3OE4A

Rat catechol o-methyltransferase in complex with a catechol-type, purine-containing bisubstrate inhibitor - humanized form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 68
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3oe4A01
2GLUA 1O54A 3G2OA 3LX6A 3GIWA 8MHTA 1M0EA 3UBTA 4QQNA 3TKYA 3UJ7A 3OU2A 4KDCA 4YUWA 3PVCA 3NJRA 2ZBPA 1XDZA 3HA3A 3MB5A 1YB2A 4FP9A 3HVIA 4F85A 1O9HA 3MGGA 4P7KA 2HWKA 1IM8A 3B5IA 2OXTA 3FUWA 2AOTA 2WA2A 1QAOA 2G72A 1Q0SA 2P3OA 3FRHA 2PX8A 2XYRA 2ZVJA 5CVVA 3PT9A 1ZG3A 3DP7A 4RYLA 5DM2A 5K0LA 2O05A 3ME5A 2WK1A 4RTRA 3CC8A 2AN5A 4PYMA 2JHCA 2OBFA 2AOXA 4OBWA 2Z6AA 5DLYA 2V74B 1XCJA 5B1SA 3LCVB 4PGGA 3VC1A 3DXYA 3T7SA 5LQCA 3SR4A 3D2LA 5HIJA 3DMFA 1AQJA 3SGLA 3HNRA 3IHTA 1RI4A 2KW5A 2PV0A 3G5LA 5E9QA 1AF7A 5E9JA 4DZRA 4YV2A 5E1MA 2NXEA 2YXEA 1KHHA 1WXWA 5ICGA 1NE2A 2FK7A 3A25A 2P7HA 2OB2A 1O9GA 3CBGA 5E8RA 4MWZA 2ZZKA 4V0QA 5DWQA 5CVEA 3THRA 2P40A 4FSDA 3DLCA 1G55A 3DXZA 5FTWA 2XYVA 5EQJB 2IBSA 1NW7A 3MTIA 5P8WA 3L8DA 1ZGAA 4FGZA 3T7RA 3EMBA 5GWXA 4WXHA 5EZSA 3M6WA 3UJ9A 3GRUA 2QY6A 4YMHA 4RVDA 2EJTA 2QRVA 5HIIA 2AN3A 3KPJA 4HGYA 2BR5A 2HV9A 2AOUA 4KVZA 5F2OA 2IIPA 4A6DA 3EGIA 4FT4A 4DCMA 5FUBA 5K0JA 5LQNA 2NP7A 1ZGJA 3FPJA 1JTEA 3G5TA 3PLAE 4RTMA 3KQTA 1D2CA 3C6MA 4AZVA 2E5WA 4UOEA 5LR6A 3GRVA 3R6TA 5EC8A 3MTEA 1PJZA 1KYWA 3MQ2A 2I6GA 3O31A 4WVLA 4R8SA 4XUDA 2H11A 1NT2A 2PT6A 3ID6C 1VPTA 2B78A 5IKMA 3FPHA 2ONZA 2GS9A 4XUCA 3UA4A 4PYJA 2NXCA 5CVJA 3OFKA 3MERA 3TMAA 2Q41A 2ONYA 4DCGA 3GWZA 1PRYA 1SG9A 2VZ9A 4GUAA 5D1NA 3BKWA 1RJGA 3E8SA 5EGSA 5FA5A 5IH3A 3GXOA 3LSTA 4C08A 1FJXA 1YZHA 1Z3CA 3P71T 1IXKA 3CCFA 4P7JA 5DM0A 5EIFA 3HP7A 3MCZA 4YUZA 3IEIA 2JJQA 3HEMA 1JSZA 2LD4A 4GC5A 5K01A 5GIPE 2IDKA 4GBED 3KU1A 2ZIGA 2FPOA 4E31A 4RTLA 4BLVA 4YV1A 5JR3A 1RJEA 2BM8A 3I53A 2C7QA 3BGIA 3JWIA 1UFKA 3M33A 4BP1A 4GOLD 5BP7A 1JQDA 2VDUE 2OB1A 3KPYA 3HCDA 1BC5A 2AOTB 3C0KA 4IWNA 5GM1A 3S68A 4ER6A 3B3FA 1VL5A 3SX0A 2AOVA 3NVKI 4DKJA 3ANXA 2G71A 1EJ6A 5EHIA 2FRXA 3TRKA 4C05A 3KR2A 3P8ZA 4LWPA 3DLIA 3HCEA 1QAMA 1EG2A 3EEOA 4X1OA 3TLJA 5EG5A 2AZTA 4FR0A 2P35A 4RTKA 3LBFA 3NW9A 5EOVA 4DM3A 5HZMA 5HFJA 5E1DA 5EHGA 3UJCA 4XCXA 10MHA 5LQKA 2IP2A 2NXJA 4FZVA 4QDKA 5DSTA 1MHTA 2BR3A 1KR5A 1JQ3A 3DMHA 4LECA 2BH2A 1RI2A 3KHKA 5E9WA 4AZTA 4KDRA 1F38A 3MHTA 2IH2A 3GRYA 3PFGA 1JQEA 3AJDA 4Z2YA 5FWDA 4DF3A 3BWMA 3FPGA 3G2MA 4PYLA 2ZZMA 4FT2A 4HSGA 4E2XA 3BWBA 1JR4A 3FZGA 2I62A 3DH0A 1KPHA 3SSMA 4EKGA 2G1PA 2PVCA 3DULA 3QOXA 1DCTA 3R9XB 5HILA 2H00A 2O06A 2P41A 3BGDA 3KQVA 4BP3A 2OZVA 2PWPA 3AY0A 4BLUA 2IH5A 2C7PA 1NBHA 1N2XA 4LWOA 2JH8A 3T7TA 5ICEA 3O7WA 4ATNA 3A26A 3P9IA 2GA9A 2ADMA 4M7RA 1BHJA 1MJFA 2AOUB 1KYZA 2PX5A 3KQWA 4ER3A 4C03A 5K0CA 2ESRA 3KPWA 3HA5A 3CKKA 1RJFA 4R6XA 2YUIA 3UJ8A 2JG3A 1X19A 2ERCA 5K0FA 5MHTA 1QANA 1VIDA 2P3LA 1I9GA 2VP3A 3I5UA 5BXYA 5FCDA 5LSAA 3ER9A 4PONA 5G02A 2DPMA 3UFBA 2AS0A 3R3HA 4XUEA 1Q0TA 1XDUA 2P8JA 3FUVA 4HH4A 4YUVA 4KIFA 2ZSUA 2PWYA 3C3PA 3V97A 4X61A 5F2NA 2C7RA 1VBFA 3DR5A 1EJ0A 3HCCA 3A27A 3LDGA 4EK9A 3LECA 2NNWB 1R8YA 3GGDA 2B25A 1INLA 1R6AA 1WXXA 3PFHA 1AQIA 3LCCA 1XDSA 5CVUA 1BOOA 4E33A 4F84A 3KPUA 3LDFA 4OQDA 4G56A 1KP9A 1N7JA 3DMGA 1L3BA 3O4FA 3UA3A 2UYHA 1ZKDA 4HTFA 1XCLA 3UJAA 4C04A 1WS6A 5EPEA 2HR1A 1XXLA 3EVAA 3VSEA 3G2QA 2CL5A 1NV8A 4C06A 5FADA 2FCAA 5DTQA 2JHPA 3FTEA 3ELYA 4RVHA 3SMQA 3RODA 2IH4A 3OPNA 3OE5A 1V39A 4R05A 1KPGA 4JXJA 1RI1A 2OO3A 1R74A 3G2PA 3LKZA 4ISCA 5D1HA 7MHTA 3TQSA 1TW2A 3TPZA 4M36A 3WSTA 5EIWA 3LKDA 3UWPA 2AOWA 3CJRA 2DULA 5DTRA 1SVUA 4PNEA 3OCJA 2R3SA 2O0LA 3GDHA 3I64A 3TM4A 1XVAA 3AXTA 4GOND 2YXDA 2P1DA 4PIPA 2ZCJA 3JWHA 1VE3A 1G8SA 5C0OE 3HM2A 1KXZA 3T0IA 1EIZA 3FTCA 3G7UA 3I58A 2IGTA 4GOMD 4RVGA 1L3IA 2B9EA 3EMDA 3AXSA 3FYDA 2ZIFA 3G8BA 3U81A 1QAQA 2O07A 2PY6A 4MQ4A 3NWBA 3SSOA 3ELDA 3HA7A 2EG5A 1H1DA 3THSA 5BW4A 1NV9A 3JWJA 5CD1A 5ERGB 3KR0A 3UJBA 5HOQA 1NW5A 2GPYA 3B89A 2YTZA 4YUXA 2N47A 2JHAA 3VC2A 3FPFA 3LCUA 4FS8A 1M6YA 5ICCA 1JG4A 4GF5A 5EVJA 1R00A 3Q87B 2ZFUA 2OPBA 2ZIEA 5CCXA 1KPIA 1YUBA 2O57A 4AZSA 3NMUF 3BGVA 4CTJA 1DUSA 2B3TA 4KWCA 4GEKA 3BWCA 1D2GA 1F3LA 1P1CA 4HTFB 1WZNA 2HMYB 3GNLA 5K0EA 5DRTA 1WG8A 5GIOE 5K0BA 2ZLBA 5LQAA 5C9ZA 4ER7A 1G60A 1HNNA 3KQSA 5DX8A 5FHQA 2ZW9A 4GC9A 5FULA 2NP6A 4BLWA 1NW8A 3BUSA 3EGVA 3K0BA 5LQJA 1YFJA 2I7CA 3EVFA 4RTNA 2CWWA 4X63A 4FSXA 1RI5A 4PCLA 2PSSA 1YZ3A 2EFJA 2FYTA 5JUWA 2XVMA 4E2WA 1YFLA 1OR8A 4RVFA 1TW3A 4QVGA 4EVIA 4POOA 3B7PA 1NW6A 2YX1A 2PLWA 1I1NA 4MTLA 4R6WA 1UWVA 4RTOA 5T6BA 2BR4A 3JWGA 3OZTA 2ZBQA 3FYCA 4ZTBA 4PYKA 2CMHA 5K05A 3M6VA 2G8NA 3C3YA 1P91A 3GRZA 4EMSA 3ERCA 2UZ4A 3C6KA 5C1IA 4E70A 5KVAA 3UJ6A 1NBIA 2BM9A 2K4MA 2ZWAA 3NDIA 5E2AA 1G8AA 4CKBA 1BKYA 2CKDA 1XJ5A 5CM2Z 1L9KA 1AV6A 3BT7A 1VLMA 1FP1D 2CMGA 3G88A 2B2CA 2ZBRA 4YUYA 2H1RA 3P2IA 2YR0A 2WA1A 3P9CA 3ELUA 4HC4A 3MAGA 4OA8A 4DQ0A 3FTFA 4A6EA 3HCFA 1VP9A 3TKAA 1VP3A 1D2HA 4AUKA 5HEKA 3HVJA 3M70A 2EX4A 5LQUA 5HIMA 3OFJA 5KYGA 4PYNA 4X60A 4U7TB 4DA4A 3KQQA 3LBYA 4QVKA 1IY9A 2R6ZA 3FRIA 2OKCA 5CCBA 2AR0A 3A4TA 5K03A 4IV8A 5GP1A 3EVGA 2A14A 3OZSA 2FK8A 2PX4A 3HCBA 5FWAA 5H02A 3B3JA 2AVDA 4GOOD 5EKXA 2OY0A 2ZTHA 4HG2A 4KIGA 1ORIA 3EVDA 1WY7A 2ZULA 2VS1A 5DX0A 1X1AA 3R24A 1NKVA 4PYQA 5DXJA 5KQSA 4RWZA 1JG2A 3EVCA 1TPYA 4PINA 4CXMA 4V0RA 3E05A 3LPMA 3HTXA 4ER0A 1JG3A 4RTQA 2PX2A 2PKWA 4QQKA 4C4AA 2XYQA 5CIYA 3PTAA 5EMJA 2AVNA 4RTSA 5T67A 3LHDA 5K09A 4MHTA 3A7DA 4PIMA 3P9KA 3LL7A 3V8VA 4BY9E 4QTUB 5ICFA 1FBNA 5DT2A 1T43A 2GH1A 1HMYA 4EQZA 3KQMA 1SQGA 2PXCA 3HVHA 3FUXA 5DM4A 2YVLA 2EJUA 2UYOA 5EZQA 3BXOA 1VQ1A 4NECA 3FUUA 3R0QA 1RJDA 4QPPA 3PB3A 5FQNA 1R18A 3M4XA 3OZRA 3Q7EA 1FP2A 2PT9A 2UYQA 2IPXA 3GJYA 3HVKA 4L7VA 4CKCA 4C07A 2PJDA 3OE4A 3P9NA 2PBFA 4E30A 2IBTA 4LG1A 5DSXA 1UIRA 4P7FA 5CUQA 4H0NA 3EVEA 4M38A 3G89A 3HCAA 2QYOA 3DOUA 1SUIA 4K6MA 1SUSA 4OA5A 3SM3A 5EKUA 1SKMA 2JH9A 2Y1XA 2ZZNA 3AWIA 4M37A 3REOA 4RTJA 2G70A 3PX2A 4MIKA 1L3CA 5EEHA 3TR6A 3FUTA 3PS9A 2XVAA 1XTPA 9MHTA 3KQYA 5FA8A 4AX8A 1SQFA 4U7PB 5M5BA 2PGXA 5K0NA 1JSXA 5DPMA 4KW7A 2F8LA 2NXNA 3QOWA 5K8VA 1X1DA 3FPEA 3KPVA 3SSNA 2HNKA 3TOSA 1ZHFA 3OU7A 5FQOA 3VYWA 4OX9Y 1ORHA 4CTKA 2IFTA 4E32A 2QRVB 2Z6UA 3NWEA 4PCAA 1ZQ9A 3EPPA 5DXAA 2AN4A 4EKIA 4YV0A 1DL5A 4RTPA 2HTEA 3M6UA 5DTMA 1X1CA 3KKZA 4PGHA 5EMKA 2YXLA 3QV2A 1R8XA 1EAMA 2NYUA 3GO4A 1U2ZA 5BW5A 4R8RA 3GU3A 2BZGA 2P3QA 4P7GA 3KR9A 1I4WA 3BWYA 2GAFA 4IV0A 4OBXA 1G38A 3B3GA 3H2BA 2C7OA 4B17A 2QE6A 3DUWA 3G8AA 5LQRA 3EVBA 3KQOA 3KR1A 4RSRA 4O29A 4OQEA 3OU6A 3IV6A 3M6XA 3ORHA 4PYIA 5F2KA 3E7PA 3ELWA 3EGEA 3GCZA 5DRYA 1KIAA 5E1OA 4QPNA 3A7EA 4E2YA 3EEYA 1QZZA 2UYCA 2PXAA 5T64A 4PWYA 3CVOA 3EVZA 5E8JA 3DTNA 5CVDA 5EMMA 4E2ZA 2XBMA 3NTVA 3ER8A 3IYLW 1RI3A 5HIKA 1M6EX 2FHPA 3FTDA 4P58A 5EMLA 5GOZA 1JTFA 1P39A 3X0DA 3NVMB 3UZUA 2VDVE 5DM1A 1G6Q1 1NW3A 1Y8CA 2OYRA 5KS2A 4KRGA 3TM5A 1YF3A 3MCTA 3BKXA 3GRRA 4HGZA 3RIEA 2Y1WA 2ZWVA 3CGGA 4HRAA 5E1BA 3TFWA 3P2KA 3SVZA 1N7IA 3K6RA 2Z6QA 4IKPA 4DMGA 1L1EA 4X41A 4F86A 3BZBA 5U4XA 3P97A 4CKEA 5K0GA 4Y30A 2V7EA 1FPQA 3PX3A 2QM3A 2I9KA 1QYRA 2PXXA 3SXJA 5GINE 4GQBA 2YQZA 3P2EA 1JG1A 2IDJA 4RX1A 3CJQA 5KQRA 2P7IA 4YMGA 4AZWA 1EQAA 3DXXA 3LGAA 5EEGA 3RW9A 3UJDA 3LDUA 4QDJA 4QTTB 2ORED 3F4KA 3KQPA 2VDWA 4PYOA 5FHRA 1X1BA 3NDJA 3E23A 3CJTA 4ER5A 4CWAA 5DX1A 4Y2HA 2GB4A 3I9FA 5GM2A 1P1BA 1B42A 4RV9A 5E2BA
chains in the Genus database with same CATH superfamily
4WJKB 1LU9A 1Y1RA 4Y1RA 1UZNA 3FJOA 3A4IA 3WK8A 4PBSA 1DLIA 2AXEA 5JU6A 4ZOLA 3OPMA 1Y8RA 4IIEA 3WDKA 4NXNB 4NZMA 1VKNA 4AUEA 2QN3A 2OXTA 2X86A 2AX4A 5C80A 1MNAA 1A69A 2E4YA 1UK7A 1GPKA 1JDBB 1VJTA 4BS9A 4H9GA 3STTA 5KTOA 3NC1C 3G2HA 5JSZB 3C3XA 1BNCA 2FFQA 2QW8A 3ZWOA 5HF6A 3C85A 1XMOB 3SX2A 1OFTA 3P20A 1QU2A 2I8AA 4US2R 2RC5A 1T15A 1AXGA 1JE1A 3RC2A 1Y5RA 2O7RA 4YROA 2ODEA 2Q1UA 2Q6KA 2G40A 3H2KA 1KEEA 2WWXA 3RFFA 3COJA 4D1YA 3A1DA 1ZI6A 4JP3A 1H2AS 2RHLA 1BU5A 1FYWA 1ZPDA 3KSZO 3C8ZA 2YXEA 3PDUA 5ESWA 3TW4A 5AKGA 3T9DA 1GG9A 1KQ3A 1EFAA 3QIVA 5FXMA 4EG8A 4P3XA 3DONA 4AJ4A 2ZZKA 4WPGA 5CVEA 3M83A 4OHUA 1F3OA 1ODLA 1OREA 4Y98A 2JGNA 1XQVA 5AP9A 3RUPA 4DCOA 4ARBA 5HFNA 4J1TC 4NAUA 2X1LA 2VBIA 3O4HA 1CQIB 2H85A 2YN2A 3N2EA 3OZXA 4FEGA 4WXHA 2BSQA 5TXGA 5KHOC 3ESBA 1G2OA 2WE8A 3FB4A 3SYRA 1FMLA 2IYPA 2RGEA 1ACJA 2AN3A 1FQOA 3TRIA 1U3VA 2C2WA 3VAZA 4HGYA 4RK5A 1J07A 5FBVB 4EJSB 2D5CA 1T5TA 2O59A 4DCMA 3DFMA 3AESA 1O9BA 3VPCA 4QLBA 3MT0A 1SVMA 3X1DA 2RBKA 2ANBA 4DDUA 5I45A 5IJ0A 2H7XA 1L4YA 1PE0A 5H4GA 2XZOA 4AZVA 4JOCA 4TV8F 1TQHA 2D5AA 3B9BA 5SY4A 3OHSX 4LZOA 2JK1A 4JJ7A 4UZFA 3TLMA 3HH8A 2W6ID 2VQ3A 5HQ3A 1JEQB 1I14A 3M8KA 2ZI6A 5IH7A 3A1EA 4NJEA 2QX6A 4L3WA 4P35A 5KYKA 1KRXA 5H3LA 1YC5A 2D3WA 2HEIA 2C42A 4NBVA 4ND3A 4NOMA 1IRXA 3A0RB 1UEJA 3BKWA 1ZK3A 3BEOA 3HB5X 5EZ6B 5BO5A 1TPZA 4W1SA 3M5WA 4GE3A 4OX9B 1C7ZA 3H3FA 3D02A 3SE0A 2FDXA 1CRLA 1KKMA 2KX7A 3IEIA 5IT5A 4GEGA 2QVBA 4YA6A 1V8ZA 1ZD3A 3AM5A 1MR3F 5DOVA 3V48A 4DCJA 4I5GA 1ULTA 2YYZA 1SVNA 2X0KA 4YV1A 3I53A 2OBMA 3FMVA 5JXHA 4Z7OB 2GXAA 1JXQA 3WKEA 1TB4A 3HI4A 3CLTC 4KK3A 4MV4A 3K6KA 3T5PA 1E0AA 4J3FA 3ZQ4A 4DFDA 2DC1A 2R68A 4MGKR 1IJBA 5BUSA 5MDHA 5BWCA 5C51B 4O4JA 4XTCS 3UO8B 4FOSA 5EHIA 2VH1A 2NO4A 1EDZA 5I7OA 1J2JA 3TVYA 1BWPA 4D0SA 1XLVA 3M4JA 4X1OA 1PWEA 4P92A 5I4IA 2AYYA 2HY7A 4KCGA 1RWBA 2DX7A 3NTOA 2OC4A 1LPPA 3D4OA 3DCJA 4BX0A 10MHA 3J80A 2GAIA 1VLHA 3WMGA 4GMKA 1Z06A 5BUZA 4JT4A 3ZHUA 1KO5A 4OIMA 3A4YA 2O8DB 2ZUUA 1X74A 3I9OA 4Q9LA 4BNDB 4MLDA 4TKLA 2G82A 4MLPA 4Q3BA 4B4DA 2OHHA 5JNTA 5JYDA 2IU4A 5GV7A 3P4YA 2JLXA 2VHQA 3DKKA 2OSVA 4ZI3A 4X97A 2QLBA 4FT2A 4YHBA 1F1JA 2KMLA 1MHPA 1P9WA 4XIGS 5F78A 2XSZA 3QNWA 5DO9A 4GPZA 2DAPA 5P21A 3KTAB 3CH4B 2XIJA 3VNAA 3DWEX 1IN8A 4OHFA 1R15A 4NK5A 4JI7B 5JSYA 1B6SA 1GAEO 3E3MA 4EECA 2JH8A 4I4TA 2AE1A 2FB9A 3R0ZA 4Z0TA 4F8EA 1BJKA 4C0AC 1CJTC 2DEUA 4ZEVA 1NMQA 1NI5A 4M0PA 4IWXA 1VMAA 2F9FA 3NG1A 1ISPA 1KNXA 1BQ4A 2HSWA 2X9VA 1Z82A 3TIFA 1RJFA 1OFGA 3SP1A 3L4BC 4MKFA 3ZHRA 3VVMA 5G0TA 1VIDA 3SAJA 4XAQA 5BXYA 5DXFA 4Q12A 1SULA 1K5PA 4QBHA 3WLTA 1KYTA 4V1CB 5CXSA 1UBCA 2W11A 1JHZA 4GSKA 5LZ8A 1DTEA 2FJ0A 4EFDA 4KHZA 1M7BA 3JD3A 4TYQA 2ON6A 3LHKA 2OCBA 3RTAA 1DBVO 4TSFA 1Q0TA 3OMXA 1OCEA 4LVCA 2HRDA 3CLUD 4MVJI 1QOZA 4WZBE 3PXAA 3SZ3A 2Y8EA 4E5DA 2C7RA 3L7OA 3REGA 1XXHE 3LDGA 5KSYA 1U8AA 2EEZA 1XNJA 5AM5A 1VL6A 5B4VA 2XNJA 5EVCA 2QRMA 2WKQA 1T9BA 1LNQA 1BOOA 2C7VA 1W94A 2R6AA 2V7UA 3W4JA 4M3NA 3BTVA 3DMYA 4K9QA 1ATZA 5SV2A 3QUAA 1XMQB 4JNCA 1YKSA 3DWFA 2OGZA 2KQUA 2QQGA 5B1YA 1SOVA 2BGJA 1NN3A 5DTQA 1GG2A 1HA3A 1NBMD 2PMDA 5FBHA 1WIWA 1VLZA 2Z0MA 3E1SA 4MSUA 4ANFA 4C7XA 1J9GA 3CPJB 5E95A 2WUDA 4P53A 1P2SA 4XARA 3WLMA 3PGXA 3AKCA 5DULA 2UXBB 1A77A 1SKYE 3D6MA 2PBRA 1MEOA 2BKUA 1M2KA 5HBRA 6NULA 4CKBB 5IPFA 3DTTA 4LYFA 4PG6A 2DULA 4MWOA 3RKRA 3SCZA 3WHLA 5EHXA 4ENUA 3LNCA 3T38A 3WXMA 3P9XA 4B3IA 4CLXA 5ARBA 4NCBA 2FAXA 3Q0EA 1Z25A 1CT9A 1KBZA 1T9DA 3D6UA 2CVHA 3BXHA 1G8SA 1E9CA 1ZOLA 4TMXA 2P90A 2W2QA 2NV6A 3HJTA 3AF4A 1F8GA 2ROQA 4JYMA 3I58A 2CCJA 3FZNA 4LZLA 2IOYA 4L15A 4TKVB 4WZBB 1L7QA 5KBYA 3D4BA 3U61B 3AUUA 4BLPA 1C1XB 1G17A 3GMTA 5ALEA 4II2A 4KOEC 1XX6A 3PEFA 1P7VA 3BCRA 1DQSA 3CLVA 4FOTA 4HAYA 1WD5A 1FYFA 5ALMA 1D5WA 3SSOA 4EHIA 1NV9A 3ICQB 1G2QA 4J6FA 2ZE6A 4DRZA 1U8FO 4G9EA 4HFMA 4ZHQB 4S12A 2HQBA 4G5GA 2Y1KA 2YH2A 1I2MA 3VC2A 4HGOA 3H2SA 4W82A 5IXSA 1KMNA 1QO0D 4ZMBA 3RNLA 2TMYA 4H3VA 1UPCA 1E63A 1KPIA 2HA6A 5TS2A 2PTGA 4NS4A 3BILA 5IJAA 1G4AE 1U0HC 1RYNA 1Y4DE 2OOSA 3NS7A 5SYNA 1ZHOA 3EXEA 1TF7A 4B6RA 2BDTA 1OZFA 3M1YA 5K0BA 1PG5A 1MBZA 3D8HA 1OH6A 5K8CA 4YWHA 2GKGA 3NVDA 1OILA 4IDPA 5CH8A 2FVYA 4EPWA 4FDVA 4KQWA 3U5TA 5IVHA 4DUYB 5IHPA 1G4HA 1QDLB 2I7CA 1FYXA 1ADBA 1RRGA 4YDRA 2PQ6A 1RU3A 1ZINA 4EF4A 1VGRA 4PCLA 3ONWA 1MIHA 1JL3A 3K4HA 4LCJA 4MV7A 4PSVA 3I09A 4DUPA 4BTEA 1L5RA 4V1CI 2XVMA 2OHOA 3L7AA 1PF7E 4YJ3A 2ZDHA 4EUKA 1K2WA 4GKVA 1I1NA 2J9RA 2NACA 3QKIA 1EYZA 2FZLA 2RGWA 4ZMSA 3V1LA 1IM5A 3EQZA 3FYCA 4LOAA 4B6GA 3UBMA 4LHWA 5LD2B 4JD5A 2RHMA 2BLLA 3Q8XB 4CMAA 1G3MA 2R7MA 3SM9A 1NBIA 3W90A 2RHHA 2F9MA 5BWOA 1DBIA 2H31A 3IT3A 1OT3A 3PVZA 1KI7A 1X7HA 4NTZA 4DYHA 5HQTA 1JRLA 4IJWA 1IOZA 4MNTA 4KQEA 4LBYA 1X13A 5LA6A 3HYNA 3ZWPA 1K7YA 4D46A 1KK3A 5SZJA 5BW8A 2Y1LA 4Y9DA 3A6DA 1JPNA 2NN3C 3FFAA 3UJ3X 1U2TA 1J0AA 3ZXYA 1HL7A 1VBMA 5JIBA 4HS4A 2QYTA 1E2QA 5IEJA 3PKIA 1O94C 3S27A 4JP5A 5KKAA 3FCUB 2RK6A 2RKOA 4G5SA 2C58A 1GRRA 3D5TA 3ZDYB 1I10A 1OX4A 1M5TA 3NDPA 3KV3O 2QY9A 1ZH4A 2PCLA 2VUUA 3DZKA 4QUAA 3SXPA 5JECA 1EGMB 4FMPA 3CVWA 2WD7A 4REOA 1P74A 2FX3A 3EBPA 2YUTA 4DT1B 2QG9A 4HZGA 4QUGA 3C3DA 3N7AA 1JDNA 5CDYA 2NO0A 2XF2A 2YJZA 2JFOA 3AR9A 1E1DA 1XZMA 2ZULA 5JE8A 3T1VA 4JP8A 3OURA 1NKVA 4O4LF 3FPSA 3PUVA 2A0UA 3D5EA 4PZAA 3ZU2A 2O52A 3R7BA 4V0RA 6REQA 4P9NA 2ISCA 3H2GA 4HMPA 5C7LO 5K2MA 5A5GA 3K31A 3KHUA 2VPWA 5CHYA 2ZS9A 2H8KA 5AVRA 2PD3A 1A5SB 3JQQA 1JB9A 1TQ4A 1GUDA 2GLTA 2VEOA 4NBTA 4ECAA 1QFJA 4U2FA 3IKLA 2LTAA 4OAPA 2I2WA 1HNWB 1JHMA 2GSWA 3QJ5A 3WLIA 1MC5A 3MCAA 4L7VA 5FD8A 1IWPB 2QTVB 3B1FA 3TD2A 4CKCA 5I01A 3OX4A 2PE5A 3R7DA 3ZUGA 3QYJA 4A0GA 2FP4A 4DE5A 3B48A 1N57A 1GNLA 5L4SA 1Z74A 3T41A 5EJ9A 4BE4A 1NHWA 1HEIA 3DCYA 1T6ZA 4U8GA 1CEXA 3SQXA 1B8PA 1C3VA 4XJTA 4YRTA 4MQUA 2LCIA 3FUTA 5FLEX 2X40A 1P45A 4OPMA 5E4YA 1KVUA 1ZISA 3BX1A 4UDOA 4J7XA 5DNEA 1E1QA 2JLYA 4JKYA 1ISSA 3BFXA 2QXTA 1WMFA 1QK5A 2B61A 1UKZA 2GGSA 1GGMA 3G7NA 4MWCA 3PQ3A 2XSZD 5TGZA 2XVYA 1T5BA 2W6PA 1YASA 5AVYA 3JYOA 1ZR4A 5C4GB 4GI7A 2V7TA 3W7AA 4OX9Y 1CETA 1RKXA 2C54A 1TKRA 3JQ7A 3EODA 3QTTA 4EY4A 1A8SA 2BDUA 3WLEA 1KK2A 4BBAA 3ZWNA 1BKDR 4C7VA 1JLMA 3OVMA 1QTIA 1MA3A 1TVKB 2XGSA 4X64B 1EDBA 1UT8A 1A9QA 1UC5B 4K9NA 4AZ0A 1OLSB 3QFCA 2AHOA 2YXLA 1RXSA 2J87A 4EF6A 3ABSB 1FSSA 1EAMA 1R8XA 2AN9A 2C4UA 1E18A 1M2VA 2V9CA 3JYLA 3I01A 4GPEA 3UC9A 3W2GA 4R8RA 4R0MA 5KYWA 4L5CA 2UZ1A 4GHWA 4E5UA 2D0IA 2PVSA 3DO6A 2BWJA 3CQ9A 2B1IA 2WU4A 4MQFB 3H2BA 1NM5C 2FV8A 4G0PA 5ALHA 3HB0A 1SVKA 3N28A 2HRQA 1KYIA 4CIDA 4QG3A 5C53B 3KQOA 1SCQA 1OU0A 3KR1A 2PT5A 5BSGA 2VRCA 1GG5A 4QOIA 5IAEA 4B0PA 4IGAA 1S2GA 4N0EA 4AYWA 1T1SA 4OXIA 4S3MA 4H7IA 3IBTA 5KWVA 5ALKA 3E7PA 4WY2A 5CK5A 1NVFA 2C5SA 2NU6A 4YLGA 3DQPA 5CM9C 1ND6A 4YRLA 1HLFA 2YJGA 4MCHA 4RU1A 5KC8A 4CT0A 2EX0A 2QR2A 5EMMA 1SA0B 3PUWA 1P60A 2PNJA 2RI1A 4UHHA 2W4IA 3DW1X 1ADFA 2C00A 2REXB 1FX0B 1A8HA 3X0DA 3V5NA 1DTWB 2D54A 1I7SB 1BDMA 3SJZA 3W05A 1Y3BE 5AUNB 5KS2A 2CEKA 1GYRA 4HGZA 3UTCA 3TFWA 4RL6A 3V4LA 4WKNA 4FB5A 3JVEA 2VTEA 1ZD4A 1UBGA 1I1QB 1BMFA 4Y2YA 5KCZA 1THTA 2AG6A 3RHFA 2RK4A 3TXAA 4HOYA 1OI3A 1Z34A 2NT3A 3P97A 3GLHE 5LJIA 1MJGA 1W5SA 1WTCA 3OC0A 2IPAB 1WEKA 5TT1A 4F60A 3ZBUA 3CR8A 3MJ4A 1TXGA 1RR6A 2OCPA 3ZH9B 2B5WA 5CFNA 4YMGA 2DOKA 2LBPA 5HKBA 1KZYC 1VKRA 4DRXA 5EEGA 4GRAA 4BHTA 3E5MA 5JOQA 4HAUA 2JAOA 3F4KA 1Z12A 4G0ZA 4PYOA 4F1WA 3NATA 3NDJA 1P3JA 1P7PA 3SNKA 1G5RA 1VHWA 3D8SA 1UUFA 2G9QA 4Y2HA 1DTSA 2OAQ1 3SC2A 2SCUB 4BIIA 3OX1A 5AHOA 1O54A 4JZKA 2RGUA 2QN1A 3TJZA 5FO1A 3W78A 4NFYA 1GYPA 2BHRA 5SYMA 3FLBA 5JARA 4RJ2A 2DTDA 3L4BA 3QVLA 1NVBA 4NJOA 2AJTA 4YUWA 4JJEA 4NEHB 3E18A 4FP9A 4F1JA 1PJQA 1QHEA 3OOEA 4UVIA 1T5LA 5DHFA 4JVMA 3PFBA 2F8MA 4ZVTA 4F11A 2GRJA 3G2IA 3IESA 1PJ2A 4Y2PA 2X58A 1IBCA 1EFHA 2AEFA 1DINA 1HDIA 1QVRA 3HDHA 3ME5A 1H93A 1Q3KA 3FNGA 4II3A 5LVAA 4OBWA 5ECYA 2VNHA 3JALB 2DUMA 1J56A 2GASA 4AIIA 1RRPA 3VUFA 1F0NA 3DXYA 1XVUA 3KZ1E 4K3UA 3AO0B 1PO7A 1EWQA 3E22A 2Z98A 1NQUA 2OE2A 4CF4A 4XQGA 1S3IA 4TV9F 3IIKA 4W5JA 1M2JA 2QU7A 3LP5A 3V6MA 3N9IA 2ZR9A 3F5MA 1EUCB 5K6AC 2NVUB 1U7DA 3A28A 1QP8A 3RC3A 3A1FA 2PLAA 1YRWA 2H16A 4G89A 3KUXA 1YJXA 5AKIA 3AKYA 3VZRA 4P86A 4XEHA 3DV0B 2EYQA 1GN8A 1U9YA 2PSFA 4XQ0A 1SCDA 2VJMB 3X1ZA 4BKMA 3GAFA 2MJLA 4WN9A 3WLOA 3W5AA 3WGNA 2PNFA 2WP0A 4C3OB 2PGIA 3TKLA 1FY2A 4Y6RA 3U4CA 2N1BA 1BHQ1 2X0JA 4GBMA 4IPTA 1X3SA 3G2KA 3BULA 1PG0A 4HVTA 4NG4A 5DI3B 5IDVA 1ZCJA 2FW8A 1JEJA 1RWPA 2D0PB 4NULA 4RFLA 1MW9X 3UHJA 5MGBA 1AQUA 4JEIA 3QVKA 1PZXA 5G2OA 3HYCA 5CURA 2X9QA 2OD2A 5K51A 1JTEA 4H6PA 4HJRA 2XA9A 3U7EB 3B2NA 1A5ZA 1XJQA 1S3GA 2R47A 4CV1A 4UOEA 4L4ZA 1W87A 1RJ9A 4K81B 2VDWB 4MIYA 4EGCB 2AIRA 2CNLA 3B5EA 3EFBA 2GR9A 3Q15C 4RSHA 4BDTA 2V1UA 2E4VA 1ISIA 3KSDO 4FPXA 4MTCA 3Q4GA 4A8TA 2WZQA 1NF8A 3I05A 4ZCQA 4YEDA 3I39X 2EZ4A 4HB4A 2GS9A 1W30A 3L6BA 1DBWA 5JD3A 4CNBA 5HW0A 2I33A 3U4AA 2PUJA 1U2SA 4PG5A 3C6YA 1CUUA 4UBOA 1UK6A 2CNBA 1N3YA 4XI9A 1O5TA 4J0HA 2OCGA 2HD4A 3E8SA 2FPIA 2XQIA 4AX4A 3WWZA 5H16A 1V26A 2EHDA 2O2HA 1F5NA 4REMA 1G7CA 4H59A 5EWLA 3F6CA 4MUAA 5FL7D 3RWBA 2YNMA 5DNWA 1UMCB 3RVKA 1UWKA 1KAGA 1OVMA 1XZ8A 2LD4A 2R7AA 2ZJ8A 4LDNA 4DOMA 4YRSA 5DISB 1EXMA 3HSYA 3KU1A 2BSAA 1RLIA 2Z5GA 4MS3A 3M9LA 4UHCA 5B3KA 2Z58A 1W49A 1AVTA 1E7MA 1R50A 1ZK0A 3BGIA 2IEIA 3N0WA 3GNSA 2NPOA 4JROA 4M49A 2II6A 3RK1A 4C4YA 4AK9A 2MR6A 2JEZA 4NENB 5B7GA 3HCDA 3IVAA 3RK4A 4IHJB 4KQMA 1VE9A 1T4BA 1VFNA 1UC4B 3LFTA 5KOIA 3ZWQA 2JVKA 2J45A 2J7KA 1DU4A 4HD8A 3WBJA 1I4TD 1VRCA 4EHBA 3KEQA 2WT8A 3PGJA 1LQUA 5K4HA 2AI2A 3PEEA 3J7TA 4WGFA 4HRYA 4FZ5A 2X8AA 2WYIA 3KJEA 7ABPA 2BM1A 2W71A 3FSGA 1E9BA 3I45A 2GNAA 3DL7A 5TT0A 2HA5A 1K7EB 1KFEB 5IM4A 1BWQA 3LK6A 1W88A 1JQ3A 3GIDA 3OIVA 1G6KA 3GUVA 5FIUA 1UPBA 4OQZA 4CKEB 1OKKD 1YQQA 3BMCA 3T0GA 1COZA 2V6IA 4BP8A 4PX3A 3QPUA 3RVJA 5TMEA 5BNWA 2FWJA 3IGFA 3OSUA 3A2NA 3F5SA 5DW0A 1EM6A 2XJ4A 3T3IA 3W8NA 3I32A 2GUWA 3NHJA 4HSGA 4J0EA 1R3DA 3BWBA 2ZZMA 2JA1A 4OB7A 4YAIA 2HDNB 2DMRA 3DKRA 4YHHB 4FBMA 3PDWA 3QXCA 5IYZF 2CHQA 1LKZA 2XE8A 5JFTA 4PR0A 3OQBA 1V1RA 4HWOA 3P9ZA 4NLLA 5LP6B 3DBVO 5EIHA 5BRNA 5HOEA 2ZUSA 2ZJ3A 1GV0A 2XCIA 4CMHA 1RLOA 3L5KA 4ARZB 4A4DA 2GAOA 3A26A 2O8BA 3QI7A 4XYBA 4ZU6X 4B8YA 5BSRA 4YY3B 2WV9A 2R5WA 1U3WA 2ONCA 3BJEA 1XHLA 3ZGOA 1AD2A 4NMXB 5IUJC 4HZUB 4REQA 4FGJA 4EY6A 1ABFA 2ADFA 3QPBA 3GPLA 3PPYA 4WXPA 5G02A 3DMTC 3JYQA 3K0SA 1GXSB 2ZT6A 3ZVMA 4NBSA 2VTBB 1NLMA 3LY8A 2J5QA 2YINC 4WL0A 5DJ5A 4UZEA 4US0R 3C14C 4XDZA 1R6BX 1Y80A 2EEPA 1A8QA 1R3UA 1YZQA 2IYZA 4MV0A 2G06A 4ZVMA 5KTPA 1EHIA 2ZU0C 3OD5A 3PENA 2ZB8A 3TZQA 5AOAA 4AF6A 2ASVA 1H1TA 1OAKA 1Q3TA 1XTTA 3I0MA 1VYTA 5GPBA 5FEMA 3L1KA 4PXAA 4OXXA 3K1ZA 3PU6A 4E33A 3SFTA 4IKEA 1Y37A 5K3AA 4EW3A 3OCVA 1B14A 4EY7A 4P1ZA 4DWJA 2PUFA 3MSCA 5JY6A 1T9CA 3UA3A 4YCNA 4GL4A 5L9AA 1PQPA 5HDBB 2UDPA 4CTOA 1QKKA 2IVFA 2VJDA 2ZG6A 3OHMA 3H42B 4B45A 2JHPA 2YOGA 3DEYX 4NZYA 2EQ5A 2XDQB 4FJ0A 3T5TA 3SMQA 4J7UA 3WFJA 5ALWA 1XZLA 2ZYUX 4ZVRA 4IHKA 5TMDA 1NP7A 3T9BA 5BR7A 1HKUA 1YD7A 7MHTA 3DJYA 2BFWA 4M36A 4UOQA 3DOCA 4MS4B 3GEBA 4C7MA 1DZ3A 1NXVA 1O94A 2PA0A 2R3SA 3HJAA 1RHRA 3LBAA 4LY9A 4AJKA 1LWNA 4GT1A 3DE3X 2E0IA 4XM2A 2XUFA 2C0CA 3AI3A 2ZCVA 4G3XA 3WYBA 1ZICA 2EKBA 2CLSA 4R5MA 2D7DA 1QYWA 4HB2A 4UDXX 3SIPA 2EL7A 2WJYA 3H9UA 3U81A 3MBKA 3WGJA 1SBYA 5IXJA 3DMRA 1JW9B 4PO1A 3D3EA 4DV2B 2VO1A 4MPPA 5CD1A 1Q6ZA 3TVTA 2FKNA 3DE5X 1SVOA 3PRJA 1WEHA 3N8HA 5HOQA 3KB8A 1CR6A 4COOA 4ZV9A 1JMYA 2W6MA 2WU0A 3UYLA 3AFGA 2IY9A 2N47A 2O23A 4P5EA 2AUNA 4WBSA 1YZKA 1K27A 3R3JA 4MO9A 1ADJA 1VHDA 3G9TA 4DANA 3NMUF 3UMVA 3BGVA 1VECA 4M7OA 4BMOB 3H5OA 1D2GA 2ODBA 3G2NA 4FONA 4MR7B 3VU8A 5A4KA 3ZD6A 2QJWA 1U90A 3A10A 5HF9A 5HIAA 2FZVA 3GCXA 4I1RA 5SZIA 1XVVA 4LVOA 3ZJTA 2CXRA 1G60A 4GC9A 1KYQA 3G6WA 5KQLA 5BN4A 5K5EA 1N1DA 1HZZA 2TS1A 5KOHA 3ZDQA 1VBKA 5ER9A 4NONA 2X8JB 4F2DA 1QS0A 2J4FA 1K1EA 3FWZA 1K6IA 3F6EX 4HN4B 4QXPA 4BQNA 2LE0A 1C8BA 2CLIB 2EBHX 3ZGYA 2LGJA 2AX3A 1C3LA 2IDMA 5LP6C 2XGMA 1IFXA 3GJ0A 2CXXA 3I1FA 4KQKA 2O2IA 3C3AA 3ZDEA 3ZTWA 3DO8A 3FMPB 1KF0A 3X3HA 1G8PA 4JI3B 4ETNA 3MN1A 2VLIA 4RHYA 1J4AA 1UWVA 2HQSA 4M2LA 5LA6F 3S7ZA 1X9GA 1XZDA 1NFQA 4UVDA 1D0IA 1J09A 2GPAA 3JWGA 3MIZA 3X1JA 1C3OB 5IK2A 2OM6A 3M6VA 3P2OA 3VH3A 3VI3B 4EDFA 3D4NA 5IBQA 3WLQA 4EMSA 3D4LA 1SCNE 2JFXA 3ONEA 1RM0A 4RSGA 1K5GA 4C1NA 5I9NA 5KVAA 3DVSX 3RSCA 2FU5C 3NDIA 5TJHA 4BECA 1KYVA 1CEYA 1TZJA 2W58A 3KK0A 3QF4B 2QP4A 2MTBA 4B87A 3RC8A 3OD1A 1O95D 2KJQA 2HKIA 1KK1A 4RHUA 4FYVA 3RUIA 3FKQA 3ENKA 1WMSA 2NZJA 5JADA 5KSZA 3GMIA 4AURA 1E5TA 2PK3A 1XLTC 3HVJA 3D7NA 1HYEA 2VP6A 1OIXA 3CISA 1V8BA 5KI6A 3UXYA 5CEFA 3W77A 2FI1A 1JKMA 4IDHA 3KP1A 4IIJA 4JB2A 3L6OO 1DOAA 4DQUA 2J5BA 4IV8A 3LPNA 4K5QA 4ZI2A 3X43A 1J9EA 3VKGA 1F48A 1A2KC 3D1JA 3OZSA 1P29A 3VI4B 3ZXSA 4IY1A 4TM8A 2I7VA 4TTPA 3ZTTA 2HJHA 1M8PA 1MRZA 2ZR8A 3PUKA 5C31A 3OM1A 3TZBA 1QYVA 4EI9A 3HV0A 4WCFB 5EJIA 2ZKLA 3HSKA 2FWPA 1JHOA 1W47A 2Q5JA 2VDRB 3VPAA 5G1OA 1WOMA 1WBDA 4XGRA 3TLGA 2OYSA 3K09A 5K0ZA 3H9JA 5J63A 3R74A 4H0FA 4WTOA 3V46A 5JZSA 2DFLA 2H5IA 1L7NA 1T5DX 3VR5A 2JI9A 5K4GA 3IQEA 4K6HA 5EWJB 1K3TA 2VNKA 2EWMA 4EQZA 1J25A 1P2FA 3G17A 1IN7A 1ZN7A 4EY3A 3BXOA 2VTKA 3RAFC 4NECA 3R0QA 1ZIPA 4GMGA 4BX8A 1DIHA 3L4SO 2GEKA 2GZ3A 3AUSA 4IJKA 4LJ4A 4AM8A 5I4BA 1AMUA 1QO0A 2JGFA 2HLHA 1GO2A 2IPXA 5G0UA 4LBZA 2ZUTA 1TU3A 2YJ6A 3OE4A 1LK5A 4C07A 5FTLA 3TRFA 4YCJA 3EVEA 2DWUA 7REQA 3HKDA 1NQVA 2QYOA 3WMFA 3OX2A 4W5HA 3FOEC 2OL4A 5EKUA 5EPUA 5LM3A 2Y93A 3OIYA 4Y6GB 2QK4A 2VAVA 4Q4JA 3GELA 2KYRA 4BZZA 4BVKA 3F5QA 2ZJAA 2QTCA 3LM8A 5IT4A 5A0TA 1NRJB 1UK8A 2OHJA 3KELA 2H07A 4RJIA 5U1PA 4ARAA 1O6BA 4PLYA 4U7PB 3ZXXA 4QU9A 1JSXA 3A3OA 3I3OA 3IEKA 5FUVA 3ULKA 5KNBH 3R8FA 1EFPB 3OLQA 1V9SA 3EEFA 3OCCA 3MELA 1TJPB 4E5SA 5DHSA 5M04A 1U7XA 2Q0HA 1SU7A 2C97A 5AI8A 4S2EA 5A7HA 3ZHVA 2Z6UA 3OIFA 4MKXA 2FUG6 1NNSA 3IAXA 5ALUA 1EXNA 2A88A 2QSYA 2ZCUA 2DR0A 3KV1A 1HDOA 4Q4DA 4XW2A 4RZUA 1GY8A 1HSZA 4V03A 3TAXA 1XQXA 2ZI4A 1F12A 1PX2A 2D4AA 3LPCA 1GA4A 5FBRB 5C7IO 5HRUA 2C2GA 4PZDA 3AEQB 2LV8A 3GU3A 5B1HA 1OZAA 4D82A 4I5EA 2QI9F 2QN7A 1D6JA 4DM7A 1ZD2P 2GMWA 1DX9A 3RGGA 3RSZA 3KSBC 4GXQA 2Q4RA 2QUHA 4B33A 4JLJA 3SBOA 4J8PA 5KU1A 3V4RA 4HXGA 2GM4A 1AT1A 1XGKA 3H19A 1B93A 3WWPA 1UBMS 5ES3A 3U44B 4JUAA 2HHLA 3ZNNA 1TK3A 3QXJA 4ZT2A 3NHRA 1B8OA 3AZOA 3QKRA 5J1TB 1OHHD 2PKQP 3K71B 2A9KA 5DHAA 1R4ZA 2W70A 3G8CA 3IIEA 5AK4A 4D3YA 4KWIA 1WKBA 2W8ZA 4IIBA 2AMVA 3FFBA 4KB5A 4INOA 5LYYA 4TPKA 5CIWA 1OFUX 3QE0A 3AB7A 3QA3E 3MWEA 3MS4A 1PUJA 4GYKA 2I1LA 3IO5A 3LNTA 4MUFA 1KEUA 4FUQA 4BATA 3LJKA 3TNFA 2YXBA 4M0LA 3VTFA 1YF3A 1PLJA 1U63A 2BFNA 5T4FA 2WZCA 3UHPA 4FMDB 1YDHA 1H22A 1TQ6A 4PIVA 1OI2A 2C84A 1FU8A 2BGTA 2XR1A 3BZBA 2OAEA 4RIGA 3AHIA 5EERA 3DGEC 3V7FA 4CM6A 1P8JA 3LF1A 2OFWA 2FSVC 3CRW1 1B7GO 3AGQA 3F6BX 3LE8A 1V3QE 2GZ1A 4V38A 4DIDA 4HZIA 4DNQA 3N8IA 4URYR 1JG1A 1HM5A 1Z0SA 2QRQA 3LZ6A 1E3DA 1RHMA 1MAHA 2KM1A 2PZAA 2VJNA 3FOBA 3L6EA 4UEQA 1X8KA 2HQ1A 1O03A 2FOIA 3KTOA 3S8YA 3W3AA 2XUJA 1EIWA 3RW9A 4DV7B 1TCAA 2N46A 2XNKA 5A3QA 2LXNA 1WB5A 1LCIA 4AU1A 1GHTA 2J09A 1JB1A 3CH6A 4CMEC 3OJOA 1TJYA 1P1JA 1M76A 2VDPB 1E32A 4QFBA 1N0HA 1CY1A 3DDCA 1NZFA 2C9OA 4IFTA 3NPAA 4ZWNA 1DRVA 1XNHA 4OJQA 1N75A 3BH6A 5K6TA 3I9KA 1PWHA 2J67A 3MB5A 4FK8A 4HEJA 4EQ6A 3L8YA 2Q1WA 3O5AA 3OHPA 3QVXA 1U98A 4N6GA 1QAOA 3D59A 4NQRA 3DZBA 3IRVA 2PQ0A 3PNLA 4I50B 4BAUA 3LKBA 5K45A 1WF3A 1TM1E 1IC6A 1OF1A 2V8BA 3HO6A 3Q0IA 5CT8A 5CVVA 1ORWA 2QL9A 4HKTA 2BOVA 4MUKA 1K7SN 1ML3A 2RKWA 3KVNA 4IVQA 3LW7A 3T54A 5ICMA 2ZUBA 2AOXA 3JRXA 4OJMX 3KYDA 1QF7A 2R8XA 4JP1A 3DHYA 1BA3A 3BMQA 4PGGA 4Q7KA 1A72A 4U0JA 2UYGA 3WBBA 4PGMA 5C8DA 5LQDA 4IXTA 2G6TA 3EA0A 1Z6TA 1Q0LA 2HFJA 3DF9A 3I9JA 4UHDA 4ABTA 1AF7A 5E9JA 4B3FX 3H18A 4KFUA 3RU9A 4QPJC 1RCUA 4Z1MD 3FVRA 4EHFA 1EUDB 2YYYA 4YJ3F 2PX6A 4I14A 4DUGA 3QELB 1TK2A 3V7WA 3KVOA 1NAHA 3HBMA 4JSTA 3KOXA 3VHLB 1OC2A 1O4WA 1JG6A 4KMSA 1QRTA 1EK1A 2P2YA 1O8BA 4EM6A 1MMFB 4WH0A 3T7RA 5LWHA 2JI4A 3C5WP 4GSLA 3AETB 1NZJA 3IEUA 4A8PA 1USKA 4INZA 1SOWA 4LYGA 3RHSA 3WGLA 3B78A 1EWKA 1Z62A 2AV6A 2QQ0A 4TQGA 5IYZA 3ADBA 1Z07A 1S0UA 1ZA1A 3VYSB 3DC2A 3IAEA 4P83A 4PQRA 4UNNA 3A6GA 1VKZA 5ECGC 5K0JA 4BOYA 5LZ5A 1WUJS 2PAFA 3H8WA 1ZGJA 5DVZA 4C6TA 3G5TA 5D51S 5ED4A 1MO2A 3I6MA 1I13A 3ZU5A 1JPJA 2HPHA 4AG6A 5LMCA 1GNVA 1W1UA 3F74A 1XL1A 5KSOA 2QG6A 2YQ4A 5DNYB 1B00A 3NALA 2OWDA 4IDNA 1VE5A 2W0SA 2ZYRA 5J4VA 2E6UX 1NT2A 2P2DA 1YE3A 2G9UA 2PT6A 4G37A 2UYYA 3FUCA 4JAVC 4HEHA 5JNSA 5EUQB 5IDWA 5D5PA 3RTDA 3II6X 3HNOA 4OQQA 4XYEA 3DAYA 1DFHA 4EX7A 4PYJA 5CDGA 2OESA 1SU6A 4RD6A 3WKBA 1NVAA 2JK0A 2PT7A 1NI4B 4LKOA 4D3SA 1V11A 3GWZA 1OXSC 1PRYA 3GFBA 5D1NA 1F2UA 3VH4A 4CEHB 4I8IA 3RSLA 1LDEA 1WXQA 3GXOA 3LSTA 2JCGA 3JAWB 4XIIA 4YFYA 1LGYA 1N2HA 3OTQA 2FDRA 3W9SA 3L06A 4B81A 5GIPE 1HQCA 3E4CA 1CSEE 1NP3A 1I33A 3LCJA 3JQ9A 1I8TA 3FYTA 1DG1G 5FR2A 4BLVA 1YQXA 4AZ3A 1YNOA 2IL1A 2Z5FA 1AKRA 2WLTA 1IJKA 1CUGA 2Z4RA 1PWZA 5BP7A 4UTXA 5AJTA 5D3MA 1T5OA 4KNWA 1QIKA 1T1IA 4GVPA 1SIWA 2XUZA 2WAYA 2IWHA 1Q0HA 4LRYA 3CB4A 3LQYA 4QZVA 1YQGA 3KR2A 3UATA 1IUKA 2W2NA 1FFSA 4RZHA 1U2PA 1CP2A 3A9UA 3N53A 2NXWA 2YWXA 3DTVB 4QREA 5KCMA 4DM3A 4FOOA 3L0PA 4B73A 1QE0A 3WWDA 3U9LA 4RH3A 5LQKA 2CK3D 1VL1A 3EISA 1DC8A 1MX5A 3NBKA 2TECE 2XE4A 3QMPA 4PNZA 1L8AA 4BLQA 1FDIA 3CS3A 2DR2A 3W1WA 3DM9B 2P67A 3F9IA 2BH2A 1R10A 3CR3C 2R86A 2X3UA 1XD8A 2C2MA 4PZCA 1RYFA 1A7JA 4X20B 2QW1A 3V42A 5IMSA 2O2EA 1VJ1A 1G21A 1ZH8A 2IZOA 2ZBUA 3H86A 1FQJA 2PN1A 3O4GA 1CUXA 1GKIA 4HDSB 4WI1A 3SSAA 2HA3A 3LW8A 1E5LA 2I62A 4DEYA 4EKGA 5JJ5A 1C30B 4WBXC 1SD1A 5LC1A 3R9XB 2JIRA 5HK8A 4YUAA 1NF9A 2Q1YA 3IBFA 4BB6A 3AY0A 4BP3A 5BPHA 2ZAIA 1SR8A 3P5SA 4KXNA 1FUKA 3Q0TA 3RLIA 4WBNB 3JQ6A 4LWOA 4DM4A 4WUTA 3T7TA 2BCJQ 4DLZA 1OPXA 3OKCA 4YT5A 2P4SA 1BHJA 4MW5A 5BYBA 2DZDA 2A1UA 5K0CA 1I6WA 5H4HA 2DKNA 4PBTA 4NMHA 3UT5A 4ER3A 4GUDA 1P6UA 3GLFE 4P33A 2RK3A 2YUIA 1TK9A 3AGPA 1ZJ6A 4YYEA 5G40A 1AKQA 3IP6A 4FHCA 1I9GA 4WDRA 5D01A 3HKEA 2V3CC 3ZTYA 3IEXA 4JOBA 4PONA 4UUMA 2Y1DA 1NYLA 4DMKA 1GNRA 3K0HA 3WNDA 5BXQC 4WK4B 2ZIUB 2W83A 3DF7A 3FUVA 1R8QA 2K5UA 1T6BY 1FIUA 1X7DA 2HK8A 2JLWA 2HJWA 4PICA 3G7SA 3TQOA 4CDGA 2XWSA 4KSBA 3SXUB 1QNLA 3T7DA 4EK9A 1N78A 4MCIA 2IV7A 2ZAYA 1TA0A 2GRAA 4HI0E 5JCOA 4ZARA 3X2EA 3H2JA 4A8JA 1T0IA 4EKYA 3BD7A 1K0FA 2BZ1A 4L0MA 3KXLA 3F90A 3Q9NA 4LPSA 5EN4A 2PX3A 4AFNA 5HCUA 3KQLA 4BGVA 3GQVA 1JBQA 3W9BA 2GF9A 4F3NA 1L3BA 2YV2A 4HNRA 1A9RA 4RLHA 1K06A 3EUAA 3PC6A 2ECKA 1Q2XA 3EVAA 1I9CA 4UARA 4TXMA 1WPQA 4E6EA 3QNMA 2A1IA 3ZJYA 3VKFA 4EB6B 3CG0A 1UKYA 2QE7D 2G0AA 5JQGA 3B3AA 3PXCX 4GPD1 2J59A 3Q2OA 4H3SA 1HORA 5DASA 3VRHA 4YQFA 1Z18A 3RV4A 1G1AA 1Z7EA 2Q3CA 1MF7A 3G2PA 3WS7A 4MQLA 2QVXX 3JD1A 3S28A 4BRUA 1XLTA 4QQRA 4G1CA 2QPLA 3WL6A 4E2FA 3BDAA 1N0WA 1YDWA 2FJUA 3D6NB 2J3HA 3AG5A 4I3GA 4Y2VA 5FBZA 3SHQA 5FL3A 1BGVA 1TKCA 1Z4KA 2YV4A 2YXDA 4C6SA 3HRHA 2OXIA 4CM8B 4H7PA 4O2BB 1ONOA 1P3Y1 4HQKA 1MC4A 3BFPA 1V7PC 1THZA 1HE1C 3ZNOA 3GGCA 5BW4A 3QSYA 1X94A 3PRKE 2VSNA 4QEDA 2O07A 3AV3A 1LXCA 4M86A 1LZLA 4FQ7A 4MQ4A 1QB8A 1E3IA 2IYLD 3HO1A 4B31A 4RABA 2YIMA 3OQJA 5EAIA 3HB7A 1DUIA 4F56A 4CMEA 1KQGA 2JHAA 1ENZA 3AOGA 3ET4A 2FLVA 1GAJA 1WSWA 1R0WA 1MV8A 2H7VA 3LCUA 2OHIA 5IABA 3BMOB 4L2IB 5F2EA 1CZLA 5JO9A 1ULAA 2CJYA 5AJYA 3TUIC 4XWTA 5DYIA 3VAAA 2JL1A 2F67A 3WNZA 4D9HA 4HTFB 3ZXUB 5HGXA 3X2SA 1YB7A 1F9AA 4F71A 1UIMA 1QTQA 3CLTD 1TMYA 3S2YA 4RIHA 1IUNA 2PMCA 4ITUA 5MN4A 5FULA 2W00A 1W9MA 4RV4A 1Z47A 2WIJA 1DHRA 5FOSA 4AULA 1AV7A 1QIHA 2AJ8A 2B92A 5FTJA 5I7RA 2QG4A 5KWJA 5BYAA 1DKUA 2DFDA 4H1UA 4RPJA 4RXTA 1ZH2A 1GV1A 5AW3A 1SIBE 1Z4JA 2V97A 5L3ZA 1Z3IX 1OLUB 4G65A 4DLXA 4UTVA 1WMDA 5L3RA 4CKWB 1TLLA 4C5BA 1E9DA 2QJOA 2WWVD 1OLXA 1H0SA 3SKVA 1KIFA 4KX5A 5DHRA 1KSJA 4UUPA 2JJYA 1H69A 2JLZA 3K05A 1JDBC 5DWVA 1BTOA 1E2HA 1H66A 2X6TA 2EKDA 4G41A 4AZ0B 2G83A 2LPMA 5K05A 3E9MA 2I7DA 3B3QA 3D54D 3GZTB 3MM4A 4IDEA 5LLDA 1E2JA 3MMNA 1V43A 3I5MA 5G4KB 5LDDC 4ZJYA 4EJMA 3LA8A 1IVYA 3H5IA 2ARKA 1U7PA 1VLMA 3ABZA 1I7DA 2O5EA 5LCXA 4INPA 1J2UA 4D41A 5ITVA 4Q3NA 1FVOA 2IHTA 1P5JA 1X6VA 3MQ4A 4MPTA 5FPHA 3MAGA 2PKYX 4WSOA 1FYVA 4CG2A 4N8EA 1SQ0A 4AP6A 4KOAA 3VU3A 2YHUA 3OCUA 1NKSA 2XCQA 3AZQA 3A2LA 5IS2A 4DTCA 3CUEF 3OQOA 4TZ0A 4UOZA 1Q1AA 4IOKA 5AJHA 1X80B 4NESA 3WZLA 1Z2DA 1D7AA 4IJVA 2AR0A 4R41A 1FUEA 2EERA 1CUAA 3INYA 3MA0A 4HK4A 1VG0B 5FWAA 4BE9A 3UHFA 2AVDA 2GLXA 5A6VA 3J81k 5DGDA 3CE9A 2P5SA 4RZSA 1DBQA 1KJZA 3A6KA 2J07A 3PQ4A 1Y3HA 2P0YA 2P77A 3PD7A 3RF7A 3UUGA 4HAXA 3BIJA 5EUBA 3KVVA 3UGTA 1EUQA 2ZTUA 4LXIA 2VDJA 2ZRQA 4ZO9A 4HDKA 4WNAB 5AVVA 3AERB 3E05A 4HYYA 3HJGA 3V1UA 4R2MA 4OYRA 1JJIA 3QVMA 1S2OA 4DQLA 2AVNA 4ENTA 4MHTA 3V8VA 4DDMA 2BJVA 1U5AA 2OYCA 5AJXA 4ENQA 3O4IA 3QHPA 4TXNA 1I4EB 4RANA 3TN7A 4QWMA 2JLUA 1GN9A 2UU9B 2B2NA 4XOIA 1VQ1A 3M2TA 4DSTA 2FQ1A 4IEFB 1E9RA 4O2AF 1QZUA 4QPPA 3CZAA 2D7JA 4C88A 1Q7GA 2VTVA 2GBLA 3KEFA 1Z0UA 3I12A 5KPJA 1GQFA 4ZYUA 2Q2QA 4D7AA 1J90A 4ZGWA 1G20B 4QX6A 2CMKA 3TDKA 1MB4A 2ECPA 5BV8A 1IH8A 5CP8A 5ADHA 2ZTMA 3WLHA 4RPHA 3HCAA 2GNPA 1DDIA 4PC1A 2GETA 1YOBA 1KY5A 2GXSA 1SUSA 2DHEA 3R5FA 5TQ2A 3WG9A 4D3ZA 4JI2B 2Z1MA 2BFFA 4RGYA 1Y7HA 3LIPA 2FF5A 1R16A 3EGDA 3REOA 3S8MA 2HEGA 1CRWG 1CVRA 1ZC4A 1T1JA 2G70A 2I6TA 2Q5EA 3FOAA 4G4GA 4C0XA 1ZGGA 4O5AA 1XLWA 2HBYA 3ICOA 4UTPA 3D6TB 4ZYWA 1NJ2A 2PLFA 3TO5A 9ABPA 2Q6LA 2C1EA 1WCXA 2O6LA 4JELA 1WKVA 1TZMA 3OU7A 1L8LA 2C03A 2WKSA 5WRFA 2Y92A 4EW2A 5I8ZA 2JFNA 4PHGA 1SUDA 4MH0R 3H99A 4D79A 1G3IA 1WY5A 4HYTA 2PFKA 3FIUA 4JMPA 4WOKA 4DZZA 3GAMA 4JEUA 5C18A 3EDOA 5CW1A 2HTEA 1Y1QA 2I65A 4JB3A 4GIBA 4B7ZA 1JPUA 1Q11A 5HRAA 4CYMA 5EJ8A 4RMNA 2XLBA 1T2NA 2FSHA 4PAMA 4NCNA 3CU5A 3KR9A 3IUMA 4QASA 1LBIA 3GEDA 1T9ZA 3UWOA 3BH7A 5A5EA 1R0YA 1Y89A 3CR7A 1MAWA 3GMDA 4DQKA 3ZDFA 3JQBA 4LJRA 1FP7A 2ZJ7A 2VK1A 2YDYA 3C98A 3FY4A 1E7SA 4PHCA 4RF2A 4Y9UA 4CFYA 1LPAB 2JBHA 4X92A 5K3BA 1NONA 3VC3A 1U0SY 4EUNA 1GPAA 3OCYA 1TIPA 3PUXA 1QQBA 1FXSA 1PGQA 1S2MA 1KDVA 2OO7A 4AY6A 3TOXA 2O5RA 1RI3A 1E9AA 1NVVQ 1NNUA 2A0WA 1GGVA 1GARA 2EGHA 1ZESA 2YFKA 5FI1B 6PFKA 1V25A 2O0JA 1D7OA 1GUAA 2R00A 2SHKA 1MV5A 1U8EA 5A4JA 2YV1A 4M9UA 4FR2A 5DBHX 1O6FA 2XUHA 3Q3JB 2CXNA 4GH5A 1TYAE 2PAAA 2QE7A 1ZGHA 3BL5A 4IKPA 3EGXB 5KTTA 1Z0ZA 4PE5B 1RPAA 2PWAA 4UD6A 5U4XA 3ZE6A 5EJ6A 4QRDA 2VN8A 5I3ZA 2RD2A 4LF9B 4JK3A 4Y30A 2A78A 2P2LA 5ER6A 2IHBA 4PZLA 2I9KA 2D1QA 1TVEA 1XUOA 3UKOA 2PXXA 1AS3A 2EKQA 3LX5A 3IURA 3EFOB 3PJFA 1QRDA 4HP8A 3PQ7A 2VOJA 1A4RA 3FGOA 4OKIA 5C8YA 4BQSA 2FVXA 1HEYA 1M6WA 3GA0A 4FC7A 3LQFA 1EQAA 3LDHA 3OQVA 1GGNA 4FFLA 5CH3A 4OHPA 3C48A 3K0AB 5CLHA 5JXWA 3UUWA 5C5DA 1N34B 1JLKA 1GU7A 4M8NE 4NBLA 5AI6A 1X1BA 1ENPA 2LZ0A 1DS6A 4HAZA 2NZUG 3A1CA 1WXFA 4MV8A 3AILA 4IHJA 1OXVA 2MU1A 4JT2A 4L51A 4NDAA 1G19A 4QIHA 2VPXA 3FGNA 5E2BA 4NBRA 4MJXA 5CX1B 4ZEXA 4R8MA 4MWDA 3QA9A 1LF0A 3R1IA 4KRYA 5L3QA 1L4EA 4JYPA 1XDZA 4E1AA 5JASA 1EFUA 1YB2A 1CR1A 4JA0A 2O2ZA 3L4EA 4K05A 5EP1A 1P9RA 1O9HA 1KOLA 3H83A 1XYYA 2WA2A 4LXTA 4PLVA 4YDSA 1AIPA 1KJNA 1XHFA 2G88A 2P3OA 4O4IA 3KLNA 4JJFA 4B43A 1H2EA 4TWBA 1XZEA 5C5IA 2WYHA 3PJGA 4E08A 3KX2A 3B6EA 3USES 1C8KA 2BP7B 3GX1A 4NH0A 3KYCB 5JCXA 3SYTA 2EFEB 3FCAA 4PW0A 3BG5A 3RRZA 4IZOA 3T7SA 2O5VA 4YJGA 1M5UA 1HYBA 3SGLA 3TZCA 4GG1A 2KW5A 3FWKA 4A73A 2FPXA 3FF4A 2H17A 3ZD9A 1PQWA 2NQ2C 2VXYA 1U1CA 4JLKA 1NE2A 3CLHA 2CNKA 2VP0A 3DA8A 1QK3A 3DLTA 4Q01A 5BNIA 1PL8A 2FH5B 2QLTA 1IY2A 1EKXA 2X0DA 2ODWA 5JJBA 1XAJA 1ORDA 3M4NA 3R8CA 5DYNA 1CE8B 1G8HA 4L74A 5P8WA 1QP4A 4X84A 4YAGA 2ZWPA 5HG0A 1GZHB 3RVDA 4DLRA 1QF6A 3RVMA 5K2OA 1BCSB 4ZOEA 5CB4A 4WUVA 3ZWBA 3K8ZA 2BF7A 4X5OA 4FM9A 4QT4A 3KJGA 4OSEA 2B4YA 4FJ2A 2BCEA 3ZY6A 1H85A 2P6PA 4J6EA 2GPSA 5JRZA 3EWSA 2IIPA 1EE1A 1ZMOA 3HXPA 4EG1A 1GT91 4B3TB 2HUPA 2FZGA 2GBGA 4TLAA 2D2FA 3IH5A 5EIBC 1G8MA 3TIXB 1U8CB 1I2DA 2COKA 2WW8A 3BCSA 5CT6A 3FWHA 2K87A 2BMAA 5FL7A 4CM9A 3Q2KA 1K7XB 4IRXA 1X7GA 1KYWA 3RK0A 3A4VA 3MQ2A 4MYUA 4F8JA 3ID6C 2EATA 2POCA 3QP9A 3H6GA 1L0BA 3QENA 5H68A 3LLUA 2VAWA 4HADA 1UMDB 3L0YA 3OECA 1U0GA 3L8ZA 1GU0A 3AW8A 1MQAA 1CB7A 3PDIB 4Z5XA 5C2JB 1G4UR 1KJYA 1Q1NA 2FP3A 3VX3A 1EGQA 3ASYA 4AKGA 1U5CA 5ALDA 1KQPA 2JCSA 3KUUA 2D1YA 1PQYA 3KKMA 4LRQA 2HXSA 1JUDA 4W1QA 2KBEA 1Z3CA 1GZ3A 3P71T 4P7JA 1Q50A 2ABWA 1NUQA 2GN1A 4XPIA 1HZZC 4LY0A 1T1GA 4IF4A 4IUDS 1R6TA 3K09C 4MS4A 3FHTA 4EHLA 4B8ZA 3ZDRA 2I34A 3A2MA 3NWOA 1VPWA 3OE1A 3NIBA 4DVGA 4I1UA 3W5BA 1YZGA 1E3WB 1W59A 2GDJA 3NO4A 2I3GA 1BC5A 1KI9A 5BQ3A 4RAOA 2YCLA 3D6FA 1IYZA 1VL5A 4S1WA 4Z9AA 3AEKA 3SX0A 4JUCA 4RQTA 3ANXA 4LRWA 3IQIX 4NAVA 5ILQA 1AK1A 1MIOB 3LUBA 5DGHA 1LLQA 2ZJOA 2ZAMA 3HCPA 4IQ8A 3FVQA 5DMXA 4AWAA 1VDZA 4QU5A 3U26A 1FXUA 4KSYA 2AJBA 2OV1A 3O8CA 1QC5B 3BERA 1WHSB 5E1DA 3IDSA 4BXOB 1FFEA 5HQJA 1TDJA 3AJ9A 3EXIB 1PWXA 3GEHA 3QEOA 1TAQA 2JJ2A 2Y2VA 3NASA 5E7MA 4UE6A 4I8XA 1CLEA 2QZ4A 5IJZA 2XOKA 3HG7A 2YC2C 4MV1A 4ZVQA 1F38A 2IEAA 3V4PB 5EKDA 3CB2A 4H7DA 2NU9B 4HX5A 3RT7A 1V7QA 2XB8A 4M9SA 3G68A 2G1PA 4JODA 3SI7A 1ZR2A 2RAUA 3QOXA 3KQVA 3BIWA 2PWPA 3OZBA 1VC2A 3PCRB 1R37A 1N2XA 3LHIA 1QS0B 2WMOB 2O8CA 1OMOA 2DKFA 4X71A 1UJ5A 2MSLA 2XOXA 3K9HA 2GEDA 2HPAA 3MT9A 2QUKA 4C4TA 1ONNA 2PX5A 2ZYAA 4RVCA 4QEZA 4GP7A 1G8JA 2ZIXA 1A2BA 4UU1A 2FUNB 2QV7A 4E3ZA 2IXFA 3INRA 1ES9A 3UK1A 1MO3A 3VGJA 3D1VA 2BRUA 3D6JA 4FN5A 1DQRA 4MDEA 2VP3A 4DIKA 1DV1A 3GJ7A 4IWYA 5LKAA 1XZBA 2YBDA 4XLLA 4PPQA 3BORA 3R3VA 3WYNA 4P36A 5JRJA 1HURA 1T2UA 2XAAA 2Q9BA 3IKTA 4UKDA 3C3PA 3LHFA 1I3CA 5CG1A 1DEKA 4U6SA 2XCSB 2PIAA 4TS4A 2O3SA 3EWAA 5IFLA 3OLVA 5IULC 1F5SA 2B21A 2OQIA 3LX4A 1INLA 5LJLA 3B38A 4MR8B 1XCOA 4EG6A 1EA7A 1LSJA 4K40A 4MPDA 4W5TA 2DVMA 4QYXA 3E3OA 1IM2A 3C1UA 2AYXA 3QWBA 5B2FA 1ISJA 4XQCA 5D6NA 4IOLA 4LISA 3LDFA 2Z8ZA 3DDNA 3DMGA 2IXGA 3S1AA 5ESXA 3WL4A 1AZLA 1WS6A 1XWFA 2A7QA 5BSWA 1VLVA 3F0TA 1XXLA 3VSEA 5ITZA 1W8DA 4HPWA 1QWOA 2G4CA 1TZKA 1GCGA 2P1ZA 2VAMA 3IT2A 1V1JA 5LBIA 3FTEA 4N18A 1YVUA 4RMJA 2MINB 2OSBA 4RYDA 1H3EA 1Z0KA 4RZ3A 1R74A 1DC7A 1UZUA 2G28A 2Z8YM 1I94B 1LPBB 4EHDA 4CF6A 1C1DB 4NEQA 2NUTB 4XGKA 4Z4EA 2CZCA 3UWPA 3ZV4A 1XOIA 4YDHB 1D9ZA 1L4LA 3OCJA 5KIAA 5BMVF 2ZI3A 3GK3A 1OWMA 4MEJA 4DC1A 3U60B 1G5PA 4PIPA 4G4SO 1N3LA 4N0PA 3DP9A 2G04A 1SHZA 3H7AA 1QMGA 3D3WB 5E9AA 1KXZA 5G3ZA 3WIOA 2DFVA 1HXHA 4BNJA 4HAWA 4D0NA 4TYPA 5JWOA 5JSFA 2BSXA 2GXUA 3P52A 3RVQA 4LTMA 3A70A 4C4PA 2HA0A 5CPBA 3VH2A 1J8DA 3GJ4A 4B7CA 2OA0A 1H1DA 3QE2A 2B34A 3WLAA 1R5BA 4A7PA 1KETA 4ZHSA 2XBUA 1D07A 4YECA 3T9CA 1I7LA 1M6YA 3D5QA 2F1HA 2PZKA 4U39A 5D85A 5F5NA 3ILVA 4EG5A 4N7BA 1G8FA 2FFRA 3F6YA 2H9YA 1Y7LA 3PQDA 2C8JA 1PFQA 5EJFA 3JARB 1XCMA 3MRVA 4WEQA 3ZOZA 1JEAA 1TT7A 4UZSA 3GNLA 4XRGA 2ST1A 3NHAA 4F21A 2B2XA 1X92A 2CLCX 2A30A 1Z38A 2PKRA 2F8SA 3K9NA 3O9MA 5HZKA 1DAOA 5JS7A 1AJEA 3KUDA 1NX9A 2AI3A 2PH5A 4OUDB 4MMXB 2MMGA 1TIBA 1CUHA 1UR5A 1XRPA 3KD3A 5JNRA 1CUYA 2H4HA 2QDXA 2X0RA 3NQ41 3WB0A 3WO1A 2E55A 1U1EA 4PLZA 4X63A 3ZDDA 4LE1A 1OYWA 2HIAA 1RQGA 1U28A 4KR7A 3RREA 2IUFA 1Q7CA 3K0CA 4FLMA 1X1SA 1VGVA 2FG7C 1L7OA 1YQ9A 3WLRA 5BSHA 3ZIAD 3IB3A 1W9HA 4G81A 3SFVA 2E4WA 3EN0A 3JW8A 1VHLA 2V7XA 5H8WA 1GTRA 2YWBA 3CUUA 3HZOA 5E6RA 3R4VA 2G9NA 1WCIB 4RTOA 5JBQA 3TEFA 4D8WA 2J46A 2JZNA 2HK7A 3AEUB 3COSA 1F60A 3HABA 4YAWA 5IDYA 4BMVA 4BO8A 4EABA 2AH5A 1CWUA 2HU2A 3HU1A 3OZIA 2QF7A 5EE0A 3DL0A 1C7JA 1PJCA 1BA2A 1RP1A 2EIXA 2ZI7A 1CY8A 3FR7A 4L50A 3OLCX 2B6NA 4FYWA 1TYEB 4RA6A 3PTLA 5AM2A 3ADCA 1Q0PA 1OZ0A 3CNEA 4R83A 4BAGA 1VG8A 1GP2A 1RWNA 2CMGA 2JAHA 1CLUA 2B2CA 3PC8A 1Q14A 1YAJA 3GG9A 2GBFA 4GI2A 5AKXA 3HHEA 4D9FA 2AW5A 2M6SA 4Q0MA 2I6QA 4QAQA 4JV5B 1J5EB 4KHPB 4FCWA 3UHOA 1D2HA 3GUYA 2HIHA 1NGSA 2HF8A 4Q4LA 5DGXA 1M2WA 3AUAA 2VHZA 3IC5A 5DYYA 1NDHA 3OJFA 4KO4S 4ND8A 4OFBA 1E3QA 1NRXA 1ZMRA 3U7RA 3V8RA 1GEEA 1E1MA 1W25A 2VP5A 4PCVA 5CCBA 3A4TA 5GP1A 4EYKA 1G6OA 4HLUA 2WWFA 3WB9A 1PEKE 3G0OA 3SLRA 3HCBA 4EWLA 2DERA 1U3TA 1C81A 4M9QA 5EKXA 7YASA 1UXGA 3PR3A 3B7WA 4EUFA 3SMVA 2AB0A 3TQFA 2Y0DA 4LHXA 1Y33E 2EZ9A 4ZK6A 4F6CA 1GZVA 4M1SA 4ONEA 3FA2A 1XC7A 5KQSA 3LOQA 2VUTA 4NPAA 1TGYA 4RE6A 2PKWA 3IVCA 2QTRA 2G25A 4G0QA 2ZR7A 4WOJA 3STXA 5B58C 1GPJA 2DGDA 2VWPA 3A7DA 5A1TA 2VCEA 4UHEA 2V7WA 5IKOA 3ANLA 5AW8A 1JECA 4N4AA 4MWTA 5FKJA 2HUNA 1J49A 1PT9A 3AR3A 3TL3A 3HJFA 3BWDD 3TNDA 2UYOA 4LWQA 2GCOA 5K9ZA 4UDYX 1M1NB 3BE5A 3AM3A 3CX6A 1YR7A 1P9NA 4L85A 3L0SA 4LC0A 4N5HX 4B82A 4BMYA 2P11A 1M1XB 2F90A 3QU2A 4RWEA 1YACA 2NGRA 3DHWC 2WU3A 3P96A 2IYSA 2XZPA 4FYKA 2FWNA 2ACVA 3D2CA 4XX0B 4LE2A 3BICA 3EZFA 4R0VA 3X2FA 2QPAA 5A9SB 3QF7A 1NBAA 2PA3A 1OB2A 1U3GA 3UH0A 2XQVA 4EQ6B 3JAKA 4KXVA 3QZUA 2I4TA 4LHEA 3U3ZA 1SC9A 1UL1X 3FDZB 3TLBA 1L3CA 4DV1B 4MDFA 4N41A 2REOA 1N5RA 1XTPA 1VIMA 4AYXA 5TNXA 5IJWA 1N3IA 4NE7A 4JI0B 1SXJD 2JNWA 2GYYA 4RJJA 1MN6A 3NCHA 2XQKA 2NU8A 3TXXA 3LP6A 4IG9A 1TT5B 2RH9B 1OWNA 1ELOA 3UMGA 3MTQA 5FQOA 1RZ3A 2ZK7A 5JANA 1ORHA 4TYMA 5CGQB 1QB7A 4YDQA 3D64A 1AG9A 2WRZA 3DO5A 5HX7A 2W9XA 1B3BA 3QFFA 4LNHA 5DXAA 5TQ0A 3QELA 1SBTA 3H8VA 4UMDA 4BQIA 1RWKA 3TE6A 3TSZA 4ZCTA 3KCQA 2DPGA 1P1RA 3QLUA 1NURA 4QXMA 2V6BA 4MVJM 4F5EA 2DLDA 1QRRA 2HIGA 3DHVA 1GSHA 1X7WB 3LCRA 3DE4X 3PDJA 4G5QA 1TL7C 5CYOA 2ZJFA 3A05A 5GWXA 5AI9A 2WD8A 2QE6A 3LT5A 4R9RA 2A57A 1JHAA 5KWIA 1EBFA 4MW0A 3C3JA 3DZ8A 4L5IA 2XCOA 3BK1A 1W1IA 3M6XA 1M0TA 3FTNA 1N6NA 3RCBA 4UU7A 3QI2A 3U4QB 2CJXA 3GCZA 1KGSA 2O6HA 3EGWA 4FEAA 4C6TB 2X2OA 2PBZA 3SZUA 4CV2A 2ZTSA 4PX2A 4CT5A 1DXHA 5E8JA 5K3CA 3GCDA 2G76A 3CUYA 2OILA 2P4QA 1V8DA 4MUHA 4JVNA 4YCCA 2A4KA 1T36B 3DFIA 1FNSA 1MDBA 1Z4QA 1CULC 2RHWA 4I3FA 4LDZA 1IZZA 4U7HA 3SFZA 1JSRA 3TLZA 3ZDZB 4EHNA 1JFTA 3HCWA 2QJFA 1GFSA 1B0UA 4DJAA 1WPXA 2WD7B 4C0SA 3RIEA 4CV3A 2XUKA 3RASA 3CGGA 3OQNA 5JPCA 2ADOA 1HG1A 2J0EA 4JOQA 4KN6A 1V11B 1Z73A 4LFCB 2OP1A 2JF0A 2HA4A 3MD9A 2CV2A 2RG1A 2QBYA 5AKKA 5TEVA 1GIAA 1SGWA 1FUYB 1T3TA 2QM3A 2GO7A 2XUGA 2JFHA 2X9GA 4OMCA 3T4XA 1OAOA 5IFKA 4ZAZA 1XMVA 4DA6A 1VIYA 2R11A 2P7IA 4RAQA 4UTRA 4KV7A 4O4LA 2PMBA 4YVFA 4TOIA 2QR3A 4AZ3B 2H4ZA 1K6XA 3RJ9A 5CEJA 2OFFA 2JFQA 5HPYB 3JQDA 5I7HA 4QQ8A 1A50B 2VUSA 5F51A 2CBGA 4D8XA 4EJ0A 3MWKA 4ER5A 2FR1A 2GB4A 4YPOA 4P5PA 2TMKA 4LX0A 1N0IA 1ID1A 1L4KA 5GV8A 2O8FA 1QTRA 1D4AA 3IHWA 4F4FA 1WULS 2V4MA 2PKXA 1YJCA 4BN4A 4IM7A 1YQEA 4JJKA 4JUBA 3HVIA 4TN1A 5K7SA 2VJBA 3N5KA 2QTWB 3TINA 2NO1A 4UATA 5LBTA 2HDWA 4ARUA 2HCTA 4RH0A 4D9CA 3KLMX 4CTNA 4W5OA 1RQ7A 3UOAB 4P4UA 5B1EA 1E1CA 2H48A 4KMMA 3ROGA 1ZG3A 3D3QA 4FOPA 3AU8A 1Q1QA 3E9ZA 3OO1A 3R23A 1S7CA 2WY2D 4FN4A 4TTSA 1QQAA 2B7LA 2JD1A 1AGPA 1KIMA 3N76A 1UBEA 4RE5A 3T0FA 1YA6A 2DF8A 1NZDA 5KNDA 4MGZR 4KITB 2MSEB 2B6HA 3IHTA 4BX2A 2WF9A 3FOZA 4ZZ3A 3G3EA 1JDVA 1KHHA 1NJGA 2A5LA 3MLBA 4F6LA 3E5HA 3PC2A 3RYHA 1FSPA 4R4JA 3WGUA 1W5BA 2NUBA 4PFKA 2BMDA 1O6GA 5CLQA 4MVJH 1CJCA 2WDZA 4OATA 1F4VA 2P40A 1REQB 3LQ1A 3ZIAA 5IVPA 4KUHA 4O8ZA 1OB5A 3RKSA 2OQ2A 3O95A 5A7FA 4N5LA 1TVCA 5FRDA 3ZE2B 1STOA 1Z4LA 5EZSA 4GFDA 4X8MA 1RKBA 4CQMD 3OPYA 3QITA 2OZLA 4PZ9A 1QR2A 4KXMA 3GV0A 2DFPA 4I6EA 4V0NA 3V8PA 1NVWQ 2GJKA 4GX0A 1EX9A 5LQNA 3VOBA 2C9MA 3FPJA 1TCCA 2DQ4A 3D9QX 2VWHA 3E0XA 3EAQA 4F38A 5BMOA 2G80A 3QWAA 4LI3X 4CIWA 1TZCA 4XJSA 3GRVA 5A4MS 1A82A 4LV8B 3RJZA 1KDPA 1WU8A 3KETA 1A98A 1QQ5A 1PR1A 2JGIA 1P4SA 3N5CA 5AVQA 3LBNA 4DG5A 4QJ3A 2QL7A 1WVIA 3HDVA 1P5RA 1P31A 3T5GA 2LP4Y 4MMZB 1GZUA 1Y6QA 3FNBA 4ZA2A 4XTRA 3OZAA 5F35A 5K3DA 4BGIA 3LA6A 5ELLA 1XYGA 3G85A 4RD4A 4Y6LA 1YA4A 1EE2A 1KAOA 1AHIA 3JQGB 4ZN6A 2QP3A 1PJBA 3IJ5A 2FEAA 2ACWA 2Q2OA 5T3UA 1Y8QA 3I1JA 2V9PA 3J81A 2VVTA 4FIDA 3D6VA 4YT2A 2WICA 1DAEA 2W43A 4HATA 3HP7A 4RIIA 2Z30A 3IOBA 3RFUA 5A02A 1FTNA 4GC5A 2HDOA 4Z8XA 1A04A 1WSAA 2QMYA 2IXTA 5KTKA 1XRRA 3L79A 4FZRA 4MVJG 2IV3A 2GPNA 2R7LA 3KYJB 1W52X 3V32A 4CQJA 1YB4A 4DV3B 4NAHA 4DREA 1WUHS 1IBMB 1E5VA 2HC9A 3BTOA 5J59A 2IA5A 1SQ6A 2LKCA 2QRNA 3SDSA 3UUEA 3JATB 4I1VA 5LDHA 1Z37A 2XB9A 2NPFA 3VZCA 3EULA 4IWNA 4ER6A 1XRLA 4GLBA 3HDQA 5ABPA 3LT4A 4HNAB 1XO1A 1P5HA 4E5VA 4C05A 2VYFA 2C57A 1HDXA 1T8PA 4OM7A 3FLEA 1KEVA 3CSSA 4JDPA 3LY5A 4QUBA 4MK4A 4R9NA 4AJLA 3LBFA 2Q6OA 4JI1B 1D8TA 1KA9H 4OYLA 3SZRA 2C7GA 3T8YA 3MJDA 4BFZA 4E15A 4KI7A 1C4OA 2Q0XA 4NDZA 1MHTA 2DQKA 3CX4A 4H7JA 5DHTA 2B36A 1QGED 3BZUA 3BMOA 2C83A 3JQFA 1T2AA 4RF4A 5K3SA 1ZRMA 4TT3A 3DNMA 4I5FA 1M54A 3GVIA 4I66A 4BNMA 4BMNA 3SF0A 4LNUB 3HMKA 1OZGA 5J23A 1PFUA 2GARA 3PWSA 1CY2A 4DCCA 3RU2A 3DAPA 3WO0A 1YJ5A 1Z5WA 4INJA 3U6BA 2XH8A 3ZHYA 4XM0A 5EPOA 3EPLA 4CL0A 2FN9A 3FROA 4OHRA 1ECFA 1G64A 2CSUA 1DELA 1A9ZA 3TJMA 4BN5A 4LDQA 3DEIA 3H0EA 2OG1A 3UKJA 3ZKWB 5JI3E 3M49A 3BK7A 1R0SA 3P9IA 4YP6A 1GM5A 3CUSA 4HLUC 3MZ0A 4QM7A 1KMMA 1G7SA 1US8B 4U9UA 1GL6A 4C03A 1QH1A 3R3UA 4HDMA 5EQFA 3TQRA 4OVKA 4X8LA 3L77A 4R1QA 4DDTA 4I4TF 4MKHA 4CGZA 3V7NA 3I5UA 5AM0A 3C4VA 1FLAA 3O8LA 3ITEA 2AWOA 1UKBA 4TSRA 3RS7A 3I0ZA 3QW2A 3W4KA 1JNXX 4HDRA 2HI0A 1MB3A 4OQLA 3VU0A 4XH9B 5G4KA 3ZHOA 4PRLA 5J2UB 4YUVA 5TMPA 1A8IA 2QRLA 2X6QA 4WEOA 5KTMA 1PZEA 2AZ4A 4D4LA 2XGOA 4QU8A 4WXEA 1XK6A 4OQFA 4G36A 2NNWB 1CDDA <