1SEVA

Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
GFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVVRGFLGQQQLEAALTGMDLIIVPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPRAIVNLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEEVYSLGPLNEYERIGLEKAKKELAGSIEKGVSFIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate dehydrogenase, glyoxysomal precursor
publication title Organelle and translocatable forms of glyoxysomal malate dehydrogenase. The effect of the N-terminal presequence
pubmed doi rcsb
source organism Citrullus lanatus
molecule tags Oxidoreductase
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2004-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sevA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1sevA02
4CLOB 3W6UA 3F46A 4E2YA 5FWNA 4KTVE 5KCZA 3WNVA 3EZYA 3QP9A 1RM5A 2HMUA 5IJZA 4R01A 3STHA 3HDQA 3ZDFA 1M66A 2X4GA 2PFGA 3GEGA 5LDGA 1E1NA 1WWKA 1GFSA 1RM3A 3QW2A 1U5CA 1Z74A 5K0ZA 2ZQZA 4HADA 3NDRA 5JDIA 2B36A 3RQSA 2Y1DA 4DPLA 5JC8A 3IKTA 5B4VA 1R0KA 3G3EA 1U2GA 4B4VA 3O26A 4GX1A 2BF7A 2YQ5A 3JYNA 4K1LA 2JD1A 1KVQA 3UICA 3OJLA 2FP4A 1BDMA 1NASA 1MC5A 2PR2A 3I9OA 5G0VA 3DC2A 4MO2A 5H81A 1PU2A 2I5PO 2DUUA 4XR9A 4BNXA 1C1XB 1RJWA 1R12A 1GCUA 4W99A 2FZWA 1NX6A 2BD0A 5H82A 1EBFA 4WEOA 1NHGA 2XXJA 1VJ0A 1GEGA 3SEFA 4HX5A 3A9WA 4BNVA 3H2SA 1HDGO 4M87A 1P9LA 4P4LA 1I5RA 3WGGA 1Q1NA 3U62A 1FDWA 1O95A 3RVDA 1UZMA 2VWHA 2Z1NA 2JCVA 2P5UA 2VHVA 2ZJ0A 4PLZA 1GUZA 4WECA 2B69A 5ER9A 3BIOA 4AFNA 2NV6A 1E5QA 3NX4A 4YAIA 1MFPA 4I08A 3WTBA 1WXDA 1XWFA 1N8KA 4BO2A 5BSHA 3LT4A 3P7MA 2BRUA 1HYGA 2VYND 3GZNA 3ETDA 1LBEA 1K6IA 1Y81A 1BSVA 2YFQA 3ITDA 3PQDA 1LDNA 3RIHA 1P1FA 2GZ1A 2O50A 4CLRB 5DCWA 5AQ1A 1NQAO 3FF4A 3ZV3A 3U5TA 4L75A 4NMHA 1H94A 3LC7O 4ND1A 4JJIA 4RL6A 4CUJA 4YAGA 2GGSA 2FRDA 2X9GA 2VUTA 3KO8A 1N2SA 3FWNA 2VRCD 4R54A 5JCJA 5IDXA 4R3NA 3BA1A 4AJJA 4E2XA 4FGWA 4JP2A 1DIGA 3E82A 4YA6A 2JFGA 4IJVA 1ENYA 4W7IA 4QEDA 3ZHYA 1SNYA 2EP5A 4E21A 5JS6A 4AICA 2E4AA 3GAZA 5ILOA 2DFVA 2ZCVA 2P9GA 4JXKA 3WNQA 5EMHA 1IULA 3FI9A 2ZYGA 1I36A 3FNGA 2E48A 1UDBA 1ULSA 2VRBA 3H5AA 4WJZA 4WUVA 5AYVA 1PGJA 4D3SA 3DBLA 3GC6A 4PG8A 4YEDA 5JPIA 3E8XA 3OF2A 4K6CA 1WDMA 2VTEA 4RDHA 5KTKA 3BZUA 3NDJA 3QHAA 4EZBA 4E3ZA 2Q1SA 3H9JA 1HE3A 5ADHA 1DOHA 2G5CA 4NK5A 1YGYA 4XA8A 1NVTA 4KWIA 3ETEA 1EUDA 5H83A 3JQ8B 4HUJA 3WGOA 1KS9A 5FI3A 4CL3A 1MGOA 4RVDA 1DBVO 4X54A 3WYEA 3DBHA 4J1NA 1E3WB 4YJHB 1F12A 1R37A 1K89A 4FC6A 4D43A 1OOEA 4D44A 4HKTA 1MG5A 1GZ3A 3PGJA 4FFNA 3OSUA 2E6UX 2GRAA 5ILGA 1YDWA 2EP7A 1Q7BA 4R51A 3T4EA 3ZCXA 5JFOA 3OQBA 1M6WA 3HN2A 4BNFA 2HJSA 3QY9A 2EXXA 4GGOA 5JBIA 3A1NA 3AFNA 2NACA 3ASUA 5KJEA 1JQBA 1VRWA 3GGPA 3LC1O 4B3HA 1DRUA 3WJ7A 3JYLA 4HFRA 3E03A 1HT0A 3KYDA 4HWKA 2NVUA 4XJSA 3PIIA 3I52A 1Y5MA 2EW8A 3SX2A 2Y93A 2Q3EA 1BWSA 2AE1A 3AUUA 1WP4A 3JQGA 2VNSA 4J2OA 1FDUA 5F1KA 3QV1A 4E5PA 1GQQA 3VVBA 1V3TA 3C1OA 4CLOA 2ZB7A 4ND2A 4I5DA 4GLLA 4BKQA 3WS7A 3OECA 3HQ4O 4P38A 4OHUA 2EERA 1W73A 3ENKA 5T67A 3GMSA 3ON5A 1WW8A 4JN6B 4ZN6A 3DONA 5IN5A 1PJLA 3WQRA 2XF8A 1C0IA 4MPDA 4MVJD 3VKUA 1UAGA 5HS6A 3PJFA 3WTCA 3PXXA 1V9LA 3GPIA 3MOGA 5BSFA 2QG4A 3S2EA 1CF2O 2RHRA 4CMBA 3CIFA 4L76A 4R3WA 4OYRA 4EGFA 2EWMA 1OBFO 2JJYA 2Q45A 3Q6IA 3I1JA 4N5MA 5L7WA 1B0AA 2C82A 4EJ6A 1I3MA 1O89A 1P45A 4E0BA 1LEHA 4QFCA 3L9WA 2DT5A 2OBYA 1GQ2A 4JBIA 4Y67A 2CSUA 2Z1MA 1T24A 3GY0A 4XRRA 1HDZA 4CLXA 2O3UA 4RPHA 2I65A 4IGEA 3DFUA 3AJRA 2J6IA 1XG5A 3ITKA 4PLGA 3E6AA 2CMDA 3HSKA 4GI2A 4OKIA 3RJ9A 2FR8A 5IF3A 5K6AC 1PJ3A 3KSUA 2GCGA 4TRJA 2GDZA 4BO7A 4BGIA 1DHTA 1B8PA 1DLIA 3FBTA 2OUIA 3ANLA 3INTA 5L4LA 1QSGA 4N18A 3WGQA 5GZ3A 3GDOA 4ZICA 1YQXA 1KC1A 3DOOA 1DB3A 3TZ6A 4XYEA 4J0FA 2YQ4A 3PYXA 5TF4A 1HDXA 2DTEA 4KTTE 4OMUA 1I01A 1LLUA 1N7GA 2I66A 5DDIP 1T26A 1T25A 2AMFA 1UXGA 3KHUA 4D3DA 1E7WA 3VH2A 3JQDA 4K9DA 3NGXA 3PHGA 4Z9FA 2EHDA 1WDLA 4MVJE 3CEAA 2J3HA 2I99A 4MIOA 3TZQA 2HLPA 4CMCA 1E0DA 4BNZA 4CLRA 1YQDA 3PQFA 1DC3A 3NEPX 3ROKA 3OJ0A 4GWGA 4NDNE 1VLLA 2HKIA 4PLPA 1O5IA 3GHHA 4J0EA 4Y8VA 1VM6A 3UF0A 2VWPA 3JQBC 3TSCA 1YBAA 5BT9A 3AFMA 3U4HA 3TFQA 2X9VA 5HRUA 1DJQA 4U7WA 4CM9A 5I7FA 3KLPX 4XYLA 4R9SA 1EVIA 4FOSA 5F3RA 1D1TA 3UCEA 1ISMA 1GZ4A 4ZGWA 1OZAA 2DPHA 1Q0QA 1NQOA 5L4NA 1QKIA 5B4UA 1XELA 2B5VA 3JQ9C 2Y1GA 1V3UA 3RFVA 5CG2A 3H3FA 4CQMD 2DVMA 3CKYA 5L7YA 1V3VA 5A3VA 2AE2A 4BIIA 1JWAB 3WGTA 1YL5A 5U4QA 5DBIA 1N9GA 5HS4A 3LT0A 3U09A 4KQXA 1E3LA 2AA3A 1ISIA 2IXAA 3WLFA 1XCBA 4YTEA 1P33A 1YONA 5CDYA 1HWYA 1E3WA 4CM1A 3ONDA 4YJHA 4CLEA 5HWSA 1PS9A 1LSOA 1Z45A 4CR7A 1PL8A 3WYCA 4Y98A 4DMMA 4E5NA 4PZCA 4DUPA 1EVZA 4FD3A 2X23A 2O3JA 4DC1A 5A9SB 3TZHA 2WD7B 4BO5A 4W9NA 1GYPA 1YQGA 4J7UA 2UUOA 3BHIA 4F46A 5KKCA 3RUEA 5CPFA 3G79A 4ALLA 4HFJA 3ZGYA 2W2KB 2X0NA 1LRJA 3OM9A 4IDCA 3ZWVA 1UP6A 1HL3A 3M2TA 4MINA 4HV4A 4YWJA 1CERA 3P2OA 3DO5A 2AQKA 3RASA 3K9QO 3ONFA 2Y0EA 1PJQA 1QLJA 4QUKA 3F3SA 1SMKA 4CV2A 8ADHA 3HUDA 3OQ1A 4OIMA 1U5AA 1B15A 1KIFA 4WNCA 4J91A 3RU7A 4R5MA 3E48A 3LLSA 3QE3A 3RC2A 1GAEO 1BG6A 3PHLA 1YE3A 3MEQA 2Q2VA 4CMEA 3WB9A 4D79A 1NAHA 4G81A 1QV7A 3WMXA 1HE4A 3CTMA 5JO0A 1UP7A 3PHHA 4P8RA 2ZTLA 4GVXA 1VC2A 3OH8A 3I9LA 3M1LA 4BHTA 4QQRA 2HMSA 3QVTA 3LU1A 4FN4A 1K3TA 3JQ7A 5CDSA 1SEPA 4AJLA 3GAFA 5L53A 1NBOA 5JCXA 2AQ8A 2BI8A 3U9LA 1D4FA 3KETA 4P4GA 5DZSA 2W90A 3I4FA 1JU9A 4Z3KA 4KZPA 1QV6A 2HQ1A 1G0OA 1PZHA 3I9KA 3N7UA 1CETA 3VZRA 2GN8A 2V6FA 4M54A 2YFHA 3ZNQA 5JDIC 1Z75A 4IXTA 4INAA 1LUAA 4FW8A 4A10A 2OXIA 3ROMA 2JD0A 1WMBA 1MC4A 5AXDA 2IRWA 3BHMA 3BMQA 3DXFA 5A04A 5G0SA 4YYZA 4BV8A 1ZJZA 3D5TA 2ET6A 2E49A 4XR4A 2IZ0A 1R4MA 1ZO8A 4EITA 2XXBA 4OJNA 1YBVA 2DLDA 3D4OA 1DDOA 1RWBA 4BNIA 2NTNA 2HCTA 3ZHZA 1GV0A 5KVQA 1KYQA 4YJGB 1MXHA 2PGDA 2EV9A 3QLJA 3DOJA 4M1QA 2VYNA 3GVXA 3KOUA 3MJ4A 3ZI0A 3IMFA 2UDPA 2I6TA 1T2AA 2IE0A 1M67A 4ND4A 2NNLD 4O0LA 2B4RO 4IUYA 1GYQA 4BO6A 1DRWA 1GCOA 1TXGA 1B3RA 4YT2A 3W8EA 1E3SA 3WSWA 4BNYA 2OOSA 1X7GA 1JAYA 1YH3A 2VUSA 2B5WA 2VRCA 1ZEJA 4J3FA 4W6ZA 2QIOA 1U8FO 3WIEA 3H6KA 1Y8QA 3DTYA 3RUDA 1H9AA 3PDJA 4OQYA 3DMTC 1O8CA 1E7MA 1QRRA 5COAA 5DCYA 5HBRA 3MJTA 4WPGA 5BSGA 1M75A 4BNMA 1DC4A 2VHWA 4BNHA 3UCXA 4RJTA 1I32A 3RC7A 1RM0A 5CDTA 3ZW9A 3U3XA 4R1SA 1X13A 4GAEA 3HZZA 2WYUA 3PZBA 1XKQA 2H6EA 3GZ4A 4CQMB 4J90A 5KWEA 3C24A 2C5EA 1MXFA 4JQCA 1G6KA 3HN7A 5AXCA 1IPEA 4WK6A 3TOXA 4RZHA 1ZJYA 1ONOA 1SAYA 3D4PA 4XRGA 4IS3A 3K92A 2QYTA 3BMNB 2R6JA 5IN4A 2F1KA 5A05A 4UUOA 3WGIA 5COQA 2WM3A 1P44A 3OQ6A 1Y9EA 1RPNA 5TT1A 3RKRA 4EYEA 7MDHA 1SEVA 1YS4A 3HB4X 1DAPA 2QRJA 1Q7CA 1T2DA 2NTVA 3AOEA 3HB5X 2WE7A 4IM7A 2D59A 2A92A 3F6YA 1CQJA 3QQPA 4MKRA 2ZK7A 1KOLA 4IMPA 2ZB8A 4E30A 3CSDA 4LGVA 5DT9A 1ORRA 2RHCA 3PHIA 5AXAA 3I3OA 4CODB 4HBGA 3VTFA 2JFHA 5HA5A 3S55A 3GQVA 5BNFA 1HKUA 3A28A 5L7TA 4LRTB 2PZJA 3Q1LA 3H3JA 1HDCA 3D3EA 1AGNA 2EGHA 4TRRA 4U6QA 4QO8A 4FB5A 2EF1A 2VTDA 5KVVA 3MWEB 1FDVA 4YR9A 3AUAA 4DQXA 1KVTA 1DSSG 1Z82A 3DBVO 4ZVVA 3W4IA 3CH6A 2CD9A 3DL2A 3RUIA 5C7OO 1FDSA 4FJ0A 1HSZA 2C54A 4PLHA 4B4WA 4J4HA 3GVIA 5TS3A 4GKVA 2VHXA 3VZSA 1M2WA 4D45A 5CAEA 4BO8A 3BTSA 4GLOA 3M1AA 4NBWA 3G17A 5CDGA 4W4TA 3OIFA 1OMOA 2G76A 3WLEA 4Z0HO 4RF5A 2C7VA 3DBLB 5IFLA 3F4LA 4MVJA 2VZ0A 1KETA 2FPIA 2Y1OA 3PIDA 1ADFA 4F6LA 1NWCA 3DZKA 3OHSX 4NBUA 2O3SA 4R68A 1WVGA 4IGFA 1HZZA 2QRLA 2NU9A 3ADOA 3R3JA 3UVEA 3W4JA 4GGPA 4RDIA 4LCEA 4MVJH 4ZQEA 5I9LA 3OICA 3DBHB 1ZK1A 3A06A 4LW8A 1SOVA 2NM0A 1HLDA 3P5SA 4H16A 5FF9A 4IZHA 5F1OA 2CZCA 5DF1A 4B7CA 1JLLA 1PWXA 3PLNA 2DC1A 6ADHA 5TNXA 4CPDA 1UZLA 2GZ2A 4E12A 4IS2A 4IMRA 1PS0A 1TVEA 3VAZA 4XIYA 1U28A 1YDEA 3ZHBA 3C7AA 3ZWCA 4U5QA 2X5KO 1U4OA 4BNWA 2A9FA 3W4KA 2HDHA 1I2BA 1P31A 3ANMA 4YBZA 3S2IA 4M49A 2NVWA 5LCXA 4OKNA 3DZFA 1I2ZA 2D5AA 1XYGA 1X0XA 2CVQA 3OA2A 3K96A 3VVCA 4FGSA 4K6FA 2DPGA 2P4HX 1L1FA 3JQGB 1ARZA 1HEUA 3M2PA 5B4TA 3ZNNA 3N74A 5L95A 3RROA 2AW5A 5JSFA 1F8GA 1E92A 1DJNA 3KUXA 1ZXBA 3I83A 3PRJA 4NFYA 2FMUA 3LC2O 2POQX 1ZSNA 1IY8A 4A27A 1ID1A 4I9UA 3G0OA 4Q3CA 3WYBA 3EVTA 5KIAA 4OXNA 3V1UA 2RCYA 4BGUA 3LSYA 2VOEA 3DZBA 4UEOA 2I3GA 4BB6A 5A1TA 1C0PA 1YO6A 3IP1A 4PCVA 1E7YA 1SB9A 3LVFO 4NZ9A 4PG5A 1KY4A 1BTOA 4W82A 1NVGA 2VZ8A 2VHZA 2VYVD 4BNKA 2NVBA 1DIAA 1IHYA 2G17A 3H2ZA 1YKFA 4WKGA 4E2ZA 3FNFA 4YJDA 3HDJA 3Q2IA 1WLYA 4CQMA 2AQIA 1VSUA 3QWIA 1DAOA 4YACA 4MVJG 3B20A 5TX7A 2PH3A 1RKXA 1CJCA 1BXZA 1GTMA 3W8FA 3TFOA 1D7OA 3V1YA 2Q1WA 2R00C 4J49A 1UXJA 2AEJA 4NH4A 3BMNA 5FFFA 2V6BA 1DLJA 2LDBA 4XYMA 3K30A 4AJOA 4N5NA 1C14A 1NXQA 1LSJA 1BVRA 4XWYA 5TSDA 1BHSA 3B1FA 4R16A 3RWBA 4BNNA 1P1RA 3CMCO 4WOJA 4H15A 1Y9AA 5GY7A 1TI7A 4GVLA 1Z73A 4MVJI 3SBOA 2P2SA 3F1LA 1O0SA 4NFHA 4CMAA 5F5LA 1F0YA 3AI2A 2AG8A 4BNGA 3EHEA 3QWBA 3WOHA 2J3IA 4HNHA 1DFIA 3AY6A 1NHWA 1BVUA 1C0LA 3BXXA 3H8VA 3QWFA 1WAMA 1DIBA 2HO5A 2EKQA 4N54A 3L4BA 4FC7A 1P77A 5GZ1A 2WSBA 4D0SA 1E7RA 1X7DA 3WGHA 3GN1A 2C07A 2DAPA 5JAMA 1VL0A 2HUNA 3GK3A 4W9NC 1U3WA 4ZA2A 4XDYA 2AHRA 5B1YA 1B7GO 1OI7A 3ETGA 3PJDA 4XGIA 2H9IA 5KKAA 1T2EA 2BKAA 5HTOA 2FPGA 1EVYA 2NQ8A 3QJ5A 1YJQA 4Y6RA 4B8WA 3TF5A 1U3UA 6LDHA 4RPLA 4ESOA 1NP3A 2Q2QA 3RJ5A 3K8ZA 5TLSA 3KB6A 4HY3A 3ZN2A 3ZWAA 2Y68A 4GMFA 4J1SA 4NR0A 5BNTA 2BGLA 3LK7A 3K73O 5I7SA 1MUUA 1JW9B 4EDFA 4EJMA 1HDOA 1R6DA 1ZSVA 1YB1A 2UV8A 2ILTA 1N9GB 4XDZA 4NIMA 3ROPA 3NJ4A 4CMEC 1ONPA 4ZRMA 5MDHA 1ZH8A 2IEBA 3PYMA 3GGOA 3HADA 2Y1EA 2IYOA 4J7CA 4L0QA 4LK3A 1QG6A 3HHPA 2QYSA 4II3A 2NSDA 4WLEA 2IODA 2X6TA 5T6BA 4CV1A 3BAZA 3GMDA 4DL9A 1LX6A 4DLBA 3PLRA 1PGOA 4RLSA 1N1EA 2V6MA 1JKFA 5DBGA 2NADA 3VH3A 4FR5A 3UOGA 1ZW1A 3VZPA 2YJZA 4PVDA 4AVYA 3PJEA 2O23A 3ZNPA 4IDEA 4YT4A 1EDZA 1BRMA 4R41A 1RM4A 2GPTA 3JYQA 4D41A 4BNTA 4L4RA 1IZ0A 2VOJA 2PD6A 4JGBA 3UKOA 2WYWA 2PKRA 3OJFA 4PRLA 1KERA 1KVUA 3GN2A 4AL4A 4HXYA 2ZJ1A 4FPXA 5GMOA 5KOIA 1E1MA 5CPBA 3ADPA 1QXSA 3BHJA 3TOZA 3EUWA 4AJEA 1E7QA 4QXMA 1JA9A 2PZKA 5C5IA 4B4UA 1E3JA 3UHAA 4YT8A 4UUMA 1DHRA 1A71A 3SLGA 5KJCA 5ER6A 3PGXA 2QX7A 4OAQA 3JQ7B 1ADCA 3D5QA 2ZATA 1P74A 4BO3A 1LQUA 2Y66A 2CY0A 5F21A 2XOXA 2QQ5A 5I7VA 4RLHA 3D1LA 4LN1A 1G0NA 1WNTA 2FN7A 3VPHA 1Q2XA 2GN6A 3D7LA 4DLAA 2V6GA 4JP3A 5CEFA 1VL8A 5IZCA 1LQTA 3IOYA 3OIGA 1NFQA 5EQFA 2JCXA 3Q9UA 4J1QA 1UXHA 2BFPA 1ZSYA 5TGDA 2O2YA 3DAGA 3ZU2A 4ILKA 1A7KA 2Y67A 4RVUA 1AXEA 1FF9A 1T4BA 2B4TO 1VL6A 1RYEA 1T1SA 2PH5A 4A73A 1PJCA 3BMQB 3WDSA 4I8XA 3IC5A 2WJPA 1GDHA 3RC1A 3S1LA 1ZBQA 1I3KA 1EDOA 1MP0A 9LDTA 2DTDA 4I5FA 2GN4A 1R4MB 4CLHA 1R66A 3GF4A 5IDYA 1GR0A 4RF2A 3LF1A 3RFTA 1OAAA 4H3VA 3ZWYA 1I30A 2VWGA 2ZIZA 1SZJG 2P91A 4PLCA 3PWSA 3RAJA 1ISHA 4YXFA 2YY7A 4RGBA 4CV3A 1AHHA 2J5KA 1LDMA 2XPCA 1O94A 4GL4A 4PLFA 1ADBA 1DIHA 2C7GA 4U0JA 2BMAA 1PTJA 1MV8A 1PWZA 3IUSA 4QFDA 2YDYA 4CM7A 3VZQA 1S6YA 4BQPA 2G0TA 1R0LA 4XX0A 4CUKA 4FSHA 1PGNA 4GSLA 1ISJA 1Y8QB 3I23A 1OC4A 1XIVA 4AJIA 4J1TA 3ZWNA 4WLOA 4LMPA 4RCVA 4DBZA 4NPCA 2WD8A 4LMRA 3KSDO 3SVTA 4CLDA 2A94A 3GVCA 5A02A 2FOIA 4ALIA 1LA2A 1NR1A 5A03A 1EK5A 1I3LA 2GF2A 2CF5A 3OP4A 5KNLA 3FR8A 3JD1A 1CEQA 1GY8A 3ZWMA 5JYEA 3EMKA 4G2NA 5EPOA 5L4SA 4FOOA 1YL6A 4QO7A 1LDEA 2CDCA 1PGQA 4BS9A 1BDBA 1EUZA 3FNEA 1YBMA 2IYPA 2X0JA 1Q0LA 4GKBA 2JHGA 4OOEA 4J6FA 3IS3A 4IDBA 4JLWA 3DB2A 3E9NA 4A0SA 3I4CA 1BW9A 1C1DB 2TMGA 4BVAA 2DM6A 2I9PA 3EY4A 3I6QA 3RU9A 2X1HA 5JXWA 3N58A 4CMGA 4DA9A 2DTXA 3I9MA 4F45A 3AY7A 3RUHA 5BSEA 1X1EA 1W6UA 5AOVA 4XGNA 4NBRA 2GNAA 5ENVA 2QZZA 3WQSB 5JNLA 2BFMA 1HF3A 1EE2A 3IJPA 4PG6A 2X86A 5F1PA 3FCOA 4GX2A 2D1YA 3FHLA 2B83A 1VJ1A 1LTHR 1XQ1A 3VPGA 1KVSA 2UYYA 5I9MA 4EBFA 4WLNA 4WNIA 4ZQGA 2NTJA 4KDEA 1Y6JA 1XR3A 5MGBA 5LDHA 4QT0A 4WEQA 3OA0A 4K28A 3DBRA 1UXKA 2YV3A 3GG2A 3GLQA 3H9EO 4KMSA 5DP1A 4BKPA 3V5NA 3M6IA 1G1AA 1GV1A 5EL0A 4DIBA 4BKUA 3KLMX 3O9ZA 1LXCA 3C1TA 3ZU3A 1PSDA 4RQUA 2VT2A 1UJMA 2IDZA 3ULKA 1UP4A 3B1KA 3WBBA 7ADHA 1DC5A 2BGKA 4XJTA 4XQCA 4DIOA 1IL0A 4BMVA 1QYWA 1EFLA 5DN9A 3NGLA 1B26A 4B79A 1IYZA 2G1UA 4BL5A 1UXIA 4MVJM 4BO9A 2NU6A 2OL4A 2CNBA 3OEYA 2IZZA 3WJAA 1YL7A 5A4DA 3F4BA 4IDAA 3RBZA 1LDGA 1E3IA 1U1IA 1ZIDA 3RUCA 4E31A 2OP1A 3MJSA 5KJ1A 4PGFA 3IAHA 1FXSA 3OETA 4JK3A 1HDYA 3V2GA 2EJWA 3UCFA 2W2LD 4DQUA 4NNJA 3BYZA 4RF4A 2CUKA 2PKQO 4IDDA 3AI3A 3RUFA 4E32A 2PD3A 2VNAA 2EKPA 3NTQA 1PL6A 2VYVA 3IQDB 2BFOA 4WASA 4R5HA 2YYYA 5JE8A 1WZEA 4FJ1A 5T57A 1Y1PA 2FSVA 1YB4A 1EUCA 4XYBA 2ZB3A 4U8GA 3Q3CA 3E5MA 3L77A 4J43A 4F6CA 3NUGA 4IPTA 4GMGA 4FS3A 2FY8A 3GUCA 1B8VA 3H9GA 4EEZA 3GGGA 1EK6A 2HMWA 2Y0CA 3NT2A 3V8BA 1Y8RA 3U4CA 1GZ6A 5AVOA 4AJ1A 1AUPA 1I8TA 4L8VA 5KJ6A 4R1NA 3TL2A 4DTIA 3FRJA 3JQAD 2OP0A 1UR5A 2Y1CA 3CZMA 3OFSA 3CINA 2NUAA 1GL3A 2Q49A 4BNLA 3NT4A 2UAGA 4TZTA 2GLXA 4NJMA 4ALMA 2O4CA 4Y6SA 4II2A 4QSMA 5DCUA 5I9NA 4UEJA 4QECA 3NV9A 2DFDA 5CEJA 1NTOA 1PJ2A 1QMGA 4Q3NA 4TWRA 4Z3DA 4WCFA 3TNLA 4R4JA 5TIIA 3K6JA 4BO1A 2Y0DA 4MKXA 4YJFA 1I0ZA 3ST7A 4DYDA 4HFNA 2JFFA 4BKOA 2YDXA 4CM6A 1C3VA 4MVJF 4QX6A 2HK8A 4DXHA 4R1TA 1O9BA 1KEUA 3FPCA 4G65A 1V8BA 3I9NA 4F3YA 4CMJA 5DOZA 2DQ4A 3MJVA 1N1GA 2R2GA 2HJRA 5IDWA 3MOIA 3MTGA 3QVXA 2X5JO 4PG4A 3E1KA 3L4BC 4Z0PA 2GN9A 4BGVA 1GQYA 4YRBA 5KVCA 4YQYA 2A4KA 2HK7A 1DFHA 2OMEA 1HDRA 1E6WA 3K2BA 2AEMA 2RH4A 4CM5A 4NJOA 1Y5RA 3LQFA 4NBTA 1JTVA 1U3TA 4BO0A 3AK4A 1XLTA 1C1DA 1E3EA 1H93A 4IBOA 1B14A 3RFXA 1KEWA 1VJTA 1BXKA 3SJ7A 1HZJA 3W6ZA 4BGEA 3TZKA 2QRKA 4CUZA 4YB8A 3DHYA 5K6AA 5TJ9A 2X0IA 2O48X 4D0RA 2W98A 2E82A 3A14A 3FN4A 3NTOA 4KOAA 4MOWA 5TT0A 3ENNA 4XB2A 1CYDA 3L9XA 2RBEA 1UZNA 2Z95A 4PVCA 3MJCA 3FTPA 2ZCUA 4BNUA 1R15A 4UEKA 1IUKA 4I9HA 4WOKA 3QIVA 2B35A 1JKJA 1HYHA 4UVHA 1F8FA 5G0UA 1LC0A 4UVDA 3VPFA 4DMLA 3T7EA 2PZMA 3BMOA 1F17A 3H5RA 3KRTA 3RC9A 3UGKA 3INRA 2X22A 3GNTA 4PZDA 1FMCA 3KXDA 1EE9A 3H65A 4UREA 3RBVA 4DPKA 1R4NB 4Q9NA 3R6DA 2VHYA 3TL3A 3EGOA 2O7QA 4TMFA 5TJHA 1IE3A 2PY6A 4A5OA 3UW3A 4MDHA 4EJ0A 2CVOA 2W4QA 1T2CA 4Q39A 4CQLA 4LSWA 4M86A 3S2GA 4B4OA 3UUWA 3ZW8A 1GPDG 5FEUA 4QTZA 1FDTA 4ZQFA 2Y05A 1NPDA 3JQFA 4C7KA 2HRZA 1GD1O 3GR6A 4IINA 3K2EA 2J5RA 4K26A 4MIEA 1H5QA 1X1TA 3TN7A 3IP3A 2D8AA 1ZK2A 3AWDA 4ZRNA 3WGYA 2PGLA 3S2FA 2O4UX 3ORFA 4J9VA 4NU6A 3JV7A 2C29D 2EIHA 2P68A 1YRLA 3GG9A 3AUSA 2J8ZA 2P9EA 4OH1A 1W4ZA 3PDUA 4UUPA 4LCJA 5CEEA 1PJ4A 5C7IO 1DO8A 1DC6A 2O3RA 3VDQA 3EK2A 1R16A 4YQZA 2Q99A 5T8KA 1KEVA 4IJUA 4CMIB 3QSGA 5G2OA 3GEMA 1EZ4A 4GBJA 4HP8A 4BMNA 1B8UA 4H7PA 4LISA 2C20A 3IDSA 1OC2A 2AQHA 4FBGA 1A72A 1YJ8A 3TPCA 2DKNA 5B37A 3WWYA 4YAEA 4M55A 4B8ZA 3QVOA 3UH1A 3KBOA 3OIDA 5DP2A 5IZCC 2GD1O 1E7SA 3DHEA 5K9ZA 3CE6A 1ADGA 3ZWBA 4XQ9A 1L7DA 2O2SA 2WTBA 2HU2A 1XU7A 1N5DA 4Y6PA 5HM8A 3NTRA 3F5SA 3QA9A 1U7TA 3IIEA 2ZB4A 4OSOA 5EN4A 2YHIB 3EVNA 5JAQA 3D4NA 2IZ1A 3PQEA 3ICPA 3SJUA 2ZTVA 3SLKA 1U2DA 2C0CA 2Y99A 5JW6A 3C7CB 3LYLA 3PI7A 3D64A 4B3IA 3JQ6A 3V2UA 3UAGA 1J49A 4DC0A 5L45A 4JBHA 4IDFA 5I8ZA 1J6UA 4KUGA 1LU9A 1B16A 3VPSA 3K5PA 2Q4BA 1K6XA 4O59O 1YOVB 1H9BA 4RVFA 1HLPA 3WGZA 4E5MA 3U49A 3F5QA 1I3NA 4FQ8A 4AJHA 4C7JA 3B6ZA 4DVJA 1TT5B 4BB5A 4S1VA 5A9RA 4CM4B 2GZ3A 4M8SA 4ZJUA 5B12A 1DIRA 4LVCA 4FFOA 5FYDA 3EYWA 3ZHXA 3DZGA 4DQVA 1ONNA 4AJNA 1QR6A 2Q4EA 4G5HA 3MWDB 1TB4A 4WE3A 3DHNA 1A9YA 2V65A 4J7XA 1ZCJA 4D46A 1LI4A 4TRMA 5JDCA 3ZU4A 1NPTO 2GR9A 3COSA 1E6EA 1M76A 4CR8A 5IDQA 5G0TA 4GH5A 3HWRA 4U0KA 1H6CA 1WZIA 1KBZA 4O6VA 4CMHA 1L7EA 4R69A 4Q3BA 1ZXLA 1SB8A 1YXMA 4ALJA 1UUFA 1PQUA 4KUEA 2QZ9A 4FFLA 3OJOA 3Q9NA 5KVSA 1H6BA 2FR1A 3VH4A 1P0FA 4HFMA 4O1MA 3D0OA 2PA3A 1CDOA 3IJRA 3O38A 4GX5A 4JCOA 3O8QB 2DBQA 4CM3A 1PX0A 1HE2A 1SPXA 2P9CA 1NNUA 4AG3A 1LSSA 3FR7A 4Z6KA 3PP8A 4L4SA 5AXBA 3Q2KA 3PJGA 2C59A 4IY1A 1SBYA 1R4NA 3WBFA 1DPGA 4A26A 2RIRA 4E5YA 4UAGA 3T4XA 4B7XA 1O6ZA 4UVIA 4Y9DA 2PV7A 1XEAA 3MCVA 2EGGA 1CQIA 3JD0A 3DMTA 3OBBA 4IIUA 2NQTA 4P4NA 3U0BA 1HTBA 3C3XA 5G4LA 2TMDA 3HG7A 3RBXA 5EINA 1A4UA 1Z7EA 4IQ0A 4CM8B 4E33A 3IL2A 4FDAA 3RCBA 3RD5A 5JLAA 1ZK4A 3WIDA 2CFCA 3KZVA 2OO5A 2W2LA 3GVPA 1NR7A 2B37A 3DR3A 1F06A 1KC3A 2UVDA 2W8ZA 3FBGA 1LDBA 3LLVA 1BW9B 1P1HA 3INGA 3JD4A 3WMWA 2PK3A 3ASVA 3VOSA 2OZPA 5JY1A 1HYEA 2PWZA 3NRCA 4KWHA 3WWZA 4TQGA 5TQVA 2BH9A 2XAAA 4W7HA 3IUPA 4IQGA 4IXWA 4JNKA 4PN3A 2C2XA 4A2CA 4RF3A 4UULA 4BNJA 1VE9A 4CMIA 2GUGA 2VZ9A 3GUYA 3KYBA 3NYWA 2H5LA 2OORA 4NBVA 3ZU5A 3PWZA 2VUUA 4D3FA 2IXBA 2F00A 4CMKA 3JQAA 2WDZA 1YB5A 3NKLA 4FJ2A 3U4DA 1H2HA 3BMCB 3PYLA 3R0IA 4LSMA 3AOGA 4MP3A 3DBRB 1D1SA 2D5CA 2D0IA 4YAJA 1JAXA 2DBVO 1TLTA 3WG9A 1H6DA 4B3JA 1HETA 3H5NA 5TC4A 2PD4A 2WYVA 3HFGA 4NK4A 1BGVA 4RVGA 3S8MA 1HRDA 1N7HA 3JYPA 1LSUA 2DUWA 3GNSA 1ISFA 1EBUA 2JAPA 5JO9A 2PNFA 4WLUA 5CDUA 5G4KA 1V35A 1X0VA 2YHIA 5L9AA 1VSVA 4J9UE 4BO4A 5CP8A 4ITUA 3TDKA 4BQRA 5U9CA 1LC3A 4XIJA 4PLTA 1GUFA 1W8DA 2V7PA 3T7CA 1IOLA 3AM5A 3WFIA 4I5GA 1I33A 4E4YA 5JAZA 3SC4A 2JAHA 2Q1UA 2NLOA 1C0KA 1D8AA 1GUYA 1K2WA 1EMDA 2AG5A 1IZ9A 3X2FA 4EI2A 1NFFA 3VKVA 4WCFC 3TRIA 3FSRA 4IIVA 1E1LA 5JY6A 3PWKA 1P0CA 1YOVA 2CVZA 1I24A 3V2HA 1X14A 2HMTA 2C5AA 1U4SA 4AJPA 2A35A 1ISGA 3PFFA 4LVUA 2SCUA 4KP7A 3G1UA 3PZRA 1PJBA 5I7EA 1TT5A 4TVBA 1H0KA 3KYCB 4ALKA 4CM4A 1LDYA 2FR0A 4PLYA 3PK0A 4L9RA 2NU8A 2Z5LA 1NQTA 1B3BA 3FD8A 3G49A 3CPSA 4RPGA 1Y8RB 4YRAA 2JKVA 1LLDA 2B4QA 3AI1A 5EESA 5A5FA 4Z9XA 4BUCA 2D4AA 4UVGA 5BNIA 1V6AA 4L73A 3I5MA 3LT2A 2YW9A 4NJMB 3L0DA 2FZEA 1QYDA 3FPLA 3MTJA 5ITWA 3H4VA 2ZTMA 2EG9A 3ABIA 1C1XA 3AY3A 3GHYA 3GT0A 3RSHA 5IAAA 3GVHA 1A7AA 3TZCA 1XSEA 4AJ4A 4WCFB 1ZKMA 1MX3A 1SO8A 4XD2A 4D7AA 3WFJA 1PJSA 1PZFA 1PR3A 3KTDA 4YJFB 3SXPA 3FNHA 4YDRA 5THQA 2HK9A 1PQPA 3AOEC 3E9MA 3HJAA 3O8QA 4J16A 5BR7A 3QRWA 1Y7TA 3EAGA 3DZHA 2O7SA 3VTZA 4KUHA 4DGSA 1QP8A 1A27A 4B7UA 4C4OA 3CUKA 4O5OA 2VT3A 2ZYDA 5JMPA 4BOYA 2O3QA 2AEFA 1A4IA 2YV1A 1ZEMA 3JTMA 3HDHA 4RVSA 1ZVMA 4MP6A 4EUFA 5ES3A 4E6PA 4WLVA 3BTOA 4IJWA 4JROA 4NG5A 1YWGO 1FK8A 3HE3A 1PS8A 4L4XA 4GPD1 1ZK3A 1TA4A 5ENDA 4PZEA 3ZWWA 1LRKA 1PIWA 3CZRA 3JQCA 1PZEA 4CM8A 1YVEI 4DREA 4XYGA 4RV9A 1AN9A 3FTNA 3Q11A 5FI5A 4LRSB 4OXYA 4D42A 4UVEA 5BQFA 1WPQA 4CL8A 1MB4A 4RPKA 4MJLA 3OJEA 1MLDA 2JL1A 4E13A 1QYVA 1CRWG 2H1SA 3WXBA 2RH8A 1KEPA 2Q46A 4FFMA 2BI7A 4AJ2A 1A9ZA 1D3AA 4GWKA 1UDCA 1X7HA 4RO0A 1ENOA 4IZIA 5CFZA 3JQFC 2R00A 1VPDA 3L6EA 3GFGA 5JAIA 1K5HA 2EKLA 3PEFA 1TT7A 4GSKA 1UDAA 1IB6A 4TROA 4A03A 4URFA 5ICSA 4NI5A 4UUNA 1JVBA 4A7PA 4CR6A 3F47A 1GYRA 4O63O 4MKZA 2VN8A 2YHUA 4TKMA 1OFGA 1ZFNA 1LLCA 3ZWXA 3ZV5A 4IDGA 5T8KC 1QYCA 3JQ8A 4EEXA 5DBFA 3BMCA 3W1VA 4U6SA 9LDBA 4L74A 3GOHA 1DFGA 5LC1A 3VH1A 5IXSA 1PZGA 3BMOB 5A5EA 2RAFA 4XZ3A 1MA0A 4TRNA 4RZIA 3OEWA 4ZQBA 4ZQHA 1AXGA 3VPXA 1NWHA 3L4SO 1E5LA 1GEEA 3DFZA 3GDGA 3U4IA 3L6OO 2H63A 4PIVA 1XU9A 1E77A 3GEDA 3W8DA 3D3WB 1PGPA 1H6AA 1T2FA 4CQLB 5TRTA 4TZKA 4ND3A 5G0WA 3BTUA 1P1IA 2O3TA 3QWAA 4P22A 3UXYA 1NVMB 2OFPA 3DQPA 3L6DA 2VCYA 3NAQA 3C8MA 1UAYA 4N5LA 5C3MA 4PG7A 2WE8A 1QYXA 4DPMA 2LDXA 5A3JA 3KM0A 3E9QA 3B70A 3WQQA 4I5EA 3GFBA 1EFKA 3PHJA 4Q3AA 3GRKA 1NPYA 5JCJD 5JC1A 3VHRA 5EIOA 2DBRA 2X5OA 2HSDA 3QWHA 1GPJA 3ZV6A 5F5NA 1VKOA 4OGWA 4OM8A 1IPFA 3AU9A 3TWOA 1JKIA 1RYDA 4WCDA 4DWVA 2GYYA 4YPOA 2CDBA 4OL9A 3JD3A 3PPIA 4EUEA 3PVZA 1WDKA 1ML3A 2Q50A 3B1JA 3KYCA 1Z6ZA 4TKLA 1BMDA 3I6IA 4FIZA 4YT5A 2BGMA 3CXRA 4YVFA 1LJ8A 2I76A 4OSPA 2P4QA 3R1IA 3PTZA 5T5QA 4GQAA 1J0XO 3HFSA 5DULA 5DNAA 4ONEA 4JJFA 5IXYA 1PEDA 4N7RA 1EEHA 2P5YA 2IEDA 1W0CA 3AM4A 3DAFA 4NQZA 4DLLA 5JYDA 3WR5A 5IZ4A 4FFRA 1CIVA 1PR9A 4KQWA 1HE5A 3ZH2A 1U7HA 4J4TA 1EVJA 5EERA 1J5PA 3X2EA 4JX8A 5C7LO 2UUPA 1LRLA 2J5QA 3WSVA 4RQTA 1NAIA 4RPJA 4PLVA 1EQ2A 4XQGA 3JQEA 5JMWA 5JDCC 4HNGA 3FWZA 2DBZA 1Z7BA 4ID9A 2X7HA 3RI3A 1JDJA 3GPDG 4MP8A 3QVWA 2J3JA 5KJFA 1I2CA 1MG0A 3V1TC 3LF2A 1ZMTA 4DIFA 2CF6A 3F1KA 3O4RA 3DTTA 3KEOA 1AE1A 4J4BA 1ENZA 1P1JA 1BXGB 2PKQP 3AW9A 1MFZA 3AM3A 2OHXA 4I1IA 3I9JA 3IKVA 4IJKA 3A4VA 2YUTA 3DEYX 5THKA 3VC7A 3ZWOA 4S3MA 3KEQA 5IG2A 1U3VA 4PFJA 5L51A 4WGGA 2G82A 4ROSA 1IHXA 3GDFA 1ZZEA 1P1KA 1NYTA 3GH3A 5EQDA 1S7CA 1ULUA 1EQUA 3JCZA 4NU5A 3SC6A 5ICMA 4XQEA 1R0SA 1VKNA 2B0JA 3KSZO 3P19A 1F14A 4GX0A 2GO1A 2WMDA 2X0RA 4YCAA 4TSKA 4CV0A 2EEZA 5EJ2A 2X58A 2C2YA 2I67A 3C1AA 3DWFA 3OMLA 4Z9YA 1Q7GA 1H2BA 4XEHA 5DOVA 4DRYA 1GADO 3HNPA 1AHIA 1JVSA 3LT1A 5C37A 3DOCA 2NWQA 2X9NA 2HRBA 2QHXA 3H7AA 2ZTUA 3BTVA 3R3SA 4KDFA 1SC6A 5U1PA 4E2WA 4ZHSA 4BV9A 3ZWPA 1VI2A 1N92A 1A5ZA 1P3DA 3ROQA 3NT5A 2BLLA 1GU7A 2PZLA 4YAKA 1XDWA 3DAPA 4Q3DA 2I3AA 2HMVA 5CHEA 3H9QA 1V0JA 3GA0A 2GASA 3F9IA 4NHEA 3WICA 3JD2A 4WLFA 1SCUA 4TVOA 4RORA 1U8XX 1DEHA 3G1TA 3KV3O 2JHFA 5GZ6A 3EC7A 3E5RA 3O03A 5L40A 4ZD6A 4JBGA 1ZK0A 2D3TA 2VQ3A 2X8LA 3Q0EA 3JQBA 1K6JA 2QW8A 5A9SA 1T1RA 3EZLA 4JJGA 3GZNB 2WD7A 3D3WA 1XQ6A 2WEKA 4JIGA 3RUAA 4ALNA 1LNQA 1FJHA 1DRVA 2GSDA 3NJ8A 1E6UA 3VDRA 4XB1A 4FCCA 1PL7A 3TQHA 2W2KA 3GNQA 1K0UA 3CMMA 4I9NA 3PFWO 2Q2WA 2VWQA 2ZQYA 3ANNA 5L3ZA 1T4DA 2OBNA 4EUHA 3JQ9A 3ICCA 2FSSA 3UFXA 3GRPA 2HAEA 4DBVO 1Q0HA 1UH5A 3RKUA 3C7DB 4R9RA 4CM9D 3LDHA 4Z0TA 5T64A 1WMAA 3JYOA 1X15A 2PTGA 4OO3A 2PGJA 4YRDA 4PRKA 3LZ6A 4NFSA 3UN1A 5ITVA 1PJTA 4OOFA 1SOWA 5J23A 1LLQA 2YV2A 3DZIA 2JD2A 2WWRA 1DXYA 5A06A 5A9TA 1JWBB 1HXHA 1E1KA 1HSOA 3JQAB 4MIYA 1XA0A 1XGKA 3ZZNA 1ZUD1 3DMYA 4AJKA 3MJEA 3K31A 2EJVA 2BELA 4XGKA 4M89A 4XKJA 1KVRA 3ZV4A 3KVOA 4EW6A 2FHSA 1I10A 1J4AA 2BHLA 4CJXA 5CG1A 1KY5A 4PLWA 5COBA 3E18A 3EDMA 4BKRA 1ENPA 3H9UA 3P2YA 4ND5A 1M6HA 2OGUA 2ZKLA 1JN0A 4FFPA 3C85A 1NFRA 2NU7A 2E37A 2GERA 1XHLA 5I8WA 4RVHA 1QLHA 3QVSA 5G4KB 3TJRA 8LDHA 2EW2A 3AUTA 3JSAA 3WX0A 1CWUA 2J3KA 2FPPA 3DDNA 2ZYAA 4J2HA 2CDAA 1B2LA 2YZ7A 4IQ8A 4Q3EA 3L07A 2FWMX 3AU8A 1ZMOA 2D2IA 4E5KA 2PLAA 1NM5A 2DU8A 1NQ5A 4BMSA 3HDYA 4OQZA 4ZU3A 3KYDB 2NVUB 3DZJA 4R1UA 4XCVA 2Y1FA 2JCYA 1QORA 1U9JA 1PQWA 3ONEA 4YJGA 3NDIA 1TEHA 3ZNOA 2Q1TA 2AXQA 2BFAA 3MZ0A 1ZNQO 1BXGA 4OXKA 4DYVA 3EW7A 4MVJP
chains in the Genus database with same CATH superfamily
4O2BF 4WKBA 1MVLA 3W6UA 4CLOB 4MAFA 1WHSA 5C4GB 3CB2A 4E2YA 4URXR 4BLVA 5FWNA 2B94A 1Y6GA 3PQ3A 2O7VA 5IT0A 3VR2D 1OXVA 2OV3A 4UASA 3VZCA 3OU7A 3O2NA 4UCQA 1RM5A 1D2GA 1G6Q1 2O8EA 3STHA 4ESVA 4KSYA 1PFWA 4N7JA 1CVIA 4MJXA 4FDVA 2ZKIA 4ISCA 5CA0B 4GE3A 1WV0A 1E63A 5IBQA 4HADA 4XTCS 4PM4A 2RIPA 3ZKWB 5JDIA 1JBKA 2B36A 1JLSA 3OX2A 2Y1DA 1BFUA 4OK5A 5FLKA 3G3EA 1L5WA 3O84A 2GK6A 1RI2A 1U2GA 4UPDA 2K7ZA 2PVSA 1QFSA 2Q29A 3EGXA 4RJ2A 4EG1A 2W2MA 3V48A 2BF7A 2GSWA 2YQ5A 2UUBB 4IVNA 3P2KA 1Z83A 4K1LA 5EIBD 1J0AA 1BDMA 1NASA 3EXG2 2IE8A 1OXTA 3FWYA 4JS0A 5IP5A 1O7JA 2C5SA 1PU2A 2R8BA 1E1QA 3GLIE 4KPYA 1SIOA 4KR7A 1XZ8A 1DDIA 1XZKA 5KUTA 2FZWA 3R09A 6GPBA 3VV2A 3UJ9A 2BD0A 2NO5A 3VVMA 1NW5A 4WD3A 3A9SA 1DWUA 3RSCA 1AZLA 3O4FA 1NHGA 4HX5A 2WWWA 3A9WA 5C81A 3TSOA 3K1YA 4BNVA 2UUCB 5IC5A 3UNXA 1O97D 5CLHA 4HQLA 1I5RA 1Q1NA 2H2AA 2QPOA 4WOPA 4CKZA 1O95A 2ES4A 3T1YB 2C97A 1RZVA 3MRVA 4ETNA 1MT3A 2Z1NA 2BFCB 2QX4A 2VHVA 1AKEA 3FPHA 2GLUA 1KJ8A 2ZJ0A 3H5LA 4HH1A 1Q92A 3H87A 1JALA 1NU6A 4MRMA 4ROTA 4MQFA 3BIOA 4WBXC 4D26A 3WNDA 1V7CA 4LF8B 1NUHA 1KYXA 1T8UA 2A14A 4AZWA 4YAIA 5EJ5A 1GCGA 3U0VA 1DELA 3D3JA 1WXDA 3W5UA 1N8KA 4CI0B 5BSHA 3MN1A 4PGHA 3O47A 3OI7A 4MTCA 1L8LA 1HYGA 2VYND 3GZNA 3NBYC 3O4VA 3R23A 5CT5A 1K6IA 2C2OA 3AJ8A 3ZLTA 8AT1A 4CF7A 2I9KA 3ITDA 4GEKA 1II9A 5BO5A 2VG8A 2GZMA 4IHJA 5DCWA 2G8LA 4M9XA 3NKFA 1P2FA 1KZGB 1XNQB 1LV7A 3OZFA 4BDSA 4X6XA 1Z39A 2HLDA 3D81A 2EG5A 3M4ZA 4B46A 1MF7A 4YECA 2FRDA 2X9GA 3PEVA 1PT7A 4V0MA 3QFCA 3VSBA 2PHZA 3EN0A 4DS3A 2FUG1 3BA1A 1W1IA 1C8VB 4E2XA 4ZVNA 3SQNA 2O05A 2Q3HA 1DIGA 5EP3A 1Y7HA 2JFGA 4IKPA 5DGDA 4RJKA 1KYZA 4QEDA 2I29A 4LWOA 3FVQA 3MCZA 1UCFA 2G25A 4WOCA 5CM2Z 1PWEA 4AICA 3ZHSA 2YWDA 3GAZA 3RAEC 1HNZB 3EIEA 2ZCVA 3ELUA 3IUNA 2P9GA 4Y6GB 5EKTA 4CKWB 1GKYA 1MOZA 2ONCA 5K2OA 3WNQA 1VJ5A 1PSWA 4WDQA 4QHSA 1F5SA 3VU9B 3M0EA 4OI0A 4NOMA 4HEA6 2E48A 1U9IA 1UDBA 3H5AA 4WUVA 4BX8A 3ODGA 4RM2A 5EFOA 3TE6A 5AW4A 3TEFA 2NUPA 2HBZA 3IH5A 4OHZA 2ZI3A 1JILA 3OZRA 4CKBA 2UVQA 1OXKB 5EMJA 3FCYA 4R2JA 5KTKA 4OHFA 5AUPB 4EZBA 1U90A 2QRPA 4DHWA 1PLLA 4RXUA 5ESRA 1FDRA 3L4JA 1HE3A 5ADHA 1N1MA 1YGYA 4XA8A 1QRDA 3TQTA 1EUDA 2REQA 4TLLB 1Z5VA 5CMLA 3JQ8B 4FNOA 4HUJA 5H83A 1KDVA 3WGOA 1NV9A 1KS9A 3ZXXA 4Q3OA 4CL3A 4RVDA 1PKXA 3PC8C 3DBHA 3GCWA 4K7JA 4XVRA 3ZZTA 1GQSA 2XTJA 5JSQA 5AW8A 3UK7A 3DFKA 2GETA 4F92B 2IKQA 4V24A 3KLBA 4OV6B 1F4VA 3DV2A 1R37A 1ZDMA 3O3CA 4X60A 3RB8A 4DA4A 2WTMA 4FC6A 2VP3A 1Y4AE 2NO7A 3KP1A 4ON9A 2A4MA 1OOEA 4F2WA 5AVUA 2R7LA 3D6TB 4BFSA 2MU1A 2V54A 4DZZA 2IZ7A 4IIHA 5FKJA 5DM60 3MTBA 4DUGA 3OJWA 3AJ9A 5ILGA 1Q7BA 4KWCA 1MRSA 4HRYA 4XI9A 4MB0A 5IVDA 3ZCXA 3F6CA 5A5DA 3ZD7A 3AZOA 4N47A 3IDFA 3BXFA 4BNFA 1JI3A 1UADA 4P4TA 3TX6A 3SI7A 2VPYA 3A1NA 5DBOA 1ZM4A 4NMXB 3CC8A 3LQRA 4Z7QB 1VRWA 3E5NA 3GGPA 4C4YA 1DRUA 3I01A 3JYLA 4Q9HA 2G7MC 4HFRA 4IUDS 3ZDEA 5LZ7A 3OIWA 4XJSA 3KDSE 3H17A 3GQBB 4Z0NA 2HB6A 5L6LB 2Y93A 3BILA 3CXUA 5LD2B 1WMSA 2VPTA 3FYCA 1ZONA 3AUUA 2GEDA 2WFAA 1IAQA 4D57A 1WRBA 4ZVPA 1FFGA 2QDKA 4YXWD 2AJTA 4EW3A 1GQQA 3VVBA 1QH8B 1E4YA 2VH1A 4CDMA 1A9QA 5KINB 1KMQA 3C1OA 2QT1A 1SIBE 5DM2A 2ZB7A 4ND2A 3K5IA 3NVAA 1MMFB 2A33A 1K9VF 3WS7A 3H86A 3CRNA 1XKLA 3CKKA 5EPEA 2IEAA 4MQUA 4NE7A 1AS3A 3OCWA 1EKXA 1W73A 3ENKA 4OHUA 4JOSA 3ON5A 4EIWA 5AVXA 3K6KA 2PUFA 1CUSA 1XJCA 4QJIA 4MPDA 1XZIA 1UAGA 2QYHA 3PXXA 2JJ2A 5DGXA 3GPIA 5BSFA 1Y80A 3K1AB 1CF2O 1KAOA 2RHRA 5DVZA 3IOEA 3KJIA 2FN3A 3CIFA 1FLVA 3U3KA 4PO9A 4M1MA 3IV9A 2CK3A 2OGTA 5EQJB 2EWMA 2OBBA 2JJYA 1PYGA 2D3WA 3NUQA 4I9GA 3LY7A 5TPZD 1DO2A 4BASA 4HQFA 1BFKA 4EJ6A 1UBLS 2VYCA 4FB4A 1P45A 2Y2VA 1NSFA 1NE7A 2M2IA 2OHOA 2A9RA 4JBIA 2CSUA 2Z1MA 4CLXA 4BFWA 1DS6A 2QJOA 4ZHQF 1GM5A 2R97A 4PZLA 5LYJB 4PLGA 4WOBA 3E6AA 2FVXA 1A7JA 3N0RA 4RK1A 2MWMA 3RJ9A 2LTAA 4HRVA 4RPIA 2GCGA 4LDJA 1OF1A 2REBA 1B8PA 3ANLA 4N18A 3WGQA 3W5CA 2WTNA 1MT0A 2G8NA 2QN9A 1Z06A 3DL4A 1ST2A 1DB3A 3D7MA 3N2IA 2C9MA 2G36A 1C29B 3DWGA 1UPFA 4PFSA 3PYXA 4XYEA 3DJFA 5FV7A 2M1ZA 1HQKA 3THSA 1I01A 1LLUA 1Z6PA 2ZYSA 1RP1A 3PC6A 1T26A 1T25A 3KHUA 3MT8A 4L3VA 1Y37A 5ERYA 3OJXA 4LC9A 2R62A 2OHGA 4R0MA 3CEAA 3QUQA 4IH4A 4ENQA 2WWFA 4I2NA 4CMCA 1XCJA 3GEHA 1KI8A 2I8LA 2J1LA 3UT0A 4EAAA 3HXOA 2ZCJA 4Q4CA 6AT1A 1O9GA 1KAQA 3BBLA 4ARZA 4JODA 1APBA 4RL4A 5KTSA 3QE9Y 3FM9A 4LDQA 4OBWA 2ORWA 2ZWOA 1YTUA 5BT9A 5CJPA 1Z4QA 1FVFA 1CY1A 3PC4A 5GINE 5BMVB 1VSBA 1LVHA 2V4MA 2L2QA 4U7WA 4CM9A 4KE6A 1RS0A 2PJRA 1P2UA 1ZGCA 2EFGA 5I7FA 5M5BA 4RTKA 1YS7A 4NPHA 5J1TB 1AKRA 4JHLA 3ZWQA 5IHXA 2HXGA 2PMKA 2FWAA 2CL0X 1BE0A 5GVRA 3RV3A 1VB5A 4I3GA 4BN4A 3R6WA 2H1OA 3EEIA 2DPHA 2BTOA 3X1YA 4OJTA 1MOSA 1QV9A 1V71A 1QKIA 2SECE 5KWSA 4MI3A 3DKPA 1OU0A 1XELA 2B5VA 1EWKA 1MD9A 2BEUA 4ZPJA 3RREA 1N3BA 1X19A 1R9MA 3H3FA 5FPTA 3T61A 3FMOB 3NHPA 3CKYA 4F3KA 2PLNA 3FSEA 2KJQA 4BECA 4FXPA 5A3VA 4EA7A 1P0QA 2IUYA 2F2TA 4U9UA 4BQEA 4ZDJA 4CIAA 2I71A 3W0LB 4IJMA 4Y1RA 4GMXA 2OGSA 3A9TA 1F20A 1JG3A 1FCJA 4HSEA 4TUYF 2V0CA 1HWYA 2X3UA 2ZULA 1E0KA 1G21A 1EUQA 1GPYA 1WG8A 3KHKA 4HTFB 1PS9A 1RSZA 1Y98A 5JRJA 1PL8A 2C8VA 1AJEA 3GLGA 1ZWKA 2WKSA 5HZGA 2FWJA 2XMGA 2E4YA 3IJEB 4YRGA 3K1TA 4DLUA 3G23A 2KYRA 1LI5A 4MIKA 2Q5IA 2V8BA 4PPYA 4Q4JB 1X8JA 1E5XA 2W6ZA 4W9NA 5AESA 4MAMA 3PA8A 1Z0KA 1CLEA 2O07A 2HQOA 1I13A 2ZIXB 5KKCA 4BWVA 3KT3A 1NLUA 5CPFA 1QG4A 3ZGNA 4HFJA 4JLKA 5AJVB 3L6CA 1TKCA 3O93A 4JOQA 1LRJA 3ZGYA 3L06A 2WB2A 4DLSA 1HL3A 4M7PA 4HV4A 3DNPA 4JT8A 1DG9A 5K7SA 2R11A 3V1NA 4URWR 2ZYVX 3RASA 1U1CA 1HKHA 1G38A 4HVTA 3VU0A 4QUKA 1SMKA 1MPXA 2QAGC 1AGRA 2V9PA 1UMDA 1K7YA 1T4GA 2OC4A 4LHXA 3WBJA 1JDVA 3Q3GE 4GPTA 4BU0A 3HVIA 3P0EA 2FRXA 4Q1EA 4J91A 2HR1A 2F1IA 2MJLA 4R5MA 4X63A 1CUJA 1RTKA 1QQ7A 3LLSA 4GPBA 4ZT4A 4HNTA 4Z2AA 5JNSA 4M7OA 3OT4A 2P2DA 3UA3A 2WIDA 1BG6A 3O0TA 1NNEA 3F3MA 4WDRA 5BV1A 3HLKA 4CMEA 1PHRA 4G81A 4RGQA 2FLWA 1HE4A 3EGVA 3VTAA 2IWRA 2XRMA 4M0KA 2WUEA 1EGHA 3TLGA 1IVYA 4P8RA 4RS3A 5JO0A 1QNLA 4WZZA 4Z2YA 3FA2A 5EHZA 1CZKA 3S2ZA 4B3MB 4M6WA 3CH4B 3NS7A 4EVQA 1IMJA 5LQAA 3D3QA 1G2IA 1SEPA 3MYRA 3D4LA 4GVPA 3GAFA 2ZYHA 4HYTA 4P84A 4K03A 4YAUA 4DQ0A 1YZYA 4P0PB 2XYGA 2F17A 2BI8A 1F1BA 1GCIA 1H2ZA 3U9LA 1D4FA 5B1HA 1H0RA 1CU1A 5A3QA 5LOVF 1V7PC 3P9NA 3MSCA 1LB1B 3EAFA 3BCHA 3MVEA 4KYTA 1C30B 5TR9A 1TMOA 1G0OA 2XUHA 3I9KA 5DASA 4DSTA 1FW6A 1X9HA 4A16A 1GU1A 1RAEA 2YFHA 3W9BA 2OVBA 5JDIC 3IGFA 5J4LA 4NYJR 4INAA 4MR7B 1LUAA 1E0JA 1QH1A 5BXQC 1WOMA 5IAGA 5L3VA 2RB4A 3R0XA 2QSJA 2R6GA 2BOVA 2RG7A 3FKSD 1U2GC 3WLSA 2AMYA 2R1TA 3QLUA 4MS3A 4JJKA 2W70A 3LA8A 1WHTB 3BMQA 2CLDX 3C3JA 5F9MA 5H4HA 5A04A 5B3KA 3H3XA 4YYZA 1KXZA 2ET6A 4DNOA 3DC7A 1R4MA 2XVAA 3BH0A 4L5AA 2FW7A 4H1TA 1WO8A 2JATA 3QV2A 3HPQA 4JJ8A 2EAUA 3FMVA 4JLPA 1RWBA 1KO5A 2NTNA 3FKJA 4BNIA 2AC7A 3GFVA 4KIUA 4N3CA 4YJGB 1Q17A 3K9LA 4E2FA 2OR3A 1KSFX 4IFTA 3QKTA 3DOJA 1NQVA 2AHOA 3A58B 4MWCA 1OFTA 2IE0A 1M67A 3GJ5A 4ND4A 4O0LA 1P5HA 2ZYWX 1E58A 1O95C 4B80A 2PJZA 4LY3A 4IUYA 3DKRA 2AMLA 1XAIA 5IBCA 1ZCBA 2EATA 2AG1A 3MWYW 5E6RB 1PYDA 3PTAA 1J8QA 1TVMA 1GZHB 4YT2A 8GPBA 4P3YA 5FHQA 2DSTA 2OOSA 2IPAB 2VRCA 1M7BA 2ZXEA 1B0UA 1FS4A 1U8FO 5EXXA 4YP9A 4AN4A 3H6KA 3BDAA 1SXHA 1Y8QA 1Z8NA 4YNBA 4OQYA 4FMCB 2DFPA 4FOLA 1IBSA 3LHSA 5COAA 2QENA 3TLEA 1I9CA 4F3NA 3NASA 1M75A 4BNMA 1DC4A 2VHWA 2Q27A 4U63A 4QHTA 4QGSA 1OYOA 4KVZA 4RJTA 3ZJVA 2ECQA 2J0UB 1RM0A 3LYHA 3FWPA 3AKDA 5DNEA 5CDTA 5C0OE 3EG9A 4YIHA 2G06A 4R1SA 3TIXB 2QAIA 1J07A 2FP4B 1CY8A 2FRDC 4OKSA 1Y4UA 4D9NA 3D2AA 1XKQA 2H6EA 2YTZA 3G0BA 3GZ4A 4MV6A 4P31A 3C24A 2B2NA 1R8JA 5BNZA 1G17A 3O2JA 1G6KA 1IPEA 1A9OA 1YD7A 4Y2UA 3TOXA 1KJJA 1Q0ZA 4RZHA 3PJRA 4EEKA 4LZNA 5F51A 2BI4A 4BB0A 3C3AA 4UBMA 1FFBA 2W4MA 4OXXA 2R6JA 3OLCX 4TT3A 1YUNA 4F97A 2F1KA 3RU3A 4UUOA 4JZYA 3D2LA 1TPZA 1CFJA 1P44A 1U9IC 4O4HA 3OQ6A 1THTA 4BV2A 2E4UA 5CA1F 4EYEA 4JBWA 1KIMA 1JAZA 1SEVA 1D2RA 3EOBI 3B6IA 4INJA 1WXIA 5DGIA 1Q7CA 1T2DA 3ZIAD 1T9GS 2WE7A 4G0YA 1YV9A 3DMGA 3F6YA 4ZKDA 3OEEA 2PS1A 2Z2XA 3M83A 2ZEJA 2ZK7A 2ZPUA 4MI9A 3MLBA 4D9MA 4E30A 2RG1A 2WJ4A 2I0FA 1DUVG 3QU9A 3P94A 4HDRB 2DBYA 1G5TA 4LWQA 1KJWA 4MVWA 5HA5A 5BNFA 3TB4A 4D80A 3WK4A 5L7TA 3NG1A 1CE8B 1HFKA 3GAMA 2B92A 3D6JA 3D8NA 4I4TA 1T8PA 4Q4DA 4WK4B 1O94D 3H3JA 2FPMA 2G83A 2P9HA 2BFNA 1U2TA 3P71T 3TJZA 4TRRA 1ZESA 4QLBA 3LOQA 4X66B 4FB5A 4YDQA 4O5AA 4PN7A 2CZQA 4WA8A 3L5KA 4S2EA 5TPWA 4D9HA 1H1LB 4DT1A 4EK9A 2IS2A 4OFXA 2OAQ1 1KVTA 1DSSG 4GMDA 3SVZA 4IVQA 4JLOA 3CH6A 1IIBA 3RUIA 5C7OO 1M33A 4JMLA 4Q66C 2OB1A 5TS3A 2G04A 2JLBA 4BO8A 3AWIA 4NBWA 3I76A 5LL6P 1ILWA 1OHHA 3FDIA 4Y2JA 4YYEA 4C2AA 1UPUA 3EVDA 1OPRA 4IL5A 5B1IA 4I1PA 3LXUX 3TOVA 4DV6B 3LDFA 2E1RA 2RAUA 4HJRA 4R05A 5E4JA 1FYDA 5TE9A 3IAUA 4PAGA 4LQCA 5CB8A 1F2UB 1GDDA 3OX4A 2H9YA 1ZICA 1H65A 1QHYA 5EXPA 4LZPA 4CKCB 3F4LA 4MVJA 4YCMA 1M0TA 2BM8A 2Y1OA 1PDVA 3DKKA 5ALPA 4H0FA 4AC9A 2ZUDA 2LGJA 4M9CA 2QE7D 1KDTA 2OFXA 4NBUA 5GOTA 3SICE 3UVEA 4IGFA 2JHAA 2MR5A 2NU9A 4PIMA 1UM8A 2JIRA 3ND9A 2GHRA 4UDYX 3UH0A 2CN1A 4GGPA 4R9VA 2ZJ7A 4WUTA 3ZE2B 2D5IA 1LK0A 2F90A 1HRKA 2O2CA 3OICA 4O2AA 4UZSA 2B3TA 4DY4A 3MK31 2NM0A 1THGA 1HLDA 1LFAA 2Z3VA 5FF9A 5F1OA 5B7GA 3F3YA 5LP6A 2J3EA 1JLLA 4AZ0A 1QTQA 3OKAA 5DLDA 2XNCA 4JLNA 1UZLA 3RRJA 2JCBA 4OP3A 4ZAYA 3HVHA 2W6CX 4IMRA 1VSTA 4IS2A 4PGGA 2HSZA 5REQB 3S0JA 3LCCA 4EUSA 1QO7A 4ZARA 1EXDA 4TZ6A 2G1JA 4M8NE 3UAYA 5KKNB 2C31A 5CCEA 2E4XA 3ZHBA 2FPOA 3C7AA 4S1TA 2JIPA 3W9UA 1AIPA 3T9AA 4J3JA 3M3DA 3VGJA 1OLSB 3ZWCA 2ZS7A 5JEEA 3LH5A 4J29A 2ZBUA 3WGKA 3NNNA 1GTL1 2HDHA 1P31A 4G9BA 1A9XB 3S2IA 4CQJA 4FMPA 1ZOPA 1GSHA 3P9CA 4OKNA 5E4TA 3FLBA 1W0KA 3DZFA 2D5AA 3HK2A 2OXRA 2IHKA 4MPJA 5E7QA 1GTJ1 1X0XA 2RH9B 3OA2A 4ND6A 3W1EA 4FGSA 2WK1A 4TS3A 3WLOA 1MRZA 1UJ5A 3I0ZA 2QWXA 1VDZA 2BKEA 2P4HX 3G5UA 3M2PA 2EX0A 4JB2A 1AQ6A 5JSHA 3N74A 4DCTA 3E35A 4URVR 1A8QA 5JSFA 3SFTA 2G09A 2YL2A 1E92A 1YZLA 3FTDA 3KUXA 3MPOA 4MCAA 5EUBA 2FMUA 4O8ZA 4YUWA 2X2EA 3KU4A 1ZSNA 3QUSA 1KZ9A 4X6YA 3A6LA 4I99A 2QM7A 3VR4D 3VR5D 1W5BA 4A27A 5AH0A 4ZT6A 4Q3CA 4YQFA 2BJHA 1U1EA 4OXNA 4EY7A 4RETA 2RCYA 2X8JB 3T5GA 5HKKD 2VOEA 1YMVA 4UEOA 3M4YA 1O8BA 2I2DA 1RNLA 2EQAA 1KJQA 3IP1A 1DINA 2PKCA 1SB9A 4FWBA 1XJ0A 4NZ9A 4PG5A 3ZBTA 3EZGA 3PNBA 2GRJA 3WGJA 4ZZ0A 1O6CA 4W5TA 1R8YA 3A4NA 1EJ2A 2WUVA 4W82A 1NVGA 3U17A 4OJQA 4UU1A 3UJ6A 1E96A 1RDFA 4HL6A 5DM70 1NVVR 1O6FA 2NYRA 2CNKA 3HA7A 5K0EA 2DT8A 2G17A 2VTBB 4LV5B 1G5QA 3BDVA 3BK1A 5IHPA 3KAPA 3HDJA 1UFKA 1NYRA 1HYBA 1SQFA 2IS6A 1MO3A 1XNHA 3O92A 4NXMB 4RMNA 4K3VA 4MPRA 3CH5A 2FZVA 1JHRA 3QWIA 5CLFA 3B20A 5TX7A 1E2LA 2R6R1 3AQ4A 4NBSA 5DM0A 4JP5A 1J00A 4QBTA 8ABPA 2R00C 1KBQA 1UXJA 2AEJA 4B34A 1NOJA 1R5BA 1T8TA 1RJDA 2A5YB 4O4LA 3SF8B 3ZYZA 4XYMA 3MYYA 4DRZA 1Y7PA 4AJOA 4GBMA 1EI9A 2IU4A 1GPMA 5IMSA 4B3FX 3DNFA 3EUFA 5KYGA 2FWPA 1P9OA 4TL9A 1OH8A 3EIWA 2CHEA 3M6WA 4JT9A 5IULC 4AURA 1QR2A 2VO1A 1P1RA 1JFRA 5CB4B 1DX4A 2BR5A 4BJ3A 2WPDD 3CMCO 4EG5A 4F5YA 5CFPA 4MR9B 2GWHA 3V2IA 4H15A 1JDBB 1N6PA 2IF0A 2JFWA 1UBJS 4KGVA 4O4IF 5BRJA 1J22A 4MVJI 3DLCA 1PSZA 1EGMB 3F1LA 4CMAA 2WIKA 1F0YA 1M5UA 1R9JA 1V47A 2VHCA 3DQZA 1M54A 3TLCA 1TO6A 3VYWA 3WOHA 1YZQA 3BL5A 3U9TA 1DAGA 1JAHA 2AFIA 3AY6A 3BXXA 3RO7A 3FLAA 2HO5A 3H2KA 3I09A 2O06A 2EKQA 5ALUA 1TM7E 3KC2A 1KQGA 2ZUCA 4P36A 3ZCRA 2WSBA 4DJ5X 5AKKA 5AJWA 1NZFA 2Q5LA 3AKCA 1E7RA 1W5EA 2QU8A 4GZ5A 1B0ZA 2XNJA 2O52A 5F1YA 2C07A 5AM0A 5ED0A 3S2UA 1AY0A 1VL0A 2B4KA 2HUNA 2JVKA 3E7FA 4W9NC 4ZA2A 2ZSAA 2UYHA 4FYPA 1OI7A 4GOMD 1HG0A 5IKOA 1XD2A 3L7IA 1V48A 3ETGA 3NCHA 2O20A 4H6WA 3IQGX 4LOHA 4XGIA 3TG2A 5DLQC 2YMQA 2OWDA 4NV1A 4X45A 1T0HB 4JLAA 1T2EA 3P0FA 4ZQCB 2FPGA 4F93B 3QJ5A 4Y6RA 2X8AA 6LDHA 1NP3A 1PEAA 5A4DA 1NDUA 2FMHA 4V2IA 2MMCA 4Y2HA 3B1VA 4Z49A 2EFEB 2JGRA 3GPBA 2BGLA 5KYXA 5I7SA 3UMRA 3SAJA 3FYTA 4I36A 1XEXB 4XDZA 5NULA 4NIMA 3HY3A 3VPBA 4CMEC 1M34B 3CF4A 3CLUD 2K2WA 2RHGB 1N7IA 3OKCA 4FEEA 5JQGA 1RMTA 4B31A 3DVQX 4D4GA 1G8HA 2W42A 3AERB 1K68A 4LRXA 3PITA 4TN5A 3UC9A 2QR5A 4MB6A 3SLRA 4AKEA 3IAXA 3B1XA 4L0QA 2PKWA 5LLDA 3HHPA 3QKRA 5K5EA 2NSDA 3G59A 4WLEA 3AZPA 4N8EA 2GD2A 2VJKA 3KCNA 1RCUA 3ABSB 1TAQA 3E15A 4FMBB 3EBLA 3LTNC 5EPUA 2A5FA 3JAKA 3PLRA 1N1EA 2V6MA 5DLYA 4M1TA 3VH3A 4K87A 2CNOA 4X90A 3RBAA 2XTMA 1ZNZA 3CRRA 2MSEB 3PDWA 2DERA 1ZW1A 4PVDA 3SWWA 1EK2A 1R8SA 4WZAA 3PJEA 1GSAA 2FX2A 2NOAA 2O23A 4B6JA 4O29A 1DTWA 1U7DA 5JD5A 1GGNA 4G5YA 5E4FA 1OYYA 1RR6A 1W5TA 3D0RA 4WH0A 2WWYA 1ANKA 3HXMA 3BIJA 4D41A 3FKQA 3NYQA 1UOQA 4FKBA 4L4RA 1JJAA 4FTWA 1DJMA 1NUUA 3NHRA 5H8WA 2FSFA 1NJ5A 2QUIA 1NBEA 3UKOA 4WBNF 1UFRA 1Z9BA 2DF8A 2FA9A 3QLUC 4WMLA 2QJFA 3PUIA 1KERA 2Z5GA 4L16A 2R60A 4TXJA 4AMVA 1TTHA 1TU4A 1Z18A 2HQSA 1WOYA 4K6MA 2OILA 4O4IA 3BHJA 3HCAA 1AB6A 1I1QB 3NXSA 4AJEA 2J0QA 4QYIB 3TAUA 4KXVA 1SA0A 3FCXA 3LC0A 2GHQA 1FLDA 2ZJBA 4H35A 4YT8A 4UUMA 4H3KB 5HE8A 2DEUA 1OJ7A 3CPEA 4BFTA 3WADA 3PGXA 4FYXA 4L2IB 1BH2A 1I7LA 2PZFA 3I1IA 3O9MA 5H9WA 2CXOA 4OAQA 3JQ7B 1QK5A 3D59A 3RHFA 2Z2KA 3DZDA 2OFWA 5AI0A 4HNAB 1LQUA 2MOKA 1GU0A 2CY0A 2RGGA 4MICA 4Q9KA 5EXTA 4CHTA 2XOXA 5I7VA 1TKAA 2D0OB 1RLJA 3A3NA 3R5KA 4H17A 3L05A 1F48A 2FN7A 2G08A 2ERCA 2P0EA 3CO5A 3PEUA 4MW1A 2DJ5A 2YXBA 3A6EA 3D7LA 4RY9A 3O95A 5KC8A 4DLAA 4JP3A 4CKEA 1LTKA 4K9RA 3HVUA 1OGIA 1IY2A 2YWRA 4M76B 3DT6A 3VPCA 1LQTA 4A0HA 3ORSA 5G1OA 1JEDA 1OW3B 4IVPA 2JCXA 1K6EA 2O7NA 3QVKA 3BHNA 4BZZA 1H3NA 2CYAA 2PUTA 4RIFA 3DAGA 4TTJA 2QROA 3IPAA 2Y67A 3D2CA 1ATZA 1AXEA 2B4TO 5K3FA 3QHPA 3CF2A 5BR4A 1RYEA 3LDUA 4MGIR 1KARA 2PH5A 3EXFB 4KNWA 3PNOA 1FUYB 1N3LA 1W0JA 2PJDA 1QFMA 1LS6A 2HWUA 3LQQA 3QJYA 1L4BA 9LDTA 1RRGA 4V39A 2O6HA 1JB1A 1R66A 2V74B 4QPJC 1GR0A 1I3OA 4KWEA 2BPOA 4L6AA 5K3DA 3TXYA 4ZO8A 4H3VA 2BGRA 3PWSA 1G291 3DAYA 1ISHA 4KHPB 3ZGLA 3ZU6A 2BFEA 3N76A 3RHSA 3UQYS 4IIBA 4DCCA 1CC1S 1YVPA 4LOKA 1PDOA 1LDMA 2IYEA 2V7QA 3HCEA 1NE2A 2VNHA 1N3IA 4WZBA 3RK0A 1D2CA 4GL4A 2VXBA 3URMA 4YCLA 1ULBA 1DIHA 3IBTA 4U0JA 2WWGA 2P30A 3ROGA 3T7SA 3I72A 5EE0A 1PTJA 1MV8A 3PEEA 1LGYA 4I4NA 2VIIA 4L57A 3LFUA 4JEUA 1JEQB 1A8SA 1JHOA 5GOZA 7REQB 3DE4X 5IT4A 4FSHA 4E4TA 3ELYA 2XJ4A 1PGNA 4GSLA 2IPXA 2WIAA 1QH9A 2OCXA 3RVBA 3WMGA 3AEQB 2G6BA 2DXIA 3OIVA 2FEXA 2BHSA 5ALWA 1SQGA 5EVCA 2O59A 5FBWB 4RCVA 5EXDA 2ZANA 2ZPAA 4CLDA 3A6ZA 2QN2A 3NOOA 1HOXA 1LA2A 1NR1A 1D9XA 1EK5A 1I3LA 2VCHA 4BZXA 1BD4A 4KRFA 3BT7A 4NDAA 3COVA 5JYEA 5L4SA 3EMKA 4K6KA 5AMXA 5IJ9B 2LR0A 3EDOA 4BS9A 3IEKA 1TAGA 5FUWA 1VZ3A 2W8BA 3FNEA 1YBMA 3DMHA 2IYPA 2HGSA 2NVOA 1T2UA 3LZDA 4L72A 4OUDB 1MDBA 4Q02A 2WKRA 2GEUA 2PX5A 1EFDN 5L8VA 1PR5A 3CA8A 3IS3A 1XZPA 3W05A 1Y89A 1M2JA 2ZJAA 3HCRA 2RC5A 4H1UA 2TMGA 1C1DB 4LHSA 3L40A 4PR0A 4X8OA 3UB2A 5IRCD 4X85A 4DLWA 2I9PA 1YJ5A 1UC5B 2KWIA 1W5FA 3ZWDA 4MR8B 4YO8A 3NHZA 4EKYA 3TMKA 1YKGA 4K9SA 1IG0A 2NXCA 1U7OA 3M3HA 1QG0A 3NTXA 5BSEA 1X1EA 1DXOA 4AWXA 4BZPA 4XGNA 3A3OA 4NBRA 4LFAB 1EG7A 3FDFA 1USVA 3IVCA 1FMJA 4H1VA 4EABA 5JD4A 2ID9A 5JNLA 2IYWA 2YJTD 2AOTA 4PG6A 1EE2A 3IJPA 5E7IA 1I7PA 4MYHA 2KHZA 2P40A 3JQPA 5FH9A 3CRZA 2YHSA 2D1YA 2FN9A 3QEMB 4V02A 4PV7A 1RYFA 3DUFA 1VJ1A 1LTHR 2RKOA 3EYAA 3K05A 4ND8B 4Q3KA 4TVKA 4AZVA 4CEHA 1EB9A 1ZN7A 4QODA 4C5AA 1L5OA 2HJWA 4LRWA 2QGFA 1B6TA 1Y6JA 3HZOA 4PX5A 2ZSDA 2Q3BA 2ZVJA 4W8GA 1DBSA 4WN9B 1TCAA 5MGBA 5LP6C 1YNOA 2A7XA 1SXJE 4K28A 3H9EO 3C6YA 5DP1A 5A3RA 3I5AA 2OVFA 3MTIA 1G1AA 2ICAA 4QQFA 4X20B 1F6DA 1QZZA 5DTQA 4EFNA 3R3VA 4HNQA 1WCXA 4ENPA 3KLMX 2BC9A 2Q6TA 4PBTA 3TW0A 2GT1A 1LXCA 1IG3A 2JGLA 3C1TA 1WUTA 3K35A 2YJ3A 1PSDA 4WACA 1N8NA 1VI5A 3BS4A 2EX4A 3MG9A 4HB0A 4HXFB 2IDZA 3JYHA 3ULKA 1E9FA 3C6KA 1HEYA 3TBFA 5DGHA 3ZLJA 4BMVA 4GU5A 1EFLA 5DN9A 2GEFA 3FSJX 2Z8XA 3NGLA 4NATA 5KDOA 1IBLB 1GQOA 1IYZA 3VKGA 5HQ3B 1VBFA 1IY1A 2RBGA 2RGXA 4O2LA 3OUZA 3O4GA 2CMHA 2W11A 3VKWA 1QCYA 2ATCA 2AB0A 2NU6A 5IUNC 4B3TB 1R6UA 2CNBA 2ZYTX 2XE4A 3OEYA 3PDHA 4GC9A 3DPIA 1UMBA 2EEPA 3F4BA 4FZJA 1X39A 1CCWA 1U1IA 4OHKA 4TYQA 3RBZA 2OP1A 5JH7F 4W5NA 3VR5H 3VR4H 4EW2A 1RIIA 2QR2A 2FPIB 3OETA 4R6XA 1JA0A 4NNJA 5E3JA 2R1ZA 3BYZA 4BVEA 2BEVA 2XWJI 3IVXA 3OPYA 1F8YA 2CUKA 3EA4A 4G1BA 4B2YA 1T2VA 3AI3A 3RYIA 2HU5A 4E32A 3FY4A 4M46A 3FRIA 5KHOC 2PQ6A 2QD4A 3SXUB 2EKPA 1ZOIA 3NTQA 3V4LA 5TMEA 4HEJA 5C8DA 2DHDA 1N78A 2ZBQA 1UEIA 4LDZA 1G7SA 1ODJA 5F3WB 1P75A 4FJ1A 5T57A 3UJ8A 1J1UA 2FSVA 4LUCA 1YB4A 1EUCA 3F2IA 4ZYYA 4LF7B 5KBYA 4WK0B 3Q3CA 4J43A 3CJTA 4P82A 3NUGA 4IPTA 4X93A 4TTVA 1JG6A 5ECWA 1XTJA 3H9GA 3GGGA 4GMKA 2Y0CA 2HMWA 3EMDA 3V8BA 1Y8RA 3KELA 3LVRE 1BOFA 1UK9A 1GZ6A 3L8MA 3T1NA 5FUMA 3EPRA 1E2QA 1NF3A 3GZTB 1C4XA 3R7SA 4DC9A 1W35A 4RA9B 2J9RA 2IHTA 4DTIA 4OPMA 1P19A 2Y1CA 1ICIA 3L0OA 3FPGA 4PC2A 2NZYA 1F8UA 2NUAA 3ESAA 3NT4A 1NBMA 3OZWA 4NJMA 4ALMA 2CLSA 5HUQA 4ZO7A 3IHWA 3RLFA 3OQIB 5DCUA 5I9NA 1FA9A 2HCBA 2YBDA 4UEJA 4LKOA 3A3PA 2ZAIA 3SEQA 1MAAA 2ROQA 3JARB 2R5FA 1EWQA 2B8WA 4PS1A 3MRXA 3OM1A 1OKKD 3CCFA 2P7HA 2WWHA 4TV9A 5T41A 2CHUA 1UKCA 3GFQA 1QMGA 2FPWA 2XNHA 1G3RA 1P7PA 1Z2PX 3TNLA 1XXHB 3UB3A 3RM3A 4JBYA 1VG0B 3K6JA 3JZMA 4YJFA 1PVDA 2DRIA 2WZBA 4C4AA 4AYWA 3ECCA 1YZNA 5JJCA 2Q0QA 3HV0A 3OKFA 5K8IA 3FBWA 2RH5A 2ZSUA 1UF9A 4MV0A 2HK8A 1UK7A 2IU6A 3BWYA 1RJ9A 4U7HA 5HRCA 1BRTA 3H5TA 4ANFA 4B2PA 1XCPA 1FS6A 4WFQA 3UAVA 1L5HB 4DXHA 3HO6A 3WYAA 3WGUA 3OFNA 3Q8LA 3I9NA 4IJQA 3FCUB 1CR2A 2XW6A 3K0FA 1YKSA 5DOZA 2A30A 5BN1A 2H1WA 1T1JA 1JECA 1UDRA 2H1HA 4ABYA 4O08A 4DBLE 1BVHA 4RHFA 4AIRA 1H0SA 2XNDA 3ZDCA 1I4TD 1ISSA 3OOEA 3EXIA 4KQMA 1E8DA 2X13A 1IZ7A 3GRFA 2BGTA 2YVUA 4LBZA 1VB3A 4ZOLB 3C4QA 3TD6A 5B55A 2IYVA 5KVCA 2P2LA 1KQ3A 4XM2A 4P3OA 1A9TA 2QXUA 5JVDB 1HDRA 3IPLA 5JH7A 3HB9A 4UNSA 2B6NA 4YRMA 2QJRA 4KV9A 621PA 2QRHA 1N6NA 3N2NA 2PUVA 3FX2A 4G5OA 2AN3A 2H7YA 5AICA 1WM1A 1H93A 3ZJUA 4K1XA 2CXSA 4IJ5A 4BZQA 2HRDA 4C6SA 1EGAA 2J32A 2R8ZA 2QN7A 2VDQB 2D0PB 3L0YA 3SJ7A 4BZWA 4F5WA 5BR8B 3TZKA 1GNQA 2E1PA 2X0IA 5KQPA 3TQRA 1X80A 3NTOA 4KVGA 5DW0A 3ZTYA 1BWRA 1GZ5A 2Z8ZA 4RX1A 4YLEA 4R81A 2VSXA 1IUOA 1PZNA 1G7CA 1V8DA 2Z95A 3P32A 4WAUA 4EY3A 1PFUA 4BNUA 4RE6A 2DWQA 4FFVA 3GUZA 4QDXA 1ECLA 4QDOA 4EB6B 2RARA 4EYKA 1YR6A 2OZLA 2X3YA 4EB3A 1HYHA 1WZCA 3OCUA 3VPFA 4BBPA 4DA8A 4DMLA 3T7EA 1U8EA 1W1UA 2PZMA 3F97A 3H5RA 3IIKA 3S68A 3ZGZA 1U3GA 4IIFA 3INRA 3WMEA 1L8QA 1AA9A 1FMCA 2CHVA 2RGEA 4NCXA 4PZDA 4R2IA 1RQ7A 4N12A 5FTWA 4DPKA 4HUTA 2BSXA 2JA2A 1EIWA 3R6DA 3RF7A 4HPWA 4PCAA 3H2IA 3VOAA 1LWNA 1RRKA 3BE4A 4Z3OA 3BXPA 4AMGA 3EIOA 2H0RA 2V97A 1IE3A 3BKWA 4DCPA 3AG5A 4BFUA 1YUMA 5ALNA 4EY6A 3UW3A 1QWSA 2C5GA 2CVOA 4MDHA 4TKUA 4AULA 4EJ0A 2HV9A 4CQLA 2PKXA 4BVFA 2A57A 3FGZA 3UUWA 3ZW8A 1RRMA 5KYUA 3ETJA 3B5EA 4UAUA 3WKAA 4I19A 3CTPA 1FDTA 5TY0A 4BFYA 2Y05A 3LA6A 2AG6A 4Y7CA 3VNVA 3CGWA 2PX4A 3PF8A 4QELA 3RVNA 3ASYA 3U44B 3LUAA 2G3YA 2J5RA 3O7WA 4XB6B 3W6OA 1ZK2A 3AEKB 3AWDA 3MSXA 5BSTA 2PGLA 2WM8A 2JASA 1FE8A 3ZE9A 4HYQA 1RMYA 2C29D 1QHHA 2VNJA 3GRYA 4FZ3A 4HMQA 2FWRA 4HRAA 2C7RA 2J0SA 2PUDA 3GXBA 3IYLW 4OH1A 1W4ZA 1Y3AA 2ZFUA 3I9V1 2QV7A 3PDUA 3KLNA 4GYWA 3ZEAA 4JEMA 5C7IO 5CEEA 2Q9UA 2VHQA 5AJHA 4XIGS 1R16A 4YQZA 3AR4A 3TRJA 2BEKA 1FB5A 4M38A 1R0CA 3ZY6A 2ZSHA 4IJUA 4Q5IA 3NWOA 1T5IA 2YW2A 2XYVA 4JXJA 4QJ4A 1YOBA 2H51A 1T3LA 4G8BA 1XQ9A 4LOIA 1PP4A 1B8UA 1P2BA 2JFXA 3IBCA 4IHAA 2I6XA 2C20A 3G0DA 3M34A 3PLAE 1EUYA 4BX2A 2WD9A 1YJ8A 2A6PA 1E9EA 2J6BA 3LPMA 4CLRA