2Q8QA

Crystal structure of s. aureus isde complexed with heme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
258
structure length
258
Chain Sequence
GEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Iron-regulated surface determinant E
publication title Heme Coordination by Staphylococcus aureus IsdE.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 80
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8qA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8qA01
4B8YA 1PSZA 2XUZA 3AEKA 4WN9A 1K75A 5BVGA 5KOHA 2RG7A 4K3VA 4TKVA 3AERB 4ND8A 2M6LA 1MIOB 1QH1A 5JPDA 2OGWA 3TNYA 3TLKA 3EIWA 3PSHA 1L5HB 3ZTTA 3CX3A 1G20B 3K1AA 5CR9A 2Q8PA 5KOJA 1K0FA 1EFDN 5JG7A 3AETA 5M34A 2WI8A 5JOQA 2XY4A 3U7QB 3PDIB 4LJSA 3ZK9A 1KARA 4TKUB 5B58T 4INOA 4FKMA 4OVKA 1N2CA 1TOAA 1M1YA 1QH8B 2WHYA 4FI3F 1FP4A 4MDYA 3AESB 1N4AA 4WZBB 4H0FA 2YNMC 1H1LB 1K7SN 3AEUA 1M34B 1QGUA 3BE5A 1G21A 4FILA 4OXRA 4XPIA 4UTOA 2PHZA 4BBPA 4MO9A 2OSVA 5BVHB 2MINA 3G9QA 2ETVA 2AFIB 4HMQA 5HX7A 5M29A 1N4DA 2XDQA 4PAGA 5HDQA 3MINB 4NNOA 4WN9B 2OV3A 3PSAA 4M7OA 5CX1A 5BVGB 3ZK8A 2Q8QA 3AEQA 2O1EA 3TEFA 1M1NA 4PM4A 2X4LA 4WZAA 4ND8B 5FLYA 2AFHA 1QH1B 3GI1A 5M2QA 4WESA 2XV1A 3PDIA 2OV1A 1N2ZA 4G07A 5M3BA 3MFQA 4TKUA 2R7AA 2M6KA 3NU1A 3K1AB 1KAEA 3R5SA 4MLZA 4NNPA 1QH8A 3R5TA 5KOJB 3ZKAA 2QI9F 4H59A 2PRSA 3AETB 5KHLB 5I4KA 3AERA 1MIOA 4WNAB 3BE6A 4OXQA 2R79A 1XVLA 4FNAA 4IRMA 4UDOA 1L5HA 5AFSA 1M1YB 3MD9A 1G20A 1FP4B 2AFIA 3AEKB 3ZK7A 2PS3A 5KOHB 1KAHA 4TKVB 4N01A 2XQVA 4INPA 3AEUB 1QGUB 4XPIB 1G21B 2YNMD 3U7QA 4UTPA 2XH8A 1K2VN 4GICA 2MINB 4UDNA 3EIXA 1ESZA 4MX8A 4HMOA 2PS0A 2XDQB 3MWFA 3AESA 3UJPA 2PS9A 4WZBA 1PQ4A 1H1LA 3HH8A 3HJTA 4LS3A 5CX1B 5GGXA 5GGYA 1M34A 3AEQB 1M1NB 3MWGA 4WZAB 2AFHB 4WESB 4DBLE 5BVHA 4CL2A 1N2CB 3HXPA 4HMPA 4WNAA 4G09A 3LI2A 5JJ5A 3LHSA 4HN9A 3MINA
chains in the Genus database with same CATH superfamily
1LQ2A 1T6ZA 1C3LA 1C4KA 3JWIA 5AW5A 3WNQA 3SBOA 1NBMD 2QW0X 3CSSA 2Q4BA 4CKBA 3ZHTA 2JIQA 1FFAA 2FFBA 1O8CA 2WSYB 3MJRA 5ALEA 3FDFA 5J40A 5IVPA 2RHMA 4KXYA 1H66A 3OT1B 4RPLA 1XXHE 4XI9A 1QIGA 4CFYA 1UZNA 1ZISA 5D85A 3RT9A 1T24A 4U0KA 1L7MA 3VO9A 4YRFA 5AM3A 2VAXA 3BZUA 3NNDA 1Z5ZA 1RI4A 4HX5A 5CB4B 3A9UA 1YVEI 3A7DA 1D1TA 1NN5A 1QYWA 3FIJA 4E2FA 4UDYX 4MWTA 1LBHA 1RQLA 3EMKA 4QJ5A 3NGXA 3SMVA 5IUNC 2H9IA 4DZRA 1T1GA 2QLLA 4PTLA 1EX1A 1LS1A 4WT7A 3RD5A 3J7AC 3H9BA 3FZNA 2AEMA 4KOAA 4FILA 4BMXA 3HWSA 1SCQA 4JMPA 1Y3BE 3JD3A 2QMEA 4BMNA 1YFKA 3GYGA 3EBLA 2W98A 1I3MA 2P4UA 3ZGZA 1P3Y1 3TJRA 3GP3A 3X1YA 3SE7A 2C7RA 3ESAA 1L0BA 4ZARA 1NG9A 3ADCA 1X74A 2FQWA 4HDRA 3RYFA 3OLVA 4GBMA 4PO9A 3T9BA 3TZLA 3FX2A 3THWB 2B8WA 4PLVA 3KOUA 4PG4A 1NRJB 3AEQA 4E08A 4D6PA 4OXXA 1MENA 3OY2A 3E5MA 1XVAA 1M0WA 2CLFB 4O4HA 4EEXA 2WQZA 3HKCA 1BD4A 2VF5X 2MSWA 5HMMA 3X3HA 1POXA 2PU5A 2A5YB 4JLBA 1JIIA 3ZHBA 4Z0TA 4N18A 1YQTA 3JWJA 4AY2A 3GAFA 3DDSA 1NVXQ 1LRKA 2X7HA 1RYDA 2PRSA 3FYUC 3LRTA 4M0CA 4Z9BA 3ZE9A 3MIZA 2PGDA 2QRKA 2WJPA 4PPGA 4YAWA 3AJAA 5ABPA 4F8EA 4KMSA 2X0DA 4QBFA 4B76A 3IDOA 4OGWA 4I99A 5CTJA 4MV9A 4ITRC 1FYVA 4BMOB 4HGQA 5JXGA 1EUDB 1T2CA 3ETDA 1WIWA 5JD4A 5CIYA 1BVHA 5CT5A 3IUPA 1XTRA 3FJOA 5CT9A 5HILA 1QRTA 1R6VA 3C87A 521PA 3OHMA 5I7HA 2GPAA 3PGKA 1MH1A 4QEDA 3HFGA 1I1NA 1TTQB 4D3ZA 4F56A 1W73A 2VHYA 3ENQA 2B1GA 4QOGA 5G4KA 3TSYA 4RD2A 1UMBB 4WWHA 3PPXA 2VYVA 4I9NA 3PC2A 1Q1NA 2PL3A 2XMZA 4ERXA 1H65A 1NW4A 4YQYA 4YN3A 4V1CB 3UMRA 2Z9CA 1HMPA 1BZYA 1RXUA 2VJOA 4JI5B 1ZL0A 4HWRA 3FYUA 3VH1A 1TYAE 3PD1A 3NDBB 2GDJA 1XYVA 4NBVA 4XWAA 2EJTA 2WF9A 4EDHA 4XASA 4W5OA 3K1TA 3G5AA 4IVPA 3RSGA 4D9EA 4WV3A 5I7UA 3IFSA 3UGQA 1HQKA 2WJJA 3UOGA 5KTRA 3EWNA 1SBNE 2XUZA 4NU8X 2O8BA 5C1OA 4B2YA 4DLZA 4JJAA 2NW6A 2ZUSA 1QAMA 4WCVA 2E6KA 2EHDA 2GN6A 4NZZA 2WJWA 4P4SB 4WA8A 5D1NA 3WL4A 1KQ3A 3AL3A 1A2QA 2C58A 3M5PA 4PZDA 4AYTA 1WMEA 3AUSA 4CXMA 3MXOA 3ABRB 3SM9A 1VKZA 1N32B 4HQLA 5C52B 2GTIA 4HQNA 4PYIA 4B2LA 1AKMA 3HZOA 2A35A 1NKTA 1Z7GA 1EXNA 3FMVA 1QYRA 2CXHA 1GZDA 5E6RA 5EUMA 1BQ4A 4YRIA 2PZAA 4D0NA 4MUAA 3T3IA 3PNQA 3LU1A 1HSZA 1J8QA 4GMKA 2JBHA 3MJDA 5B58T 4TZ6A 2O6LA 4E70A 1GL6A 2PX8A 3DE3X 1PJTA 3LS2A 2WHYA 3FHJA 1YDGA 3OPQA 3V8QA 2AFIE 3NHFA 2RHOA 5T41A 3THYA 5JLAA 1LI5A 4NLLA 2ZAMA 1Z3IX 2OC4A 2PTHA 1COWD 1CNEA 3CT4A 2JFWA 1GCOA 5AJYA 1OX5A 1C9KA 5FAKA 1CP3A 1VL5A 1GFSA 5HGJA 1GKIA 2GEKA 2Y4OA 3TM4A 3S7TA 2F3RA 4A8HA 5ALQA 1Z4LA 1DIHA 3B2EA 3RVLA 1PT6A 3V8RA 1GOTA 3DMNA 3WLJA 1S4QA 3IUEA 3ZHQA 4A3SA 1IG0A 2X1HA 5JCZA 3ZK8A 4WK2B 4X6YA 4CL0A 5ERYA 4YRAA 1XRPA 1GR1A 2IYVA 3IAAA 2PZGA 5CFMA 4QM7A 1S3FA 4QL3A 4I3GA 5EESA 3U1VA 1V5IA 1WVIA 2OV1A 3KQKA 1RQ2A 2GK4A 2J67A 4CR6A 1MB0A 4B3TB 1SUDA 1SFRA 4J2OA 4D9MA 1V6CA 1IM2A 2P2DA 3DLHA 3OHSX 5HRCA 5I4KA 3S8YA 3EY9A 4GFDA 1HC7A 2FGKA 1W94A 1Y63A 3VPCA 4P3OA 4MGIR 2QWXA 2ZLBA 3OT1A 3IKVA 2PJDA 2IUSA 1MN6A 3L84A 2YVKA 1NVWQ 3PTZA 1BJTA 4K1XA 3IPLA 4OXIA 5C4GB 1ODLA 5I7FA 4HZIA 5AKGA 3LWNA 3S4YA 2V6FA 1T34A 1T9DA 4LOJA 1KU6A 2WHRA 1QM5A 2R6R1 1L7PA 4G0QA 4MV1A 4LHXA 5CB4A 1G21B 2QDXA 1A3CA 3BHJA 4JYBA 1OFUX 3NTVA 1TVKB 4O4IA 4WRRA 4DMFA 1YU6A 4NX2A 4DQDA 1ZD4A 2VP5A 2CUTA 1YC2A 4KRGA 5I01A 2A1IA 3DAHA 4CCWA 1VIAA 1RU3A 3L0IB 4K28A 4MUXA 1JJ7A 1D6SA 5AKYA 3GP5A 2A30A 3TI9A 1F48A 2AC2A 2BV3A 4P0TA 8ABPA 3A32A 1TAHA 3F3YA 3Q3CA 4LVCA 3FNHA 5J59A 3VYWA 2AZTA 4OI1A 1G3RA 3ICVA 1EBBA 1M1NB 3NT2A 5ALUA 3ZH9B 4AXXA 4N7JA 4XCQA 3UMYA 5K0BA 2V58A 2IBSA 1AQJA 1DX4A 2Q27A 3K9WA 3ORFA 1E5XA 3SIRA 2IC5A 4CIYA 5K6TA 1PJ8A 2PM8A 1XN4A 1DKRA 3LKZA 3B6EA 3IQZA 2WR8A 4ILKA 3T9DA 2KWIA 3SYRA 1PSZA 1X2EA 1ZP6A 1NU6A 4C3OB 4DMUB 3THWA 2QE7D 2HBYA 3D8RA 4BCBA 3QVWA 3VMMA 2XKJE 4N54A 1ATZA 5G2OA 4HSEA 4B3MB 3LZDA 1K8YB 4N1AA 3LIIA 4A0HA 4S1TA 1T1SA 5A7FA 5EMLA 2OGZA 4XGRA 3KETA 3AR3A 5DLDA 5E38A 2VYNA 3LVBA 2C95A 4CF6A 4GQAA 3RS3A 2FH5B 4GBED 5K3DA 2ZAIA 1NFQA 1KMNA 3LWZA 3L41A 3LA8A 1RHMA 4PAMA 5ULLA 4ZZIA 1HY3A 2PGOA 1I4OA 1XDDA 3OLCX 2FN7A 4GMDA 2HWUA 2HA7A 1JXAA 3FD8A 4FNMA 4HVTA 3RANA 1B8UA 1M5RA 1C9JA 3EFBA 3L40A 1NGSA 4YCMA 2BSXA 2W00A 2H1WA 1UK6A 3C3CA 4RIIA 3OF5A 1W0CA 2GD1O 1WSAA 1X7HA 2BC9A 4TKUB 2OL4A 1YDWA 1D1SA 3E6AA 1Z56C 4LZJA 3IJ5A 1EUDA 5IASA 4P93A 1D0SA 2PO7A 2H1CA 3DMPA 4G3XA 4H3KB 5FUBA 3F6SA 3NVMB 3BCHA 4K9OA 4TMKA 4PC6A 5H81A 2Q0HA 4AX8A 1LJ8A 1WETA 1O1YA 1NLUA 1US8B 1TA9A 3NM5A 3GLKA 4C0AC 1I6KA 3AVQA 3H9EO 3R7LA 1P1IA 4FFNA 2PWZA 3DZKA 3QRWA 3WWOA 2PXHA 1A82A 1PS0A 2QRHA 3IA2A 3R0JA 4GZ6A 3KQMA 3MB8A 4OXNA 4AYWA 1VHLA 1FYFA 3FDXA 1RM5A 4IGIA 4V1CA 4YB8A 1NXSA 2E0IA 2D2EA 3TEFA 4L0MA 3BD9A 3M4XA 1L7AA 3QX8A 4O6VA 1RBQA 1UQUA 4G07A 4UBIA 1X8JA 4P35A 2NSYA 2NYRA 4LSMA 5ICFA 1PT9A 4II7A 1TXGA 2PN1A 2C94A 3ET4A 2XNDD 1JXQA 3HHPA 4RQAA 2VP6A 2W71A 1A4UA 1NY5A 5DI3B 5DNDA 1NQAO 1WCWA 2DLNA 2WUEA 2P67A 3OECA 4IHJB 1TYBE 3TPCA 3UG6A 2X5KO 3D1LA 3AIOA 1PR5A 1SZPA 4P4SA 4D9IA 1E7YA 2WKQA 3EGDB 4R71A 1J2UA 5AKZA 3D64A 2P6OA 1FNDA 1I5OA 1G3MA 1PR2A 5LLTA 3SQXA 3KPJA 4LYHA 1PVDA 1Z62A 3Q9UA 1P91A 4R40A 1U1EA 1IXRC 3NFYA 1EX9A 1QE3A 2BMJA 4HLUC 1NZFA 2W7TA 3MJCA 1QHHB 1KGSA 3B70A 5AK6A 3MMSA 3TFQA 4BLTA 5BR8B 3HA5A 1ESZA 2PX6A 1Z5NA 4S2UA 2OBLA 2I3DA 2LWIA 2Q3FA 4US0R 3ITNA 5HKKD 1P60A 3WHLA 1CZKA 3OKPA 4HNRA 4OXYA 2RG1A 1VYUA 2EF1A 2QVCA 1ZKMA 3OAAD 3WBFA 2ID9A 4I1YA 5LB4A 3D8HA 4FI3C 1XVIA 2NSJA 1M33A 2XGGA 2CXRA 4LOLA 4PHCA 5PGMA 2F3UA 3JYLA 2H2GA 3RRNA 3FSRA 1XZJA 1E18A 3CWZA 4IOLA 2XCQA 4ERNA 4TXHA 5TC4A 3ZU4A 5HYVA 1SZJG 1QGYA 3AC0A 4GLJA 1KIAA 2DBQA 1O4VA 2ATVA 2H4FA 4OQDA 3SEQA 2A94A 3GYBA 1S1MA 2O2DA 3MCVA 4FN4A 3OE7D 4HLUA 4F12A 3WA6A 4BBJA 2HZ7A 3CX3A 4IJKA 1JEAA 1R6UA 4PAWA 4EABA 5CBKA 4YXWA 4KWHA 4JP8A 4BLVA 3E3NA 3AFNA 4MLDA 2CDCA 1QTQA 1ZHHA 3RIGA 2EG5A 5J5VA 3ZDZB 1L5KA 5BN4A 1TEVA 1E0JA 3K9CA 1GQSA 2JGKA 2YC4C 3QENA 4YJGB 2HSGA 1SHJA 4FD3A 3VSAA 3KHKA 3M1YA 4BVKA 1C9DB 1P9OA 2DWQA 5HSGA 1A9RA 3QNUA 5TVKA 2FKAA 2VWGA 3RE1A 5LFAA 3ZTYA 2UZAA 5D3ZA 2XLBA 1O5TA 4YP7A 3KQQA 1U31A 2QGNA 4LZZA 4IUCS 1ZCBA 1G21A 3OEHA 2GHIA 4LJRA 2IUFA 1TVKA 3CLUC 3UWSA 1ADGA 5BNWA 3RFTA 4L9WA 2G0TA 4YPOA 1RAHA 3EXAA 2XPCA 2XTNA 4DBZA 3G0HA 4R2IA 3NT5A 5GY7A 3MS4A 1B15A 1RR6A 1S3GA 1JG1A 2BFAA 3NDRA 3VGPA 4CE6A 3K71B 1D0IA 2IEGA 4M0LA 4ZO4A 1DI0A 1ORWA 3SZ3A 2NOAA 1Z45A 4HG2A 2HMUA 1M1NA 2JJ1A 5GM2A 2O0MA 1C3OB 1OIXA 1AK2A 2HSJA 2BVNA 1A95A 2QW1A 5I8PA 1QQ6A 1NURA 5KNDA 1LBIA 4DPLA 3I0MA 4HNAB 10MHA 1YZGA 1LF5A 2QRQA 2JBAB 3COSA 3GJRA 3P9PA 5BW6B 1YR2A 4NF2A 3P2OA 2NSHA 3JATA 4EI7A 1XZDA 4O2AA 4LMPA 2EP7A 3OLXA 1I7PA 2NO4A 3WISA 4KFSA 3AKZA 3V8MA 1NVMB 2I54A 1EX7A 3O8DA 1PTJC 2R8PA 4JFAA 1QO9A 3OOYA 4P58A 3PNSA 3PVCA 2Z09A 4YAOA 2HLDA 3GJ3A 3KQSA 4H7FA 1SG6A 2BLLA 4WFKA 5K0TA 3DONA 3L6BA 4F6CA 1AHNA 3FYHA 3ZUPA 1ID8A 4QDXA 3MWYW 2ATXA 3TQOA 4BNYA 5EGNA 1I7DA 3KVOA 4KR0A 3G3EA 2PJZA 3W3AH 4UM9D 2NZWA 2X8JB 3UG7A 3VH4A 1HRDA 1SC3A 4RH3A 5JS8A 4KQWA 5B6PA 4ARZB 2Y8EA 2ZRFA 4KB5A 1UM8A 1WO8A 4BQOA 4DUYB 1XQYA 2WZQA 1RWNA 2HO4A 4BEVA 3GG9A 4ZK2A 3SJCA 3PNKA 1US8A 2QTRA 2F7SA 4HB0A 3C1OA 4QJIA 1B8PA 4MIEA 1YQGA 1H94A 4I7EA 1Q0UA 1NVBA 1Z6GA 4Q3AA 2X0KA 3N2IA 4WNAA 3RSZA 1JG6A 1U0HC 3BYZA 3FTQA 5EWLB 4F91B 3G0IA 1PTJA 4I1UA 3R74A 5CCEA 5L7TA 2YYZA 3DFIA 1PGNA 1TYDE 5ITWA 3QQPA 5JBNA 2NO0A 2ZDHA 2RC5A 3PD0A 4OI4A 3U4HA 4CL8A 4ARUA 1XZBA 3NWBA 4TM7A 4C22A 3VNSA 2IXFA 1ICEA 2XBLA 1ZIYA 3EFHA 4E5KA 5LXTB 3GPLA 4BNFA 2G71A 5B1YA 1E59A 3RS0A 3ACBA 3EIWA 4D74A 1CYEA 5HM8A 1SXJE 3F4KA 3PPVA 2P9CA 4HLQB 1P33A 3QY9A 3AF0A 4JXJA 3GHHA 1G8KA 1ZPDA 3G02A 4Q3DA 4REQB 3PR3A 3I1IA 5DI3A 3NM4A 4IHJA 2ZETA 5E1BA 3R24A 5H70A 4GYYA 2BKLA 4UU0A 1KZGB 3O1JC 4XWTA 4YLEA 1KQNA 3ZGNA 5JTTA 4MKRA 2FPPB 2H0AA 3EGDA 3LE8A 4XD7D 1A8PA 1NG1A 3DHEA 1HTBA 2PSHA 3KELA 2X6TA 3I12A 1M2VB 3NNNA 2R8OA 1OA1A 1MB9A 3KSDO 2H4XA 1DQZA 2WE7A 3N53A 3PRKE 4JC4A 4L6IA 5JNUA 3DV2A 4PCAA 3FG9A 2JD2A 1G8JA 4BLQA 3KQNA 1OXXK 1JHDA 3AEZA 5FOVA 1R0BA 3K6KA 4P0QB 5K0JA 3C5EA 1JVNA 2ZW9A 4Q9AA 3VU3A 4D4JA 3LUCA 5DP2A 1WZNA 1KO8A 4B46A 3MJ4A 1MBZA 1URPA 4CM3A 1DC5A 2WOOA 3A2LA 3LVRE 4HXYA 1K8ZB 2VJPA 3KDAA 1ZL2A 4KW7A 4Y2TA 5IAOA 3RO7A 4DR6B 3OMLA 3BICA 5BMVF 1PGPA 3TQHA 4P4LA 5AVOA 2C2YA 2ZE7A 2TYSB 4IFBA 5IT5A 5FT9A 1AM4D 2EQ5A 1L8OA 4R16A 1Z7YA 3F90A 1HKHA 4Q9KA 3QUSA 4GKAA 1Y6FA 1RXYA 4W7HA 1Y6ZA 3GV0A 4XEUA 3UK7A 4Q19A 5IJZA 3UV7A 2QY6A 3S8EA 2C7QA 1Y7LA 2XE8A 2HZBA 1H8HD 2XSZD 2G6BA 3EEBA 3GJZA 4DDTA 4QNMA 5FBRB 3UJ6A 4LGMA 1N3LA 3O2SB 1AB5A 2XT6A 3X2EA 1Y1LA 3L01A 3AR8A 4DM4A 1XSEA 3GDOA 4NS4A 2CHEA 2GWHA 4QODA 3TOCA 5DHSA 4CDNA 3EVAA 4J03A 3F6BX 4JT4A 4ZAZA 5HIMA 2WPDD 1QGZA 4R9RA 3F0TA 4FYYA 3VX4A 2HHHB 5FOUA 2WHPB 1T35A 5ALWA 3PTAA 5ARCA 1KSJA 4NULA 4YJGA 2H18A 3WHKA 5JSKA 3KK0A 3WGOA 5IT9A 2E5LB 4QPJC 4AF6A 3QPCA 4DLLA 2Y27A 1BHQ1 5U4QA 5JZBA 2RKOA 2R6CA 3KKLA 1DAGA 4J0FA 1XRNA 1XFDA 3IVCA 1J22A 5HTOA 4UTNA 3UJHA 2XR1A 1QRAA 2PMDA 3JWGA 1GZ7A 2FWNA 1UT6A 1G9XA 4MUFA 1YZHA 4ASUD 5BRJA 4PC2A 3V9AA 3DE0X 3PHIA 2C9ZA 3WQRA 1REQB 2EEZA 1NY6A 3WLTA 3TDNA 4NYMR 3VZCA 1R7RA 1VYHA 4TSKA 3ESYA 2PLWA 3EVBA 4JEIA 1ECJA 4R9VA 3PFGA 1CUSA 2C4TA 1QC5B 3EVZA 3NKVA 3NTQA 1HMYA 4ZI7B 1YQQA 4CTNA 4AMVA 2JAHA 4FEEA 1AV6A 2CXXA 3WK8A 2W6OA 3SC2B 2VCEA 4DQUA 2WWHA 5EQJB 4QX6A 4G4SP 1SVNA 5IF9A 3JQ8B 1Q92A 3DLAA 3M1AA 4E5PA 3Q8LA 4LQCA 4OATA 2QL9A 3A9CA 4BFVA 5A9RA 1HQDA 5FPSA 4HNAA 2JA2A 1FY2A 3G6WA 1G19A 1TM5E 3ASUA 5TRTA 1F5SA 3RLIA 2QLMA 3ZHZA 3SWWA 2C4HA 2C5SA 2P2LA 4J0GA 4TMYA 3ZWBA 1Q1ZA 1W4RA 3ME5A 3FNGA 4KN9S 1KC1A 3C98A 5JOQA 2AZDA 1FFBA 2XIQA 3KJNA 5JNRA 3P4UA 4JHXA 2AV6A 2FMHA 1PS9A 1UUFA 2EERA 1E2LA 4OO3A 3TZHA 1J07A 3JQ6A 3CPSA 2H07A 5EZYB 2HADA 2RARA 1E6KA 2GN4A 2X9LA 3OQ1A 1ML3A 3C43A 3OZIA 3C7KA 5GP1A 5BSHA 2V1UA 2VHZA 4IFTA 2YWXA 3GGJA 4LDZA 3E9CA 1IVYA 3IBYA 4RFLA 2P6UA 3AVVA 1P8JA 4QOEA 3QOFA 4IO1A 4JBWA 4V0SA 3G2JA 3KU4A 3NHZA 4NJEB 5E4JA 4IVRA 3NRCA 4EI9A 2RHGB 2W8ZA 3UWPA 2X8JA 4WVLA 5TJ9A 3SSMA 1R9JA 2I7CA 2ETVA 2GBFA 4MVJE 4X3OA 5AHRA 3BD7A 5J5AA 3VZPA 2XNCA 4AN0A 4E46A 4YT2A 4ARZA 1IQUA 1SN7A 2HA4A 2E4AA 1DJPA 2D3TA 2IHBA 3IALA 3DNFA 4KI0A 4ENVA 5KNCH 5BN5B 2ZIAA 3I1FA 4BVBA 3WJ7A 1QQ5A 5DCYA 3BGDA 4XTRA 5CB8A 4DF3A 2EATA 1K7XB 5JYDA 1B76A 3VSEA 3D0QA 1DWOA 2PT6A 2YN4A 2Q45A 2P5TB 4E6EA 4MB0A 3B6IA 1KVUA 4NKRA 1SD5A 3AM3A 3BH7A 4L16A 5AUOB 3L18A 5HK8A 4GKJB 5JS1A 5EWLA 1WW3A 2II6A 1I6MA 3RUPA 5EHIA 4IGFA 4DRZA 1HZZA 1KMMA 2NLOA 3QYFA 2R25B 4G4GA 3AFOA 4OOEA 3RU9A 5KVCA 3TECE 4LXHA 3T3EA 4DCJA 1NXQA 1CQPA 2IXAA 1FYXA 3NHRA 3E0QA 3PNVA 1NVGA 4D80A 3GD7A 3IR7A 4C07A 5LXTA 5KQLA 3TQRA 4BU0A 2ESRA 3UMVA 3BJMA 1UBNA 3FPHA 4NYIR 5EXTA 4X85A 5A6VA 3D0KA 3QWBA 4TYYA 1FS4A 1VGQA 2YRXA 3OLQA 2NO5A 3ONEA 3FE2A 4Y2YA 3LPNA 1JU4A 2OBBA 4REQA 4AD8A 3FY4A 3ZH2A 2E2WA 5J47A 3IS3A 3I6IA 3EC2A 3N8DA 4GMGA 3ZKWA 2O0KA 5K4AA 1LW7A 5EJFA 1OIWA 1Z22A 2LDXA 1RM3A 2PBRA 5J4LA 1NUTA 5F2KA 1CIVA 4EBBA 1FTQA 4BB6A 1HG0A 2IS2A 1J0DA 2A1TR 2G77B 3QFCA 5JS6A 4I08A 4TRJA 1JJVA 1M2VA 3D3EA 2Q3MA 1QHXA 3MUOA 1UQRA 1DIBA 2RHDA 2GZSA 3K6JA 2HSZA 1KBQA 1RTKA 4PHTA 3SLKA 4PNEA 2ZBEA 3M82A 4HDKB 3CZ4A 1CY2A 1G7SA 2OCDA 1IYZA 4M3NA 1LC3A 3CRVA 4RY8A 5CVJA 5JPIA 1NT4A 2PDAA 1KFEB 4PZ9A 5A02A 5HTKA 4BO2A 3KHTA 1TK9A 2D06A 2W8BB 4B35A 1YZYA 5FRDA 2AMYA 5EWMB 2CE7A 1YQDA 3F97A 4FEAA 2X0NA 4RKEA 2MWMA 2IGTA 2VTBB 5F52A 4IVNA 4MKXA 3H5IA 1V37A 1P6QA 2FPIB 2QTZA 4B8YA 2F59A 3A1TA 1ZVVA 1E5VA 3TQIA 5DYGA 1AGXA 1ZIPA 2WV7A 1P7YA 5FNZA 5EZSA 3OJLA 2M6LA 1GTSA 3KQVA 2OHFA 1EU1A 2P41A 4LA4A 4YJDA 3DAPA 5C7IO 3I2FA 1JLHA 2J30A 1M8GA 1QIHA 3OE4A 4OHPA 3B51X 4QTZA 5TF0A 1VLLA 3PWSA 1Q84A 4Q12A 4UE6A 3KYDB 3STXA 3TR6A 3VC2A 3S5JA 3ZJUA 4YGXB 2CW5A 1KQOA 1X1DA 2B7BA 3ANXA 4FMDB 1XK6A 5EZ5A 3JRXA 2ACWA 2JIOA 1FW8A 3DUFB 4B84A 1YBMA 3CVJA 3L0YA 4BZQA 2I3ZA 1XLVA 2Z83A 1EXWA 5E1OA 1ZGBA 4RQUA 5D7BA 1EIZA 4RSHA 5JU6A 2GJSA 1HEUA 1QZXA 2DQ4A 16PKA 2AL7A 2C31A 2IYSA 3ICCA 3BQNB 4LJSA 2CV1A 1NI4B 2O3QA 2YS7A 2HI0A 4WXYB 1W4LA 5B57C 4WLOA 1V71A 1ZMOA 3U0VA 1G20E 2Q9AA 2D5AA 2G70A 2GR9A 3VR3D 4C7OB 1KMHA 2HAEA 3C6KA 3RFFA 4O4LF 3OZDA 4BNJA 1S0UA 4MW7A 5KJ6A 2WHPA 3KZXA 2ZREA 5BXYA 1LNQA 2QG4A 4UM5A 1XMSA 1IC6A 5H1YA 1F4PA 3TIVA 4M89A 9MHTA 2GHQA 1W4BA 2EDCA 3GPBA 3GMIA 3WLSA 4JSTA 3DKRA 4DR2B 2JAWA 3Q1KA 4UMEA 1LLUA 2KLBA 3H2ZA 3VZQA 1XDZA 1QQBA 2P9EA 4D0GA 5KWIA 2C4WA 2J9YB 2OXCA 3OMWA 5C8DA 1ORVA 3ROTA 5H4HA 1L4GA 4FKBA 3P9SA 4X6UA 3PNMA 4PM4A 2YRWA 3CE9A 4UAJA 1DEHA 1U1DA 1REQA 1CERA 1YJAA 2R0QC 3MS7A 3AO0B 2FEOA 3E7FA 3PEYA 4MH0R 2I99A 3JPYA 1K3TA 1X70A 4QGFA 3ZXYA 1AQLA 1QC5A 1EDZA 2E4WA 3L0DA 4BKPA 1X1AA 1TMGE 3A2NA 5EE9A 3KDPA 2V5VA 2RB4A 1F38A 1OX4A 2Z95A 3SC2A 1I2ZA 1JXMA 1SKYB 1UC9A 2IUTA 2P4HX 1KYZA 3IP8A 5IAAA 1VJ1A 1Y3HA 3JQ8A 1C9NA 2DSNA 4H60A 3JQGA 3SEZA 3LQYA 1XDBA 4NBNA 2VYCA 4EQ6B 2LV8A 2PT5A 2LXNA 2ZKLA 4LWPA 1SHKA 2HQ1A 4YQZA 3L8MA 1ZRHA 2HJSA 2XUKA 3A9WA 2IDMA 3JZMA 4QOIA 3RJ9A 3E5HA 1BSVA 4JQOA 1ONBA 3NB0A 2BL4A 3AEYA 2GXQA 2BRUC 2YVUA 2D0OB 3S70A 2HT1A 4B7ZA 4GWKA 2IDJA 5TXGA 1JAXA 4HPJB 1OF1A 1V3VA 3NGMA 4JEHA 1ZH8A 3PFIA 3ETJA 5CD9A 3LY9A 221PA 1ISJA 3DZJA 5EZYA 4YMIA 4MVJF 3K6SB 2ZM5A 1KEWA 4D42A 3MM4A 2X0IA 4JT9A 1QTIA 4LYJA 4C1NA 2VCHA 4TS9A 1X19A 4HB3A 3V1KA 1PJ3A 1XA3A 3D4BA 4RIGA 3V8BA 5ICEA 1LZKA 1OWNA 2GD0A 2HEGA 3ZZUA 4YS6A 4D4MA 3TKAA 3DHYA 1EFLA 2O4UX 1TCVA 4HFJA 4MW1A 3SYLA 3UK1A 1BFDA 5LMZA 1PR4A 3BD8A 3P45A 3CV3A 3CA8A 3IJEB 5BN5A 1KYVA 1Y8QB 2GM9A 3DQQA 3LYHA 1NMEA 1E7QA 4O4JB 1VSVA 3Q9LA 3REGA 3THSA 2CKMA 4HDMB 2BRUA 2O3RA 4K88A 4U5QA 1GSOA 1W93A 3UOWA 3JYPA 5LBUA 2IZOA 2LIVA 5HFAA 4AECA 1KR2A 4YA6A 2W5UA 5T5QA 3MWKA 1IFXA 2WAXA 1A76A 1PLJA 1YE5A 4LIPD 5ES4B 3LZ6A 1R64A 2C8LA 2PR2A 3LX5A 4ZDIA 4DJDC 3VHLB 1I7QB 1QU3A 2XCOA 2FW6A 5CFNA 3FI9A 1FBTA 1YASA 3ABSB 5LA6B 4F5DA 4ZT6A 5H83A 4WJLA 2QOEA 4J43A 4U02A 4O8ZA 3BG5A 4XQ0A 1I1QB 2QPLA 5EUQB 4UAVA 4BB5A 2TECE 3BGOS 3R4CA 1L5SA 3NYQA 2CL0X 2H48A 6Q21A 5I9NA 5F7OA 4DNFA 2NU6A 4M9UA 1GAQA 3NETA 4XDGA 5FLEX 4UHEA 4ZYLA 2X1MA 1E69A 4C0KA 4YRMA 4MAFA 4DV7B 2GK6A 4QPDA 5D8DA 3GH3A 3ZZ1A 2OYSA 3OM0A 2GZAA 4CT5A 4FIDA 1Q3HA 5M7EA 4BQRA 4ZEMA 1A8QA 2DVMA 3N0XA 4HDKA 5FPQA 4C7JA 4BQEA 2HUPA 4EYEA 1BHO1 3COWA 3STHA 2VZ0A 3R4VA 3DEIA 3QXCA 3EXG1 1MAVA 1VIYA 1ZQ1A 3H6GA 5DBIA 2QZZA 4DRYA 2W8BA 4LEIA 1W0JD 1E2QA 5EWMA 5CG2A 3EPPA 2EFJA 4K3UA 2ATCA 3KXKA 2VTBA 1HDXA 3AF2A 3U0BA 5SY9A 1T3TA 1W6UA 2FPIA 3BA1A 3K9LA 4GZLA 3DKVA 2HXSA 3SLRA 3SSAA 5ALNA 1KDVA 4N0EA 2GTHA 3KV3O 1QFMA 3DZHA 4DOMA 2WU8A 4BRUA 2G7MC 3I30X 2Z8YM 1KPIA 5AOCA 4IIXA 4JUIA 1FMCA 3HKDB 4DUPA 3TG8A 3COJA 1SK9A 1J2EA 1ZZGA 2YWEA 3BQMB 3H11A 3HU5A 3KYDA 1HF3A 1NLFA 4PRZA 5FHRA 4MEAA 4QAJA 3AP2A 3UV3A 4ZN6A 5JSFA 2DPHA 5H02A 1XEWY 4QHYA 4RH1A 4UBMA 2ADFA 3UANA 1P0FA 5JE8A 4HR7A 4RCVA 4XB6B 2ORVA 1NI4A 1IPHA 4Q05A 1EVYA 3EF1A 3R7AA 3WGYA 4BKOA 5ES3A 1DWQA 3TOSA 2Q9BA 3WGHA 4BJ1A 2YV5A 4RVOA 4C0BA 4C7OA 1UKBA 4N6OA 3GXOA 1BE1A 3F5DA 3UYKA 1T2FA 1MO3A 2NV6A 5A4IS 4L8YA 3RFCA 4C4OA 3FRHA 1QCDA 2Z2JA 2VQEB 3B13B 3OPYB 4R7ZA 3L82B 3LT2A 4OL9A 3REOA 3KTOA 3ZD7A 5KCMA 3EAQA 4MAAA 4B0PA 2JK1A 3S29A 1JT9A 1QYXA 4JYPA 2O2CA 4R1TA 2GESA 1Z2AA 1Q14A 1KAOA 4AUEA 4AMBA 5AI9A 721PA 2IQIA 3BF7A 3A2MA 4CEIB 2ONZA 1C81A 3QXJA 1N92A 1K75A 3IDQA 3V8NA 3M6IA 1J42A 1TKCA 2Z1NA 4IMJB 4KTVE 4PX3A 5TV2A 3FN4A 3GLSA 1IN4A 1RAEA 3MCTA 4XD2A 4LF7B 3WAKA 5KYUA 1W2GA 2C5LA 3RUCA 2QTLA 4JQSA 1E5DA 4C43A 4V1CI 2XRYA 4GBJA 3K09C 1WJGA 3BCSA 1VI2A 2G4CA 5G3ZA 1NQWA 1VXRA 1PYGA 1P1BA 2HL6A 4IZHA 1KE1A 3RU7A 5ESDA 3UT5B 4DLKA 4AKTA 2NV2B 3PT9A 1DPFA 3WI7A 4ARSA 5BQOA 1QKKA 2RI6A 4JR2A 3S44A 1ZRNA 4PEVA 4EQ6A 2ZBGA 5TMBA 2FYTA 3G2PA 3DOJA 2BF7A 2OILA 2C2KA 2XCLA 4O33A 4ZYUA 2BMEA 4GDFA 2IP1A 5DM1A 5ED0A 2IW1A 3UXYA 2Y0EA 3BAZA 2GCPA 2VH1A 4DL9A 5MN5A 3MOSA 2HYIC 4C0SA 4HRVA 3K6SA 4KO4S 1YZVA 2NUBA 1JPVA 3C7CB 2ZUTA 3A10A 2NYAA 4AP6A 4HAWA 1YRHA 2F43A 4WXRA 5LDGA 1PJRA 1OH7A 1SUCA 3K09A 3TRFA 3CJQA 4CRWB 1T2AA 4X1IB 3T54A 5K7SA 2FMUA 3HRHA 4ECAA 4AZSA 1FC0A 1OLSB 1KZHA 2GN2A 1HG1A 1S02A 2HQRA 3A3PA 3FIUA 4KLNA 2VJNA 3KHSA 3QBJA 3HB9A 3MYYA 4ZAFA 3C1UA 1DXHA 4G84A 1LBQA 2WSIA 5DHPA 5K3FB 3GFTA 4RK1A 3EPJA 1GTRA 1Y8QA 2AJCA 1XCOA 4O4JA 2YWGA 3A8TA 1NE2A 1Z3CA 2F1HA 2HV9A 4D0SA 1XTSA 3PHGA 2VJYA 2IPAB 2YHAA 3LUFA 3MCAA 1L4MA 4HDMA 3PEEA 4LX8A 1B74A 1CUHA 1I4LD 4IDQA 1R8YA 2NO1A 3HPRA 2AJTA 4OLHA 5A5FA 2W2QA 2WF5A 2YJ3A 5DYIA 4I8IA 1NQUA 1OWOA 5DHAA 1K66A 4DEVA 3UJNA 4DMRA 5L6LB 4EZIA 3ZJVA 2WJAA 4L4ZA 2OQ2A 1JXOA 1VL1A 4KYTA 2B3DA 3H2IA 5I5GA 3TIIA 3D3JA 3CPHA 3T6KA 4AURA 1DUSA 1VGRA 2DFVA 2NQ8A 4L0CA 5D86A 1DINA 5LA6A 1I7NA 2EF0A 4IV0A 5FL7A 1ST3A 1HE3A 3TR0A 5CM8B 5HUQA 3R0XA 3SR3A 1C29B 2C9DA 1JG7A 1X14A 3KQTA 2C5AA 3LUAA 4BMDA 4DSZA 4G0VA 1ZCAA 3NBKA 1WOYA 2V6JA 3C3WA 4YRZA 1R16A 5CX1B 1UBMS 1VRWA 3IODA 3RVBA 1AA6A 2D8MA 3WOVA 3EX7C 3DCIA 1FSPA 4AY3A 4ESEA 3GDFA 3AVWA 1TW3A 2CVOA 2J41A 4JLSA 1Y8RB 5EQFA 5JAPA 2R751 3JQDA 4PONA 1TM7E 1V16B 2J31A 1GRQA 3S8MA 4XDYA 2FKNA 3DTVD 3RM3A 1YK0A 2RGAA 2AOUB 2WSSA 5ALMA 1P8AA 2ERYA 1K2WA 5E8JA 4C4XA 3E35A 1A9OA 2OK8A 5LN1A 4FFDA 4D1YA 3CQ9A 4CMEC 1MXFA 1BOFA 1LPAB 3KYBA 1N5MA 1GLNA 4CMIA 1KVSA 4HPXB 1M2OB 2ZQ5A 1QUFA 3W6ZA 4IX9A 5DGCA 4B34A 1Q77A 3WGUA 4X66B 2OOKA 2PK3A 3EQ9A 4F21A 1YZQA 4RK7A 3HRIA 4XGQA 1M0SA 2AUMA 2NACA 1Z88A 2YQ5A 1U6KA 1BMQA 1EWTA 3L2OB 4YREA 2QLJA 4FM9A 1NZJA 4KR7A 1P1KA 1AUQA 1D1QA 2XRMA 1OSNA 4NMHA 3M6FA 3V3KA 3NT4A 1W36B 2IA5A 2BJHA 4JLVA 4RF3A 3VHRA 1FYDA 3G1TA 3DFMA 5BYKA 2BFFB 1N7JA 2YXDA 3D8TA 4PTZA 2WVHA 2DR0A 1FMJA 4TYQA 4ER3A 1J0AA 1UJCA 3ZVNA 5HIJA 1X77A 4RCZA 3EHDA 3O2NA 1T5LA 2BBSA 4FQ8A 4KPFC 5I9IA 4FCTA 4CMEA 5JQGB 5A9TA 1SOAA 3DL4A 1T9BA 2CLHB 4TTJA 2VLIA 2HBQA 3KPVA 1T25A 2V3WA 4FFOA 4NOKA 1APBA 4ZQFA 3L6UA 3NKFA 3CEPB 4X1YB 4AI6A 3AYZB 3T61A 4ER0A 2OHVA 4DC9A 4HLNA 1UPUA 4I81A 3DCNA 3OPYA 5CBPB 1D2NA 3ZDCA 3KJGA 1F9EA 2AFVA 5K6RA 5A3JA 3PQ5A 1SC1A 2XOXA 3E3AA 1W0KA 5HKAA 3KZCA 5IN4A 4XYGA 2VG8A 3O73A 5IU6A 2XUGA 4L73A 4A23A 1J06A 4MLZA 4CEIA 1H2XA 2CXOA 3PUZA 1RJ9B 3C0KA 1IZ7A 3FLMA 1PHRA 1L5RA 1P2GA 2VRBA 3C6QA 1X1TA 3QK7A 3NTXA 4CG2A 3DVSX 4FT4A 5KTTA 5AHWA 3L7YA 3WYDA 2AGVA 1M2FA 1EVEA 3L46A 4WIAA 1MR3F 3E2IA 4WQMA 4EAQA 3W8EA 5JSZB 3THXB 3TWOA 3TW0A 4JNKA 1ENOA 2JDID 2PSJA 1V6AA 2Y0CA 4ZOEA 1XYYA 4LY0A 4F9TA 1YVDA 3I5MA 2GFHA 4LZWA 5KYKA 3FZQA 4K6OA 1NTRA 3ID6C 4ITVA 1ONOA 1FLNA 2VO1A 1SXHA 4G81A 2GPSA 1DAEA 2AZXA 3WB9A 2D5BA 4QYWA 4TV8F 1YMQA 3UXHA 3L0PA 3ZCRA 3EIXA 2PRKA 5JYEA 4YAUA 3BH0A 4BP8A 2WJ3A 4Z4CA 3U40A 3LVFO 1QK5A 1ZZEA 1FQJA 2R47A 4ZMBA 2EKZA 2YDYA 3VI4B 4C7MA 1L7XA 1TM2A 2EDAA 3OZRA 4NG5A 1MP0A 2Q4OA 1NDHA 4ND2A 3RYTC 1MW9X 3HCPA 2PUCA 3O03A 4TROA 3A7EA 3A6KA 5E4FA 1T0JB 4EPYA 4MICA 3HBFA 1IK6A 1R74A 1TIBA 2P9GA 3TLMA 2QGZA 3ECCA 3SIWA 1FSFA 3A4TA 3DWEX 3UNXA 4ACBA 4DS3A 5JVDF 4Z9YA 4GMHA 3N8GA 4PPFA 2QAGB 3VU9B 5KWJA 3CEJA 3F74A 1TVMA 2JI6A 1KA9H 3NGLA 4LRXA 3RUAA 2Q2QA 3ZV4A 2IY8A 1HDIA 4MS1B 3PHLA 5I9BA 4JLMA 4K26A 5AXCA 2ZCJA 2H2FA 1T9HA 4BX9A 3KUDA 2WHXA 1ZJ6A 3P9KA 5EHNA 3RLFA 3HB1A 2IBMA 1OLSA 1KEEB 3I32A 1I3CA 1O97C 1ESCA 2BM0A 4PLTA 4CF7A 4ACAA 4XB2A 2IV2X 4QULA 2C4KA 4JCOA 5DM4A 2OWDA 2F3SA 1KS2A 2ZCVA 1GCGA 2VDKB 4K03A 1UBJS 5CYFA 3WTBA 1U1FA 5FUQA 3W9UA 2CBGA 1J09A 1K0FA 1ZICA 1XZNA 2Z1DA 4UM7A 3VOBA 4EGCB 1DEAA 4GP6A 5IP5A 4D2IA 1F12A 1G8HA 3HJRA 4N5DA 1PYDA 1S9HA 3SS9X 1N6PA 2ZE6A 2QT9A 4IQFA 2G3YA 4M60A 4DCGA 3KXIA 1JYEA 2DHRA 3MHPA 4QSMA 2OT3B 4RSRA 4ENTA 5KU7A 2Y68A 3C16C 3GX1A 3ZJ4A 4LZNA 3TN7A 3I0ZA 3MRTA 1BWQA 1KK2A 4G1UC 4S24A 4W1QA 1AY0A 5K4HA 4F3NA 4A8JB 5DISB 4MZXA 1JJAA 3T1NA 2GJ4A 2I34A 1LSJA 3LHIA 2PPVA 2LZ0A 2VK4A 3I9NA 3M0EA 4HS9A 3MXTA 3Q7TA 4IIUA 1ELOA 1GT6A 1BMDA 5DT9A 2ID7A 3S2FA 3P2KA 2MYTA 4L95C 3GWGA 1Y6JA 2YC2C 2XUJA 4WDRA 5CX1A 2IHZA 4GLOA 1OQAA 3KLBA 3ZNOA 4ZTUB 3UB3A 3MS2A 3PJFA 4YGYA 3KKNA 3R3VA 1GSHA 1XMVA 1YXMA 2A5FA 1Y8RA 3MSXA 3OFND 5D3KA 1W36C 3QHPA 1E3TA 2P9TA 1DC4A 4JX8A 3EZXA 2FSSA 2XOEA 4DW8A 1CY7A 1NXOA 1B8NA 1P39A 2AOUA 2QI9F 2V4ZA 3HJUA 3HKBB 3IVGA 3QPAA 3U37A 4EYGA 5EJ5A 5K5EA 5KKNB 1KY2A 2YZMA 3BWMA 3CHYA 4PYKA 4PLZA 2Q6KA 5AUNB 2JRLA 1ZMBA 5CGZA 4EG5A 2YXEA 3CW8X 1SCUB 2GQ0A 3OCXA 1E3MA 1A1SA 3BSWA 3NASA 1NNUA 3ZD8A 2OV6A 2BGWA 2VZ8A 4BNVA 3DM5A 1H22A 3L4KA 1ZCZA 4NONA 5L3SB 2Q1XA 3OIVA 4I6GA 2JH9A 3U6BA 1B1AA 1ISRA 1V7PC 3C70A 4OIFA 1QOPB 2BAGA 3AEUB 1YR3A 1GCAA 4LSGA 2I1LA 3NTOA 4KYIB 2RI0A 1QLWA 3QE4A 1HDEA 1NX6A 1T8SA 3PQ8A 5JS2A 5ENZA 3OA2A 3ICWA 2H2DA 3TLZA 3PGXA 7ADHA 2Q2WA 1EK5A 3DMFA 1U8FO 4K05A 4YCAA 2FSIA 3AHGA 1IWBB 2BFFA 3SAJA 3DEHA 3T5BA 4FB4A 4H7HA 2PUBA 4IQ4A 3GJ7A 3HCOA 2R1VB 3DP7A 3WRYC 1E6EA 1EPUA 2MT9A 5JQGA 1N2CB 4OU4A 1W96A 4J4TA 3N2KB 3EXFB 3HSKA 3LO5A 1GXSB 4RTOA 3GLIE 4POAA 1DXQA 3C8HA 5DBFA 4XH9B 4NBLA 3TW8B 2IXTA 4LX0A 4X1YA 3ZKWB 5CA1A 2H9YA 2Q3BA 1EFTA 3I76A 5H8WA 2NVWA 1KHHA 5LP6F 1W87A 2B37A 4ILEA 3AK4A 1M83A 3D7SA 3EFEA 3O9ZA 4YV0A 5JO0A 5CBPA 1RWPA 5DPMA 3LDGA 2QZ9A 4IAOA 4Z3KA 1CEYA 1X9HA 3DB1A 4BBZA 1N8SA 3IPRA 1UWVA 3RS4A 2SBTA 5GQSA 4BQIA 1YKFA 2NTVA 4D8XA 4ZYVA 4BWVA 4J0EA 1RJ9A 3T7JA 1B2LA 4ESVA 4A0FA 2GXAA 3QVKA 3Q8KA 4AQ7A 2QAGC 1Z82A 4IBOA 4A0QA 7MDHA 3THXA 4ZAXA 3T7RA 4JEMA 1ZR2A 1V9SA 3O84A 2V6BA 3JZIA 3GFSA 3N75A 1YR9A 2B25A 1G3IA 4NDAA 1QHNA 2WIGA 1PK8A 3OETA 1EP9A 1LV7A 5I7OA 3VJMA 3T06B 3C2QA 5I7VA 3U4QB 4LK2A 3A11A 4XX1A 1V43A 2JJQA 3UJ8A 4HAOA 1CVLA 1WPQA 1JPJA 1KRXA 2C1EA 1NQXA 2XECA 2XTAA 1M67A 4ZQHA 1N4DA 3C3JA 4WE3A 1VZ2A 4HQKA 1BEUB 1FQWA 2RJ3A 3F9CA 2J7KA 5AICA 2PD4A 1Y7PA 4EHLA 2E18A 1JR3E 3OSUA 4DBVO 4E88A 1OT5A 2J5XA 5CFPA 1KP3A 4Q4DA 4ESOA 2FLKA 3FFXA 4KJXA 3QFHA 3OF2A 1KEUA 5K2MA 1CQZA 2FRVA 4XW2A 4DKJA 2NO7A 3D6HA 1P81A 3BJIC 4KV9A 4LJLA 2N75A 4AUNA 2XCUA 4RTSA 2WLTA 3N39C 1Q3KA 4OSPA 3KUXA 1E3LA 3TAXA 3I9KA 1HSOA 2QAGA 1HI9A 3VU9A 5JIBA 3KQWA 1IJEA 1GA4A 3LQKA 3ESDA 5CEEA 5KYXA 4MS1A 4O1IA 4A8JC 2WG1A 1CR6A 4MW6A 3CRMA 3QWHA 1PZGA 3OTHA 4Z8YA 5IAKA 4QYTA 2R48A 1HUQA 5EKDA 3A3OA 1Z37A 3CVOA 3KOWA 1UOQA 4AROA 1OWPA 1WEKA 2J3IA 5B3LA 2XXAB 3ND6A 3IUYA 4A9AA 2WF7A 1N34B 1JU3A 1PJSA 2Q28A 3MD9A 5HQ3B 3H75A 1OUMA 5AP9A 2B4TO 2JFOA 3K4PA 3CUWA 3VTFA 2O4CA 2R8EA 3H99A 1GNPA 1RWOA 4LWZA 3IXMA 2FZ4A 3PFKA 4D4GA 2AJDA 4LYAA 3W5CA 2JKZA 1TO6A 2Y9MB 1W8DA 2Z1MA 3MVEA 3IA7A 3HL4A 2AA3A 4M36A 4PX9A 1XCGB 1DAOA 4IWNA 1Z0ZA 3KCQA 4BQPA 1OXMA 3UXEA 3OCVA 1Y8ZA 3IT3A 4JB3A 4YR7A 2BEJA 5H9WA 3AILA 4OQEA 1RT9A 2GZ2A 4PC1A 3IEPA 3TS1A 4URFA 5ADHA 1ZRSA 2ZUEA 1W1UA 3OTQA 4AZ3B 5CB6A 1J49A 1KERA 1RJEA 4N9QA 4O63O 1KK0A 4ZVRA 4A8JA 3L6DA 5FF9A 5L8VA 1U3GA 3D2BA 4IDPA 4L15A 3F47A 3HDJA 2XZPA 2XUIA 4JXXA 3ZGOA 4LFBB 5K8JB 5K20A 4IS2A 4BECA 1IN7A 3UV6A 2QRJA 2VQFB 3N70A 3JQEA 4DLYA 3PJGA 2G83A 3SIXA 3NV7A 4A03A 3LNCA 5I3ZA 2H6EA 1KYWA 1RKBA 3L43A 5ILGA 3TIGA 1HNXB 3AERB 2AUNA 1FK8A 4IY1A 4XQEA 3RRJA 1IY0A 4JMLA 3KB2A 4A2CA 4IJ5A 4R7GA 4JITA 1YH3A 2A0UA 2XWQA 1Y9EA 3ETCA 1QBKC 3KR2A 5FL3A 1QH0A 4E6PA 4JBNA 4YC7A 2I71A 3HKBA 4DLAA 2FK8A 2G8NA 3NW9A 3OP1A 1D2HA 1H93A 1AGYA 3PC3A 4UHBA 3TQFA 3IL2A 3PCXA 2JLUA 1MJNA 1P74A 4KODA 4MLCA 1H5NA 3M9LA 3M8KA 3MRVA 4UMVA 4WGGA 2HN9A 1B00A 5BOSA 2Z6AA 1SCUA 4JJ4A 4CLOA 4R2MA 4OVKA 3HWRA 3OIGA 2AHOA 4PC7A 4J7XA 2OQVA 2C8JA 3Q0IA 3RUFA 1B0PA 3Q7RA 2JC3A 5L3SA 1I33A 3ADOA 4GPAA 1L4KA 4Q1CA 3CKYA 4RADA 5I7AA 4DNXA 5LMCA 1RC8A 2P8JA 2VHEA 3AEUA 4A8PA 4LI0A 1YDFA 3EN0A 4DJTA 1ORTA 1F3LA 2AB0A 2EJVA 1D2RA 4F86A 1Z0JA 5EAIA 4WVFA 2QRUA 3V33A 2A92A 2W6ZA 4N6NA 2OBYA 4DEXA 1GAWA 5JV5A 3TF5A 1F7UA 1NOIA 3HACA 4M1OA 1VXOA 3CN7A 5JHHB 3JQ9C 4BFXA 1VKJA 3ANLA 1LLCA 1B8VA 5SYNA 1U1CA 3SN6A 1CUZA 9LDTA 2MIIA 2FPLA 2R1VA 2ZBFA 3W79A 1ZCFA 2R4TA 4LISA 3N3AC 1LVUA 4LVNA 5LZ9A 5FTWA 4QATA 3N2KA 1T4GA 2GCEA 1JRLA 3EXFA 3N0WA 1GXSA 3UAVA 5BWOA 3MW8A 5J4HA 2EGGA 3TW8A 1CZHA 2WA1A 4B6GA 1RYYA 6ABPA 3WMXA 1IB6A 4FBLA 5CCBA 2GEFA 1AQUA 1KK3A 1NW7A 3DHWC 4UUNA 1M76A 3PI6A 3V4ZA 3EGIA 1O4WA 3BXGA 1E6MA 5LUBA 2IUUA 5AM2A 1R50A 3HY4A 4K7JA 3DPSA 4OUKX 3GEBA 1N1EA 2PUWA 5HF5A 4B3JA 4EFLA 2P9BA 3VKGA 4WZ6A 2VDMB 2ZBUA 4IRMA 5CDUA 1DEXA 1TZBA 5CVUA 2EGUA 1P2UA 4KE6A 2G17A 1XV5A 2YR0A 1YAJA 3TLCA 1IEXA 3BTSA 3WDMA 6REQB 1QRSA 1FB5A 2HPAA 3PT5A 4V24A 1F17A 2VTVA 1UPTA 1ZNXA 4QQNA 4E2ZA 1NV8A 2ASEA 3DSRA 3JQ9A 3PWKA 4EG1A 5J2UF 2CVHA 2UXDB 1Y1SA 4RK4A 2OXTA 1XNRB 2I65A 2A5DA 1VCIA 4M8IA 5JSHA 3U48A 2HRDA 3PF8A 5EC8A 2R6ZA 3A14A 1E1LA 4OBBA 1TK3A 2QN9A 3IHLA 3M7IA 1SXQA 1K8XB 1Q15A 3KAPA 3EJWA 1F4VA 1IEVA 3U4QA 2M6RA 2CL6X 2ZSDA 3OEWA 2OAEA 2DULA 3AHIA 2P9YA 2PGLA 4MULA 4L4YA 4OOFA 2XJ9A 1HWYA 2ZDQA 1C8KA 2XEXA 3HXPA 4BQNA 2WTUA 3GZTB 1TA0A 3LECA 3A3NA 3VPSA 3VHQA 2BMWA 5AI5A 3WXBA 1PL8A 4OD0A 4RMGA 5JJ5A 3VR6D 1SQSA 4QJBA 3OCJA 4YBRA 4R9NA 1PI3A 1UXIA 2A2ZA 3OMXA 1XQVA 2QTGA 1JT2A 2Y76A 1RJDA 1AG9A 2Q6LA 1EFHA 1Q57A 1Z08A 3I52A 4FOOA 4MR9A 3TUIC 3ZQUA 5AJZA 2PFGA 1GUFA 2EYQA 2DCMA 5EE5B 3F6PA 3FDZB 5ICMA 3TNYA 3I01A 1RHUA 1IHPA 3JPWA 1E1NA 5TGDA 2J4DA 1G8PA 1A2OA 2WJGA 1FSZA 2H3EA 2UVPB 4EFNA 1ATIA 2QE7A 1Y7HA 1GRNA 1EVLA 2ZPAA 1S8NA 4TS3A 5B3AA 3TAHA 4B3CA 4B82A 2HDWA 2VNAA 1U8EA 1W4CA 3USZA 2DUNA 4ALKA 3WKCA 1Z5GA 1FL9A 4H1UA 4I3FA 1D04A 3GZJA 2X8BA 2P91A 4RIFA 4IUDS 1IN5A 3EYWA 1E9VA 1WQ3A 2XE6A 1RYBA 2PKCA 3MTIA 3VC3A 4C20A 1J90A 5HQ3A 1XXLA 3IQXA 2X4DA 2M32A 4NMXB 1GGKA 4H17A 4CUJA 5HOEA 3EYAA 3BQ9A 3FLBA 3BHNA 1MAAA 3JARA 4KGDA 1ODFA 4CKCB 3GA7A 3PI7A 3W1VA 2QSYA 2W9XA 1FRQA 4UM9B 4K6MA 4UU7A 2IYLD 1XIVA 3CURA 3H2BA 4GOOD 4G86A 2I2BA 4GE3A 1X0XA 3WL7A 4R2HA 4IDDA 3TGLA 2CDNA 2NTNA 1E3QA 4KXNA 4XVCA 1KI7A 4MKFA 1YTUA 1J7KA 4D79A 4O59O 4NU5A 3OZTA 3QJYA 1TZKA 2DPMA 2R96A 3T1YB 1S2NA 4D25A 1RRKA 4AZ3A 1MB3A 1QH1B 2RHLA 2Y66A 3D7LA 3H5TA 2W90A 4MPDA 3P9RA 4C0HA 1Z33A 1BW9A 2C98A 4ZO9A 4AP9A 4QGGA 1XEFA 1HFKA 3N7AA 2G40A 3H1TA 4L5BA 2GX6A 4PYOA 4I5FA 4EG4A 2SKEA 3UBMA 1KAEA 3TSOA 2QL7A 4UNQA 3NPMA 4KQ9A 2AK2A 3VTKA 5EHXA 1HE5A 2AF3C 1KJIA 2QTFA 4KFCA 2ZTVA 5H5JA 1EGQA 5SYAA 2AX3A 1NJFA 4ADSG 1XD8A 1V8FA 4AJLA 3AERA 3ANYB 3QYPA 1NONA 4DQKA 3P2EA 3KNZA 4KN5A 2Q3CA 3PQEA 4MP8A 3FR7A 5AM1A 3D6JA 4W6QA 1SCJA 2QMOA 5U9CA 4R9SA 3PICA 3W5BA 4HV4A 4QRDA 4MP3A 1KWGA 1ID1A 1FFCA 1RBZA 4CVNA 1D4AA 2ZULA 1DFIA 1KIFA 1EDDA 3FTFA 1BGWA 1CJKC 3L7NA 1MX1A 1JDBB 4F97A 1CUXA 1Y5IA 3CZ5A 4CLHA 4UEJA 4XGIA 3MQFA 4GOLD 2D5CA 2Y1DA 4QTUB 3ZV6A 3ICQB 4JS0A 4Q82A 2ZTMA 3B12A 3VV2A 5FR1A 4J07A 5EMNA 2WM8A 3IEUA 4TX1A 2CJYA 1M54A 4FWIB 3CF6R 4N3GA 1XRLA 4O25A 4Y0VA 3P4XA 3FCYA 1UINA 2ENUA 2JIDA 2Z3WA 4MUBA 4N3BA 3B36A 3T5PA 5JD5A 4A6XA 3L1VA 4RTRA 3H2GA 2I4IA 3H5VA 4Y2SA 3I6YA 3O7WA 3FCUB 1ULZA 5GVRA 2GM4A 1XXHB 4M98A 1NF3A 3ZY3A 1VL0A 4HBZA 3IKLA 5A5EA 1CQXA 4RPGA 1L5VA 1K06A 1PGJA 3FUTA 2R6FA 3U1BA 3QKWA 2ZR0A 4WI1A 2QN8A 1QIEA 3AQ4A 4H77A 4C7XA 4Y2RA 4IFEA 1E7WA 2O1XA 2VSNA 3IHKA 3VA7A 1BDHA 2MTBA 2ZUCA 1GLVA 3FCAA 3VOTA 3JQ7B 5I9SA 4PIVA 3W2HA 2NZUG 1UWKA 1EK6A 3PXGA 3O91A 1LX7A 3ODPA 2Q9CA 4BP3A 1GZSA 3D4IA 2FJPA 5IKEA 5J3JA 1ZH2A 2AMFA 4XVHA 2ONKA 2HLNA 2ZSKA 4TKLA 2ID8A 1K0UA 3PDHA 1ADJA 1EUCB 4ZPJA 3WQQA 4KIFA 1MC1A 4V3BA 2H8GA 6REQA 2ZI6A 2VXOA 4LTNA 4N40A 4Y9DA 1Y7TA 3GJ6A 3G9TA 4JOQA 4CMGA 1DDGA 5B7PA 1QK4A 2IYPA 3D6VA 4G1EB 5BW8A 5JDIA 2PQ2A 1QE0A 2IBTA 1Z39A 1A9ZA 1JS1X 2NO6A 2NPIA 3BXZA 4NE7A 3ROKA 2Q3LA 3K5IA 3ZJYA 2F1IA 2QIOA 3LK7A 2ODNA 4BN4A 1XOIA 3TBHA 3R0ZA 3SYMA 4JJFA 4O3MA 3EEYA 1U2GC 3PKZA 5FBHA 4L5CA 1EYZA 3CSDA 1U0FA 2VHQA 2RHTA 3SDSA 3SQWA 4L78A 3ZI4A 2AC7A 5CMLA 3SHVA 3KVYA 1UKVY 3TZ6A 2HA2A 4PR3A 3IEIA 4KLAA 2FW8A 3L77A 1U5AA 4RKQA 3D0RA 3GRCA 4CV2A 1T0IA 4CQJA 5ALJA 2X19A 3BRSA 3EDOA 2RBKA 3PQ7A 1THMA 2MHCA 1F2TB 1JV2B 1IH8A 3MWDB 2QTTA 5KBYA 2CHQA 1T9CA 1RM0A 3T3OA 5LR6A 2QF7A 2HJWA 2LIPA 3HP1A 4QDJA 1YB2A 4PRLA 3D3WB 3L6RA 1ORRA 1THGA 4FQ5A 1ESNA 1E2IA 4IOMA 4LJ7A 5LKAA 2H59A 4V0RA 2P6PA 4DCUA 3GUVA 4XLZA 2J9ZB 4O2BF 4YIHA 4PZCA 5JAOA 3L7KA 3AHHA 4WFJA 2J5RA 3U31A 1U2GA 2ZU6A 4LV8B 3RSFA 4RDXA 2DLCX 3BL8A 1HLGA 4Q6BA 4WGFA 1AIPA 4X20B 2C29D 3CPJB 5F4ZA 5FO0A 4OI0A 4JB8A 3NQ41 3JAKA 4XTCS 4H9GA 2CK3D 4KQ1A 4GSKA 4PTYA 3RTGA 2VPTA 4OU5A 4UFNA 3WYGA 5HZGA 3BT7A 2DWOA 1KHTA 3D31A 2Y0DA 2ZUFA 3R7SA 3PV0A 2QN3A 2NPOA 5IJAA 4CN9A 4PLCA 1A9PA 1PT8A 3AGQA 4HJXA 4CKCA 3LQ1A 2XB2A 4Z4GA 5AKHA 3UKJA 4QYIB 5IYZA 5EL0A 4AVYA 1XQ9A 5T3YA 1J8VA 3EPRA 1QP0A 2HLHA 3V48A 3ZDAA 4YAIA 5CW1A 2CB9A 1LF0A 2EZUA 1VYTA 2EXXA 3K3PA 3ZHCA 2ZI5A 1GNTA 1P0MA 1IN6A 2OVFA 1PR9A 2VS1A 3A06A 3O1IC 4YDHB 3BGVA 1JDBC 4YO7A 5D5PA 2BGRA 3DB2A 1XDUA 5KDLA 1NP6A 3TE6A 4RHEA 1K86A 5CVDA 3PZBA 1L5GB 3SHTA 1PBNA 4FX5A 5U4XA 4DREA 4D96A 1UEXC 4R1NA 1MIOB 1QH1A 2IHKA 4KZPA 3T1VA 5ITZB 2DH5A 3PR2B 2FP4B 1LTQA 3L02A 1H8EA 1NA5A 1QQ7A 2UYGA 2WNSA 2WJYA 3A4VA 3COZA 4G36A 1U2DC 4EOGA 1L5HB 4F5EA 3P8ZA 5HZKA 1CJUC 1Y33E 2CLOB 2VDWA 1ULBA 2BGGA 2R8XA 4QQRA 5LBIA 3I8SA 1W2WB 4YROA 4UU8A 1MO4A 1JWAB 2I3GA 3QVTA 3U49A 4X1KB 2FW1A 1DARA 4JI2B 3AG5A 1NWHA 4TXMA 4UW9A 2RDMA 2JLCA 2ACKA 3P5SA 3I2KA 1BO6A 1IN1A 1ADBA 3OJFA 2IUEA 1E1QA 1YR1A 3MB5A 2QB5A 2GPWA 3ZWNA 3W04A 3WS7A 4IILA 1KSFX 4MKHA 4IH4A 5TIIA 2JAUA 3DKIA 2CNDA 2BH9A 4KQKA 4BNNA 3GNTA 1RSZA 3UFXB 2MDTA 4A5OA 5ALVA 1ZN8A 3AOEC 5JALA 1RP1A 2ECPA 4URUR 5AJWA 3PNYA 1DL5A 1NT2A 1XMPA 2JCYA 4ENQA 5K8IA 2COKA 4OAOA 3A1FA 3B7PA 1U2DA 1JI0A 2GAAA 4EPRA 1Z38A 2C20A 4N49A 4NESA 3DGFC 4B3XA 5ELLA 5FTKA 3ZE7A 1PBTA 2CLKB 2JEYA 3I5YA 3CUSA 1GQFA 3JV7A 1NV9A 2DPYA 3OZFA 4DCMA 1X42A 4RANA 1WCV1 3Q87B 1XXHA 4RPCA 4ABTA 2R65A 1P2DA 4YYZA 1ECFA 2M6KA 3LA6A 1EG2A 5HS6A 4NNPA 3RFXA 3EOBI 5LLSA 1KSGA 2H85A 4RV5A 4FMPA 4WMLA 2XGSA 1FUEA 1N6KA 2BMFA 4KITB 4JIMA 3DDHA 5LIRA 4DA4A 2GFQA 1LY1A 2YX1A 2I7XA 2J32A 1GFZA 4JGBA 3RSHA 3JQ7A 2YJ4A 4G4IA 4Y6RA 3AOEA 4F9GA 1LUAA 1ZI6A 4MS4B 4F4DA 2WTXA 3E27A 3OJ0A 1FP4B 3OOJA 1C0PA 4PS1A 2PX4A 4Y2QA 3ESBA 1FXSA 1TJ5A 3DBHB 2BM1A 2YJZA 2XQKA 3BSFA 3CF2A 1J0CA 4GOMD 4X24A 4YVFA 5EQTA 2LPMA 3N8NA 3UTCA 1AK1A 3B89A 5J5CA 1DOHA 1U3DA 4RYDA 4AJHA 2PUGA 3O0TA 1EUCA 4FYPA 2CL7X 4Y3UA 3H3FA 4F1KA 5C8YF 3K70B 1P7WA 1VJ0A 3QLEA 4V0KA 1DLIA 5LQUA 1FLAA 2I76A 2I7VA 2O23A 3CBGA 4KBYA 3IIIA 4G0XA 3IMFA 3PUHA 1GQYA 4QECA 1G18A 1SKUA 2IP4A 1T0HB 1WQ4A 3UWKA 1PFUA 4ZICA 2XIJA 4DB4A 1YMVA 4ARBA 3VYVA 2FPKA 3BH6A 4QTTB 4Z99A 4CMJA 1EWQA 4NG4A 5TNXA 1WY7A 4RXMA 2WTNA 4WOJA 1FXWA 4S35A 5DXFA 1D1PA 2FR8C 4UU1A 3LHSA 3S1LA 4AWXA 3H97A 4EVSA 3U44B 3QQ5A 4FVTA 1MGPA 1GKLA 3HNOA 1R8XA 3KKPA 4PS0A 3EIQA 4D43A 4W1SA 1J24A 2CVPA 2REQA 2Y3IA 4CCSA 2P6RA 1WUKS 5EIHA 5C4IA 1XAJA 2HBZA 2YIMA 3QV1A 3H87A 2W70A 4EO9A 2BDEA 2C1ZA 1NBIA 2V8BA 3P0FA 2GAJA 4NFHA 4ZQCB 4D9CA 4DNQA 5IYZB 1WPGA 4Z49A 1F2TA 3MWDA 3ZR4B 5KIAA 4JASB 2K87A 1CHDA 1PZNA 1DAKA 1VSBA 3AL2A 3D3WA 4PGFA 1FA9A 1AS2A 4P4GA 3CSUA 3RARA 5FDFA 5AUPB 2AVNA 4CLXA 5SY6A 1W8IA 5K09A 3U4MA 1K68A 2VWHA 3OOHA 5B2ZA 3RUEA 1M8KA 5AW8A 2F1KA 5JSQA 1IPFA 2QRGA 3G5MA 3LPLA 4DMKA 3QJ5A 2HRBA 4OF4A 3UAGA 1XJWA 3MBKA 4FSXA 3R9IA 1XDWA 2FR8A 2WFLB 3GFRA 4N5LA 4FGKA 4X20A 2DWUA 2BFBB 2JLWA 3V9PA 1I3LA 4K9LA 3D54D 3OE5A 4GR5A 1W48A 3EW9A 3FKSD 2CLDX 5DW3A 1DIAA 2CUKA 4JUCA 3VJLA 5BV7A 1FX0B 1UDRA 3KL2A 5KTPA 4P7BA 5KVSA 1AKVA 3JYHA 2FEAA 3ROEA 1V4BA 1K5PA 1E77A 1L8QA 1NW5A 2C4NA 1E0AA 1AD2A 1PUIA 4TV9F 3ZCQA 1J5PA 4G65A 5IWCA 1N0IA 4YY3B 4N8DA 1H0SA 4JR1A 1VSTA 3KTDA 4IIFA 4M49A 4QYIA 4EY5A 1PVOA 1XI2A 2NUTB 2PSFA 5K0SA 5D87A 1NI3A 2WWXA 3A3KA 5LZ5A 1K89A 3RCBA 1UJMA 2AW5A 1XTUA 3UIEA 3MAJA 4RM2A 5IC5A 3E7XA 4ALNA 4FTWA 3GUUA 3EDMA 1B43A 2PBLA 2IDKA 4TTPA 1UKEA 3DMYA 5CFZA 5KINB 1F1BA 2XQIA 2C7PA 2O1SA 4LRSB 1JBQA 1JSZA 2BKAA 5IRCD 1K98A 5HW0A 4QO7A 4D9BA 3NHLA 1MIOA 3OUZA 2ODEA 5JWRA 2FP4A 3A3YA 3RI3A 1C1XB 5AESA 4LHEA 2I4MA 4YDQA 4MO2A 2JASA 1L5HA 1YUMA 4NQRA 4OK6A 3DLBA 2B83A 4U63A 1LH0A 1SWWA 2AFIA 4IINA 3DW3X 4WERA 4ENSA 4OP2A 4CEJB 4TT3A 1DMSA 1WKVA 2OFWA 2R2GA 2ZVPX 3IV9A 5FBWB 1S96A 1GA1A 2HM7A 1KGDA 1W52X 1PWYE 2B6HA 4UAUA 4XJVA 3W78A 4DIMA 3LCVB 3QUCA 4ICIA 1P1CA 1QV6A 4FYXA 1TADA 3NALA 3UC9A 1PJ2A 2ZIXB 2ZJ7A 1G6KA 2E4VA 3PD7A 4JBXA 1TKBA 1UXJA 3OCCA 1PG0A 4KDEA 4MUHA 4V2IA 3RK0A 3HXOA 4DWJA 3BRQA 2JAOA 2Q29A 3EZFA 3ODGA 2CDRA 5U1PA 4DLTA 4EUKA 5CLLA 4IDNA 3W6OA 4B4UA 5BMVB 3UFXA 1V8DA 2XOKA 3T3MB 3WNVA 3MWGA 4CTKA 4YI3A 3KUKA 3PUJA 3WL3A 4DBLE 1XG5A 3T0IA 4RJ2A 3DHVA 3ESRA 4R1LA 2E85A 1K97A 2VDQB 2OO5C 5IAGA 3T4XA 4DMHA 2V7XA 1R4NB 3SZRA 4Y2VA 4FYWA 5FPPA 1C30B 1T1IA 1YJ8A 1V5WA 1BFUA 5IK2D 1MV5A 1CPYA 1N3IA 2O20A 2B21A 2WBLC 2C00A 3K70C 1DDOA 1ZS9A 4H7IA 5TPZD 3HO1A 3WZLA 5DN9A 2QPTA 3E53A 3BSYA 3HBAA 1PKXA 2X9GA 5HQJA 3ZLTA 1SQGA 2VXYA 2KB0A 2CNKA 2J6CA 4NCHA 2JJ2A 1NUQA 1M2JA 3I23A 4QRIA 3S6JA 3UA3A 1MQ8B 1PKEA 1MQAA 4M0PA 4ES6A 3WBBA 2AN1A 1K8QA 5EJAA 5JNWA 4X8OA 2FG6C 3N76A 2ZI3A 3RC8A 3C5VA 1ECBA 3SNKA 3HCWA 3UKOA 3ZW7A 1VJTA 2HB6A 1E8MA 4TQGA 1ML4A 1J8FA 4RTQA 1FP4A 2ZSHA 3QVGB 5E2BA 3VBEA 2FHSA 3F6RA 5HJ2A 4NY1A 3T38A 2C2MA 2OO5A 2PZBA 3EOAI 1R15A 3I2JA 5E7JA 4OBEA 4B6OA 3B3JA 1Y9DA 2ZYIA 4PICA 1PL0A 5TQVA 3WLLA 1BC5A 5HF8A 3TE7A 1JDVA 3QOWA 4X94A 2OSVA 3TW4A 1Q83A 1XP8A 3ZCSA 4FDLA 2NTYC 3K9NA 5BRNA 2I80A 1AZWA 4G1CA 2JGJA 5FKJA 1UBRS 4UBJA 1ODCA 3G1WA 2O8CB 4OAQA 4DY4A 5JNSA 4WZBE 1AKEA 2QORA 4J1SA 3WE7A 5IDVA 3E82A 5CFOA 1KJ8A 2VSFA 4W4TA 4YAEA 2DPXA 4OYYA 4IJMA 3G0OA 4Z7JA 1DSSG 1M66A 5DB4A 1AGPA 5CYOA 2PKYX 1TZJA 3RROA 2F90A 2O0LA 4ZJPA 4CKYA 4EF4A 4YRGA 4N76A 1C7JA 3U44A 1WA5A 3EY4A 1YFJA 3E3OA 2FEXA 2QAJA 4WOKA 3B20A 4QHTA 4HX2A 4YQEA 4F11A 1R5NA 3L8FA 4Z0NA 2D54A 5CYPA 1JIXA 3RSOA 2LD4A 4BTVA 2P79A 4MV7A 1DAPA 1SZDA 2UZ3A 2VRCA 3LW8A 4QUDA 4D81A 1VE3A 4M53A 2AXPA 4G8DA 3N2EA 4AS3A 1N6HA 2B2NA 2HA5A 2VWPA 3HM2A 4OK5A 3VR5H 2H1HA 4GD3Q 4E2WA 5BSGA 3CG4A 3P7MA 1DT5A 1JALA 1Y3CE 4RVGA 3AJ8A 1G8GA 1VPTA 1FVOA 1CC1S 1PZMA 2RGCA 3TTVA 1RBYA 4M8SA 4XM1A 3I5AA 1JDZA 1SKAA 1IMOA 3IPCA 5FIUA 3RC3A 4P38A 5KHAA 3VYSB 5HIAA 3U7JA 2PXAA 4BTLA 1PG5A 1XTQA 3IOMA 4WUTA 4IIBA 3O9VA 4PLYA 3CUTA 4KAXA 1ZC4A 2PJRA 1DQNA 4RD3A 1E79A 1E9EA 2WM9B 3OEEA 2X4IA 4HMOA 4ND5A 3E4DA 4KX5A 1ZOIA 3GN2A 2FR1A 1U7HA 2FWMX 2WFLA 2AT1A 1Z0DA 2DYKA 2FR0A 1ZK3A 2JAPA 2QR3A 2QRMA 4L0QA 3DAOA 1OLXA 4QUEA 5EJ2A 4QXQA 2BFBA 3QPWA 2O2EA 2YV1A 3AKYA 4PANA 3UEOA 1YNSA 1CLEA 4L3VA 5FOXA 4G0UA 5F4BA 2G08A 4FYMA 1EA7A 2QM3A 2IHUA 4G26A 4MPTA 5AR1A 4ZVSA 4DV2B 2O59A 1YQ9A 4OQLA 4EKYA 3VR5D 4MVWA 3OJOA 1I1OA 1T26A 3DE5X 1SXJB 2CLEB 1DC3A 3NM6B 2LBPA 1N9GB 3ELUA 3PDWA 2VJKA 3AJRA 1SC6A 3FYSA 3GGGA 2W6ID 3AEKA 4ME6A 4XSGA 1OPRA 2H7YA 2P7IA 1EFPB 2J33A 3WICA 4URWR 2OZLB 1KWKA 1CU1A 2NUTA 4GPTA 4RD6A 3FKJA 3IUNA 3DCYA 2IPOA 2FFRA 2QRZA 3WNDA 4DMLA 4RTMA 3V3TA 5GZ1A 3K5PA 1RWBA 2P69A 3Q7IA 1T4MA 4J76A 4TWAA 4XVRA 3W1WA 2JVKA 4J7UA 4LTDA 2VPXA 1WD5A 4B3BA 1CSEE 4B8ZA 4CMCA 4J1NA 5SICE 3V4RA 1KDYA 5IDXA 3RUDA 4DJFC 5IJ9B 1QZTA 3T7TA 4A1FA 2R1UA 2K4MA 2QXYA 3RIHA 4B45A 3Q3IA 3CX7A 4BEWA 4ZC8A 2FOIA 5ELMA 4LF6B 1GKUB 1RDFA 3CGGA 3PL1A 5DT2A 4MQBA 1QH8B 5D2CA 3UPUA 2AEEA 4G0PA 3UWOA 4W9NC 3HRKA 3ONWA 3WLPA 1E2GA 3IKTA 1DKLA 2I6UA 5ALGA 2YVQA 3I9OA 3WGVA 4CEJA 4TWIA 4XRRA 1V4NA 1ITZA 2PSSA 2YIDA 1Y48E 1U5BB 2BGIA 3BHMA 3K1YA 4I6JA 3ZE6A 1FFEA 2OFPA 3DE2X 1E4VA 4Q15A 1K4KA 4FX2A 2OLKA 4G0OA 3KD3A 4MV8A 3QNWA 2JGDB 1RZUA 3SPXA 3NIWA 4C7BA 3G8YA 4E31A 2Q3DA 1WLYA 4B3IA 4ZT4A 3CLTC 4X8HA 3F3MA 4IJQA 1ULAA 4LBVA 4M55A 2JCXA 1RHRA 2UZIR 3N59A 1ISHA 3KOXA 4JI0B 4C3UA 1U0BB 4EG0A 1E7RA 3U3MA 4KH0A 2YFYA 4MA0A 3KUUA 3T7IA 4RY0A 4ZGWA 3QF4B 3I72A 5KTKA 3LBYA 3C8ZA 3I9V6 3NAMA 3ZY2A 1GPBA 5EMMA 3FF1A 1R4NA 2ZAOA 3FWKA 3OQHA 3SKXA 5DWQA 3U3OA 3BMQB 5BV2P 4KXMA 4W9NA 3DDOA 4NBWA 2C4UA 5I4BA 4QEKA 5EMHA 3IPYA 3O0DA 3DFKA 3MT0A 5GPBA 1G2PA 4ABYA 4QM6A 4BNWA 5JNVA 4QUGA 2BJWA 4WOPA 3AF1A 2X3UA 2IU0A 4B85A 2FDCA 1TJYA 5IC6A 4EGJA 5HUHA 2E6UX 4PLGA 3LUPA 4O4LB 13PKA 1YS9A 2D1RA 3MRSA 2XZLA 1Q1BA 4TRNA 1GN8A 1EHYA 3PE6A 4IIEA 3A70A 4KPGA 4YFYA 3G9XA 4WKOA 1ESDA 1UEIA 4IOKA 3ND7A 2CBXA 4E5MA 4F8JA 1FS5A 4MYDA 5IBQA 3QVGA 4DMCA 4TZKA 3BE8A 2J48A 5HF6A 3LUDA 3QIAA 3HH8A 3E3MA 3HJTA 3C5CA 4LS3A 4EG8A 4M1TA 4RE6A 4BV2A 2MYPA 4EW6A 2Q3JA 1H2WA 3LT4A 4PC3A 4M37A 4ZEWA 3WXMA 4QAQA 4RD1A 1JQDA 2F62A 2OQRA 3IB6A 1CP2A 3I04A 3U7GA 2FFHA 4KHPB 5EEGA 1MABB 5CH3A 4B4OA 4MLPA 1QZZA 3STYA 2O8CA 4QRHA 5DU2A 3BOSA 3RYCB 4P81A 3E0XA 2CDBA 3SFZA 4KR9A 2FWIA 4W7IA 1O96B 1QCYA 3TJZA 4A91A 1UAYA 3ROZA 1TCCA 1OI4A 4FHCA 3I58A 1DOZA 4P3YA 2AFHE 4IH9A 4CT4B 3H2SA 1M75A 2AI1A 1YDHA 3AM4A 4GWLA 5T4BA 4EDFA 3AKEA 1K1EA 1A0OA 3HZHA 4EEKA 2GPNA 4BV8A 4GG1A 3IOBA 4D7AA 2WAOA 1NNSA 1PFVA 2J7PD 3K72B 1H9CA 1U2TA 1T6BY 4UMFA 2BI8A 5REQB 4ND3A 2ZT5A 4UQOA 4FW8A 1SXJC 3PLNA 2ET6A 1QIMA 1ZW1A 2NU7B 3VI3B 1VSQA 2ACEA 3NXKA 2QNIA 2I9PA 5CFLA 2X0FA 1V96A 4Y9RA 1JEJA 4GO1A 3HJBA 4NENB 3DDZX 4F9EA 3ENZA 4UBNA 3TXXA 1K7EB 4PPYA 1Y7IA 3ACDA 2RK6A 2V54A 3MG9A 4CGZA 4LMAA 2IX3A 3D2AA 1A7JA 4KQCA 2GAIA 5ALKA 4GHWA 1JHMA 2O48X 3CZPA 4HJRA 1TVEA 1H4VB 1OLUB 3OIFA 5HIIA 4C4TA 1FUIA 4UMDA 2CYAA 1VGVA 1DTEA 4D57A 1GJRA 2YIVX 1YA6A 2YZKA 1N5RA 2C3OA 3CJRA 2OTCA 3M6UA 4L8LA 1LI7A 4QLBA 4O08A 1KTVA 2NUPB 1POWA 2CMDA 2FPOA 2GLUA 1TM1E 2QX9A 2YJ5A 3BEOA 1PJBA 3CB4A 1QFJA 2PXCA 2ZTLA 1Z35A 3IAFA 3IC5A 4LQLA 5CH5A 2XT9A 4DIKA 4FCWA 4Q01A 3W77A 1OTXA 1SXJA 3UK0A 4OHMA 1N9GA 5NULA 4E7OA 1CIJA 4DG9A 1ODKA 4JP3A 4UD2A 1XL1A 1CVIA 1WXFA 3TQCA 3EQ8A 2VHTA 5HWSA 2QP9X 4CM9A 2GO7A 4NBRA 3B53X 4ND1A 3I3SR 4YHBA 1NW8A 3TPFA 3HXMA 5MHTA 3SQNA 5MF6A 1HEIA 1G41A 4BV9A 4UNIA 1Z6AA 4C05A 5ALOA 3REFA 4RK6A 3R6WA 1AV7A 3H4IA 3VQTA 4PN3A 5KQRA 5IXYA 1Q7CA 4GYWA 4TL6A 3A1WA 3SICE 1O3YA 1PL7A 4DV6B 5IJ9A 3PENA 1JEOA 1QXSA 4RK0A 4UVEA 1J2YA 1F0PA 2PL1A 2Q8NA 3C7TA 4TLAA 3ZGVA 1U0SY 2ZI4A 4EG3A 3QW4B 1KY3A 3IVMA 3QEJA 5BW4A 5FLXA 4AUMA 3VNVA 4YUXA 3O8NA 3BE4A 1N2IA 4JU8A 4DIUA 3D7KA 4HUJA 3R3WA 4WW0A 3WLKX 4CGYA 4JP5A 4UNRA 2GRAA 4I4CA 4INAA 4NCNA 5GGYA 5KC8A 2QNRA 4KSBA 1E62A 2A0YA 2JGDA 2O7SA 4Q3NA 5AJHA 5F9MA 3GCXA 3OUUA 1QIDA 2I6FA 2Q07A 3V1NA 3SQLA 4JK3A 2FHPA 4FWTA 1EWKA 3VU1A 1SBZA 2OESA 4C0LA 2BGMA 5AKKA 5IM4F 5IFKA 4CM5A 2UDPA 2I66A 1R6DA 1AQYA 3SBEA 1P72A 4MB2A 3W1EA 3KV1A 1TL7C 1Q50A 3IPXA 1B3BA 1ZGGA 4I5IA 5G0TA 4ETMA 3MQ2A 4H35A 2PYIA 3B60A 3SF8B 3KXLA 3QF4A 3ZIAD 5FBVB 1YL6A 2XUQA 1E6CA 2FOXA 2HSWA 4YPFA 3ZWCA 1N77A 1WBBA 2HSEA 1XKXA 3OOWA 1G20B 2IXEA 2IYFA 1LLFA 2QUBA 1W46A 2X6QA 1NAIA 2XMCA 3DBRB 3PIDA 3TRKA 4JB2A 1I9CA 4U2CA 3T15A 2HTFA 3ETLA 3ZE1B 4W6ZA 4ZZ0A 1B0AA 2OOSA 4E0BA 1E4OA 1CIPA 2OORC 1KI8A 1II0A 1WM1A 3MWLA 3E9MA 4PYMA 4TTQA 4WCDA 4DV5B 4D56A 1CRPA 5BT9A 3UW1A 1L6IA 2X2OA 2H3HA 3P2YA 4MCIA 1TLFA 1HNWB 3HCFA 3ZCUA 1WXXA 1W30A 2H17A 2JD1A 4EM6A 4TZ0A 4O4LA 4PSVA 1JVBA 4KNYA 1UT8A 3W2FA 1J1ZA 1BD3A 2Y2VA 2YICA 3L5KA 1UZAA 3JQPA 1JLMA 1O9GA 4RPHA 4KIGA 5G1OA 1HEYA 3T7EA 2NP6A 4EPXA 5CFRA 4GNRA 4B33A 1HKUA 3D6AA 3A05A 4OHCA 1DKMA 2OKGA