1SEVA

Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
GFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQQQLEAALTGMDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVSFIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase, glyoxysomal precursor
publication title Organelle and translocatable forms of glyoxysomal malate dehydrogenase. The effect of the N-terminal presequence
pubmed doi rcsb
source organism Citrullus lanatus
molecule tags Oxidoreductase
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sevA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1sevA02
4HKTA 5I7VA 1H5QA 5B4VA 1K6IA 2OFPA 5KOIA 2VYVD 3GPDG 3JQFC 4FFRA 2NTJA 3WWYA 3CMCO 1LX6A 1KEUA 1QSGA 3VOSA 3WQQA 4CM9A 1JQBA 3WBFA 4A7PA 2PZLA 5T64A 4JNKA 3KZVA 1PGOA 1C1DB 4HFNA 4YA6A 2FRDA 2PFGA 3C85A 2YY7A 3A06A 5JDIA 4GX2A 1PEDA 1MG0A 2B0JA 4NMHA 1QORA 3BMOA 1EVZA 4JQCA 4CM4A 2AEMA 1UZNA 4UVDA 3ZNNA 4R9RA 5IFLA 4XR4A 2Q2VA 5ADHA 1GD1O 5DOZA 3RKUA 2I3GA 5TS3A 3A14A 4M54A 4OIMA 1EE9A 4HV4A 2W4QA 3LC2O 1R0LA 4GBJA 4TVBA 3U09A 3H5AA 3OJFA 4YXFA 1SB9A 1PGPA 2HRZA 3BYZA 3F5SA 4DMMA 1H9AA 3NT4A 2PH5A 1Y5MA 4XIJA 2JCVA 4UVHA 3RUHA 3SC4A 4OQZA 3ROKA 4BNMA 3MWDB 4PLCA 3AFNA 5COAA 2X4GA 1PX0A 3G1UA 4J0FA 4CLRB 4GLLA 1U8FO 3PHLA 3EUWA 3GEDA 4PIVA 3HWRA 5EIOA 3G79A 5KCZA 2RIRA 3GOHA 3HFSA 2JJYA 4J4TA 3DTYA 4GVXA 4BNYA 1H6DA 3E18A 4FOSA 1HYEA 1AHHA 3ASUA 3D4OA 3WJAA 1JWAB 5A5EA 1EDOA 2G17A 4FOOA 1VL0A 2Y93A 1M6WA 5IZCA 2XAAA 2WJPA 1BXKA 2UUPA 1I3LA 1N9GB 1GPDG 2AXQA 4RPHA 4ALNA 3I83A 4J7CA 3RC7A 3AUTA 1DC5A 4RJTA 1SOVA 2AEFA 3WGGA 3LDHA 1FDTA 5IF3A 5JCJD 5DT9A 3GDFA 4PFJA 1O8CA 5AQ1A 3GA0A 4MVJH 4YWJA 3WB9A 4CQMB 3ANNA 5G0UA 3TPCA 2NWQA 3N74A 4K26A 5KKCA 3GRKA 2EW2A 3V2HA 4YQZA 3OJOA 4R69A 4J7XA 3GQVA 1SO8A 4IMRA 2QRJA 4Z0TA 1Y6JA 2UUOA 1IULA 3AM5A 4FFLA 1H6BA 3AI3A 1X13A 3UF0A 2IZ1A 2QX7A 5JDIC 3K73O 4BO4A 1YDEA 2JHFA 5IDWA 4K9DA 4ZRMA 5HWSA 3GH3A 4S1VA 5LDHA 4YB8A 1EK5A 3H5RA 1KVUA 4IQ8A 5C37A 2X0IA 1AGNA 1BSVA 1R4NA 4Q3AA 1LNQA 1ZK2A 2HUNA 1W73A 2BKAA 2J3IA 3K2EA 1P74A 3K96A 4FD3A 4WLEA 5JFOA 1Q0LA 4PCVA 5L51A 4A0SA 4RF2A 1NVMB 5BSGA 2O50A 2H5LA 1E3JA 1IZ0A 1H6CA 3F1LA 3NT2A 4JJFA 3HZZA 4XYGA 3A1NA 4MJLA 4FFNA 3GFBA 1HDGO 4EUFA 4Q3DA 3Q9NA 3CZRA 3PP8A 1LDEA 2GNAA 1PL6A 1NNUA 1NXQA 1PJTA 2PD4A 3KBOA 4FSHA 2P68A 1ZK1A 5HA5A 4DXHA 3FF4A 4PLVA 2EIHA 3U3XA 1G0OA 3GDGA 3PIDA 3TN7A 5A3JA 2JL1A 1T2EA 4B79A 3I9MA 3VVCA 3GY0A 1BDMA 3G0OA 1ADBA 1RYDA 4JXKA 3ZWWA 3GG9A 4R1UA 1ZUD1 2WSBA 4LSWA 3FSRA 3WIDA 1L1FA 2ZYAA 4MKRA 1UJMA 4E0BA 2YFQA 3L0DA 3BXXA 2Q49A 3TZ6A 1K5HA 1E77A 3S2EA 1XCBA 1VJ0A 1QR6A 3WGQA 4PLHA 4B4WA 3DMYA 3HDYA 4XYLA 3QWHA 3K5PA 3ZWCA 1GFSA 2PKQP 2YHIB 4Z9YA 2HSDA 3PDJA 2B83A 3F4LA 3KVOA 3GK3A 3RU9A 3GUCA 1BXGA 1DLIA 4PG5A 4PG4A 1F8GA 4CR8A 4B3IA 1MX3A 1EMDA 1EK6A 2XXBA 4Y6PA 1D7OA 1HDYA 3V8BA 5G0TA 2ZATA 4RO0A 1ISMA 5L4SA 2P5UA 2VYNA 2C7VA 3ZH2A 3TL2A 1ULSA 1TI7A 1XLTA 2Q1WA 1O0SA 5HM8A 2R6JA 3PHIA 3JQEA 4RV9A 5IDYA 3BMQA 5DCWA 3C7AA 2ZTUA 1DDOA 1KVTA 3F46A 4XQEA 1WAMA 4HBGA 2C0CA 3ZNPA 4ND2A 1J5PA 1HETA 3PPIA 4QFCA 4AG3A 4MP3A 3QWFA 3BMNB 3RFXA 2WYUA 3BTOA 1ZK4A 4RZHA 3QA9A 1PQPA 2VZ0A 4J1NA 4ZQEA 5K0ZA 4KP7A 5AXBA 1ZEJA 1C3VA 2Y1FA 1EBFA 3DFUA 3E9MA 2JHGA 1GCOA 2VT2A 1EEHA 4KWIA 3AI1A 3RSHA 1H2HA 1PGQA 1R15A 4RVHA 2JD1A 4YJFB 1X15A 4KUGA 4TVOA 4R4JA 2W2LA 1SZJG 3VPGA 4DREA 3LF1A 4GLOA 3FNEA 2AEJA 2G0TA 4J43A 4EEXA 1ML3A 4IIVA 5DZSA 2POQX 4GVLA 4XWYA 3KB6A 5KNLA 3ZHYA 2P5YA 3PWKA 5DBIA 3ENKA 3PFWO 4GMFA 3GT0A 3VTZA 4E31A 3PHJA 4Z0HO 3B1FA 1GZ6A 1VJTA 3E9QA 2C2XA 4RGBA 3MJVA 4FGSA 2HQ1A 3BMCA 4DPLA 5EQFA 5CDGA 3P5SA 2BD0A 3ORFA 4D79A 4MDHA 2VRCD 4IS3A 3OQ6A 1MC4A 4DC0A 1QLJA 1ZMTA 4XGIA 1RYEA 3DOOA 2BRUA 4J9UE 1DHRA 3DEYX 4P22A 4DPKA 3IKVA 2Y1GA 2FPPA 2JFGA 5F5LA 5A4DA 5JY1A 3IJRA 3Q2IA 4R9SA 3RKRA 1U7HA 3WIEA 3OA2A 2NNLD 4YJHA 3LC7O 1F12A 2QW8A 2WYVA 5GZ1A 3DAFA 3ZWOA 2DAPA 2GCGA 5L4NA 5A9SA 3DL2A 1PWXA 1FJHA 5FEUA 1I3MA 4NK4A 4BMVA 1E1KA 4BO6A 2GERA 4XQCA 1Z45A 3JQDA 1KETA 3HJAA 4MO2A 4CMCA 4ESOA 3BZUA 1O95A 4YVFA 1E7YA 4BNLA 2I6TA 3AUSA 4UREA 3FNGA 3K31A 4AJ4A 1AE1A 3LT2A 2NUAA 2RBEA 1BG6A 2Q2WA 4FQ8A 5JYDA 5DF1A 3LT0A 3K2BA 3ZNOA 1JKFA 1CYDA 1QYWA 3DFZA 1A5ZA 4ALMA 2NU9A 1DO8A 1YBVA 5AYVA 5A05A 1KEPA 4L4SA 5DULA 1GYPA 5L3ZA 2CDBA 2DKNA 3ZZNA 4ITUA 3C24A 3D7LA 2LDBA 3KYDA 2CNBA 1EZ4A 3H3FA 2GUGA 1VL8A 4BO1A 1I2BA 1VC2A 3CXRA 1BHSA 3K6JA 1KS9A 1H94A 3VPFA 4I8XA 1TXGA 2GZ2A 1PZEA 2YYYA 4ZQBA 5G0SA 3R6DA 2P4HX 1NVGA 3H8VA 1YS4A 1UUFA 1GR0A 3SX2A 3HG7A 4E5PA 1YL6A 3BTVA 2O7QA 2ZTVA 3TZQA 3ZHZA 5HTOA 4NJOA 3ONDA 2XPCA 4Q9NA 2A4KA 2Q1SA 2OL4A 3NAQA 4P8RA 4BKOA 4RPGA 4DVJA 4N5NA 1I0ZA 2Y68A 1F8FA 2ZK7A 3M2TA 3BMOB 1PS8A 1ZEMA 2FSSA 4NI5A 1LLDA 1Q1NA 4D42A 4YAKA 3WSVA 4II2A 1WPQA 4UEJA 4NIMA 3PK0A 4F45A 2I9PA 4XKJA 4PGFA 1JTVA 4IINA 4R68A 4R41A 4DLLA 4IDCA 4BNVA 3EYWA 4H16A 1W4ZA 4BO8A 5FWNA 4I9UA 3O4RA 2I76A 1D3AA 5TQVA 1E3EA 7MDHA 4KDEA 3FTNA 1XSEA 3AOEA 2HK7A 3RBXA 2JFFA 4BNTA 1EQUA 1I30A 4BO5A 1DEHA 1X7GA 5KTKA 1EVIA 2PNFA 3W6UA 5KVSA 1I2ZA 3OQ1A 5C3MA 1P1FA 4QTZA 3B70A 4PRLA 1E1MA 4YRDA 1L7EA 3FD8A 4O0LA 4L0QA 4BOYA 1DIRA 4EEZA 4A03A 2J5RA 2YHUA 2UDPA 4LW8A 3RWBA 4WE3A 2AQKA 5T57A 3UCFA 3GEGA 4WLVA 1A7AA 4WECA 4J6FA 5GMOA 4DUPA 1YKFA 3DR3A 1U2GA 2EEZA 3OEWA 4XB2A 2B5WA 1E3SA 4XQ9A 1Y81A 5CP8A 4PLTA 3V1UA 4ND1A 1DRVA 4IDBA 4Y67A 3S55A 4EW6A 5G2OA 2X7HA 3R0IA 4D3DA 2Q3EA 4HNHA 4NDNE 3WQSB 3F6YA 1XQ1A 1ZMOA 3UN1A 1YQXA 1YQDA 3DZJA 4N54A 1T25A 2RCYA 1ZO8A 1NBOA 4FN4A 3JCZA 2FWMX 2O3JA 3RC1A 5ER9A 5IAAA 4ZICA 3GGPA 4EYEA 4ZHSA 3IS3A 3S8MA 3AU9A 4QUKA 1UDCA 4U6SA 4YEDA 5C7OO 4LVCA 3WICA 4NK5A 4RVDA 3UUWA 1J0XO 3F3SA 2D5CA 1WNTA 3I4FA 4RORA 1AHIA 1U4OA 2IEBA 4R01A 4AJIA 3OP4A 2NVWA 2ZCUA 4JJIA 3WX0A 4CM8A 1GYQA 2FOIA 5L4LA 1DIAA 2B4QA 4CMIA 3KEQA 1X0XA 2YFHA 5DCYA 1I33A 1R4NB 2HMTA 5TRTA 1PR9A 1NR1A 3FNFA 3NKLA 3EVNA 1LSOA 1G6KA 2PWZA 3GAFA 2ZB7A 3JQ7A 4CR7A 2ZYGA 4MVJM 1ISHA 3AUUA 3INRA 4XYMA 2O4CA 4GSKA 5JMWA 1A9YA 1B14A 1Q7BA 3GVIA 4BGEA 2Z95A 4Q39A 5IG2A 3AOEC 1IUKA 3I3OA 1BXZA 1NM5A 3OJLA 5KIAA 2X5JO 4YJFA 1ZK0A 3H2ZA 1HZZA 3ZN2A 3CMMA 1KY4A 5EPOA 4OOEA 4E21A 5JNLA 1E92A 3SJUA 2FR8A 3INTA 1UP7A 1QV7A 3PGXA 1A4UA 3PRJA 3FR7A 3L9XA 3QY9A 4OL9A 3G49A 4OXKA 2EV9A 2PY6A 1HDZA 3LLSA 2OXIA 4MVJA 3VZQA 1TB4A 1SEVA 3EZLA 5GZ6A 3GDOA 3ROPA 3MJEA 2X9GA 3S2FA 5J23A 4W82A 2V6MA 3QWIA 4YAEA 4D46A 4W7HA 3HQ4O 1PR3A 1W0CA 1I3KA 5JE8A 5A5FA 1NPTO 4GX5A 3ZV5A 5I8WA 3E5RA 3WGTA 4BO3A 4R5HA 3TFOA 4YT4A 1NYTA 4E32A 2EG9A 1OC4A 3H9GA 2XXJA 5HS6A 1VM6A 3RI3A 3UOGA 3V1YA 3M2PA 4PG7A 1FMCA 4QQRA 1ZJZA 2EP7A 2JD0A 4FW8A 1MP0A 1LDYA 9LDTA 1PTJA 4IJVA 4NBUA 4A2CA 4RPLA 2OORA 1JKJA 3GVPA 1V0JA 4BNXA 3JD2A 3KO8A 5TNXA 3RROA 4AVYA 4EI2A 1U1IA 4XQGA 1BXGB 1FDVA 3Q1LA 3I9NA 3PHGA 1QYDA 2WWRA 5ILOA 1DIBA 4CJXA 2Y99A 4WEOA 1HEUA 4JIGA 4INAA 4IDEA 3RUFA 4WLFA 2CUKA 2V7PA 4FFMA 4E13A 3VKVA 1I24A 2TMGA 4FPXA 5A04A 1XIVA 3BMQB 2BFOA 4AFNA 3DBHA 1D4FA 3E5MA 4B7CA 4DBZA 1LQTA 4UVGA 4BGIA 1YOVA 2VTEA 3FPLA 4IDGA 3U62A 1IYZA 3W6ZA 3ULKA 3SBOA 3LC1O 2FN7A 4H15A 4E2ZA 2NQ8A 4PN3A 4KWHA 3G17A 1ZSYA 3AUAA 1UXGA 3E82A 3IMFA 4JCOA 4XIYA 4B4VA 2VRBA 4RCVA 5HS4A 4UEKA 4EJ6A 3NV9A 1QYXA 4DMLA 1M75A 4W99A 1E6WA 1SBYA 1BTOA 4IGEA 2E6UX 4NFYA 3VZRA 4MPDA 4RF3A 1RM5A 4WUVA 4PLPA 4XA8A 4GX1A 1LSJA 3TNLA 1IPEA 3I9LA 4RVUA 1FDUA 2Q4EA 3NX4A 5FYDA 2Q1TA 1I8TA 4NFSA 2JD2A 5AXAA 5CPBA 3FWNA 1F06A 1Q0HA 1W8DA 4Z9FA 3RASA 2XF8A 4L73A 5BSEA 1LI4A 4L75A 3MCVA 2UAGA 4Z3DA 3W4JA 2RH4A 3C3XA 1AXGA 1HYGA 2DTEA 2E4AA 2Z5LA 3JQBA 1PWZA 3GPIA 4ND3A 2XOXA 1LTHR 1OFGA 2DPHA 2GR9A 3GHYA 5KVQA 3I1JA 2QZZA 3WTCA 4CV2A 4TMFA 2VHVA 1WMBA 2DU8A 2ZB3A 5K9ZA 3CZMA 5AOVA 3F47A 2GZ1A 4A26A 4J1QA 1IB6A 3MOIA 3PLRA 4K6FA 3TL3A 3V1TC 3EK2A 4CM9D 2O3TA 5DBGA 4WASA 4DIFA 1EUCA 1OI7A 2HLPA 4TQGA 3VPSA 4FB5A 1AN9A 3F1KA 5B4UA 2F00A 3BMCB 4X54A 5EQDA 4D0RA 3VC7A 2WD8A 4PLZA 4IDDA 3U5TA 4J1SA 1ZSNA 4OSOA 3AI2A 4PZCA 4M1QA 4CMBA 2QHXA 3C1AA 3ZU4A 3RIHA 3GGOA 3NJ4A 3IDSA 3QHAA 4RPKA 1T2CA 2AHRA 3PIIA 4BO9A 3KSDO 4IM7A 2A92A 1C0LA 3H4VA 4IQGA 5JSFA 3HSKA 3EW7A 1SAYA 4YJHB 1VLLA 3RC2A 2UYYA 2Y1OA 3WBBA 4CUZA 3I9JA 3D5TA 3ZWVA 2UVDA 1U3VA 1C14A 1Z7EA 2B37A 1DLJA 4BNWA 4DYDA 3U4DA 3JQAA 1M67A 3BTSA 3PJEA 3AY3A 5A9SB 2B36A 4BB5A 1ID1A 4DRYA 1EVYA 5MDHA 1V9LA 2A94A 2CSUA 4B3HA 3IIEA 3C8MA 4CLOB 4Y6SA 1PJBA 3NT5A 1HZJA 2B69A 1UP4A 2YQ4A 4JN6B 3DZBA 1I36A 4B8ZA 2VN8A 1JVBA 1ISIA 4GMGA 4MINA 2OBNA 4I5FA 1OMOA 3ZV3A 3MWEB 1ENOA 1HT0A 3T4XA 5KJ6A 1JAXA 3IUSA 1VE9A 2B4RO 2VZ8A 4NQZA 5JMPA 5K6AA 2FR1A 3E6AA 3BHIA 5JDCA 3KYDB 4MIOA 4XDZA 3DO5A 2VT3A 3JQBC 4RVGA 4HX5A 4YRAA 1E7QA 3FN4A 3AOGA 2C59A 1DC4A 4ILKA 2VWGA 3MJTA 3P7MA 3WGIA 4BVAA 1TEHA 4OHUA 1CJCA 1IE3A 4BMSA 2NLOA 4E2YA 4BV9A 2J5KA 3AY6A 4Z3KA 3CIFA 3FI9A 3NRCA 5JLAA 3RFVA 5H81A 3SC6A 1N1GA 4FFOA 3Q2KA 5JAZA 1RKXA 3NJ8A 1BVRA 4L74A 2NVUA 3IQDB 5TC4A 4BKRA 1SCUA 4FJ2A 1AXEA 4TKLA 3WYBA 3ZWYA 1P45A 1SOWA 3PJFA 4WJZA 4DPMA 5CDTA 5L40A 1M2WA 4MP8A 3VTFA 3WLFA 3F9IA 1GQYA 2CY0A 3NUGA 3TRIA 3H9EO 3I9KA 1GZ4A 2D4AA 2OBYA 2X58A 3L07A 1HDCA 2IYOA 5TSDA 1HRDA 2YJZA 5FFFA 1WXDA 2HAEA 3I5MA 4C7JA 3GRPA 2FY8A 1WDLA 4YBZA 3VPXA 2BGLA 4N5MA 3EVTA 5IZCC 4U5QA 1TT7A 3ZWNA 3DZKA 1B3BA 3ZU5A 2GASA 5JYEA 1GUZA 2HDHA 1CQIA 2EERA 2IE0A 1U3TA 3FHLA 4KQWA 1P0CA 3LT1A 3H9UA 2DUUA 3EHEA 2EP5A 3TDKA 4N5LA 4EDFA 3LZ6A 2BH9A 3H7AA 4II3A 3GG2A 2WE7A 2X9NA 3ZU3A 2VWPA 1DFGA 4A5OA 3GMSA 3TSCA 2NACA 1FXSA 1ONOA 4EUEA 1GPJA 1HTBA 1XEAA 3MOGA 1E7WA 1GZ3A 3ZDFA 5FF9A 3TZCA 4J1TA 4DGSA 5K6AC 4BNFA 5IJZA 3DQPA 1DAOA 2IEDA 1HE4A 1U7TA 1P1JA 1BVUA 3BAZA 1LXCA 3BHJA 4G65A 5JDCC 2RHRA 4XX0A 3P2YA 3PZRA 4CV0A 1XWFA 2X22A 4DLBA 1NHGA 4UVIA 4BKQA 1QV6A 4D0SA 2C54A 4I1IA 5IDQA 1PQUA 4JP2A 1GQQA 1KOLA 1AUPA 2WMDA 4ZD6A 3VHRA 1DIHA 1Z6ZA 3DXFA 3JYNA 1MUUA 4ZVVA 3OJEA 5I7EA 4OOFA 3G1TA 1PU2A 2C07A 2JCYA 2P9GA 3VH3A 3ZHXA 1PIWA 1K2WA 1QRRA 1T1RA 4CPDA 5ICSA 4R5MA 2CVOA 4BNHA 1GQ2A 2IXBA 1KVSA 2GF2A 1GYRA 3E9NA 3L9WA 1ZXBA 3QRWA 4DIBA 4CM8B 3K8ZA 1N7GA 2SCUA 1HLPA 4Q3NA 1Q2XA 1DPGA 2BLLA 4CMIB 1X1TA 2DFDA 8LDHA 1R4MA 1NPDA 1E0DA 1WDMA 4UEOA 2WDZA 5JS6A 1IHYA 1HKUA 3DHEA 1LLQA 2WE8A 2HCTA 3ENNA 2IODA 3INGA 2EJVA 3JV7A 3JQ7B 5CEJA 1UXIA 4LN1A 4NZ9A 3X2EA 3K92A 4W4TA 1F14A 1E3IA 3PDUA 3QWAA 4OXYA 4KDFA 3ZU2A 5JAIA 4KOAA 4MVJG 3WQRA 3IJPA 4IMPA 4LCEA 4Y8VA 4E30A 3UKOA 3FRJA 7ADHA 4WOKA 3ZW8A 4EZBA 2ZJ0A 5F3RA 5LC1A 5TJ9A 2W90A 2ZYDA 2P4QA 2JKVA 4UUPA 1GV0A 4YQYA 1U8XX 2Y0CA 3GR6A 3AM4A 3GZ4A 1K89A 4D44A 3GN1A 4ALKA 2B5VA 4YACA 5U4QA 3DTTA 3KRTA 3LQFA 3MTJA 1CIVA 1E6UA 4U0KA 1HDOA 4KTTE 5THKA 3TQHA 4IQ0A 1VL6A 1KBZA 2FPIA 2NQTA 1MFPA 4Z9XA 1OC2A 3HDQA 4BNJA 1A9ZA 4JP3A 5TT1A 3NDRA 3R3SA 1NFRA 4ROSA 4LISA 3VPHA 4YRBA 1ORRA 2EJWA 4ZQHA 1B15A 4M89A 2G76A 3HB5X 1IOLA 1VJ1A 3O9ZA 3WWZA 5DCUA 2VRCA 1NWHA 2C82A 1NQTA 3WLEA 2X1HA 4BKPA 1B8UA 1NX6A 3WYCA 2DTDA 1EVJA 2IZZA 3B1KA 4G2NA 5CG2A 4DQXA 1H0KA 2FSVA 2W2LD 1DHTA 1PGNA 4QXMA 3DBVO 4Y6RA 2W98A 2PZJA 4GL4A 1ZNQO 3CEAA 3PLNA 4OKIA 2DC1A 4WPGA 3ON5A 4FDAA 2QQ5A 2BGMA 3PJDA 4L9RA 4MVJP 5KWEA 1CWUA 4WNCA 1DSSG 1EQ2A 4UVEA 3EGOA 3IP1A 3DC2A 3T7CA 4IUYA 2G5CA 1PZFA 4WLOA 1P9LA 2EKLA 1TT5B 1Y9EA 5CAEA 2BGKA 3JYPA 1JWBB 4MVJF 1O9BA 1B26A 2D5AA 4CMEA 4CLOA 2X0JA 1R16A 3FWZA 5JW6A 3JD4A 4R1NA 3FR8A 1HE2A 5JY6A 1O5IA 1P1IA 3DBHB 5KKAA 4LMPA 3FPCA 2HKIA 1YOVB 4YYZA 5I9NA 4R3WA 1P31A 3V2UA 3T7EA 2EGGA 4IZHA 4P38A 1YDWA 4IY1A 4GH5A 2PD3A 5BSFA 1U3UA 2GO1A 5IXYA 1VKOA 2OO5A 4J0EA 4DWVA 4OH1A 1GEGA 1ZZEA 5L45A 1TA4A 4BNGA 2ZQYA 4O63O 3KLMX 2J5QA 4IS2A 4U6QA 3D64A 5L7YA 3VVBA 5F1OA 3I6QA 1NFFA 4AJHA 5JBIA 3TOZA 3QWBA 1XG5A 1KVQA 4W7IA 2AQIA 2YV2A 2O3RA 1P77A 1PL8A 2I65A 2W2KA 4LRTB 4N18A 4BIIA 1UP6A 2WYWA 2X6TA 4YPOA 4I9NA 4BGVA 3PFFA 4EJMA 2DBVO 3U4IA 2FZWA 3KYBA 1HWYA 4CQMD 4TRNA 3Q9UA 3LYLA 2P9EA 1WVGA 1E1LA 2ZKLA 1ZH8A 2ZIZA 5BNIA 2CDAA 2OZPA 1I01A 4BNNA 1Q7GA 3U0BA 3I4CA 5DDIP 4RF5A 1RM0A 4YT8A 3PYLA 4FFPA 4FC6A 1XA0A 2B35A 4AJPA 4WLUA 3BIOA 3JD0A 4YTEA 1BW9A 1RM4A 1C0PA 3WGZA 1W6UA 4WCFA 4KMSA 1YBAA 3JQ8A 4NBRA 2HMVA 1YWGO 3HFGA 1Z73A 3M1LA 2YDYA 2FP4A 4MOWA 4DYVA 1PS9A 4QX6A 4B8WA 1QG6A 3H5NA 5L53A 3LLVA 4D3SA 1Z74A 2FR0A 2PA3A 3SJ7A 3I23A 4K6CA 5LCXA 4GKVA 2BI7A 1PZHA 4AJ1A 5T6BA 4B4OA 4ZRNA 4CMEC 5IN4A 4OKNA 3RUCA 3DAGA 1T2DA 1YB5A 2PZKA 4RQUA 1B7GO 1F0YA 4BNKA 2GN9A 4L76A 1XU7A 4RZIA 2OHXA 1WZIA 2C5EA 2O2SA 4BGUA 1ZIDA 3CTMA 3JQCA 3IP3A 5ENVA 3COSA 4BB6A 2IDZA 4WNIA 3D1LA 1LU9A 3K30A 3LVFO 3JQAB 4XGNA 2R2GA 1NASA 3QW2A 2C5AA 3WNVA 3QVTA 4IPTA 1LDBA 1UDAA 4HWKA 5KJCA 4YJGA 1F17A 3NTRA 1ZCJA 4FS3A 5TGDA 3KEOA 1J49A 4BS9A 1Z7BA 3GN2A 1WP4A 1N5DA 2VHZA 4XJTA 3C7CB 3V5NA 4JGBA 3ETDA 3PZBA 4BV8A 4R1SA 1ISFA 4HFRA 3TF5A 2YZ7A 4MKXA 2VWHA 5LDGA 3JQGB 2VQ3A 2Y1CA 4AJJA 1TVEA 2DBZA 2O7SA 5JCXA 1MV8A 3BHMA 4RDIA 2GN6A 2BFPA 4IIUA 4E5YA 1JA9A 4CLDA 1H6AA 1GTMA 1WDKA 3MTGA 4YAGA 1X1EA 3W1VA 5U9CA 5AVOA 3WGYA 4BNZA 4RF4A 4CMKA 1VSUA 5IZ4A 2PKQO 4QFDA 4GQAA 4GI2A 4XZ3A 5ITWA 3OF2A 2I66A 2I67A 1EE2A 2Q1UA 1GCUA 3HN2A 1T1SA 2AQ8A 3CKYA 3UGKA 3G3EA 4E3ZA 3PI7A 1GADO 2QZ9A 2C29D 3OJ0A 4WCFC 4Q3BA 5ER6A 2PZMA 2LDXA 4O1MA 3DOCA 3NDJA 1KYQA 2ZTLA 4J90A 1QYCA 1G1AA 1K6JA 2NVUB 1C1XA 2Q45A 2FPGA 4HADA 1VSVA 2IXAA 5AXDA 4NBTA 3GNSA 2DBRA 3ZW9A 1LLCA 2PR2A 3UW3A 5EINA 1ZBQA 4NG5A 3ZWAA 3OM9A 2PLAA 3WR5A 4NJMA 1EFLA 1HSZA 2OUIA 5F21A 4RPJA 4CMHA 1PS0A 1MC5A 3VDQA 2NU7A 3PYMA 1I32A 3NDIA 3S2GA 3ZV6A 4G81A 4GWKA 2V6BA 1YB1A 4TRJA 3WMWA 3RC9A 2GZ3A 4OM8A 4A73A 1GAEO 5G4KA 4B3JA 1A71A 4JJGA 4BO0A 4S3MA 4G5HA 3OHSX 4XRGA 5ILGA 3PEFA 1A7KA 5BT9A 3D3EA 1Y8RA 4CQLA 1ENZA 5TJHA 4CUKA 5CDUA 1R66A 4AJLA 4ZN6A 5L7WA 4AJ2A 2AG8A 3CINA 3WJ7A 5T67A 5JAMA 1O6ZA 4TROA 1LDNA 4GSLA 4LK3A 1DJQA 1MXFA 1QP8A 5CPFA 2IZ0A 1DFIA 2NM0A 2HO5A 1OOEA 4Y98A 5EN4A 1QKIA 1XU9A 2EKPA 3QQPA 4K1LA 1HE3A 1HE5A 3FNHA 1I2CA 5EMHA 3HE3A 1H2BA 4JROA 2ET6A 1TLTA 1TT5A 3PHHA 2VOEA 4QECA 4O6VA 4TSKA 3NEPX 3HHPA 4XB1A 2Y1EA 2UV8A 1YH3A 3DHNA 4ZU3A 5BSHA 3GNQA 1OBFO 2YW9A 4AJEA 4ZA2A 2J8ZA 4D3FA 3QVWA 1NAHA 5JXWA 4OSPA 5F5NA 3RUDA 2OMEA 2GSDA 3P19A 1QXSA 3DBLB 3SLGA 5DN9A 4DQUA 2X23A 4EJ0A 4L4RA 2DLDA 4LCJA 5DP1A 1PGJA 1T4DA 3ZWPA 2O3SA 3ETEA 2O23A 3JQ6A 2QRLA 3BTUA 5H82A 1PJQA 2AQHA 3U4HA 1UDBA 1ADGA 1CDOA 1R4MB 2VYVA 3DWFA 3U49A 3V2GA 6LDHA 1ZVMA 2CF5A 3NGXA 4U7WA 4XR9A 3UAGA 3VH4A 2YUTA 3RFTA 1UZMA 5JAQA 4EBFA 3HB4X 1YB4A 4WCDA 4QT0A 4QEDA 2GGSA 3AU8A 2FHSA 4WKGA 1T2AA 4J3FA 5FI3A 1LSUA 5I9LA 2YV3A 3GZNB 4EUHA 4GGOA 4DQVA 1CETA 3SEFA 1EBUA 2O3UA 1N7HA 2J3HA 2DUWA 1UAGA 1B3RA 2JAHA 2BHLA 3C1OA 4F6LA 2FMUA 5A02A 4UUNA 1EUDA 5C5IA 2E82A 3Q0EA 4J91A 5A1TA 1GV1A 1Y7TA 2HRBA 1PJLA 1UXKA 1KC1A 4CM5A 5BR7A 1ADCA 2EKQA 4CMGA 4D7AA 2X5KO 4MP6A 3H6KA 1NTOA 5THQA 1SPXA 3TJRA 2G1UA 4BKUA 1MG5A 3GNTA 1HL3A 3L4BA 5BQFA 2PH3A 2TMDA 1VI2A 4M86A 1NAIA 3TZHA 1M76A 4BQPA 5G0VA 3WOHA 4NBVA 5JC1A 4WK6A 2WD7A 5A06A 5C7LO 3WGOA 1FDWA 3UXYA 1Y8QB 3C7DB 3C1TA 5B4TA 4ND4A 4NFHA 2IYPA 4J16A 2Y1DA 1X7DA 1N8KA 1DFHA 3H65A 1O89A 2QYTA 4KUHA 3QLJA 1IPFA 4DA9A 3KYCA 1JAYA 3RUIA 1GEEA 1T2FA 4DL9A 3JTMA 3WFJA 3CUKA 2PGJA 1LDGA 1H93A 3OETA 3MJSA 1E7SA 1SEPA 1U3WA 2PGLA 3GUYA 1XHLA 5JCJA 3DZGA 1HLDA 3PWSA 4H7PA 1LC0A 3WMXA 2ZB8A 1E7RA 1O94A 5CHEA 4ONEA 4TRRA 3HADA 4RDHA 3ADPA 4BNUA 4OAQA 6ADHA 3F4BA 3U9LA 4E6PA 1NQOA 3O38A 3B20A 1R0KA 1V8BA 1KERA 3RAJA 2ZB4A 3JQGA 4I9HA 4U0JA 4YAJA 5JPIA 1BWSA 4IJUA 2V6FA 1P1HA 2J3KA 3ASVA 2GDZA 2A35A 3UVEA 3CE6A 2NVBA 1V3TA 1LLUA 3DDNA 3IAHA 2VTDA 3JQAD 5JO9A 2H6EA 2RHCA 3JD1A 3GVCA 4NBWA 4CODB 3WG9A 1YXMA 4MVJE 3RQSA 4PZDA 1XKQA 2Q50A 3IUPA 3UCXA 1IZ9A 3SXPA 2H1SA 2PK3A 3RJ5A 3OIDA 2O3QA 3A28A 3FTPA 3ANMA 2W2KB 1ZK3A 5IN5A 3GHHA 1G0NA 1EDZA 3MEQA 3L4BC 1Z82A 2VZ9A 2QYSA 4OGWA 2JAPA 4CL8A 4BHTA 4GPD1 1K6XA 3QVSA 1D8AA 4D45A 3DAPA 4FJ0A 4XGKA 3AJRA 3H9JA 1LRLA 1JVSA 1C0KA 4NPCA 3B6ZA 3PWZA 4R16A 3P2OA 4GKBA 4OO3A 3AY7A 2OP1A 4I08A 1ZJYA 3W4KA 2HMSA 3BA1A 1NQAO 1QYVA 4YT5A 4RL6A 3M1AA 1E3WA 3ITKA 4R54A 3HDJA 3D0OA 5T8KA 2VOJA 5EL0A 3KLPX 1BW9B 1XQ6A 2ZJ1A 3JYOA 3O8QA 4MKZA 4A27A 2VNSA 2ZCVA 4WCFB 5DOVA 3JQ8B 4ZQGA 2D2IA 2BELA 3VZSA 1DB3A 3RCBA 4AJNA 2VUSA 3ZI0A 2X9VA 2JFHA 2NV6A 1NQ5A 1R6DA 2Z1NA 3ITDA 1LC3A 3PQDA 4GAEA 3ROMA 3L6DA 3ZHBA 5B1YA 4OXNA 4WOJA 3CSDA 3WSWA 4CMAA 2V6GA 2RAFA 4R3NA 2E49A 2CVZA 2FZEA 2O2YA 5U1PA 4XD2A 1KC3A 2AG5A 4M8SA 1JW9B 4QO8A 2QG4A 3KOUA 1PJSA 1MLDA 1S6YA 3VZPA 3HNPA 1T24A 4IGFA 3HDHA 3RBZA 5F1KA 2DTXA 1CRWG 2C20A 4HFMA 1VPDA 3QSGA 3GF4A 4C7KA 4PZEA 2H9IA 3ZV4A 4DTIA 1B8PA 3AWDA 4TRMA 3E8XA 3TFQA 1SNYA 3UHAA 1X7HA 1C0IA 2NADA 3JYLA 1PJ4A 3JQ9A 4YJGB 4YDRA 1H9BA 1CQJA 4P4GA 5I9MA 1UAYA 3GC6A 4ID9A 4L8VA 4RVSA 2DBQA 3PQEA 4J2HA 1WMAA 1GL3A 3PQFA 3U4CA 4E33A 1HSOA 2VHYA 1DRUA 1WWKA 2ILTA 1BRMA 3E03A 2EGHA 3IC5A 2CDCA 1LUAA 3MJCA 3DMTA 4IDAA 4HFJA 2BFAA 5HBRA 2D8AA 4ZQFA 2GYYA 2ZQZA 1A4IA 1HF3A 3AW9A 3JYQA 3L77A 4IBOA 1B8VA 1OZAA 3O26A 3DBLA 4W9NA 3WNQA 3LT4A 1JKIA 3PVZA 1ZSVA 1RWBA 4Z6KA 3GMDA 5TLSA 1WLYA 2NTVA 5C7IO 1ULUA 5I8ZA 5I7SA 5ITVA 3GLQA 2X86A 5A3VA 3PJGA 5T8KC 4MIEA 2DQ4A 1T26A 2J3JA 2OGUA 2BFMA 3I52A 3MZ0A 1JU9A 3WFIA 1NVTA 4MIYA 4FBGA 4W6ZA 4IZIA 1YL5A 4YAIA 2VYND 1GUFA 2CFCA 3CPSA 3D3WA 4M55A 2GLXA 4PLWA 1QLHA 1ZKMA 1A27A 5DNAA 1Y1PA 1LEHA 1YL7A 4E4YA 1RM3A 1C1XB 4L4XA 3I9OA 3VKUA 4FR5A 2E37A 3GZNA 4DIOA 1DXYA 2DFVA 1LBEA 2BI8A 3JSAA 3E48A 3R3JA 2VUTA 2GD1O 4BQRA 2VCYA 4FCCA 2HMUA 4CL3A 1Z75A 9LDBA 4PLFA 3ONEA 4M49A 4NJMB 2P2SA 3NTQA 4HUJA 5F1PA 5G0WA 4PG6A 1XDWA 4GGPA 4AICA 2PGDA 3E1KA 2JCXA 1SMKA 1ZFNA 1YVEI 4IXWA 2OP0A 3NGLA 1YQGA 1SB8A 1V35A 1R37A 1RPNA 3JQ9C 1C1DA 2HJRA 5G4KB 8ADHA 4DC1A 2RH8A 2X0NA 3H2SA 3LU1A 4E2XA 3PYXA 2C7GA 4BL5A 2ZTMA 3FBGA 1GUYA 4FIZA 1U4SA 2AE2A 4RQTA 4I5EA 4I5DA 5BNTA 2I3AA 5KJEA 2DVMA 3DHYA 1Y8QA 1Y8RB 4UUMA 4CQLB 2NU6A 1YO6A 1UR5A 3OBBA 1DBVO 4JX8A 3MJ4A 4E12A 3DMTC 3WYEA 3DONA 1J6UA 3RUEA 1Q0QA 1DAPA 4TWRA 2VHXA 2AA3A 2HU2A 5IXSA 1R12A 4URFA 1YJ8A 3GFGA 4PG8A 1OAAA 1Y9AA 4IDFA 5CDYA 5EJ2A 4W9NC 2HK9A 3H3JA 1JN0A 3PTZA 3DBRB 3OIFA 1HDXA 4XRRA 5KVCA 3VAZA 2A9FA 5L9AA 1K3TA 3A4VA 2Y0DA 5A9TA 3WS7A 3STHA 1VKNA 4CV3A 3ANLA 3KSUA 2H63A 4CLEA 1I10A 4A10A 3W4IA 4NR0A 1ENPA 1SC6A 2D1YA 4HY3A 3S1LA 4EITA 3VDRA 4CLRA 2X8LA 4ZJUA 4MVJI 1U5CA 4E5KA 5DBFA 1LRJA 1FDSA 2O48X 3N58A 3ICPA 4TZTA 3OFSA 4JLWA 5KJFA 1P44A 1JDJA 3RVDA 1WW8A 1J4AA 4NH4A 2PD6A 1E5QA 1EUZA 4CV1A 4PRKA 1XYGA 5EESA 5JO0A 1N9GA 5COQA 4B7XA 1M66A 1ZW1A 5CFZA 2EWMA 4FC7A 1E5LA 1YONA 2Z1MA 2Q4BA 4YT2A 4CR6A 3PXXA 4DLAA 3ABIA 5A9RA 3OEYA 4JBHA 2QIOA 4RLSA 1NFQA 3B1JA 3EC7A 3L6EA 4CQMA 2CVQA 1D1SA 1DJNA 2Q46A 4ALJA 1N2SA 4ALIA 4UULA 3QV1A 5EERA 1MB4A 1GDHA 3GVHA 5KVVA 3DOJA 3N7UA 1ARZA 1IHXA 1V3UA 4J7UA 4CM6A 4PVCA 3FBTA 1CERA 1KIFA 4EGFA 1NPYA 1GU7A 1YGYA 3H9QA 3T4EA 1E6EA 5CDSA 1RJWA 4WGGA 3KHUA 1LSSA 2QRKA 2Y05A 4KZPA 4M87A 2D59A 3OSUA 4N7RA 4FGWA 3OIGA 5COBA 4AJKA 5L7TA 2WEKA 5CEEA 4D43A 4Y9DA 1X14A 2Q2QA 3PGJA 5TT0A 1PJCA 4NNJA 2X5OA 3DZIA 4B7UA 3GGGA 1U9JA 4E5NA 3OQBA 4PLYA 4JBIA 5TIIA 2WD7B 1UXJA 3Q3CA 4J4BA 4B4UA 1S7CA 2W8ZA 4JK3A 5TF4A 4NU6A 1E1NA 2PKRA 4LVUA 2VUUA 2C2YA 3W8FA 3NTOA 4CM1A 2CD9A 4D41A 4CM4B 2VNAA 1MFZA 2VWQA 1BMDA 5G4LA 3OECA 2PTGA 5DP2A 4PLGA 4K28A 3SVTA 2DPGA 1JLLA 4U8GA 4KQXA 5KJ1A 3KYCB 5CG1A 3ZWXA 3ICCA 1T4BA 4UAGA 3RD5A 1N1EA 4OYRA 2R00A 4GWGA 3OMLA 1P3DA 1YJQA 4KUEA 4TKMA 4YCAA 3X2FA 2BF7A 3KSZO 1DC6A 2Y66A 3WTBA 4Q3EA 4F3YA 3Q6IA 2V65A 4OMUA 4XCVA 5I7FA 3HUDA 3EY4A 1B16A 2J6IA 4FJ1A 2NSDA 5T5QA 2DT5A 4CMJA 1B0AA 3QJ5A 1LRKA 1PL7A 1CEQA 3UICA 3TOXA 1NWCA 1XGKA 3VH1A 5H83A 1V6AA 3M6IA 1MGOA 5FI5A 4HXYA 4J9VA 1YE3A 3WXBA 3TWOA 1P1RA 4Q3CA 4Z0PA 3RBVA 2AW5A 2D3TA 4NU5A 1X0VA 4ND5A 4CLHA 1HYHA 1ISJA 4O59O 1KEWA 3WGHA 1E3LA 1CF2O 3IL2A 2YHIA 3CH6A 3EAGA 2Y0EA 3QVOA 3AM3A 3W8EA 2VHWA 3QVXA 3VH2A 3LSYA 3RUAA 1UH5A 4J2OA 2P9CA 4DBVO 4YJDA 1U28A 2HMWA 5ICMA 3DZFA 1Q7CA 3AK4A 1BDBA 1LA2A 1PQWA 5ENDA 3ZWMA 2GRAA 1LDMA 3ETGA 1KVRA 2GN8A 3R1IA 2HK8A 1A72A 1XR3A 3TZKA 3D4PA 3NYWA 4R1TA 1LJ8A 4I5GA 4LRSB 4JBGA 2AMFA 2YQ5A 1R0SA 3W8DA 3WDSA 3ZGYA 3KTDA 1MXHA 1P1KA 2O4UX 3K9QO 3SLKA 3BMNA 4ZGWA 3ZWBA 4XYBA 1NR7A 3ROQA 3EZYA 4TZKA 2OOSA 3ONFA 4WLNA 1ENYA 4BO2A 2CZCA 4QSMA 5A03A 4H3VA 3Q11A 1E3WB 4BUCA 1PZGA 1L7DA 3F5QA 3IOYA 4J49A 1K0UA 3A9WA 4C4OA 3S2IA 4XDYA 4XEHA 3O8QB 1PSDA 2R00C 1KY5A 1GY8A 3L4SO 2NTNA 1IL0A 2YV1A 5HRUA 3KUXA 2GN4A 1P33A 5MGBA 1YBMA 3OH8A 5ES3A 4KTVE 3D5QA 3DZHA 3UH1A 5IDXA 4BNIA 4CUJA 4RVFA 1LQUA 1EFKA 4E5MA 4YR9A 2WTBA 3LF2A 4LGVA 2DM6A 4HNGA 3KETA 1UXHA 1I5RA 4XYEA 3FCOA 1MA0A 2NU8A 4BMNA 4F46A 2BMAA 4F6CA 1IY8A 2YDXA 3EMKA 4IJKA 3AFMA 3HN7A 4LSMA 4XJSA 4O5OA 2G82A 3JQFA 4IXTA 3KM0A 5B12A 3ADOA 4QO7A 3JD3A 1P0FA 4CM7A 2HJSA 3D4NA 5GZ3A 4CLXA 4MVJD 3GAZA 1NP3A 4HP8A 1HDRA 2EXXA 1I3NA 3EDMA 4P4LA 2PV7A 3DBRA 1DC3A 1HXHA 1E7MA 1U5AA 5TX7A 1PJ2A 3RU7A 2F1KA 3DB2A 1N92A 1Y5RA 2EHDA 1DOHA 4R51A 3L6OO 2AE1A 4AL4A 2P91A 3ZNQA 2CMDA 3OICA 4IJWA 2CF6A 3GVXA 1U2DA 3UCEA 2D0IA 4J4HA 1YRLA 2X0RA 5CEFA 1V3VA 1WZEA 1PJ3A 4RLHA 3ZCXA 1D1TA 3LK7A 2EF1A 4LMRA 1XELA 3O03A 5L95A 1QMGA 4BO7A 2I99A 3I6IA 3ST7A 1VRWA 4E2WA 1ONPA 5GY7A 3UFXA 4OJNA 1ISGA 1ONNA 4AJOA 2Q99A 1FK8A 2WM3A 3OA0A 1ADFA 1DIGA 4NHEA 2E48A 3QIVA 4CM3A 4UUOA 3KV3O 5BNFA 5JC8A 3D3WB 1FF9A 4ALLA 1KEVA 3IKTA 4GX0A 2IRWA 2I5PO 2B4TO 2Y67A 5B37A 1B2LA 1M6HA 1NHWA 3QP9A 4PVDA 3RJ9A 1BGVA 1ZXLA 1DRWA 2GPTA 4P4NA 2EW8A 1UZLA 3KXDA 3QE3A 3GEMA 4WEQA 5AXCA 4OQYA
chains in the Genus database with same CATH superfamily
1NV8A 1DOZA 1I14A 1Z06A 2H1WA 3BA6A 2UYGA 2XTJA 3P2JA 4UKDA 4OI0A 4LJAA 4YHBA 4CIDA 2VYVD 3JQFC 4IXDA 1XWWA 4AY2A 3QPCA 4LKOA 3AZOA 3G9ZA 3CMCO 1IY9A 1QSGA 4F9FA 3WQQA 1JECA 1XMIA 4CM9A 4PHHA 2GN1A 4D98A 4A7PA 5T64A 1U2TA 3PC4A 2HU5A 4OI4A 1NN1A 5F12A 2FJ0A 3CKKA 4F4UA 3FUWA 3SDBA 5HZGA 3CGGA 3EZ6A 4OQFA 2Y6VA 4LVOA 4D80A 3KQNA 4CEIA 3DJFA 2YY7A 3GO4A 3A06A 3OQPA 1SUPA 3G7SA 3JASB 4YRFA 1JMKC 1C3OB 1NMEA 3GQBB 2CVPA 1MG0A 2ZWMA 4NMHA 4MR7A 3ESCA 4XFDA 4JSYA 4JQCA 1AH2A 2REQA 3RKSA 4UVDA 3JS5A 2Q8NA 4M3NA 4R9RA 5EVJA 5FI0B 1QRUA 5FJIA 1B8NA 2ON6A 2NXCA 3N2NA 2ZULA 4M54A 4MMZB 2AOUA 4OIMA 5B7NA 1F9AA 3AF3A 5DX1A 5IBPA 3BJMA 4ZCPA 2F1IA 2H5JA 1RC1A 4TVBA 1OGYA 3H5AA 1ZBDA 5JTTA 3AYXB 3WLMA 3U9TA 5AOBA 2X1LA 3BYZA 5LZ4A 3UK2A 1U0NA 3L0SA 5E95A 3QVGA 1H9AA 1FOEB 2AR0A 4LV5B 4YPFA 1KZYC 4M1WA 3E3OA 1FMLA 3CW8X 1AOXA 2C9OA 2C3PA 3F6PA 1VBMA 3H2YA 4GKAA 1DL5A 4HWSA 3DV0A 3B1ZA 3MWDB 2WIKA 3FYUB 4UU8A 1CRQA 1QTNA 1IHUA 2X4GA 4R2XA 1Q0TA 1YI0A 4J0FA 2OZVA 1AQNA 2Z6UA 3G89A 5KYUA 3IR6A 3GCZA 2PKYX 1L4NA 5GZ6A 3U4QA 4JXZA 3G7NA 3I5AA 5KCZA 2RIRA 2UXCB 3PRHA 1S96A 5H9WA 4PCUA 1QB7A 4QUJA 2APJA 4FOSA 3H5TA 4TXJA 1F51E 1PG5A 5A5EA 4AKIA 3GP3A 4B80A 3ZDQA 3USZA 2QPLA 2XAAA 4PYQA 4MLDA 5LQRA 2OENG 5CFOA 1W87A 1N9GB 2BUBA 4CNBA 3X1JA 4DSTA 1NY5A 1QQTA 5IK2D 4ER7A 2GEDA 3C5HA 1I1HA 1II0A 2VA9A 4MWOA 3GLFE 1D2EA 3MTBA 2J0UB 4R81A 3WGGA 3OD1A 3R5HA 2QT9A 2W9XA 1KJZA 2IYUA 4RFSB 4Z7NB 5LBIA 4PFJA 2BGNA 2WWXA 2BV3A 4PO8A 2GPYA 3T9BA 2ONCA 3LM8A 1GKYA 4JXXA 2GKOA 3TPCA 4OUKX 1TZJA 3L4JA 1YRAA 1PCXA 2EW2A 3MB5A 4J7XA 2J3DA 1KDOA 1CHNA 4Z0TA 3DOFA 2UUOA 2HL6A 1B42A 1IULA 3EGWA 2Q3JA 4KR0A 4NCHA 5D5PA 4BRZA 1H6BA 1GPUA 3AI3A 3RVOA 3UF0A 4LSGA 4MGIR 3ZY6A 2B8TA 1SM4A 4B6JA 2BFDB 5TARA 1YDEA 1ZN7A 4TSFA 1NZFA 3T5CA 4MDEA 4WERA 4JLBA 3SS9X 4S1VA 4EJFA 2B3TA 1SCJA 4YLEA 1FW6A 1I0IA 4B2YA 1EK5A 1ZOPA 1KVUA 2OBLA 4KIJA 5JOQA 3FLEA 4IQ8A 1NXWA 1QDUA 3DH0A 3PX3A 4QARA 2MSEB 5BVGA 2VQ6A 1LNQA 1DTEA 5HOEA 4WK2B 3T35A 3L6UA 1OZFA 4WL0A 5AW6A 5KQMA 2J3IA 4M7RA 4F92B 4JWKA 3QUQA 1P74A 4QQKA 4D9NA 4FD3A 4WLEA 3Q5DA 3A70A 3HXTA 1BKDR 1JIVA 1VHWA 2ORIA 4KJXA 2CFIA 5A62A 2G3YA 4RF2A 2H5LA 1XEFA 2J31A 1BX0A 1DMRA 2VP9A 4IJ6A 1FP1D 1H6CA 1U8YA 3F1LA 5HMLA 3HZZA 4YV2A 4RX1A 4XYGA 1BX3A 3A1NA 1SELA 5BN1A 5IYZA 4WZ6A 2H2HA 1IU9A 2O2XA 2C04A 2GPNA 2XW6A 1JHVA 1VBKA 1HDGO 3NW9A 1C7JA 3TEJA 3EIFA 4OBWA 3Q9NA 4Q3DA 1G4AE 4Q3KA 3QU5A 1A9XA 3ABSB 2BEUA 1GLNA 1NYQA 1NXQA 1PJTA 3GFSA 3MS4A 1TF2A 4I14A 4INZA 4BVKA 3KBOA 5ECYA 3ZJVA 4JSRA 1ZK1A 3CURA 2B1RA 1Q84A 1OTYA 1G0OA 3GDGA 1RYHA 2IHYA 4HTFA 4YDSA 4EI8A 1JQLB 1Z68A 4Q9DA 3VPDA 4GUAA 3VVCA 3V1LA 4MI1A 3D3NA 2BBWA 2VLIA 5FNVF 3TLCA 3BXEA 4GPIB 3Q6NA 3FOEC 2OHGA 2EQBA 1ZUD1 2H59A 2WSBA 4RIEA 1V96A 3AC0A 2QT0A 4TL7A 4MW7A 2A14A 2IGTA 4EYGA 3VV2A 1TEZA 4MKRA 5HK8A 4ZU1X 5JZMA 1XRPA 2NSHA 5EWJA 5EY5B 1BQEA 4FZJA 1HYBA 3LE8A 1K5HA 3TZ6A 4ATNA 1XCBA 1VJ0A 4NVRA 1DQSA 3T1VA 1Z12A 2VBFA 4LGMA 4O5AA 2VJBA 2FPMA 2VSNA 4LJ8A 3EARA 4BN5A 4O08A 5DX8A 1MJNA 3K5PA 1UWVA 5KOHA 5FUQA 3HY4A 2HI0A 4DB4A 2YHIB 4YAOA 1CUXA 2HSDA 4Z9YA 1EM8A 1W49A 3F4LA 3KVOA 3K1AB 4LZLA 3B8EA 1DNPA 4HVCA 3RU9A 5K05A 4K2HA 1DLIA 2PGNA 4PG5A 4ZAZA 1O77A 3QF4B 1MX3A 5B36A 2MSNA 1RWQA 2P1DA 4Y6PA 4EVIA 1E6CA 5I48A 2PUCA 1HDYA 5BV8A 2DFLA 4FMDF 4UM9D 2WPDA 1WCYA 1ISMA 5L4SA 2P5UA 2O8DA 1DUSA 2CXRA 2CJPA 3V33A 2P4UA 3HCBA 5H68A 4A6PA 5FADA 1XLTA 4FX2A 1O0SA 4F12A 3ND9A 4M0UA 2R6JA 1RLIA 3JQEA 3KJNA 3PHIA 3Q3IA 4RV9A 4AKSA 2G5PA 4KQCA 3J81k 4YMGA 1OUMA 2BGRA 1QH1B 3RSGA 1WAMA 2IXEA 5TF0A 4HBGA 2HNBA 1VIMA 4YXWD 4BRUA 1QBKC 2WZQA 4J0JA 4TTTS 1HETA 1U1DA 3LHIA 4FHDA 1G8JA 1PG0A 3LUBA 3PPIA 3NWOA 3GXOA 4QDUA 1K5GA 2MCFA 4ANFA 1IWBB 4JS0A 3DEAA 1ZVQA 3HCAA 4Q9JA 2YFKA 3T3HA 4V02A 3TB6A 2PGIA 4X97A 1NVUQ 4FN5A 1PQPA 2O2IA 3DZ8A 4ECEA 4PXSA 4GOMD 4MGHA 4O2AF 5DCLA 3NHPA 2FDRA 2XUFA 5J4VA 1QHNA 1CUCA 1QIEA 2JI8A 3E9MA 5E7MA 4X8OA 3CR7A 2H08A 4E51A 2F8LA 3OZUA 4ZYWA 2Q5EA 4HGZA 1MENA 4PPGA 1EESA 5CVJA 5IAJA 2F9LA 4RYDA 3G6KA 4AN4A 4BXOA 6REQA 3AEUB 2FXIA 2ZUVA 3AEKB 4YNBA 4D9CA 3JVEA 1PHRA 1X15A 2MYTA 2VDNB 4D25A 4KUGA 5B6PA 4OU5A 1J21A 2P9YA 4INJA 4RKRA 4C4YA 3A4YA 3BHNA 4R4JA 1E2BA 2QW1A 3FMVA 3VPGA 2VA8A 2FCAA 3DO6A 4LDPA 2NU8B 4NFLA 1AF7A 4R2LA 2G0TA 4J43A 1IFXA 2POQX 1YC2A 2X8WA 3KB6A 4G26A 4GVLA 3SHVA 1NJ8A 2JIDA 3LI2A 1YTLA 5DBIA 1NMZA 4FWIB 1L9KA 1G20B 2G88A 3PHJA 3L7YA 4X6UA 1YZQA 2KWIA 1S0UA 4PZAA 3H16A 3HZOA 3OZCA 3KJEA 4P82A 1QU2A 1Q7TA 4YROA 5L6LB 2ZXFA 4OB6A 3H0EA 1BJRE 3E9QA 3HV0A 1FIUA 2C8LA 4RYLA 2WHPA 1MORA 2XUOA 3BMCA 4RSHA 2VPZA 4HX9A 4B83A 3ZGLA 1WSAA 3MJRA 1W47A 3ORFA 3GBVA 4MDHA 1MVNA 3NBFA 4OLFA 3DOOA 2FSFA 2WNIA 4P22A 2FGJA 2W2QA 2W2VA 2XSZA 3DV9A 3RVBA 2Y1GA 2W6QA 2GA9A 2JFGA 5A4DA 5CR9A 3NVMB 4HDSA 2EW1A 4RGYA 4X63A 4F1KA 3BIWA 4FMCF 1X1BA 3RARA 1XPUA 1FTWA 1TD1A 4ERNA 3Q40A 1S8AA 5B1IA 5J43A 4D3DA 3QMVA 2JGFA 1I4EB 3MOSA 1BMTA 1F12A 1TC1A 2XMPA 1AKUA 2XBMA 1OYWA 2FSIA 3K0BA 4GI7A 4H1HA 4ND8B 2QQGA 5CTAA 3O3NB 5D3ZA 1L5FA 4KL8S 5F76A 4H3KB 5H9VA 1I1NA 2DAPA 2FP3A 5BSVA 2OC4A 1T10A 1V39A 3FUUA 4Q18A 1XL1A 5DU2A 1X1AA 4HJRA 4BMVA 3HXQA 1H1DA 4UNIA 4N3BA 4YGXB 5I3ZA 1COZA 4MO2A 2TMKA 4W5QA 4TTAA 1O95A 2RH5A 4YVFA 2WWTA 4YJ2F 5EIXA 3DEKA 1JR4A 1ANKA 4DKJA 1KJNA 4LK2A 3FNGA 3CLVA 2OCAA 5K0ZA 4IW3B 2G04A 3EQ7A 5KYWA 1F0NA 2BDTA 3HR4A 1ZRMA 3NLLA 5LSAA 5DGIA 1T3HA 5AI4A 4DCNA 3K2BA 4HH3C 3ZNOA 1CYDA 2ODNA 4ZJPA 1E79D 3DFZA 1A5ZA 2OECA 3DYVA 1T5OA 1WW3A 4FILA 5AYVA 4DG8A 3CUSA 1ZXXA 3KAJA 4L4SA 5BSKA 4A9AA 2DKNA 1VFNA 4ITUA 1NLMA 1ZGCA 3ADKA 4KVAA 2CNBA 1EZ4A 2WFLB 3Q7QA 2GUGA 2YWHA 1VL8A 1ZH6A 1ZD2P 3ZCVA 4BO1A 4DHWA 1EFVA 4DQ0A 5KTTA 3ENVA 5B1SA 3GROA 3ESQA 1D9XA 1G2QA 1H94A 2V5VA 1CS0B 2V7GA 3G68A 3HUFA 4X7RA 3WKBA 2FUEA 3STVA 3B85A 4I8XA 1TXGA 4V0SA 2B4YA 1SVKA 2GZ2A 3E7FA 3G2PA 4XB6B 5E1OA 5H02A 4X6XA 2P4HX 3VBCA 2HLNA 3PGKA 4AWXA 4RTRA 2ZUFA 3H8VA 1YS4A 1L6RA 3C0KA 1GR0A 1PJZA 4RPIA 3O8BA 4Q7EA 5IJ0B 3OQNA 4GPBA 1GL9B 1VG0B 2GBLA 1WCWA 2O7QA 3COYA 1LGYA 4BNDA 2XPCA 3CH4B 4Q9NA 3UY4A 3ERCA 2A4KA 2Q1SA 4P8RA 1EFHA 2V96A 5JCOA 4RHUA 4ZPJA 3AEYA 4DVJA 3CONA 1Z4JA 4D5EA 1O6GA 3IQGX 1F8FA 2ZK7A 3G2JA 2VH5R 3T5AA 1ZOOA 2DP4E 3OQJA 2FSSA 4HDMB 2O07A 2FSUA 3Q7TA 5IMBA 1YQTA 2ZIAA 4DMUB 5KQLA 2OCBA 1ZNWA 1E9VA 1LLDA 4DLSA 3LBHA 4YAKA 4ENPA 1R74A 5L3VA 1Q7EA 1TRKA 2C00A 2IBMA 1MOZA 1KZHA 1TJ5A 2GJSA 3RV3A 3I9FA 1WPQA 4TYPA 3P5BA 4ZIRB 2WABA 4Q7QA 1SURA 2VIIA 1Z83A 3PK0A 1DAHA 3BN3A 4PGFA 3BSYA 4TMYA 4R68A 2PX6A 3NHWA 3ONWA 4R41A 4OGKA 2GAOA 4JI3B 1SA0A 1TA9A 4KK4A 1XVIA 4H16A 3K2QA 2A7XA 3O4RA 2I76A 1X3LA 2YXNA 5E2AA 5TQVA 1E3EA 4B3GA 3AOEA 1T0UA 3TGLA 3AERB 1XZDA 1XTRA 2QPAA 3A1VA 1I30A 2EDAA 3D02A 1N5JA 1DEHA 4BO5A 5LQDA 2WAXA 4ZOLB 1EVIA 2PNFA 3PC7A 4N0MA 3TD9A 3UATA 1E2PA 2QTLA 4WA7A 5B57C 5C1PA 2DWQA 1HI9A 2HDWA 3ETNA 3ZCPA 1XNHA 2VTBA 5DM2A 4CGZA 5EEHA 4LOAA 4UUAA 1E1MA 1B76A 5K0BA 3FD8A 3B38A 4L0QA 1DIRA 2VZLA 4EEZA 1BVHA 2YHUA 3SHFA 3WYAA 3RWBA 2ZETA 4LJ9A 2YWXA 1KKMA 3G0IA 3I1FA 3OX2A 4WECA 4J6FA 4HYYA 4ZGGA 2V7XA 3PQ4A 2ZWOA 4G01B 2EEZA 3UHJA 1XXHE 2OCKA 3T3DA 1E4EB 3LBFA 5AOCA 4XQ9A 2MR6A 3ZBQA 1AGYA 1Y81A 2GPAA 4PYIA 5FA6A 4R2IA 4PLTA 1U9IC 1VL2A 1IBLB 2ZIUB 3FIUA 3H97A 2FHPA 4ND1A 5CXUA 1SFRA 5KTYA 3IP7A 4PGAA 2X7HA 4B6FA 4FK8A 1QMPA 1TECE 4LV8B 4K9RA 3TQOA 4WOBA 3UN1A 4X1KB 1ZCBA 1HMYA 4V0ME 1LD3A 1KDYA 5C4GB 2RCYA 4QEZA 2JRCA 3K0EA 5GVRA 3V8QA 5AICA 2FWMX 3HC7A 5ER9A 4Q6BA 5BOSB 5IAAA 4RTJA 1WA5A 4NJEA 1UJCA 4HGNA 1A9QA 2AYYA 2HDNB 4BVHA 3EB9A 3S8MA 4ZHSA 4LOLA 1A04A 4QUKA 4J0HA 4BQQA 3JR3A 4GO1A 4G86A 4J0QA 5AM1A 5C7OO 3WICA 1Y7IA 4G0PA 4EAQA 1Y1KE 4JV5B 1C3EA 3L8CA 3VR4A 4YHHB 4RLQA 2DEUA 5SY6A 3SXUB 1WEHA 3E15A 2ZCUA 4JJIA 1D07A 3E81A 3WX0A 2FOIA 1NW3A 2P3QA 1WCV1 1QU3A 1DAKA 3NB0A 1DWPA 5AVWA 5FAKA 5JPDA 4C43A 1ZGHA 2C57A 4CMIA 3KEQA 1X0XA 2VG8A 2XHEA 4HO1X 5JRDS 4P84A 4PCAA 5ICFA 1PR9A 1JEJA 2QM7A 2AB0A 1S3GA 3DEHA 1LSOA 3CVJA 2ZXEA 3ORQA 4A8JC 4BV3A 4DJFC 1P2TA 4KXLA 4PGGA 4Y2VA 4ZDKA 3GAFA 2GILA 2JI6A 3JQ7A 1W581 5E3IA 2ZYGA 4BGDA 3FB1A 1TTQB 3DLCA 3QUBA 5FUXA 4GSKA 3QENA 1BFDA 1SXQA 2OTCA 3GVIA 1WUIS 4BGEA 4HK4A 5ALZA 3MAAC 1IUKA 3KB2A 1BXZA 3FCUB 1G6HA 1VXRA 2HEIA 2WAYA 2X5JO 1JR3A 1VZ3A 4YJFA 4IIJB 4U63A 4PIPA 1UOPA 5EYPA 5KNCD 1QK4A 1XTKA 4Y7CA 4G4SO 2IU4A 2IYAA 3O93A 4RKYA 5JNLA 3TJMA 1XDUA 2G1KA 2FZ5A 2Z3VA 1H0HA 3LUKA 1OWPA 1QV7A 1A4UA 1KR2A 2A4MA 2DOKA 3CNHA 3PRJA 1YDHA 3G49A 2ARKA 5BVHA 4M7OA 3RSZA 4ZANA 1HDZA 3LPAA 3VZQA 3VKFA 1VOTA 2VPQA 3TTSA 1X80A 2PAFA 1JIXA 1M34B 3H3XA 3KX2A 4U00A 3H6GA 3ROPA 3MJEA 1VG9B 3S2FA 3VMFA 4JLKA 2CBZA 4W82A 2Q0HA 4L6CA 2F55A 4G5GA 1GSIA 4OQMA 1W0CA 2NZJA 1I3KA 3EZ7A 4V0QA 3UQYS 4EUKA 1ZGJA 2I8LA 3GELA 4INOA 1QS0B 2FF5A 3KZMA 3ZV5A 3JVUA 2FPOA 4LFCB 5EJGA 1NJ6A 1TAGA 2HJ9A 2ZG6A 3NTUA 4GEKA 4BO3A 5HGXA 2CBXA 1FYWA 2CLOB 4OQDA 3VKWA 1SR8A 2EG9A 4KWCA 3ZC3A 5B3LA 3H9GA 1NMSA 2XXJA 5HS6A 5C46F 3CVYA 4JY7A 4PG7A 3U3DA 3KALA 1N25A 4A0RA 2W7TA 2JD0A 1XQ9A 2N47A 3EODA 1MP0A 3FZNA 3UKJA 1ST2A 3VNSA 4NBUA 1WETA 3AMVA 2BDUA 3JZDA 4ZVNA 4BX9A 4WBNF 2R65A 2OORA 4JUIA 1T8PA 2IZ5A 1JYFA 2I29A 2J3MA 4HWOA 4MGEA 5FUYA 4EHNA 1BXGB 1MO4A 2VK1A 1HQCA 3TBHA 4JR1A 3Q1LA 5I8PA 1T3LA 2HJGA 3AJAA 3PD0A 2P4EA 2I2CA 4WEOA 3ZR4B 2X77A 2ZUUA 4GBED 4RE6A 1K3UB 5E9WA 3FTEA 4IDEA 3RUFA 3AG6A 3ENWA 1YCGA 1YFKA 8GPBA 3AVUA 1MTZA 3CS3A 1I24A 3GFPA 4YJKA 1YS7A 4NCJA 3VNBA 3JTEA 3BMQB 3EGXA 3BC1A 4OLHA 1JEYA 3DBHA 1VIAA 1X1QA 3ETLA 3AYZB 1LQTA 4PGHA 4TTJA 3A9TA 1TF7A 4BGIA 2ZRMA 1G8YA 1OGIA 1YOVA 3HBMA 3UZUA 1V8ZA 4RK1A 2IJGX 4EJSA 4QG3A 2OFWA 3LC1O 5E2IA 3SBOA 3NQ41 2QPOA 4G9BA 3SIWA 2K4MA 1JFLA 4S0ZA 2Z6VA 3AUAA 3BDVA 4PN3A 1D2CA 3A3KA 1G18A 4XIYA 2GVNA 2VRBA 4G37A 4RCVA 1IB0A 2QP3A 4MWZA 3UK7A 3NV9A 1FP6A 4FWBA 1ORWA 4KIFA 3AR7A 4W99A 4IH1A 4BWGA 3WIOA 5G1NA 1RJ9B 2BEVB 1E6WA 3KOWA 1BTOA 4QTUB 1C8KA 4IHKA 3QKRB 3UC9A 1PK8A 2H06A 2RJ3A 3RW9A 1UKEA 3ZG6A 2DR2A 3RS3A 4ZFNA 4G6ZA 4PAMA 3B78A 1YMQA 5EP2A 1RM5A 4IICA 2AYXA 2WAMA 4XA8A 3KLBA 1R1DA 5CNMA 4MYUA 4GRIA 1IHDA 3E0XA 4EB3A 1EKXA 3V4LA 3TNLA 2RHLA 1W4LA 1E66A 3I9LA 1E89A 4B0PA 2LR0A 4C88A 4BZZA 1OLSB 5J47A 1CRZA 1QH8B 3NX4A 2JIMA 4IDHA 5FYDA 5EMMA 2JD2A 5FBKA 5CPBA 2ODEA 1ZIYA 3CT6A 1DOAA 3G8CA 1Q0HA 2G07A 3CJQA 1W29A 1N8SA 1SBZA 3V4ZA 5KSOA 3VR0A 1GGFA 2A0UA 1GQRA 4K9PA 4PQGA 3W4JA 1JHZA 4TMWA 5AKEA 3BH6A 3N2GB 4U2KA 3UWKA 4N82A 1B2RA 3VV3A 1OFGA 2I6QA 2GR9A 1G6OA 1TVKA 4IF6A 2FFRA 3FSJX 2VHVA 3PG5A 4TMFA 1AF4A 1WMBA 1EP9A 3A6KA 2ZB3A 3BIJA 3ZDEA 4JHXA 1PTJC 2IVFA 3EOZA 4KKXB 3R74A 2GZ1A 4M4SA 4RTSA 1JFSA 5K3FB 5ICMA 1SHKA 1IB6A 3MOIA 5D5QA 4K6FA 2RHDA 2MTBA 3IR5A 4N76A 4A4DA 4CM9D 3GX1A 4KQ9A 1GARA 1OI7A 2FFQA 1W5SA 5B4UA 1C30B 1E2QA 2VF8A 2V98A 2WD8A 4PLZA 4HATA 4X7MA 2BFFB 1P2UA 4XDGA 3VDNB 4UCWA 3ZJUA 1T3GA 1PX2A 3LUAA 4JVLA 5MFZA 2FRXA 2NMVA 4PQRA 2Y76A 3MRXA 4BPBA 1MAHA 4M1QA 4CMBA 2QHXA 4HB4A 4IJMA 1TA0A 4NZOA 4HN2A 1NOIA 2PUWA 1FJGB 3G2IA 3X1ZA 4HSGA 1TQ4A 1NRXA 1D2GA 4JQYA 1JQ3A 1VPVA 2JGKA 3AL2A 3RYCB 3M82A 3EOAI 2HY7A 2VK2A 3PBKA 2ODAA 1XP8A 1QHXA 2CKDA 4DJTA 3HSKA 5TY0A 1YUBA 4HDCA 4YJHB 1VLLA 2YS6A 2XOKD 4ZZ2A 4DR5B 1X87A 1JDNA 3WBBA 5IJXA 3K1JA 5KNCH 1QH9A 2B7BA 2UVDA 3AB8A 3GLGE 3H1BA 3B9RA 1DLJA 3JQAA 1M67A 1NBWB 2JPDA 3IUBA 1QLWA 1OAOC 1L7NA 3SCZA 3TD2A 4BB5A 5A9SB 5CD1A 4F9TA 4MLZA 2CXOA 3BK1A 2HCJB 3G0DA 3ZDRA 1TUEA 2G5TA 2VC2B 2GZHA 4G09A 2JEOA 4HUQA 4B3HA 4D81A 3EXEA 4Y6SA 1HZJA 5FWAA 5A3RA 2E87A 2B69A 3TCXB 2YQ4A 4JN6B 4K9MA 2DFNA 1RQGA 4W9MC 3G23A 2EC5A 1YQ9A 5AO9A 4B8ZA 2JCBA 5H3HA 1MGPA 1ISSA 1P8JA 2FWAA 1ACJA 1BMFD 3LSTA 3WNCA 4DIKA 1NXOA 2ZAMA 3ZKWA 4QDXA 4GP6A 1HTTA 2O9JA 3HJHA 1GGEA 1OFUA 2R8YA 4WFJA 3UMSA 4FR0A 2XYHA 1KZ6A 2NU9B 1E61A 4YUWA 2VFAA 3JATA 2IPAB 3GYGA 1ULAA 4DNXA 2FR1A 3DF7A 3E6AA 3PA6A 1PP4A 5AVYA 1DBSA 4QUIA 3KYDB 1ZD8A 4GPAA 4XDZA 3W2IA 5FOWA 3JALA 3JQBC 1G2PA 2WIGA 1G17A 1HC7A 3U60B 1DAEA 1E7QA 2C2WA 1KHHA 1G8PA 3R0ZA 3AOGA 3ETJA 4GKKB 1GTL1 4K46A 4IOJA 1DC4A 1VYTA 4ILKA 1MQ8B 2HD4A 3P7MA 1ORVA 2DHDA 3OQOA 2QLBA 3L18A 3RO7A 5EJEA 2FWBA 2I7CA 1K27A 3AR2A 3DXZA 1N36B 2NLOA 1YJXA 2EFDB 2QR3A 4KRYA 3RF7A 1E3TA 4B9AA 3FCEA 1TOAA 5EJ7A 2J5KA 1KOJA 3FI9A 3CCFA 3KTOA 3SC6A 1N1GA 3TO5A 3Q2KA 4LJKA 1RKXA 2F3SA 1BVRA 3EIWA 3G2LA 3O2NA 3VM6A 1OYYA 4HB3A 4BKRA 1SCUA 4FJ2A 2Q4TA 3MYRA 3Q8XB 5KCMA 1VPWA 3CVXA 1L4GA 2IU0A 1AB6A 4R05A 3CX8A 3REGA 3KYJB 1P45A 1SOWA 3PJFA 4TSFD 4WJZA 5CDTA 4UC0A 4Z4EA 1KJIA 5H80A 4ENRA 3AVQA 3F9IA 2CY0A 3ZH9B 4A8PA 3DSRA 1SY7A 5T3YA 5IT5A 3C48A 1G9TA 3FMOB 2ZYHA 1RP7A 3BCHA 4QGGA 3WGNA 3ZBUA 5BV2P 5TSDA 3ZTYA 3QJGA 1G5IA 2YJZA 1WXDA 2HAEA 4RZUA 1W85A 5H8WA 4RLFA 2OXFA 4M6WB 4N5MA 3QXGA 4A6XA 4U5QA 1VE5A 3ZWNA 2I55A 2XUQA 3DZKA 3G82C 3GUVA 2GASA 1WKCA 3V4VB 4US2R 5JYEA 5SZIA 2HDHA 4D8VA 1EX7A 4ZPXA 2B78A 2ESRA 3MNFA 3OZXA 1II9A 3OURA 2Q9BA 4MEJA 4PYRA 1U3TA 1KO1A 2O0LA 1P0CA 3R5TA 4M9QA 1H9CA 4H35A 2EP5A 4UTZA 1VJGA 4EDFA 3F96A 3LZ6A 5C35A 4M98A 3NNNA 3NPAA 1R6AA 1M2JA 1UPTA 4Y7DA 3ZCSA 3GG2A 2DWCA 2HR1A 2X9NA 3MBIA 4A5OA 3TSCA 2NACA 1CVIA 4CKZA 1FXSA 3EVFA 4U8HA 1LI5A 3UBTA 1HTBA 3N5CA 1N34B 2IQIA 5C5EA 2G5GX 5BUCA 1PYOA 3EPKA 4ESHA 3LBIA 3ADBA 4EUSA 1GQOA 4DGSA 1EU1A 1G7SA 1E32A 2GWHA 5FV7A 5IJZA 3DQPA 4G4JA 1U7TA 3OY7A 3C43A 3ELDA 5JDCC 3CR8A 4C7BA 3FVVA 3P2YA 3PZRA 4CV0A 4Q82A 4NLLA 3QU9A 2H17A 3THXA 1PK9A 4KITB 5HQTA 3R4CA 1C1YA 1RIIA 4UVIA 4BKQA 1SCDA 1IXZA 1QV6A 4D0SA 3H87A 2M6SA 2E4YA 5IDQA 1GQQA 5K20A 1AUPA 2K2WA 2N42A 4NX2A 4X95A 4HTAA 4FFDA 4OLJA 5JAHA 2UYOA 4FZRA 4R8LA 2OQVA 1KAHA 3VHRA 3JYNA 3I76A 1NBMA 3OJEA 4JKIA 1MAWA 1P6UA 2KS6A 1ITZA 5DISB 1BCRA 2JCYA 4KE8A 3K6SB 4OK6A 4FP9A 2OUKA 4RD2A 2V7TA 1GSOA 5ICSA 2WHRA 1JHDA 4R5MA 4WXEA 2CVOA 3TPZA 5KWIA 4BNHA 4ZTZB 1QFYA 2I6SA 2GF2A 2BFBB 3UENA 3E9NA 3L9WA 8AT1A 3E4CA 4DIBA 4HI0E 4DXDA 3VC1A 1DO0A 1O3YA 2KLHA 3K8ZA 4EY8A 1HLPA 3TH5A 2Z57A 4Z8YA 1Q2XA 4B4KA 2HRRA 5LOVB 3A6GA 3QI2A 3LA6A 4TV8B 3N05A 4EHKA 2WPDD 3BCRA 3RVRA 2WE8A 2HCTA 4KQ2A 1VIVA 1FNBA 4FEEA 3QUTA 4LN1A 4NZ9A 3GJYA 4ZO4A 3H2JA 3QWAA 3QBJA 1H8HA 3BGSA 1GTG1 5ALGA 1CY1A 2FSGA 3WQRA 3WLPA 2HA4A 4Y8VA 4BVGA 4E30A 3Q3HA 3WMEA 1GUDA 3O84A 4JYBA 7ADHA 5B58T 3DGFC 3I92A 4CEJA 5TJ9A 2GAAA 1VRVA 2ZYDA 4R9NA 4REQB 1A9PA 1DAMA 4QGAA 3VI4B 3KJQA 3OLQA 1ZJJA 4TN5A 3AM4A 4PZPA 1T6XA 3W79A 1DCKA 1K8RA 3RVSA 1YRYE 3V3TA 1EI9A 3HACA 4YACA 5D6OA 5H5JA 4M0PA 2JHPA 3DOIA 4H7DA 2Z5FA 3DL0A 1A8QA 5ECGC 3A1DA 1ZUNB 5K3AA 3GGCA 3GLHA 1E6UA 2YL2A 4GLBA 1V2HE 2G25A 4AKHA 2GHQA 1GG2A 3RSFA 3UMJA 3HXMA 1W5TA 1RLOA 1PV2A 2H4FA 3SOPA 1ULBA 2PO5A 1WUKS 2FWRA 3GWGA 3NDRA 3AONB 1X1RA 2GKSA 2WSSD 1NFRA 3R3SA 4UDXX 4F7WA 2OHJA 2WW8A 2ZE8A 3PPWA 4IQFA 3P9NA 3KHTA 3L05A 4ZQHA 5E7IA 3VPHA 1FU8A 5F52A 4MWSA 1NWHA 3CCCA 2C82A 5H59A 2GX6A 521PA 2AVNA 2AJ8A 3WYCA 3ESBA 4G2NA 3B1KA 4D82A 1B41A 4B40A 1U4NA 4D3XA 4R2WA 5HEKA 3EBLA 2WUDA 4S1TA 4CVNA 4JVMA 4EG6A 2QM8A 5HFAA 3SN6A 2CL6X 2PZJA 2W2NA 1I5OA 5LQKA 4DLRA 1VBFA 1TJYA 3IIIA 1M3SA 3LGXA 2DC1A 2EQ5A 3NKFA 1YNOA 3OEHA 1VA5A 4EG5A 4EW3A 2XF2A 3SJAA 4P3OA 4YLYA 1QNLA 3K9NA 4FDAA 1LNSA 1R2QA 4FSXA 4MVJP 3W0LB 2GLTA 1RHMA 4FHZA 1EQ2A 1IBSA 2R48A 3EGOA 1MDFA 2R1VB 2V4MA 3H8WA 1UBEA 3IP1A 4IUYA 5FLYA 5HCIA 3NAZA 4F2WA 3NPMA 1RXEA 1OT3A 2EKLA 5KYYA 4ZO8A 1PHPA 1Y9EA 3WZLA 4EHBA 5CAEA 5KX5F 3VJRA 2X3UA 4ESEA 3LGAA 1NUPA 1K4KA 2BGKA 2GD2A 3UB2A 1YSCA 4MVJF 5AJTA 3SSOA 3RGGA 3VU0A 2CLIB 3EMVA 4K1XA 2O1SA 4WADA 4CLOA 4CKCB 4MV0A 3RYIA 4TLMB 4F6RB 5ECWA 4MARA 4UJ3A 1IRIA 4AZVA 1RPAA 1P1IA 3L1UA 3AJEA 2C4WA 3BGVA 3LOPA 2CFRA 4AU1A 2R66A 2XSZD 3ABQB 2XNSA 4JUDX 4RSRA 1YE5A 2ENUA 3KQMA 4YYZA 5I9NA 1UMBB 3M9WA 2NSLA 4KI7A 4UXIA 1QX3A 4B87A 4QPZA 1MOSA 3ICVA 1D4AA 4IY1A 4A0GA 3TSOA 2GARA 5EKSA 3NH9A 5BSFA 2XCQA 1VL1A 3GFOA 1VKOA 2OO5A 3IB6A 3FHJA 2J32A 3MINB 2ACEA 4LE2A 4JOCA 3M5WA 5L45A 2HNAA 4LYDA 4BNGA 3R7NA 1LZLA 2P6OA 2O8NA 2J5QA 4J0GA 2E2WA 1XPOA 3JWGA 1S9DA 4MCJA 3QEBZ 3KWFA 3VVBA 2GT1A 3HLKA 3NBYC 4AJHA 1L8LA 1JPNA 4EHLA 1G7TA 1U7ZA 1M5RA 1M1UA 1KVQA 1VBNA 3A26A 5TMPA 2CE2X 3CW2A 1MCZA 1P77A 4RL6A 3W04A 1JI0A 2CD7A 2C9ZA 3FA2A 3AVWA 1F8XA 4XJXA 4BGVA 3PFFA 4EJMA 3K1YA 5DXJA 2FZWA 3EXIB 4EPYA 3F8WA 1P2BA 1X7YB 4DNFA 4QLAA 1DKQA 1TE2A 1XBTA 1RI2A 3QYPA 3PLAE 2C8KA 4KFUA 1HKHA 1SQ5A 1AC5A 1E1LA 1WVGA 3CT4A 4YP1A 3TVDA 2O6HA 4JI4B 1VGRA 3OJXA 2G77B 1CJBA 4XQ0A 3KWMA 3ISJA 4ZT3A 3FVWA 4YT8A 3RFCA 4HH4A 3NHYA 3LDUA 5K0GA 1O08A 4BWYA 5AUQA 1JAZA 4NV3A 3VMMA 4Z53A 3BIOA 3SP1A 1E8DA 3R0JA 3MWJA 2FUCA 5A0FA 1Z33A 4ODIA 3KOMA 2BDEA 1OLOA 2YZMA 3N5KA 5ALEA 1SN7A 2B1JA 2WF9A 3L1IA 3O7MA 2HMVA 2AZ4A 1NSFA 3HFGA 1Z73A 2GYVA 3SMQA 3OFVA 2JDID 5BN4A 1GXSB 1QG6A 1Y37A 3R2JA 1VHLA 4IIHA 4MA5A 4D3SA 4K6MA 1QFZA 4MS4B 3QG5A 3H4TA 1E4OA 5A3SA 3I23A 1E1RA 4K6CA 3DCYA 3IMEA 2LKCA 4N0PA 2H4JA 4OHWA 4V0LA 2L2QA 1X7WB 3SK0A 3AIIA 2R87A 4UHJA 1B6TA 2ID9A 1EXVA 5IN4A 1XVAA 2V4UA 4ZKDA 4JZYA 3VYVA 1T2DA 1YFLA 3N59A 2O7VA 1KFEB 2PZKA 2CJWA 2WKQA 3A9UA 4MW5A 5FBRB 2GN9A 4L76A 3TXAA 2F1OA 2OHXA 3SMVA 2O2SA 4NDAA 1ZIDA 3CTMA 3DEJA 2EYUA 4GU5A 1GKIA 3KTAB 3COSA 2VHQA 2WG0A 1XTIA 5JSZA 4D96A 4LX0A 1PR5A 5B3KA 1A97A 1W6RA 2QRUA 2R2GA 2C5AA 5TPWA 3ZHCA 2PUBA 4IPTA 5ALNA 5ALYA 4QJ3A 4R1LA 1WV0A 1W48A 1HM5A 4HWKA 4P32A 4AF7A 2QYOA 3M6FA 3PXDA 1ZCJA 5JVDF 4IHJB 1CJMA 1V16A 1VCNA 2I62A 3IE1A 3MVEA 1CU1A 4DR7B 1CV2A 1IBRA 4OHCA 4QNNA 2VYCA 3Q7EA 3WLLA 1YJBA 4FYIA 5IF9A 5DHSA 5EMLA 3TF5A 1PZMA 4ZYTA 1WSWA 4MKXA 2VQ3A 4AF6A 3PUHA 4P54A 4TS1A 5GGXA 1YIAA 1MV8A 3OUZA 1AQUA 1GZDA 2BFPA 3VO8A 2BONA 2ZSIA 2ZU6A 3OJCA 2Y2UA 3OX4A 1WDKA 1GTMA 4IVPA 4Y18A 3ROZA 1X1EA 4MRAA 4YAGA 5DNEA 5A3QA 1H4TA 5U9CA 5AVOA 3AKCA 4IKEA 2PKQO 4QFDA 4TS3A 2XNHA 1T8RA 2ZRFA 4ISCA 3VHQA 2Q1UA 4E09A 1V8DA 1Z0JA 4CQNA 3LXMA 2CVHA 2AQ8A 3MN1A 3QH4A 4KXWA 2BBSA 4A0QA 1O7JA 4B82A 3ZOKA 2RAPA 4C2TA 3OG9A 3PI7A 4CDRA 3GA5A 2QZ9A 2Y9MB 4WH0A 1OH5A 5ER6A 2PZMA 5EMJA 4EF4A 4O1MA 3CISA 5JJCA 2A1TR 3H2KA 2JIZD 1FXUA 2ZTLA 4OQ4A 3ID6C 3SE0A 1AM4D 1QYCA 5A4KA 1K6JA 2IY8A 4F2HA 3O5AA 4N49A 4W1QA 1W1WA 3LWNA 5CJJA 3RTAA 3TSAA 2VI5A 2QTTA 5K0SA 1JFTA 1WHTB 2SHKA 3KUCA 3LKZA 3AZQA 2YV4A 3VR4D 2C7OA 5AXDA 1N6LA 2WMYA 5TV2A 4E07A 4U9UA 2OQIA 1JQAA 3ZKAA 1WXFA 1W52X 2V03A 3M6UA 5EINA 3PFHA 1X39A 2PLAA 1L6IA 1PF7E 3CUYA 4LZZA 3W9YA 4A1OA 2JAQA 2ZJBA 1ZMRA 3K16A 1HSZA 2JFVA 2P9JA 4NJMA 3R09A 1T5DX 3CG0A 1I32A 1GT91 1XCLA 2O20A 3G8YA 3HXLA 3WY9A 1AV6A 2IP1A 2PSSA 3MQFA 1JEQB 5B7PA 4DR3B 3HYSA 2G4CA 4Q1FA 2Y6UA 2YWJA 4JOBA 2GK4A 3L8DA 1KP3A 1XAGA 4IEFB 4BJHB 1GAEO 3M6VA 2CYBA 1U7DA 4X24A 4C1NA 4WZAE 1ONSA 4LGCA 1V3QE 3X1KA 3ZPXA 3OHSX 1XRSB 1EHYA 3U7JA 1JR3D 4D0LB 3ZEIA 5BT9A 1AMOA 1L7OA 3D3EA 3LAWA 2W83A 1R66A 5JNTA 1JFRA 1E3DA 4KVZA 1OWLA 2AG8A 1CEEA 2IIVA 5TQ2A 3U3MA 4UE2A 3WJ7A 1IQ0A 1H2FA 1FLVA 1CUFA 1U6JA 2QR5A 4TROA 2H1VA 4GSLA 4LK3A 1DJQA 1QP8A 4ZZ1A 3BWXA 1NW7A 4R2KA 2NM0A 2OD9A 2HO5A 2QX9A 3GAAA 5EN4A 4EHAA 3QQPA 5IYZF 4K1LA 2DG2A 3B82A 4HEA1 2ZBRA 3K6RA 2M32A 3D8HA 2EX1A 3ORRA 3TRHA 4JROA 3H75A 1UPAA 1ZUIA 1G3QA 2GCOA 1F9EA 5IBQA 4QECA 5D1HA 4TSKA 2Q0XA 3NEPX 3IQIX 4B74A 2A7QA 2R1UA 1AK1A 4EVSA 3ZHUA 1IG0A 3GYBA 3HO8A 1MBZA 4PBSA 1C50A 2OMEA 4G1BA 1GOTA 4JSTA 4ENUA 2EG5A 1W19A 4EG1A 3FPAA