3OE4A

Rat catechol o-methyltransferase in complex with a catechol-type, purine-containing bisubstrate inhibitor - humanized form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 68
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3oe4A01
3D2LA 3O4FA 4OBWA 2IPXA 3HCAA 5FWDA 3A25A 2P40A 3M6XA 2VDVE 3KU1A 3LCUA 3MCTA 5K03A 1RI3A 2AN5A 2NXCA 5KVAA 2ONZA 1QANA 2FK7A 2QRVA 4IKPA 3KQOA 2IIPA 2ZBQA 2OBFA 3ERCA 2XYVA 2WA2A 4KIGA 3CKKA 3SX0A 5MHTA 3B7PA 3KQWA 2JG3A 5LQUA 1JTEA 5ERGB 2CWWA 4CKBA 2GPYA 5GM1A 1KR5A 3HTXA 1JR4A 1KP9A 1O54A 5GM2A 3CJTA 3G8BA 2FK8A 1NV8A 2CL5A 5EIWA 3M70A 4RSRA 3ER9A 4KW7A 2PJDA 1RI2A 3FUTA 3OZSA 2HWKA 3P71T 1BHJA 1XJ5A 3ORHA 1VIDA 2YVLA 4GEKA 4QTTB 2AOWA 1ORIA 4WVLA 3TLJA 5DSXA 2AS0A 5LSAA 5GINE 3KHKA 4P7FA 1N2XA 2CMHA 1BC5A 5DPMA 5T6BA 2GB4A 3MERA 4EVIA 4YMGA 5EIFA 4PWYA 2AZTA 2G72A 3KPJA 2OO3A 3PT9A 3T0IA 1AV6A 3UFBA 4KDRA 5FUBA 3OZTA 4ER3A 2DPMA 4H0NA 3GCZA 3TFWA 1YZHA 5K01A 5DT2A 2C7QA 5HIJA 2LD4A 4RTSA 5E2BA 3LDGA 4IV8A 3DUWA 3EEYA 5BW4A 4HGYA 3DLIA 2CMGA 3G7UA 3DR5A 2FHPA 3P2EA 4M38A 2ZFUA 1KXZA 3Q87B 3RODA 2JHAA 2ZTHA 3HCBA 3HCDA 3K0BA 1ZKDA 3O7WA 1DCTA 2PKWA 4PGHA 3BWYA 4DZRA 2ZIGA 4X60A 3H2BA 1NBHA 3GU3A 2ORED 1N7JA 3P2KA 5CVEA 4AZTA 5F2NA 3PLAE 4XUDA 5C0OE 3Q7EA 3FPFA 3MHTA 3AJDA 2PX2A 5FWAA 3P9IA 3P8ZA 2OYRA 5EHIA 3TKYA 3TRKA 2AOUA 2O07A 4X61A 2GH1A 3A26A 4BP1A 1YF3A 2G8NA 3FUWA 5DXAA 2NP7A 3FRHA 3NVMB 5CIYA 5U4XA 2BH2A 1ZG3A 5LQKA 4QQKA 5EKUA 5K0EA 1AQIA 2QE6A 1EAMA 5H02A 5HFJA 2NXEA 1SUIA 4GOMD 3WSTA 3SXJA 4RTKA 2P1DA 2R6ZA 3I64A 3R3HA 4HRAA 4ATNA 1IXKA 1NKVA 4PYIA 3V97A 4RTPA 2I6GA 3UA4A 1U2ZA 3JWJA 3FUVA 2OZVA 3GIWA 5DM1A 1WG8A 3PFGA 4GOND 4M36A 3OU2A 4GOOD 4Y2HA 3FPJA 4DM3A 2Z6QA 1VL5A 2PXXA 3GGDA 5K0JA 1FJXA 1L9KA 4HTFA 4YMHA 1XDUA 3C3PA 2IH5A 1INLA 3NWEA 1KHHA 2HMYB 2ZZNA 3NVKI 3CGGA 4OQEA 4R6WA 4E70A 4E2XA 2PT6A 4DCGA 2P3QA 5FULA 3BXOA 3UJDA 3TPZA 3IHTA 5EZQA 3LL7A 2O05A 1Q0TA 4IWNA 2AVNA 2PX4A 1RJEA 3KPVA 4KDCA 4RYLA 1X1CA 5CVUA 3THRA 5E9QA 5EMMA 1M0EA 3G5LA 3I53A 4FSDA 3EVCA 1RJDA 2VDWA 3FZGA 3G5TA 4MHTA 4Y30A 4OBXA 2IH4A 4E30A 4P7GA 3C6MA 5DX8A 5GWXA 4L7VA 3KQYA 2YQZA 1EJ0A 2B9EA 4XUEA 5ICFA 5GIOE 4GUAA 3VYWA 2VDUE 2PX5A 5EHGA 3BGDA 4EKGA 5CD1A 1P1CA 1R00A 3ELWA 2HV9A 1YZ3A 2FCAA 1NBIA 4QQNA 3B3JA 3O31A 5FA8A 1SKMA 5E2AA 5IKMA 2O0LA 2JHCA 1JG4A 2YUIA 1EQAA 4HSGA 4RVDA 3PVCA 3LSTA 4C08A 5LR6A 3KKZA 5CVJA 3AXTA 4RTJA 1NE2A 3ELYA 2P41A 3EVZA 2IDJA 5FCDA 5KQSA 2XBMA 4AUKA 5CCXA 3LX6A 3I9FA 3DTNA 4UOEA 3SMQA 4LWPA 4P7KA 3B3GA 5EMJA 3UJCA 2A14A 3KR1A 3HVKA 2H00A 1R8XA 4X63A 2UYCA 5T67A 1NW8A 4F86A 4GOLD 5G02A 3CCFA 3LCVB 5DX0A 4LWOA 2B25A 3EMBA 2BM9A 1KYWA 1ZHFA 5B1SA 3A7EA 3M6VA 2GS9A 3EVAA 5C1IA 2ERCA 1I1NA 1XDSA 1KPGA 2BZGA 5LQAA 3KQTA 2E5WA 2XYQA 4PCAA 5EEGA 2AR0A 3C6KA 2HNKA 3OFKA 2AOVA 3ME5A 4X1OA 1F3LA 1AQJA 2F8LA 5CUQA 1WY7A 1VBFA 2QM3A 2OKCA 3NDIA 2GAFA 3G2QA 1KYZA 3CJQA 2BR5A 3GXOA 4GC5A 4CWAA 3KR0A 2ZIFA 3BT7A 5IH3A 4PGGA 2QYOA 4FZVA 5CVVA 5E1OA 3L8DA 5EC8A 7MHTA 1NW6A 3GRUA 3VSEA 4A6EA 4MQ4A 1HMYA 5HILA 4E31A 3T7TA 2EG5A 1YB2A 4CTKA 1ORHA 4XCXA 1DL5A 4MWZA 4QPNA 3HVHA 2WK1A 8MHTA 2WA1A 4E32A 3DXXA 4ER0A 1VQ1A 3GJYA 5BXYA 1MJFA 2ZIEA 3HM2A 5DTQA 3R24A 2G1PA 5DTRA 4QTUB 4E33A 1R74A 3EGVA 4E2WA 5LQCA 5HIIA 3I5UA 4HC4A 1QYRA 1IY9A 1VLMA 2ZULA 4PNEA 3BWCA 5EMLA 3G8AA 3DP7A 4G56A 5DXJA 5HZMA 2NXJA 5E9WA 3TM4A 3IEIA 5DM2A 5BP7A 3AWIA 2G71A 5E1DA 4DQ0A 4O29A 5LQJA 3DULA 1KPHA 4FT4A 2BR4A 4DCMA 1P39A 5GP1A 5K0NA 2YXLA 2ZBPA 5GIPE 4A6DA 5FTWA 2P7HA 3GWZA 3OFJA 4JXJA 5ICGA 2Z6UA 4EQZA 1BKYA 2ZVJA 3LDFA 4PONA 4P7JA 3REOA 3MB5A 2ZZMA 2ADMA 4AX8A 1M6EX 3A27A 4HGZA 3SSNA 5KS2A 3LBFA 2P3OA 3PB3A 2NP6A 4YUZA 5EGSA 1KPIA 3IV6A 4NECA 2JJQA 2OPBA 1SG9A 3TM5A 3OCJA 3DOUA 2H11A 3HEMA 3EGIA 4CXMA 3R0QA 4R8RA 2JH9A 2IP2A 1G6Q1 4V0QA 2ZWAA 2YXDA 5DLYA 4QVGA 4C05A 2AOTB 3LPMA 1G38A 3A7DA 4M7RA 2UYOA 3TOSA 3R6TA 1L3BA 4B17A 2Z6AA 2CKDA 3G88A 4RTQA 2EX4A 4M37A 3RW9A 1G8AA 4R8SA 3DXYA 3OZRA 3BWBA 3BUSA 4PCLA 3SVZA 1ZQ9A 1QAOA 2OB2A 2QY6A 5CVDA 4ER6A 3HA3A 3DMHA 1JQDA 1JG2A 3B3FA 4XUCA 3DLCA 1JQ3A 2XVAA 3G2PA 2PV0A 3OE4A 3EPPA 1F38A 3FYDA 5FA5A 5DX1A 1ZGJA 1N7IA 1M6YA 2FRXA 3CC8A 2PX8A 5K05A 5K0GA 1FBNA 3LBYA 4FGZA 10MHA 1FP2A 3UBTA 4V0RA 3LCCA 5GOZA 1JQEA 1PJZA 3ELDA 3FRIA 4RTNA 3PS9A 1Q0SA 4EK9A 4EKIA 3KQPA 3ANXA 3GNLA 4YV0A 5M5BA 2PLWA 2XVMA 5E1BA 3AY0A 4CKCA 4Z2YA 4PYJA 3KR9A 4E2ZA 5HIKA 2P8JA 3OPNA 4RTLA 4PYMA 2FYTA 5DM4A 3FTFA 5EKXA 2OB1A 4ER7A 5D1NA 2NXNA 3MTIA 5T64A 3NW9A 1O9HA 5JR3A 4AZWA 4YUWA 1IM8A 5K0FA 4WXHA 1NW3A 2ESRA 4R05A 2I9KA 2VS1A 1FP1D 4DA4A 1G55A 1TPYA 1JG1A 2Y1XA 3EGEA 4KWCA 3T7RA 3VC1A 5ICCA 2UZ4A 1XCLA 2PWPA 2P35A 4MTLA 3BGVA 4AZSA 2ZBRA 1B42A 1D2CA 2V74B 3P2IA 3KQMA 3PX2A 2EJUA 5F2KA 3NMUF 2PSSA 2Y1WA 2NNWB 3EVBA 3PTAA 1PRYA 1TW3A 3HP7A 1QAQA 1SQFA 1UIRA 4QDKA 3T7SA 2YR0A 4RTRA 3CBGA 3HA7A 2BR3A 3P97A 4C4AA 3C0KA 3OU6A 4OX9Y 1VP9A 1X1AA 2PT9A 5KQRA 3PFHA 5EPEA 1UFKA 5DM0A 3TMAA 1VP3A 1UWVA 5CCBA 2AOXA 4FSXA 3EVFA 3LGAA 4CKEA 3EVGA 4RTOA 3U81A 3M33A 4POOA 4GC9A 3CJRA 4RVFA 1RI1A 2DULA 5KYGA 5EOVA 2PWYA 2ONYA 3A4TA 3UA3A 5LQRA 1EJ6A 4RVHA 4BP3A 3RIEA 1X1DA 1XVAA 3KPYA 4GQBA 2YXEA 4BLVA 3EMDA 2PBFA 3BWMA 3B89A 4IV0A 3AXSA 3P9NA 5D1HA 4C07A 3E7PA 4BLUA 3LECA 1X19A 2P3LA 1R18A 3R9XB 3FTDA 2P7IA 3BZBA 1RJGA 3DXZA 4PIPA 1ZGAA 3UJ9A 2EJTA 4X41A 5EMKA 2AOTA 3UZUA 4QVKA 3KPUA 3UJAA 4P58A 4ZTBA 2Q41A 2VP3A 3KQQA 4PYKA 3GRVA 1YFLA 5E1MA 1QAMA 5DRYA 3UJ7A 3UWPA 4KRGA 2EFJA 4K6MA 2UYQA 3LDUA 3NTVA 5P8WA 4RVGA 1D2HA 4PINA 5ICEA 2C7RA 3LKZA 1V39A 1T43A 1RJFA 3DMFA 3HCEA 1JTFA 5K0LA 1XXLA 3ELUA 2K4MA 1FPQA 5DWQA 1WXXA 1JSZA 1R6AA 4RTMA 1O9GA 1P1BA 3HA5A 4PIMA 1DUSA 3GO4A 3M4XA 4GF5A 3GRYA 2O57A 4YV1A 4KVZA 9MHTA 3LKDA 1JG3A 4RX1A 3X0DA 2YTZA 4YUVA 2PXCA 3E05A 3TQSA 2AN3A 4QPPA 1BOOA 5K8VA 1L3CA 4GBED 5LQNA 4R6XA 5CM2Z 2ZW9A 1G60A 4QDJA 4ER5A 3BGIA 4DKJA 2QRVB 3JWIA 3E23A 1XDZA 3MQ2A 1I9GA 4RWZA 3TKAA 3MAGA 5FHQA 3EVEA 4PYQA 3EEOA 3GRRA 1AF7A 4PYNA 1WS6A 3HVIA 3NJRA 5FQNA 3M6WA 2NYUA 1HNNA 1VPTA 4C04A 4EMSA 1RI5A 2UYHA 5EQJB 3UJBA 1XCJA 3HCCA 3KQSA 5HEKA 4E2YA 2O06A 4KIFA 2B78A 1NV9A 2ZCJA 1EIZA 1TW2A 5K09A 1P91A 3P9KA 2PXAA 2V7EA 3FUUA 3HVJA 3MCZA 5JUWA 5K0BA 3FPGA 3C3YA 3GRZA 1Z3CA 4FT2A 2G70A 2HTEA 4FP9A 5BW5A 3FPEA 4FS8A 3M6UA 3P9CA 3UJ6A 4CTJA 5HOQA 2I62A 2ZZKA 2IBTA 2N47A 1SVUA 3FUXA 4PYLA 3F4KA 4C03A 2GA9A 5C9ZA 4FR0A 2IFTA 5K0CA 3S68A 4OA5A 2IBSA 4LECA 3HCFA 3JWGA 3E8SA 3BKXA 1L3IA 2HR1A 3G2MA 3GDHA 1KIAA 1YUBA 3LHDA 4OA8A 3FPHA 2YX1A 2PGXA 1X1BA 3QV2A 3NWBA 5E9JA 2B3TA 2AN4A 2B2CA 5FHRA 5F2OA 3TR6A 2ZSUA 2C7OA 4U7PB 4F85A 3THSA 3OU7A 1NW5A 3SSOA 1QZZA 2OY0A 3SM3A 5HIMA 2KW5A 4U7TB 4C06A 5E8RA 3DMGA 5EG5A 1D2GA 4BY9E 4RV9A 1NW7A 3SR4A 1R8YA 5EVJA 2JH8A 5DTMA 3UJ8A 4OQDA 1I4WA 2GLUA 3KR2A 1XTPA 2AOUB 4AZVA 4BLWA 3SGLA 4YUXA 5FQOA 3DH0A 3SSMA 3QOXA 3KPWA 1G8SA 3NDJA 1WZNA 2JHPA 4DMGA 2IH2A 4F84A 5E8JA 4YUYA 4LG1A 3QOWA 1RI4A 2OXTA 2ZWVA 3BKWA 3FTCA 2PY6A 3ER8A 3I58A 2BM8A 3V8VA 1OR8A 3FYCA 2H1RA 3MGGA 4YV2A 1NT2A 1SQGA 2IGTA 3OE5A 4MIKA 3FTEA 2IDKA 2VZ9A 4HH4A 1EG2A 3B5IA 3K6RA 3CVOA 2C7PA 1L1EA 3IYLW 5EZSA 3PX3A 1VE3A 2R3SA 5DRTA 1SUSA 2AVDA 1H1DA 3ID6C 3JWHA 4PYOA 3HNRA 4HG2A 5EEHA 4DF3A 2FPOA 4HTFB 1JSXA 2I7CA 1WXWA 2ZLBA 2PVCA 3G2OA 3KQVA 1Y8CA 4ISCA 5FADA 1YFJA 3G89A 3VC2A 5DSTA 3MTEA 1MHTA 2XYRA 3EVDA
chains in the Genus database with same CATH superfamily
1ATZA 2JI4A 2NWQA 3D2LA 3PZRA 2G67A 1RYFA 4RZ3A 3WYGA 2VNHA 4DB4A 3IBYA 4FZJA 4HAWA 4YJHB 4G9GA 3U4QA 2GF9A 1YUNA 4QHTA 5AOCA 1LBTA 1HETA 3NVDA 2VPIA 3PQEA 4N01A 4Q15A 4IKPA 3QE4A 3RO7A 4A0QA 4HB3A 4BO7A 1M8FA 4IDHA 3KIPA 5CBPB 3RFFA 5IARA 5A4JA 4YXFA 5JQWA 4B4OA 1TUEA 4AJ1A 4KSYA 4FDAA 2ONKA 1VLVA 4EB6A 1QX3A 1O54A 2CBGA 4HEA6 3G8BA 1MKYA 4ZVUA 3ZVKA 4YRZA 4P5DA 3ER9A 4KW7A 1EFRD 1DLJA 1VIDA 2YVLA 1N0IA 1IZZA 2PZKA 3L1HA 3NYIA 3RS7A 1U63A 1BA2A 5DSXA 3TLJA 4DGSA 1N77A 2YRXA 1T8PA 2PUTA 3FYTA 4JP5A 5REQB 3VV2A 4YMGA 5TF4A 3IQGX 3HZOA 1CUHA 3WDKA 4G1VA 4M0LA 3UFBA 3M3HA 1DAPA 1UC5B 2NVOA 3DAOA 3JALB 3PC6A 3SC4A 5IHXA 3TFWA 1E8MA 1BDJA 1H1LB 3HYRA 4EW2A 1CUFA 2OV4A 4QGFA 1NN1A 2JFQA 4BVJA 3SYRA 2J6BA 3AJAA 4L2IB 5SICE 2I9PA 3AUKA 3DWGA 5JJCA 4H7EA 5A4AA 2G06A 5E4TA 2ZTHA 1FU4A 1LF5A 3MF4A 2ZJBA 3ZBPA 4Q6WA 1N6PA 1QC5B 1LPBB 1F8XA 1Q12A 3NHZA 3PEVA 4ZKEA 2VBIA 1EWKA 3I42A 3O4RA 5DGXA 4L9SA 4UPDA 4D9KA 3C16C 3O7MA 2OG1A 3T5CA 2C7VA 1P80A 1BXGA 1ISPA 3PKJA 4X1KA 3VPDA 5FH9A 5JW6A 4CGZA 5HGXA 4C2AA 3HJFA 3Q7EA 2VQDA 1OPXA 1ZL2A 2B7CA 1C9JA 1RT9A 2VCEA 4LXHA 4DF3A 3VAAA 4ECAA 3TKYA 4TWBA 1F2TA 1IMJA 2D1RA 2YXBA 3BDAA 5BSEA 2WKRA 4DJ5X 4L15A 5DYYA 2M98A 3F6PA 3I6MA 3L0SA 1HQKA 3L7BA 3UB2A 2HA0A 2WTAA 4FUQA 4WKGA 3ETGA 5AIAA 1K06A 2ZVQX 1N6KA 3N76A 4AO6A 4YFYA 4YY3B 2OCGA 1XX6A 5IUJC 4HRAA 2R44A 4BNLA 1IXKA 4DDUA 2YMLA 1EVZA 2J46A 2I6GA 3DCNA 2VHUA 4HGNA 4F4IA 1NQTA 2XUFA 1MFPA 3IDSA 4MYHA 3H2YA 3W6OA 1Y8QA 2L0XA 3IOYA 5AOVA 2GYWA 1Z2PX 3ZLTA 5K3DA 4R2HA 3W8NA 4RGQA 1TAGA 1R0BA 1QK5A 2LP4Y 4PX5A 4UHJA 3H2JA 4MVJH 1Z0ZA 5EKSA 3UXYA 1UP7A 1VPLA 5ALJA 2E85A 2LZ0A 1JHUA 1ODSA 5EZQA 2UXCB 1Y1KE 4F71A 4IWNA 4CLDA 4U2EA 1RJEA 3RK0A 3RJTA 3GOQA 2Y0EA 3LFHA 4MKIA 3ZIAD 4I19A 5BNZA 4PRZA 3G5TA 3GHYA 5L7TA 1Z0IA 4IR7A 3RRFA 2B82A 3R3UA 5AW2A 4LJAA 3VH2A 4W1PA 4Z9FA 1R37A 2WP0A 2Q5FA 2TECE 4RH3A 1C4OA 1FXUA 1K4KA 1YZ3A 5AKGA 4NCKA 4OKSA 4QJIA 5BSHA 1FFYA 4MDHA 2C96A 1B23P 5E2AA 3B6ZA 3KP1A 4BKRA 5LU9A 2ZR0A 2JK1A 3S2GA 1ONPA 2C5AA 3QK7A 4YQYA 5CNKA 4EEKA 2WDZA 5F33A 3RROA 2JLQA 3H0EA 1EJ2A 4U0KA 1Z2AA 3E3NA 5EXDA 4J94A 2Z09A 1QONA 1RIIA 2PGJA 1GPYA 2C8KA 3DTNA 4K9DA 3U4DA 3UJCA 5HUHA 5IWAB 1KFBB 4HYTA 2A92A 2O8EB 1GL7A 2XQKA 4CM6A 2IU3A 2PCLA 4F86A 1YCDA 1IFXA 2EZ9A 1L4UA 2MOKA 3JYHA 1Y1QA 4Q3LA 3R6LA 5DDIP 1QV6A 1A1SA 3IP5A 3IBFA 1OV6A 4XI9A 3TSYA 2DWCA 2FGJA 2UZ0A 3BK1A 4QYIA 3VKVA 2E5LB 1D04A 1N6IA 2J6CA 3ZDYB 4PLPA 1FFGA 4I7EA 4IH1A 4XUGB 3ZE2B 5LQAA 4BO2A 3MIIA 2AR0A 4WZ6A 1G18A 4KODA 3FYUC 1IVYA 2O2HA 4Z7OB 1IIBA 1BEUB 3RSQA 3GLFB 2I6FA 1LC0A 3KKQA 5CX4A 1N6LA 4RDHA 1O87A 1OREA 4UTVA 1ANKA 3GMDA 4MQBA 2V7PA 2X1LA 3RKSA 2J9FB 1XXHE 1LFDB 4K9PA 4MDYA 1ZRHA 3BT7A 4ZZ2A 2BEUB 2EGGA 5I4IA 1MU0A 4ENPA 3F71A 4V2UA 1W25A 1TJYA 2HAEA 4N0MA 4YH1A 4U6QA 1R4MA 1WCIA 4OFXA 1G3QA 3WGYA 5ADHA 4GIBA 4KVGA 2W2PA 2EJBA 2PYIA 1WMAA 2VUSA 4MWZA 3ITEA 3IAUA 5DTEA 3EQ6A 8MHTA 5ED4A 2ZB3A 2I7XA 4UQPA 5LDDC 3L4JA 4M1QA 1MJFA 2DT5A 1SXIA 2FPRA 4O4IB 4GI2A 2GAIA 2PSEA 3EGVA 4B85A 4E2WA 2FZKA 5TEWA 3NXKA 5ARCA 1ESNA 3EXIB 5B4VA 2Q0XA 4CLRA 2W00A 1C0EA 1P0QA 3FNQA 1J39A 1JG6A 3IPXA 3ONDA 4OHCA 4EO4A 3ORYA 3CH5A 2O8FA 3E2IA 5M04A 4N1AA 2J3QA 1AS3A 4UOQA 3WGGA 4YCSA 3AYZB 1OU0A 2D1YA 2XVXA 1M0WA 1XQYA 2OLEA 1FX1A 3WGVA 4NAHA 5BYKA 5LZ4A 5J4VA 1YDEA 5ICGA 1TL7C 2JAQA 4QULA 4Q7EA 4BO4A 2ZZMA 1PEAA 3L6BA 3MB5A 1UBCA 2FFHA 3MXTA 2FEPA 3AY3A 1EX7A 3E7FA 1OASA 4NENA 3U7HB 4XGIA 4NV1A 2VDMB 3TW8B 2VFAA 1T13A 4J9UE 2H1LA 3WWPA 2PNJA 2H8KA 3N2KB 1SVKA 2VP4A 3PICA 2IGBA 3LNCA 4MAFA 1QGOA 5G4LA 5K4AA 1WQ1R 1K6EA 1PI3A 4MVJI 3STXA 2H07A 1SG9A 2JKYA 3BTOA 3LTEA 4YCDA 4NXMB 3TOXA 3EGIA 5C5EA 5TB5A 2Y1EA 4KGXA 1BMFD 1GV0A 4V0QA 4DA7A 2QV0A 4NYJQ 1G3MA 3A31A 2FPPB 1P6UA 1OX6A 4YMVA 5DGHA 4KR2A 3ESZA 1CZRA 1JI0A 1BQ4A 1B15A 3H3JA 4M88A 4R8SA 2QN6A 1VKJA 4LYFA 4UU0A 1EHYA 1WJGA 3HA3A 2G1KA 1B6TA 1JQDA 2KPOA 5AXAA 5LDHA 3IE0A 1HNZB 3U6BA 4A0RA 5KHOC 1JV2B 5JS8A 1ORTA 3DMNA 5C3UA 4AX4A 2ZU0C 3ROGA 1N0WA 2BDTA 3ML1A 4YALA 1A95A 2LCFA 1UBHS 4P83A 2O8VA 1PZHA 3BH0A 3PNPA 3ZGZA 1NYQA 4EG6A 5LZ7A 3DOCA 5FFMA 3QKSA 4H7HA 4LDPA 2O8NA 5BVHA 1F6WA 3R40A 3R1IA 4JVNA 1XNHA 1PFYA 3AQ4A 2X0NA 4D9EA 1G2QA 1UFQA 4YQZA 5EINA 3H5LA 1JA9A 5JE8A 4ZCRA 4YUWA 4PY2A 2VKQA 3AKYA 2ONJA 2HU2A 4IFBA 3KL2A 4G0ZA 1XKQA 4Y2PA 3WMXA 4N8SA 2OLKA 5A6SA 1H6CA 1W0CA 3LWBA 3HXQA 4QHSA 1K8ZB 3MINA 5DCLA 2P35A 2WMNB 4OMCA 2J08A 3PX2A 1B43A 5I7AA 2Q49A 4PHHA 1NVTA 2OCYC 4PG8A 4BWGA 3H5AA 3SEZA 1SHUX 2NNWB 2WIDA 2BBOA 5H5JA 2R1VB 2XHZA 1YDMA 4DS3A 1SQFA 1YQUA 1XUOA 4XWKA 3T7SA 1GFZA 2AMJA 1KFJB 2FOLA 1GGMA 1OBFO 4KQEA 3GROA 1L5ZA 3SF8B 4BC1A 4EATA 5BSWA 4PVCA 3DTYA 2I3AA 1T0JB 1SOWA 3ECSA 4CT5A 1VJGA 2JGRA 2FVYA 3H11A 1F8FA 3EYWA 3GW8A 1N5LA 1E7WA 2X86A 4LS3A 4RTOA 3LX8A 1I9CA 3NHPA 3QOFA 4BZXA 4BO3A 2EBWA 3SQMA 4U9UA 4NAUA 1PG5A 2V96A 3IJPA 3ZTWA 3ZOKA 5A5DA 4KR7A 3CEAA 3Q2KA 4GXNA 1FS6A 2GXUA 3U4AA 3H2SA 1BMTA 1PGPA 1W581 4CF7A 5KYXA 1XVAA 1EP1B 2NX2A 4GQBA 2P78A 3KXKA 2IXFA 3V46A 2GBLA 3V1KA 3B89A 2P2GA 2Y67A 5EIXA 1NVDA 3BXPA 3NWPA 4M1OA 3W6NA 4KE6A 1SFRA 2I55A 4BLUA 1G2OA 4D81A 5K8UA 3OC6A 2LV8A 1QH9A 2VTEA 3L8EA 2WWTA 3JQGB 1SCIA 1H3NA 2FTKE 4GQIA 4K6KA 4X8OA 3UAZA 4ZJUA 4XGRA 4GL2A 2CNLA 3MJEA 4K6HA 2J4CA 5JNRA 2QVYX 3GLSA 1TZKA 4HD8A 4M54A 4D8VA 4LJ6A 1AHNA 4UUMA 5HZKA 4C88A 2DSTA 2Q41A 3RT9A 3FF1A 3VX3A 3LBIA 1VCOA 1YFLA 1IZ8A 1XPUA 3TRDA 1E2MA 2J4DA 3IT1A 2VO1A 4KRGA 5JYDA 3G82C 4HDCA 3P0EA 5J5VA 1FB5A 1Q19A 4RVGA 4Q4DA 4BEBA 2GNPA 3PL1A 1F7VA 4GNKA 3ADCA 5TMEA 2ZTSA 3BCUA 1SCAA 2HXYA 4PX2A 3U19A 1PVVA 5KO2A 1UPCA 3E2PA 3KOWA 5KNCD 3AIIA 3EASA 3DLTA 1DUSA 4U4AA 3F3YA 2HPZA 3ZE7A 4F8YA 2AKAB 2MSLA 3GN1A 5CIWA 1OBHA 2QLLA 1SVOA 1FTQA 2OM2A 2FR8A 2DPXA 2WW8A 2CJYA 5EERA 5I7HA 3IP7A 1HRKA 2Q7OE 4LJRA 1V25A 2ANBA 4IVQA 1MEJA 1VJCA 2DFDA 2VOEA 1TKAA 4BFTA 4DKJA 2A5DA 2HHJA 4CL0A 4OGWA 1NF9A 4YRCA 2RBEA 1KO8A 2I22A 2IPAB 3HVIA 3IBTA 4NC9A 3GLHE 5I7SA 3OO1A 5D3MA 2WUWE 1WV1A 3FVVA 2QV7A 4LVUA 1G6KA 1FSSA 1T9ZA 2FPXA 2BHTA 3REQB 3JRNA 3H2ZA 2A30A 2O7SA 1GFWA 1JNXX 1XA4A 1BW9A 1PWEA 3CZPA 4JS0A 4C0AC 4CLOA 1R12A 1R6BX 2FY8A 1W5BA 3EIFA 4JJ7A 4GE3A 4KR3A 1BU8A 5JSUA 5C8VA 1K97A 1UJBA 3BHNA 1N2IA 4LJ7A 3ZYCA 1KJQA 3MJSA 1ADCA 3QUQA 5BMOA 3I0NA 2KWIA 5JSFA 1C0IA 3GGOA 2XOXA 3AR3A 3LZ6A 1KAHA 1SN7A 3GR6A 4KQ2A 4N5MA 5DNAA 4JJKA 1CB0A 3K92A 1B2LA 3HRIA 1AUQA 2AW3A 2PLRA 3KTFA 2BE9A 3MMNA 4L6IA 4B3BA 2GWRA 4MVJG 1NVWQ 1G5FA 1F5NA 4YCMA 4UNSA 1ONOA 4B2PA 1QIGA 3LPDA 5EJ4A 1L7BA 1ZJJA 2GEBA 4F06A 4FDTA 2AMVA 4Q1CA 3DEHA 3UJHA 3G2MA 1BCRB 4KXQA 2OCLA 3HEAA 4TXMA 5KHAA 5TSDA 2A1UB 2I4TA 5GONB 4S2EA 3RS2A 1XT6A 4YA6A 2QRKA 3FPKA 3LQQA 4FB5A 1XYGA 1JF8A 2CDCA 2GN6A 2ZPUA 4IXDA 3LZCA 4DIUA 5LA6F 3COWA 3DVLA 2RKBA 1F4VA 3NYWA 4ZT3A 1XI2A 4D0SA 5KX5A 2OHOA 2H7XA 3DEFA 5KNBA 1HYBA 1SU6A 4JFAA 5ISMA 4H7KA 1TVKB 2ZYAA 4PS1A 1ZNQO 1NLFA 4YUXA 1ZISA 3WY9A 4O4JA 2H2DA 3CO5A 3NX4A 3VKWA 4LC0A 5EHNA 3NJ4A 5F35A 2AQIA 5BN5B 3RRXA 4EENA 3V8NA 5L45A 3RS9A 1E6LA 1RJWA 2C82A 1L7XA 1PJ3A 1WKCA 4OCZA 2JRCA 3L46A 2UKDA 3TZ6A 1OXSC 1ACMA 2W8ZA 2BM8A 2FZ4A 2ZTUA 3T1YB 2OAEA 4LZPA 4ZDWA 3MGGA 3ZH9B 1H8HD 1UCFA 3AO0B 2GN2A 3HN7A 1QRTA 2JIOA 4GPD1 1L1EA 2QL6A 1ZD2P 4FFVA 1FP6A 1XTRA 3JWHA 5HXAA 1N6NA 4ZRDA 3RBVA 1GR1A 4IGFA 4QRIA 4F8EA 1L4NA 1QTNA 2QM8A 3PFNA 5TQ2A 4PZPA 2OBMA 1NLZA 2AX4A 2FOIA 4PRKA 1D9XA 5T57A 5CB4B 3FOFC 2QT9A 3D3QA 2BFBA 3G1WA 4XLLA 4ABYA 5I4KA 3FKSA 3RWMB 2HBYA 4I6JA 1GTSA 1YR7A 4DMMA 1XKLA 2ZI4A 2IIPA 3EQ9A 4DPMA 4S1VA 2CWDA 4C0WA 2C3UA 4D96A 4LQ4A 4AQ7A 2PQ0A 4P5EA 1HNXB 1JTEA 2ZYRA 2CWWA 5JCOC 4KKXB 1U1GA 4C7BA 4W6QA 1T9DA 4QUHA 2QZPA 2DGDA 1KBQA 4ND6A 1M1YE 5A7FA 2PBRA 3OP1A 1JU3A 4PNHA 4WVLA 2PX0A 2WABA 4FWIB 5DNWA 5GV8A 4A0SA 4EGCB 4F1KA 1BDMA 4GD3Q 4C21A 5JBIA 2JGDB 3ZHQA 5IC4A 2F9LA 2YIJA 2XRZA 1NG9A 1PZMA 4YRSA 1XP8A 1KDTA 1M67A 3DOFA 4HEHA 1JIKA 4NNOA 4CVNA 2WJJA 4BQIA 5BSKA 3OZTA 4M0DA 5IJ0B 2OZPA 1CR1A 5SZKB 1U5BA 3R7WB 1RYNA 3U1BA 5EZ6B 1YVPA 2OL4A 1YR9A 3L7OA 2J7PD 3R5XA 4NFLA 2JVJA 4GL4A 5G3YA 2HIHA 2GBGA 5EIEA 2EIHA 3DBVO 2VT6A 1QOPB 4NBWA 3DLIA 3R5JA 4XYGA 2FAXA 2D0OB 2NO0A 4JGIA 1H0RA 2D59A 1P33A 5EJIA 2HLDD 3RD5A 1NNI1 4RK0A 3UTDA 1W4BA 4N3AA 1E2JA 1OFVA 1L5OA 3RFVA 3EZYA 3JQ9A 4WKOA 2ERXA 2HTFA 4I1SA 2E4VA 5JPCA 3QPVA 3AF3A 4TLAA 4WNAB 2JFOA 5A3SA 1DUIA 3BMOA 2FN4A 4IFTA 5CVEA 1HL3A 2R00C 2F17A 4QXPA 4UEWA 4X44A 3LP6A 4FMCB 1FP4A 2F2TA 1ADGA 1PLKA 4RESA 4XGQA 2ZE5A 4FR5A 1QTRA 2O07A 1XZDA 2GH1A 4BP1A 1W2HA 4CMIA 3I5AA 1HEUA 1QYWA 3G9XA 3NHBA 3VPFA 1YRWA 4DY6A 1IJEA 4BO5A 2H9YA 2WV7A 1EJBA 4WN9A 4ZQGA 5H02A 5T4BA 5EJ6A 1X87A 4GZ5A 4S12A 4ZQEA 1MLDA 2B20A 4I6GA 3C4JA 4NBVA 1CS4C 4UBJA 1J0AA 1CYDA 1YZUA 4H3VA 2CUNA 4BNJA 1L5WA 4FGUA 1JLKA 4G2NA 2O3TA 4DQVA 5KPJA 1GQQA 3RAEC 3FUVA 2OZVA 3LBHA 5JD5A 1QZXA 2JFBA 4MRMB 3D64A 3DHYA 4DWJA 3DPSA 4LY6A 3VXKA 1E6WA 5F3RA 1QRSA 1XEWX 1FLVA 3I9MA 4TVOA 3RTBA 3JAKA 3BHIA 3RGWS 1U02A 9ABPA 2C31A 3R20A 2FW7A 1Z28A 2JAUA 2DFNA 3SX4A 5JAMA 3H1AA 2CVPA 1T36A 3VVLA 3BF7A 5FWYA 8GPBA 4GKVA 4FCTA 1HT3A 2P9FA 1RE1A 1ZGCA 1DDGA 4ZEWA 1GZVA 1ACJA 4CE6A 4EJ6A 1GPDG 1JHMA 4V1CI 4ME6A 1Z39A 3O8BA 3EQ2A 4Z49A 2P9HA 2CXNA 3FD8A 4U00A 2OP1A 4MHTA 3RSLA 1NR7A 3G8DA 2V7UA 1U0LA 5BR4A 4JITA 3OQ1A 1HLPA 2PX5A 5FPHA 3STTA 4G4GA 2A1TR 2PEZA 1KEUA 4WZAB 2G80A 4LXUA 3AR8A 5L3QA 2EP7A 1NLMA 3X1YA 1E64A 4WFJA 2NUAA 1NZJA 3DVAB 1W2GA 2O0LA 3VR4D 1AK2A 1P5ZB 1WHSA 1B8NA 2C5FA 1RYYA 4PZLA 2GN9A 4C5BA 3DR3A 2O2YA 4Z7NB 1PR9A 1NE2A 3TH5A 1EZ4A 3DTVD 3AR5A 3U7RA 5CCEA 5D01A 3RSCA 3R4CA 4J16A 2R4UA 2XY4A 3E6AA 4I50B 3O8DA 1BYUA 2XYPA 1R8XA 4OHMA 3PX7A 1SVIA 3ISVA 3OZXA 2A78A 2IYRA 1Z25A 1XNJA 5FLEX 1P9OA 2A0FA 3V4ZA 2IZZA 5IDWA 1QDLB 1BD3A 1CZHA 2C2BA 5KQMA 3MUFA 3RYFA 5DBOA 4ZTZB 1TMOA 5FOXA 1A5TA 5LMZA 2RSLA 3H9GA 3WB9A 1SIWA 4H3SA 2RB5A 2X8JB 4CKCB 3KELA 6NULA 4UMDA 4HRXA 4P7BA 4OQYA 5KYUB 1GNSA 4XLZA 4P38A 4ZVQA 1XMPA 1G8KA 4DY4A 3GGSA 3VYTB 1BCSB 3OFKA 4HX2A 5JEDA 4DLLA 4ESVA 4CZ2A 1SC6A 3VU1A 3X1XA 1Z6AA 4FBMA 1GUBA 3HFSA 1KJIA 2IZ1A 2BEVA 3K9WA 4GC5A 2WE7A 2XITA 2NT4A 1RWVA 3VSEA 4D92A 2PU7A 5C4GB 4BZWA 1UQRA 4RF3A 3PYLA 3M4YA 2GZSA 4BZQA 1Z17A 3GEIA 4KQIA 5HHTA 2BIFA 1RZRD 1U9YA 4M9UA 2FG7C 1ENZA 2PIDA 3AHJA 3OP4A 4JR0A 1MA0A 2JJ1A 4G26A 2WLTA 3SYTA 1TM7E 3IA7A 4J49A 1TADA 2FQ1A 3KB2A 4XEHA 3CVYA 4R2LA 4GVXA 2QENA 3TEFA 5HIIA 4GAEA 3WSWA 5DM70 2H4ZA 1S5PA 1NA5A 5EMLA 3WFIA 3K70D 1H9CA 3DP7A 3H7IA 5IKXA 1UK6A 1TI7A 2BI8A 1OY1A 2NXJA 5E9WA 1JEQB 3F6SA 3PHGA 1S9HA 3QEOA 2CHGA 2HF9A 5DEIA 2AMLA 2MSEB 3IVRA 3WAKA 2IOFA 2YMMA 3ZU4A 1AGYA 5FV7A 2BR4A 4PTZA 4DCMA 1NJ6A 1J21A 1G17A 1M33A 4GX1A 1VYUA 1YU6A 1HF3A 2HCBA 5DISB 4Q1DA 2F8TA 5AR1A 2ZSDA 2FW9A 2QN3A 3OFJA 4AWXA 3KV1A 1SG6A 3P52A 2ZAYA 2ID4A 4QPDA 1OH7A 1QCCA 3U7IA 1GNRA 1QYVA 2R6FA 3ZCXA 5H9VA 4NVRA 1RFLA 4WAUA 1DLIA 3CINA 1UDWA 4TS4A 5JI3E 1YL6A 1RBQA 2QN8A 3GDWA 1W9MA 5JSZB 2JJQA 1WDTA 3ZU3A 1NQOA 1KEWA 3T9AA 4DIMA 1WSWA 1AKTA 2RK6A 3KWJA 1G6Q1 4PTLA 2ZWAA 2GDZA 2YXDA 3CH7A 4QGBA 3TG8A 4KREA 1HDRA 4EG1A 1UT8A 3M2TA 2QBYA 1E3IA 3IOEA 3PBKA 1E7QA 1F1JA 2D1SA 2V59A 1O8CA 3O91A 1E1DA 3UMSA 5I7EA 4WASA 4Y2YA 4C7MA 4YBRA 1PK9A 3GCGA 3B38A 3QYAA 4KLZA 3VKUA 8LDHA 5JZSA 5CVDA 4OHYA 2XMQA 3HJBA 4BX3A 4E5SA 1X9GA 3EY9A 1JQ3A 3ZD6A 1JHQA 3EXG2 4LWZA 4M7PA 1GSAA 2WIBA 1ZC3A 2WD7B 5K0GA 3V2GA 4Y98A 3QXGA 2LW7A 4YR7A 3LXRA 2XUDA 5CYOA 3TSOA 4N5LA 4V38A 1BXZA 3T9BA 2POQX 1ID1A 2BKAA 4ZARA 3S0JA 1E9AA 3DDOA 4PGAA 1CY6A 4M8SA 1JB1A 1L5GB 1JVSA 1NDHA 2DQZA 4QC2A 1BRMA 1FNNA 1X8LA 5KSPA 3ZBUA 2QVGA 1CJSA 1CIJA 4KPUA 2DY0A 4IHJB 2L69A 1P5HA 3AHIA 5MDHA 3OZVA 3Q3JB 4RJJA 4AFNA 4MCIA 3ACDA 4WXHA 3L6OO 2WJZB 4FFWA 3TFQA 4W63A 1ECLA 1BG6A 1CW2B 1FP1D 1HKUA 2B1JA 4B6SA 2NSJA 1AKUA 4U63A 5CM8B 2PZGA 4LYJA 3CF6R 4K8OA 3Q3HA 5BWBA 3BGVA 5EZYB 1ECFA 4Q7KA 4E5YA 2G9VA 4AO7A 2ES4A 2VYNA 1DEAA 3PDWA 5GV7A 3LQKA 4ESHA 1NJ8A 2J31A 3EZ9A 3QWIA 1TK2A 4AUEA 4E1BA 3SJCA 4EG8A 5KSYA 2XVYA 4AKTA 4PANA 4L73A 4AI6A 3LUJA 3HA7A 3QEBZ 4G0UA 3V7WA 1A2OA 2PR7A 3OWHA 2RC6A 1CQPA 1JJAA 3C5EA 3D0QA 4MUMA 4JC8A 3TMAA 1URPA 1VP3A 1VE1A 4PS0A 4IMJB 4ZPJA 3H4TA 4RHFA 2AG5A 1AURA 3QEMA 1EMDA 1Z38A 3NAZA 4YRGA 4JBIA 2XGSA 3A6ZA 3M33A 3PV0A 4LXGA 1RCTE 4POOA 4PFKA 1Q21A 4K5QA 4MMXB 2G5GX 2DULA 3Q72A 4UHKA 2QIOA 3NG1A 3NWOA 3D6VA 2QXUA 3OJLA 4UASA 4AMGA 4JI4B 2GI4A 5IU6A 3BRCA 1RAIA 2JK0A 1W88B 1ZWKA 2ZS8A 3E8XA 3M1AA 3KT6A 1L6IA 4OXNA 3GLIE 2DQSA 4DN6A 2PKQO 3RUDA 2H52A 1H8ED 4Z7QB 1SBQA 1KMNA 4Y0VA 2W2QA 5JTUA 2BMVA 4DZZA 5JANA 1HURA 5D7BA 1E0SA 1W36C 1X13A 4TTVA 3PHIA 3AYXB 4R0VA 5H70A 4RQAA 1QCYA 1N5RA 2QPTA 1NP7A 3U9SA 4C7XA 2N1MA 1JAHA 4G1UC 4DQKA 4E6EA 4WJLA 2PTHA 1OLXB 4OI2A 4QDXA 4RWEA 5DM60 1DJQA 2EJTA 3H3FA 2Z6VA 1CIVA 4QVKA 5A9SA 4DLTA 4P58A 5ALKA 4PZEA 4DV0B 2IXTA 4NBUA 2P6PA 3ZW7A 4MVYA 2UYGA 1XU7A 5BSTA 1F0YA 4UM9B 2KS6A 2IUFA 3EZ2A 3LDUA 4RKQA 3TSZA 4YWJA 3UT6A 1PLLA 4H1HA 1TIKA 1AX9A 4U3JB 2GR9A 1OWLA 1XVUA 1RXCA 1JAYA 1JBKA 3DHWC 3HB4X 4LFAB 3I32A 421PA 3FOWA 4Q3OA 3DDZX 4NBSA 5CFQA 4MV3A 2K4MA 1CY7A 2ZPAA 2Q0HA 3FSJX 4DL9A 2CK3A 2HIMA 1P1BA 3BIWA 4MO9A 1G6HA 1U2DC 2IUEA 2C1XA 4KVZA 4GU5A 3LKDA 2BZ0A 4JYMA 3TEMA 4DRYA 1NUHA 1X80B 3SZOA 2HA4A 2AN3A 4YJ3F 1EINA 2Q4BA 4GBED 1CZLA 3Q7RA 3UKDA 5EHXA 3IUJA 3EZ7A 4IDPA 1VKRA 2UZAA 4WRRA 4REOA 4X95A 3RT1A 4UPEA 3OHPA 1TEHA 4P3PA 4HQFA 3NJRA 3O6VA 1L7PA 4DEVA 1PR0A 1SVSA 5EQJB 3KG2A 3TTVA 2ZAGA 3JQAD 4QE3A 4EB6B 3EQ8A 3BSYA 3AHCA 1E8NA 1LJUA 1TE2A 3CUVA 2VAXA 1C2TA 3T15A 4PN3A 1NQUA 1XCGB 2GJ4A 2R8ZA 5LA6A 4B9EA 1ZZEA 1PGQA 4BQFA 1DC7A 3Q2OA 6CHYA 2D2IA 4F04A 3LGXA 4MV0A 2PS9A 4FT2A 2PUWA 5LP6C 4KI7A 2WJ3A 4ZI7A 3RF7A 2X1HA 1YZGA 3M6UA 2CXTA 3GX1A 4FS8A 3FMGA 4RD0A 5U1PA 3T7IA 1TO6A 1YRLA 2GESA 3GGJA 1VG1A 3F3MA 5EIBC 4PYLA 5JSQA 1QRUA 1Z2EA 1TYBE 5LNK6 3NTXA 4UBMA 1Z07A 2VEOA 5H16A 2NAPA 5HVNA 1C9KA 4JJ4A 3T3GA 4MB2A 2H59A 4ZOCA 2BM1A 5DVZA 1PBNA 2WWYA 2WKPA 5AVXA 3P9RA 3PXDA 3I2JA 3QV2A 1IONA 3I83A 2PZMA 3DYIA 1QDUA 3GH3A 2VH2A 3OF3A 4XSGA 1X70A 3CA8A 3H13A 3WGNA 1QOZA 3CBQA 3FOEC 5EHZA 4OEHA 4AP9A 5F98A 4GM1A 1QRAA 4ZOLA 5GQSA 4MVJP 1EVKA 1ZI8A 1BXGB 2DAPA 3O1JC 1Z47A 3G2NA 4X1KB 5AI6A 4Q4CA 1JUDA 1Z4MA 4KPFC 2PD6A 1Y1LA 3CW8X 4IEEA 4LDNA 1OFTA 2I3ZA 1UBLS 2JH8A 3T3DA 3RAGA 1F2TB 2IYSA 3P96A 1P7VA 4AJHA 2Y3IA 1IN1A 4R9RA 1IHUA 2O2JA 3RNLA 4OJNA 2HRQA 1YACA 3NWJA 2WWXA 1RRKA 2C03A 2VZ0A 2H51A 4XKJA 2HNBA 4KQWA 4BNHA 4F4UA 4BVAA 3JD3A 2L2QA 3EVTA 1BJKA 4EY6A 3LUGA 3GY0A 4ZO6A 5JNVA 2NZXA 4H7JA 3A70A 3IAS1 2F3QA 1EG2A 4WI1A 2CNWD 3H2IA 1QBGA 3GB9A 2JCBA 4OIFA 1OLUA 4DQLA 2FSSA 1MJHA 2I6XA 1Y8QB 4OHXA 1R66A 3N58A 4UU1A 4A36A 3FZEA 3N05A 5CEJA 4LDZA 4RBNA 3RV4A 4H7IA 1GUZA 2Z9CA 3DYVA 3N7AA 3QFTA 5C4IA 2IF0A 5AESA 1ZJ6A 3G7NA 1DSSG 3N0TA 1MHTA 1ZUNA 4IOLA 3ZKWA 1X7GA 4J76A 3LP5A 4NH0A 2ISCA 2P40A 1HDXA 1YI0A 1PLJA 4CLXA 3SOPA 4NZNA 5CH3A 4B40A 4FYHA 5KTOA 1KY3A 2JI7A 2YWFA 2J9GA 2GMWA 2XMRA 3TLXA 1S2LA 4GM4A 3TSWA 3C15C 3WMRA 1AUXA 1FFSA 2QRVA 4Q05A 2ISQA 3ZHOA 2BSAA 1WR8A 4OK6A 3SX0A 5EQFA 1FS5A 1XZLA 4L0DA 3CXRA 4AYWA 1E60A 1EP9A 1VHLA 1YFKA 4H31A 2HLPA 4FDVA 5B7NA 5KOIA 1AHHA 4RACA 1NV8A 1MH1A 1EXNA 3BTSA 1TFRA 2DR3A 3QFHA 1MW9X 2ZB2A 3LCJA 5EIWA 2JDID 1WHTA 5A5FA 4JNCA 3OZSA 3T5BA 1A3CA 3O4IA 4BFCA 1XJ5A 5I8WA 3FFBA 5I01A 1IEQA 2JB9A 4BV3A 4YRJA 4KJXA 3T41A 3T4PA 4UC0A 1COWD 4C3VA 3P9YA 4E1VA 3DKRA 1RBZA 3ESQA 1VRCA 1Z68A 4RHEA 1K2VN 2H1OA 1E5VA 9LDBA 1KH2A 3VH1A 4R40A 4RC9A 2ZUUA 4IPTA 2DETA 4P2GA 3Q7QA 3T5MA 2PH3A 1SUAA 5IXJA 3C2QA 1YZHA 1NM5C 2IA5A 3OIYA 1Q16A 3OY2A 5AI4A 3VOAA 1GTG1 2PS1A 4DWWA 4HGYA 4D4JA 5BNIA 3V8PA 1BE6A 5I7VA 4ZRNA 2Z1MA 1V6AA 4QRDA 4F5DA 1UJ6A 5AW6A 2VP5A 1KF0A 1FYVA 2VZEA 5GGXA 4YPFA 2ZT8A 3K1AA 1QF6A 4TS9A 4XIJA 4PR3A 4QYIB 2XQJA 3QNUA 4C0JA 2YHIA 1A69A 4KWTA 1TTHA 3N8KA 5AHRA 3T0GA 4WWHA 2UUCB 1Q3TA 2WIKA 5T4HA 1R27A 3TGPA 2PLAA 1I6KA 1OCEA 2E89A 3PRHA 3MS7A 4RW0A 5F76A 2Q4TA 2X8LA 5AJTA 4JXZA 1K7XB 1KHTA 3TTUA 5D2CA 3TOZA 5K2OA 1EB9A 2YNMD 3AU9A 2NU7A 3ECCA 3GD5A 3GXBA 5DXAA 2UV8A 5FNVF 2C20A 5AFSA 2ILVA 1P4JA 4P0TA 4P4GA 5JSYA 4DDHA 1OFHA 2V3VA 1N0VC 1PJ8A 2ZVPX 3GG9A 4B83A 2I65A 1R4MB 4HVLA 3GEPA 4HF7A 3WTCA 2NXEA 5CJPA 1VSVA 4TMVA 4K87A 4Q19A 2R6ZA 3I64A 1KY5A 1J90A 2DHEA 3PKIA 4EHJA 1GKKA 5DIFA 2A84A 5FOVA 4JL8A 1IQ0A 4QM7A 4UEKA 4Y9DA 5DM1A 2PL1A 5I8ZA 3L82B 4TMXA 3T9CA 1EGMB 1JZTA 2WJGA 4YYEA 1PTKA 3OU2A 4II2A 1QG0A 4LGCA 1SEVA 3D59A 1U2EA 4FFBA 4Z0HO 5CFOA 2PUEA 1Y63A 2WHYA 1SCBA 3IP9A 2C0QA 1GG8A 2A4KA 3MWYW 4IKOA 1YZKA 4J8PA 4LDAA 1DTSA 4W4TA 2O8FB 5JARA 4MHSA 3HXKA 3ZY5A 1KZYC 2WPDD 1ADJA 1Y5MA 121PA 1Y5LA 4D26A 4MUAA 1I1HA 2ACVA 3TPZA 3OUZA 1IBKB 2JFHA 3QJ5A 1FYXA 4JH0A 3TD6A 4BJHB 5JFTA 3WNQA 2G9NA 2AXNA 4MYTA 2PGIA 2PH5A 4MRVA 4NENB 1RTTA 3FZGA 5ULLA 1P3DA 1J5XA 4NICA 4LJ9A 2GX6A 2IHBA 1LH0A 4MYRA 3L84A 2FW0A 4QDOA 5DX8A 2JI6A 2HGSA 1EJ0A 2ZRNA 3OZCA 1H4TA 4D6PA 1ZJ5A 1GPKA 4QYXA 1G20A 1IOLA 1SBZA 4EKGA 5G0TA 1OIWA 2L18A 2YCLA 3G6WA 3PGA1 1BS9A 2O4UX 3UHPA 3WDLA 3P27A 4AN4A 1ZK0A 2JLZA 4GBMA 3SD7A 2VQFB 4HWGA 4ZD6A 1WCWA 2VTVA 4XPIA 3VC3A 2IUTA 1EGVB 3IP1A 2K6GA 1P19A 2ZKLA 4CODB 1UADA 3Q15C 2GAAA 3EF0A 3KUUA 3CT4A 2QQFA 4JL5A 3WGJA 1MT0A 1PNVA 1FFDA 4P92A 2MSWA 3T4UA 1PV4A 1HDGO 2Y8EA 5H80A 4TYNA 3DB2A 3GJ5A 3G5MA 4LWOA 1CF9A 1HNWB 1KDOA 2VRCA 4U7WA 5FTKA 3G8CA 3V3KA 4GOJA 1ZS9A 3QKSB 4Q00A 2GEFA 1MDBA 2QNRA 2FEKA 2XA1A 2G1UA 1XDWA 5EEGA 1SKAA 2HDOA 1CJUC 4WE3A 3PJRA 5ECWA 2WINI 2W7TA 4W99A 3ZCPA 5B3LA 3N75A 4X1OA 1AQJA 4FMPA 1LB1B 2XA9A 2PPLA 1LBSA 2YOGA 4TT8A 3V8EA 2HGZA 2YYAA 2ZIFA 1ZM3A 3EXAA 3MINB 1DMRA 5IH3A 1EUQA 2QW0X 4UAGA 3G2LA 1SIUA 1JDSA 1H6BA 2H1CA 3ACBA 5DF1A 3OHSX 3S2YA 1ZR2A 4XQGA 4PHCA 3ZE6A 4YREA 1EH5A 4HMPA 4XCXA 1ODLA 2F59A 2C5LA 1PFKA 2ZR9A 5K8TA 2FN7A 2C4WA 3A3NA 3CB2A 5CAEA 1ETUA 3SEAA 4DUPA 3F78A 4PC2A 4Z4IA 1WVGA 2EGHA 5EIAA 3LMKA 4A10A 4FK8A 5DMXA 5CDFE 5ALDA 1VLMA 4QYWA 3D7KA 2W2TA 3F5MA 3H11B 4FYVA 4KTTE 1F1BA 2GERA 3B5EA 4O4LF 2OFFA 4DLYA 1G291 2FW8A 3F2VA 2YJGA 4DQ0A 3PSHA 4W5TA 3B85A 2PO5A 3DULA 5H8WA 4UE2A 2B8JA 1JILA 3W9UA 2W70A 4R83A 4QNNA 3GDOA 2D4AA 2PUJA 3EC7A 3ZQKA 4BJ6A 5KNDA 4BCCA 4J03A 4WEOA 1WUKS 2CJPA 2YY7A 4GGPA 4PC7A 3DW3X 1OT5A 1W5AA 4EDHA 5K6AC 4NG5A 5KYXB 1QQ7A 5LXTF 2ZUVA 3THWA 1K75A 1P1HA 1PG0A 2QMOA 3KDPA 4HKTA 4MV5A 4CR6A 1JDBB 4Z6KA 4X85A 3FBTA 1UPBA 3GNQA 3IH5A 5LM3A 1SWWA 2NPIA 4LZZA 1TVMA 4ZXPA 1D1TA 3L6UA 3E4DA 2NU8A 1YU9A 4ZJYA 3KD3A 1PL6A 1TAHA 1UOEA 3RUCA 1FU7A 2HWXA 2R60A 2RHJA 3E84A 3ZHCA 4DCPA 4MWGA 4AU1A 1CJKC 3NV7A 3E9MA 3UHAA 3W2FA 2JJMA 4IIUA 5AVSA 5HA5A 5EJGA 3TECE 1TKRA 2VZ8A 2UDPA 4G07A 2PZLA 3AHGA 4OQQA 1U7UA 3E03A 3Q5DA 1IULA 4WUVA 1JR2A 3ASUA 2IEBA 1EFRA 4OB7A 3G2PA 4XIYA 2IYTA 4L0MA 5ADWA 3QTBA 5M34A 2VI5A 5CXSA 5IVHA 3CZCA 1Y82A 5L4LA 1U7PA 4AY2A 4K6OA 1G3IA 3DD5A 5TS3A 3MWGA 4FFLA 2DX7A 2QB5A 1GRNA 2HXSA 2PN1A 4P81A 1XZKA 1GZDA 4LGMA 4CMJA 4L5CA 3TLAA 1JFSA 2MMCA 1HZZC 3GFPA 3S99A 1FFXA 2YWHA 2XT0A 4R1OA 4PYJA 2XPCA 3E3OA 4RPLA 4WGFA 5H3HA 3MB8A 3FTFA 5FBKA 3SHOA 2FUEA 2BGGA 3MTIA 4G41A 3WLKX 1DJNA 2EKLA 1WBJB 3CTPA 3IUMA 3D54D 5JR3A 2ATVA 2BP7A 4FHGA 5IF3A 1ENYA 4UM8B 2XQVA 3EODA 1ODCA 5TRTA 3WLOA 2WBLC 1YD7A 4YDQA 2X0KA 5D3MB 2H92A 2F9FA 3K9BA 2X41A 1U8FO 2AXPA 1CHNA 1Q11A 1SA0A 4PTYA 4WUTA 3A3YA 4CLOB 3OQPA 2X22A 1R0KA 3JARB 4O4HA 5DBGA 2GF0A 2A33A 5IAOA 2VPQA 3KNZA 1T6YA 1P1JA 2WWVD 5T5QA 4K9QA 4LHYA 4G5YA 3QLJA 5MFPA 1IHYA 2B7LA 4MJ3A 1XL0A 3IT2A 2P2SA 1K8XB 4Y6RA 1ELOA 1FYDA 4A23A 2ZBFA 4J0GA 2X23A 1RKQA 5DM0A 1NNEA 2WUEA 2VYVD 4PBTA 3G8YA 1UWVA 2NV0A 1Y8ZA 1SCUB 1XLUA 4YFVA 1H0KA 3ORFA 3EVFA 3HY6A 2WJYA 4C7JA 1NMZA 4OM7A 5LZ2A 5JZOA 1XZNA 2NVBA 4OB6A 3ZCSA 2O50A 4GC9A 5B2FA 3CJRA 4R31A 3ACCA 2NU6A 4ZAGA 3QFFA 1IWBB 2FLKA 1XROA 3AEYA 2IYEA 3IR7A 1ADBA 3DE5X 2IIBA 2CF6A 1O8BA 3OZWA 5KX5B 2PWZA 4CFSA 1RLTA 1Q1QA 3H5RA 3RTEA 3Q0IA 2OCKA 1UPFA 4KO4S 3TTYA 2JIQA 2F6RA 5FT9A 4OVKA 5IYZA 1QMPA 3AEXA 3NAQA 4YWHA 4FFDA 5AXCA 3DJFA 3HY4A 2VDWB 4QUIA 4YJ3A 3RVPA 2J59A 2ZWMA 2VF8A 2V6GA 2BGMA 3AP2A 3OSUA 4MW4A 4WNYA 1TCUA 3UJ9A 3W05A 1EFUA 4FDLA 2FH5B 1JZQA 1B6GA 1D0SA 2CVFA 1FYWA 1U7WA 1UXGA 1G21A 2MWMA 4REQA 2QTLA 2VK8A 5E1MA 3PEWA 3UWPA 1DFIA 1UMBB 3AL0C 2R66A 5JJ5A 1OD6A 3FFTA 4ARVA 2P6RA 4MAMA 1YVUA 3NBMA 1F0NA 1RWMA 5DWDA 5FOWA 3FNIA 4KLNA 4J43A 3TDMA 4GZ6A 2QL5A 1QPZA 3IRVA 3PNYA 3W5JA 4JC5A 2HFJA 4NF2A 3NQ41 5TQ2B 1L5VA 5AVVA 3EPLA 1GKLA 3OPYA 3UV3A 2D0IA 3K0CA 5D6OA 4KFSA 4CQJA 1NY6A 1KZ4A 1JQJC 2BUAA 4LSWA 1W5TA 3SM9A 4MK4A 3AZOA 2GTIA 3MWKA 4UZFA 3O0TA 5B7QA 4G81A 4NQRA 1G6OA 2GPAA 3BGIA 4B6FA 4O2BF 3RVRA 4D8WA 1M6WA 2QTZA 3TKAA 4B3FX 4WBNB 1Y6QA 3T7DA 4EITA 1Z4QA 3HKDA 1EXWA 1AKYA 1EVJA 1XTVA 2VHZA 1ISRA 5AM1A 5TEVA 3UJBA 4B2IA 1THTA 5ENDA 2GSWA 3KVOA 4LSMA 4CIVA 1IN6A 2PYZA 3N9IA 2Y6VA 3PNOA 1TW2A 3AONB 4MWSA 4L5JA 3A4LA 1JGTA 1VM6A 2BFEA 3WK9A 5GOTA 1I4DD 4JLWA 3RRBA 4D3DA 2CV2A 3V1MA 1E79D 1ZUIA 2DPLA 2AV6A 2BGTA 2Q8PA 2QYTA 3F5SA 1GN8A 4MIEA 5HNKA 1EQ2A 1ORDA 4L6AA 4ZU3A 2PTGA 1FTWA 1V9SA 2COUA 3ZWVA 2IHUA 2RAFA 4PBRA 1YBMA 1E1QD 3U7FB 3ZZUA 1CUAA 1I3MA 5F73A 1U5BB 1DIOB 2HO5A 2QRGA 5GJWC 1A76A 2FV8A 5FDFA 2VL7A 1S7GA 1T4GA 1L5HA 1UQTA 5H83A 3L8CA 4I81A 3E8SA 1W35A 2VPWA 3WIDA 1BGXT 3HL0A 4OHVA 2I2XB 4EX6A 3G9ZA 3N0RA 4OHOA 3L06A 1W52X 1V8OA 4CQNA 4S1WA 2O1EA 2ZSUA 4HNTA 1A9YA 3SC2A 2QLNA 3QUTA 4QGSA 3F9CA 3HXLA 3WP1B 2OQRA 4F97A 1PUXA 2PVPA 3DNMA 4O8ZA 3PEUA 3OBBA 4HI0E 2ZRBA 3BMOB 5THKA 1EXDA 2X5KO 4MROA 1JALA 3I9V1 3SJ7A 1SHZA 2QRMA 1SXJC 1K5PA 2YMQA 5AXBA 2YL2A 1FP4B 4D82A 1E3SA 1G1AA 4JXXA 1K88A 1N6OA 2VBFA 1S02A 1Z2OX 4E09A 1N2SA 3QTLA 4JP2A 4CMIB 3ZEAA 5CURA 3G2IA 3DNPA 1KJYA 2ORWA 2CMFA 2VUHB 4J2OA 5FJIA 4WN9B 3GNTA 3DTTA 4JZYA 1DELA 3ZKAA 3R6GA 1C1XB 3U3RA 1UOQA 2CD7A 4ADSG 1X39A 2AC7A 4GQAA 3RSSA 3OE5A 3FTEA 1FS4A 1NBWB 2V0CA 1NVEA 1ZW1A 4HH4A 3BCRA 4RVUA 1ENPA 3Q8KA 4IQ0A 2QQEA 2QORA 3HJNA 4R98A 3ZE1B 2EL9A 5IZCC 1RZVA 2AVDA 4LZWA 5G4KA 3ZHSA 3ZXSA 2DUNA 7YASA 4DJFC 4EGSA 3FSEA 3JAKB 4RK1A 5AOAA 2I7CA 4MICA 1XRSB 4HN2A 4F4DA 1IVSA 3HJCA 4ZCPA 2NV2B 6Q21A 5IANA 1P44A 3FCXA 3KT3A 3MTEA 1T36B 3D4LA 4J4TA 5FWYB 5JWRA 2ZIXB 1JEEA 3F6RA 1M2FA 2WC1A 4YUAA 5HCNA 2IYQA 3MCTA 1USWA 3E22B 5K03A 1IHPA 5KVAA 2V6JA 2ONZA 2YV2A 2FK7A 4H15A 1W4AA 2HLHA 1XLWA 1KI6A 1XD8A 2OBFA 2QSJA 1X1TA 2JLVA 1WZUA 4FBGA 1R4NB 5MHTA 1LZKA 4QEKA 3CFYA 3O1IC 3NLLA 4XWTA 4XVHA 4BEWA 2JCVA 1Q14A 2QD3A 2F67A 2GD1O 2QTTA 1GU0A 2ZSBA 5DP2A 2D1FA 5D00A 2CL5A 2Y0DA 4UMFA 1V3TA 1SC4A 3TRJA 2DQ4A 4HDOB 4X9XA 3P71T 2HWKA 5L3QB 3VNRA 2NUAB 1ZAYA 3E53A 5BRAA 1ODJA 5EWJA 3FPSA 4JT4A 4DWOA 1WHSB 1QO9A 3ED5A 3KWLA 1E0DA 5TXGA 5EWMA 4CRWB 4BXOA 1PP4A 3R6DA 3S8EA 4LE0A 4MINA 3OICA 2AN1A 1FTNA 2X58A 2E4XA 5DOZA 3T0IA 4XDHA 1UAAA 3F3KA 4RKFA 4PU0A 3AFHA 3DO5A 1B8VA 4C4SA 1D0VA 4DJJA 4ER3A 4YT2A 2VPXA 5BMVF 1RQPA 2ODAA 3SS8A 3BMNA 3I2HA 1AA6A 3BIJA 5E2BA 3IHLA 4IV8A 1NI5A 2ZB4A 4MA0A 2IWRA 3UV6A 3PFWO 1JHPA 2REXB 3AY7A 3G7UA 2ZSEA 2OENG 3LCMA 4URUR 4YPOA 3FOZA 2CUKA 3RYFB 3PNLA 3IE1A 4J07A 4LE2A 2VHYA 2BGWA 1N2EA 3O7WA 1DCTA 4LN1A 1AT1A 5JO9A 4ZO9A 3UMCA 4RMJA 5D3QA 2R7NA 3BWYA 1RR6A 5ESRA 2KB0A 4C0QC 1YCHA 1M5RA 5JG7A 2Q9BA 3A2MA 3MJCA 1J1UA 1TLTA 4QODA 4DNFA 1R9GA 5CDSA 4KBGA 2Q6IA 4MVJM 3IAFA 4RZHA 3LVQE 1I14A 3CURA 1Z5VA 3P8ZA 3N1UA 4UU7A 3WLNA 3IVGA 3DBHA 4OYYA 3CT6A 2BEVB 4GRAA 2JJ2A 3HDQA 4G24A 3OTQA 3QEJA 3FRHA 5ICMA 2YOHA 2ZB7A 4CLHA 3P45A 1DBRA 2WFZA 5CU7A 2BH2A 2IZ5A 4GOKA 2OECA 1DINA 4GXQA 2BFCA 4ZKDA 2TRSB 5HFJA 1P1FA 1YCGA 3QELA 1B41A 1GPMA 5SZHB 3L7AA 1PTJC 3ZWYA 3ZJ4A 5BN4A 4RTKA 4J0HA 3T5AA 3R9WA 5IJAA 5H68A 3MMPA 4K9LA 1BD4A 4W7SA 2FF5A 4G0WA 3Q6IA 1OXKB 1PZGA 3FYHA 4ZP1A 3MWLA 5EXSA 2IV7A 1FQWA 5HWSA 2PDAA 1D6JA 1GZHB 1CR4A 2AXEA 2W2LD 3NNNA 1ZN2A 3P9ZA 5EQTA 1Y3BE 3LG2A 4KNWA 4L3WA 3SKXA 3ZXXA 2IYYA 2PNFA 2RGBA 2WF7A 3FKQA 1INLA 1W75A 2GNAA 3NONA 4QVIA 1KHHA 4YP7A 1XD2B 4A3SA 1P5JA 3NVKI 1JWAB 1XF1A 1K9SA 4TVSA 4JT2A 2QW8A 4GZMA 4ODIA 4A1FA 5F64A 4KE9A 4F6RA 1JE1A 3INNA 3QKTA 3PXCX 5K6RA 4E1AA 4EI8A 2UUPA 5KNCA 5COBA 4RYLA 3JQ7A 3RU9A 1NNSA 1N3BA 5CVUA 3X1JA 1XPOA 2VSNA 2W6IA 1HC7A 4JCOA 4M60A 1W2WB 3N8IA 3NIBA 3KYCB 4IH4A 4N48A 4LYAA 5KZMB 3BULA 2QQ0A 3KSZO 2BJVA 4B34A 3D7SA 2Q4DA 1M1XB 3A4IA 2BGLA 3F7NA 3PYXA 5TQ0A 3P0HA 3JVEA 3DB1A 3BGDA 1KMHA 2FWMX 1NLUA 3KTDA 3FHCB 1ICEA 4TOIA 3OOSA 1CLUA 4CKZA 1NBIA 3PC8A 3SEFA 3A9TA 3O31A 3ASVA 1ZVMA 1QH1A 1FUYB 1G16A 4GP6A 4IUCS 2UZ1A 3VHXB 1L8LA 1LSUA 2QBYB 1Z8DA 3AV0B 2YCBA 3HCNA 2BEWA 5AVRA 3QX8A 1B3RA 3TL3A 1CQJA 1YUMA 3L0YA 1WW2A 5IFLA 1SZCA 1WE2A 3PGXA 5AM5A 4XX0A 4YAIA 3CXUA 2RCNA 3RV3A 1QMGA 3I9FA 2YRFA 3JQQA 5BYAA 1OIVA 3RR2A 2DTEA 3IELA 1KKLA 2RG7A 3AB7A 4IRMA 5F3DA 1GSIA 2XCTB 1H2EA 2C4VA 3HVKA 4OHPA 4S1PA 3T12A 3ZW8A 2NMVA 2XZPA 4G8BA 4I9GA 5KWJA 4S0XA 3BB4A 3HBFA 2BKUA 4QYTA 1HUQA 4DR5B 5E3HA 1ECBA 2ROQA 3IO3A 3UMJA 3GJ0A 3QE0A 4DLBA 2H1VA 1I1NA 1A8SA 2Q0QA 2C84A 4KXNA 4CMEA 3MJDA 2EQBA 1FXWF 3EIXA 3FMFA 3WQRA 3HVRA 4KPUB 2H4HA 1N78A 1XQVA 3WLLA 4FX5A 1CY2A 1A5ZA 1XKXA 3C6KA 4CTOA 3FHTA 1E6KA 2XNHA 1WD5A 4F4HA 3M49A 2AOVA 2PUBA 4E94A 5FPQA 3N28A 3UUFA 1C3OA 1KK2A 3PR3A 4R3WA 1U80A 3EC1A 721PA 4J2TA 4AULA 3E61A 1GZ7A 1V8PA 1UC8A 4KQXA 2G9ZA 4MQLA 4KH0A 3FCOA 1PT6A 3VPBA 2XUAA 1PWZA 1IEXA 1HDEA 3DHVA 4OQFA 1QSGA 3A1NA 3DNFA 3IVAA 4HUQB 4JWKA 4RDIA 2M9MA 3T7TA 4B3SB 1MX5A 4IGAA 1K3FA 1O03A 3PITA 4RIGA 4FYPA 4G1MB 3EDOA 2OCDA 1YGYA 2WK1A 1U8CB 3A36A 3GEMA 1EDEA 2GPWA 3QVLA 4L5BA 2ODEA 4JAVC 4U9HS 1E9SA 4LMPA 1L7NA 2QQ5A 2DQKA 3WXBA 3W5CA 3VHQA 3MUOA 2QP4A 3ZK7A 3K6SA 3R0ZA 4TMZA 3HZZA 4X5OA 4PNEA 1EFLA 4ZT2A 4G56A 3B1JA 5HZMA 2RI1A 3GJ3A 2ADFA 1GADO 2ZP1A 2ZBDA 3Q3EA 1TT5A 2GZMA 4I4TF 1M2NA 4DXAA 1KH3A 2M1XA 2QTRA 4ZV9A 1A9QA 4M0EA 1ZO8A 3AFIA 2H1FA 2HJGA 4F0JA 4YRAA 4MZXA 5JJBA 1D2MA 1MH9A 3R5KA 4NXNB 5F4BA 5BSRA 2QI9C 3REOA 4MJ7A 1UMDA 4MUFA 2F64A 4J0JA 4BLTA 3TIFA 1ZOLA 4LCEA 5AUNB 3D0KA 1GN9A 2CC2A 2VHJA 4M9CA 5EGSA 1ZJWA 1OAOC 4XSHA 2OKGA 1XQ9A 4EP1A 2WG1A 1OJLA 4HZUB 4RUKA 4R8RA 4YRDA 1HX7A 1CG6A 3V7UA 2GRAA 3LPMA 5DGDA 5A9SB 3QPCA 3T5GA 5AKXA 4B17A 2QPAA 1V35A 5IRCD 1T9CA 1MJNA 1X77A 2HMTA 3CO0S 4BCDA 1M5TA 1P29A 2P9BA 2AFHE 1H93A 1PK7A 1AC5A 2VDPB 4K86A 4JLUA 3OOJA 1H22A 3IKVA 1NI4A 4QU8A 3VJMA 1DOAA 1NKTA 4N6NA 4RELA 4RF5A 5J43A 1F38A 1SJ9A 3INTA 5DX1A 1IJFA 2X1MA 4CNBA 3OEED 1LRKA 3HE3A 1K8RA 3QPDA 4JEIA 1FBNA 3KRTA 3QBEA 4NU8X 4A8HA 3VMMA 4DREA 5JPDA 4C5CA 3EIOA 3IEVA 2HPAA 1DI0A 2QZZA 1FY2A 3DLAA 3FR8A 1Q0SA 5LD2C 1AKRA 1RHMA 4L4XA 3V1YA 3THOA 2PLWA 1TO2E 4CEHA 4XQEA 5JAUA 4C7OA 4DRXA 4M3NA 4AJLA 2GT1A 1OC2A 1FNCA 1LA2A 1PFQA 2H5LA 5DM4A 1Y37A 2NXNA 3W6ZA 1C7ZA 1FU8A 4D1YA 1KGDA 4HNGA 2J3KA 1A8PA 5JO0A 4QPCA 2BGKA 2GM3A 4UDXX 1P81A 1PQUA 1G55A 2R6CA 3CKMA 1M0SA 2J0UA 1ND6A 2VUIB 4O25A 4PAWA 4UUAA 2NSHA 3VC1A 4AP6A 4EUKA 1LS6A 5IT0A 1QVAA 4HP8A 4X3OA 3SZUA 1IG0A 5CXXA 4IDEA 3AVTA 1QHIA 3PTAA 4EA7A 3BD9A 2BTQA 3TE6A 4P93A 4LJSA 3RI3A 2CCJA 1DQRA 5B12A 4J4BA 2OK7A 1QR2A 2NT3A 4JJGA 4ZI7B 1TO1E 2WP8J 1KYQA 3ABQB 3PWTA 1HORA 1VP9A 2VDLB 3ESYA 5EN4A 1BDHA 5JS6A 3H0KA 1O95C 4NCHA 4O1HA 3NHSA 4INOA 3BAZA 3JX9A 3D2CA 1U4NA 2BF4A 3WLFA 2PKEA 3DO6A 2G5TA 1NW4A 2OORC 13PKA 2W6JA 2XCLA 3F8WA 4M76B 5KYNA 1COZA 4AAYA 4DPLA 4GZ3A 2Q3LA 3HKEB 5F1YA 3H5NA 4Q3KA 3W3AD 2FMUA 5ESDA 3G9UA 3ENNA 4HLUA 1WXDA 1X1SA 1RXSA 5LYJB 1JI3A 1HT2E 2WLSA 4LDQA 5AVZA 1EM8A 5EYPA 3WMFA 1ZUD1 3EMDA 5HS4A 1PL8A 4H1TA 4Q3DA 4ZOLB 4BE4A 3BYZA 2JANA 2XLCA 4PIVA 1GP2A 3A6KA 2ZUWA 4LHZA 2ZUFA 4XCQA 4L4ZA 2GSDA 2FFBA 5DU2A 1KMCA 1O77A 3BZBA 2JAOA 2JH3A 4MA4A 3U80A 3KQKA 4HH1A 1ZH2A 2IOHA 4MGKR 4ZEVA 5FPYA 2XTAA 2AI1A 3M5WA 3AL2A 2QLMA 4RM2A 1YJCA 3TZKA 2CDAA 2XXBA 4BN5A 5AK6A 3CN7A 4DIBA 5AJUA 2Z58A 4K6GA 5EUQB 2VP6A 4OI1A 4NZOA 3VDNB 4UVDA 3T8YA 1N1MA 1QAMA 3F4BA 3MZ0A 3NTLA 4HDMA 1YQGA 3OCXA 3KOYA 1K08A 3TLMA 4W8HA 5AK3A 4N4AA 4QU5A 1VSQA 4Y6GB 1Y1TA 2IX9A 1V39A 4FE3A 4LCJA 1U11A 3IUNA 1HQCA 1E89A 1OLUB 2BKLA 3OOWA 4LOJA 3GFTA 4FMDF 4RJIA 3WLIA 1XXLA 3ELUA 2DT8A 2H63A 3JD4A 4FW8A 3VR4A 2ASVA 4LX8A 3ZC3A 1I7DA 4H1VA 4P36A 3IPAA 3MJ4A 3R7FA 1Z62A 2KYRA 1ZICA 3BIXA 2Q5JA 2QTAA 3FRJA 3GO4A 1PEYA 2DHRA 3QI7A 3TUJC 2PE5A 3COPA 4AT1A 1ZUNB 3ZKWB 5C4MA 3VU8A 1UKCA 5HSGA 1V41E 3IXQA 2Z04A 5LQNA 1QVWA 1F0PA 3W5DA 2ACEA 2XUOA 2WR8A 5ETJA 3UQYS 1SOAA 4RGBA 2H18A 1G19A 4P5PA 4QDJA 3A1VA 1J0BA 2QRVB 7AT1A 2H1HA 1QWOA 2HMVA 3RYCA 4WHMA 3BSSA 3B9RA 3Q8WA 1LLQA 4CMGA 2CLCX 1SUFA 2V7GA 4Y8VA 5FQNA 4D4GA 5JFGA 4LX0A 1XTBA 3LKVA 4MUNA 4W1QA 4XYBA 3OPQA 2X3UA 1XCJA 4A8PA 1YONA 1H1TA 2EARA 1SOUA 2EATA 3GD7A 3PJDA 4IXMA 3ADPA 5KNBH 1J7KA 3ET4A 3UB4A 2OSVA 5T3UA 1WHTB 5CX1A 3EZ6A 4QICA 4RA6A 4MGHA 4HWSA 1PZNA 2PT7A 4D98A 5CVCA 1JDTA 1NNLA 1QBKC 3M9WA 1JIVA 3UEOA 5JZVA 3HJUA 2GHTA 4JJIA 3L01A 4L8GA 1NONA 1E4VA 3SE0A 3P9CA 5HOQA 3B5JA 3F4LA 1IJBA 4JUAA 4BBZA 2I62A 2IU0A 4GKBA 1NRXA 1RDFA 4FJ1A 4OMUA 4YMLA 4CF5A 4KRYA 5FJJA 2IODA 2OXEA 1RZRA 1OV4A 1T5LA 1WMBA 1NJ2A 4IIBA 2C83A 4AG5A 1TFUA 3AI1A 5F3WB 2EKZA 1YUBA 4OJYA 1CDDA 1TRKA 2D74A 1GLGA 1CLEA 4HB0A 2PZ8A 3NRBA 2JCXA 5CD9A 3OWXA 2AUMA 3QVVA 2YHIB 3WHKA 1C3JA 4DA8A 3B20A 2H48A 5CGQB 2LUOA 2PKQP 2VK2A 3C74A 3AR4A 4Q7MB 4ZVLA 1H0HA 2X5JO 2ZXUA 1Z2CA 2HV8A 4MCHA 2GZHA 4IRXA 1JKXA 3S28A 3WL6A 3A9UA 2HD4A 3KDSE 3FLEA 2VHCA 1NTOA 1C8KA 2GLUA 3IUQA 4NU6A 1P5RA 4C0LA 2NU7B 1RC8A 3OJFA 3DDWA 4M0KA 4C4TA 1DE0A 4BO6A 3AVWA 3TIVA 5BRJA 3VZCA 3N07A 1EPUA 2FFAA 1S8AA 4H3KB 4GM0A 4NP6A 2Z98A 3BKWA 2OG2A 3C45A 2GEKA 4EHNA 1WD7A 4JYCA 3ER8A 3LC1O 1L6RA 2PKYX 4Z0TA 2H29A 4QBIA 4DAEA 1QGUA 4RH0A 5DCWA 3D7RA 2VHEA 3H5OA 1IBSA 1VIAA 1MX9A 1Z7GA 2QKYA 4KIUA 3B5IA 3O3MB 4WN3A 3C39A 3HXPA 1XMJA 4ITRC 4MWTA 4PZDA 3PX3A 3HJRA 1XZEA 3I1JA 3EF1A 1V47A 3IERA 3OLQA 3O74A 2DR0A 5EEHA 4JIGA 3UB3A 3G13A 2I7DA 3W2GA 2LR0A 2RHCA 2YXPX 4FFSA 5DHRA 2XEDA 4NS1A 5C31A 3V9PA 1OQAA 4EFDA 4CETA 1TOAA 4URZR 5FADA 2FPUA 1MZVA 3TX2A 3C14C 3OOEA 1LQ2A 3KBBA 4OBWA 1WBBA 1ZSVA 2VDVE 3LS2A 4RSMA 4Y9SA 3ZJ5A 2QWXA 1CZOA 3DZCA 2W90A 4OL0A 4EWLA 5BMVA 1CZUA 2YRWA 1ZAKA 1CNEA 3HYCA 4JLOA 2B4KA 2O5CA 4IFEA 3GLUA 1TVCA 2Y9MB 3FPAA 5IJ9A 1YIDA 4NOJA 1X1RA 4P3YA 5FPPA 1G20B 1KP9A 1M2JA 1E61A 2IVFA 3FPLA 2GUWA 3PI6A 1MRSA 2BCEA 4LQLA 1VA4A 3I2GA 2I6UA 3L7IA 3ILVA 1E18A 1GR0A 2WWFA 3ORHA 1YVEI 4K03A 5AW0A 5DH9A 4XPIB 5KB3A 1WPXA 2FWPA 2PBLA 2D8AA 1KOLA 3VO1A 1CHDA 3QKRA 4COKA 2H7YA 3PRKE 4Q7JB 1I4TD 1U6KA 4BVBA 4G5HA 5IABA 2P9ZA 2BW0A 2ZETA 1LDGA 4E15A 1N3YA 2QP9X 1GIAA 4QO7A 4IIJF 4H0NA 4BVFA 5D87A 4D3XA 3BCHA 4TWJA 3A4NA 4Z86A 4YMIA 4JUDX 4YAEA 2FZLA 3IS3A 3KV3O 3TB6A 3DXFA 2ZXEA 1RXUA 3S40A 3I1FA 4DMKA 3OA2A 4L6CA 1FFHA 4WH0A 3SLRA 1E7MA 4EL0A 4OQZA 3U61B 3GRAA 3I4FA 2FWJA 2WHPA 3Q87B 1T2VA 2XRYA 4JUFA 4LRWA 4LRQA 4PQGA 5FPTA 2OA0A 3CKLA 3P7MA 3U7JA 3NEYA 2HADA 4PLTA 3OY7A 4LNUB 4CIYA 4OXQA 2CXHA 5CLIA 1YCFA 3FF4A 5LLSA 2AYZA 1ULZA 4IZHA 3FTNA 3WYEA 1VJ1A 3KAKA 4JUBA 5JC1A 2J9XB 5DGCA 5BWMA 2CLFB 2PX2A 2QEQA 1I6MA 3GT7A 3QY9A 4EUNA 1JQKA 1I4LD 4DQUA 5DNDA 3HWX1 4X61A 2X0IA 3RKUA 4PSDA 4WK2B 5KYTA 1H8EA 1U9JA 2FWAA 4HDRA 4FKMA 2OILA 3UGKA 1SC1A 5CXQA 1AQNA 4EYSA 2D4HA 1YDFA 2Q4OA 1U0GA 2C3MA 2J0EA 1RYMA 3AOEC 3ON5A 4ALNA 8ADHA 4IDOA 3EMKA 1KI3A 2QVLA 5FUXA 4Q21A 4TKUA 3UK2A 2DUJA 4ZK2A 2YZ2A 1RWOA 1RCUA 4Z3DA 1CETA 1YAJA 2R7LA 5TS2A 4FYWA 4ATNA 4BE9A 5EMNA 3ZUPA 2WHXA 3C6ZA 1JZSA 5EJAA 5CAEB 1K6MA 1TC2A 4E7PA 3O83A 4RTPA 1NBMD 1GRCA 1NIPA 2W8BA 5J1TB 2C2OA 2JLWA 1QH8A 4Q34A 3K0FA 5DLPA 1E4YA 3QYFA 3O4JA 1ULSA 4W9RA 5ALTA 5AVJA 1X7XA 2JHFA 3SYLA 1LPAB 4JI3B 1R50A 2RBKA 5DCUA 1HE5A 2BELA 1NL3A 1DMSA 1H6DA 3O75A 3VZDA 1SVWA 1SUBA 4IGEA 4C20A 1MENA 1C81A 2R8PA 3DBLA 4KYVA 5ALYA 4HS9A 3B1YA 2Q1SA 4ND5A 1KC1A 3GA5A 4CPDA 4EYQA 2IE0A 2PAFA 1E63A 3ENVA 1CRZA 3RUPA 4X24A 1Z33A 4JU8A 1GU1A 4QBFA 4EEZA 3THWB 4HX5A 5FTMA 2Z2JA 2B8TA 3E2MA 1I2MA 4MMYB 5EP2A 3TOVA 3MYYA 5GZ1A 3QQ5A 5JCJD 1BU5A 3KZCA 3JWPA 1ZH4A 5JIBA 3COJA 1OKKD 1QPBA 3ONNA 4OYLA 5EHGA 5HKKA 2DU8A 4RY2A 5EP1A 4Z4QA 3ISTA 1P1CA 3LUBA 5KC9A 5FWXA 3TNJA 2GZRA 3WLHA 2MR6A 3FNGA 1QOQB 3H9JA 3HMQA 2XDYA 3ETCA 5MGNA 1Z56C 3LSTA 4A9AA 3AKCA 2W0MA 4V0OA 4G25A 1ES9A 1W96A 3AXTA 2EBUA 1HTTA 3LKBA 4CQMA 1X7WA 1NAHA 2YN2A 1ZMRA 4RIEA 1C8BA 3D0OA 3K5WA 1PJ4A 3DHEA 2UUAB 2H5IA 3WL8A 4XPZA 3DE7X 2CXXA 1VYTA 3KKPA 1AA9A 3M9LA 4IGIA 3BZWA 4N9WA 1AUPA 2JGLA 3LY8A 3PQDA 4QJ3A 4XRRA 1NOIA 4GX0A 3RH0A 1YHYA 2C3OA 2ZDGA 5HQ3A 1M2OA 3A7EA 4FX2A 1C7FA 4B4DA 4BNYA 1D0IA 1Y9EA 5FO1A 3B12A 4Q1FA 2GZDA 3V32A 4AF7A 2YWJA 3FWZA 4PYRA 4UQLA 2HBRA 3T99A 4TZTA 5DBHX 1NXOA 1PWYE 2B2XA 2NSYA 3AEUA 3D1VA 3QNMA 2B4YA 3V7FA 1Y3HA 4TQUS 4U6NA 1F3LA 5E6SA 3WADA 5BORA 1B2RA 2F8LA 5H3CA 1A98A 4I4TA 1HFKA 1NT4A 1YA8A 1Z6GA 4GKAA 3GXOA 2QYOA 3PC2A 5EC8A 4D79A 1W48A 1SA0B 3PFBA 3M4JA 4EZIA 2HA5A 5C46F 4NIMA 4O4HB 3IAAA 3UMGA 2ILTA 4NZYA 5DLDA 1AKWA 4C5AA 1EESA 3L8GA 2Y1DA 2ZRGA 3BHMA 1YV9A 1NJ1A 2HA6A 1HFWA 4QASA 5LFAA 4WLFA 2V9CA 2VR1A 4MI9A 4PVDA 1ETHA 3HFRA 2G1PA 5DTRA 5HS6A 8AT1A 4MS1A 3X1DA 2ATEA 1EUYA 4WMLA 1IY9A 6ADHA 2I78A