2Q8QA

Crystal structure of s. aureus isde complexed with heme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
258
structure length
258
Chain Sequence
GEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant E
publication title Heme Coordination by Staphylococcus aureus IsdE.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
total genus 80
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8qA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8qA01
2OSVA 4WESB 5BVHB 2WHYA 4HN9A 3MWGA 5KOJB 1L5HB 1MIOB 3ZTTA 1QGUA 2Q8PA 5FLYA 4HMQA 2PHZA 2Q8QA 4G07A 4WZAB 4DBLE 1TOAA 4TKVB 5GGXA 3NU1A 4N01A 5BVGB 2M6LA 1K2VN 4WN9B 3MD9A 4GICA 3MINB 3AEUA 4ND8A 2AFHA 1PQ4A 1M1NA 3MFQA 4MLZA 4B8YA 4UTPA 1EFDN 3AERB 2XDQB 4XPIB 1KAEA 2AFIB 2XQVA 2M6KA 5HX7A 1XVLA 1ESZA 1K7SN 3LHSA 3ZK7A 2X4LA 5I4KA 4WESA 3ZK8A 5BVHA 3AETB 4WZBB 1M34B 2OGWA 3PSAA 5KOJA 1L5HA 1MIOA 5KOHA 1G20B 3U7QB 4WZAA 4MDYA 4TKVA 2OV1A 1KARA 1N4DA 3PDIB 5BVGA 3GI1A 2QI9F 4WN9A 5JOQA 3AESB 5CR9A 3ZK9A 3MINA 4UDOA 4PM4A 1QH8B 2YNMD 1N2ZA 5GGYA 1FP4B 2OV3A 4M7OA 4UDNA 4UTOA 3AEKB 5M3BA 4G09A 3AERA 2RG7A 2XDQA 3K1AB 4XPIA 3TLKA 3LI2A 2AFIA 2ETVA 4MO9A 1QH1B 4FI3F 4HMPA 3EIWA 3EIXA 5M29A 4IRMA 4TKUB 3AETA 3MWFA 2XUZA 2XV1A 1M34A 4FKMA 2PS9A 3HXPA 3AEQB 1G20A 1G21B 1N2CB 3U7QA 2R7AA 5JPDA 3HJTA 5CX1B 5M34A 3PDIA 4LJSA 3AESA 3CX3A 2PRSA 4NNOA 1QH8A 5B58T 1FP4A 2PS3A 3AEKA 4WNAB 3HH8A 2PS0A 3K1AA 4BBPA 3UJPA 4HMOA 4OXRA 1N4AA 1PSZA 4H59A 5AFSA 2MINB 1QH1A 4H0FA 1H1LB 2XY4A 2WI8A 4K3VA 2R79A 3R5SA 4OVKA 4TKUA 1K0FA 1M1YB 3AEQA 4WZBA 5KOHB 3BE6A 4INOA 1G21A 1N2CA 5HDQA 5CX1A 1QGUB 3BE5A 4PAGA 4CL2A 1K75A 1KAHA 2O1EA 3TNYA 3TEFA 4LS3A 2XH8A 4NNPA 3AEUB 4ND8B 4MX8A 4WNAA 2AFHB 3R5TA 5M2QA 1M1NB 3G9QA 5JJ5A 4FNAA 2MINA 3PSHA 5KHLB 4OXQA 1H1LA 4FILA 4INPA 2YNMC 5JG7A 3ZKAA 1M1YA
chains in the Genus database with same CATH superfamily
1TMOA 3T0IA 2OB2A 3JYNA 4FFDA 4P3XA 1ZW6A 3JZIA 3K1ZA 4M8NE 3DFKA 3VV2A 2NSHA 3VZCA 3TZQA 3GJRA 3ZN2A 2D2IA 3PGLA 4BN4A 1KDTA 2Q46A 3PB3A 4D9JA 1NN3A 521PA 1UF9A 2HCJB 3H65A 2DY0A 2VH2A 4HGPA 2C9YA 2QTWB 3FVQA 4I5IA 2NUTA 3L8GA 1L5GB 1M1NA 1FUYB 1ISGA 1RE0A 2P69A 1E5XA 3M82A 4FE7A 4L3OA 2O8BB 1DFHA 2A0YA 5KX5F 3AERB 4FEGA 4IWYA 1Z88A 1J0AA 3W6UA 1ECJA 4Y3UA 1GLGA 1LQ2A 3BOSA 2Q2OA 3I2KA 3KB6A 3M2TA 5EJ6A 5BQXA 5EFOA 1DHTA 2CLEB 3KAQA 4GSLA 3WGYA 4FSXA 4ER7A 5E6RA 1I0LA 1ULUA 5LKRA 1VG8A 4F72A 2I91A 1GUZA 3MCZA 4KODA 2ID8A 2XAUA 4IQFA 1KVRA 3JZFA 3KSZO 1SVSA 4R05A 1WXXA 5ICGA 1ISSA 2XMCA 2DFNA 2FSFA 4KDFA 4NU6A 4R0NA 4MQUA 3NEPX 2YNMA 1N2ZA 1VSBA 3BFVA 1RE1A 2O06A 4ALLA 3RRYA 3QTBA 1Z74A 3JASA 2I3GA 4QGGA 2P41A 1AH2A 1WHTA 1XEWY 3EY9A 2K2WA 3HY3A 5U1PA 3ELUA 2VQSA 4Z9BA 3O4IA 3PQ7A 5B3JC 4NBLA 3ELBA 2EX1A 3AB8A 3JD2A 4BLQA 3GRZA 3AETA 1XD2A 3QEAZ 5F9FA 2E4AA 3AL2A 3U9SA 1C80A 5KC9A 4F3NA 4JJ4A 5MFPA 1TYCA 5IZ4A 5FA5A 4OBEA 5AMXA 2PCLA 2Y1KA 3A4YA 2JJ8A 3P9SA 3QF4B 4Y0NA 3ZHVA 1EINA 2G7ZA 1RAHA 3BCSA 4HNTA 4CW7A 1HDOA 1T9GR 1S2OA 2HXGA 2CHQA 2QVBA 3ESDA 3JAWB 3VR5D 3NEJA 3KQUA 3OFNA 4LGVA 5BXQC 1N9KA 3P9XA 4RWZA 4PYNA 1VRCA 4P80A 3FDXA 1KZ6A 3A28A 5DGTA 4KXWA 3OPYI 2GYWA 4RORA 1G6Q1 4BDSA 3ZWYA 2LCQA 3LP6A 5EWMA 4JENA 1H0HA 2J9FA 5GONA 2XZPA 4H1HA 1CQPA 3URMA 1DVRA 2IHJA 4QRIA 2AW5A 1SGWA 5GJBA 3ZVMA 1TLLA 4TV9A 1J06A 1NJ5A 4B4UA 4HLNA 2BE9A 5HUHA 2WJAA 2ZYSA 4ZCRA 1MB3A 1WCWA 2QSUA 3PPIA 1JQBA 3CW2A 1SXGA 5AW8A 3F7OA 4FE3A 3TECE 5ICCA 3MTAA 3Q7PA 2XCQA 1AKWA 3CPSA 5CIYA 1RKUA 1IN5A 5FBZA 4N48A 1G8HA 2BIFA 2Y2VA 3M4JA 2AIRA 1JDPA 2D0OB 2I3DA 4HDNA 5EZYA 4RK7A 1YZUA 3QXCA 4HG2A 2GAOA 1I94B 7ADHA 4LISA 3O26A 1RYEA 3O1JC 2FP3A 1Z5PA 1IBCA 3HO1A 4W4TA 5EWJA 3DONA 1F2UB 3WMWA 4I2NA 1GRCA 2ZRGA 1VKRA 3X0DA 4MB6A 5DBIA 1VA5A 2I03A 2VDRB 3NTXA 2OO5A 2Z9CA 4NBVA 1R3UA 3MWEA 3RKRA 4QARA 1TJ5A 1MR3F 1QH0A 5BYKA 3OFJA 1XRJA 4G6ZA 1SWVA 5EXPA 3WL4A 2ZPUA 1NZJA 1TL7C 2PANA 3KR2A 4M60A 1HZZC 5K0ZA 1XVIA 4JXXA 1RCFA 4CV1A 1P3JA 2OCYC 1J09A 3TN7A 4F3CA 5KNCA 1D03A 3M81A 4WACA 4S0ZA 1BS1A 4JX8A 3RTCA 1N6NA 2E4VA 3DL2A 4OH1A 4FGSA 3OHSX 1AHNA 4RTQA 1XVUA 3V3TA 4BKRA 1J8FA 1N8KA 3DOFA 3G89A 1QP0A 4EYQA 1GJRA 3QK7A 2VDLB 4L8FA 4KLZA 5IBRA 3TX6A 1M7BA 3EUFA 1LPAB 1HGXA 1QE0A 1E0AA 4QODA 2NVUA 5K0CA 1TQ6A 1NFQA 4Z0NA 4E12A 2FRXA 4UM5A 3TUJC 1C29B 3JRWA 2BFPA 2WDPA 3H8VA 3NDIA 3BHJA 1JA1A 3NP7A 1B76A 4FFNA 4GMDA 4GG1A 3IAS1 3HXOA 4XTCS 2NWQA 4EJSC 1H4TA 4KV9A 2DUNA 1G9TA 3SSMA 1SZPA 3GFFA 3G8CA 2PMWB 1K5GA 2O8DB 1IBSA 2ZQYA 5I8WA 4EY6A 3SM9A 3F0TA 3DWIA 5CEJA 2XE7A 5CTJA 1EWTA 1X9IA 2ZSAA 4E88A 1OZAA 2CK3A 1VJTA 2QDKA 3ESCA 3MJTA 1YONA 4GAEA 1GFSA 4NR0A 3FTQA 4RPJA 1LDMA 2DRIA 2XUZA 4CDRA 1A5ZA 1Z0ZA 2QYOA 5LP1A 1G3QA 5FBLB 2HRBA 2F2TA 1FE8A 2OXEA 1AQLA 2XTMA 4JUDX 3ONNA 1EUCB 2D1QA 3ANLA 2R6HA 4GWGA 3TE7A 4F84A 3JAKA 5L6LB 2BTEA 4EBBA 4MGYR 3JR3A 4NNJA 4ML3A 4GIBA 2GK3A 4M38A 2PUJA 3PQFA 1SURA 1EDEA 3TK1A 3KXIA 3ZCTA 1A50B 1AV7A 2R44A 2GD1O 2VYFA 1WOYA 4QOSA 1CU1A 4DSTA 1KDPA 3CF4A 1W30A 2W4MA 4C7MA 2R79A 2DBRA 3RU2A 1JWBB 4PAWA 1GA4A 4JBHA 4LOAA 4IR7A 4CCYA 2ZG6A 4A7PA 3THSA 4Q02A 2Z8XA 1P0MA 4DV4B 2QAIA 4F97A 3STUA 3HN6A 3NPMA 3NYRA 2J87A 4W5OA 4EFLA 1EH5A 3FHCB 1QDLB 4RZSA 3G2PA 1Z8FA 1ULSA 2WP0A 5ALKA 3L7MA 4I4CA 4WFQA 5A5FA 3EGXA 2YMMA 4LOLA 1XQ6A 3CN7A 2E49A 2K2QB 1B0AA 5HFNA 2YINC 3QW4B 1PJAA 1DC3A 4UHJA 3VX3A 2ZSEA 3KKPA 4AU1A 3SEAA 3QVXA 2EAUA 3S40A 1KRHA 5E38A 3R74A 3QEMA 5LNK1 2IPXA 1SQFA 1T2UA 4PIMA 1MIOB 2QLNA 4I4IA 4JUAA 1DI0A 2NU8B 3KTAA 1AMOA 1UXKA 4YAGA 5EMLA 5JO0A 2QU7A 5B2ZA 1KORA 4TV8A 1GT6A 3WRYA 1CIJA 1OYOA 1FDIA 2RGEA 1IB6A 3DOEA 3AFGA 3FHOA 1BFKA 4G0NA 2OKGA 3NVMB 1NPDA 3R0ZA 2ZB8A 3EH1A 4FC6A 4NZNA 3SI7A 4Z7QB 2VUIB 3OG9A 3GG2A 5DPMA 4D8WA 3D4PA 5BWCA 3O95A 4N5DA 3U9TA 1G8MA 1MJHA 3PNLA 1LBQA 1PJ8A 4RY8A 4A8TA 3TF5A 3BE4A 4WBXC 4DMFA 1P3Y1 1VJRA 3RIEA 4DCSA 4R6XA 3QVWA 4XGIA 2AN3A 3WB1A 3BRWD 5CU7A 4FDTA 4HGOA 4QA9A 4NHOA 3KZKA 3JQ7A 4JJAA 3L8YA 3HDQA 5A1TA 3OY2A 4QQNA 4KG7A 4ECEA 1L4UA 5JDIA 3ZVKA 4EFKA 2OFFA 1W0CA 4QJBA 3S1SA 1CK4A 3PGMA 1XA0A 1HMYA 5BYAA 3FBWA 5AKYA 4LZAA 4Z2YA 3KFVA 4K03A 3NT2A 2E7ZA 2K4MA 4IDCA 4C4XA 2XUDA 4OHBA 1WDMA 4B4KA 5LQDA 3EEYA 3TQTA 3QP9A 1Z16A 3TGPA 1E6WA 3OJOA 3Q5DA 2DT5A 2AJTA 1EEHA 3VPDA 3H17A 5TMPA 5DT9A 4BQNA 2P67A 2DHRA 3QY9A 2PMEA 2WFAA 4DIKA 3QBVA 3E7PA 1FJXA 5C3MA 1HXHA 2RGWA 3NM4A 3IA2A 2ABWA 5HILA 1SU8A 1JKXA 2TMGA 3KLOA 4MR8A 5HF5A 3H5OA 2G6BA 2JLWA 3AESA 3EG9A 4YP5A 1P0CA 1UUFA 2H54A 2NO4A 3H1PA 3W5HA 3Q1LA 3UJHA 1VG1A 2YWJA 3DMGA 4KDRA 1BE8A 1HT2E 2IXGA 3BMQB 3MTBA 4FM9A 2D7DA 1UJMA 4LJRA 2C98A 1YKSA 1MH1A 1VXOA 4JBLA 3U16A 4JR0A 4R1LA 1VI2A 1U5AA 1P1HA 3QUAA 3LXUX 2GDZA 3W04A 3FAZA 1Z5OA 2REBA 4JEUA 2H16A 2I2WA 3OZSA 4OQYA 4MGHA 3T5GA 1K0FA 4G1VA 1IOWA 2IHYA 2PUVA 4QGBA 4X84A 3HSYA 1JV2B 5AVVA 1GNVA 1Q1ZA 3HTXA 1U3TA 1YDHA 4INOA 1ZJYA 4COOA 1MHPA 4JJ8A 1XZBA 3V8MA 3NGLA 1Y9DA 2Z5VA 4E07A 3HKCA 2FVXA 1CJBA 1K6JA 1GL3A 3O0TA 3R3ZA 1YE3A 3V2IA 4AMUA 5LIRA 1T9GS 1U2ZA 1GGJA 1CVRA 1Z82A 4X60A 4GLJA 3NHRA 4XQGA 4ZVPA 4JNKA 4FGUA 4OG2A 4UBMA 4JCOA 5K05A 5GADl 2HCTA 4QVIA 4C3ZA 1UBNA 1Z18A 1IXRC 4YROA 3GRFA 1L5SA 1AUPA 3JW8A 4JSRA 4AXBA 5DB4A 1G2IA 1XU4A 1XDUA 1QBKC 1O94C 1W5BA 5IS2A 4O2RA 1P0IA 5DM0A 4DV1B 1H3EA 4P34A 3PQ3A 2LGJA 3EQ6A 2RH4A 2J08A 1RHKA 2QWXA 4IJKA 1CS0A 3PD7A 4JQSA 7YASA 1TRKA 3JSXA 5EKTA 3OQMA 1NR1A 2F17A 2FN8A 1PK7A 4NCJA 3EUAA 4AUNA 5ADUS 2WIBA 3KEQA 2Q8PA 4YPVA 2Q3CA 4W5JA 5KYUA 4DBLE 4I8DA 3TFWA 2EC5A 4TQAA 5BVGB 3D4LA 1S2NA 5B30A 5L4LA 3THYA 4XM2A 3VZQA 5JVDF 1BSVA 1QO0D 3RC9A 1WUKS 4G3XA 4AG5A 4WZ6A 1Z4OA 2WZQA 2NPOA 3R3HA 4OPMA 4ZI7A 4RTLA 2D4AA 4Y2HA 5JANA 3SS7X 1CEYA 4W9RA 1PJSA 2O8NA 2RG1A 3D2CA 5I9LA 4JP5A 3QE9Y 1I6MA 1CSEE 3RYHB 3AW9A 3CNNA 1QF7A 3DHNA 2H85A 1C9EA 4LHXA 1I13A 4TLMB 4XVHA 2ZBGA 2ROQA 1EU1A 1QTIA 4KE7A 1C2TA 2PQ2A 3T15A 3ZNOA 1FFGA 3C8HA 3E22A 1A8HA 3I9NA 4ALNA 3U7QB 3CPHA 3PDJA 5CB4A 2N47A 1G16A 2CEAA 1G5FA 1ENPA 3B2EA 3VZDA 1RWVA 5CGZA 1EE1A 4ENUA 6AT1A 4BJ6A 2K87A 3L0DA 3ICPA 3VHXB 1NXXA 4EAQA 4A10A 2GXUA 2V59A 3LY7A 4I1PA 1R9NA 1Q0PA 1Y9AA 4D0RA 3ER8A 2JGRA 1A5SB 4FMDB 2J46A 1JT9A 3AUYA 3OLVA 4DLPA 2DBQA 1TD9A 2Y0DA 3T3PB 4WZBE 3ZXXA 4GGOA 1SM4A 1V5GA 4B35A 3BMCA 5B7QA 2ONJA 4ZKDA 4BAUA 2VA9A 1MV5A 1P5ZB 2VL7A 4EMUA 3BKWA 3N75A 4GSKA 4D9FA 3TKLA 1UMDB 4JT4A 3F49S 1JAZA 5FB3A 3K9NA 4R3NA 3UPDA 1OFHA 2WUWE 4F93B 2CV1A 1T9DA 2H2WA 4FFSA 2HJWA 5HTKA 3H2GA 2DR2A 3FTDA 3PEWA 1MJ5A 3UB2A 1F48A 1UPXA 3DYBA 3HZRA 4YACA 3THXA 4DADA 1Q0SA 1AKTA 4JWTA 3W34A 2GCEA 4H59A 2C03A 2Z2ZA 3K1JA 4RKEA 3RYIB 1XV5A 7REQA 5BYJA 5G40A 4PFSA 2M6SA 1XRNA 2H48A 2M9MA 2R1VB 1ES9A 4NI5A 3QI2A 4ENQA 1ZZEA 4DCGA 1R6DA 2IUFA 4RVSA 3FCEA 4M89A 4GPEA 3GRRA 1LPSA 1U8UA 4WHMA 2BD0A 4ZRDA 1Z34A 5B36A 4BUJA 2B3TA 4JODA 1FMJA 4HZGA 2EKLA 1D2RA 2IUSA 4WK0B 2R8EA 3LQKA 2VRCD 3GFPA 1IQPA 3QFSA 4BL5A 5IDYA 1T4MA 3DDNA 3D4BA 1EFVA 4XGNA 3KCQA 1I7QB 1F7UA 2RAFA 3QFCA 2ZYRA 5KC8A 4YT4A 4GI5A 5AJWA 3OI7A 4HUQB 3ECCA 4YAUA 2FG6C 4F5DA 4MZDA 4U2FA 3LUBA 3TRJA 3DT8A 4B6FA 3ZHBA 1S3IA 1VIAA 2NNWB 4FGZA 4I1RA 1L5NA 5K99A 1XTIA 3PC2A 1PZGA 4C7KA 2B1IA 2P68A 1GCGA 5TQ2B 2R00A 2Q9BA 3QJ5A 4LTDA 3WBFA 4J2OA 1FSZA 3H97A 1E7YA 1XU7A 1G42A 3LQFA 5C7IO 1WB5A 3JZAA 4BJHB 4KUGA 3GCWA 5K6AC 5LYJF 4KIWA 3P9PA 3VKWA 3QX3A 1ESEA 1EZZA 5D5HA 4AYTA 1OD6A 4CKXA 4K9QA 3ZE6A 3Q40A 3R3JA 4OU5A 1K86A 3QJGA 4G24A 5FAXA 2B4QA 1SXPA 1ZQ9A 3O31A 3A1FA 4IJVA 2O2JA 5EMHA 5B7PA 1DEKA 4LN1A 4TTVA 2ZR7A 4RPLA 1U63A 1VJ1A 2X4LA 1DXOA 3ILSA 2Y1LA 4P7KA 4ZKEA 1T3TA 1LLUA 1M34B 3FCUB 2IBSA 3PC6A 3W2IA 1H8HD 3HA2A 3IAAA 4P84A 4II2A 5EHQA 4CIBA 4E4RA 2GZAA 1GGMA 3U5ZB 4V0ME 3A9SA 3FWKA 3FDFA 2OD9A 2FJPA 4JYMA 4RJKA 5JAMA 2H63A 2V3VA 1N9GB 4DEYA 1FP6A 2ZE6A 2DAPA 3JQDA 4CCAA 1ZUHA 1IM2A 1WMDA 2H06A 5AHOA 5E4TA 1OX5A 1Z7GA 5LP6B 1U3CA 3E15A 5HCUA 1SHUX 4QBGB 3M4XA 3T9EA 3VGJA 4QNMA 4MO9A 4WL0A 3IHLA 2HMVA 4X7PA 1Z83A 4Q7QA 3I6YA 3NBXX 1DBPA 1OE0A 4C87A 3LC7O 2JAWA 2ZYDA 3ZBUA 2IS2A 4O4IA 1HYEA 4R84A 1J4AA 1JA9A 4XB2A 3RKUA 2XZLA 3K4HA 1TJ4A 5LDHA 3LYHA 2FPIB 2OZKA 3NWPA 4MV4A 3I9FA 2AOVA 4JKOA 4BNFA 5CT5A 1N32B 3EQ2A 4Q4DA 5LU9A 2HWKA 3PLNA 3QLUA 3JATB 4LMPA 4BWYA 1SZJG 1HETA 2W58A 1YR2A 2NAFA 4W8OA 1U7PA 2WSMA 5IULC 2FWMX 1C1YA 2ZUCA 4CI0B 1G5IA 4O4JB 3AWIA 3PHCA 3DQQA 1AXGA 2PL3A 3Q6IA 4UQPA 1SUPA 1GADO 1Z28A 3DKPA 1M2HA 4H0FA 4V02A 1YA6A 3T52A 1K27A 1HO3A 1PJRA 3HB9A 4U2DA 1CY1A 3QKSA 4R83A 4N39A 4WN3A 4LQLA 1ESCA 3STYA 2VH5R 1RM5A 4XVCA 5KREA 3SQMA 3IDQA 3R24A 2I2FA 2R1TA 1BO6A 5L3SB 1NBIA 4W8GA 4ALIA 1G21A 1NKVA 1R0RE 2CF5A 1XYYA 4ZZ2A 3PIRA 4MPDA 1I5RA 4OUKX 4DIUA 4CFZA 5LZ4A 2I3BA 1BCSB 2C4VA 2BMFA 1K75A 2P7HA 3MSCA 4RHYA 4LBVA 4IWXA 2DFPA 5D3QA 6LDHA 4TQUS 4WNIA 3VYSB 4GWKA 1O3YA 4IXTA 2ADOA 1BTOA 3KU1A 1P19A 2JFQA 2OCDA 4JXZA 2ZJ5A 2BFFB 3HSSA 3PSHA 3U13A 4F6RB 1DRKA 3A6PC 4AQ7A 2AQKA 3F74A 4RY9A 3J7AC 4RLQA 4NEQA 3G5AA 2AYYA 1OWMA 3NLLA 1YRWA 3ZWDA 1SVLA 1I7LA 2Z09A 5JZ9A 4FZ3A 2W2XA 4RMJA 4FQ7A 3NTQA 1P0FA 1XAIA 3RUPA 3FNGA 1QONA 1QHNA 4H4CA 4Q82A 5GZ1A 5DN6D 2QZSA 2XCTB 2FOIA 2OAEA 2QLLA 3KR9A 4HGNA 5CDSA 4BUZA 1JJ7A 5T8KA 3ROEA 2R7NA 1FY2A 4M1QA 3KQWA 4MLCA 2ZTLA 5HMLA 5A06A 2GXAA 2ASEA 1QKIA 4C4SA 1PGJA 4XD7A 1PQ4A 4OSPA 2O07A 3QYJA 1PFWA 3RK0A 2QRHA 1CY2A 1OPXA 3ONEA 2CNLA 3C3YA 4Y9SA 3IERA 2YBDA 1BHO1 5F4BA 1UDRA 3VOSA 4D79A 1C9MA 1RI5A 2CVPA 4AJ1A 1GFZA 2VN8A 3ETGA 5BSEA 1TAGA 4UBIA 4AJLA 5DP1A 4WCVA 1ABFA 3ANSA 1K7SN 3G3EA 3I9V6 3KPJA 3SKVA 3Q2OA 4C20A 5FWYB 2QAGB 1AHIA 4W5QA 2XCLA 3CT4A 4JL6A 2DUUA 2H1VA 3VKVA 1TU3A 2XCIA 4WXEA 3MF4A 4L8GA 2BEVA 4YJDA 3VDXA 4JJFA 1DEHA 2C5HA 1T8TA 2PTHA 3KAJA 2R5WA 4RD3A 3QTTA 4UZFA 4KPFC 2ZB2A 3S8MA 5ITZB 1V3VA 1K4YA 5G0UA 3RIXA 1U8CB 1XG5A 1ZCJA 3GPBA 3I9LA 4GBGA 4MKIA 4CLHA 3E9YA 2OV3A 2FETA 2YJ6A 2CJXA 5ITVA 2HPVA 4YQFA 1VE7A 4C05A 5CVCA 1PFQA 1X1QA 2IL1A 5BNTA 3ICQB 1TLFA 1J5PA 1MUUA 4AZVA 2X6TA 2OFPA 1PR9A 1ZXXA 4GXNA 3TRIA 2G83A 4I4TF 3KDSE 4BX9A 4EUNA 2PEYA 1ECCA 2DTDA 2Y6UA 3DXXA 4CM4B 4BGEA 4L16A 2FPUA 2X7HA 3T1OA 1GRNA 3LNTA 3ZIAA 5B3KA 2L42A 2FVYA 3CWQA 3IQEA 5K51A 3DE1X 1KYTA 2B6NA 1O5IA 3GRPA 3WYAA 3LPCA 4I9FA 1QVZA 3GLKA 3CX3A 4MW9A 2DHDA 1DCMA 2WD8A 4L9RA 3I6MA 4ZGBA 3ADBA 2J4FA 4ZRMA 4E70A 3JQBC 4RA6B 1JG4A 1XQVA 1IHXA 1QHFA 1FLDA 1XZPA 2EBUA 1YS1X 4MS4B 5DMHA 3W5CA 3TEJA 3UC9A 1O4WA 2BCJQ 1R27A 3LMKA 1SCDA 2J3MA 5PNTA 5DCYA 4RGBA 2JATA 3PEYA 4QIHA 2W9XA 5HS4A 2J5KA 3FTCA 4J4TA 5ALUA 1XL0A 4PBSA 1I33A 2X42A 1TAQA 2WTXA 4JJKA 5G41A 4QM6A 1PCXA 4PLCA 3VTKA 3D7MA 5EN4A 2H31A 2X8AA 1J0XO 1Z2DA 5C4GB 1UT6A 2NZUG 2N0SA 4RKYA 5TQ0A 1TA9A 2NO0A 3ZD7A 4PQRA 2Z2XA 3HUUA 3F8SA 5CFPA 1O5OA 3OX4A 1HL3A 4IHJA 1EXVA 1DCFA 3EUWA 2F43A 4BAGA 2OTCA 1XDSA 4PZPA 3T38A 4B9EA 4PQEA 4DLBA 2QRKA 1IMOA 3CSSA 1N2XA 5AJHA 3OIDA 5BR1A 4V0NA 2ANCA 3L7AA 4FS3A 4NK4A 5JUWA 1JB1A 2D1YA 2EP8A 3DFIA 3SYLA 4OTZA 1YNOA 2NN3C 4GZ3A 2CHEA 2ZQZA 5F3DA 2WSSD 5ECYA 4BRSA 2MMCA 3HXKA 1KAMA 5F1KA 1CR6A 1JI3A 2ODBA 3GJ6A 5BVHB 5C1BA 5EG5A 4H1VA 5BOVA 2F8MA 2G08A 3HUTA 4ZOLB 4DR1B 2FW7A 1N34B 3E23A 1QWOA 2AR9A 2JZNA 4RMNA 4U9HS 4UCQA 3GHYA 1A5AB 3TPFA 4QVKA 4MRMA 3EJWA 1AE1A 3WP1B 5C5IA 3QELB 3FUXA 3QWBA 4BKPA 1EFPA 2XXAA 2BC9A 1XTZA 2HLDA 1G6KA 4OA5A 4HEA1 4L5BA 4ZQIA 4HXYA 3H9CA 4DLLA 2VKTA 4GYKA 3SF0A 2HHAA 1VI5A 4W5WA 1LJUA 3F67A 3LT2A 4OP2A 4KVAA 1NJFA 1V5FA 1KL7A 5LQUA 2GPAA 1TIPA 4QATA 1ICIA 4OAPA 3QU2A 5T6BA 3LIIA 3TBKA 3CH5A 1KIAA 4Y2PA 1Z5GA 4R7TA 1XEAA 1RHUA 2QMYA 1IAQA 2WW8A 1ODSA 5CW1A 2XNDA 4HWOA 4QLAA 3GU3A 1B74A 2IEIA 5KQRA 2PUGA 3ANNA 5FRDA 1R88A 1PGPA 1XRPA 3WYNA 3ZCQA 3LBAA 5C81A 4YJ3A 1FIUA 5HF6A 4HSGA 3NR2A 4M0EA 3AEKB 2BGWA 4PYLA 5I4IA 1GTZA 4CIAA 3N6RA 2D6FA 3ZWMA 3GCGA 1VHTA 2AFIA 3Q8KA 5TR9A 3TR0A 5FA6A 2GTPA 3NDJA 5HR5A 1TQHA 3DBOB 4KFTA 5G4LA 3Q7TA 3GELA 1V96A 3ZU6A 4IUCS 1PF7E 2R6DA 2V7TA 3D3NA 5FF9A 1E6EA 4ZZIA 2PZ8A 1GSAA 3H5AA 3PXCX 1P2VA 3U3MA 3TNJA 2Q4EA 4YUXA 1GGNA 5FDFA 5BRNA 3DUWA 1W0KA 5ISMA 3AKYA 1E9DA 5IEJA 1Z5UA 3LLSA 2BI4A 3WWOA 3OWHA 4DB2A 1GPUA 2H1HA 4E94A 2WWIA 2CNKA 5DTMA 1J9ZA 1M0WA 4GKVA 5B58T 2PT9A 1NI5A 3GJYA 3DHVA 4W1SA 1PSZA 4JZYA 3DMDA 3S8YA 3I2YX 5BN4A 3UTDA 3E6AA 5DBOA 3A11A 1JQ3A 2QTHA 2LW7A 4Z1MA 3U26A 3REOA 1OB2A 5F9HA 3OLQA 1VLMA 3WNVA 3ZCVA 4G8BA 3PJDA 2WKQA 1K7FB 3ND9A 3PKIA 2YBEA 4CPDA 3ZH9B 3DEKA 3RFUA 3UBTA 1LS1A 3ZBQA 1Y5LA 1NF9A 3NHUA 4C2TA 3UEOA 3R5JA 1YQUA 2BR4A 2E89A 2O6HA 3QKRB 1UBRS 4IDQA 1VE1A 5D3MA 2X0RA 2VKQA 4GC9A 3RHTA 3ZGXA 3BGSA 3QENA 4UEOA 1J6UA 1PG0A 3ZTYA 4B5KA 5MHTA 1BDJA 5KDLA 2IE8A 3K8OE 1V8DA 3GN1A 4ENPA 3A8TA 2X5XA 1XP8A 2Q0QA 1GNQA 4GVXA 3W4KA 1JQ5A 4AMBA 2OAQ1 3LJKA 4EYOA 1YCGA 4CODB 1P72A 4N6NA 3DVSX 3PCTA 3FNBA 3FW1A 1SBHA 3HJRA 4YWJA 4ZCSA 1LY1A 3SZRA 2JFUA 3WIOA 1OA0A 3EFOA 4UXHA 3F2IA 5LMUB 3RFVA 2SHKA 1JSLA 4WDRA 1XVVA 4YAOA 5IN4A 1O77A 3LGXA 4DPKA 2O7RA 2X8BA 2X8JA 1Q50A 3FBTA 3EVEA 4UREA 1UIMA 3DV0B 2VQ3A 1GFIA 2JFHA 3BB3A 3R23A 4PZUA 1EBFA 1IQUA 1XRRA 4BOYA 2PGDA 1DRWA 4K2AA 3NYQA 1ZVQA 2VDOB 3BGDA 4JSYA 5CDFE 4DUZB 2FDCA 3JARB 3AI2A 3KWFA 5G2OA 1KFCB 1KP3A 4WKPA 4M7WA 5J5AA 3WS7A 1M2GA 1DJPA 2HHJA 1JKFA 4E2YA 1HFEL 1R6BX 3PLRA 4RLHA 3PC3A 2BFNA 1KO1A 3CNQS 2H5IA 1PEKE 2I80A 4MPJA 5C1OA 3PHGA 4HX9A 4WXPA 2AG0A 2HK8A 1JEYB 1DC5A 2RK6A 1NC3A 1U8YA 2FWRA 4P3NA 1VB5A 3PQ8A 2I2CA 2H92A 3VYUB 4G9EA 3UAOA 2YDYA 2QE7D 3R7NA 4O1HA 2XEDA 4AZSA 4CGZA 5L3RA 4TYYA 2D54A 3E70C 1GT91 1W25A 4IVQA 4DDVA 2PG3A 2QQ0A 3EAFA 3KZNA 4LHEA 3UGQA 2C3YA 5EEHA 4Y7CA 1E77A 2CV0A 5B2EA 3P0RA 3QPCA 2AI1A 5BWNA 2W8ZA 1GG9A 2MR5A 5EXDA 4BFCA 2HR1A 3EDCA 4LGMA 2B8NA 4OQFA 3OHMA 5E7MA 3V7WA 1T9CA 3VAAA 3OZWA 2XWBF 1WF3A 1R12A 2QP9X 1XA4A 3Q9SA 4P4NA 5HQJA 4MVJE 4X6LA 5AVKA 3PVZA 3WIDA 1GKIA 4G0VA 1UMKA 3R40A 5H68A 2B1JA 1SXJE 1H23A 2Z8YA 3E61A 4K87A 4B7ZA 1BWPA 3L8DA 1NQAO 4MWGA 2PZGA 2NU8A 4X91A 5IAKA 5HGXA 1E1DA 3RYCA 2TYSB 3IT0A 4KH1A 3D3EA 5CT9A 3NTLA 1COWD 3WQBA 1Z3IX 2XGSA 5P8WA 4CV2A 4O3FA 5KJFA 4ICIA 1IHYA 3ENZA 2WV7A 2ZI7A 1W85A 1O0BA 2UUBB 1AQNA 1G7TA 2EW2A 2MINB 2WRZA 2B9EA 1FTWA 1E96A 3QTLA 4FCCA 5CYOA 5AK4A 4DLVA 3A05A 5LOVB 1F7VA 1CDEA 1JX6A 1YZYA 4J7CA 2VO1A 1Y1SA 5BSRA 4HWSA 4EB0A 2A35A 1SUIA 1JIKA 1X77A 2EFHB 1TUBB 5EE9A 3VR6D 1UZLA 2HL6A 3QHAA 4TLAA 2B82A 4CN9A 1E1CB 4DUYB 3PNKA 1VKJA 1VLJA 1U3WA 4ARCA 4BVJA 4KGZA 2CVQA 4RVFA 4BP1A 5JARA 2IEBA 2VHQA 5IW8A 3L1VA 1L4HA 4JI8B 3UJ9A 2AG6A 1OKKA 2QV7A 3A4IA 4I9UA 1U7WA 3IAFA 3CWCA 4LMRA 4DSNA 4KV7A 4UPDA 4DJJA 2AEMA 4KR0A 3RRXA 1Q1EA 4QBIA 2Z6QA 1B2LA 1DXQA 2DPGA 4BMCA 3EMDA 2JGEA 2J0SA 1XSEA 3FTFA 4JVLA 4UKDA 1MF7A 4L95C 2EG9A 3PCRB 1ZCFA 4YMSA 2CLIB 2HT6A 2QM3A 2HSWA 4L8WB 4BLRA 5DW3A 1FRZA 1YFLA 4PFQA 1NU6A 1IATA 5MFZA 4HBZA 6REQA 2GJ9A 2GERA 3ZZUA 2DYKA 3ACBA 3A37A 2AK2A 1RXEA 4AJ4A 1HFWA 2HRDA 5LB2A 3WRXC 2FPKA 4RJIA 2QUBA 5DE3A 3LNCA 2XMPA 4YJ2B 4KQFA 5TEWA 5TMDA 3IB3A 3W78A 3ZDRA 5KKCA 4WERA 4ER5A 2DWUA 3E4DA 1FVFA 4NH4A 2C0QA 3NIDB 4B3DA 1QLHA 3DBHB 1JJBA 3Q98A 4LDAA 4MCIA 1C3EA 4P5EA 5ILQA 3LCJA 3N0RA 4Q0MA 2Q9CA 3T06B 1T5OA 4GEKA 2XKBA 2L17A 4TVSA 3KHSA 3VYTB 5IYZA 2P3OA 2W6OA 1NVAA 1SUBA 2XQFA 2CDCA 4ZYLA 4DDWA 1A04A 1APBA 4PZ9A 2V4ZA 4JQYA 5K5EA 3TIXB 3RTEA 3WLSA 1XHFA 1UC9A 5CLLA 2WHPA 3ORHA 3PRJA 1GDHA 1QGED 3CE6A 3HWSA 1GL9B 4HXEB 1QP4A 1Z39A 1VJ5A 2JJ2A 2ZRIA 3QIAA 1MAVA 1O94D 4R16A 2Y0CA 2FZGA 3ZU2A 5KQGA 1JH9A 1V1RA 2CV2A 2PAAA 3OTGA 3GHHA 2C4NA 4R2WA 5B37A 1HDIA 1NATA 2WTEA 3TM4A 1BXKA 1I8TA 2IEGA 2GAJA 3H2JA 2J7KA 4TMKA 4IJMA 5AVJA 1XZMA 3IGFA 4PO3X 2XSZD 1CYDA 2QN9A 2BH2A 1KR5A 1KIFA 1NM5A 1E7SA 3O8RA 2CF6A 1V5WA 1G3UA 1SBNE 1LC3A 2WAXA 3B53X 1FS5A 2Y1GA 3GJTA 3OPVA 4YH1A 5ENVA 4CHGA 2IIBA 2VQ6A 3KYDB 5BR8B 3BF7A 5AJVB 5EE1A 3AUUA 3ZG6A 5KNDD 3HO8A 2C3OA 4N76A 1M6VA 3HJBA 1A76A 2JFFA 1JR3D 3FLMA 4L9AA 3NKLA 1U3UA 2PBZA 1KMHB 2RHWA 3A6LA 3LE8A 2D3TA 2VJNA 2W2QA 3D54D 3LM8A 4TUYA 5FBQB 5T4EA 4D45A 5C5CA 3NJ4A 5U4QA 2V58A 5FTWA 5FBHA 2VHXA 4EZEA 4EHKA 2Y93A 2OHOA 1OI4A 3ZZTA 1VG0B 4X94A 4IIYA 3H6GA 4GP6A 1EK5A 3PYMA 5JZMA 5LZ9A 1P31A 3TLXA 3AR2A 3QJYA 5H9VA 2E1PA 4E5MA 4UTVA 1IJEA 3H42B 4IIVA 1VLHA 2R68A 1M2VB 1K7XB 4PO8A 3FB4A 4CM6A 2C29D 2EWMA 3JTMA 2LXNA 1YJAA 2C83A 2W90A 1IY8A 2G9UA 2OO3A 2YQZA 3I45A 5I3ZA 4FYPA 4LZNA 2FX3A 2DHQA 3RC8A 4BX2A 1Y5MA 1R6XA 4UUPA 2GBPA 5DSTA 3ABOB 4TMFA 4A6PA 5KHOC 13PKA 4UJ3A 1LKZA 2ZRFA 4G86A 1E9BA 3MJ4A 4BNJA 5K0FA 1KRWA 2XHZA 1EP2B 1GTJ1 2OV4A 2QTLA 2AD5A 2RI0A 3V8BA 4CMBA 2JCXA 4DA0A 2GNPA 1C9KA 4ZOQI 4XR9A 1KOGA 1Q91A 1GCAA 1Z45A 1NHGA 5E6SB 4B0PA 5JSZB 3V2HA 2UUCB 3EUEA 1Q11A 1EQAA 1A3CA 1ODIA 3CG0A 2QVYX 3FNIA 3TQQA 4QXRA 3IP8A 3V1TC 5SZIA 3Q7QA 3T5BA 5DOVA 4X6YA 5AVRA 1K9SA 5T4FA 1QIFA 3QGMA 4PLPA 3THOA 3CVYA 2QRVA 4M8KA 4RYLA 4Q3CA 2BYTA 2JFYA 3ZZ1A 4C0HA 4C88A 4YRGA 4G5GA 1ENZA 3EEIA 4KZKA 4RH3A 3V4FA 1FFXB 4FCTA 1E3QA 2E4ZA 1UFOA 3CJRA 1KXZA 2HMUA 3E3AA 4N18A 4UJ5A 2Y71A 1EDOA 1H3FA 1QZUA 1VIMA 4RCYA 5AHWA 1IRXA 1QFJA 3BORA 2CFCA 2GEJA 4HJXA 4WZAA 4BC0A 1KSFX 1JSCA 2Q4OA 2OV1A 2H6EA 1POXA 3EGDB 5FPTA 5IVDA 2QEQA 2YJ3A 2CY0A 3IEIA 2PSFA 4L0MA 3KIPA 5LQNA 4BIIA 3KSMA 1AM4D 1UKZA 3DZCA 3OFVA 1JQAA 3E7WA 3L46A 2BRUA 4MIEA 3ZDFA 1LX7A 3COSA 4QPCA 4BV2A 5JCPA 4D9IA 2WHQA 1IIRA 3T7JA 3H3JA 4IIHA 1CUYA 1GZHB 3CKLA 4WI1A 4DR6B 4CZ2A 2HK9A 3FDZA 3R77A 3OH8A 1W5AA 2DOKA 3OWOA 3GRAA 4GX5A 4AO7A 2ZCUA 2DPMA 1E1QD 1GM5A 1SA0A 3I92A 2ET6A 4DCPA 1E4OA 3ZWCA 3OEHA 3OTOB 2C3MA 2YKGA 3AEZA 3P0HA 3QBDA 1T1IA 4EY5A 3ZV6A 2VNIA 2ISCA 3KWJA 5ETJA 4FDLA 1T5SA 1CP2A 2ZJ7A 1RWPA 4XWOA 3T1TA 4IOJA 5U9CA 4AI6A 2PRJA 1MNAA 3FX2A 3II6X 5JFGA 2SCUB 2FN4A 4PRYA 3DH0A 1EIZA 1UPTA 3ICWA 5IAEA 3FMVA 2OHVA 2PZEA 1Y7LA 3A1VA 4C4YA 4X5OA 1HRDA 2QKYA 5KHAA 1ABEA 3H5IA 4UMFA 4F6CA 1BG6A 4HNGA 1XF1A 3WRWA 1SXQA 4X1YB 3OIGA 3OJCA 4LWZA 4N3AA 3K30A 3REFA 1MABA 4DARA 4E5VA 2Q1WA 4MGKR 1I4EB 2V8BA 4W99A 2IEZA 3TDKA 4B46A 4DMHA 4ZYYA 4MWTA 5IDVA 4MA5A 4U6SA 2I65A 2CL6X 1DT5A 2R6GA 4NDZA 4WFJA 2YN4A 1CZNA 1WMBA 2A7XA 2EBHX 3KCNA 4JYPA 1RAIA 1ULTA 3D5EA 5CHEA 4D3SA 1XN1A 4HCJA 4H6XA 3EVNA 3GAZA 5LL6P 1CXZA 1UM9B 3E7DA 3K6KA 3O8DA 1DWQA 4J1TA 4Q3OA 4S1NA 3SXUB 1LF5A 3T5DA 1TEVA 3ZNQA 4ADSG 1GZ5A 3GAMA 4MQBA 3NNNA 2W2PA 1AGNA 1JLHA 2YHIA 4OHKA 5K3FA 5K3CA 3ROGA 2VYVA 1U7OA 2FP4B 5A5VA 5JYCA 1FZQA 1XKXA 3K09A 1G98A 2ECKA 1VL2A 1PJLA 1QOZA 2XF2A 2PXHA 3FPCA 2R6FA 3I53A 5KQSA 5CM2Z 4FZVA 5I4CA 4CMCA 3TTVA 3CS3A 5FOVA 3K5IA 3M9LA 1JTVA 2EBWA 3MBKA 2VP3A 4RADA 2IYYA 2RHOA 5DNAA 2O2DA 1OF1A 3OVMA 2J09A 1KJJA 1E5DA 1OGJA 2P1ZA 3HU5A 2MTBA 1VHQA 4RFLA 1EX1A 4AULA 2EEPA 2G1AA 2C5EA 3BQMB 5IBPA 4EPYA 5C46F 4WN9B 2I5PO 2VH1A 1H2FA 2YOHA 5DEIA 3GP8A 2XUKA 3WFZA 3DM9B 1E5TA 5I9TA 2DQKA 1XZNA 3IKMB 4J0QA 4N03A 2BGRA 3WYCA 2D7CA 3W2GA 3RANA 2CUZA 1WSWA 1H2HA 1OGYA 1R0LA 2YWFA 3ZCPA 3SYMA 1BD4A 1MOZA 4G56A 2JIOA 4G0MA 1VSUA 4UE2A 5AW0A 4YNBA 5HZGA 2Q3EA 4RMHA 4LXHA 2X9QA 5GQSA 5FTKA 3NCTA 4O25A 1CX9B 3CF4G 1Z6AA 1G20B 2VJDA 4P0QB 1E79D 4HLUC 4XYEA 1WDLA 4KPUB 1KY5A 3EWAA 2D5BA 4E31A 1IUNA 3SHTA 2JA1A 3SIXA 5ANRB 2VWPA 3MGAA 2QNRA 2OD7A 4JVNA 5H81A 5FUWA 4FMDF 4R2IA 4QTZA 5DH9A 4LF7B 1XKQA 5EUBA 3BXHA 5FBWB 4CTOA 4O6VA 4PLGA 5ALFA 4QECA 5HK9A 1HG1A 1IZYA 2JIPA 2RONA 4JASB 3FMPB 1TK2A 2IEDA 5JSFA 1AQ6A 3EIWA 3EVBA 2HRQA 3I28A 3SLKA 3I1IA 2YJTD 2AC2A 5JC8A 2ZS9A 2IIVA 2FFBA 3NALA 2IEAA 2NG1A 3GC6A 2OC9A 3T7IA 4KLNA 1KEEB 4RIGA 2X7XA 2G09A 4OGKA 2JLYA 2HF8A 3NATA 5FO1A 3JTEA 2OP0A 5FUVA 2YWRA 5FUYA 1D09A 3LCMA 2XUPA 2ZWAA 3B6JA 3ETNA 3WLJA 5C1DA 1ELOA 2C3UA 3KTFA 4RSMA 3SBXA 3QOYA 2V0GA 5JXHA 3NBYC 3UT6A 3W6NA 5BN3A 1LLCA 3SKXA 1U0RA 1O6BA 2OO7A 3L8HA 2OUKA 5B6JA 4YUZA 1B16A 2JGMA 2WI8A 1YFJA 4BVAA 2O4CA 3FCAA 3AF5A 3KALA 2B99A 1JPUA 3OSZA 3PNPA 4XX1A 4ZU3A 4AJ2A 5J2TB 1IFXA 4BFYA 3OA2A 1Y8AA 1VE6A 3FDJA 3BE6A 2FEWB 2OBMA 3GLIE 1U6IA 4LGCA 1BVRA 2HQ1A 4Z86A 5ERGB 3QEOA 1KEVA 4FOOA 1ZVJA 3BMNB 4MUXA 4NKRA 2QUHA 1W35A 4X6XA 5IC6A 4BGUA 4CG0A 2JVIA 4TTPA 3WAKA 1PAUA 4H0NA 4LC0A 4PSAA 2O1XA 3GA5A 3ICOA 3S2YA 1YZTA 1ZIOA 2PRYA 2VPZA 3TD9A 5JFTA 5JJ5A 1ZGHA 1VZ3A 3EASA 3MD0A 1R6UA 1SULA 2ECOA 3AR8A 1T0UA 2FUNB 2C2GA 1Q16A 2NZ2A 4Q03A 1U9CA 1O9BA 4TPKA 1RADA 1RI4A 3VR3A 4RX1A 2DT8A 5A6SB 4MGIR 5D51S 2XLCA 4UOEA 1E3WB 4DPMA 1NDHA 1Q14A 1Z25A 4N0DA 3WWEA 5DBFA 5A02A 1GNTA 3MT9A 1NF3A 1JJIA 2A14A 2PZJA 2DFLA 3IRUA 2QAGC 4IW3B 4WNYA 1U80A 4P9NA 3GJXC 1YBVA 3IR5A 4W9NA 4ZQBA 3BD6A 3VR4D 1YZLA 4QQRA 2V7QD 2L19A 2QYTA 3NHYA 3IAM6 2NU7A 3PTLA 1G5RA 1CVLA 1JQDA 3EWNA 4IRUB 4MUJA 3RC7A 3WHIA 4ARZA 1PG2A 5JEDA 3CUKA 1LU9A 2ATCA 4ZEVA 4DMUB 1BMTA 4BCCA 3MUEA 1CZUA 1WD7A 4ILEA 3WMFA 4CM3A 3W9YA 4CCSA 2G25A 4CQMB 5IJ0A 1NYQA 1XWIA 4G5FA 3RTDA 2FPGA 3EHEA 3N86A 7GPBA 5KVAA 2X4GA 2JLVA 3WV4A 4JR1A 1A5BB 1I9CA 4Y9DA 2FX5A 3WK8A 3L7BA 4NBRA 1QU2A 3I37X 1Q2UA 2WHEA 2Z2YA 5JZOA 3ZCUA 2F4VB 1LS6A 2H3HA 1CRPA 5JMWA 4TYWA 2GKGA 3STTA 5HQ3A 1KWKA 1P1IA 3I76A 2WPDD 4EM6A 3GW8A 1JG3A 1XO1A 2C9DA 3OZCA 1JLSA 1OBHA 1X14A 1G41A 1VSQA 4BMNA 1BJKA 1FFHA 5HPYB 1YZNA 4PICA 5LP6F 1IY9A 1KS2A 1YE8A 3I0NA 1L7VC 1MEEA 3I6BA 1DAPA 4H17A 3FUWA 3LLUA 4QGFA 4UEWA 5GZ3A 2VPWA 3RS5A 1U28C 1EWKA 2QW1A 1ZJZA 5TQVA 2UU9B 5FT9A 2QRMA 1VGVA 5G4KB 1QGYA 4CMAA 2ZUBA 2ZSBA 4OXKA 4RK4A 3RSHA 2JFBA 3V8EA 1L5YA 4ZAFA 3V33A 3WI7A 4AIRA 5M04A 4Q7KA 4P86A 5IXSA 1BEEA 5K0JA 4JY7A 4X7BA 5HFAA 1EX6A 3OUTA 1DKPA 3HDYA 1CRWG 2F00A 3AVWA 2ZTVA 4IL5A 1ZR2A 4M6WA 5EJ2A 1RDFA 4S04A 3WGQA 4AKTA 4MV9A 3T1NA 1M7HA 1WW2A 2DUWA 3BULA 1EM6A 3PTZA 2FHPA 4O4JF 5H83A 3VSCA 1FXSA 1HFJA 4Y98A 3GFSA 3I1FA 4WQMA 1RQRA 1TC2A 3GMSA 3K1AA 5FEMA 3UJPA 1OC4A 3UKDA 3MA0A 4XOIA 5BMVB 2BBTA 5ELMA 1XD9A 3QFHA 3KBBA 1ACJA 3EEOA 2PYIA 4MHOA 4PY2A 5AK3A 4DVJA 1N78A 1PFUA 3EA5A 1SVIA 3SR0A 1PL0A 2N9UA 4YC7A 4XOUA 4C14A 4C43A 3ZLJA 2GO1A 4RVNA 3R9IA 3HM9A 3VO2A 3HBAA 4FGKA 1V6CA 3VM6A 4E7PA 3Q8XB 4Q12A 1Y6GA 2VK2A 1KHTA 2GQ0A 4H16A 5IPFA 4HKTA 5I9MA 4MQEB 1B42A 3X1WA 4DLRA 3O4RA 1JHXA 2AD1A 2ZRNA 3ANMA 3OCWA 3ZEAA 3T5AA 4RF5A 3KFXA 1CNEA 1J8VA 3D8SA 1JMYA 1T5DX 5TY0A 3P0FA 4KBGA 1XPOA 3TLBA 4ZQGA 2RHMA 1QAMA 2ZPAA 3PDWA 5G3YA 1X9GA 1ZKMA 1CUXA 2VPXA 1MHTA 5CPBA 2R8PA 1E9VA 1Q7BA 3IPRA 4JP2A 2WTUA 2Z43A 3A6DA 2G9RA 4F45A 3C97A 1UBOS 1X1EA 1GL7A 4DN6A 1JIJA 1AB6A 3CH6A 5BMOA 2X1MA 3C5VA 2PMCA 4I81A 2JCGA 1CW2B 2Y8EA 5KNBD 3N6VA 3CR7A 4MYHA 2DHEA 3UJBA 6ADHA 3GLGB 2EFGA 1U1GA 2RKBA 4ZTUB 4UHDA 4BFWA 4QULA 3VDRA 3U44B 4Q4AB 4FFBA 1WV0A 2P5TB 3VC3A 4OEHA 5KYGA 3OPMA 1FSPA 1X1CA 5HZKA 1V48A 3FI9A 1TCCA 3GMTA 5D7NA 3N59A 2Q3BA 2CL5A 1NULA 1BHJA 1KYXA 1YOVB 5AK5A 2JJ1A 2D8MA 1R9JA 2X3UA 1F2TB 4AF8A 3GWGA 3ILHA 4Q1VA 4KAFA 5FWXA 1VC2A 1D0SA 3GAAA 1NY6A 3KB8A 1TO1E 2OGWA 3ML1A 3USES 1KQGA 4N0EA 4UBJA 1PR1A 3WX0A 1OZGA 1NPTO 1RBYA 1REQA 2XYVA 3QMVA 4WBNA 4CF3A 5JJCA 3I5YA 4L4SA 2JIBA 3I9OA 4XGKA 4J0IA 1BMDA 2AKYA 4ZI5A 1ZC4A 5AW9A 1K7CA 3E9CA 1W59A 3R4CA 1EYZA 4GYYA 1RXYA 2UZ0A 4QUIA 5EQDA 5JAQA 1LRJA 3JQ8A 4YCDA 5G1PA 3GFGA 1VIYA 5JECA 5DHPA 5FI3A 3UATA 1DX9A 1RABA 3SDZA 4CMKA 2OESA 4TQ9A 2PUFA 2JD0A 4LF9B 3F6YA 1XAJA 5FWNA 2O59A 4PBTA 1SC6A 2J48A 3WGMA 4IDBA 1F12A 5BV7A 2XV1A 3I09A 4IH9A 2HGSA 1HORA 3D7RA 5HRCA 3EOZA 5IASA 1TJYA 3AIKA 3L1KA 1E2NA 3PR1A 3U7GA 1QE3A 4DV2B 2PUCA 2CXHA 4YRKA 1OQAA 2AOUB 1P61B 1XK7A 4QC2A 2CD9A 3DTYA 3SF8A 4BTLA 3G2NA 2A1UA 5BPFA 4FLMA 2VQFB 4RE5A 1YL7A 2FZLA 2P4EA 3BZBA 4JB2A 1GGFA 3W2TA 3FDIA 3GEPA 4YRDA 1PRYA 4Z8YA 4Z99A 5A4AA 4UHBA 4BPRA 4UEKA 4YV7A 1XLVA 4PYMA 3BFJA 2GKOA 1NASA 3UUEA 1N2EA 4DMKA 2QMQA 1UWCA 4QYXA 4TTSA 3LQQA 5LZ7A 3OO1A 3Q4GA 1JDJA 4D3XA 5KYXA 1BXRB 3JD0A 3HXLA 2QD3A 3KEGA 5IHXA 4D9MA 1NP7A 5DHSA 3B3GA 1JNYA 1EBBA 1II8A 4GKAA 3P9RA 1Z36A 4OB8A 1LBEA 2QPLA 3SJBA 4EHFA 2Z1NA 4N9QA 4OXXA 3WWPA 3EC7A 2V3CC 1XCBA 2CVOA 2C31A 4URXR 4ZALA 3N58A 3F7MA 2NMVA 3DEAA 5DNVA 4DQKA 3JWHA 4BV8A 5IJ9B 5JCJD 1Q7RA 3H11B 3Q0IA 5H02A 3H0EA 5TEVA 1TUEA 2KI5A 2Z3WA 1ECBA 2UVDA 2Y27A 1PW5A 1ZUIA 3EWIA 2GJ4A 4FCVA 5MGNA 4PNHA 4C7XA 2G6TA 3KYCB 4ZOLF 1PNRA 3P45A 2DSNA 2BJVA 4EHAA 4AJEA 4OBXA 1GZDA 5IAJA 3W8FA 5C7OO 3EFBA 1KI2A 2Z3VA 4G8DA 1M75A 3VC2A 1QIEA 1SO8A 4JL8A 3RWMB 2IDKA 3PGKA 7AT1A 5L9AA 3G8AA 1TAUA 1QYRA 3LG2A 4IUYA 5HKKD 1MO6A 2QGZA 4MCAA 1XEXB 5I9BA 2AR7A 3QXHA 4CF6A 2WD7A 4J7XA 4YJFB 2OK7A 4ISCA 1X0VA 1SWWA 5DNWA 5JCOC 2CFSA 1B23P 4EW3A 3AFOA 3ZU5A 1IULA 2ZE8A 3JX9A 4LQ4A 5AM4A 3TJRA 2WV9A 4LZWA 5B1EA 1PQWA 2FWPA 3M4NA 5KI6A 2JHAA 1VPEA 1ISFA 1FDOA 1TM4E 2AMVA 4OLJA 3S2UA 3K2IA 3O3MB 1KNQA 4PYRA 1H6DA 1TZMA 1RXCA 1T1EA 5ALMA 2CD7A 4J7AA 2ZSJA 3LPLA 4M7RA 1D2CA 4D8XA 3CZ4A 4WZBB 4YDRA 5JJKA 3M1IA 1CJKC 4DDHA 2VBCA 2BFAA 3WL6A 1RRFA 1KQFA 5CH5A 1YE5A 3BHIA 3V4VB 1IYZA 4EUSA 1P1KA 3L9WA 1L5OA 4KRGA 4KQMA 3HRKA 3LBNA 1ZMBA 4OYLA 3EXG2 4JJ6A 3MJDA 2AW3A 3TIIA 4AZWA 4J9UE 3ADCA 4KB5A 3T12A 3TDNA 4Q4JB 3FMFA 1Q22A 2EFCB 2C7OA 1C7IA 2AOWA 1X80B 2O0LA 3PWSA 2VP4A 2QX8A 3RH0A 3VR0A 2A6PA 1NE2A 2P2YA 4GBJA 3ZDCA 2WF7A 2ZZKA 4HDKA 2OBBA 4AL4A 1R10A 4CRWB 3HXQA 4P7GA 2ZW9A 2OBFA 2JGLA 1J5XA 1WUIS 1Z26A 2YWCA 3RVBA 3VMFA 3H19A 4XUCA 3TQHA 2X77A 1IXKA 1YZHA 1EZ4A 3F9IA 2YFQA 2O1SA 1HRKA 1O58A 1ST2A 3BWYA 2ZJBA 1RYDA 3N6XA 3LD9A 1Y1KE 3FOBA 3VJLA 2UXCB 1YGYA 2IDJA 4DIOA 4B85A 1FP2A 1UWVA 3QVSA 3ZE7A 4GOMD 5FBVB 1O96B 1UJ2A 2DKFA 2H2FA 2PRSA 1N7HA 1C41A 1SCIA 2FPSA 3LT0A 4B4WA 3MAGA 3EPJA 3CUYA 4HDMB 4JH0A 2NZ8A 2E9SA 2VJMA 1NKSA 4WY2A 2FRDA 3KKZA 4JGIA 5FL3A 3SBDA 4EF6A 3K0AB 3GP3A 2ZS7A 3P4UA 3LP8A 4DQUA 4YCCA 3DG9A 3VU8A 4YB8A 5EPEA 1EHIA 1GG2A 2GBCA 2QR2A 2IPMA 2W2OA 3TSAA 1IG3A 2WQ6A 1JBEA 2IYNA 3T5PA 1PJ3A 4E46A 3NHJA 1J2YA 2I8CA 1U2TA 2V7XA 4M36A 4OIFA 3WYDA 3RC3A 4BQEA 4YP1A 1JDVA 3BSYA 1QIHA 4KRFA 2FFHA 2I4MA 1ZP6A 2BM9A 1WPXA 2P9GA 3K0FB 3LV8A 1L7OA 3BK7A 4MUAA 4C04A 3PR3A 3WWYA 2SKCA 4PGGA 4N5LA 2QJRA 3K9HA 1AZWA 1O2DA 4K9RA 3OZ7A 1GTRA 2IITA 4KWTA 5SZJA 1E9FA 3NTRA 4KBYA 2G67A 1QMGA 4J0KA 3I01A 4MWZA 1VA4A 2GZSA 2ZDGA 4WNAA 1KQNA 5BURA 3LUJA 5KTOA 2XMBA 1DBIA 3ORYA 4EG3A 2ZDHA 1U0BB 3RD5A 1P8JA 3VYVA 5JH7A 2DBZA 3DCIA 1ZGGA 3U4IA 5GZ6A 3G5UA 4EPTA 5IU6A 4KTVE 4EW1A 2CFTA 3JYQA 4X8MA 2BDUA 2EDCA 3HR4A 2RGDA 2C7PA 1RNLA 2OCKA 3EISA 4AKIA 2Q5IA 3ESYA 5HDBB 4Y6RA 4MJLA 1AS0A 4OQNA 1ATZA 3LX8A 1M2OB 3FN4A 1L5HB 3H99A 3OCZA 5F33A 1JVBA 1N75A 2C59A 2PHZA 3AUAA 4ZT7A 1ZOLA 4KC0A 4F4UA 5JI3E 1INLA 2V03A 1IJKA 4N01A 5EXEA 1JTFA 4BRZA 1CUEA 2KM1A 1JEEA 2BFDA 2CJFA 3E8SA 3FNRA 4JEIA 4RABA 2X1VA 1Y8QB 3L40A 3N7TA 3MG9A 5CDHA 3BJRA 2WYOA 1JH8A 2DULA 5C8ZA 1KAEA 2F7SA 4MB0A 2HTFA 4JOQA 4NU8X 4OQ4A 1IZ9A 2BTQA 4QASA 4KN5A 4XFDA 1RACA 1YHNA 2FEPA 2R85A 3VNUA 1B7GO 1TIBA 3DL4A 1J99A 3UXYA 1AU9A 2JIZA 2JKYA 1O9GA 3K6JA 5IFKA 3IKTA 1IN1A 2WG1A 5AUPB 3RGWS 1JIQA 1WD5A 1MO2A 1YRYE 3GNSA 2OYRA 4NOJA 2IDMA 1T8PA 3RSQA 1I5EA 2JD2A 1OREA 3EZGA 1NLZA 2GZRA 3IOMA 4RWEA 3VJKA 2RCYA 3RLIA 3ORRA 2CHVA 2MSLA 3LBYA 5BSMA 2J7PA 1CE8A 2BFBB 1AMUA 4DRXA 2Q4BA 1JB9A 5J1TB 5K0EA 2YZ2A 1QM5A 3O4HA 1RWQA 1ZM3A 4F56A 1XBTA 2QBYA 1IOVA 1MO5A 3BB4A 3PXEA 2FGKA 4OJQA 4F4HA 1T29A 4TQGA 1CNMA 2REXB 4MW2A 4QLOA 4HF7A 4HQFA 1J21A 2I78A 2NADA 2GBGA 1SHTX 3DMYA 3B5IA 3NM5A 3NYIA 4DTCA 2UXBB 3EIOA 3DEZA 2LKDA 3I05A 4IQ8A 2UUAB 3RFTA 3KT6A 4EB6A 1S7GA 5EJ8A 4RULA 1C9DB 1HZJA 1U0EA 3ME5A 1FP4A 1OSNA 1U1DA 2I2AA 3MMXA 3OEEA 4ZI3A 5LOVF 1YA8A 4ZIRA 2IIPA 5AOBA 2GN8A 4NMWA 1DJLA 1PFYA 1MORA 2Z6AA 1XJCA 1Z4IA 4QDTA 5CB8A 1JJFA 1FFXA 1QMPA 2C4WA 1TM5E 5ER6A 3FF1A 1YQQA 5K09A 1X7YA 5DLEA 1QRAA 1VP3A 1PEAA 2BLNA 2GZ1A 2R65A 4ARAA 2H4JA 2EWWA 4BYGA 3QEJA 2C1XA 5KYYA 2ST1A 4FDAA 3R7WA 4NWIA 1ZD1A 2YXBA 3KR1A 1XTKA 5BNFA 3UAGA 4JDPA 2P35A 4L4RA 1WA5A 1R8YA 3A1EA 5TPWA 1BKSB 2X1HA 4N5HX 5HF8A 4EG4A 1T91A 1TTPB 1JZSA 1YVRA 1Z4JA 1LVHA 1YRLA 3GDOA 4Q9IA 1XFDA 3TQSA 1NYTA 3HQ4O 5JQGA 2R00C 1A69A 2WUVA 1JEDA 1TVMA 3E5HA 2R1UA 3EEQA 4NTZA 1T6YA 4X1KB 1Y9EA 4YDHB 2HF7A 1XZHA 3I3OA 3AVOA 4RZIA 4ZU1X 3RRMA 1SNYA 4B73A 5HOQA 1RYYA 3EYWA 4CYMA 1WW8A 2EG5A 5KAPA 3S7ZA 1OH5A 5JDCA 2GZ3A 4AMYA 3HCPA 1E5VA 1KYVA 4LKRA 2FPRA 4NBKA 4J3NA 4BO8A 3BL8A 1NBAA 3IUBA 1QYXA 1CQIA 4HS4A 4NU5A 3T7AA 3T7SA 3GZJA 1G0NA 2JRLA 4L0CA 2C4TA 4S1TA 4ZYZA 2E48A 4KQWA 3RVMA 1T8SA 1O95D 1D0VA 1UC8A 2OGUA 1OLXA 2W2VA 2ZBDA 3H5WA 4YJ2F 5E7IA 1X15A 2R0QC 3KQPA 2XECA 3C3DA 1D5CA 3FF4A 3MWLA 4KX5A 4O4HA 5HHTA 4OM7A 2IU4A 2M6LA 4JDUA 4YIHA 1E6LA 4UHKA 4HX5A 4ZVMA 5SYMA 1Z7BA 3PUKA 6CHYA 3ND7A 3MJSA 3W6ZA 4QJ3A 3LUGA 2DLCX 1QS0A 1GQQA 4QOGA 2Q27A 5LWHA 2QMOA 3O1LA 3QPAA 2ZRJA 3L7DA 4B8ZA 3A1TA 4IIJA 2WKSA 1IBLB 4CLOA 1FDRA 1KEUA 3U37A 1AA6A 2IYVA 3SYNA 2MCFA 3ZWWA 3PQ6A 4BLPA 4F60A 2XOXA 4ZODA 3A9WA 1MP0A 5EMNA 5K7SA 2FQYA 1YZFA 4RIFA 2V6JA 5IJWA 4B76A 2MYUA 3ND5A 1XJQA 3W05A 4DFDA 2NU9B 2NYRA 1ND6A 4YCNA 1KYZA 1Z35A 2ODNA 2VDVE 4D3YA 1Q0RA 3MXTA 4LSWA 5JSKA 3T9BA 2X58A 2HZ7A 2PR7A 3KOWA 4LXXA 1R50A 1EI9A 5LFAA 4R9SA 2JAUA 1IUOA 2QUAA 2XRMA 5FOSA 2UDPA 4EMSA 5B1HA 4US2R 1FSFA 1I4DD 1Y8CA 1TYDE 3DTVA 3ZI0A 3JVDA 4V3CA 5K8JB 3PJGA 4E5KA 2WTAA 5DTRA 1PIWA 1OFUX 1VBKA 3IOBA 1Y4UA 3DYVA 3NOXA 1R4MB 1ZH8A 3Q7RA 5B3LA 1LV7A 2BGLA 2WNSA 4I2VA 3GLFA 4D9KA 3TVYA 3TRDA 2ZSFA 4YRMA 3CVXA 1J22A 3MAAC 3L7YA 4QPDA 5FOWA 2FMHA 5LXTB 1BQ4A 5AI0A 3L6RA 5DHUA 1JIIA 3ELDA 4NZYA 1WZUA 2CWWA 4MKFA 2XMDA 3PDIA 2QENA 4MRAA 1EJ0A 4B7AA 4NATA 1E59A 4N12A 1T4DA 2OXCA 3VDQA 4BVBA 2H0AA 2N42A 2NACA 4O33A 4B7XA 1QU3A 1XT6A 4NOMA 5EJ4A 3UA3A 2PS3A 2XGOA 3P96A 5EIHA 1ZHHA 4J7UA 2H57A 1THMA 2ZFUA 3LUPA 3T9DA 1I7DA 4R2JA 2CXRA 4LI3X 4XIIA 3R8CA 3KQSA 3AR7A 1KH2A 5IFLA 1QHHB 4LCBA 4GL2A 1HE1C 2Y77A 2QG9A 4R71A 3GB9A 1FPQA 4FHZA 5C53B 5DYNA 2PKQP 3C87A 3N8IA 4EG8A 3QIVA 2IYSA 5D3KA 3AEQA 3IBFA 4LFAB 1CS4C 1GKYA 1P4HA 4AMZA 4L5CA 2RHHA 3H87A 4GM1A 4P3PA 5LSAA 1JEOA 1L4BA 2FDRA 1WVMA 2I76A 3EAGA 3F6EX 3GZTB 3IV9A 4ZI2A 1K89A 2ZLBA 1L3BA 4Q3NA 4RTMA 1YI8A 1PR6A 1P4GA 3KKQA 3LPDA 2HI0A 2HEGA 3M6LA 5D00A 3U4DA 3VMMA 3ZGNA 4K05A 1CUDA 2HWWA 1I32A 5J5VA 1USGA 2SICE 4X1YA 5ECDA 4LKOA 3JYOA 4XH9B 4IRXA 5BSHA 3AKCA 5F73A 1G2OA 1RTTA 5AW1A 3T0GA 4G8CA 1CIPA 3CUUA 5EIAA 1OA1A 1IHOA 1HX7A 3V4ZA 2DTXA 2JIMA 1C9NA 1HSOA 2VJYA 3CU5A 5ERXA 2YYZA 3RARA 4QU8A 3KT0A 1R5OA 2B4TO 1E1LA 1R0SA 2JCBA 4RUKA 5DXFA 3OTWA 4C1NA 1D1SA 1BX0A 1W0JD 4DR4B 1VZ2A 2NXJA 3LK7A 3ESRA 1L6RA 4PF1A 3WKAA 1W4AA 2J31A 1LJLA 2VYQA 1GR0A 2VXYA 4GE3A 4LHZA 2WUFA 4LUCA 4TXHA 4QSHA 1MX5A 2R5NA 2VF7A 5BN5B 3WLLA 5KQLA 3FBGA 2WZDA 1KZHA 3H0CA 4QTTB 3HUFA 1NQUA 2Y99A 1E89A 3DTNA 4KPGA 4N3BA 2Q1YA 3FUTA 3W7AA 2RDMA 1ZK4A 4RFSA 4BQQA 1NXVA 3I2IA 4UTPA 5LNK6 3AF6A 3AJDA 5CA0A 3CE9A 2HY7A 5EERA 2V5AA 4EK9A 1FPMA 2A4KA 1SCKA 3ONFA 1DDGA 1NVTA 1RSZA 2WJHA 1FTNA 3NZEA 1R0XA 1YJCA 1BROA 2ZSUA 4P92A 2ZAOA 3RSLA 2GJSA 2XB6A 3PDCA 4FFLA 1A4IA 1MFPA 4A2QA 1T5HX 4PINA 5CT8A 1QYCA 5ALIA 3V55A 1U8ZA 4TKVA 4L73A 4W1RA 3WZMA 3N2NA 2NX2A 2IYWA 3INYA 3OCVA 4CG3A 3TZCA 1EVLA 1DC8A 1FVXA 4FR0A 5TJHA 1R1DA 2PSJA 5EHNA 1P5HA 3DD5A 2GVDC 3GRVA 5BYBA 3FXAA 4A6DA 5DLDA 4UAGA 4A82A 2VK1A 1L9KA 3N76A 3RU7A 2I66A 1DOZA 3QQ5A 3TL6A 1L3IA 3ECSA 1J97A 4M1SA 2ZJOA 1I14A 2HXSA 3CVVA 3KEMA 3P9QA 2I6FA 3BH6A 3C14C 3GD5A 4C0WA 2HJHA 3UMSA 1KZ7B 1X42A 4WK6A 4U8GA 1GY8A 4HGRA 1H3NA 2IS4A 1VRWA 5DI9A 3RWOA 3Q3CA 5JROA 5L4SA 1M2NA 4KK3A 5CX1B 4DC0A 4F4DA 3ZW9A 5COQA 3ACCA 3IJPA 5DM4A 3N8KA 3WL5A 4KXUA 4J8PA 1OLSB 4PZZA 2QNIA 5BW4A 3KJNA 3ZLVA 1EAMA 3G02A 5JQWA 4HX2A 4LF5B 1NVEA 1G8GA 1YA4A 4DE5A 1NR7A 2XEXA 4WUVA 5JPIA 4CMHA 3PUVA 1NN1A 3N2IA 3E7XA 3D0KA 1YB2A 1QH1A 2FSUA 2IOFA 3IT1A 2BUCA 1OWLA 1VMKA 1XDGA 2HMAA 2PMKA 1CZLA 2Q1SA 3O4VA 4JQZA 4Q18A 2QSJA 2AVNA 3RUAA 4DCMA 5FOXA 4LDZA 1FJGB 1FNNA 3P27A 4ZU6X 1MD9A 3QWAA 2WYVA 1WCXA 2P77A 4G9GA 1O54A 1PD1A 3P4XA 3SK0A 3CUWA 3P0JA 3UM9A 3GFBA 2ENWA 2J8ZA 1VCOA 2PVPA 3T95A 2O1WA 4HVCA 3TWOA 4YV0A 1XJ5A 3N39C 3RHSA 2PBLA 4R2KA 3R6GA 2NTJA 1JLRA 5B4UA 5CVUA 5CPFA 4DGQA 3OFND 4NMHA 1OV4A 1DL5A 1K92A 1SVKA 1UC5B 4L6CA 2FF5A 5FL7A 5ULLA 1UKBA 1QHIA 2E21A 2OGZA 3BWCA 4DZZA 2Z6UA 3LFHA 4JVMA 2WJ3A 3C45A 1T36B 1ISMA 3OQIA 4KQ6A 2QTMA 2Y66A 4OMFG 1OHHA 3GGGA 1RYHA 2IYOA 4XXHA 3C6ZA 3FJ1A 3ABSB 2Q99A 2YYYA 5MDHA 3C70A 3QWFA 2XB2A 3CPJB 1JE1A 5KOJB 1W8DA 5BP7A 1HQKA 3IA7A 2QK4A 1C4WA 2ZJ4A 4LXYA 4OHFA 3RSZA 4MP3A 3GUYA 4LSMA 2WJVA 2IXEA 1TAHA 4NYMR 4UTRA 1CEQA 1UM8A 4ZPJA 2C5GA 2CDBA 3NAQA 3RAGA 5K4GA 1M0SA 5T4BA 1W87A 1OWOA 1RXUA 2FUCA 1NLYA 3D0RA 5T67A 2VHVA 3IVRA 5DX1A 4LJAA 3WOVA 2JASA 4AICA 2G1JA 5FJIA 1CUGA 4TMVA 3SHVA 4C4OA 3KETA 5DM2A 4MA4A 2XDWA 1CIVA 1BWQA 4UPVA 1UJBA 2V45A 3QG1A 5ALWA 4DR5B 2BF7A 3G79A 4R4JA 3OIYA 3TFOA 5B1SA 3E7FA 3F5DA 3GJ4A 4YAIA 4W5HA 4IDOA 5JV5A 2GSDA 4D92A 2VR1A 3QM1A 3DWFA 3OJ0A 1U2SA 2HJ9A 2ZETA 4KKVA 5I9SA 4A1FA 2QN8A 4PYOA 5DNUA 4R69A 4WLEA 5JCXA 1WHSB 3BVPA 4MUNA 3OM0A 5KJCA 2EIXA 4R8KA 1N57A 1U65A 3U7IA 4EF5A 2WSBA 1V8ZA 1DARA 2ZT5A 1SK8A 2WFLB 3F5SA 1X7WB 1HLGA 4REQA 4NCBA 3MRXA 2PNJA 4WKGA 2QRZA 4JLMA 2JDIA 2OXTA 5KNCD 2XVAA 1H1TA 3KKLA 4EVSA 3RB8A 3T5CA 2RGNC 3V4LA 3CISA 4Z6KA 2VVTA 4HB4A 1II0A 3GVCA 1G3MA 5KTTA 4UMEA 3VOAA 2RHTA 2D1RA 4JLVA 4IIGA 1QC5A 2QRNA 3Q1KA 1ZJ4A 3K1YA 4H7PA 4RKRA 1H9AA 2AEEA 3LKDA 2RJNA 4FZ5A 1WRBA 3QPUA 1MDBA 3V8PA 2XMSA 4PSCA 1RIIA 3VNAA 5J47A 1PJBA 1D7OA 5FP0A 4H6WA 2CVHA 3M3PA 4Q3LA 4C6SA 4LYAA 1YQGA 3UHJA 1WEKA 1J1UA 4AZ3B 1CRLA 1QH8A 1UANA 4MUKA 4MK4A 4MW7A 4HDSA 2J5RA 4Z8XA 3RSGA 3N8HA 3T41A 5LB4A 4QAJA 5F76A 5K6TA 2PCJA 2G0AA 4MVCA 2VDNB 4PPNA 4PTYA 1U4SA 2IHNA 5J2TF 5AVXA 4CIXA 1HMPA 3EDQA 4V24A 3WXMA 1OXUA 2BEJA 2EJWA 3U3RA 4A0RA 4R81A 2CK3D 1EFHA 4KIUA 4B2YA 2UVPA 1G63A 1R2QA 4H7IA 2HU2A 1M6EX 4NH0A 4WJLA 4CEIB 1N8TA 1RQXA 2QLTA 3KPVA 2WM2A 1CZHA 2X6RA 3I8XA 4IIDA 2LCFA 4KQCA 4AJ9A 1P1CA 3DGFC 3WAJA 5TS3A 3I9V1 1KY4A 4UCFA 3TSCA 1W47A 1J8MF 1WSAA 3LH5A 3P5BA 5I5GA 4EUFA 1CUWA 1Z6ZA 3U7JA 5A5DA 1GQRA 4MR7A 2YIJA 4PSVA 3CLKA 4JYAB 3N2GA 2FPPA 1NMSA 3N8NA 3VPBA 5C52B 1WZEA 2JLQA 2QRJA 2CBXA 3DPIA 4EHBA 2IIQA 1JWAB 5H3CA 4PWZA 3L7JA 4DQDA 4WEQA 2XGMA 3N87A 3BRSA 3Q5GA 1TVKB 2O8CA 2V7EA 4YQYA 1Q17A 4Z7OB 2VNSA 6NULA 1KPHA 3W3AA 4TWAA 4DLXA 4KAJA 4XASA 2JFNA 1SUWA 4CQLB 4ERXA 2WMYA 3SZGA 1WLSA 3FB1A 5SZKB 5AKJA 1CY8A 3K16A 1OLUA 3KPYA 4ENVA 1YVPA 1T2DA 5JJIA 1CPYA 4P0TA 1CF4A 4TKLA 4N47A 1WMFA 3DO5A 4OGLA 5AW6A 5IM4F 2A9FA 5FUBA 1N6PA 4RDIA 4NCIA 1UPCA 3QPVA 4PV7A 1BXRA 3WGKA 2ORVA 1J2RA 5AUQA 5EKXA 3GPDG 4X1IB 1D4OA 3PC8A 3PU6A 4B87A 1YR3A 3V97A 5AUOB 4H3SA 5KMGA 3JQAA 3EE6A 5ALJA 1GA6A 2H4HA 1N2IA 3N0XA 1KETA 3OWXA 4NARA 1YD7A 2QZJA 5GIPE 2WF9A 3OF3A 4M4SA 3I83A 3X2FA 4BNDB 2ZZNA 2AFVA 1BWRA 1GOTA 4UTOA 2HWYA 4BWFB 1GGHA 1N0VC 2JGFA 3WGGA 3X1XA 2N46A 4BAZA 2AZDA 4V1CA 3G1UA 4L51A 2GPSA 3I9KA 3NUQA 5MF6A 4DV5B 4M9ZA 1RLTA 5D3ZA 2BT4A 1A7KA 3HKEA 4BP8A 4RACA 1ZVKA 1LX6A 3ED5A 1QIDA 4IXMA 4IWNA 4MRRA 4ZV9A 3EXFB 2GEFA 4ZVNA 1WJGA 4B2PA 4D57A 5JTTA 1Y8RB 5AOAA 2HJGA 4W5NA 1WB6A 3OLZA 3O4GA 4PX3A 2BMEA 4UDXX 1NPYA 4ZXPA 3L79A 4I6EA 4ZC8A 3D3KA 1QHGA 4B2LA 5BMVF 2QMEA 4EW6A 3L1JA 4D2IA 3PYXA 3LXXA 2ZS8A 3WIBA 1TKBA 2VYNA 2H5JA 2XD9A 1PGQA 3W5DA 2BMWA 3D31A 4Y2JA 2VJOA 4NFSA 1PD0A 1NRJB 5HMMA 4TKUA 4K1XA 4Q01A 2BFWA 2R5FA 2Q4RA 2YWEA 1W2HA 2HNBA 2BBSA 4WZBA 3D64A 2RHGB 3BEOA 4TTQA 1IDOA 1R00A 1DMRA 4CKEB 4NP6A 4OQXA 1MAUA 3KQYA 1GPBA 1ZU4A 2H65A 1NUUA 2QD4A 3J7TA 3T61A 1B4DA 4N0PA 5DBHX 1A2BA 1E66A 1DAIA 3L4BC 4WADA 2QR3A 4Q7LA 4B84A 2VK8A 4ID3A 4V0QA 1HE4A 3L7IA 2DCMA 4WA8A 4BMYA 5A4KA 1S89A 2AQIA 3HR8A 4FNAA 4AN1A 1AHPA 4G5HA 3EPHA 1TW3A 1KXJA 3ZHRA 2CXNA 4V3BA 2CLCX 3CJTA 1W36D 1I4TD 2MSKA 3AF1A 4A2WA 4BVEA 4EKNB 1ORHA 4ITRC 2CNOA 2AOXA 3M6AA 1GYRA 2GWHA 1U1IA 3EIEA 5E6UA 4R5MA 4DA6A 1G8FA 4DDTA 1GPDG 2I22A 1AUQA 4HDCA 5JSYA 1NJ1A 4MR9A 4US1R 4D8TA 1VLQA 3R6DA 1WEHA 3CF0A 3CG4A 1V11A 2A1IA 3D8BA 4HNRA 5DHTA 5KKAA 2PT5A 4DHWA 1TK9A 3FTPA 4JC0A 4OV6B 3RG8A 1FQOA 2G8LA 2J9XB 3OO0A 3KSUA 1MC5A 4ND3A 3UFXA 3UMYA 10MHA 3FFAA 1YS2X 1JBKA 2YS7A 1L3CA 4I1OA 1UKCA 5TPZD 5CB6A 3LQ2A 1JYSA 3HZHA 3I5MA 3UW1A 2CJWB 4A16A 5HIKA 4WIAA 3K32A 2J5BA 2P9TA 1M72A 4FIZA 2IVZA 4YT2A 5J4HA 3UY4A 5EFZA 2CUNA 2CLDX 4AMGA 3HVRA 2FSVA 4CM8A 4DG9A 4HYYA 3ROMA 1UBCA 4WSOA 2PSDA 1E61A 3FIJA 5EZ6B 4BN0A 1WPGA 4TL6A 5EJMA 3VZBA 5CYPA 3SS8A 2HOQA 1YKFA 1NM5C 3FFXA 1OWPA 1Z08A 1D2GA 2Y05A 3UVEA 3QVMA 4ENWA 5L3ZA 2R8XA 4I50A 1GIAA 4JJZA 1SC9A 3OIUA 3RFXA 4RA9A 1FDUA 1U02A 1NYRA 1MQSA 1RAEA 3ANXA 3AHFA 1I4WA 3IUNA 1BJRE 2HQRA 3N2KA 3OFSA 4Q00A 4QUGA 4BNXA 5AKIA 1UOOA 3WLMA 4P4TA 4PWYA 2NO9A 4BWVA 5KDDA 2Q1TA 1OBOA 3FA2A 1IWOA 3OC6A 1DQZA 1P4JA 4ODIA 3ED1A 4OI2A 1LD3A 2AF4C 4MMZB 4JLKA 5A1JA 3CXUA 3PC7A 2YMPA 3G2IA 2JVKA 3L04A 4IIXA 3SZMA 4M9XA 4BGDA 1TC1A 2BSXA 2QTZA 1JG7A 3KJXA 1NURA 1V2GA 2HHHB 3KB2A 4GT1A 4D4HA 1AIPA 1LBTA 5TLSA 2VRBA 1LXCA 2H4FA 5E1OA 5AK0A 3WKCA 3GGDA 4W8HA 4O59O 1EB8A 5LWQA 4R1QA 2QTBA 2FV8A 1JVNA 4ND5A 1GVNB 4V0MA 3ZEIA 2DVMA 2C84A 2V7WA 1JA0A 1CUHA 3DVLA 3EVTA 3M6MD 1AA9A 1JFFA 1VB3A 2GBLC 2R6ZA 1ORTA 3QU7A 4Q7MB 4RQTA 5GJCA 1RRVA 2W2LD 4CT4B 1FFWA 2J59A 3W5IA 2BGGA 3T3OA 1QG2A 3O90A 4XDHA 3SSAA 4AUEA 2FSPA 2XBUA 4PZYA 4NEHB 1MIHA 4CMGA 4M37A 4BO6A 1PR0A 2DF8A 2WEKA 2DEUA 4JI0B 2ES4A 5HTOA 3MT7A 1A97A 2QX4A 4KDEA 1XK6A 1IK4A 4Y2YA 3FOWA 1ZNZA 2WU1A 4D4LA 4QU0A 1R0KA 4IHQA 3FMGA 3TNYA 5HM6A 3AG6A 3DMPA 4EZBA 4QOFA 3C1UA 1L5FA 4B7CA 3MPUA 2V6IA 3KWMA 3AY6A 1JS1X 2JD1A 3L8EA 1YR7A 3STHA 4BBJA 3EEFA 3CLSC 3ESAA 2BEUA 5F98A 1DJQA 3QA3E 3NONA 3OP1A 2WJWA 4X90A 1T3ZA 1T1JA 4NJEA 1AJEA 3IR6A 2OENG 1TTHA 3I4FA 4C89A 2ONCA 2OWDA 3D6UA 3V32A 4RYDA 2ZU6A 3H86A 4D8UA 4U9IS 4L08A 2YJ5A 2G5PA 4BE9A 2I6QA 3TLJA 2O8FA 3OT1B 3D4IA 3SD7A 3IHWA 3OT4A 4R31A 5CAEB 3LS2A 4PN7A 1VCIA 3NWOA 3U09A 1ZH0A 4Y6PA 4K8RB 4GICA 1Z5WA 2ZUSA 2I2XB 3ZZ0A 1H8ED 1T1GA 4BTEA 5JWRA 5TGDA 3KDPA 2C5BA 5ALYA 5FPHA 2LZ0A 3DF7A 5K01A 3NETA 4UQLA 1J0DA 1D04A 1SU7A 2ZU0C 3REQA 4D4MA 3O21A 4F5WA 2W8BA 1P1FA 2AJCA 4BJ3A 1Q15A 5EMJA 2DLDA 3M6IA 1QP8A 4Y2SA 5F23A 4EFNA 1EGVB 2VNKA 4FC7A 4KMMA 3THRA 3IBGA 3HDJA 5A3SA 4GBED 3W9SA 2BGUA 1GZ3A 1NIJA 4L5JA 5CGQB 1MOPA 4HEA6 4C22A 4EARA 2PE5A 1Z4KA 1JKJA 4BCDA 1UBGA 3ICCA 2P91A 2Z5FA 3CUEF 3DUFB 2TRSB 5CXSA 3S70A 3T3MB 4ZQCB 3C5WP 1V1JA 1TCAA 4MRSA 3MT8A 3KE8A 4NS1A 1GPWB 4QYSA 4X1KA 2FMUA 1E69A 5IC4A 2WSLA 3JYHA 2RAPA 2C0PA 1SKMA 1RWNA 2XUIA 5EIBC 2JBWA 3O84A 3GZNB 4F6LA 4AS1A 1I3LA 3EZLA 3EXHA 3BREA 2IPAB 3THWA 1K5PA 2G80A 3J81k 4JVSB 4ZA2A 4BKUA 1CD5A 3L8FA 3EPLA 3G2QA 4IY1A 1GD1O 1RZVA 1W581 3H6KA 3R1IA 4YK7A 4Q16A 3TZBA 1XNJA 2GD6A 3BUSA 2W2KA 4TTAA 1EFAA 4NMLA 1C30A 4MV8A 2R87A 3DZ8A 4Z0PA 3U39A 2BEWA 4WWHA 3TTWA 1KMMA 3AUSA 2OORC 1E2FA 1PL7A 2IQIA 1G8YA 1M1UA 3NI2A 3KQQA 4CIYA 2GD0A 1PV1A 4PNZA 2Q1XA 4R7GA 3ZZMA 4CETA 2JGDA 3GVHA 4QFBA 1B41A 1PHPA 1URPA 5B2FA 1OFTA 2O48X 1WZCA 3HUEA 1Z62A 4IQGA 1JG2A 1GA1A 1P2UA 1V37A 2BMVA 3Q7EA 4BXOA 3BQ9A 4NK5A 2D1FA 2FJUA 4ILKA 2WZBA 5AJTA 5CFZA 4TWJA 4B81A 5JXGA