2Q8QA

Crystal structure of s. aureus isde complexed with heme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
258
structure length
258
Chain Sequence
GEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant E
publication title Heme Coordination by Staphylococcus aureus IsdE.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
total genus 80
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8qA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8qA01
2XDQB 4ND8B 2R79A 2OGWA 4HN9A 4TKUB 5M29A 4FI3F 4INOA 3ZK8A 5KOHA 5GGYA 4NNOA 1MIOA 3AEKA 3PSHA 4WESA 1M34B 3AEUA 3ZK9A 4GICA 3U7QA 2PS9A 1XVLA 3HH8A 4WZAA 1QH1A 5KOHB 2YNMD 2XDQA 3AEKB 3ZKAA 1QGUA 4WESB 5BVHA 3AEUB 3AESA 3U7QB 3AEQA 2ETVA 4WZAB 1G20B 3HJTA 3LHSA 2Q8PA 1EFDN 4INPA 1QH1B 3R5SA 1QH8A 4OXRA 2XH8A 1M34A 3MD9A 3EIXA 4IRMA 4FILA 4WZBA 5HX7A 1N2ZA 3EIWA 3ZTTA 1QGUB 2YNMC 5BVHB 3AESB 3AEQB 3PDIB 4NNPA 1K0FA 1QH8B 4WNAB 4HMPA 1M1NB 3TNYA 4WZBB 1H1LB 2X4LA 4HMOA 5KHLB 4DBLE 2XQVA 1G20A 4UTOA 3G9QA 3R5TA 3AERA 5GGXA 4G09A 3NU1A 4MX8A 4TKVA 1FP4B 3BE5A 3TLKA 2AFIA 3AETB 1K75A 1N2CA 3MWGA 3K1AA 3PDIA 4WN9A 4MDYA 4H59A 1N4AA 2XUZA 4CL2A 5FLYA 2O1EA 3AERB 3BE6A 4WNAA 4K3VA 5KOJA 1G21A 1M1NA 4XPIA 4UDOA 1H1LA 4TKVB 4FKMA 4LS3A 2MINA 2AFIB 2M6LA 2XV1A 1N2CB 3LI2A 3K1AB 3MINB 4WN9B 3ZK7A 4HMQA 2PHZA 5JJ5A 3TEFA 2QI9F 2M6KA 1FP4A 5KOJB 3PSAA 1G21B 4XPIB 5B58T 3AETA 2WHYA 4M7OA 2MINB 5CX1A 4OXQA 2OV1A 1K2VN 4MO9A 2OV3A 2RG7A 1TOAA 4UDNA 5JG7A 1L5HA 4BBPA 4UTPA 2XY4A 1PQ4A 2AFHA 5M34A 3MINA 1ESZA 5CR9A 1N4DA 5CX1B 1PSZA 4H0FA 4B8YA 3GI1A 2PS0A 1K7SN 1M1YA 1KAEA 2PS3A 1L5HB 4G07A 5BVGB 5M3BA 5I4KA 4N01A 2AFHB 2WI8A 3MFQA 2Q8QA 2OSVA 5AFSA 5M2QA 1M1YB 3UJPA 5HDQA 1MIOB 4FNAA 4ND8A 4PM4A 4TKUA 2R7AA 5JOQA 3CX3A 4MLZA 4PAGA 4OVKA 5JPDA 1KARA 2PRSA 3HXPA 3MWFA 5BVGA 4LJSA 1KAHA
chains in the Genus database with same CATH superfamily
1F2UA 3DTVA 2WUVA 4YO8A 4BCBA 3NQ41 4QTTB 5B4VA 2AUNA 3D2LA 1B6SA 1BHJA 3DE7X 2AZMA 3MCTA 4K7JA 3HL4A 2DM6A 4GRIA 5UKDA 3ZC3A 5H4GA 5GGYA 3AG5A 5H59A 2HJVA 4EI9A 2N46A 4DLZA 4ND2A 1E9BA 1P1FA 3OTGA 2FSVA 5D84A 4F11A 2F00A 4KBFA 2REQB 1WOYA 1U65A 1ZNWA 3NLLA 3UT5B 3DKKA 2ZI9A 5GM1A 2PUHA 4MINA 2SICE 2NO9A 4KQCA 4PLFA 2ODQA 2QRVB 5IC6A 2QX8A 5JS2A 2QY9A 4NFHA 4EG8A 1H23A 2IQ5A 3G2LA 5GAJA 4F6CA 3AV3A 1Y9ZA 2Q4TA 2JANA 4QGAA 3RQSA 3R6TA 4BX3A 3FWNA 3RBAA 1XHEA 4JNCA 5EAIA 4RKWA 5SZIA 4K5QA 3C1UA 1R66A 1O4WA 1S7CA 3COPA 1B6TA 5DJ5A 2FRXA 5DT2A 3W34A 1DX6A 5A6SB 5KO2A 2C20A 4AL4A 5AESA 2JJMA 1E98A 3FOBA 3G2OA 4KFRA 4JX9A 3PUZA 3B3QA 1U9JA 1E9DA 1UINA 2OC9A 3BDVA 4M7WA 3VR2D 2NZUG 2OCYC 3JQ8B 3P9CA 4UTOA 4WLEA 2W2VA 5C8YF 1IXKA 3GJXC 1QR6A 3DUFB 4QOEA 2ZT7A 5DTEA 4E2WA 1L3CA 3W3AD 4D81A 1ZVMA 1PJ2A 4TTVA 4YROA 5JWRA 4O59O 3PXUA 4F8YA 2VATA 2B7LA 5ARCA 1IMOA 5TPZD 4H59A 4QQ8A 1CQWA 2F62A 3DKPA 1XDWA 1PWZA 5JZMA 2UUCB 1SRQA 1IL0A 2OBBA 2JHCA 2ZIXB 2FXVA 4BLWA 4TL6A 1AZSC 1UL1X 1BGWA 1JMKC 5L40A 2HQ1A 3FHJA 1ZGCA 4TXJA 5J2TB 1ZUIA 2R7NA 4WY2A 3QPWA 1YL7A 3AXTA 1YQQA 2VDWB 3TSAA 4N03A 2AQHA 2I1VB 3R0QA 3CH4B 1USGA 4X6UA 3VV2A 3TMKA 4BBAA 5F2NA 2A4KA 3ONNA 1WL8A 3MVEA 4R68A 2A88A 3KAKA 4LN1A 5KJ6A 4I5FA 1HT2E 3HU2A 4DIBA 4F06A 4JR2A 3RHSA 2I0FA 2GK7A 2XLBA 4GC9A 1ST2A 4HFRA 3D8SA 2IY9A 3GL9A 2PZKA 3DDNA 5J63A 1VL5A 5G4KB 2P6PA 4RVUA 1IDN1 5AYVA 4MGEA 5CEFA 1SXJC 1R27A 4URXR 1MU0A 4IHAA 3E3AA 5A62A 5M34A 2OGUA 4YALA 3SYNA 2J0VA 3TNLA 2EF1A 4QC2A 4NCJA 2NZ8A 1C1YA 4DQ0A 4KQHA 1IRIA 3AZOA 3FKSA 2RB5A 1NQXA 1Y8QB 1AQIA 1C50A 4J76A 4EWLA 5AVXA 1JQEA 2QW1A 1N34B 2V7WA 3DTVD 3GJSA 3N2YA 4R1NA 5L3SB 3ANMA 1J0BA 3A27A 3OEWA 3PYMA 5CBPB 1F1JA 1H2RS 3DDOA 4A27A 2BSAA 1K8XB 5BY2A 1AMUA 3INYA 1AKYA 2VT7A 3ELUA 3HVUA 4RVCA 3OU7A 4ZYVA 4LXQA 3DG9A 3NPMA 2NTYC 3N2KB 2PL9A 5K0EA 3QA9A 2WOJA 2BFCA 1OQAA 3I0NA 4ND8B 5KJCA 3FOEC 4UVGA 5GONF 4GDMA 4HGRA 2CJWB 3OE5A 4OQDA 4B6OA 3VNRA 3PG5A 5D3KA 4U4AA 3N2ZB 4D8WA 4ZYLA 3K2EA 3DT9A 4ZEMA 3T9FA 4MRNA 1ZAYA 3EVCA 4X00A 3RKUA 3VR5H 4JWTA 4JGBA 4P32A 5A03A 1TFUA 1UCFA 2GN0A 5AI8A 4QUGA 1ZFNA 1RACA 3WGQA 2OBMA 5B4UA 3KZKA 1DEOA 3HJGA 3NI2A 4MPJA 1SCQA 5ALJA 1H2WA 2CLDX 5JEEA 2WINI 2RHGB 3HL0A 2A1UA 4Q7KA 5AOBA 3R5SA 1NLYA 2WTAA 5LZ4A 2JFOA 4G1BA 3COVA 1T8SA 1Y63A 3D6MA 3HABA 3FM9A 2VBCA 3K5IA 5B64A 1DWPA 4Y1GA 4LGCA 1W96A 2IKSA 3L7DA 5FBVB 1F3OA 3BMOB 1UC8A 5AW6A 1LSJA 2L82A 4OEHA 4HDNB 2CNLA 4PZAA 1YI8A 3U2QA 3WMXA 3B1FA 3WJAA 1Q0HA 4DA7A 1CQJA 1WXWA 3A6EA 1A96A 2IS1A 1Q7CA 2X4LA 3AFIA 4GC5A 4KRFA 4NTZA 4XWTA 5JBIA 4QUEA 4YRNA 1QNFA 2ZXFA 5AVOA 3EQ6A 2IYLD 3W0LB 5IAOA 1ESDA 5ER6A 2E4WA 1AZWA 4YJFB 1KMQA 1KRHA 1SC3A 2B2NA 2QTRA 5LSAA 4EGCB 3OZGA 3RRNA 1G17A 3S2FA 2JGKA 2OCAA 2FPGB 5KQRA 3ICEA 5KYNA 2GLXA 4J0EA 5JCXA 1ZIDA 4LOKA 1IK6A 1J42A 3IGFA 3KG2A 2R00A 2JAOA 3VR6H 4BLOA 2ZTVA 1P1IA 4EFKA 1KFKB 4BZQA 4FKBA 1UBMS 2LDBA 3BULA 5CCEA 2JVKA 4G5HA 4PBTA 2ZRGA 1IY2A 5ADUS 2JDIA 1NTOA 4JT8A 2HA2A 3V8NA 1OE0A 4CYMA 1U02A 5FO1A 4QUJA 3I9NA 1IY1A 3JQQA 3IEUA 3OOJA 3HMQA 3ONVA 3AKEA 5AJHA 4ZYYA 1SELA 2PV0A 2W5UA 1K5PA 3AVXA 1A04A 3FKSD 2BN4A 3LKBA 4J16C 5HTKA 5IDVA 2R5NA 3IE1A 4J0HA 3JR3A 3CLHA 3MINA 4BZZA 1I4TD 5BNIA 3HEBA 3SHFA 1MP0A 1CY8A 1XKTA 4PQGA 5KCMA 2JHPA 1NUSA 2ZSIA 5E8JA 5E6RB 1LZLA 3FUTA 4E33A 1KQGA 2QZ4A 1QTRA 3EDRA 4KPYA 4EW3A 3IR6A 3NB0A 2JGEA 5JPIA 2A0FA 4F84A 4P0TA 2CVOA 4WVFA 1ZNZA 1GL3A 1T8PA 3A4TA 2WOOA 2XUGA 3QVGB 3IRVA 4XYGA 4UU0A 1E1KA 2YHAA 3H7IA 1HFEL 4WOBA 2H5EA 5AW8A 1EFAA 2ZTLA 1Z6AA 3T0FA 3ZEIA 1X1TA 2DLDA 3JQGB 1JI0A 2HNKA 2BP7B 5I3ZA 1XN1A 2XQJA 3UA3A 1BN7A 4FMDB 3KCQA 3CZAA 5ALVA 1E89A 3OX4A 1BA3A 2WK1A 1XGKA 1UDXA 3WL7A 1BGVA 3C5CA 4NNOA 4LZNA 2FQQA 1JHOA 5FRDA 4B71A 6REQB 4GVPA 1NV9A 5BOSB 2A35A 4XTCS 1Z38A 2D74A 2UVPA 3BIWA 1HE2A 4C0QC 1WAMA 2VSFA 1W5SA 4IDGA 2XXAB 2XSZA 2WTNA 4M9RA 2RC5A 3HBJA 4D9HA 3INRA 2I6UA 3B2NA 2ZBDA 4BTVA 1XEXA 4LZPA 2O3JA 4CQLA 3D64A 3ROXA 3C24A 2ZUSA 4MWCA 5G1NA 1Z88A 2WD8A 4Y9UA 4LQ4A 4RHXA 1K88A 1Z4MA 1XZHA 3BBPA 4O0LA 2QMEA 2C00A 2HRCA 3PYLA 3ISVA 2YNMA 3AJ9A 1VCMA 1P0QA 2HJRA 4YPFA 5J5CA 4IGFA 2RD2A 1E2BA 1E7QA 4WKCA 1XN4A 5IJWA 1PJZA 4MITA 5ECYA 4DWVA 2CMKA 4IV0A 1GZ4A 1RD4A 3FCYA 1DLIA 2VPIA 4JUDX 4HMOA 2VYCA 2P27A 4IOLA 3ES9A 2CJFA 4C89A 2WD9A 1IUOA 1Z68A 4DLBA 4KZKA 3HB9A 4FLMA 5EIAA 5LQMA 2VCYA 3L1JA 1RJEA 1Y3IA 3ESRA 1E2UA 2GPWA 1BA2A 2PBFA 1HYGA 3GG2A 3M82A 3MRTA 4Y3UA 3TR0A 1QE0A 3L1IA 1SFRA 1AB5A 4JQOA 4RVDA 3MWGA 4AWXA 1BH6A 1YRLA 2YJ3A 2Z4RA 5FI5A 4RTSA 5ALFA 4X44A 3I4LA 3ULKA 4MP6A 4FKMA 4F04A 3TIIA 3SZ3A 2J5BA 4MZDA 4GDFA 3VZDA 5ECDA 3S1SA 3LFTA 4HMQA 2AMFA 3RK4A 1JPJA 1ISFA 5D3MA 5A7HA 4CV1A 1K7CA 5DW0A 4N3CA 2AHRA 3GFVA 5E1MA 3WK6A 2J85A 1DG9A 1J0CA 3MJCA 4U3JA 3WWZA 3I73A 3FMPB 2V1XA 1CYEA 2AXPA 1H69A 3MB5A 2PGOA 1DFIA 2LNDA 3S2YA 1XXLA 1VJ5A 4UE2A 1HDEA 4D82A 3AKZA 3WZLA 3NHAA 5DLPA 1DV2A 2HUNA 5L8VA 1X3LA 1F5SA 1IPHA 1HKUA 3K1JA 2VPWA 4K87A 4XGKA 4AYXA 1FFHA 2XMCA 3KPWA 4KWTA 4US2R 5KYTA 2Z6QA 4RIIA 3DZ8A 1DIGA 1ZN9A 4MOWA 2C5BA 3ZHCA 2BI8A 3GY0A 3INTA 5FFMA 1OFHA 3HSSA 4H6VA 1FIUA 3EZYA 3SVZA 4E14A 4GZLA 4CMKA 1U81A 5ILOA 1EA7A 3OC0A 4X65B 1L6IA 1WV0A 3KEQA 4MRRA 4DDVA 1OA0A 2DVMA 4EVQA 3ZHUA 1HDRA 3LH5A 3U7FB 5IMBA 3EUWA 4BZWA 2D62A 2BELA 5FOVA 4S04A 3QPVA 4EX6A 3QSGA 1M2HA 2W0MA 2X42A 3SBDA 4I81A 5EZYA 2B92A 5F76A 3D2BA 2XE6A 2XSZD 3WBFA 3LF2A 3PIRA 4IG4A 1ND5A 3RUIA 3VVLA 2RB4A 4LHWA 5L9AA 2PJZA 3RT7A 2GB4A 4J43A 4FBMA 3CUVA 3V48A 2FG5A 2WPDA 4OO3A 4TWZA 4EHLA 4FSDA 5T5QA 1A5BB 3WWEA 3X1JA 2QLFA 3C2QA 4M6WA 3U49A 4L75A 1OYYA 3TOZA 4JJ7A 3ZXUB 1ADJA 1HDIA 2RDMA 2Y1KA 3HZRA 4N18A 4YT5A 3TW4A 3OT1B 2YNMD 2ZRIA 4DCTA 4C2TA 2CL0X 4MUXA 4PSVA 1JB9A 1YZNA 2JAXA 1WZIA 5BVHA 4GWLA 4MGKR 3JSXA 2P1DA 3GC6A 3GQBA 5U1PA 5JO0A 3QUCA 4R81A 4YJ3B 1CERA 1Z4LA 1YNSA 3CPEA 4UHCA 1DG1G 2FUNB 4N3BA 5F5LA 4ZZ1A 5KEIA 1R4NA 1GTRA 2WFZA 3C8MA 2DPXA 1RLJA 4I9UA 2PANA 3M1YA 2J45A 1OLUB 4FYXA 1SN7A 1JEOA 3NBMA 4NYMR 3N0WA 3RYTC 3K70D 4CF7A 4D6XA 4YI3A 5IEBA 3WYNA 5TS3A 3A1CA 1PIWA 2O8BB 3H04A 5JMPA 3ZQJA 3R4VA 4ILEA 4YR7A 2HA0A 3M89A 2PZJA 2TMKA 4DILA 3AG6A 2UXCB 5BT8A 3DLTA 4BX2A 4HAXA 4Q4AA 2F17A 3GJ4A 4GIBA 4I2NA 4Q82A 1PD0A 2R6HA 2W22A 3GLTA 1RXYA 1E9SA 2H59A 5EQJB 5L95A 5FPKA 1GT91 3O8LA 5LA6A 3MJDA 1CXZA 4EJSA 4CM8A 1NSFA 5H9VA 2XUZA 3Q6NA 1XQXA 4BX9A 2O0HA 1WR8A 5JD4A 3G8BA 2AKYA 1THGA 2GZSA 2Y1WA 3Q3EA 2Q21A 5BWLA 2WKSA 2WMNB 1GNLA 2RC6A 4V0LA 5H82A 1L5VA 5ELLA 4EARA 2GZ1A 1C30A 1DI0A 1KMHA 3VX3A 1JECA 1JR3E 2I6FA 3NBQA 3EGCA 1AUQA 1EFPB 3FNIA 3I23A 3USCS 3V32A 3Q7EA 3PJDA 4C6TB 2AG5A 4ZVTA 5DSZA 3JYNA 2GCOA 4HTFB 1EZ4A 4MA0A 4O5AA 3I58A 1ZMOA 2QYSA 3TX2A 2BIFA 2OV3A 2RG7A 1HNZB 1QH0A 1IEXA 1X6VA 5LC1A 1VIYA 1YA4A 3H9JA 4YCNA 4N5LA 3I3SR 3L0CA 4PFJA 3HR4A 1NXOA 1ZICA 5IM4F 3TQCA 1EFTA 1JQBA 3OCWA 1COWA 3ZBPA 1O0BA 3HY6A 1ATZA 2PKYX 3OCVA 3W6PA 3VKFA 4D9CA 3GPBA 5KJFA 2O8FB 1YTLA 2FRVA 1U8UA 1K5HA 4FNMA 2R6AA 9ABPA 2R86A 2XWBF 1Z07A 1A8IA 1XDZA 5G4LA 3KZ1E 3JD0A 4CQJA 4E03A 2A1TS 3DVQX 4ND7A 3B89A 2X1MA 3EVGA 4RU1A 4PPGA 1LFAA 3NCTA 4RZ2A 4NPCA 1MA0A 2XE4A 5I7SA 1TUIA 3BWBA 1RBQA 1E32A 2DPMA 2I2FA 2BEVA 4JLVA 4PO9A 3HXOA 1OF1A 3Q9LA 4O25A 1BWQA 3PNLA 4N0MA 1FZQA 2GTIA 3GROA 1J24A 3FLMA 3CCFA 3NWJA 4O8CA 5CA1A 5FUQA 5JRZA 2VJPA 3DVAA 1ZI9A 2B2XA 2AX3A 4YV7A 3OZAA 3VMFA 4RJKA 3T0IA 4D3YA 1JZQA 5MN5A 2V3VA 3WGHA 1EQUA 3NIFB 1ZOOA 4QPZA 3VI4B 3HLKA 7MHTA 1L7DA 3IE2A 3LHIA 1XTTA 3MTIA 2ZIZA 1TD9A 3CUUA 1S3IA 3N8HA 2FMUA 1TK2A 1V7PC 8OHMA 2IYAA 1N9GA 4KHPB 1DCMA 1GADO 1SXHA 1UZUA 4PZYA 3SMVA 4AUNA 1OWNA 4JY7A 3CVOA 4OKIA 1NONA 5GJCA 3MWEA 1CEYA 2X13A 2OO7A 1V5IA 3GX1A 4ZK2A 2Y1CA 4FDLA 3K1YA 1P3JA 3DZGA 4G5YA 3X44A 1NUAA 3IO5A 3NHLA 3IHWA 3KLMX 2LIPA 5JCJA 1EB9A 3WHLA 4QDKA 3BRSA 3GLVA 3PQ8A 1UH5A 4MCHA 4G0XA 3FCCA 1NVEA 2FSUA 2YZMA 1YGPA 3KEOA 3NAQA 2HWWA 3DD1A 3OPMA 3ZV6A 3ND8A 3PTAA 5B6IA 5A0VA 2CLSA 4BB5A 1M7BA 3DVLA 4GX5A 5K4AA 4BLVA 2O23A 3HBFA 4A6XA 4JEMA 3MBKA 5AK3A 2WJHA 4B5KA 4B1FA 2HR1A 1E5TA 3BIJA 5E7IA 3ANNA 5DULA 3K5PA 3OQOA 3ESYA 3PB3A 2YBEA 1Z3CA 4ZQFA 4WV3A 1GNSA 1M73E 2FR0A 3DM5A 1G2OA 4UTRA 4NMMA 1FTQA 5FADA 1M6VA 2O1SA 4GE0A 4H7PA 1HSZA 1QMGA 2JI4A 4CIDA 5CITA 4WCFA 3CEHA 1W2WB 4PV7A 3IA7A 2OXRA 1KDVA 3SC2A 4PANA 4DMKA 2QM0A 3SBEA 4CLHA 1E60A 3IP7A 1VPVA 4D2IA 3LI2A 2D1TA 5EPOA 1B3BA 5LXTA 3FPAA 2PUFA 1EX1A 1EVIA 2PRYA 1A0OA 1XZDA 4Q18A 5B2ZA 2Y0PA 1E3SA 3S8MA 4ESEA 1RXWA 1XMIA 5BV0A 2XB2A 3PCTA 1RVV1 4NZNA 1COWD 1T9CA 2CHQA 3HA3A 3SEQA 3THYA 1D8TA 1UT8A 5AUQA 3TD9A 3KU1A 1F0YA 3CPSA 5CLIA 3A4NA 5BPFA 3BGVA 3KELA 4NCBA 1FUKA 4BRWA 1MEJA 1MC5A 3TMAA 3OAAD 4R5MA 3OKAA 2JI7A 5BQ3A 1GPKA 3ICOA 3LUAA 3EGEA 4FXPA 1RNLA 1JQKA 2IX9A 2ZROA 4N65A 5E1DA 4W9RA 3ZHSA 5A3SA 1O6ZA 3VH4A 1QFJA 1MABA 3NTXA 4Q15A 1RVDA 4DDTA 3GGOA 2GDJA 2V03A 2ZUCA 3ZD6A 4BNDB 3LV8A 2ODWA 3WOVA 1XMOB 1KMIY 3RASA 3P5BA 3WB0A 4XW2A 4YJHA 4A2WA 2VDOB 2IBMA 2V7BA 1P4SA 2A5DA 3CY6A 4F72A 3V2IA 3FUCA 3SIRA 1UMCB 1YA8A 3HB5X 3ABQB 4RAQA 4L6CA 3U3DA 2JA2A 5JHHB 1Y48E 2RFLA 4KAJA 4YJGA 3L2OB 4HR7A 3CISA 2B8NA 3N6VA 1L7AA 4EB0A 4WBNF 4MB0A 1PQPA 4C9BA 3CRRA 3K8YA 3U3MA 5IHXA 1VSQA 4KYVA 3ENVA 2W8BB 3TW8B 3WRXA 1HDYA 1SZCA 2RBEA 3CXRA 3RC2A 3ZJ5A 1PFYA 1UIRA 3KBOA 4CKXA 1NVDA 4ITUA 1CVRA 2NLOA 4P0QB 3ZWOA 5CEEA 2C07A 3HHEA 3MERA 5JCJD 3FUXA 1KVUA 4LXUA 1P4GA 1EXDA 3GEHA 4OCZA 2ZI4A 1WPXA 1ENYA 3R40A 1Q0LA 1XTRA 2GPNA 1NVUQ 4ZOEA 5EYPA 3UXYA 2GAAA 4LUCA 3EZGA 1TGVA 1LDYA 1GKLA 1DPGA 3CF6R 2QPLA 4HYQA 4O2AF 1EE9A 4C0SA 5HYVA 1JHDA 4INPA 4X94A 4ALMA 4BNFA 1TADA 4LJYA 3OQJA 3VH2A 3CR3C 1I3MA 3HWSA 1KEPA 4IRMA 4DIMA 2VLIA 1ZJ6A 5JC1A 1EVKA 1QLHA 1Z3IX 1M1YE 1H0RA 1GCOA 1JIKA 1Z2AA 4FLFA 5E8RA 1KGSA 5LP6A 4CDRA 2JGNA 3C48A 3P0FA 1X7WA 5CT5A 3O31A 3T7TA 2OHOA 1K68A 2O3UA 2PBRA 3EZ9A 4X63A 5CNJA 3MD0A 4WN3A 4IIJA 5JAUA 3EEOA 3AVUA 5LZ8A 3VUEA 1TJ5A 1XJ5A 4MRMA 4MUAA 3H6HA 2GEFA 5F64A 4AG6A 1ID1A 2BRUC 1GU7A 3WLQA 1DO8A 4PZUA 1HLPA 3R76A 2QHXA 4NOKA 4E7PA 3E0XA 2G1KA 5IASA 1BYIA 1F8XA 2FUEA 4Y9TA 1Q1EA 5KNCA 4WDQA 1HR0B 5AO9A 3WQHA 3N0TA 4CT4B 2GARA 2ZRFA 5J2UF 5A9TA 3U7RA 1HYBA 2XUPA 3THRA 2XTAA 3HV2A 3EDQA 2WNHA 4JJKA 3HO8A 4TM7A 2X77A 2CBXA 3EGVA 1YTUA 2OORC 5LDGA 1UKEA 4AUEA 1BYUA 2CMFA 1RQXA 3NHUA 2Y1OA 4YEDA 2IEGA 2PZAA 3DEHA 3OKFA 2A59A 4RBNA 1IE3A 5ALDA 5ARBA 2MIIA 3BUSA 3IQHX 1PLKA 5CT8A 1P9NA 1D2RA 2X41A 1J23A 1IXRC 5JG7A 5JC8A 4TRNA 1AHPA 1OIWA 3RYFB 3ESXA 4IXTA 2ZJ4A 3UIEA 2K4MA 2JGJA 3FRHA 5HK8A 4BASA 4G5RA 3A4LA 4OD0A 4N8EA 4QRHA 1Z13A 3IYLW 4F9GA 3QPCA 5ITVA 3JY6A 2QRQA 5KQMA 1U1CA 1TCUA 1JBQA 3P5SA 3PBKA 3A05A 1ULTA 5HIIA 3RIXA 4PCAA 4DCGA 4E4TA 1H4QA 3RT9A 1G2IA 1Z4OA 5F51A 5HXAA 4K8RB 4BOYA 1GFZA 2VRWA 3RSLA 1ZMTA 4KO4S 5ALTA 2XUOA 2QTLA 3S27A 3ZWPA 1JHRA 3C7KA 3MC1A 2AZXA 1K63A 1ZOPA 4P86A 4ETNA 1JF8A 3D4OA 5JHGB 3IKMB 3TW6A 1AKQA 4NBNA 5EE0A 3W6NA 1K86A 5JUWA 3EG9A 3TEJA 3V33A 5DE3A 3K96A 4L08A 3PQ7A 2QJWA 3SYRA 2ASEA 4U2EA 5AW9A 1CZRA 1GQ2A 1GQSA 2Q4BA 3ODPA 1SWVA 2E6KA 2WTMA 4GQAA 1YR1A 5CGQB 4DLSA 1VE1A 5I7FA 5F4BA 6ADHA 1VYVA 1C3OB 4WK2B 2R65A 2Y68A 2YIVX 3R5XA 4ARAA 2XMBA 3LY5A 4RCVA 4PONA 3ZK9A 3PR1A 1RKXA 2I6GA 1XNHA 1XP5A 4JVLA 1WUIS 4GSLA 3DT6A 4HB2A 5KHOC 2DBYA 1O6CA 1MENA 1JI3A 4LQLA 1QH9A 1TM2A 1Y82A 3EXFA 3JAKB 4NBSA 4Q1CA 4Y1FA 4BRUA 1U1EA 2ZWOA 4MYCA 3SLRA 1B15A 2H8GA 1H42A 4OHZA 4F2DA 1M2OB 3A4VA 4B34A 5FBZA 1PL6A 4RK1A 5CPBA 4ZKDA 5JRDS 3PITA 3AHDA 1I2BA 1O6GA 2YRFA 3A6GA 4RULA 4KFCA 1C7ZA 2ZIWB 4KYTA 2QRZA 3SIPA 2XCOA 5I4IA 1T35A 2CLCX 3SFVA 1EVEA 2YUIA 4BTEA 2FPUA 3TKYA 2FKNA 4EPYA 1U0NA 3GDWA 1WXQA 2EDCA 3WV5A 3DEYX 1NBMA 1IUKA 3C97A 3GZTB 4FLEA 5KNCD 2CL7X 2VS1A 4COKA 3PC3A 2NUAA 2AFRA 3GLSA 4I50F 4DXDA 2DBRA 2VDVE 3QYJA 4MCJA 2QT9A 3EEQA 3IV6A 4Q48A 4WW0A 4YMVA 2Q6OA 1SCUA 4MI9A 3ZCRA 1PYOA 1QHYA 3T1QA 1JXAA 1GXSA 2B25A 2ZJYA 5TQ2B 1C7IA 1FFBA 3AUUA 2SNIE 1CUXA 4R98A 1GG2A 2JH9A 4QT4A 5DT9A 5JS1A 4NYMQ 4M60A 1M2KA 1XTPA 1WZ2A 1ICEA 1TA4A 2XT9A 3TIVA 2FLVA 2PTGA 4L4UA 3MPOA 4PPQA 1LQTA 1UC5B 3KOWA 5K5EA 4IQ8A 2GN8A 2ZAIA 3PSAA 2Q0QA 3VO9A 2I3BA 1WIWA 4WZAE 4N12A 4QTXA 4MPRA 3T34A 2YOGA 3UTCA 1VKZA 1YQEA 1SK8A 1YV9A 2FWRA 4ZI3A 3JWPA 4Z4EA 3FVWA 2WRZA 4UCXA 5H80A 421PA 3NNSA 4BVFA 1Y7HA 1XL1A 3P45A 3SR3A 4Y0AA 1Z25A 2HXSA 1NJ8A 3SPXA 1TU0A 3OEED 3G0CA 3OU6A 3R3UA 4IF4A 5IABA 4J6EA 1MRNA 3GLIB 4QTZA 1SVWA 4CCWA 2DRIA 4GOXA 1A8SA 1O8CA 1U8ZA 2IHUA 4HNRA 4R8VA 4JXXA 5BURA 3UGQA 2H4FA 3K94A 2VH2A 4PNHA 3ZWMA 2DFNA 2ZSKA 3QQPA 2TRSB 4FIDA 1B1CA 2O2YA 4GEKA 4EGQA 1R0RE 4YXFA 1AC5A 2E4XA 1U0RA 3PUHA 1XT6A 4MI1A 5AK4A 3L9WA 1WCV1 3GDFA 1UFVA 3A36A 4HDCA 4JEHA 2W6OA 5EIBD 5T7BA 2BFNA 3RIHA 1R0BA 5JXJA 2FPMA 4RFLA 3WK9A 9MHTA 4KVAA 4IH9A 4N4AA 4ZIRB 5LNK6 1L5WA 3AI7A 3UC5A 3ER9A 2FR1A 3QQ5A 4RKEA 1KZ9A 2P1ZA 1AXEA 3VZBA 2CL5A 4W7HA 1EXWA 2G25A 3NHFA 4FFDA 5FBRB 3UXHA 2IU3A 2OZKA 3WIOA 4OU4A 4TKUB 4CNBA 4HV4A 4FCTA 4UZEA 1E4EA 4EUHA 1JDZA 4KV7A 4ZEWA 4WK0B 4ZI2A 1X7HA 1M2WA 3KKMA 1X9GA 3RWBA 4XYLA 1MDBA 2PS9A 5KMGB 1A2BA 3HH8A 1OY1A 1UODA 3AUFA 1EK6A 4I55B 5DP2A 3ND6A 5IDWA 2EC5A 4F1KA 5FTLA 4G9GA 4NONA 1KEVA 1R9MA 1RSZA 2JVIA 3AHGA 4JASB 4Y1EA 3RJ9A 3RKRA 2NZVG 5DWVA 5AW3A 1CUDA 4KO2S 1F17A 3FNHA 4MUFA 4NAVA 4UPEA 5IC4A 3M6FA 4C6RA 3IKTA 5JYBA 2E0IA 2XMGA 1MG5A 2W00A 6AT1A 2BE9A 4FOPA 5I6DA 1SVNA 2YWCA 3FYDA 4O1IA 4CR7A 1UJNA 3LUPA 4QUAA 1RIFA 2VRBA 5TSDA 1N2ZA 4BNHA 6PFKA 2FSGA 5HX7A 1RXUA 3FZEA 1FVXA 2OLKA 1NY6A 3V46A 4XWWA 1SXQA 1TYCA 1GWNA 4C3ZA 5E38A 4BZPA 1YR2A 5A1JA 1RWPA 3NJ4A 2PRKA 2JFZA 4DL9A 2CLKB 2O7VA 1MOPA 4BMOB 3K9FC 4HFMA 1PUJA 2P9QA 3G5TA 1XLVA 5CVCA 4GLBA 1LLDA 4ANFA 1U2ZA 2FOXA 4YJ2A 1EXNA 2RHJA 1U5BA 3HPQA 2J7PD 1JAZA 3CLRC 4JCCA 4TV8F 4DF3A 4EAQA 1PV4A 5F73A 1AS0A 2HJSA 5BSRA 3NEAA 1X8JA 3EXIA 3MT7A 1SUEA 1GG8A 2IOFK 4OQPA 1X7GA 3N1UA 1ECFA 5SYNA 3DAYA 1T3TA 3O8OA 2AOUA 3ZV7A 5CAEB 4BQSA 4PTYA 5JATA 2JS7A 4WNAA 2OENG 5I51A 1RI1A 1ULZA 3EC7A 3EFOB 1I2ZA 4QXPA 5C9ZA 3DE2X 1NF3A 3KB6A 3WY9A 4YP0A 3TTUA 4HRVA 4R9NA 2QX6A 3RVBA 5LQSA 3ZWQA 4OXIA 1N1MA 4ZOAA 5FUYA 4BCDA 3MTDA 4GUAA 5K03A 3M5WA 1TAGA 2DEUA 4R2KA 3I4FA 1A9XB 2X0RA 3H2KA 4M8IA 1Z62A 1CS4C 1G41A 2VF2A 3NC4A 1TW3A 2QPAA 4HH0A 5FWNA 1EX7A 3ZR4B 1C4XA 4FEYA 3EF1A 3GAMA 3HN7A 1UJ6A 3IPXA 3K2QA 2AF4C 1PZHA 3QNUA 1JAIA 1B8NA 4WLVA 5F3DA 4AX8A 2X22A 3SWWA 1RRMA 1QOPB 1RZVA 1D1SA 1CJMA 4UOEA 3V1YA 5EHXA 2QRPA 2RK6A 1FDSA 1KTVA 1SXJB 4N8DA 2X6RA 3DCNA 1QVAA 4DA0A 2Y1XA 4F60A 3W5SA 3OFNA 3FOZA 2WT9A 4D8YA 5C7IO 2QRJA 1UDWA 3L82B 1E3EA 4OMDA 5CP8A 4YJDA 4FYWA 1ZXLA 1WM1A 3QFCA 1Y3FE 3FE2A 3OMXA 4P2GA 1IQRA 1EFCA 1M2VA 2AMVA 3QMMA 3VFDA 4EA6A 4P4SA 1L8QA 4CU5A 4J2OA 2IGTA 1ZUHA 3AKCA 1ESCA 1YXMA 4D26A 5DCLA 1RCFA 1K8RA 4FCWA 3ZZ0A 5B1SA 4K9RA 2DWOA 1X42A 1F9AA 1T0BA 2PIAA 5JZBA 1QBGA 2ACKA 4PGGA 3LRXA 4I19A 1IVSA 3R74A 2CKMA 1PJSA 2PKCA 2X1HA 3K5WA 4H7FA 4C5AA 4ZVKA 3L7LA 4CR6A 2Z4TA 3TYXA 4R0NA 2D6FA 1NKVA 2P90A 1V6SA 4JBLA 4TYQA 3S1AB 1FY2A 2PFGA 2FCAA 1T8TA 2KW5A 4FNOA 4Q9KA 4N6GA 3AF6A 1HYQA 3OY7A 3FROA 3I9FA 3OFVA 5BWCA 2GBCA 1OAOC 4FQ5A 5KHAA 1EGAA 1IYZA 4CLRA 4JODA 2Q5EA 3RUPA 3HB1A 4C4ZA 1Z8NA 4MGIR 5JSKA 3ER8A 3K4QA 4JENA 2ERXA 3U5TA 3CNEA 4D6PA 1NXPA 2DWQA 2FPIA 4CW7A 1JHXA 4JP2A 4L57A 3P4YA 1NU8A 4MVWA 1Z7WA 2FUG6 5HZHA 2R9VA 3VYVA 2NO6A 1E1CB 3K0HA 5LNK1 3BCHA 2EHJA 1F5NA 2FOIA 3GT4A 3IKJA 5EVCA 2WY2D 3ZE2B 4QJ4A 4HNTA 1HE5A 4IOKA 3BD6A 4E31A 1UF9A 2MMGA 1VE6A 4Q02A 1N7HA 3HCRA 3AFGA 5JSYA 1ZRNA 4C6HA 3WYBA 4EHKA 2FEKA 1LNQA 1QSGA 1EFHA 1UC4B 2C42A 4FMCB 5FYQA 2AZ4A 5TF4A 2J1LA 1JHAA 3RBXA 2D8AA 4Q05A 4XVRA 4ZYTA 3NWOA 2IS4A 3MS2A 2QRKA 1VSUA 4EHFA 2QSYA 3G0IA 4PIVA 1M2NA 2HREA 5KYKA 2GDZA 3L4BC 1PNRA 1U63A 4AKIA 1BQ4A 3MQ4A 1I94B 2GSWA 5KVQA 4AUMA 2JBWA 3L02A 3CZRA 2OKCA 4QBGB 4S3MA 4GMGA 5DHQA 5ALMA 2HZ7A 4NECA 4WFKA 3ZHRA 4DBVO 4G1FA 1AB6A 4DNPA 3H2YA 5CVVA 3U5ZB 5JANA 3O38A 4D6YA 2ZM6B 5ESDA 1W2GA 1V5FA 1UMDB 1DBWA 4C4XA 3UHPA 1U2GC 1L1RA 4MLCA 2Y8EA 2Z8YM 1KE2A 1WCIB 3CURA 4C0HA 1W1IA 3TZ6A 5JDIA 2OP1A 3JQBC 1NIPA 3GWZA 1F6DA 2Y77A 1KVTA 3IDQA 4PYOA 5JO9A 3DWEX 2CVQA 3T4UA 1Y7PA 4WSOA 1B6GA 4LJKA 4KACA 4EKIA 5HRUA 4WZBE 2VYND 1IHPA 2PWAA 4LDAA 4U0KA 5F5NA 3D3WB 4L07A 1H2XA 2P9FA 4O4HA 2VP9A 4AZ3A 4BFSA 4BLRA 1O5IA 2ADOA 3AOGA 3THOA 2WA1A 1V0JA 1P44A 2EGUA 2RMKA 2VNHA 4HL6A 4E08A 3BORA 2W2MA 4P54A 1G8JA 3GJ0A 3REGA 5GPBA 1O9HA 4TT8A 4CHGA 4NCXA 1IJKA 3FI9A 1VBKA 1Y8RB 2O3RA 2V7VA 3C7CB 3EQ9A 3HB0A 3ODGA 2MSKA 4QUIA 4RFSB 1XF9A 2Q6KA 2ID4A 2GEDA 5JJKA 1X1SA 4KQGA 1IK4A 4IM7A 3SFTA 1T3GA 1JLHA 2ICAA 1AZTA 2ZB8A 1UBNA 1OIVA 5HS6A 1OFUX 1VCIA 5BN5A 2BW0A 1E4OA 4A1FA 2BWJA 2A5JA 3U4IA 1XWWA 3BAZA 4W8HA 3C3BA 5FPHA 4FYHA 1E1QA 4GI3A 1GGJA 3GVPA 5B3KA 5CXQA 4H1HA 3PLRA 4PBRA 3JD3A 3Q3HA 1KR5A 2J3QA 4J0KA 2HBQA 1KL7A 2ZUWA 1S2NA 4CV3A 1JILA 1UIMA 4CF4A 3S7TA 3P94A 4KI0A 2IQIA 4Q4HB 1G5PA 1C9DB 4G86A 4S2EA 3IHTA 5AP9A 3AOEC 3MTQA 1U28A 3C6KA 3DAHA 5CURA 3SJZA 2YCLA 1JHVA 3EIEA 4D5GA 2QE6A 4M0DA 3FTCA 4ODIA 4P4TA 4U2CA 4ZO7A 3LXXA 3VHRA 1DBRA 3QKSB 1QIDA 4RM2A 1P60A 1ZBQA 4EG6A 5EIXA 3BB3A 1CZOA 4TYYA 3LGXA 1U6JA 4R1PA 2R8EA 1RFGE 2CFIA 4QQKA 5AVKA 4GGOA 1DKLA 1UZMA 1SHKA 3IV9A 4FGJA 1HNXB 3HDJA 4OXXA 1QQ7A 5EMKA 1TYAE 5FULA 2FW0A 5LZ9A 4ML3A 5JJIA 3ZD7A 3DXFA 5JD5A 2C7GA 2VDJA 1PZFA 3HJUA 2CV1A 2Q6VA 3QE0A 5LVAA 1MV8A 1QTIA 3BC1A 2XRYA 4MKRA 4B3GA 1I3KA 1BJRE 4CNQA 4E0BA 1NF9A 2EKBA 3F90A 1FTNA 4J16A 2Z9BA 4OMFG 3PX3A 1MG0A 1PGNA 4U6SA 4DNOA 3ZHVA 1E2JA 2FSFA 4ZAZA 2O1EA 3FMFA 4NK4A 3GEDA 5DI3A 4NFLA 4D79A 3AF0A 1HTWA 1JWBB 4UCFA 3M5CA 4TMTA 5FTNA 1H1LA 3FPLA 2BHTA 2NU8B 2MJLA 1JKMA 5K3BA 1V16A 2JFHA 4WKOA 4Q9JA 5JJ5A 3GJ8A 1XZ8A 3UB4A 1EUCA 4DCUA 3LU1A 4DKXA 3IUMA 1ONBA 1P5ZB 3USES 1DUVG 1Q1NA 2NZJA 5CCDA 3SZGA 1UMBB 4AECA 4AXBA 1YKFA 4LVOA 5FWAA 4RS3A 2PBLA 1U1FA 4OHVA 3VPDA 2QDXA 1D4FA 2JCBA 1Y5RA 4BHTA 1U0FA 3DNFA 1AF4A 1DIAA 5I7OA 1OFIA 2WKWA 3ENQA 4J1TC 2PX3A 3WIDA 2F43A 1BX1A 1Q77A 2FUG1 5FWXB 4M89A 1I5OA 2C98A 2UYGA 1H4VB 5CR9A 2IH5A 1ISMA 4JEIA 4IHQA 1UDBA 1CP2A 1WA5A 3DOOA 2WB2A 4FYVA 3IOBA 4G97A 2I4MA 2JIPA 4MWGA 3STYA 3W5DA 2QMQA 4LW8A 4AZ0B 1DB3A 1OBHA 2EZ9A 2HF2A 2ZKIA 1LBSA 3E22A 3DOFA 4RMIA 4RSHA 4CM9A 4D0RA 2JFPA 2HH9A 3UJ7A 1U7WA 1RI5A 3FNRA 4ESOA 1ISGA 4CIVA 2GEUA 2HBZA 3NKFA 3UFXB 4MQ5A 1FSFA 3KVYA 3RVOA 2FCRA 2GPYA 2IW3A 1E1QD 1ITZA 3KL4A 4L95C 5EPUA 3T9AA 4Q16A 2CXQA 2WJYA 2CVHA 3QWIA 1JQ3A 1XZJA 2A0KA 4YH1A 2PGDA 1ACMA 1L7VC 5ALNA 2AC7A 1KY4A 1WUJS 2CXOA 4RDXA 1RXVA 1CB7A 1FRQA 2PVPA 1ODIA 5A05A 4B9AA 1UXGA 1W59A 4AMVA 3MOGA 3RS3A 1TMOA 2PVCA 1D1QA 4IDAA 3H1BA 1DQPA 3MIZA 3UA4A 1E7MA 2ZT6A 5BRJA 2VH5R 1ZITA 4WT7A 3IAFA 2IDKA 4QDZA 4OGKA 4FXOA 1HQYE 4RKRA 3DLPX 1EK0A 2CVZA 1FS6A 4QYIA 2QLLA 3ROTA 1U7XA 5D7NA 1XEWX 3MN1A 4N6OA 4JBYA 4ARIA 4DKJA 3D7KA 1C3XA 4B4VA 4D9EA 1QGUA 5A4JA 4P4GA 4JU8A 5J4LA 1EH5A 1SQ6A 3KSUA 1XRLA 3ECSA 4Q03A 5FUVA 4BNKA 4NZ9A 4DEVA 4EG3A 1C3EA 1N25A 3BMCA 4K40A 1VSBA 4LGYA 2ZB7A 4QLAA 5KWEA 1I4LD 3BWMA 2JW5A 4DMGA 2XWJI 4B0PA 4DY4A 1K66A 4EB8A 1UBEA 1RP1A 2PGNA 4LGVA 1XI2A 2XXJA 5B30A 2EIXA 3TVDA 1ECCA 1S5PA 1YRHA 2B9EA 2FWNA 1YCGA 2J67A 1TKAA 3PC8C 2P9JA 3LKVA 4ZOLF 5TEVA 3VYSB 1T2VA 1UM8A 1KS9A 1PU2A 5SYMA 5F2OA 4F96A 1OH8A 3H87A 2Z9DA 2AQ8A 3B6MA 3PJFA 3LY9A 4CTOA 2QORA 3LS2A 4S0ZA 4XXHA 4BNYA 4ZZIA 1UJ2A 3TQFA 2V9PA 4XLTA 1A7UA 2W2LA 2WTUA 2AK2A 4OQQA 5ICFA 3W3AH 3KDPA 5LU9A 5HHTA 1I0IA 4QJ3A 2WFLA 4Z4CA 1XD2A 1DKMA 2YVKA 4LHVA 2H5IA 1WMDA 3TK1A 3VAYA 4A92A 3EZNA 4HUQB 1NG9A 1DELA 5KSYA 5K45A 4YACA 1TLLA 2Z1MA 4BJ1A 2AJCA 1FA9A 1XXHB 1THZA 4Y6QA 1ADCA 4EKGA 2AR0A 2QD3A 3BXXA 3J7TA 1TKRA 4Q5IA 1IVNA 3OTIA 4EGSA 3F73A 4JITA 2NAPA 4MW1A 4OKSA 2JD0A 4CLEA 3U7JA 1E6MA 3E9QA 3IJEB 4KUGA 4H1VA 3PXAA 3SHWA 5MN6A 3RAGA 1J4AA 2O0JA 2XUIA 4HK4A 4CLOA 4GR4A 4CMCA 2WDPA 1Q7BA 2DF8A 4PX5A 4N0QA 3JVUA 3WR5A 1ZLYA 2HQBA 2XQFA 2WWHA 4L74A 3G5MA 4LY0A 3LAWA 1U4SA 4IZIA 3PQCA 4HGNA 2BM1A 4CM9D 2DBQA 4ENWA 4RJJA 3TRHA 3FHTA 3H19A 3TLGA 3M1AA 1K6MA 4KUEA 5SY4A 4CI0B 3FZQA 3A8TA 4R9SA 2QK4A 3BD7A 3DOIA 2BMEA 3GMSA 2Q27A 3PKJA 1UXJA 4CKEB 4MW2A 4WCDA 3G0DA 1FDUA 4YVFA 1DJQA 1L3BA 1POWA 2OUKA 3A11A 5KSPA 4RTLA 4JC8A 3SQNA 3IBGA 4J7XA 3PKIA 4IGAA 1VPEA 2GPSA 4D74A 2EJVA 4QBHA 1NYLA 1SHUX 2ST1A 4K9KA 2FW1A 2H1VA 1B73A 2WHEA 2GNOA 5ES3A 4KN6A 4AT1A 1XUOA 3KTAA 4ASUA 2ZSEA 1KRXA 1D2AA 2BM0A 3LWNA 1L5KA 2UZ4A 1U0EA 1U1IA 1YDMA 5FI1B 2R8YA 4WUTA 3SQMA 3TTYA 4IS2A 1SKQA 3OY2A 4ENRA 5A7FA 3SXPA 2ZDHA 2WFAA 3QUSA 1LK5A 4MUIA 4L7VA 4O02B 3B51X 4MQUA 3I61A 4IAOA 3LUGA 2OD7A 3HZOA 1C9EA 1RHJA 1Z5UA 1AS3A 3ZBTA 4B6RA 4DT1B 1J5XA 4C30A 4EB6B 4ZHQB 1GPLA 3JYQA 4H6XA 4ZVLA 5K6TA 4X62B 1K8YB 2VEOA 2WHXA 2ZR8A 2HXGA 4JR0A 5THKA 2NOAA 3T6KA 4CVNA 2BF7A 4KE8A 3VYWA 5EP2A 3ZVKA 4DLRA 2JA1A 2FH5B 4YMWA 3E58A 2CSXA 5KCZA 4LJ6A 4H1UA 2FZLA 4KK3A 1CQIB 2ZJ8A 3COSA 4KW7A 4NBLA 3HO1A 3QEKA 3U7QB 2EJTA 3RYHB 3NGXA 1XMPA 2QV7A 4M98A 4UBJA 4DDKA 4BMSA 4Z6KA 2Q7XA 2R0QC 1IBKB 2E1PA 1L4GA 5T3UA 5EXSA 5HRCA 4MVJE 3IQIX 3ANLA 1G64A 4JBGA 2CB9A 1JKXA 3N7UA 1I4WA 2GCGA 1DOAA 1HE4A 1MZPA 3ZLJA 1WDKA 3RIYA 3LX8A 2W2LD 3GUYA 3I6QA 4IMJB 3I1FA 4RPLA 2VDLB 1VLLA 3Q5DA 3HB7A 4RENA 2UZ1A 2QENA 5DX0A 4B2PA 3L1HA 5EOVA 1MFPA 3LK7A 2Q5CA 3M9XA 1I13A 3D8NA 1GZ7A 1UAGA 4JZYA 3O84A 4M8NE 3Q7IA 1XELA 1EG7A 2RHBA 1GAWA 1YU9A 4Q1AA 2B4AA 1CZNA 3PCRB 2PUCA 4XPIA 3AO0B 2ONYA 2ZYSA 1FX0A 3JQ8A 3KLPX 2QTGA 1NF8A 2AE2A 1PS0A 1W5FA 3DUFA 2OCXA 3IIJA 2BR3A 2G9VA 2V6FA 4MW6A 1WQ4A 4RC9A 1CUJA 3STUA 4LE0A 3I2IA 5GIPE 3FR8A 4G85A 1VIAA 1FJXA 5JFGA 1ZW6A 1G21B 2NSDA 1Y8AA 2ONZA 3LL4A 2YDYA 4II2A 1D6NA 1KXJA 2FVXA 4JUAA 3AF3A 4OHOA 1AA6A 4RDHA 3QVMA 1LI5A 1WMSA 1NQTA 4EPVA 1RYHA 2O59A 1NJ2A 2ZIXA 2ZBVA 2BMFA 2GZ3A 4KGDA 1GYRA 3DAOA 4UDNA 4MRPA 5EXXA 3LBHA 1A4RA 1DC7A 2GM3A 2GS9A 3EYAA 1AMNA 521PA 2R2GA 2VDWA 3CUYA 5ALHA 4AY5A 5H3CA 5BYBA 1TUEA 3DONA 1X39A 2ZCVA 1DPFA 3KKPA 4BVJA 1KMMA 3UN1A 5CDGA 4B3XA 3CM0A 3GLGA 2IPLA 2Y9MB 3DFKA 4ZAWA 5A3RA 5HM8A 1L9XA 3MPUA 4DN6A 3IQEA 3PICA 4P3KA 3BKWA 1OWOA 2P2NA 3QI7A 2C9OA 1YUNA 2MSCB 3FPCA 3K4HA 3OWXA 5EEGA 3C5EA 1P18A 4GBED 1YR8A 3KO8A 3I5XA 1DJPA 4BFYA 1KY2A 3DWFA 3LC2O 3EA0A 3OFJA 5AVQA 4RACA 13PKA 5JPDA 3IL2A 4HVCA 2GZAA 3OE7A 3SZUA 1W6UA 2CBZA 2J59A 5HBRA 4WLNA 4YJKA 3BM5A 1NN3A 3L8CA 3RWMB 2P9TA 4C7JA 2WJWA 4WECA 2XMRA 4UJ5A 5FKJA 2Z6AA 3KETA 1XB2A 4W6QA 5L3SA 3BZBA 3D6TB 1WUTA 5JXWA 1E1MA 1PD1A 3EOZA 2HA5A 4M83A 4GYJA 3UKOA 4G5XA 4MWZA 4FGSA 4G81A 4Q47A 2H2HA 3JPYA 2RGRA 1NYTA 1D1TA 1Q0UA 1QS0A 1RM3A 1KYYA 2VEDA 4XWGA 4DQDA 2WEKA 1WHSA 1Y81A 4YCAA 3O83A 3N2KA 3A3KA 4HXYA 5JI2E 4BGEA 4D9NA 2IUFA 2OQVA 5JYEA 5DCUA 5H16A 3VPBA 1NFQA 4ZO8A 4CIYA 4N47A 3SYLA 2CJWA 5K01A 1MHTA 5ITZA 1NOIA 4HATA 4QU0A 3UJ3X 1GDTA 4QTYA 5KX5F 1TT7A 4FIZA 3SU8A 4JT4A 3MILA 4JKOA 3V1NA 5A5GA 1LVHA 2TS1A 4XTRA 2G3YA 3TR5A 2YZKA 3FZGA 1M6NA 1BDMA 4GBJA 4LY6A 4ND3A 4FINA 3V4OA 2HLNA 5CCBA 2PWYA 2I8CA 1UFRA 4CDMA 3V1TC 3NXSA 3UH0A 1BJTA 4WK4B 4Q9HA 2D06A 4A0GA 3R09A 4ZHSA 5LD2B 1WX1A 2C29D 2W4QA 1BU8A 3HVJA 4OXYA 4AS1A 3R3HA 1A5SB 1SQGA 4PR0A 5CYGA 4R1SA 3WKCA 1VLZA 2IZZA 3MT0A 2IODA 2CCKA 1DO0A 3ZBUA 3TXAA 1QKKA 2WNSA 2QP4A 2WILA 4DTCA 3GQVA 3DGFC 3LQ1A 1I7DA 1ADFA 3BMOA 4RE5A 2E4AA 2BEWA 4XFJA 5EZ6B 5D51S 1R6BX 2CLFB 2I7VA 2CD7A 4WBSA 2ZUFA 3JASA 1BXKA 1PSWA 2G4CA 1P2VA 3D2AA 5JALA 1BRMA 1XPRA 1LSOA 5C4MA 1FP6A 2QIOA 4KL8S 4HEQA 5KU1A 1ES9A 4FX5A 4NYIR 4YJFA 4YQYA 4N7JA 1IPFA 5B37A 3VC1A 1Q1BA 1SUIA 2BFMA 2GNPA 1TCCA 2YWJA 1CZHA 3A70A 4X7BA 5TJ9A 2WSMA 3L0DA 1Z2NX 5TT1A 3O1LA 2NXEA 5K8UA 2WZCA 2YH2A 3NTUA 1UFOA 4BLTA 4XQGA 1UBRS 1OBOA 1LWOA 3OJ0A 2R6GA 3EAFA 3QXSA 4WFQA 3QE9Y 3OIUA 2O1XA 5IAEA 5F1YA 1V8ZA 1L5HA 2A86A 2PGJA 3L8EA 4L5YA 2IW1A 1Z8FA 5DSXA 3WBJA 3HGTA 2XGOA 1A98A 3CBQA 3NBKA 1O6FA 1PK9A 1JT9A 2FDXA 4GX1A 5TE9A 4A6EA 4OAPA 1OLSB 1ZUNB 4B76A 1NX9A 1C5KA 4NH0A 3DHYA 1Z74A 2JGIA 2JKYA 1UDRA 4CQMA 4HQRA 3CRQA 1HMPA 1ODJA 3OE7D 4OFXA 4JYCA 3A9TA 1IJBA 4WXEA 3GFBA 3LPDA 1C7EA 3UG7A 2HW8A 3D5QA 1LPAB 3FOWA 4WUVA 4I3FA 1MUUA 1RXIA 2BTQB 3ID6C 1J99A 1JWLA 3O0DA 1RAAA 3IDFA 3ZOZA 1F8GA 3BH6A 2OHFA 3ZI4A 4AG3A 3G2NA 1J0XO 3I9V6 4CM1A 4ZKEA 5E6RA 2UYHA 1M8GA 3I9KA 3WRYA 5JBNA 1DBIA 5K3EA 5DTJA 2EAUA 2TYSB 5JYDA 2NIPA 1FU7A 3LA8A 4TTAA 2WG0A 1SUAA 3IULA 2C5GA 2YHUA 3JZAA 2R79A 2VKTA 3KWMA 4JBHA 2J9ZB 3IP6A 2HA3A 3O2QB 5D2CA 1DADA 2HI0A 3GVIA 4NK5A 5IJ9A 1Q7EA 3K6SB 2XGJA 4W82A 3U60B 3L05A 5CD9A 4BWFB 3KSAC 2XUFA 2HN9A 3UY4A 1W19A 2P9GA 4BQIA 3HCFA 4FS8A 3DZHA 3P9SA 2NP6A 1KS2A 2WWWA 2OGZA 5C7OO 3STXA 4CGYA 2WF8A 2YC2C 3FOCA 3P8ZA 4FZ5A 5JI3E 3KLOA 2YZ2A 3LOUA 1R7RA 4Y1RB 4A8JC 2OLEA 3G3EA 3UQYS 1SXGA 4I46A 2O8EB 2FWMX 3AEQA 1Q1AA 1LTHR 1NZFA 4BQRA 2DWCA 3EW9A 5GV7A 3VVBA 1QRUA 3ZVRA 1YE5A 5BOSA 5EMMA 4B09A 3Q8MA 2QUKA 3EBPA 3GVXA 2RGXA 1VSTA 2X2EA 3EXHB 3OJWA 4KI7A 1NDQA 1V45E 3E7DA 2JCXA 4PSAA 2ZRHA 5G3YA 3WGMA 1HORA 5SICE 1P1JA 4AJKA 2ENWA 4F3YA 1K0FA 1FNNA 3IQZA 3IR7A 5KWJA 2JB9A 3FUVA 5JASA 1QVWA 2OORA 3RVMA 1RR6A 4AJOA 4UBIA 3LC7O 3AF5A 4UDXX 3ZHTA 1N5RA 1V3QE 3QEMB 4Z0TA 2GAFA 4FUQA 1EWQA 1AD2A 2O14A 1QWOA 1V7QA 3IH5A 4KMRA 2R96A 3DKIA 5K20A 2CWDA 4Z53A 3H9GA 4V0QA 1XV5A 5B6PA 1TF5A 3WDMA 1VJCA 4NAUA 3T4EA 3FYUC 1Q95A 1F4PA 5E4FA 4AY3A 4CKYA 3VYRB 1AK1A 1JFLA 5KVAA 2C7OA 5IVDA 3UK2A 4F1WA 2WPNA 2ZRJA 4M8LA 3WGGA 4DV0B 4DHWA 3VM6A 3HTXA 2NV6A 2P6MA 4YNBA 2H85A 2M6LA 1ENPA 3TSCA 5C18A 5H83A 1N2CB 5K8VA 1EGVB 4JBWA 1W36C 4YUWA 3D8UA 4ZI7F 1LI4A 3GJZA 3JTMA 5DOVA 5JH7B 1VB3A 3LVFO 1VOTA 2W2NA 2M32A 5AW5A 1UXIA 3H5LA 5IFLA 4P53A 4AJEA 4A2QA 2Y76A 3KK0A 2VYVA 4WI1A 1FMLA 4DJEC 3ZCPA 4FFWA 4CQMD 1Q2XA 3IBSA 1VLHA 1WLYA 4F2WA 1SBHA 2YY5A 1E2EA 3GLKA 3I52A 5CMLA 3MWLA 3PE4A 1RM5A 3FLEA 4QBFA 2C4WA 3V55A 3W6ZA 1KK0A 3WRVA 1I3CA 4QEKA 1PYGA 1VL6A 2VJLA 4LXYA 3R7DA 2BKXA 1KAEA 3U3XA 3GEBA 3H11A 2ONJA 5AKKA 1R5BA 5HKKD 3A0RB 5C53B 5DLQC 2A84A 1RWQA 4M46A 4Q3OA 3JQAB 4IQFA 3NT2A 3GGPA 4RLSA 3GPCA 3L0BA 1PGQA 2QSJA 5AQEA 3R7NA 4R1LA 3OJXA 4K1LA 4NDZA 4QOJA 4PYKA 4Z4HA 4LCEA 4M4SA 3ZQUA 3QVSA 3VVCA 3BWVA 3LIIA 4PYMA 1NVBA 3AFNA 3ICQB 1GEGA 4MR9B 2B1JA 3QWHA 3V8MA 1R64A 1H65A 2PSSA 3R3JA 1IMJA 1EJ0A 3DTYA 3PIDA 4PXSA 5REQB 2HF9A 4CBVA 1DG3A 2WZDA 3IUQA 4IIYA 1DRVA 4IDFA 4L4YA 4DMRA 1NFFA 1Q0PA 1BH2A 3HPRA 5KYUB 3M6IA 5CIQA 1G9TA 4J6FA 3PRJA 3IAXA 4MNTA 4DCPA 1HL7A 4V1CI 4LKRA 2ZIUB 4AIRA 1PQUA 1PE0A 1VYTA 2V6JA 2ZB4A 2O0LA 4FE4A 4UM9D 3V00A 3V7UA 1NBHA 3QIAA 1XVLA 1P77A 4URVR 5BP7A 1TTTA 2V7TA 3K71B 2HV8A 4XFDA 2B8JA 3IBTA 4M49A 3UWPA 3PDHA 3NDJA 1T8RA 2JASA 1JMYA 3T9BA 1K0UA 3DFFA 1Z2OX 1DE0A 1B6RA 3GB9A 1QH1B 1GPUA 2IEDA 2UKDA 5B58C 3QKRB 1B41A 1H5QA 3GPDG 6YASA 3WGIA 3LE8A 1J2EA 2CN1A 5KSOA 3SK0A 1WXEA 3WNDA 2CBGA 1GTVA 2D2FA 3BMNB 1JDBC 4EI7A 2NX2A 3C6ZA 3I9V1 2ZRQA 4OI1A 1YIOA 2NVOA 4I4TA 4RIGA 4C2BA 4MJ7A 4O4IA 4M76B 2NU9B 2PG3A 3RT1A 2VPYA 1BMFA 2ORVA 3C6YA 3GH1A 3NETA 5DNEA 5FNVF 3SDZA 1GL9B 4BIIA 4QJIA 4RGBA 3CVWA 3X3HA 3OP4A 1YQGA 4MX8A 1PDVA 2Q7OE 3MT9A 2GLTA 4C0AC 2Y1GA 4N0DA 2DQYA 1TAHA 5GJVC 4IWNA 1O8BA 1LF5A 1D5WA 1RADA 1W6RA 1L4EA 2FFJA 2I3GA 3OQ6A 2O8BA 1PV2A 1VKOA 2KLHA 3FCOA 3PJGA 3M5PA 4RETA 1XG5A 3P2IA 5BV1A 1BXZA 1FDRA 1NN5A 2VYVD 3CIOA 2QM8A 4TKVB 4M7PA 1DNPA 2BFPA 4DVJA 1XZNA 2H4ZA 5K0GA 1I80A 3ZE9A 4BP3A 1DARA 2OEPA 4Z2AA 3B12A 3P9NA 3GYBA 1P8AA 2QG4A 3A6FA 4RM3A 5KINB 3KIPA 5IC5A 4MIOA 2K7FA 1ZH6A 2EGHA 4XYMA 1YE8A 2JGDA 2ZYRA 4JSTA 4F46A 3KSMA 2VUHB 3TOSA 5CYPA 3ZWDA 3FPHA 4I1SA 4O0MA 2RJOA 2J0QA 4JVMA 3V6MA 3HFGA 1OHHA 3A1EA 3CTMA 4Z2YA 3UJ9A 2PGLA 5AIAA 2C3UA 1OXBB 2OV2A 4RH0A 5EJ9A 2DG2A 4UNIA 3O1IC 2K5UA 4ZCSA 3TZKA 4BY9E 1IC6A 1IHUA 1L1QA 2NZ2A 4D3ZA 4C6TA 1DIOB 1RYNA 3O8NA 1GRCA 2BZ1A 2C4VA 3CMCO 3F3YA 1JMVA 5CVJA 5LA6F 2MYUA 5C4GB 3TNFA 1VFPA 4N40A 3ZZUA 2AR7A 4CTKA 5FORA 5L7YA 4JJAA 4KQ6A 2DBZA 1Y4DE 2DZDA 3RVJA 4HBZA 1Z6ZA 4MKGA 1V9SA 1DQRA 3D3JA 3M6AA 2DMRA 1FRVA 1IU9A 2JJYA 4LRUA 3B3GA 1TM7E 3S2ZA 4CMHA 1WKBA 1UKCA 2OFFA 3TCXB 5MN4A 4TS3A 3ZNQA 3ZGOA 4WINA 4RPKA 1CE8B 3RS9A 1QRDA 1UOOA 5L7TA 3JQ7B 4JX8A 1Q0RA 1WCXA 1ZCZA 3EN0A 1KJNA 3ZTWA 4ACBA 4W4TA 1X7YB 1CJTC 1X9IA 3GLHB 2BFWA 1AXGA 3ILYA 3JU3A 4I1UA 1U8FO 3F6SA 1HFKA 3DXZA 4IZOA 1JQJC 2I3DA 4TLDA 1S8FA 4LSMA 3QRWA 4I2VA 3RS7A 1QIEA 3BCRA 1Z0SA 1MW8X 5JRJA 3EWNA 3MB8A 3MGBA 2V74B 1EB8A 1PG2A 1J7KA 3WLRA 5LM3A 1KYVA 2DQKA 4ZDJA 2CHFA 4TKZA 1TIPA 3LCUA 5JBQA 3L5KA 3GJ7A 4WJZA 2WLTA 3NYWA 4G36A 4TWAA 2J09A 4JROA 4PCLA 1RPAA 4RD6A 4CKWB 3I9OA 4JA0A 4F4FA 5H5JA 1XKLA 3A6KA 1ZD2P 4EL0A 1GR0A 2WJ6A 2CY0A 4ZVRA 3H1TA 3BXEA 2WBLC 4O2BB 1IQ0A 5FUXA 2B7BA 3WHKA 4XLZA 3PFFA 3K6RA 4BATA 3W3ZB 1ZCFA 4MGYR 4AJHA 4OXRA 4TQAA 4ID3A 5IXJA 3C4JA 1BMFD 4HDSB 1GFWA 3LT1A 1G16A 2B3DA 5CW1A 1GJRA 1GP2A 3OKCA 1AM4D 2PH3A 3HCOA 1WU7A 2PL5A 2EZ8A 1P0CA 2H7XA 4G0NA 2DTDA 4JD5A 2QTWB 2BEKA 1V4VA 2A9PA 4HLUC 3RTDA 4CRWB 4JI1B 4B7UA 5CA1F 1C3VA 1HDGO 4HNAA 4CCYB 4BC0A 3JRNA 4WA7A 4XCVA 5JMWA 3DOCA 4OFWA 3ESDA 4EMTA 4RTOA 1I33A 2CB0A 3BGIA 5D87A 3NEYA 1VPTA 3TL3A 1ZJWA 5EINA 4O3MA 4TYMA 2ZETA 2AFIA 4M9XA 4OL0A 4H4DA 4HUJA 5DYYA 4LBYA 2O7RA 3CU5A 4HAUA 5DV9A 4ALKA 4GPZA 3FVVA 4POOA 1J7JA 1GCGA 3L49A 4MB2A 5L7WA 1BE0A 5LKAA 4JQCA 3ASVA 2Z3WA 3CW9A 4LSGA 2PUEA 4RVHA 4XLLA 2EBWA 4AW9A 4BVHA 3BG5A 5B1DA 4NMXB 1OHHD 1CPYA 4DSZA 1RZRA 1TLFA 1QHSA 4S1NA 1NBME 3B1YA 2AX4A 3PEWA 1UBTS 1B2LA 3HACA 4X91A 4N41A 4I9FA 3OQIB 3PNMA 2I2AA 3N75A 5DHFA 3PJEA 1LZKA 1XTZA 4ZT2A 4KRYA 2NU6A 3RF6A 4I8IA 4NS1A 1S9DA 1ABEA 1KVRA 4RQTA 1SQFA 1NASA 2ZK7A 3BXOA 3G2PA 1S96A 5E1BA 5NLLA 4D1YA 4D25A 1EUQA 1JDTA 5C8YA 4C78A 3IVMA 2F4NA 3B1XA 2PS0A 3SJBA 4C2UA 4XD2A 3TXYA 4L50A 1O58A 4OM8A 2V0GA 3NVKI 3RE1A 3FTPA 2B4KA 1Z33A 1A7JA 2SECE 2Y6UA 1H0HA 1R5JA 4HDMA 2ZJBA 3NDIA 2ZUUA 1T2UA 4N01A 3K8OE 2QXTA 1NW7A 3GCGA 1E3IA 3FBTA 3IVRA 3RIGA 1FQOA 2I2DA 2QAGC 1F14A 2VXYA 1OI2A 1VE3A 4KPUB 5D5HA 2BGJA 3TQOA 5AR1A 4E46A 1P9OA 3CPJB 3LVQE 1G5TA 1HT1E 2IXBA 3ENWA 1A82A 1WO8A 2C31A 2JIMA 3O91A 1W47A 1ZD3A 2H11A 3O4GA 4R84A 1WOMA 3RRBA 4BNDA 3JXEA 2VNJA 3I37X 4JQYA 4IICA 1XYVA 4S1VA 1FNDA 3PXDA 4YLGA 2VNIA 4MS4B 4AJ2A 1MXFA 3IS3A 3LP6A 3CLVA 4V2IA 1SAYA 1FW8A 2FX3A 2AXEA 4LRTB 5TIIA 3T5DA 3FNFA 2AW5A 1M2FA 5DHPA 5EL0A 3K35A 4OGGA 1GCIA 1O9GA 3GJQA 3W5HA 1FSPA 2GN4A 3G88A 9GPBA 3U3JA 4R7ZA 3EIQA 3KPVA 4YS6A 5EKUA 4LFCB 3W5BA 2ES4A 3OU2A 3EZLA 1H2BA 2Q99A 5G0SA 5F3WB 4O2RA 1BS1A 3I8XA 1VE7A 2P6NA 4GMKA 2QZZA 4RIEA 3T61A 4N3GA 1TUBB 2H1HA 1L5QA 1LPBB 3WMRA 3CEAA 3TW8A 2OCBA 4DG5A 1LEHA 3KKLA 4TZ6A 4JMLA 1W8IA 2E6UX 2YXEA 5C1IA 2DXIA 4QWWA 4CM4A 4QXRA 2IXGA 2WQZA 3G1TA 1EG2A 5JVDB 5BXQC 2PKXA 4IIBA 2H9IA 1O5OA 3BSFA 3DHWC 2APJA 2QR3A 5JLAA 1JJFA 1N8SA 4KG7A 4QBIA 4QUHA 2C3MA 4UFNA 4DR6B 3D5EA 3O7MA 4HQLA 4WX2B 2ZT8A 3RW9A 4EJ6A 5KTSA 3ITEA 3LF1A 4HD8A 3EXG2 3DYBA 3OVMA 3I42A 2GD6A 3V9AA 2ZYVX 4YYEA 4EELA 1NMSA 3GR6A 1P0MA 1X1EA 3L3BA 4NU6A 5FUWA 5H68A 5FHRA 3W90A 3GDOA 2FJUA 1U2GA 1X77A 1OH7A 5GONA 1NXQA 5KNCH 4NYJR 2GLUA 2C9DA 4TLEA 5U9CA 3OQBA 4E4RA 1CR2A 2X9NA 3V1KA 3MJTA 5JJBA 3P19A 4YPOA 4G5SA 1Z0KA 3T3DA 1N3IA 4JN6B 3ZVMA 4JL8A 4G41A 4MCIA 2HJHA 1T0IA 2WSIA 1QTQA 1QIFA 3QPDA 2XTJA 1JLRA 3NWEA 3ZGXA 5HCUA 2C84A 2EJWA 2G63A 5DH9A 3UB3A 1D2CA 1N2BA 5DYIA 4KQXA 1ZIYA 3OIVA 1YUBA 4G1CA 4OQFA 1DRKA 3B2EA 3BXPA 7GPBA 3UMYA 4U2FA 3HLYA 4CL3A 1UMKA 3LFUA 1OX5A 3QVKA 3U44A 1JHMA 1ZGBA 4KDRA 3D31A 3VU9B 4ENSA 1UWLA 2VC2B 1KEEA 2PYIA 5ELMA 1G63A 2MYNA 3NAMA 5LP6F 4JJFA 4C0JA 4DA9A 2ZCJA 4JJGA 4D8UA 3F6EX 1X38A 3RVLA 1GRVA 3F6PA 3VHXA 1ZC3A 3FI0A 3PGMA 5MGNA 4PY2A 4OB7A 5JY1A 1ZO8A 3TL6A 2ZXEA 2PSFA 2QM7A 3FOAA 4GI1A 4QL3A 4Q3KA 2J0EA 5JZVA 3B48A 4RORA 4BEWA 1T4GA 5A4FS 5CA0F 4AN1A 2AFHB 4JGGA 3O3NB 4MV5A 5KDLA 3BWYA 3R7LA 1Z35A 1QVZA 3G2QA 3FDZA 2Z3ZA 3WJ7A 5C8XA 3FA2A 4OP3A 1WB9A 3AOEA 3WLJA 1ZGAA 5IVHA 4XRRA 1CQXA 3UMVA 4AJNA 5HGXA 2O3SA 4UCQA 4X1YB 2R7AA 3JX9A 3Q0IA 2HJWA 4C7VA 1RHRA 2L2QA 4FWTA 1EQAA 3PHLA 2G9QA 1J9ZA 4XIJA 4A15A 3ORHA 1LDGA 4N8SA 3M2TA 5GIOE 4F5YA 4YRIA 3VZSA 3JWEA 1KAHA 1K7XB 1LLQA 2ZUTA 3O8BA 2IY7A 3T3NA 2F9FA 2YUTA 4D43A 1WRBA 3AH8A 1GUAA 1RRFA 3K0BA 3E61A 4WAUA 1KY3A 2G9NA 1FQWA 4YRAA 1EA5A 3QXJA 4MKIA 1SOUA 2WU3A 2WC1A 2EX1A 6Q21A 1NVMB 3NIGB 2ZWVA 1CBUA 2MDTA 3ESBA 3HJNA 2BISA 4R2JA 1H9CA 1XTQA 3BGDA 3KOZA 3H65A 5EWJB 1ZN2A 1GZVA 4IV5A 3QVLA 3AESA 3EIHA 1SC4A 1WY7A 2P75A 2PSDA 1GAQA 1UZAA 2HPHA 1XRMA 1Y42X 1LTKA 1C3OA 1GPBA 1R37A 4PPYA 5FR2A 1HWYA 1O54A 4OV6B 3QPBA 3ZXXA 2DWPA 5CNKA 4LSWA 2IU0A 5K8LA 5BUSA 1G2QA 1SD5A 4FILA 3UMRA 1ECJA 1CLEA 2FN3A 2WD7B 3KUKA 4R8MA 4FFBA 5LB2A 2VHCA 3GD5A 2QBYB 4MQEA 4E5UA 4D8VA 4MQBA 1BGXT 1JN0A 1GNRA 1WE2A 1WUHS 1SR8A 5HQTA 3IP1A 3JAKA 2O2JA 1VRWA 1VDZA 1Z5PA 5BYKA 1KAQA 1NFRA 2G4VA 1XROA 3C8ZA 4P3XA 5DM4A 2LRHA 3GLUA 5F52A 1S01A 3SD7A 3ON5A 2EFJA 3QSYA 3T5PA 1U80A 3G8DA 1HQKA 3WMWA 4FPXA 3F5MA 5BQOA 4BJ6A 3DCJA 3N2GA 2G1AA 4WXPA 3KU4A 3DTTA 4RLQA 1AGYA 3NHSA 3GFSA 2IIPA 4MYRA 4URUR 4HFNA 5A0FA 2V6IA 3T1OA 4ZVMA 3OZEA 3ZN2A 2HSGA 1JT2A 3LHDA 2AW3A 2OHIA 1SVIA 2H1RA 3F0TA 3HZHA 1U99A 3MWDA 4NJMA 1L5NA 3WLSA 3LX6A 5E7MA 3HBNA 1NF2A 4L76A 3KR2A 4XUCA 1OU0A 2XV1A 5AVJA 5A0TA 2AD5A 2HPVA 3CH7A 3PD7A 3FG9A 3PVCA 4FYMA 1CUEA 4JYMA 1JIUA 1A5AB 1FYVA 2HQSA 3R7WA 3EDMA 2BYTA 1GRNA 4CKCA 4L4SA 1V35A 5KYWB 5K8JB 2HRQA 5TQ2A 2IXAA 2XWQA 4JC4A 5FP0A 1YONA 2H1FA 3TGPA 1SHZA 2G5GX 4KR6A 3QKIA 2V7UA 2X9VA 3EEFA 4W7SA 4FOLA 1QIGA 2QLJA 4FWIB 1TOAA 2D5LA 4G63A 2XB4A 3RADC 4QDTA 2A9KA 4KGVA 5DBOA 1R8XA 2RBGA 2P8SA 4NCIA 5B7PA 5C34B 2X5NA 1SA0B 4S0XA 2HA4A 4BUJA 2E5LB 1K3TA 3N9IA 2H29A 2P1RA 1RLIA 2VZ0A 2JAQA 2WJIA 4QARA 4DLXA 1C0EA 1H05A 1GPWB 1TZKA 3HSKA 3IQGX 5I9SA 4HX2A 1HG1A 2JZNA 2Q8QA 3BWDD 4H3VA 4CKBB 2D1SA 2Z08A 3I45A 4OGLA 4R5HA 3HNRA 2JLZA 4HN2A 3KV1A 3P9QA 1H8ED 1L7PA 4XWYA 2W93A 4OLHA 1A27A 4JB0A 3WADA 1D2NA 1V1JA 1MVOA 4FCCA 1FEZA 1PGJA 1QHNA 2R6CA 3GA0A 4JT2A 4D97A 2I6XA 1APBA 4B32A 4OFZA 3IP5A 3L04A 5KQSA 2WKQA 3H3XA 3NW9A 4ZAXA 3L0OA 3Q7TA 2CLEB 4RVSA 1KI2A 3WDKA 4BUCA 1CJCA 4TLMB 4J0JA 5B57C 3GFFA 1E2LA 2AN1A 3AL0C 1OMOA 3K2IA 5FPSA 4ZXFA 4A6DA 3L6DA 3AMVA 2DOKA 3UK1A 1C1XB 3AR5A 3BB1A 1TZBA 4PO3X 1GU0A 2JEYA 2WUFA 4M9CA 3KQNA 1PQWA 2ZQ5A 1R9GA 2HLDA 1HUQA 3SIWA 1EU1A 1K7FB 2VDUE 3DVSX 2I7TA 3LNTA 3K05A 1LV7A 1NX6A 2E9SA 4Z99A 3BCUA 5TVKA 2PMFA 2OXIA 3TQRA 5LUAA 1G20B 3QELA 3JZDA 5T4BA 5K2OA 1WVGA 1GVNB 2HQRA 4YA6A 3IEXA 5HPYB 4RHCA 3PLAE 2R47A 4I55A 2JLUA 4DMMA 4XM0A 5CCXA 2ZANA 3RG2A 1OKKA 4JP1A 3ZS9A 1Z2PX 1T2EA 2I76A 4JL6A 2P41A 4XWKA 3RH0A 2KBEA 4I66A 4YRKA 3U1BA 2UXDB 3TNYA 1D07A 3AEYA 3PFIA 4ONEA 4YB8A 4D41A 3NP7A 3OSUA 4OLFA 1QF6A 4QX6A 4TXHA 2PRIA 1JAYA 1A9QA 1A9TA 2BE7A 1WUKS 2EZUA 3BRWA 1ZM4A 3IESA 4UFOA 1FP7A 4RZ3A 2CXSA 1RWOA 3HCBA 1OV4A 2QQEA 4GQIA 4HWKA 4DJDC 2R8OA 2F1KA 1PO7A 4LDPA 1IEVA 3I6YA 1XQWA 4YMLA 3EWSA 1J9EA 4IDBA 5IJAA 3V1MA 3VI3B 2YR0A 4BNWA 1IZ0A 3WSTA 1VM6A 1ZUWA 2PZFA 1Y5MA 1D2HA 2YC4C 3IUYA 5D00A 1SM4A 3SAJA 3W8FA 1OT5A 4F6RB 3B9RA 2HYIC 3A1DA 2OPHA 2A7XA 4NR0A 4H7KA 2PQ2A 1FS5A 1YVRA 3DMGA 3E3NA 1RKUA 1CP3A 4JLAA 5DLYA 1EDBA 1C9YA 1E9VA 1C7QA 4PC3A 3T12A 1PT7A 1DWQA 4I1OA 1DGQA 1YZHA 4MPDA 4PVCA 3ZJ4A 3ENZA 3ZVNA 1PLLA 1A2KC 2HMVA 3EGDB 4A0SA 4DQVA 3WYAA 1LWNA 2WNIA 5F5XA 3DP9A 2XDYA 3NALA 1V1RB 3PK0A 3R2JA 3RI3A 1BD4A 1UBUS 3W78A 5HSGA 2V9CA 5K6AC 4YJ2F 1DCTA 3EZ6A 3TJZA 1ZBDA 4JBXA 3HWRA 4JKYA 3HUTA 3O4FA 2JEOA 1CUWA 1Z9BA 2Q3EA 3PQEA 1GKIA 3S1LA 1OX6A 2FG7C 3FNEA 3WC4A 3ZD9A 2YWRA 1KQPA 2OCPA 4R9VA 1BMTA 1I14A 3NBZC 2J9FB 4G8DA 3VO8A 1CUSA 3QVXA 1V6CA 2OSBA 4ROTA 3IUNA 1YR7A 2XRMA 4BE4A 4BVBA 2YINC 1DX9A 4RIHA 2NACA 4U7WA 2V97A 3I64A 3DEIA 2WF7A 3DFZA 1VXOA 2G67A 3G9TA 3HADA 4G8BA 4BKOA 3CG0A 1U0GA 5E4TA 4J4TA 2OHGA 1QDEA 3PNOA 4P38A 3TGWA 2W71A 1P7VA 2RCYA 3FMGA 3ADBA 4W7IA 3WIEA 5HFAA 3STWA 4JWKA 4MUEA 2HLDD 5JQGF 3K0AA 3MTEA 4PIPA 1KF0A 3ED1A 3GW8A 1L8XA 1LJUA 1GTL1 3Q6MA 3RJTA 1ML4A 2DLNA 1M34B 2FSVC 2NSHA 3A1UA 3G8YA 1WBBA 4XQ9A 3CE6A 1G59A 1M0EA 3G5LA 2G77B 4RTJA 3PL5A 1K4KA 2Z1NA 5EZQA 3KJQA 1LC3A 3OJFA 3VNBA 4ON9A 5IM4A 4AQ7A 3HCWA 3U4QA 5I48A 5DXAA 4EABA 4Y0NA 2VIIA 5GZ1A 1KDYA 3E18A 2YZ7A 5DLEA 2IPMA 3A2NA 3D6UA 3KKQA 1SU7A 4OB8A 5MHTA 1OKKD 4HP8A 2K6GA 1N6IA 2EQBA 2X8JA 2B34A 4YYZA 3KZCA 1NIJA 2OHJA 4B35A 1HC7A 5H9WA 3II6X 3TLXA 1P29A 2G72A 4E13A 3DDWA 1CDDA 1JIVA 3DDHA 3IDSA 1I2CA 1P2FA 4COOA 4BDTA 3N28A 2L17A 4KYIB 2PUWA 3HJRA 1TEXA 2PR7A 4TXLA 4DMHA 2VSQA 1NQAO 3P0HA 4H4EA 1KIFA 4NMHA 4PZ9A 1ULUA 5EUCA 3EDYA 3AR3A 2OK7A 1P17A 2ADFA 1U90A 3WA7A 1EYZA 3EEBA 1ZDMA 3GD7A 4M0UA 3UV7A 1RAFA 4B3HA 2Q3JA 2HTEA 4RK7A 2O4CA 1GYPA 4OJQA 4LY3A 3B3JA 3TRJA 4WD3A 3WWDA 3EJ6A 2ODPA 1ID8A 2VAVA 3LO8A 1THMA 1VJTA 1JVNA 4YMIA 5IVIA 5C1DA 4O4JF 1JEQA 5ALZA 3SC6A 1E1CA 5K0JA 3ZIAA 1UPCA 4Y30A 3N6XA 3I9LA 4CF5A 1BMDA 2YW2A 5ED0A 4DJTA 4HX9A 1W5AA 2EZTA 5AD1A 2P3OA 2IZ6A 2ZCUA 3K1AB 3I01M 4X1KB 5BMVF 4BYMA 1QO0A 2KBFA 1OCEA 4D9JA 5M7EA 2BDUA 1CCWA 2O20A 3U7HB 1P3DA 4WMLA 3SQOA 5IJ0B 5A1TA 2ZSBA 3G2HA 1PHRA 4WOKA 2XKKA 1UOPA 2CC2A 1N0HA 1AGNA 1VL8A 2QZPA 4LISA 4FD3A 1Q14A 3RVKA 5AI9A 4PLYA 2PX8A 3T5CA 1AHNA 4Z1MA 3CVUA 4XA8A 4EPXA 4Y18A 3LXUX 1C80A 2JHAA 2AEMA 3H2GA 3M6UA 3OTWA 1VP9A 5K09A 2ZT5A 2IOYA 1MCZA 4LDZA 3HN2A 4P0PB 1WDTA 1L8OA 1WQ1R 1QK3A 1SQSA 4LE1A 3BHJA 2J6BA 1OB5A 2I6TA 3O74A 1G1MA 4G07A 1MT3A 3WQSB 1WMAA 1ZH0A 2C58A 5IYZB 3DMHA 4P9NA 5CNMA 3FFTA 1SU6A 1C1HA 1YD7A 3GRFA 1ZIPA 1V48A 2IIQA 1LRLA 1IB6A 3K9WA 3K92A 4M0KA 2NVBA 4UUOA 3RS8A 4DPMA 5M2QA 2C4UA 4R8LA 1ORTA 1UKYA 5CXXA 5P8WA 4ARZB 2HBYA 2W58A 3E1GA 4FJ0A 4O2AB 3C4VA 4KGXA 5DP1A 4GGPA 3DWGA 3SSNA 3JQDA 3P26A 3D3WA 4WXMA 2XCQA 2FDRA 1LA2A 3QV1A 3ADDA 3JAWA 1PT6A 1Y33E 3OUZA 1JU9A 2HF7A 4JQSA 4LYAA 5CJ2A 3WWOA 1LI7A 4QUKA 3ZNNA 1GUBA 2O2SA 5AW7A 4ARSA 3VV3A 4HAIA 1ZAKA 2ZYIA 3TMYA 4BAZA 1IBMB 5DCYA 5J40A 4YASA 5EGSA 2H4JA 2ILTA 5A4IS 4QBKA 4C1BA 1WXFA 2BMDA 1N7JA 1YIDA 1P39A 1XSEA 3OIGA 3ZX4A 1FJ2A 4PC6A 4V24A 3QV2A 4U2KA 2XGMA 4AF7A 4EJMA 1SD1A 1AO3A 3QW2A 4ZT4A 1OH6A 3SHTA 4B6QA 2P3QA 2AEFA 2OZPA 2GMWA 3AJEA 3K32A 3TPFA 3C6XA 3PNBA 1RPTA 2I99A 3G68A 1PJTA 5EEHA 4F56A 3SQWA 4Y2VA 3BA1A 3I3OA 3Q7PA 1W581 1XNQB 2HCTA 4FHEA 2C2GA 2PCLA 4P1ZA 2JGRA 2ZTMA 1I24A 1BKSB 4HY3A 1SIWA 3NX4A 4X1IA 4DDUA 4A8JB 2F55A 4PG6A 5COAA 3F4BA 3ROQA 4FW9A 4EDFA 1UPUA 5T3YA 4BMZA 4A16A 3KT3A 4YRDA 1DDGA 1L7XA 3TVTA 3EGXA 5HZGA 1CUIA 4LHXA 4NEHB 1V8DA 4KAXA 5AKYA 4B3CA 3C0KA 3ICCA 4CV0A 1Z15A 3UQZA 4Q7LA 4R3WA 5PNTA 3ZIAD 4DBLE 1HO3A 2ODBA 3KQUA 3R5TA 3A3PA 1N1EA 2O2XA 2I3AA 4G09A 1FVHA 4E5DA 5CLFA 3WLEA 1C4KA 2VDRB 5EVJA 4FC7A 1DC6A 1QO0D 2C1EA 3RRXA 1BVUA 1ZKMA 2HSZA 3R0XA 2SCUB 3FDXA 3S2IA 1VMDA 2AYZA 2HK9A 4P98A 5KNDA 4KMSA 3WNZA 4AICA 2CZGA 1NRJB 1T3ZA 2R00C 2EHDA 3JAMA 1Y6JA 1HSOA 2J32A 4Y6LA 3WNVA 1M54A 4YAJA 5CVUA 1RWBA 1F2DA 3GRYA 4RY2A 3R9KA 4KE6A 1MJHA 3T3GA 5ADWA 4LTDA 3ROMA 5JECA