1U0OC

The mouse von willebrand factor a1-botrocetin complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
195
structure length
195
Chain Sequence
FYCSKLLDLVFLLDGSSMLSEAEFEVLKAFVVGMMERLHISQKRIRVAVVEYHDGSRAYLELKARKRPSELRRITSQIKYTGSQVASTSEVLKYTLFQIFGKIDRPEASHITLLLTASQEPPRMARNLVRYVQGLKKKKVIVIPVGIGPHASLKQIRLIEKQAPENKAFLLSGVDELEQRRDEIVSYLCDLAPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Botrocetin
publication title The snake venom protein botrocetin acts as a biological brace to promote dysfunctional platelet aggregation
pubmed doi rcsb
source organism Mus musculus
molecule tags Blood clotting
total genus 70
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1u0oC00
2VDLB 3EOAI 3ZQKA 1RS0A 1N9ZA 1IJKA 3M6FA 1PT6A 3VI4B 1PD1A 1M1UA 2I6SA 4C29A 3TXAA 5KYWB 1JV2B 3E2MA 4A0QA 1NA5A 2ODQA 1BHO1 3PPYA 4WK2B 2WINI 3V4VB 4IHKA 2VDMB 4HQOA 3F78A 1Q0PA 4G1EB 1JEQA 4HQKA 3PPVA 1ZONA 1PCXA 3EFOB 1YVPA 1XDGA 5E6SA 5E6RA 3HXOA 4WK4B 1MJNA 1AO3A 1AUQA 4JDUA 2M32A 2VDNB 1CQPA 3EGDA 4F1JA 4HQNA 4NENA 1QC5B 4C2BA 2NUPB 2ADFA 5KYUB 1MHPA 4XW2A 2B2XA 3K71B 1AOXA 2I6QA 4WFQA 3ZE1B 3VI3B 3ZDYB 4DMUB 2NUTB 1IDN1 1YVRA 2VDPB 2WW8A 4BJ3A 1SQ0A 3N2NA 1XDDA 5KYXB 1FE8A 4HQFA 1V7PC 1U0OC 5HJ2A 1U0NA 1RRKA 2QTVA 2VC2B 2I91A 4UM9B 1QCYA 3TW0A 3BQMB 1BHQ1 3T3PB 1UEXC 3TCXB 1IJBA 3K6SA 4Z7OB 1CK4A 1JEQB 3NIDB 1L5GB 3ZDZB 2VDQB 3K72B 3T3MB 2VDRB 4CN8A 4WJKB 2NVOA 4F1KA 5E6RB 3RAGA 3ZDXB 5KYNA 2XWBF 1TYEB 2IUEA 2O7NA 3EGDB 3FCSB 1MQAA 5LN1A 2VDOB 1U8CB 4O02B 4NENB 1T0PA 1FNSA 5KYYA 2ODPA 1JEYA 1MQ9A 1ATZA 4MMXB 4UM9D 1M2VA 3EG9A 1M10A 3IJEB 3IBSA 2X5NA 3EGXA 4NEHB 5E6UA 4Z7QB 4Z7NB 1DGQA 1M2OA 4IXDA 3EH1A 1T6BY 1IDOA 3QA3E 4HQLA 4WK0B 2NUTA 2XWJI 4CN9A 5KYWA 4PN7A 5ES4B 2XGGA 4M76B 3NIFB 5E6SB 5KYXA 1SHUX 4FX5A 3V4PB 3NIGB 4UM8B 3K6SB 1MF7A 4C2AA 1SHTX 4MMYB 2VDKB 1OAKA 4G1MB 5HDBB 4MMZB 4IGIA 3TVYA 3EFOA 3ZE0B 3FCUB 1RD4A 1RTKA 3BN3A 1ZOPA 3ZE2B 2ICAA 3EH2A 1ZOOA 3BQNB 5KYYB 4CNBA 3HI6A 1JEYB 3F74A 1QC5A 1PD0A 1JLMA 1DZIA 1M2VB 1XUOA 2NUPA 5KYUA 3PPWA 3EG9B 3HXQA 3GXBA 3Q3GE 1M1XB 1MQ8B 1LFAA 5BV8A 3EOBI 3EGXB 5HGJA 5E6UB 1N3YA 3PPXA
chains in the Genus database with same CATH superfamily
1TMKA 2JARA 1N7HA 3FMVA 3M5PA 1ULTA 3PTAA 2YV2A 2OAQ1 4PQGA 5LQJA 1GQRA 4QUAA 1KOLA 2HIAA 3CNNA 3QRWA 2DPYA 1EVLA 2BBWA 5SY4A 4IFIA 4B3MB 2I7VA 4F3RA 1MRNA 3NJRA 5EFOA 2FMIA 4N5DA 4WOCA 5I4CA 4CEJB 3NTUA 4P33A 1OW3B 4NU8X 3TLMA 4G86A 1D6MA 1TYAE 1EVJA 2YJ4A 4PYMA 2ZYGA 1IHDA 2QMZA 4YAWA 4AU1A 3EGEA 4JLAA 4WK4B 4K3VA 5DM1A 3T3EA 3QLVA 4OP2A 1FS4A 5T4FA 4C2TA 4X8OA 2CZCA 4ZP1A 4RJ2A 1KXJA 1SCIA 3HCRA 1J2EA 4NPAA 4R8MA 2IYOA 2H1LA 3F8TA 3G1UA 1EVIA 3PEVA 4UPEA 4IIJF 4ZK6A 5FTJA 4X92A 3WNVA 5K0GA 2H4FA 3LHFA 2XSZD 3RC8A 2UUBB 2JJ1A 4D3YA 3LVFO 3OIWA 1H0HA 2X0JA 3O9VA 1IDN1 2PANA 4ASUA 5DBOA 3AHHA 2WNSA 4N41A 3FUUA 4HWOA 1GGHA 2DMRA 1DS6A 1L7MA 2BGMA 3DBHA 3ETLA 3QVVA 5ALRA 1TQ4A 3LF2A 3D3JA 3NFRA 1WF3A 4XAQA 3JQBC 3SF0A 1PGJA 3OLWA 2GK4A 4E3ZA 1FLNA 1Y9AA 2J3DA 1D9XA 4B43A 4BO9A 3VOTA 4HMPA 2GPWA 8ADHA 4LJLA 2W71A 1SBZA 5AXBA 3UA4A 4WLVA 4AD8A 3R40A 3T3MB 2VP3A 5EE0A 2YV1A 4RSRA 2X5JO 4OHKA 1G42A 3QKSB 5AKEA 4G0XA 3LUJA 3TTYA 1QTQA 1OASA 4FFVA 1P1BA 4FHGA 1HLDA 2VAVA 1LSOA 3TRIA 2Y1CA 1GG8A 4BRUA 1BX1A 2WJPA 4YAOA 3SE0A 3T9CA 1VPDA 1NU8A 1H2HA 1SCQA 4YMGA 4EA8A 5FTMA 3I0NA 1PNTA 3H3FA 1FFHA 1YKSA 2SHKA 1PG2A 3UV3A 4ZRDA 5TS3A 1L5NA 1GRRA 1HKUA 3MLEA 3P1JA 4TMXA 4X1YA 2AWOA 2H06A 3U7QA 3C6BA 1R6UA 4AQDA 1TO6A 2H08A 4FINA 3HWSA 5EG5A 4RPHA 3E5HA 5MFZA 3NGXA 1Z25A 3X1JA 1HLGA 3A27A 4WV3A 5JAIA 2NWQA 4C0QC 4URFA 3EIWA 8LDHA 1C41A 4MR7A 4DHWA 4ZN6A 5D86A 2RH8A 5CT6A 4I8XA 1FW6A 3O3NB 4C5CA 1G21B 2C2MA 3ZY6A 2QXYA 4DLAA 3R5XA 1XQ1A 2M6RA 4PFJA 4RQBA 5AJZA 3UFXB 2D3TA 5GMOA 3RPEA 3DNFA 3VO9A 4LVNA 2WQ7A 2W2NA 2Y1KA 5MN5A 1BD4A 3B13B 4HGNA 4RNCA 2A9RA 4C6SA 4Y2PA 4DA8A 2D00A 2V6BA 3AVUA 3ROKA 4ZJYA 2IHTA 2X2PA 1NVTA 4KLNA 2VPXA 1OD6A 1ESNA 3C5HA 1VPWA 4B3TB 4BKQA 1LFAA 3RUEA 5KUTA 2BGGA 2OUIA 5DKFA 1E77A 1GA6A 1FBNA 2Q27A 1D2EA 3TOCA 2G80A 3HU5A 5FQOA 3U2QA 4HDNB 2J9XB 3TD6A 1MOQA 2FK7A 3NHJA 2FGKA 2RH5A 3MIZA 4Z5XA 2IYLD 5FL7A 3JD1A 3WFJA 4ZTUB 4JSRA 4GKKB 3FYUA 3MGKA 4XWWA 1IATA 4M8SA 3W5HA 3ZU3A 1SN7A 5CW1A 3M4ZA 3MD9A 1TZCA 3D3KA 4TXMA 1WXIA 3PGA1 2GXSA 4G1EB 4OB8A 5L3ZA 3RVQA 4EKEA 4JLPA 4P92A 3IPAA 3PVSA 4JEHA 1LDYA 3ZTYA 1PT8A 3T7DA 3D2AA 3JQEA 4YP9A 4F3TA 2COKA 1V41E 2FFRA 5G02A 4HNAA 4GRDA 3UNXA 2BY4A 5KTPA 2DEUA 1YZHA 5DHSA 4UMVA 5TDHA 1JHQA 1PJAA 1QVVA 1R66A 3Q0EA 4FKZA 1G4AE 1GYRA 4MGEA 3Q8MA 2GARA 3Q11A 4KQXA 4ARZA 4E2XA 2ODBA 3TLKA 4TTTS 5IC6A 3B6KA 1JE0A 1A4XA 4TYWA 2QRLA 1Q57A 3C45A 4CL0A 1JPUA 3WGOA 2APJA 3K6RA 4MXDA 5AUQA 1Q6ZA 5IAAA 4LF5B 4LOIA 2PJDA 1R3UA 3B53X 3JU3A 4Y2JA 1V6AA 2Y4OA 3ZV7A 1UOQA 1JPJA 1GG5A 3OQ6A 4L6CA 1JJIA 1FDIA 4ZCLA 3R7DA 3SC4A 1C1DB 2X8BA 2EZ8A 3FW1A 3HA7A 2VK1A 3NHLA 4II2A 1OX4B 4C4SA 4JROA 2CBXA 1WQ4A 2QYTA 1I2BA 1TD9A 1KOJA 2G3YA 1XLVA 3OEYA 3R0QA 4M9SA 3S2ZA 3WKAA 2AEEA 1I24A 3TMKA 3I62A 5EJAA 3CLTD 4X3CA 1QR2A 3D8RA 4U7PB 2GEUA 1Y5RA 3C15C 1ISRA 3CNLA 4PLYA 1DAHA 2FCRA 1I30A 4G63A 4Y67A 4F2PA 5ALXA 1MOSA 4QREA 1P2GA 3MCZA 4Z7NB 3THWB 5LM3A 3EXFA 3ZDQA 3C1AA 3UXEA 4EVRA 4YMVA 1WF6A 1YUBA 3PYMA 2KPOA 3STVA 1SAYA 1H93A 5DMXA 1ZQ1A 2FVYA 2BH2A 1C0IA 1NQWA 1T5SA 4CMEC 1FJGB 1BXZA 1J7JA 2XDQB 2ZRDA 3G2JA 1X9GA 4G85A 4G1MB 3DAPA 3GEIA 2X7XA 1LNZA 3I73A 4JT8A 5JCOC 1N3IA 3LLCA 1GPAA 2EJBA 1I7NA 3Q87B 3GD7A 2O0JA 1DC8A 3O94A 1G0NA 5I7RA 1V8BA 2Y92A 2EFDB 4U8HA 4Y6QA 1HE1C 4D4IA 1JXQA 1O8BA 2O52A 3GBVA 4FGLA 4ZYTA 3UGKA 1I2MA 4IG4A 4FT4A 3BD7A 3DHWC 4NBLA 1T0BA 5H59A 1ZITA 2J48A 2HLNA 4I7EA 2PCJA 4Q4AA 5LQKA 1XDUA 2CXSA 1W4RA 2RKOA 5K2MA 1T9CA 1SR8A 2OLJA 4B4DA 2BM0A 3X2SA 4IDCA 2GJ4A 1J8DA 2P9TA 4L95C 4MOWA 3T1QA 3ZGLA 3U19A 1FXWF 3IPXA 4GWGA 3EXIB 3RVOA 4QXOA 1BHO1 1T0UA 1CVLA 1FYVA 1LLCA 1KU0A 3RDPA 3OP1A 3QXJA 1GM5A 4CF7A 4JLWA 2XZDA 1E64A 1HYHA 5B2ZA 3I9KA 4G1FA 4A1OA 3NHPA 3ODPA 4QTYA 1J2TA 3BD6A 4GZMA 2ZI9A 3AV3A 3OF2A 2DSNA 1EXMA 2JFWA 4HNUA 5IXYA 5KC9A 2DR3A 4C3ZA 2FDXA 4GMXA 5L45A 4BMYA 3P5SA 3ZIDA 4CV0A 1QTRA 4OHVA 1DJPA 1VL0A 1RU3A 1J33A 1Z5WA 2XB4A 2YDYA 2GEJA 3CS3A 3TD2A 5AUNB 3DLHA 2O5EA 2QW8A 1OLSB 5FHRA 3R1IA 2EJVA 3S55A 2XB9A 2B6HA 2BFBB 4YONB 1IBKB 5JAZA 2WSSD 1OFTA 2C9ZA 5IM4F 4N5LA 1T4GA 3HRIA 1XDDA 5U4QA 3ZCQA 1OHHA 2K4MA 1DZ3A 2PX2A 3EA5A 2PZMA 3MWJA 2X0FA 5AWFC 5DTIA 3WL6A 3GJ4A 3I0MA 3WGLA 3A4TA 2P91A 4JLKA 3O4GA 3ER8A 2VQFB 4MWZA 4EUNA 2XYQA 1EGHA 3Q6NA 4HS9A 2FPRA 2Z2XA 4L07A 1CJCA 3ZNPA 1IK6A 3EC7A 3MCUA 1DC3A 4KPFC 3AVOA 4QICA 2RHLA 4DUPA 3ZDBA 8MHTA 1OXUA 3FSRA 4PTZA 5DSTA 2PSJA 1S2LA 2QROA 2O23A 3F49S 1D09A 2GNOA 2BHRA 4WLUA 3CH4B 2CK3D 3ABSB 5HMLA 4A8PA 3JSXA 3M6MD 4F5EA 1IJFA 2CFOA 4MINA 1YQQA 3DV0B 3HU1A 1RI5A 2C4UA 2W6CX 5FOTA 3ZBPA 3RAJA 1Z63A 3RK0A 4KRGA 1SCJA 4LDJA 1MQ9A 1T5IA 3ABOB 4HLNA 4KWIA 4UM9D 1N6KA 5AI6A 4OQXA 1BMFD 3VMFA 1Q0LA 3M1LA 4EFNA 1B42A 1QTIA 3F6CA 1L4LA 1PJRA 1Q1NA 2OZEA 2QLMA 3QLVC 1T8PA 2BTQA 4PGMA 1TC1A 4D8XA 1J8FA 4HATA 1TKAA 4WCDA 2QSYA 1IUNA 5CJPA 3WYNA 4DNPA 3LP5A 4R4JA 4DIEA 1ZZEA 5HRCA 3AL0C 2X9GA 5FBWB 4B8WA 3AIOA 1BXRB 5CX4A 1QGZA 1DBIA 4DEVA 4PN7A 1Q7EA 1QYWA 2HKIA 3ACBA 4GYKA 3UV6A 4G0MA 5BWMA 1MZVA 1HORA 4UOZA 1NI3A 3IDZA 4PC7A 3RS2A 3RQIA 1NPYA 1AGXA 3T5DA 2AQKA 3R5KA 2IX3A 1YCFA 2X0KA 1ZD4A 4P4TA 3MVEA 3GJ0A 2HC9A 3AIKA 3RKUA 4KMRA 5HQ3B 1T1RA 3JWIA 1YS4A 4EI7A 3I6ZA 3RUHA 5T6MA 1GUDA 3EZ7A 3IKJA 3PEYA 1FNCA 4R2XA 4WFKA 5BT9A 1SK9A 3R7SA 5EMNA 5IRCD 4ZREA 1FUEA 1A9SA 1Y9JA 3GLGA 2C7OA 1OVGA 1OBVA 1XMPA 2BBTA 1T8UA 2VAMA 3V2HA 5JPCA 3BFKA 3G0OA 4D5EA 5BV8A 1JWBB 1X6VA 1L6IA 3IRVA 5B58T 1XCLA 4DMRA 1XXLA 2V7TA 4PR0A 5J5CA 3R5FA 3T12A 4D9CA 3ZNNA 2FWAA 2FCAA 4MVWA 4Y2RA 4HDMB 3TRFA 3A3NA 4Z0TA 1UP6A 2BM9A 3JWGA 1O5IA 4CHTA 3AFIA 2C61A 1WRBA 2DBRA 1NHWA 3FZEA 4Y1GA 1YIDA 3M34A 4HYYA 4MVJE 3N2KB 2PLWA 4GW3A 3ICCA 4ZVMA 5DO9A 4K1XA 2NTJA 2O8CA 3F71A 3VU9B 1AS0A 1F0PA 2UYYA 1QM5A 3C39A 1ZG3A 3GRPA 3GLIB 4CXMA 1HM5A 1SG9A 3CR8A 5B37A 1GG2A 1FVFA 4CR8A 2QI9C 1QBKC 2QRZA 2VCHA 2F48A 3CZ5A 3H11A 2PH1A 3HG7A 2ABWA 4CLRB 1ZJJA 2BGRA 1P7YA 3R8CA 1JWAB 1LNQA 2OPHA 1PZEA 3FY4A 1AS3A 1PSWA 1PVOA 1QQAA 1NN0A 1U81A 4KHZA 3RS4A 5HCUA 1KR2A 1PR4A 4N0QA 1YB6A 3RIEA 1F0KA 4ZO7A 2XRZA 3VZDA 2D62A 1ZPDA 2PX3A 1VYVA 3L77A 5E8JA 3RC9A 2H57A 4KJZA 2D1YA 5D1NA 4GPBA 4OFWA 3NI2A 1VG0B 4EKGA 4EYQA 1YJQA 3GJYA 1J39A 3HMKA 2EJCA 3MJEA 3RREA 1DAEA 1MJGA 1WZNA 1XN1A 1XTSA 4EG6A 4CKCB 3DDNA 1JDVA 4OQ4A 1DKPA 1SUIA 3HUFA 2B1RA 3HBJA 4FVTA 1NTOA 4EB0A 2FEWB 3REQB 2YINC 3A70A 1T4BA 3AF5A 3I9V6 4J1TA 2B2CA 1O95D 2OCLA 4PPNA 4R2KA 5FBRB 3GFGA 1W36C 2EW2A 4KBYA 2YW9A 4F93B 4M83A 2FPOA 3WKDA 3SG0A 1QCZA 1RYEA 1CUHA 4JA0A 3I72A 2B1JA 1M1NA 2L82A 2ZK7A 2BUCA 4J49A 2ONCA 1RAAA 1M1YE 3E05A 3OT5A 4ZOLA 5BSRA 1DRUA 1V43A 2XCLA 5J40A 5KCZA 2IH2A 4H1TA 4HB2A 1ZUWA 2H4HA 1YS7A 2X9LA 3M0EA 1UP7A 4LHEA 5EI5A 3CURA 5JD3A 4BGVA 3YASA 4Q48A 1KDZA 4V0OA 4A73A 2YXNA 4RTNA 2R1UA 3O73A 3OPMA 3TGPA 3M9WA 1Q77A 1QGYA 4R41A 3CMCO 4YRFA 3V1MA 1SXJE 1MAAA 2EIHA 1NUQA 3H6KA 5ENVA 1WHTA 3TSYA 3LH5A 4WSOA 4F04A 5JFGA 4EG5A 3U4QA 3IOEA 3PICA 4TLEA 5B3LA 2FR8C 4KSCA 3WDMA 1DC6A 4RY0A 2WSSA 3AUYA 3QPUA 1CNMA 1O6CA 4PQEA 4MNTA 3BKWA 5A4MS 1JQEA 3ELBA 4JLVA 4EYKA 4C03A 3SIPA 2YOHA 2E0IA 3WAJA 3ADCA 4RBNA 1JMKC 3IQEA 4Q4HA 5KTKA 9LDTA 5F9FA 2O2XA 1A76A 3DJFA 16PKA 1DCFA 1Q3HA 3QGMA 1L8AA 1XYVA 3QKWA 2B0JA 2YMMA 2G8NA 2R3SA 3WOVA 4EY5A 2BFDA 1FMFA 1SXHA 1U9IA 4IRUB 4A6DA 3DPSA 1CJMA 4LFCB 1TEZA 3OPYI 5KAMA 4ZIRA 1XD9A 1R0XA 1W1UA 1GPKA 1M6HA 2CMHA 1CLEA 2JFQA 3T7SA 3UAWA 4AIRA 4YRZA 1F6DA 1J0DA 1KBZA 3LQQA 5LB2A 1W5BA 4JB2A 4KQ6A 2OXEA 2QR5A 3WMRA 2LP4Y 3QSYA 4AROA 4R81A 3WK5A 4B48A 3I53A 2QWXA 4RIIA 3TAHA 4P32A 4K7JA 2J9FB 3AEUB 3AVXA 3IIEA 5LKAA 1UOEA 3DG9A 2ONZA 1OSNA 3R3HA 3Q7TA 4JI6B 4BQOA 1OIVA 4ZYLA 1DADA 1NN1A 1N2CB 1P2DA 2XD9A 4R05A 3AILA 4MAAA 1QK4A 3W78A 4B32A 3WGUA 1ISSA 1X87A 4KVZA 3LPLA 3L7OA 1RWVA 3P2OA 5H8WA 2P4HX 5TQ2B 1ISFA 4UEKA 5J4KA 2SKCA 4GOJA 5BMOA 2N3ZA 3I6QA 3RARA 2JS7A 3B1WA 4GX1A 4ODIA 2IDKA 2XT6A 1JBKA 3ICEA 2PXXA 2O2HA 2XADA 5K8JB 1U1GA 5EJEA 3FCEA 1SKYE 2IW1A 4BNNA 3ZQ4A 1C7JA 3K94A 3H2HA 5JBQA 4X7BA 1S8AA 1J24A 5LQNA 2X4GA 5LSAA 1M6NA 1UPFA 4I55A 3FR7A 2OMEA 3AVVA 3N2NA 4QT0A 4RDHA 2ZYWX 5A1TA 1IHUA 1E2GA 3EZ9A 3ZY2A 4DMKA 4LZPA 5GOZA 3LYLA 3DO6A 4CKYA 1ST3A 3UICA 3H3XA 2QGZA 1A82A 3ZEIA 4LZWA 3GLFA 1N8KA 1P1RA 3PGLA 3COWA 1U0BB 2YXLA 3WRYA 2ZYTX 1RAGA 4BWGA 3FOFC 1UBUS 2ZUSA 4YCNA 4L9RA 1PFUA 3WYGA 4DR5B 4WZZA 3EWIA 3K4HA 2LTAA 3CTPA 2XCIA 5DIFA 5LN1A 2NPFA 2UZAA 4IRXA 2A57A 3GC6A 5JZBA 3O91A 1D04A 2AUMA 5LMNB 4PCVA 5CVEA 4PLTA 4I3GA 3A9WA 3V46A 1E2HA 4HGQA 5ECWA 2I62A 3ENKA 5DLYA 5JJLA 4KREA 1YMUA 2BC9A 5KJCA 1WLSA 3DBHB 4HEHA 1QE3A 3AEXA 1Q0TA 4RPIA 1E9CA 3BYZA 1C0PA 1BOOA 1IG0A 2H9IA 4TQUS 4YR9A 5TC4A 2C4KA 4EY7A 4BP1A 5ESDA 2OR3A 4CMIA 4MGIR 3F3YA 5F35A 1BROA 1C7ZA 2CXNA 4OLJA 3THOA 4BVGA 2AOUA 2P2DA 1QZ3A 3ANNA 3AEYA 1GRVA 2ZJAA 4ZJZA 1E3MA 3F47A 1I01A 3AEKA 3DBOB 3N5KA 4QJ4A 4HDQB 5KKNB 1UDWA 1Z4KA 3C7DB 2A0YA 2PWZA 5DIZA 5CT8A 3K4QA 3DL2A 3MHTA 5D1HA 3OJXA 4WGGA 5HKKA 3DV9A 3HFGA 4DIFA 3LIPA 3M6WA 1KYXA 3ZQUA 3LF1A 5JLJA 1TJ4A 1VIYA 2OV4A 1R2QA 4YALA 4EFKA 4X1YB 1CXZA 5C8VA 3MAGA 4MV7A 1O95A 3FFBA 3FTPA 3FAZA 4YPOA 1BOFA 3U7QB 1E96A 2UZ4A 4EUKA 3ZKWB 2Z5VA 1H1LA 4NFYA 3UA3A 821PA 5KVQA 2WJGA 3F1LA 3PE4A 2YN2A 1W87A 3VVMA 1CUVA 3EMDA 1E9BA 1L8LA 1PZMA 3NEYA 1EQAA 4N82A 2HF8A 2FG6C 3OIDA 5ICGA 4MA0A 5EXSA 3D6VA 2KW5A 1Z3IX 2H2HA 3LDFA 3PL5A 4JI4B 2Q28A 2DZDA 3KTDA 1ULZA 3RTCA 1WM1A 1P4JA 3EZ6A 1NVGA 2WIDA 1R5BA 3S28A 3CB2A 3JALA 5K3CA 4B7CA 2FA9A 4NG5A 4TM8A 1NW5A 3IXLA 3CGWA 3EEIA 1DKNA 1Z5GA 4QDXA 2FDCA 4GX5A 2DQYA 2HCBA 3SQDA 1HYEA 3VNBA 4DGSA 3G7NA 3ZGVA 4DLYA 3HM9A 1V35A 3H18A 4EKYA 4BY9E 4UDYX 3ID6C 5B3KA 2MOKA 2Q9BA 4IXTA 5T5QA 2PS1A 5UKDA 2FZLA 3LBIA 4P4GA 3TQOA 4O4HA 5CXUA 2XQIA 4W4TA 2I5PO 3WQBA 2NO5A 3H2GA 4M8LA 4XWYA 1JJ7A 2C7VA 1VPTA 4KVGA 4HNRA 3R0ZA 3HEAA 5EKTA 3QU4A 3V4ZA 4Y6PA 5MN4A 3FHJA 3JR3A 5IAKA 3P4UA 3FYUB 2IJGX 4KI0A 3SR0A 3VHQA 3RJZA 2E5LB 1Z12A 4X8LA 1Z0AA 4G01B 4Z7OB 2WF8A 3WIEA 1LTHR 4FEGA 2B36A 5KVCA 2D2FA 1G3RA 1GUZA 4M1SA 4BQSA 2Z2ZA 4RO0A 2JIBA 4FYKA 2OQIA 3SNKA 3AZPA 4LHZA 3CCBA 1T0HB 1F8GA 1XRLA 1WULS 2BGLA 3P2YA 4HNAB 2VBGA 3ZNQA 1JEDA 4S1PA 3TRHA 1DELA 1EP1B 1IHYA 1JQJC 1SCBA 1ZIXA 2R85A 2VHVA 3N8GA 3TZLA 5BQ3A 1TJ3A 1JECA 3NC0C 4ZOAA 5EKUA 3N70A 4H0NA 1VYHA 2TSYB 4FYJA 4ZALA 1I3LA 4A3SA 3FTFA 5FV4A 4ALIA 1QRDA 1Z2AA 4KQ2A 4N3AA 3WO0A 5J4LA 1W47A 1NXVA 1C50A 3I30X 1FUYB 1XJ5A 4QARA 4ARZB 4BFVA 3CM0A 3OCYA 4ZHSA 2F1HA 3N7TA 2Z8YA 5D3MA 3KEOA 1JHUA 1VE9A 1QO0D 4J0KA 1UZMA 4PHHA 4WRRA 2QD1A 4DQDA 5SYMA 4AC9A 2PT6A 2JPDA 3HJGA 3HU2A 3I3SR 3TTVA 4GUAA 1PG5A 4B4OA 4UJ5A 4NZPA 2PZFA 1Y8QA 4Y18A 3FTQA 5FYDA 5BUCA 3PENA 1RWOA 1P0MA 1UBFA 3BIFA 1SHTX 3PSHA 1S1CA 2I2XB 1JPNA 3DHNA 5C53B 4NU5A 2CD9A 4W8HA 3OWHA 5KSPA 3K73O 1AB5A 2G09A 2AG5A 2KJQA 3GT7A 5DYNA 3CTMA 3HZZA 2OORC 4CL3A 2GLXA 5SY9A 3UQZA 4MUFA 4YUVA 1Q7CA 1A9OA 3WB2A 2ZT6A 3OJWA 3NEAA 3NDRA 5FOVA 2Y1GA 1UQUA 4QDOA 3K32A 2YZKA 1XTBA 1GO2A 5GONA 2O8BA 1QPBA 4XI9A 4D9GA 2ZRQA 5I7FA 5CBPA 3WLNA 1P61B 5DPMA 5FPHA 2PPVA 4OQMA 2VUUA 3CLVA 3DWIA 2CFCA 1NLMA 3EXFB 1AU9A 5FHQA 2RB5A 4JXZA 4TSFA 3ES9A 3FNIA 1DLJA 1O3YA 2QNRA 3JVVA 3SM3A 1JT9A 1QE0A 4DCPA 1JEOA 2C58A 3DZKA 5J58A 1CYDA 2FSIA 1AKYA 3CX7A 2RIPA 1P3Y1 2D7JA 3A31A 4KLRA 4B79A 5JD4A 4H1WA 3E9MA 3IT0A 4BGIA 1SXPA 1JFTA 3GV0A 3IAM1 3OD1A 1XQ6A 2HF2A 1EAYA 2ROQA 3AUXA 3H8WA 3GT0A 4ZCSA 1QIDA 5B1SA 4BP8A 1N0IA 4HEQA 2GSWA 2BZGA 2COUA 4IMRA 4CM4A 1W2WB 1KFEB 3K92A 3QVMA 1E9EA 1QX4A 4GVLA 4OG2A 4JAVC 4CIWA 2D1QA 2GD0A 3D64A 4HXEB 3RG8A 2RHTA 1CRZA 3ZU6A 3ISTA 3ZPXA 3E3MA 2I67A 2EKZA 1JDUA 4L5JA 3OSUA 3NANA 5I8WA 1Q16A 3LXRA 4IHJF 2YZ2A 4IJWA 2VJBA 4Q4AB 2HSDA 3OQNA 3QEAZ 1SHJA 3MCWA 2WAYA 3AUFA 3C5EA 1Z33A 3EWNA 5KDLA 1L1QA 4M0PA 4KQEA 4WVLA 3SHWA 2IHVA 1HFJA 1D2GA 3U3XA 1Z4NA 3UQYS 3SKXA 1LBIA 2W7TA 2E6KA 2YYSA 4EJ2A 5HZKA 4V38A 3D6JA 3QUTA 5AJTA 3GPIA 1Z5PA 1IN8A 1JDBB 1IK4A 3K9LA 1L8OA 2CV1A 3AC0A 3OZWA 4LRXA 3VBCA 4Z0NA 2NTYC 2VQEB 5FXMA 1XEWX 2VP2A 3VTAA 4DMFA 5L7TA 3ZXSA 1IWBB 2G1JA 1IY1A 4D2IA 4O3FA 1M8GA 2FRXA 4OHBA 4QAQA 3CW9A 1RRCA 3N76A 1T24A 4IL5A 4PVDA 2MR5A 4PZDA 4YRCA 2HLDD 1T1JA 4MUJA 3GARA 3FFAA 3GZJA 3NPAA 1NUAA 1T0PA 3QKUA 3GNQA 1RQLA 2WK1A 1UJCA 3G2MA 4X3PA 2I7XA 3G5MA 4OKIA 2B8NA 3HCCA 4OREX 5KIAA 2CYBA 5AI0A 2H0RA 2J41A 3OUZA 4US0R 4GYYA 3DMGA 4ZAFA 3WQSB 1GKLA 1KY4A 4UOEA 2H9AA 2NV2B 4C4PA 2NZXA 3GP3A 2NAPA 4PLWA 3ZV5A 1RACA 2ZANA 3L7CA 2VJMA 2QDXA 1O9BA 1D2RA 5HBGA 4ECEA 1ONSA 4MQ5A 5JRDS 1VPVA 4OU5A 4ZGWA 3JXEA 4D98A 5KQGA 2JFYA 4ND8A 4DQVA 2ZIEA 4MTLA 3HVHA 2PR7A 5HZGA 3FSEA 2YFHA 5K45A 2B37A 4POOA 1LV7A 2Q0QA 1XF9A 3M5WA 3RSZA 1A97A 1LK0A 1OWNA 4D4LA 1VJGA 2A30A 4G25A 5C0OE 5BUSA 1P6UA 3LQ2A 3RC2A 4ER6A 5BWBA 4I2VA 3WRYC 2YX1A 2B3DA 2HW8A 3BHJA 1WEKA 3TNYA 2WB4A 1PFQA 2FPKA 3OZBA 4MV8A 1KFJB 3ZV4A 1B6SA 5JSQA 5K0CA 2Q6OA 3TKLA 2BTQB 1N78A 3VSAA 2CLKB 2B4YA 3CG4A 3GJXC 1LTQA 4XQGA 1BIFA 1MPTA 3CZCA 3T9FA 5E9AA 3N9IA 5D01A 1KMMA 1S6YA 2OHXA 4S24A 3M6FA 5FV7A 2BFNA 1T2VA 1VKNA 1JLKA 2GZAA 3IE0A 2C8JA 1Z5UA 3BH7A 2W0SA 1WXGA 3IVMA 5FP0A 4F60A 2G1AA 2WQ6A 1TM1E 3TK1A 2WVGA 4DM4A 1JSXA 4BNYA 4KPUA 4M7RA 4RTJA 1OJLA 4RPLA 3D2LA 3ND7A 2GPNA 1X1SA 2VDMB 4QZVA 5J2TA 3IESA 4XIJA 4UBKA 2GJ9A 2X19A 3VJLA 3WB1A 3IBYA 1QO0A 4URVR 2GUWA 1CEXA 1XU9A 4AZVA 1ZBDA 2PBLA 2PRIA 4A2WA 1MJNA 3IR7A 1ZM2A 1NX9A 4LDQA 3R7NA 3TOVA 2VJNA 3UJCA 4EGCB 3I32A 2DHCA 3O90A 5E7JA 2G9UA 2B4TO 3TO5A 4DGQA 2BTEA 4CL8A 3CLKA 3KT8A 4OHCA 2RGRA 3KJIA 3QFSA 3E1SA 3IE1A 4MHOA 3GLGB 2DPHA 1UM9A 4IGAA 4DV2B 3TRJA 1U8AA 2VWQA 5ALQA 1P1CA 3CH6A 2IYYA 3L07A 1G98A 2YDXA 4IXMA 1P9NA 3MRVA 2HWUA 2X3FA 5GZ1A 3LFHA 4I1RA 2C3OA 3QIVA 2P68A 1RXIA 4D3SA 3OAAD 1O0BA 2GBIA 1CR2A 1IHXA 3AG6A 4GM4A 5F7JA 2ZSUA 4E6PA 1LPPA 4K2HA 4U0JA 3IODA 3LXMA 4TN1A 2ZTLA 4CT4B 5KNDD 3NDJA 1T2AA 4GDMA 5LB4A 4NOKA 1A9PA 4KWEA 4XPIA 2IBMA 4B7AA 2O8CB 1Z6XA 4CN8A 1FFXB 1V5GA 2TYSB 1KQOA 1VMIA 4HB0A 2JATA 1RHMA 3KFLA 2H2FA 3ZR4B 4YAIA 4ZU1X 4AFNA 1IQ0A 1EFCA 4RZ2A 2PWBA 1NRIA 2WOOA 1EE1A 1FS5A 2YMPA 3GCDA 2H4YA 3BXGA 1CTQA 3O75A 5BOSA 3IAEA 4GE3A 4J6FA 5KNCD 1U4SA 4LSZA 3TS1A 1POWA 3R24A 1PI3A 5FTLA 3E53A 4IQ4A 1KTVA 2NW6A 3WLRA 3MTIA 1FF9A 2Q5CA 3IHLA 4FDMA 3DEAA 4MEBA 4DCCA 1YJ5A 4QSMA 1ZUHA 5IJXA 3L4KA 4N1AA 1ZP6A 5FOQA 5L40A 2JLXA 3JRXA 3KKLA 3L6EA 3QI2A 3KT3A 3WNQA 4OLBA 1G7CA 4HUQA 1BE8A 2FPSA 2XUDA 2BAGA 3CYFA 3FXAA 3NYWA 3TLXA 2GHRA 3R75A 1XQVA 3DVSX 3VU8A 4L8LA 2WUGA 2R6CA 1G5PA 3D8HA 4K86A 5TY0A 4UM8B 5HFAA 1E2MA 5COBA 1JQBA 2AEJA 2FQYA 3IC5A 3JQRA 5E3IA 1GTJ1 2BH9A 5FUYA 4IGKA 1DI0A 3ABRB 4UPDA 2DFPA 2VDKB 1IRXA 4DJEC 3ILSA 3M6LA 4RHUA 5DT9A 1QG4A 2GMWA 1HTTA 4ZYZA 2IXFA 2CNDA 1IZ7A 2FZEA 1QG6A 4KV7A 1HOXA 4F97A 2HY7A 2FPPA 3SIWA 2AWNA 2CT8A 4DWJA 2H18A 1L5HA 3C1TA 3L92A 2EU8A 3P9RA 1TA9A 2VJLA 2X15A 1M1NB 4LWZA 3ORYA 3T1HB 4C7OB 4ZOLB 2NU7A 1J1UA 2W6QA 3II6X 3MCTA 2GRAA 5K8CA 2NZVG 3SBDA 3CLUC 1N2IA 3CMMA 2FW8A 1Z6QA 2HLDA 2VLBA 3HPRA 4IY1A 2Q7DA 3STXA 4E33A 3RRFA 3F1KA 2YWEA 1RXVA 2FEXA 5ADWA 1BHSA 2QTCA 2RKWA 3IR6A 2ZJFA 1H4SA 3LHSA 3S1AA 3GJQA 4NCBA 1D8AA 1MC1A 1MGOA 2YR0A 3AB3A 4QPZA 4XOUA 4RY8A 3TXAA 4EJ6A 3GMDA 1LBTA 1WHTB 3OJFA 3GRKA 4M0UA 3GGJA 3U4QB 3G8CA 1QYDA 2ZCVA 4C01A 4FI3C 3TGLA 1KOGA 4KZPA 2YH2A 4UTPA 3QU2A 2Q1SA 4PIPA 3UMJA 4U39A 4CCAA 4XWOA 4MUKA 4BCDA 4CG1A 2XUJA 3PNBA 1Y6JA 1DOZA 4Q4HB 5JEDA 5LD2C 1FA9A 4G67A 2G5PA 2HMYB 5CJ2A 1D9ZA 2IUUA 2CL6X 4ALJA 1ORHA 1C3LA 1PR1A 2FXVA 2I55A 2BFDB 2OE2A 4KU4A 4XM1A 5GQSA 5HTKA 2I6TA 2CLMB 1U3CA 3G5AA 3KDAA 3LYAA 3HYCA 1THMA 4HGOA 1A04A 4TSRA 4YCAA 3KQLA 2I8LA 2NXEA 3OTOB 2WWWA 4QEZA 3OFNA 4ZIRB 1NQTA 4EO9A 4B3GA 5KU7A 4R1NA 2QZPA 1V11A 3VTKA 5JJBA 2CE2X 1BZYA 1OXMA 2BFOA 3DOCA 4UUQA 4OHWA 4AWBA 4F11A 4HH3C 1ZNXA 2DVMA 5DH9A 4FGWA 2FKNA 4I8IA 3LW8A 1WXFA 3CU5A 4M1TA 4DWWA 3MSXA 1G8KA 3RO7A 4UM9B 1I7PA 5M7EA 4ZVPA 2ZIZA 4F4HA 3L0YA 4AP9A 2DY0A 3OZRA 4V2UA 5FJJA 4MDFA 4W7IA 4KPYA 2OC4A 4N4AA 2FLVA 3BEOA 4B2IA 5B64A 4I50A 4Q24A 2XVMA 4LYHA 1QP4A 2PSFA 3GEHA 1FU7A 1KETA 4UXIA 1SU4A 2RAFA 1JKFA 3KAPA 4F71A 4Q9IA 3EDOA 4X85A 4B84A 2O7NA 3E27A 1W9MA 2XAUA 4V24A 5AK6A 3W1VA 3LBHA 1C9EA 1YR6A 1DEAA 2QAIA 2FUG6 4OFBA 3U3ZA 5EJ8A 5IZCA 1ZC4A 4YDSA 3T3HA 4CGZA 2EWWA 3KAKA 1V48A 2ZJ4A 5JQGA 2OHHA 1G5FA 2QN2A 3H75A 1PK8A 3UG6A 4CCYA 5KNBD 2EKLA 1L4YA 3NX4A 4NYIQ 4ZICA 4LNHA 3P4XA 2K87A 5DF1A 2HHHB 1Z7EA 1ZMXA 1KZ7B 3AW9A 1A2BA 3ZYCA 2FY8A 4JKYA 3DW3X 3AVTA 2AMYA 1RFGE 1GLGA 3VU0A 2F3RA 2O2SA 5E3HA 4NSNA 4CM6A 1NMQA 4DC1A 1L7AA 2CLCX 1XTPA 1JQAA 2ERXA 4HBZA 4I9NA 5G1OA 4G5RA 1BDJA 4FOOA 1RKBA 3GLFB 3V4PB 2GHQA 4YLEA 2DTXA 1UK8A 2DPXA 2EQAA 3H5NA 2BE7A 3IPRA 1AZSC 3OM0A 1MH1A 4XWAA 4XB6B 1KJZA 3OAAA 3DC7A 3UYKA 1NNSA 3SGLA 3KPYA 3VSEA 5KNDA 3FZNA 5EE9A 1A7JA 4HCJA 3A6DA 4F2GA 4RA9A 1U2EA 1D4OA 3QE3A 1R4ZA 4TSKA 1USIA 3EPRA 2PN1A 1J0BA 3PDWA 5H02A 3TMYA 4EX6A 1IN7A 1ONBA 2E48A 3JQQA 1DDIA 1Z17A 4Z4GA 3UOAB 4HVTA 2ZRGA 2CE7A 2BKXA 2FW0A 2HK9A 2OOKA 3OU6A 4OAQA 4OSOA 4TKVA 1OXTA 5IUJC 3HLKA 3WA7A 1ECFA 2CVOA 1N7GA 1ZJ4A 3N2YA 3VI4B 3TW8A 1BCSA 5IULC 3CCCA 4XVUA 2WM9B 1LBEA 4A0QA 4K6MA 2OCGA 4CMIB 1JAXA 2EKPA 4RHYA 2UZIR 1R0WA 2AOUB 1MEEA 5IKPA 4O2RA 2IHBA 3RFXA 2LRHA 4FGSA 4CI9A 1SBIA 3AM4A 3R3WA 3TE7A 1N0VC 2HBRA 4LQLA 4UCWA 3T1TA 1J0CA 1J49A 1U1CA 4I1IA 2GZMA 4XXHA 4CF5A 3AEKB 4ITRC 1NULA 3WFIA 4YMHA 2EZ9A 3W4JA 3UGTA 3V55A 5AKKA 3N0TA 1EWRA 5FR2A 3C97A 1B74A 3V5NA 2J6CA 2WKWA 3E03A 3Q9SA 3VU3A 3K9NA 3SY8A 4ZVVA 1FVHA 4RTLA 1KFKB 1KSHA 3DKPA 3QBTA 3NM4A 5EEGA 2NV0A 2Y9MB 3B6MA 3E3LA 3RSCA 3GNSA 3B52X 4V0KA 2QVZX 3L0BA 1VSUA 4KK4A 3L2OB 2Z1MA 1JIJA 2G06A 2HWXA 2W6ZA 4CIYA 4FFWA 1ECLA 3MJSA 4KQJA 4QQKA 2W70A 1NMXA 3SS8A 4EARA 1H1LB 5IAJA 4NV3A 1NNUA 2P7IA 3N8NA 3UW3A 1DWOA 1Y98A 3RIGA 3SAJA 4RWZA 3BMNA 1M1ZA 1YAHA 3RT1A 1AQ6A 3GA7A 3IVAA 2A9KA 2ATIA 1T2DA 1TKRA 2C2XA 3U13A 2D2IA 2FJUA 4L5CA 3ZXUB 4XCVA 2IZ5A 2W4IA 4ZZIA 3D7KA 2C5FA 3F4KA 4MPRA 5EIEA 4PCAA 2EOAA 3TNJA 1VL6A 2FR0A 1GTVA 1V3TA 3JALB 4K28A 4NV1A 1J56A 1EDOA 5KINB 4BC1A 2I1VB 3GFRA 3H16A 10MHA 1D5WA 1G2IA 2O8DA 2HDNB 2FUKA 5LUAA 3NBAA 1A2OA 4H16A 2OHVA 2H4XA 3B1ZA 4PVCA 3BUSA 5EQJB 3CF6R 1K2VN 5BXYA 3I58A 1Z0UA 4H15A 5K3OA 1F17A 2GPAA 2NSJA 1YH3A 3DOFA 2WAXA 3NTRA 4KIGA 1O97C 3NOOA 3DCNA 4O4HB 1X19A 3HO8A 3I9OA 5DZSA 5GPBA 3VR4H 2HYDA 2V4UA 4UCXA 1TFUA 1E8NA 3LRTA 1N6IA 4H7KA 5F3WB 1WP9A 4QL3A 5CH8A 1IIRA 4BN5A 1YQUA 2G67A 3PEUA 1T5LA 1WZUA 4I5GA 1G64A 2D1SA 5K0NA 2WU3A 3UAOA 1TKCA 4NJEB 2AG1A 2XBUA 1H4VB 4CQLA 5L51A 1E8MA 1SELA 4KQMA 4MWGA 1ZR2A 1NDUA 1QK5A 1V8FA 2GBLA 2R7KA 2ZBQA 3IMGA 4B6FA 5CEEA 5IDQA 4AZ0A 1G19A 1RHQA 4BKUA 3PQ2A 1LW6E 1RD4A 1G9XA 2I87A 5LR6A 4BUCA 5E9JA 1F48A 3EE6A 3O1HB 2EV9A 1WA5A 1W5SA 5G4KA 2IYSA 3C8DA 1GEEA 1CV2A 4PW0A 3NXSA 1B00A 3GBPA 4C4RA 3SP1A 5B5SA 1YQXA 2J8ZA 3QLUC 4PC1A 2IEDA 4GKBA 3EIXA 5AK3A 4UEQA 3ZW7A 3ST7A 3WDKA 1MV8A 3RIHA 3Q2KA 4TXNA 4V3BA 2N1MA 5HGJA 2R66A 1NSTA 1R9MA 2P41A 1FK8A 1A5BB 1SOMA 1ZNQO 2R8YA 1H2XA 5D6OA 3U7IA 3V2UA 4J2TA 4QBHA 1I3KA 2BRUC 3IEIA 4C7XA 1RABA 2YIMA 4EJSC 3Q7PA 5B30A 1M6VA 4ZQEA 3B8HA 3LVQE 2YWGA 2JVIA 1NZFA 1Y8QB 1RPNA 1RCUA 5ANRB 4YCJA 3R7WA 4FJ0A 2JCXA 4BEJA 5KMGB 4L50A 3CNQS 1IPHA 2DBZA 5A5FA 5KNBA 1FQKA 4GFDA 4M3NA 2PUJA 2G07A 2G5CA 3WMEA 4C0WA 4F4UA 4RVUA 1JILA 1TF5A 4KE6A 4XFDA 4ARUA 3O8LA 2VYFA 4HQRA 4MAFA 4AMVA 1TXGA 5AW8A 2AEMA 3RI3A 1TIBA 1Z38A 2VBFA 4JFRA 1RIFA 4G4GA 5BUQA 1HLFA 3H5TA 2Z5FA 2HDOA 2MYTA 1H2EA 3PEEA 4Y7DA 1OROA 3SZRA 1E7YA 2VA9A 4UE3S 3S8YA 3A3PA 5AK0A 4C87A 2YRFA 1EM6A 1R8XA 2O8BB 3KYBA 5A05A 1CFJA 2F9FA 1KP2A 1GAWA 1V7CA 4JASB 3UGQA 2XE7A 5EE5B 4WOJA 4EP1A 1XPJA 3GD5A 1YBMA 3FNQA 3NYIA 4OUDA 3ND9A 4OA8A 4UNPA 4OFZA 2H4WA 3FDJA 4FKBA 4L76A 4MZDA 2ILTA 4CUKA 1JQLB 2VJDA 3OE7D 1CZLA 4K6CA 3JAWA 4TT3D 3AR7A 3FMPB 5AJUA 5EERA 1AM4D 1SBQA 1L4NA 4M7WA 3QLJA 2CC2A 4L9AA 2QT0A 3ZCUA 4LI3X 4WKCA 3N1UA 1FQJA 1I13A 2A5FA 1WDLA 4CM4B 3WLTA 4ZAWA 3LSYA 4FBGA 2ORYA 1Y5MA 3FZGA 4ZVKA 1ZUIA 4IOMA 3I09A 4HGPA 1DUSA 3PYLA 1U5AA 2W2XA 3W5DA 4RVSA 2VK8A 5FI5A 4TS1A 1HFKA 3KU1A 3PXCX 2PVPA 5C5EA 5IJZA 4DLNA 5JXIA 3INRA 2VQ6A 3Q8XB 2VPTA 4YJHB 2JFBA 2WTMA 1M3SA 3K15A 5IW8A 1TLFA 3PFBA 2X0DA 3UJ6A 4X66B 3B6IA 5CH5A 1NATA 2J67A 4FGKA 4D26A 1UFQA 2CW5A 3M70A 4V03A 5JC1A 1XCOA 2VHJA 1YL7A 1R0SA 3BVPA 3SMQA 1XNQB 1F5SA 1CR4A 1NM5A 1D3AA 1E5QA 1P4SA 2ZSIA 3AGPA 1BO6A 3W2TA 3TG8A 4QODA 1LQTA 5C37A 5J1TB 5GJWC 2FEAA 3IV7A 2P77A 1L3CA 2MR6A 4ACAA 4PZ0A 1ISJA 1XRPA 1XCJA 2IZ0A 4O4LA 5KJEA 4MV1A 3FPFA 1Z34A 3U3JA 4OGFA 4QLOA 1H9AA 3TNDA 3O9ZA 3H2JA 4Y0AA 1NJ5A 1SRQA 4JT9A 5K6AA 3IKVA 3VA7A 3CH5A 3IXMA 2PKWA 4C0AC 1J2UA 1UC5B 1XALA 3IEKA 1XRMA 3IS3A 1WZIA 1ZOOA 2PO5A 3Q85A 2GEKA 4IJMA 2R2GA 2O2EA 4IDHA 1ZJYA 4OBBA 5FB3A 1H2AS 3TNFA 2P5UA 2WKSA 1M1XB 3AJDA 4WLOA 2EX0A 1E2UA 3PXXA 4K5QA 2QUZA 3TVTA 2ODTX 2EFYA 1MD9A 2C3PA 5ICSA 1FNMA 1OV6A 3QSGA 2P4QA 3FTDA 1Z7YA 1XGKA 4QPDA 3C8ZA 4MO9A 4M99A 2VJMB 4JODA 5ADUS 1SO8A 2QM7A 3AONB 4Q9LA 5ICFA 5AVZA 2OECA 3R76A 4D9FA 1V9CA 4Z6KA 3FHLA 1AB6A 1UBMS 3C8MA 4ND3A 4ND8B 2REQA 3E3NA 3V8PA 3AJ9A 1IXRC 3E22A 3I2HA 3RBZA 3SHTA 3TFQA 1J8MF 1GU0A 2P3OA 3LOQA 1UKEA 4KGXA 1SVNA 1XRJA 2ZLBA 3H9GA 3NHFA 4HQKA 4X1OA 4EHAA 1PCXA 3DONA 1KAMA 2D2EA 4YRTA 2ZRPA 2WMDA 2SECE 3Q8LA 1ENZA 4NNOA 4C0XA 1PKEA 4OYHA 1VJRA 1VHLA 4BX3A 5EZ5A 4R3NA 3U56A 1O57A 4M0LA 3IAHA 2ZKLA 1MW9X 1TC2A 4ATNA 4G23A 1JGTA 4BNWA 2ORIA 5A3SA 4B7XA 4DA4A 4C4ZA 1WPXA 1ATIA 1W5FA 2QB5A 3FPKA 2JANA 2FLWA 4G26A 1KMHA 1LKZA 3BJRA 2R65A 5HBRA 2YZMA 1Q84A 1DCKA 3OMWA 2AKYA 1JJVA 4DDMA 2O6LA 4I6EA 4CUJA 3UMSA 1HDIA 2O3TA 2JH9A 1NJFA 1T9ZA 4OHRA 1CRQA 2CCGA 2UDPA 2W6ID 2LWIA 2IE8A 1EK1A 3BFXA 4AMZA 5E4JA 2H1HA 3WC4A 1ST2A 4Y9TA 4KPUB 4KNVA 1BQEA 3PSAA 5KO2A 5KQSA 3GUHA 4LPSA 4LFBB 2GT1A 2C2YA 3BJEA 3D6NB 1KJWA 4FQ7A 3T95A 3RSQA 3UMRA 3UUGA 3W6NA 1FUKA 4LF4B 3UK7A 3AKZA 4FNMA 1SPXA 4RANA 3BREA 1OI2A 1XXHE 1HEIA 2E1PA 3HGTA 3IBGA 4MLDA 3QF7A 4J0EA 1R15A 3AKYA 4MI3A 3WOHA 1PSDA 2GESA 1XD2A 2J7PD 4ZD6A 2OVFA 3G23A 3IVXA 2YW2A 1LWOA 1VGQA 4X94A 3F6YA 3S29A 3T4XA 4L8FA 2GSDA 3KOZA 5CLJA 5I9LA 2AG0A 1U5BA 3JQ8A 2DKFA 3ZHZA 5B3JA 1IPEA 4M0CA 1QVZA 5G0TA 4DQXA 3U4IA 2EJWA 4O6VA 2AF4C 3SLRA 1CJKC 4K9DA 2GN1A 3WGJA 1C4KA 1XEWY 5JSZA 1VFPA 2DSTA 4B3HA 1W8DA 2J85A 5G4LA 3TTXA 4BNKA 4EJ0A 4WERA 1R1DA 4B4KA 3HXLA 3PT9A 2GYUA 1IJEA 3KQVA 2H7CA 2Z2KA 3L6DA 3IPYA 5CVDA 4DQ0A 1M1YA 1QDUA 3QV1A 3JX9A 4XPIB 2ZAYA 2V7WA 2GF9A 4FWBA 4NBUA 2BJHA 2M98A 4FDAA 1RAEA 4MJ3A 1Q7TA 3V8EA 1PJZA 1QANA 3WLEA 4URUR 1J9EA 3AHCA 2CJWA 5HK9A 3FOZA 2WWFA 4OHUA 3HWWA 1JTVA 1XD8A 3WYEA 3ML1A 3IEUA 2YIDA 3UC9A 4NABA 3OE7A 5BOSB 4V1CA 1XHLA 5DWVA 1BE0A 2DUWA 4QDZA 4C6TA 1VBFA 1OIXA 5THXA 5AW1A 1OXVA 4I1VA 5ITWA 2RK4A 1MVNA 1CG6A 1JDSA 2R6R1 2WG1A 3ESRA 5AXAA 4OOFA 3RBVA 4GRIA 3BCSA 4UAJA 3VR3D 1OQAA 1MV5A 1E32A 1Y6QA 3V3KA 5JG7A 1NFRA 5AM3A 3T61A 4PSDA 4TTVA 5HKLA 1D07A 2WTUA 2HWYA 1U7TA 4RTPA 4HUQB 2RDMA 4OD0A 4TM7A 2LIVA 3OHMA 4WECA 3EEBA 3QFCA 4MIYA 1AGYA 2LE0A 1LSJA 3DM5A 2RGGA 2ZR7A 4N03A 4IICA 4A2QA 5CHEA 2CCJA 3D7NA 1GQOA 1OXKB 3EXG1 2DPMA 2QN9A 4LRTB 3WL8A 1L4HA 5JNSA 1EWKA 2OCPA 3FBTA 3OQOA 1VXRA 2XAAA 3TIFA 5F52A 3H42B 1LW7A 4BCBA 2RFLA 5GIPE 2FPPB 3WLQA 1L5HB 1WB9A 1YUNA 1ZO8A 2C2GA 4Y2XA 3IV6A 3NRCA 4FJ2A 4CM9A 2GBLC 3CE9A 2ZZKA 4JR1A 3QEBZ 5JAHA 2NU7B 4Z9AA 4ZRNA 1OH5A 2PQ2A 2FI1A 1OOEA 1IFXA 5H0IA 4BPRA 2A0UA 3BGWA 1JG1A 2D0DA 4Q93A 4D80A 5BNWA 2PH7A 1FYWA 4JJIA 4OM7A 3VPAA 4OMCA 4Y3UA 2J31A 3A4YA 4ZT5A 3KX2A 4GPEA 1QOZA 1WL8A 4NYJQ 4TKLA 2QE7A 3S1AB 4WBXC 3E9YA 1IAVA 4K9SA 4U4AA 2QLJA 2A92A 2HI0A 3E82A 3QK7A 4YUXA 2ZR0A 3K9WA 3N2ZB 5BQPA 4A0SA 2GF0A 1T6YA 1RZVA 3BSYA 4BNDA 4A8TA 5C8XA 1QQ7A 2G88A 3I92A 1R6BX 1ZHFA 4Z4CA 1MX3A 1E4VA 3G7UA 1AXRA 4AXBA 1YOBA 5EIFA 2IV2X 5KYTA 2E5WA 5SZHB 1Z4QA 4E08A 3ZDDA 2LKDA 3DUWA 3E2IA 4TROA 5DHQA 1YJCA 3VPFA 3ZGXA 1PZNA 1A72A 1G3IA 3AWIA 3BXHA 3CVJA 3EQ2A 5CK5A 3N6XA 4AY3A 1CPYA 1ATZA 2J3IA 2JLZA 3OLYA 4I46A 1S3IA 1FIUA 2H85A 1FRNA 1UKBA 2WT9A 3G59A 3PA6A 1QQ5A 1TMOA 4GNRA 4NMHA 1UAAA 3RW9A 2ZWMA 1PNOA 4HH4A 1V11B 2EW8A 3HYSA 2VIIA 2X5NA 1RYBA 4FFSA 2P2LA 2OD9A 4QBGB 4ZMBA 5KOHA 1ZVMA 2ZJ0A 2GPBA 3HDHA 3IEXA 3INGA 3LX8A 3SEQA 3ZBTA 1V45E 2Q0XA 3JD0A 4LY3A 5IKXA 1AK1A 4GOOD 2Y66A 3DFUA 3COSA 2IA5A 3HSKA 3VXKA 1L5LA 2CD7A 3U62A 5AKYA 2PYDA 3W6OA 3UW1A 2QZJA 2DHEA 3RRYA 4H1VA 1YZGA 2C8LA 4I50B 1X8KA 5AI5A 4PGFA 4Y9RA 5FOWA 1IEVA 2AG6A 3G0GA 1I80A 3AY3A 3IELA 4CHGA 5B2EA 3QVUA 3A4VA 4QTXA 5CB4F 2C7QA 3LKBA 2QOEA 2W6IA 4RF5A 4ENUA 4J2HA 1RAIA 3QFTA 2H8GA 1W94A 2WRZA 3CONA 3WL3A 5H4GA 1HH4A 5GGXA 2ZS9A 1TUIA 2ZVQX 2CSUA 5JQGB 4BV3A 2XI4A 1AKMA 1YSCA 1JZQA 4CIAA 4INZA 1MQ8B 5JJKA 5AJYA 4I9UA 4G2TA 4RCYA 4YJKA 4RJLA 3T54A 1N34B 4MW7A 1CUFA 4BNUA 1T6XA 5B55A 2ZIUB 5MFPA 3DWGA 4WBNA 3PFIA 4KFTA 2W6PA 2J7PA 2R5WA 1QFSA 1E1LA 1WDWB 3BXZA 3FKJA 3LQRA 5GAJA 3ZBQA 1H1DA 4BEWA 4KPEC 3HB7A 1DPGA 1N1DA 3EFBA 1CR6A 4P3OA 1J07A 4OGLA 4A91A 1O0SA 4Y6RA 4GD3Q 3TSOA 5MN6A 1FXSA 2EBUA 2HMUA 4YDHB 1KI4A 1CETA 2IIPA 3EUEA 4JYCA 4MS4A 4QRDA 1IOWA 4MUMA 5IVIA 5HPYB 2ZB4A 1FXUA 3NHSA 3FMGA 1NM5C 3G8DA 1DQNA 3B70A 1CY0A 3CVUA 4P3PA 4PHTA 3GPLA 3PKJA 1T2FA 4HNGA 5FOUA 2XT9A 4F1JA 2VDWB 4MKRA 4UM7A 4TN5A 3ZW8A 1H5QA 3H3JA 3GO4A 1Z0FA 4XLLA 1N75A 2KX7A 4W9RA 4OQDA 4RA9B 1SXIA 3OJEA 1N5JA 5CVVA 4XW2A 4E31A 1KDOA 1W35A 1FNBA 1FJXA 1KJYA 2EZUA 3UHFA 2H16A 2DT5A 2R9VA 4EATA 3S68A 2EP5A 2QENA 4H6XA 1AHPA 5ALTA 2OV2A 3M3PA 3NASA 1QVRA 4YACA 4TKVB 2GYWA 1II8A 4FXOA 4MWOA 4PLFA 2FEPA 3B1VA 4RIHA 3TW8B 1E0DA 1BCSB 3H1TA 1Q22A 3M6VA 2I91A 1IEWA 2CXUA 2BFWA 1UFRA 1RE1A 4BX2A 1WZCA 2EJTA 1JAHA 4X61A 4ZAGA 2HF9A 3NVAA 1U7HA 2A35A 1YRAA 3K70D 2XVAA 1ZOIA 1ZMBA 4MV5A 5HMMA 1PGQA 1S9DA 3HBLA 3OZDA 4M1ZA 1O6ZA 1E18A 2EF1A 4CJXA 2UUCB 3INNA 1XZAA 2PLNA 1BJKA 3BH6A 2NU9B 1YK0A 4BKMA 4DDKA 3KD3A 4ILEA 4RLFA 1VJ0A 4IDBA 2QUAA 3KOUA 4UVDA 3NT5A 2JAQA 2GN9A 5JH7A 1E3SA 3GL9A 3VPSA 1K4MA 1AD2A 1ODTC 2FOLA 4TVOA 2AZDA 1B41A 3H4VA 2QD4A 3UT6A 4QOGA 4DG5A 4OF4A 5GTDA 4NBVA 1WS6A 3LQKA 2MSEB 4OPMA 3ZD8A 1X15A 1L5RA 3AYXB 3OPYB 4J16A 2WIFA 1M2OA 4WINA 2W8ZA 4R71A 2F1KA 1VG9B 2Q3LA 3EVNA 1OFHA 1RI3A 1D0VA 1YC5A 3GG2A 4HN2A 3ZK8A 1XZGA 2RHDA 4OH1A 3LY9A 4IIYA 5KYWA 1NW8A 4GIBA 4UUOA 3L7AA 4KAJA 4NFSA 3BMNB 2QSZA 3I9V1 4OYRA 3O03A 3WL5A 3NDBB 2I65A 4RSMA 1U7ZA 2VNSA 1GNLA 3L40A 3RJMA 4RD3A 4P36A 2EW1A 5HIIA 2VSNA 1S89A 2C2ZA 3C87A 3RG2A 5BUZA 4WN3A 3KM0A 1QVWA 2EIXA 1NF9A 3U7FB 5F98A 1NSYA 5KTNA 2V4MA 2O8DB 1H9BA 3EWAA 4JUAA 3CIOA 4RFSA 3K09A 3TVDA 2CFTA 2MYNA 3NORA 4V0RA 4K9KA 4D82A 1IEXA 3FE2A 3LT0A 3QX3A 2ECFA 1XUOA 1AQUA 1LZLA 3CEMA 4WN9A 2C83A 4BO6A 3LHIA 5EC8A 2GPJA 4DL9A 5CGZA 4E1BA 1SVUA 5LYYA 2HUNA 2W2TA 4Z2YA 4UATA 3PYXA 3MUEA 4IWNA 1J97A 1DTWA 1ZMOA 4P54A 4FN4A 5IJ9A 1PYGA 2NZ2A 1TPZA 1EUDA 4EMBA 5JD5A 2AHOA 3EZNA 3GRZA 5FYQA 2W93A 5JAOA 1MJGM 3HC7A 1P4AA 4DDUA 5B3JC 4CQLB 4F92B 3IT2A 3MWGA 1WOMA 1P5JA 2Y3IA 2WINI 1P3DA 1HX7A 2GN0A 2W6OA 4NMXB 1ZK0A 3PHBE 1G66A 1Y34E 2WP8J 4I6JA 4AZ0B 3OWOA 2QJWA 4N76A 3NHUA 3A6GA 2PK3A 4D74A 3P0JA 1O8CA 1XTZA 2WHRA 1N2EA 4BNJA 1YKFA 4K9PA 3EXG2 5G4KB 1RYMA 1XDSA 1L7PA 1X1DA 4XJVA 1CU1A 3E7XA 2J45A 1KI2A 2FE4A 1J0AA 2BJVA 1PUJA 5C8YA 3WK8A 4ANFA 4NX2A 1WMBA 2VSQA 4EEZA 1HFEL 4H08A 2ERYA 2R8ZA 2FWPA 1OA1A 4TLAA 2O5RA 4BFYA 1SXJC 2EFEB 1G5QA 3EMBA 1HYBA 2XPCA 3K1ZA 3RUDA 3HMQA 5IVKA 3BE8A 4B3XA 5ER6A 5TQVA 1EP2B 2CXOA 1EK6A 1HDZA 2D06A 4JJAA 5G2OA 1M6VB 1LZKA 4LRQA 5COQA 3ZE8A 3Q5DA 1ZGBA 2R6HA 3HCOA 2FJ0A 2E37A 3R7WB 4BE9A 4DLVA 5ABPA 5BYAA 5E1DA 1UEXC 4NDZA 2QPOA 4PFQA 2O2IA 1ACLA 2P9BA 2UYOA 3W5CA 1NBIA 4G8DA 3G7SA 3Q15C 5EJ4A 2CLOB 2G7ZA 4O4HF 4JZKA 2W2KB 4YIHA 2XUQA 3AB8A 5AXCA 1W44A 1GQ2A 5KAPA 4JLNA 1MVLA 4ZK2A 4MUEA 1GAJA 1KHTA 1N3BA 1OLOA 1TNDA 2X0RA 1BQ4A 4KOAA 4NJOA 2PMKA 3T3OA 1FYEA 5BSFA 3CLUD 5EJGA 4FYIA 2VK4A 7ADHA 4AUNA 2IYEA 1FRFS 2IBTA 5P8WA 2VWHA 2QN8A 2NNWB 3KBBA 4FUQA 4UHFA 5A5VA 1JBEA 2PL5A 4OUDB 3KJXA 4NRDA 4DJDC 2QTFA 3HH8A 1X77A 4Y9SA 1VI5A 1CY1A 4CMHA 2D74A 2IYAA 2V65A 4WKGA 1PQUA 3GOQA 2HU7A 4DB2A 1AUXA 3GDHA 2FAXA 1PHRA 1R88A 4PO3X 3JAWB 4N8SA 2NXJA 2DB3A 1ZHOA 3HV0A 1CX9B 4G1UC 4H17A 1ISIA 1B8UA 3RSOA 1N0UA 3FSJX 2H2GA 3GJSA 4IGIA 5J43A 3DE1X 4A15A 5A4FS 2WDPA 3JQ7A 4HK4A 3ZWMA 4DFDA 1KYWA 1SVLA 4L0MA 1QHEA 1TUGA 1ZGHA 2Z8XA 1KZHA 4CFZA 3A9VA 2MHCA 3CT4A 2P1RA 5M04A 2ZTVA 1MRZA 2DQKA 1HG0A 4ZAXA 4L73A 1UXHA 3LWBA 3KJHA 1VMAA 1SRRA 1GL9B 2N46A 1URPA 3AJAA 4GBGA 3T06B 4ARSA 4GMKA 1A9QA 2C4VA 1JE1A 2JK1A 4IRMA 721PA 2F8SA 2DG2A 2FFJA 3N0RA 5IAGA 4F3CA 2WUFA 3ZIUA 2A8YA 4NULA 2WF9A 2FN9A 3AT1A 3TDKA 4OM8A 3KJFA 5T8KA 3HO1A 3AQIA 4JNCA 5DTEA 1M2HA 1M0TA 2I6SA 1VE3A 4BMCA 5KNDH 5C7YA 2NP7A 3BTSA 1BRTA 1FDUA 1N4AA 3AZOA 1FNDA 2QPLA 2QQGA 3GUZA 4K9MA 2IOQA 2HIHA 4P86A 5AM0A 2ZZMA 5BO5A 3V4VB 5EXDA 3HUTA 1F38A 2RGCA 3PFFA 3PIIA 5DWQA 4O4LB 2AZXA 2O2ZA 2K5UA 2JK0A 1P17A 1ZA1A 2F1OA 3D31A 4BO8A 2C07A 2ASVA 5K03A 2IHUA 1JVSA 1G60A 5A5EA 2BBSA 4BDSA 1ILEA 1IG3A 2NO4A 4GGPA 3ZC3A 4AUEA 4GDFA 2J4FA 4FTWA 3OURA 1ULBA 2JJQA 1YL6A 2GBFA 3I76A 4J0JA 4ERXA 1IAQA 1FDRA 4CKBA 3QVGA 4CL2A 1KJQA 4Z49A 1D0IA 1CLUA 4FFMA 3E7WA 2A5LA 4KSBA 1LLFA 1WVMA 1KOFA 2B1IA 2YYAA 3GPCA 3RSGA 1IQPA 3HCWA 3O1IC 1BU5A 2ENUA 4M60A 4D3ZA 5BN5A 4WGFA 5FLXA 3CUKA 4HAZA 3WLFA 5LOVA 2VZ8A 3EVGA 3J7TA 2ODEA 3PUXA 5AM5A 1MX9A 2I1LA 4G9BA 3TB6A 3NAQA 3ER9A 1P7ZA 3WLKX 3ZTTA 2RGNA 5D3KA 5LJLA 2Z6VA 3EZYA 3GELA 1BX3A 2C5BA 3JQGA 2REQB 5KX5B 1T8TA 1XO1A 3E22B 4MQEA 4RQUA 4LRWA 5KWVA 2IOHA 1TUBA 1O03A 2CZGA 1OTXA 1Q7GA 3O6VA 4GKJB 4WXPA 1M66A 5PNTA 2EHDA 4XPZA 4DIOA 3VC7A 2VNHA 3LRPA 3DEHA 1V9SA 3DO8A 3DQPA 1ZZGA 4CW7A 1U3TA 5HHTA 5G0VA 1I4EB 3VZPA 1TM5E 2IU3A 3SOPA 3OCWA 1NZJA 1RQNA 2G4CA 2K7FA 1ZYUA 3QEMA 4JI5B 2OB1A 4INOA 2BMVA 3AHEA 5JCPA 3D3WA 3N8KA 2WMYA 3UKJA 2GEFA 5DHAA 1ODSA 3F97A 3ZCPA 1HV8A 1MORA 3FVTA 3PNOA 5JY6A 1KMHB 5FUBA 3CN9A 2AJCA 2OHIA 3U48A 2PG3A 5ITVA 4R31A 3VJRA 3E23A 1S96A 5HOQA 1ODKA 4XQ9A 2YCLA 4W5JA 2CBGA 3W6ZA 2JEOA 3FMIA 3NBZC 1C1YA 2WEKA 1KO7A 2IF0A 1KMQA 5HILA 1IY9A 1YZFA 2YMLA 3MWFA 4MULA 1XKQA 3EA4A 4BMPB 2WF7A 3HVIA 1T9GS 5ES4B 5TQ0A 1JEAA 2DULA 4XDYA 3E9ZA 4PO1A 1RVV1 2A1UA 2JI6A 3RU9A 1DMRA 3PDJA 4ZO9A 3V6MA 4D0NA 2YMQA 4DCNA 4Q4CA 2A0WA 4BBPA 2Q2NA 2OGZA 5LBTA 2WG0A 3EFOA 5A7HA 4L4XA 1QU3A 2H2IA 2PZ8A 5HDQA 2JA1A 5CITA 3ET5A 2CSXA 3SWWA 4OL0A 3U4MA 2FN8A 1XD2B 2GQ0A 2CDRA 1QRRA 2I2FA 2Y0DA 4XKJA 5K0TA 1BDIA 3EIUA 3PNSA 8OHMA 2P9ZA 3TSZA 1YB1A 3FPLA 4D46A 4RTKA 3Q3GE 1U5BB 3A9UA 3JQ8B 3KEQA 3OHSX 4Y0VA 5C8ZA 4S2EA 1A8UA 4FS3A 3NJ8A 2VDLB 2WU4A 3ESAA 3TFWA 4C7JA 4PGHA 5JSZB 2X5OA 3FA2A 1RYYA 2FRVA 2H00A 1P0CA 2HTEA 2ZQ5A 3KFVA 4HFNA 5LC1A 3TRKA 4C4YA 1XAHA 2OO5C 3H97A 4FC7A 4OHZA 3RU7A 5IG2A 3I2GA 2ECOA 4ALLA 1G2OA 2AIRA 1RKQA 2AW3A 2P79A 2V6JA 3ILXA 3LCVB 4IWYA 5SY6A 4EPXA 2HBQA 2E18A 1I0LA 3H9QA 5AVOA 3DCYA 4IH9A 3BL5A 2NVWA 2WUWE 5BSUA 2CJWB 4W82A 5AI8A 4AYXA 2W2LA 2OBYA 3WDSA 4WIAA 1H2RS 3WGYA 1UXKA 1ZSNA 1YBVA 2BDEA 2UU9B 3WKCA 1G8SA 1TAHA 4GGOA 4RGQA 3AIIA 5EZ6B 3VR5D 4EKDA 5C1PA 4C6TB 3R3ZA 4JJZA 4DXAA 4B87A 4JDPA 3QKRA 3ZBUA 3AOGA 3NBFA 3HA2A 4P80A 4QOJA 3UK1A 3F7TA 3J81k 5BMVB 4YB8A 2N9UA 1BWRA 3K09C 3ZY5A 1NE2A 1HG1A 4UVGA 3WY9A 1BG6A 2QTNA 1B1AA 2DWCA 1B15A 1Z28A 2UXBB 4TWIA 4JQSA 3JTMA 3JW8A 3WXMA 3EDRA 3HHEA 4MVJI 5F78A 5CB8A 5KTRA 3OIVA 4W5HA 5CK4A 2A5GA 2JFZA 2X4LA 3GUVA 4TQ9A 2JFNA 2WJ4A 3SKYA 1PGPA 3MRSA 4AG3A 4Q6BA 3ZZ1A 2IPNA 2QX8A 4X8MA 3T4EA 2P2YA 1K89A 1VQ1A 3UJ8A 2A4KA 4ZCRA 3JAMA 2O8EA 1YFLA 1OAOC 1VZ2A 3OZGA 4GH5A 4X41A 2ADOA 2E82A 1Z82A 3MW8A 4F6RA 2DETA 2C9YA 5EUQB 1OX5A 1Y9ZA 2Y0CA 4KDFA 3TLCA 2J0SA 2F62A 2HJHA 2HXYA 4LVCA 4YRRA 3CR7A 3MEQA 4J2OA 1MABA 1HL3A 4N5HX 5BSEA 5HTOA 1O58A 4JYPA 3FB4A 1FL9A 2XE4A 3B82A 4TYMA 4ZTZB 1MIHA 5ALSA 2CDBA 3H4MA 3W8RA 2I0FA 1SHZA 4MKGA 2C0PA 4ETWA 2QEQA 3IP6A 3VNAA 4R5HA 1Z06A 4R1MA 4AJJA 1E0JA 1RCTE 3QA3E 3VPCA 2O4CA 2D5CA 1KPGA 1W52X 3I34X 1RT9A 2JC3A 2ZJOA 4RAOA 1IM5A 4BNDB 3UB2A 1K8RA 4H1HA 3G6KA 3VVBA 4PZAA 4P4SA 4ESEA 5NULA 2XB2A 1MOZA 3D4LA 4E6EA 5LQCA 3ABIA 4P4UA 5ECGC 3KDPA 3PDHA 4OY3A 4I9FA 1IXSB 1GDDA 3RF6A 4A0GA 3LO8A 3KOMA 4IDEA 4D4KA 2FJPA 1P75A 4RGBA 4NS1A 1MX5A 1O6FA 4Y9UA 4MRAA 1PDWA 1WXWA 5EKSA 3SU8A 1CEEA 4ZT7A 2EERA 1M0EA 4HZIA 1DEHA 3BWVA 1I4DD 2QV7A 5I7SA 4TGLA 2Z3ZA 4RQTA 4JVLA 2H29A 1F8XA 1IN5A 1XQXA 3BMOA 3OKPA 4ZEOA 5KOHB 3C2QA 3FNFA 1P5HA 4DPMA 4M0FA 1WSDA 2QMYA 1ZCJA 3M6IA 3REOA 4D8VA 2A5JA 2Y6UA 1KQ3A 4TL9A 1JR3D 3EXHB 3NGLA 4A92A 2VFAA 1E3LA 1MB4A 4Q3DA 4CU5A 4L9SA 1TW2A 1NA5A 3CKYA 1U63A 1ZK4A 2WWRA 4HAUA 3KHSA 3B48A 3SQLA 1DT3A 4NMMA 3CEJA 3F78A 5IJ0B 4QD3A 2VR1A 1TW3A 4G4SP 2AUNA 3NV7A 1ES9A 2GM3A 5JE8A 3TPFA 3WLAA 5HF5A 1RKUA 5HS6A 2O48X 4XFJA 1OR8A 4L8WB 3ANTA 1RRGA 2P6PA 3RS8A 1X14A 3QFRA 1D2CA 2EBWA 3O74A 1NG9A 2W43A 5AW9A 4EUSA 1VKOA 2ADFA 2VSOA 2UZ3A 3QYAA 1JFVA 2ZGVA 4M9RA 4B44A 4J76A 3KPWA 2WLTA 3AFHA 4L3OA 2I3AA 2RI1A 2WSMA 2VDPB 1AHNA 2EQBA 4FZJA 2NG1A 4GE0A 4IDFA 2ZI4A 3ADPA 4JP2A 4KAXA 5IJ0A 2FPGA 1NQUA 4B71A 4WBNB 1B7GO 1W2HA 3C7KA 1U0OC 3FWZA 4MV3A 1Y4UA 1HR0B 2WHPA 2WIBA 4MVJH 5IHPA 2GRJA 3GLIE 2HXGA 2ZS7A 2P4SA 5EZYF 3RLFA 3DKVA 4FMDF 4CG3A 5LP6C 4MS4B 1GRNA 1LF5A 1XDWA 1UAGA 3PL1A 1UJMA 4FFRA 1G59A 5AW7A 1GQSA 4KE7A 3ESQA 1H69A 3OTIA 1P29A 4L22A 2B0CA 4Q03A 4GC9A 5K0ZA 4E7OA 1ZN7A 4G6ZA 3RBAA 1DEXA 2ODNA 2WIKA 1H2YA 1AXGA 3F46A 4PBSA 4CIVA 4DW8A 4AY6A 3NIWA 5ALLA 3K8ZA 1E9FA 3CEAA 1G1AA 3L9XA 1OBOA 3IQWA 3OT1A 4EDHA 1IBLB 2NTNA 3D8TA 3DLAA 3DYBA 2X8JA 1I10A 2OQRA 2WAAA 3GUCA 1KK2A 5DMHA 5EMHA 4JI8B 4ZZ3A 3WRVA 1XPUA 4G07A 3FGZA 1ZJZA 2VPZA 3ACDA 3L0DA 1P2FA 1EESA 2V96A 3COZA 2B4RO 3WMWA 1II8B 2M2IA 2FWMX 3D4NA 5FL3A 3W6PA 2AH5A 4GHWA 3MOGA 4LGMA 4MTCA 2Q50A 4LDPA 3RFCA 4DYDA 3PJEA 4QFCA 1QDLB 2JDIA 4BO7A 5E6SB 4DIDA 1AJEA 4IF6A 4CNQA 5EE1A 5FWAA 1YR8A 3V9AA 2YWBA 1SQSA 3I6MA 4OHFA 3S2EA 3OTWA 3SZOA 1W1IA 4HTAA 1KRWA 4ZANA 1K3UB 1P2BA 2PEZA 1TX4B 3OX1A 4IIJA 2X5XA 3ENNA 3ZHBA 2V8OA 4B6GA 4Q12A 4ZGBA 5ELXA 3ABZA 2ZRIA 5JH7B 1XNRB 5HRUA 4TRRA 1ZC3A 5L8VA 1XZDA 4P5EA 4TWZA 5E7MA 4B6OA 3J7AC 3MUOA 2VT3A 1OFUX 4GOND 5DI3A 5J2UA 1EFVA 3KCQA 4F3NA 1OB2A 2AX4A 4NF2A 1MC5A 3AXTA 3SS7X 2X4DA 3IILA 1M2OB 3F6EX 1QKJA 3THSA 1XLUA 1K6IA 2AK2A 4URYR 2ORWA 3KQNA 3IP7A 5IKEA 2YHBA 5CUQA 1Y3CE 4YMSA 3GAZA 5KYWB 5BVGB 3DLCA 4DQKA 1L5FA 3FJYA 4Y98A 1EBUA 3P0HA 3KELA 4YS6A 3PQCA 4DBVO 2GCIA 1YBFA 4Y2SA 3TL3A 3U9SA 1JFFA 1JMYA 1K4YA 4S1TA 3OESA 5IEJA 1XAJA 3IO3A 3I01A 4JI2B 2PX5A 4JBNA 5K8IA 2QL9A 1YL5A 4EGAA 3RU3A 1D4FA 1FLDA 1AVTA 1J23A 4ML3A 3U4DA 4AULA 3VR6H 4PRKA 1QO7A 2BV3A 2FETA 1AKRA 1UR5A 4RFSB 3IB6A 5IXSA 2UV8A 1WW2A 1P0QA 5JJ5A 4WN9B 3G02A 3AF2A 2B2XA 2PGIA 4OOEA 1H05A 3R5JA 3TW6A 1HDYA 2XUFA 1DTWB 3RROA 2R6DA 1WW3A 5EWMA 2PA0A 5SYAA 3SYKA 4E30A 3VHLB 4UZSA 5IJ9B 4LWPA 2HSZA 1EUDB 5HJ2A 3UPUA 4BIIA 1N2CE 1LV8A 4OB7A 4GR5A 5ELLA 1E9AA 2FQWA 2VCEA 3C24A 3UMBA 5C7LO 1PQ4A 3UN1A 3UHAA 2ZG6A 4ZCIA 1HT0A 3I37X 4UXHA 4CWAA 1S3FA 5I7AA 1O89A 3WA6A 2FPMA 1DX6A 3CV3A 1DVRA 3CZMA 3IDOA 4Q7LA 3S2SA 4DF3A 5CM9C 3USCS 2R79A 3OX4A 3BSFA 4JK3A 2VDRB 3IX7A 4F1KA 2CNLA 2HJWA 5CDFA 3HCEA 1A8PA 3CW8X 5KI6A 3NUZA 5KYNA 1B0AA 4OEHA 3KZ1E 1JG3A 1GGFA 1XMIA 2I2DA 1L2TA 1E94E 1YQ9A 3ZCSA 1Q1QA 1NQXA 1KR5A 4IJ6A 4TUYF 5K2OA 2Q4EA 5C8YB 1DU4A 1AQLA 2P40A 1YI8A 1F2TA 3ZWBA 2PFSA 4AXXA 4Q3EA 3PGJA 3NOVA 3ONFA 1CZKA 2EATA 4L1KA 3OT4A 4XFKA 5M29A 4H1UA 4DJ5X 2B4AA 4EUFA 5CNMA 3HXKA 1YJAA 2C95A 1ENOA 4GPTA 3F6PA 4UAUA 2J0QA 2YY5A 1V47A 3RVKA 5IXJA 1UBCA 1YVDA 5BR7A 3RCBA 2VVTA 1M5RA 4LYAA 5HCIA 2NUBA 5DJ5A 1CF4A 2IV7A 5KTYA 3TCNA 2JGKA 5F2EA 2C4MA 1GJRA 3GMIA 2KBEA 2WFAA 3EVTA 4JIMA 4Z54A 2DKOA 1ADFA 2FUG1 2HA5A 3C6YA 4G41A 2ETXA 4QHYA 2HX1A 1F6WA 3LFTA 4R1QA 3JYHA 3TUZC 4KRFA 4E3WA 1DIAA 3HJCA 5D8DA 3FNGA 1G8AA 5BYBA 2CHFA 1C2TA 3I9FA 2ZUWA 2IOFA 3RSSA 1S8NA 3WWZA 3HKBA 1RWPA 3BQNB 1S4MA 4BO3A 2C7PA 1DIOB 2M1XA 5JS6A 4NEQA 4L7QA 3RC3A 2HHJA 1T1IA 1ESMA 1RKXA 1TGYA 1GA4A 2GNPA 2O8VA 2REBA 2K7ZA 4H4EA 3SZUA 4C0JA 5B57C 1ABFA 4OJTA 3ORRA 1JBQA 1T9KA 4PWZA 1U0FA 4CF6A 4DMHA 4F85A 4DR4B 1BU8A 4ZCPA 4BVHA 1QR6A 2QUHA 1Q1AA 1PT6A 5FRDA 4D9IA 1WW8A 1JHRA 4HB3A 4DBZA 3RAGA 1JZSA 5H3HA 3IAUA 2V1XA 1AGRA 2VHXA 1S3GA 2FX3A 3WQQA 5KJ6A 1PNRA 2OSBA 4IZIA 1MA0A 1W6UA 1SEPA 1SQGA 2P9FA 3FX2A 2G36A 2EHJA 2IUYA 2OG2A 3C6MA 3PBKA 3TEMA 5AD1A 3JQ7B 4FPXA 4JOBA 5E6RA 4GEGA 2XQFA 3LOPA 1ZH0A 4FILA 5C46F 1X9IA 3PDCA 3RBXA 4WT7A 2B61A 4GWLA 5DWDA 5AIBA 4I5FA 4Q3BA 1NMEA 3D3EA 4NE9A 3K70B 1KEWA 4R9VA 2CMDA 4MYCA 1YDWA 1UAYA 3ADDA 4ZRMA 3KKQA 5CDHA 4K6FA 2QMQA 1N5RA 1Z0IA 1GPMA 3TBHA 2A5DA 3B3FA 4KDEA 1PJQA 4LECA 5FNVF 5EESA 3BORA 4E03A 5IC5A 4AIIA 2X6RA 1TK9A 1XZHA 1KQFA 1XLWA 2OC9A 4BKOA 3K9FC 1QHSA 1Z7WA 1BS9A 2QLTA 4BU1A 3BIOA 1F3OA 1NG1A 2HCJB 2I2CA 1P4RA 1Z26A 2IYTA 2X23A 2BM1A 4Y1EA 4A8HA 4DSNA 1PZHA 1X80A 4CIXA 4FNGA 3B3AA 5AOBA 5CIYA 2C5HA 5K8UA 1C8KA 4LUCA 2VJCA 4R3UC 3W5SA 1PAUA 2OGTA 3P97A 1Z08A 5F5XA 7YASA 1WEHA 4F7DA 2AG8A 1RDFA 1I7DA 4TYYA 2A7XA 3DAFA 1NUUA 1Z18A 4TTIA 1GQFA 5FTNA 3QWAA 1CZNA 4P4NA 4CQMD 1RPZA 5EZSA 3LYHA 4CKBB 5CLFA 1CZOA 1IOLA 4UMFA 1WE2A 2B25A 4MJLA 3BB1A 1GHTA 1B76A 4K0RA 1D2AA 1PK9A 4BQPA 4G36A 4HLQB 1FXWA 1Z35A 4JBYA 4LF9B 4DLKA 5BN5B 3AF3A 4MW4A 4Z7QB 5MHTA 2ECQA 4MCJA 1MTOA 5LOVB 1XXHA 4LSWA 1MX1A 1PR2A 1JPVA 1GU1A 2OK8A 1Q19A 3D4PA 1Y48E 3KCNA 4PC6A 5AQEA 3G9TA 4YPFA 3VPXA 3CBQA 1A27A 1ITZA 4RAQA 2NUTA 1XU7A 3RVRA 1W25A 3NT4A 3JQGB 1M2JA 4DA0A 4DLPA 4G37A 4MQEB 4INPA 1M5UA 5HP4A 3A3YA 3S1LA 2GR9A 2MMCA 5AHWA 1VBNA 3H6GA 2BMFA 3CPHA 2CHQA 3LUDA 3ZTWA 1M75A 1PS8A 2PTHA 3ROQA 1ZRNA 1AKVA 2HTFA 2CMFA 3LQFA 4UTXA 1GSHA 2E9SA 1UADA 1XLTA 2GHIA 3B3JA 3QEMB 1Q0UA 3DHVA 1JG2A 3DAHA 3LC2O 1EVZA 1Y1RA 2IEIA 1UPUA 2ZPAA 3D3WB 3EH2A 4R0VA 4QOEA 5DNDA 3TQCA 4EHFA 3FLBA 5IM4A 1E3DA 1U04A 3JYQA 1K2WA 1E3EA 1P1HA 2GPYA 3GN1A 4LDRA 3GY0A 3PPWA 3ECAA 5IFKA 1CUWA 2CEKA 2IS1A 5EPOA 2VRBA 5CNIA 3S44A 3EVFA 4UVIA 3WGGA 3SXPA 5EXPA 1ZI6A 5ITZA 5FAKA 3CLRC 3PX7A 3I9NA 3COPA 3SHVA 1E5XA 1M8FA 3PG5A 2Q6TA 4JJ6A 4NZMA 2F8MA 4QUKA 4UBOA 5J9FA 1SQFA 1J8YF 1U0JA 2B4KA 3FCCA 3KEFA 3MZ0A 2LNDA 1EDEA 2ZB3A 4TZKA 4NJMA 4FBMA 3LT1A 1YS1X 3RAEC 3LG2A 2A1UB 3B1XA 4CCWA 4DRXA 2E4XA 3F5DA 4HKTA 4ZC8A 5AW0A 1ZIDA 1F3LA 4L4UA 1XVIA 1RC0A 2EBFX 5BPHA 4LOAA 2FRDC 1SCUA 1B0PA 2PLRA 3G5TA 4OQZA 3WGZA 3ZHVA 3EFOB 1MA3A 5GVSA 2IH4A 2AOWA 4IAOA 3O31A 3SSNA 4GR9A 5LQSA 1CDDA 1ESZA 1GQQA 4LC9A 1MB2A 1B16A 1N1EA 1OI4A 1V5WA 1W49A 1ZMRA 1R37A 3F98A 5T4HA 5DV9A 3ED5A 3UCEA 2PSDA 1SD5A 2QYSA 5EAIA 2HBYA 1FRVA 2NADA 3PKIA 4TV8F 4B3BA 3THXA 2AC2A 2WF6A 3PQEA 5KX5F 2ZUDA 4RESA 1L3BA 1L4UA 3Q1LA 5L3QA 3A1FA 5H83A 1EM8A 1JHZA 2FW7A 5I9BA 3GGOA 1RJDA 5JYDA 2A3RA 5C3MA 2C1EA