3OE4A

Rat catechol o-methyltransferase in complex with a catechol-type, purine-containing bisubstrate inhibitor - humanized form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 68
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3oe4A01
2GLUA 5GM1A 5D1NA 2HV9A 3OFKA 3BGIA 5EEHA 2IH4A 5FHRA 4DCMA 1U2ZA 1TW3A 3G8AA 3TFWA 4QDJA 3UJ9A 4AZSA 2KW5A 1X1CA 4CKBA 2I6GA 4PNEA 3B7PA 1M6EX 2FK8A 1OR8A 3FUVA 5E9WA 5EMLA 4QDKA 3I5UA 4R6WA 3TMAA 1NT2A 5EIFA 2B2CA 1BHJA 5D1HA 4E2ZA 3F4KA 5HIIA 4RTPA 3CBGA 3LCVB 5E8RA 3IV6A 4PIPA 3BGVA 1QAMA 3KQMA 1TPYA 3Q87B 5EOVA 2PX5A 3HA5A 2Z6AA 3PLAE 2ZBRA 3JWIA 5F2NA 2BR3A 3DMGA 4PYQA 2WK1A 5KVAA 4GOOD 2JH9A 3HCFA 3LBFA 1WZNA 1JG2A 3OZTA 1XDZA 3C6MA 3FZGA 1JSZA 2PGXA 5DM0A 2CMHA 5EPEA 3FUTA 1UFKA 3OCJA 5FADA 5FWAA 3EGEA 4L7VA 1DUSA 2CWWA 2FPOA 4LECA 3I9FA 1VP9A 2Q41A 4GEKA 4LWOA 3K0BA 5ICCA 4HH4A 2OZVA 4IWNA 3LGAA 3EVCA 5IKMA 2AOUB 3KR1A 4R6XA 3OU2A 1RI3A 5FA5A 1EJ0A 1L1EA 1ZHFA 2FHPA 2YTZA 3MAGA 3VSEA 2IBTA 4PYLA 1QYRA 1QZZA 5DTQA 1L3BA 2AOXA 1SUSA 2ERCA 4E32A 3FTFA 1SQFA 3GWZA 4QPNA 1ZG3A 3O31A 5C9ZA 3EVBA 4K6MA 3B89A 3WSTA 2Y1XA 5GINE 5E9QA 3B3JA 2NYUA 3LCUA 3G88A 4CKEA 1JSXA 1RI5A 4RTSA 4MHTA 5DTRA 3MGGA 5LQNA 3FPHA 4HC4A 3I64A 4HG2A 1G60A 2G72A 3TRKA 3HNRA 5LQUA 3OFJA 2ZWVA 1WG8A 2P3LA 3EEYA 3FTDA 8MHTA 2UYCA 2UYOA 4FS8A 4RTQA 4BLVA 1O9HA 3I53A 2PKWA 3LECA 2XVMA 2V7EA 1XCJA 5CVEA 2HR1A 4NECA 5EG5A 1RJDA 1VLMA 2PX8A 5BXYA 2IPXA 4GF5A 2GAFA 2OB1A 4M38A 3NVMB 1WXXA 3M33A 2PX2A 3LDGA 3HCAA 3BWBA 1JTFA 3L8DA 1JG3A 5BP7A 3G5LA 3ERCA 2IBSA 3MCZA 4PCLA 4YV0A 5DX0A 1NBHA 4PYJA 3M4XA 1X19A 1YF3A 3TM5A 5CUQA 4Z2YA 3TR6A 3GCZA 4EVIA 3REOA 3BXOA 3OU6A 3GO4A 4RV9A 4AUKA 4AZVA 3M6VA 5K0EA 3LKZA 2UYHA 5DLYA 1FP2A 4JXJA 4CTKA 4GOLD 4QPPA 3LSTA 3EMDA 5IH3A 4RTKA 2QRVB 4CTJA 2OO3A 3SR4A 1HNNA 5DRYA 5C1IA 2ZTHA 3GIWA 3TKYA 5CD1A 3BWMA 1RI4A 5FQOA 1F3LA 4GBED 3GJYA 4OQDA 2QYOA 1ORHA 4BY9E 4GQBA 3CJTA 2NXNA 3HVIA 3MERA 3NWBA 1TW2A 1KIAA 3E05A 4KIFA 5EIWA 3SSOA 4FGZA 3GRZA 4RVFA 5K01A 3KQSA 5E8JA 1IM8A 3KQVA 4RTNA 3FRIA 1FPQA 1P91A 2P8JA 4Y30A 2P7IA 5ERGB 3TOSA 2LD4A 2AS0A 2ZIFA 2JHCA 3FTCA 5E1OA 5HIJA 3GDHA 4PGGA 3M6XA 3A26A 2PXXA 3OU7A 3P9IA 5LQCA 2BR5A 5EGSA 5MHTA 1X1AA 2AOVA 4R05A 5LQRA 3TM4A 2FCAA 3ME5A 4DM3A 5EHIA 1AF7A 1RI1A 1XDSA 5EZQA 3O4FA 3G2MA 4MTLA 4QTUB 4EMSA 3UJDA 4RSRA 1H1DA 2XBMA 1KR5A 5DT2A 1NW7A 1YB2A 2PV0A 5CCXA 5BW5A 1RJEA 3AY0A 5DTMA 4OA8A 1MHTA 4YMHA 4DQ0A 2H1RA 2IDJA 4DZRA 1AV6A 1SVUA 1BC5A 3ELDA 3MHTA 3C3YA 4EKGA 4PINA 3KR0A 5EMJA 4M36A 1XVAA 2YXDA 3PS9A 4RTMA 3P9KA 1ZQ9A 2ZLBA 5GWXA 4XUEA 2R3SA 1ORIA 1SG9A 4KIGA 4PYMA 2GPYA 1VL5A 4XUCA 5E1MA 3TPZA 4QVGA 3CJQA 3HM2A 3DMFA 2NP7A 3E8SA 3UJBA 5FA8A 5K0CA 5LQJA 1FJXA 2HTEA 1RJFA 3GRVA 2G70A 4PCAA 1WXWA 3CKKA 3AJDA 1IY9A 3SM3A 2Z6QA 3P9NA 5EKUA 5DSXA 4F84A 4ISCA 4E30A 3G2QA 4DF3A 2ZSUA 4HSGA 4CXMA 2QRVA 4FP9A 2UZ4A 1M0EA 1SQGA 3K6RA 1VBFA 3EGIA 2ZFUA 3BKWA 5KQSA 4ER0A 2PXAA 3SXJA 1G55A 5FQNA 4QQNA 4C07A 5K0JA 4X61A 1DCTA 3NJRA 3UJ8A 3T0IA 3DR5A 3FPJA 3KKZA 2VDVE 1NV9A 1L9KA 1FBNA 3UA4A 3KPUA 1P39A 5E1DA 4DKJA 3ELYA 3OZSA 3HCEA 1I9GA 1G38A 3FUUA 1XCLA 3R24A 3FYDA 4Y2HA 2N47A 4H0NA 2JHAA 4V0RA 5LQAA 2JH8A 2R6ZA 2YVLA 3E23A 1JTEA 3KPWA 5EC8A 3FYCA 3LPMA 4IKPA 3EPPA 3V97A 3EVFA 5M5BA 3UBTA 2PY6A 3FPEA 5CVDA 3T7RA 3RW9A 1B42A 5K0FA 2G1PA 5F2OA 3VYWA 2GH1A 4YUXA 4C06A 1KXZA 3A27A 3OE4A 3P2IA 4ER3A 2XYQA 1D2GA 5EMKA 4FT2A 4E31A 4LWPA 1RJGA 2VS1A 2GA9A 3U81A 1EJ6A 1FP1D 1JQDA 3KQYA 3NDJA 4GC9A 3QOWA 3NDIA 1UWVA 2O0LA 3BKXA 1AQIA 3Q7EA 4EK9A 1PRYA 2ZZKA 1O54A 2AZTA 3B5IA 3DTNA 1N2XA 2YUIA 3EVEA 5T6BA 2OY0A 4FZVA 1RI2A 3A25A 4FSXA 3JWHA 4HTFA 2AOUA 2CMGA 1ZGAA 3H2BA 3LDUA 5JUWA 2IIPA 4X63A 4IV0A 2NXCA 5LR6A 3FTEA 1Q0TA 4WXHA 3CVOA 3HA7A 1KPHA 2UYQA 3NW9A 2O06A 4KW7A 4HGZA 5DM2A 5EHGA 2OKCA 3GRRA 5F2KA 5FWDA 4B17A 3B3GA 5B1SA 4RX1A 3BT7A 2NNWB 3C6KA 5GM2A 2OB2A 1DL5A 2JJQA 1L3IA 3M6WA 4O29A 4R8RA 3ER9A 3KQPA 2FYTA 2YX1A 5DWQA 2NP6A 3OPNA 4GUAA 3DLIA 1KP9A 5K8VA 1XDUA 3HVKA 2B78A 2PLWA 2PSSA 2QM3A 3EVAA 5EEGA 5K0NA 1QAOA 2ZULA 2JG3A 5G02A 5BW4A 2PT9A 3R9XB 2P40A 3T7TA 2AVNA 2H11A 4PYKA 1NKVA 4GOMD 3FUWA 4DA4A 3P8ZA 3ELUA 5HEKA 4PYIA 2PVCA 3BGDA 5C0OE 2K4MA 3V8VA 3EVZA 2ONYA 1JG4A 2ONZA 4XCXA 3FPFA 4YUVA 5KYGA 2IGTA 3GGDA 5E2AA 3UZUA 3KQOA 3TLJA 2AOTA 2YR0A 2VZ9A 4P7GA 2DPMA 3LHDA 2P3OA 4IV8A 1L3CA 3ID6C 3LBYA 4AZTA 3FUXA 4G56A 1KYZA 3LX6A 3KQTA 4YUYA 4P7KA 3SSNA 3ELWA 5CVJA 1KPIA 1G8SA 5ICEA 1MJFA 4E2XA 2C7QA 3ER8A 1NBIA 3C0KA 1I1NA 3MB5A 3R6TA 3P97A 5DXAA 5DX8A 3P9CA 4C4AA 1AQJA 5GIPE 3G89A 2BH2A 2HNKA 2BR4A 3NMUF 2QY6A 2AR0A 2ZZNA 3HCBA 5CM2Z 1O9GA 4AZWA 2IP2A 4YV2A 2EG5A 3LL7A 3THSA 3KR9A 3LKDA 3G7UA 4XUDA 4EQZA 5FTWA 2PX4A 4DCGA 2B25A 5K09A 1EQAA 2AVDA 3UFBA 1R00A 5DSTA 1YFLA 3C3PA 1XTPA 3T7SA 4F86A 1VPTA 5CIYA 3KPVA 3ANXA 1UIRA 4FSDA 5EVJA 3MTIA 2B9EA 2ZVJA 3HVHA 4V0QA 2ZBPA 3G2PA 5E9JA 4CWAA 2I7CA 1NW5A 3D2LA 3FRHA 3M70A 1XJ5A 2BM9A 3OE5A 5DXJA 3HVJA 2OXTA 4QVKA 2YXLA 5K0BA 2ZWAA 4OBWA 4OX9Y 2ESRA 4PIMA 3UWPA 4FR0A 4FT4A 4P58A 2E5WA 4DMGA 4F85A 3DUWA 2H00A 2IH2A 3OZRA 4E2YA 5HIKA 1KPGA 9MHTA 1X1BA 1JR4A 2ZIEA 3JWGA 1Y8CA 3SMQA 3CCFA 5LQKA 3DULA 2PWPA 5T67A 1G6Q1 4RTLA 4GOND 2IFTA 3MTEA 1P1CA 3ORHA 2BM8A 2XYVA 3R3HA 5JR3A 4HRAA 4A6DA 2NXJA 2ZIGA 5HZMA 1N7IA 3DXZA 3PFHA 3JWJA 3QOXA 1X1DA 2P41A 3HEMA 2XYRA 2IH5A 3KU1A 3SSMA 4KRGA 5P8WA 2B3TA 2HWKA 5U4XA 3GRYA 1V39A 1ZKDA 3BUSA 3MQ2A 4BLUA 3BWYA 2EFJA 1R18A 1ZGJA 2BZGA 4OA5A 3QV2A 3E7PA 2P1DA 2ZBQA 4X41A 3UA3A 4EKIA 3AXSA 3SX0A 2ZZMA 3RIEA 3P2EA 3GXOA 1R74A 2WA2A 4X1OA 3SVZA 1HMYA 5DM4A 4POOA 5KQRA 2I9KA 2ZCJA 2AOWA 2CL5A 2A14A 4C05A 2AOTB 2PXCA 2ZW9A 4E33A 1VE3A 5E1BA 2P35A 4RYLA 5EQJB 5CVUA 5H02A 2AN3A 1T43A 2IDKA 5GOZA 3DH0A 3KQQA 4PYNA 2ADMA 5K0LA 3TQSA 5HOQA 1M6YA 2FRXA 3B3FA 4YUZA 1BKYA 1R8YA 5GP1A 5LSAA 4KDCA 4HGYA 4AX8A 1YZHA 4M37A 3PTAA 1VIDA 2WA1A 1QANA 2P3QA 4RVDA 2F8LA 3IEIA 5CCBA 2VP3A 2PJDA 2VDUE 1WY7A 1SKMA 4U7PB 1EIZA 3PT9A 4U7TB 1EG2A 4KVZA 5FULA 5KS2A 1INLA 5EZSA 4YMGA 2CKDA 4PGHA 4CKCA 3DLCA 4X60A 3X0DA 4OQEA 3GU3A 3PVCA 3R0QA 4ER5A 4RTRA 1YFJA 1SUIA 5GIOE 3IYLW 3EMBA 4R8SA 4E2WA 1KYWA 3EVDA 1I4WA 2EJUA 4PWYA 4RVHA 1BOOA 3S68A 4A6EA 2PT6A 1IXKA 3A7EA 2AN4A 3AXTA 1VP3A 1VQ1A 3MCTA 2O07A 5EMMA 2VDWA 1Q0SA 3PX3A 4P7JA 3THRA 3HP7A 3EGVA 4OBXA 4RTJA 4YV1A 3HCDA 1D2HA 2GS9A 3M6UA 4LG1A 2FK7A 2GB4A 3AWIA 1NW3A 3HCCA 1KHHA 5FCDA 3BZBA 3DXYA 4ER6A 3RODA 3CC8A 4RWZA 3KPYA 2YQZA 3UJ7A 5T64A 4PONA 3HTXA 2QE6A 7MHTA 2O57A 2OBFA 3DXXA 5DM1A 1NV8A 3GRUA 3NVKI 4KWCA 2I62A 3KPJA 5ICGA 5HIMA 5CVVA 3UJ6A 2EJTA 1NW6A 3P71T 4ER7A 1NW8A 2NXEA 2DULA 1JG1A 3DP7A 3O7WA 3LDFA 3UJAA 3CGGA 3P2KA 4E70A 4KDRA 4RTOA 2C7PA 1YZ3A 1NE2A 2HMYB 1G8AA 3KHKA 5HILA 1WS6A 2O05A 1YUBA 2G8NA 3A7DA 2PWYA 3UJCA 1Z3CA 1PJZA 5FHQA 4C04A 5DX1A 1N7JA 3PB3A 3NTVA 3NWEA 2ORED 3EVGA 3HA3A 3EEOA 4MIKA 2G71A 5K03A 4YUWA 1EAMA 5FUBA 2V74B 1R6AA 4C03A 3G2OA 2YXEA 4PYOA 4QQKA 4UOEA 10MHA 4RVGA 3DOUA 1JQ3A 3GNLA 4ZTBA 4BP1A 4WVLA 3LCCA 3DMHA 1XXLA 3BWCA 5DPMA 2C7RA 4C08A 2EX4A 3G5TA 2PBFA 5E2BA 2AN5A 3CJRA 3A4TA 2OYRA 3G8BA 4ATNA 4BLWA 5ICFA 2Y1WA 4MWZA 5DRTA 5HFJA 3SGLA 1F38A 2JHPA 4P7FA 3VC1A 3TKAA 3IHTA 5K05A 2XVAA 5EKXA 3KR2A 1D2CA 4MQ4A 1JQEA 3VC2A 4BP3A 5K0GA 2C7OA 4M7RA 1R8XA 2P7HA 3PX2A 4QTTB 3I58A 3KQWA 4HTFB 2OPBA 3FPGA 3PFGA 2Z6UA 1QAQA 1P1BA 4GC5A
chains in the Genus database with same CATH superfamily
2OHHA 3K0HA 2HV9A 3OFKA 5EEHA 2ACVA 5EIXA 1TYAE 3UAXA 3QXHA 3SC6A 3TFWA 1PT8A 1TTTA 1W0JA 1DJMA 3F7OA 1ZWLA 2CVZA 4ZODA 5ESXA 1FK8A 4DA9A 1V3TA 2ZB3A 3C4JA 5DGTA 2O8EA 2Q6TA 3DZGA 4OHWA 821PA 1M6VA 5G0SA 4D45A 1XAHA 4PG5A 5SY9A 4GYYA 2PJUA 3BTOA 4KGXA 4WUVA 2GO1A 2YFYA 3FWKA 2J6BA 1Z6GA 2Q3CA 4IDEA 1G2IA 3HXKA 3KQMA 3E35A 2PH5A 3N0WA 1XZDA 3JRNA 1NN3A 1Z6PA 3IAXA 3M1LA 4WEOA 2CSUA 2CKMA 3WV4A 2CUZA 1QF9A 3L8EA 4HX5A 3RIGA 2PUAA 2DLCX 2CUKA 2P5SA 4KQCA 1OCEA 5JD4A 3BMOB 1NBWB 4RYDA 1YJ5A 3STXA 4BC0A 1K6XA 1SCJA 4EUEA 2LGJA 4ESVA 3ZVRA 2Y0CA 5FBHA 5EWLB 4F21A 1V1RB 1XMJA 4PC6A 1M2OB 4FZ5A 4TRRA 1NPYA 1UQRA 3RC7A 2GCEA 2O8CA 2ZATA 4ZDWA 2HKIA 1W48A 1O5IA 1BW9A 4KO1S 5BN5B 5HUHA 1L1EA 1SXJE 3OFSA 4IIBA 4OBEA 1QHNA 5DTQA 4HDRA 1GUDA 2F48A 3U19A 2Z2KA 1XTUA 4E32A 2C2BA 2O50A 5ICSA 4B31A 3PDHA 2DBRA 2XB2A 3QE3A 3WYGA 2Q5OA 4O4JB 4MWOA 2G80A 4X1YB 4Z6KA 3MD9A 3B3AA 4OKSA 3S2GA 2H16A 2Q50A 3K8ZA 1P5JA 4MQLA 2NQTA 1HDOA 3HUUA 2DAPA 1TYEB 3BDAA 1C8VB 1YR3A 2CEAA 2PRSA 3OC6A 2F3UA 3TO5A 1XR3A 2VUUA 2X77A 3KJXA 3HNRA 5D51S 3OFJA 4IZ6A 4A9AA 1NONA 1X80B 3BGSA 4LHXA 4LW8A 4M9RA 1OGYA 4QPCA 2WIBA 5JCPA 3KO8A 3PWKA 3IIJA 2VDJA 4Q9NA 4Q3LA 4WLNA 4ASUD 1PZFA 3K5IA 3A9WA 3HUTA 3LECA 4M9XA 1E2QA 1E92A 4O2AB 1ECCA 1EZZA 1U98A 4ZU1X 4ZI7B 4E4RA 3I6QA 2ZYAA 5CBKA 1QQAA 2XCQA 3G3EA 3KQHA 2MJLA 1C1XA 1N6OA 1YDMA 2FPIA 1QUEA 2JFNA 3VC3A 5DNAA 5KTTA 1LS6A 4UD6A 5KYXA 1S89A 1TUBB 4MLPA 4RIIA 1ATIA 1B7GO 2J09A 3HFSA 1HEYA 1RKQA 3D1JA 3HWX1 1A27A 1JBKA 3MELA 1RRGA 1C7FA 2DY0A 1Z7GA 2Q3MA 3IR5A 4I1UA 4R2KA 4U63A 1GAEO 1ZC3A 4BP8A 2LCFA 2Z5VA 4MKFA 2JPDA 4WZAB 4JASB 1TUEA 1WUTA 1EFDN 2D1SA 3CPEA 4LBZA 4CE6A 5BMVF 2GDZA 4AZVA 3F67A 2VPTA 3ZCSA 2J3MA 4EVRA 1DAGA 2P4HX 4ZCMA 5CT8A 2ZBVA 2OFWA 2Y3IA 1D2NA 2PJZA 3IP1A 1V2HE 3LHIA 4ZOLA 5EJMA 2Y1GA 4AF7A 4PZUA 2OGSA 1G6KA 2N46A 1IQPA 4PU0A 2AFHA 2FPUA 1UWLA 2X14A 2ZXFA 1PJ2A 5IAKA 3GJXC 4K9DA 4TXNA 2WFLA 3IP9A 4WBSA 5ARCA 2DTDA 3JW8A 3THOA 2X2PA 1EFAA 2Y68A 2WSSA 5HKLA 3E7DA 5EIWA 4MV5A 4NJMB 1P5FA 4B3MB 3K70C 3IR7A 5JAPA 3PIIA 1Y8RB 3I2IA 4X6XA 1BSVA 1U0NA 5E8JA 2CNLA 1EP2B 1HLFA 1ZCAA 4Q15A 4INJA 4PXAA 3U56A 4K8OA 2X0IA 2LD4A 2RGCA 2XADA 1QRAA 1VBMA 1WUHS 4JUBA 4KSBA 4DDKA 2ORYA 1XZHA 4F6LA 5INTA 2XWJI 2Z8YA 4ZYVA 4NV1A 4D8VA 2E4ZA 4KWHA 5EGSA 4I2NA 3DT6A 3KBBA 5H59A 3RJMA 5LQRA 4Z51A 4P3OA 1L5RA 3KDPA 4KXFB 5J4VA 3DBIA 1PWZA 1RI1A 3A3NA 1NF3A 1XVUA 2HSJA 2WD7A 5FJJA 2ICAA 2BSXA 3KEGA 3GZ4A 4JB8A 1UC8A 3OJOA 1MHTA 3LX4A 5JO9A 1U3DA 3U3XA 5IBCA 2K7FA 3E0QA 5FO0A 4M9QA 3H0EA 4Y6GB 3S70A 5IUJC 1MO5A 1YS7A 4RF2A 5AJHA 4Z9FA 4BO7A 3QVMA 1YQ9A 2OHJA 3BFJA 3PQ5A 3ANYB 1I8TA 1KAHA 4PX2A 1VL5A 4XUCA 4F56A 9LDTA 3VKGA 4IUYA 5CLQA 1Z68A 4AY2A 2YWFA 1C7JA 2TRSB 1HE5A 1SR8A 2WU4A 4G1EB 1Z2CA 4BECA 3L6RA 5F1KA 4K6FA 5EJ5A 4ARCA 3ZHXA 2I2DA 5AI5A 3IKVA 2WUVA 4PCAA 3FNFA 3DAFA 3V5NA 4CU5A 3IGFA 3P4XA 1RP7A 3S8YA 2QJFA 1I3CA 3CLVA 4HYYA 5D86A 2QTCA 4C2AA 1RKBA 2Z8YM 4WHMA 5JZ9A 3RK4A 1LFDB 2I3DA 2GLTA 3IDQA 2CT8A 3GLIB 2HJVA 1OTYA 1R66A 3IE0A 4B3GA 1K4KA 3QLUA 3JD3A 5CDUA 3G0BA 1PYOA 3KUDA 3T0IA 1EX9A 5JLJA 2WPDD 4WLFA 5ALXA 4CR8A 4I8DA 4MUMA 1OHHD 1YVUA 1VLZA 2VSXA 2VPIA 3FNEA 4KQGA 1GVHA 1I4DD 2C4WA 4OHVA 3S7ZA 5CURA 2DTXA 1F0YA 2W6JD 5E0OA 1D9XA 2Y2VA 4PEVA 3E23A 4IV5A 3PPVA 2EFEB 4Q1EA 4BX0A 4JLOA 3EPPA 4Q39A 4GDFA 1DJQA 3I1YA 3KKLA 4WZAA 5AJUA 4FD3A 4OXIA 1W4RA 4CV2A 4PLGA 5IDYA 1HDIA 3A1WA 1MH1A 3V55A 5K0FA 1JBEA 1GYQA 2H5LA 2G1UA 2RH4A 1NTOA 2IU3A 4YPVA 4UCWA 1KJ8A 1VI2A 1XZ8A 2VHWA 3COYA 2Q1TA 1ND5A 2XYQA 2O8DA 1P0MA 1CEQA 4PSUA 1B6SA 2HPAA 3O8NA 4LWPA 3AJRA 2WM9B 1U9ZA 1N0WA 2H9IA 3N8GA 1XA0A 2X2OA 3L1VA 3PZBA 3HKCA 1RCUA 1RWKA 4JY7A 1ADYA 4CZ2A 1XKXA 1WDWB 2O59A 2FX5A 1SOUA 4FYIA 1TVEA 2VWGA 2FAXA 4YRNA 5GVSA 1NBAA 1IM5A 3D8RA 1XELA 3NHMA 4OHZA 2WU0A 2BEVB 1AU9A 2RARA 5FUXA 1I33A 3VDNB 2BHRA 1KE1A 2NXCA 3UT5B 2LCIA 1N2HA 4Y2RA 2O06A 4HGZA 1GU7A 3E9EA 4US2R 3QYAA 1EBFA 1XUOA 1RRCA 4CI9A 4R1TA 3SIWA 1LI7A 2GO7A 4LXUA 4XYMA 1VB3A 3K2BA 3MW8A 3CRVA 3E48A 2W2MA 3NAMA 3UT6A 1XEXA 4R7GA 2OUIA 5ISMA 3AVTA 1U1IA 2MYTA 3ANMA 3SP1A 5LR6A 1XROA 2V9PA 3K32A 2QN3A 2YCLA 1DKQA 2Q9AA 4U9HS 2NSLA 2D7DA 2QUHA 4AJPA 1T4BA 2GM5A 2REBA 3EIQA 4OM8A 3TLMA 3WDKA 5K0NA 4A0QA 5JROA 5TEWA 2P40A 3BXXA 2EYQA 2Y67A 2H11A 3T7TA 3TR5A 1JMKC 3G9TA 3R3ZA 2QTWB 2PVCA 2JGEA 5FXMA 3Q8WA 4PRKA 5SY6A 4CM9D 1JG4A 2Z2ZA 3JQPA 4J91A 3Q5GA 3P0RA 2DX7A 1CBUA 1GLNA 2OO5A 4N5MA 2EHJA 1F3OA 2HA3A 2R84A 1Z4IA 1U8ZA 1G3MA 3MGKA 5JANA 4F2WA 4ZOCA 1MLDA 4WN9A 4AI6A 2DEUA 1EYZA 2YH2A 1PVOA 3ZE0B 2RHOA 1S9DA 2DHQA 3ER8A 2CXTA 2C7QA 1K86A 2GYUA 4XR4A 1K89A 4MUAA 4H0CA 2B5OA 3B9QA 4DBLC 2BH2A 2FDCA 2I4LA 1V4BA 1XEWX 2JCSA 2H2AA 3RUIA 1R1DA 1PHPA 2HUPA 1S2DA 3HCBA 1ACLA 1U6KA 2YDXA 4JJKA 4OYRA 4Q0MA 1Z6QA 2GEJA 4Q24A 2AWNA 1V16A 2PCJA 4TVBA 4UE2A 1YBFA 4DQDA 3CYFA 5L9AA 3TGWA 3DHWC 1T9KA 4NEHB 3MQFA 2AI3A 1GFZA 2XRMA 1RTKA 1OXTA 5EP2A 4DIKA 1R00A 2P2NA 4MV8A 3RV3A 1JLMA 5B2FA 3AY3A 1OV4A 5C3UA 1IN4A 3OCXA 5DK6A 3C3MA 5DXJA 1HURA 5FBLB 4DC1A 4EGCB 4K46A 4PO1A 3UY4A 1T0JB 3WLMA 3NAZA 2QZSA 5ESRA 3FSEA 1W4AA 1NMSA 3F7NA 2BFEA 2XAAA 3MUFA 4FR0A 4XEUA 1K66A 1M1YE 2Z1MA 2NTVA 3SMQA 3P94A 5D6OA 5L7TA 1Q50A 2EL7A 1NKSA 1NOIA 1N5RA 2H85A 3DKKA 3IIEA 2HA6A 3WGZA 4DWOA 4AQYB 1UFOA 1YE3A 3UB4A 2P1RA 4FCWA 4OUDB 3U4IA 1YE8A 3KFLA 4HRAA 4L75A 1JX6A 2VAXA 4X1IA 2IYEA 4X8LA 2OKGA 3FWPA 1N6NA 1ZRSA 5ANRB 1DAPA 5AVXA 5A3VA 3NTRA 1N2ZA 1MDFA 3BFXA 4PFSA 3FETA 3Q6NA 2CNWA 3LVBA 4PRZA 1FRNA 4MWTA 2ZUUA 3JTEA 1SZPA 3AY7A 4BNMA 4J4BA 1GT6A 4UMDA 1QR6A 1QZXA 2HMVA 2BE9A 3IQXA 2JGAA 4K6CA 3AXSA 3JVDA 4I08A 5EJGA 1L4YA 2BHSA 4G4SP 1V37A 1C50A 4KYTA 3HPRA 3TUIC 4FQ8A 1NLYA 1E58A 5LZ9A 5H81A 1QOQB 1K9SA 3FNIA 3WB1A 2ILVA 4C05A 3NDPA 4B35A 3ZV7A 3GLGB 2ZYGA 4CUJA 5SV2A 5JI3E 1KTIA 1E6LA 4ZQFA 3TQSA 4D98A 3WOVA 2NTEA 2GEVA 3E5NA 4ZVNA 4KWTA 3I2YX 4KDCA 2H0QA 4PX3A 3A6FA 5FTNA 5DNCA 4M37A 4HYTA 2R60A 3ESYA 3JAKA 3KZKA 2GI4A 2ZXEA 1L7NA 3ND6A 1ZHOA 2EFYA 2F8LA 1GN9A 4RDCA 4MIOA 3LQKA 2WI8A 1Z8DA 4J1NA 4UNIA 3S1LA 2ZJ3A 1FE8A 2O6LA 3DYBA 1EIZA 2OP0A 3BWDD 4U7PB 4CQJA 3DLBA 4Y6OA 1C1DB 3VR2D 2JNWA 1AM4D 4ON9A 4PGHA 4DILA 1ZQ1A 2RB4A 4H1UA 1L6IA 4HV4A 4GH5A 5C53B 1E2BA 4MO2A 2C07A 4MYDA 1FS5A 2J41A 2R47A 4YBZA 2IYYA 4JBGA 4O4LA 3ST7A 3VOTA 1O89A 1YQGA 3AW8A 4N0QA 1LF0A 3IP6A 2BFFA 2F00A 1XJWA 3WBFA 1FS6A 1VQ1A 3HY6A 3LC7O 1Z2NX 3N2GA 2QTLA 3M5WA 4JLSA 4TWIA 4QSMA 3OD5A 5AHRA 4DC9A 2I67A 3KTAB 4JZYA 1K88A 1KOFA 2FFAA 5EIAA 3RGWS 1E62A 4URFA 2QPTA 2DBZA 3CW8X 4DDUA 2Q4BA 1MAHA 1Y3FE 3P4UA 5T64A 3TDKA 3MMPA 4B33A 2R5FA 7MHTA 3ZY3A 3EQZA 4XCVA 1I51A 2KX7A 1BFKA 2I62A 3GOHA 4JI2B 4F8EA 3JQEA 4ONEA 5IUNC 1E1NA 3GF4A 3KKMA 4RPLA 1NW6A 4YP0A 4FE4A 2UUCB 1Z37A 4O4JF 3A14A 3REFA 4JA2A 4H16A 1AK2A 4JI3B 5CGQB 1W0KA 3GUHA 5E4JA 4B6JA 1JWBB 2XRYA 1ULAA 4HNQA 2BSQA 1QCZA 1OH7A 2OGTA 4BBJA 2XNJA 1RZRD 5IFKA 3C3JA 3OKPA 1XKQA 5L7YA 2G8NA 1N0HA 1UODA 4ZAXA 1B3BA 3EZYA 1XFAA 5DX1A 3OO1A 3A9RA 2RBEA 2WJIA 2ORED 3BWXA 3JQFA 4I81A 1OAOC 2DQ4A 5LD2B 1FMFA 2G71A 4B2YA 3C14C 1NBMD 3A37A 4FIDA 4XJXA 3TFOA 2HMUA 5KKCA 1BXGB 4FHEA 5KJCA 4BPRA 3ZI4A 3H75A 3RVLA 4C08A 2EX4A 4QARA 5A4MS 3REQB 3DPSA 5CFNA 3CRNA 2PKQP 3ZQUA 4H3SA 2XKAA 5LP6B 2PGIA 1XQWA 2WF9A 1ZNYA 4ATNA 4N3CA 4KR3A 5DW3A 3OAAA 1QU3A 5KYKA 1ITZA 3ZDZB 2QZPA 3VC1A 2PL9A 1FF9A 1M2HA 3IEPA 1A8SA 4L8FA 2MT9A 2XF8A 1AO3A 4OHKA 4U7FA 1NYTA 4UHDA 4XLZA 1OU0A 4LCEA 4S04A 4RE5A 2VBFA 2JAOA 3MBKA 1WW3A 3N0TA 3HU2A 4KXNA 4R9VA 5CP8A 5SICE 2VH1A 3F1KA 5IHXA 3PX2A 3UENA 3NBQA 4WNAA 2F90A 3VA7A 3BX1A 2H4WA 5KZMB 4I5IA 5KSYA 4G1UC 2B1QA 2MSDB 4KR2A 2DWUA 3B7WA 3H16A 3C4VA 1B0ZA 2WILA 1OZFA 5F73A 3S44A 4J0GA 2ATXA 1OLXB 3B1YA 2KW5A 4IMRA 4XDZA 1GAQA 1CD5A 5JFGA 2O2SA 3TCXB 2WFMA 1GV1A 2FK8A 3FUVA 5BN1A 4ALMA 3T3PB 1HDEA 5ALEA 3I5UA 2X5XA 4BV2A 1YB6A 4U2EA 5AI4A 4P3XA 2C54A 1UXKA 1E0SA 5DI9A 1NDUA 1O9BA 1RYDA 4TTJA 3AVWA 1GIAA 2Q7XA 1UKAA 2CXOA 1YI8A 3DT9A 1MG5A 1SZCA 3DMGA 2QTBA 5KVAA 2R6R1 4FI3C 2H8KA 2GASA 1X3SA 2B8JA 1XFDA 2XE8A 1U8YA 3GEDA 1XDZA 4MROA 3C6MA 2ZDQA 3VAAA 4F9TA 4JSRA 1V8DA 2AV6A 5CCDA 2KHZA 3BXFA 3T5MA 1AT1A 1WNTA 3F5DA 3GLIA 4QTYA 5A05A 4R2XA 1OT3A 2OCDA 3PL1A 1G63A 4FFNA 1WBBA 4QYMA 4RK6A 1U7DA 2QVLA 2WVGA 1P4HA 3EVCA 1IEXA 2PGDA 1PQYA 1C8KA 3KR1A 3LC2O 5HMMA 1ZVJA 4IWYA 4DQXA 3RUHA 2GX6A 1J20A 4BB5A 1XD9A 3AHJA 2TMYA 4H7FA 2EW8A 5ES4B 5HGXA 1NRWA 2OECA 4S1VA 1MR3F 1YL6A 2P79A 2BMAA 4LHVA 4C20A 2BL4A 2PUTA 1BMFD 3B89A 3JQ7A 2FFJA 3MF4A 3SQMA 5BUSA 4J0DA 3I61A 1HC7A 1IEWA 1E3SA 4NFLA 3R8FA 1E1QA 2FA9A 1YRHA 3LCUA 3G88A 1KZ6A 1R3DA 4IIDA 2AW3A 2FEAA 4AD8A 1TO1E 1LK7A 3DVLA 4EWLA 5DLEA 2E2WA 3RSOA 3NWOA 2C29D 4TUYF 4ZO9A 3FPHA 1N8KA 3NGMA 1GTL1 2QNIA 3T7CA 3WJ2A 4WZBE 4BB0A 1Z2EA 2EEZA 3HKEB 4NBNA 4ZOBA 3SE0A 5JS6A 1QP0A 2WUFA 3T06B 3HO8A 1FSPA 3FSJX 4X97A 1VFPA 4UHEA 1UOPA 3IO5A 1OU4A 4YAEA 3RPEA 5FLYA 1SC4A 4D9EA 1YA4A 3C3KA 4RABA 3AR2A 3U4GA 2Q4OA 1II8A 1RAGA 1SUEA 1K6EA 2FG6C 1NR1A 4BKRA 1TKRA 3K96A 5ESWA 3PPXA 4LJ5A 4B43A 1DQNA 1HG0A 2Z3ZA 3D8SA 1FZQA 4D25A 1KR2A 4RL4A 1O6ZA 2BY4A 4HQNA 4MQMA 4P5EA 4XKJA 1F2VA 3BWBA 4R1OA 3WLAA 2O7RA 1P80A 2QRHA 3G2JA 2Y0EA 4JJGA 3BL5A 2OZLB 1NURA 4N5IX 2PKXA 4X3PA 5A06A 2BPOA 1AE1A 1AK1A 4JHLA 2FP4A 2I66A 3BORA 2EKQA 3R76A 3UN1A 3VPFA 4C2BA 2FUG6 1WP9A 1X80A 1T4DA 3D02A 2NSHA 3CUEF 4GBMA 4GX0A 4EVIA 1T5TA 4KRYA 1F5SA 3ZBTA 3O38A 1BJRE 3N2ZB 1OTXA 5JXHA 3ETHA 4PIVA 1C7ZA 1KVTA 2GD0A 4ENVA 4L3WA 4E94A 2JIRA 4NFYA 1SUFA 4XSVA 4GM4A 4UM7A 2DB3A 2AC2A 2W48A 3BDVA 3NBKA 4IHQA 3LHKA 2IODA 4N5LA 5FO1A 2JAUA 5A9SB 4NS4A 4PQFA 3GPLA 1W6RA 4RLSA 2Y0PA 4DWWA 2YXBA 3MJHA 4OQDA 1DBIA 2J7KA 3M81A 4JR1A 5DJ5A 3A4LA 4UDNA 3F8TA 3UWKA 4DJJA 1TW2A 2FWPA 4PTYA 1KETA 1QRDA 3VU9B 3VR3A 1Z4KA 1CP3A 1VG8A 3A1TA 3FRIA 4PY2A 3LY8A 4C1NA 4TOIA 3LUBA 4N0PA 2NYRA 3Q5EA 4D6PA 4IUBS 1SEVA 3NASA 4KV7A 2HSEA 2PRKA 2IUUA 4LJLA 5A3RA 1N8TA 1I5RA 3M6XA 4BMVA 5TSDA 4P3YA 1J1UA 3OU7A 3T3EA 1VJCA 2YOGA 1TUGA 2C4NA 4RO0A 4URWR 2WTAA 1O1YA 1J6UA 3FCYA 5AW5A 3OQHA 3CLUC 1Q95A 2YVUA 4MQBA 2ZYVX 3SLKA 1OX4A 1U8FO 4ZCRA 5LDDC 4F5WA 3COZA 4MGZR 4EMSA 2CV1A 1H4VB 3JPWA 4I6EA 4LXQA 4PHGA 4YCAA 3TTYA 1G18A 1VMDA 4X71A 1TUIA 4U0KA 4XQ0A 1RPJA 2AXQA 2RB5A 3AKCA 5IS2A 3RADC 1SVUA 4BCBA 3ADBA 1B8VA 3C3YA 3KR0A 4OPMA 3UKOA 1EJ2A 2H1IA 3V32A 2EL9A 1NA5A 2PMBA 3V7NA 4RF4A 4L4SA 4FXOA 1W88A 1RAEA 2B8EA 3DBLB 3V4LA 3ND5A 3N2KA 4IDCA 2BFMA 4FMPA 3DMFA 1J8FA 1SBTA 1TVCA 2YINC 3Q3CA 1J97A 4I1OA 4II2A 4EP1A 1M33A 2ZRKA 3NNSA 5E3IA 1B74A 1X7XB 3WLHA 1EM6A 4LZZA 4MMXB 4EUHA 1CY0A 4QFDA 3M3DA 3NGXA 2C00A 4FOLA 4KPUA 5CJPA 4V24A 5H9VA 4BJ6A 2QL7A 1SNYA 1M0SA 1E1RA 3VNBA 3OIYA 3RJZA 4DV2B 5DMXA 2PHZA 5KQSA 2Y1DA 1Z34A 1JSLA 3PBKA 3UHPA 4C07A 4F6CA 1A9RA 2GF2A 1MQSA 2YYYA 1R10A 1YRQA 2C2WA 3RYTC 2PUFA 3G9UA 4Z0TA 3R7LA 4RADA 4AQDA 4MI6A 2V55B 4EB6B 4MKRA 2B7LA 4G81A 2UZ1B 3F5SA 4G4SO 1EZ1A 3MOSA 2VHUA 1RJ9B 4E4YA 5TLSA 4PVDA 3CUKA 2MYNA 2PMKA 3BC1A 3KZ1E 4J90A 4OUKX 4PS0A 3KT0A 4XUGB 3KYCB 3RFUA 3SYTA 4J7UA 3WQSB 2N47A 1HY3A 2ZREA 4B6PA 3R0IA 2PMFA 4ZT2A 5GAJA 3STHA 2SKCA 3ROGA 3ANTA 4LHSA 3KZVA 1S01A 1VLVA 4DRZA 5C1BA 1ANKA 1J24A 2VPPA 3JQGB 4NBUA 4I4LA 3SIRA 1LTQA 1ISHA 2PTGA 2PY6A 4NY1A 4DNQA 4KQWA 4QXAA 1A8UA 2C9YA 3AUUA 3LQ4A 2I1WA 2YWJA 4LKOA 1QH9A 4K9SA 4K9RA 2EJVA 5D3ZA 4UAJA 3W5BA 3HMKA 2BM0A 2IXDA 5T6MA 1UBEA 4X8MA 4EF4A 4ARAA 4DG8A 4F5YA 4KMSA 1E63A 4HDAA 1A71A 1JHOA 3CO5A 2JFFA 4EZEA 3USCS 1K7XB 2IE8A 2GA9A 2H51A 2HHCA 3EXHB 2AHRA 2OCLA 3KQYA 3RUPA 3T9FA 3D1LA 3ZE2B 1EUYA 1NLZA 1XO1A 1DQSA 2RCYA 3RNLA 2WYOA 3RASA 3M6MD 2HCRA 3UYKA 4O4HA 1WZIA 2AMJA 4JJIA 4YJ2F 2Q0HA 1EZ4A 2BHTA 3FXAA 2FEKA 3EGXB 4IQFA 5B7PA 4E1AA 4KNYA 1CW2B 1PSZA 1FFCA 2J6HA 1JNXX 2R8YA 3A25A 3PRKE 1BXRA 1PFKA 3E3NA 3FMFA 1DHRA 4GM0A 4NBSA 4OY3A 5AK0A 1EE9A 5FOUA 2QD5A 2R7LA 2VTEA 4BB6A 1Y1TA 4Z1OA 3PEWA 1G2PA 3CVOA 4KW7A 1ACMA 3I45A 1J0BA 3RSCA 1R0YA 5DWVA 4HLUA 3RS0A 4XPIB 1WLYA 4NU5A 2XLBA 4WV3A 3OZ7A 3I42A 5GM2A 2R0QC 3O2QB 4QDOA 1OWOA 4KOEC 1BMFA 4S2UA 3HUFA 2CNBA 3QMWA 3DYVA 3AINA 1O0SA 2LDBA 2B8NA 2OHFA 4HEA1 4U2BA 4LOLA 2OENG 3LUFA 4IO1A 4XGRA 2IXBA 2PLWA 2PSSA 1R0LA 5HP4A 1T3TA 3BK1A 4V38A 2GBFA 3EA5A 2YBDA 4LBYA 2VT2A 2EJCA 3ORYA 4RJ2A 2QGZA 4DA4A 4L8YA 3L7DA 4P08A 4Q5IA 4S05A 2GVDC 4HB3A 2G4VA 2J6CA 1WAMA 4HAVA 1F0PA 1KO5A 1YBMA 1VZ3A 3A4VA 3O3OB 5IJXA 4FM9A 4MI9A 2LCQA 4YI3A 4RFVA 4OREX 3T3HA 3MUOA 1Z0AA 4H35A 5E7QA 5K6AA 4LF9B 1SBNE 3A0UA 2HBYA 4B7ZA 1QVRA 4NR0A 1I5OA 1BCSB 4C7BA 4E2XA 4F5DA 3TOZA 3EMKA 4D8WA 3THYA 4LNUA 1U9CA 4BQNA 3MB5A 3OJXA 3QIVA 2GPJA 2RSLA 1H2BA 3IVCA 1CQIA 3DEHA 3NP9A 5GIPE 3HXOA 5DASA 2W98A 1ZIOA 4ADSG 2WVAA 4TPKA 1EGQA 2A35A 2GK3A 5B7GA 1S8OA 2Y66A 4XUDA 4QBHA 3L2OB 3TKLA 1UC4B 5CHYA 3V1KA 3X43A 4X7BA 5L4LA 3T1YB 4FI3F 1E2HA 3NTOA 1CUGA 4RFSB 1UXGA 3THRA 3PGXA 4FSDA 3FWHA 1ZVQA 3TD6A 3OJFA 5BPHA 3FRHA 5H9WA 2R00C 4M22A 3NXSA 2O0JA 4X65B 1BE1A 3SYKA 1XTQA 2ZTUA 1UANA 2QQ0A 4OX9Y 2ODQA 3HCPA 1HDCA 4FT4A 1J5XA 3ZYCA 4BFYA 1AB6A 4B3TB 1UK9A 4UARA 4KPEC 3OTOB 4ENQA 4S1TA 1N3YA 5DBFA 2B2XA 2O2JA 2P5TB 4C4AA 2CB9A 4URXR 1YU9A 4UATA 1RYMA 2HK6A 4EYSA 4KN9S 2PANA 3TFQA 1P1CA 5I4KA 2X0FA 5CFQA 1GDDA 1ODJA 3I4LA 5C5DA 3T1TA 3GLFB 4W7SA 2YIVX 1JEDA 3M1AA 3B1WA 2D1TA 4KRGA 4JL8A 4DYDA 3D4NA 4EZIA 4RPIA 1Y3CE 3VYRB 1ZUIA 3WP1B 4ZGGA 3NCHA 5JOQA 4FONA 5HZGA 2CSXA 3BSYA 3B8HA 4WY8A 2XGGA 2GD2A 5FUQA 5IMBA 3UA3A 5DNVA 3SX0A 2CBXA 3HNOA 5KHLB 2D0PB 2XOKA 3N2EA 3OJCA 3AP2A 2VR1A 2C3MA 2OZKA 3GFFA 3PRHA 4P34A 5I4BA 3O73A 5F3WB 3F6PA 4G85A 2ZUEA 3JQFC 2XMGA 4DA6A 1SC9A 1ZGCA 2O48X 3FGZA 1DCTA 4E2FA 4ZZIA 1LRLA 4ZOQI 2GZSA 4N47A 4CKXA 2X8LA 3AKZA 4DCOA 4EVQA 3T8YA 1GNPA 1VIDA 2UZ0A 2FQXA 3PTAA 3SMVA 1GR1A 4QG3A 1NM5C 1U8EA 2A0UA 1PQWA 3OOSA 4EPWA 5I51A 1E61A 3RHTA 3IP5A 3AF6A 1W35A 2GWHA 1EXWA 2D0OB 2VPZA 3JY6A 1QC5B 1IVYA 5M34A 5BWMA 3ZLUA 2JLVA 1W0KD 3T3DA 1CE8A 3MIIA 4J1TC 3BBLA 1VYTA 2N42A 3LQYA 4A1FA 2GTIA 5IVHA 3IIMA 2ZI5A 4UFPA 3H9BA 4MTCA 4A6EA 1BOOA 1GPAA 1EBUA 4CTMA 3H17A 1VP3A 2PSDA 1BE8A 2B82A 1V26A 5K3OA 1CS0A 3D1VA 4QOFA 2GESA 1PT9A 4GPD1 3GQVA 3NU1A 2QLLA 1XTBA 2GS9A 4MRVA 1NW3A 1Z0DA 2QMEA 2AG5A 2D3WA 1DKPA 2XBLA 2ZQ5A 1T5DX 1IZZA 3LPCA 3NALA 4OXXA 3WL8A 5AVQA 4MR8B 5BNZA 1GTMA 1YJ8A 4G0QA 3R0VA 3TD9A 4EHNA 2LPMA 1PYGA 1YIDA 1KWKA 3O8RA 4CYMA 1NBEA 4DQUA 4ZOAA 2UUOA 2ENUA 3AI3A 4QG7A 1OZAA 2OK7A 5EZ5A 3ROKA 4ER7A 1SVLA 2NXEA 2Z4TA 2ZEJA 3HYTA 3KLNA 3GEHA 1CEEA 1I1QB 2Y76A 1HT3A 1NE2A 1ZZGA 4H1HA 2BGTA 5EUMA 5C1OA 5L8VA 1G8AA 3OJEA 1XVIA 3G5UA 2RHJA 4XOIA 5HILA 1X9GA 2G5PA 3RYHB 1TD1A 3Q9LA 1NUUA 4ZRMA 3ZE7A 3A7DA 5BR4A 1NUQA 1ORDA 2Y9PB 4C04A 2VJBA 2JANA 2J3EA 3IDAA 5IJAA 3MS2A 5AVZA 3EVGA 3JQAA 5KIAA 1LQUA 5DW0A 2AEEA 2MINA 2QN7A 2R8RA 3DMYA 4MKHA 4RETA 4B3IA 3ETJA 3EUFA 3QEMB 3UG7A 1NXXA 3NM5A 4MR9A 4PYOA 4ZQEA 4F97A 5BQFA 1QO0A 2IYZA 5KREA 1M2VA 2AX4A 4O02B 4JKIA 1KH3A 3KZNA 3A2NA 5KVQA 3PG5A 3GVIA 1GGMA 1UBGA 3EIOA 2CLEB 6GPBA 4W5TA 4WXYB 4OB7A 1QKIA 3LGXA 3TL3A 3PC6A 1G8PA 1XA4A 3CLTD 3DKIA 3V4OA 4DKXA 1XC7A 1C41A 2NTJA 3HXTA 5A7GA 5G0TA 1D2CA 9ATCA 1M72A 1U4OA 4BP3A 1DBPA 3MWDB 2Q6LA 4IDOA 3FDZB 4C0KA 2K2WA 3VMMA 1G5TA 3FF4A 3HDQA 1U2QA 4KXWA 4KG7A 1T3GA 2XUZA 1GKIA 2JFWA 2RGWA 1QIFA 2WZCA 4OB6A 3RT9A 2A5JA 2J67A 4EFNA 5AM5A 2TYSB 1YRAA 4TX1A 1D0VA 5FIUA 1NJFA 2JGIA 3KXDA 1QP4A 1VJRA 4ZCQA 3UHJA 1RM4A 5LZ7A 3EOAI 5I5GA 1W88B 2I87A 4N6OA 5KNDD 1PS0A 1IZ9A 3IR6A 4QDKA 3VKUA 4XTCS 2J3DA 4RLFA 4D43A 1AZLA 1SCQA 2DJIA 4V39A 3PNQA 3GVHA 1XA3A 1PK9A 4NCIA 4IZIA 2I6SA 4K9PA 1XD2B 4UU7A 3Q0EA 2W8BB 2GPAA 3CBGA 2FN7A 2MYPA 4PIPA 5AW3A 4CEHB 1SVKA 4XVHA 5EUCA 3BWEA 4MH0R 3TEMA 2Z3WA 4YDSA 1OBOA 1JBQA 1RMTA 1U9IA 1KXJA 1Y6ZA 2ZIUB 3NBFA 4OAOA 4UM8B 4E6PA 1NP6A 1QKKA 3PQ2A 3USES 1AGXA 3K0FA 2C2MA 2F17A 1CIVA 2XB9A 3FUTA 4FGSA 4JJAA 4G5XA 3GNSA 2PQ2A 4HQOA 2PLFA 3R2JA 2X4DA 4WN3A 3ONNA 4OHUA 1PSWA 2EDCA 1LK0A 2PDAA 3CUUA 4B5KA 4DJDC 1YULA 4ZHQB 5JZMA 3S40A 1JJ7A 3IQFA 5JMPA 4DCPA 4HOYA 3WKAA 2GD6A 4OHXA 5DI3B 1GU0A 2H54A 4CLRA 1FFSA 1EIWA 2BEJA 4REOA 5CDSA 3AILA 4OQPA 2XGOA 5KUTA 2PX0A 1MX1A 3EX7C 1WBDA 1W4ZA 4PFQA 1AUVA 1SIOA 4JI4B 1GD1O 2FSFA 4WL0A 2IVFA 1FNDA 5JRZA 2QIPA 4NBTA 1A3CA 5HQTA 2XDQA 4CNBA 4RTSA 3AL2A 5KHAA 3T52A 4Q9HA 4XVUA 2IVZA 4WLOA 4U6NA 1CY7A 1A50B 2XTJA 3F49S 1MXHA 2FU5C 4LC1A 4UQOA 4R3NA 1VMAA 3L8YA 2R44A 3UOGA 4XWYA 1PGPA 4QREA 1WUYA 1LK5A 2I22A 1Z2OX 5LA6F 3KZXA 2D62A 3QLUC 1P6XA 2N1MA 1UDXA 2ZB4A 3A4NA 4D0GA 3CB4A 3S27A 2B3DA 3H1BA 1MOZA 2ORVA 4GS5A 4MUKA 4Q01A 2O3TA 4HDKA 5KNLA 4B34A 2VDLB 4KIJA 4GZMA 1SY7A 2XSZD 1BIFA 3M3HA 3WBKA 4F1WA 1RJDA 1SZDA 1CJUC 4V1CI 3U4QB 2GRJA 2WVJA 1P1RA 4CDNA 4F2HA 1QYCA 1V1MA 5BXQC 2A1TR 3KUUA 1WZCA 1WV0A 3HZOA 1KERA 3OKCA 3OLQA 3VR0A 3NVMB 1WXXA 3EEFA 3LDGA 2CUTA 5DYIA 2PZJA 2FRDC 2PZBA 3B6KA 2WFLB 4J6FA 1OXKB 4UE3S 3RSSA 5IYZB 3LPDA 5HDBB 3S7TA 2LTAA 2Z1NA 2CLOB 1Q11A 4D1YA 3GYGA 3PGMA 4NMXB 2QB5A 3UAOA 2ODTX 1CRWG 1IFXA 1YZFA 3AH8A 2HH9A 2PLRA 3CVUA 2IEBA 1RM5A 3NV9A 5EWJB 2DUMA 1FP2A 2XRFA 4QFMA 3VTKA 2ZCVA 4N49A 3PR1A 3T4EA 4E13A 1U0BB 2DLDA 1Z18A 4R2IA 3B48A 5CLLA 4Z0HO 5LQSA 4XI9A 1OC4A 2P9CA 2Q9UA 2ZWOA 3PNYA 4NZ9A 4UZFA 5AVYA 2IWRA 5LP1A 5DOZA 4Q18A 2AW5A 5I9BA 2BP7A 4KP7A 2HPVA 3Q3IA 3NP7A 4HNSA 2BJVA 4JBIA 3RVQA 3SS7X 2GMWA 1RI4A 4DTCA 1PLLA 2W00A 3QYPA 1HLPA 3MRXA 2G08A 1W5AA 2ZJ4A 3IOCA 2V0GA 3EEQA 3C7CB 3I62A 1MB4A 2QG9A 3BMQB 4LY0A 1QV7A 2JEOA 3IT3A 2VQ6A 2NVUA 4LOIA 1SBHA 5CB4A 3ETDA 5K01A 4RTNA 1Z74A 3QX8A 2HX1A 3KJZA 2GAOA 4DAEA 5ERGB 4L73A 2Q45A 3Q9NA 3IAM6 1PI3A 5G40A 2FUNB 1LI5A 5LLDA 3PV0A 3NVDA 5AMXA 3PDWA 2UZIR 2F7SA 2VTBB 3A26A 1WXHA 3CE9A 3DJFA 1PEYA 3R20A 4QUEA 1QU2A 1YA8A 3TSWA 3MMXA 1EAYA 2O2ZA 4RGQA 3BOSA 4G9BA 2ZUFA 3CPSA 3GARA 4WK2B 2VZEA 4B2IA 2B98A 3PNVA 2XGMA 3PXXA 1I7QB 4ZYUA 1CQXA 3UVEA 1OF1A 2XB8A 4JNKA 3EBLA 1HSOA 2YV4A 2ZRIA 3IEVA 1YBVA 4E22A 4O33A 5CITA 4GZLA 1YMVA 2MOKA 1CJTC 1E3LA 1U02A 1S8NA 4MITA 4IX9A 2IDJA 3DF7A 5DYYA 1HDZA 2WP8J 3GFVA 5EZYA 2WW8A 1TMOA 3GAZA 5K6AC 2OLJA 1EVEA 3B1FA 3RYHA 1X13A 3DTYA 1DXYA 2WHXA 2JFGA 1AMUA 4BLQA 1F1JA 4Q4LA 4XUEA 1NLFA 4XYEA 4TZ6A 3MN1A 1VBNA 4JEIA 1ESCA 1TCAA 5DGHA 3CKLA 5I3ZA 4RU1A 1U1CA 4WNCA 2ZUTA 5K0CA 4MUBA 5AKIA 1N1DA 4A15A 1J8VA 1GUAA 1TF7A 2E6UX 2ZRGA 3AVVA 2FJ0A 1FXUA 2KE5A 3BA6A 4I19A 4DC0A 5JJKA 1XZMA 2GR9A 4XWAA 5I7OA 1XJQA 2ZYIA 2OE2A 4RH3A 3V48A 3P0EA 2VTBA 4IFBA 1T1EA 4TQ9A 2XODA 4LI0A 3RTBA 4YRMA 2P2ZA 1PZXA 1WOYA 3H6HA 4CF6A 1G41A 1YQUA 4EG5A 4UTZA 2UZ4A 3THWB 3MPOA 3VVMA 1PV4A 1MBZA 2B36A 4KYVA 3ZQJA 1L8LA 1MVOA 3QBTA 2PRIA 4FKBA 4RH1A 3HB4X 4ZEXA 1KI6B 4GECA 1VM6A 3UJ8A 1IWOA 3VGJA 1IM2A 4GL2A 4R1SA 1TQHA 1UBNA 1Y6JA 3CRQA 3PUXA 1JFRA 2X76A 3Q85A 5K3CA 3RC3A 4YA6A 1EUCB 3PEEA 3WL6A 2AB0A 1FY2A 3HYNA 4H0NA 2GZMA 3W4JA 3EC1A 2VYVA 2FLKA 1EFRD 2QUAA 1BNCA 3AETA 4XWKA 2ILTA 3OHPA 1VZ2A 3OI7A 5FUWA 2OBBA 4KLZA 5CFLA 5CDHA 1W59A 4D26A 1BVYF 1MOQA 2W5UA 3KFXA 5F2OA 3HJGA 2O2IA 4BO5A 3N7TA 2QLBA 2FE4A 2ZR7A 4L5IA 4QFCA 4RK0A 4RZQA 3U44A 4HWPA 2VUSA 2ZRAA 2EQAA 3GLGE 1EH5A 4MAFA 1SC6A 1FTSA 1MIHA 3JYOA 4A5SA 1YS2X 1PR3A 1YV9A 2HXSA 5AXAA 4C0SA 4G8JA 3IRVA 4BB9A 1S3IA 1DNPA 3C70A 4PCUA 4BZXA 4NP6A 2QEQA 2HMWA 2XUOA 5CH3A 4KQ6A 1UWCA 1NWCA 1WE2A 1E9VA 3BTVA 4H7DA 3MXTA 2VK1A 3ZDRA 1GQOA 4RV4A 5JRDS 3GLGA 2XCOA 3HO6A 4LV8B 3W78A 2ODAA 1ENPA 4BVLA 1M0WA 3HA7A 4FUTA 4B17A 1P1IA 1SBQA 2E5FA 1OXVA 4OVKA 1I30A 5IJ9A 1DCFA 5G2OA 1JLHA 3VZCA 4JL5A 1ISIA 1UDCA 1QBKC 3LKBA 4R8RA 5D5HA 3M4JA 4V0KA 3W5AA 1NZJA 2YX1A 3DVAA 1J9GA 4WINA 1KDVA 5CXQA 3P9YA 3I01M 5K8VA 3F6SA 5FH9A 1JKJA 2B78A 2J9FA 5REQB 3SBXA 2FEWB 1E64A 3T9EA 2JI9A 1ZNWA 4LXIA 3QTLA 2EV9A 4KFRA 1RBZA 3A3PA 4AIRA 5ELMA 1GQRA 1UL1X 4XIYA 2ONYA 1U0FA 4KDEA 2M6KA 1JF8A 3HJBA 1Z26A 5AO9A 1BE0A 1GZSA 1XHFA 3M83A 3W4IA 3AHFA 1H5QA 4LSGA 4H1TA 3FCEA 4UBOA 4UBNA 1OLOA 3MAAC 1I6LA 2G9UA 5FEMA 1BFUA 4YWHA 2KSQA 3H3FA 4DLTA 4YUYA 1ZY2A 2SKDA 2VPXA 1ARZA 2W0SA 1RQGA 1JHVA 1VRWA 4M60A 3DFIA 3W9YA 1JXMA 4ZZ3A 1NU6A 1USKA 2W93A 2BFAA 3AK4A 3I83A 4UBJA 3I5YA 4EQ6A 1CX9B 1EUDB 2D6FA 4ENPA 1GSAA 5JVDF 5HHTA 2QTHA 2JAHA 2X4IA 3PHLA 1R6BX 3EXIA 3E1KA 1L4EA 1QIGA 3L7OA 1PE0A 3TPCA 2W6PA 2MSLA 1NNLA 3A6LA 1Z25A 3TSCA 3UNXA 4IH9A 1O03A 3IAFA 4E51A 4GP7A 2RAUA 3SZ3A 5BT9A 2D7JA 1EGMB 3TJRA 5LQDA 4YCJA 2BIFA 2OK8A 2WWIA 2GHTA 2ZPTX 4M89A 4UC0A 1CZHA 4HNUA 1QTIA 5KYYA 1Y8ZA 3OZEA 1CDZA 1EM8A 4D8TA 2NAFA 3WQBA 3ZU3A 3W1EA 4ZREA 4AMUA 3ABSB 2YXLA 2V4ZA 3TZEA 2L18A 1R0WA 2F59A 1ODFA 1OAAA 3ZDYB 4P58A 1GNTA 1T9GR 2QWXA 1L5NA 4LOJA 3KKNA 1M34E 2IH2A 1N1GA 3K1JA 5IAEA 4CTOA 4WA7A 4G0PA 5H4GA 5A7FA 1T1IA 3QF4A 3EPLA 1N5OX 4RCYA 4A8TA 1X94A 3M6LA 3ESRA 4HRXA 2SECE 4L8VA 1C1XB 2FPIB 2V5AA 3DLHA 1G42A 1L1RA 3IOYA 4K5QA 1E2KA 4C4TA 4QODA 3TQRA 1OAOA 3G6WA 1OMOA 1IBLB 2HWKA 4BUJA 5EKSA 4HUQA 1H1LB 3K8OE 3Q7PA 2V0CA 4MGIR 4Y6SA 3ROFA 3LX5A 4KAXA 5I8PA 3K71B 3SYNA 3RIEA 1BWRA 1WPGA 1A7KA 2W42A 3LUAA 3ABRB 3AZOA 2WHQA 3CZMA 2H4HA 1P60A 4H4EA 4I50A 1E3WA 1VSTA 4ND8A 2PKEA 1GA6A 1DWOA 1M8PA 1Z7WA 3FVWA 1Q0RA 2P0AA 3HUDA 2CNOA 4TTTS 3SXJA 5JH7F 1EP3B 1N4DA 1T8RA 1ZJ5A 1OH6A 2O7NA 4EOGA 2J9GA 1B43A 1R37A 2GPWA 3O8QB 4NESA 5FFMA 2VQSA 4DB2A 1BKYA 4D02A 5HJEA 1NTRA 4FEYA 1TQ6A 1JN0A 3OQ6A 1HX7A 3A8TA 4GQIA 3OQNA 1EUQA 1MNQA 2DR3A 1YHZA 2VQFB 1DZIA 2IX9A 3HWSA 4B9AA 1Q22A 1F6DA 1ZC4A 1R9JA 3PT9A 2AG1A 2WZDA 2HA2A 1INLA 2GZ2A 2QTVA 4DV7B 5F23A 4QJ3A 3FDXA 2GEUA 2ZJ2A 1AKYA 4GRDA 2B37A 1V1RA 4ARIA 1YFJA 2Z5LA 2JCXA 3H8JA 3KVOA 5AT1A 4JLMA 5KHOC 3EVDA 1PT5A 3RH0A 5B2ZA 3UOAB 3AFOA 4A6PA 1X8LA 2B35A 2W4MA 5I7UA 4CEIB 1D8AA 1KFCB 5DYTA 2X0EA 3TSOA 3GRFA 3MPUA 3ODGA 3YASA 1PK8A 1Z15A 2Q5JA 3I9V1 3HP7A 4OBXA 5LZ2A 1V0JA 1XQYA 4YRQA 1PJQA 4BLRA 3WLFA 2Q99A 1SU4A 1VIYA 1CJVC 3AWIA 4KH0A 4XWOA 1I14A 3DXYA 3NVKI 3E2PA 1XNGA 2W43A 3L7MA 1ZJYA 4M7WA 4RSMA 3PDCA 4DIMA 2AHOA 2C5EA 2PUWA 1N6LA 1O77A 2A0XA 2DFNA 3EA4A 3FOWA 4KPFC 2I2CA 5A1TA 5JBQA 4GSLA 1JHRA 3KQUA 2FOIA 4MLDA 1YB4A 2XT9A 4B71A 1US8B 3AIMA 2H9YA 2YDYA 1BH2A 3FHLA 3I2JA 2ECOA 2VHCA 5LOVA 3HYLA 1LSJA 1FP6A 2OCBA 5EJ8A 4YQFA 4JUDX 4HH1A 1LB1B 1W581 3B1XA 4BNVA 4IGAA 2HMYB 3KHKA 4NOLA 1E1CB 1BJKA 1S7GA 3BCSA 1RXEA 3QA3E 4IZHA 1Z0KA 4HY3A 4NHOA 1VJ5A 1M1XB 3OZUA 4FOOA 5FYQA 1XMSA 1DXHA 2QORA 2V3WA 5TB5A 4DMUB 3RK1A 1O57A 2ZVQX 2WM3A 2DT5A 3C3CA 4TLMB 2V74B 4C03A 2WKPA 3LQ1A 4ZT5A 3ZWBA 2BGIA 3GGGA 4BP1A 2J30A 1S4MA 1P5HA 2YYAA 3KLOA 3L0SA 1P81A 1XRPA 3CZ9A 3NB0A 4FJ2A 4H3KB 4ZP1A 3VDQA 2BM1A 1OLSA 3VX3A 4EO4A 1NNEA 1ESMA 2AN5A 4QUHA 3E9RA 1T8TA 3CJRA 2IV3A 2EKLA 3DBRB 4O5OA 1MQ9A 2QT1A 4ZKEA 4BLWA 4W1SA 1MO4A 4P38A 4L5CA 2IZOA 4HQ0A 4HYEA 3OAAD 3B9BA 4MQ4A 5EJEA 3CH4B 3AL3A 4PPYA 4C3UA 3QVOA 4JJ4A 3RAPR 2Z9CA 3PKJA 2WAAA 1YAJA 2IY7A 2PS9A 3U0VA 4DG9A 1ZIXA 2RH9B 5C5IA 1UP4A 5CBPA 2IYSA 3D7MA 2FSVA 1ZLXA 1QFJA 4LXXA 5CLGA 4DCMA 5G0WA 2NX2A 3BH6A 2WT9A 4CIVA 4BTEA 1UJ6A 3FIUA 1UC5B 4HWKA 4NQRA 4WBNA 8ADHA 4GRAA 5TJHA 1TB4A 2OT3B 3TBFA 4CKBA 2I6GA 1U9YA 2PQMA 5LXTA 4EMUA 5BYKA 1M6EX 4HBGA 1U3TA 5E9WA 5THXA 1VKZA 3K1AA 4IW3B 2FZWA 3MWEB 1NT2A 1H9BA 1ZA1A 4JI1B 4RSGA 2RGNC 4QM6A 1MRSA 4HXGA 1ELOA 3AUYA 4I2VA 5FUYA 3RK0A 4E5DA 2RKBA 3BMNA 3T95A 4TYNA 3CF6R 3QHPA 1UJ2A 5KOJA 1VSQA 5LB4A 1Z3IX 5JO0A 1Q3HA 2FPGA 2GT1A 2QTAA 5FL7A 1CSEE 2PSHA 2VBCA 4H3VA 2CMHA 3UWMA 4F7DA 3OCJA 5JD3A 3DVQX 3V7FA 3C3BA 3LK6A 4L0QA 4JVSB 4PM4A 7ADHA 1NVXQ 4LECA 4KE7A 3ZNPA 2PL1A 4MLZA 5AM0A 3WYFA 2ZJOA 2NU6A 3GLHE 2AC7A 5IDQA 3LGSA 2FSHA 1Z0FA 5F4ZA 1QQ5A 3FYUC 2VUIB 1FSZA 2KWIA 2IUSA 3EIEA 2XEDA 1JALA 1AK9A 1QZZA 2FMFA 2C3UA 1DAOA 2AOXA 5UKDA 5HRAA 5TX7A 4MJ3A 3KSBC 3GGJA 2XNSA 5AXCA 3TZBA 1R4MA 2IXEA 1TC2A 2H08A 2Q8NA 1W2WB 5BRNA 4EX7A 3NI2A 4NH4A 4CKEA 2JRLA 1PJRA 3IBCA 1GWNA 4HCJA 4IYRA 4MI1A 1LPSA 1GUBA 2GCNA 4Q16A 5K7SA 2IU0A 2XAUA 3DKVA 4R8LA 2B4QA 2I3GA 4CF5A 2UU9B 2FSIA 5IZCA 2CLLB 3LLSA 3PQDA 1TJ4A 4ZQCB 5C7IO 3TNYA 4CUZA 4HG2A 2AMLA 2QUKA 1RE1A 4UNPA 4EA9A 2XXBA 3RWOA 5AW6A 2JGMA 3T54A 4DCVA 5EXXA 5JNWA 3OESA 3EEYA 3UCXA 2UYOA 4FS8A 4W9NC 3O21A 4O6VA 3T4UA 3I53A 5J47A 1E1CA 2C58A 3FBWA 1N3LA 4QYXA 4KCGA 4Q9JA 1OI7A 1BS9A 4GSYA 1SUAA 4MDFA 4DV4B 2Z95A 3EYWA 3TW6A 1TAHA 3GD5A 4PAGA 4R40A 2QAJA 3U37A 2A30A 3N28A 1KH2A 2UXBB 1FTWA 1KBOA 4PLPA 2WTXA 2DWCA 3ERCA 5DEIA 1LVUA 1R16A 1N2SA 1ULTA 4UVDA 2H1OA 3NHRA 5DH9A 5KVVA 2OQVA 3IUEA 3ZBQA 1NBHA 1JEQA 2WPDA 5ITSA 2QQEA 2ES4A 5E6UA 1DAHA 2QRPA 2VA9A 4O2LA 4Q9IA 2GCIA 5CUQA 4Z2YA 1M5RA 5CM8B 4K3UA 2FCRA 1YVDA 3L6OO 1W93A 3F2IA 1T5LA 1ZOOA 3E03A 3W06A 2II6A 4TLBA 2BDEA 1QZTA 4HS4A 4IM7A 4MJ7A 3IHKA 1KAMA 2VVTA 4N4AA 2PUBA 4GYJA 4MB2A 2J7PA 1HNNA 2B6NA 1FZTA 3TLZA 1GTSA 1CQWA 2EGHA 2HOQA 2HLPA 2LV8A 1UEJA 4YJ3F 3BWMA 1V6AA 4G2TA 2A78A 3PUIA 1LDGA 2PUHA 3AQ4A 1AUPA 1ONBA 1WB6A 3G1WA 3OLWA 5HCNA 1Y5NA 5B30A 5IT5A 1IXYA 4GQBA 1BX3A 4V03A 1LPBB 3G68A 3MERA 1DP4A 4MDHA 4DBVO 3M8KA 4FGZA 1XTSA 4O25A 4J4HA 3FSGA 5BQPA 3N0VA 1H9AA 2NZVG 3SY8A 5A2GA 3KQVA 1XMIA 1MJGM 3CNEA 4IIHA 4BO3A 2WEKA 2NU7B 3IVAA 3AR4A 4QU8A 5TT0A 2W2OA 2GLXA 2HUNA 3M4ZA 3WNBA 1XI2A 5THQA 4ACBA 5MHTA 1YDEA 5DHQA 5GZ6A 3IERA 5ALGA 3LY7A 1MF7A 4HADA 13PKA 3AKDA 3NX4A 4FZ3A 3DOJA 4E15A 4LJSA 3K1YA 1KMCA 2H29A 1SRQA 2W4IA 2FZ5A 2G17A 5KNBA 1G19A 2O0HA 4M3NA 4RK4A 1AS3A 1GAJA 2I91A 1MW8X 4FR2A 4CETA 4GZ6A 2OG2A 4RVUA 5FOXA 3MEQA 5KJEA 4BTVA 3COVA 3WDLA 4GM1A 4ZPXA 3K53A 5AIAA 4D74A 5TXGA 4DCCA 4UPEA 4ZTZB 5K6RA 2MR6A 3N87A 5U9CA 1U2GA 1U2GC 5AXBA 3V7UA 2YXDA 4URHA 3WWZA 4UUAA 1YC2A 4MQ5A 5SZHB 4ZV7A 1T5IA 3EYAA 3TPZA 3KYIB 4YIKA 2FB9A 5JDIA 1KJNA 1T8WA 1U3CA 2IS1A 1C2TA 3AVQA 1RWPA 2WJWA 3VOBA 3DNPA 4B87A 5AR1A 3U48A 4E08A 3ITNA 3IESA 1U90A 2YWBA 4OV6B 5DBGA 1XRLA 1SXJD 2MSKA 4NULA 1FJXA 3VVLA 4I3FA 2Q1XA 2HIHA 3NIFB 4RBNA 5BNFA 4X5OA 5D01A 3TX2A 4BQPA 3EB9A 5LJLA 5C31A 3ZQ6A 3GOQA 3EEBA 2W2VA 1BJTA 2ZUCA 1YOVB 2JJ1D 4PWZA 5ETJA 4AF6A 3WRYA 3TQQA 1DAFA 5CB4F 3UBMA 3P26A 1SKYE 2NTYC 3LRPA 3IH5A 3ZHBA 2E48A 2YWEA 3ZZTA 4E09A 4BGUA 1CEXA 1G8FA 3N74A 3KSDO 3Q0IA 4RFSA 2YY7A 4GD3Q 3UAYA 3BE4A 1NV9A 1AN0A 1A2KC 3SK0A 4G1MB 3KPUA 2YQ4A 3TTXA 4M98A 1KEKA 2DSNA 3BCRA 3QU9A 3RS9A 2ZJZA 3W5IA 3L6UA 4JI6B 1IC6A 2YUTA 3BF7A 1BA2A 5AKYA 3HBMA 2P91A 1NQVA 3R6LA 3T61A 2WTBA 5ALPA 5HRCA 4LDJA 4CT5A 4CR6A 4ZHQF 3WMGA 4M1OA 5HUJA 3IDOA 3ZV6A 2ID8A 2JGDA 5CX1A 3M1YA 3FYCA 3DTVD 3FIJA 1H6CA 4F1JA 1E5LA 4EY4A 2EQ5A 4NATA 3C39A 5M5BA 3G7NA 2JI6A 2AR7A 3OTIA 3A04A 4HGOA 4ZQHA 1GRRA 1ESDA 4HUJA 1N6KA 3BDIA 3R7FA 4RS3A 3TW8B 1G8KA 2IXTA 3ICWA 4ER3A 1ORTA 1OXSC 5IAAA 2X6QA 3FLBA 1GSHA 4UUPA 1ZBDA 5A3SA 1N9GB 3V4FA 2Z8XA 1UPAA 2FQ1A 4HGPA 2VS1A 4BKPA 4F8YA 5E6SB 1K1EA 2C2GA 3AEQB 2W6OA 4OQXA 2VK4A 4EHHA 4LZJA 4RFLA 4X84A 4J8PA 2I6UA 4A23A 4DMCA 2C20A 4IIJF 4BAGA 2GJKA 4NDAA 4E4TA 1H2AS 5ITWA 5IZCC 1T13A 1CF9A 2CMGA 2QI9F 1JKIA 4H0FA 1GPKA 1LDNA 4M0UA 3NWPA 4U6SA 5HS4A 1WMEA 5FOVA 1KPHA 4L0CA 4GI2A 5CYFA 1X42A 1K68A 1PS9A 2P9GA 1DCKA 3K5PA 3B82A 1RZUA 1XNQB 1XNRB 1LLDA 1XNHA 1YDWA 2PKCA 4IDFA 4N5DA 3QXSA 4GXNA 4P3PA 1OI3A 4FFBA 1DL5A 3MFQA 4HQLA 4EPTA 3RWMB 5DWQA 4US0R 3CLUD 4LNHA 3GMSA 1KP9A 4JBXA 1WULS 3ENKA 1JA9A 5CK4A 2DCMA 2WNIA 2PT9A 2Q7OE 4WZBA 2IYUA 4EYQA 1LBEA 5F5XA 1RKXA 2CHEA 5M7EA 3BULA 1RCFA 3LP6A 4LV5B 3HFRA 5B3JA 5I45A 2QS9A 1E0KA 1SOWA 1K4MA 3B2EA 4HS9A 3ET4A 3D3KA 1VOTA 4LRQA 5ALIA 2BMWA 5EIBC 5K51A 3VR5A 1ADBA 2DPMA 3PWSA 1QVWA 3AZPA 3RSGA 1NM5A 1CLEA 3PQFA 4N8DA 3FTQA 3KL4A 2NZWA 2OMEA 2ZVPX 5ICEA 3NORA 1AQ6A 1NQWA 2EP7A 3BEOA 1C5KA 5J2TB 1E8NA 3GJ4A 4UASA 5KOHB 1ODSA 3I5XA 1PIWA 5LDGA 2XTMA 4LTDA 2QA5A 3NRCA 1KOLA 4FOSA 2ZZNA 5ADVA 4FFWA 2XDAA 4RD2A 4REQA 1E2PA 4A2WA 1APBA 1GPBA 4K81B 1E60A 1DBWA 3EWIA 3LKDA 3NV7A 1X39A 5EJ9A 2XUHA 1SMKA 1JUDA 3DVRX 3I9LA 2EU8A 3OZDA 4ZO7A 3N2IA 3E6AA 7YASA 2OXRA 3UJNA 3D6MA 3AFIA 4J76A 5A0FA 4BN4A 2IEAA 4EUFA 1JWLA 1HFJA 1N5DA 2YN0A 2F1HA 4I6JA 1M34B 3CB2A 4PRYA 2V6MA 5CT6A 4TXHA 1ZMRA 4GI7A 4JMLA 5E7MA 3HVJA 1JH9A 1QVVA 4TS4A 5CA1F 2XT0A 3ICPA 1J33A 4K03A 4MAAA 3WGTA 2FX2A 2XNHA 5JTUA 1CLUA 3DUWA 4NBVA 4E2YA 1OX5A 2IHYA 2EBFX 1E9BA 1UXIA 4K6KA 1GKLA 1RQ7A 3RSFA 1MO2A 3OTGA 1KEEB 4WX2B 4S1OA 4RMHA 2AUTA 2G9VA 1GO2A 4YPFA 4LK2A 4BVFA 1U5BA 2WHPB 2V3VA 3NHYA 5JAQA 1VHQA 1FL9A 2QSZA 4LFBB 1CETA 1J09A 1OIXA 1OWPA 1MORA 4ZJPA 3N58A 1KBZA 5CU7A 1L0BA 3VDXA 5JXWA 2HMSA 3ISJA 3NRBA 3JWPA 4ZVKA 2JJ1A 1ZKDA 2FKAA 3MQ2A 2QX7A 4ALKA 4GI5A 1K7SN 1E98A 2BZGA 2H3EA 4RDIA 3OCZA 4RZHA 1JL3A 1E2EA 4FQ7A 4C0WA 2GETA 4F12A 3P2EA 2DHEA 5JWOA 3WWPA 1A0OA 2J0VA 4L27A 2FPPB 5IXYA 4MCAA 2X6RA 3AEQA 4XLTA 2AEJA 2FKNA 3WLIA 5CVUA 2X9NA 1KP2A 3INRA 3WNCA 1KYTA 2GOYA 1K8RA 2OSBA 2A1UA 3IXLA 4UMFA 5HOQA 4ZVVA 4EW2A 5KWVA 1RQLA 3CTPA 4X1YA 4A82A 1YVEI 4R41A 1OBHA 1CRQA 3HABA 4C7VA 5LNK6 1TC1A 4EO9A 3WLKX 3L6BA 4RA9B 3C8HA 4WI1A 5EGNA 4U7TB 1X15A 1V45E 4XGIA 2X0DA 2OV8A 4DLLA 2H17A 4Q4AB 1HDRA 1L5QA 4M6WA 4X9XA 4O2BF 4ZIRB 4AN1A 3HXMA 4FYXA 3U4MA 1H65A 4CM4A 3H4MA 5JSZB 3A7EA 4K0KB 3SZGA 1HYQA 2OLKA 2D1YA 2FMHA 2WNSA 1T26A 4QRDA 3ZDFA 4E88A 4EHFA 4N82A 5FWYA 4IEIA 5FT9A 3I1FA 3IAS6 4DLAA 4RTJA 5HFAA 3ISTA 1N36B 2AN1A 3M6UA 2GB4A 1E5TA 2V59A 3F0TA 2WIGA 3HWWA 3S2IA 2AH5A 4ED9A 5IF9A 3GT3A 1RKUA 4Q48A 2V6IA 3DV2A 4NFSA 2G36A 2MINB 1WL8A 1QTQA 2ZB7A 1ZCBA 4K05A 4FDTA 3DXXA 4HMPA 3Q7RA 3TB4A 5IH7A 1GZ4A 5KC9A 4NPHA 3CKYA 4WVFA 2FN3A 2VO1A 2GRUA 3QI7A 1FQJA 4KQEA 3V80A 3WO0A 5CX4A 1YB7A 5JPIA 5IVIA 1T25A 1F8FA 1NXWA 3ZXYA 4CMIA 4X66B 2Q49A 1TQ8A 4IIFA 3ZDAA 1M73E 2GK6A 3I28A 3PYMA 4QUAA 5E7IA 3AOEA 4HDNB 4DBZA 1FU7A 3QGMA 3KAJA 5TF0A 1C3VA 5DNUA 4MKXA 1X7XA 3R1IA 3MJTA 3G59A 1JJAA 4MV7A 5AM4A 5FAKA 3U0BA 5FBVB 1PHRA 2V7GA 4JWTA 4PLCA 4XD7D 1Q74A 3M9LA 2BI4A 3HB5X 4MINA 3PENA 3DTTA 3N2KB 2KBEA 1XQVA 3FZQA 2HN9A 2QSYA 4D44A 2CEKA 1MX5A 2I7DA 1EAMA 3H86A 5HRUA 3TAUA 4UCXA 1G1MA 2YXEA 2IJGX 4WD3A 4MB6A 3EY4A 4YXWD 1FNCA 5JDIC 2WE7A 4QATA 3GGOA 2PBFA 4Z9YA 3R9WA 5ULLA 3FCAA 4GQAA 1DI0A 1KI4A 3OT1A 3EUEA 3S55A 1U28C 1Z7EA 4LBWA 4OUDA 4AWAA 4BNIA 4YCDA 4RQAA 3WZMA 2JHPA 2BVNA 5AHOA 3TKAA 3QVSA 4NICA 1BFDA 4Y1RA 1CJMA 1PR4A 3G82C 5CHEA 1XEFA 3VC2A 3U4DA 1WXDA 1RLJA 4TKLA 3B20A 4YN3A 4Y2PA 5ARDA 1ML3A 1YQXA 1D09A 1EFLA 3ND7A 2HY7A 3HQ4O 4QTTB 3N3AC 3DUFB 4JKYA 4BVAA 3GFOA 3QJ5A 4LISA 5BMVB 5FP0A 5CPBA 4E5YA 3L40A 5BOSB 1SA0A 2GXUA 4P32A 1NMXA 4U2CA 2H2FA 2NACA 2X7HA 1T0BA 2X22A 1GPDG 3K9BA 3T9CA 1A76A 1AKRA 1RHKA 1THZA 3MMNA 2QZ9A 3RAFC 3RC8A 4UAVA 4R6WA 3ZHUA 1IXZA 3LXXA 4NNPA 3P9PA 1AN9A 1QLJA 4OQNA 5DDIP 2FVYA 3BJIC 2EF1A 2NO1A 4NWIA 3P4YA 1KJJA 5AUOB 3D6FA 3I8SA 2XMPA 5LD2C 3PLAE 2E4XA 3QLTA 5IDVA 1WZ2A 5B4UA 4EARA 5IDWA 1ZH8A 2LWIA 2MSEB 3PXUA 1YI0A 4A26A 1JG2A 1V95A 4R0VA 4CPDA 1MA0A 3HU5A 1MENA 2YFKA 4QO8A 5DM0A 5EPEA 1KI8A 4GPZA 1IH8A 4WK6A 3A6ZA 1Y5MA 2CWWA 4OBBA 5LA6B 3I9FA 4NC9A 2MCFA 2DBYA 3CQ9A 4PN3A 3DAOA 1AKWA 2B69A 5IKOA 3EIFA 3SDZA 4FFRA 4MWGA 1PGJA 2BV3A 3BM5A 3L0IB 5H0IA 3RU7A 5J1SB 1QYWA 2I80A 3WAGA 5A02A 3VJKA 1TAUA 1XP8A 3DE5X 3PT5A 2XITA 3T6KA 1HE8B 4BQFA 5FWNA 1E3DA 2ZYTX 1L5HA 3GWZA 2CFCA 5AM1A 1ECBA 3N6RA 4D41A 3MD0A 1UJBA 5DP1A 4F06A 5E9QA 2R8XA 2VRWA 3TQHA 4C4YA 2ZTMA 4WJLA 3R3JA 1JSXA 4HAWA 1ZR2A 4N7JA 5JD5A 5LU8A 3MGGA 1T8SA 5BSKA 5ALKA 2A67A 1A9TA 1G9TA 1V7QA 4Q9DA 1V8PA 3OUTA 4OMCA 4PAMA 5FNVF 2VRNA 4PLWA 2BMJA 1NVGA 4JBYA 2ZWVA 2YIMA 3H5RA 3U7EB 4BMNA 5BYAA 1G64A 3ANSA 4U8HA 5ENDA 3FTDA 1CG6A 3T9BA 2UYCA 1E4VA 4NYIQ 1ZAKA 1QO9A 3P2JA 2PFGA 5E6SA 5DNWA 2XVMA 1HYEA 4QXOA 1FS4A 2WIFA 3E27A 3IHLA 1U2DA 3VR6H 5HCUA 3PXEA 3HR7A 2IZ7A 3TIGA 2VJLA 2PKYX 4XAQA 3IPAA 3QY0A 4IR7A 4PHTA 3QWFA 3F6CA 2JLWA 1YKGA 3HACA 4U7GA 1ZUD1 4HLQB 1NRXA 5HDQA 4YV0A 1L4NA 3S2EA 1SG6A 3WGGA 3UWSA 4AX4A 2YWCA 2GZ1A 1I2DA 2NVUB 1EJBA 3REOA 3U7QA 2J5XA 3ZIDA 3OU6A 2IEIA 2ZT5A 4B3HA 3J7TA 5JS8A 3HB9A 4CTKA 1BQEA 4JXJA 1U7UA 3OQIA 2MMCA 3FFBA 4MUNA 4F3CA 1MN6A 1Q0ZA 1UM8A 1XJ0A 2OGUA 4HQKA 4L07A 4OGKA 1HQYE 1U5CA 3QXJA 4BC1A 4CTJA 2V5UA 2J3JA 4WNIA 5CLIA 5G0VA 2OZEA 1FTQA 5DRYA 4CHGA 3DHVA 1FSGA 3IQHX 4DRXB 2B21A 1JP7A 1TQ4A 2JLSA 1XZLA 4XD7A 4RK7A 4K9QA 4WJKB 3KB8A 5D00A 4GX1A 1E2MA 1ZM9A 3QJYA 2NXNA 4XVQA 1EFHA 4RY2A 4BMYA 2JH3A 3PC3A 4POAA 2OM2A 4TYMA 3GRZA 5BSEA 4EEKA 3E9ZA 3SQXA 1KI3A 1ZNZA 2X0JA 5JFOA 4P33A 1GAWA 2BHNA 3I1IA 1P0FA 1YONA 2EZUA 2HGSA 4XPIA 2J46A 1QDLB 3O4HA 1XE3A 1NG1A 2LBPA 3VHLB 1DWPA 1JFVA 3FD8A 3U3OA 4YIHA 3EDMA 4C7OB 3RE1A 2J4FA 2HI0A 1UM9B 2IYVA 2DGDA 3DDZX 4FFOA 3CF0A 1VGRA 1F06A 3WK5A 4RZXA 3OP4A 5SY4A 5EHIA 2V8BA 1S1MA 2ORIA 2ZYSA 4R51A 1JHPA 1K6MA 1DJNA 2CD7A 4MS4A 1H3FA 1JYEA 2AQKA 4RK1A 3NYWA 5REQA 3LXRA 1LPAB 2XBUA 4DIFA 1NW7A 1SVOA 4F72A 2EAUA 2XVZA 3IB3A 4QRHA 4NCAA 4OA8A 4MUGA 5BV1A 4DZRA 3IULA 1Z56C 1BC5A 1BTOA 2Z1DA 4HPWA 4XX1A 4MRMB 2OXFA 3OG9A 2ANBA 4B4OA 1KA9H 3GFRA 3GLFE 2SNIE 3UK1A 2D2IA 2XZPA 2VP5A 1H8HD 4IXMA 4X61A 5A4FS 3EZLA 3AHIA 3MS7A 3PRYA 3NCTA 5J59A 4FCTA 3UPDA 1NG9A 2POCA 2Z6VA 2NP7A 4FD2A 2HW8A 5BQXA 2P9YA 4GPIB 1O96A 4Z4GA 3A6PC 1SHTX 4XWWA 3Q8LA 1DSSG 3NETA 4BNUA 5DN6D 1VPWA 4QOIA 3EF0A 4RY8A 3E81A 1RPNA 1SC3A 2HO5A 1HE4A 3AJDA 4RKWA 2PZ8A 3ABOB 4CG0A 5DM70 1E2DA <