4XTRA

Structure of get3 bound to the transmembrane domain of pep12
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
348
structure length
305
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMGALADLTGSIPGIDEALSFMEVMKHIKRQEQGTFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
total genus 100
structure length 305
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xtrA00
4G5RA 4EJSC 2OXRA 3W90A 2FFAA 3PUXA 1RRCA 2Q3MA 3HR8A 1E9EA 4LHXA 1WE2A 2ZJYA 2Q3HA 3CPHA 1ZNZA 3UWOA 2GJ9A 5KDDA 1CS4C 5FTNA 1J2JA 4ASUA 4URYR 2BDTA 1S8FA 1OE0A 1ONBA 3IO5A 3UK6A 3A36A 2D62A 2Z5FA 5HZHA 4BZXA 4XSHA 3PCRB 1LY1A 4TQUS 1Q1QA 3MWKA 1US8B 1Z47A 2ZAOA 4LY6A 4CT4B 2ZS7A 1Z8FA 2HT6A 2DHRA 1G20E 3T12A 4ON9A 3ZS8A 1QG4A 5FBQB 4GP7A 5AJXA 1B0UA 1XJCA 1OXTA 4ILEA 2KE5A 4GFDA 2DBYA 4IOKA 1GDDA 3UMSA 3NH6A 1ZM4A 2J59A 2BEJA 1Q0UA 4DLYA 1E32A 1E1RA 2G0TA 3CPEA 3AVTA 4KU4A 2GBLA 4TMXA 4C7OB 2WAXA 4URVR 1YZTA 4QGHA 2VIIA 2WAYA 1NVVQ 3FKSA 4HUQB 4LJ8A 4W7SA 121PA 1T0JB 3TR5A 2LWIA 4BFSA 4OHZA 3TW4A 4PHGA 2WHXA 3ZVLA 4LYHA 4HDOB 2RGNC 3LH5A 4OHVA 4KV9A 4IVQA 1OFTA 4JIMA 3NBZC 2REXB 2E1RA 3C4JA 1SULA 4RD2A 2FPLA 1JJ7A 4AYWA 2B6HA 2J3EA 5FFMA 5IRCD 3PEWA 1JAHA 3I1FA 3KJIA 3KQUA 2WKRA 2P6UA 4O25A 1T3LA 4NYIQ 3Q85A 1UJ2A 1LS6A 3U3OA 4MDEA 2CXXA 4XD7D 3A1UA 5FBWB 1S9HA 1XD8A 2FA9A 3NKVA 4QFMA 2V8OA 1NRJB 2ZIAA 2G83A 3IEUA 3DEFA 3CR8A 3R9IA 2JEOA 4R9UC 4DIDA 4AKIA 2F3TA 1YZQA 4AC9A 3ADBA 3DDCA 4B76A 3KFVA 2QGNA 3ADCA 3BK7A 3N2IA 1OT3A 4KFUA 3WRXC 1GVNB 1ZD8A 3MUFA 3NHAA 2GEVA 1YJ5A 4A0GA 4A2WA 1G8HA 2CL7X 2WWIA 2JLSA 4BZQA 1XMSA 2JJ1D 1XJQA 1W0KD 2DWPA 4D6PA 3AVUA 2AD1A 1SKQA 1ZJ6A 4NBSA 3L0IB 3CWQA 1ETUA 2QT0A 4EKDA 4C0HA 1HURA 2VPPA 1LNZA 521PA 4D4LA 2W0SA 2QBYB 2ZRNA 2XSZD 4CIDA 1Z6YA 3NBFA 3MGCA 3K0SA 2OCAA 2C9OA 2J0VA 1VG8A 1OF1A 2V1XA 4JLPA 4B71A 4MYTA 2XX3A 1JECA 1KMHA 1CJKC 2R6CA 2FWRA 4EPVA 2B8TA 3SBDA 3C16C 3QBTA 3UG6A 3W6NA 4DEYA 1OLOA 3BFVA 1G9XA 3FFAA 1KAOA 1QHNA 3EG5A 4A8JC 1F2UA 3MJHA 2IYZA 2NZ8A 3WMGA 2XZOA 3B85A 2QTVB 2REBA 3UMFA 1EFCA 2CLCX 4JZKA 2ZRJA 1XWIA 3EPJA 1XCGB 5SZHB 2D7DA 4GL2A 1YZLA 4NHOA 1E9FA 1ZM3A 2RGBA 4JLBA 4TL6A 4B3DA 2GK7A 4ACAA 4QL3A 2AL7A 1G1MA 1TEVA 4QGGA 3R20A 5TB5A 1WA5A 5IDVA 1E69A 1QHIA 4Q03A 5JS8A 2V9PA 1R2QA 3B1WA 1PUIA 3JZMA 2DWOA 5CB8A 4AWXA 3GP8A 4LUCA 2XJ4A 4NU0A 3CF0A 2OUKA 2EYQA 1NL3A 4DDTA 4B3CA 4PSAA 1G8FA 3B60A 2Q0HA 5H8WA 2PJRA 5EXTA 4KSBA 2FPMA 3Q9LA 3IKJA 5LDDC 4YDHB 1W5SA 2GZDA 1D2MA 3QEOA 1W46A 2HCBA 4IDHA 1KK1A 1MO3A 5JHGB 3IDQA 5AJWA 3CF2A 1D9XA 4OJKA 4QBGB 1EFTA 1XB2A 4P0TA 3L43A 2ZRCA 3QY0A 4IW3B 4NONA 4IEIA 1P2SA 3ZS9A 5HPYB 2GXQA 4PQYA 5J4KA 2IYRA 3BOSA 2XNSA 3V4RA 3EC1A 4DKXA 4AKHA 2HXYA 4B2IA 1SGWA 3AP2A 3AF0A 4R2IA 4Q4AA 5E3HA 2FEOA 1XPUA 3BB1A 4FIDA 3OZXA 4FW9A 4EPYA 1MV5A 3GLHE 1KNQA 1P3JA 4RZUA 4AG5A 3OEHD 5CJPA 2QMEA 3WBKA 2BKEA 3QXSA 1IJEA 1WRBA 4OKSA 1MH1A 3KTAA 2XB2A 1MR3F 3TUJC 5CYPA 1AKYA 1IN7A 2XGJA 4YC7A 1JXOA 1RRGA 4Q1FA 3H4MA 3NIBA 3LBHA 1XEFA 1DG3A 4G5SA 4YXWA 1RRFA 3KXIA 1Z63A 2CHGA 2P5TB 1NN0A 2GNOA 4TTPA 1N2CE 4UJ3A 3OAAD 3GLHB 4L4UA 5EXXA 4F7WA 1VHLA 2FNAA 3BORA 3VNVA 2ZU6A 2JGNA 3OIUA 4WA7A 2AN9A 4JVNA 4LBYA 2QE7D 2YNMA 1KI8A 4Q19A 4BQSA 2ZRLA 4HZUA 1TUIA 1LV7A 2CLDX 1P73A 1EK0A 2YJTD 1ZCAA 1OKKD 2ERXA 3GEIA 4PQFA 1YRAA 4PZZA 3B1YA 4HSEA 3SC3A 4M8NE 5KNCA 1JPJA 4OI2A 3PUWA 1HE8B 4C0LA 3AM1A 1UEJA 4KFSA 4ASUD 2OFXA 1E2HA 2J1LA 5EE0A 2GAAA 3QKRA 4LHVA 4PPNA 4RZXA 4WXRA 3W8RA 1P62B 4A36A 1N6OA 1G3UA 3EW9A 4A0HA 4K81B 1E99A 4HLCA 2EFEB 4DLZA 2FFBA 4Q66C 4PXAA 3RVBA 1E2GA 3E5HA 3IEVA 1MOZA 4U7DA 4GMDA 4Z51A 5KU1A 1FNNA 4PR0A 1GP2A 1J8YF 1W1WA 4MRRA 2C03A 3UPUA 5BN3A 4UNPA 1NG9A 2HXSA 3SQWA 1KO7A 3L0PA 2IYLD 2Q9AA 2EW1A 4TL8A 3HYTA 3OESA 2O8EA 2EWWA 3PV0A 2KB0A 2DFKB 3P32A 4TZ6A 2IEZA 1UBCA 2OLKA 2WSMA 1D5CA 1ZP6A 4PC7A 1KI7A 1ZU4A 2XZPA 2GZHA 2NQ2C 2ONJA 5LB4A 1Z6AA 1XJ0A 4TT3A 3T61A 2O8CA 3SNHA 3CX6A 3KKPA 3A6PC 2GA8A 1KMHB 1W7AA 3FKSD 3QKUA 4M21A 4N0DA 5GVSA 4PSKA 1EX7A 1W47A 3NHBA 2O0HA 1DEKA 2R65A 5FPYA 3WRYC 421PA 1ZINA 5K8TA 2IYSA 3GJ7A 5TARA 2IS4A 3EC2A 1Z0KA 2ZI4A 3SYNA 4L15A 2IS2A 4KBFA 1EWQA 2AFIE 3CONA 4B33A 3A1VA 3GFOA 3KJHA 1K8RA 4JMPA 2G1JA 4RD1A 5FPSA 1XNJA 3TBKA 1YVDA 1HY3A 2SHKA 2R6DA 3X2SA 2ZE7A 4M1SA 2C95A 5KPDA 3FHTA 1KO4A 4IDOA 3U7FB 1DAEA 2G88A 2J0QA 5JLJA 2IYTA 1P6XA 3RABA 4GDFA 1QVRA 5EE1A 2CCJA 3QVVA 5EE3A 2ZRBA 4GRAA 1R0XA 3QQ5A 4WAUA 1UBGA 2OCYC 4PFSA 4GT1A 1W5TA 3RS3A 1CR2A 2BBOA 4LBVA 4P4TA 2WIBA 4DB2A 1XD2A 3T35A 1R10A 4TSFA 4ACBA 2WIAA 5EZ5A 2CMKA 2IYWA 4B43A 2WMOB 1JR3A 4R2HA 2MSEB 5CDFA 3X1XA 4A82A 1YZUA 1Z06A 5FBLB 4ARZA 4C0KA 1SQ5A 3R7WA 4KCGA 4Q47A 1U8ZA 3MWYW 2HYDA 1E94E 3CH5A 2XTMA 3AGQA 3NVAA 3HDTA 3Q7PA 4OL0A 3T1TA 3LVRE 3U60B 2X8AA 5AJVB 4R98A 1SHZA 4Q4AB 2VA8A 3P20A 1P9NA 4HLUC 1AA9A 2OCPA 1OJLA 4PC2A 2JIZA 2ZR9A 3IILA 1VCMA 3NBYC 2ANCA 3VHLB 4Q48A 3MLEA 2QROA 1KZGB 2FF7A 1F3OA 3BXZA 3LXXA 2G77B 3H0KA 2RAPA 2V55B 3A1WA 1JR6A 2YOFA 3GEEA 4EJSA 2ZRIA 3ONWA 5UKDA 2RB4A 2ZYVX 1FZQA 4ZIRA 3PEVA 3KTAB 4D82A 4MRVA 1W36B 3AVYA 4BFWA 3BAFA 1NI3A 3THWA 2IK8A 1UKZA 2PT5A 4JLKA 4D0NA 4O2RA 2IHBA 2XNDD 1NBME 3GD7A 2Z4RA 3V4FA 1XEXA 3PXGA 4TYWA 4FMDB 4KSCA 1GZSA 1N0WA 2A5GA 1TUEA 2HLDD 2YWFA 4AK9A 2QA5A 2ZJ5A 4QJ5A 1OIVA 3W6OA 4TL9A 3HU2A 5DLQC 5DI3A 3TAUA 2OILA 4HZUB 2GXAA 4AIIA 4UJ5A 1BS1A 3PIRA 1ZUIA 2VHQA 2IYUA 2KBFA 5JCPA 1Z0JA 1J7KA 5DYGA 2GESA 2X77A 4GOJA 1WXQA 3PITA 3K8YA 4U02A 2Q9BA 4OQLA 1XU4A 3ZZ0A 5A5GA 3LLUA 2VSXA 3W5IA 3GPLA 1OH6A 3OIYA 2XJ9A 2H7VA 1WMSA 1U0LA 1ZM7A 2GEUA 2CCGA 1SVLA 2QEQA 3PVSA 1KAGA 4BLSA 1G7RA 4P33A 3QKRB 4RKFA 3AVXA 2GTPA 4TYPA 1EFHA 2ANBA 3KX2A 1JBKA 2HJGA 4LI0A 1P9RA 4PZLA 2JCSA 2R8RA 3QI2A 2BC9A 2GJAA 4PHHA 4GZMA 4A0RA 4ABYA 4GNKA 1NNEA 3KXKA 4PAOA 5FOSA 2RGNA 1E0AA 4K46A 4DSOA 3THYA 5EUQB 4LBWA 5DN6A 2XXAB 4GMXA 4DLUA 2AXNA 4I1VA 4DCVA 1Q12A 1Z2CA 2PEYA 1U81A 2HF8A 2ZS9A 4ZI2A 1YQTA 1VCIA 4MDFA 4TMKA 4BASA 4B6FA 3K1JA 2OBLA 2C99A 2X1VA 1NMXA 4ZI3A 3FTQA 1W36D 1ESMA 4I1OA 3DMDA 3QKSB 4QOSA 5JMTA 4IDQA 2O8CB 3BH7A 4YXWD 4D2IA 4Q1AA 2GILA 5SZKB 3RS2A 3GLIA 3ICEA 1I4LD 2QP4A 1SZPA 4TLAA 2WJHA 3PEUA 4AKGA 2ZJAA 1Y63A 1N6RA 4N1AA 2WWHA 2N1BA 821PA 2ZJZA 1NVXQ 1E2EA 4Q7JB 2GCPA 4XWAA 3I72A 2ORIA 2ZE6A 4HUQA 1OB2A 2ZUBA 3LBNA 1R7RA 4BFZA 4DLVA 3KQHA 1YHNA 2OEPA 2BJWA 3D8BA 2XTNA 3O47A 2CL0X 1Z83A 2QI9C 3LW7A 1YRBA 4OQMA 3DM9B 3VR4A 1KDTA 2AK2A 2QPOA 1TX4B 3IIJA 5G3YA 3E70C 1JR3E 3QXJA 3VKGA 4F38A 1KI1A 3UG7A 1OXSC 4MGZR 4FWTA 1LS1A 4QHTA 1RC8A 4C4PA 2JLXA 2XB4A 2O8DA 2ZR0A 3BIFA 3HP1A 1YZGA 4NCKA 3ZGXA 3ASYA 4A8JA 1CJTC 1JQJC 1NMYA 1W4RA 2RH5A 1A4RA 3L82B 4Q9HA 5FOUA 3O8CA 1UFQA 2WKPA 1XD2B 3AVWA 4HLQB 2FX3A 2F1HA 3PG5A 1RYHA 1KO5A 1UKEA 3RSOA 5DISB 1N0UA 3DVLA 1KK2A 3T1QA 4Q4LA 1DAIA 1VG0B 2QSZA 3IBYA 2IBMA 4DLTA 3GQBA 2BBTA 1U94A 5C4GB 1KNXA 1ZMXA 2CDNA 3QKTA 2ZANA 1E2PA 2B7CA 2CHVA 2JAQA 2ZI6A 3MWLA 5KYKA 1TU4A 4NH0A 4TT3D 1XD9A 4KLZA 3DZDA 5EUMA 2OESA 2W2TA 1ZUNB 2WJVA 1XX6A 1IN5A 1E0SA 1KI4A 4JVSB 4LYAA 3GJ8A 3SYKA 3ND8A 1OFUX 3AH8A 2VHUA 4JLJA 2OSBA 4EJSB 2YZ2A 3DOEA 2OE2A 4KHZA 5JZVA 2IXEA 4ZIRB 1D9ZA 4LYFA 1T3SA 3IO3A 4TLEA 4WIAA 3BB4A 3B82A 4QBHA 2O0JA 1DVRA 1E3MA 1R0ZA 5DSZA 3THWB 2QQ0A 4Q1BA 2WKQA 2ZJ2A 4MH0R 3LQRA 1G19A 2FU5C 1CRQA 1Z6TA 4KO8A 3RAPR 4TYQA 4QJ3A 3EZ7A 5J40A 1IY0A 1I4DD 1RW4A 1DTSA 3TUIC 3VU9A 3O8RA 5DI3B 3DM5A 3I62A 4NCIA 2ATXA 1OXVA 4W5WA 2G0NA 1GIAA 4R71A 2O8BA 1H65A 1GKUB 2AR7A 1VDZA 3T5GA 3VKHA 3CBQA 3FMOB 221PA 3CIOA 3LFUA 4IXNA 2Y8EA 4AYXA 1G3MA 2WVJA 3ZD6A 4DXAA 3MD0A 5D3QA 1NLFA 1HQCA 3TVTA 1KY3A 4FWIB 3F5FA 3KB1A 4RCYA 2ZSAA 4P4SA 2CNWA 2YWHA 4OK6A 4TSFD 1WP9A 2ZI5A 1DAMA 1YU9A 1JR3D 1NVVR 4AG6A 2JLRA 3GLFE 3C7KA 4OQNA 4WOPA 5B2ZA 2WWXA 2QPAA 3GCGA 1XEWY 1M7GA 5HE8A 4LHWA 4FMCB 3IPXA 5FTLA 2H18A 1JEDA 3WXMA 1XXHA 1KJWA 4RD0A 4ZDIA 4KVGA 3NXSA 2NO1A 2ZTSA 1E9DA 1M34E 1EFUA 3THYB 2JIZD 1E2MA 3GLIE 8OHMA 1R8SA 2AX4A 1COWA 4NYIR 3GLFB 3JZAA 3EZ9A 1PJRA 5E7JA 1TEXA 5HCNA 1T3HA 3KKOA 4AURA 2DWQA 1W4CA 4HLDA 4J0QA 1NVWQ 4RJLA 2J87A 2W6IA 4Q7LA 4C0SA 4F4IA 5BYJA 3Q8XB 4E22A 4EFMA 5TXGA 5KO2A 5FR1A 2YOHA 2ZRKA 3W34A 1N5JA 2BBSA 1E4VA 1KKLA 3JVUA 1OW3B 4MRSA 2NO9A 3GLIB 1OV4A 1JEEA 2PH1A 2QENA 2FEMA 4EAQA 5CB6A 1CEEA 2HV8A 4XIGS 1IHUA 1LB1B 1W2HA 3Q3JB 3LY5A 2EYUA 1BYIA 3RS7A 3V9PA 3F8TA 1AK2A 3CO5A 2ERYA 2CHQA 3ZVMA 4HAVA 4ZDKA 5FOXA 4Y0AA 3NC0C 2C2HA 3W9YA 1T91A 4PAQA 4ITRC 5GADl 4B3GA 3K9NA 2WJGA 1NP6A 1IOZA 3GLHA 1XBTA 2Q9CA 4CT5A 3EZ2A 1M7BA 3QPWA 3F3YA 1T0HB 5CITA 2CVHA 1HYQA 1T8UA 4BFUA 2WMNB 2C9CA 2WPDA 4OBEA 3R8CA 4UNNA 3RSLA 1O3YA 4ZDJA 1FTSA 5IHPA 4LJ4A 4LJ9A 1GTVA 2C96A 3VR2A 1X8LA 4JBWA 4RSGA 1N0VC 5BYKA 4A2PA 2QM8A 1KSJA 5FUYA 2O8DB 2NIPA 3AF3A 3HPRA 1G8PA 4URUR 3LQQA 4A8JB 3MWJA 1W48A 2F9MA 3AP3A 2RGXA 3K0CC 4KFRA 4M1KA 5DN6D 2WV9A 2VHCA 5FH9A 4V0NA 1XMVA 5KTYA 3MRSA 1P7CA 2P6RA 2DB3A 3A1TA 4RCZA 4LJ5A 3CH4B 1JNYA 5DIFA 4QNRA 5DE3A 4E03A 2OAP1 3A58B 2QY9A 5LD2C 1QF9A 1XTIA 1N25A 4LYJA 1XZPA 4B3FX 2KI5A 5FPTA 1G7CA 2BOVA 1EFRD 3M6AA 4IJMA 2MSDB 3I92A 1CKEA 1OSNA 2X2EA 3FVQA 1ZC3A 2G1KA 3BS4A 4TLDA 3SQXA 2RMKA 2DFLA 4C9BA 1ZIOA 4TQAA 4UKDA 1ZU5A 4XTCS 4M9ZA 1MABA 1E1QA 1OYWA 1RKBA 2DPXA 4IEEA 5DO9A 4XSGA 4TQ9A 4XWOA 5KDOA 2VHTA 2ZRGA 2QNRA 3RC3A 4LGMA 5JEDA 3EIEA 3FFBA 4A4DA 1HQYE 1X8KA 2FZLA 1XTRA 1E9RA 2VRWA 3QNUA 3AKEA 4AKEA 1GNPA 2ATVA 3LLMA 3I4LA 4GP6A 4O3MA 2OBMA 1U99A 2VTKA 2YWGA 1G5RA 4D26A 4OQXA 1UBFA 1ZW6A 2PEZA 2QPTA 2ZYUX 2FGKA 1DO2A 1F2TA 3VU9B 2O8FA 1G16A 4RD3A 4HLUA 4B47A 1A2BA 2QTFA 2QU8A 1HUQA 3AVQA 2O8BB 2IXFA 4PO1A 3VR6A 3PUZA 4Q5IA 1NF3A 1OIXA 5DHAA 1IY1A 1XXHE 2A30A 2ZRFA 5K8LA 3DPUA 5FOVA 4FMDF 3FMPB 1JAIA 4P4SB 1Z29A 4G5QA 1FUKA 1G7TA 2LKDA 3M4YA 1B23P 4TMTA 2ZEJA 1RFLA 1G21E 2J46A 1U0HC 2ZSBA 4BLPA 1P2UA 2EQBA 5DYIA 3MAAC 3RLFA 1KSGA 4DSTA 2ECKA 1J8MF 1FOEB 2VP2A 4CEHA 3OFNA 2QT1A 1YR9A 5BXQC 2AKAB 3K53A 3KUDA 5JFGA 1GUAA 3VX4A 1SHKA 2P6NA 5TDHA 1XXHB 1LW7A 4IVRA 1EWRA 1HT1E 1TQ6A 2FE4A 1BIFA 1R0YA 2W00A 4M9QA 3BFXA 1UBEA 2Q6TA 2ZI7A 1ZYUA 2G9NA 1KJZA 1RIFA 3ICQB 2PT7A 2A5FA 4PQRA 1FMJA 4LSGA 2BKUA 1ZD1A 1NY5A 2Z4SA 1G8GA 1UPTA 2PLFA 4US0R 1Q1BA 3QENA 2VF7A 4LX0A 1Q20A 3QEJA 1UKYA 2R9VA 3FMFA 3I8SA 3RRYA 3O8DA 3TSOA 5JI3E 3AEZA 3ECCA 2VH5R 2ZRMA 1KSFX 4M4SA 3PUYA 4BGDA 2ZITA 3RS5A 2H1LA 3TSWA 1UDXA 1SVSA 4IFEA 4PSVA 2J7PA 1AM4D 4LCBA 4POAA 2BM1A 2IL1A 2ZPTX 3B1XA 3H86A 4AYTA 4L16A 4B35A 3SYLA 1JQLB 5DH9A 3B8HA 2HF9A 3AVVA 1YZNA 1CR0A 5ANRB 2ZRPA 4DSNA 2ZETA 1DBSA 5FTMA 4D81A 1G17A 1N5LA 1L2TA 4WVFA 2JJ8A 4JL8A 3LW8A 3K09C 2L0XA 1ZNYA 5JWOA 2ODBA 3I8XA 2OM2A 1AQUA 3DKPA 1CJUC 2CNWD 1I4TD 4IOLA 5BWMA 2GJ8A 3F0TA 5JEEA 3IIKA 2ASEA 3TUZC 2AHOA 4B2LA 1VYUA 2PZFA 4R7ZA 3X1WA 2IX3A 4M1MA 2W6JA 2ZS8A 3IBGA 2XEXA 1NBMA 2Z0MA 4LJAA 1TMKA 2W2VA 4OQFA 3GMTA 4OHWA 4Q9IA 1MO4A 3FPAA 2H5EA 5E7IA 1BKDR 2WJJA 5TV2A 1FP6A 2HCJB 3UKDA 2YHSA 4YQFA 3AF4A 1CRPA 2YVUA 3RYTC 1S2MA 3NG1A 2CL6X 3RANA 1LFDB 2OZEA 3PEYA 4Q7MB 1NMZA 4JYBA 4PPGA 3IUYA 3SZRA 2P65A 1N5KA 3RRZA 4MYCA 3QF7A 4PPQA 1G6OA 2I1VB 2XAUA 2Z6VA 2A2ZA 3KDSE 5HZKA 5F9HA 2PCLA 4MYUA 4D25A 1TADA 4RZ3A 2CCKA 1G3RA 2W6ID 5A0FA 4DDVA 2XXAA 5JS7A 1KI3A 2CLSA 1U9IC 3VAAA 3SJCA 3LBIA 4L5BA 3NDPA 2JLWA 3REFA 4M53A 1M1YE 2AWOA 3CRMA 2JLYA 3QF4A 1OPXA 4M1WA 2R6AA 4IOMA 4D4KA 3EIHA 3QKSA 2G3YA 1E1RD 1MABB 1UAAA 3A1SA 3ND9A 4LJ7A 2JDIA 1NSTA 4DCUA 2GWHA 3QBVA 1X3SA 1ANKA 4BLOA 3OEEA 3UANA 4US2R 2I1QA 3FWYA 3C5HA 4CEJB 6Q21A 1PZNA 3SBEA 4RFSA 4ZPXA 4NE2A 3VHXA 2ZR7A 3CNNA 2ZREA 1O87A 1XCMA 5JHHB 5KOYA 2WPDD 2RCNA 3CRQA 5CLLA 4HDQB 1PUJA 5AJYA 1E2KA 1F2TB 2O8FB 1GL7A 2JJ2A 1SVIA 3REGA 3SFVA 4EPTA 2QORA 5FUVA 4KVAA 4B44A 1VECA 5CM9C 5JBQA 4Q02A 2H16A 2ZI9A 3CNLA 3P27A 3U3RA 4JS0A 2IUSA 4Q4HA 1JALA 3EAQA 1KMQA 3MFYA 4H1UA 4QXAA 4Z54A 1GRQA 2ZI3A 5EQTA 1EG7A 4CEHB 2OAQ1 3B1ZA 5AR1A 4XH9B 3R9XA 3U44A 2EFCB 2C9YA 4FINA 1S3SA 1S4QA 3I73A 1IXRC 1R6BX 4BZPA 1VMAA 3AF2A 3B9PA 2BMJA 3T1VA 2XZLA 3ZD7A 1TF2A 2WZQA 1R4AA 1JPNA 2UZIR 4HAWA 4CZ2A 3U3JA 4S2EA 3NEYA 4QNMA 1WF3A 1NIPA 1XCPA 4BEBA 4QC2A 4KI0A 3WHLA 1PV4A 3IHWA 2PMDA 4FMCF 4V0LA 1E1QD 2VYFA 2DCUA 2REOA 4FCTA 4DLWA 1PLKA 2RHMA 3Q5EA 1Q3TA 2J0UB 2R62A 3CF6R 2OLJA 1T8TA 3EWAA 4U5XA 4CDGA 3GEHA 1QBKC 1QHXA 5D3MA 1X1RA 2P3SA 4D0GA 4MUBA 2FDCA 3WYFA 4Q00A 5B30A 1UEIA 2OHFA 3U2QA 2LKCA 1ZUHA 1C1YA 2LCFA 4XVQA 4TYYA 2IYYA 3I61A 1RJ9A 1DELA 2ZJOA 3B2EA 3WNBA 4JSTA 5J4VA 3WYAA 4ESHA 4JL6A 2QGZA 5JSZA 2OXCA 1TF5A 5KPJA 2AFHE 1W4AA 3BWDD 3BB3A 2HJVA 3K70C 3FB4A 1ZNWA 1BOFA 2NPFA 2IWRA 5EE5B 1Y3AA 2ZYTX 3GFTA 1SXJC 1Z22A 3O8BA 1HT2E 3N2EA 2H92A 3QIAA 1E0KA 3RWOA 3W3ZB 1AN0A 4DC9A 3LVQE 2PJZA 5L3SA 2GJKA 2E9SA 3WMEA 3ZZTA 1KOFA 1JXMA 2QSYA 4CVNA 4URWR 3B5JA 3EARA 3OFND 1IXZA 3EPLA 1YR6A 2BCGY 2D3WA 5KNBA 2F55A 1Z3IX 2B21A 4A6PA 2GAOA 3A4LA 1FW6A 4A9AA 1K5GA 2FGJA 4NYMQ 4LDJA 4B73A 2BCJQ 5JCZA 1G4UR 2MMGA 2YOGA 4LZZA 4DCNA 3THXA 4MGIR 4II7A 3FE2A 2WBLC 1XZQA 3VR3A 4QBFA 2GF0A 2H17A 1L8QA 4I4LA 2EVWX 2B8WA 3KB2A 4Q9LA 5J4LA 1ELOA 2QZ4A 4Q7KA 1A1VA 3BD9A 2ZSEA 3SI7A 3FOZA 2F6RA 1KKMA 1N6LA 5AK0A 1IXSB 1EXMA 3GLFA 1KO1A 1FMLA 3B9QA 2OCBA 2Z83A 2WOOA 1FFHA 4B75A 2BV3A 1ESNA 2J7PD 3DL0A 3P4YA 4N0EA 4Q21A 4F4JA 3P26A 4GPTA 1SVWA 4TLCA 3QF4B 4WZBE 2Z43A 1DPFA 4HAZA 4KYIB 3CX8A 1NKSA 1A82A 3K9GA 4WZ6A 3TK1A 2ORVA 4M1OA 2AXPA 5KUTA 2IS1A 5LPNA 1Z2AA 3K0CA 4TN1A 3KFXA 5JJIA 5FOWA 3U3KA 5C4MA 1MT0A 5B58C 4JT2A 1Z07A 4FMBB 3THOA 1DADA 2QQEA 3BGWA 2YWEA 1G3QA 2VL7A 3KUCA 2FFHA 2ODNA 4RFSB 2W2XA 2VSOA 3GJ0A 4MQBA 2QMOA 1W0JA 1GM5A 2F1RA 4TZ0A 4LC0A 2W6JD 1AS2A 2JJ1A 2ZE8A 3QPVA 5K8UA 1NBMD 1QVAA 1E2IA 2CBZA 1M2OB 3LX8A 1QHGA 4CYMA 4HB2A 3KQKA 1FX0B 4Q18A 1NLZA 1R5BA 3SJZA 1AIPA 1M8PA 1U0JA 1LTQA 2JLUA 1VTKA 5FOTA 2QP9X 4Z1MA 4UNRA 4MUAA 4Q4HB 1KZ7B 5FI0B 3LD9A 2XOKA 4MRNA 2OFOA 2WTUA 4KODA 4ZDWA 3LAWA 2F7SA 1NLYA 1PLJA 1KK0A 2GXUA 4E5UA 3FYHA 1EGAA 4DEXA 3ZLJA 1E0JA 3TSZA 1XF9A 2VBCA 3A4MA 1C4OA 3U44B 3GJXC 1GL9B 1FQJA 4M9SA 4RVCA 4E07A 2IYVA 4NL4H 1DAHA 3I3SR 1VPLA 1XMIA 3QPUA 4IVPA 1TTTA 1S0UA 2IXGA 3K0EA 1A5TA 2JATA 3VNUA 2NGRA 3G5UA 5KHOC 1P9WA 5C18A 2P5SA 1RZ3A 2ZSFA 4M22A 4XJXA 4A0FA 1GNRA 3D6TB 1FQKA 4FN5A 4KLNA 2AK3A 3CNOA 1N6IA 5SZIA 2F9LA 1G8YA 1U8AA 5M04A 5C1BA 4LK2A 1G41A 2JDID 1K6MA 3Q5DA 4TMVA 5CJ2A 3OEED 2BBWA 3KL4A 2NG1A 5EXSA 3A37A 5D3MB 4LV8B 3A4NA 3S1AA 4EDHA 2A78A 3B6EA 2XITA 2RGCA 3IGFA 5F2EA 1RJ9B 2G6BA 1FPMA 2QN6A 4NKRA 3DMNA 5JSZB 3GJ3A 4JLDA 4Q1CA 3HYRA 3J81k 1NJFA 4PO9A 3OE7A 4EIWA 4JBXA 4UQOA 4WW0A 2ZUCA 2BMEA 1E2LA 3PUVA 5FTJA 3SS8A 3T5DA 4ERNA 4JBYA 1OB5A 5AUOB 2R44A 1IAQA 1ZNXA 3KKQA 4AD8A 1S1MA 1E9SA 3PQCA 1ZC4A 2YYZA 1QDEA 3TQFA 4MKIA 1CULC 5L3SB 4LPKA 2BM0A 2GKSA 4QRHA 4EPRA 1XTQA 4NMMA 5FBVB 5C46F 2AWNA 4W5HA 1TQ4A 3TVDA 4BFTA 3TGPA 4RY2A 3D3QA 5AJZA 4NCNA 1D2NA 2F43A 3CRW1 4C0BA 3FGNA 3WP1B 1TF7A 1J90A 3T34A 4F4CA 4XWKA 4US1R 2BWJA 5IK2A 4D0LB 3DZ8A 5TMPA 4AI6A 1GAJA 1EX6A 1TNDA 3THXB 2FSGA 4V0ME 3RDPA 2IYQA 3K09A 2C5LA 4M1TA 3KKMA 2B7BA 2BMDA 3CX7A 4EFLA 2QAGC 3C5CA 1L4YA 4LPSA 4TYNA 4LJYA 5LBIA 5IF9A 4N3NA 1CLUA 1P75A 2V54A 4C3ZA 4F91B 2EFHB 4BLQA 1D8TA 3I5YA 1G18A 4ZKEA 1QRAA 3BBPA 2YC4C 2ZRDA 2VEDA 3M1IA 2IWHA 2P67A 5GJBA 1G6HA 1VCOA 3RS4A 4IHQA 2ZYWX 1P61B 1II8B 2IS6A 3CLVA 2V1UA 3QUSA 4BLRA 5FTKA 1P2VA 3OIVA 2ZRHA 4H9GA 1RPZA 2N42A 3IQXA 4CRWB 4FXPA 1OIWA 4DBLC 4HAYA 4QGAA 3WMFA 3AP1A 3PENA 4C2TA 2R6GA 1GWNA 4KFTA 5FL7A 3DO6A 5EP2A 2NMVA 3ZYCA 3ZDQA 1DAGA 4Q01A 3NH9A 1IN6A 1L7VC 4A6XA 2F1IA 1F60A 4HAUA 5ELXA 1CR1A 4DB4A 4LHZA 1W2GA 4ZV4A 3L0SA 3QXHA 3AKYA 2NZJA 3SHWA 2GETA 3AB3A 4PHTA 4NDZA 5LD2B 4RKEA 5AUNB 2GEDA 1KYIA 1NKTA 1E2JA 3L8YA 1RVDA 1U9IA 2N46A 3U5ZB 2CJWA 2JLQA 2A5DA 5FI1B 2V4ZA 1R5NA 3TRFA 1BYUA 1T5LA 2BEKA 2MSCB 5E4FA 5J4YA 3R8FA 1G5PA 3VR5A 3AF1A 2A9KA 5KSZA 4PX9A 4DUGA 3GJ5A 2UZ3A 3U61B 3SHFA 2FH5B 3HJNA 4P31A 4HDCA 1XTJA 4DJTA 2VP9A 1DAFA 1VCNA 5JI2E 3ZH9B 5GJWC 3U6KA 1N6HA 2ZRAA 1C9KA 1GKYA 1KY2A 2OV2A 2GJSA 1JI0A 3MCAA 4NCJA 3EPKA 1W4BA 3EZ6A 4IOJA 2D2EA 3SN6A 2GK6A 3CUEF 5CIQA 3U6BA 3MSXA 4U00A 4Y0VA 5HTKA 4GZLA 4DVGA 3RNLA 1G291 5DHFA 3K9HA 1ZCBA 1NY6A 3TAHA 1IY2A 3TMKA 1K5DA 1DG1G 1VHTA 5GJVC 2V7QA 3TW8B 4URXR 1YKSA 1Z0DA 5JWHA 3WY9A 5J47A 1GRNA 1CIPA 2EFDB 3AVPA 5H68A 2RKOA 2JLZA 3GFPA 1E96A 1IQPA 5FUWA 4BWYA 5DNYB 3ZVRA 3U3MA 1G7SA 2GCNA 1PVOA 3HR7A 1TQ2A 3CWZA 4OK3A 5HE9A 1GFIA 5JJLA 5TVKA 3DKVA 3TLXA 1MRNA 1SKYE 4BE7B 3JVVA 2GF9A 3BH6A 1GSIA 2C77A 4QJ4A 3LA6A 3VFDA 3NTUA 3TQCA 1AS0A 2PX3A 4DHEA 2BMFA 3NWJA 5CLQA 5BQ5A 3S1AB 5L3VA 3U4QB 4JLAA 1W0JD 4IKEA 1MO5A 4L8GA 3QG5A 1NN1A 3LDAA 5J4HA 4F93B 1Z08A 3QXXA 4CEJA 1KDRA 1KSHA 4UXJA 4L9WA 1V5WA 2NO7A 3OHMA 1S96A 1SKYB 5FR2A 4EUNA 2AKYA 4HUTA 1F5NA 2CEAA 1QHSA 3AKCA 4JJZA 1IN4A 2BIFA 2J45A 3FKQA 3WNCA 4Z1MD 1YZKA 1P5ZB 2XOKD 5F9FA 3GLGA 3ZVNA 1DARA 3GJ6A 5L3QA 2PMKA 1KDPA 2HYIC 2ZJBA 3G0HA 1OHHA 4X8OA 3ZIAA 3L0OA 3EIQA 4LV6A 1Q21A 4PC3A 1E2QA 4OJQA 3P1JA 1IJFA 5G53C 3VX3A 3MJRA 4C30A 2F1JA 2F43B 1NVUQ 2PCJA 2XTZA 1II9A 2IYXA 2XNDA 2RGDA 3CZQA 3WNDA 4JLNA 1AS3A 1DO0A 1NN5A 1H8EA 1N5IA 4BEJA 3KZ1E 1ZM2A 4DRZA 2QL6A 2HLDA 1OFHA 3DOFA 3NBXX 4XTRA 2JA1A 2P0EA 2W58A 1SXJA 1DS6A 3R9WA 1N3BA 4M9XA 1VG1A 1G3IA 1YE8A 1R8QA 5G41A 1WCV1 5P21A 1GKIA 4D80A 4EQ6A 1P60A 4OI0A 2J9RA 4KAXA 1BO6A 1FNMA 4OK5A 3T06B 1ZD9A 4QM6A 4B48A 3CR7A 1ZVQA 1XRJA 1JJVA 1H8HA 4Z8YA 3KKNA 1T4GA 1GILA 4HI0E 2JASA 3FHOA 1CBUA 2IT1A 1FL9A 4O0MA 4PTLA 5C2JB 1HE1C 1MO6A 4B3BA 3TH5A 4Q9JA 4IDPA 4JSYA 4RZ2A 2D2FA 2J0UA 2CK3A 3GJ4A 4DDUA 2CE2X 4BRUA 1CU1A 4A92A 5K8IA 3BRWD 1WDTA 2I3BA 3OE7D 3CB4A 4YMVA 1S3GA 1JB1A 3HU3A 5FPKA 2A5JA 4DLXA 1OH7A 3ZQ6A 2WJIA 3TE6A 2OO7A 2R6FA 2O5VA 3CKLA 1YR7A 2V6JA 4DSUA 3SE0A 1ZRHA 2QUZA 2GDJA 2CJWB 3OIWA 1AZSC 1OXUA 4KYUA 1KTVA 1RYFA 4NCHA 2QP3A 3B1VA 3PR1A 4RFVA 4B2PA 1WB9A 2IUUA 1CXZA 1E79A 4RD4A 3BFKA 5DI9A 3UMRA 1NSFA 1E2NA 2IF0A 1AQYA 3L2OB 3ZZUA 4LHYA 4XVUA 3B13B 1MKYA 1Q44A 2ZU0C 3WYGA 3VR1A 1Q22A 2VO1A 1CTQA 2J41A 4UXHA 5IK2D 4MRPA 3BC1A 4MKHA 5JRZA 2RGGA 1QHHA 3D31A 4TLBA 4PZYA 1GRRA 1P72A 4YMSA 1Z5ZA 2KJQA 4B3XA 5HKKA 5IT5A 1HEIA 4URZR 2DFNA 3TR0A 1Z6XA 1BMFA 4PC1A 2D74A 3N5CA 4EPWA 1GL6A 2ZQ5A 2VF8A 1YR8A 1SVOA 3FMIA 3LRPA 4JVLA 3AKDA 4QG7A 4AY2A 1J70A 1E9AA 1COWD 2ZAMA 5JJKA 3B78A 2OBNA 2W83A 4NPHA 4G5OA 1QG2A 3RWMB 1SVKA 4MKGA 4CGZA 4NYJR 5J5CA 4JVMA 4V0OA 4FD2A 1G64A 4Z8XA 1FP7A 2D06A 1DOAA 3W6PA 2ODEA 3WP0A 1E9BA 1UKVY 2ZROA 4NTZA 5G3ZA 4C0JA 4QM7A 1HH4A 4HB0A 4PHFA 1R5OA 4UXIA 2GRJA 2QMUA 5FL7D 4BFXA 2O0KA 3X1YA 2ZUDA 2NO0A 2F3RA 2FZ4A 4OI4A 3IHLA 4PC6A 3AGPA 5CM8B 2E87A 2ONKA 5H70A 4C2UA 2C04A 1FTNA 2JLVA 4WXPA 1SVMA 2H8KA 5EP4A 3RS0A 4EFNA 2ODWA 4KXFB 1GOTA 3C15C 4TTRA 4A2QA 5L8VA 1CP2A 3H84A 2GBLC 1FUUA 3IIMA 3GLGE 1CF4A 3QXCA 3RHFA 1M74A 1TPZA 3E2IA 3RRMA 5A4JA 1RE0A 3K0FA 1OFIA 5KSPA 4BFVA 4OHYA 1II0A 4HEJA 2OFWA 4MKFA 2WOJA 5LB2A 1UADA 4ZCIA 3UIEA 4DT1A 1NN3A 2VSFA 1IM2A 1L4UA 1M7HA 4TTQA 5E7MA 4DUGD 3U7HB 1N6NA 1KIMA 4MA4A 1NJGA 2H57A 3MG9A 4HYYA 4B32A 1X6VA 3GLGB 2WJYA 4FCVA 5CYOA 5L3QB 4P3YA 1VYVA 4QHYA 5DGXA 1OH5A 1E2DA 3OF5A 4TMZA 5KNDA 3H2YA 1FX0A 4NYJQ 5G40A 5SZJA 3BERA 3E1SA 3EZFA 5AWFC 1F2UB 1SXJE 4XOIA 5KSOA 2R2AA 5FBRB 3FDIA 4HAXA 1KI9A 3Q7QA 4IFBA 4LOAA 1XDBA 1X86B 4PAMA 4DLSA 1NG1A 4ZKDA 3EX7C 3QVUA 4Q1DA 2MMCA 2WSSA 4HB3A 2GCOA 1KDOA 1W44A 1V43A 4MITA 4QHSA 1E6CA 2V7QD 2KSQA 1U8YA 4WZAE 4I99A 2KBEA 4CF7A 4NZYA 1OH8A 3FHCB 1HA3A 2VHJA 3K70B 1TL7C 2IUTA 4I1UA 4I1SA 2WWWA 3X1DA 4A15A 1P4SA 1SXJB 3RRNA 1VIAA 1ZBDA 3CM0A 1DAKA 721PA 4YDSA 2YC2C 5HCIA 3EASA 1XTSA 4EQ6B 1AGPA 2OG2A 1N6PA 1U2RA 3KJEA 4ZCLA 2WWYA 1T5IA 2FFQA 2PZGA 5AUQA 1D2EA 3B7GA 3PJRA 1XTKA 2IHYA 5EP1A 4NYMR 4NP6A 5GVRA 2FPKA 2PBRA 1ZAKA 1NIJA 5CK5A 2VP0A 2FSFA 3X1ZA 2BVNA 3VTKA 5E95A 4UNQA 3BE4A 4HATA 4DDWA 4YLGA 2HT1A 3SU8A 4CEIA 1I2DA 1WBDA 3SOPA 4X8HA 2A5YB 5FPHA 3T1OA 1J99A 4LJ6A 2J0SA 4PO8A 3HPQA 2QAGA 4BFYA 1Q1ZA 2PL3A 1HV8A 1UF9A 2K5UA 4DLRA 2IF2A 3N70A 4YMWA 5BN4A 1OHHD 1ODFA 4G01B 2FG5A 4JLMA 5EP3A 1G5TA 3ZIAD 5JRJA 2HEIA 4CW7A 1KGDA 2CVFA 4OHXA 1VG9B 4QBIA 4X8MA 1TAGA 3PFIA 3M0EA 4L9SA 3K9LA 2GVZC 5L3RA 2ZVPX 4LV5B 1P2TA 1GNQA 3EA5A 4ZO4A 2HDNB 5EE9A 2QTHA 3UATA 1F48A 2GXSA 1DE0A 1G4AE 1X8JA 2PZEA 1QHHB 3MMPA 3RC8A 2W0MA 1Q3HA 2D4HA 3L8ZA 4UNSA 1H8ED 3K70D 3VKWA 3TKLA 4LWZA 4TL7A 4ESVA 4PANA 4TWZA 5EJEA 1D6JA 3TNFA 1KI2A 2V3CC 621PA 2YKGA 1SXJD 4D4MA 3CRRA 4G5GA 2TMKA 3ADDA 4P4UA 3K0AA 1Z0AA 4F92B 4JLVA 3AQ4A 1KI6A 2QG6A 2VQSA 5AUPB 3U7GA 2DR3A 2DFTA 5CK4A 2ZE5A 1OXXK 4H1VA 1KO8A 4G3XA 3KJGA 2QM7A 4JKIA 1H8HD 1XPOA 2B92A 2FMXA 1UM8A 4HB4A 4I81A 1QZXA 3QOFA 3TIFA 5B57C 2WM9B 3IPYA 2FOLA 3VMFA 1LF0A 3C41J 1S9DA 5FL3A 4DCSA 2OT3B 4DWJA 5JWRA 1OYYA 1W49A 2CK3D 4Q4JA 4X8LA 4A1FA 1HTWA 1LVGA 2C8VA 2ZSDA 4O2LA 1Z28A 1GG2A 2J5XA 4Q9KA 3VQTA 3NDBB 3I32A 2PLRA 4HZIA 1VKJA 4MYHA 4V0MA 1II8A 3LO5A 1W36C 2IEYA 4P32A 3EPHA 4IXMA 4XD7A 5JECA 3QG1A 3SEAA 2WICA 3BJIC 1ZIPA 1Z6GA 4M2LA 2D7CA 1KJYA 1IN8A 3AVOA 4JLOA 2I4IA 2FN4A 3K0FB 1QHYA 4KJZA 4DIEA 3ZJYA 1AKEA 4GOXA 4MGKR 1A2KC 1GITA 1E79D 3ZQJA 2O8EB 3C14C 4DT1B 2FV8A 2UVQA 1VYTA 3TJZA 4BPBA 1US8A 2QRNA 2GVDC 1MRSA 4OI1A 3W3AA 4DCTA 3G82C 4B34A 3SJAA 2J7KA 1XMJA 2GHIA 2IW3A 1W0KA 2QAJA 3QSYA 2ZVQX 3A8TA 3QE0A 4BUJA 3Q72A 1EFRA 1WQ1R 2FSHA 3AUXA 3KXLA 3CZPA 4RD6A 3AV0B 4W9MC 5HKKD 5CIWA 1KHTA 4OYHA 3AUYA 4BLTA 5BW8A 4KBGA 4FCWA 2FJUA 2XSZA 1BMFD 4LC1A 4V02A 1KK3A 4MGYR 1CJVC 2EFGA 3U7EB 1PLLA 1T9HA 2PX0A 1LF5A 4LBZA 4C7OA 2DYKA 5FUXA 2GCOB 3SFZA 3W8NA 2NOAA 3LXRA 4BECA 5KSYA 1CJMA 1AZTA 2KWIA 4Q1EA 2X19A 3ASZA 3UXMA 2EWVA 4EPXA 2O52A 1RRPA 1T6NA 3HU1A 3HWSA 3CRVA 1I2MA 3WHKA 2ZM5A 1XFAA 3EWSA 1EESA 2WWFA 1Z0FA 2NTYC 2QRZA 1E9CA 5CDFE 2HUPA 3EA0A 1R0WA 1BH2A 4GSYA 4K8OA 4V03A 1IBRA 2VP4A 3CPJB 2VLIA 4IDNA 4YMUA 4GI7A 1IONA 4JKYA 1E98A 3LWNA 4C0QC 3C8UA 4D4JA 5EZ6B 3V00A 4YMTA 4ZCMA 3SJBA 1S1CA 3CW2A 1U90A 4G0NA 2DY1A 3W5JA 1TQDA 4M1YA 2A3RA 4QGFA 1F6BA 2NO6A 4E09A 3IQWA 2AD5A 4ARZB 3NEJA 5EXPA 2BHRA 2IC5A 4GOKA 3R7WB 3U4QA 4CEIB 3I5XA 2X2FA 1Q1EA 5TY0A 1VIYA 4DZZA 5F3WB 1XP8A 1XPRA 3H1TA 2NPIA 2YINC 4B74A 3LNCA 2QAGB 2Q3FA 4B6EA 2V6IA 3BH0A 3SR0A 2JJ2D 3EXAA 1XEWX 5F98A 2YV5A 4G1UC 4IRUB 1Z0IA 4BRWA 2BJVA 5H1YA 4PPFA 5HR5A 1WBBA 5B64A 2C98A 1UDWA 2QBYA 2VP6A 4KITB 2CE7A 4JYCA 2FSIA 1N6KA 2VP5A 2GZAA 1CR4A 4FI3C 2ZXUA 2P2LA 2IA5A 3D7MA 3LV8A 2C78A 2WSSD 1U98A 4GBMA 4LRWA 3KQNA 2ZJ8A 4S35A 1ZM9A 1A7JA 2RGEA 3ADKA 1E4YA 1Q57A 1X1SA 4WBSA 1XEXB 4M0LA 3OEHA 1E2FA 4C0AC 2RGAA 3KQLA 4XVRA 1TU3A 1AGRA 5KDLA 4YONB 3ETLA 4JL5A 1M6NA 3SDZA 3K0AB 4W5JA 4JJKA 3WBJA 5GJCA 1KI6B 2WWGA 2RHDA 2UKDA 3LX5A 4TMWA 2QMHA 4JT4A 3OAAA 3T15A 2EU8A 5BN5A 1AJEA 3DHWC 3NC1C 2Q21A 2QE7A 3QJYA 4QKQA 2ORWA 3P4XA 4V0KA 3UWKA 2A7QA 4Q4JB 1OKKA
chains in the Genus database with same CATH superfamily
3H5NA 4M8KA 1ORHA 3BF8A 3BRCA 3MZ0A 4FFVA 5AK5A 4X95A 2OXRA 3ESZA 1VQ1A 2ZBQA 1U8FO 5E4YA 1NYTA 2H00A 4ZT7A 3PUXA 3G0OA 2SNIE 4OXXA 4QO8A 3W5DA 1E3WA 1NTOA 2IE8A 3CPHA 3UWOA 2NNLD 5B2EA 3PEEA 4M0FA 1CS4C 3A3NA 4I3FA 1FSFA 1QM5A 5D6OA 1XNHA 2V0NA 3JYQA 1UJ6A 4QGBA 2DBQA 3GGJA 3SLKA 3NKLA 1BJTA 4BZXA 4C04A 4XSHA 2B0JA 1W9MA 1Y4AE 3PCRB 4RULA 1O5TA 3PUKA 3A6FA 3VH2A 3BRSA 1J8FA 1Q1QA 5AI5A 2CXQA 4YASA 1Z47A 3PDJA 2EKBA 2PRZA 2HT6A 4BN4A 1IQ0A 2FLVA 5ALGA 3TI7A 3I01A 2AOXA 5IM5A 2R1TA 3I9KA 3WLQA 1X42A 2BGGA 5G1PA 5BV7A 1DUSA 1L4LA 5JIBA 1Y42X 3ZS8A 4FYHA 1MOQA 2QRJA 1GGHA 3AR8A 4DPMA 3FXAA 3UHJA 4WJKB 2Z1MA 1OXTA 2I4MA 2WYWA 4ILEA 5EVJA 4I1YA 3H3XA 1D4OA 3VPHA 4IHJA 3U13A 1RI2A 1T1RA 3ABOB 1RYDA 2VQ6A 4KIJA 1E1RA 1AC5A 1Y1KE 1YE5A 2DJIA 4O1MA 3HTXA 4F72A 5KBYA 4C7OB 2WAXA 2W2LD 3KYDA 3UAOA 1TCCA 4DIFA 1DWQA 1NV8A 1NGSA 3T54A 1D09A 1Y37A 5LXTA 3H11B 3PSAA 4PLGA 1T0JB 3TR5A 1AGXA 1O7JA 2LWIA 3L4BC 3R3ZA 4Y6LA 2VHZA 3KELA 4OYYA 4PHGA 4RHTA 2ZYIA 1A88A 2WQZA 3RVSA 3ZDDA 2HJ9A 3CF4G 5C7IO 3OMLA 4BBJA 3N2KA 1OFTA 1P7WA 4JIMA 3NBZC 3CSDA 2RCYA 1NXWA 4MUMA 1R12A 1P5RA 4J0KA 1NVMB 5EGSA 4HWRA 4E1VA 2HRZA 5EWLA 5J5AA 2CBXA 1XZCA 1WOYA 2P6UA 1R4MA 4Y2PA 2CDCA 2BGRA 4RTOA 4N12A 3P5SA 5HHTA 3DYVA 3Q85A 3WNZA 1SOMA 2EQ5A 3U3OA 2VC2B 1GUFA 1JSZA 2H2WA 2QW8A 5FBWB 4KDRA 4L6AA 4QFMA 2P2SA 3LTNC 1FMTA 4YJFA 4ZK2A 3DMRA 1NRJB 1Q2XA 2E4VA 2ZIAA 5DX0A 2VUUA 1J1IA 2BKVA 1PFGA 2QTWB 1K7SN 3OBBA 4R9UC 3DDCA 4EZIA 3H1GA 1X1QA 4Q34A 4U7HA 2HUNA 1OT3A 3MFQA 3IEKA 2FKAA 2Q27A 1OREA 1XZAA 5BV8A 3IPCA 2JI6A 3H2BA 2GEVA 1GQRA 2GN1A 3A4VA 3TDKA 3TVYA 4A0GA 2NU6B 1KARA 2WABA 4L6CA 1G8HA 4A2WA 1M75A 1W0KD 4OVKA 4TTAA 4O4IA 4F8JA 2IUFA 4XM1A 4ZOEA 4PFJA 2I29A 3A25A 1ZJ6A 1LD3A 3RQSA 1GO2A 3CWQA 1PGOA 1PZGA 4C0HA 4EKDA 2VPPA 4LISA 521PA 3ZY6A 2ZT8A 1QIIA 3D8TA 5I4KA 1UINA 3OD5A 4NH4A 4RQTA 4CIDA 1Z6YA 4U2DA 3MGCA 5U4XA 5BR4A 3RPEA 3R5JA 5EHZA 5LP6F 3Q3IA 2IFTA 4I08A 1VG8A 1B8VA 1OF1A 5P8WA 1GTL1 1XZFA 1GARA 2ZKLA 3PVCA 1QTRA 3L6EA 2WF8A 2R6CA 2FWRA 3G79A 2B8TA 4P58A 4W1SA 4KOEC 2QX4A 5SY9A 3SBDA 5JAOA 3PA8A 3KOWA 4JJAA 1ULSA 2WWVD 1G9XA 1P9LA 2QJTA 3FFAA 4XVCA 1WKCA 1QHNA 3MJHA 2A4KA 2IYZA 3CKKA 2XZOA 3TFQA 3VI3B 4WEQA 2GTIA 4QYTA 2WYOA 2B3TA 4LTDA 3VPAA 1EFCA 2CLCX 1GZVA 4JZKA 4DV6B 2CLMB 3EPJA 3AF5A 2ODQA 5SZHB 2D7DA 1YZLA 3L93A 2A58A 4B3DA 5EJ6A 4GWLA 3KOZA 2GK7A 5KC9A 2WZBA 4L78A 1WD7A 4BVFA 4YPOA 2GM9A 3W06A 5HKBA 4YUVA 1G1MA 1TEVA 1U65A 1U1GA 4MGHA 3RVOA 3A9TA 4MEBA 4U2EA 3HJBA 2YV4A 3JAWB 1VJRA 4GZ3A 5TB5A 2DH5A 1E69A 1QHIA 3O8NA 4PNHA 4Q03A 3SAJA 1ODKA 2AEMA 4ITVA 4OL9A 4BTVA 4D98A 2V9PA 3IP3A 3JZMA 2CLEB 2HMSA 1QPGA 1E8DA 4AWXA 2O59A 4PFQA 1ND5A 4GM1A 4NU0A 5FJIA 3CF0A 3L49A 1CS0A 4LE1A 1G8MA 4U6QA 1BRTA 1NL3A 3Q3CA 4YHBA 3TZQA 1PJBA 1X7XA 1J5PA 1WMFA 2IYNA 4MR7A 4LFCB 5A5EA 3FSEA 4WZAA 5EXTA 4LRYA 3UUFA 1SD5A 1NONA 2ZIGA 2MINA 3Q9LA 5LDDC 4PNZA 3VHQA 2B36A 3EYWA 1Z4MA 2HCBA 2I6XA 3EFBA 1LDYA 1GQFA 1MO3A 1QJ4A 2Q45A 2ZJFA 5CAEB 2I4NA 2ZT6A 5JHGB 1EGHA 1KFBB 1U0OC 1Z25A 2OZLA 1YUBA 3CF2A 3PYMA 3QYAA 4CV0A 1BHJA 3SXUA 4QBGB 1E3WB 1VIMA 4ZOBA 3MRVA 1K3UB 1I80A 1QIHA 3HCAA 3QY0A 4IW3B 3K9FC 2ZJ1A 3ONFA 4BL5A 1O0BA 2WJ6A 4K9OA 4PQYA 5J4KA 4KIGA 1FYFA 1UIRA 2LXNA 3EC1A 4YAIA 3GO4A 4JQCA 5CGQB 2ISQA 4AJIA 5KNDH 4HFJA 2Y6UA 1SGWA 1A96A 4HUJA 2WZDA 3AF0A 2E6KA 3NCTA 5AQEA 2C59A 4AJ2A 1CYEA 4F4FA 3BB1A 4QE3A 1M8GA 1GGFA 4FW9A 4R7TA 4U39A 3TAXA 4BDSA 4PYIA 1P3JA 4HH0A 2OYRA 4NZNA 4YUAA 4CMAA 2Y1DA 3TQOA 2QMEA 1T1EA 3WBKA 1KVRA 1QFYA 1XRRA 1XMOB 2RJ3A 3A2MA 2FQQA 1N2XA 1IJEA 1FJHA 3H0EA 3QXSA 3DQPA 3KTAA 1O94C 1K4KA 3PD1A 4EW3A 1J9ZA 1MR3F 4W1PA 2BSXA 5CYPA 1AKYA 1C30B 2XGJA 4LSWA 4YC7A 3MB5A 4O3FA 1L7RA 5H5JA 4AN0A 1DG3A 4YXWA 3KYDB 1VSTA 1QIEA 2VPXA 1KS2A 3KXIA 3KL2A 2OZKA 3F74A 3PFBA 2GNOA 4URHA 1JDPA 1U2DA 1FS4A 2ZJ7A 3CQ9A 4RMIA 4TTPA 1NSYA 2YWXA 1GAQA 2FWNA 4X54A 5C8YF 5EXXA 4L4UA 2H65A 1GY8A 5LXTB 1C8BA 2FNAA 4CKZA 3SEFA 1B6TA 2ZU6A 1NVGA 3S3TA 2WUDA 4JVNA 3WYEA 3Q0TA 3OP4A 5G2OA 2OV4A 3PNYA 1KH3A 2CEKA 2YNMA 3OA2A 3QE3A 1Q17A 1E5TA 1RXEA 5K0LA 4HZUA 3AI3A 3N2KB 3RC2A 1J5EB 1TUIA 3G0GA 1VGRA 2CLDX 3L8MA 2JARA 1Z5WA 3BBLA 5FCDA 1GGNA 2IE0A 3C6MA 3ETEA 4CNQA 3E5RA 4CLOA 1YRAA 1WCIA 5EWLB 4TV8A 3VO2A 1I8TA 3B1YA 1X94A 1KZ6A 2JI9A 4M8NE 1R4MB 5CD1A 3CU5A 3G7NA 5AM1A 2VZ9A 4OI2A 4PIVA 5FUMA 1FFWA 1CZUA 1KBQA 3SQLA 1A2OA 4LMBA 1EB8A 2FPPB 4EI7A 3F7OA 4MINA 2BFAA 4YJFB 2P4SA 4LVCA 3SNKA 4ASUD 1QIJA 1E2HA 1PJAA 2MU1A 3G89A 3QM1A 4O2BF 5EE0A 2D5LA 1VJ5A 3AOEC 3U7QA 5CFQA 4HFNA 2WTAA 5BW6B 3DCYA 2WAOA 1E99A 5FBKA 3QUCA 1WTAA 2EFEB 4DCPA 2FFBA 2O2XA 4Q66C 3V4VB 1MQSA 2FE1A 3OU2A 3CNBA 4NV0A 1E2GA 4QT4A 2DPGA 4DLKA 2JFWA 1G55A 4OV6B 3DWEX 1CUSA 1U4NA 3QQPA 4GMDA 3K6SA 1V37A 1J8YF 2ZBEA 5BN3A 3NFYA 2BGLA 2HXSA 4O4IB 5JZSA 2ZWPA 1QU3A 3B2NA 1JR2A 2UZ0A 3VR5D 2VWHA 3HYTA 4IX9A 4LQLA 1EUZA 3FIUA 1XDUA 4HDRA 2B69A 4OIFA 4TZ6A 5ALKA 2A0UA 3WK6A 3DTYA 1GZ6A 1GZ4A 4PHCA 4JUAA 2CXNA 5EVCA 1TTQB 1ZP6A 5SY4A 1KRWA 2GZHA 1C9EA 2D1QA 2Z2JA 4ESEA 1TC1A 2ONJA 3G02A 5CT9A 3UPTA 2WAMA 3T61A 3SNHA 4AMBA 4G2TA 4D9EA 4MVJD 4OQYA 4OX9Y 1QFMA 3NALA 2WRZA 1QJCA 3OU6A 1UJBA 4RADA 3O75A 4K1LA 3BXHA 1UKBA 2HD4A 3RSQA 5HZGA 4L9AA 2GERA 4MLZA 2R65A 7ABPA 5FLXA 4JBHA 2HQRA 5TSDA 2OKCA 1ZWKA 2WSIA 5TARA 5AESA 4W9NA 2ZI4A 1ZIDA 4AJNA 3RIGA 3SYNA 4FIZA 1HF3A 2IS2A 2FR1A 1EWQA 2PXCA 3HBFA 1Q50A 4F9EA 4Q16A 1CUUA 2P9QA 3A1VA 3GFOA 1VJCA 2DAPA 3I1YA 2FZKA 1J2EA 1X77A 3M4NA 4RD1A 4ZTUB 3K9CA 2MCFA 3RVLA 1FDSA 4R05A 1YVDA 1K7YA 4DG5A 4Z2AA 4A8PA 1TFUA 3LK6A 4U7JA 1CX9B 2QMQA 2ZE7A 2C95A 3AEUA 3A3OA 5T6MA 4FD3A 4KX3A 3UH0A 4YY3B 1Q6YA 3U7FB 4KR2A 1L7QA 1RCTE 1UK6A 1V1MA 3OECA 2IYTA 1P6XA 3C48A 3NU1A 4Y2YA 3RABA 3WFZA 3L7NA 2XF8A 4L9RA 1CS0B 3T9AA 3EQ6A 1QQ5A 1X7XB 1H2BA 4MR7B 4QODA 5AFSA 3PHLA 4CN9A 4ZI7F 5TMEA 2OCYC 4PFSA 4N3BA 4D9HA 4K26A 2H1VA 2MINB 1XAHA 3KVRA 1UOPA 1PJ4A 5KCMA 5F52A 1MZVA 5AVUA 5DOZA 4B7UA 2C00A 3IPLA 5BMVA 5IT4A 1I4OA 4BBZA 1YFKA 2PRSA 3KOYA 1R10A 2OZLB 1TYDE 3ENQA 4FGUA 3ZDBA 2CMKA 5T8KA 4IDGA 1AXGA 1JR3A 2HMVA 1YAHA 2WMOB 1HO3A 2K7ZA 2VPTA 3L6DA 5CDFA 3ZU3A 5M2QA 2W93A 1L4GA 1YZUA 3R0JA 5FBLB 4A82A 2P6OA 4RIFA 4ED9A 4C0KA 1NW9B 1ULUA 3D7SA 1R16A 1S7CA 5DMHA 3LP6A 3WK4A 1CFJA 3MWYW 5ES3A 3CH5A 4OL0A 4RLSA 3NVAA 3T1TA 3MTEA 1QP7A 3V55A 2PQ6A 2XTJA 4W8GA 5AJVB 3EYAA 4BTLA 2HK6A 3GWZA 2WNHA 4HY3A 2VA8A 2IITA 2X5OA 4JYPA 5EIFA 3INTA 2X76A 5K20A 1NT4A 1TK3A 4A8TA 1ZUNA 1NT2A 3Q0EA 1VCMA 1WLSA 2ANCA 2YFQA 3ZBUA 2XUOA 1V6CA 4KBYA 1KZGB 2G04A 3RT1A 1GQOA 2YOFA 2OBFA 3GEEA 4E88A 4F3KA 1WW3A 1X2EA 4OTZA 1FYWA 1ZK2A 3OZCA 1C50A 1M0EA 3KTAB 3P9SA 4D82A 4MRVA 5DW3A 1GGKA 2GD0A 3N53A 4UBJA 5JNLA 1VL0A 3N8KA 1K63A 4ARIA 4BVJA 4YDQA 2UZ4A 2IK8A 1RC1A 1UKZA 2PK3A 2PT5A 1QYVA 4O2RA 3ZJ5A 2IHBA 2AR9A 1SBYA 1GR1A 1NBME 4MWZA 5CLFA 3V4FA 5LIRA 1R66A 4RTRA 1PR3A 1VGVA 2Z5LA 4FMDB 5LJIA 1N0WA 3ZDCA 1M8JA 1TUEA 1U1CA 2COUA 4QJ5A 5B53A 4KNVA 4PW0A 3VX4A 1HT0A 3N2GA 4TL9A 3DBIA 1S2LA 4BEVA 3TAUA 5C1PA 3O91A 3BDVA 4HZUB 2ODPA 2X1LA 4UJ5A 3ZE6A 4AIIA 5HRAA 2GXAA 1ZUIA 1Q0QA 2IYUA 2KBFA 3UT6A 4CLOB 1WCIB 3P9IA 2X77A 4TV8B 3PITA 3T1HB 2AN5A 4QUHA 1KGSA 4U02A 3LUDA 1U7TA 4CMBA 4WBXC 5AI8A 3ZV6A 2KQUA 3KLNA 1CNEA 4LECA 1Q0LA 3AFNA 1S8NA 4UVHA 4DMCA 1CUYA 5ALVA 4P3NA 2XCSB 4AF7A 3K35A 1F1BA 5AKIA 3I64A 4CN8A 2XJ9A 3JQPA 2CYAA 4AO7A 5A9TA 3UM9A 3R4CA 3HJFA 2GEUA 4F3TA 3NR2A 5E1BA 4BLSA 1G7RA 5FWXA 3WSVA 2XUKA 1NJSA 3AVXA 2AE2A 2BF7A 3D6MA 3IP9A 3N76A 3RIYA 3U7QB 4A26A 2GTPA 4ENVA 1YVPA 2PR2A 4YJ3B 5ADWA 2HJGA 4PYQA 2J6HA 2QYHA 1HPLA 3P0JA 1WG8A 1GKKA 3QI2A 5H0IA 4B4VA 4GZMA 1NNEA 3RU3A 4PAOA 3BD7A 4OH7A 4DSOA 3QWBA 1JFTA 3K6SB 1WPQA 1DKLA 4BKMA 4GMXA 1MB9A 4W8HA 2AXNA 2GSWA 3UTDA 4XUCA 3E1KA 5BN3B 1XZLA 1Z2CA 4CM4A 1ISGA 3A0RB 1BDIA 4PBRA 4QYXA 1CUBA 4DW8A 3NTVA 4HDRB 4HWGA 2O1EA 4MDFA 3GCWA 5LZ8A 4MPTA 3G88A 4XOUA 3BTOA 4NOJA 2OBLA 1NMXA 1JHOA 4HCJA 5TQVA 4CETA 5JJBA 1NXQA 3K8OE 2JFBA 3NAGA 3BH7A 3VR0A 4D2IA 3GLIA 2P9YA 4ZEOA 2QP4A 1SZPA 2BR5A 3WRXA 5IG2A 4R5MA 2H4FA 4MOWA 4KE6A 1E2BA 5KOIA 3UN1A 1FYXA 1NVKA 3NEPX 4BNMA 1E2EA 3MELA 5EKSA 3VZQA 4LOLA 3ND7A 1QGOA 1R0CA 4KV7A 1OB2A 2ZUBA 4JDUA 3PR2B 4DLVA 1IQRA 4K9QA 2OMEA 2ZBRA 3HEAA 5AW9A 1WPGA 4S1VA 5AT1A 3VR4A 2FW8A 3H6GA 4PF1A 4D79A 4CTMA 1AUXA 4Z49A 2O1SA 3IIJA 3NP7A 2I71A 2P4QA 1FFEA 1JR3E 2IEIA 2N75A 1ESCA 1V1MB 1CQIA 2Y1LA 1GPBA 4OGFA 1FDWA 4F38A 5JNVA 4FWTA 4MGZR 3K31A 1LS1A 2BI4A 2YQ5A 1I2ZA 2EIHA 1RC8A 3TLJA 3WDKA 2JLXA 1NE7A 2O8DA 3QUTA 4X97A 4ZT2A 2J6IA 2ZR0A 1DJOA 2CB0A 3A1FA 3DMTA 4PNPA 4EWLA 5BSFA 3Q7TA 3ASYA 3R5SA 4I1PA 1PEDA 1KY5A 1NMYA 1W4RA 1OAKA 3O8CA 1ECBA 5BMVB 2QQFA 2UV8A 4KMMA 4BGEA 1BHQ1 3AVWA 2FPIA 4W9RA 3W5HA 3D6NB 4E4YA 2PGXA 3ICCA 2JI7A 1N0UA 1WU7A 2C5FA 2QVBA 4JCCA 5K0CA 4FFDA 1DAIA 3Q6MA 2YW9A 4TZTA 1K68A 1JHDA 2OGZA 4TS9A 1Q77A 4NFHA 3ZX5A 1WZEA 4B3FX 3OQ1A 1DC6A 1PQYA 5C4GB 3QKTA 5LC1A 3ZWNA 2ZANA 1MQ9A 5IJAA 1KF0A 1STOA 3E9DA 3FYTA 1TU4A 1AUQA 2GZ2A 2ZIZA 1UBLS 4CI0B 4KLZA 3ANYB 4DV7B 1DBWA 3O82A 1TMYA 3ENZA 5IFKA 1TJ4A 2W2TA 5EUMA 3WLJA 1DQSA 2B37A 1ZUNB 2QDXA 4FKMA 3H65A 3GGSA 2WJVA 3MBOA 1ZMBA 3GJ8A 2C4UA 5IVHA 1S2GA 1BROA 5DNUA 1OFUX 1CEXA 4ESHA 4OYRA 5A4FS 4RSMA 1GRVA 5B1HA 2OE2A 5JZVA 3PF9A 3R3SA 1D9ZA 4Q3CA 1T3SA 2QXUA 3IO3A 2Q4OA 4TLEA 5LDGA 3TTYA 4EF4A 3DHVA 5EGNA 4QBHA 1CEYA 1DVRA 1S8OA 3WBBA 4BZWA 2XA1A 1EWKA 1IU9A 5LQDA 4A0QA 3LQRA 4KO8A 4A5SA 4QJ3A 1ZZEA 4AY6A 4B4OA 4Q3LA 3IMFA 4J6FA 1RMQA 2CHFA 1T24A 4I9HA 4YIKA 1WUHS 3I9V1 3L18A 5IFLA 4EI2A 1ZJWA 2QX6A 2OK7A 1JA9A 3S1LA 3HA7A 3M1YA 4EH1A 1ZESA 3DWFA 3GNTA 1YS7A 1DTSA 3N2GB 2DR0A 3WJ2A 2CNNA 3HSSA 2IZOA 1B42A 4XM0A 1C0LA 1DIOB 2BUAA 4G9BA 4WV3A 1XMXA 1OXVA 5KC8A 2I8AA 4BXOA 1GKUB 1ICIA 2AR7A 4L3VA 3T5GA 3CBQA 4WFIA 221PA 1NBOA 1QGZA 3IKVA 1G3MA 1UCFA 4X85A 3PYXA 2I6GA 5HZMA 3FCXA 5D3QA 4ZO7A 1Z7BA 3RNOA 4KR3A 2QS9A 3BMXA 3W2EA 1QCYA 4YJDA 3F5FA 5LXTF 4EECA 1XROA 2CNWA 2P0AA 4FYMA 4Y6GB 1DEXA 1FYEA 3S2SA 1SBTA 3SXPA 2WJZB 3W5VA 4AG6A 5THKA 4BFCA 5AKXA 2DRIA 4WOPA 5B2ZA 1BWSA 1X80A 6ABPA 3CUUA 3T5PA 4C1NA 1SU6A 4PG4A 5AKKA 2DQ4A 5HE8A 4NESA 5BUZA 5FWXB 1LLUA 1RKUA 4FMCB 4N7RA 1HETA 3TQIA 1RQLA 2H18A 1JEDA 4UNIA 3N8DA 5ITSA 3NM6B 3ROGA 1KU6A 1UFRA 1E61A 1FFCA 1IDN1 4RD0A 5CVVA 3IMGA 3KV3O 4KVGA 4ZZ2A 1WB6A 3DLTA 2NO1A 5H8WA 2JFXA 3D6VA 4D4HA 1DBIA 1RYEA 2NZUG 2WMDA 2GHRA 3QBEA 1EFUA 4X45A 4X3OA 3SPXA 2JIZD 3WWDA 5K09A 3GLIE 2J3HA 4NYIR 1V8BA 4HVAA 3PDIA 4CM4B 1JE0A 2AX3A 3STHA 1T3HA 1WV1A 2VPWA 2NXNA 2DWQA 3UAVA 4AURA 1U2ZA 4BO6A 9MHTA 4FPXA 3A6JA 4BZZA 5BWCA 4J4TA 4E32A 2Q7DA 3SR3A 3SEQA 1PS9A 3P9YA 4PTZA 2HA4A 4EFMA 4JBLA 3MS2A 1ZKDA 2JH8A 5KO2A 1ZH2A 2IXTA 2R751 3SR4A 3UGJA 4MEAA 2BTEA 2H5JA 1CY2A 3NYWA 3W34A 2BBSA 4UMVA 1JDTA 1KKLA 1Q16A 3D1LA 4Y98A 1XCOA 1FZTA 3IQEA 4OBWA 2FSVA 4MS3A 3GLIB 3GRAA 1KHHA 4O4IF 2R6JA 4EAQA 4ZTBA 5I8PA 1IHUA 3JQGA 5BNZA 4V38A 1RZRA 1HDYA 1GPYA 4Y6OA 2NYRA 3I6YA 2PWBA 2EYUA 4TT8A 5I51A 5IKXA 2I3ZA 3HWRA 3TXYA 2IYAA 2CHQA 2Q41A 4HAVA 3ZVMA 3WNQA 2VQDA 3NV9A 2I7VA 2C2HA 3OLQA 1T91A 4MV0A 4CR8A 3S70A 1AXEA 1LDGA 1GADO 2P0YA 3W77A 1IOZA 3T9DA 1XBTA 1M7BA 4IVNA 4REQB 4LY3A 1H23A 3BL8A 3HADA 3QPWA 5ALSA 3H9UA 3AR4A 4CQMA 2C9CA 2WPDA 4G0MA 5D5HA 5IAJA 3R8CA 1FJGB 5F3DA 3UO8B 4L22A 3RSLA 3PLNA 3QPBA 2CJXA 5C5EA 2I9KA 1CQIB 3PDUA 1R0RE 2XHEA 4BIMA 1UDRA 1LNSA 1BKYA 1RAGA 4JBWA 3R09A 2BFFA 3NS7A 3TZEA 1YB7A 1IATA 3HVUA 1T9GS 2O8DB 3HBJA 2NIPA 1Q11A 1TK9A 2YRFA 3QX8A 3T7IA 4OSEA 3KSZO 3UJ8A 3JQ9A 4C7KA 3IT2A 5CBPA 4U9UA 5JYBA 1XCBA 1P19A 3MWJA 3K0CC 2FXIA 2R1ZA 2FPIB 4YVFA 2V6BA 5DN6D 2HU8A 2UUOA 1COZA 2O3UA 3V1NA 4CNBA 2R84A 2X2OA 4X3CA 1H1TA 2QIOA 2HX1A 4U2BA 4E94A 1P7CA 4HPJB 3MS7A 1ZGHA 3A1TA 4P22A 4RCZA 4LJ5A 3R7DA 2XHZA 4BO3A 3LECA 3H7AA 4ZRNA 5IASA 4GG1A 1N25A 4TS3A 4F2WA 2KI5A 1U0FA 3O38A 1NW6A 3ABQB 2PU5A 4F06A 3RHSA 1PJQA 2DQKA 3OCWA 2QLFA 1YK0A 1IVYA 2H9YA 5CVDA 3E6AA 1EVEA 1OSNA 1PZMA 3CV3A 3I5MA 3I92A 3KB6A 3VGPA 5LZ9A 1F17A 1ZC3A 3I2YX 2G1KA 4PCUA 2FSSA 3TZLA 4XGRA 4TQAA 5I7WA 4AO6A 4MUNA 4XWYA 1C1DA 4KO4S 5HIJA 3FR7A 2D2IA 3IE1A 1LLCA 1JXQA 3L0ZA 4TQ9A 4XWOA 2DSNA 2ZRGA 1ZIYA 2P6MA 4Q7EA 5JEDA 2ID7A 3DONA 3S29A 1E0DA 4BMXA 4RDXA 1USIA 5K8CA 4XDYA 4C05A 2FZLA 2WHEA 1ULBA 4M87A 3M5PA 1CUXA 3L8DA 3AKEA 3TRDA 4AKEA 1QGYA 3B8EA 3LLMA 2GBIA 5DM2A 1KMNA 2IIQA 2VTKA 4IGAA 4DLPA 4OQXA 1UBFA 1ZW6A 2PEZA 1XVUA 2ZYUX 3CE6A 3BZWA 3EJ6A 4JC4A 4JEMA 4NBRA 4RO0A 3VTFA 3ZNNA 1Y9EA 1THMA 1G16A 1RAAA 3KLOA 4B79A 1CQPA 2VRBA 2JNWA 4HLUA 1A2BA 2IPOA 1I51A 4I9UA 1QANA 1ZOPA 1HUQA 3AVQA 4RK5A 5J5VA 4AZ0B 1DQZA 4MP6A 3PUZA 3MA0A 1O54A 4M0CA 4Q5IA 4WZZA 4ZANA 2PA3A 1W5AA 3UHOA 2IPAB 2WLTA 2FDRA 3ZXIA 2ST1A 1AZWA 3BJEA 3DC7A 4JU9A 4WLNA 7ADHA 5KWVA 1N2OA 5FOVA 4FMDF 3H13A 3GYGA 4O08A 4OM7A 1K08A 1FUKA 4HNTA 4QXOA 3ZWCA 3ITEA 2XT9A 1QBGA 5EUBA 5I9SA 3IMKA 5CB4A 4NENB 2AFIA 1X80B 3RLFA 1VFNA 1BDBA 4DSTA 4FBMA 1T8RA 2QRVA 4X84A 1J8MF 1E8NA 1FOEB 1MEOA 1XRPA 2ON6A 4OQ4A 2WE7A 2YRXA 1YR9A 3FSJX 2ZBFA 4Z9XA 5BXQC 5JFGA 1GUAA 4CMEC 2P6NA 4TV8F 1LW7A 2NYUA 4NS4A 1EWRA 5BPHA 2FE4A 4HT3B 1BIFA 1R0YA 3ED1A 4N3GA 4TVSA 1BEEA 5DYTA 1NC3A 2X7JA 4JJ8A 3MNFA 1KJZA 2MSKA 3SC6A 2J08A 4PQRA 1KYTA 4LSGA 3W5UA 3MD9A 3UICA 3FZGA 3JVEA 2NLOA 2Z4SA 2B35A 1G8GA 2FUNB 2PLFA 1D0VA 4N7JA 3PDIB 3EZGA 1B1CA 3P2MA 4ENSA 4CU5A 1YB5A 2R4QA 1JT2A 1UKYA 2VJOA 2VK2A 1SBNE 3F7NA 3FMFA 2EL7A 3HL4A 4MRMA 2OZVA 4MJXA 3PVZA 5TQ2A 4YJ3F 4YAWA 4HZGA 4CFYA 5ITZA 2PZBA 1VHDA 3AI1A 3BK1A 2E4ZA 2Y76A 3JPWA 4G4GA 4M4SA 4UMDA 3A9VA 4B87A 2VZ8A 1UT5A 1UXIA 3PGVA 2GN8A 3EQ2A 2HA6A 3S2EA 4I6EA 4IFEA 4HMQA 3GRCA 1QIDA 4IX1A 2O3TA 4OP1A 4PSVA 4RF3A 4MS3B 4UEWA 2J7PA 2HZ7A 2IVFA 2AN4A 3C1OA 2PTGA 4DL9A 3JQGB 5KTSA 5JH7A 1GA6A 3K4QA 3ZDXB 4IYRA 4L16A 1GYQA 4B35A 5C1DA 2JB9A 3O4GA 4DNFA 3W7AA 4Z6KA 1DSSG 4LMPA 4UDOA 1D0SA 5ICFA 3DR5A 1RWOA 5FTMA 1OWOA 4PZ9A 3BL5A 4R0MA 1G17A 3H3JA 3VZPA 4WVFA 1K6EA 3C70A 3L77A 4G0VA 1V4BA 2Y68A 3QRWA 4XWGA 5ESDA 1FRQA 4FONA 1YTLA 3AZPA 1MEEA 4L5YA 2OM2A 1IAVA 1PO7A 3PZRA 1CJUC 4C4RA 2W6NA 4IOLA 4NJMA 1FB5A 4CQMB 3LA8A 4XRGA 3BXOA 1O94D 3IIKA 1QIMA 1USKA 2AHOA 1FP1D 3KAQA 4MCAA 5JARA 4PAWA 1GG9A 3VU1A 2ZS8A 4XYGA 3QWAA 3K71B 4FCCA 3F3KA 4FOPA 2J07A 1H9CA 1RJDA 3GMTA 1G0OA 3FPAA 3C3PA 3KZKA 3NIWA 4EHIA 1ZXLA 2ZUSA 4EI9A 3BWXA 5BWOA 2B4RO 2HK8A 4JYAB 3AF4A 2R2GA 2VZ0A 2EW8A 5CBPB 3L9XA 4OB6A 1CHDA 3MGGA 4RHYA 3ZWYA 3FUVA 3I53A 3LHIA 4GLOA 4X61A 1N2GA 2PANA 3R5KA 4Q7MB 2H5LA 3DL4A 3ET5A 4JYBA 3FDZB 4K8RB 4PPGA 4KOAA 2QD4A 3BIJA 2CVOA 3QF7A 1Y4DE 3BG5A 3E0XA 2XAUA 4PPQA 5MN5A 4MVWA 3Q3VA 3WGJA 1K7EB 5HZKA 3D4PA 3N0RA 4ID3A 4F8YA 2I3GA 3GMSA 3H6HA 2PCLA 4D25A 3IA7A 4KDCA 4BJ1A 1AKUA 3DFIA 3GFFA 1G3RA 1PR4A 2BEWB 2W6ID 4AJJA 5KIAA 4X00A 5A3RA 4II2A 1JU3A 2AG5A 3NWEA 2CLSA 1FMCA 5BMVF 3VAAA 3WFIA 4BHTA 5JD5A 1XLTA 1J2UA 3LBIA 4RENA 1W87A 2JLWA 3ENKA 3IX7A 5BXYA 4HBGA 3TWOA 1QPBA 2A1TS 4M53A 1XJWA 3IXLA 4PLCA 4FGZA 3CRMA 4QUAA 3DP9A 2Q49A 2BYTA 4MW6A 3JASA 5FO1A 4ALIA 2R6AA 1OXBB 3ZIUA 3EIHA 1PNTA 1ONOA 3MT8A 3WL7A 4RCVA 1Q5PA 5D3ZA 3EGIA 1C1DB 1H6BA 3QVGA 3ND9A 1SUPA 4LJ7A 4LNUA 1DIBA 1I30A 4UD6A 4QG3A 1EA5A 2JDIA 2HHAA 4J3FA 4F2GA 2QR3A 3UANA 2QT9A 3B3AA 4DE5A 5LQNA 1JN0A 3ZKWA 3D3JA 3STYA 4BQEA 4JEIA 1YCDA 5GZ6A 1MO2A 1RM0A 2FG7C 4UMFA 4ZPXA 3RYIA 3ELWA 3HCWA 3V97A 1EE9A 1A5ZA 1MVLA 1Z2DA 2CF5A 3G5AA 1QYXA 2RHHA 3R6TA 3S2FA 1W1IA 3F73A 4HDQB 3PSHA 3O94A 1XV5A 1EE2A 3UCXA 2AJBA 2P9EA 1YGPA 3OMXA 1GL7A 4P83A 3ZTWA 3VR2D 1SVIA 3REGA 2G5PA 4KZKA 1YJQA 1JDSA 2AZXA 5ALEA 2RJOA 2QORA 2OO5C 1I3OA 4KVAA 1DEHA 3ANSA 3PL5A 5CM9C 2R8EA 3GNSA 3MAGA 2OGUA 3R3JA 3OJ0A 2ZI9A 5DGHA 4DLYA 4DMFA 2PSFA 4KAAA 3P27A 1KEWA 2P90A 3ILSA 2O54A 1L5WA 1PVDA 4Q4HA 3EAQA 2TECE 2FQ1A 3F9CA 3LPMA 1KMQA 2NSYA 3UKJA 3MFYA 4CLXA 5CB4B 4CM6A 1BJKA 2GASA 2Y0BA 4X7MA 4JB2A 4XQ9A 5F64A 2I6FA 5MFZA 1GRQA 1U3DA 2QRVB 2OC9A 3LI2A 1A27A 1FRNA 1K5HA 3ORQA 3CT6A 5AR1A 1VM6A 2WM2A 3R9XA 3LS2A 4RHUA 3U44A 3K0BA 2C9YA 1S3SA 3I73A 3MB8A 4BDTA 1R6BX 3BXXA 1VMAA 2WTNA 4AJLA 1P2DA 1MVOA 1JFFA 3U4MA 1JW9B 3ZWKA 1TF2A 5G0WA 2EDCA 2WZQA 5EJ7A 2YWRA 3HYSA 4HAWA 4LDAA 1Q19A 3GLSA 3UENA 4CE6A 4QNMA 1WF3A 5HA5A 1ZVKA 1JJFA 1FA9A 3PD7A 1EEXB 1PV4A 2D0PB 2QV7A 2PMDA 3EPRA 3GEDA 3IHWA 3NT2A 2VT3A 3JRNA 4FMCF 3RUAA 3V8PA 1NJ8A 1E1QD 2O6LA 4O5AA 4KE8A 5TQ2B 2I54A 2DCUA 2REOA 2VYFA 1X7WA 4FCTA 5K3OA 2XD4A 4AY2A 2O8EA 3ES9A 3V6LA 3ZLTA 3NGXA 3UGKA 4L0QA 1EIZA 3IAS1 1F2VA 3M6XA 4CI9A 3QPDA 4JOBA 4ZT5A 1Q3TA 4P7KA 2QRQA 3CF6R 3N28A 4LOKA 4P80A 2BFWA 4IUCS 1ZQ9A 2OM6A 3LFTA 1QHXA 1OX4A 1JHYA 4OXYA 3RVNA 4D0GA 2FDCA 1UM9A 5FF9A 5AW4A 4Q00A 2Q4EA 2W2OA 1V3TA 3WIEA 5JH7B 4AS1A 1C1YA 3CVXA 3VR4H 5B37A 5HKLA 4M8IA 3PKIA 5I9TA 1G2PA 5HXAA 3TOSA 4BV8A 2AA3A 4Y9UA 3PWKA 1F0PA 2I3AA 2OXCA 2Q4BA 2AFHE 2H7CA 1XVAA 3MM4A 4IHAA 1O1YA 3ITNA 3K70C 3QVTA 5T57A 5IAAA 4ZZ1A 4QVKA 2MSLA 1Y3AA 5AO9A 2ZYTX 3SHVA 1BWRA 5E8JA 4C4OA 1Z22A 2HIGA 2XVYA 4TN5A 3EIFA 1KDYA 3W78A 3N05A 3QIAA 4NJMB 1E0KA 3TRHA 5CHEA 5FDFA 4EO4A 5FNVB 4UARA 1JVSA 2PJZA 3AESA 2FP3A 4L8WB 3EAFA 2RG7A 4FBGA 4NY1A 1KOFA 4E08A 2PUEA 3PDWA 3GUHA 3EVFA 2MSWA 5AD1A 3T5AA 1ZCJA 2C3OA 3M2TA 4QTZA 3TDNA 3V1TC 2D3WA 5JAQA 3EPLA 3M6FA 3D8HA 4GOND 5ALHA 2RH9B 1L7OA 1PV1A 3A06A 4N8SA 2O2DA 2D5AA 1TGYA 1VL8A 4YO7A 5AOAA 1GPNA 3JATA 3IKTA 3HXOA 1RI3A 10MHA 1I01A 1PQUA 4EUSA 4OLAA 5EIHA 4ALNA 4LDJA 4FFWA 2H54A 2BCJQ 2QRUA 3GT4A 4MVYA 1EFKA 1AB5A 2MMGA 2YOGA 4FZVA 1GN9A 4LZZA 4MGIR 5LP6C 4DCNA 1KBZA 4HNUA 5C4IA 1XZQA 2YJ3A 3BA1A 4ZAZA 1EBUA 2HCFA 3CRZA 3H5AA 4NEGA 2QL7A 5K0BA 2UYCA 1QO0A 2B8WA 3KB2A 3D5EA 5IS2A 1BEZA 1EVQA 3ICPA 2G7MC 4QDZA 3SQDA 5EHXA 2GKGA 1Z0ZA 3SI7A 3OZDA 1RM4A 3DEJA 3LKBA 1NVDA 3DO8A 3H5VA 5AK0A 1IXSB 4R1OA 3GLFA 5ALLA 2OCBA 2SKEA 1DC5A 4B75A 3WLNA 1FC0A 3A9RA 4Q21A 4X7BA 4BB5A