A 2GJSA 4TSFA 2F1JA 1WRBA 2BBWA 4IDHA 4RJLA 1RJ9B 2ZI3A 1SXJB 3BH0A 3QEOA 3VQTA 3C7KA 4NHOA 2QM8A 4LYAA 4TLAA 1U9IC 4RSGA 3IHWA 1CBUA 4DSNA 4Q18A 3FVQA 1IN5A 4GP6A 4Z51A 2FPKA 1M7BA 1TX4B 2C77A 2GWHA 3WRXC 4B43A 2REXB 5JECA 5JCZA 3RANA 2FFHA 5L3SA 1G16A 1Z47A 2XXAA 3JZAA 1FP6A 1XFAA 4TTQA 1OYYA 1G4UR 4PHGA 3GP8A 5JEEA 5FBLB 2EU8A 3EIQA 3B1WA 1T9HA 1KK1A 4PQFA 4NYIQ 2LKDA 4QBGB 1Z3IX 2ZJAA 2PCJA 4A0GA 2CEAA 1C4OA 5F2EA 3I5YA 4PZYA 2CJWB 2JLRA 2IBMA 1Z6GA 4MQBA 4P33A 3RDPA 4B34A 1YZNA 2HCJB 1WA5A 2XOKD 2C9CA 4HLCA 4BRWA 4C0SA 1GOTA 5LB4A 3KXKA 3CKLA 1W49A 4M2LA 5DO9A 2WKQA 3EWSA 3K1JA 2L0XA 4Q19A 4B2LA 4FCTA 3BB3A 5B58C 4XVUA 4TQ9A 4DEYA 4DT1A 1JR3D 2A5YB 2H16A 4P4TA 4NYMR 5EQTA 3QKTA 3M0EA 4XOIA 3EZ7A 1G3MA 2QBYB 4Q7JB 1E4YA 4JL6A 2CHQA 4Q1DA 4EPYA 3KDSE 1TF5A 1XD2B 4HLUA 4RZ3A 5H70A 3TIFA 4F38A 5C1BA 1WB9A 4FMDB 4WOPA 2JEOA 1AIPA 3CW2A 3WMEA 3DKPA 4IXMA 1XXHB 3I73A 2GBLA 1Z0KA 1MRSA 2O52A 4W5WA 1XJCA 4IDOA 4MH0R 2JA1A 4MRSA 2F3RA 3I62A 1E32A 5KPDA 2EFEB 1HE1C 3VU9A 4UJ5A 2MMGA 4AK9A 1DAMA 2QT0A 3FOZA 1KO7A 3LD9A 3WXMA 1MT0A 2ZYWX 3ND8A 3THWB 3K53A 1G8FA 3W6OA 1QRAA 4RKFA 4BRUA 1II9A 1LNZA 3MAAC 1KO8A 4FW9A 4PPQA 4V0OA 1JPNA 3NIBA 4B44A 1QHIA 5JHHB 3C16C 3AUYA 2Q3MA 4IFBA 2YC2C 4QHYA 1ZD8A 1E3MA 3C4JA 5L3QB 4HAVA 1FMJA 1W46A 3KZ1E 1CJVC 3LVQE 3O8DA 3OAAD 2O8BA 2F1RA 2O8FA 2H57A 1T6NA 1BOFA 1VIAA 1XMIA 2PL3A 1DELA 4IKEA 1AQYA 4LHZA 1LTQA 2HLDD 1KAOA 2REBA 4UNRA 2VP9A 2PJRA 2P65A 2AD5A 4U5XA 4W5HA 5FBVB 4LY6A 2C03A 2EYUA 5AJXA 4CF7A 1XTSA 5FOSA 5IF9A 2GXQA 1UJ2A 4D4LA 1CP2A 2IYUA 2YNMA 2RKOA 4JLDA 4DDWA 1GZSA 4G5GA 1VECA 4M1KA 5E7JA 5CLLA 3IKJA 3IGFA 1N6LA 5HE8A 3GQBA 4IJMA 4Q48A 3B8HA 2GF9A 4MRRA 2FFBA 1G5PA 4N3NA 1OFUX 1J8MF 3RRNA 2WTUA 4POAA 3B1VA 3SFVA 1XD9A 1P5ZB 3EZ2A 1GKYA 4OK3A 1E2MA 1SVWA 4CYMA 1KNQA 2F3TA 3I4LA 5EXTA 5FI1B 1ZM3A 1F2TA 1E99A 1YHNA 1JAIA 4M9QA 4NYMQ 3UPUA 3OZXA 1VDZA 3EZ9A 3HYTA 2W6JA 3OIUA 3ETLA 3RC3A 1W0JA 3QG1A 1V5WA 2C2HA 5FUWA 4AWXA 2GEUA 3KB1A 3OAAA 4LPKA 2ODEA 1IY2A 4MYCA 3AKDA 1U90A 1RZ3A 4MDFA 5J4KA 2J0VA 1IBRA 4MDEA 3RWOA 3DM5A 1OXSC 1VYTA 4C7OA 1G20E 4OQXA 2PX0A 1FL9A 2OBLA 4IOKA 3KB2A 2GEVA 1N6PA 1P2TA 1E2KA 4ACBA 1XBTA 1US8A 2HT6A 4E03A 2YOFA 1CXZA 3KFVA 5EXXA 3GFPA 5IRCD 1Z5ZA 1G5TA 1S3GA 3OESA 3Q5EA 2AFHE 3SQWA 5BYKA 1KI8A 2CVFA 3RSOA 1Z29A 5HKKD 1NKTA 3H4MA 4NDZA 1W7AA 2GVZC 2ZI5A 3TMKA 1FX0A 3L0IB 3DMDA 2R6AA 1KDOA 4C4PA 2ZAMA 3GPLA 3REFA 1JXMA 3GEHA 4Q9KA 2ZSEA 5FH9A 2P0EA 2JGNA 1R6BX 5HZKA 4V0KA 2ZU6A 4PO9A 1KDRA 2WJIA 2JATA 3TVTA 1OB5A 1P72A 1T8TA 2QQ0A 4UXIA 3U6KA 4KI0A 5JS7A 5LBIA 2ZRJA 2AFIE 1YRAA 3LX8A 4A8JB 3LAWA 2H18A 4HZIA 1M8PA 1X8LA 1ZP6A 3A37A 5GJCA 2D2EA 3D31A 4NU0A 4WAUA 2CCGA 2BCGY 5DYIA 3UATA 2DB3A 1JJVA 2J7PD 5CJ2A 1UM8A 2GILA 4XVRA 1HT1E 3MWYW 3QG5A 1SVIA 2WJHA 3Q7QA 4DCTA 4GOKA 3MWJA 3RS3A 3ZD7A 3VMFA 4NCKA 3LH5A 2CHVA 4L15A 1II8A 3CM0A 1KAGA 4F4CA 2YC4C 3GLGA 1OXUA 2IHBA 1KDPA 2E9SA 4HZUB 4HLUC 4MRPA 2F6RA 2ZS7A 2B21A 3EC1A 4BZPA 5HKKA 3ZVMA 2O8DA 1HURA 4TL6A 4Q4JA 2PEZA 1E9FA 5HCIA 3CRRA 4QGAA 2GBLC 1LW7A 3MWLA 1E4VA 2C9OA 1AQUA 1NJGA 2OUKA 2ZRFA 4Q00A 2XITA 4QKQA 5GJWC 2OILA 1G8HA 1G291 1P6XA 2XSZA 3WP0A 4CT5A 5HR5A 3BJIC 4D25A 2FGKA 4Q1BA 3DKVA 2QU8A 2DR3A 1DAIA 3NBZC 2OE2A 2QRZA 3BB1A 4M1SA 2OLJA 4JBXA 3A6PC 5JI3E 2QAGA 3VTKA 5H8WA 5AUNB 2XNDD 1P62B 4YQFA 4US2R 4EKDA 4DLUA 1U81A 1GIAA 3QPWA 2F1IA 3T1VA 1P7CA 3ZD6A 1UADA 2DFKB 1FMLA 3BOSA 3QF7A 1CS4C 1DAEA 3EW9A 1S0UA 1XZQA 5KYKA 2BMDA 3QI2A 5KDDA 2CL0X 3RS0A 3B9QA 4PC1A 4NP6A 5CM9C 1GUAA 1U99A 2GXUA 3A1SA 2OFWA 1R5BA 2F9LA 721PA 3GD7A 1DADA 1TUIA 5B57C 1N0UA 5JWOA 4ZI3A 2A3RA 4GZLA 4V02A 1GL6A 4DXAA 3KUCA 2OCAA 4QM7A 3B5JA 1Z0AA 1PJRA 4AD8A 4AY2A 4LDJA 5SZJA 2LWIA 1TNDA 2WAYA 3KQNA 2VHQA 1BKDR 3QOFA 2NOAA 1W36C 2DFTA 5L3SB 2C5LA 2J1LA 3HWSA 4OQMA 2NTYC 3U7HB 1N0VC 2YV5A 1L8QA 3CWQA 4NL4H 5JJLA 1Q12A 1S96A 5D3MA 1H8ED 4URWR 4ITRC 2IYZA 3BC1A 4PTLA 2WIBA 2QL6A 4YC7A 4FN5A 3U7FB 1BO6A 1PZNA 1XEXA 4JLNA 1IN6A 1Z6AA 5M04A 2XB2A 3SJZA 4JLPA 4KYIB 2WWYA 4DDVA 2XNDA 4PO1A 5DH9A 2G9NA 1E2LA 3CRMA 1W2GA 4QJ3A 1EG7A 3PITA 4M1OA 5K8LA 2CCJA 2OSBA 1CJUC 3I32A 4A2PA 3AKYA 1FFHA 3OE7D 1OPXA 2MSDB 1H8HA 1MO6A 2Z4RA 4KLNA 3AVOA 1A1VA 2SHKA 5GJVC 3SDZA 1E96A 4DC9A 4PANA 3NC1C 2GHIA 4B33A 5B30A 2DFLA 4QJ4A 1Y3AA 5EJEA 2ZRBA 2ODWA 3MLEA 4PZLA 1GDDA 1E2IA 1ZRHA 2QPOA 2CDNA 5K8IA 2QGNA 1PUIA 3W9YA 3NH6A 4FCWA 3TR0A 1N6KA 4TYNA 1E79D 3BH6A 2ZSAA 2D3WA 4OI2A 5FTNA 2IWHA 4FMBB 4HAUA 3IIKA 3IQWA 3KTAA 3OIVA 3KFXA 2CLSA 4Q4LA 4TLBA 1NMXA 1NN1A 2VPPA 4XJXA 4Q4AB 1VHLA 4RD1A 4KITB 1H8EA 2ZS9A 3CF2A 1JNYA 2QT1A 3A4NA 4B71A 1NN5A 1WF3A 4KYUA 2EFGA 4Z1MA 2B8WA 4HEJA 4B3BA 1IN8A 2XNSA 1RE0A 4JMPA 5CB6A 2OZEA 2ZYVX 4TZ0A 3JVUA 3DEFA 4DLZA 5EP4A 1G9XA 1XEFA 1FOEB 4QL3A 2YOHA 1JQLB 4LHYA 1YE8A 3DOEA 1P75A 2V9PA 1J7KA 2HXSA 1ELOA 1GL7A 1XTJA 2GZDA 1GWNA 3MUFA 2BKUA 2O8FB 1MOZA 3QKRA 2IA5A 3HYRA 6Q21A 2UZIR 1F6BA 3IO5A 4R71A 4Q4HB 3QENA 1NRJB 4DCVA 2QTHA 5BXQC 4CDGA 1KMHA 3F8TA 1NVVR 3IUYA 4ARZA 4LJ5A 4I1VA 1EX7A 4OK6A 4KFTA 1XX6A 2W6ID 2IEZA 1PLKA 2VYFA 4AIIA 4KU4A 3FWYA 1KY3A 4UNQA 1Z0DA 4S35A 5FBQB 3NC0C 2Z83A 2IYLD 4DVGA 1E79A 1G19A 2EWVA 5KSOA 1GP2A 4II7A 2IUUA 1W36B 1CIPA 3BERA 3LA6A 1NIJA 4O2RA 4YDSA 1KI6B 1G5RA 4Q02A 1KIMA 1N2CE 1X8JA 4X8OA 3A8TA 5F9FA 2PX3A 3GJ0A 4FMCF 3ZGXA 1R4AA 2BBOA 2FSFA 4C3ZA 4JZKA 1OH7A 2MMCA 4Q03A 3MWKA 2VH5R 3P27A 3VFDA 4F91B 4B32A 1Z6YA 1P2UA 3U2QA 3VX3A 3EPJA 4GDFA 3C41J 1N6OA 3LWNA 4ZDJA 3WRYC 1F2UB 2JJ1D 5JWHA 4ZIRA 5KOYA 3RRMA 4QGFA 2IT1A 4A0FA 1QVAA 5FUXA 4B3GA 2OHFA 1E2QA 1SULA 1XEWX 4B3FX 2WHXA 3MFYA 5KUTA 4F4JA 3IHLA 2IXFA 1KDTA 1KO1A 3EG5A 4FD2A 4KODA 1D9XA 5FR1A 2IXGA 5D3QA 4DHEA 2ZI7A 4R9UC 1E94E 2YWHA 1T5LA 5FOUA 2XAUA 4C7OB 4MRVA 3RABA 3ZH9B 2PEYA 1F3OA 4RCZA 3ZIAD 3K8YA 1ZIPA 3U3KA 4AC9A 5KDOA 1W4CA 3ZJYA 3A4LA 1LFDB 3UIEA 4B6EA 4BFVA 5TB5A 5JFGA 1U98A 2PBRA 3X1WA 1RRFA 3E2IA 1P4SA 3QKSA 1T91A 2JIZA 2TMKA 4TLDA 5IK2A 4XIGS 4BZQA 2XTMA 3DDCA 1VCMA 2VHUA 3DL0A 1DG1G 2YOGA 3CNLA 4G5SA 4B74A 4BFXA 4C30A 4B47A 3B78A 4BPBA 1W4BA 2DYKA 2XJ4A 1SXJC 3THXA 4BEBA 1HA3A 3T1OA 2GRJA 1YR9A 1D2NA 1Q1QA 1QHYA 2IL1A 1NVVQ 1P61B 1TADA 4IOJA 2QA5A 3PQCA 4TMWA 4EJSC 1GNQA 1KI3A 1LS1A 3T34A 4MYTA 5E3HA 1YU9A 5C46F 3B6EA 2OLKA 1OFIA 2GK7A 3B13B 1ANKA 1DS6A 4ASUD 4LK2A 4CEHB 3GLIA 2NMVA 4PHHA 5CIWA 1KJWA 4MGZR 1GM5A 1LY1A 1T3HA 2UZ3A 2YWFA 4DSUA 2JASA 3PUXA 4BFTA 3HU1A 5CM8B 1E9DA 1N5IA 4OHZA 3O8BA 2EWWA 3H84A 3RWMB 5J4YA 2O8DB 2PH1A 2HYIC 1E0KA 1NY6A 4ZI2A 4DLVA 2WKPA 2QM7A 2H8KA 4M1WA 4UNPA 5CJPA 3KJGA 3UG7A 4K81B 4EPRA 1Q1BA 2VSOA 1J8YF 2J46A 1I2DA 1RPZA 3WBJA 2G1JA 5KTYA 4Z8YA 2E1RA 4LHWA 4BFYA 1XMVA 2A5DA 2GAOA 4D0LB 5K8UA 1OSNA 4P3YA 3EX7C 4JJZA 2V54A 3UANA 2ZRNA 5DIFA 3GLFA 2K5UA 4MKGA 2ZJBA 4CVNA 4QNMA 3V4RA 1TQ2A 3CPJB 1IAQA 3K70C 4BZXA 2ZYUX 1IONA 4CGZA 2JLVA 2QAGB 4A1FA 4PC6A 5K8TA 1A7JA 1G1MA 3R8CA 4EIWA 2ZPTX 5LD2C 3IEVA 5G41A 5JSZA 2ZM5A 4DSTA 4ASUA 5B64A 3PIRA 1JR6A 2QP4A 3CBQA 1Z0IA 4JJKA 3VR5A 4EFMA 1G18A 5L8VA 2YJTD 4LYHA 3QSYA 4OHYA 3KQUA 4LV5B 1TF2A 1U0HC 3CIOA 1LB1B 1GTVA 2XX3A 4ZCMA 1EWRA 1RRPA 1YZGA 1ZNZA 2PLFA 3RS4A 2R8RA 5FBRB 4Z54A 3QBTA 1A82A 4PPNA 3L43A 4LYFA 5EP3A 4W9MC 4FINA 2YHSA 3IIJA 2ZROA 4IDQA 1H65A 1NBMA 5EZ5A 3RVBA 2QPAA 4H1VA 4Y0VA 4URVR 1E2EA 1Z8FA 2ZTSA 4JLBA 2XZLA 1AN0A 3B1ZA 3JZMA 5E4FA 4EDHA 1UPTA 2NO0A 2BC9A 3GJ7A 4B2IA 2ZRKA 4LGMA 3F3YA 3R20A 5TDHA 3VR4A 1XZPA 4RFSA 2Z0MA 3G82C 2NO6A 4QFMA 2REOA 5F98A 4OQLA 3KKQA 1IM2A 1E9EA 2OXRA 1P2SA 3BK7A 4BFSA 2ZRHA 4C9BA 3U44B 3AVYA 2ZJYA 4PZZA 4QNRA 4EJSB 4CEJA 2FFAA 3ASYA 4XD7D 2BDTA 4JVMA 4DLXA 2N42A 4FWTA 5DSZA 1VYUA 1ZCAA 3GLHA 4BECA 1GNRA 4Y0AA 4HI0E 5DI3B 2JJ8A 1KI1A 5FL7A 4LYJA 1YR6A 2BKEA 2VP6A 4ABYA 4BFUA 1XWIA 2CE7A 2W2XA 5AUPB 5FBWB 4TWZA 3TE6A 2RGCA 4CT4B 4P4UA 4RKEA 3C14C 3UG6A 1OXVA 3AUXA 2NPIA 4IOLA 4RY2A 3W5IA 2OFXA 1ZUHA 2J0UB 2OAP1 4LJ9A 1PV4A 2GCPA 3G5UA 1HYQA 3KXLA 3LY5A 2WSSA 3K0CC 3MCAA 4WXRA 3RYTC 2Q21A 4JL8A 4PQRA 1D2MA 4HUQA 1MRNA 1OLOA 4QC2A 3U4QB 1VTKA 3GCGA 2IYQA 2FFQA 2OV2A 1M2OB 5BW8A 1M7HA 3U7EB 3QY0A 3K0AB 2AD1A 2BVNA 3B85A 2HJVA 2WZQA 4ZDWA 4PPFA 2QMHA 3PJRA 4F4IA 4M1TA 1F48A 1CR2A 3P4XA 1NLYA 3UXMA 4CZ2A 1SXJE 1IXZA 5EP1A 2YWEA 2O8EB 2HYDA 1UDXA 3KKOA 2VIIA 3K70B 2ANBA 3EXAA 3KKMA 3L0OA 5ANRB 4TYPA 1ZM7A 4P31A 4PPGA 2CMKA 4ZKDA 1KNXA 3PEVA 1P2VA 1RC8A 2Y8EA 3TUIC 4OI0A 5LD2B 2CL6X 2QP9X 3RRZA 2ZREA 3KL4A 4JLOA 3SBDA 4JT4A 2VP2A 3EIHA 4CEIA 2DBYA 3CRQA 1NNEA 2PLRA 1NN3A 1KTVA 3QKRB 5SZHB 3FKQA 2XOKA 2OCBA 2W0MA 1FQJA 5ELXA 1X1RA 2ZRMA 1S8FA 4TTPA 1BMFD 2ERYA 3C15C 2C98A 4URUR 4A8JC 2B6HA 4B3XA 1N0WA 4U02A 5FPHA 5KNCA 1JR3A 1GVNB 2AN9A 3OEED 4DLYA 4B3DA 2QY9A 2V8OA 4LBYA 1IN7A 1EESA 4JKIA 1I2MA 1T3SA 4HAYA 4YMTA 2FPMA 4G1UC 2W2VA 3PR1A 4FXPA 3B60A 4A0HA 1ZD9A 1XD8A 1LVGA 1HE8B 1AS2A 1S1MA 3E70C 5FL3A 5KHOC 3TUJC 2W00A 4PO8A 3FB4A 4NONA 4QG7A 4XSHA 2P5TB 1XXHE 2G83A 2QE7D 4L5BA 3CPHA 2ZU0C 1AKEA 2ZRAA 4GP7A 2ZEJA 1X1SA 3NH9A 5BQ5A 5JRJA 1S2MA 3AF0A 1P73A 1KZGB 4M8NE 5FPSA 2X1VA 3NHBA 2VP0A 5J47A 3B1XA 1TEVA 1KSJA 3CH4B 3GJ8A 5HTKA 1HH4A 1TUEA 2PMKA 3HPQA 4X8LA 4DLRA 2ORIA 2WBLC 3ICQB 2F43A 2VF7A 2WPDD 1DVRA 4JYBA 2J9RA 4XWAA 4P4SB 5EUMA 4KAXA 2RHMA 1BMFA 3D3QA 2FPLA 4ESHA 3H2YA 1Q57A 1AK2A 3CB4A 1T3LA 3OEEA 1ZBDA 1W0KD 2ZR9A 2FGJA 2GAAA 3QE0A 4V0ME 4YMSA 2HLDA 2GXAA 2AHOA 3S1AA 4JIMA 3U7GA 2FV8A 2X2EA 5A5GA 1I4TD 2BMEA 3D8BA 4G5OA 3K9GA 2C9YA 2DWPA 3SZRA 1ZCBA 2ZE6A 3ZS8A 1OXXK 3T1QA 4EAQA 2RGNA 3NTUA 4LC0A 2C8VA 2Z4SA 3QF4A 2JLSA 2IYTA 2ATVA 1CULC 3DMNA 1TU4A 4RFVA 1RIFA 2OT3B 4A92A 1SKQA 1XMJA 2A9KA 3EASA 5UKDA 5F9HA 3TQFA 5J4LA 4OQFA 4EQ6A 3N70A 3HP1A 4WA7A 1COWD 3BFXA 3JVVA 4KBFA 4V0NA 1N6RA 3OHMA 1R2QA 3TVDA 2J7KA 4K8OA 4LWZA 1QBKC 3RRYA 1QHHB 3EWAA 1WE2A 3T12A 1M6NA 1Q3TA 5SZKB 4DEXA 2P5SA 2GCOA 1Z83A 2RGGA 4TLEA 2IUSA 4RD2A 1Z06A 1TQ4A 3L82B 1SVKA 3E1SA 3W5JA 2QUZA 4OHXA 4NH0A 1QHGA 1E2NA 5AK0A 1ONBA 4HATA 1EK0A 5FUYA 5AUOB 1ZIOA 1OV4A 3IBYA 1HUQA 4BLPA 4EPTA 3GLIB 2IF2A 2AL7A 1KKMA 2BJWA 2ONJA 1S3SA 3LVRE 3P26A 1U0JA 1Z6XA 1KI7A 1DO2A 2KBFA 2R6GA 2RH5A 3AEZA 3HJNA 4PC2A 3V4FA 4NMMA 2NIPA 1UEIA 1XTIA 2ZANA 4QHSA 4HDCA 2JLWA 2ZRIA 1RRGA 3SYNA 3LQRA 4RD4A 3TH5A 5TVKA 3TSZA 1NG1A 1FP7A 3EIEA 4CRWB 4A4DA 2WICA 4MA4A 5JBQA 1JPJA 2ECKA 4Q1CA 2O8CA 1TAGA 2QGZA 3K0FB 3LBIA 4WW0A 1WQ1R 2RAPA 1N6HA 5AJZA 3KQLA 4LZZA 1D8TA 2PJZA 3FKSD 1YVDA 2ZUCA 2E87A 3BAFA 4O25A 4OJQA 4URYR 2BBSA 1COWA 2VLIA 4O0MA 4KXFB 3TRFA 4D6PA 2FX3A 4BE7B 1E0SA 3GLFB 3PUVA 2WMNB 4QGHA 3TSOA 2IK8A 3BB4A 1UBEA 421PA 1YZQA 2G0NA 2QI9C 1SHKA 3SS8A 1DG3A 4A36A 4NKRA 3ZVRA 3KQHA 4M21A 2VA8A 3QXSA 1IXSB 1CTQA 1XPOA 2FE4A 2CBZA 2FN4A 4N0DA 1R7RA 3ZZ0A 1M1YE 5DLQC 5BN5A 2ORWA 4MITA 1FUKA 1G7SA 2ZI6A 1EFCA 1N5KA 3AKEA 4ZKEA 1OHHD 3TR5A 2G77B 2J7PA 3R7WA 1Z0JA 1Z6TA 3GJ3A 4PXAA 4BLRA 1SXJD 4DBLC 3AF2A 4GI7A 3LBNA 1NN0A 3ZDQA 2RGBA 5KU1A 2ZJ2A 1UDWA 2VTKA 4Z8XA 2VBCA 1NLZA 5BN4A 2QRNA 3GMTA 1EFUA 4D82A 4ESVA 3G0HA 2WWIA 3SQXA 4LOAA 4N0EA 4BFZA 3B1YA 2Z43A 5CITA 2ASEA 1T8UA 2JDID 1SGWA 1W1WA 3HPRA 4TMTA 2NQ2C 5FPTA 2Q9BA 3E5HA 2IYRA 3VHLB 1E2GA 1Z22A 1Q22A 4FIDA 3FKSA 4RFSB 5G53C 2QTFA 4U7DA 5F3WB 2ORVA 1E6CA 3QPVA 1QG2A 1R0YA 3LQQA 5AJVB 2NGRA 3OEHD 4FI3C 4MUAA 2XB4A 2X77A 2IX3A 1ZMXA 3DVLA 5J4HA 3AM1A 2XTZA 1RW4A 5CYPA 2IWRA 3F5FA 2XXAB 4PSKA 1NIPA 1YKSA 2C96A 4A15A 3P1JA 3VR6A 4W5JA 4AKIA 1SVOA 1ZAKA 4WVFA 3EZFA 2BMFA 1OH8A 2W83A 3GLHB 3LNCA 4E5UA 3VHXA 4B73A 2NZJA 4L4UA 4TYQA 2QAJA 4Q01A 1CJKC 2ZJOA 3X1XA 2W2TA 4OYHA 3THYA 1UFQA 2QNRA 2AKAB 1IY0A 3Q8XB 3ICEA 4NCJA 1G8PA 2GK6A 3I3SR 4MGYR 4I4LA 4QBIA 5G3ZA 1OE0A 1E9AA 2KJQA 3DM9B 5FOVA 3CRW1 1IY1A 2ATXA 4GFDA 1XPRA 2QEQA 4DT1B 3J81k 1E2DA 1MV5A 1R5OA 4BASA 3KX2A 4Q7MB 3T5GA 5FTJA 2DHRA 3WHKA 4IDNA 2QQEA 1TQ6A 3K70D 3Q5DA 4HAWA 4JYCA 4MKFA 3FMFA 1YZTA 1OJLA 5JLJA 2CK3D 4KBGA 4A6PA 1M7GA 3AF4A 4E22A 2Q6TA 3FTQA 5JZVA 2V6IA 4AG6A 2J41A 3FHOA 4MKHA 3VKGA 1J99A 1E1RD 2CLDX 2IEYA 4JLJA 4OI1A 2FH5B 5JWRA 4UXJA 3SYKA 3NVAA 2CJWA 2R6CA 1HEIA 1KK3A 3ZYCA 1UAAA 3PFIA 5GJBA 3VU9B 2QN6A 3I61A 3PG5A 2WWFA 1G7CA 2WJYA 1XCMA 1GNPA 1E98A 3B2EA 4GBMA 4EPXA 3IIMA 1XEWY 3IILA 5G40A 4JT2A 2C99A 2UKDA 4UJ3A 3UMSA 5LB2A 5H68A 4DIDA 3T1TA 3UWKA 1IOZA 2GVDC 2MSEB 2QBYA 3UMRA 3MMPA 4JLAA 3AVQA 3SYLA 1XD2A 3A58B 4X8HA 2JLYA 4HLDA 4Q5IA 3T06B 3OE7A 3LO5A 5JJKA 2J3EA 1KK2A 2O8BB 3B7GA 3CWZA 4AYWA 1YZLA 1W47A 1OIWA 3PXGA 3PUYA 3KKPA 3LX5A 4YMUA 2KWIA 2ZYTX 3QXCA 2D06A 4IRUB 4NCHA 3TGPA 5FFMA 4UNSA 2I3BA 5LPNA 2JLUA 3TJZA 3MRSA 3THWA 1UKEA 4ZO4A 2C04A 4PC7A 2I4IA 4TYYA 4OBEA 2IS2A 3M4YA 2HF9A 2PCLA 1W48A 3B9PA 3NBFA 4WZAE 4ZCIA 1NSTA 1QHNA 4TYWA 4A6XA 5CDFE 3MSXA 1DAGA 4G5RA 4DUGD 3KJIA 1KY2A 2A2ZA 4NCNA 4RCYA 4R98A 2ZI4A 4KCGA 1PLJA 1QF9A 1EGAA 4QBFA 3AB3A 2I1VB 4G3XA 2OFOA 4NCIA 4V0MA 1FNMA 3M1IA 1F2TB 4KHZA 1XJ0A 1GAJA 1E1QD 2IF0A 1QVRA 2F1HA 2VHJA 2VHTA 5KNBA 3CONA 5G3YA 2R6FA 3OF5A 4PHFA 4L16A 3BGWA 4BLOA 1OH5A 1VHTA 4AYXA 3H1TA 2IS6A 1RVDA 1Q1EA 5BN3A 2QAGC 2O0KA 3C5HA 1U9IA 2RB4A 1R0WA 4YDHB 5E95A 4OK5A 1CR1A 3PEWA 4LJAA 2CNWD 4PAQA 2GA8A 1JALA 3U60B 4TZ6A 1SVMA 3C8UA 3Q3JB 4YLGA 2W6IA 3EA5A 2X2FA 4PSVA 3P32A 2HCBA 1O87A 4W7SA 4H9GA 4F7WA 5JJIA 2OCPA 2AWOA 2CXXA 1US8B 4OKSA 2GKSA 2GDJA 1KI9A 3GFOA 1F60A 1JECA 2D2FA 4M9SA 4LBZA 4DKXA 1N6NA 3ONWA 3WMGA 4C0LA 2IYVA 4HB4A 2A5JA 4FMCB 3WMFA 1E9RA 1SKYB 5E7IA 4NPHA 3PCRB 3ZQ6A 1GILA 1XF9A 5BWMA 1HQYE 4EQ6B 1ZM9A 2OAQ1 1MH1A 2FDCA 1FX0B 2J59A 2NZ8A 1R10A 5FTKA 5IHPA 4G01B 3K0EA 5HPYB 3U3RA 4JVNA 3T61A 1ZUNB 2QMEA 5P21A 4HDQB 1ZVQA 2GCOB 2HT1A 3QJYA 2JJ2D 4H1UA 1A2BA 3W8RA 1FTSA 1AS3A 2JJ1A 1U2RA 4LV8B 4PQYA 3THOA 1G8GA 1G21E 2Z6VA 1JXOA 3ASZA 3GEEA 3LV8A 4KV9A 1G41A 4HSEA 1E9CA 2AXPA 2NG1A 3ZS9A 1EFTA 4JBYA 2DY1A 2ZIAA 2D74A 3Q85A 4DLTA 1QHXA 3AF3A 4Q9JA 1QZXA 1L2TA 3IQXA 1Z08A 2CNWA 5JEDA 1PVOA 2XGJA 3AGQA 3M6AA 3ZZUA 4RZUA 1U0LA 1HY3A 3U3MA 1RRCA 2NO1A 3CZPA 3IPYA 3ZIAA 1II8B 3CPEA 3ZQJA 3T5DA 1NMZA 4S2EA 5IDVA 4WXPA 4F92B 1RFLA 3CR8A 2HXYA 2JAQA 3GLGB 4XVQA 2F55A 1GG2A 1DOAA 2ZXUA 4DRZA 1UBFA 5KO2A 2O8CB 2BM1A 4HDOB 1ZNXA 4JBWA 2YYZA 3WBKA 3SJCA 4LPSA 5KSYA 3GEIA 4Q4JB 2IS4A 3NWJA 2BBTA 2WIAA 3RLFA 3F0TA 3VNVA 3TUZC 1JQJC 3I8SA 4NBSA 5EE3A 1LV7A 1S9DA 1Z07A 2XJ9A 5FI0B 4DDTA 4URZR 1N5LA 2JJ2A 1ZC4A 2GZHA 4AKGA 1P9RA 5KDLA 4DWJA 2XZPA 5LDDC 1J2JA 4E09A 5H1YA 5TV2A 3U6BA 1BYUA 4IOMA 3B82A 2J45A 5JCPA 1Y63A 1Q21A 2DCUA 2KSQA 3AP2A 1KHTA 4NYJR 4RZXA 4RD0A 1R0XA 2FWRA 3QXXA 4HB0A 2GZAA 4HZUA 3A1VA 3R9IA 4M53A 3ADBA 2J0QA 4LJ8A 1VMAA 4R2HA 3R7WB 2ZRDA 1M74A 4DCNA 4KVGA 4TMXA 3EZ6A 3P20A 2ZUBA 3HR7A 2KBEA 4XSGA 1HQCA 2QP3A 1V43A 1NKSA 1HT2E 4N1AA 3V9PA 1OF1A 4M1YA 2AKYA 4AYTA 2EFCB 3K09A 4QGGA 2Z5FA 3U61B 2Q9AA 3FGNA 3VKHA 1XU4A 3WYGA 3GFTA 1EFRD 1CRQA 1GKIA 1QHSA 3OIYA 2N46A 1T0HB 5J40A 3ECCA 4LC1A 2P6UA 1VKJA 1WP9A 2KB0A 1R8QA 1NLFA 4ZDIA 3BE4A 2I1QA 2WJGA 3ZVNA 2IYXA 1Z2AA 1L4UA 2FG5A 2WV9A 5D3MB 3PEYA 2Q9CA 3HU2A 2V3CC 3FPAA 2LCFA 4M22A 1KO4A 1TL7C 1XEXB 5DN6D 4ILEA 5JRZA 1Z2CA 3CH5A 3X1ZA 3A1TA 2F7SA 1WMSA 4F93B 1E2JA 2ZRPA 221PA 1WCV1 1B23P 4RD3A 4BQSA 1XPUA 2ZR7A 3AVUA 2QZ4A 3Q9LA 2HEIA 2XEXA 5DGXA 2PZEA 4HB2A 5C4GB 4FMDF 4LX0A 1OH6A 4TQUS 2A7QA 1I4LD 4JS0A 3LXRA 4UQOA 5FR2A 3RS7A 2ZSBA 2DPXA 3H0KA 4B2PA 3T15A 2J5XA 3WY9A 1NSFA 1ZU5A 3BWDD 4V03A 5CB8A 2P2LA 3LRPA 4GL2A 3IPXA 5EZ6B 4IEIA 2NO9A 1N3BA 5AJWA 1PUJA 2ZSFA 2IYSA 1NMYA 2H17A 1F5NA 1EFRA 1KI4A 3RC8A 1HTWA 5KPJA 4RVCA 5EUQB 3KTAB 3L8YA 4NYJQ 3W3AA 5FPKA 2HUPA 3NDBB 1YRBA 2FSHA 5GVRA 1G6OA 1UF9A 1W5SA 2O0JA 2OM2A 3PUWA 3RSLA 2YZ2A 2AR7A 2ZRGA 4Q9LA 2Q3HA 3CR7A 2HDNB 3A4MA 1NL3A 1YQTA 2QSZA 2UVQA 4WZBE 1ZM2A 5DN6A 5EE9A 1TMKA 4QRHA 4TL7A 4XD7A 1JB1A 3C5CA 1LF0A 3SE0A 3U5ZB 2GXSA 3ZLJA 1KO5A 1OT3A 1DARA 3TW4A 1R5NA 4KVAA 1CRPA 1TPZA 1FQKA 5KSZA 1KMQA 1S1CA 2AK3A 4GNKA 2EQBA 4GPTA 1W5TA 2Q0HA 4XTCS 5EE0A 1ZUIA 2ZQ5A 5CDFA 4P0TA 4D80A 1X3SA 2R44A 2BM0A 3LLUA 821PA 3D6TB 1W36D 1KMHB 5TXGA 1CJMA 1E2HA 4ARZB 1AGRA 1YR8A 2FNAA 3CNOA 4I1SA 4E07A 1DAKA 4Q4AA 4LV6A 4BFWA 2N1BA 4I1UA 1SZPA 2DWOA 1ZU4A 2WWGA 2RGAA 1D2EA 1ETUA 2AX4A 4JVSB 2B7CA 4FWIB 1N5JA 5GADl 1OFHA 1YJ5A 3PUZA 4EPWA 2FF7A 1ZD1A 4XTRA 2HF8A 2G1KA 4KSBA 4DLWA 2D4HA 1GKUB 1XCGB 2W6JD 4M1MA 1W0JD 4HUTA 1S9HA 1CLUA 1GRRA 2D62A 2FU5C 3AVPA 5SZIA 3AVXA 3QUSA 4B35A 2P6RA 2WKRA 5BYJA 2RGDA 521PA 4Q4HA 2ZVQX 4JVLA 3RS5A 2WWWA 2GJ8A 3L2OB 121PA 5KSPA 3FFBA 4C0HA 4GOJA 3VAAA 4ZIRB 3OFND 5EE1A 1CF4A 3ADKA 3MJHA 4EFNA 1K5DA 3CX6A 4XWKA 3CNNA 2RGXA 2R2AA 3WHLA 4YMWA 2YINC 4URXR 2VO1A 4YMVA 3WNDA 2QROA 4KFSA 1IJEA 5DE3A 1XTRA 4GMDA 1KI6A 1KI2A 4LHXA 5FPYA 1KKLA 3KUDA 3AP3A 3RAPR 4EPVA 1EX6A 1JJ7A 1FZQA 3NEJA 4C2UA 3HU3A 4LUCA 1LF5A 3QXJA 1D6JA 2AWNA 3AGPA 2VF8A 2W0SA 2P67A 3KJHA 1IN4A 3QKSB 3NHAA 3AF1A 3NBXX 1F2UA 3K09C 4IW3B 4PR0A 4ERNA 4Q9IA 5C4MA 3SFZA 1TQDA 4Q9HA 3DO6A 3KQKA 4LJ6A 1ZNYA 5A0FA 2QMOA 1SVLA 4EUNA 2H1LA 3WNBA 2VP5A 4US0R 3SEAA 1VG0B 2QE7A 3IO3A 4QBHA 4IFEA 3THXB 2A78A 4M9XA 1U8ZA 2HJGA 1FTNA 1MR3F 3SC3A 3W90A 3HDTA 1T4GA 1BS1A 4UXHA 1FW6A
chains in the Genus database with same CATH superfamily
3Q1LA 1PWEA 1M8KA 4NVRA 2ZRLA 3KXIA 1MGPA 3NDPA 4I50B 3WOHA 1Z39A 2OO7A 2JB9A 4E5NA 1ORHA 2PBZA 2GCNA 3AKCA 1C4WA 3QKUA 3W2TA 1H4SA 2HV8A 3SEQA 2EF0A 5JYCA 1EIWA 2EL7A 3B1KA 2JRCA 3AR4A 3VSEA 1C9KA 3SVLA 3ADCA 1U94A 3SP1A 4NJEB 2PX6A 3JQ8B 2ODBA 3U3DA 2JKYA 3EXEA 2QRUA 4IQFA 4YY3B 1BOOA 5J2TB 2AMFA 4MVJE 4IO1A 2Z5LA 4DUYB 1MOQA 3MT0A 4GOND 5K6TA 3UT6A 4JQZA 4WLEA 2WUGA 3PHJA 1W0KA 3F96A 4TTIA 2O2CA 5JNRA 5KTSA 4RTKA 2Z08A 2EXXA 3ON5A 2Q3LA 4XB6B 3AI2A 1T6YA 2PIAA 3AESB 2ENWA 1UH5A 1UM9A 1J9GA 1KSFX 1PR1A 2PQ0A 2XSZD 3L4BC 4L8VA 3X1YA 2FEXA 4JX9A 4DS3A 1GEEA 1BDHA 2JI6A 2PKCA 2WUEA 2XYRA 2UVPA 3EXG2 2QPTA 4JSRA 2CHFA 3FMPB 4MRNA 1YI1A 3T35A 4Z0TA 3RS8A 4QD3A 1ZMTA 2V97A 1S7GA 4KZKA 1IIBA 1YZUA 5F2KA 5DW0A 1X80B 1UKYA 5CXSA 5B2ZA 4AT1A 3PGA1 1C1YA 3KZOA 3SNHA 3VJKA 3VZSA 4L51A 5AW7A 4GLLA 3F2IA 3ZKAA 3B48A 3FFXA 4QBTA 3UV7A 1Q0UA 4F3NA 1G6HA 1GRQA 1V1MA 2FA9A 1AZLA 1RWVA 3BXXA 3ZVLA 4OL0A 3TM4A 4ZARA 4QELA 4ZPXA 2J87A 5J1TB 3I4CA 2X9LA 3W9UA 1DBSA 4RF4A 5E1BA 3OT4A 4F72A 1SQ5A 1BX1A 4G8BA 3UJPA 1SC3A 1UXKA 2CL7X 2D5CA 4IVPA 5LSAA 1LTHR 1E4EB 5JSZB 1CS0B 1H85A 3UAWA 1SBYA 4C2TA 1NW3A 1GRNA 4ZRDA 1O9HA 4ZYZA 3LW8A 1TU3A 2VP3A 1QYWA 2Z4TA 4M7WA 1MOPA 3CLVA 2B99A 2IYYA 1H4TA 1BNCA 2DUJA 4A23A 3GLIE 1JI0A 1CUVA 4LQDA 5KTTA 3UUGA 3ZHTA 4B6GA 2GDZA 2IHVA 3F5QA 4L3OA 5LQAA 1AGPA 2Q41A 4N6GA 2VJKA 3P97A 4IHQA 2V58A 2UYGA 3DWFA 1ZKDA 4HAZA 1Z4IA 2RAFA 5DTIA 1PEKE 4KXWA 4Y2YA 1ZW6A 4JOSA 1EZ4A 1R0ZA 3ZXXA 2V3WA 4BVJA 5BUQA 1H0HA 3ZE2B 4TYNA 1ZJZA 3BIFA 2K6GA 1E8DA 1RJDA 2C78A 2D0OB 3ICWA 3PZRA 5F3RA 3WYFA 4BTLA 2EKQA 1R37A 2G4CA 2VSQA 4WESB 5HMMA 3QQ5A 4BNUA 1M8JA 2QLJA 1XHLA 4JP1A 5IHXA 3CINA 4W6ZA 3WRVA 3N6VA 4V3CA 4KN8A 1G7RA 1VGRA 5CFNA 1NW5A 1T13A 3AFMA 2OXTA 2J09A 1WBDA 1SR8A 2OBMA 3K96A 3Q88A 1J0CA 1BMDA 1Z8DA 2VHWA 2C5SA 3IP1A 3L0CA 3NHZA 3F4BA 2QIOA 4NICA 1RLMA 3C3JA 5G2OA 4QYMA 2CJXA 2J08A 3E4CA 3GP3A 4OBBA 4CM8B 5CA1F 3ET5A 1N7IA 1MCZA 4TL8A 1N5RA 1N0IA 2VPYA 4P81A 3REGA 1J09A 3EF1A 3W6NA 3E0XA 5EKDA 5A4JA 1MO4A 4YJ3A 3GLFE 1XZDA 2C0PA 4G5QA 3IQGX 5AKGA 2WRZA 1P31A 3OTHA 3RJ9A 2CV0A 2PXHA 3FR7A 3TLYA 4ZDKA 3LYLA 1XTQA 4QFDA 4CBVA 2VEDA 3KPUA 2HA7A 3D0KA 3OLCX 4E11A 4EHDA 3Q1KA 4PXSA 3UK2A 4YQFA 3U09A 1OFTA 1RM0A 4DLBA 4TT3A 2I7CA 2PPVA 3QPUA 1CDDA 1OHHA 3B2NA 4ZO7A 2EP5A 5EY5B 1SA0A 2WU3A 5K4HA 3PQ8A 3TX6A 2Z3ZA 2FQWA 5LNK6 1RJ9A 1T1SA 2REQB 1Y3FE 5DISB 5AXDA 3GB9A 3SX0A 1Q20A 1VPVA 1ZGCA 1WDTA 4WXEA 4NH4A 3VC1A 3KG2A 3HUTA 5I3CA 1UKCA 3JD1A 1VI5A 3M6VA 4HNSA 4UU8A 2OA0A 3UKDA 3CQ9A 2WWXA 4J0HA 1QIJA 1B8VA 4MWGA 3RUPA 1NF3A 1NBME 1YL5A 4KO8A 4MEBA 5BUCA 1M6WA 1NY5A 2CMGA 3D7MA 2YKGA 2WM9B 1W59A 3AY6A 1DLJA 4FEGA 4GLOA 4PG4A 3VHQA 4NDAA 5DI3A 2WUVA 3WV4A 4WNIA 4BNIA 1TK3A 1WPXA 2I67A 2JCSA 2VQSA 3ER8A 4UBLA 4K46A 2BW0A 4JP3A 3LYHA 1O94D 2IW3A 1CV2A 1ZJ6A 3K5PA 4JHXA 1WWKA 3MGCA 4BXOA 5JAHA 4LZOA 1TK9A 2NPFA 4EB8A 3ZLUA 3PENA 4I36A 3NX4A 4L4RA 1ILEA 5FIUA 2IV3A 1OKKA 4ARUA 2E5FA 1CUXA 3K16A 4ZICA 4MP6A 3LDGA 2XZTA 5FOTA 1TZ2A 3A6GA 4MCHA 3VKWA 3O4JA 1JBKA 2I65A 4G4JA 2WSBA 2MCFA 3NM6B 1FDOA 2FSIA 2ZUDA 1N2CB 4MUBA 2DFPA 4ZTUB 3GQVA 5AW9A 3SFTA 4J3NA 2DLCX 2NV0A 1G3RA 1P1KA 5KYYA 4EG6A 1BROA 1H2FA 1M2NA 1PZFA 3EC2A 3AW8A 1OMOA 2XZOA 4D97A 1IM5A 3D64A 1XXHA 1QAMA 3OF2A 2V7EA 4A8PA 4E6PA 1CZUA 3VNUA 1XNJA 1KZ7B 4IVRA 4CM1A 1X1EA 3BF7A 2ZBDA 3FSGD 3ZXYA 2WABA 3K6SB 3RLIA 1G3IA 2A5GA 1Y1PA 3IT2A 2BM8A 4QHTA 1E20A 4CMIB 4RV9A 1GTL1 2BUCA 2ZE5A 2PT9A 2FZ4A 2J3LA 4NMXB 3LUJA 4XZ3A 4DREA 3RAEC 2G0TA 2ZR0A 1Y7LA 3TAXA 3UWPA 1VCNA 1RAGA 1YQEA 2C3UA 1NASA 2A0XA 1XYGA 3IE0A 4L9RA 5AO9A 1ESCA 3GNTA 4KUEA 3CJTA 3ABIA 3AVTA 2C4HA 3U1VA 4YR7A 1KJZA 3IDFA 2E6KA 2Q5FA 2BGIA 3IOEA 2OORC 3K5WA 5C5DA 4HDRB 4O2LA 4UTVA 2H92A 1KSHA 1U65A 5A03A 4TMYA 3SBEA 4GMFA 1P1IA 3TZLA 2GK4A 1C0PA 2G36A 4JLVA 3DE1X 5LCXA 3FZGA 4D98A 4C7VA 4L9SA 5HIAA 2X5KO 4HB3A 1R8SA 3JAMA 4GNRA 4I81A 2CLCX 4PFSA 3D3JA 2E5WA 3BD9A 1KEEA 5DGHA 3CRVA 2RK6A 1RHQA 4GR4A 4KRYA 5IJ0B 4YJGB 3CUWA 3NBUA 4H2DA 3W0LB 5JS8A 1JDJA 1ESEA 1CUIA 4HUJA 3SHWA 5IK2D 3DZKA 2XMDA 2CFRA 3DOFA 3H86A 4DRXB 2PRKA 3WR5A 2ZITA 2FW6A 3PRJA 1DXYA 4NZYA 2FXIA 2GZMA 1OBFO 3EGCA 3GGGA 4R8LA 3NO4A 2IV2X 3X1MA 2LKCA 3JRNA 2XVZA 2J5QA 4DNFA 2O5VA 2QK4A 3W5UA 3WDMA 3WBBA 3KKNA 5TY0A 1BH6A 5JSFA 4I99A 3GRKA 2RCNA 4RK6A 1TD9A 3CO5A 3H04A 1BMQA 2Z56A 3B52X 4GXTA 3VDXA 5CW2A 3CZQA 2YBEA 3V1MA 2AUTA 4MWOA 1U0RA 2P1DA 4NMWA 3ZE6A 4F5WA 3PX2A 3WLIA 5BQ3A 2Q1YA 3AQ4A 4UEKA 3HUUA 2BZGA 5K8JB 3H5RA 4E4TA 4W5QA 1VHJA 4MTCA 3SXJA 4LMBA 1U31A 1UJNA 3L0PA 4Q3CA 1SG9A 1XLVA 1JHPA 1CERA 5ED4A 3G2HA 4UDNA 2BCJQ 3VU8A 5JI2E 1W73A 1OXKB 4KBYA 2CLOB 3WGKA 3MJRA 2O0HA 5EE5B 3VMMA 1Y1RA 3LLMA 3QBVA 3G3EA 4MW4A 1NFRA 3IQFA 3DEKA 4QO8A 3SI7A 1ZOOA 3U7IA 3PJGA 1K27A 5AWFC 2GJKA 3DWIA 3SYRA 4K6FA 2GPJA 3DPIA 5JAOA 5KYNA 1F0YA 2ZI9A 4LSGA 4AI6A 4Q7KA 2B8NA 1YULA 3PC8C 4Q1FA 3W4JA 5J59A 2BFBA 3N6XA 3FWZA 3C7CB 4KB5A 4IIHA 4U6NA 2CHEA 3CO0S 3WP1B 3VR3D 3ZWXA 1DCTA 3AL2A 4M83A 1TCCA 2DG2A 2HU5A 3RHTA 1BEZA 3N9IA 3SSAA 1O57A 2PSSA 2YV4A 4LI0A 4U39A 5ALEA 4B48A 4H35A 4WIAA 1GITA 5KIAA 3QNWA 1L0BA 4G0OA 2WIFA 1HZZA 3PRKE 2PZFA 2VYVA 3RU9A 3O8RA 3EK2A 1ESDA 1DQZA 1O77A 2WMOB 2XW6A 4NNPA 2ZAIA 1FU7A 2OCYC 4TSKA 7MDHA 1N25A 2ZDQA 1P9NA 2ZIFA 4NECA 5EIBD 1QC5A 4Q6WA 2X8JA 1YO6A 3X43A 2HIAA 2IPXA 2WEKA 3PNLA 2WG0A 4IMJB 4LBWA 4V0LA 5T4HA 3N3AC 2W71A 1IHUA 2YQZA 4I9FA 3NHYA 4XLTA 2RGEA 1UBGA 3A1CA 3D8TA 1MABB 1GPUA 3K9HA 3W2HA 2XQJA 4HWPA 4MJ7A 1J4AA 1SKYE 1B1AA 2JLXA 3NNNA 4L9WA 4J6EA 1L7OA 2WOJA 1G17A 4YJ2A 4DC0A 1ZC3A 4HDNA 1M0WA 5EHQA 1FTGA 2ANCA 3SFVA 4XWOA 1CR4A 3U81A 3M4JA 3S2SA 4RPHA 1PK7A 1J24A 2FW7A 2PMDA 4I4TF 4TM7A 3COVA 3UJDA 1WMBA 3V97A 4WGFA 4CQLA 2YVUA 3FVVA 1Z2NX 1GA4A 2WZDA 1VP3A 1R4NA 5IVPA 4DSOA 3KOOA 1ZM4A 2Z2ZA 4GMXA 1J90A 3MAGA 1V7ZA 4NULA 5K3FA 5CFQA 1G55A 4N3AA 1SD1A 4K3UA 2Y66A 2O9JA 4AMUA 3D8SA 2BEUB 1GV0A 1VB3A 1PO7A 2PTHA 2WJJA 4X94A 5TF0A 4EZEA 1WBBA 1E0JA 2OG2A 3K0FA 1GQSA 3M81A 3MWDA 1KA9H 2DR2A 7ABPA 3NWBA 5KYUB 3CW8X 1UMDA 3D7LA 4DLSA 1EX9A 4JASB 1Z4PX 2B7BA 2QZZA 1P4AA 1T0BA 4K3VA 2HMUA 4F9TA 5CBKA 1CQWA 2YXEA 4JL5A 5IUKC 4AB1A 2C2GA 5BN4B 4I4NA 2F4VB 2OP0A 4WCDA 3M5WA 4H7KA 4Q47A 1OYWA 1U9CA 1XAHA 1G8MA 4G07A 4RTMA 2Q0XA 4MR9A 5KINB 2ZATA 2X1HA 3JQGB 2EGGA 4YLEA 1MHPA 3UQYS 1GSIA 4QLAA 3U3JA 1LBIA 1FMFA 4D3YA 1G2QA 1RKBA 3OLYA 2CEKA 3SD7A 4TVSA 3DAPA 2I6UA 1E9BA 2ZRCA 2YRFA 3TAHA 3DTVB 4NV0A 1J97A 2YUTA 2EHDA 4RYDA 2P8JA 3GA0A 3N2GA 4MV1A 4OHWA 1A4UA 1P74A 4UC0A 5KCMA 4BU0A 4JV5B 1B73A 2BZSA 1RPNA 4JJ8A 5AIAA 1SU6A 2ILTA 3IODA 5EMHA 4B7CA 5KNDH 1VMDA 2IEDA 3JQPA 2IUFA 4UVHA 3BMOA 2C95A 1MX5A 2EW1A 3G9XA 5JFOA 3NVDA 3FYUB 1FDVA 3K1AA 3TNFA 4JH0A 1R9JA 2FSVA 1ESNA 2PD4A 1OAOC 2WSSD 1RI2A 1AO3A 1EEXB 2BAGA 1E6WA 1H2EA 1IC6A 2Q1UA 3FD8A 2BEKA 4MYUA 3N0WA 1XZGA 2ZSIA 3UK6A 1THZA 5C8VA 4I3HA 1UKVY 2OO3A 1LBQA 1OI4A 1F9AA 1EWQA 1RXEA 4RK7A 2PXXA 5JD5A 3V33A 2A1TR 2GJSA 3AHJA 3E23A 1A9OA 4ND3A 4OMFG 2F1JA 4TWJA 2HJHA 3KVYA 1M75A 4TSFA 4EZBA 4BO0A 2CVQA 3AG6A 3G5MA 4X95A 1GTMA 2YW9A 3C7KA 4QXRA 2QM8A 4UEQA 1U9IC 3PYXA 1V5GA 1CBUA 3ZLVA 1KGSA 1RAAA 1S2OA 1IN5A 2Z1NA 4RA9A 3MOGA 3CCBA 3L6OO 4Z51A 3ZXIA 4F56A 1TX4B 1FF9A 4B43A 2ZVJA 5L3SA 2JHGA 1G16A 2JGJA 1P7YA 2IOYA 3RYIB 4CI9A 4TTQA 1XFAA 1OYYA 1TRKA 3IDOA 4BJ6A 2B6NA 3TRJA 4KE8A 1Y4AE 5FBLB 2PANA 4GX0A 3LI2A 3EIQA 4ML3A 1QIKA 4PQFA 3T9BA 2BKXA 3JASA 4QBGB 2O20A 4C76A 3HCPA 2ZJAA 4RX1A 4IDCA 3JQEA 3HKBB 5ECDA 4ZAZA 3QOWA 1C4OA 4O8CA 1L7RA 2R7LA 1XZEA 3I5YA 2LW7A 2JLRA 2V6BA 2PMWB 1Z6GA 4MQBA 1T24A 4P33A 5C8YA 3TZEA 4B34A 2HCJB 3EW7A 1WA5A 4CLOA 5CA1A 2A0YA 1KVRA 4FOOA 2SKEA 4HH0A 2WSLA 3CCCA 3KXKA 3OT5A 4G81A 4M2LA 1CEYA 2J6BA 3SXPA 3K1JA 1FW8A 4FCTA 4Y6SA 1T9CA 2AGVA 3HVJA 4KK4A 4TQ9A 3O7WA 4R6XA 3DAHA 3JAKA 5ULLA 3VJLA 4BNDB 4D6XA 4PR3A 2H1FA 2WTEA 4MMZB 5ESRA 3WFZA 1R6UA 2OV8A 1Y81A 1AXEA 1WUHS 2OOKA 3ZBPA 3QKTA 1N7HA 4QUBA 3TTVA 3QTBA 3EZ7A 1G3MA 1RI3A 2NADA 3VPGA 4EJSC 1E4YA 3SEZA 4JL6A 5A7GA 4GICA 1BEUB 1MX3A 2PMCA 5CLGA 5H70A 4F38A 1LPAB 1Z6ZA 3KBOA 1MPXA 5C1BA 1PJ3A 3JYPA 4FMDB 3N2LA 3IBCA 5JBNA 2FLKA 4BAGA 2GWRA 3BWXA 1I3MA 4IXMA 3ZR4B 1XELA 1L3IA 3IQHX 2OXFA 1USGA 4W5WA 4DYHA 2NU6B 2GSDA 4GX5A 3UT5B 4WFKA 3JW8A 3I62A 5K0EA 1LI5A 1TZCA 5TR9A 4CIAA 4NFYA 1L7DA 2HGZA 4N5MA 3AR7A 2W6OA 2MMGA 3E7DA 4BMOB 5B58T 4AK9A 5SY9A 3JVIA 4TV8F 5DYTA 2FSPA 2RJNA 3HKEB 2ZBGA 1MT0A 2ZYWX 4HSGA 3W6OA 3AHEA 5JAIA 1XDZA 1LNZA 4RLSA 1RP7A 4V0OA 3MTBA 1AKTA 2I7DA 3L9WA 1QHIA 1PL8A 2QTTA 4XQCA 5KTPA 2I7XA 2QYOA 3AUYA 4IFBA 1LQUA 4EY6A 4QHYA 3TS1A 4DIUA 1HKHA 4KPEC 4EMUA 3C4JA 2OBXA 4MO9A 3KZ1E 4TTAA 5KWVA 1T6NA 3A2LA 1VIAA 2VJMA 2JK0A 2PL3A 1F8FA 5FBZA 4HWSA 1W9HA 4MS1A 1E7RA 3PNMA 3PNOA 4UNRA 2AG6A 4DILA 2P65A 1MUUA 4QA9A 2LCQA 4DLKA 2G82A 3BJEA 2BPOA 5ISMA 2SKCA 4G97A 4AN0A 5A2GA 5LMCA 3QX3A 5ENVA 3MOIA 4QQKA 4UE6A 2COKA 5L4NA 1FQOA 4CF7A 5IF9A 5FOSA 2MYPA 1PIWA 4D4LA 2JGMA 3T4PA 4MWSA 2EBWA 2BI4A 3ANNA 3K9WA 2BN4A 2RIPA 2YWBA 3KYBA 4FOLA 4OFWA 2JFXA 5JZMA 2XQVA 5CLLA 1V7QA 1NBAA 5E4JA 3SVZA 3TLGB 5HE8A 1EFPB 1HK7A 4FHGA 4RM3A 3GFSA 4C89A 3V1UA 5HRAA 3WJ7A 5B3KA 4ZGGA 1M2HA 4BNTA 4C7KA 4F1JA 2HRRA 4N3NA 3HVHA 4KC0A 4POAA 3BRSA 3WHIA 1DT3A 3CVOA 2BCEA 3R0JA 2ADFA 2WMDA 1VPEA 1XD9A 3EZ2A 3OE1A 1C9MA 4HH4A 4OK3A 5CNMA 1UPAA 1KNQA 2F3TA 3D8NA 3I4LA 5EXTA 1ZM3A 4CYMA 5C5EA 1ATZA 1E99A 3NAQA 1JAIA 1QBGA 2R60A 5B53A 5HZGA 3LP5A 2YDYA 2UXDB 4KWCA 4LY0A 1O5TA 2VT2A 2Y71A 5JMPA 1Q14A 3HBFA 3KUKA 1X39A 4P4NA 1IEVA 1WW2A 3BK1A 1EMDA 3O1LA 3QG1A 4ED9A 3NVKI 3NFRA 4JY7A 3KT6A 3SLKA 1IUPA 1D09A 2E37A 1IBSA 3FM9A 1WLYA 3BJMA 1IY2A 5GY7A 4I7EA 1MG0A 4B32A 5J63A 4E1VA 5J4KA 2CL5A 2VSYA 4MDYA 4RHXA 1E1CB 4MDEA 2EJCA 3ONEA 3AY7A 1YH3A 5AICA 3KB2A 1Q1AA 1AZWA 2R4TA 2AOVA 1US8A 1C0KA 4E03A 2ISQA 1Y5NA 5IRCD 3GFPA 3FWNA 1GN9A 3OX3A 1PR6A 1G5TA 1S3GA 4RDXA 4WK0B 3CVWA 2AF3C 4IF4A 1DC4A 1R4MB 2YIDA 4EG8A 1UBUS 5HKKD 3FNQA 3Q2IA 3EJWA 3KV1A 4INJA 5CD1A 2RGRA 2GVZC 1MV8A 2WHPA 1ZJ4A 2QV7A 3EDRA 1ZH4A 3CV3A 4U3JB 3ROFA 1RQPA 3ND5A 3TLAA 3WYEA 1Q0ZA 4AIRA 2CGEA 1FX0A 3L0IB 4BRSA 3DMDA 3QEBZ 4C4PA 2ZAMA 5KQRA 5EUBA 1ZUNA 4RWZA 5K03A 5KMGB 4EK9A 3D6MA 1H6DA 4Q9KA 4Q4CA 2WB2A 3A11A 5TMDA 2RK4A 5ICGA 4G85A 2ZU6A 4HDKB 4PO9A 1RWKA 4YACA 1P72A 4UXIA 1KZ9A 3DYBA 1GPMA 1VYHA 4GX2A 4KI0A 1D8AA 3T7SA 5ALZA 4C4ZA 4ENSA 3AEUB 5KHAA 3CZ5A 1ZY2A 4A8JB 3LX8A 3AZPA 3LAWA 3RVRA 5GJCA 5K0FA 2PGXA 5DOZA 2FK8A 4WAUA 1D1QA 3TOZA 3IE1A 4HX5A 3UATA 2HSWA 1BGWA 3GPBA 1ZLYA 4R7GA 4C87A 2I8CA 3U7QA 1UM8A 5ABPA 1E3WB 2B1RA 4DNQA 1JS1X 2HWYA 4QIHA 3QG5A 5ECWA 3O4IA 3E8XA 3SF8A 1SVIA 1F0KA 3ZU6A 5JCJD 4QEDA 3SMVA 4G09A 3BHIA 4N8SA 3TTTA 3ZHQA 2NACA 3NT4A 4L15A 1D03A 2PGNA 1II8A 4NCKA 3V2IA 3VMFA 1YQUA 2HGSA 2YC4C 2W2LA 3ER6A 3F7MA 3ID6C 5AXCA 1TUBB 3DNFA 2CLIB 2WM2A 4ND4A 1RHRA 5LQNA 2IZ7A 3D8UA 4GX1A 2IQ5A 2P9GA 1KDPA 3P2KA 4JEUA 5DM0A 5TPZA 5AVXA 4HLUC 2ZUWA 2WTMA 5CGQB 3TGWA 1K5PA 5IXJA 3PCXA 1ZJWA 5LKAA 1IOVA 1RXCA 2ZS7A 1PJSA 2B21A 4BZPA 2QRKA 5JG7A 3AERB 3VDRA 2O8DA 1DCFA 1Q91A 1WVIA 2PEZA 4HG2A 2E21A 1A76A 2P9EA 4OXXA 5HCIA 3ZNPA 1LW7A 3QV2A 1UT8A 3MWLA 1AQUA 1NJGA 2OUKA 3L7DA 4L28A 4JI0B 2KM1A 4MNTA 1JQ5A 2XCTB 2AZXA 5GJWC 1JTVA 1CPYA 1RXIA 2OILA 2IYFA 2PO5A 2PZBA 2WM3A 3H2BA 5KVQA 4DHWA 2PQMA 4FDLA 1G291 1O95D 1P6XA 3MPUA 3WBFA 3WP0A 4CT5A 4DMCA 4FKZA 1RHKA 1FQWA 2HLHA 4ZEOA 5HIKA 3FBTA 3DKVA 1P1BA 2DR3A 5AVVA 1ZMRA 4YA6A 1ZBQA 1JYEA 4B6OA 1YS6A 4MSUA 5LDHA 3ABSB 2IEGA 2QY6A 1E58A 1FC0A 3NP9A 3W5BA 1XVVA 2H85A 3A6PC 1H4QA 3VTKA 4ND8B 4X00A 1DJNA 2XNDD 3AILA 1R16A 1PD1A 5H9VA 1LK5A 3UWSA 4D4HA 4YP9A 4DLUA 4JHLA 5I5GA 5LC1A 3LHSA 1GIAA 1QS0A 1KFJB 3PGJA 2I2BA 1YZYA 1XGKA 2WUDA 3IMGA 3B6KA 1IEXA 4FYKA 4JAVC 4GC9A 3IDAA 2DFKB 5IARA 4CU2A 1NQUA 1RCUA 3VYSB 2HR1A 2ZIVB 5KYKA 4I4TA 1HDCA 1MJGA 3QI2A 1CDOA 2DY0A 4N4AA 4D02A 1KMCA 2FMKA 3SIWA 1SIUA 4NP6A 4H08A 5CNKA 1U99A 2NZXA 1ORDA 2PLWA 3QRWA 3G1TA 3LL7A 4J94A 3ZHOA 5JWOA 2XB8A 4RIHA 4NZPA 4CCSA 3G0CA 3FPJA 4GZLA 2YRWA 5EIFA 2ID4A 3S99A 3UHJA 4L74A 4RY0A 2WD7B 4X3CA 3ZD9A 5JYEA 4RLFA 2VF2A 4AD8A 3H9CA 1R74A 1J9ZA 4A03A 5SZJA 5JNUA 4IFTA 1WXWA 2WAYA 1JIJA 5FXMA 1VMEA 1N92A 2VHQA 3QOFA 2NOAA 4K9SA 3FOEC 1L4LA 1XVLA 2FUG1 4J0IA 4J1TC 4K2AA 4OQMA 5EXDA 3DLHA 4MWZA 3W4IA 5I01A 4LGYA 1N0VC 1GT91 1UC9A 1CVIA 1L8QA 1K9VF 1P91A 4Y6LA 4YB8A 1BRMA 1DX4A 3P45A 1H2WA 1KS9A 4W82A 3V2GA 3GAFA 1S96A 3QWAA 1RAHA 4OQQA 2IYOA 3BC1A 4IDDA 3R6WA 1V95A 4V1CI 5AHXA 3IMKA 1J1ZA 4MKXA 2A35A 1L1FA 3UXYA 2XB2A 3SJZA 3WSVA 3FNRA 3H97A 5REQB 3FTEA 3TR6A 3O8QB 1P8JA 2O6HA 4DDVA 3PCTA 4PO1A 2G4LA 5D6OA 2R8ZA 2JFVA 4LYEA 1W5FA 4QJ3A 4HN9A 2X2PA 5K8LA 4RSHA 4LXXA 3AKYA 1OPXA 2ZB2A 1H8HA 4ROSA 5DBFA 1NZDA 4K26A 4DDHA 4KLNA 4WTOA 2LDXA 1NF9A 1U11A 4OPMA 5T64A 1J8QA 5L7WA 5LN1A 1KEWA 4JKOA 3UHAA 3MEQA 4PANA 3NC1C 2GHIA 5B30A 4I19A 1H9CA 3I9JA 2UYQA 2V7VA 3D6FA 5EJEA 1Z38A 4OHMA 1EDDA 2I4MA 5K8IA 4JBHA 3R23A 2HCRA 2OGZA 1FNDA 4MROA 4C4SA 3AR8A 2EP7A 4HS9A 4EGJA 1ONSA 2E1PA 2XIQA 4HX2A 3QWBA 4M99A 2R2GA 1G4HA 3O4HA 4P7FA 5IEBA 4J9UE 2IWHA 3COWA 3ENWA 4HAUA 3IQWA 4QO7A 2QUJA 3RSHA 5GOZA 3ZE1B 2ZIUB 5G1NA 3H87A 4Q4LA 4TLBA 3S2IA 2VPPA 3ZPXA 4Q4AB 2Q3BA 1VHLA 2PK3A 1DRWA 4IPTA 3T3IA 1A9RA 1GVHA 1QU2A 3GXOA 2Z2IA 3OKAA 2RKBA 1H8EA 3CF2A 4QYIB 1JNYA 1IHXA 2QT1A 3ICCA 3LWDA 2EFGA 3MMSA 4IG4A 1L7EA 3KKLA 2WY2D 3VUEA 4B3BA 4JMPA 4QPPA 2ZYVX 3EF0A 1J0XO 3AI3A 3ZWNA 3ZHVA 4M3NA 1KHHA 1P3Y1 3DMTA 4G65A 4DLZA 1G9XA 1JIXA 1V9LA 5JSHA 2YOHA 3G0GA 1I9CA 4HZGA 5I51A 5IC4A 1P75A 5AKJA 4D96A 1JDBC 1E3QA 1FFEA 5T6MA 5ALDA 2FP3A 2H51A 3ILSA 5K3SA 4KGVA 1MOZA 2DJ5A 4IQ4A 5AKKA 4D45A 3QE9Y 3NP7A 4HXEB 1E2BA 4Q4HB 4WXYB 1SNYA 1NRJB 2P3LA 3AL0C 2HQRA 1CJCA 2EP8A 2Q8QA 1SCNE 4OGFA 3VKVA 4CDGA 2QN1A 3IUYA 4E51A 5BXQC 9LDBA 3M82A 4KQ6A 4W6QA 3I1IA 5BWOA 1XX6A 2R1ZA 4GD3Q 1FUYB 3VPBA 2VFAA 2DAPA 5TQ0A 5JVDB 2JZOA 1UPCA 1C9JA 1XV5A 1V4BA 1Z0DA 4C78A 3NC0C 1V47A 2IYLD 2J3QA 5KSOA 1GP2A 4QUAA 3M6UA 1UP6A 4KQWA 4G9BA 3PI7A 4OKIA 3SGLA 1RIIA 1NIJA 1KQOA 4O2RA 5IDWA 1G5RA 2FN9A 3DMPA 5MN6A 2FW9A 1C2YA 2QTNA 3QLUA 2HFJA 3RUHA 4LOIA 2JIMA 3LRXA 1H1LB 3ZCUA 4FHDA 6LDHA 1U1CA 4EJFA 4JZKA 3MWKA 4TV8A 2Y0PA 3G9UA 1M1UA 1MFZA 1YOVB 3ESRA 3PE4A 3A27A 3M3HA 1CK4A 1Z6YA 2WUWE 1G21B 3HZZA 1QYIA 1B8UA 4YCMA 3WRYC 1F2UB 1T8SA 2EDCA 5JWHA 2QVCA 4ZIRA 4NENA 3ECSA 5KOYA 2FQYA 4QGFA 3DOHA 2Y27A 5FA6A 4YV0A 3U16A 1QVAA 2P35A 3HA7A 5B6PA 1YAJA 2OHFA 4RHEA 4Y2UA 3MLBA 2ZSHA 2WD8A 1FBNA 1N3IA 3RNOA 3HWWA 3IHLA 4F4JA 3G0HA 2BTOA 2I1WA 4L2IB 1I7NA 1QRRA 1T34A 2QUHA 4YHBA 4GYJA 5CAEB 4ETWA 1D9XA 1NXSA 4MUYA 2IXGA 2XWQA 1T26A 4NEHB 3RUFA 1PJ8A 4DHEA 4ZTZB 1WCWA 1E94E 1X94A 3BDVA 4Q4DA 5FOUA 2XAUA 4I8DA 3T99A 5DBIA 4Y6OA 4NJMA 3ZH9B 3GG9A 5E2IA 3F3SA 1RYMA 3I01A 3G0BA 4F5EA 1XZLA 3JD3A 5A4MS 1N2OA 3PWTA 5F1OA 3PD0A 1LFDB 4BHTA 3CZ9A 3UIEA 4B6EA 3RYFA 4BB9A 2J67A 5TB5A 1U98A 2H4HA 3X1WA 3TZ6A 3E2IA 3QKSA 3H5TA 4ZN6A 2G7MC 2OHIA 3OSZA 1GUFA 4TLDA 4LZNA 2ZB4A 3SX4A 4ZHQF 4DR3B 1A9ZA 4FFWA 3L49A 4B74A 1DG1G 2YOGA 2AKEA 4JUAA 2V5VA 3BA6A 1HSZA 4C88A 1MQSA 4B47A 2JS7A 4C0XA 3G85A 5E9WA 3UFBA 3A04A 1G5HA 1NUUA 3QOYA 4G0MA 4YJKA 1U0SY 1ZA1A 2GNPA 2D0PB 1OWLA 1X14A 4EGFA 4GMGA 1J2TA 1Q1QA 5CLIA 3RBZA 3RFTA 5C35A 3G8CA 3TIXB 2IL1A 4L27A 1P61B 1TADA 2QA5A 2CYAA 4ZCPA 1L7PA 1V16B 1V7CA 3WZLA 1T1JA 3T34A 2C59A 5ENZA 3OPXA 2W6PA 5C46F 1UDBA 2OLKA 5GONF 5A62A 2JKZA 3ZE9A 1QYVA 4BIIA 5MFZA 1U6KA 1OBOA 4XR4A 5D5PA 1QFMA 1PW7A 4ALLA 4XSVA 1AA6A 5I8WA 4N54A 3DFKA 4AF7A 1LY1A 2VTEA 3L77A 4DSUA 3F8SA 1AQJA 1JMVA 2JASA 3KSDO 4HJRA 1ENPA 1P1RA 1ABEA 1BJRE 2YS7A 1SBTA 4OHZA 4W5RA 2Z30A 1RHUA 4AJJA 2MSLA 3RWMB 4G4SO 2WP8J 4OJNA 2IDZA 2L82A 4GE0A 3MMZA 2PR2A 5FP0A 5C81A 2HYIC 3KQMA 2GN6A 4HEQA 4DLVA 1GQ2A 2FPRA 2QM7A 1RABA 1TA4A 2H8KA 4JUDX 4M1WA 1U5BA 4NS4A 4UNPA 5FBKA 4EYQA 3PTAA 2VSOA 4R83A 3URMA 3DDUA 4L50A 2J46A 4FFNA 3G1WA 4YAKA 5AKLA 1NDUA 1YE3A 2G1JA 2L17A 3ODGA 4FS3A 3WBJA 5KTYA 4B3SB 4Z8YA 1J56A 4N9WA 4LHWA 3JR3A 1XK6A 1RKXA 3FDZA 3KDAA 3SXUB 2GAOA 5K8UA 1OSNA 1SK9A 3AHGA 1WJGA 2DQKA 2FMFA 3UW1A 3JQFC 1QNFA 2IU4A 2ZRNA 4MKGA 2ZJBA 1PWHA 2GTHA 1T1RA 4QNMA 5NLLA 4DTIA 4C20A 1B6TA 3TCKA 5E1MA 1YS1X 1IONA 1YBVA 2JLVA 1PDVA 5EERA 1G1MA 5EZYF 5ADWA 4LOHA 3T3GA 3FCCA 1R8JA 2GBPA 3EJ6A 1Z15A 2Q3EA 3ORFA 2ZM5A 2BGUA 4DSTA 4G86A 4X6XA 3F97A 5B64A 3PIRA 4JC8A 4UVGA 1JR6A 3GU3A 4MW5A 4GSKA 3HV0A 1JKIA 1FJXA 4OHYA 1G18A 4LYHA 5BSEA 5K2OA 4NARA 3FOFC 3KQUA 2EHJA 2G0AA 4GWGA 1TF2A 3U62A 3DD1A 1U0HC 4HYEA 3QE3A 1HMPA 4YO7A 1RM3A 3UAXA 1GTVA 5EFZA 2XX3A 4ZCMA 2WG1A 1RR6A 4QGBA 2FW8A 2DXIA 2R8RA 3GLRA 3JQ7A 1MB3A 1U8TA 3EDYA 3U4HA 1DKQA 4PPNA 4RGVA 5LQCA 3V42A 5CFZA 3QFHA 2YHSA 2YHBA 5EZ5A 4Z3DA 4ARVA 1QE3A 2BEWB 3NKFA 4H1VA 3RVBA 5KS2A 4MPPA 1FXUA 1E2EA 2RBEA 2BKLA 2DMRA 1UBNA 1AN0A 2GHQA 2JCBA 2VDWA 2ZTSA 4JLBA 3SX2A 1UPTA 1V2GA 2AN3A 4CMGA 1PL0A 3GNLA 3GJ7A 3W3AD 1XTTA 4LGMA 3F3YA 1Y98A 1T9AA 2W6NA 2JVJA 3BRWA 1NVFA 4QVIA 1YTLA 1QTRA 1T4DA 2BKVA 3VR4A 1XZPA 1MN6A 4LGVA 5EPOA 3ZUPA 3G82C 2XBUA 4QFMA 2BELA 2REOA 1Y3CE 2HK6A 3A9RA 4ZI7F 2XD9A 4F2HA 4WKGA 5ECYA 2NU9B 2XVYA 2ZRHA 3U44B 4RDCA 2QM3A 4EJSB 1V4VA 2JCVA 5DULA 4CEJA 4O29A 3A6LA 3HY4A 3ENVA 4PYQA 1FFYA 3TIVA 4XD7D 1CY4A 3OD5A 3PBKA 4JVMA 2N42A 2I8LA 4WKPA 3BULA 2GZ1A 4FWTA 2IPMA 3GLHA 3UK1A 3OM1A 2JJ8A 1X7YB 2P9BA 3FCUB 3P9PA 2VP6A 4LYJA 5FL7A 5L6MB 3RVPA 2FRVA 3S3TA 2W2XA 5AUPB 3TE6A 3F74A 3LUCA 4TV9F 1VC2A 2Q0QA 1N5OX 2RGCA 1OU4A 3B7PA 4CT4B 4X97A 1QH0A 2FMUA 5E8JA 1RWOA 5F2OA 5ALWA 3TM5A 2V4MA 4EUEA 2XEDA 3LDUA 4RY2A 2OFXA 2OAP1 2J0UB 5A1JA 2GCPA 2NU7B 3G5UA 3KXLA 3D6HA 4ARIA 2BGWA 4Y1EA 3BILA 4J43A 4JL8A 3L4BA 1S2IA 4PQRA 2XUGA 4RVGA 5L3ZA 1MRNA 1MQAA 1OLOA 3E9EA 3EQ8A 3KQPA 3OZEA 4R01A 3UKOA 3U4QB 5JAZA 2XYPA 5EGNA 4XUEA 4EAAA 4OCZA