1SEVA

Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
GFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQQQLEAALTGMDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVSFIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase, glyoxysomal precursor
publication title Organelle and translocatable forms of glyoxysomal malate dehydrogenase. The effect of the N-terminal presequence
pubmed doi rcsb
source organism Citrullus lanatus
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sevA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1sevA02
2PD3A 4Z0HO 1YL7A 5DCUA 3LT1A 5TF4A 3KETA 2VYVA 5GZ6A 3Q9NA 4FN4A 4BGVA 4ND2A 3OECA 2JCXA 4XKJA 4XB2A 4MO2A 1E7MA 2VZ0A 2X0IA 3ASVA 4M54A 4NBTA 2EIHA 3JYPA 2W2KB 4CR8A 2PH3A 4BOYA 1U3VA 3U3XA 5AOVA 2J3HA 3VC7A 3E82A 4IMRA 1EEHA 3KLPX 1PGOA 1Y6JA 4IXTA 4QFDA 1HETA 1MFPA 1SEPA 1LRJA 3RC2A 2JJYA 3O38A 5BSGA 3QY9A 1YB4A 4D3DA 3E9QA 4QECA 1HE3A 3F47A 4RPKA 4N5MA 1ISMA 5G0UA 4WJZA 3WIEA 4XRGA 3T7CA 4KMSA 4LRTB 1ISGA 5AXCA 4JN6B 3PJFA 5T5QA 1EBFA 1B8VA 5JMPA 2NU8A 4EBFA 4D3SA 1HE4A 4ZD6A 3HDJA 2E82A 3FSRA 4BMSA 4JIGA 1FDVA 1PQPA 4CL3A 3JD3A 4GX5A 1LRLA 4MKZA 5EQFA 2RHRA 5HWSA 1H6AA 1F14A 1PX0A 1JN0A 1SBYA 2Y1EA 3CIFA 4FFOA 1N1GA 3IIEA 4FD3A 1U28A 5TS3A 1JU9A 3FWNA 3WTBA 1NPTO 3FCOA 3QWBA 5GMOA 5C7OO 1FF9A 2Q1UA 2D1YA 3WBFA 5DNAA 2DLDA 2YYYA 3LK7A 2O50A 2ET6A 2B35A 1EBUA 4RVFA 2AG8A 4B4VA 4DC1A 4IQ8A 1Q0LA 1T26A 1E7QA 5TX7A 2Q46A 4U6SA 1PJTA 1QYXA 3LC1O 4LGVA 4RPJA 2EGGA 1ENPA 1H9AA 3VPSA 3INTA 1X0XA 4I5EA 4J90A 1DJNA 4C7KA 3LU1A 4W9NA 3ADOA 1Y8QB 5KVSA 1ONNA 1BSVA 1CJCA 4FS3A 4RPGA 3UOGA 1UZNA 4MP8A 3RJ5A 1GADO 4BUCA 5JO0A 1ZMOA 2ZJ0A 1DFGA 1GL3A 3L6OO 2AA3A 2HLPA 3AU8A 4YRBA 4NBUA 5BQFA 3UF0A 4BO0A 3JQBA 4QUKA 5T8KC 3KVOA 1PWXA 1AUPA 3VKUA 3V5NA 1KVSA 5G0VA 5AVOA 3LT4A 1KETA 3ZNPA 1SMKA 4BKPA 3T7EA 3TL2A 3V1UA 4B7XA 2E37A 3JYOA 5FFFA 3VOSA 1GCUA 2D2IA 3WFJA 1RM0A 4XGNA 4R1UA 1PZGA 4GX0A 4IZIA 4BHTA 1M6WA 2HJSA 1ZSNA 1ZSYA 2BFMA 5JAQA 4CQMD 2YY7A 4M1QA 4GH5A 5JFOA 5DOZA 4Y9DA 1N7HA 1O94A 3DMTA 2PFGA 4R1SA 4BQRA 2VWPA 1R12A 2GUGA 4YACA 1E3EA 1NNUA 1ZEJA 1QYWA 3D4PA 2H63A 2FR8A 3R6DA 2V65A 1YGYA 1ZJYA 3NDJA 3RJ9A 4UVIA 4B3JA 3I9JA 3AW9A 4L76A 3PWZA 1EMDA 1Y7TA 3U5TA 3H3JA 2GRAA 1UP4A 2Q49A 2VRCD 2VRBA 3CXRA 1R6DA 3TF5A 4K6CA 2QIOA 3ITDA 4D0RA 2WWRA 2ZCVA 1ISIA 2O2YA 3D1LA 4R16A 3JQFC 3G0OA 1HLPA 2Q99A 4JBGA 2HU2A 4CLHA 1PIWA 3BTSA 4FIZA 4DWVA 1QMGA 3OP4A 2ZB4A 4RO0A 4J6FA 1I2ZA 1SOVA 3GVIA 1M6HA 4EYEA 2JHGA 3F4LA 3GNTA 4JK3A 2B5WA 4U0JA 2A4KA 3E03A 3DAGA 3OIGA 2FR0A 5EN4A 1E7WA 1KIFA 3OJ0A 1YB1A 1OAAA 4BGIA 4CM4A 1WNTA 2HMVA 5A05A 4FOSA 2O3UA 2CF5A 4WECA 1GEEA 2B4QA 1J0XO 1A4UA 1N8KA 2HRBA 5GZ1A 1EUCA 1EVZA 1DAOA 2PKRA 7ADHA 4J2OA 4R01A 4NG5A 2QYTA 4R5MA 5KKCA 2CZCA 1C0KA 2OFPA 3GUCA 1IOLA 4RLHA 3U4IA 1DC4A 5AQ1A 2OO5A 4MJLA 2Q4BA 2I67A 1GZ3A 1UDCA 4DYDA 2AQ8A 4IQ0A 4YXFA 3E6AA 3RWBA 1G6KA 1VJ0A 5I8ZA 3RD5A 4BNNA 5IDQA 3R0IA 1R4NA 1HRDA 1AHHA 4Y8VA 3MTJA 2FZWA 4BNMA 4IDAA 4DXHA 2ZB3A 3PP8A 3HSKA 3G79A 1KC1A 3S8MA 4BNHA 5L51A 4FFLA 3EUWA 2ILTA 5FI5A 1A9YA 4DQUA 9LDTA 1I2BA 3JQ7A 4F45A 2NU7A 4R1NA 3KEQA 3NUGA 2F1KA 3PHLA 4HNGA 2E4AA 4MVJH 2NNLD 4Y67A 5COAA 3DBHB 3LQFA 2E6UX 1MC5A 4WKGA 2JFHA 1N5DA 4CQLB 3PFWO 2O48X 4CMIA 3GGPA 3VPHA 1Z75A 1XU9A 4RF5A 3TNLA 3DTTA 3L4BA 3TL3A 3VTFA 4PIVA 3V1YA 4H7PA 3PLRA 3QA9A 3UHAA 1LQUA 1UDAA 4FR5A 2NACA 2X5KO 3E5MA 2DBQA 5B37A 2Q4EA 3WNVA 3MJ4A 3GC6A 1P33A 1QYCA 4KP7A 1UDBA 4JQCA 3TFQA 4L4RA 3AM3A 1I3NA 4E2ZA 2FR1A 5AXBA 3MOGA 4XX0A 2FY8A 3Q2KA 3PJEA 4PCVA 3AY7A 3W4JA 1M75A 1Y8RB 4PLCA 2BFPA 3PFFA 4NJOA 2B4TO 4PLYA 3GZNB 3ROPA 3AI3A 1LXCA 3PQDA 1T1SA 2YQ4A 1ADGA 1WVGA 1DLJA 1J6UA 1R4MB 2Y0DA 3I6IA 4OMUA 4HFJA 4J0FA 4BGUA 2HMUA 1TB4A 3CPSA 2NQTA 4DC0A 3D0OA 4DGSA 3CZMA 5JBIA 1U3WA 3AI1A 2YHIA 4CQMA 4FFRA 3PIIA 2G17A 4GVXA 3AOGA 3VHRA 4A0SA 4OXYA 3DBRB 3RFVA 3W8FA 3LLVA 5IDXA 3BA1A 4BO9A 1T2CA 4NFSA 2BFOA 4E5YA 4GPD1 3CINA 1ZFNA 3I9NA 4KOAA 3TRIA 2TMGA 4E31A 4DTIA 4O5OA 5KCZA 1B2LA 3Q3CA 3COSA 4D43A 4HBGA 4PGFA 3JYNA 1K3TA 4JXKA 3S1LA 2PY6A 3BMCB 4EUFA 3GVCA 4OGWA 2J5KA 4YAGA 1JKIA 2DKNA 1K5HA 2VHXA 1P0CA 2RCYA 1Z82A 3ZGYA 2W8ZA 3WJ7A 5DBGA 3SBOA 1P31A 2G5CA 1IZ0A 2J3KA 1T2FA 1D1TA 1LDBA 4WASA 1A71A 1YJ8A 1B0AA 3PXXA 3HB4X 3QE3A 4TSKA 4YT8A 1NR7A 2PD4A 2V6GA 2CUKA 1MB4A 2WM3A 3ZZNA 1SEVA 3RUDA 3PWKA 1FDUA 1QORA 3FI9A 3IJPA 1EFKA 2NVUB 1C0LA 4IDFA 5IJZA 1P1JA 3FF4A 1NFFA 2NTNA 3F6YA 3GFGA 3KZVA 1ENYA 3A14A 1E3WA 4AJ2A 3WB9A 2DC1A 1VRWA 3VVCA 5L4LA 1TT5A 3C7AA 2DVMA 3B6ZA 4A2CA 4BVAA 1I30A 3R1IA 4EITA 1IPFA 5ENDA 1DRVA 3M1LA 2LDXA 5G4KA 3AUUA 4MKRA 1TEHA 1XGKA 2AQKA 2DAPA 2I3AA 2ZB8A 3GVPA 3ONEA 2EXXA 3GUYA 3K9QO 3PYMA 4OH1A 2FMUA 3ZWOA 3ZWNA 3P7MA 2YZ7A 1BDMA 3JQ9A 3DAPA 4D7AA 2UYYA 3SEFA 4BO6A 4FBGA 2DBRA 4OQYA 1NX6A 4WOKA 6ADHA 2GN9A 4WNIA 5B1YA 1WDLA 1WP4A 3AY3A 3KBOA 5CDYA 3PJGA 1HEUA 2QRLA 3WGZA 2OMEA 1DC5A 3KO8A 3BHJA 3L0DA 3W4IA 5L7WA 1SOWA 3GN1A 4ZQFA 4Q3CA 2VWGA 3FPCA 4KUEA 3FHLA 3KTDA 3GEMA 4LMRA 4ESOA 3SLKA 1U7HA 3NDRA 2CDAA 4PLWA 5IDYA 3NKLA 1XQ6A 3OETA 1GV1A 4X54A 4P22A 4BO3A 3GHYA 3WTCA 2I3GA 4Z6KA 2HQ1A 1LSJA 4G81A 4JP3A 5TGDA 1JLLA 4XQCA 2A92A 3BMQB 1YDEA 4NU5A 4ZN6A 1VLLA 3MZ0A 3QWAA 3UCFA 3PVZA 2D5CA 4HP8A 1JVBA 2DPGA 3GQVA 4JBIA 3EZLA 4GWGA 4ZQHA 3SLGA 1J5PA 2NSDA 4CM9A 2J3IA 4GMFA 4IY1A 4MVJG 3VPGA 4MVJM 2DUUA 1VSUA 3GOHA 1WXDA 1ADCA 2UAGA 3DB2A 1DXYA 3S2GA 3ZV5A 4AJHA 4ALKA 1HF3A 4NU6A 2GNAA 4RDIA 4H3VA 4DLLA 1DHRA 3WSVA 2YW9A 3G17A 1I10A 3UVEA 1LUAA 4R1TA 4IIVA 5KJ1A 1ONPA 4RZIA 2DBVO 1ISFA 2PGDA 3TOZA 1ZUD1 1C0PA 3D64A 3F1KA 4NHEA 4EUEA 2NUAA 4YQYA 3WNQA 4F6LA 3IUSA 4AJNA 3WGOA 3JSAA 2OORA 4BNIA 2EW2A 4XYBA 1IPEA 2PR2A 1BXGB 1V3UA 3EZYA 3S2FA 4ZU3A 4BQPA 1ZXBA 4CMAA 2IE0A 1ZIDA 5G0TA 2X4GA 1HZJA 1V3VA 1WDMA 3ZWMA 1ZK2A 3ONFA 4IXWA 3WLEA 4BB5A 1DIHA 4PG4A 2NQ8A 3DTYA 2HMWA 1RWBA 3MJCA 4U7WA 1AGNA 1OC2A 4XYMA 3DZBA 4YR9A 2ZQZA 1PJBA 2C2YA 2C7VA 3W6ZA 2C07A 5A4DA 5CDSA 2W98A 5IZ4A 4E21A 4TKMA 1KVRA 4C4OA 2E49A 1LI4A 3ZWAA 3ZN2A 1DRWA 2BLLA 2CY0A 4E13A 5ICMA 4XWYA 3RQSA 1YO6A 4NFHA 4Q3AA 2DFVA 3VZPA 3NTQA 1K0UA 1Q7CA 2BGMA 4DPLA 2EJVA 4FJ2A 2EEZA 1E6UA 4IM7A 4WOJA 1R37A 3JQ8B 3Q6IA 3VZRA 4B4OA 2Y1CA 3DFUA 2Y1DA 4UUOA 1ISJA 2C54A 1ZH8A 2DUWA 4IUYA 5DCYA 3UFXA 4Z9YA 1V6AA 1X0VA 4BKQA 3GLQA 4YTEA 5C7LO 1PZEA 4OOEA 3GG9A 2PLAA 4MDHA 3KB6A 4TQGA 4EDFA 5JDIA 4GL4A 2FWMX 4Z3DA 1IB6A 4U6QA 2WD7A 2X58A 3MEQA 2A94A 3WQQA 4XQGA 3X2FA 4I08A 3OM9A 4DREA 2OP1A 3BHMA 3C7CB 1FJHA 4UREA 2HK7A 4CLXA 5CPBA 4RCVA 1DB3A 1S6YA 1VL6A 1PJCA 1LSOA 4J43A 4PFJA 3OSUA 1IUKA 5IZCA 3H8VA 4JP2A 3K73O 4KWHA 1EK5A 2Y0EA 3F4BA 2WYVA 4Y6RA 2CSUA 3PDJA 1SB9A 5IN5A 2EKPA 4U5QA 3RUAA 5B4TA 5CAEA 3R3JA 4D0SA 1NFRA 5EL0A 4D44A 1E1MA 1RM5A 1UJMA 2GZ3A 3ANLA 3JD2A 3PZRA 2AE2A 4XR4A 5L40A 1PJQA 2PWZA 1E3JA 2CFCA 4TROA 1I01A 2ZKLA 1CQJA 1AE1A 1ZK1A 1W73A 2VNSA 4ND1A 1K89A 4BGEA 2J5QA 2X0JA 1W4ZA 5CEJA 1LLQA 2POQX 3KOUA 4IQGA 5DF1A 4MIOA 4R9SA 3L77A 3D5TA 3SC6A 2BKAA 1P3DA 4CMHA 1PQWA 5T67A 1D4FA 3C8MA 1MV8A 4QFCA 4OXNA 4EJ0A 5IN4A 4AJKA 1KEUA 3WWYA 2AG5A 1GQ2A 3QVSA 3CUKA 5A02A 1H6CA 4KQWA 3F5QA 4OXKA 3TZHA 2PZMA 2X7HA 3QVOA 1DPGA 4R69A 4RV9A 1LU9A 5JAZA 4KDEA 3Q2IA 4YCAA 3K96A 5CPFA 5TSDA 5KJFA 5TQVA 4PLHA 3BIOA 4O63O 1LC0A 1Z73A 1GFSA 3IQDB 3ADPA 1Q0HA 2VHWA 1C1XB 2OXIA 4PZEA 4KQXA 4A10A 3QWHA 2BI7A 3WICA 1XEAA 3IS3A 3RUHA 1GZ4A 5L95A 4Z3KA 1Y8QA 2HKIA 4NQZA 4S1VA 3NT4A 2OGUA 4LSMA 5B4VA 2ZJ1A 3CEAA 4IS3A 3VH4A 3GDFA 4HWKA 3JD1A 1PL8A 1YVEI 1SPXA 4DMLA 2CDBA 4XGKA 5HA5A 1P1HA 4XYGA 5EINA 3MOIA 4LN1A 3AY6A 4RDHA 4NJMA 2QYSA 3FR8A 3JYLA 4BNLA 1ID1A 2B36A 2B37A 1X15A 1UP7A 4CODB 1H9BA 1KVUA 3DZJA 9LDBA 4O6VA 3QHAA 3O8QB 3JTMA 4XB1A 3HNPA 1YL5A 1M66A 1PL6A 3IJRA 4E2XA 5CEEA 5KIAA 3GVXA 3BTUA 3Q0EA 5TJ9A 1LBEA 1UAGA 1JWAB 2O4UX 3UCXA 2CNBA 1IZ9A 1H5QA 2TMDA 1QYVA 2H9IA 2EHDA 3G49A 2ZYAA 2FSVA 4NBWA 2DU8A 4RVDA 4ND5A 3VTZA 4GSKA 5EQDA 1Q0QA 1Y1PA 3I5MA 4WEQA 2ZTVA 4UEJA 5G2OA 1Q7GA 1F17A 4Q3NA 4B3HA 4I9NA 3WGGA 3WQSB 1QYDA 3GGGA 4ALIA 3FNGA 4DBZA 3D4OA 3PWSA 2HRZA 4XEHA 5AXAA 3DR3A 3WGTA 1H94A 4A03A 5T8KA 4N7RA 3RVDA 2WDZA 3P2OA 4J4BA 4YVFA 4CMCA 4E5PA 1O0SA 1MC4A 2P5UA 3AWDA 1GZ6A 1YQDA 3INRA 4ZQEA 3FBTA 3B1JA 4CMGA 2YFQA 1U5AA 4FB5A 4XR9A 3E18A 4CUZA 3DC2A 4TVOA 3C3XA 4O59O 3WYBA 3RROA 2GD1O 3WSWA 4E2YA 2RHCA 1I36A 4BL5A 1BDBA 2EKQA 2GERA 5TLSA 1HDYA 3SJ7A 3ZV6A 5G0SA 3FN4A 3H5AA 3QWIA 4B3IA 5L7YA 3UICA 2Q50A 4FW8A 1LLDA 5JE8A 1ADBA 1NTOA 3NX4A 1PSDA 4FGWA 3GPDG 5C37A 3IDSA 3L9WA 4WLEA 1KBZA 4BKOA 5THKA 4PRKA 4ITUA 5JO9A 5A04A 2V6BA 3AUSA 1F8GA 1LC3A 4L9RA 2JAPA 1ISHA 2ZYGA 1D3AA 1KY5A 4AJJA 1DBVO 3WJAA 4HKTA 1KYQA 4B7UA 4EJMA 1Y81A 1ZNQO 1I3KA 1U8XX 3JQFA 4BNWA 1K6JA 4YYZA 3ZNOA 3ULKA 2D59A 4J1NA 3HG7A 3ZNQA 4BNYA 3KEOA 1HSOA 5TJHA 2A9FA 3ZWCA 4PG5A 3ROMA 2GO1A 3H65A 4XZ3A 2YDXA 3OMLA 1DIAA 3E9MA 2P4HX 4DL9A 4II3A 1ORRA 4UULA 3NRCA 3LSYA 2Z95A 4B79A 3ZCXA 1BWSA 1PJ2A 3CZRA 4WLFA 5L4SA 1ZKMA 1HLDA 4XA8A 1GQQA 4GKBA 1ZK4A 2QW8A 1NVTA 1GPJA 1DAPA 1HT0A 5JS6A 5I9LA 4GI2A 3DBHA 5KKAA 4EEXA 3O03A 4UUPA 2EGHA 2JCVA 3INGA 3ZV4A 1GU7A 4CQLA 3K8ZA 3W8DA 3ROQA 4CLRB 3Q9UA 2GSDA 4Q39A 1E7SA 3UUWA 3UCEA 4I5GA 5COQA 2IEDA 2O3SA 1U3TA 3EGOA 1OBFO 4HFRA 4J2HA 5JYEA 1E92A 2VCYA 1CRWG 4YAKA 3SXPA 3PGJA 4W82A 4YDRA 3B70A 3C85A 4UVGA 3ZHZA 3RC7A 1N1EA 3QV1A 2QQ5A 1HE5A 2C0CA 4DLBA 2WTBA 4IPTA 4L8VA 4D45A 2VUTA 2X9GA 4NNJA 3GZNA 5EESA 3UXYA 3JD0A 2I9PA 3LC2O 3HDHA 4RZHA 1BXKA 4UEKA 3RAJA 4RF3A 3GNSA 4OO3A 3I52A 1EUZA 1OFGA 1ARZA 1O6ZA 3H2SA 4IZHA 5ENVA 5DN9A 4GX2A 4PLTA 1PZFA 4XDZA 3PHGA 1XR3A 3RUEA 3JQEA 4FC6A 3LYLA 4M55A 2WEKA 5L4NA 5I7FA 4FPXA 2JL1A 3ANMA 1ZW1A 4IMPA 4F3YA 4ZQGA 2VHVA 4P8RA 3DBRA 5FI3A 5I9MA 2P9EA 3GMSA 1LEHA 3C1AA 1XDWA 4W4TA 3TOXA 2IZ0A 5K0ZA 3P2YA 1T4DA 3MTGA 3DOOA 4CV3A 1LNQA 4DIOA 1A4IA 4TRNA 3NGXA 5FWNA 1PTJA 4WEOA 1L1FA 5J23A 1WW8A 3U4CA 3BTVA 4MINA 3PPIA 1LA2A 3IAHA 3GEDA 5A9SB 4D3FA 2GYYA 3OF2A 1VM6A 3DHNA 3DZGA 5CDUA 2BD0A 4XCVA 4R9RA 1I3LA 3EY4A 2JAHA 4IJVA 2CF6A 3AM4A 5JPIA 3ROKA 3F9IA 3DBVO 4CM1A 1ZMTA 3ZNNA 3WOHA 4ONEA 2PZKA 4MP3A 2W4QA 1E1NA 3GT0A 1PS0A 2IRWA 4ROSA 4I1IA 4KDFA 3K31A 5JNLA 4H15A 1NVMB 4JJGA 4TRMA 2O3RA 3FNFA 3GVHA 5DBIA 4G65A 4UVEA 4BO2A 3A06A 1QKIA 2X0NA 5A9RA 2IEBA 4WNCA 4A5OA 3PI7A 2VHZA 2OP0A 4ND3A 2P4QA 4CM9D 4QT0A 5EPOA 4L73A 4WCFC 3H3FA 3FNHA 1P1FA 2HK8A 2P9GA 3KHUA 5I7SA 4BO1A 4NK5A 3QIVA 4FJ0A 2BMAA 2EV9A 5AXDA 4R54A 1PWZA 5BNIA 1MGOA 4QSMA 3F1LA 3L9XA 4YRDA 1MUUA 4L75A 4OQZA 5HM8A 2GN8A 1PL7A 3DZKA 3F5SA 4O0LA 3AUTA 1E5LA 4RVGA 3FNEA 1GYRA 1H0KA 2X5OA 2HCTA 4IDEA 4YJFB 4ALMA 2NU9A 1NAIA 4J16A 2B4RO 2P68A 3IP1A 4CM4B 4BMVA 1CETA 5BT9A 5A06A 2YUTA 1GV0A 5DBFA 3WGQA 4DQXA 2Z1MA 3D3WB 2O7SA 1C14A 3BXXA 3WFIA 1PGQA 2AQHA 2O7QA 1ZCJA 2D4AA 1QP8A 3LT2A 2WYUA 3PLNA 4WCFB 1DIBA 2ZQYA 1M2WA 5DZSA 2I6TA 1DOHA 1PGPA 1NXQA 4XJTA 3KM0A 4CM8B 3O26A 3DXFA 1CERA 4M87A 3KYDB 1NQAO 2BF7A 5I9NA 4J49A 2V7PA 1U7TA 1YL6A 5CP8A 4CM6A 4JBHA 3EK2A 4J0EA 2DTXA 5JLAA 3M2PA 3DZIA 3DBLA 3BMQA 2X5JO 2NTJA 1TA4A 1C1DB 3AM5A 3AI2A 3ITKA 5T64A 5L53A 2QRKA 2J5RA 1K6XA 3EW7A 5LCXA 5KJEA 1YBMA 1P44A 2F00A 4H16A 4AFNA 2QRJA 3IC5A 3JCZA 1PU2A 3PEFA 4IJWA 1N9GA 3OJOA 4IGEA 1AN9A 2GN6A 2XAAA 1NQ5A 2HAEA 1E6EA 2P91A 4UVDA 4NDNE 3V2HA 1WPQA 5EERA 3WDSA 1TVEA 1Z7BA 2DFDA 1A9ZA 1JTVA 3FBGA 1HTBA 4CMIB 2VWHA 4J1QA 1UXKA 5FYDA 5TT0A 4J3FA 3GHHA 5F1KA 3W8EA 3GH3A 1R0KA 4LCEA 3TZQA 2VTEA 2A35A 2EWMA 3I9OA 2H5LA 4CUKA 3OHSX 4W6ZA 2IZZA 1GDHA 4GQAA 1ZZEA 5A3JA 3HADA 4XGIA 1PJ3A 3DEYX 2CVQA 1IL0A 1YJQA 2O3QA 4N5LA 5F1OA 1BXGA 1LQTA 3IUPA 3ZU5A 4I5DA 1NM5A 1ONOA 5T6BA 4R5HA 1EFLA 4K28A 3FTNA 5ILGA 1PEDA 3HHPA 2W2LA 2VOEA 2RBEA 4B8ZA 3UKOA 3WS7A 4N18A 4P4GA 1XKQA 1X14A 5BSEA 3CH6A 2Y93A 2X6TA 4HFNA 3S2IA 4M86A 3UW3A 2EKLA 2I76A 4E33A 1GY8A 1X7HA 4M49A 2OUIA 3OA0A 1P1IA 1FMCA 2UVDA 2DTEA 1P1RA 2FPGA 4J1SA 5LC1A 3V8BA 2P5YA 4ALLA 3KLMX 3GDOA 1M67A 3OJFA 4XYLA 5DDIP 4PLVA 3DZFA 1W6UA 3JQ8A 4R3WA 3VDQA 2DTDA 3CMMA 4A26A 4CPDA 4FOOA 2GPTA 4AJOA 4CLDA 5TNXA 3HE3A 2JCYA 4RQUA 3K30A 3ZWVA 5CG1A 3FWZA 4EEZA 3H9JA 3ZHBA 4BO5A 3LZ6A 4D79A 3P19A 4L0QA 3WGIA 4QO8A 3DWFA 5A5FA 4UAGA 3VAZA 4Q3BA 3U4DA 1V0JA 3RASA 1D8AA 2C29D 1J4AA 1X7DA 1VKOA 2VHYA 3KV3O 2Q2VA 4XD2A 4Y6PA 4BNXA 1A7AA 3LF2A 3KYCA 1E3WB 2Q1SA 3H9UA 1U4SA 1CIVA 2VT2A 4JCOA 5DCWA 2RH4A 5KVQA 4IBOA 2HMSA 4IGFA 3I4FA 1XLTA 1E7RA 1BW9B 4GGPA 1EE9A 4FC7A 2Q3EA 1NYTA 1YE3A 1EQUA 1MA0A 4Q9NA 4JJFA 2PZJA 2VN8A 4IINA 5HRUA 1GYPA 1EUDA 4R68A 1UP6A 2UUPA 1LDNA 2CDCA 3I3OA 4AJ4A 3WGYA 2VOJA 2FRDA 3R3SA 4MPDA 3WMWA 5LDHA 3GGOA 1ULUA 4DPMA 4BNFA 3LLSA 4ZRNA 5KNLA 5TT1A 1S7CA 3OQ1A 4TRJA 1T1RA 3QVTA 5L3ZA 5JAIA 1GUYA 1U1IA 5K6AC 5KTKA 1YOVA 3F3SA 4S3MA 1WMAA 1V35A 4JROA 3ZU3A 1JVSA 1BGVA 3AUAA 4LMPA 4Z9FA 4R4JA 4YJGB 3RBVA 2IXAA 4PZDA 5EJ2A 4N5NA 3VVBA 1JKFA 2B69A 2JHFA 1C1XA 4YPOA 3HZZA 4D46A 1BHSA 4HNHA 1C0IA 2C59A 3GAFA 1D7OA 4RGBA 4CLOB 2X9NA 1MX3A 1SC6A 3CMCO 4R3NA 1LDEA 4BNTA 4E12A 4JNKA 1LDGA 3K92A 4TZTA 4WE3A 2ZK7A 3TWOA 3KYBA 3HN2A 4J7UA 1A5ZA 3ETEA 3H9GA 4CM7A 4YJDA 4IDCA 1LLCA 1NVGA 2FOIA 2GCGA 3GN2A 2I5PO 3WR5A 5KVVA 4CMEC 3OJLA 1TLTA 5U1PA 3HFSA 5C7IO 1LJ8A 2VZ9A 4XIJA 1DRUA 3QQPA 2X22A 4B4UA 2W2KA 3O8QA 4IDGA 3AFNA 3W1VA 2OL4A 1VKNA 3LDHA 4IIUA 4C7JA 3EMKA 1SNYA 3RSHA 2JD2A 1T4BA 4WGGA 1ZXLA 1H93A 1XA0A 4I9UA 3AOEC 2RAFA 3PIDA 4ILKA 4YAEA 2FPIA 2WJPA 4B4WA 3ZV3A 2B0JA 1DDOA 4HFMA 3GK3A 4YRAA 4EZBA 1LDMA 3DHEA 4NZ9A 1NHGA 2X9VA 1WZIA 4HUJA 5ITWA 2PZLA 2GGSA 1R66A 4MVJF 1HDXA 1YBAA 1F12A 2I66A 3OIDA 3SC4A 1DIRA 4FJ1A 1LDYA 3C7DB 4EGFA 1DSSG 2NV6A 4Z0PA 2OBYA 1KOLA 3GZ4A 5ER9A 4YEDA 4EJ6A 3K2EA 3M2TA 3WG9A 2DT5A 2Y67A 3O9ZA 1E5QA 1HDGO 3WXBA 1W0CA 4Y6SA 2JFFA 4LVUA 4YJHB 4UUMA 2O23A 1XWFA 4CMKA 5IFLA 1B3BA 3ANNA 1BVUA 3U62A 5MDHA 1QG6A 3H5RA 4WLVA 4E5MA 1PJLA 1Z45A 4YB8A 5F1PA 2EJWA 3RUFA 3VPXA 1CF2O 3ETDA 5LDGA 1LRKA 4FQ8A 1QR6A 4CV0A 2VUUA 1V8BA 4FDAA 1I33A 3OQBA 3KRTA 1G0OA 2QZZA 3DZHA 5G0WA 4ZRMA 5H83A 1U8FO 1LLUA 5JDCA 4GAEA 4PLGA 1MG0A 1H6DA 1L7DA 1O9BA 3NYWA 5JSFA 3E1KA 3P5SA 3JD4A 5C3MA 2GLXA 1MFZA 1T2DA 3A9WA 4IJUA 4WLNA 1IE3A 3DMYA 4NIMA 4F46A 1HDZA 5BSFA 4UUNA 3EC7A 3DOJA 3FRJA 1UAYA 3W4KA 3L07A 2BELA 4QXMA 5JMWA 4XIYA 1E0DA 3PDUA 3RIHA 4GWKA 1F0YA 2PD6A 1JAYA 4GLOA 2AEMA 3DO5A 1IYZA 5A9TA 5JC8A 3GA0A 3GPIA 1B15A 4MVJD 3RFXA 1RM3A 3STHA 4TWRA 4ZHSA 1RYEA 1HYGA 1FDWA 1RPNA 5ICSA 1NBOA 1YWGO 1KEWA 1UZLA 3BYZA 5BR7A 1NWCA 3CKYA 3WBBA 5G4KB 1U4OA 1N7GA 2GASA 2BGKA 1E1LA 3MWDB 5JDCC 4N54A 3AK4A 4R41A 4XQ9A 4DMMA 4E5NA 2G1UA 3PHHA 3FR7A 5DP1A 3RI3A 4LW8A 3ZH2A 2ZTMA 4FSHA 4E30A 2J8ZA 2W90A 2Y05A 4PZCA 1X1EA 2FHSA 3IKTA 3N74A 3PGXA 4E4YA 3GFBA 2AHRA 1ZVMA 4NH4A 4RLSA 5BNTA 4GKVA 1T24A 1E3LA 3NJ8A 5DULA 1E6WA 2R00C 2C5AA 3JQAB 1JDJA 1MP0A 2OZPA 3RBZA 4ALJA 3JYQA 1HKUA 1WMBA 3UAGA 1NASA 5A3VA 4CLRA 1AXGA 1MLDA 1FDTA 3KSUA 1YB5A 1BVRA 1R16A 4JLWA 5IAAA 4E6PA 2OBNA 3U0BA 2D3TA 2G0TA 3BAZA 1XQ1A 4GX1A 3ENNA 3DL2A 1Q7BA 1YQXA 3PRJA 1TT7A 2YFHA 4PLZA 3NTOA 4M89A 1OZAA 3IP3A 1YS4A 1KEVA 2R6JA 3ST7A 4L74A 1I3MA 1P45A 1Y5MA 3QVXA 3DAFA 3OEYA 3ZW9A 2XXBA 4K6FA 4J7CA 3A4VA 4YWJA 3W6UA 3IOYA 4LVCA 5ILOA 3BMNB 5KJCA 1XSEA 4FFMA 4BKUA 4QO7A 3A28A 3D4NA 4CUJA 1UXJA 1CEQA 3FD8A 4BNUA 1I32A 1AXEA 1E1KA 3JV7A 3JQGB 3BMOB 4LK3A 4L4XA 1WDKA 4KUGA 3U09A 2IYPA 5HS4A 4P4NA 1BMDA 4RL6A 3M1AA 4XQEA 3KUXA 1QV6A 4OJNA 4TKLA 4DIBA 5BSHA 1O95A 4CV2A 3ICPA 4NR0A 1EVJA 5ITVA 2EP7A 1Z74A 5F3RA 4NJMB 3TZKA 3OA2A 3TFOA 2Y0CA 4CJXA 2JFGA 5EIOA 4BNKA 1Y9EA 1LX6A 1YXMA 4A7PA 1O8CA 5A9SA 4MOWA 1Q1NA 3MJSA 5L7TA 3EVTA 1AHIA 5A03A 4ZICA 2IDZA 1F8FA 3MJEA 1A7KA 4YT5A 8LDHA 2Q1TA 2D8AA 5CDGA 2RIRA 6LDHA 1DIGA 3IKVA 1A72A 2JD1A 1SO8A 3DQPA 1JWBB 3ASUA 2I65A 4FCCA 2DPHA 2P9CA 3DOCA 4OOFA 1YDWA 2NVBA 4W9NC 4PLFA 2WSBA 2GF2A 4E5KA 3DHYA 1HL3A 4W99A 3OH8A 4BS9A 1P74A 3TDKA 4AICA 1GUFA 2E48A 4PN3A 1P9LA 2Y99A 5IDWA 2PKQO 4NBRA 1UH5A 4MIYA 2H6EA 2VZ8A 3MCVA 1KVQA 3QW2A 3SX2A 2UDPA 1VL0A 4XRRA 4GMGA 5TC4A 2VYND 1E77A 5C5IA 2DQ4A 3G3EA 1B7GO 1PGJA 2HJRA 1WWKA 5DOVA 1EZ4A 3JQBC 1EVYA 2BI8A 5I7EA 2J3JA 4DIFA 1CWUA 5THQA 3WYCA 4J91A 4YBZA 3U9LA 1Y8RA 5F21A 1E3IA 2PV7A 3BTOA 4MVJA 5DP2A 2X1HA 3I83A 1XU7A 1ULSA 4PG6A 1UXHA 1KS9A 1VJTA 1R4MA 3K6JA 2G76A 4J1TA 3HDYA 3VH1A 3I23A 3VZSA 1Q2XA 1QV7A 3PYXA 4JX8A 4K26A 3VZQA 1LSSA 5COBA 5HTOA 1FK8A 1YONA 4E32A 3O4RA 1JKJA 3DMTC 4FGSA 4W7HA 1Z6ZA 4YJFA 2V6FA 4BV9A 1PGNA 1U2GA 2NM0A 3K5PA 3WMXA 1PR9A 3WLFA 2HUNA 1CDOA 1UXIA 4ZGWA 5L9AA 1JAXA 2XPCA 2VNAA 3NDIA 4KTVE 1SZJG 3RFTA 3D3WA 4ZJUA 3I9LA 3QP9A 1EK6A 2P2SA 3H9EO 2Y66A 4B8WA 3BHIA 2W2LD 5F5NA 4CL8A 2J6IA 2DM6A 4BNGA 2WYWA 4WCFA 5JW6A 2R2GA 3ZWYA 3PHIA 1U3UA 1NPDA 2GN4A 1IHYA 5F5LA 3BMCA 4BO7A 4CM8A 3BZUA 3H6KA 4DPKA 3V2GA 3KYDA 1L7EA 3E48A 2SCUA 4YAIA 1VI2A 5IXYA 1U2DA 2FN7A 3ICCA 4WLOA 1PQUA 2XOXA 1C1DA 3VH2A 3AU9A 1XELA 1T2AA 3RCBA 1GR0A 3L4SO 3D3EA 1B26A 1OC4A 2JKVA 4PG8A 4I9HA 1YRLA 3GRKA 2YJZA 2PTGA 1NR1A 4LSWA 1B3RA 1F06A 1GAEO 2IYOA 1NPYA 3RU7A 2ZIZA 4QTZA 1N2SA 1TI7A 2VTDA 2NVUA 1NQOA 4CV1A 5AYVA 2CVOA 4IDBA 3PK0A 4I8XA 3NV9A 3GNQA 1P1KA 4A73A 3HWRA 4YT2A 4GLLA 3FPLA 4TMFA 2ZCUA 4NMHA 1RYDA 3UGKA 4AJ1A 3ZWPA 4I5FA 3A1NA 3PYLA 2D5AA 1QLJA 2O2SA 4BNJA 3GAZA 5DT9A 3JQDA 1X1TA 1B16A 2C20A 2ZATA 3D7LA 4PLPA 4EI2A 1P77A 1IULA 4KTTE 3ZHXA 5CFZA 1H2HA 1NP3A 3ON5A 4MP6A 1GCOA 2OHXA 3KXDA 4WK6A 3WIDA 4FFNA 3RKRA 2YDYA 1GUZA 3TZ6A 1HWYA 2GR9A 2VT3A 4PG7A 1BRMA 1D1SA 4M8SA 4URFA 3TJRA 1RKXA 5IG2A 5KJ6A 3E8XA 4RF4A 5FEUA 1NWHA 2AQIA 2O3TA 3SJUA 1IHXA 4OKNA 3TPCA 1NFQA 3G1TA 4YQZA 1MXHA 3I1JA 3JQ6A 2Q2WA 3HB5X 3HJAA 1UXGA 4WPGA 1EVIA 1VJ1A 4II2A 1PR3A 3ZU2A 1N92A 2HK9A 2ZTLA 4GGOA 2NVWA 4AJLA 3L4BC 4Y98A 5ER6A 5U4QA 1QLHA 3EYWA 1ZO8A 1T2EA 4NPCA 3V1TC 4NBVA 1Y9AA 2X0RA 2VWQA 1R4NB 1DC6A 3KSDO 3OICA 4RQTA 4ZA2A 3HUDA 1T25A 2Q1WA 3AFMA 7MDHA 5EMHA 3N58A 3QJ5A 4ID9A 4NI5A 2EG9A 3F46A 4JJIA 4OL9A 2Z1NA 3RU9A 2VYNA 3TQHA 3TSCA 5T57A 1OMOA 1EDZA 2BH9A 4D41A 4GVLA 4F6CA 2WD8A 1Y5RA 5B12A 2CMDA 4J7XA 2VRCA 3JQ7B 3QRWA 1W8DA 4CM5A 4UVHA 4LRSB 4OM8A 1GQYA 4PVDA 1K6IA 2PNFA 3ZU4A 4IDDA 4LCJA 5TRTA 3GEGA 3I9MA 2BFAA 3KSZO 1WLYA 2AXQA 3RUIA 5HBRA 2PGJA 1G0NA 2EERA 1HYEA 4BO8A 5A1TA 5JCJD 1X13A 2Q2QA 4MKXA 2IODA 1CYDA 1HXHA 2AEJA 4OYRA 3LT0A 5I7VA 3CSDA 4ZVVA 3MJTA 1BTOA 3C1OA 3T4EA 2EW8A 1DFHA 2GZ1A 3EDMA 2QX7A 4AJPA 1H2BA 4KUHA 1O89A 3NJ4A 3ZW8A 2FP4A 4RVUA 4IJKA 1VL8A 1JQBA 1SCUA 5ES3A 4OKIA 1OI7A 4P4LA 1EDOA 4W7IA 5GY7A 1UZMA 3D5QA 3VPFA 1WAMA 1BW9A 2BHLA 3NAQA 2YHUA 4RORA 1C3VA 3I9KA 4D42A 2Y1OA 3U49A 4ALNA 3ZWWA 1ZK3A 1JA9A 4A27A 1NAHA 5IF3A 3PTZA 2EF1A 3PZBA 4HXYA 4U8GA 4RJTA 4DLAA 3G1UA 1VSVA 4CMJA 2PKQP 4FFPA 4J4HA 2YHIB 1RM4A 2X23A 3QLJA 4CQMB 4RF2A 4BMNA 1FXSA 1NHWA 1XCBA 4EUHA 2CVZA 2NTVA 1R0LA 1EQ2A 3OFSA 1YQGA 4Q3EA 4WLUA 2H1SA 2WE8A 1I8TA 2FSSA 3JQCA 5FF9A 2YV3A 2GZ2A 3K2BA 1E7YA 1U9JA 4YJGA 3JQAD 2UUOA 5JY6A 5KVCA 2O3JA 4Q3DA 1UUFA 3QWFA 4UEOA 3ABIA 4KWIA 2Y1FA 1WZEA 4Z0TA 2O4CA 3M6IA 4DQVA 4R51A 3LC7O 8ADHA 1BXZA 3EHEA 5G4LA 4CLOA 1LTHR 2C2XA 2QZ9A 5H82A 4E0BA 2GDZA 4QEDA 3HDQA 3DDNA 3QSGA 4AJEA 2FZEA 1DFIA 2HDHA 3DBLB 3SVTA 2AE1A 3UN1A 2YV1A 3JQ9C 4K1LA 1YKFA 4AG3A 5HS6A 4HX5A 5JY1A 4CR6A 1HSZA 4E3ZA 5K6AA 3HQ4O 1TXGA 3GRPA 2C7GA 1ZEMA 3ZWBA 2IZ1A 1NQTA 4CMBA 3GF4A 1ZBQA 4GBJA 4BB6A 4PRLA 5CG2A 1V3TA 4RVSA 1N9GB 3LF1A 3PHJA 3H4VA 2B83A 3C1TA 1FDSA 4YAJA 3RC1A 1DHTA 2OOSA 3S55A 1DO8A 1ENZA 3AJRA 2VQ3A 3VDRA 4DBVO 4MVJI 3Q1LA 1TT5B 2Q45A 2FPPA 2PH5A 4BV8A 2NLOA 3OEWA 4EW6A 2ZTUA 3I6QA 5CHEA 3DONA 1HDRA 1DC3A 2CD9A 1DJQA 2JD0A 2NU6A 3IMFA 4HY3A 4P38A 3FTPA 1KC3A 3H5NA 1ADFA 3E9NA 3HFGA 4DYVA 2HSDA 4HV4A 3DFZA 3RUCA 2WMDA 3T4XA 4INAA 4LISA 4E2WA 2VYVD 5JYDA 4OSPA 4TRRA 1VE9A 1BG6A 1GD1O 3PJDA 4QQRA 1PS8A 2NWQA 4CLEA 4L4SA 4OAQA 2AMFA 1MXFA 2ZYDA 1ZJZA 1HE2A 3ENKA 3ETGA 1O5IA 3L6EA 1ZSVA 4XYEA 4YJHA 3OJEA 1JW9B 3WYEA 4CMEA 2C82A 4ZQBA 1B14A 2X86A 4GSLA 2VUSA 4BKRA 4AL4A 3GDGA 1G1AA 3IL2A 4ND4A 5L45A 5U9CA 4MIEA 4OIMA 3ONDA 1LSUA 3L6DA 1XYGA 2D0IA 5CEFA 3TZCA 3B20A 1I24A 1HDCA 1CQIA 4BNZA 4TVBA 3RBXA 2QHXA 4PVCA 1H6BA 3AOEA 4AJIA 4JGBA 4NFYA 5I8WA 1XHLA 1XG5A 1J49A 4XJSA 3NT2A 4J9UE 3VH3A 4BIIA 3B1KA 4OSOA 2YQ5A 4J4TA 1GYQA 3EVNA 1M76A 2HO5A 4K9DA 5JCJA 1ENOA 2C5EA 2Y1GA 1Z7EA 3CTMA 1VPDA 3NGLA 3CE6A 3Q11A 3C24A 1KVTA 1YH3A 1I2CA 3MJVA 2XXJA 3NT5A 5JCXA 4WUVA 2BRUA 1EE2A 2Z5LA 4RVHA 3PQFA 2DBZA 5CDTA 2IXBA 5BNFA 3E5RA 1I0ZA 1PJSA 3H7AA 1PZHA 1QXSA 3H2ZA 3ZDFA 2LDBA 2PK3A 1V9LA 2WE7A 3WX0A 1P0FA 1HZZA 1I5RA 5MGBA 2PGLA 3UH1A 4DRYA 2RH8A 2B5VA 5IXSA 1PS9A 1MG5A 4DVJA 1UR5A 3GR6A 5ADHA 1QRRA 2AEFA 3X2EA 3NTRA 5JXWA 2QG4A 2EP5A 4KZPA 4WCDA 5GZ3A 3OIFA 4Z9XA 2PA3A 2HMTA 5JAMA 5B4UA 4QX6A 4RPHA 1ZK0A 1B8PA 5H81A 4BNVA 1HYHA 4MVJE 3NEPX 3KYCB 3S2EA 4YA6A 3EAGA 4CM3A 1X7GA 2BGLA 2I99A 3ZWXA 3JQAA 1QSGA 1RJWA 3B1FA 4CR7A 1OOEA 3I4CA 2NADA 2YV2A 2G82A 1PJ4A 2Y68A 4DUPA 2X8LA 3ORFA 1GPDG 3H9QA 3PQEA 3GMDA 1GEGA 3ZHYA 4IS2A 5JDIC 1XIVA 3GG2A 4DA9A 4AVYA 4G5HA 3TN7A 1B8UA 2XF8A 5K9ZA 3OBBA 5TIIA 1R0SA 1GTMA 1A27A 4G2NA 4TZKA 3MWEB 5IZCC 4XDYA 4RPLA 1DLIA 4O1MA 1YOVB 3ZI0A 1SB8A 4J9VA 4MVJP 3RC9A 1ML3A 1K2WA 1HDOA 1U5CA 3BMNA 1YBVA 1VC2A 2AW5A 2ZB7A 3WQRA 2R00A 1KEPA 3N7UA 3VKVA 3LVFO 5A5EA 3V2UA 3HN7A 3OQ6A 5KOIA 4BO4A 3GY0A 1SAYA 1R15A 3WGHA 5KWEA 2V6MA 4HADA 3JQGA 4U0KA 1E3SA 3BMOA 3RKUA 4NK4A 1KERA 2UV8A 3WWZA 4B7CA 3U4HA 1DEHA 1IY8A 5JC1A 2WD7B 1KY4A 4YT4A 3QVWA 4OHUA
chains in the Genus database with same CATH superfamily
1LBHA 3PUIA 4I50F 2PBRA 1NU8A 4HPWA 5DCUA 4PYJA 3SS9X 1M2FA 2JGNA 1KAEA 2B61A 3ZVLA 4F96A 1NATA 3Q87B 1CXZA 1D6NA 3P27A 2JCXA 4L85A 4C4YA 4FHFA 1VGQA 4XB2A 3B36A 1E7MA 3JXEA 4LV6A 1HG0A 4LFBB 5ED4A 4KLAA 4KQ1A 3ASVA 4MB0A 2YIVX 1ZM7A 4RM3A 4QU8A 3OU6A 1CRZA 2AMVA 4BOYA 5FTWA 1U3VA 3U3XA 2DWOA 3BUSA 3BFJA 3EPRA 4XEUA 1EEHA 4IXTA 3CNBA 2JRCA 1HETA 1RLUA 1SEPA 1LRJA 2VS1A 5BOSB 1OASA 2JJYA 2FPIB 5KC8A 3AVXA 2F3RA 4AROA 2YJ4A 3E7DA 2BH2A 2XQIA 1ZRSA 1HE3A 2BFEB 2AFHE 3T3EA 3G85A 4N5MA 4D9NA 2GI4A 3IERA 3S1AA 2IH2A 4WJZA 3BZBA 1IXKA 3HU5A 4KIGA 3WIEA 1DTWA 3N75A 5K8VA 2FQWA 1ISGA 4I2NA 3PJFA 4JN6B 4QOGA 5T5QA 1Y89A 1F7UA 1LBTA 2ASVA 2GRUA 3PCRB 5HPYB 1SC9A 2H0QA 4K86A 4D3SA 2PUGA 3A1FA 4CHGA 2E82A 4CKCA 2J0QA 3QUBA 1G9TA 1UT5A 4DHEA 5H8WA 1KY3A 1TJ3A 1T9ZA 3TLMA 4MVXA 5EQFA 2Y1EA 4FFOA 1JN0A 2OO3A 3CIFA 5F2OA 4PAOA 4RS3A 2OYRA 721PA 5TDHA 3P2MA 1NC1A 1T5HX 3FWNA 2I71A 3HGMA 4I9GA 3EUEA 5IJ0B 5T7BA 1OLSA 3T5GA 1UBFA 3NTVA 1IXSB 1UQTA 5DNAA 3EJWA 3LK7A 1S9DA 1NRJB 2AG8A 2QDKA 4RVFA 4DDVA 3UMBA 1Q0LA 4NMXB 5TX7A 1XUOA 4KNYA 3P9XA 2XI4A 4TYWA 2IYZA 4O4HB 3BT7A 3B1XA 3OQNA 1N36B 3SG0A 2I4NA 5IKEA 1H9AA 3VPSA 3INTA 2FSVC 4W6QA 4DG9A 4GPEA 4V0RA 5JZOA 4KXVA 3NH6A 1TFUA 2R5WA 4HDRB 2I9KA 1EFUA 1Q6ZA 2FA9A 1QK4A 2QM7A 1ONNA 1BO6A 1M7HA 4A4DA 4FS3A 5EP3A 1D6JA 1UMBB 4M7WA 4MP8A 4RA6B 1G17A 2DHCA 3N07A 4TL6A 1XXHA 3I1FA 3NM4A 1IU9A 5K0JA 1CTQA 1DFGA 2D0PB 2YINC 2Q28A 2GDJA 3TAXA 1V5GA 3E8SA 1AKTA 2P65A 3AU8A 1ZIYA 2BLNA 4LE0A 4N8EA 4LG1A 4CEJB 2VXBA 1EK1A 4OX9B 1NULA 1RCTE 2YNMA 1U6JA 2ORVA 2K4MA 3NB0A 4WNAA 2M98A 3UQZA 5FBZA 4E5VA 2F2TA 1PWXA 3WKDA 4KXLA 1KVSA 2OBXA 3FJOA 1QQ7A 2OCDA 4O33A 3G6WA 3LT4A 1SMKA 4IFEA 2R751 2BZSA 1TJ4A 3EWNA 2GYWA 2ZYRA 4ZIRA 1YB2A 5BV7A 1UJBA 5FFFA 1T15A 3UC9A 3VOSA 4EATA 1VMAA 3REGA 4C89A 5D3MA 3QTLA 3NNNA 3L6UA 3EW9A 1XZMA 3OJXA 2WPDA 2AFVA 4LX0A 1PZGA 3R9KA 4H7DA 4IZIA 1O9HA 3O4GA 4ND8B 1N3LA 4M1QA 4GH5A 1GGMA 2I8AA 1MJ5A 4NENA 1X7YB 4D3ZA 3WMFA 1R12A 2GUGA 1C4XA 5E9AA 5IS2A 4YACA 2XECA 1ZEJA 5BVGB 2PUTA 3D4PA 3RJ9A 5KDOA 3GLIB 2BGWA 1YGYA 1SRRA 2GB4A 2QM0A 3PUKA 3W5SA 4B6GA 3JAWB 5BN3A 3TD6A 1QIDA 3M4XA 4UVIA 2WLSA 5F52A 4AMYA 3DVSX 2EDAA 4L76A 3BH6A 3PWZA 2ASEA 1SXPA 3PUZA 3MTQA 1WCWA 3AZQA 4LPKA 4CZ2A 5JIBA 4P3OA 2DPYA 1V11A 3H3JA 3IAS6 3OE4A 4M4SA 4IQFA 5EXSA 3TNYA 4C1BA 2VRBA 1F4LA 1R6DA 1I0LA 1BKSB 1RKBA 1L7BA 1R8QA 4F5DA 2UXBB 2C5FA 4LJSA 4LPSA 4I55A 3V8NA 2ZCVA 5JECA 3D1LA 1EFPB 4R16A 1FNNA 2QRVA 4PEVA 3UJ7A 5TV2A 4NBNA 4OLBA 3GRYA 1GIAA 4FXPA 4CLHA 3BTSA 3WYAA 2IDMA 4DWVA 5J43A 1KEEB 4JI3B 5EXPA 1I2ZA 5GV7A 3YASA 5I4KA 3GVIA 4EYEA 3OTQA 2I91A 1QIJA 2J0UB 3F4LA 4BDSA 1G8MA 4KB5A 1L0BA 3LNCA 1JPJA 1RPTA 4UMDA 1FS5A 2ANCA 2YIMA 3E03A 5IH7A 1OB5A 1H4VB 3MYRA 1AJEA 1C30B 3SX4A 4F3KA 3IQHX 1XB2A 1E8DA 3R3VA 2D1SA 4PR0A 2FMTA 1BYIA 2UUCB 1WNTA 1M2OA 4JUBA 4WECA 1NW8A 4G4IA 2FN4A 4X90A 3FOWA 1AB5A 1VI6A 1QFXA 1U0HC 2JIRA 1EUCA 4WZZA 2VTBA 1DAOA 1AQ6A 2OHHA 4PHHA 2WI8A 4AMVA 2VSFA 4CL0A 4N5HX 2O5VA 3K9WA 2B30A 2QXUA 1ZOLA 1QVRA 2QYTA 4J2OA 4KV9A 5LA6F 3SJBA 1C0KA 2OFPA 1UPBA 4AZ0B 2EFDB 4WGFA 5AQ1A 4D4JA 5TPWA 4X7MA 1ID8A 5ALNA 2NT3A 1I2MA 2I67A 4X61A 4LBZA 4DMFA 1K75A 4DYDA 2XZTA 2VC2B 1YRAA 1G6KA 1VJ0A 1JQLB 3A11A 3RD5A 1E1YA 2W6PA 3WO1A 3GFOA 2TMKA 5JD4A 4OA8A 3WIUA 3Q85A 5ALXA 2VDMB 3U17A 3NHAA 1P9RA 3KJIA 5CW1A 2Y1LA 1K6EA 1Y5LA 4OBXA 3HFJA 2V0CA 1NVWQ 4DXHA 3PP8A 3HSKA 3CTPA 4B0PA 3G79A 3CUUA 4YJ2F 3TSWA 5L51A 4FFLA 1ZQ1A 3MWFA 3EUWA 1X1SA 4TS4A 5BSUA 1A9YA 9LDTA 3AHIA 3A1DA 1D2RA 2NU7A 3ICWA 3RJZA 4LJRA 1XQ9A 3DZCA 3NUGA 4NCJA 4U9IS 2OPHA 4B6JA 5SZIA 2WBLC 2NNLD 4KH0A 3GARA 5COAA 2HF8A 2AJ8A 3STXA 2E6UX 2RGNC 3IVXA 4WKGA 1KRXA 3GMTA 1N5DA 3E70C 3M81A 4MV3A 3PFWO 4FDLA 4M1YA 4QWWA 4CMIA 2PANA 3IIIA 4Z5XA 1T0HB 1C3OA 5DNUA 4F9TA 1DV2A 1R74A 1U7PA 2V4ZA 2I4MA 2X15A 3DTTA 1E9FA 2CVPA 3L4BA 4DKXA 3U44B 2KM1A 3DKIA 3VTFA 1BWPA 2VSOA 4OM7A 2B3TA 3CO5A 1P4HA 5HFJA 3KB1A 4EGSA 4OQMA 1RE0A 4DVGA 5JMTA 1FE8A 1UDAA 2OAGA 3P26A 2J31A 4RENA 2NACA 2X5KO 1DO0A 1SXGA 2ZWAA 3E5MA 4FMCF 5FOSA 5B37A 4F6RA 1YBFA 3ZD8A 3FTDA 4OHVA 5AJTA 1ZUWA 1POWA 2IPXA 1CHNA 2CW5A 2ZJAA 1T6BY 3EBLA 5J1TB 5LYJB 1UDBA 3HRIA 4JQCA 1NQXA 3AM3A 3TFQA 1I3NA 3C3PA 4I1PA 2ZWVA 1M1YA 5AXBA 1PTJC 1KKUA 2QRZA 3ENWA 4XX0A 4EVSA 3Q2KA 1R5NA 4MWBA 4OK3A 5DW0A 5WRFA 5MGNA 4RTSA 4E46A 2CVHA 1JAZA 3M6WA 4LY9A 4P5PA 1FP4A 2ZVJA 5FOVA 3EF1A 1RHQA 2RHGB 1RWQA 3PQDA 2YQ4A 4FCWA 1WVGA 2GS9A 1Y42X 4K6HA 4O2RA 4Q7JB 4QUBA 4UQLA 4D26A 4QFBA 1P5ZB 4TQ9A 1KP2A 1U1EA 2Y0DA 4V2UA 3RIEA 1DX6A 1WPRA 3FDIA 5HBGA 4OMUA 4HFJA 5HCNA 4DLNA 3DKKA 4EABA 2HMUA 3FLBA 4AW9A 1NI4B 3NOOA 3KKPA 4NOMA 4DCCA 1X8JA 4DGSA 2V9ZA 3CZMA 2PUHA 1U3WA 4IH1A 3AI1A 4I6GA 5CBPB 4H3SA 5DISB 3PIIA 5AVSA 3P20A 5E7QA 3GJ6A 3SQXA 4AYWA 1RC1A 3VHRA 3I5AA 2G0NA 1Z15A 3S27A 4P82A 2K87A 1JIQA 3DBRB 3W8FA 1AVTA 3NC0C 4E5YA 2XEDA 3I9V6 1PZNA 1SRQA 3CINA 1ZFNA 4E31A 5IEJA 4X63A 1YULA 1EGQA 2DHQA 3HV0A 3Q2OA 4DTIA 2HRCA 2JJMA 5DGHA 1I6LA 2A9RA 5D8DA 3WV5A 5GADl 1QK3A 2PKXA 2BBTA 4JXKA 3S1LA 1XTKA 3R7SA 3ZJ5A 4H77A 1GGFA 4LNAA 4OH7A 3BMCB 4UBJA 4X0EA 4EGQA 3QPWA 5K4GA 1BN6A 4JLJA 1C2TA 2OB1A 3V46A 2C8LA 3B8HA 2ZYUX 1RYBA 3ESBA 3PRKE 5KPDA 1ZC4A 2W8ZA 1YA4A 1JU3A 3I8OA 4FYJA 2HRQA 5HFAA 1ZVKA 2WIDA 4WASA 1B0AA 1TUIA 4LHYA 3NMUF 1EDBA 2JFVA 2YWGA 1D2HA 1KY2A 1CS0A 4OVKA 2QUKA 2YWFA 4KO8A 2CUKA 1MB4A 1K63A 1RXYA 2WM3A 2Q9CA 3ZZNA 1K5PA 4UXHA 3SR0A 4P35A 2NVUB 4A8JB 1EFKA 3T7KA 1GPKA 2G40A 5ALUA 4CHTA 3THWA 4UXIA 5FCDA 2XKJE 3W77A 1Q20A 1IBSA 2ZUUA 3FF4A 1JE1A 2WAXA 3QU5A 1Y4SA 2NUTB 2HD4A 4UZFA 4YI5A 1L9XA 4C0XA 4YRIA 4G0QA 3CX6A 1E3WA 3DDHA 5I4CA 1H5NA 1PNQA 2WHXA 3QH4A 3CNHA 4R83A 5L4LA 4KBGA 1G6HA 2A57A 3N6XA 5DTIA 3R1IA 5F7JA 4D9JA 4Q1BA 4FQ5A 2VPZA 4R2HA 1KNXA 1U11A 2PDAA 3CNNA 1NVFA 3CUTA 3M1LA 3CH7A 3DE0X 2OXFA 3ZGZA 2PYDA 1G2PA 1ZH2A 3SYTA 2WJYA 1XAIA 1XGKA 1TU3A 5JALA 2AQKA 2DAPA 3SLGA 3PYMA 3HR4A 1Y4DE 3A6FA 3ZWOA 4O4HF 2WB4A 2VP5A 1NC3A 4I14A 3FPEA 5BWLA 3IDQA 2P2LA 4OU5A 1NF8A 3AVYA 2PMKA 5AHKA 1UJCA 3L1UA 4GLBA 5EKXA 3SEFA 2HQRA 4BO6A 4D7AA 1OI4A 2DBRA 3GLFB 3SJAA 1KXZA 1Q44A 3GQBB 4F2WA 2GN9A 5HCIA 1U0SY 1WDLA 1ZJ4A 1WP4A 4GI1A 4KFRA 3KBOA 1NXSA 4OUDA 3PJGA 3QMWA 2HJWA 2IYTA 1KI9A 4I1YA 2C9MA 2ZIXB 2ZSEA 4KIUA 4PTZA 2Z58A 5CM2Z 5AP9A 5KCMA 4DJ5X 2HOQA 1Y4ZA 2Q21A 1XE3A 3HVKA 1J99A 1W44A 3KO8A 3NBMA 2IYYA 4MI6A 5L7WA 3FFXA 1SOWA 3E3OA 4WBSA 4DSOA 3LRPA 2VWGA 1PQYA 2FMXA 4KUEA 2V54A 1AZWA 5LQNA 3SLKA 3VSAA 4CFSA 4WVFA 4PLWA 4S05A 5IDYA 1HM5A 4P81A 3ZV7A 5J4YA 5CGZA 4J0QA 1VFNA 3N0TA 2H9YA 2BMJA 1GV1A 1ZR4A 1UJ2A 1SY7A 3QY0A 4P22A 2RFLA 4MARA 3NHSA 2BTQB 1KQ3A 3WTCA 4D0GA 4G81A 3WKAA 1XZPA 1JLLA 1QGYA 1T4CB 4XQCA 1J5EB 3CNLA 1J1ZA 3HCDA 3SZMA 3F4KA 4BMOB 3KSRA 1UWVA 4KYVA 2I8CA 2D5CA 3RVSA 1RACA 4WBNB 4KKXB 5LKAA 2JLZA 3HJHA 3LDAA 3GQVA 4JBIA 3EZLA 1J5PA 2Q0QA 2H2AA 2NSHA 3BSFA 1FP2A 2HEGA 3VPGA 4JMLA 4JY7A 3FZYA 4I4IA 3HWX1 1E5XA 1VSUA 3C3CA 3KEMA 2UAGA 2Q5OA 2R48A 1LV7A 2H8GA 3LY8A 2R44A 3RH0A 1T10A 1KDRA 1BWQA 1X19A 2RGBA 4RDIA 4KQKA 3AERA 3LPNA 4P3XA 4BJ5A 3G5TA 4R71A 3WSVA 1TW3A 2QN7A 4OQEA 3ZGXA 4REQB 1IRIA 1ZI8A 4AY4A 4IIVA 5BWBA 1V96A 3U3DA 3HUUA 1B4DA 2Q6KA 3H5TA 4UNPA 2C77A 3TOZA 2IEZA 4MKIA 3WXMA 2DSNA 4GBMA 4ZAVA 1JRLA 1QIFA 3TIIA 3GJRA 4CTKA 2QEQA 4L3OA 5CH8A 4F8YA 4UHCA 2ENUA 5CCXA 1XK6A 3IUSA 3DWIA 4Q21A 2W83A 4FDUA 5DBOA 4AJNA 1HT1E 2C9CA 2ZJ2A 3JSAA 5F3DA 2R1VA 1XRRA 2OORA 3L5KA 1ZHOA 2L0XA 4MR7A 5I5EA 3RVBA 4HN4B 1MORA 2GPYA 2CE2X 4XYBA 4K6GA 5JQWA 4XLTA 2PR2A 5JROA 2CLSA 3PFGA 4QUDA 1T0BA 2FP4B 2YJ6A 1BX0A 3AHGA 1JYFA 5KHOC 4ZU3A 3WWEA 3O90A 4FZRA 4BX8A 4QKQA 2EZ9A 2CLKB 3KZ1E 4B2PA 1V2GA 2G63A 4CMAA 1ZIDA 5BNZA 2H16A 4PCAA 3A9CA 4HWTA 5G0TA 1V3VA 1WDMA 2C96A 2X40A 4R98A 5EE1A 1H9CA 3PDCA 4IXWA 2GTPA 1DIHA 2JK0A 2XRFA 2W6JD 3UPUA 1DARA 4FE3A 1NP6A 3CRZA 1XO1A 3DTYA 2HMWA 2O5RA 3IQWA 4OI2A 5DXFA 5LU9A 4OK6A 2D1RA 2QI9F 4XYMA 4ER0A 2DR0A 2R1TB 2CJPA 3DZBA 5FOWA 1PJBA 2XE8A 3GLKA 3P4UA 1QG4A 2C07A 2NO7A 4MH0R 2W98A 2CLCX 3DMHA 3K94A 3TBHA 1ILEA 1KVRA 3EIXA 4BO0A 4AKIA 4HGZA 2O8EA 1XD8A 3ZWAA 2FWIA 3ZN2A 1DRWA 1USIA 2GAOA 3MWEA 3RQSA 2R6GA 1WF6A 3FUTA 4YI3A 2RK6A 2W0MA 4Q3AA 1DJMA 5FADA 1OA1A 3ZBTA 2PMWB 2BGMA 3IOMA 3NTQA 2EJVA 4CIXA 1R0BA 1E6UA 2JFQA 1GG9A 3AXTA 4IM7A 1R37A 2CLLB 2WFLA 5JRZA 1U98A 4C2UA 2CXNA 4BQFA 4ARCA 1CP3A 4I4TA 1M0SA 2Y1CA 4NXMB 3FOFC 1PT9A 2H4WA 2DUWA 2FETA 3CT4A 4KCGA 2CZQA 3L18A 4RTOA 4URUR 4JXXA 1N6KA 1P2FA 1V6AA 1X0VA 1DJPA 1D8TA 1XLTC 2H1FA 3A1TA 3OOJA 4G9BA 4WCVA 5AW5A 3UWMA 1PZEA 1JE0A 4BVHA 3D3NA 5F5XA 1DMRA 5B1SA 1WG8A 4UHDA 3KIPA 4EDFA 1JLKA 1OU4A 4Z3DA 3A3NA 2GPSA 3LPDA 5D5PA 2X58A 4AZWA 1NOIA 2HSZA 4I9FA 1DC8A 3AF1A 3GZTB 3ZXUB 3H2IA 3OM9A 4G97A 4MDFA 2OP1A 3C7CB 4CLXA 3TLGA 4DHWA 1KHTA 4U2KA 1DB3A 1QFMA 2WP8J 2OYCA 4CG3A 1RC0A 2O2XA 3DW3X 4INZA 1LSOA 2AOTA 5EKDA 5I4BA 3L7IA 3OSUA 4MUNA 3W79A 1JQAA 3C3WA 5IZCA 3NAMA 4PANA 2EQBA 3K73O 5EUQB 3F4BA 4WY5A 4HAVA 1OUMA 4GPIB 3BGOS 3PDJA 5ALVA 5IN5A 1SIBE 3RUAA 4BP3A 2XCRB 5B7QA 3I01A 3TR6A 4MQFA 4D44A 1OH5A 3O1IC 1UJMA 3JD2A 5KYVA 5LYJF 2V7BA 2ZI3A 4S0ZA 1EUYA 1UFQA 1G20B 1PWYE 5TGTA 2PWBA 3OUTA 4M53A 1V5FA 3UMJA 2XYGA 1BCSB 2WW8A 2VNSA 4Q37A 4KACA 1W4ZA 3I76A 5GM2A 2POQX 2WOJA 2D54A 1P9WA 4MPRA 5BYAA 1EAYA 1WBBA 4PZZA 5HZHA 1GCIA 3EXHA 5KNCD 2ZUWA 3EEYA 2PBFA 2K7ZA 3OOSA 1U7DA 3GJ3A 5FIUA 4RJ2A 2NYUA 3ZWKA 1TVMA 5AW2A 1PR1A 4JLVA 1YQEA 2WWXA 3D1VA 1N34B 2LE0A 5JQGA 2NP7A 2OK8A 1RAAA 1FP1D 3A0RB 1OU0A 2M2IA 4HWRA 4S1NA 4YCMA 2CLHB 2AG5A 3PGVA 4I66A 4Q3KA 1M9NA 4E5UA 4JZKA 3AR5A 3N0RA 4KQWA 3F5QA 3OKAA 1O9GA 1QONA 2IK8A 1JXAA 3TZHA 3TUZC 4ZCSA 3QVOA 4KYUA 4AMGA 3OCJA 2FWPA 3Q3VA 4PZPA 5EZYA 4Z53A 4HGPA 2PJRA 3AKDA 5CPFA 1T1JA 2NVOA 4PLHA 1M7GA 3S0JA 2D2FA 4UFPA 1KZGB 1Q0HA 2VHWA 4P3YA 3TCNA 1LFDB 2OXIA 5DXJA 3FDXA 4KQXA 4MV9A 5EZQA 4KDRA 1E2QA 4A10A 5CIYA 1TTHA 2A67A 2E85A 2O2GA 3QE0A 4NS4A 3B3AA 5T6MA 3PV0A 3ZE0B 2NV2B 3TW0A 4UDOA 3OCUA 3NWPA 4D9HA 4V0KA 4IS3A 3VH4A 4EYSA 4MRRA 2GZSA 2CXSA 3WP0A 4ZJYA 2XNKA 5KREA 1SPXA 2FPMA 2XVAA 4YONB 3O47A 5K3BA 3RVPA 1P1HA 1T6XA 3R6LA 3MOIA 3KT6A 4UE6A 1VFPA 3LFUA 3FR8A 2IT1A 2VDWA 3SQOA 3GJ0A 3QBDA 2BZGA 1XTRA 2B37A 1X15A 3GCWA 4ZO8A 1KVUA 3CNQS 3DZJA 4Y2UA 9LDBA 3BEDA 4O29A 4POOA 1Y9JA 4UOEA 5JTUA 1L3BA 2BKLA 3VSEA 1RQXA 3EIQA 1G98A 4H0NA 3O8QB 3INNA 3Q15C 4OHPA 4B44A 2GF9A 1Z0DA 3EXIB 3HNPA 5I9IA 2FKAA 3OU2A 4K9PA 2P6RA 5EJAA 4RMIA 2LR0A 1P81A 3KT8A 3WDKA 4XVCA 2EG5A 1LBEA 2W6JA 1G3QA 2IWHA 4DSUA 2ZDQA 2HA2A 1KO7A 1H5QA 4WQMA 1WBJB 1MNQA 3G49A 3VU8A 1SXJD 3L4JA 2ZYAA 821PA 3BSSA 4P0TA 1P17A 4RVDA 2D1QA 4ND5A 4CWAA 3H17A 1OXKB 1Q0QA 1HG1A 3QPAA 1SCBA 2ZJ5A 4MX8A 2IHBA 2EJBA 3HSYA 5EHIA 4DXAA 5G2OA 1Q7GA 1F17A 3AF3A 3UYLA 4EDHA 4I9NA 4ZVSA 1G38A 1TIKA 5CDFA 1KJNA 1HA3A 4ITVA 1VE7A 5IWCA 3LI2A 3TBFA 4KXWA 4NSNA 3LL7A 2IS1A 4IF6A 3AHFA 4JVOA 1H94A 1ODTC 1G5RA 5T8KA 4CNQA 5AUQA 2WDZA 4Z1MA 5LB4A 3HK2A 5B58C 1Q1GA 1Z5GA 3P2OA 5EMKA 2XYVA 4M1WA 3OG9A 3G8DA 3SZ3A 3WMEA 4RK4A 3FNRA 2QMZA 3INRA 2JG3A 2C2HA 1UPXA 2NZWA 4LJ6A 5HIJA 4WK0B 1YSCA 4KQCA 2QPTA 3C3AA 2VPWA 4UCXA 2LGJA 3B5JA 5E6RA 2YFQA 3UXHA 3N2IA 4IICA 4DNXA 1Y6FA 4FB5A 4LNUB 3WP1B 2ZDHA 3ZJYA 3GYBA 2ADMA 2Q07A 4GYKA 3WYBA 2H29A 1G3RA 3RROA 1C7IA 2VPXA 4P1ZA 4N49A 3T1NA 4MGEA 3MF4A 4V38A 1JJ7A 4AS2A 1A2BA 3UT5B 5TLSA 1XPRA 3EQ7A 1L4KA 5G0SA 3EASA 2AH5A 3H5AA 5JRDS 3U19A 2M1XA 5BPHA 1JI0A 6YASA 1JMVA 3R5KA 4FW8A 4AM8A 2HFKA 1V7ZA 2QPLA 3NX4A 3P97A 5FD8A 4B2YA 5C37A 2HNAA 3B48A 3AR8A 2G80A 3O94A 5DI9A 4G26A 1KBZA 2GHIA 4YPFA 3FETA 2AT1A 1Z5OA 1WM1A 2Z3VA 4PRKA 3TSYA 1WY7A 1XNQB 3CO0S 1F8GA 3D4LA 4TN5A 4Z51A 5JPCA 2ZYGA 3EZGA 5BXQC 2QR2A 3D43A 4GXTA 1T6YA 2A1UA 4ZVQA 1GZ7A 2QM8A 1SZDA 3LPMA 5KAPA 4GXNA 4GWLA 3RVJA 1U8XX 3BB4A 3JQFA 2B7LA 3H9CA 4F91B 5C53B 1WCYA 4YYZA 3WGUA 1JSLA 1X8XA 2XWPA 3QPBA 5B2ZA 1UEXC 1BE8A 2D59A 3VBEA 4EW1A 2G88A 4DABA 4AS1A 3M4ZA 3FOCA 2IELA 3KDPA 2GZRA 2OMKA 1KJZA 2BC9A 1PYDA 1U2TA 4DEVA 4R2IA 1GL6A 2BYTA 3R3ZA 3ROMA 4RNDB 1JG4A 1FMJA 4RK1A 2FWAA 4WACA 1BA2A 1H8EA 1X7WB 4QGGA 4V1CB 2P4HX 3V97A 4YUWA 1WU8A 1QRUA 3NRCA 4C7OB 3LSYA 3TM4A 5C51B 2Z95A 3EGXA 2H85A 3QVGA 4AT1A 3K15A 3GP8A 1HLDA 4XA8A 3PVSA 3AFGA 4TXNA 5M29A 4FT4A 1G9SA 5FPTA 4I81A 2CHQA 2CV0A 3EAQA 2WNSA 3FYUC 3OM1A 1UEJA 4XUDA 5I9LA 5JS6A 3DBHA 4H7FA 4QJIA 5ERXA 3X1XA 3HB9A 4LRYA 4Q48A 5JJIA 4KWEA 2JAUA 1M3SA 4HX2A 3TQFA 1RBYA 3ZQKA 3K8ZA 3ND7A 1E2UA 2WQZA 3PQ4A 3S1AB 1PFQA 5D86A 1SU7A 3EPJA 2REOA 2FKNA 3ORSA 1XDZA 7REQA 3V4PB 3ZH9B 1AD2A 2A9KA 2PH1A 1E7SA 4LE1A 1IZYA 3QI7A 2ZIEA 3V8PA 5AVTA 3WA7A 1ESNA 5K2MA 3K0CA 4EAAA 1JR3D 4I5GA 1IEVA 4ESEA 3C8DA 5COQA 2GKGA 5HSGA 4Z7JA 2C9DA 1RHKA 2F1RA 3N2YA 4J2HA 5JYEA 4FI3C 4NBLA 3M6LA 2XHZA 5ERGB 4YAKA 1CRWG 1RXEA 1B43A 2DWCA 2QORA 4LSZA 1E6LA 1X9HA 2QTZA 3ZE2B 3B70A 4P34A 1XEWX 4KXNA 4JC4A 4JYBA 2F3TA 3ZHZA 4NV0A 3W5VA 4R9UC 1YKSA 3VYWA 2W43A 1IUNA 3QV1A 4IFBA 2H57A 5HKOA 1VIAA 1ZWKA 4IPTA 5I7RA 1JFSA 3T06B 4D45A 4OHYA 2VUTA 2X9GA 3GZNA 2BMFA 3QOWA 3JD0A 4QXOA 3TK1A 3X3HA 1CYEA 2ZJFA 3L92A 3LC2O 1RPJA 2E4ZA 1BXKA 1EXWA 5F9HA 3K8QA 5KWSA 4FFWA 5BSMA 2J09A 3B1WA 3U9TA 1MRSA 3GJTA 1NG1A 1VHTA 4ACAA 2YMLA 4LXHA 5ENVA 1O6ZA 1GNVA 2Q8PA 5GVSA 1JHDA 1GKYA 1PZFA 1EWYA 3NCHA 3V4OA 3HTXA 1EJBA 4D4LA 3AEQA 4FC6A 2V1UA 2VEDA 1SXJA 1ZNZA 4OA5A 3CXUA 3CBQA 4FPXA 1RPZA 2JL1A 4ADSG 3GCZA 5FI3A 5DYTA 1XXHB 5I9MA 1LF0A 1JHVA 2P9EA 3V6LA 4OBWA 1TIPA 1XDWA 1XTPA 3BK7A 1WSBA 2IZ0A 3PTLA 5D3ZA 3P2YA 3IBTA 1FJ2A 1L4FA 5IG2A 3QU9A 1P62B 1SGWA 3L0IB 1P91A 4MR8B 4CE6A 1LNQA 4XFKA 3DQZA 5AOBA 2I1QA 3EBOA 3WQBA 2MDTA 2OAP1 2X2FA 1YE5A 1ZIOA 3R0XA 1RU3A 5C1OA 3BTVA 4MINA 4AF6A 1F0PA 3UXEA 4XD7A 2REQB 1N5IA 2QZSA 4ZEMA 1L7PA 2AFIA 4MVJF 4O4JA 4P5DA 4UU7A 3F3KA 1FRVA 2I7XA 4K88A 4YRCA 3QMPA 521PA 5A9SB 3L7DA 4ZIRB 4YRPA 2JH3A 1OI3A 2OCPA 4UAVA 1I3LA 3EY4A 4HH0A 1SG0A 2OLJA 4IJVA 2HQOA 4CIYA 2OZKA 3F9IA 5FLEX 1QHXA 3AR2A 2HJGA 1BVYF 5KNDD 1ZMTA 4KFCA 3ZNNA 2HCFA 4Q3OA 3W9YA 4B6QA 3OOWA 5EXTA 3GELA 1MT3A 2PZKA 3K0AB 1R0WA 5EEHA 2HW8A 4O4LB 5A4JA 3TB4A 1YAJA 3GT0A 3PFCA 1JBKA 2F3SA 5GTDA 1LW7A 1U81A 4M6WA 4FUQA 1U2GC 4GO1A 5JNLA 3U4QA 4H15A 3Q8WA 5CCBA 1KYZA 2O3RA 3GVHA 4H1HA 5DBIA 3WDLA 2J3MA 5CD9A 3ZTTA 3FY4A 5U4XA 3T1HB 4LJKA 3MA0A 5A9RA 3GBPA 4RBNA 5BWMA 3PI7A 2VHZA 2OP0A 1SCDA 6PFKA 4CM9D 6ABPA 3HPRA 4QT0A 5AVYA 1ZAYA 4DR7B 2QTAA 1CQXA 3LUFA 1YUNA 4WCFC 3H3FA 4XPIA 4ZOCA 2O7NA 3HBFA 1SKBA 4LC0A 4B87A 2XY4A 2HK8A 3ZLBA 3O93A 3ZBPA 5DM2A 4NK5A 3NXKA 3AEKA 3CCFA 4C76A 3HKEA 3MRTA 5B57C 2ZUDA 2QRVB 1G60A 1B23P 1ZQ9A 4R54A 3NHUA 1NKSA 2ST1A 3U16A 1L6RA 3VVMA 2GN2A 1WMFA 3O2SB 2GN8A 1XMIA 4I0WB 5AHOA 2J0EA 3DZKA 1V25A 1YK0A 1E5LA 1JKJB 4N8DA 4MUBA 3E3LA 1S8AA 4DWOA 3QXCA 4IDEA 1CS4C 2Q5LA 4UZEA 1C9EA 4YJFB 5DX0A 1NAIA 4J16A 5AT1A 4GMHA 1QIIA 4PZYA 1M5TA 2P68A 2EGUA 3CPJB 2GXUA 1I80A 4JFRA 1AQUA 4URYR 3ZCUA 2JGIA 4YRTA 2O59A 3FMFA 4YYEA 4YS6A 3IGFA 1ZD5A 5BT9A 1M2OB 1G2OA 3REFA 2MSWA 3WGQA 3IMGA 2Z1MA 4P0QB 1KYIA 4JVLA 4L22A 2OZEA 2VKTA 4IVRA 5CYFA 4EAQA 2HWKA 1C14A 3BXXA 1FVXA 2IIPA 1J07A 2XB6A 4LTDA 5J3JA 2QIPA 4NAUA 4OGFA 3UBMA 2D4AA 3LT2A 1CRLA 2IOHA 2WYUA 3PLNA 3ZXXA 2GXAA 4W8GA 4OV6B 2ZQYA 4Q15A 5DZSA 3CNEA 2I6TA 2R96A 5K8TA 5B64A 3KM0A 2ORED 3DXFA 3HR8A 4O5AA 5FTKA 1CUZA 3KYDB 1NP7A 2BF7A 3FZNA 4HB2A 1FTWA 5D87A 2V7PA 3VKWA 1U7TA 4CM6A 5FWXB 3D6JA 3OZGA 3DEFA 3EK2A 3WAJA 4N9QA 2O5CA 4W5NA 4LQDA 3VO2A 4TTSA 1N6RA 4V24A 5BNWA 4UD2A 4QZVA 2NTJA 3AI2A 1M34A 2FEXA 3MJFA 5MN4A 3KWJA 2QRKA 2J5RA 1K6XA 3GFRA 5IJWA 1E69A 2FZ4A 3R9IA 3IBSA 1C7JA 4K9MA 1P44A 4H16A 1ORWA 3AR6A 3ROFA 2QRJA 2B5OA 1BX3A 4IJWA 1MJHA 1T4GA 2JBAB 2ZQ5A 3FNIA 4A9AA 5HR5A 1NQ5A 4UVDA 4NDNE 1Z2CA 2JFWA 3ES9A 1G5PA 2X6RA 4I5IA 3EZ9A 1TVEA 1Z7BA 1SC1A 1YJXA 3ESYA 1Z18A 2DFDA 4LTMA 2YWJA 3DFFA 1HTBA 4CMIB 3U7FB 1IY2A 1OBOA 2FX2A 2IF2A 2XX3A 1NW6A 1CZNA 1RYZA 5TT0A 3WISA 1BD3A 3H2HA 4LCEA 3L5OA 1CNMA 1J42A 4EFKA 2EZTA 3RANA 3TZQA 1TTQB 5K0EA 2EJUA 1OI2A 3H19A 4EL0A 2IZZA 1QE5A 1ZN2A 1WEHA 4RELA 2LP4Y 3UY4A 4F06A 2P9BA 1EKXA 3TXYA 4YRJA 3HEMA 3L7KA 2DUMA 3FXAA 3O9VA 4DIEA 5T6BA 3B2QA 1EFLA 4HBZA 5CVDA 4N41A 2WFZA 2MOKA 4MUGA 3HHPA 5JSKA 3RR2A 2W2LA 3SF0A 1E2IA 2RBEA 1G5HA 1SVWA 2C58A 1UMDB 4P4GA 5F98A 1ZRNA 3PC6A 3MT0A 4KVFA 4M9QA 2PZFA 5E2AA 2DCUA 4RTRA 1TVKB 1X14A 3PPXA 3CH6A 4U2FA 4B32A 2IY9A 3L4EA 4BAUA 3S2IA 4BNDA 3CQ9A 2WAMA 2I76A 3VYSB 5TMPA 5FFMA 3S28A 4JWTA 1FBNA 1N2HA 1T43A 3CKKA 1P1IA 3OP1A 1Z4OA 4W5RA 1FMCA 2UVDA 2BEUA 4EF5A 4XIFA 4KVZA 5FOQA 3B89A 1T0PA 3OTIA 2FK8A 2QROA 2HRDA 1RLOA 1U2ZA 2R7MA 5E7IA 3TEMA 3THYB 2O8FA 4BJ1A 1M8JA 1PLLA 2Q27A 2ZBRA 3PFNA 2C8KA 2CHUA 2HDOA 4G0XA 4LXQA 3RT1A 1M67A 1RYYA 3BGSA 4NYMQ 3CZ5A 1A5BB 5IM5A 2BGGA 1DRJA 1YA6A 4GDMA 2JI8A 3DZFA 4RE5A 1IG3A 1W6UA 2PO7A 5K0BA 4DZZA 2H4FA 6AT1A 2QA5A 3FHJA 3CMMA 3ZW7A 4ZT5A 4CPDA 4EFDA 5BV0A 1M8PA 3IV7A 4LQLA 3GLGB 2GPTA 1T0JB 2YUIA 1BNCA 1XTUA 4B17A 5J2TB 3CF6R 5HNKA 1LCIA 4TLLB 4QHSA 3KHKA 3BQMB 2JCYA 3EA5A 5CG1A 1D7AA 3DXXA 3LH5A 3MOSA 3C8HA 3P45A 4HZUB 5DWVA 2AN3A 3KKQA 4MMZB 5T3YA 4EEZA 2E6KA 5DI3B 4YV0A 2BZ0A 2IOQA 2PS3A 3H9JA 3HU3A 4U9HS 1TK2A 1XMXA 3LO5A 3LZ6A 3P19A 4IKPA 5E4FA 2JARA 3EZFA 1ZOIA 5A2GA 3MBOA 2XNDD 2FZKA 4FLEA 4L7QA 4O4IB 5IJ9A 1W4LA 5JNUA 3EIEA 1KARA 4QNMA 4HGOA 2XKAA 1UMCA 1KZYC 1WCV1 1SUDA 2PRZA 2R6DA 1P18A 2VHYA 3KV3O 2AYZA 1AGRA 2GPAA 3BWEA 2C3UA 1SULA 5HKBA 5MN5A 4BNXA 1A7AA 4AIIA 3LF2A 3LY7A 2J3EA 5C5DA 1TRHA 1E3WB 5KYNA 2Q1SA 3SNKA 1U4SA 4DQKA 4J0KA 1USVA 1HC7A 1O96B 4LZOA 2VT2A 1EFCA 4UTPA 3FWKA 2RH4A 2FGJA 5A0TA 3ZKWB 3UUGA 4AU1A 1HLGA 5J4LA 4Q82A 4RKEA 4KO3S 1FYXA 5E1MA 4NTZA 4EHDA 1N6NA 5AW3A 2VAPA 1EE9A 1QYRA 4FC7A 4GGPA 1H4QA 2AR9A 5HRCA 1CNEA 1ZWLA 1EQUA 3KTOA 4LJAA 4N3CA 1KYXA 2VN8A 5BO5A 3C97A 4HMOA 5B55A 2W9XA 3ISTA 4KBFA 3PA8A 4TS3A 1Z6QA 1A1VA 2CDCA 3GFPA 1EVKA 4RLQA 5GJVC 4EYOA 3PD0A 1CT9A 3QPUA 3R3SA 2LBPA 1XJCA 1SQ0A 4LHVA 4PU0A 4TXMA 3LLSA 1OV6A 4BNFA 5KNLA 4B6PA 3RRYA 2OV6A 4S2UA 5K6AC 1GUYA 2PFKA 3IQZA 5K3SA 3VU9B 4HB0A 4TOIA 3NCTA 2JA1A 5T41A 3SN6A 4OUDB 3OC6A 3R5FA 1UANA 2PX5A 3WBJA 1I14A 4AURA 4DR5B 1N2CA 4QOHA 5EY5B 3EEFA 3OZSA 1GUAA 3RRBA 2BDTA 3W6OA 4YJGB 2BGTA 3RBVA 5EJ2A 5AVVA 2QM3A 5PNTA 3VR3D 1IVSA 1K7CA 1AK9A 2JHFA 1U1DA 4YPOA 1RQGA 3KG2A 3VR6D 4D46A 5JBQA 4G5OA 1BHSA 2DPXA 2ZM5A 2ZSBA 4PHCA 4CIWA 3D59A 3D0QA 1I7DA 4ER5A 3GAFA 1D7OA 5GVRA 4CLOB 1SC6A 3CMCO 3ABRB 3OTWA 2VRNA 5INTA 1SC4A 1XYVA 5ANRB 1FL9A 3O5AA 2F4VB 1WB9A 2JFNA 3M6UA 3AVVA 5F9FA 1FMFA 1YR2A 3H9GA 4FUTA 4CM7A 1JEYA 2CE7A 2CVFA 2O5EA 5IVPA 1GITA 1U2EA 4YJDA 5KUTA 2P2GA 5ESXA 1FNMA 3U3OA 4O4LF 5K4HA 4Q4HA 2I5PO 5SYAA 3WR5A 2CUTA 1Y3CE 4L5JA 4IX1A 2AC7A 4PZ0A 4YRSA 2AS0A 2GJSA 4EHBA 2F7SA 2X22A 1QNFA 3QQPA 2HDNB 2VATA 4ZVUA 3I8SA 3A6HA 3CF2A 3DDUA 4IDGA 4OBEA 3AFNA 4QBIA 5ARDA 2OL4A 3CLTC 3W1VA 4DEXA 4FHZA 4IIUA 4RIEA 4C7JA 5HUHA 5FQOA 3VAAA 1SNYA 1RRKA 1T4BA 1BQEA 1PKEA 1I3CA 1ZXLA 3PQ5A 4WFIA 4YAEA 3M4YA 4JI8B 2AC2A 1NU6A 1X92A 2W2VA 3ZV3A 4ZZ0A 2K6GA 3LUAA 4IJQA 1GZSA 3OLXA 4MYTA 1LPSA 3U3MA 2PZLA 4MW7A 1H2XA 4NXNB 2IP2A 1NXOA 3IDZA 1D4ZA 5AJZA 3SC4A 4US2R 2E21A 2EX1A 3JRXA 2BUBA 5HIMA 1VE6A 3F5MA 4EX6A 1JDZA 2OBYA 5ER9A 3CSUA 2AF3C 3COVA 5IW8A 2ZE8A 3CVXA