4XTRA

Structure of get3 bound to the transmembrane domain of pep12
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
348
structure length
305
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMGALADLTGSIPGIDEALSFMEVMKHIKRQEQGTFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 100
structure length 305
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xtrA00
2ZE8A 4JLMA 4UNPA 1TQ6A 3P4YA 4BFXA 2AXNA 5LD2C 1NVXQ 2YWHA 4A2QA 2GCOA 1Q57A 2B21A 1IHUA 4ZDKA 3NBYC 4YMVA 2NZ8A 2QBYA 1YZQA 4Q4AB 1IJEA 3C8UA 2KBFA 3SN6A 5KNDA 2C9YA 2GEVA 2J0UB 2PT7A 4PO9A 2JLYA 3K0AB 2D2EA 4U00A 2G1JA 1VYTA 3C5HA 1TL7C 4TLEA 2KI5A 5B58C 3G5UA 4YDHB 4U02A 3X1ZA 3BFXA 4F93B 1RYHA 4YMSA 5FUWA 3ZH9B 5BQ5A 3QEOA 3GLFA 4ZDIA 1P2SA 1VHLA 3A58B 3UG6A 5KNCA 5TARA 1EX7A 3O47A 4PC3A 1IY1A 3BH7A 2ZSBA 4IRUB 3ADKA 2ZRNA 3NH9A 5EE1A 5FPYA 4BFZA 1QHNA 4P3YA 2QE7D 3W6PA 2ZR7A 2GXAA 4JL5A 3LXRA 3H0KA 1E9RA 4D26A 4EPXA 4LY6A 1IOZA 3PCRB 1LS1A 4TQ9A 4UNRA 1ZYUA 2PZFA 2BMDA 1XX6A 3IGFA 4HUQA 1OB5A 1A82A 4QXAA 2ZI3A 1XMVA 5F98A 1AZTA 1E9SA 1LF5A 2FU5C 1ZUIA 2PT5A 2VSOA 4CYMA 2QGNA 4URXR 3ZIAA 1N6HA 1DAGA 2BM0A 1O3YA 4KO8A 2GRJA 2X1VA 3IPXA 4RD2A 5EXTA 1Q1ZA 5A4JA 3ZJYA 3TVTA 4PHGA 5DI3A 4TYYA 4X8MA 1KDOA 2WICA 4QJ5A 4XVQA 2WPDD 1H65A 4MRRA 5J4HA 2ANCA 5F2EA 3VKWA 2NGRA 3RS3A 4DEYA 3IDQA 2YOHA 2ZIAA 1XCMA 1TUIA 3DZDA 3MFYA 4S2EA 3NKVA 4IOLA 1GRQA 1OFIA 1MRSA 4QGAA 3SYLA 1E3MA 2JJ8A 3UXMA 4FMDB 4KV9A 4M9ZA 4OHVA 5AJZA 3UMRA 4DCTA 3QUSA 3L82B 4DHEA 4O3MA 2WMOB 4G3XA 3R9XA 2J0QA 1DELA 2IYXA 3EASA 3W8NA 2RH5A 4CVNA 5JSZA 2GZHA 1ZD9A 1XTRA 1ZM9A 2FFQA 4D0LB 4TL8A 1YZTA 4LZZA 1ZVQA 1SVSA 4LX0A 1Z08A 1P73A 3WP0A 4QNRA 1FQKA 5TV2A 2OXCA 3AH8A 2K5UA 3ETLA 3GFTA 5C4GB 1JXMA 3FFBA 1RFLA 2QMOA 1XTIA 2PMDA 1KI9A 3AP1A 4KLNA 4XD7A 3FMIA 4QJ3A 3BERA 2QQEA 3RS0A 4PZYA 3R9WA 1MABB 2FF7A 1L4UA 2OG2A 1N0WA 2FPMA 2G1KA 4NL4H 5B2ZA 2WJYA 3LVQE 2ZRAA 4OI4A 1E0JA 1XWIA 3K9GA 1KDTA 4N0EA 5L3RA 4UXHA 2PZGA 3GQBA 4M0LA 1UADA 1SVOA 1R5BA 1KK3A 3BXZA 2A30A 4MA4A 3UK6A 4C9BA 1EFUA 1Z22A 3GLGE 4C2TA 1RRPA 3TSOA 5FTMA 1OXXK 5EZ5A 2IYWA 3UMFA 2P65A 3CRQA 1VCMA 3FE2A 5DE3A 1B23P 5KNBA 1JQLB 1KJZA 3EZ7A 1U9IC 2J0SA 5KSYA 3CH5A 1OH6A 2BEKA 4TT3D 5CYPA 5JLJA 5JI3E 2C77A 1DO0A 5EE5B 3A36A 4EFNA 4DSOA 1N6KA 3QOFA 2G6BA 4ZKDA 2ZQ5A 3HU3A 3KQKA 2OAQ1 3WHKA 4B6FA 3EA0A 1UBGA 1KK1A 2RGCA 4HYYA 4AK9A 1UFQA 5JS7A 4CEJB 2EFDB 3GLIA 1KNQA 3AKCA 1P6XA 3RWMB 1KY2A 3PV0A 4JLNA 2ZEJA 3KUDA 2J87A 2FPKA 4FN5A 5DI3B 1JB1A 4BFYA 1U0JA 1Q3TA 1BYUA 2ZYWX 4FI3C 1NBMA 3IILA 4BPBA 4JJZA 4OJKA 1OYYA 3K0CA 4LYAA 2KSQA 3P1JA 4ZCLA 2EWWA 2ERYA 1I2MA 3OE7D 1NMYA 3TR5A 821PA 4YC7A 3K8YA 3CR7A 3KFXA 2GF0A 3HP1A 3Q7QA 4RFSA 1X1SA 2GHIA 4C0BA 2GZDA 2W2TA 4WA7A 4PTLA 2IWHA 5CITA 2A5FA 1T8UA 521PA 2ZRCA 1E96A 3CX7A 2RB4A 1G8YA 1SXJC 1IQPA 3I8XA 4DDVA 1NN0A 2XAUA 2O8CB 4DLXA 3CO5A 1NLFA 3AEZA 1KI4A 3T5DA 5EXSA 2N46A 4LBVA 4C3ZA 2Q6TA 1AIPA 4OK3A 3EC2A 4LGMA 2D06A 4Q4JA 3MWKA 1TEXA 4PFSA 3T5GA 3LY5A 3ZD6A 1CXZA 2GILA 1D2EA 1T91A 2ZRLA 4TQAA 4YQFA 2ZVPX 1G3QA 5E7JA 3A1SA 2O8BB 2VRWA 2ZS8A 4RZ3A 1MO5A 2F9LA 3X1YA 1KZ7B 3T06B 3SQWA 5DNYB 3LX5A 1UBEA 4YLGA 3TVDA 4IVPA 2CNWD 2C04A 2YC4C 3Q5DA 4BFWA 4HAZA 5CDFA 1DVRA 1HH4A 4HDCA 1ZD1A 4P32A 5LPNA 2ONKA 5G3YA 4HAYA 4HI0E 2CVHA 4LJ7A 4C4PA 4D4MA 1GL6A 4TL6A 4NP6A 1AS3A 4RCZA 2P3SA 2QROA 3W3AA 1NG9A 4MYUA 4RD6A 4M1WA 2ZRMA 1PZNA 2GWHA 2OAP1 4HLCA 4O2RA 2IXEA 1GITA 1KDRA 5D3MA 3G0HA 1AM4D 3CF0A 2VSXA 3KQLA 3B9QA 3UG7A 1CS4C 2FZ4A 1HUQA 3MCAA 2V6JA 1JBKA 3A1WA 4GT1A 2WJIA 1YZKA 3QPVA 2WIAA 1LFDB 1P4SA 2MSDB 5FUXA 3K0FB 3QF7A 1R7RA 1NIPA 1Y63A 1TQ4A 4LBWA 2QSYA 1R8SA 1GZSA 1Z8FA 3D3QA 3EWAA 3BD9A 1G1MA 1ZM2A 2CL6X 3K70C 1IN6A 3GLIE 1HE8B 5HE8A 4TWZA 3SE0A 4Q7MB 1TMKA 1YR8A 2GXSA 5ANRB 4A36A 3C41J 2GJKA 2WJGA 3HJNA 3DL0A 3PEVA 4M1MA 5SZKB 1ZINA 1E2PA 1NSTA 5FOVA 1R5NA 3TNFA 2D7DA 2REOA 1GL9B 4AG6A 1CF4A 1DAMA 3WNDA 5HKKA 4BE7B 2WKRA 4EKDA 4BLSA 1IN4A 1NVVR 4JBWA 3A6PC 4PHTA 3RRNA 1KHTA 2FNAA 3EWSA 2QT1A 5IT5A 3Q72A 2XOKA 2R65A 2NOAA 2Q3FA 2O52A 5LB4A 5CB8A 2IYZA 2REXB 1W46A 3A4LA 5BN4A 3SQXA 1DAHA 1VDZA 1U99A 1NG1A 3THOA 3OFNA 4A92A 2QY9A 3QPUA 1E1RD 4YXWA 3ASYA 4JL8A 5C18A 3TSWA 2ZRDA 1XTSA 2WJVA 4PR0A 1U98A 1YR9A 4QJ4A 4DVGA 3VKGA 5HZHA 3CPEA 3A4MA 3PUXA 1T8TA 2KE5A 4F38A 2JGNA 4KBGA 3OEHD 1RRGA 5FTLA 2BJWA 2NO7A 3AF3A 1OHHD 3T15A 1U0LA 2CVFA 4GBMA 2D4HA 3TW8B 2BM1A 3WYFA 1G7TA 4TTQA 2VP4A 1W4AA 1KOFA 4I81A 4HATA 5FBWB 1JJ7A 1Z6TA 3VR4A 4DXAA 2FFAA 1FNNA 1SKYE 4NH0A 2WOOA 4A4DA 4BGDA 2JA1A 1KO1A 1LTQA 3CUEF 2UZIR 4NZYA 2QP4A 4PC7A 1ESNA 3U60B 3FVQA 1QVAA 2Z43A 3BB4A 3H4MA 3HR8A 2GTPA 4XJXA 1IONA 2W58A 1IAQA 2WAYA 3VU9A 1U0HC 3F5FA 3TRFA 1LS6A 1US8A 3P32A 5LBIA 1G5PA 1AKEA 4KVAA 4OK6A 1CKEA 1M6NA 3IUYA 5FPTA 1QHGA 5B30A 1E1QD 1W0KD 2XITA 3CWQA 4YMTA 4C0SA 1HA3A 1BS1A 3TIFA 4BEBA 1S3GA 5CYOA 1EFRA 2QSZA 3LBHA 4LOAA 2NZJA 4LJ4A 3AF0A 2J46A 4C7OB 4EDHA 5F9HA 1GRRA 2V6IA 3EZ9A 1MOZA 4DCUA 2EYQA 2H57A 4C0JA 5KSPA 1KNXA 5C2JB 2QM8A 3KKNA 3T34A 4I1OA 1QHHA 1T9HA 1JI0A 1DADA 1KY3A 2HEIA 3WY9A 2WHXA 4KJZA 4B2IA 1NBME 1N6OA 4TMWA 5CIQA 4I4LA 3K9NA 2NO9A 2XTMA 3LLMA 4TSFD 1IN8A 3QEJA 3SI7A 2OM2A 4CDGA 4Q9JA 2CL0X 4LJ5A 1E4YA 5KO2A 4ARZB 4G5QA 2BMEA 3KKOA 5BYKA 3GLFB 1DAEA 1M1YE 1P2TA 1XNJA 4RD0A 2VP6A 4BZXA 3WHLA 2EFGA 1JAIA 3EW9A 4AYWA 2WTUA 4TL7A 5E7IA 3EXAA 1RC8A 3QKRB 3PUZA 4HZUB 1CJMA 1MT0A 1XMSA 4QBFA 4US0R 1F2UB 2OCPA 4RD3A 1Q22A 1GIAA 3DEFA 1K5DA 3QXJA 2PCJA 4B35A 5KDLA 1EGAA 2V54A 1R0YA 3N5CA 4TMKA 1YE8A 2QAGA 3VKHA 2JATA 1L4YA 4LRWA 1R2QA 1M7HA 2DYKA 2XNSA 2YWGA 4JVNA 4NHOA 1F5NA 5IK2A 4IDNA 3VR5A 4ZCMA 2RAPA 1SZPA 1VIYA 1VG1A 1Z07A 1FP7A 3GJ7A 1BH2A 4WZBE 1ZM7A 5CIWA 4EPRA 1EWRA 1UPTA 1P2VA 3R8CA 4GPTA 1AQYA 3AKYA 4QGGA 5LB2A 1JJVA 1CJUC 3E5HA 2W00A 5JWHA 3TMKA 1DOAA 2O8DB 4URUR 1S1CA 3TLXA 2CLDX 3SEAA 5EE0A 1U94A 4LPKA 3LRPA 4NYIR 2B8TA 2C99A 3BFKA 2RGXA 5J4YA 2D74A 3T1TA 1RPZA 2B6HA 3G82C 5H68A 3VR3A 2FGJA 3C16C 3HR7A 3R20A 3H2YA 1FFHA 4A8JA 1GNPA 1KO4A 1OT3A 5FUYA 3K0CC 1XD2A 4JKIA 3RRMA 4WW0A 1TF7A 4QOSA 3WP1B 5FBLB 4Z54A 2IYYA 3UIEA 4Q1DA 3WBKA 3QKSA 2D2FA 5BYJA 4KBFA 1RZ3A 1SHKA 1A5TA 4Q1EA 3GMTA 1KI6B 3KB1A 1TU3A 3KTAA 1SVLA 2V9PA 4GP6A 4EIWA 4A15A 2WWGA 4KFRA 4ILEA 4BRWA 1Z6XA 3DO6A 3ZVNA 5EP2A 2OXRA 3ND8A 2XJ9A 4R7ZA 4R71A 2WVJA 3KB2A 2QZ4A 1VECA 3FKQA 4JJKA 1FMJA 1GAJA 1E6CA 1G8FA 3H84A 3SDZA 3B8HA 3CBQA 1KO8A 3ICQB 1XEFA 2A5GA 4GSYA 3TE6A 3ASZA 3BWDD 5J4KA 2R2AA 2X8AA 3GJ0A 2EWVA 5B64A 1KTVA 2XZOA 5BN3A 1CR4A 4PAMA 2KWIA 2VHJA 1ZC3A 3GLIB 4P4SA 4IHQA 2WZQA 1ESMA 2HF9A 4CT4B 5AUPB 3W34A 5DISB 2LKCA 2WAXA 3QSYA 2IF2A 4KCGA 4LYFA 2ZS7A 1N5LA 4D25A 3B9PA 2O8BA 1PVOA 4PX9A 4HUTA 4LHWA 2HXSA 4TYNA 4MGIR 2QMHA 1Z0DA 4KSBA 3SJCA 3FB4A 1L8QA 2JAQA 5AUOB 1X6VA 3NHBA 3LO5A 3IIMA 5KDOA 1DAIA 2IUSA 3GJ3A 1VYVA 5SZJA 3U3JA 3VHLB 2O8DA 2HCJB 1KI2A 1SVIA 4V0OA 3U3MA 5B57C 2FE4A 2JLRA 5DN6A 1S2MA 2KJQA 2CCKA 4IKEA 2PX0A 4DLSA 1BYIA 1LB1B 1GNRA 1U81A 3NBFA 2QTVB 5G3ZA 4OI1A 4B76A 3LBNA 4UKDA 2XZLA 4MRSA 1SVKA 4AYTA 2OCYC 2J5XA 4DB4A 2XXAB 3B2EA 4D80A 2IYSA 4WIAA 1H8HD 2O8FB 1JAHA 4DDTA 3LD9A 4POAA 2IHYA 2ZSFA 4P31A 1XDBA 2IYUA 2ORIA 2VA8A 3REFA 1E2EA 5KHOC 4NCIA 5KYKA 4OL0A 4TLDA 1CR1A 3RVBA 1KDPA 3QJYA 4AC9A 4F4JA 4MRNA 3K09A 1CJTC 5AJXA 2WSSD 3Q3JB 1WE2A 1VIAA 3CNOA 1Z2CA 4C0KA 2PMKA 4AD8A 2NIPA 1RE0A 1R5OA 1DAFA 2FV8A 1E2DA 2RHMA 4JLJA 4E09A 3UKDA 4GZLA 4OHYA 1JR3D 1FOEB 1AGPA 3I8SA 2VEDA 3SZRA 3W5JA 1HQCA 2XNDA 4PO1A 2BDTA 3AB3A 2AK3A 1G7SA 3JZAA 4JKYA 2OBMA 4PC2A 2B7CA 3H1TA 4Q9LA 3WMEA 1Q0UA 5JZVA 5DYIA 2O8EA 1W2GA 4TZ0A 4ZI2A 3THYA 5JJLA 3DKPA 2HLDA 3ZQ6A 2ODBA 1TADA 3D7MA 2WKPA 3CLVA 2OLJA 3NIBA 4IDOA 3SJZA 2QL6A 1XXHE 3B6EA 2QM7A 1QHYA 1W5TA 3QG5A 1SHZA 3AGPA 1GG2A 2RGEA 4ITRC 8OHMA 2CXXA 1XP8A 2QT0A 3B85A 3DKVA 3DHWC 1FW6A 5CB6A 1RW4A 2AN9A 4DDUA 2X2EA 1IY2A 1IXZA 3FMOB 3BK7A 4PSAA 4ZIRA 2ZU0C 1NMXA 3CONA 2FSHA 4HLDA 5FOXA 3I4LA 2F1HA 2E9SA 4V0NA 4DLVA 1EFHA 1NSFA 2PJZA 2V55B 3NDBB 4B3GA 3X1DA 4E07A 1CLUA 1S9HA 1WBDA 3HU2A 2BVNA 3THXB 2DFKB 1JR6A 1B0UA 1NY5A 5JSZB 1JQJC 1Y3AA 2ZR0A 5KOYA 2ODNA 4QRHA 1QBKC 3QNUA 2OLKA 2GVZC 5CDFE 4AWXA 1AS2A 2QE7A 3UANA 3NH6A 4P0TA 1Z6GA 4CT5A 5JEDA 5HPYB 3NBXX 1FMLA 2GA8A 3IEVA 4MRPA 1EESA 3FYHA 5E7MA 2F1IA 1M8PA 1OW3B 1Q3HA 4RZ2A 5FR2A 3ADBA 5JHGB 1XMJA 4L8GA 2J41A 1W0JD 4LK2A 4R2IA 1TTTA 4OHWA 2F6RA 4M1YA 2IYLD 4IVQA 3B1ZA 2P5TB 4DLUA 3CRW1 4Z1MD 2JLUA 1XZQA 1Q1QA 3OIVA 2OBLA 5GJCA 2Z83A 4JT2A 3OAAD 3ZS8A 4RCYA 1KSGA 4HLUC 2ODEA 2IUTA 1NN3A 1ZNWA 3KKMA 4Z8XA 4G5SA 4JSYA 4MYHA 1UBCA 4DIEA 1A2BA 5EUQB 4AKHA 1EFRD 2C9CA 1S0UA 2ZUBA 3CM0A 3H86A 1IXSB 1MO3A 2YINC 2QGZA 3FHCB 2IHBA 4WZ6A 1W36B 4DUGD 3P20A 4PQYA 2JLZA 1GNQA 3P26A 2IEZA 3RC8A 1G16A 2YWEA 4CRWB 2CHVA 5FFMA 5D3QA 1VCNA 3K9LA 4XTRA 2ODWA 2NO0A 3RNLA 4EQ6B 2WWHA 4GL2A 4RD4A 1OE0A 5TY0A 1XRJA 4WXRA 2W6IA 5J40A 2VSFA 4PPFA 3RAPR 4A8JC 1WB9A 1XXHA 2IT1A 4XOIA 4TLCA 2IW3A 1E79D 3DOFA 2OILA 4LJYA 2IWRA 4TTRA 4HDQB 2WM9B 5JJKA 4TTPA 3U2QA 3I5XA 2D62A 3GEIA 4CEIA 2PL3A 3OIYA 2WWYA 3KQNA 3B1XA 1YKSA 3I61A 1N6LA 3AM1A 3QXSA 3CB4A 4JLBA 4TQUS 4HAVA 4CZ2A 3ZGXA 4MUBA 1E2MA 4G5GA 4BFSA 1CJVC 4K46A 4TT3A 1ZNZA 3GEEA 3ZD7A 3LQRA 4XSGA 2J1LA 3CWZA 3KFVA 2QRNA 4RFSB 4NPHA 1EG7A 1G20E 1P7CA 4ASUD 4D4LA 4C30A 5GJBA 4V0KA 1LV7A 1ZM4A 2NPIA 1X8KA 4ESHA 5K8IA 2OSBA 4NCKA 1BO6A 2IS2A 3F8TA 4W5WA 5FOWA 2DWPA 4BZQA 4I1VA 1G7CA 4DC9A 1KSFX 1R0ZA 3GPLA 4IEIA 1GILA 3TUZC 4PPQA 3SFZA 4UNSA 2RGNA 5JRJA 1OHHA 5FH9A 3U3OA 4L16A 2WJHA 2Y8EA 3K0AA 1FPMA 5DHFA 2IYQA 4Q1AA 2H16A 3VR1A 3KUCA 2P5SA 3F0TA 1Z47A 5CLQA 3R9IA 5AUQA 3RSOA 1N6NA 2QBYB 1K6MA 1KJWA 2HV8A 3MWLA 3QBVA 1J8YF 1NIJA 2Q21A 4UNQA 5JCZA 2DB3A 4BRUA 4N0DA 3HPQA 4HSEA 4R2HA 2BKUA 2AHOA 4TYQA 4OI2A 4B71A 3B1WA 1ZD8A 4MRVA 5EP4A 3TJZA 3TH5A 1P9WA 3U44A 1YZNA 3BJIC 3FWYA 1PV4A 4JBXA 4KHZA 4O2LA 4K8OA 2QRZA 4A0GA 2BBWA 4IFBA 4Q1CA 2ZSAA 5K8LA 3K0SA 3REGA 4QM7A 1JPNA 2ZUCA 3AVUA 2A7QA 2HJGA 1R0WA 5KPDA 1G18A 1SGWA 3DZ8A 3SS8A 1N6IA 4GZMA 5AUNB 5DHAA 3ICEA 2ZYUX 5EP1A 1WMSA 3A8TA 2J7KA 4NCNA 4QGHA 4KVGA 1XD2B 4EFLA 3MUFA 2O0HA 1OF1A 1XZPA 2HJVA 2GETA 4PHFA 2C9OA 4JLVA 1WBBA 1E2QA 3FFAA 1GOTA 1ZCAA 2VO1A 4Q48A 3GJ6A 5KU1A 2XNDD 1WF3A 2A78A 1NKSA 4NMMA 2ZXUA 4YONB 4Q4HA 5HE9A 1H8HA 1V5WA 2XB2A 3N2EA 1E9BA 1QVRA 4PQRA 2NMVA 1QDEA 4ZV4A 3J81k 5KPJA 4OQXA 2BV3A 3MMPA 1WRBA 2CLSA 5F3WB 1EX6A 2BCJQ 4P33A 2CNWA 2ZYTX 3F3YA 5FPHA 3BOSA 2FOLA 3WMGA 3I32A 3LQQA 3QE0A 4HDOB 3S1AB 1AJEA 5L3QA 4PZZA 4M4SA 2OZEA 2CHQA 3CX8A 2WJJA 3VHXA 1CR0A 1ONBA 1I4TD 3W9YA 1GVNB 2N1BA 3GLHA 1Q1EA 3TAUA 1DAKA 3GCGA 1QG4A 2ASEA 2Q9AA 2C78A 1EFTA 1N25A 2JLXA 2ZJ8A 1OFTA 2JCSA 2DBYA 3X1XA 2CCJA 4Y0VA 5GVSA 4DB2A 2OCBA 2WBLC 1KAOA 2Z6VA 1M2OB 3EZFA 1AZSC 2ZJBA 1YZGA 2WOJA 1G9XA 4F4IA 1ZJ6A 1FUUA 4DT1B 4E22A 3L0SA 3K70D 1P61B 5KSOA 1KJYA 3ECCA 1ZIPA 4HZUA 2ZANA 1Z6AA 4OK5A 2OFWA 2XGJA 4OHXA 3RRZA 2PCLA 3BFVA 4A0HA 2C5LA 3IKJA 1PLLA 2LWIA 4LC0A 1R0XA 3QQ5A 1XCGB 1UM8A 2ZI9A 2N42A 5FBVB 1N6PA 1II0A 1II8A 5E95A 4JLKA 3FKSD 3CR8A 2AFHE 4QHSA 2C03A 4IOMA 5A0FA 5UKDA 1E94E 2FEMA 4XVRA 3MSXA 4AIIA 1E32A 4UXIA 3IPYA 3LA6A 1ZUNB 1CRQA 2IS4A 1RRFA 1MRNA 4X8LA 1FUKA 3Q85A 5IF9A 1GTVA 1TUEA 4MKFA 1XEWY 2CHGA 3D6TB 1XBTA 1U8YA 3UWOA 1D2MA 3OIWA 3EPHA 5H1YA 5IDVA 3LV8A 3B5JA 3CKLA 3VNUA 2PBRA 4KI0A 1LF0A 3FDIA 3VX3A 2FFBA 3MWJA 2F1JA 4FWTA 3GLFE 3KJIA 5JI2E 5EZ6B 1TQDA 4W5HA 3TUJC 4YMUA 4FXPA 2W2VA 1N5KA 1II9A 1ZU4A 2A9KA 2AXPA 3FGNA 3M1IA 4URYR 1XTKA 4Z1MA 3WNCA 3B13B 4XH9B 3ZZTA 4BLQA 2IK8A 1NNEA 2ZSDA 3TQCA 2O8EB 2OBNA 1A1VA 3MG9A 4Q7JB 5EE9A 4DLWA 2BEJA 4DSTA 1PLKA 1NMZA 2WWWA 1UKVY 1G64A 2CE7A 1FZQA 1FTNA 1D2NA 3AQ4A 4LHZA 1QZXA 5FTKA 1N3BA 2RGGA 5IRCD 4QM6A 2HYDA 1XD8A 2IXGA 2W83A 1P9RA 4D0GA 1Z83A 1M7BA 1SXJD 4LHXA 3TW4A 3SOPA 2YC2C 2NTYC 4BUJA 2G77B 4LYJA 2RHDA 1JR3E 4J0QA 3CF6R 1Q20A 2ZUDA 3T35A 2GK6A 4U7DA 3THWB 2I1QA 3B78A 1UAAA 3U4QB 3E2IA 2FX3A 3VR2A 1GUAA 3VQTA 1OIWA 2ZE7A 4JZKA 2FJUA 1XPOA 2R6AA 3ZS9A 4WXPA 2XXAA 2WWXA 3GP8A 4KXFB 5FL7D 4LPSA 4JIMA 5FBRB 4DLYA 1JALA 3RWOA 4A0FA 3RHFA 1P3JA 1VHTA 1TQ2A 3FKSA 2FGKA 5HCIA 5AK0A 4MYCA 3U7GA 4K81B 4A2PA 4KLZA 4L5BA 1JEEA 1DE0A 2GCPA 4EAQA 2ZI6A 2DFTA 4Q7KA 4R98A 1ZM3A 621PA 1Q44A 4B75A 1KYIA 1Z0AA 2BJVA 1LW7A 2V4ZA 4TYPA 4BZPA 1ZP6A 2L0XA 3DVLA 4BFTA 2AKAB 3SC3A 4DRZA 4F91B 3SYNA 4IOJA 1AK2A 1VPLA 2DY1A 5JHHB 4TYWA 2GEDA 1HURA 3OEHA 3VX4A 1NVUQ 3PUWA 4M1OA 4ZCIA 4GDFA 1G6OA 1LNZA 4BFVA 1QG2A 1P5ZB 2G88A 4AURA 4JLPA 3VTKA 2EQBA 4UNNA 2WIBA 4QBGB 3OAAA 3LXXA 2JLQA 3W6OA 3UPUA 4YXWD 4MYTA 1IM2A 4DLTA 2QP3A 4DCSA 4P4SB 2FH5B 4JT4A 1T0JB 4F4CA 1KMQA 2QMEA 2JDID 2JJ1D 4BASA 1E0AA 1KKMA 2BOVA 3AF4A 4JBYA 4BLTA 2XOKD 2AKYA 5BWMA 3CPJB 1GKUB 1D9ZA 1XU4A 4I1SA 2F43A 4LC1A 1Z3IX 1NKTA 4ASUA 2C98A 5DLQC 1VYUA 2GJSA 4GFDA 5FOTA 3IQXA 4XSHA 3BH0A 2DR3A 1P9NA 4BEJA 4MDFA 2ZRHA 3I5YA 1TF5A 4XVUA 3QF4B 1FNMA 1T5IA 4CW7A 2HT6A 2W6ID 4DJTA 3AV0B 3N70A 1FX0B 3BH6A 1WA5A 5KSZA 3PJRA 1S1MA 2CL7X 4I99A 5TDHA 2YHSA 2O0JA 4GI7A 2OEPA 2DWQA 1KMHA 3QKRA 2ZM5A 4JS0A 3GLHE 3EARA 3B1YA 5TVKA 1XTQA 4DCNA 2KB0A 2JLWA 2WWFA 3LNCA 1COWA 4KFTA 1XXHB 2QAGC 2YOFA 2EYUA 2BMJA 1NP6A 1R6BX 2ZU6A 5KTYA 5JFGA 2CLCX 4DDWA 1CULC 4Q4JB 2JJ2A 1X3SA 5EXPA 4DWJA 1X8LA 3Q8XB 1G291 2WSMA 1E2JA 1UKZA 2MSCB 3U6KA 1VG0B 1ANKA 2ZAMA 1CBUA 2JIZD 2XB4A 5EP3A 2CCGA 1YU9A 2CJWB 4B32A 4G1UC 1XF9A 5BXQC 1Z06A 4UJ5A 1HV8A 2RGDA 1TF2A 3CIOA 1XEXA 4US2R 1Z63A 2ZJ2A 3CW2A 4G5OA 1KO7A 3NEYA 1VCOA 5J5CA 1BMFD 4Q18A 2DPXA 5FR1A 4HLQB 4V02A 4Z51A 5HKKD 4QL3A 3UMSA 2GJAA 1YRBA 1N5IA 4DT1A 3RYTC 2V3CC 1VMAA 4HZIA 4NBSA 4HB0A 2QEQA 3M6AA 2ATXA 2XSZD 4IEEA 4CGZA 3EIEA 2Q3MA 1DBSA 2YKGA 2CDNA 4FIDA 1Z0JA 3HWSA 2O5VA 1IBRA 1BMFA 2P67A 4M9SA 4HB4A 4DKXA 4B44A 5L3SA 3NG1A 5GJVC 4OJQA 3U7HB 4Q4LA 4ZIRB 2UZ3A 3L8YA 2WMNB 2VHCA 1KSHA 3AF1A 1U2RA 3DMNA 3L43A 2G9NA 3TGPA 3N2IA 2ZVQX 2C2HA 3I92A 3WNBA 4EJSA 4A0RA 4D4JA 2VBCA 4A1FA 1HEIA 4N1AA 1HT1E 2Q9BA 3EIHA 4LHYA 2QN6A 3U6BA 5IK2D 3SU8A 2EFHB 3R7WB 3BE4A 3IHLA 3CNNA 3LLUA 1T0HB 2IS1A 2ZI4A 1DS6A 4PC6A 5JWOA 4Q4HB 1UKYA 4GOKA 2YV5A 1Z5ZA 1UKEA 6Q21A 2FSIA 1R8QA 1TX4B 3GEHA 4WBSA 1NN5A 1D8TA 4FINA 4OKSA 4JSTA 3MD0A 1MABA 4B3XA 1MV5A 3I3SR 4A6PA 2R9VA 1J99A 3FHOA 4LV8B 3CRVA 4MKHA 3RSLA 4C7OA 2GXUA 3EG5A 4L4UA 1XEXB 1GWNA 4M9QA 3X1WA 3PIRA 4ARZA 5JWRA 4LSGA 1P2UA 2VF7A 4E5UA 2GVDC 3SFVA 4IDQA 1N5JA 2GAOA 3P4XA 1Q1BA 2QPOA 2V7QA 3A4NA 1CU1A 2BBTA 2ZS9A 1NRJB 3B60A 3GFPA 2IXFA 3JVVA 4LBYA 4UXJA 4PZLA 4ZPXA 1GP2A 2VH5R 3QI2A 4RD1A 1WDTA 4GOJA 2WSSA 3MJRA 1R10A 3THYB 1G3IA 2J7PA 3CF2A 4NE2A 2V1XA 2RGBA 4ACAA 5D3MB 1J70A 1WQ1R 5JS8A 1JECA 3B7GA 4WOPA 4NYMQ 4UQOA 2F43B 1ZIOA 2IX3A 5FPKA 1D6JA 5JBQA 3L0PA 2R44A 1W0JA 3CNLA 5L3SB 1E2FA 2QPAA 4MGYR 3V4FA 2C95A 2JDIA 1E69A 1D5CA 2CE2X 1JXOA 3WRYC 4OQMA 3A1TA 4IXNA 2NO1A 3DM9B 2QORA 3BB1A 3LAWA 2D3WA 2QTFA 5E4FA 2J0UA 1ZAKA 1YHNA 1F48A 1OXSC 1FX0A 3E70C 1NY6A 3EA5A 1OLOA 2H17A 5DN6D 4B43A 2VP5A 4RY2A 4TSFA 2B92A 1US8B 3NXSA 4ON9A 1COWD 1N0VC 2OFXA 1II8B 5BW8A 1DG1G 3WXMA 2AL7A 4D82A 1L7VC 4D0NA 3SJAA 2VL7A 2BKEA 3KJEA 4FWIB 1ODFA 3EZ6A 2GKSA 2PJRA 4TMTA 3NBZC 4DSNA 1T6NA 1AKYA 3MRSA 1NBMD 1MH1A 3O8RA 3A1VA 3ONWA 3CPHA 1W4RA 1YJ5A 2QMUA 3QENA 5HCNA 2V8OA 3W5IA 3QXHA 1PJRA 3UWKA 2A2ZA 3SYKA 1ZBDA 2DHRA 5FI1B 3PG5A 1XMIA 1Z28A 3TBKA 4A8JB 1E9DA 3TUIC 3C5CA 3PFIA 1AGRA 1G5RA 3KXKA 3L8ZA 3M0EA 1C4OA 1P60A 5G41A 5J47A 3GD7A 2GDJA 1NVVQ 4OI0A 4V03A 2PH1A 4EPWA 1ZC4A 1W7AA 2QAJA 4Q03A 4KYUA 1OXVA 1ZW6A 3BAFA 2J9RA 3CX6A 3LBIA 1CP2A 3W6NA 1DO2A 1XFAA 2JEOA 5JEEA 4Q1FA 1ZNYA 1ZNXA 1GM5A 1K5GA 2A5DA 2YZ2A 1VKJA 2P0EA 4Q66C 2AD1A 3BB3A 4EPTA 3NVAA 3EX7C 2ANBA 3SHWA 1N6RA 1T3LA 3VNVA 1W47A 2Z4SA 1E9CA 4GP7A 1LVGA 1ETUA 5CLLA 5SZIA 1H8EA 2CK3D 3PR1A 2F3TA 2P6RA 4QGFA 1KI3A 3EAQA 4BLPA 3AF2A 3L0IB 1E9EA 2VP0A 1FQJA 1DG3A 4QBIA 4X8HA 2HUPA 2ZROA 4DCVA 3PUVA 4Y0AA 5AR1A 4B3CA 4AKGA 1E0SA 3I1FA 1LY1A 121PA 5DIFA 4NU0A 2YYZA 4PHHA 4FCVA 1QHHB 1OH7A 5CK5A 2ZJZA 4MDEA 4MQBA 4Q5IA 3K0FA 4U5XA 1SVWA 2DFNA 2VPPA 1YQTA 3I73A 2A5JA 1TNDA 3ZVMA 1UEIA 1E1QA 2BCGY 2QQ0A 2NG1A 1EFCA 2F55A 3T1OA 4TLAA 3AVOA 1MO4A 3Q7PA 3BIFA 1U9IA 1NLYA 2X19A 4MKIA 4YMWA 2GJ8A 3KZ1E 3ZIAD 1DTSA 1Z2AA 1OPXA 2AR7A 3AVVA 2ZRGA 1XEWX 4IXMA 2E1RA 1A7JA 4URWR 3W3ZB 1UDWA 4BFUA 5LD2B 4MITA 2IL1A 2E87A 2YVUA 2O0KA 3HU1A 2FN4A 1FTSA 3IO3A 2LCFA 3K53A 1D9XA 5DI9A 5L3VA 1NJGA 1E2LA 2AWOA 1CRPA 2FFHA 4Q9KA 3QVVA 3HDTA 1HT2E 2XZPA 4IDPA 3KQHA 2D7CA 2RCNA 1OV4A 4FMBB 4EJSC 4A82A 3DDCA 2R8RA 3MGCA 4ABYA 4M8NE 5CJ2A 4DUGA 3TSZA 2RGNC 2CK3A 4PPGA 4HLUA 3O8CA 3RS7A 4X8OA 3GJ5A 1CIPA 1U8AA 3NTUA 4DEXA 3EPLA 2B7BA 3PITA 5G40A 1P62B 4HAWA 3TK1A 5IHPA 1UJ2A 4R9UC 2UVQA 4IW3B 2OHFA 5AJWA 1SQ5A 3KL4A 1RIFA 1E9AA 1TPZA 3D31A 3BRWD 3ND9A 4JLDA 4B3BA 3KKQA 2ZJ5A 1UBFA 3AVXA 1KI8A 1Z6YA 3O8DA 4JYCA 4AI6A 1KI1A 2OCAA 4RKEA 3LWNA 4CEHA 3ADDA 3VR6A 1W49A 1BOFA 1Q21A 2GBLA 3X2SA 4G0NA 2F9MA 4QHYA 1VTKA 5F9FA 2W0MA 3PUYA 1S96A 2FG5A 1RJ9B 1G19A 4HUQB 2BBOA 2J7PD 4KFSA 4TMZA 3ZYCA 4XWKA 1KSJA 2ZE5A 4Z8YA 2OV2A 4OQFA 2JJ2D 4I1UA 3LVRE 1E1RA 3AUXA 1NI3A 1F2TB 4PPNA 1QHIA 2GXQA 3P27A 3CZQA 4URZR 4MH0R 3U4QA 1OYWA 1G41A 1T3SA 2VLIA 2IBMA 4NCHA 4QC2A 5CJPA 4XWOA 2JIZA 1ZMXA 4M22A 1G8GA 2HF8A 1GKYA 5AJYA 4OBEA 4L9SA 1KZGB 2GJ9A 1Q12A 3U7EB 2O8FA 1PUJA 3VMFA 4FMCF 2ONJA 5JECA 3LW8A 4QKQA 2X2FA 3A1UA 3QXXA 2VYFA 2XTNA 3TAHA 2FDCA 1E4VA 1E99A 3NC0C 3QG1A 1RJ9A 2H7VA 1G3MA 2VP9A 4AYXA 1NN1A 2IYVA 2QA5A 2ZITA 5C4MA 1YR7A 1ZUHA 1Z29A 3LFUA 5L3QB 1W4BA 1QHXA 1G5TA 5L8VA 5ELXA 4H1VA 2OT3B 2R6CA 4TLBA 2YJTD 2F1RA 4QBHA 4PXAA 4RSGA 1XJQA 2WKQA 3IIKA 1I4DD 3IIJA 3MLEA 1X8JA 4B2LA 3AVTA 4HAXA 4JMPA 1G4AE 3PQCA 4M53A 3HYRA 4NYIQ 4WAUA 5SZHB 1F60A 4D2IA 3IBYA 4B47A 3L0OA 4OHZA 4XWAA 4EPYA 1O87A 4MGKR 2HLDD 1UDXA 3AP3A 3K9HA 4QNMA 4XD7D 1KO5A 1VCIA 1E9FA 1S4QA 4TMXA 5G53C 3ZVRA 3M4YA 3NEJA 1GRNA 4HEJA 3C15C 1SKYB 3L2OB 3V9PA 1G4UR 1MKYA 2F3RA 1G3UA 1KMHB 4Q9IA 3AKDA 2W6JA 2Q0HA 2ZI5A 3QY0A 4JVLA 2OESA 3EPKA 1JR3A 2I1VB 3THXA 3DPUA 3LDAA 5FUVA 1XPUA 1BKDR 3AVWA 1CTQA 4B34A 4D81A 1U8ZA 1JPJA 1ZRHA 3KKPA 1F2TA 2GCOB 4NONA 4FD2A 4IDHA 3TR0A 5DH9A 1RKBA 2BMFA 1T4GA 4EUNA 1M34E 2A3RA 5JRZA 3GLHB 3OFND 1DPFA 5AWFC 3W8RA 4AG5A 4IOKA 2VHTA 4NYJR 1WP9A 2I3BA 221PA 3FMPB 3T1QA 1H8ED 3OZXA 2ZYVX 4PAQA 2C8VA 2JLSA 1C9KA 2YWFA 4A6XA 1NL3A 2ZRFA 2G3YA 1RVDA 4XIGS 5CM8B 2QG6A 2ZSEA 4NCJA 1KAGA 2XX3A 3K0EA 1TAGA 3U7FB 1GSIA 2ZJOA 2R6GA 4BLOA 4H9GA 5HTKA 4QHTA 1OXUA 3KJHA 4RKFA 4LJ8A 2IYRA 2A5YB 2AWNA 3RS2A 1RRCA 2MMCA 1PLJA 4L9WA 4YDSA 3RANA 2PX3A 2ZREA 4NDZA 2QUZA 3U3KA 4UJ3A 5K8UA 2FA9A 4MUAA 3QKUA 4OQNA 1J7KA 2J45A 4LCBA 2HT1A 1G3RA 1FL9A 3KTAB 4GMDA 4DZZA 2O8CA 4PO8A 5GVRA 3RDPA 2HDNB 3T12A 3EZ2A 3D8BA 2PLFA 3IBGA 5TMPA 3BGWA 2GNOA 3PENA 2RMKA 4LJAA 4RZUA 5KUTA 2ZETA 1M74A 1ZCBA 3FTQA 1KK0A 4NKRA 3CZPA 4P4UA 2ZJAA 3O8BA 3MJHA 2GK7A 4KYIB 3LX8A 4FMDF 5CM9C 3U44B 3TQFA 2PZEA 3IEUA 2X77A 2J3EA 4KU4A 4O25A 4JLOA 2DCUA 2QAGB 4MGZR 2JASA 2Q3HA 2CMKA 3GLGB 4HAUA 1IY0A 3SBDA 1SXJE 2TMKA 1YZUA 4Q7LA 1FP6A 4KSCA 1ZU5A 3AUYA 4TN1A 4ZI3A 1OH8A 2LKDA 3AP2A 1W2HA 2DWOA 4NTZA 4HB3A 3MAAC 1W5SA 1TEVA 4IVRA 3E1SA 3OIUA 1BIFA 2SHKA 3ADCA 2F7SA 1E79A 4M1KA 4JYBA 3WBJA 3JVUA 4V0LA 2XJ4A 2AFIE 1G8HA 4PC1A 3A37A 4CEIB 1CR2A 5DGXA 1G7RA 5DSZA 3KX2A 1P75A 2H8KA 2MMGA 4DBLC 1R4AA 4A9AA 5EUMA 4CIDA 5EXXA 2J59A 2V7QD 3MWYW 1W4CA 1W0KA 2R6FA 5FL7A 2P6NA 1Z0IA 1YZLA 2Z4RA 3K1JA 3AKEA 2Q9CA 4TMVA 5JCPA 2NQ2C 2P6UA 1GKIA 1QF9A 4LWZA 1G21E 4KAXA 3LH5A 3VFDA 2ZTSA 3FHTA 4C0HA 1CEEA 2ORVA 1W1WA 3W90A 5J4LA 1GFIA 3CRMA 1J8MF 4LBZA 2PLRA 4DLRA 5H70A 2FPLA 1J2JA 4ZDJA 2WPDA 3EIQA 4A2WA 2Z0MA 3GLGA 5EJEA 1OFHA 4M1TA 5J4VA 2AX4A 5HR5A 1VG9B 1K8RA 4M9XA 3OEED 5CK4A 1A4RA 3T61A 1C1YA 1E0KA 1HTWA 2XTZA 4OYHA 4M1SA 3KJGA 3DMDA 1N2CE 1SXJA 4Q47A 4ZDWA 1N0UA 3C7KA 2ZJYA 2V1UA 1YRAA 5A5GA 1KI6A 1YR6A 5E3HA 2FMXA 4H1UA 3ZQJA 2H18A 1XCPA 3PEYA 1L2TA 4LV5B 2C96A 4P4TA 5GJWC 3DM5A 4W9MC 1TU4A 1EWQA 2W2XA 3KQUA 4GNKA 1I2DA 2P2LA 3RS5A 4C0AC 4BECA 4B2PA 4JL6A 2BWJA 2KBEA 1IN5A 3EC1A 5TB5A 1KK2A 421PA 4E03A 2IA5A 1XTJA 4S35A 5C46F 1F3OA 3Q5EA 1IXRC 3THWA 3PXGA 3C14C 3SR0A 4PSKA 4TZ6A 3U5ZB 3IQWA 2EVWX 3IHWA 1F2UA 3NDPA 1G17A 2ZE6A 4WZAE 4B48A 2CEAA 2OE2A 2ZR9A 3NC1C 4W5JA 4CEJA 1OKKD 1JNYA 3ZZUA 3BORA 3QIAA 4EJSB 4KITB 4B6EA 1MO6A 2RGAA 2QP9X 2B8WA 2GEUA 2BC9A 4L15A 1OJLA 4GRAA 4DSUA 2REBA 2GCNA 3SNHA 1S8FA 2OUKA 1XJ0A 2J0VA 1RYFA 2EU8A 3Q9LA 3JZMA 1E2IA 4AKEA 3ZDQA 2ZRKA 4F92B 4AKIA 3OF5A 4NYJQ 3PVSA 3WRXC 721PA 1AA9A 4DLZA 2IUUA 2H5EA 3HYTA 5HZKA 2AK2A 4JVSB 4Q21A 5FOSA 4US1R 1OIXA 1IJFA 3SHFA 4C0LA 2QI9C 3U3RA 1EK0A 2YNMA 1W48A 3BS4A 2VIIA 5KDDA 4FCWA 1X1RA 4M21A 3RLFA 2IYTA 1HYQA 4M2LA 2IEYA 4KFUA 2HYIC 3BC1A 2G0TA 1EXMA 1V43A 2XEXA 2VHQA 5DO9A 2PEYA 4C0QC 3I72A 4B3DA 3PEWA 2ZI7A 5JMTA 3WMFA 2R62A 1U90A 1HE1C 4WVFA 3U61B 1DARA 2PEZA 1W36D 3TKLA 4FCTA 4PAOA 1KGDA 4LI0A 4B73A 3SBEA 4D6PA 4B3FX 4MKGA 4Q9HA 1YVDA 3QBTA 4Q19A 4GOXA 1SKQA 1PUIA 4EFMA 2YOGA 1NVWQ 4GMXA 1AQUA 1XB2A 1JEDA 3V4RA 3K70B 2AD5A 2FSFA 1CJKC 2ZRIA 5P21A 4FMCB 4O0MA 4KODA 3AVPA 4PQFA 5C1BA 1HQYE 3OHMA 2VHUA 3KXLA 2ZRBA 4IFEA 1OSNA 3KDSE 4N3NA 1E2NA 2QNRA 1XJCA 4LHVA 2QENA 3T1VA 3NHAA 3FOZA 2CBZA 4LYHA 2JLVA 2BIFA 2OO7A 4G01B 2WWIA 3BBPA 4LJ9A 5TXGA 4ESVA 1W36C 1G8PA 2HCBA 3QKTA 4HB2A 5EQTA 4D4KA 3RC3A 1NF3A 2WV9A 1HY3A 2I4IA 2H92A 2IF0A 5FI0B 2GF9A 3IO5A 2R6DA 2NPFA 1VG8A 3RRYA 1AN0A 1ELOA 5AJVB 3VAAA 3NWJA 3I62A 5LDDC 3R7WA 1UEJA 4V0ME 4Q4AA 2ERXA 2VP2A 4B33A 1T5LA 2NO6A 3ZVLA 1W44A 3OE7A 3FMFA 3QF4A 1OXTA 4W7SA 2BBSA 1I4LD 4ZKEA 2BHRA 2GZAA 1WCV1 1WXQA 3VU9B 4F7WA 2ORWA 5M04A 1E2GA 2GESA 3AVQA 2HXYA 1OH5A 5BN5A 1F6BA 5JJIA 2GBLC 3PEUA 1QHSA 4Q02A 2EFCB 1OKKA 5H8WA 5FL3A 4CEHB 4ERNA 2GAAA 3FPAA 2ZPTX 3WYGA 2CJWA 4B74A 1OIVA 5DYGA 3AVYA 1NLZA 4BQSA 1E98A 1SVMA 4Q01A 1AS0A 4RFVA 5GADl 2DFLA 2QU8A 2IS6A 1P72A 1Z0FA 1GDDA 1A2KC 2RKOA 2ZAOA 5FPSA 4II7A 4V0MA 2QTHA 1X86B 2FWRA 3SJBA 5FTNA 4XTCS 3EPJA 1GL7A 3RS4A 2ECKA 3OESA 4CF7A 2W6JD 2Z5FA 4LDJA 4EQ6A 3V00A 4RZXA 1QRAA 1DEKA 4LUCA 1IN7A 2EFEB 5FBQB 3S1AA 3UATA 1XPRA 4LV6A 1E2HA 2XSZA 1UF9A 4JVMA 2ZRJA 3GJXC 2ZRPA 1KKLA 3K09C 4BLRA 4Q00A 2VTKA 1MR3F 3QKSB 4C2UA 3QVUA 2OFOA 3R8FA 1S9DA 3RABA 4FW9A 1SXJB 2JJ1A 1OFUX 1KI7A 3OEEA 3DOEA 4LJ6A 1S3SA 1Z0KA 2QPTA 3CH4B 4ZO4A 3KXIA 4IJMA 4RVCA 2FSGA 4OQLA 1J90A 3AGQA 1G6HA 2FZLA 2FEOA 4PSVA 1E2KA 2VQSA 3GJ4A 2MSEB 4JLAA 2IC5A 4QG7A 1NJFA 2H1LA 2VF8A 5EE3A 1XD9A 3HPRA 4DIDA 3GJ8A 2G0NA 4URVR 3B82A 4G5RA 1T3HA 3WYAA 1OB2A 3GFOA 3QXCA 4ACBA 4BWYA 1M7GA 5FTJA 2ATVA 3LW7A 2W0SA 4NYMR 4QFMA 4EPVA 2EW1A 4Q1BA 5FOUA 5K8TA 4AY2A 4TL9A 1SULA 3CRRA 2UKDA 3ZLJA 3ZZ0A 2G83A 3QPWA 3C4JA 4RJLA 3B1VA 1KIMA 4PANA
chains in the Genus database with same CATH superfamily
4U6QA 2GN4A 4JLMA 4J8PA 3OCZA 3RF6A 4BJ1A 2AXNA 5JQGB 2YV2A 5K4HA 4RKWA 4OATA 2H2FA 4UE6A 2B21A 1IHUA 2FMFA 2OBFA 2ZJ3A 4ZDKA 4I1PA 3NBYC 5GMOA 4ZQEA 4YMVA 1IJEA 5KNDA 5U4QA 1QLJA 4C04A 5IUNC 1L7PA 4P0PB 1YB4A 2AR0A 3NJ4A 2JLYA 2JIBA 1B73A 2C29D 2G1JA 4U00A 2ADOA 1TL7C 5ALUA 3EXFB 1XTUA 1S8OA 3VHQA 3FIJA 4UCQA 3X1ZA 5I4KA 3DTVA 1Y1LA 4TUYF 3SSMA 1LD3A 3DFUA 4XDGA 3LL7A 4EENA 1RYHA 2O20A 1M6VA 4M86A 4FM9A 1KY5A 3GMIA 4YMSA 4ETMA 3C7AA 3ACBA 3QEOA 3UG6A 4HDSB 5DBGA 5IBPA 1V16A 3O47A 4DRYA 5AT1A 4PC3A 1X1CA 1S3IA 2H85A 4QPDA 2YJGA 2ZSBA 1I32A 1R0SA 2ACKA 4CM4B 1OOEA 1PT5A 1J4AA 3CJTA 1N57A 2AJBA 1YO6A 4H17A 5AVWA 2RJNA 1F2VA 5EE1A 1M2OA 1JWBB 1HKHA 3FBWA 1C9EA 4R0NA 3EVCA 2BM8A 1XVLA 4P3YA 2QE7D 1BEUB 4IHKA 4RW0A 2ZR7A 3PS9A 5EXDA 2GYWA 2WG2A 4RTQA 4S1VA 1E3EA 1I9GA 1NFRA 4H18A 3UQZA 5IXJA 1PT8A 3FPEA 2LBPA 3U13A 2NZVG 4R1UA 3RUPA 2EL7A 2LIVA 3PTLA 3WRVA 4P5PA 1RHQA 1QIHA 1XX6A 2HBQA 2Q4RA 2F8MA 3M4XA 4FYIA 2A1UA 5KWSA 1XMVA 3ZNOA 2J09A 2PLWA 3MK31 1NI5A 1MX1A 1ZUIA 3DB2A 1DQYA 4CYMA 4FFPA 1T2AA 4URXR 2BSXA 1DAGA 2BM0A 2FAXA 3CEJA 1MJGM 5CURA 1UM9A 2GRJA 1MVNA 4K9PA 4CWAA 2A9RA 5AXDA 5LQJA 4U7HA 4FW8A 5FQNA 1K7XB 3DEHA 2Y6UA 4QJ5A 3ZY3A 1J0CA 4MRRA 3SVLA 4BVHA 2CFRA 1CYDA 3PA6A 4K2AA 5JTTA 1G55A 2GGSA 2VDRB 4BJ3A 2YOHA 2ZIAA 4TTIA 5K0EA 5AOBA 1TUIA 4HH0A 3CC8A 1BU8A 3NKVA 3HA7A 4MZXA 4Z9BA 3DB1A 3P71T 2JJ8A 3OOYA 3UXMA 3PLAE 1WUIS 4FMDB 4K3UA 1DBRA 4AJPA 4O3MA 4DYHA 2J6BA 2A1UB 2OORC 2XCIA 1DELA 1T29A 5A7HA 1YMQA 4CVNA 5F7XA 4GL4A 1BEZA 2FUG1 3BL8A 3O7WA 4M7PA 4JN6B 4DV0B 4MDYA 5AJTA 3ZGZA 2FFQA 2I66A 2WWVD 4PGMA 5LP6F 1SVSA 5CT8A 1Z08A 3L7OA 3T7DA 4P4LA 3L8DA 2NM0A 3DZGA 2GNAA 1OREA 1VKRA 1UKAA 1WBJB 1U1IA 4MQMA 4OQ4A 4KQXA 3I01M 1J6UA 5GAJA 4EUFA 2K5UA 4JQCA 5U9CA 3DP7A 3ZDXB 3GFTA 5C4GB 1ATZA 3MXOA 3N6VA 1JFLA 4KMRA 2AF3C 4OMCA 5LOVA 1T3TA 2PMDA 4KLNA 3AP1A 1L5SA 4R54A 2E6UX 3DEYX 5KYXB 4EMUA 1DC5A 1V11B 2QQEA 1M8FA 4ZI5A 3RS0A 3Q6IA 4XGQA 3R9WA 2CFIA 1CDZA 4NL4H 2XAAA 1M76A 1SUPA 2FPMA 3M6XA 4L0CA 2XCQA 5B2EA 4YP7A 1MPXA 3USZA 1Y1QA 1XLWA 2WJYA 4ZEVA 3K9GA 1XWIA 4KN5A 2BD0A 1H23A 4QU8A 2O8NA 5ES4B 3VDXA 1MQ9A 1AF7A 1RQLA 2PZGA 5BSUA 4YIKA 4M0LA 1RC1A 4CODB 3IT0A 2H2GA 3E3MA 4OJTA 2WF9A 2W2KA 4IX1A 4MA4A 4NVRA 4CQLB 5NLLA 1U02A 3X44A 4G09A 5BV2P 1EFUA 3GFRA 4I5EA 4K26A 4HT3B 1YS4A 1BDIA 2D4AA 1OXXK 5FTMA 2IYWA 4ODIA 5BQOA 4QPCA 4K9SA 2GM9A 3CLRD 4DXAA 3CH5A 4M36A 3LVFO 3OMWA 4PZEA 5EG5A 1DO0A 1RIIA 2O1WA 4RXUA 3YASA 5EE5B 2L42A 4DSOA 1KXZA 3SF8A 2YIMA 3QOFA 3TIIA 2AYYA 1O95D 5EMKA 1T2NA 3KQKA 2WHEA 4C2AA 4MJXA 5IH7A 1UBGA 4KL8S 2RGCA 2ISSD 3D8TA 1QC5B 2GWRA 4RV9A 5C8YF 4IWNA 1RACA 3E6AA 4P84A 5CH5A 4ZV9A 3RWMB 1M6EX 3HNPA 3PV0A 2ZEJA 1LLDA 3KUDA 2AIRA 2J87A 4ZEOA 3S8MA 3OZAA 2IZOA 1U1CA 3ICCA 1Q3TA 4FI3C 3HDQA 3AW9A 3IBTA 4CM9D 4PVCA 4RJKA 1QOQB 3IILA 1HNNA 2W42A 4JJZA 4FR2A 4KVFA 4OJKA 3G2IA 4H08A 3Q2KA 4LYAA 3OU7A 2OYSA 2DHEA 4RK7A 1HLFA 4ENVA 1NMYA 2B1GA 3VR6D 4YC7A 2H1OA 3FWPA 5BR1A 4RFSA 2QD1A 3ZBPA 4C0BA 3IUBA 1EM8B 1X1EA 3B3GA 8LDHA 5KC8A 1E7WA 2IWHA 3UCEA 4JY7A 3RHZA 3ZQKA 4RSMA 4BO3A 521PA 3CX7A 1ZQ9A 3N8NA 1Z4KA 3P94A 5FYDA 2DR0A 1QYCA 3R41A 3A31A 1IQPA 2GN6A 2EX0A 2YXBA 2O5CA 1NN0A 2RHTA 4DA6A 4NXNB 3CO5A 4DJEC 3U09A 4FDLA 5I6DA 1REQA 4GGPA 5EXSA 3TDMA 1DMRA 1I14A 2YZNA 4LBVA 4LGMA 3H9EO 3QMWA 2ERCA 1TEXA 3LYHA 1EM6A 1UWLA 1DHTA 3ZD6A 3ICVA 1FJHA 1X8XA 3GY0A 4WGFA 1D2EA 1QO0D 1T91A 3JQAD 1QP4A 1CS0B 4TQAA 2R751 2ZVPX 3B7PA 2AOUA 4MSUA 2VRWA 1JAYA 2HZ7A 2ZS8A 3H2GA 3P2KA 5DHPA 5G2OA 4D9HA 3X1YA 4LYDA 1L4FA 3T06B 3HRIA 4MWBA 2P7IA 1K6JA 10MHA 4F4HA 2HMYB 4H6WA 3LECA 1PR3A 4HBGA 2GLUA 2JF0A 1ADCA 4QRDA 1KP3A 2J07A 5BY2A 1I1HA 4NESA 1PV2A 3GF4A 2ONKA 4YPOA 5G3YA 5LVAA 4HI0E 3W3AH 4LJ7A 4C4PA 1NA5A 2ID7A 3QX3A 2ZTMA 4ZEWA 1PYGA 4NP6A 2UU9B 1AS3A 1BHO1 3GR6A 5HF8A 2QROA 3W3AA 4D9GA 4D45A 1NG9A 5IULC 3MCZA 4LDNA 3OOJA 2PT9A 4M0DA 5T4EA 3I5MA 4MYDA 5KYXA 1AM4D 3CF0A 2VSXA 3GCXA 3GJYA 5DM0A 3W2EA 1XNGA 2IOFA 4KN6A 4HKTA 2DM6A 2VHEA 1C8VB 1EWKA 3ABZA 3QPVA 1IPFA 4RVHA 2POQX 2HWUA 2PX5A 1GZVA 3RT1A 3FTDA 4E1BA 2I22A 5JW6A 3QVKA 4ZTZB 2Q62A 1T4MA 1R7RA 2Q29A 2YVKA 1W25A 3ABIA 3AR4A 4MV3A 4QYSA 3TBHA 4IZ6A 1TQ4A 2PXCA 5CA1B 3A9RA 3QVXA 1SXGA 2ZB8A 1R8SA 1Z56C 1Z8FA 2QTRA 4PLFA 4U2FA 5KHAA 3NFRA 3GLIE 1HE8B 4HEQA 2ZSKA 2Y1CA 3HZHA 5E1DA 3SE0A 1TMKA 2GM5A 2VWHA 1T9AA 2GJKA 3VOBA 3HJNA 4D9EA 1SAYA 2KHZA 5LZ2A 4QUKA 2REOA 4WOKA 3I05A 3EOZA 1QGUB 1CF4A 2CYAA 3E4DA 3WNDA 2CD7A 4ZALA 1CY8A 1JKMA 4BE7B 2WKRA 4EKDA 3CX4A 3OZIA 3TCXB 4JBWA 3R44A 4PHTA 1O5IA 1QPZA 1T43A 4RHTA 4O5AA 1E1KA 2WUWE 2HCRA 3A2NA 5CLHA 4QQNA 3SSOA 1PTJA 2XOKA 3SP1A 3LX6A 4REOA 2YJ5A 2NOAA 2Q3FA 2O52A 4TXJA 1JLLB 5CLGA 5LB4A 2CUTA 3R0QA 4ZVOA 2REXB 4PR3A 3I42A 2MIIA 2WZDA 3GVCA 2NU8A 5BN4A 1DAHA 2YH2A 2VZ8A 2QLJA 3THOA 4BO8A 2BT4A 3H42B 3OFNA 4BMPB 1F8FA 1MAWA 2XA9A 3R74A 1UK7A 3QPUA 3ZE9A 3HXQA 1A71A 3ASYA 3WWZA 2ZRDA 2GM4A 3DJYA 3KG2A 4OFZA 2WJVA 1NDHA 1U98A 2IXAA 4TV8B 3BK1A 3RYHB 3VUFA 4DVGA 3DYIA 1AURA 6LDHA 1OT5A 2NW6A 3A4MA 4OTZA 4F38A 3VU0A 2JGNA 4YI5A 4HS9A 1R64A 1YDFA 2X2OA 3BDAA 3NAGA 4QUGA 4BMCA 2BJWA 5T6MA 3WI7A 2R5WA 1HMYA 1HYBA 5ALPA 4QAQA 1U0LA 1NXXA 1YDMA 3DC7A 2BM1A 3HCOA 4LQCA 3TW8B 3WYFA 1OBCA 1H9AA 1RWOA 1N2EA 3ADOA 5FUQA 2AFIB 1KOFA 1C50A 2VK1A 4UBLA 3ZN2A 4CMGA 3VYSB 1H2BA 3DEJA 1IBKB 4IV5A 1P18A 3UAZA 3DBHB 3KZCA 4A91A 5CLIA 3WA6A 4DG9A 4JELA 3KVNA 4TKUB 1GVHA 2XW6A 1IHPA 3LI2A 3UMCA 1R27A 4FYYA 3O8OB 1SKYE 4ZEMA 4BGDA 2A57A 1KO1A 2JA1A 4FDMA 3U7RA 2FPIA 2IEIA 5I7VA 5L7WA 3JQFA 4W1SA 4E2FA 4WBXC 5FO1A 4NZYA 3U60B 1ESNA 1R00A 3N0WA 3PYMA 1QVAA 3H4MA 3IDAA 1BAPA 2Z57A 3OJWA 1RI3A 2LE0A 2W58A 2XRFA 1RHRA 2WAYA 3GPDG 3M1AA 4WKPA 1URPA 3VU9A 2HBYA 1DCKA 1U0HC 3IODA 5IDYA 3KB6A 3TRFA 1N33B 1P74A 3GYGA 1VRWA 1R4MA 3IUNA 4N7MA 3VPFA 3KXDA 2QV7A 3WGOA 3ZEIA 1L4KA 2IEDA 2W93A 3HBJA 3GGPA 5ERYA 3IUYA 4DR3B 3NOVA 1QHGA 2R4UA 1P2BA 2QW1A 4C08A 1E1QD 1W0KD 2I7XA 1Q84A 5JADA 5B3JA 3UB2A 4C0SA 1BS1A 2QR3A 4QUBA 5TSDA 1BFDA 3TIFA 4LOAA 4OHRA 3LBHA 4LS3A 1YHYA 3EVZA 3R0XA 3BKXA 4XCXA 1XZBA 5FV7A 4EDHA 1HDIA 2EHJA 1J8DA 3PXDA 4K5QA 1H66A 1MOZA 3L0CA 5G1OA 5KQRA 3R4VA 2PS3A 2FETA 1ZJYA 5HBRA 2H57A 2JHCA 1KBQA 4C0JA 1FZTA 3V4LA 4MLCA 5H3CA 4K9KA 4RDCA 1VJRA 1KNXA 3HO6A 2E6KA 2O2DA 1SCDA 1YFKA 2GO7A 3RK1A 5IBCA 2O54A 3MW8A 1V4VA 2P9EA 1FUYB 3KR1A 5F77A 1KY3A 1S8AA 4IIGA 2G72A 4KJZA 1NBME 4B2IA 4DCOA 1IXYA 3I2KA 1LFAA 1YCFA 1GN8A 3ED1A 4FTWA 1LWOA 1GLVA 3AHJA 5KCZA 1KEVA 1NQXA 1F51E 1GRVA 1BU5A 3JAKA 1XLUA 4EOGA 1JHUA 3BQNB 5DBIA 3TJMA 2OVFA 3K5IA 3CVYA 2EJWA 2Q07A 3HQ4O 4AM8A 1MENA 2FE1A 3NBKA 3QX7A 3KKOA 1ZI8A 5BYKA 1P2TA 1XNJA 4IQGA 3GDFA 1FLVA 3WHLA 4ALMA 2XWPA 2ZIVB 4FIZA 3R5XA 1JAIA 4GS5A 6REQA 5LU9A 3ORSA 4TL7A 2Z3ZA 4R1TA 5LP6C 4DAEA 5CA0B 5J2TF 4Z49A 5E7IA 3F73A 1RC8A 5CXUA 4HZUB 4KQGA 1MNQA 2ZB4A 3SIRA 3CN7A 1U8XX 2QY6A 4OH7A 2WILA 3D8RA 4US0R 2HRQA 2QRVA 2IZ1A 2QQFA 1O6FA 1GIAA 3DEFA 2IE0A 1FNCA 1DKLA 1PEKE 1B42A 2BUAA 3MA0A 5DBHX 4EATA 1Z38A 1EGAA 4OG2A 2H48A 1OGIA 2YJ3A 2ZG6A 1L1RA 1QVWA 1A4IA 2PGOA 2EZTA 1R0YA 3EF0A 1D04A 1FEZA 1ORHA 3N8GA 4J2HA 4JXJA 3DL7A 5B2FA 3HXOA 1YE8A 1KU0A 2H3EA 3GFSA 4IIJF 1GDHA 2FW8A 1L4YA 2XNCA 2EAUA 3RREA 1F5NA 3NRJA 1H9BA 4IDNA 3UTDA 3VR5A 1CUDA 2C8JA 3VPAA 1SEPA 4ID3A 1FP7A 1R6XA 5HMMA 4UHBA 4CLXA 3WGQA 1SBIA 2QD2A 1X9HA 3A1EA 2GF2A 3P0JA 4IR7A 1EWRA 4NFHA 1P2VA 4RC9A 4GPTA 4MV1A 3T8YA 2PYZA 1CJUC 1DT3A 5BMVB 5CDGA 3EUEA 3B48A 4ZAXA 5LMNB 3DKIA 3JQBA 4Z53A 1YK1A 5IVIA 3GI1A 4O4LB 4RDHA 4AJHA 2CLDX 5EE0A 1U94A 4LPKA 3EGCA 4UVDA 5E8JA 1E1DA 3NETA 1N9GB 3EQ7A 4LW8A 4F96A 3HJAA 2RGXA 1E5DA 4LRSB 2D74A 3RU3A 1OD6A 4AZ3B 2CJFA 3AEKB 3CLSC 1C9MA 5F4ZA 4XIJA 3VR3A 2XKKA 3S2SA 3C16C 3R20A 1OT3A 3DE1X 3VZSA 1MXHA 1XD2A 3GA0A 2I6XA 3JX9A 3M5PA 2I54A 3QVOA 3QYPA 4FFNA 4G9EA 1EUDB 1MDBA 4IV8A 4P9NA 2I78A 3WP1B 4JODA 3EIWA 2D5AA 2J4DA 2PWYA 4A5SA 5J2UA 1UMBB 4XGRA 2VF2A 3QKSA 2J9GA 5BMVA 1BGWA 4O2AF 2C3YA 4YO7A 5I9SA 5EHZA 3L7JA 4JI8B 1KI6B 3KB1A 2JD1A 2YMMA 1DC3A 1C0IA 3DT6A 3H3FA 5A1TA 2BSQA 4ND1A 4KFRA 2NZYA 4ILEA 1EFDN 3DO6A 1V7PC 5DIZA 5IANA 5IM4F 4R71A 2OC4A 2XQKA 4RKRA 3KB2A 2QZ4A 4UEJA 5K3BA 5KOIA 2F2TA 4R84A 3FKQA 4JJKA 4FGSA 3RFUA 3BRWA 3GT7A 1KS9A 4WCVA 4DSZA 2QIOA 5E0OA 3ICQB 2HWYA 2WF6A 2Z3WA 3BXFA 2EBUA 4GSYA 5T4FA 1FLDA 3BWDD 1KZ4A 4E0BA 2R2AA 2DQ4A 1FRNA 4UFPA 3OQJA 4H4CA 4YJFA 2XQVA 3IP6A 4PG8A 5B64A 3WTBA 1XLTC 5B53A 5EIOA 1XNHA 3RYCB 4PAMA 1SUSA 3AI1A 4ALLA 4WASA 1ZC3A 2E4UA 2VJOA 3IBSA 4EP1A 2Q5JA 4JJAA 2F1KA 1O8CA 2HR1A 1M1NA 2EZ8A 2C97A 2HF9A 3FGZA 3K8OE 3S40A 2IP4A 4ALNA 1L7NA 3W34A 1WG8A 4RHXA 4DY4A 3D3JA 4KCGA 4LYFA 1N5LA 3D3KA 2Q2NA 4RANA 1G6KA 4YJKA 3K6SA 3KEOA 2BGRA 1EWVA 2HXSA 1HDOA 1JTEA 5CAEB 3F5MA 2F9FA 4TYNA 4IRMA 2XLBA 4MQEB 5AI4A 3ZY4A 3MMNA 4IHAA 5FCDA 5H80A 3SJCA 3OETA 1L8QA 4G0UA 5EIHA 3DDNA 4K9MA 3NHBA 1IY8A 2D00A 2IUSA 5C8XA 1UODA 4XWGA 4ZU6X 5I9TA 3U3JA 2O8DA 3F4BA 1SVIA 5IZ4A 4IIJB 4V0OA 1P1JA 3U3MA 5AD1A 3THRA 2FE4A 3DOOA 2C7OA 4GEKA 1X15A 2GEJA 3GL9A 2IRWA 4MR8A 3HNOA 1S2MA 1X70A 2WYVA 3TW8A 5ED0A 1V7ZA 2XGMA 3S2ZA 4UKDA 3OY2A 1BVRA 1YB5A 4WNIA 2ENWA 2XZLA 2EV9A 3H1BA 4N39A 3O8OA 4FLMA 1P29A 1XE3A 5HFNA 4NBUA 3KKEA 4EYEA 2IYSA 4WIAA 1H8HD 2UUOA 1E4EB 3ZWPA 2YIDA 4DDTA 2O8FB 1NT4A 3BJEA 2HWXA 2IHYA 4ZT2A 1T8PA 3F4LA 2ORIA 1FVXA 3N0XA 4JSRA 3CRZA 1H0KA 4KXVA 4UARA 3FGOA 2CBXA 2GHQA 3CZ5A 5JARA 1EA5A 1P80A 2YWCA 4LYYA 3A4YA 5DP1A 5IKOA 5C52B 4U7GA 3BMCB 3QJYA 4Z0NA 4F4JA 3NFYA 2VQ3A 5HFJA 4GI5A 4N48A 1MB3A 2RHGB 5AJXA 4PX5A 1WE2A 1VIAA 2IE8A 3CNOA 3EFHA 4C0KA 1QONA 1IVSA 5D5HA 2PMKA 2FTKE 1THGA 2O7RA 3KHSA 3L1IA 3B6MA 3DDHA 3WRXA 2DECA 4U2BA 4YRQA 2JKYA 1U28A 2I03A 3KLPX 3UKDA 2JI8A 4E09A 4EGCB 1JR3D 2QNBA 2XUAA 3FJ1A 2VEDA 2Y76A 3W5JA 2XNDA 2H1FA 2BDTA 3AB3A 5HFAA 2AK3A 1IUNA 3PRHA 1PU2A 3DTYA 3DO8A 4MINA 4Q9LA 3WMEA 1R66A 1Q0UA 1AQLA 3JSXA 2HBZA 1TDJA 4X97A 2VUSA 4GKBA 1LH0A 2IUEA 4A0QA 4TKMA 4FZVA 3DZKA 5EWLA 2FN7A 4J16C 3WAKA 1TLTA 2IPXA 3BMCA 3ZQ6A 3PSHA 2HW8A 1U2GC 3H05A 2GA9A 2WKPA 3CE6A 3CLVA 3N8DA 4IDOA 1I10A 3EMKA 4ZJPA 1J1UA 4CLEA 3DNPA 2QM7A 1HDGO 1D6MA 2M6LA 3QG5A 1UK8A 2W90A 3RSQA 1WABA 4HNRA 2CXXA 3EQ8A 2Z1NA 3W2IA 3GUCA 3DKVA 1JEOA 5CB6A 2RDMA 3VI3B 1ZD2P 1M2EA 1K5HA 2X2EA 1JIIA 1IY2A 5DTQA 3TW0A 2XVYA 2PD4A 5ETJA 2ZU0C 3L8HA 4IJ6A 3HEAA 2QMYA 2ZULA 2F1HA 2E9SA 3RUFA 1M8JA 4K86A 1Z2EA 3WZ2A 3R5SA 1QWSA 3LCVB 2DLNA 3JU3A 1ZOSA 2I9KA 3WKBA 2V55B 3KCQA 1O95A 4E07A 2A1TS 2GASA 3NJ8A 1CLUA 1S9HA 2PZBA 4KLAA 4C6SA 5IUJC 1QK5A 2ISCA 2F4VB 1JRLA 2I1LA 3KZOA 4L0MA 4MUEA 5HJ5A 1JR6A 2Y68A 1DWPA 1NY5A 3EVNA 2YBEA 4F2WA 2BELA 1JQJC 4MIEA 2ZR0A 4N8SA 3OPMA 5G0UA 5CAEA 2ZTLA 5KOYA 1N8TA 2G9VA 2IZZA 4ZCSA 1QBKC 4NWIA 1BHQ1 2LD4A 4X1KA 3QEBZ 4L3VA 5CDFE 3LMKA 1AS2A 3TX6A 2P8SA 4BX8A 4A03A 4WNYA 4CT5A 1Z6GA 4X94A 3WYBA 1L8LA 2EARA 1QANA 4MRPA 1IHYA 2ZWVA 1M8PA 1OW3B 1ZG3A 4KQJA 4PCUA 4RZ2A 5FR2A 4KOEC 4DDHA 4LK2A 4TKZA 2BFBB 2QD3A 3R9KA 3UV3A 3L07A 4OHWA 3VNSA 4C21A 1ZVJA 1HLGA 2X0EA 4IVQA 4YA6A 1NXQA 1F4VA 3HGTA 2P5TB 2IBTA 3COSA 4ZA2A 2JLUA 1V5FA 2P69A 1R4MB 2VPWA 1DJOA 2G4VA 1T13A 5CH8A 3UN1A 5K6RA 1AE1A 2OBLA 2O4CA 4HGQA 4A23A 2PS1A 4RCYA 1KSGA 3PUHA 1R9NA 2CHFA 4GYJA 1NN3A 4AY3A 4ZYXA 1R9GA 3G2NA 4J0FA 1UAGA 2C5BA 4G5SA 1RAIA 1DZIA 5TRTA 3E3AA 2WDZA 1X39A 2XYPA 2JCXA 3HG7A 5EUQB 1U0GA 4AKHA 4JWTA 1QMPA 3UC5A 1V9SA 1UJ6A 1NV8A 2ZUBA 1U7DA 3AJAA 4U0KA 4JP5A 3VDRA 4CDMA 1X1BA 2YINC 1I2AA 2G9QA 2GTHA 3BXOA 4KJXA 5HHTA 5JSHA 1TK3A 1W36B 3OE1A 4IJVA 4Y9SA 1LBSA 4DV6B 2PGNA 2IEZA 1OGJA 1E62A 1PL8A 1ZN8A 3DXYA 2CHUA 3R5HA 1YCDA 4R9SA 5D3QA 3WRWA 4XTRA 2AC7A 1O96B 2ODWA 3IP5A 1YI0A 3DDZX 3KHUA 1TZCA 1X1AA 2VF5X 4OEHA 4UU1A 2C5FA 3BZUA 5DHUA 5IC4A 3FOEC 3ZWBA 2OCKA 3WIEA 3WYCA 3FW1A 3JQ8A 4YB8A 1ZGBA 4FFOA 4EHNA 3D02A 4P83A 4TLCA 4RJ2A 2O4UX 4LJYA 2CLKB 3U2QA 1HOXA 4N3AA 3K1ZA 3OIYA 3GZNA 1NSYA 3KQPA 4YRAA 3KQYA 1RFGE 3IQDB 4PYLA 4FZJA 4KEAA 5D87A 3AM1A 3CB4A 2IHTA 1JQKA 1KY4A 4TQUS 3ZGXA 1RMYA 4Z6KA 3M49A 2QZSA 4OLJA 4BFSA 4TT3A 4K46A 5DFAA 4JITA 3ZD7A 1V7CA 4GM4A 4GXNA 4F3TA 4YCDA 3K1AB 4D4HA 3ZDBA 3WISA 1WEKA 2ECQA 3U3XA 1G2QA 5M34A 1EG7A 2RGUA 5FNVF 1YUBA 4RHYA 1WXHA 2VI5A 3MTBA 4GNRA 3STTA 1N7IA 4H7DA 4D4LA 2FFRA 2HSDA 3EEQA 1X8KA 3OT1B 4JOSA 4ESHA 5LLTA 3PL5A 4NCKA 2YWDA 1DB3A 3P0EA 2QRLA 4DM4A 4WJKB 2ZLBA 2OZLB 4Q3EA 5JH7F 4I4TF 2I3AA 3PNVA 4K0KB 2I7TA 3H5WA 2JIOA 1GILA 1W6UA 2PUVA 3QEKA 4MB6A 3HKEA 4X20A 3KQWA 3SFZA 1ADJA 5WRFA 5GY7A 1N36B 4IILA 5K0JA 2FPPA 4R8LA 2RHLA 4V24A 2Y8EA 2GZRA 4I4TB 3K5PA 1WVGA 2IZ6A 3ZHSA 2Y0BA 3EDQA 2AVNA 2B30A 3K94A 1IOVA 5SY6A 2FSUA 4RTOA 1HSZA 2CUKA 1KJWA 4FEGA 2BMAA 1NIJA 2Q21A 2HO4A 1Y3FE 1FFXB 4UNQA 4YRRA 2SCUB 4N0DA 2PZ8A 2OSVA 3RYFB 4PBTA 1H0RA 4OI2A 3E03A 1VL1A 4MRVA 5EP4A 1N34B 1P9WA 2VNHA 3MUNA 4QUIA 1FMFA 4O1MA 3E05A 1JIXA 4KHZA 1OC2A 4NCXA 5CX1A 5IM5A 5A6SA 1BQ4A 4K8OA 2ZUVA 1ZVVA 3K0SA 4X84A 3SXJA 5K8LA 4QM7A 2YW9A 4LRUA 3K73O 4OYYA 5IJXA 5KPDA 3KVOA 2A9JA 3BSFA 4FBLA 3QMVA 1DXQA 1N6IA 3PNBA 3F5SA 2FWMX 4NS1A 2H00A 3SXPA 1EMDA 1F7UA 1X0VA 3DFKA 3GRUA 1VE1A 2WAOA 2WIDA 3V1YA 4AMGA 4CV3A 4NU6A 2Z09A 4DMHA 3TM4A 2C20A 5ED4A 4RTNA 3PRYA 3ANSA 9MHTA 1U0SY 3FNFA 3DE3X 2HJVA 1PJ2A 5IBRA 4MWCA 5M3BA 4ANFA 3SYTA 2O19A 1SPXA 2VO1A 4WSOA 3GJ6A 3MERA 2XNDD 1NWCA 4YAFA 2ADMA 5GTDA 5HSGA 4JXXA 3OT1A 4QOGA 5EINA 5A5DA 3ANTA 2KLBA 1V5WA 4G84A 3TNDA 4BTEA 2XB2A 4HPXB 1QVRA 4PQRA 2NMVA 1QDEA 4FR5A 3J81k 1RXYA 3HDGA 5I9LA 5KPJA 2XADA 4Q0MA 1WRBA 5F3WB 4RZSA 3AJEA 1EX6A 3P97A 4JR1A 2CNWA 3CS3A 4FHZA 4BNMA 3IV9A 3UBMA 3O7MA 1L7RA 5FPHA 3BOSA 3M6IA 5IT9A 3IULA 2FOLA 1E60A 2NWQA 5GP1A 4F4FA 2CV2A 1HQKA 1V3UA 3S1AB 4HDOB 1P19A 4QDJA 4U1RA 4CU2A 4O6VA 4NQRA 2HA0A 5L3QA 2OZEA 2P2DA 1W5BA 5JXIA 4B45A 1ONBA 4BNKA 2N1BA 1RBZA 4NARA 2W71A 5COQA 4H1WA 1GGVA 2YY6A 3GCGA 4JBLA 1NMQA 4UHKA 1PJTA 4C76A 1EFTA 1N25A 2AR9A 1C3LA 2FZKA 5IN5A 2WIFA 2XUGA 4KRYA 3X1XA 3KTOA 4DB2A 2OCBA 5DTRA 1ADYA 1OASA 1M2OB 4E32A 3EDRA 3JWJA 2ZJBA 3PVZA 1AKMA 1JYFA 2WOJA 4X90A 2FMTA 2A3NA 1ZJ6A 1KEEA 1FUUA 3GEMA 2GPTA 2QVBA 4QXPA 5JSQA 1FFEA 5JYEA 1KJYA 3ECCA 1B6TA 3GAAA 3INGA 3JW8A 3M3PA 3OC0A 4LTNA 3WGTA 2H51A 3EE6A 1Z6AA 2WA1A 4OK5A 3I0ZA 1T9BA 4O4JB 2XGJA 3PBKA 4LMRA 4OHXA 4Y7DA 2PL9A 3KO8A 4IGEA 3RRZA 4A0HA 1C7ZA 3FN4A 2Z5GA 3ZZ1A 3K16A 5BVHA 4FLFA 2F1OA 1TZJA 1LCIA 1JLSA 1DIRA 2ZI9A 2P5YA 2N42A 2VJAA 3PNSA 2UZ0A 2R7AA 2YZMA 4OU5A 1ZGJA 1II0A 3U0VA 3KJQA 3ER6A 4C6TB 4JLKA 1UDRA 3FKSD 2C03A 1DQNA 5A0FA 5J5AA 3RTDA 5I9MA 4DYVA 3JZIA 1C1HA 4YRMA 2VT6A 2BFWA 4U9IS 5DXAA 1H6AA 2QPLA 2I4OA 5EY5B 4HPWA 4MK4A 2XGOA 3BL5A 4Z3KA 6GPBA 3UGJA 4Z0TA 4R8KA 9GPBA 4PG7A 3DZFA 5FEMA 1SFRA 1MRNA 1GKKA 2JFQA 3UBTA 1FUKA 2K2WA 2A35A 1GTVA 1L7QA 2A9QA 2HSEA 4UVIA 5F1PA 1Q7GA 4MMXB 4ETNA 3ESYA 3O8NA 4A6DA 4GSKA 1KRWA 1YAHA 3K5HA 1JIUA 4AUKA 3D4BA 2JEZA 4MWEA 4BQOA 2PRKA 5IDVA 1KIFA 3B5JA 2W9XA 5HA5A 5BSMA 9LDBA 1KZHA 2XHEA 4IRXA 1KPGA 1LF0A 4KI0A 1KJQA 1QP0A 4DNQA 1X7HA 2F1JA 3P9IA 1ACMA 4FYPA 2E55A 5BWNA 2W2VA 1N5KA 3ONNA 5EWLB 3ZZTA 3FYSA 4DBLE 4D9MA 4ZZIA 1NNEA 2IK8A 2N0SA 2CSUA 2P4SA 2Z2JA 3OM8A 2H7XA 2XMSA 3GN2A 2CWDA 3MG9A 2IYFA 3L3BA 2C2BA 2ZYRA 3C3XA 1V1RB 3KYIB 4EB3A 1UQTA 4ND5A 5C34B 3TM5A 3OKFA 5CB4A 2Y67A 1SU4A 1RHUA 2O1XA 2CE7A 1QK4A 1FZQA 1FTNA 4TWRA 4XA8A 5TS3A 4E4RA 1N3BA 2RC5A 2OFFA 3R7NA 2CVZA 4F5ZA 3NVDA 1YS1X 1XD8A 3F6PA 2SECE 3L4EA 3Q87B 2W83A 4XQCA 4BAGA 5KYGA 4QU9A 5A4JA 5LZ4A 1MVLA 1Z83A 1FU4A 1SVUA 1XALA 2E82A 3E82A 1FLAA 1YDHA 2XUHA 3DE2X 3TW4A 3JQGA 2C2KA 1JR3E 3QV1A 2I4TA 1KMMA 4GECA 4JIGA 4UHFA 5A7GA 3T35A 4N5HX 1K9VF 5IWCA 1OX4B 2H63A 2WJAA 4YT4A 3Q3EA 4ZHSA 5JR3A 4MUXA 1A5AB 2GARA 4MUNA 2FX3A 2R6R1 1KQPA 1NBWB 3EHDA 4GR5A 4I55A 4RVNA 7ADHA 2FJ0A 1DV1A 1Z2OX 3DLIA 3T41A 3TLBA 1P1RA 2ZE7A 4ARVA 3SIPA 4JZKA 1SKMA 3ILXA 3WXBA 1BD3A 3MHTA 4G4SP 2R6AA 1D6SA 1GTG1 1VQ1A 4WXPA 4KXWA 2BPOA 4LPSA 1UMDB 3LXUX 3LKZA 2XNKA 4IZOA 4DLYA 1AKNA 2WUVA 5LZ8A 4A0FA 4CKEB 4MWSA 5B1YA 1Y4ZA 4MA5A 1VHTA 3LUCA 2F3UA 3FKSA 1NW9B 1ZIDA 1QZ3A 2CDCA 1EA7A 1YR1A 2EF1A 2QJRA 4MV6A 1QP7A 3PX2A 2C2YA 5AK0A 4M6WB 1E6MA 1VSBA 4KLZA 3W5HA 1FQWA 1JEEA 4I4TA 1DE0A 2GCPA 1NC1A 4KXYA 3TFWA 2ZI6A 2VDWA 4Q7KA 3ZW9A 4R98A 3EGDB 3HLKA 1ZM3A 4GOND 621PA 1DG9A 2IH5A 1IEVA 2V4ZA 2B37A 4BZPA 1LPMA 3R3UA 5F2NA 2L0XA 1S3FA 4N6OA 3I0MA 4BFTA 3SC3A 4DRZA 2PYDA 1E2BA 4IOJA 3FRIA 2ZCJA 1PR6A 1IZ8A 1VPLA 4UHEA 5LQDA 2GEDA 1HURA 3OTWA 3R6TA 3VX4A 4ZCIA 1JSZA 2XWBF 3K20A 4BFVA 2EQBA 3O4RA 5CYGA 3OAAA 3LXXA 5DBEX 3W6OA 4AJEA 4Y2RA 4BVLA 3N7AA 4MYTA 2B4YA 4BYGA 3HKBB 5LCXA 3UJNA 2WJPA 4G0WA 3ZWQA 1ZXBA 4BASA 1E0AA 4EVIA 5JO0A 2DT5A 2F3SA 1WHSA 5ECWA 1ULBA 3GAFA 4KBYA 1J25A 4BLTA 2XH8A 3IE0A 4KUHA 3CPJB 3MZ0A 3GK3A 2F43A 4LC1A 3OWHA 3IV7A 1NKTA 2B1JA 4BXOA 1VYUA 2I33A 1RJEA 4G5YA 4M37A 2GJSA 2F8SA 3O2JA 4Z9FA 1QAOA 3HE3A 1QKKA 3HYNA 1P7ZA 3IQXA 4GFDA 4UTXA 1RR6A 5F4BA 5FOTA 1Z39A 2XF8A 4XVUA 1NE7A 2YFQA 1FNMA 4LY0A 1T5IA 3U4DA 1JI3A 4CLOB 2RAUA 3QEAZ 2K2QB 4E51A 1RYYA 3BH6A 4AS3A 4L85A 4EAAA 3PJRA 3M7IA 5JYDA 4MA0A 2VCEA 2CL7X 3T5MA 4CQLA 2YHSA 1J1IA 3VR5D 2ZM5A 4JS0A 3GLHE 1UDCA 4H0FA 3B1YA 2NVOA 1U2EA 2AN5A 3E0QA 1SCAA 4HDMA 1K3UB 1BFUA 3D6AA 4LYGA 1LZKA 4PFQA 2JLWA 5KWJA 3H5TA 2X15A 4O4LF 1XXHB 1I8TA 1ICIA 2QAGC 2PRIA 3I37X 4OXQA 2IY8A 1R6BX 1YQDA 2P3OA 2H6EA 1I1QB 3AR7A 5CYFA 3EWIA 4IHJA 5AK5A 5JFGA 5KTYA 4DDWA 1CULC 4MP6A 4QGBA 5FIUA 1B15A 1PJ8A 1WUHS 1K92A 1T1GA 2DHCA 1EZZA 2H4WA 2VJKA 1TM1E 3HUFA 5BR8B 2SKDA 2OCGA 1G291 3G0BA 1MH9A 4M8SA 5E3JA 5F3DA 1UKZA 4IH4A 3ABOB 3AYXB 1VG0B 1ST3A 2ZAMA 2FY8A 2QRJA 2XB4A 2X5JO 4ALKA 1XF9A 3G85A 4NICA 3G7SA 1Z06A 1N4AA 1HV8A 2NP6A 3G0GA 4HH4A 2R48A 3BDIA 4US2R 3H1PA 1C1DA 2ZVJA 4XB1A 3UMMA 3CW2A 2I9PA 4YR9A 1UMDA 4FDAA 4G5HA 5LDHA 2P9FA 2Q5HA 2ZR8A 4F86A 1TZMA 4PX2A 5JD6A 1V5IA