1SEVA

Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
b'GFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQQQLEAALTGMDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVSFIRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase, glyoxysomal precursor
molecule tags Oxidoreductase
source organism Citrullus lanatus
publication title Organelle and translocatable forms of glyoxysomal malate dehydrogenase. The effect of the N-terminal presequence
pubmed doi rcsb
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sevA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1sevA02
1KEVA 4Q3BA 1LEHA 4HUJA 1K89A 4CV0A 1PU2A 3BYZA 5L51A 3LYLA 5ES3A 3NDIA 3ZWPA 1NM5A 3F5SA 5CEFA 3U4CA 1YE3A 3KV3O 4IPTA 3I83A 3ROKA 2PKQO 3ZWBA 1EZ4A 2C7GA 1PR3A 2E4AA 4NPCA 3UN1A 3NX4A 4RVHA 4IIVA 3RD5A 4AJ2A 3RBZA 4GQAA 4RL6A 1K0UA 5GY7A 4UVDA 1HYHA 3V5NA 1ZEMA 3PWSA 3ITKA 3ANLA 1XWFA 5IJZA 2Y1GA 3ADOA 3GRKA 1HXHA 4WLEA 2BLLA 4LMRA 2NSDA 4N5MA 4EUEA 3JYQA 1D3AA 4GX5A 1WXDA 2GGSA 4DPKA 4FFRA 3W6ZA 3GNQA 2ZYAA 4ALNA 2OL4A 3HFSA 1DC3A 4JBHA 4BNIA 4BNTA 3HWRA 2VUSA 3PJEA 4RQUA 1PEDA 4O1MA 3HADA 1DDOA 4GSLA 5JY1A 4TWRA 2PWZA 4PZDA 1N2SA 1PGJA 3LT0A 4MVJM 2HSDA 4BGEA 4IDEA 4XZ3A 3PHGA 1DO8A 1X7HA 2VRBA 3PYLA 1CWUA 5LCXA 3CZRA 5JMPA 1R6DA 4UAGA 3WGZA 3RKRA 4WLUA 1B15A 3NKLA 3NEPX 2I66A 3R3SA 4DXHA 4EW6A 5I8WA 4E2ZA 2PZMA 4W82A 4WCFA 2GR9A 2C2XA 5CG2A 5KJ1A 4DMLA 2ZB8A 3G49A 3OIFA 2OP1A 5TJ9A 1M75A 2DKNA 1XU7A 5JMWA 1U2DA 3QWFA 5C7LO 2VTDA 4FC7A 4PG4A 2PY6A 2DC1A 1ZO8A 4D44A 1RM0A 1PZGA 4JQCA 5L7YA 5U4QA 1DHTA 1SCUA 4E4YA 3LF1A 1NQOA 5A06A 3QWHA 1GYRA 1B26A 1GQQA 3LC2O 1KY4A 4BO9A 1NR1A 3PJGA 4PZCA 3L6OO 2IEBA 4DMMA 4OHUA 2JD1A 3O9ZA 1WWKA 1PJTA 3ENKA 3ETGA 4GAEA 1ENOA 4N54A 4PG7A 1XELA 4NI5A 5L4LA 1EEHA 5HM8A 5HS4A 3QVTA 3UH1A 5EL0A 1UAYA 1MC5A 3I4CA 3G1UA 2O4UX 1NASA 3IOYA 2BGKA 4KUEA 2X6TA 3MJTA 1OAAA 3COSA 2FMUA 5L9AA 4GH5A 3P5SA 4LISA 2B0JA 3ADPA 4XDYA 4DLLA 2B4RO 2Q99A 4NFYA 2HMVA 1XQ1A 2C20A 5U1PA 4DRYA 2DFVA 1DEHA 4CLRB 3ZWAA 1M67A 3NT2A 4JNKA 1XDWA 4PLTA 1FDVA 1V3VA 5TF4A 3RU9A 2X9NA 3C85A 2I3GA 2LDBA 3M1LA 3TRIA 4CL8A 2W2KB 3AUSA 4GPD1 1I24A 1DAPA 3TFQA 4XD2A 4GX2A 1U1IA 2E48A 2ZTMA 4QX6A 4WGGA 2ZCVA 4BNGA 5EESA 2J6IA 3OA0A 4D3SA 1LDBA 3TNLA 1T2CA 4KUGA 3RFVA 2VCYA 3ITDA 5JYEA 4B8ZA 4BUCA 3A14A 1CF2O 5IN4A 2GLXA 5JAZA 4KQWA 3RJ5A 3A9WA 3E03A 3UHAA 3KLMX 2AEJA 2C29D 2J5KA 2VYND 1UXIA 4DQXA 1T4DA 4PLHA 3TFOA 4MJLA 3R3JA 5IZ4A 1ZXBA 5DCUA 1ISFA 1N1GA 2RBEA 4EZBA 1FDWA 1SC6A 3M1AA 2F1KA 1GR0A 1NX6A 5FFFA 2Y0CA 3EYWA 5KVVA 3ZHXA 1E7SA 1AGNA 3BMOB 3PFWO 4J90A 4TROA 1UR5A 3DDNA 2JFGA 3ZHBA 1QORA 4J7XA 2I3AA 2O50A 3ZU5A 1ULUA 4YVFA 3D64A 4L74A 1RKXA 2P4QA 3SEFA 3MZ0A 3WX0A 5JDIA 3IAHA 1UZMA 2GERA 5EERA 3I1JA 3EZYA 4ND1A 3GHYA 1PJ2A 5EN4A 4BO5A 1FF9A 3DZJA 2CUKA 3U49A 3TSCA 4NHEA 4B3IA 3IP3A 1T2DA 1W0CA 5EQDA 3VPSA 5KKAA 1MUUA 2FPIA 2C59A 1HTBA 2QZ9A 3PVZA 4ID9A 5FI3A 4YRAA 4BNUA 4OXKA 3PTZA 1J0XO 3D3WA 4XR4A 4I9HA 3SXPA 5EIOA 5JXWA 1GUFA 2FZWA 3ORFA 3B70A 4XYEA 4G81A 3PPIA 5HBRA 5IDXA 4ZVVA 1P1KA 2FY8A 4IZIA 3V2HA 5C37A 1KC3A 1OC4A 2EW8A 2O23A 2OP0A 1DAOA 2VWQA 5THQA 3AOEC 3CTMA 1NQAO 3BMCA 1XR3A 5ENDA 3WYCA 4BO8A 2YUTA 3H2SA 2C7VA 4Z0TA 3W8DA 4IJUA 1QYXA 4JJGA 1EUDA 2GASA 2B35A 1SAYA 5BSEA 3RUAA 1SPXA 5KJCA 2WSBA 4I8XA 3QP9A 4FDAA 3BMNA 4LSWA 4J0FA 1EQUA 1XKQA 2FZEA 4K6FA 2D8AA 1YRLA 4NDNE 1E3IA 4MVJF 4Y6RA 1UDBA 3F46A 3VVBA 3GZ4A 2PV7A 3LSYA 3NUGA 4IDBA 1X15A 1HF3A 1LX6A 1YWGO 2EF1A 4E13A 3WGGA 2CMDA 4LK3A 3VHRA 3ZH2A 4PFJA 1MP0A 1T1RA 2BFOA 4RVSA 1E3WA 1WZIA 2OO5A 1NNUA 4CMBA 3GC6A 1Z74A 5DF1A 1VPDA 2J5QA 1AHIA 1RM5A 4YDRA 1R0LA 3NJ4A 2Y1DA 5JAQA 1LNQA 4YJGB 1E5QA 2RIRA 3VTZA 1LSSA 2BFAA 2EGGA 3H65A 5COQA 5TSDA 3DQPA 4IJWA 2X5OA 3HDJA 1ZK0A 1P0CA 4IMPA 1QV6A 3GGPA 3WSWA 1DIRA 2EEZA 2O2YA 4Z9YA 4D79A 4G5HA 2AXQA 3VKVA 4KMSA 4WNIA 3WNVA 3IQDB 1HKUA 1H94A 3IUPA 3HE3A 5CAEA 1H6BA 3MJEA 5TLSA 3KTDA 3JQAB 2DTEA 3ZW8A 1YDWA 1TLTA 3DBHB 3KSZO 4UUPA 4J49A 2HRBA 1HDCA 3IKTA 1Y9EA 4NZ9A 3E18A 3DAGA 2FOIA 4M49A 1GYPA 1J4AA 1YJ8A 4JJFA 2JD2A 1QKIA 3HN7A 4BO1A 3ZU3A 2CVQA 3SVTA 4HWKA 5TJHA 1AXEA 4TZTA 4H3VA 3TL3A 3LLVA 2JKVA 4CMKA 2ZB3A 3ULKA 4ND5A 4A10A 5H83A 4AJOA 2D0IA 2UVDA 4LVUA 3K96A 3WG9A 1PGQA 1UZNA 4NJMA 4S3MA 3WOHA 3ZWOA 3MOGA 5AXBA 1BSVA 1VM6A 4PLCA 2IYOA 3QA9A 3KZVA 4J3FA 4L8VA 4RLSA 4C4OA 1ZIDA 1I2ZA 1OI7A 2I5PO 3B1JA 1BDBA 3FNFA 1HLDA 5HWSA 3H3JA 4XYGA 4CL3A 2GD1O 2Q1SA 3ZNQA 3CUKA 1DJQA 4B8WA 3PFFA 3T7EA 1QLHA 3GVHA 5T6BA 3PYXA 3UCFA 1FDUA 1XG5A 5L40A 1HRDA 4L4RA 4O63O 1K3TA 3JYOA 4YAIA 2P5YA 3W4JA 4RPKA 4XRGA 1R15A 5IAAA 1SOVA 2J3IA 1A4UA 1U7TA 1C1XB 3PHIA 3BTVA 4IUYA 1BG6A 3ZHYA 2AE2A 4UEOA 5DP2A 1PJCA 1TB4A 1Y9AA 1GADO 1VJTA 1KIFA 1I10A 2AQKA 3JCZA 3JYPA 3Q9NA 4DIFA 4D3DA 3RSHA 4K9DA 2UDPA 2Y99A 4ZRNA 2QRJA 1G6KA 4IDCA 1NHWA 2C2YA 4KWIA 4II2A 2CY0A 5A9TA 2GN8A 2NUAA 1F8FA 4IDFA 4C7JA 3DMTC 4AL4A 2QG4A 3A06A 2PD3A 3O8QB 2Q1WA 3AOEA 5ILOA 1ZH8A 2OMEA 3HN2A 1HSZA 1HE4A 2RCYA 3DFUA 4ZN6A 1E7RA 5B4TA 4B4UA 3ETDA 1E3LA 3WLFA 1IZ9A 4RDIA 1DFGA 1DC5A 1T1SA 3H9QA 2HJRA 2Z1MA 3WTCA 4PLFA 3ZWNA 4CMJA 5G4KA 1K6JA 2C0CA 1YO6A 4OJNA 1SZJG 2X5KO 3KOUA 2X8LA 1NQTA 5BSGA 1NPTO 1R4MB 2A9FA 4OKIA 2AEFA 3U9LA 1WMAA 1F12A 1DOHA 1UDCA 4BO4A 5JO0A 4BQRA 3PK0A 4U0JA 2E82A 4BMSA 3D3EA 5G0WA 1YKFA 4B7XA 4CM3A 3DZHA 5DBFA 1ZSNA 4R4JA 4XX0A 1WPQA 2ZCUA 4WNCA 1LDGA 4BV8A 3H4VA 4LW8A 1Y5RA 9LDBA 2G0TA 2Y1FA 3PDJA 2Q46A 1V8BA 4NU5A 4RDHA 3WMXA 3NJ8A 2PZKA 3D1LA 1M66A 4R1UA 4RF5A 3IS3A 4B4WA 1NP3A 3GFGA 4IINA 3S8MA 3JQBA 2VNAA 4D43A 4GWKA 5JAMA 4UUMA 3PI7A 3EAGA 2POQX 3A4VA 4CMHA 5TNXA 2FPPA 4MP8A 5B37A 2RH4A 1XYGA 1TXGA 4UEKA 4MPDA 3Q1LA 2X0JA 5ICMA 1CETA 2X7HA 5F1KA 4PRLA 3ST7A 4ALMA 4GLLA 1PWXA 2DU8A 3Q2KA 1LDMA 4PLGA 3PGJA 2VWHA 3PLNA 2QW8A 1P1JA 2V6BA 2ZTUA 5F3RA 5BNFA 1YB1A 1B8UA 1F06A 3AUUA 5HA5A 4CV1A 4MDHA 3PIIA 3NGLA 2VYVD 3I9MA 4II3A 4LSMA 2W2KA 5DOZA 2HMSA 1NXQA 2VQ3A 3GVCA 1T2FA 3K5PA 3DBLA 4PGFA 4R1NA 4R9SA 4CQMD 2HMUA 4TRNA 3WLEA 1N8KA 2C54A 3LLSA 4E0BA 3UICA 3JQ9A 1JKFA 2ZYGA 4CMEC 1A9ZA 1PJQA 5L3ZA 5KJEA 3NDJA 1LJ8A 4U7WA 5JCJA 2X1HA 1KEUA 4M89A 3K92A 5A5EA 1EE9A 4YAKA 1GPDG 1HE2A 3H5AA 2NLOA 3AW9A 1DFIA 3K9QO 3C7DB 1GYQA 4ILKA 4DLAA 1LC3A 4G65A 3F4LA 3LQFA 1MA0A 4W9NA 2A35A 4BV9A 1JTVA 3KUXA 4FW8A 2YV1A 4W99A 1PX0A 4D41A 4BB5A 2C07A 4PG6A 4GLOA 5TGDA 3MTJA 4YJFA 4KWHA 3V2GA 5T67A 6LDHA 1V3UA 3QWIA 3OMLA 1NPDA 2Z95A 3OICA 2BI7A 4WPGA 3DBVO 4RQTA 4TRRA 3UOGA 4AJNA 4E21A 5A04A 4NG5A 4R3NA 2VWGA 4PZEA 1GUYA 1T26A 1PJBA 4TRJA 4BO6A 1VL8A 1YBAA 4IDAA 2F00A 4Z3KA 5L7TA 2GYYA 1I01A 1HDRA 2YY7A 2XOXA 1T25A 2B4QA 4FFNA 4W9NC 3EVNA 3ONDA 1UDAA 1U3UA 2HAEA 2VYVA 3DZIA 3GMSA 3NTRA 1GUZA 4JIGA 2GN9A 3ZU2A 3WBFA 4A03A 2NTNA 1WZEA 5FYDA 4ZJUA 2HK9A 4QO7A 3SBOA 3JQDA 4R01A 4DIOA 2NTJA 5BT9A 4D42A 1ZZEA 3E9NA 3HDHA 3HNPA 4WEQA 4U6QA 3LC7O 3C8MA 3INTA 1DLIA 4Y6SA 3PJFA 3GUCA 2IZ1A 2D2IA 3NT5A 5DT9A 3RI3A 4W4TA 1QP8A 4WEOA 2H6EA 2OGUA 3JD0A 1NAIA 3K2EA 2GZ2A 1LLCA 1B3RA 3DB2A 1YXMA 3ZU4A 3CINA 1A7AA 1DC4A 1I33A 1ZMTA 1HETA 3GGOA 5DDIP 3JQGB 2FHSA 5JE8A 3Q9UA 2V6MA 1PZEA 2GZ3A 4GBJA 1I32A 1GQ2A 1ZBQA 1P9LA 3RWBA 2AEMA 3DR3A 1YL7A 4Y9DA 1BXGA 3JQGA 4YAEA 3U4DA 3W8FA 1ENZA 2IRWA 5C3MA 2EWMA 3ASVA 3S2EA 3KB6A 5JDCC 2ZTVA 3H9UA 3IMFA 1CDOA 4J2HA 1ARZA 2Q3EA 3ZWXA 4CR6A 5MDHA 1EVYA 3BTSA 4GMGA 4CLDA 1XIVA 3TZ6A 4NBTA 3GEGA 3JQ9C 2O3RA 2YQ4A 1ONOA 3IP1A 4AJPA 3KYBA 4MIYA 3WBBA 4BGIA 1LLUA 2GN4A 2AHRA 4ALLA 2ZKLA 1R0KA 3B20A 4CLXA 2ZJ1A 4RPLA 3AUTA 4OSOA 1NHGA 3OHSX 4WLVA 4A7PA 3AI2A 1IULA 1J49A 1EDZA 1N7HA 2G17A 2P91A 3AI3A 3ENNA 2PGLA 1EBFA 4WJZA 2VZ9A 3K30A 1RWBA 5EJ2A 4QECA 4J4HA 1SOWA 2BGLA 2J3JA 2GNAA 3FR7A 2Y66A 4FFPA 2ZYDA 4BO7A 4E3ZA 4CUKA 2JL1A 3PLRA 1WDLA 4GVXA 4OH1A 3PZRA 1NVGA 4YQZA 4BB6A 1ZCJA 1EE2A 4TVOA 1SMKA 5CFZA 2DT5A 2YHUA 1R4NB 1EUCA 4CLOB 1QV7A 2YV3A 3AM3A 3GDGA 4BO3A 2AW5A 3ON5A 5AVOA 5ITVA 2NWQA 4QSMA 1EVJA 2E6UX 2PGJA 4Q3NA 4CM7A 1EUZA 2X22A 5JO9A 3RJ9A 4YAGA 3GAZA 4P22A 3WWZA 1N9GB 3VZRA 2VNSA 4D46A 4B79A 3VC7A 5IDYA 1YB5A 3D4PA 4MKXA 4FQ8A 4I1IA 5ENVA 4O6VA 4RO0A 4D3FA 5TT1A 3RUCA 1ZK1A 2C82A 3RBVA 3DAPA 4EJMA 2C5EA 1GEEA 1S7CA 3SLGA 2OZPA 2CZCA 4GKBA 2PZLA 4W6ZA 1KC1A 4AJ1A 1HSOA 3JQ8B 5B12A 2JD0A 1WP4A 4HNGA 1PS9A 1E1KA 1SEVA 1ZMOA 2B5WA 3BIOA 5F1PA 3CMMA 4Q3AA 3V1UA 4AJKA 5ER9A 5L7WA 3CKYA 3BHMA 4O59O 1DRWA 3F1LA 2HK7A 1QYVA 1E3EA 2D5AA 2Q1UA 2WYWA 4HX5A 3CZMA 3WGQA 4QFCA 4K28A 4INAA 1M2WA 4R69A 1ISIA 1QYDA 3DHYA 1LI4A 1IZ0A 2ET6A 5G2OA 3WNQA 1XLTA 1B2LA 3GG9A 1E3SA 1M6WA 2HCTA 2WM3A 1B8PA 3DZGA 1D1TA 1ZSYA 3H8VA 3KEQA 1KERA 1Q0LA 4FFLA 5ER6A 1B3BA 2O2SA 3F47A 4IS2A 4CLHA 3ZV6A 4OM8A 4EI2A 3LT1A 5DOVA 3H9JA 2FRDA 4TMFA 4E30A 3MWEB 3OFSA 4FJ1A 4ND2A 5DP1A 3VZPA 1DFHA 2NU8A 4A26A 1WAMA 3ICCA 5IG2A 4PG8A 1BXGB 1LSJA 3L6DA 1ADGA 4CJXA 4PLZA 5G0TA 3PWKA 4F3YA 2BGMA 2GPTA 3R0IA 5CDSA 1IYZA 3IJRA 1ZEJA 4F6LA 2VRCA 4QUKA 3H2ZA 3WDSA 1B16A 1E7QA 3O03A 3HDYA 1XQ6A 3T4EA 2B4TO 5GZ1A 1LUAA 1TT7A 5BSHA 1B0AA 2VHVA 3QVWA 2YV2A 1F0YA 3FWNA 4AJHA 3U3XA 2HUNA 2FP4A 4BMNA 1VL0A 4Z0HO 3RUFA 3STHA 2O3UA 3KBOA 4YRBA 3OM9A 4RF3A 1DJNA 5JS6A 3PHHA 3BTOA 1BXKA 3JQ8A 3GY0A 3TDKA 2BRUA 2CDBA 3N74A 1BVRA 1Z7EA 2PZJA 3A1NA 4L4SA 1Q0QA 1V35A 3NGXA 3OQ6A 2RHRA 4FCCA 3B1KA 1DRVA 4OOEA 4HV4A 3K31A 4BNXA 1Q7BA 5CDGA 4J7UA 2QX7A 4IQGA 1KEPA 4AVYA 2FPGA 4HFNA 5F21A 3OF2A 1ORRA 4QEDA 1D7OA 1PSDA 2RH8A 4I5DA 1XA0A 4B3JA 1I2BA 1YOVB 3GNTA 4NBVA 1K6XA 4OAQA 1PQUA 1U8XX 1O9BA 3D0OA 1PJSA 5JBIA 5JPIA 1I3LA 3AU9A 5AXAA 2DLDA 3GNSA 4Q9NA 5ADHA 3KHUA 5ITWA 1H6AA 4ZQEA 4E5KA 2BMAA 3BMCB 5FF9A 2DAPA 1PGNA 2D1YA 2VOJA 4U8GA 2EP5A 4Z0PA 3MOIA 3KYDB 5DCWA 5JNLA 3CIFA 3FBGA 1P45A 2YYYA 4IZHA 4B3HA 2SCUA 5KVCA 1KEWA 4J6FA 2GCGA 3GA0A 4CR7A 3GH3A 1PL7A 3WXBA 3FNEA 2JCXA 1GZ6A 4JN6B 4BGUA 3GMDA 1YB4A 3U62A 2JJYA 5TS3A 2EG9A 1ZXLA 5BSFA 3ZHZA 4EEXA 3RQSA 1H6DA 1ONPA 3H9GA 3JQEA 3G1TA 3O26A 3AWDA 4DTIA 1E77A 3SJUA 3UF0A 3Q3CA 5L4NA 3UCXA 1F14A 2V7PA 1PL8A 3ONEA 1D4FA 2HRZA 5COBA 2FSVA 5JSFA 4YEDA 2XF8A 3ZI0A 3LC1O 2LDXA 4XWYA 4JBIA 3F3SA 3LF2A 4E12A 1XU9A 3B6ZA 3PQFA 2WDZA 4XB2A 3GT0A 5I8ZA 4J16A 4ZRMA 3S2IA 5JW6A 3GLQA 3EDMA 3ZWCA 3RBXA 4UULA 1P44A 3WGTA 2J8ZA 2H5LA 4RF2A 2PGDA 2GRAA 2X86A 3V2UA 4OXNA 3TOXA 5DNAA 3JV7A 5JDCA 2AE1A 3GPDG 3GVXA 2E37A 3AFMA 3L4BA 5AXDA 5G0SA 1TEHA 2G76A 2I6TA 4OO3A 5DBGA 2Y05A 2VZ0A 1RM4A 5AXCA 3W8EA 2JHGA 2QZZA 4YT5A 3F5QA 5J23A 1Z75A 5THKA 3UFXA 3WWYA 2A92A 2DBVO 4JGBA 1XGKA 5A05A 1DXYA 4LRTB 5CPFA 4BIIA 2QRLA 4NFHA 1ZVMA 2JAPA 1E3JA 3DXFA 4DPMA 2H1SA 4BNYA 2H9IA 3D5TA 3JQ6A 4W7IA 1NPYA 3P7MA 3KRTA 5KKCA 3DONA 3H5RA 4H16A 4KDEA 4MKRA 2CDAA 1EVZA 3WIDA 3IIEA 1SB8A 1N7GA 4IGEA 4CQMB 1E0DA 5KJFA 2NU7A 4W7HA 4J1SA 4H15A 3C7AA 4B7CA 1GQYA 4AJ4A 3JQ7B 3G79A 3WGOA 4ROSA 3OP4A 1MG5A 1JKJA 1O8CA 2HU2A 4I9UA 4CR8A 2Q50A 2QYSA 3LK7A 2X58A 1UXGA 3L9WA 4NU6A 3I5MA 4DLBA 1GCOA 5U9CA 1LLQA 1N5DA 3AM4A 4UUNA 1JAXA 3JTMA 1P31A 1HDGO 1Q7GA 3JD3A 4Z3DA 1ZJYA 3L4SO 3WGYA 4GX0A 2W98A 5L53A 4LGVA 3ZNPA 1Y8QB 3I9KA 1EQ2A 4WECA 3PIDA 4L0QA 1KBZA 4YJDA 1UAGA 2NU9A 1YL5A 1JLLA 4Q3DA 1K6IA 4DYDA 5A3JA 1KS9A 2O3JA 1DIHA 3OQBA 5CHEA 4MVJG 5ILGA 4MVJI 2H63A 1U3TA 1YVEI 4J2OA 2DBZA 1CQIA 3ASUA 4GL4A 4OQZA 5CPBA 3O8QA 3GQVA 1X0XA 2Q45A 4DUPA 3DZFA 4A2CA 2FWMX 1GD1O 3I9LA 4CODB 2XPCA 1Z82A 5T5QA 4DQVA 3DZBA 2HJSA 3FSRA 3GRPA 1DSSG 1ZNQO 3LT2A 4RV9A 4XGIA 4NK4A 5A5FA 4LN1A 3IDSA 4AJEA 4IY1A 4B4OA 4BNZA 3HDQA 5TQVA 3IJPA 1C1DB 3LU1A 3RIHA 1LRJA 5K9ZA 1IUKA 1ZFNA 1ZK2A 1PIWA 2O48X 3MWDB 1HZZA 4YJFB 3AFNA 4AG3A 3DBLB 4P38A 4ITUA 3VH3A 3C7CB 3CE6A 1BGVA 2IZ0A 5KCZA 3H9EO 2PNFA 1R4NA 1UZLA 1YBVA 3L4BC 4IMRA 3OA2A 3TN7A 1H6CA 1LLDA 3VOSA 4ALIA 2I99A 4CMEA 5KIAA 1BWSA 3OJFA 3PGXA 4HFRA 3M2PA 4EUFA 5LDHA 3WB9A 4YB8A 2YDYA 4J1TA 4EEZA 2AQHA 5CEJA 5JC1A 4DIBA 3GOHA 5JY6A 5DBIA 1S6YA 1JQBA 4XQEA 2IXAA 4FSHA 4OSPA 4D0RA 4EBFA 4FN4A 3Q2IA 3UW3A 5F5LA 3WQRA 3M6IA 4Q3EA 3HUDA 3UVEA 3AY6A 1PZHA 4DA9A 1I3NA 1N9GA 2CFCA 3PXXA 4MIOA 3P2OA 3FF4A 4HY3A 4OXYA 1BMDA 1DIBA 1ML3A 1VE9A 5I9NA 2B37A 2VUTA 3JQ7A 4ZD6A 4CLOA 1O6ZA 1MGOA 3V1YA 4BO2A 4PVDA 4OL9A 1K2WA 4AICA 3I23A 1GEGA 1L7DA 4CQMA 3VZSA 4G2NA 3TF5A 1Y5MA 2WE7A 4ALJA 7ADHA 1LQTA 2A4KA 2CF6A 2WTBA 3DC2A 3ZV3A 3X2EA 1QYWA 4DYVA 4K6CA 2JCYA 3ZNNA 1P1FA 2FSSA 2P68A 3RC1A 2DPHA 1I8TA 1PJ4A 1U3WA 2FR0A 1VJ0A 4E31A 3GVPA 1YL6A 3C3XA 5HRUA 2ZB4A 1PGOA 3JQAD 1LSUA 2VUUA 4WLFA 4ZQGA 3QVSA 3JYLA 5I7VA 1A27A 1RYEA 5K6AC 5T8KA 1PR9A 1W8DA 3DOCA 4CM5A 3V8BA 4O5OA 4BQPA 5I7EA 4NBRA 4RZIA 3FWZA 4M87A 3VDRA 2Q4BA 1N92A 3CPSA 3DZKA 1E1NA 2BI8A 1Y7TA 1MXFA 5G0UA 3OJLA 3NV9A 2PA3A 4MOWA 1WMBA 1GY8A 2W2LA 3DMTA 2Z5LA 4S1VA 3WMWA 3T7CA 1NWHA 1RPNA 3I4FA 1PL6A 3NT4A 2PKQP 4IJVA 2BD0A 5IFLA 1V3TA 2ZJ0A 1SO8A 3K73O 4BO0A 3S1LA 4MVJH 3WIEA 3WGIA 1DIGA 5BR7A 4BKUA 4XRRA 2EHDA 3QW2A 1KVQA 3BMNB 2UYYA 1ENPA 3HB5X 1G0NA 4Y6PA 1UXKA 8ADHA 4YT4A 3PQEA 5KNLA 1I3MA 2W2LD 3AY3A 1R4MA 5IDWA 4BKQA 1XEAA 3NYWA 1HE5A 3BTUA 3MJVA 3UXYA 3BMQB 3RROA 3GEDA 4FB5A 4R68A 1H5QA 4FFOA 4NJOA 5JLAA 2WJPA 5MGBA 1MB4A 2CVOA 1SB9A 1LXCA 4MIEA 3UKOA 1ZW1A 2EKPA 5TIIA 1LTHR 1H93A 4WOJA 3I3OA 1IHYA 4XDZA 3H6KA 4WUVA 1H9AA 4XJSA 3CSDA 4FOOA 1PQPA 4YCAA 3RC7A 5JYDA 3S2GA 2QHXA 5KVQA 4DBVO 2DBQA 4Z9XA 2YJZA 4WLNA 4NMHA 3RAJA 4BNMA 5A4DA 1YBMA 3FBTA 4M55A 4I08A 5GMOA 4YACA 4ZQFA 1UP7A 3VKUA 2OORA 1YGYA 3OJEA 2PK3A 4QTZA 1FXSA 1NYTA 3EK2A 2PD6A 5B4VA 1Z6ZA 2VHYA 3SLKA 2Q1TA 4ZU3A 1MFZA 2NVWA 4HP8A 1OBFO 4B4VA 4JXKA 1ADFA 4IIUA 1R12A 3A28A 3I9NA 1Y8RA 2WYUA 1TVEA 4U0KA 7MDHA 3ZCXA 4RF4A 4FFMA 3E9MA 3JQCA 2JAHA 3KO8A 4MO2A 1V6AA 5HS6A 3JD1A 4J7CA 4R1SA 2NNLD 1JDJA 5JDIC 4FD3A 4JK3A 2Y0EA 1VLLA 3JQFC 2GF2A 1GZ3A 3EY4A 3IUSA 4N5NA 3U0BA 1EVIA 4XA8A 4MVJE 1XHLA 4XEHA 3ROQA 4PLVA 2UAGA 1R37A 1ZKMA 3PP8A 4NR0A 3QJ5A 3K8ZA 4PN3A 1YQGA 2GDZA 4E5PA 1YDEA 1Y8QA 4P4LA 4BNFA 4OIMA 1HL3A 3DMYA 4XKJA 3UUWA 4CM1A 4TVBA 2D59A 5EQFA 3CXRA 4NJMB 4XCVA 1R16A 1TT5A 2GSDA 3GDOA 1QSGA 4MINA 5K6AA 4UVGA 1U5AA 4OOFA 2GZ1A 3EC7A 4CM9D 1PQWA 2R6JA 5C5IA 2V6FA 3JQAA 1NBOA 4MP3A 3ZZNA 1E7WA 2Y1OA 1X0VA 4XGKA 2ILTA 1HDOA 2G5CA 1C0LA 1CERA 3GDFA 2BELA 4I9NA 4UREA 2UV8A 1FDSA 2Y67A 3QHAA 5I9MA 1GPJA 2YDXA 5LDGA 3SX2A 2HMWA 1GV0A 3GUYA 3VAZA 5CP8A 2CNBA 1E7MA 2WEKA 3BXXA 1IY8A 4NBUA 1XCBA 3W4IA 2JHFA 4ND3A 3RC2A 5I7FA 2OOSA 4R54A 2UUPA 1Q0HA 3VDQA 5TC4A 5BNIA 3HFGA 2WYVA 4YBZA 2BHLA 1WW8A 1I30A 4R1TA 3WQSB 4YAJA 1U9JA 5CEEA 1IB6A 1P74A 4HFMA 4I5FA 4BNVA 1HDZA 1YQXA 3GPIA 3V1TC 1EDOA 4ALKA 4Z6KA 3ZW9A 4PLYA 3VPGA 1P1RA 1IL0A 1KETA 1U4SA 4IXWA 1DRUA 3ROMA 3P19A 2E49A 1VRWA 2IODA 3LZ6A 1E1MA 3ZV5A 3PEFA 4FPXA 3ONFA 1E3WB 9LDTA 3WSVA 5JAIA 5A3VA 1Z73A 5T8KC 1MXHA 1U4OA 3EZLA 4DGSA 4Q3CA 2YW9A 5BNTA 1Y6JA 1UJMA 1E6UA 3K2BA 2DBRA 1ADCA 4JBGA 4N18A 4ZHSA 1PGPA 2WE8A 4BNHA 2OBNA 4NH4A 1BW9A 4FGWA 1LRKA 2WD7B 1SEPA 3FPLA 4CM8A 2EGHA 3E1KA 3VPFA 1Z45A 2IZZA 2QRKA 4AJIA 3NTOA 1W6UA 2EJVA 4F45A 4YT2A 1NFFA 1M6HA 2AMFA 3EW7A 4K26A 1X14A 3S55A 4C7KA 4ZICA 4ND4A 1Z7BA 3ZWMA 3OBBA 2TMDA 3JD4A 4WCFC 1CIVA 4PLPA 3L0DA 4WOKA 3KYDA 3FNHA 1TA4A 2I9PA 4F6CA 1KYQA 3MJSA 5IDQA 5T64A 1C1XA 1O89A 3F9IA 5KWEA 1GZ4A 3TQHA 2NQ8A 5GZ3A 1T2AA 2Y68A 3AU8A 2HO5A 3FR8A 1TI7A 1NVMB 3F6YA 3SC6A 3HSKA 5JC8A 2DUWA 3ZWWA 1Y1PA 1GDHA 4D7AA 3BZUA 3L9XA 4FBGA 3WJAA 2Y0DA 1YOVA 2VN8A 1LQUA 2RAFA 3LT4A 4TSKA 3GGGA 2FR8A 1GU7A 1DB3A 1ISGA 4GGPA 2BF7A 1A7KA 1YONA 3I52A 3U4IA 5H82A 1NAHA 1UUFA 1BVUA 2EJWA 4P4NA 1I2CA 3C24A 3JQFA 5L95A 2OUIA 3KSDO 4GX1A 4M86A 5CDUA 3NRCA 4BGVA 1WNTA 3FD8A 4IQ0A 3HZZA 4E32A 4L73A 4CV3A 1D1SA 2CD9A 3TJRA 1A71A 1SNYA 1E6WA 1GFSA 3Q11A 5L4SA 4XQCA 3RUHA 5K0ZA 1PZFA 2G82A 2DTXA 4N5LA 1CYDA 3W6UA 2VYNA 5AQ1A 1EFLA 3DFZA 1VKOA 1BRMA 1G1AA 3DBRA 4R16A 1I5RA 1ISMA 2ZK7A 5DN9A 4DVJA 4IGFA 4UUOA 3Q0EA 2VT3A 4CM6A 4EITA 3GHHA 1F17A 2X0RA 3I9JA 4B7UA 3D4NA 4LCEA 1CQJA 4XYMA 1Q1NA 4YQYA 2EKLA 4WCDA 2HDHA 1HLPA 3E5MA 2BFMA 5AOVA 1UP4A 3C1AA 3E9QA 4IS3A 1PWZA 4I5GA 1O5IA 1Y81A 4MKZA 4MVJP 2P9GA 1U3VA 3FTPA 3UGKA 4UVIA 2OXIA 3VH1A 3VPHA 1RM3A 1C1DA 3PJDA 2D5CA 2GO1A 3I9OA 1T24A 3SJ7A 5B4UA 3EGOA 1P77A 3BAZA 4L4XA 4JLWA 1X7DA 4YRDA 3OJ0A 2O7SA 1MV8A 2VTEA 1A9YA 3ZWYA 2D4AA 1DHRA 1V9LA 1HYGA 1I0ZA 3TZCA 2AG5A 3RVDA 1IOLA 4EYEA 2HKIA 3LVFO 4RORA 2EXXA 1IHXA 4CUZA 2TMGA 4OMUA 3TPCA 2CVZA 3DO5A 3DOJA 3S2FA 1RYDA 1LDNA 3RASA 1JVBA 1T4BA 4KQXA 1LDYA 3VVCA 1X7GA 3FHLA 1J6UA 3VZQA 4UEJA 3WS7A 4M54A 1KVUA 4ONEA 4BNKA 1OMOA 4UVEA 2JCVA 6ADHA 3O4RA 2NVUA 3F1KA 1YQDA 4J1NA 4WASA 2YZ7A 1W4ZA 2X5JO 3RUIA 2DVMA 3QIVA 2CDCA 1UXJA 3WTBA 3UCEA 1JVSA 1ULSA 4BNLA 3G17A 2I65A 4XJTA 3GFBA 4A0SA 1LBEA 1BTOA 4JX8A 5T57A 4F46A 1EMDA 3AK4A 2YHIB 3QY9A 2B69A 4P8RA 2PH3A 4YXFA 2X23A 1F8GA 4KP7A 4YA6A 1EFKA 4RPJA 4P4GA 3KM0A 3DL2A 3L6EA 4BOYA 2O3QA 5DULA 3KYCA 3OEWA 4MP6A 3NAQA 3D3WB 3OH8A 4U6SA 4FS3A 1FMCA 4CMIA 4M8SA 1LC0A 1E5LA 1DLJA 3AY7A 4NQZA 4EUHA 1YJQA 4IBOA 4DQUA 4JCOA 4FIZA 2ZQZA 2YFHA 1DIAA 2EKQA 4KTVE 4J9VA 2P5UA 2W90A 4DWVA 2B5VA 2G1UA 2EERA 2YFQA 4CPDA 4XYLA 3QVOA 5FWNA 3CMCO 3ZNOA 4BHTA 2QYTA 3KYCB 1QMGA 4ZQBA 4BL5A 5KTKA 4KZPA 3GVIA 1A72A 1OC2A 3KVOA 1N1EA 2PLAA 3KSUA 4QFDA 2IYPA 4E6PA 2I67A 3RUDA 4Q39A 4HADA 3BMOA 4CMIB 4CM8B 4IJKA 4HNHA 3EHEA 1O94A 2EIHA 3PRJA 1P1HA 4ZQHA 5CDYA 3ROPA 2O3SA 4GKVA 1VJ1A 3HB4X 4NFSA 1WDMA 3T4XA 5FEUA 1FK8A 2NVUB 1VL6A 2WWRA 2OHXA 4L76A 3RC9A 2CF5A 3DHEA 4KUHA 2NU6A 1KY5A 3IKVA 1PS0A 3JQBC 3EMKA 1R66A 1Q2XA 1D8AA 3OETA 1UH5A 1LSOA 4R5MA 1KVRA 2AQ8A 3VH2A 4RPGA 1U2GA 1IE3A 4HXYA 4O0LA 1VKNA 3MEQA 5JCJD 1BDMA 4GMFA 4Z9FA 5A02A 3KETA 4CUJA 5CDTA 2ZIZA 5A1TA 2BFPA 3ICPA 3PHLA 1ADBA 3L77A 2R00A 1BHSA 3UAGA 3MJ4A 4JP2A 1NQ5A 3E8XA 4GVLA 4GI2A 3GG2A 4CM4B 1C0IA 1JU9A 1KVSA 3X2FA 1NFRA 1LDEA 1CRWG 3WYBA 4CLRA 5TT0A 1ZUD1 5GZ6A 1WDKA 2VHWA 4JROA 4LVCA 3RFTA 1MFPA 4Y8VA 4QXMA 2XXJA 2Z1NA 4NK5A 1HT0A 3PYMA 4RVUA 4E2WA 1O95A 1ZSVA 5ICSA 2Q4EA 1OZAA 5IF3A 3AJRA 1FJHA 3NDRA 2JFHA 4GWGA 1DC6A 5G4LA 4RLHA 2AG8A 1P0FA 2DPGA 2OBYA 3VH4A 1X1EA 5A03A 4BMVA 3AUAA 1AXGA 1E1LA 2C5AA 1RJWA 1VC2A 4H7PA 1ENYA 4ESOA 3KLPX 4DBZA 1JW9B 3D4OA 3FI9A 5C7OO 2GUGA 2V65A 4ZA2A 3WFJA 1B8VA 1OFGA 3HQ4O 3DTTA 2ZATA 1MG0A 2WMDA 4EDFA 2P2SA 3LDHA 2X4GA 1O0SA 4TKLA 4J1QA 4M1QA 3GN1A 5AYVA 1KVTA 4CM9A 1E7YA 3GR6A 3GZNA 3INRA 3RCBA 4YTEA 4BKRA 4EGFA 5TRTA 4PCVA 4BNWA 2GN6A 3DBRB 1LRLA 3PHJA 1ONNA 4IDGA 4LMPA 4MVJD 1VI2A 2Q2QA 5IZCA 3U5TA 4J0EA 4N7RA 4CMGA 2QIOA 2Y1CA 4K1LA 3E82A 3B1FA 5KOIA 1HWYA 3QVXA 3OSUA 1EBUA 3DWFA 2W4QA 4FC6A 4OQYA 1QXSA 2VOEA 1GTMA 2HLPA 3DHNA 1LU9A 2PR2A 3W1VA 1YH3A 4A27A 1NVTA 1G0OA 3U09A 4URFA 4E5YA 3QRWA 2PTGA 3W4KA 4WK6A 3H5NA 1XSEA 2CSUA 5H81A 1U5CA 3WGHA 2NQTA 4LCJA 2NADA 2Q49A 3TL2A 2AQIA 3G0OA 1P33A 3MTGA 4RPHA 2PH5A 4AJJA 3M2TA 3I6QA 3E5RA 3OIGA 3U4HA 2P4HX 4YJGA 2VRCD 1C14A 3Q6IA 1P1IA 2V6GA 2X9VA 4R9RA 4CLEA 4DL9A 4GGOA 3C1TA 2DFDA 1VSUA 1QG6A 3OQ1A 3SC4A 1WLYA 1QYCA 5DCYA 2O3TA 3PQDA 1AUPA 2RHCA 2DTDA 4XIYA 3H7AA 1ZK3A 1H0KA 3VPXA 1QR6A 4CMCA 5KVSA 3QV1A 4R3WA 1Y8RB 2R2GA 2DM6A 1H2BA 3IL2A 1M76A 5HTOA 4FJ0A 5A9SA 1NWCA 2BH9A 3FRJA 2W8ZA 4J4BA 1HZJA 2J5RA 4X54A 5TX7A 4YPOA 4IM7A 3HG7A 4NNJA 2X0NA 1E6EA 2IEDA 2NM0A 2WD7A 3N58A 1ISJA 1UP6A 4L75A 4U5QA 4DC0A 2XXBA 1IPFA 4RCVA 4D0SA 4CQLA 3E6AA 2EV9A 3EUWA 3K6JA 4IXTA 2NACA 1X13A 3CEAA 3DEYX 3ZV4A 1SBYA 1GL3A 2VWPA 3TOZA 5G4KB 1V0JA 4TKMA 3R6DA 4E5MA 1HYEA 4PG5A 3KEOA 2ZB7A 4J4TA 1W73A 4WLOA 2EW2A 4PIVA 5EMHA 3WYEA 4FJ2A 4YJHA 3ABIA 4R41A 3ZWVA 2PFGA 4AFNA 2B36A 1X1TA 4QO8A 8LDHA 4J43A 1CEQA 3GEMA 3E48A 3OECA 3H3FA 4YWJA 2O7QA 3TWOA 3FNGA 3WQQA 4BKPA 4CQLB 4PRKA 2BKAA 1QLJA 1A5ZA 2QQ5A 3G3EA 3IC5A 4CMAA 4DC1A 4XR9A 1PJ3A 3F4BA 5I7SA 1PJLA 3RU7A 2NV6A 1MLDA 2IXBA 4UVHA 4RVFA 1GV1A 4XB1A 3WJ7A 4EJ0A 4YR9A 2R00C 2Q2VA 1QRRA 3WFIA 4HBGA 3BHIA 3D5QA 4RGBA 3MJCA 3FTNA 4I5EA 4IDDA 3RUEA 4EJ6A 2NVBA 5F5NA 2EP7A 3QLJA 3QWAA 3FPCA 1VSVA 1DPGA 2IE0A 4JJIA 2FR1A 2VHXA 1JN0A 3GF4A 3D7LA 2ZQYA 4E5NA 5A9SB 4WKGA 2HK8A 3QQPA 2J3HA 3ANMA 3ZDFA 1UXHA 1CJCA 2X9GA 4L9RA 4MVJA 2VHZA 2PKRA 1C3VA 3JD2A 5JFOA 1I36A 3PDUA 4IQ8A 1T2EA 4J91A 2AA3A 3N7UA 1I3KA 5IZCC 1BXZA 1MC4A 4XQGA 3O38A 4RVDA 4BS9A 4YYZA 3C1OA 3PWZA 1FDTA 1H2HA 3HHPA 5C7IO 4HKTA 4PVCA 5LC1A 4RZHA 3HJAA 1AE1A 4KTTE 1JWBB 3OIDA 4XQ9A 4TRMA 2ZTLA 1HDYA 3CH6A 3VTFA 3ZGYA 3ETEA 3GK3A 1P3DA 5FI5A 3DAFA 3OJOA 4R5HA 4FGSA 2YQ5A 1ZJZA 3NTQA 3TZKA 1EK6A 3DBHA 4HFJA 4R51A 5COAA 4E2YA 5DZSA 4AJLA 3GZNB 4TZKA 2D3TA 5F1OA 5I9LA 1H9BA 2VZ8A 1NTOA 2YHIA 5IN5A 4FR5A 3R1IA 4OKNA 1TT5B 1JKIA 1KOLA 4DPLA 4KDFA 4Y67A 4GSKA 4CM4A 1AHHA 1C0PA 1DBVO 1HDXA 2UUOA 1EK5A 2WD8A 4A73A 3BA1A 1AN9A 1B14A 2A94A 5KJ6A 1JAYA 5IXYA 2X0IA 2HMTA 3JSAA 5CG1A 4QT0A 3DTYA 5G0VA 2Y93A 4QQRA 2B83A 4YJHB 4BKOA 2P9EA 3RFXA 3AOGA 3BHJA 3INGA 1HEUA 1BW9B 2DUUA 4BVAA 4E2XA 4KOAA 3GN2A 1YS4A 2IDZA 5JCXA 4E33A 1NFQA 1LA2A 3BMQA 3GAFA 2P9CA 3AI1A 4D45A 4XYBA 3WICA 1C0KA 3TZQA 5B1YA 5BQFA 2PD4A 3FCOA 5A9RA 3I6IA 1ID1A 1GAEO 1U7HA 4J9UE 4NIMA 1J5PA 3QSGA 4XIJA 2VT2A 3PZBA 2DQ4A 3QWBA 4JP3A 5EINA 3QE3A 4NBWA 3L07A 2Y1EA 2FN7A 2I76A 1L7EA 1WVGA 4RVGA 4WCFB 5L45A 1NR7A 4Y98A 2Q2WA 3FN4A 4XGNA 2NTVA 4BNJA 5IXSA 2HQ1A 1PTJA 1E92A 1JWAB 1Q7CA 4LRSB 4FOSA 3RKUA 3JYNA 3DOOA 3WR5A 3TZHA 4YT8A 1GCUA 1ZK4A 2OFPA 4A5OA 2XAAA 4ZGWA 1B7GO 4OYRA 4WE3A 3KXDA 1IPEA 1HE3A 4CV2A 3AM5A 3MCVA 3ANNA 3ZN2A 2JFFA 3OEYA 4BNNA 1U8FO 1K5HA 2J3KA 1L1FA 4TQGA 1PS8A 1U28A 1OOEA 2O4CA 4RJTA 5EPOA 1JA9A 4OGWA 3EVTA 4PLWA 1A4IA 1ISHA 3P2YA 4DREA 1R0SA 1MX3A
chains in the Genus database with same CATH superfamily
2JDID 4WKCA 1J2TA 3GH1A 1D09A 2GBCA 1LEHA 2OE2A 2QP4A 2VG8A 3C16C 2I03A 4OXIA 1TADA 3LYLA 2J0UA 1M2OA 4G4IA 4D8UA 1N1DA 3ZWPA 4S2UA 3DVRX 4DGQA 3W9SA 2KBEA 5J47A 4C1BA 4XUDA 3U7QA 4P86A 2LKDA 1BE0A 3K05A 1LVHA 3EPLA 3NX4A 3RD5A 4AJ2A 3QNUA 1GP2A 2WKSA 4H7IA 2NMVA 5EIBC 4A6DA 5GY7A 3ZX4A 5F73A 3CNQS 1HYHA 1YZYA 3RS2A 3BE5A 1NZFA 1EFUA 1U7OA 2PVCA 3CB4A 3DKIA 3E9YA 4DCPA 1XWFA 1NNSA 1ZI9A 2GEFA 1F2VA 2GWHA 5IJZA 2UZ1B 1A95A 2H7CA 4QPDA 2HBRA 2Y1GA 5HUJA 4LMRA 3TQSA 1V7CA 3BA6A 3OWXA 2F8MA 3QUQA 3JYQA 3QELA 1S1CA 1O57A 2GEVA 4IF4A 4IG9A 1WXDA 1ZYUA 1SXGA 2GGSA 3FCUB 4LYFA 2VI5A 4BFYA 3K3PA 4RENA 4E4RA 4B5KA 5HZMA 3T9FA 1Y1LA 1JJFA 4GP7A 2B8WA 4NONA 3CLSC 2R6FA 2VUSA 1G64A 1YB2A 4NVRA 2C7QA 1PEDA 2NAFA 2CHGA 4O1MA 5FD8A 3IJEB 3HADA 4V3CA 1U0JA 1XEFA 3H18A 1TYEB 4GSLA 2QLFA 4TWRA 4PIPA 1N2SA 1W0KA 4X94A 4F8EA 5KTPA 4JFAA 4WKNA 5K0CA 1G7TA 1SJ9A 1MPXA 3I0ZA 1N0VC 2HRRA 1TA9A 3ENZA 4X95A 3L1HA 5I8WA 4E2ZA 4QD3A 3AINA 4M1MA 2PZMA 3ZU2A 4BLPA 2ZJAA 4F56A 4MR8A 1Q0RA 4YROA 2C2XA 2G5GX 4U3JA 2ZUFA 2EFEB 2OP1A 1E4VA 3IBGA 1M75A 3ZY4A 2DKNA 5LFAA 1OI2A 3UMCA 1XU7A 4HDMB 1NSFA 3TSWA 2QSUA 2ZIEA 5AK4A 3VV3A 5H02A 1ZH4A 2Z2YA 5C7LO 1K68A 1MW9X 1S8OA 5C1DA 1DKOA 1GRNA 2PY6A 1SM4A 1RM0A 1ZIOA 3P2JA 3LCRA 4JQCA 1VKRA 2FSGA 3LQQA 1DHTA 4P5PA 4UE3S 3SKVA 1PW5A 4MI9A 1FQWA 2W6ZA 4L8FA 5HYVA 1NQOA 2UU9B 4C0SA 2BC9A 2GH1A 3QWHA 4RANA 3DKRA 4QBFA 3R7WB 1B26A 3TVYA 4EO4A 3ROGA 5KNCD 1R3DA 3IV7A 2JIOA 1V96A 4U9HS 3PJGA 1P2FA 4DDTA 5A5GA 5DNUA 1DDGA 2JD1A 1NQXA 1SXJE 3OJCA 3KPVA 3ENKA 3LXRA 1RHJA 1TVKA 2ZT5A 4ACAA 1F0PA 4C3ZA 1JBQA 4PZZA 2VPZA 4LAFA 5L4LA 3ESRA 4Y18A 1SWWA 1L7RA 1GG9A 2ORVA 4PYIA 5EL0A 5FL3A 3RYIB 2FYTA 3F6RA 4H7DA 5AKLA 2KS6A 4JL8A 3DKPA 4MZXA 1JUDA 2BGKA 1BYUA 2X6TA 2QA5A 1KQFA 1J9ZA 2ODPA 4PYLA 5L9AA 3OPYB 2Z1DA 1TZJA 4PYOA 1W34A 2RONA 4G4SP 4MJXA 2O8CB 4OQLA 1Z35A 4EG7A 3LHIA 3E53A 2C20A 4DRYA 3WBJA 3PFBA 1FNSA 2P9ZA 1YR7A 4R6WA 3USZA 4MDYA 4PC6A 2W2PA 5F5XA 2PYDA 2QGZA 3BKXA 3QE0A 2YXNA 3RRJA 3N86A 2QZPA 2EL7A 4RS4A 1WOMA 2JIMA 3G9QA 4FGUA 4CL8A 3D9QX 1QO7A 1S3IA 2GK6A 2JGFA 2GHQA 4GPD1 4GBMA 4QOIA 3KQHA 3CZ4A 1F9EA 5LXTF 1X1AA 3T06B 5KDDA 4QX6A 3V7WA 2IH4A 2ZCVA 2B1GA 5EESA 3VDXA 5IKPA 4UDYX 4CDRA 5KNDD 4RHEA 4FB4A 5C1IA 1TUBA 2VDVE 4G1FA 4NV0A 3RFVA 2AG1A 5JYEA 4LRWA 4BUCA 2V5UA 1JYSA 1ZUNA 3A14A 1CDDA 4NMLA 1RC0A 1TF7A 2GLXA 3MBOA 5IN4A 3PFIA 5DE3A 3ZX5A 2AFIB 4Y6OA 5EUQB 3SMQA 3KLMX 4EX6A 2AEJA 2WWXA 2PU5A 3UXEA 2FUEA 4EA7A 4NZPA 4QOSA 2O8VA 4DQXA 3TLBA 5E8RA 1YDHA 4QPJC 3W2HA 5IZ4A 1BXRA 3VX4A 5DCUA 5DSTA 3TUJC 5JNSA 4EQZA 2GAOA 3L84A 1UPAA 8ATCA 5FFFA 1NX6A 3YASA 4KAXA 4EPRA 1JKJB 1NMXA 1ZUWA 3AEKB 4XWTA 1H8EA 4TUYF 3BMOB 1GR1A 1KYTA 4BLUA 3F3MA 1AKMA 1PNTA 4DLYA 5HSGA 4J90A 3RAFC 5SICE 1KZ6A 4KXFB 3BRWD 1JXAA 5HQTA 2WSYB 2CB9A 4R9NA 2O50A 2UKDA 2GETA 5EJ8A 3EIHA 4S05A 3F78A 4S2EA 3NIDB 3V1KA 3MZ0A 1S2DA 1JSRA 4X1YB 4G1MB 4KFTA 3IAHA 4WK0B 3PDIB 2RGWA 2MCFA 2OYCA 1CLEA 1GNLA 1JR4A 3OI7A 4N47A 2ID9A 4ZCRA 2OFWA 3QJYA 1PJ2A 4RW0A 2CV2A 2BDUA 1B8NA 3K6SA 5EHIA 3WGUA 821PA 2XZPA 1MC8A 2RGCA 2C4VA 3L7OA 4GLJA 2IFTA 3CJRA 3H2HA 4AMUA 3G59A 3GV0A 4DCSA 3ANSA 1IZ8A 4MRMA 1QIGA 1HY3A 1HTBA 3R75A 3FPSA 1N25A 4OHRA 4OXKA 3PTZA 5LVAA 5EJAA 4GDFA 4KHPB 1JALA 4XR4A 4DABA 1E0KA 4I9HA 4P33A 5KQMA 5EIOA 4M9RA 4L57A 1GUFA 4DA7A 2FZWA 2HPAA 2ORWA 3NP7A 4HVTA 4IOKA 1YS9A 1C30B 4MQMA 5C37A 1OC4A 1Z4JA 1BOOA 1YZHA 2O23A 2OP0A 1Q17A 5CBPA 1S4QA 4MYDA 3ZBTA 3GLGA 2QRZA 4PCLA 1NQAO 4A6PA 1QJCA 1XR3A 5KS2A 1N34B 4IJUA 1SAYA 2QAGB 3CJQA 1SPXA 3HP1A 2ADFA 1T3SA 3QMMA 1THTA 4TTVA 4WCVA 4B84A 4FDAA 4MPTA 3I30X 3EIUA 5EAIA 3GCWA 1E2LA 1INLA 2EJTA 3KT8A 1EQUA 3OHMA 4OI1A 1XKQA 2FZEA 1C80A 5T6MA 4OYYA 5IJAA 3A1SA 1MAAA 3TIGA 1RHUA 2PIDA 1Z5PA 3F46A 3VVBA 3NOOA 1ANKA 4H1VA 4Q9HA 1KDOA 1XPUA 6YASA 4BLWA 5CFOA 2Z2KA 3WGGA 2CMDA 3AHEA 4MQFB 1YHYA 3CYFA 3C7TA 4UCFA 3WIBA 2QYHA 2VF4X 3HZRA 1EA5A 1VECA 2C2KA 2BFOA 4RVSA 1C4XA 1WZIA 4HEJA 1EK0A 4G5XA 2PUDA 1NNUA 3OY7A 3UPTA 2CEKA 2ONYA 4MW2A 5J1SB 1UWLA 3B78A 1RM5A 3N75A 5EP1A 3AVXA 2QNBA 1LNQA 4YJGB 2BBSA 5K51A 3VTZA 3OQMA 3S2SA 4GPEA 3WL6A 2OLJA 4AULA 1K5PA 3S6JA 1L4BA 5TSDA 1HPLA 2FW6A 3JASA 4FOTA 4FP9A 2ZBQA 1KFKB 4UATA 4U63A 3ZDYB 1GPUA 1M2HA 2VAPA 1GN8A 3ZS9A 4Z1MD 3Q3GE 3WSWA 4A8TA 1UWCA 4Z9YA 4EPXA 4BZZA 2F43A 2HWWA 4WFQA 4N40A 3LUKA 3B6IA 3IQDB 5FQNA 3UM9A 5C9ZA 1H94A 3KKKA 3IUPA 4EJSA 1H3FA 1UBNA 4NSNA 5TLSA 2DWUA 3KTDA 2VJMB 4JVSB 2DTEA 3TL6A 3RF7A 2R6AA 4P98A 4AI6A 1U8AA 1CIPA 1YDWA 3BBLA 4WZAA 5C1OA 3IUNA 1C9JA 3KSZO 4HAVA 4UUPA 1UINA 2DHRA 1J1IA 4NV1A 5KHLB 1HDCA 1K06A 2CNKA 3HABA 2YWFA 4LXGA 5FPKA 2GKOA 3CR3C 3E18A 2H54A 3DAGA 1AOXA 3EGDA 4INPA 1UFKA 3OCUA 4QQKA 4J0HA 4GMHA 1OLSB 3VYUB 1G17A 4HHEA 1QKIA 4IIXA 3ZU3A 4RTNA 2EJCA 3O73A 2ZAOA 4MITA 4BZXA 1SVKA 2CNWD 2C94A 4HWKA 4LHYA 1AXEA 5TQ2B 2ZYSA 1XNJA 1L5MA 2XKBA 3LLVA 2JKVA 2ZB3A 2P9TA 3HZHA 3MAJA 5TARA 3UB2A 4A10A 2SNIE 3BEDA 5H83A 1NC3A 2O2GA 2UVDA 4TXNA 4LVUA 2RB5A 5FTNA 1PGQA 1DMSA 1UZNA 4HLCA 3U7EB 4ZO4A 2QPOA 3USCS 4URVR 2Q5OA 1BSVA 4MXDA 5B6PA 1VM6A 4PLCA 3O8OB 3PGLA 5JWRA 2NG1A 4I9GA 5CT9A 1U1DA 3O6VA 4J75A 3H5WA 1H8HD 5FUXA 3NH9A 1HQYE 1HLDA 2BFDB 1IY2A 2PDAA 2OV3A 2Q21A 2BOVA 4HDSB 1MO4A 4PE5B 3ZU6A 4L6CA 4RC9A 1K7CA 3R40A 4L1KA 1CNEA 1DJQA 4QXRA 4UNNA 4B8WA 4AKEA 1T6BY 3PYXA 1LFDB 1PAUA 2P67A 2V0NA 3FOAA 3G2JA 3HCNA 5JRJA 1ILEA 3R6TA 1EFCA 2FWJA 4OBWA 2PE5A 3NWBA 3BRQA 2R8BA 2W93A 5L40A 1Y3CE 1UK9A 2BE7A 2TMKA 1M2NA 4YAIA 1R5OA 4IH4A 4RPKA 4P7GA 4RV5A 5GP1A 2WZQA 2QTCA 1LK7A 5IAAA 4KR2A 1AKNA 1KO5A 2J3IA 3TX6A 3UV7A 3BTVA 2VLIA 2ZYTX 4WXHA 1D07A 2WF6A 5H4HA 1BG6A 1OFUX 2I6XA 4UEOA 3W9UA 1PJCA 3VR5A 2IA5A 2H31A 1KMHB 2VHCA 4JLDA 2AQKA 1KIFA 1L4HA 4KN9S 2ZWIA 2WSSA 1XLUA 3WHIA 1H85A 3RSHA 1JR3E 2YTZA 4K9DA 1FW8A 4ZRNA 2QRJA 4KWIA 3FB4A 4J2TA 3U60B 1R6AA 2BIFA 1AZLA 1JKXA 2QMEA 4II2A 2P2NA 1FX0A 1SKUA 2BGIA 1C9YA 3CLUD 1SXJB 4ZP1A 2DB3A 1II8B 2FPIB 3HK2A 2QG4A 3HB1A 3CKLA 4J03A 1IN4A 2Q1WA 3AOEA 4MQ6A 5ILOA 1V1MA 1XZEA 2RCYA 2W2NA 3DFUA 4RJJA 5BN5B 4CHTA 4HVCA 1LV8A 2H5IA 3ETDA 3WLFA 3EPJA 1T36A 4S1WA 2CE2X 3U2QA 3GGDA 1IZ9A 3NYIA 2CXPA 2ZBEA 2C3UA 4KXLA 1MNAA 4JWTA 4CMJA 2OAEA 2Y9PB 5G4KA 2J08A 1FVOA 3UC5A 1SZJG 4ARSA 2EWWA 3U44B 5A0VA 3D3NA 2FX3A 3CVUA 1V4VA 1TW3A 4IIGA 3DE1X 5K0JA 1NPTO 2A9FA 2N1MA 3U9LA 2AEFA 1G6Q1 5LOVF 2WBLC 4F86A 2C0PA 2NW6A 3R3WA 1Q0TA 3A7DA 1W1WA 4NBLA 5JO0A 3DPSA 1TIBA 4BQRA 4KODA 1TAGA 2EFCB 4IFEA 4JC4A 2IYWA 3KKEA 1XRMA 4RK7A 3X1WA 9ABPA 5T3UA 3VC2A 5JSHA 1VJDA 3E9EA 5J3JA 5ECYA 4MW4A 1DO2A 1R1DA 2AW3A 3DEAA 3DZHA 3WL4A 4EF6A 1JTEA 4FYXA 2DECA 4BV8A 1QRDA 5BUZA 5JARA 4EYSA 1G6OA 1Y5RA 3OCCA 4FEYA 1N2CB 4NU5A 5KU7A 1W8IA 3KZKA 1L3BA 3WMXA 4DJTA 3NJ8A 2PZKA 4C6RA 1EGQA 4RF5A 3IS3A 2JLWA 1QWSA 3E2IA 1VXOA 3GFGA 3L8HA 3JQBA 5AHXA 5G3ZA 1CRQA 4MAMA 3USES 5JAMA 1RQRA 2DWQA 2GZMA 1OI3A 1ACLA 1DUIA 1FPMA 2D2EA 3ZKWA 4CMHA 4HTFB 1XYGA 4DQKA 1TXGA 4BRZA 4MPDA 3Q1LA 1U8YA 2X7HA 5LOVA 2JFWA 3OFJA 4ALMA 4R84A 3E7XA 4GLLA 4J6EA 3ROFA 1W88B 1V1MB 2CL7X 1LDMA 2RH5A 5TGZA 1R50A 2LP4Y 1RNLA 2ACEA 3A7EA 4V2UA 4DHWA 2F9LA 3BIJA 2JASA 5LYJF 1L1QA 2G77B 5BNFA 5LPNA 5K2OA 1DZ3A 1JLMA 1YB1A 1B8UA 4COOA 2C9CA 2D1TA 5GVRA 1KJJA 1NMYA 3ILVA 3L18A 4II3A 4L78A 1NXQA 4L22A 1T2FA 4KBYA 4TS9A 5E1BA 3T1NA 4CQMD 2HMUA 4KK4A 3WLEA 3ZIUA 2C54A 3LLSA 5FOXA 3CLSD 1DWUA 4OJQA 1LPNA 2CLMB 4BN0A 2VJAA 2GVDC 3AJAA 3OM0A 4IIEA 3AEZA 3OWOA 3SYMA 4RY2A 1P0PA 3L0YA 5FPTA 1QP0A 4B7AA 1RPZA 3A1CA 1PJQA 1E79D 2MSKA 3DWGA 2OBBA 3NDJA 2HF7A 1Z08A 5ANRB 3TOSA 1MOQA 4KQ6A 3O3CA 1WQ3A 1Z2CA 3C3MA 5JCJA 4G0VA 2VDLB 1YQTA 3EGXB 2CVPA 3OT5A 1RFLA 4NATA 2NN3C 3MCTA 1E9BA 4OUDB 1GPDG 2Q5EA 3MBKA 4UASA 2G9NA 1HE2A 1P2TA 3VNBA 4YIKA 4TSFD 1X39A 3BXEA 3K9QO 4JVOA 2ZCJA 4M1TA 3C3CA 1EX7A 3T5CA 4DLAA 1FFXA 3LKBA 3BSSA 1KU0A 5LZ7A 1A9SA 3H5OA 3LQFA 3WNDA 4DILA 1UBJS 2HSGA 3IAFA 4FW8A 4W99A 3HDVA 4XLLA 3TSOA 2WKWA 3LVRE 1L7BA 4J8PA 5KDLA 4BB5A 3VA7A 1EXDA 4GLOA 1HG0A 2W22A 3HGMA 1ZL2A 5C8XA 3A58B 3HKEA 4KWHA 3VR2A 2HV8A 2KYRA 3UAYA 3V2GA 1KQNA 5KTYA 3A04A 3I2IA 3P0RA 6LDHA 3MIIA 2QLTA 4TYWA 4RXUA 2BI7A 3W5AA 1DKNA 4WPGA 5TR9A 1SVUA 1Y42X 3DBVO 4CHGA 3FLBA 2C61A 4MGIR 2H1RA 4AJNA 4NYMR 5JQGF 1RABA 5K8LA 3HBLA 3T7AA 2RHMA 3KQTA 3L4KA 3ZY3A 5AKJA 4BO6A 1PJBA 1Y1QA 2KM1A 4IWXA 1PHPA 4XTRA 4Z49A 4FGKA 1YE8A 4CG0A 4QYIB 5H8WA 5KPJA 4RK0A 1OJLA 4FMPA 5CM9C 3FCYA 3E0QA 4JKIA 2GYYA 5L7TA 1HDRA 2YY7A 2ZJ6A 2Y6UA 2B4QA 1VFPA 4KSBA 2OZLA 1AKQA 3EVNA 3IHKA 3VVLA 3BICA 5BWLA 3OT1A 1CZUA 4GEGA 3FNRA 3GCDA 1H65A 3WBFA 2NTNA 2PG3A 1WZEA 5FYDA 4BMDA 4EP1A 5KYXA 1ZGHA 3P9XA 4G9EA 2JBWA 3KFXA 3SBOA 2CFTA 3DEFA 2Q1XA 2V7QD 5ERGB 2IHYA 4DIOA 3UNXA 4C76A 4IKEA 3A27A 3E9NA 3FUTA 2DSTA 4U6QA 2P77A 1OX4B 2VP5A 3C8MA 3LC7O 3QOYA 1Y8CA 4H4EA 4V03A 5EPEA 1HR0B 2CXQA 2AZMA 3BD7A 5NULA 4X60A 2IU3A 4ESHA 4UFOA 5GTDA 1J2RA 3FI0A 4FFBB 3ICEA 5DT9A 2R1ZA 2V5AA 5CH8A 3RI3A 1E8DA 4W4TA 3M70A 2XZDA 4K3VA 3UHOA 1EKXA 1NF3A 3K2EA 3O8NA 4LSGA 5AJUA 1OXXK 3UA4A 4IVQA 4HPXB 5K0SA 4OGGA 3GGOA 1X9IA 3JQGB 1R8JA 3CR7A 1NXOA 5H3LA 5JE8A 1QZXA 3TEFA 5CB4F 1QX3A 3AWIA 2V6MA 1PZEA 3A0RB 5KVAA 2RAVA 4GBJA 3C8UA 3M9WA 5E2AA 1P9LA 4TVKA 2P41A 1QFXA 4Z54A 2HDWA 1CYEA 5GIPE 1YULA 4O2LA 5SZIA 1XAJA 3PNYA 3U4DA 1ABEA 3W8FA 2IRWA 5C3MA 1GNVA 3S2EA 3QG1A 4NOKA 5EXPA 3VNAA 2EKBA 3IMFA 5H7XA 4J2HA 4BBJA 4AAYA 2QNIA 4OHMA 1RMYA 4EM6A 1EVYA 3MD9A 3EVCA 3AF2A 2BONA 3EDRA 2ADOA 2QD1A 4AKSA 2YQ4A 4EY6A 4BGIA 3FMGA 4PHTA 2F4NA 2FFAA 2XIJA 5ALLA 2FFJA 3PENA 3ZZMA 4HT3B 1K7SN 2Q07A 2B99A 1VTKA 3SZRA 4A16A 2ZJ1A 2E4UA 3KNZA 4RPLA 5FTLA 1FNBA 1HT3A 3V4RA 2XB2A 1G16A 1V43A 3KFVA 3O31A 3WISA 2OAP1 1T1GA 3N2YA 3EF3A 1J49A 1EDZA 1USWA 2G17A 2H0AA 2P91A 3EF0A 3P96A 3BGDA 3D5EA 5GJWC 4WJZA 2VZ9A 3K30A 1JG1A 3P9YA 4J4HA 1GQRA 1W36B 1BEUB 1P8JA 3DDZX 4UDOA 4EO9A 2GNAA 3FR7A 2Y66A 1B2RA 4FFPA 5EUBA 5HE9A 4LQDA 2NSJA 2R751 4GVXA 1RD4A 3FIJA 5KREA 1ULBA 2CW5A 1NVGA 1QHXA 5FOQA 3HBMA 3OF5A 3R8XA 1EE2A 1NBMD 1QHSA 4Q18A 2FW9A 5HEKA 5CFZA 2YNMA 3EJ6A 13PKA 3LHKA 1PCXA 5HQJA 1NOKA 3WAJA 1FS5A 3O1HB 4FK8A 3T3IA 4CKWB 3GDGA 5AVOA 3OG9A 4CCYA 2E6UX 2P2GA 1U2EA 5CDHA 1GXSB 2E4ZA 1YZGA 3GAZA 1JPNA 3IDZA 4IV0A 3UUGA 3VZRA 5JNTA 1JJAA 1FU8A 3QHPA 3NS7A 3Q10A 4KG7A 4PYNA 3D4PA 3VC7A 3EUEA 1ZN7A 3AFHA 4FQ8A 4MKXA 4MUNA 3BD8A 4RO0A 5GPBA 3UJ7A 3HTXA 1RHRA 3FWYA 2VATA 4LZLA 5IW8A 1HNZB 3MT0A 2I2FA 1TO1E 3DAPA 4MTLA 4A0GA 4CI9A 3Q40A 3IUYA 5AR1A 3Q0TA 4HAXA 1JXMA 2CZCA 2PZLA 3T54A 1KC1A 2GJKA 4O2AB 4OV6B 1V5EA 4M2LA 3U40A 1E1KA 2YZNA 1ZMOA 2NUBA 1TLFA 4WXRA 4CEJA 3BIOA 1X1BA 2JCBA 4B3GA 2XCRB 2AFRA 3D3KA 1SXJA 5ER9A 1J06A 4KLAA 6AT1A 1DRWA 3PU6A 3F1LA 5BN4B 4Z2AA 2HK7A 1N5OX 1QYVA 4PPFA 4C4AA 2HJ9A 2E0IA 3EG5A 3CZMA 3WHLA 3UBTA 3K0BA 1PVDA 2HLDA 1UK7A 4TMZA 4EHAA 1M2WA 4DV1B 4QDXA 2QI9F 4R69A 3RVSA 3W2GA 1IZ0A 1Z0FA 3RS3A 4ER0A 3SS7X 4ENRA 5KMGA 3OLQA 1B2LA 1RAGA 4JR0A 4WZAB 1CLUA 1FLNA 1OFHA 2JANA 4OJTA 5FJJA 3DZGA 1D1TA 1YBHA 3NTLA 3WLIA 2OCGA 1CULC 1UC8A 4MQ4A 3KEQA 1JAHA 4AUKA 3TRFA 2PCLA 1R6VA 3IE0A 4QNRA 2JKZA 5ER6A 1B3BA 2QP9X 2W6ID 2O2SA 2YCBA 3F47A 4QRIA 3WGLA 3ZV6A 4CLHA 1SELA 3SK0A 3NC1C 3IHWA 3LT1A 1IN7A 4MKHA 2IV7A 1IEXA 3H9JA 3F6EX 4I4TB 4MRSA 1EWRA 1EAYA 1NX9A 4ZFNA 3MWEB 4F2HA 4FJ1A 5WRFA 4X6UA 5GONB 3VZPA 1E2PA 3AUXA 1DFHA 2NU8A 1R6UA 4FDTA 5EXEA 1C9MA 1WAMA 4REQA 3U80A 4A26A 1RP7A 1BXGB 2O8DA 4QUHA 3VFDA 3L6DA 2RG1A 2PWYA 4CJXA 1N32B 3N2GA 5G0TA 1AN0A 1P9OA 3M6AA 4F3YA 1DRJA 5KC8A 1H66A 1NF9A 1WO8A 2FK7A 2G1JA 1DBSA 4NBSA 2Q5FA 4JXZA 2VRCA 2NV2B 1EXNA 1NULA 3F7TA 3TDNA 3O03A 1U31A 3AR9A 2A9OA 2B4TO 2CFSA 2FQ1A 2Q5JA 1ZNWA 2Z4TA 1YFLA 4RTQA 3CURA 3V55A 2L82A 1JQ5A 1Y7HA 3I01A 4ZI5A 2YV2A 1F0YA 3FWNA 4OLHA 1FFEA 4AW9A 5ALHA 3QU2A 2FP4A 4DUGD 1M0WA 1VL0A 2OY0A 1P9RA 1PJRA 4Z0HO 4XX0B 5CFQA 3NW9A 1DJNA 2X9QA 4BCCA 3PHHA 1IMJA 2K87A 1HQCA 3ESXA 1Z4PX 2CDBA 3O8RA 1Z7EA 4HAZA 4QLAA 5IEBA 1V35A 4FQ7A 5I45A 4HV4A 3BWBA 1ZJJA 3UBMA 4QPNA 3PUZA 4QBGB 4ZMBA 5ALVA 4DA4A 3CX8A 4NABA 1C81A 5C80A 4YCNA 2FW7A 3GELA 3IH5A 1JZSA 1I4DD 4HFNA 4HNAA 4NULA 5F21A 3OF2A 3EIEA 4QEDA 1D7OA 2WFAA 3R5HA 2AXEA 2QPAA 2DKOA 1QF7A 4OKSA 3QMWA 4H3KB 1J20A 1XJQA 3SR4A 4DLZA 2IHUA 4OLBA 1K6XA 1U8XX 5IT5A 5CIWA 3D0OA 1PJSA 5CCDA 4G2TA 1KEZA 1I3LA 3FYCA 1W94A 4XUCA 5AXAA 2O0MA 4C04A 3MAAC 5ITWA 4F3RA 4ZQEA 1JJVA 2BMAA 4TL9A 4FLMA 1ISPA 5JS8A 1CF4A 3Q98A 2QTVB 2QGFA 3MOIA 1RSZA 4EI7A 2GZHA 1MW8X 5F2KA 3LLUA 3FBGA 3VVMA 2HTEA 2X1VA 3K6SB 4IZHA 3X43A 5AOBA 4AJ9A 2PSFA 2SCUA 2RK6A 3H8SA 4B3HA 5HQ3A 3ZCRA 2OHJA 3GH3A 5EJ5A 3A37A 2MYNA 4YRJA 3WXBA 3IQFA 2J59A 2ODQA 3TNJA 1GZ6A 2QXUA 1YB7A 3PXGA 5JI2E 4BGUA 4XWGA 4YV2A 1VSTA 3LY5A 4OGLA 3U62A 2O1EA 3JZMA 2FN4A 4YJ3F 1BE1A 1JEQB 4WFIA 2OLEA 1BMTA 2BP7B 4RBNA 3VR4H 1UKYA 5REQB 2A4MA 1H6DA 1ONPA 1YC5A 1YQQA 2JGMA 2ZRHA 3H9GA 3I8XA 1M8KA 3JQEA 5D84A 2FEAA 5BURA 1XZBA 3GLGE 3O26A 3DUFB 4QOFA 3EEOA 1TW2A 3RPEA 2I6GA 2PXHA 4DTIA 2GYUA 4P0PB 3OFKA 2IS1A 3UF0A 2VNHA 4EY4A 1ZL0A 4M0MA 3M4NA 4KVFA 1D4FA 1XZAA 1YVDA 2HRZA 3IQIX 2NZXA 1Z6QA 2RIPA 4MVCA 4Y0NA 3SX0A 4DBLC 3AYZB 2LDXA 3IEVA 2B4YA 2C4MA 2Z3VA 3KK0A 2VAXA 3E9ZA 3L02A 5I8ZA 1QAMA 1IM8A 1XVIA 2H2IA 5JCOC 3SNHA 1P44A 3D3JA 1T9GR 4E15A 4X66B 2PGDA 5ELLA 4HZIA 3SZGA 4B6EA 4HNSA 2QD4A 2C97A 4NMXB 3U31A 3PXCX 1JFVA 3TQIA 3DXXA 1QPZA 5DYTA 2B2NA 1LPBB 2O0JA 3HRHA 4JT8A 1EFVA 1LPAB 2HO4A 2IPNA 3MWFA 4PBSA 2ZT8A 5KTSA 2I6TA 4GU5A 3OQIB 4EKGA 1KPIA 1Y4UA 2P6UA 1BKDR 4NESA 1KPHA 3PRHA 5AXCA 4CKYA 2XZLA 3NPMA 1A77A 1Z75A 3GJ4A 4JYCA 1KFEB 2NO7A 4XQ0A 3I9V1 4JGBA 2R7NA 3C98A 3IULA 3CZCA 4MR9B 3SM3A 4AP6A 1V11A 3N53A 5AWFC 3EXHA 2HNKA 3ZTTA 3VR4D 1DXHA 2QN7A 2H9IA 3A3PA 3LL7A 3E22A 4W7IA 4RLFA 1GL7A 1L7PA 3DONA 4MKRA 4KDEA 2O2XA 5DYNA 2DQYA 2OV4A 2TECE 5CA1A 4Q1EA 2WUWE 3D6VA 4N0MA 3WIDA 5LQSA 2X19A 3MB5A 3ZVKA 4W7HA 3EA5A 2IHTA 2FHPA 4FWBA 1WABA 3EQZA 3MM4A 4J1SA 3RYTC 4H15A 1C3EA 1OI4A 2F43B 2JGEA 2WJIA 2ZSIA 2QRUA 2W2VA 4B7CA 2MDTA 2YVUA 3DDOA 4TZ6A 5D8DA 4GVPA 3AR2A 5AK5A 4IHJA 3A4LA 4CR8A 5CXQA 4GBGA 3FUXA 3DOEA 4ZVTA 5JCOA 1L7NA 4FFBA 3RVPA 3AUJB 2KJQA 4E1VA 2HIMA 3PFGA 2WHQA 4CIYA 1HGXA 1N5DA 3MBIA 1AB6A 1JAXA 1P31A 1QHHA 1ZMBA 2XLBA 3BWVA 3ESQA 2BGRA 3Q6NA 4CEJB 1YRYE 2LTAA 1NZJA 3EC1A 3IIJA 3TQFA 4RTOA 3V4OA 2QV0A 1EQ2A 3C8ZA 5EZ6B 2VEOA 4QC2A 4UTPA 4L0QA 2J0EA 1P5ZB 4G4JA 4B3SB 1WXIA 5A3JA 4OB6A 3ADCA 5FOWA 2O3JA 3C1UA 5DM4A 2YYZA 4Q4HA 5T41A 4UM9B 4MVJG 4W1RA 4S1PA 5ILGA 1SN7A 1YVEI 4J2OA 4XW2A 1K8RA 5A0FA 3VM6A 3AF6A 1USVA 4GL4A 4OQZA 1W93A 2HJHA 5EIEA 4GFDA 3QBEA 4ZK6A 3DZFA 1Z0ZA 2BR5A 3I05A 4UTNA 2FWMX 2GEJA 3HJGA 4CODB 1WU7A 1JXOA 3REFA 3IJ5A 1KBOA 1Z82A 5DM1A 4QYIA 1HORA 1KDTA 1QZZA 2HJSA 3GRPA 4IJ5A 4YRMA 5KBYA 4RKYA 1MRSA 1E62A 3IDSA 5DGTA 1I1NA 1BE8A 4B4OA 1HFEL 4BNZA 3B3GA 3HDQA 4D9CA 3OIVA 3RIHA 1QBGA 2HJGA 4R9VA 4BQSA 5LQJA 3ZVRA 4H1UA 1LRJA 1RWWA 1UFOA 2HGZA 3DMRA 1ZK2A 4FZ5A 1BX0A 3B3QA 3MWDB 4EYGA 3WIUA 3FPFA 4TTQA 2VQSA 1V5IA 3JARA 4P38A 4B6RA 3C7CB 1TCVA 1C7RA 3R5JA 3WY9A 2H4YA 2JEZA 5HWSA 4W5QA 1YBVA 1E5TA 2LXNA 5JMOA 1J0EA 2CXHA 4LZAA 3TQRA 5AM4A 1NMZA 1BWQA 2ZT6A 4ALIA 3RYIA 3KJZA 4PQFA 4CMEA 2YL2A 1FVXA 1BKSB 2PZBA 1N4AA 5L3SB 2A9QA 4EUFA 1SUAA 2LIPA 3KT6A 1RTTA 4UE2A 4YB8A 1WJGA 1H42A 2AQHA 5C4IA 4OUDA 6NULA 5CEJA 5JC1A 3LTEA 1N1MA 2AOXA 2HUPA 2ZBDA 3GOHA 1M5TA 3ZE1B 4PNEA 1JPVA 4Y9TA 5FRDA 3FOEC 4GUDA 4EJSC 2Q0QA 4OSPA 2IY9A 4JGGA 1X87A 5GAJA 1AB5A 3WL3A 2DT8A 3WQRA 3C97A 4QICA 3M6IA 4Q3EA 1EDEA 4RMJA 3R3ZA 3W5UA 5JQWA 3THXB 3UVEA 1FNCA 1WULS 1FUEA 4UAUA 3DFKA 4BAGA 4RMIA 3V32A 2GF0A 3G2IA 4FN5A 4DMGA 3L8YA 4WBNB 2CFCA 2OCYC 3IXLA 4PTZA 5JPDA 3K1JA 3P2OA 5GGXA 4AF6A 1WU8A 4X7PA 3UHPA 5I9NA 4H27A 1AMNA 1P60A 5I47A 1DEOA 2VUTA 1XA4A 1O6ZA 1MGOA 3OZTA 4WESB 2ZE8A 5A6VA 1MQ8B 2Q9CA 2ONJA 1PG2A 4YH1A 3AI7A 2F1JA 4TVSA 4KJZA 2OUKA 1U8ZA 2FSVC 2O0HA 4ALJA 4LHVA 3QPCA 2RKWA 4MEAA 1NI4A 7ADHA 5LOVB 3PNLA 2WTBA 3DC2A 3NCHA 1QYWA 4K6CA 2EOAA 1GKUB 3H9CA 4OA8A 2FSSA 3IQZA 1I8TA 1VMKA 1XDDA 3L46A 1A1SA 3WNBA 2A67A 2GAJA 3T3DA 2TRSB 1VJ0A 1FUIA 3PEUA 2MMCA 4LE0A 4XLTA 2XXAA 2C42A 3GVPA 4NCAA 2AJDA 3C3XA 1K3FA 4MRVA 1PGOA 1NT2A 3KQQA 2VUUA 4R7ZA 4QATA 1FFYA 3B53X 4M9UA 2YWBA 4MX8A 4UTXA 4MUMA 4XGRA 1QHEA 2P2LA 5K6AC 3X1XA 1VE3A 4JQZA 4UMDA 1PR9A 3O4GA 1SRRA 1JG2A 1W8DA 3DOCA 2UZ1A 1TYZA 4MS4B 4NBRA 4RZIA 1ST2A 5CTJA 1D4AA 2PJRA 1UM8A 2K6GA 1WUJS 2B9EA 2FPPB 2Q4BA 5AKEA 3DZKA 2ATCA 5A4FS 2F1OA 2WF5A 4JIMA 1AKYA 2BI8A 3IP9A 4JMPA 4BMOB 1D2MA 5CB8A 2GM4A 5G0UA 4DCGA 2QRQA 5IT9A 2WTUA 3K0HA 2Z5LA 1KZ9A 3T4UA 5KZMB 1KPGA 1Q77A 1VSQA 3IVRA 2YN2A 2R1TB 4II7A 1NWHA 2QTFA 4PX3A 1IHPA 1OFUA 2BD0A 1M34E 3SQDA 4FYVA 2P9YA 1YA4A 2JIZA 2ZJ0A 3M8KA 4TMXA 4BX8A 4DLVA 4ZHQF 4GOMD 3K73O 4C07A 4P58A 4BO0A 2BDTA 3IPAA 3STTA 2FSPA 4YP1A 3WIEA 2NUPA 4K5QA 3WGIA 1KJWA 2HZBA 4O4JB 5K3OA 4LFCB 3TCKA 1EESA 4ENQA 1YHNA 2ARKA 1KVQA 2RMKA 3R3VA 1TVKB 2HQBA 4WNYA 5T4FA 4DDKA 4Y6PA 8ADHA 5JQGA 2ECFA 1Z5VA 2O20A 1I3MA 5KNLA 1R4MA 4QSHA 1QBKC 3L7IA 1TJYA 3LFTA 3NYWA 4BJ6A 2G8LA 3KEMA 1UBTS 4KN8A 4PPQA 1HE5A 2HV9A 4QYWA 5HCIA 4H2DA 4AK9A 1QP4A 1U8EA 3RROA 1Z18A 2XRMA 4QL3A 4C6TA 1NJFA 1DKLA 4R2IA 3FX2A 3RVBA 4R68A 2WU4A 2GM3A 2K4MA 4KAAA 4LZPA 1SB9A 2Q8NA 3UKOA 2JK1A 4BRWA 2VF7A 4EHKA 1LTHR 1TM7E 4Q16A 4U2DA 2P8SA 5TIIA 4ABTA 1IHYA 1LPSA 3EWAA 4WUVA 1P7YA 1MIHA 2J32A 3I58A 3AETB 1CR1A 1OH7A 1TCAA 1QNLA 1PQPA 1I2MA 1QH8B 2VH1A 1DKMA 3D81A 3F67A 1E2IA 2QHXA 2VS1A 2XUPA 2ZRGA 5HBGA 4Z86A 4URYR 3T38A 1A3CA 4NMHA 3AF1A 2GJ9A 4ZEVA 1ZI8A 4BQFA 1EWVA 5A4DA 2OCXA 4ZQFA 1IN8A 1SXIA 1GN9A 3E4DA 3FCAA 2XYHA 1USUA 4BYMA 1LTKA 1Z7YA 2NZVG 1XJCA 1A50B 3KWFA 3AX6A 4XVRA 3DLAA 4TMWA 2VHYA 1WSDA 4YMIA 4ZU3A 4E07A 1VP3A 5L6MB 1I13A 1OBFO 4JU8A 4UDXX 2G1PA 2VJNA 3AH8A 4P3KA 4TOIA 3LPDA 5LQUA 4GOKA 1N0HA 4X44A 4UPEA 1JMKC 1ZOSA 4TSFA 5DX0A 4U0KA 4OQ4A 3O8OA 1ZN8A 2IUTA 4ER6A 1Z2OX 2W58A 4BZQA 2A8YA 3JQCA 2JAHA 3KO8A 1V6AA 5HS6A 1CEEA 4ZMRA 3O0DA 1ZUHA 3KCQA 3WLNA 1KZYC 4Q7JB 3CNEA 3KXLA 3V4FA 1YR8A 3G8DA 3T1HB 3WJ1A 1H69A 1OXMA 2Y0EA 1P2GA 4N5NA 4O4IA 1EVIA 3M6LA 1Y7IA 4OBXA 2PS0A 5J4VA 3DHWC 4XEHA 1T4MA 3GRUA 5TQ2A 2UAGA 3ROQA 3QJ5A 4INOA 2C92A 2VYFA 4K9QA 3CLTD 3K8ZA 1QPBA 1YQGA 5CM8B 3CRRA 4JHXA 2W6QA 4Y1RA 4N7JA 1AA6A 4E5PA 1YDEA 3VHXA 3OE1A 4LDNA 1Y1KE 4OIMA 1KORA 2WAYA 4TVBA 4ENTA 1SVSA 1YS7A 1RAHA 1OILA 4ECEA 1G5RA 3CXRA 4NJMB 3AHIA 1HFJA 1P3JA 1F60A 2GXSA 4XCVA 3TLZA 3RTCA 4R8MA 2RI1A 5EJMA 1AGPA 4KSYA 4OOFA 4BTVA 4BVJA 1PQWA 4XVQA 3UJDA 3W78A 5HF9A 2OZEA 3JQAA 1NBOA 3HCCA 1MOSA 1RP1A 4L27A 3ZZNA 3ZZTA 5LNK1 4RFSA 5MN5A 2A14A 3HA5A 3OAAD 3GDFA 1NXPA 3WBKA 1YIOA 3WADA 4GOJA 5HX7A 4UREA 3Q7PA 4ZZ2A 3WO1A 2OMKA 2Y67A 5FFNA 3TI9A 1E8MA 4BX9A 2V7UA 1U0SY 1JHRA 3V4PB 3EVEA 1M5UA 3FUVA 1MAHA 1TPZA 3B12A 3BH7A 1GGVA 4KW7A 5KNCH 1NXWA 1E7MA 1XEXA 2VDOB 2WEKA 3BXXA 5HIMA 4AUEA 4DXAA 1C7EA 2GLUA 2OLKA 1S2NA 2QUIA 4WRRA 3WGJA 5HRAA 3W4IA 5AM3A 2I55A 2JHFA 3UJ8A 5JIBA 3ZVMA 4XPIA 4B9AA 1MDBA 1QIDA 4KGVA 1VCHA 3RC2A 3RABA 3ZEIA 5A4KA 2OVFA 1Q0HA 2Q3BA 3EXHB 1XAGA 3LLCA 3FY4A 1GTG1 4H6WA 4UTZA 3NFYA 5TC4A 5IFKA 5H0IA 1JFFB 1COWD 2H65A 2WYVA 4IVRA 4YBZA 5BN4A 4JSTA 5CCBA 4BEBA 3NBMA 2JGRA 2JLCA 3H16A 3LO8A 1KDYA 5C1PA 4I0WB 2GCNA 3WNCA 5BWOA 1EFAA 2DQZA 3EFOA