3OE4A

Rat catechol o-methyltransferase in complex with a catechol-type, purine-containing bisubstrate inhibitor - humanized form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 68
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3oe4A01
3KQPA 1NBHA 1NV8A 1X1DA 3KU1A 4FSXA 4QQNA 2ZZMA 4RTJA 3FPGA 3BKWA 2BM9A 5DLYA 2VDVE 1NW8A 3GRRA 1KXZA 3FPJA 5DSTA 4BLUA 3B3FA 5FTWA 3TR6A 1UFKA 1WG8A 3LGAA 5GOZA 1IY9A 2PKWA 3CC8A 3EVDA 4RVDA 3KPJA 3E7PA 3SSOA 2YTZA 3REOA 4P7FA 5T64A 3DTNA 1G6Q1 2ZVJA 3E05A 1RI3A 3CKKA 3A25A 3TKAA 3UWPA 4DM3A 3THSA 8MHTA 4RWZA 5KYGA 3FUWA 2NP6A 2BR3A 3CGGA 3KQYA 1NW3A 2P3QA 4AZVA 4RTKA 3G7UA 3GO4A 3BGVA 1KR5A 1F3LA 3P2IA 3LECA 4PYLA 4RSRA 3T7SA 2QRVA 3FRIA 3G2OA 3KQMA 1WY7A 2IBSA 2AVDA 4PCAA 2AS0A 5ICFA 4A6EA 2UYCA 3O7WA 1XDZA 5EVJA 2BM8A 4PGGA 1SG9A 3HVKA 3KPUA 5BW4A 4BY9E 3LX6A 1AQJA 3DLCA 4ZTBA 2NXCA 5E1DA 2ZULA 5FHRA 2BR4A 2AOUA 5DM4A 3SM3A 3KQSA 5DX1A 4X60A 2Q41A 3ELYA 5FWDA 5HILA 3M6XA 5C1IA 4E33A 4PNEA 1JG4A 2IH5A 3DP7A 3MTIA 5DXAA 2JH8A 3JWGA 3G88A 2GB4A 4KRGA 1WS6A 1JG1A 3OCJA 2O06A 4PIPA 4EKGA 2IP2A 2AR0A 2O57A 3KR1A 4P58A 5LQUA 3E23A 4RTMA 3X0DA 5E8RA 4YUVA 3TOSA 1XDUA 3LHDA 3A26A 2AZTA 3NTVA 5ICEA 4AZSA 1R8YA 1DL5A 4M37A 1KIAA 3GGDA 2JH9A 1R18A 1Q0TA 2PY6A 2ONZA 1TPYA 2OZVA 5DXJA 5DT2A 2Z6UA 2YVLA 3G89A 3I5UA 3GCZA 5D1NA 2HR1A 2PXAA 5DTRA 3PLAE 1RI2A 2BZGA 5K0LA 4F86A 4GC5A 3IYLW 2UZ4A 4PYJA 3GIWA 4HTFB 3O31A 5EG5A 4CWAA 4H0NA 4ER0A 5CVEA 2AOWA 1N2XA 4IWNA 5ICCA 4V0QA 3B89A 3QV2A 4XUCA 1ZGJA 3LKDA 3SVZA 3DLIA 5C9ZA 4HH4A 5FUBA 2OXTA 3I58A 1AQIA 3LDUA 3UA4A 5K0GA 2FPOA 4PYQA 4E70A 5LQRA 1VPTA 2ONYA 2VS1A 5U4XA 2PGXA 4GEKA 4EMSA 2AN4A 3P2EA 2G8NA 1SQGA 4KWCA 4OQDA 5G02A 4E32A 10MHA 4HGYA 4ER7A 5JUWA 2G70A 4PCLA 5CUQA 4PYOA 2H00A 5C0OE 2UYHA 4MHTA 5KQRA 5E1BA 1EJ6A 1YFJA 5M5BA 3PT9A 2N47A 3OU2A 3SMQA 1Q0SA 2PLWA 3C6KA 3OU7A 4LG1A 3OPNA 5HIMA 2PVCA 1QAMA 2PWYA 1VLMA 2GPYA 1L1EA 3KR9A 4KW7A 1L3BA 4K6MA 4PYKA 2CMHA 5DM0A 1Z3CA 2ZIFA 3G2QA 2VDWA 4L7VA 2B25A 3F4KA 5DSXA 1I9GA 5T6BA 4FT4A 2YUIA 3MB5A 1XVAA 2PJDA 3MAGA 1NV9A 1VP3A 3HNRA 3HP7A 1B42A 1JSXA 3KQQA 3VSEA 3CVOA 5HOQA 3FRHA 3T0IA 3H2BA 1O54A 3EMDA 1BKYA 3IV6A 3OZSA 4GBED 3R0QA 5IH3A 5E9WA 4LWOA 3FTEA 1JG3A 3TRKA 3JWIA 2YXDA 4R8SA 3LCUA 2ZZKA 2PX8A 2AOTB 1O9GA 2B3TA 1ZGAA 3FTFA 4E2XA 2PT6A 1WXWA 2QE6A 4Z2YA 5E2BA 3WSTA 3TKYA 1RJGA 3R24A 1JTEA 2PWPA 2IFTA 3BZBA 3DH0A 4PGHA 3PX3A 3S68A 3MCTA 3M6WA 1KYZA 3EEYA 3RIEA 1N7JA 1QAOA 5HIIA 2QYOA 1ZG3A 2P40A 5DTMA 2PX5A 4E2ZA 2K4MA 4F85A 4M38A 2ZBPA 3FPHA 4M7RA 1D2CA 4MIKA 3FTCA 3EGIA 3BUSA 4X1OA 4Y30A 3U81A 4QQKA 2I62A 4MWZA 2G1PA 5HFJA 2NXJA 1SVUA 4KIFA 2EJTA 4WXHA 4UOEA 1SUIA 3EVGA 1JQEA 2H11A 2P3OA 3DMFA 3Q7EA 4EKIA 4YUZA 5EMLA 4QTUB 2EX4A 2HNKA 3UJCA 4FZVA 5LQCA 1WXXA 1XDSA 3RW9A 1INLA 1FP1D 2YQZA 3KPVA 1TW3A 2P8JA 5CVVA 4C08A 4RX1A 3R3HA 4YV2A 3O4FA 4HG2A 4CTKA 3HTXA 3CJRA 3G5TA 1M6EX 4GF5A 3EVZA 5K0EA 1T43A 1VE3A 3FZGA 5EIFA 2Y1WA 3UZUA 2C7PA 3NW9A 1MHTA 4C03A 4OBWA 4PIMA 3M70A 1RI5A 3QOWA 3LBYA 2AN3A 3B3GA 3KR0A 3SSNA 5EMMA 2JHAA 3THRA 4IV0A 5LQAA 5GWXA 1P39A 3Q87B 3D2LA 4ISCA 3CJQA 1SQFA 3CJTA 3I64A 4P7KA 4HTFA 2ADMA 3OE4A 2HTEA 2ZW9A 4GUAA 1YB2A 4AX8A 3OZTA 4PYMA 2I9KA 5EMJA 4R6WA 3PVCA 3EPPA 3NDJA 3SGLA 2A14A 2IGTA 1BOOA 3BGDA 3AWIA 1RI1A 2XYRA 3E8SA 3ID6C 4YV0A 4DMGA 4YUXA 2JG3A 5LQJA 1NBIA 4RTSA 1NW5A 5BW5A 2IDJA 4ATNA 1YZHA 2HWKA 1P1CA 3HCEA 3EVEA 2GAFA 1KP9A 3LKZA 3BGIA 4V0RA 3GU3A 3M4XA 3UJAA 2C7OA 5DX8A 4C07A 3GRYA 1UWVA 3NWEA 4XUEA 1QZZA 1QYRA 1JTFA 4LWPA 2CMGA 3ELWA 3M6UA 5DRTA 2OBFA 3P8ZA 2FRXA 2IH2A 2CL5A 3ORHA 3PFHA 3SSMA 5K05A 5BXYA 4C4AA 1D2HA 5F2NA 2C7QA 4HSGA 2P1DA 1D2GA 2G72A 4EVIA 1JQ3A 3V97A 4R8RA 1XCLA 3NDIA 5K03A 1AV6A 2PSSA 2EFJA 2PBFA 1EG2A 2CKDA 4C06A 3NJRA 1DUSA 3AXSA 5CVUA 2NP7A 1YUBA 3HCBA 3L8DA 1QANA 5ICGA 5FADA 5K0JA 3M6VA 3C3PA 3KQVA 2AOTA 4DA4A 3P71T 3NVKI 1G55A 4YMGA 5ERGB 3IHTA 3MERA 4M36A 2P7IA 1RI4A 3BKXA 2XYQA 2YX1A 3PS9A 4DZRA 4IKPA 4YV1A 5CD1A 2OB2A 5IKMA 3GRUA 5HIKA 3OFKA 3IEIA 5MHTA 5EC8A 3UJ8A 5K0FA 3GXOA 1NKVA 5K01A 4QVKA 2OB1A 3LCCA 5FWAA 4KDCA 3HCAA 3A27A 2ZWAA 3C3YA 2R6ZA 2V7EA 4KVZA 3T7TA 1G60A 1QAQA 1XXLA 1RJDA 5EHGA 2WA1A 5T67A 5K09A 1JSZA 1U2ZA 3SX0A 2BR5A 3KHKA 3KPWA 2IPXA 5FULA 4GOMD 1VIDA 1NW7A 5KS2A 3NWBA 3LSTA 4AZWA 4RTLA 1HNNA 3FPFA 2OO3A 2I6GA 2ZTHA 3FTDA 3LDGA 4EK9A 2AN5A 2ZBRA 5EMKA 3K6RA 1OR8A 2PX4A 4FR0A 3SR4A 4DCGA 1FPQA 5E8JA 2F8LA 4YUWA 5KVAA 4PINA 2ZIEA 4HGZA 1O9HA 5D1HA 5CVJA 1WZNA 5GM2A 1X19A 3B3JA 1JQDA 3UJ9A 1M6YA 3A7DA 4RVHA 1JG2A 3MTEA 5E1MA 5HIJA 2UYQA 4AUKA 3TQSA 4RVGA 4RTNA 2H1RA 3ER8A 4MTLA 4CKCA 3DUWA 5EQJB 1KHHA 4RTPA 1EQAA 2XYVA 2ERCA 3TMAA 2EG5A 2FCAA 2WA2A 2ZSUA 2NXEA 3LCVB 1AF7A 4PYNA 1M0EA 3GNLA 2B9EA 2I7CA 1NE2A 3DXZA 5F2OA 3TM4A 1EAMA 3P9CA 4DF3A 1RJEA 3HM2A 3KKZA 4F84A 5K0CA 3PX2A 4E2YA 1XTPA 3DOUA 4BP1A 4A6DA 4GC9A 2ZIGA 2GS9A 1EJ0A 3BWYA 4R6XA 2LD4A 4ER6A 1L9KA 3CCFA 3KQTA 5LQNA 2OKCA 4E31A 4DCMA 2VP3A 4OA8A 2HV9A 4YMHA 3DMGA 3DR5A 5CCBA 3HA7A 1KYWA 4KIGA 3EMBA 2V74B 4RYLA 5DPMA 4R05A 5K8VA 1BC5A 4OA5A 3EEOA 4XUDA 5GINE 5E9QA 5FA8A 5GP1A 4XCXA 2ZCJA 3RODA 3GRVA 3BWMA 3PB3A 3HA5A 3LPMA 2C7RA 4JXJA 2GA9A 3HVJA 5DRYA 3OZRA 4GOND 5EKXA 3NVMB 2ZZNA 3OU6A 3P97A 5CM2Z 4CKEA 4X63A 1X1BA 3FUVA 3FPEA 2BH2A 3M33A 2B78A 2ESRA 3FUXA 3ANXA 3CBGA 3PFGA 1BHJA 2IH4A 2XBMA 3ER9A 2O0LA 3K0BA 4QPNA 5EZSA 4FT2A 3C6MA 4O29A 1I1NA 2AOVA 5GM1A 3SXJA 4CTJA 1R6AA 1V39A 3FUUA 3R9XB 1X1AA 5LR6A 5K0NA 1H1DA 2FYTA 1I4WA 3HVIA 2NYUA 1VP9A 3ME5A 3EGVA 5FCDA 2PXXA 3UFBA 4QVGA 1L3CA 3ELUA 3MGGA 3TM5A 2Y1XA 4FSDA 4CKBA 3EVFA 2CWWA 5GIOE 3AXTA 3UBTA 2WK1A 3A7EA 1R8XA 1JR4A 1L3IA 3G8AA 3HA3A 3UJ7A 3UJBA 4C04A 5GIPE 4DKJA 3R6TA 4QDJA 3G2MA 5EGSA 4BLVA 4CXMA 2OYRA 3EVCA 2Z6AA 4Y2HA 1FBNA 4B17A 1ORIA 5LSAA 3ELDA 4GOLD 3P9KA 1FJXA 1YFLA 5EHIA 3HVHA 3VYWA 3G5LA 3LL7A 5CIYA 1MJFA 2ZLBA 3MHTA 1FP2A 4U7TB 2IDKA 1XJ5A 3TLJA 2UYOA 3GDHA 4P7GA 4RVFA 4DQ0A 2E5WA 4QPPA 3G8BA 5B1SA 3AY0A 5EPEA 1ZHFA 5CVDA 3B7PA 5E1OA 2XVAA 3G2PA 2P35A 2QY6A 4FP9A 1KPHA 5DM1A 5DX0A 5EKUA 5H02A 3UJ6A 1ZQ9A 4NECA 1N7IA 1UIRA 4P7JA 3TPZA 4RTRA 3PTAA 1TW2A 2HMYB 2P7HA 3C0KA 5DWQA 1PJZA 2Z6QA 1P1BA 4BP3A 5JR3A 4HRAA 1RJFA 1G8AA 3HCFA 2VDUE 3VC1A 3ERCA 5FHQA 5FQOA 5P8WA 1X1CA 4AZTA 1IXKA 3KR2A 2ORED 3FYCA 4U7PB 5CCXA 2ZWVA 5E9JA 4OQEA 2QRVB 2P41A 3UJDA 2ZBQA 4BLWA 2PXCA 5EOVA 2ZFUA 3BWCA 3DXYA 2O07A 3T7RA 4PWYA 3NMUF 1R00A 5DTQA 2DULA 1IM8A 2GH1A 1R74A 1F38A 1NW6A 3GJYA 4GQBA 2AOUB 5BP7A 3I9FA 2PT9A 1YZ3A 3MCZA 3MQ2A 2OY0A 4GOOD 3DXXA 4E30A 7MHTA 4X61A 3KQWA 2JJQA 1KPGA 3V8VA 3OE5A 2NNWB 1VQ1A 3GRZA 3JWHA 4ER5A 5EIWA 1YF3A 3UA3A 4LECA 1G38A 2OPBA 3B5IA 2DPMA 4QTTB 5E2AA 3JWJA 2AOXA 2YXLA 2FK8A 3KPYA 2YXEA 5EEGA 4C05A 3VC2A 5HZMA 1PRYA 3OFJA 4EQZA 2JHPA 2EJUA 3DULA 3BXOA 2XVMA 2VZ9A 3P9IA 2PV0A 2G71A 2B2CA 2YR0A 2NXNA 3FYDA 3HCDA 4FGZA 3DMHA 3TFWA 4ER3A 2QM3A 5DM2A 5EEHA 2GLUA 9MHTA 5K0BA 1SKMA 5FA5A 2IBTA 4E2WA 4QDKA 3EVBA 3P9NA 4YUYA 4HC4A 1G8SA 1DCTA 5FQNA 2JHCA 4OX9Y 3BT7A 4OBXA 5KQSA 4PONA 2AVNA 3GWZA 4FS8A 2PX2A 3HEMA 3QOXA 3LBFA 3A4TA 2IIPA 4PYIA 1SUSA 5EZQA 5F2KA 3LDFA 3BWBA 1Y8CA 1EIZA 2KW5A 4G56A 1ZKDA 4RTQA 1P91A 2P3LA 1KPIA 2FHPA 5HEKA 3I53A 1VL5A 3FUTA 3EVAA 2FK7A 1ORHA 4KDRA 2O05A 4RTOA 4WVLA 5LQKA 1VBFA 3AJDA 3HCCA 3P2KA 1HMYA 4MQ4A 3KQOA 3EGEA 4RV9A 2R3SA 1NT2A 1XCJA 4X41A 4POOA 4IV8A
chains in the Genus database with same CATH superfamily
1NV8A 1DOZA 1I14A 1Z06A 2H1WA 3BA6A 2UYGA 2XTJA 3P2JA 4UKDA 4OI0A 4LJAA 4YHBA 4CIDA 2VYVD 3JQFC 4IXDA 1XWWA 4AY2A 3QPCA 4LKOA 3AZOA 3G9ZA 3CMCO 1IY9A 1QSGA 4F9FA 3WQQA 1JECA 1XMIA 4CM9A 4PHHA 2GN1A 4D98A 4A7PA 5T64A 1U2TA 3PC4A 2HU5A 4OI4A 1NN1A 5F12A 2FJ0A 3CKKA 4F4UA 3FUWA 3SDBA 5HZGA 3CGGA 3EZ6A 4OQFA 2Y6VA 4LVOA 4D80A 3KQNA 4CEIA 3DJFA 2YY7A 3GO4A 3A06A 3OQPA 1SUPA 3G7SA 3JASB 4YRFA 1JMKC 1C3OB 1NMEA 3GQBB 2CVPA 1MG0A 2ZWMA 4NMHA 4MR7A 3ESCA 4XFDA 4JSYA 4JQCA 1AH2A 2REQA 3RKSA 4UVDA 3JS5A 2Q8NA 4M3NA 4R9RA 5EVJA 5FI0B 1QRUA 5FJIA 1B8NA 2ON6A 2NXCA 3N2NA 2ZULA 4M54A 4MMZB 2AOUA 4OIMA 5B7NA 1F9AA 3AF3A 5DX1A 5IBPA 3BJMA 4ZCPA 2F1IA 2H5JA 1RC1A 4TVBA 1OGYA 3H5AA 1ZBDA 5JTTA 3AYXB 3WLMA 3U9TA 5AOBA 2X1LA 3BYZA 5LZ4A 3UK2A 1U0NA 3L0SA 5E95A 3QVGA 1H9AA 1FOEB 2AR0A 4LV5B 4YPFA 1KZYC 4M1WA 3E3OA 1FMLA 3CW8X 1AOXA 2C9OA 2C3PA 3F6PA 1VBMA 3H2YA 4GKAA 1DL5A 4HWSA 3DV0A 3B1ZA 3MWDB 2WIKA 3FYUB 4UU8A 1CRQA 1QTNA 1IHUA 2X4GA 4R2XA 1Q0TA 1YI0A 4J0FA 2OZVA 1AQNA 2Z6UA 3G89A 5KYUA 3IR6A 3GCZA 2PKYX 1L4NA 5GZ6A 3U4QA 4JXZA 3G7NA 3I5AA 5KCZA 2RIRA 2UXCB 3PRHA 1S96A 5H9WA 4PCUA 1QB7A 4QUJA 2APJA 4FOSA 3H5TA 4TXJA 1F51E 1PG5A 5A5EA 4AKIA 3GP3A 4B80A 3ZDQA 3USZA 2QPLA 2XAAA 4PYQA 4MLDA 5LQRA 2OENG 5CFOA 1W87A 1N9GB 2BUBA 4CNBA 3X1JA 4DSTA 1NY5A 1QQTA 5IK2D 4ER7A 2GEDA 3C5HA 1I1HA 1II0A 2VA9A 4MWOA 3GLFE 1D2EA 3MTBA 2J0UB 4R81A 3WGGA 3OD1A 3R5HA 2QT9A 2W9XA 1KJZA 2IYUA 4RFSB 4Z7NB 5LBIA 4PFJA 2BGNA 2WWXA 2BV3A 4PO8A 2GPYA 3T9BA 2ONCA 3LM8A 1GKYA 4JXXA 2GKOA 3TPCA 4OUKX 1TZJA 3L4JA 1YRAA 1PCXA 2EW2A 3MB5A 4J7XA 2J3DA 1KDOA 1CHNA 4Z0TA 3DOFA 2UUOA 2HL6A 1B42A 1IULA 3EGWA 2Q3JA 4KR0A 4NCHA 5D5PA 4BRZA 1H6BA 1GPUA 3AI3A 3RVOA 3UF0A 4LSGA 4MGIR 3ZY6A 2B8TA 1SM4A 4B6JA 2BFDB 5TARA 1YDEA 1ZN7A 4TSFA 1NZFA 3T5CA 4MDEA 4WERA 4JLBA 3SS9X 4S1VA 4EJFA 2B3TA 1SCJA 4YLEA 1FW6A 1I0IA 4B2YA 1EK5A 1ZOPA 1KVUA 2OBLA 4KIJA 5JOQA 3FLEA 4IQ8A 1NXWA 1QDUA 3DH0A 3PX3A 4QARA 2MSEB 5BVGA 2VQ6A 1LNQA 1DTEA 5HOEA 4WK2B 3T35A 3L6UA 1OZFA 4WL0A 5AW6A 5KQMA 2J3IA 4M7RA 4F92B 4JWKA 3QUQA 1P74A 4QQKA 4D9NA 4FD3A 4WLEA 3Q5DA 3A70A 3HXTA 1BKDR 1JIVA 1VHWA 2ORIA 4KJXA 2CFIA 5A62A 2G3YA 4RF2A 2H5LA 1XEFA 2J31A 1BX0A 1DMRA 2VP9A 4IJ6A 1FP1D 1H6CA 1U8YA 3F1LA 5HMLA 3HZZA 4YV2A 4RX1A 4XYGA 1BX3A 3A1NA 1SELA 5BN1A 5IYZA 4WZ6A 2H2HA 1IU9A 2O2XA 2C04A 2GPNA 2XW6A 1JHVA 1VBKA 1HDGO 3NW9A 1C7JA 3TEJA 3EIFA 4OBWA 3Q9NA 4Q3DA 1G4AE 4Q3KA 3QU5A 1A9XA 3ABSB 2BEUA 1GLNA 1NYQA 1NXQA 1PJTA 3GFSA 3MS4A 1TF2A 4I14A 4INZA 4BVKA 3KBOA 5ECYA 3ZJVA 4JSRA 1ZK1A 3CURA 2B1RA 1Q84A 1OTYA 1G0OA 3GDGA 1RYHA 2IHYA 4HTFA 4YDSA 4EI8A 1JQLB 1Z68A 4Q9DA 3VPDA 4GUAA 3VVCA 3V1LA 4MI1A 3D3NA 2BBWA 2VLIA 5FNVF 3TLCA 3BXEA 4GPIB 3Q6NA 3FOEC 2OHGA 2EQBA 1ZUD1 2H59A 2WSBA 4RIEA 1V96A 3AC0A 2QT0A 4TL7A 4MW7A 2A14A 2IGTA 4EYGA 3VV2A 1TEZA 4MKRA 5HK8A 4ZU1X 5JZMA 1XRPA 2NSHA 5EWJA 5EY5B 1BQEA 4FZJA 1HYBA 3LE8A 1K5HA 3TZ6A 4ATNA 1XCBA 1VJ0A 4NVRA 1DQSA 3T1VA 1Z12A 2VBFA 4LGMA 4O5AA 2VJBA 2FPMA 2VSNA 4LJ8A 3EARA 4BN5A 4O08A 5DX8A 1MJNA 3K5PA 1UWVA 5KOHA 5FUQA 3HY4A 2HI0A 4DB4A 2YHIB 4YAOA 1CUXA 2HSDA 4Z9YA 1EM8A 1W49A 3F4LA 3KVOA 3K1AB 4LZLA 3B8EA 1DNPA 4HVCA 3RU9A 5K05A 4K2HA 1DLIA 2PGNA 4PG5A 4ZAZA 1O77A 3QF4B 1MX3A 5B36A 2MSNA 1RWQA 2P1DA 4Y6PA 4EVIA 1E6CA 5I48A 2PUCA 1HDYA 5BV8A 2DFLA 4FMDF 4UM9D 2WPDA 1WCYA 1ISMA 5L4SA 2P5UA 2O8DA 1DUSA 2CXRA 2CJPA 3V33A 2P4UA 3HCBA 5H68A 4A6PA 5FADA 1XLTA 4FX2A 1O0SA 4F12A 3ND9A 4M0UA 2R6JA 1RLIA 3JQEA 3KJNA 3PHIA 3Q3IA 4RV9A 4AKSA 2G5PA 4KQCA 3J81k 4YMGA 1OUMA 2BGRA 1QH1B 3RSGA 1WAMA 2IXEA 5TF0A 4HBGA 2HNBA 1VIMA 4YXWD 4BRUA 1QBKC 2WZQA 4J0JA 4TTTS 1HETA 1U1DA 3LHIA 4FHDA 1G8JA 1PG0A 3LUBA 3PPIA 3NWOA 3GXOA 4QDUA 1K5GA 2MCFA 4ANFA 1IWBB 4JS0A 3DEAA 1ZVQA 3HCAA 4Q9JA 2YFKA 3T3HA 4V02A 3TB6A 2PGIA 4X97A 1NVUQ 4FN5A 1PQPA 2O2IA 3DZ8A 4ECEA 4PXSA 4GOMD 4MGHA 4O2AF 5DCLA 3NHPA 2FDRA 2XUFA 5J4VA 1QHNA 1CUCA 1QIEA 2JI8A 3E9MA 5E7MA 4X8OA 3CR7A 2H08A 4E51A 2F8LA 3OZUA 4ZYWA 2Q5EA 4HGZA 1MENA 4PPGA 1EESA 5CVJA 5IAJA 2F9LA 4RYDA 3G6KA 4AN4A 4BXOA 6REQA 3AEUB 2FXIA 2ZUVA 3AEKB 4YNBA 4D9CA 3JVEA 1PHRA 1X15A 2MYTA 2VDNB 4D25A 4KUGA 5B6PA 4OU5A 1J21A 2P9YA 4INJA 4RKRA 4C4YA 3A4YA 3BHNA 4R4JA 1E2BA 2QW1A 3FMVA 3VPGA 2VA8A 2FCAA 3DO6A 4LDPA 2NU8B 4NFLA 1AF7A 4R2LA 2G0TA 4J43A 1IFXA 2POQX 1YC2A 2X8WA 3KB6A 4G26A 4GVLA 3SHVA 1NJ8A 2JIDA 3LI2A 1YTLA 5DBIA 1NMZA 4FWIB 1L9KA 1G20B 2G88A 3PHJA 3L7YA 4X6UA 1YZQA 2KWIA 1S0UA 4PZAA 3H16A 3HZOA 3OZCA 3KJEA 4P82A 1QU2A 1Q7TA 4YROA 5L6LB 2ZXFA 4OB6A 3H0EA 1BJRE 3E9QA 3HV0A 1FIUA 2C8LA 4RYLA 2WHPA 1MORA 2XUOA 3BMCA 4RSHA 2VPZA 4HX9A 4B83A 3ZGLA 1WSAA 3MJRA 1W47A 3ORFA 3GBVA 4MDHA 1MVNA 3NBFA 4OLFA 3DOOA 2FSFA 2WNIA 4P22A 2FGJA 2W2QA 2W2VA 2XSZA 3DV9A 3RVBA 2Y1GA 2W6QA 2GA9A 2JFGA 5A4DA 5CR9A 3NVMB 4HDSA 2EW1A 4RGYA 4X63A 4F1KA 3BIWA 4FMCF 1X1BA 3RARA 1XPUA 1FTWA 1TD1A 4ERNA 3Q40A 1S8AA 5B1IA 5J43A 4D3DA 3QMVA 2JGFA 1I4EB 3MOSA 1BMTA 1F12A 1TC1A 2XMPA 1AKUA 2XBMA 1OYWA 2FSIA 3K0BA 4GI7A 4H1HA 4ND8B 2QQGA 5CTAA 3O3NB 5D3ZA 1L5FA 4KL8S 5F76A 4H3KB 5H9VA 1I1NA 2DAPA 2FP3A 5BSVA 2OC4A 1T10A 1V39A 3FUUA 4Q18A 1XL1A 5DU2A 1X1AA 4HJRA 4BMVA 3HXQA 1H1DA 4UNIA 4N3BA 4YGXB 5I3ZA 1COZA 4MO2A 2TMKA 4W5QA 4TTAA 1O95A 2RH5A 4YVFA 2WWTA 4YJ2F 5EIXA 3DEKA 1JR4A 1ANKA 4DKJA 1KJNA 4LK2A 3FNGA 3CLVA 2OCAA 5K0ZA 4IW3B 2G04A 3EQ7A 5KYWA 1F0NA 2BDTA 3HR4A 1ZRMA 3NLLA 5LSAA 5DGIA 1T3HA 5AI4A 4DCNA 3K2BA 4HH3C 3ZNOA 1CYDA 2ODNA 4ZJPA 1E79D 3DFZA 1A5ZA 2OECA 3DYVA 1T5OA 1WW3A 4FILA 5AYVA 4DG8A 3CUSA 1ZXXA 3KAJA 4L4SA 5BSKA 4A9AA 2DKNA 1VFNA 4ITUA 1NLMA 1ZGCA 3ADKA 4KVAA 2CNBA 1EZ4A 2WFLB 3Q7QA 2GUGA 2YWHA 1VL8A 1ZH6A 1ZD2P 3ZCVA 4BO1A 4DHWA 1EFVA 4DQ0A 5KTTA 3ENVA 5B1SA 3GROA 3ESQA 1D9XA 1G2QA 1H94A 2V5VA 1CS0B 2V7GA 3G68A 3HUFA 4X7RA 3WKBA 2FUEA 3STVA 3B85A 4I8XA 1TXGA 4V0SA 2B4YA 1SVKA 2GZ2A 3E7FA 3G2PA 4XB6B 5E1OA 5H02A 4X6XA 2P4HX 3VBCA 2HLNA 3PGKA 4AWXA 4RTRA 2ZUFA 3H8VA 1YS4A 1L6RA 3C0KA 1GR0A 1PJZA 4RPIA 3O8BA 4Q7EA 5IJ0B 3OQNA 4GPBA 1GL9B 1VG0B 2GBLA 1WCWA 2O7QA 3COYA 1LGYA 4BNDA 2XPCA 3CH4B 4Q9NA 3UY4A 3ERCA 2A4KA 2Q1SA 4P8RA 1EFHA 2V96A 5JCOA 4RHUA 4ZPJA 3AEYA 4DVJA 3CONA 1Z4JA 4D5EA 1O6GA 3IQGX 1F8FA 2ZK7A 3G2JA 2VH5R 3T5AA 1ZOOA 2DP4E 3OQJA 2FSSA 4HDMB 2O07A 2FSUA 3Q7TA 5IMBA 1YQTA 2ZIAA 4DMUB 5KQLA 2OCBA 1ZNWA 1E9VA 1LLDA 4DLSA 3LBHA 4YAKA 4ENPA 1R74A 5L3VA 1Q7EA 1TRKA 2C00A 2IBMA 1MOZA 1KZHA 1TJ5A 2GJSA 3RV3A 3I9FA 1WPQA 4TYPA 3P5BA 4ZIRB 2WABA 4Q7QA 1SURA 2VIIA 1Z83A 3PK0A 1DAHA 3BN3A 4PGFA 3BSYA 4TMYA 4R68A 2PX6A 3NHWA 3ONWA 4R41A 4OGKA 2GAOA 4JI3B 1SA0A 1TA9A 4KK4A 1XVIA 4H16A 3K2QA 2A7XA 3O4RA 2I76A 1X3LA 2YXNA 5E2AA 5TQVA 1E3EA 4B3GA 3AOEA 1T0UA 3TGLA 3AERB 1XZDA 1XTRA 2QPAA 3A1VA 1I30A 2EDAA 3D02A 1N5JA 1DEHA 4BO5A 5LQDA 2WAXA 4ZOLB 1EVIA 2PNFA 3PC7A 4N0MA 3TD9A 3UATA 1E2PA 2QTLA 4WA7A 5B57C 5C1PA 2DWQA 1HI9A 2HDWA 3ETNA 3ZCPA 1XNHA 2VTBA 5DM2A 4CGZA 5EEHA 4LOAA 4UUAA 1E1MA 1B76A 5K0BA 3FD8A 3B38A 4L0QA 1DIRA 2VZLA 4EEZA 1BVHA 2YHUA 3SHFA 3WYAA 3RWBA 2ZETA 4LJ9A 2YWXA 1KKMA 3G0IA 3I1FA 3OX2A 4WECA 4J6FA 4HYYA 4ZGGA 2V7XA 3PQ4A 2ZWOA 4G01B 2EEZA 3UHJA 1XXHE 2OCKA 3T3DA 1E4EB 3LBFA 5AOCA 4XQ9A 2MR6A 3ZBQA 1AGYA 1Y81A 2GPAA 4PYIA 5FA6A 4R2IA 4PLTA 1U9IC 1VL2A 1IBLB 2ZIUB 3FIUA 3H97A 2FHPA 4ND1A 5CXUA 1SFRA 5KTYA 3IP7A 4PGAA 2X7HA 4B6FA 4FK8A 1QMPA 1TECE 4LV8B 4K9RA 3TQOA 4WOBA 3UN1A 4X1KB 1ZCBA 1HMYA 4V0ME 1LD3A 1KDYA 5C4GB 2RCYA 4QEZA 2JRCA 3K0EA 5GVRA 3V8QA 5AICA 2FWMX 3HC7A 5ER9A 4Q6BA 5BOSB 5IAAA 4RTJA 1WA5A 4NJEA 1UJCA 4HGNA 1A9QA 2AYYA 2HDNB 4BVHA 3EB9A 3S8MA 4ZHSA 4LOLA 1A04A 4QUKA 4J0HA 4BQQA 3JR3A 4GO1A 4G86A 4J0QA 5AM1A 5C7OO 3WICA 1Y7IA 4G0PA 4EAQA 1Y1KE 4JV5B 1C3EA 3L8CA 3VR4A 4YHHB 4RLQA 2DEUA 5SY6A 3SXUB 1WEHA 3E15A 2ZCUA 4JJIA 1D07A 3E81A 3WX0A 2FOIA 1NW3A 2P3QA 1WCV1 1QU3A 1DAKA 3NB0A 1DWPA 5AVWA 5FAKA 5JPDA 4C43A 1ZGHA 2C57A 4CMIA 3KEQA 1X0XA 2VG8A 2XHEA 4HO1X 5JRDS 4P84A 4PCAA 5ICFA 1PR9A 1JEJA 2QM7A 2AB0A 1S3GA 3DEHA 1LSOA 3CVJA 2ZXEA 3ORQA 4A8JC 4BV3A 4DJFC 1P2TA 4KXLA 4PGGA 4Y2VA 4ZDKA 3GAFA 2GILA 2JI6A 3JQ7A 1W581 5E3IA 2ZYGA 4BGDA 3FB1A 1TTQB 3DLCA 3QUBA 5FUXA 4GSKA 3QENA 1BFDA 1SXQA 2OTCA 3GVIA 1WUIS 4BGEA 4HK4A 5ALZA 3MAAC 1IUKA 3KB2A 1BXZA 3FCUB 1G6HA 1VXRA 2HEIA 2WAYA 2X5JO 1JR3A 1VZ3A 4YJFA 4IIJB 4U63A 4PIPA 1UOPA 5EYPA 5KNCD 1QK4A 1XTKA 4Y7CA 4G4SO 2IU4A 2IYAA 3O93A 4RKYA 5JNLA 3TJMA 1XDUA 2G1KA 2FZ5A 2Z3VA 1H0HA 3LUKA 1OWPA 1QV7A 1A4UA 1KR2A 2A4MA 2DOKA 3CNHA 3PRJA 1YDHA 3G49A 2ARKA 5BVHA 4M7OA 3RSZA 4ZANA 1HDZA 3LPAA 3VZQA 3VKFA 1VOTA 2VPQA 3TTSA 1X80A 2PAFA 1JIXA 1M34B 3H3XA 3KX2A 4U00A 3H6GA 3ROPA 3MJEA 1VG9B 3S2FA 3VMFA 4JLKA 2CBZA 4W82A 2Q0HA 4L6CA 2F55A 4G5GA 1GSIA 4OQMA 1W0CA 2NZJA 1I3KA 3EZ7A 4V0QA 3UQYS 4EUKA 1ZGJA 2I8LA 3GELA 4INOA 1QS0B 2FF5A 3KZMA 3ZV5A 3JVUA 2FPOA 4LFCB 5EJGA 1NJ6A 1TAGA 2HJ9A 2ZG6A 3NTUA 4GEKA 4BO3A 5HGXA 2CBXA 1FYWA 2CLOB 4OQDA 3VKWA 1SR8A 2EG9A 4KWCA 3ZC3A 5B3LA 3H9GA 1NMSA 2XXJA 5HS6A 5C46F 3CVYA 4JY7A 4PG7A 3U3DA 3KALA 1N25A 4A0RA 2W7TA 2JD0A 1XQ9A 2N47A 3EODA 1MP0A 3FZNA 3UKJA 1ST2A 3VNSA 4NBUA 1WETA 3AMVA 2BDUA 3JZDA 4ZVNA 4BX9A 4WBNF 2R65A 2OORA 4JUIA 1T8PA 2IZ5A 1JYFA 2I29A 2J3MA 4HWOA 4MGEA 5FUYA 4EHNA 1BXGB 1MO4A 2VK1A 1HQCA 3TBHA 4JR1A 3Q1LA 5I8PA 1T3LA 2HJGA 3AJAA 3PD0A 2P4EA 2I2CA 4WEOA 3ZR4B 2X77A 2ZUUA 4GBED 4RE6A 1K3UB 5E9WA 3FTEA 4IDEA 3RUFA 3AG6A 3ENWA 1YCGA 1YFKA 8GPBA 3AVUA 1MTZA 3CS3A 1I24A 3GFPA 4YJKA 1YS7A 4NCJA 3VNBA 3JTEA 3BMQB 3EGXA 3BC1A 4OLHA 1JEYA 3DBHA 1VIAA 1X1QA 3ETLA 3AYZB 1LQTA 4PGHA 4TTJA 3A9TA 1TF7A 4BGIA 2ZRMA 1G8YA 1OGIA 1YOVA 3HBMA 3UZUA 1V8ZA 4RK1A 2IJGX 4EJSA 4QG3A 2OFWA 3LC1O 5E2IA 3SBOA 3NQ41 2QPOA 4G9BA 3SIWA 2K4MA 1JFLA 4S0ZA 2Z6VA 3AUAA 3BDVA 4PN3A 1D2CA 3A3KA 1G18A 4XIYA 2GVNA 2VRBA 4G37A 4RCVA 1IB0A 2QP3A 4MWZA 3UK7A 3NV9A 1FP6A 4FWBA 1ORWA 4KIFA 3AR7A 4W99A 4IH1A 4BWGA 3WIOA 5G1NA 1RJ9B 2BEVB 1E6WA 3KOWA 1BTOA 4QTUB 1C8KA 4IHKA 3QKRB 3UC9A 1PK8A 2H06A 2RJ3A 3RW9A 1UKEA 3ZG6A 2DR2A 3RS3A 4ZFNA 4G6ZA 4PAMA 3B78A 1YMQA 5EP2A 1RM5A 4IICA 2AYXA 2WAMA 4XA8A 3KLBA 1R1DA 5CNMA 4MYUA 4GRIA 1IHDA 3E0XA 4EB3A 1EKXA 3V4LA 3TNLA 2RHLA 1W4LA 1E66A 3I9LA 1E89A 4B0PA 2LR0A 4C88A 4BZZA 1OLSB 5J47A 1CRZA 1QH8B 3NX4A 2JIMA 4IDHA 5FYDA 5EMMA 2JD2A 5FBKA 5CPBA 2ODEA 1ZIYA 3CT6A 1DOAA 3G8CA 1Q0HA 2G07A 3CJQA 1W29A 1N8SA 1SBZA 3V4ZA 5KSOA 3VR0A 1GGFA 2A0UA 1GQRA 4K9PA 4PQGA 3W4JA 1JHZA 4TMWA 5AKEA 3BH6A 3N2GB 4U2KA 3UWKA 4N82A 1B2RA 3VV3A 1OFGA 2I6QA 2GR9A 1G6OA 1TVKA 4IF6A 2FFRA 3FSJX 2VHVA 3PG5A 4TMFA 1AF4A 1WMBA 1EP9A 3A6KA 2ZB3A 3BIJA 3ZDEA 4JHXA 1PTJC 2IVFA 3EOZA 4KKXB 3R74A 2GZ1A 4M4SA 4RTSA 1JFSA 5K3FB 5ICMA 1SHKA 1IB6A 3MOIA 5D5QA 4K6FA 2RHDA 2MTBA 3IR5A 4N76A 4A4DA 4CM9D 3GX1A 4KQ9A 1GARA 1OI7A 2FFQA 1W5SA 5B4UA 1C30B 1E2QA 2VF8A 2V98A 2WD8A 4PLZA 4HATA 4X7MA 2BFFB 1P2UA 4XDGA 3VDNB 4UCWA 3ZJUA 1T3GA 1PX2A 3LUAA 4JVLA 5MFZA 2FRXA 2NMVA 4PQRA 2Y76A 3MRXA 4BPBA 1MAHA 4M1QA 4CMBA 2QHXA 4HB4A 4IJMA 1TA0A 4NZOA 4HN2A 1NOIA 2PUWA 1FJGB 3G2IA 3X1ZA 4HSGA 1TQ4A 1NRXA 1D2GA 4JQYA 1JQ3A 1VPVA 2JGKA 3AL2A 3RYCB 3M82A 3EOAI 2HY7A 2VK2A 3PBKA 2ODAA 1XP8A 1QHXA 2CKDA 4DJTA 3HSKA 5TY0A 1YUBA 4HDCA 4YJHB 1VLLA 2YS6A 2XOKD 4ZZ2A 4DR5B 1X87A 1JDNA 3WBBA 5IJXA 3K1JA 5KNCH 1QH9A 2B7BA 2UVDA 3AB8A 3GLGE 3H1BA 3B9RA 1DLJA 3JQAA 1M67A 1NBWB 2JPDA 3IUBA 1QLWA 1OAOC 1L7NA 3SCZA 3TD2A 4BB5A 5A9SB 5CD1A 4F9TA 4MLZA 2CXOA 3BK1A 2HCJB 3G0DA 3ZDRA 1TUEA 2G5TA 2VC2B 2GZHA 4G09A 2JEOA 4HUQA 4B3HA 4D81A 3EXEA 4Y6SA 1HZJA 5FWAA 5A3RA 2E87A 2B69A 3TCXB 2YQ4A 4JN6B 4K9MA 2DFNA 1RQGA 4W9MC 3G23A 2EC5A 1YQ9A 5AO9A 4B8ZA 2JCBA 5H3HA 1MGPA 1ISSA 1P8JA 2FWAA 1ACJA 1BMFD 3LSTA 3WNCA 4DIKA 1NXOA 2ZAMA 3ZKWA 4QDXA 4GP6A 1HTTA 2O9JA 3HJHA 1GGEA 1OFUA 2R8YA 4WFJA 3UMSA 4FR0A 2XYHA 1KZ6A 2NU9B 1E61A 4YUWA 2VFAA 3JATA 2IPAB 3GYGA 1ULAA 4DNXA 2FR1A 3DF7A 3E6AA 3PA6A 1PP4A 5AVYA 1DBSA 4QUIA 3KYDB 1ZD8A 4GPAA 4XDZA 3W2IA 5FOWA 3JALA 3JQBC 1G2PA 2WIGA 1G17A 1HC7A 3U60B 1DAEA 1E7QA 2C2WA 1KHHA 1G8PA 3R0ZA 3AOGA 3ETJA 4GKKB 1GTL1 4K46A 4IOJA 1DC4A 1VYTA 4ILKA 1MQ8B 2HD4A 3P7MA 1ORVA 2DHDA 3OQOA 2QLBA 3L18A 3RO7A 5EJEA 2FWBA 2I7CA 1K27A 3AR2A 3DXZA 1N36B 2NLOA 1YJXA 2EFDB 2QR3A 4KRYA 3RF7A 1E3TA 4B9AA 3FCEA 1TOAA 5EJ7A 2J5KA 1KOJA 3FI9A 3CCFA 3KTOA 3SC6A 1N1GA 3TO5A 3Q2KA 4LJKA 1RKXA 2F3SA 1BVRA 3EIWA 3G2LA 3O2NA 3VM6A 1OYYA 4HB3A 4BKRA 1SCUA 4FJ2A 2Q4TA 3MYRA 3Q8XB 5KCMA 1VPWA 3CVXA 1L4GA 2IU0A 1AB6A 4R05A 3CX8A 3REGA 3KYJB 1P45A 1SOWA 3PJFA 4TSFD 4WJZA 5CDTA 4UC0A 4Z4EA 1KJIA 5H80A 4ENRA 3AVQA 3F9IA 2CY0A 3ZH9B 4A8PA 3DSRA 1SY7A 5T3YA 5IT5A 3C48A 1G9TA 3FMOB 2ZYHA 1RP7A 3BCHA 4QGGA 3WGNA 3ZBUA 5BV2P 5TSDA 3ZTYA 3QJGA 1G5IA 2YJZA 1WXDA 2HAEA 4RZUA 1W85A 5H8WA 4RLFA 2OXFA 4M6WB 4N5MA 3QXGA 4A6XA 4U5QA 1VE5A 3ZWNA 2I55A 2XUQA 3DZKA 3G82C 3GUVA 2GASA 1WKCA 3V4VB 4US2R 5JYEA 5SZIA 2HDHA 4D8VA 1EX7A 4ZPXA 2B78A 2ESRA 3MNFA 3OZXA 1II9A 3OURA 2Q9BA 4MEJA 4PYRA 1U3TA 1KO1A 2O0LA 1P0CA 3R5TA 4M9QA 1H9CA 4H35A 2EP5A 4UTZA 1VJGA 4EDFA 3F96A 3LZ6A 5C35A 4M98A 3NNNA 3NPAA 1R6AA 1M2JA 1UPTA 4Y7DA 3ZCSA 3GG2A 2DWCA 2HR1A 2X9NA 3MBIA 4A5OA 3TSCA 2NACA 1CVIA 4CKZA 1FXSA 3EVFA 4U8HA 1LI5A 3UBTA 1HTBA 3N5CA 1N34B 2IQIA 5C5EA 2G5GX 5BUCA 1PYOA 3EPKA 4ESHA 3LBIA 3ADBA 4EUSA 1GQOA 4DGSA 1EU1A 1G7SA 1E32A 2GWHA 5FV7A 5IJZA 3DQPA 4G4JA 1U7TA 3OY7A 3C43A 3ELDA 5JDCC 3CR8A 4C7BA 3FVVA 3P2YA 3PZRA 4CV0A 4Q82A 4NLLA 3QU9A 2H17A 3THXA 1PK9A 4KITB 5HQTA 3R4CA 1C1YA 1RIIA 4UVIA 4BKQA 1SCDA 1IXZA 1QV6A 4D0SA 3H87A 2M6SA 2E4YA 5IDQA 1GQQA 5K20A 1AUPA 2K2WA 2N42A 4NX2A 4X95A 4HTAA 4FFDA 4OLJA 5JAHA 2UYOA 4FZRA 4R8LA 2OQVA 1KAHA 3VHRA 3JYNA 3I76A 1NBMA 3OJEA 4JKIA 1MAWA 1P6UA 2KS6A 1ITZA 5DISB 1BCRA 2JCYA 4KE8A 3K6SB 4OK6A 4FP9A 2OUKA 4RD2A 2V7TA 1GSOA 5ICSA 2WHRA 1JHDA 4R5MA 4WXEA 2CVOA 3TPZA 5KWIA 4BNHA 4ZTZB 1QFYA 2I6SA 2GF2A 2BFBB 3UENA 3E9NA 3L9WA 8AT1A 3E4CA 4DIBA 4HI0E 4DXDA 3VC1A 1DO0A 1O3YA 2KLHA 3K8ZA 4EY8A 1HLPA 3TH5A 2Z57A 4Z8YA 1Q2XA 4B4KA 2HRRA 5LOVB 3A6GA 3QI2A 3LA6A 4TV8B 3N05A 4EHKA 2WPDD 3BCRA 3RVRA 2WE8A 2HCTA 4KQ2A 1VIVA 1FNBA 4FEEA 3QUTA 4LN1A 4NZ9A 3GJYA 4ZO4A 3H2JA 3QWAA 3QBJA 1H8HA 3BGSA 1GTG1 5ALGA 1CY1A 2FSGA 3WQRA 3WLPA 2HA4A 4Y8VA 4BVGA 4E30A 3Q3HA 3WMEA 1GUDA 3O84A 4JYBA 7ADHA 5B58T 3DGFC 3I92A 4CEJA 5TJ9A 2GAAA 1VRVA 2ZYDA 4R9NA 4REQB 1A9PA 1DAMA 4QGAA 3VI4B 3KJQA 3OLQA 1ZJJA 4TN5A 3AM4A 4PZPA 1T6XA 3W79A 1DCKA 1K8RA 3RVSA 1YRYE 3V3TA 1EI9A 3HACA 4YACA 5D6OA 5H5JA 4M0PA 2JHPA 3DOIA 4H7DA 2Z5FA 3DL0A 1A8QA 5ECGC 3A1DA 1ZUNB 5K3AA 3GGCA 3GLHA 1E6UA 2YL2A 4GLBA 1V2HE 2G25A 4AKHA 2GHQA 1GG2A 3RSFA 3UMJA 3HXMA 1W5TA 1RLOA 1PV2A 2H4FA 3SOPA 1ULBA 2PO5A 1WUKS 2FWRA 3GWGA 3NDRA 3AONB 1X1RA 2GKSA 2WSSD 1NFRA 3R3SA 4UDXX 4F7WA 2OHJA 2WW8A 2ZE8A 3PPWA 4IQFA 3P9NA 3KHTA 3L05A 4ZQHA 5E7IA 3VPHA 1FU8A 5F52A 4MWSA 1NWHA 3CCCA 2C82A 5H59A 2GX6A 521PA 2AVNA 2AJ8A 3WYCA 3ESBA 4G2NA 3B1KA 4D82A 1B41A 4B40A 1U4NA 4D3XA 4R2WA 5HEKA 3EBLA 2WUDA 4S1TA 4CVNA 4JVMA 4EG6A 2QM8A 5HFAA 3SN6A 2CL6X 2PZJA 2W2NA 1I5OA 5LQKA 4DLRA 1VBFA 1TJYA 3IIIA 1M3SA 3LGXA 2DC1A 2EQ5A 3NKFA 1YNOA 3OEHA 1VA5A 4EG5A 4EW3A 2XF2A 3SJAA 4P3OA 4YLYA 1QNLA 3K9NA 4FDAA 1LNSA 1R2QA 4FSXA 4MVJP 3W0LB 2GLTA 1RHMA 4FHZA 1EQ2A 1IBSA 2R48A 3EGOA 1MDFA 2R1VB 2V4MA 3H8WA 1UBEA 3IP1A 4IUYA 5FLYA 5HCIA 3NAZA 4F2WA 3NPMA 1RXEA 1OT3A 2EKLA 5KYYA 4ZO8A 1PHPA 1Y9EA 3WZLA 4EHBA 5CAEA 5KX5F 3VJRA 2X3UA 4ESEA 3LGAA 1NUPA 1K4KA 2BGKA 2GD2A 3UB2A 1YSCA 4MVJF 5AJTA 3SSOA 3RGGA 3VU0A 2CLIB 3EMVA 4K1XA 2O1SA 4WADA 4CLOA 4CKCB 4MV0A 3RYIA 4TLMB 4F6RB 5ECWA 4MARA 4UJ3A 1IRIA 4AZVA 1RPAA 1P1IA 3L1UA 3AJEA 2C4WA 3BGVA 3LOPA 2CFRA 4AU1A 2R66A 2XSZD 3ABQB 2XNSA 4JUDX 4RSRA 1YE5A 2ENUA 3KQMA 4YYZA 5I9NA 1UMBB 3M9WA 2NSLA 4KI7A 4UXIA 1QX3A 4B87A 4QPZA 1MOSA 3ICVA 1D4AA 4IY1A 4A0GA 3TSOA 2GARA 5EKSA 3NH9A 5BSFA 2XCQA 1VL1A 3GFOA 1VKOA 2OO5A 3IB6A 3FHJA 2J32A 3MINB 2ACEA 4LE2A 4JOCA 3M5WA 5L45A 2HNAA 4LYDA 4BNGA 3R7NA 1LZLA 2P6OA 2O8NA 2J5QA 4J0GA 2E2WA 1XPOA 3JWGA 1S9DA 4MCJA 3QEBZ 3KWFA 3VVBA 2GT1A 3HLKA 3NBYC 4AJHA 1L8LA 1JPNA 4EHLA 1G7TA 1U7ZA 1M5RA 1M1UA 1KVQA 1VBNA 3A26A 5TMPA 2CE2X 3CW2A 1MCZA 1P77A 4RL6A 3W04A 1JI0A 2CD7A 2C9ZA 3FA2A 3AVWA 1F8XA 4XJXA 4BGVA 3PFFA 4EJMA 3K1YA 5DXJA 2FZWA 3EXIB 4EPYA 3F8WA 1P2BA 1X7YB 4DNFA 4QLAA 1DKQA 1TE2A 1XBTA 1RI2A 3QYPA 3PLAE 2C8KA 4KFUA 1HKHA 1SQ5A 1AC5A 1E1LA 1WVGA 3CT4A 4YP1A 3TVDA 2O6HA 4JI4B 1VGRA 3OJXA 2G77B 1CJBA 4XQ0A 3KWMA 3ISJA 4ZT3A 3FVWA 4YT8A 3RFCA 4HH4A 3NHYA 3LDUA 5K0GA 1O08A 4BWYA 5AUQA 1JAZA 4NV3A 3VMMA 4Z53A 3BIOA 3SP1A 1E8DA 3R0JA 3MWJA 2FUCA 5A0FA 1Z33A 4ODIA 3KOMA 2BDEA 1OLOA 2YZMA 3N5KA 5ALEA 1SN7A 2B1JA 2WF9A 3L1IA 3O7MA 2HMVA 2AZ4A 1NSFA 3HFGA 1Z73A 2GYVA 3SMQA 3OFVA 2JDID 5BN4A 1GXSB 1QG6A 1Y37A 3R2JA 1VHLA 4IIHA 4MA5A 4D3SA 4K6MA 1QFZA 4MS4B 3QG5A 3H4TA 1E4OA 5A3SA 3I23A 1E1RA 4K6CA 3DCYA 3IMEA 2LKCA 4N0PA 2H4JA 4OHWA 4V0LA 2L2QA 1X7WB 3SK0A 3AIIA 2R87A 4UHJA 1B6TA 2ID9A 1EXVA 5IN4A 1XVAA 2V4UA 4ZKDA 4JZYA 3VYVA 1T2DA 1YFLA 3N59A 2O7VA 1KFEB 2PZKA 2CJWA 2WKQA 3A9UA 4MW5A 5FBRB 2GN9A 4L76A 3TXAA 2F1OA 2OHXA 3SMVA 2O2SA 4NDAA 1ZIDA 3CTMA 3DEJA 2EYUA 4GU5A 1GKIA 3KTAB 3COSA 2VHQA 2WG0A 1XTIA 5JSZA 4D96A 4LX0A 1PR5A 5B3KA 1A97A 1W6RA 2QRUA 2R2GA 2C5AA 5TPWA 3ZHCA 2PUBA 4IPTA 5ALNA 5ALYA 4QJ3A 4R1LA 1WV0A 1W48A 1HM5A 4HWKA 4P32A 4AF7A 2QYOA 3M6FA 3PXDA 1ZCJA 5JVDF 4IHJB 1CJMA 1V16A 1VCNA 2I62A 3IE1A 3MVEA 1CU1A 4DR7B 1CV2A 1IBRA 4OHCA 4QNNA 2VYCA 3Q7EA 3WLLA 1YJBA 4FYIA 5IF9A 5DHSA 5EMLA 3TF5A 1PZMA 4ZYTA 1WSWA 4MKXA 2VQ3A 4AF6A 3PUHA 4P54A 4TS1A 5GGXA 1YIAA 1MV8A 3OUZA 1AQUA 1GZDA 2BFPA 3VO8A 2BONA 2ZSIA 2ZU6A 3OJCA 2Y2UA 3OX4A 1WDKA 1GTMA 4IVPA 4Y18A 3ROZA 1X1EA 4MRAA 4YAGA 5DNEA 5A3QA 1H4TA 5U9CA 5AVOA 3AKCA 4IKEA 2PKQO 4QFDA 4TS3A 2XNHA 1T8RA 2ZRFA 4ISCA 3VHQA 2Q1UA 4E09A 1V8DA 1Z0JA 4CQNA 3LXMA 2CVHA 2AQ8A 3MN1A 3QH4A 4KXWA 2BBSA 4A0QA 1O7JA 4B82A 3ZOKA 2RAPA 4C2TA 3OG9A 3PI7A 4CDRA 3GA5A 2QZ9A 2Y9MB 4WH0A 1OH5A 5ER6A 2PZMA 5EMJA 4EF4A 4O1MA 3CISA 5JJCA 2A1TR 3H2KA 2JIZD 1FXUA 2ZTLA 4OQ4A 3ID6C 3SE0A 1AM4D 1QYCA 5A4KA 1K6JA 2IY8A 4F2HA 3O5AA 4N49A 4W1QA 1W1WA 3LWNA 5CJJA 3RTAA 3TSAA 2VI5A 2QTTA 5K0SA 1JFTA 1WHTB 2SHKA 3KUCA 3LKZA 3AZQA 2YV4A 3VR4D 2C7OA 5AXDA 1N6LA 2WMYA 5TV2A 4E07A 4U9UA 2OQIA 1JQAA 3ZKAA 1WXFA 1W52X 2V03A 3M6UA 5EINA 3PFHA 1X39A 2PLAA 1L6IA 1PF7E 3CUYA 4LZZA 3W9YA 4A1OA 2JAQA 2ZJBA 1ZMRA 3K16A 1HSZA 2JFVA 2P9JA 4NJMA 3R09A 1T5DX 3CG0A 1I32A 1GT91 1XCLA 2O20A 3G8YA 3HXLA 3WY9A 1AV6A 2IP1A 2PSSA 3MQFA 1JEQB 5B7PA 4DR3B 3HYSA 2G4CA 4Q1FA 2Y6UA 2YWJA 4JOBA 2GK4A 3L8DA 1KP3A 1XAGA 4IEFB 4BJHB 1GAEO 3M6VA 2CYBA 1U7DA 4X24A 4C1NA 4WZAE 1ONSA 4LGCA 1V3QE 3X1KA 3ZPXA 3OHSX 1XRSB 1EHYA 3U7JA 1JR3D 4D0LB 3ZEIA 5BT9A 1AMOA 1L7OA 3D3EA 3LAWA 2W83A 1R66A 5JNTA 1JFRA 1E3DA 4KVZA 1OWLA 2AG8A 1CEEA 2IIVA 5TQ2A 3U3MA 4UE2A 3WJ7A 1IQ0A 1H2FA 1FLVA 1CUFA 1U6JA 2QR5A 4TROA 2H1VA 4GSLA 4LK3A 1DJQA 1QP8A 4ZZ1A 3BWXA 1NW7A 4R2KA 2NM0A 2OD9A 2HO5A 2QX9A 3GAAA 5EN4A 4EHAA 3QQPA 5IYZF 4K1LA 2DG2A 3B82A 4HEA1 2ZBRA 3K6RA 2M32A 3D8HA 2EX1A 3ORRA 3TRHA 4JROA 3H75A 1UPAA 1ZUIA 1G3QA 2GCOA 1F9EA 5IBQA 4QECA 5D1HA 4TSKA 2Q0XA 3NEPX 3IQIX 4B74A 2A7QA 2R1UA 1AK1A 4EVSA 3ZHUA 1IG0A 3GYBA 3HO8A 1MBZA 4PBSA 1C50A 2OMEA 4G1BA 1GOTA 4JSTA 4ENUA 2EG5A 1W19A 4EG1A 3FPAA 1CY8A 4MQFB 3OZWA 4JLOA 3DBLB 4R1PA 2OZEA 1M0EA 1AA9A 1TU4A 2HZBA 5I4CA 4L4RA 1DRJA 2HJVA 1NE2A 4LCJA 3DNMA 2BKUA 1EAMA 5DP1A 4DF3A 1PGJA 4D8TA 1DQZA 2O3SA 3PX2A 3DOUA 3ETEA 3WLJA 4HQ0A 5K8CA 3JQ6A 2AMYA 4O3MA 2HM7A 3U4HA 2J9XB 3KZ1E 3LJKA 3R20A 3CRMA 3R8XA 1ZVMA 3PNOA 4IXNA 4U7WA 1S1CA 3GLTA 4KXYA 2F48A 3UAGA 1VJ5A 2IPOA 5LM3A 3VH4A 2YUTA 1GGVA 3LRPA 4WXYB 1WIWA 5BWCA 1LBTA 3F6EX 4HX2A 1RPJA 1W5EA 1FFXA 1SCAA 4FNOA 3IALA 2FHSA 2FMXA 4RH0A 2FMIA 4BFVA 1T2AA 2A5JA 3JARA 3L46A 1LTKA 4DQVA 3NC1C 1CETA 3SEFA 2O3UA 4DJEC 4RJIA 2J3HA 4QODA 5I9BA 3SF0A 3AF1A 3HY6A 3UUEA 1UAGA 1TADA 5DYTA 1GM5A 4RXTA 1V5GA 3ZXXA 1Z35A 3I30X 1JB1A 2P62A 4ZALA 3Q0EA 4KGXA 3MMSA 1H1LB 1Y7TA 1MZPA 1N1MA 5IT9A 2JLSA 4NOKA 2ZSFA 2GAIA 2DSNA 5BR7A 5HP4A 3LXXA 2SKCA 4XSGA 2A78A 3H6KA 2G7MC 2ZRGA 2IYRA 3C6MA 3VSAA 4BFCA 1UZUA 4ZO9A 1QP7A 3PDCA 4DMKA 1G21A 1MG5A 2YJ5A 3R9XB 4DLPA 5E6UB 1AS2A 5FCDA 2BFEA 4H6PA 1KK2A 1RAHA 5KWSA 1JIIA 1NAIA 2O2ZA 4L5BA 2O0KA 3WOHA 4NBVA 2BE7A 5FBWB 2ZJAA 2A9RA 2B7CA 3PD1A 5A06A 5C7YA 1FDWA 2ZPUA 1FFEA 2J1LA 4TYNA 3JPWA 1E69A 4L8LA 4BLVA 1MNQA 1QHHA 2YY5A 3C1TA 3WOVA 3UGQA 4C6HA 2OEPA 1ODSA 2OG2A 3OLYA 2Y1DA 1X7DA 2E7ZA 3RFUA 3MMPA 2YJ3A 3IBCA 1O89A 1I7DA 2HA3A 4MR8A 3S29A 3QLJA 2QRPA 3HJNA 3WE7A 1DQRA 2PRYA 2Y1KA 3OZEA 1XZ8A 4TYYA 4P7GA 1T2FA 2EKBA 1VHQA 3U13A 1I1QB 3FBWA 3ZXYA 4DL9A 4QDZA 1F3OA 2PGJA 4M1MA 5C4IA 3VR4H 5KQGA 4DV4B 5D87A 1XZQA 1TPZA 4G97A 5J1SB 3RM3A 2YHAA 3GUYA 4ER6A 5B3JC 3G2NA 5AJUA 2QF7A 3C6BA 3ML1A 3EUFA 5JCJA 3D54D 5D84A 3QFTA 4H7PA 1I7LA 1LC0A 3HKEB 4OXQA 1RJFA 3BFVA 1U3GA 2ZB8A 3KKEA 4S1PA 1R8SA 1E7RA 4LNUB 2XVZA 4ONEA 4TRRA 5P8WA 3HADA 2QAGB 3STXA 1FUUA 4U7PB 1FRFS 3L40A 3VDXA 3U9LA 3O38A 2PXCA 3B20A 1C3LA 2A0XA 3WBKA 5J1TB 2QVLA 1FFAA 3J7AC 1W46A 2XJ4A 3OTWA 2XNDA 3C39A 3QKUA 3RAJA 2ZB4A 3JQGA 1RLTA 1ILWA 2COEA 4RBNA 5JPIA 3ZCXA 4AS3A 2ZUTA 1KI9A 2J3KA 2XYGA 2I4NA 4U7DA 3UYKA 1MJGM 3QMWA 3UVEA 4JB0A 7MHTA 1E58A 4JT9A 1V3TA 2J6BA 1YR7A 1WTAA 3IAHA 1NGSA 2VTDA 3JQAD 3JD1A 4IIXA 2HTFA 4X61A 3WZMA 2A9JA 4CODB 1KMIY 3A0UA 1MB0A 3MD0A 3WIUA 3JWHA 3M4YA 5E7JA 3LLUA 4HLUC 4KMRA 1N0VC 4PTZA 3JR7A 1FUIA 4ZZ0A 3VC2A 3C4JA 3O3OB 2VDQB 1L5HA 3FTPA 1R0CA 2WILA 3C6YA 2LCIA 3JY6A 1N5MA 2R7NA 1U0HC 2I2AA 3L4BC 2XVMA 4HH0A 2W6JA 1JHMA 4KXXA 4DA7A 2JAWA 3IBGA 3QVSA 1D8AA 5HCNA 3EWIA 2WLTA 4FJ0A 4XGKA 1LRLA 5C53B 1JVSA 2OCDA 2QM3A 3PWZA 1MJGA 5EIAA 4CCAA 4R16A 1PW5A 2PMDA 1N2BA 2D2EA 1GL6A 3U40A 2IBTA 1YR1A 3VR3A 4X64B 4JVOA 3P0EA 4GRAA 4OO3A 4JC8A 3EVBA 3PEVA 4IYRA 4MJ7A 3AEQB 5B5SA 1JPVA 4EVQA 5ALPA 2HMSA 3K32A 4J16C 1XNGA 2WU1A 4YT5A 4AECA 3RAEC 3M1AA 3P32A 3BQ9A 3ILHA 2VEDA 3O2QB 1HT3A 4R54A 3VUFA 5EL0A 3ZS9A 1SUSA 2VAWA 3LTEA 3JYOA 3L84A 3ZX5A 1SU8A 3EWSA 3O8QA 5JASA 2VNSA 2ZCVA 3KHSA 4WCFB 1SOMA 5CA1A 1ZM3A 1MW8X 3DVQX 2D2IA 3NIDB 1GTVA 2JLRA 1T5BA 4QXOA 4TTSA 3VZSA 1Z15A 5K3EA 1DIOB 1SUAA 2VUSA 5FPPA 3RIXA 3P2KA 1UXOA 2X9VA 2V1XA 2JGLA 1NT2A 2QXYA 4X41A 2LCQA 5K45A 4LF9B 1NQ5A 2VDKB 5TQ0A 3PQDA 3QY0A 2OSVA 1TL7C 4GAEA 4YJ3F 1VKHA 3GGSA 2WJZB 4V0OA 5GONA 4C20A 1Z17A 2J30A 4WKPA 2OV1A 3CSDA 4CMAA 2V6GA 1ZA1A 2CVZA 2VF4X 5CA0A 1O94C 4HOYA 4XD2A 2PZGA 4XVHA 1KC3A 4M8SA 1JW9B 3LKBA 5LB4A 3KOUA 1YBHA 1PJSA 1LFDB 4EL5A 4XAQA 4RETA 1UPCA 4FMDB 1Z25A 1T24A 4GMXA 3UUFA 4DDVA 3P94A 2D1SA 2NO1A 2C20A 3CEMA 5F1KA 1VPDA 3THSA 3TMYA 2J9YB 4C7KA 3H5VA 4M76B 1FUKA 4TRMA 1SNYA 4DW8A 4KO2S 1Y63A 3B9QA 4UJ5A 1OB5A 4ALKA 1FNNA 1C0IA 4L27A 4Y6GB 5D51S 1C4XA 1M0SA 1OU4A 3JQ9A 3N2EA 2XT0A 3VC7A 2FPLA 4BKMA 4AQ7A 3X1MA 4PZZA 2Z2XA 1SOAA 1V8PA 3I73A 4YIKA 1PWHA 1X3SA 4BMDA 3UAZA 3WL4A 3LX6A 4Y0NA 3N1UA 4K9NA 2Z0MA 3FNRA 2PEZA 4N7BA 4E33A 3ELYA 5G3YA 5CCDA 2DWPA 2GM3A 1P7YA 1E5TA 5CBPB 2ILTA 5DXAA 2AI3A 1BRMA 2ZT8A 4Q4HA 5L6MB 2CDCA 3HKCA 3MJCA 3CWQA 2DPYA 3UJ3X 1OIXA 4NCAA 1THZA 2QTVA 4JUBA 1JF8A 3CUUA 3QYAA 4QICA 4WJLA 3VJKA 1J39A 1HR0B 3O26A 5KNBA 3EGDA 3LT4A 1JKIA 2RKOA 1J07A 6NULA 2WJGA 3B2NA 1UBCA 2R6R1 1XF9A 4IEEA 1VLQA 4LWZA 1J8FA 3HLYA 3NIFB 2W2TA 4G4GA 2HU8A 1ZP6A 2NTVA 4AK9A 1DARA 3HJRA 5C7IO 5I8ZA 1NJ2A 3D6VA 5AIBA 1SH7A 4PYJA 5T8KC 2DQ4A 1T26A 4LC0A 4TMKA 5I4IA 3ENQA 1ZCAA 1EFUA 1FL9A 1JZQA 1NVTA 1QJCA 2IYXA 2AYZA 1LPPA 3IEKA 3K30A 1AO0A 4DR6B 4W6ZA 1QQ6A 5KYXA 1YL5A 3EEFA 1QCDA 3R7WA 4NV0A 1GUFA 4QXQA 4RADA 1F7UA 1XMXA 2ADOA 1IN8A 2AH5A 3Q0IA 1XV5A 1I94B 3PVSA 1SQGA 1SVMA 1YL7A 2GFIA 1GILA 1K6EA 3TGWA 1C1XB 3L0PA 1I13A 2G70A 3VUEA 2FPGB 2UYHA 2ZSHA 3FFAA 3O47A 4UCXA 3HVRA 2E37A 4DIOA 1DXYA 3LPCA 5ALIA 2RHMA 3JSAA 5IH7A 1T15A 1BZYA 2A33A 2QVBA 3B51X 2VUTA 3R3JA 4BQRA 3D1JA 3QPDA 2XB4A 4URXR 1VLMA 3KOYA 3UT0A 3L43A 2UUBB 2XA1A 4H7KA 2BZ1A 1SXHA 2WP0A 4GHWA 1T0PA 2H3EA 4DIMA 3GLFB 2PJDA 4M1SA 3QPWA 3NTQA 4KIWA 1QIIA 1VP3A 5F1PA 1GNRA 2PJUA 3I4LA 3KFVA 4WESA 3E1KA 2PU5A 3M5PA 1X77A 3HKDA 4KQGA 3X1DA 1ZFNA 4MITA 5CX1A 1YVEI 2OP0A 3PUXA 3EEIA 2IK8A 1TC2A 1MA3A 1F8YA 1H8HD 1R37A 2VSXA 3LCUA 1W2GA 5AT1A 4FMCB 3USCS 1Y3FE 2AOTB 4I55A 4EG7A 2QVYX 3LU1A 4E2XA 1T8TA 1L5QA 5HZHA 1GQSA 5E2BA 4WDQA 4W5RA 2O1WA 3FBGA 2RGAA 1U4SA 3P4XA 3H13A 4RQTA 2HYDA 3RIEA 3ZD9A 2I3AA 1CNFA 2QW0X 2D2XA 5BNTA 3GFQA 1N6NA 1YR3A 4CQLB 2RGUA 3WADA 3U80A 4Q4AA 1JGTA 1UR5A 2H85A 4PNZA 3T41A 4F85A 5H4GA 4K9OA 3OBBA 2R8BA 4FUTA 2AK3A 3K9CA 4GOKA 1XHEA 4I1UA 1G5TA 3UMVA 1QHYA 5E0KB 1EYZA 2JAXA 2VJNA 1DG3A 4OPMA 3NEYA 5IBRA 3WYEA 1QGZA 4YJ2B 1R12A 4YUZA 4RC9A 4IDFA 4EAAA 4TWAA 5EJ2A 1JEDA 1ADYA 1Y1TA 4NRDA 2HK9A 2IYQA 1USUA 2WFMA 2Z56A 3H3JA 2XV1A 4F6CA 3DBRB 1C7EA 3D43A 3OIFA 1QGAA 3O4FA 4HG2A 1SQSA 1I1OA 2ATCA 4KAAA 3I5XA 3VAZA 4QAQA 5I4KA 3EVZA 3ZOZA 3U1VA 1K3TA 5L9AA 2FFHA 3GJ5A 1RW4A 2EGUA 3STHA 1D0IA 4NAUA 2JFQA 3M70A 4NCNA 3H17A 3VJMA 1AIPA 2FWJA 3EXG2 3W77A 4CLEA 2NTYC 1BEZA 1SC6A 3JQRA 4EITA 3VDRA 3E5NA 2X8JB 3TLKA 2X8LA 1V1MB 1QF7A 4X93A 4LDAA 4B2IA 4CM1A 4E5KA 4UFPA 5DBFA 1S2MA 3RB8A 3LT5A 3SFZA 4WN3A 1KAEA 3F2IA 3N58A 3ICPA 3NDPA 4Y0AA 3PKJA 3Q7RA 3GLSA 2Y77A 8ABPA 2ZBVA 4X71A 1J4AA 4GBMA 4B44A 1XDDA 2R47A 4UU7A 3PEWA 4CV1A 2PLRA 4PRKA 1MX9A 3TZEA 3ZQKA 3AWIA 1JEEA 4L5YA 2HJWA 2PCLA 2FRVA 3UT5A 4B7AA 5COQA 3L4KA 1T0JB 1I3OA 1M66A 2O2HA 2VJYA 1CB7A 4PZLA 2KBEA 2PGOA 3M6AA 5C1OA 1J97A 1P1CA 3EQ2A 4ZDIA 3DFFA 1G3RA 3PXEA 5TMDA 2QPTA 3BGIA 4DLAA 1ZD3A 2BUCA 3KAKA 3QUCA 1KFBB 5A9RA 2CEKA 1QZUA 4JBHA 2QIOA 1E9CA 3EC7A 3L6EA 4CQMA 2W0SA 2IF0A 2Q46A 4QOSA 1MC1A 4ALJA 3ORHA 5JZBA 3AX6A 4C4AA 5KZMB 1MB4A 3COVA 3NM6B 1MR3F 1KAQA 2OC9A 3NHLA 3RYFB 1HA3A 2J4CA 3DM5A 3KSRA 1BD3A 3DOJA 3B3AA 2C5BA 2F4NA 3L6BA 3N7UA 2V7QA 4R9UC 1SRRA 4RKWA 1ARZA 1NIJA 3OQIA 1OPRA 4QJ5A 1G16A 5CB4A 1J22A 4UBLA 4EGFA 1MX1A 1NPYA 1RYNA 4LI0A 2VO1A 4U6NA 4I1VA 4EATA 1EWTA 3KQVA 2J08A 4M8NE 5A6SB 2P5SA 4KZPA 3AUYA 3T5MA 2V5AA 3OSUA 5DM70 2C4TA 3OIGA 1TNDA 5AK4A 1W36B 3ER8A 3WV4A 2VH1A 4LQDA 2OB2A 4YV1A 4Y9DA 1BYIA 3IEIA 1UODA 3PGJA 3WL6A 1GA4A 3UPDA 3T3IA 4Q19A 3MTQA 4BUJA 3ITEA 1RXSA 4I4TB 4D5GA 4PLYA 5JQGB 1QAQA 4JC4A 2UUCB 3G9QA 2AF4C 2NUTB 1JSZA 2ZVQX 4TLAA 4UQPA 3K35A 4NU6A 3V4RA 3G0HA 4LVUA 1VIDA 3CZCA 4B6QA 3INNA 2IX9A 3FOWA 1RXVA 5EZ5A 3GJ4A 3OECA 5DP2A 1E60A 1NBME 3FYUC 4KHZA 2P8SA 4PLGA 2PX4A 5GV8A 4LZOA 4CF5A 3EUAA 3HBNA 5KBYA 1GZSA 4KV7A 2QGZA 5BN5B 1E2EA 4PY2A 4IUDS 5M3BA 5JALA 3EFOB 4R8VA 1CUYA 1Z4IA 3CZ5A 2JFOA 3ICCA 1E59A 1MF7A 5CXQA 1USIA 3B12A 1JG2A 1IEQA 1XN1A 3VBEA 4KUEA 3C14C 1XZIA 5FBLB 5HIJA 4F5DA 3FZQA 5IMSA 3WTBA 2H1RA 2EFHB 3B2QA 4FYKA 2V65A 4NZYA 4OMUA 4XCVA 5SYNA 5HJEA 4Q93A 5I7FA 3THYA 3EY4A 1G19A 1EQAA 2C3UA 2L19A 3NFYA 2Q5LA 4FJ1A 1CUGA 2SNIE 5GGYA 1Y4DE 3HH8A 4HQOA 4ECAA 1PT5A 1VMIA 4Y2JA 1DAFA 2JJ8A 2I1WA 5F2OA 4Z1MA 5IKPA 1LRKA 1B93A 1YCDA 3QA3E 4DFDA 4BVEA 5FPSA 4UD2A 1E1RD 4HB0A 1B43A 4GC9A 1BE1A 1RKQA 1DKUA 4Z9BA 4ZV7A 5H83A 3M6IA 3QU4A 4N8SA 3IIMA 4PM4A 4Y2YA 3VI3B 1RDFA 3LXRA 5FI5A 3QXSA 3F5FA 4J9VA 1YE3A 3WXBA 3GJQA 4F8EA 1T5IA 4URWR 2OHHA 4Q3CA 2V45A 2EFYA 2V59A 4Z0PA 3HA7A 1YQEA 2AW5A 2V74B 4JC5A 4NU5A 1RXWA 3I39X 4Z7JA 4O59O 3CXUA 5FKJA 3RNLA 1M2KA 1JUDA 1NNI1 3IL2A 1IY1A 4JI7B 1W7AA 4Q12A 2XB8A 4JJAA 3MSXA 3AM3A 2ZCJA 1E2GA 3QU2A 3GLHE 1OT5A 1VMAA 4OFBA 2VHWA 4PQFA 4YWHA 3RRYA 3BWMA 3QVXA 4CW7A 1UH5A 1X8KA 3B48A 3HVJA 3IXQA 2R4UA 2RG1A 3OPMA 4JFRA 4K9LA 2P9CA 4XUGB 2I6UA 3ZD8A 2ZZNA 2CXUA 3ONNA 5CM2Z 3T5PA 4XI9A 2HMWA 3WJ1A 3DV2A 5CDHA 1Q7CA 3FUVA 1PQWA 1OKKD 3VU3A 3M33A 1WPXA 5HJ2A 1AU9A 3QVLA 3C3DA 4H31A 2IBSA 2MSKA 4B73A 4QM6A 3ZCQA 1BHJA 4FEGA 4GZ6A 2IH4A 4ZK6A 1B1CA 1KVRA 2C3OA 3R1IA 4JH0A 4K81B 4NATA 4QPNA 4RHCA 1A72A 2ZAIA 2PN1A 4G89A 1XR3A 4JZKA 1BN7A 4O4IB 3D4PA 3NYWA 1UJNA 5HCUA 1LJ8A 1AKRA 4MROA 4MV3A 4NABA 4XWGA 3W8DA 1L3CA 1JLKA 1QVZA 1P1KA 2ZS8A 5FTJA 3SLKA 1D03A 4QYIB 4CKBA 1NR7A 4IX1A 2CZCA 4H3VA 3Q11A 3K5WA 5LIRA 1B00A 4N47A 1FLDA 1V2GA 2HCFA 2OBMA 1OLXB 1L7AA 1PQYA 3TXXA 2D0PB 1UBTS 3R7AA 4C4OA 4JBWA 3PHCA 1R3DA 3VNQA 2W43A 3FSGA 5KDLA 2AV6A 3EQ8A 2R00C 5SZJA 4A23A 3AKYA 1Q16A 2XB2A 1S1MA 1YR9A 4R7TA 3ZVMA 1KKLA 3L4SO 1H1TA 2NTNA 5HRUA 3BWEA 3KUXA 4F3CA 2GN4A 4FHFA 2X3FA 5MGBA 1PYGA 3V42A 3D5QA 4G5OA 4U7TB 5LA6B 4AS1A 3HKBB 4WBNB 3GDHA 3ZIUA 1EFKA 4Z54A 4QELA 3HGTA 4AO7A 1E2JA 2C2KA 1MABB 3VHLB 1QQAA 3KKNA 3R5XA 4W5NA 4V1CI 4LHEA 1XKTA 1WBDA 2Q07A 4PC1A 5T4EA 1S4QA 4QRDA 1I5RA 4LCBA 3HWSA 3WL7A 2IUSA 4DA6A 1PL0A 4BUZA 5LP6A 4XSHA 1CULC 2HXGA 1QDLB 1UM9B 2G82A 4J07A 3HCFA 1H2EA 1KU6A 3P9QA 3MJDA 1PLLA 4RDCA 4LY6A 4ZI7A 1Z4OA 5JI2E 4GP7A 2FMTA 4GD3Q 1PR6A 2HJSA 1L5KA 5GZ3A 3W3ZB 2GKGA 3KVNA 3GAZA 2H4YA 2VBGA 3MD9A 4MVJD 3O0TA 1HDRA 3DXYA 5AVVA 2DF8A 4LJ6A 3RTDA 1N4DA 3AL0C 3HYLA 2QP9X 4HVAA 4UOQA 1WULS 5DTQA 1NJFA 1KO8A 3NOXA 4O4LF 4PX3A 4BP8A 1V47A 4RANA 5TX7A 1PJ2A 3RU7A 2F1KA 1AQYA 3R5FA 2ATVA 2R4TA 3I34X 1UEIA 1BE6A 2XECA 3GUUA 3DOEA 1C8BA 1E63A 1Q3KA 4GOXA 3RFFA 2EHDA 3L1HA 2VPYA 3AF6A 4R51A 3R7SA 3F6BX 1FVHA 2OHIA 3F9RA 3ZNQA 3CLSC 5KOJB 1MX5A 2CFOA 3NBZC 2CMDA 4V1CA 5MN5A 3OC0A 1N5OX 2GVZC 3FWKA 2JJ2D 5AWFC 3CRVA 1IY2A 1OWNA 2D0IA 1Y6ZA 1WW2A 3DFKA 2OWDA 4I6GA 4S1WA 1WMSA 2BMWA 1V3VA 2Q62A 2XD9A 2B2CA 1QCCA 1XZGA 4X1IA 1CS4C 4ZYYA 3NHAA 2Z5GA 5AESA 1O4WA 2MYUA 1UK7A 4LMRA 2H29A 2FQYA 5L95A 3T7IA 3V9AA 2I99A 4LZPA 1T9GR 1X7ZA 2TECE 1VRWA 3S1AA 2ZJ6A 4E2WA 4QDKA 1F7VA 4KR6A 4HB2A 3Q4GA 3TLGB 2NYRA 4BWVA 4EI7A 5BSUA 3RHTA 4EP1A 1KZ7B 4IH9A 3AP1A 3FJ1A 3ZCUA 2B9VA 4PONA 3T3GA 4CM3A 5K4HA 2HHLA 1AMUA 2BFNA 3D59A 4ALLA 5JH7A 1KEEB 4D9BA 3IUMA 5F2KA 4GX0A 4Q1AA 3NP7A 4TTIA 1NVFA 3LDFA 3BWBA 1NVEA 4AZ3A 4TKVA 1M6HA 4O8ZA 5IM4F 3OZFA 3QP9A 1GITA 3TUZC 4AJIA 4RTOA 1KAOA 3O4VA 2GPTA 5CXSA 1P7VA 1MPXA 1Z62A 1QYIA 2V6JA 5IUKC 4KHPB 2R2AA 1G8FA 4PSVA 3CZ9A 1XXHB 1JDTA 3ET5A 1IVYA 3QE3A 4G0VA 5HQ3A 4DCMA 1SWVA 4HKTA 4XIFA 5I7VA 3HPRA 1JEOA 1ATZA 4BVLA 1GJRA 2P79A 5DMHA 1H2RS 2OFPA 2ENWA 2PANA 4L5AA 5EIBC 1NW4A 4NMWA 2XDAA 3GPDG 3HCNA 1R88A 5LNK6 1T36A 4RMJA 4RE5A 3KT0A 4Y2PA 3WWYA 3DOHA 1W9MA 4ZEOA 1QVAA 2XXAB 1PV1A 1EH5A 1VLJA 2YTZA 4N03A 4ZVTA 3V2IA 4NENA 3WBFA 5LXTA 5K3DA 1M9NA 1JNYA 3H0CA 4RM3A 4JFAA 4EG4A 1PGOA 3SIRA 4YA6A 2D4HA 2BR3A 2FRDA 3ODGA 4FLEA 2PZEA 4QGHA 5IX8A 1UL1X 2C9DA 1TFRA 3C4QA 1SKBA 4HNVA 5B1DA 2UXBB 1R27A 3BMOA 3VOBA 4M0LA 4CM4A 1UZNA 4L15A 4RHTA 3RR2A 3ZNNA 1S4MA 3UC5A 3I45A 1J9GA 5KHAA 2Q2VA 2HGSA 2Z9CA 3HS3A 1LPSA 1TUGA 2I3GA 4UAJA 4MMYB 1CUHA 3A14A 3RKUA 2WP8J 2Y8EA 4UHKA 1RRPA 3RABA 3FDZB 4G8DA 1KFJB 3KNZA 3A9RA 3QXXA 2XNKA 3LC2O 2OR3A 3OJFA 1U2DC 1V48A 4WK0B 3MHPA 1ZICA 2JIBA 1MPTA 1RAAA 4KI0A 4DMMA 1FC0A 1XZNA 1EEXB 3BB4A 2PH5A 3NT4A 1G5PA 1V95A 1Y5MA 4XIJA 3RUHA 4WZZA 2J3LA 2BTOA 4P93A 4XGQA 4G5FA 1R8YA 4BNMA 4S24A 1KIAA 4PLCA 2XTMA 1Y3IA 2JH9A 3BCUA 3BXPA 5COAA 5K4AA 3NG1A 3L06A 1D9ZA 4CLRB 3B13B 1U8FO 3I5UA 1DEXA 4OHVA 2Z2YA 4WW0A 5LL6P 1D6MA 3PFCA 4U7GA 3IO5A 5JADA 3GOHA 4F7DA 1IEWA 4GC5A 3DTYA 2R7MA 2C94A 3NC4A 4BNYA 4D8UA 1A8UA 1P9WA 3DNFA 1SCNE 4K6GA 3NBAA 1JWAB 5BY2A 5ICCA 4MUGA 1EDOA 2I4OA 2WNHA 4MUMA 1T2VA 1NVXQ 1JA1A 3PPYA 5IZCA 2WJPA 4YDHB 2ONYA 1KMNA 1D4ZA 1I3LA 1I3CA 3SZOA 1KTVA 2XDQB 3DF9A 4JUFA 4R84A 5IP5A 4D9EA 1UQRA 4RPHA 4BECA 4DR1B 3I83A 3RC7A 4EO9A 4LE1A 1F2UA 5IAGA 1MH1A 1YDMA 4L07A 3TIXB 3SVLA 3UMMA 1FDTA 1RZ3A 5JCJD 4LE0A 5DT9A 3GDFA 2RK3A 1O8CA 1O0CA 3L7LA 5AQ1A 2PVCA 3EXHA 2PWYA 3GA0A 4MVJH 2YVKA 3WB9A 1BH2A 3G2QA 4RSGA 1XMSA 1WABA 4C87A 2A5LA 2NWQA 4XWKA 1NONA 3AJ8A 16PKA 3GRKA 3QVVA 4JLDA 2WUWE 3V2HA 1H66A 4MVXA 4WQMA 2CLDX 1SO8A 3MAGA 2QRJA 2RHWA 3HP7A 3BDIA 4BQNA 1H4VB 2MU1A 3AR5A 2XNDD 1NY6A 4I4IA 2ZVPX 4MYCA 1QIJA 2FXVA 4LEIA 2VAXA 3T0IA 3R76A 4C0KA 2OV8A 5JDIC 4E4RA 1L4LA 4BO4A 2R5NA 2H1OA 4D6XA 4K9DA 3GP5A 4YMIA 2PX8A 4ZRMA 1F5NA 5HWSA 3X1YA 3LUFA 5C8VA 1IUPA 1MRSA 1RAIA 1XNRB 4I36A 4MV9A 1AGNA 1G59A 1BSVA 2JGNA 2XMDA 5AJXA 1AQLA 2CLMB 4EJ2A 3SF8A 3EPHA 4LHYA 3E7WA 2GJ4A 5CURA 1W73A 3SM9A 4ENQA 3K2EA 3QFSA 2I2XB 3FTCA 3GJ6A 1WHSA 4L3WA 4EB6B 3FTQA 1LWOA 4LYEA 5SV2A 3BREA 1X9HA 5JFOA 4PCVA 5L51A 1DWUA 1ZN9A 2PWBA 3URKA 1YRBA 3M9LA 3WGLA 3KOXA 1NVMB 2A3NA 3NETA 4FDVA 2ZAOA 4L5IA 1NXTA 3NYQA 3QKSA 1XDSA 4BLSA 5TQJA 4JJEA 1KJYA 3AESA 3Q3EA 4I50B 4X20A 3QE0A 4JA0A 4YMWA 2G28A 4Z7OB 4MJLA 1J99A 4LRQA 5FI1B 5AM3A 5K2OA 4NZMA 5BW8A 3GFBA 1TMGE 4QJIA 3CZ4A 4E6EA 4QAJA 3DUFA 5D3MB 1OI3A 3PP8A 2PRSA 5JTUA 4AUNA 3T3OA 1LDEA 1W5BA 3PNYA 4OJYA 2GNAA 3N8DA 2IUTA 2AG0A 2RDMA 4RY0A 1LBHA 4ZT7A 5HA5A 3VU9A 4DXHA 4JUAA 3FF4A 3V6LA 2C4MA 3U3XA 5JXHA 4DV1B 2HFKA 1NP6A 3AHEA 2JL1A 3HB0A 4B79A 4EFDA 2VEOA 1YB2A 2VVTA 3FGOA 4G5QA 1SUWA 4JXKA 3GG9A 4W7SA 2FUNB 2KMLA 2PMCA 4Q6WA 5CMLA 3ZDXB 2CZQA 3AF2A 3FSRA 2QRGA 1UC8A 2OBBA 2Q8PA 1TGVA 4FNMA 1WUYA 4O3FA 3I04M 1UJMA 5MN6A 4B4DA 3COWA 4BFWA 3L7OA 2ZTSA 2YFQA 3L0DA 1C0EA 1XE3A 3BXXA 2QD2A 4XM0A 1L0BA 5A5DA 2WI8A 4KV9A 2HWKA 2PBRA 1CR2A 3DMDA 3I0MA 3HDYA 2GAFA 3MF4A 1N2CA 1YZKA 2VK4A 3UJAA 3GRYA 3ZWCA 1GFSA 2XNJA