1U0OC

The mouse von willebrand factor a1-botrocetin complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
195
structure length
195
Chain Sequence
FYCSKLLDLVFLLDGSSMLSEAEFEVLKAFVVGMMERLHISQKRIRVAVVEYHDGSRAYLELKARKRPSELRRITSQIKYTGSQVASTSEVLKYTLFQIFGKIDRPEASHITLLLTASQEPPRMARNLVRYVQGLKKKKVIVIPVGIGPHASLKQIRLIEKQAPENKAFLLSGVDELEQRRDEIVSYLCDLAPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Botrocetin
publication title The snake venom protein botrocetin acts as a biological brace to promote dysfunctional platelet aggregation
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1u0oC00
1YVPA 4CN9A 4IHKA 3ZE1B 4O02B 3IBSA 3M6FA 1RS0A 1T0PA 1M10A 2O7NA 3BN3A 4G1MB 4A0QA 2IUEA 5ES4B 3EGDA 3PPWA 3TVYA 1OAKA 3N2NA 4UM8B 3EOBI 5E6UA 1MQAA 5E6SA 5KYYB 5LN1A 3Q3GE 1DGQA 1IDOA 4MMZB 4NEHB 2NUPB 1U0NA 4C29A 4HQOA 1MQ9A 1SHUX 2I6QA 4WFQA 3EG9B 3PPXA 1M2OA 4G1EB 3K6SA 3V4PB 1ZOPA 1JEYB 2I91A 3PPYA 1BHO1 1BHQ1 1CK4A 1SHTX 1XDDA 1U0OC 4M76B 1MJNA 5HDBB 1ATZA 1IJKA 1SQ0A 2M32A 3VI3B 1M1XB 3HXOA 3ZDZB 1MQ8B 3E2MA 4HQLA 4JDUA 1JLMA 3ZE0B 3ZE2B 3ZQKA 1ZOOA 3EG9A 1LFAA 4NENB 4IGIA 2VC2B 2VDPB 1JEYA 3EGXA 2VDRB 3F74A 5HJ2A 3EFOB 3HXQA 1CQPA 1UEXC 2NUTB 2ODQA 3RAGA 4CN8A 1TYEB 5KYWA 4UM9D 4C2AA 4MMYB 3T3MB 5KYXB 2XWJI 5KYUB 4HQKA 1NA5A 1FE8A 3TCXB 4BJ3A 4IXDA 1AOXA 4PN7A 1JEQB 2VDMB 1XUOA 4F1JA 3EFOA 3NIDB 2WW8A 3NIFB 1JV2B 2QTVA 3PPVA 1PD1A 4WK4B 3V4VB 4Z7OB 5KYYA 1RD4A 1N9ZA 1PD0A 3TXAA 1V7PC 4MMXB 3EOAI 2NUPA 2ICAA 1M2VB 3FCUB 5KYNA 3K72B 3VI4B 1N3YA 1QC5B 1YVRA 2VDKB 3QA3E 3ZDYB 2VDQB 1RRKA 1PCXA 1RTKA 1Q0PA 4XW2A 4CNBA 5HGJA 3IJEB 1M1UA 1M2VA 4WK0B 1U8CB 3EGDB 2ADFA 1QC5A 4NENA 3EH2A 1L5GB 2B2XA 5E6UB 4WJKB 3TW0A 4F1KA 3F78A 4HQNA 5E6SB 3ZDXB 3FCSB 2NUTA 2XWBF 2VDLB 3GXBA 4Z7NB 5KYXA 2XGGA 5KYUA 3K6SB 3EH1A 1T6BY 1MHPA 2NVOA 4UM9B 1ZONA 3BQNB 2I6SA 1JEQA 1PT6A 1XDGA 5E6RB 4WK2B 2VDNB 1AO3A 4Z7QB 3K71B 3HI6A 4DMUB 1AUQA 2WINI 3T3PB 4FX5A 3BQMB 1IDN1 1DZIA 4HQFA 2VDOB 1QCYA 3EGXB 3NIGB 2ODPA 2X5NA 4C2BA 5BV8A 1FNSA 5E6RA 5KYWB 1IJBA 1MF7A
chains in the Genus database with same CATH superfamily
3D6JA 4PVCA 1YVPA 4X91A 4S1TA 2JFUA 2F1OA 3V2HA 3ZXXA 4CEJA 3IERA 2B1QA 4ALMA 3OZGA 2CXTA 1ZESA 1CRPA 2D5CA 4G1MB 3GUYA 1P7WA 1ZH2A 3D6TB 3A25A 3LT1A 4J90A 4CCAA 5CFQA 4JODA 2VTBB 1E0AA 2C2YA 2G0NA 5A0FA 2OBFA 4DMGA 3RSSA 3A9UA 5B1SA 1QAMA 4RHUA 2VLIA 3SHQA 3SQDA 1M8KA 3OQ6A 4UHKA 3RK4A 5MN5A 3WK7A 3QEJA 3HR4A 4K81B 1C7IA 3FJ1A 5CHYA 3OP4A 1NJ5A 2KLBA 3V6MA 3ZYCA 5KEIA 2IYOA 3IKLA 3C5WP 3I05A 4CIXA 2QBYA 1EVKA 1Q19A 3O84A 3I30X 3PIRA 3ED1A 4TV8F 1M1XB 3GJ8A 1GPLA 4QU9A 1YZLA 4HG2A 2EW8A 2R1UA 4N39A 2JIBA 1B26A 4QUJA 4BTEA 2I87A 4DMLA 2X7JA 4ENQA 1OAOA 2G80A 3BHIA 2GHIA 2BFBA 2C4NA 2B8EA 3Q6NA 3AKEA 2J85A 4GAEA 1JECA 1W1UA 1SBCA 1KVRA 3PRKE 4XDGA 3C6MA 4CKCA 2CV2A 2Q2NA 1UPBA 1XL0A 2GN2A 1RM4A 1NPYA 2FQ1A 2I4NA 4Y98A 2P6RA 1PEKE 2SKEA 2PKXA 3DBOB 5J1TB 4C7XA 2BONA 4RHXA 4AD8A 3L8YA 4B0PA 1WJGA 1LDNA 1ES9A 1Z6AA 1PD1A 1FZQA 2W5UA 3DKKA 1E7QA 1OHHA 4H6VA 4ZCSA 4LZOA 1C81A 4P5DA 4Q3OA 2OYCA 1Z88A 1KIMA 2I2BA 3CZCA 1Z5GA 9ABPA 5I7EA 1IBRA 3IKJA 4F5EA 4XWKA 1DXOA 1ZM2A 4F9TA 4EL5A 4KREA 5JUWA 3BD8A 3SQWA 2WY2D 3NBUA 3NOVA 1Y8QB 4ND1A 4DLTA 4KRFA 2GBPA 4DQLA 3R3UA 2IS6A 1J7JA 1NT4A 3T0GA 1I36A 3T7SA 1SBQA 1REQA 3KAPA 4X6YA 4EG3A 1TF2A 3GFBA 1QQBA 4AKGA 2GPJA 2Z8ZA 2Q1UA 1XTKA 3MMSA 4FCVA 1KYXA 4FYJA 1AIPA 4PC3A 4Z5XA 3R3JA 4CMCA 2Q3DA 3TOVA 1TZJA 1E8NA 6REQA 2YOHA 3GGDA 4HWPA 3W8RA 5HF6A 3TF5A 1YRYE 2ORVA 4J7CA 5K3SA 3G59A 3DH0A 3WDLA 1RKBA 3GA0A 4N48A 3L49A 2EZ4A 5FR2A 3MUEA 1OX6A 3IAAA 4K6HA 4RZQA 5AM2A 4KITB 1GG5A 1UZMA 2XVZA 5A3JA 1E2LA 2C97A 1KKMA 3RUAA 1VLJA 3KJIA 4WK2B 3ENQA 4KMRA 4HDRB 1FY2A 4HH4A 3SM9A 4ER0A 3CUVA 4HNVA 1JJ7A 4COKA 4XYMA 1E59A 3EC1A 1HWYA 4H17A 5I48A 1JQDA 4M7OA 5TLSA 1FBNA 3MOIA 1OAOC 3ZGNA 1SD5A 3PP8A 3HXTA 4MXDA 1AHIA 1IJBA 1NSTA 2J0EA 4GQIA 3KR2A 4DXAA 4B6FA 4AB1A 4CN9A 4RVFA 3G7UA 1RYBA 3A04A 1L6RA 4PR3A 1CR0A 2XA2A 4MQFB 1UEIA 1OYOA 1X1QA 3PITA 4OP2A 2JPDA 1COWD 1JE1A 2C54A 2P6OA 1CY7A 4KE6A 3QVUA 1E2EA 2UVDA 2C04A 4Q21A 2JNWA 4REQA 3T7JA 3A6FA 2VJLA 2ID7A 2QRJA 4DR4B 1E2GA 2E21A 2YXNA 1ZHOA 4IV0A 2D59A 3ABIA 1QZ3A 3GK3A 1DAMA 1Z2OX 5IK2D 1T3GA 1XA3A 3Q8WA 4PLPA 1K4KA 3WRWA 3OESA 2GXUA 1ODLA 1UDRA 4EUNA 4AK9A 3JX9A 5AKGA 3D6HA 3DBVO 3SSMA 1YK0A 4FSHA 4JYPA 3NR2A 3ZG6A 1E69A 4PFQA 2PBLA 2ZB7A 3DV0B 1T2CA 3QJ5A 2Q9AA 4YDHB 3UO8B 4P58A 4WZBA 3SICE 4MQUA 2RGCA 4U2KA 1OFVA 2GF0A 3AETB 2ZR8A 5E38A 1IOZA 3H2JA 3VZBA 2VQEB 1E5LA 1CW2B 1T3HA 3MAGA 4OXQA 5DI3A 4DANA 1V8FA 1RBZA 1G8GA 2Y8EA 4V3BA 3RLIA 3T9DA 1CUVA 1R9NA 4HX9A 2IPMA 1AKWA 1LNZA 4FFDA 4GLOA 1YDGA 5E9JA 4D4GA 1I94B 2IYFA 3BFPA 1FFCA 4TVBA 1QWSA 1U8YA 5FPHA 1PEYA 1XJ0A 3DLPX 4YRCA 5L6MB 4GPZA 2XHZA 2QYSA 2YIJA 5H3HA 2IOFK 3ON5A 2ILTA 1O95A 3OSZA 6AT1A 4YALA 2Z5LA 3O91A 4RH0A 4F7WA 2WF7A 3ABQB 1H93A 1MHTA 1OWOA 2ZP1A 4EHJA 5TQ2A 5DX0A 1RM5A 3NHYA 3HMKA 3L9XA 2DWPA 5AESA 1XFAA 2AK3A 3CRQA 3EW7A 3VNVA 1VFNA 4LGCA 2MHCA 1QVWA 3PKZA 5KJ6A 2NO9A 3H9GA 1WMAA 2R6R1 5CP8A 4JI8B 1U0HC 2HWWA 5EFOA 5JLAA 4CF6A 1W85B 2II6A 3DWIA 3IE0A 2AZDA 3AL2A 4LNHA 4N9QA 4A73A 4DBZA 1K66A 4UAJA 4A6DA 3MFYA 5EJGA 3B8EA 1FMFA 2YTZA 2VPWA 1DIGA 1A5SB 2JCSA 3ENZA 2N46A 2ZI3A 3UK6A 5I4BA 4C7OB 2GD6A 3B13B 4EABA 3CRVA 4FDMA 1RI1A 1XWIA 4FGSA 4HVCA 2AJTA 4NX2A 2QD1A 5BSUA 2Y9MB 5A62A 1SZDA 1Z4NA 1Q22A 1KK3A 2H4YA 2HUNA 3OOWA 1TKAA 4Y7CA 1JJVA 3ZWQA 4F04A 5DNUA 1RJ9B 1ZGCA 2P1DA 3IAEA 3JQRA 4LI0A 3OQJA 5HJ5A 3H1AA 1NX9A 1KYVA 1AS2A 2VXYA 3UAWA 4CL8A 2O6LA 4MVJD 3IEVA 3U4QB 2HJWA 3GIDA 3HP4A 4FUTA 1EESA 2GAAA 3UAGA 1JEEA 4I1SA 4P3PA 3RVSA 3OZWA 2O14A 2VNAA 2JIOA 1NY6A 2P7HA 3Q3VA 1CQJB 3CXUA 4U0JA 5BO5A 3FX2A 4Q9JA 1NAHA 3AV0B 3WL5A 4BBPA 1JQAA 3B6IA 5ED0A 4FGUA 4AYTA 4OJTA 4L50A 5LQMA 1GHTA 2QUIA 5JNWA 1KI1A 4RFSA 1IN6A 5GIPE 3CZPA 5BSVA 3PQ7A 4OHOA 4Q4JA 5HKKA 2DWUA 2FPKA 2DR0A 3N05A 4DNFA 4HH3C 1M75A 1PUXA 2QD5A 2G4VA 4J0FA 1JTEA 5HUJA 4XD7D 3OPYB 1UK8A 4J7UA 1FJ2A 2WKQA 3TZHA 3ZWMA 1CE8A 4BNJA 3QEMA 5CB4B 2L69A 5CTAA 1R7RA 3GO4A 3M49A 3N0RA 4WXEA 2OM2A 3TK1A 5I9LA 3K53A 1O95C 4HZUB 1JG4A 3VZPA 3N6RA 4IEIA 2X3FA 3L7IA 4L28A 1OOEA 1U5AA 1TJ5A 5ER9A 1N2JA 4GPTA 2QOEA 2DBQA 4MGZR 4H2DA 4OHCA 1KVQA 4Y0VA 1CR6A 3H9EO 3UW3A 5FUYA 2HBQA 4AY6A 2CWWA 4FQ8A 1N2SA 3ZBQA 1QM5A 4S12A 5EPEA 1DHTA 3I1FA 2PYIA 1N77A 2V54A 4WDRA 5KU1A 1E3WA 3LLVA 4JBHA 3U9TA 1YS2X 1PHRA 4ZT3A 3P97A 4ZPXA 5ABPA 1BKDR 4FGZA 2M2IA 3TR6A 5LYJB 4X66B 1W4CA 4RHTA 2AL7A 4URVR 3CXRA 4D26A 1NP7A 1VL5A 4DGQA 5LQKA 2PBRA 3IMFA 4BFXA 1EK2A 3PRHA 3JSXA 1Y3HA 3EJWA 4RY2A 1F7VA 2ZS8A 3OTHA 1SCAA 4A23A 4W1QA 3K1AB 1JQ3A 4P1ZA 4RKYA 3V4VB 3DO6A 3JD1A 4AS2A 4DWJA 1Z2DA 2QMUA 4HF7A 4QD3A 1SBYA 5KVVA 4YCJA 2AN5A 1NBEA 1VYVA 1JKJA 4MR7A 4BQOA 3ZU2A 1GZ4A 5C52B 4M53A 2HF8A 5HTOA 3BPSA 4KH1A 4BLQA 2B7BA 3LLCA 1KY3A 5E9WA 1PCXA 3HN6A 4MUKA 3T99A 1QP4A 3AK4A 3K9WA 4NBKA 4RAQA 3WNCA 1J99A 1Y1QA 2F3SA 2OCIA 2FE4A 2QR2A 3K0SA 4DAOA 3E9NA 3V4SA 4AUKA 4YJGB 4PM4A 3FZGA 4ZQHA 2D1TA 2FLVA 4W99A 2AYYA 1YJQA 5E7IA 1SPBS 4KR9A 3FOAA 2WAMA 3FR8A 1NG1A 3OPMA 2VJPA 2UUCB 2A5YB 3DVSX 4PC6A 2GPAA 1AZSC 1I80A 5ISMA 5HIIA 3WWPA 4C1BA 3UGTA 2IHZA 4AMVA 2ECQA 4CNQA 2V8BA 3MTDA 5KMGA 2BKAA 4FOPA 4F4UA 1C7FA 4M1QA 2GZSA 3AHGA 3VU8A 4HMPA 3QE4A 4OQXA 3IR5A 1PR2A 3KE9A 5LU8A 3N59A 3NIBA 4DJAA 3T0IA 3USES 1Y5MA 2CVOA 2FCAA 4TLBA 4YJDA 1HYGA 2GXSA 4EHFA 3O75A 1V5GA 2DUNA 3WDSA 1YMVA 2QT9A 4KQJA 3RSFA 4U39A 2A5JA 3IIKA 3U5ZB 4MV4A 4LRWA 4QOIA 1BGWA 1WOMA 1KP3A 1N57A 4PINA 3UVEA 1PZMA 3GFSA 5ALKA 2ENUA 2BLLA 3NQ41 3UHFA 2GT1A 1Z6YA 1YB4A 4RK4A 1BS9A 2RGUA 1XZNA 1H2AS 2PDAA 3OZDA 5IYZA 1U90A 4XUDA 1O94A 3LYAA 4RK7A 4GP9A 4JLWA 4CM4B 2BP7A 2HHLA 3C6ZA 1FTSA 5BYAA 4GPEA 4ZVUA 2I5PO 4TUYA 4C0KA 2A33A 1NVVQ 1EFAA 1RHJA 2YYYA 1U0TA 1P4AA 2JGNA 3AM3A 3Q3GE 4MUAA 4EDFA 2JLCA 6YASA 5JYEA 4P36A 1MABA 1X0XA 2C61A 4HCJA 5G0UA 3FBTA 3ZBPA 1IY8A 4RDIA 1ACJA 1LQ2A 2YICA 3H2KA 4DM4A 1R9GA 5FL7D 1H0RA 1G20A 1BHQ1 3N6XA 3N7UA 4ID3A 4YJ2A 3C3AA 3AF4A 1QJ4A 3OI7A 3PL1A 2ZJ5A 3D6FA 4FYIA 2WZCA 4QRDA 4XLZA 4KH0A 2CV1A 3AGQA 2A5DA 3GAFA 4NWIA 4BQNA 1X7XB 5BYJA 4UU0A 2HYIC 5K8TA 2Q8NA 1KYTA 1R2QA 5CDUA 2P2GA 1ZKDA 3FROA 5FHQA 3SR0A 2D06A 4D46A 4YK7A 4RZHA 1RWBA 1DAOA 4L5CA 3HJRA 4U9IS 5KNBA 2GN8A 2FOXA 3CZMA 3E27A 3PQDA 8MHTA 1XYYA 3E53A 1PUIA 3H16A 4DZTA 4D8WA 5CLHA 3PXDA 1WXGA 2W6OA 4BC0A 4D2IA 3E1GA 2ABWA 3OWHA 4EB0A 1IQRA 1OLSB 1TZBA 4FDLA 4LUCA 1Q95A 5FR1A 2R6AA 1FYWA 3R0JA 4ZYLA 2V7EA 3SJAA 5E4FA 1UK6A 3BCSA 3ZDRA 3AVOA 5ITSA 1NI5A 3PQ6A 3O82A 1SUCA 2O8CB 2XUHA 2WSSA 2DHCA 3QA3E 4KYIB 3WGJA 1KFBB 2BFEA 2QLJA 3ZLBA 3ZDYB 4E11A 2VDJA 4B4VA 2WG0A 3ZIDA 1H05A 4JXXA 3HU3A 1SEPA 2WE7A 3HABA 2RI1A 1L5YA 4MQ5A 5F2EA 1U9CA 3BD6A 3Q1KA 4RY0A 3U2QA 4N0MA 4CM6A 5P21A 5J4HA 1QFJA 4HAVA 1E3QA 1O94C 2BBTA 3CCBA 3IQHX 3T7DA 4CUJA 3RFUA 2BRUA 4IDFA 1U8UA 3UJNA 3EA5A 1Z08A 3FMGA 1EGVB 1G6OA 5F12A 3ZDXB 4B3CA 5CFOA 3H75A 3OEYA 1PNQA 3LRTA 4JHLA 2O3TA 2XWBF 3MELA 1H2RS 3NM4A 5B7QA 1Y3DE 1KPGA 4KBGA 2W4MA 3QXGA 2I03A 4ZMRA 5I45A 5EKXA 3HBMA 3KWMA 1BE6A 4JFAA 1SCJA 3I01A 4K9LA 1KOGA 5CAEB 5IARA 3EZNA 3HB0A 3C1AA 3EEIA 2OXIA 3DO5A 4ND4A 4PBTA 4RJJA 4LSMA 4I19A 3OEWA 2XCTB 1KBOA 3RJ5A 4RL4A 3R5TA 1C1XA 3HXLA 3I0NA 4MUIA 4YHBA 3KQMA 5TMBA 3RREA 4YMLA 2PS1A 1GCUA 3WZMA 1QZTA 4O4LA 2WMNB 4L3OA 3JQDA 3JXEA 5TJ9A 4Z0PA 1MG0A 2I62A 4HGNA 1U9ZA 4Q4AA 2O0HA 4DPMA 3LX4A 2NP6A 4FDTA 5DLPA 4QARA 2AOWA 1EIZA 1HOTA 1QVVA 1RZVA 2GFQA 4ARSA 3UJPA 1H3EA 4EVRA 4ZQBA 1U0RA 1TUEA 1XTQA 2YY7A 3AEQA 3KYCA 1BWSA 1Q3HA 4NOJA 1TCUA 4PPFA 2P40A 5CRIA 3T61A 2O5VA 3A1NA 2Q1YA 4LOAA 3VX4A 1ORVA 5M29A 4TTQA 3TGPA 3FGNA 1T9ZA 3H3XA 5L7YA 1X2EA 4F3YA 3FE2A 3LC1O 5DYYA 2NSLA 1G3IA 4IJQA 3WQQA 4MWTA 2F1JA 3BH6A 1V37A 1WP4A 4GRDA 4YAKA 3G5TA 3EVGA 4BX0A 3A1CA 1S7CA 3ZTTA 2AMYA 3V1KA 1XDDA 1DAGA 4QFDA 3R74A 1ISHA 1OIXA 4ZHQA 3GV0A 2JFWA 2O1SA 2F1HA 3IPCA 4I9GA 2FOIA 5AJXA 3VR5A 4AJIA 5BN5A 1AVTA 5GQSA 1Q74A 5JVDB 1C0PA 3K5HA 2A92A 4B6JA 4X44A 3T35A 1XZCA 4Q24A 4HS4A 3T94A 1XZ8A 4EHKA 5KOHB 1OASA 3U7GA 3OHMA 5TQ0A 2BRUC 3UAZA 4FBMA 5EZSA 3VU1A 4E32A 3WKEA 4BLRA 1YR3A 2G09A 4I6GA 3LYHA 4KXMA 2BTOA 4R9SA 4TMFA 3RTBA 2E9SA 2FSHA 3CZ5A 4P3YA 3ZW8A 4XIIA 2CXNA 1X1SA 2OP1A 1OLUB 4PYJA 5FBZA 4OAOA 2JCGA 2XV1A 3DM9B 4D74A 3RASA 2QU7A 2I3DA 3B7PA 4BNNA 1F2UA 4MKHA 4Q7QA 5GZ1A 4TTAA 2FDRA 3TXAA 2FSFA 4DT1B 5LA6A 4WUTA 7MDHA 5CA0B 1KJNA 1PWHA 2OFOA 5KSZA 2BWJA 4HEA1 4U7FA 3IUSA 3ZWWA 2ZI6A 1ZQ9A 1SD2A 1TM3E 1XQ9A 4FYKA 5H3LA 2VDQB 2XB6A 1C1YA 3GDHA 4QULA 1TTPB 1CUWA 4UASA 2XDAA 4YRLA 1I3OA 3GEBA 1P72A 3INTA 4ETMA 1CUYA 1K2WA 3HBAA 1XTZA 1ZI6A 2HZ7A 1AKRA 3LK6A 2R7MA 4ZDJA 1LS1A 4FE7A 1TM5E 4HC4A 4WERA 4Q9HA 5FI3A 1HE5A 5JCOA 3EYWA 2QPOA 3N2GB 4C78A 4D42A 1RHQA 4UE3S 2RI0A 1A4XA 2QIPA 3NC4A 1GKIA 4EFNA 2AFHA 2W6JD 2X0EA 3T7AA 3T95A 3PC6A 1YULA 4I1RA 4NNJA 2UYQA 5DNCA 1HEUA 1T1IA 4NV0A 1UBNA 5HJEA 3OD5A 4JB0A 1YGPA 5M5BA 4CV0A 4FIDA 2JAOA 4FILA 1JTFA 3WQSB 2D54A 5JG7A 2VDWA 5FKJA 4KN8A 4FHGA 1R37A 4RHYA 4OD0A 4UU1A 5J59A 4EKEA 1EB8A 2WABA 3T9CA 1EFLA 3SZUA 1KEEB 1YFZA 2WPDD 3QMMA 4RK5A 3PYXA 1IULA 2G7MC 2H57A 3IQZA 1D9ZA 1I14A 1J0BA 3AR2A 2EG5A 4L5IA 4EZIA 2HJGA 2H51A 4N5IX 3AYXB 2AD1A 4GU5A 5M04A 4HWTA 4AZVA 3R7LA 3L7AA 2QSYA 2DULA 1GPJA 3NPMA 1YS4A 1A77A 4OXXA 5EIFA 5ICMA 2B9VA 1GGKA 2WD7A 1MOPA 4WBXC 1VA5A 5CVJA 1F8FA 5REQB 1RAGA 1S9HA 1T35A 1NXQA 3GBVA 3MRXA 1E2MA 1Q92A 1XTPA 4EYQA 5CEEA 3GJ0A 5ED4A 4IH1A 2VXBA 2C3YA 2D0DA 3M7IA 2VNKA 2XNDD 1EA7A 3GJ4A 3UUFA 3K0FA 1ICEA 3K9LA 1JDBB 2Q45A 3BTSA 4GGPA 3OKCA 3KXLA 2Q3EA 3RUPA 1G19A 3FNFA 3RYIB 4JCOA 4ROSA 2X15A 3VPDA 5C8YF 3CTMA 4LHSA 4EMUA 5BXYA 3EJ6A 2GEDA 2MDTA 1E5QA 2ZWMA 1FFXB 5CM8B 1XDWA 2A78A 4CUKA 3UWSA 4DLVA 1T0BA 3SZGA 5C1BA 5TGTA 5BUZA 2RAVA 4IIUA 2P27A 1KRXA 4ND8A 3C98A 2ID9A 16PKA 4G84A 4NJEA 4YRDA 2CUNA 3TW4A 4D9EA 2G5PA 4CLRA 3K0AA 2E6UX 3OJEA 5JCOC 3LWZA 1C7RA 4GZ5A 2YZ7A 2R96A 5IT4A 3ZIAA 2P11A 3V7WA 3LZ6A 4GXNA 4BBAA 2ZTHA 3ZYZA 1PYOA 2CBZA 1E9EA 4FMPA 5TVKA 2XUFA 1U0BB 5U9CA 1O6GA 5D01A 4ZYYA 1AV7A 2HC9A 2JGMA 2WE8A 3F8TA 4RS3A 5JCZA 1NG9A 1IXKA 3BGOS 3G6WA 4FS8A 4RDHA 4TTTS 3RROA 1DJQA 4YCLA 3COWA 3FPGA 1YBHA 4XVHA 1PGNA 4D80A 4UAUA 4IFEA 3MJCA 4I50A 4B40A 3QLTA 4N03A 3O4GA 2H08A 5K2MA 3G88A 1H2ZA 5BSHA 3GVIA 2DEUA 1HGXA 3KB6A 1N0HA 2X7HA 2ZBPA 3EK2A 3SVZA 4DM3A 4CL0A 1EDZA 1OCEA 4Y67A 3LUCA 5DBIA 4V1CI 2C7OA 1C2YA 2IYWA 1V1JA 4ZHSA 4PAOA 3GLIA 1Q0QA 4DSTA 2RGWA 1OXBB 1P2GA 4BV3A 5ITZA 1S89A 1VMKA 2C8KA 2WUVA 3KBBA 4WADA 3S1AB 3ECSA 3QK7A 4GEKA 2HV9A 4Z9FA 4XXHA 5T41A 5KOJA 1HA3A 1Q57A 5F2NA 2FZKA 4TLCA 4A7PA 4S05A 2CXUA 4DSOA 2YXEA 3BMOA 2ZZKA 5UKDA 2ZJ8A 4JLMA 1E7RA 1DBPA 4P83A 4KR0A 1DV1A 1K7YA 4B4UA 5CYGA 2C07A 3G9QA 3NS7A 3PNVA 2VWHA 2D5BA 2E1RA 1WMFA 2CUKA 1T6BY 4QSMA 3JPYA 2BC9A 1V4NA 1ZCAA 1BZYA 1F14A 2FCRA 3BBLA 5IKMA 2OXCA 3O8BA 4IJWA 3DZJA 5F76A 5CXQA 3ADCA 5KOIA 5LP6A 1OI2A 2OG2A 3DONA 4R7TA 4RDCA 4JJZA 3HACA 1WMDA 1E79D 4BKUA 1I0IA 1TECE 3PC2A 4IQ4A 1DRWA 4F84A 1VOTA 5AKIA 1NXTA 4FTWA 1Z2NX 4DV1B 3MTBA 2JFFA 1P8AA 2M1ZA 4NULA 2W2VA 4BNDB 2J3IA 2VDOB 1EX6A 1HRKA 1LJLA 3NRJA 3RRYA 2A14A 4R0NA 3A4VA 3QVVA 4HUJA 3S7TA 1ZUNB 1QIEA 2C2WA 3T3OA 2XMCA 1J8MF 1O54A 3N2YA 4CCYB 2F8TA 1F0NA 3AHEA 3ELBA 3NT2A 4I1UA 1PR1A 2AVNA 4NS4A 4ZAZA 3T1QA 2X4DA 4KQXA 1UXKA 1QE5A 3P9CA 5EE3A 2GPNA 1M2KA 1RQ2A 2G9ZA 2LRHA 3O1JC 5JBQA 2ROQA 4NF2A 1AURA 2QTVB 1I7QB 1RAIA 2ZUTA 1BMFD 1DI0A 2C96A 4X20B 1JLLB 2DH6A 5AHWA 4KUGA 3B5EA 4BQIA 4HQOA 2R2AA 3LLMA 4ZQFA 4MVJF 1WZ2A 5BRJA 1UOPA 4C6TB 1L7QA 3C85A 4DJ5X 3PE4A 2IU3A 4GBMA 5LBTA 3H4MA 1RQGA 1WUJS 3CS3A 4JY7A 3L8ZA 4L5AA 4M89A 5B1DA 4LDAA 1V95A 5DHAA 5L8VA 3PUVA 3KPWA 3CLVA 1NXVA 1Z7WA 2BN4A 4XX0B 1C3EA 1DO0A 1UPCA 1PGOA 3SJZA 1GPYA 3KSRA 1J2YA 3V7UA 2PTGA 4LYYA 2XE7A 5I9MA 4H35A 3UXMA 2PZAA 3PWKA 1YVUA 3JYHA 2R7KA 2VQDA 3MCUA 1P33A 3N0WA 4JI1B 3SDBA 2A67A 1SFRA 4BMZA 1P9WA 3OEHA 4Q3CA 4N47A 4EKNB 3I39X 2YJ4A 3CW8X 3ICPA 3BMCB 3OTWA 3RVRA 1R4NA 3VSDA 5SICE 3O4JA 2YX1A 5LP6C 1XBTA 4OUDA 1KMHB 1UOQA 1JHYA 3JVUA 4EELA 5B53A 5IT0A 4L7VA 4F6CA 3C3DA 3EF3A 4QO8A 2F59A 1M5TA 1V7ZA 4DLYA 3ZHXA 3A0UA 2FYTA 3ESXA 2QL9A 2GN0A 3H2GA 2FUEA 1PGJA 2RHBA 3F47A 3SX0A 4ASUA 1JWAB 1ZLXA 1RP7A 1EWTA 1NJFA 1TT7A 2HPAA 3CG0A 4XM2A 4D9GA 4MR9B 2INGX 5EIBD 4G0PA 3O1HB 3U17A 1YL7A 2BGGA 3OAAD 3KQUA 1SOWA 1Z3IX 4RWZA 2DE0X 3NONA 1T3ZA 3EGDB 2N3ZA 1GYRA 4KODA 5JAZA 1U1CA 1ZOSA 3LXRA 4LSGA 1TEZA 1MBZA 2WFAA 4AJHA 5AK0A 3LU1A 2PRIA 1FSSA 1JLRA 2UVPA 3RRNA 5LB4A 4B6PA 2QRVA 3S8EA 3CWCA 1RKVA 1GRRA 4Y0AA 3D2AA 5D3QA 1N5LA 2C4HA 3CLTD 3QX9A 4R1SA 3P4UA 3ZCSA 1J4AA 3EH1A 4DBLC 1UINA 3L93A 1LC3A 4O33A 1TIPA 2ZLBA 4AP6A 2W2TA 4CRWB 4HLQB 3U13A 1OBOA 2NV2B 2QYTA 2CK3D 4MVJP 3TTVA 3WLNA 4I14A 3RS3A 1U6KA 4UBLA 1ABEA 2OKGA 4L3VA 3LTNC 2VXOA 2V7UA 3AR3A 4RLSA 2YMQA 1H1DA 1QF7A 1S4QA 2A1UB 3E8XA 4O1IA 1IBSA 1QCYA 3FHOA 4BLTA 4BV8A 1OR8A 1ZD3A 5JYBA 1WS6A 1C0LA 2HHAA 4BFYA 2UYCA 2R00A 4RSRA 4OFBA 4DUGD 4NOLA 4JX9A 2C7QA 5CDHA 2AZXA 2ZIEA 4TV9A 1RKUA 2PMFA 2Q5HA 3TL6A 1R18A 1WCXA 2YHBA 5DLYA 4E15A 4ZN6A 5ARBA 2CV0A 4LHZA 2VK2A 4YMVA 2ZWIA 3LCUA 2PGIA 4WLUA 4OA5A 4EY4A 3JRXA 3GFOA 3ER6A 4CDRA 3CRRA 3JS5A 4B17A 3KJEA 2BR3A 1L5KA 5E7JA 3EMKA 3MLEA 3OE7D 4GYWA 3G85A 5FNVB 1QRDA 2H1LA 2ADOA 4OTZA 1EVIA 4OHZA 4PGFA 3OOHA 4JP5A 3RC7A 2WWHA 2VPTA 1VL1A 3GN1A 3I4FA 3BGDA 4KWHA 5CNIA 1B6RA 4YP0A 5AKHA 3PTAA 3C87A 4DW8A 4JJIA 3I04A 3U37A 5FTJA 3LQYA 2FZGA 4RXMA 1HT0A 3IURA 1IZZA 1PKXA 4QQRA 2EP5A 2BPOA 3JVDA 2EJVA 1UFOA 2VQSA 3OOEA 1XLVA 4URFA 5DM2A 2RCYA 2X0IA 5AKEA 3KQHA 2GBLA 3VKHA 3OMXA 3KVVA 5CTJA 1Z38A 3NFYA 2VHWA 2FJPA 4MIEA 1EM8A 2J7KA 4MI6A 3DLAA 2VP0A 3I1YA 3NLLA 2C94A 3Q87B 4G8CA 3TRKA 1MG5A 1RJFA 4FB4A 3KZXA 3A7DA 1HFEL 5H68A 1BQ4A 2PGAA 4B6OA 3TECE 1XXLA 1TUBB 3CB2A 1E3IA 1QPGA 2PJDA 3AIIA 3E7FA 1E4EB 1D4AA 1T4MA 3UFXB 4MDEA 5BV0A 3KQNA 2GJ9A 1D2MA 4WHMA 3GR6A 1RZ3A 4JXZA 4ZU1X 5JBNA 1K3UB 4CM9D 1B3RA 4OHXA 2OC4A 4NSNA 4QTYA 2GFHA 2HMAA 1T5OA 2I65A 4AN1A 1MDFA 2H4XA 3ESBA 4D45A 2AWNA 3ORYA 1JWLA 1QG2A 1TYDE 4QGGA 1MOQA 1XELA 2VRCA 4J76A 2R00C 2X22A 4LWZA 1VLMA 4CKZA 2FP4A 2NO6A 3UPTA 4B3MB 4K88A 4O0MA 3BEOA 3HK2A 3KQSA 1IB0A 4J2TA 2JGEA 3AZPA 1BVHA 2F9FA 1YS7A 5EZYB 2OYRA 4CT0A 4D5GA 4M9XA 4BZWA 1XEXB 2YMPA 4QUIA 2C7PA 1P0PA 5ULLA 1DTWA 4NCAA 4TXJA 4F5DA 2HRCA 1JHMA 2J5KA 1WXEA 3AVQA 3B5IA 1O9HA 2K87A 3LNCA 4LRQA 5JSKA 1KGDA 1F6BA 1UBKS 3NWOA 1GIAA 1G3RA 1SKYE 3E05A 3GCDA 1LC0A 4BMXA 1NM5A 3LAWA 4TTSA 3RYHB 1QHIA 1V5EA 3WIBA 3TDNA 1P75A 3ANMA 4B31A 3ZXUB 1ZAKA 2GTIA 4Z4EA 1I1OA 5LZ9A 1B74A 2ODAA 2OECA 4KPGA 1JRLA 2QSZA 4FSDA 4AM8A 1C3VA 2JFYA 3PUWA 4BGEA 3PX7A 3JAKA 3U19A 1K4MA 4ZAWA 1HFKA 2PH1A 2BW0A 4GL4A 2GBLC 4YRPA 2AHOA 3AM1A 1NN5A 3Q98A 5JD3A 1T5HX 2COEA 3FHJA 3ZY2A 2O7SA 1LRJA 4MLDA 4PYIA 5EXSA 2H0AA 1S3GA 4H1VA 1M76A 4EMTA 1W4BA 4OQQA 1LZKA 1RYMA 4OO3A 5JSQA 3I1JA 4U6NA 1QZUA 2C42A 4RMHA 4XE5A 2XYGA 5LMCA 3IEMA 4AP9A 2OCYC 2QV7A 3UHAA 1HT3A 3TQQA 3FDIA 4LF8B 1XMSA 2X0FA 1FMLA 3P2KA 1R0LA 3FMIA 1YQUA 4W9MC 5KO2A 3WISA 5COAA 2A1TR 2X9GA 2JAWA 4QT0A 4CI9A 4NK5A 3TX2A 5KKNB 3ZCRA 1C50A 1F38A 2VYFA 3ETCA 1A2KC 3OQIB 1LLFA 4EJFA 4R1UA 4E08A 3EWSA 2H2AA 1CDZA 2OQIA 4RGBA 4EHAA 3AVVA 2ZYUX 1A71A 2CC2A 5L3ZA 4P80A 4XGRA 2YN0A 3DEFA 1WB5A 1DKPA 1TRHA 2Y66A 3MLAA 4OH7A 3I61A 1DVRA 1MCZA 3ILXA 4Q1AA 3RARA 3LJKA 5ALZA 2QTHA 3BSFA 4HPJB 3CPSA 1MXFA 1A8PA 1W4AA 4UBMA 5DTRA 3V8PA 3W4KA 2R6GA 5JCPA 4IIGA 3M3PA 1QOQB 1IHDA 1TM4E 1QZXA 2JGJA 1TRKA 3TOZA 2RD2A 2XVAA 3SC2B 3E9MA 4L8LA 2I8CA 1NM5C 4N40A 1TTQB 3W1WA 4A8JB 4O1MA 5PNTA 3T5GA 3X2SA 5L7WA 2WW8A 2OZLA 4HEQA 2VXCA 2RG7A 1BU8A 4MI3A 5AUNB 5IJ0B 2D0IA 5JW6A 3T4UA 1F1JA 1F0YA 3TTYA 1N2GA 2BBWA 1OQAA 3DEJA 3IIMA 1ORHA 4X3OA 5CA1B 1XQXA 1Y1LA 3BWXA 4FBGA 1VLLA 3KZNA 1K98A 4Q6BA 1BKSB 1Z25A 3V00A 4AYWA 4F4HA 2W48A 2Z6QA 4B76A 1A2BA 1U7ZA 1NLZA 4Q37A 4WDQA 3OQOA 4ZOCA 2IHBA 2Q3BA 1RZRA 1EVYA 2H1SA 5I7VA 3DDNA 1RQXA 1TYCA 1QLJA 3JQGA 2PUTA 3M4NA 4YAFA 4B83A 1AHNA 4ND7A 3PLAE 1RU3A 1WPGA 2OVBA 2R4QA 1L8QA 4HSGA 4NL4H 4P3KA 4RF2A 1N2HA 1KVSA 1VLVA 3O4VA 4F6RB 3IAFA 5FYQA 1HQDA 1PZHA 1KEZA 2NUTA 1CSEE 2HQRA 5IULC 2DXIA 1D1TA 3FSEA 4ZCMA 1FB5A 1IQ0A 1M2OB 1NBHA 1M34A 2GSWA 2P75A 2R25B 1VBFA 5DK6A 3RS0A 2QVBA 4HUQB 4DSNA 1U2QA 4OI2A 3JQCA 3ACDA 2G17A 4HEA6 2HM7A 5KX5B 1BMTA 1UPAA 2QUHA 2OUIA 2DP4E 2EBWA 2VSXA 2XAUA 2YINC 3OZRA 2EWMA 3WGKA 1LXCA 3P1JA 4D0GA 2FHSA 4US1R 1T8UA 1CQIA 1L4YA 2NOAA 2RBGA 1QCDA 2J32A 3I3OA 4IMIB 4QYWA 5FWDA 1V5IA 3DTVD 4C01A 1WMBA 1XT6A 3LH5A 2RH4A 3IDAA 3ANLA 4JJGA 4W5WA 3ZTYA 3ZN2A 1ADCA 1I51A 4EI8A 3FWKA 2WJZB 1XX6A 5FTWA 5TGDA 4LVOA 1NVXQ 3OKFA 4KIUA 3JYLA 4CLOB 5JT1A 4EKDA 3FTEA 1OX5A 3SQXA 5AI8A 1XCPA 2RJNA 4E4RA 2JHGA 3AUAA 3BRQA 3R7FA 1VSQA 4LFAB 2XXAB 3QV1A 3TKYA 3FTDA 3D8UA 2O2GA 3GZJA 3VYUB 3WO0A 1L4FA 3PENA 4UBKA 2PGLA 2FN4A 2EQBA 2JZCA 3LZCA 4JEMA 4GVPA 1TVKB 4GOMD 5CT5A 3THYB 2BGLA 1TYAE 2FSUA 2A9RA 4XI9A 2IX9A 4Z9XA 2OCKA 1A9YA 1OFTA 3DWGA 2XYQA 1I7LA 4BVEA 5ALMA 2FW8A 4HAWA 4X65B 2I2AA 1J8QA 3NB0A 3EQ8A 4GT1A 4IIVA 1FK8A 1VBKA 5TGZA 3S6JA 5EJ7A 2WMYA 2ZJ7A 3DFUA 2VAMA 2Y1EA 4FHCA 5IXSA 2QENA 4G85A 3QVJA 2PMCA 2RE8A 1JHXA 3EMBA 2ZVJA 4G8BA 5BVGA 1O96A 2FMKA 1YZKA 2ACEA 3CVOA 4UCQA 4BO9A 3K5IA 3EYAA 3H8JA 4HNTA 4CKYA 4S04A 3HXQA 4BMYA 2GJ4A 4N0QA 1V26A 4BP9A 1QRAA 3QX8A 4H7HA 2WJ6A 4WKGA 2BJHA 3TTTA 4C20A 4YRGA 2WF5A 5MFZA 3GLGE 1GXSA 4EL0A 3PEYA 3KKEA 3EUFA 3ROPA 2ZUWA 3S29A 3DPUA 1KJIA 3GCZA 5A05A 3DMPA 1B16A 5I9SA 3PTLA 4R6XA 3USZA 4BYMA 3GIWA 1JV2B 1THGA 3AHDA 2G6BA 2YC2C 2FJ0A 3L1IA 3QVKA 4NMHA 2GHTA 4LISA 3GLKA 4XJTA 4Y6OA 4BRSA 5KYYA 1E60A 2V9CA 2ZQ5A 4JNKA 4KGXA 4B74A 2I8AA 3HVKA 1ODCA 2H16A 4MUYA 4G81A 2OBNA 1Z17A 3HVRA 1GGJA 4FGKA 2XQVA 1D2AA 4HUTA 1RLMA 1C29B 1N8NA 3HG7A 4L95C 1KORA 1SURA 1XR3A 3R9XB 3V8EA 2ZBUA 2I1VB 3R0QA 4KQHA 5DHUA 3KVNA 3SCZA 4EKGA 2VHXA 2O8NA 3FGOA 3IHKA 1C5KA 2XA9A 2I7VA 4G65A 4UVHA 4FMDB 1B6SA 2XQIA 4P6VF 4UE2A 4MQMA 2R5WA 1XROA 2YDYA 2HR1A 1DJMA 2H5LA 1K06A 4PC7A 4DLPA 3GJSA 4EQ6B 2Z1MA 1M83A 1Q77A 1QGOA 2P9BA 3JD4A 1M6WA 1AN9A 1CRLA 2YY6A 3ED5A 2LD4A 3E7WA 3FCSB 4NBSA 3RJ9A 4XTCS 3RD5A 2NYVA 1UWKA 3HHPA 1ZKMA 4NYIR 1G8SA 1PWZA 2I4RA 1P7CA 2PAFA 4GI1A 4XLLA 3UXEA 1Q1NA 1KC3A 3U7IA 4RPKA 5TPWA 1J0EA 4KXQA 4Y9SA 3QOFA 4O3FA 5G3ZA 1CV2A 4M0PA 4Z7QB 5I7OA 2IU0A 3ER8A 3IVAA 1G5QA 3AJ9A 2WFLA 3WLMA 5D87A 1IONA 4FX5A 1E3EA 3MBOA 1Q91A 1UP4A 5KSPA 2CEAA 4FFRA 3SD7A 1IN1A 3REQA 3G13A 4KXYA 3IDQA 4PRKA 3BA1A 4F12A 3P9IA 3NPAA 5LZ5A 4RHFA 2Q7XA 5CJPA 1JLHA 3KTAB 4HAXA 2A5GA 3CRNA 4I4IA 4OHMA 4EEXA 2I3GA 5CG2A 1IB6A 3M83A 4PCUA 4DMHA 4HNSA 5I4CA 2UYGA 1HFJA 1NI4B 2BJVA 2P62A 2VTVA 2WZDA 2YVQA 4OXIA 2NT3A 2DRIA 3H4VA 3IOCA 3IUNA 2PX4A 3GWZA 2ZTMA 4EGSA 5FPYA 4AZ0B 2JLZA 4BXOB 4JJEA 4J4HA 1JHOA 4M6WA 1H2EA 4QPDA 3RFFA 3UENA 1QFYA 4ZKDA 1IXRC 1E8DA 3O74A 4RZIA 3ORSA 4F2DA 2WM8A 3IE1A 1WHSB 1II8A 3N6VA 4RPIA 3KVRA 3O5AA 4P5PA 1DXQA 2BISA 4QDZA 1Z35A 1UBTS 2HWKA 3K35A 4TVSA 3HJCA 2MINB 3PEEA 2W4QA 1KC1A 3C1TA 4O2AA 4QQKA 4WTOA 4EYSA 2LCFA 1I7SB 3EXHA 2AGVA 4XQ9A 1V11B 2A1TS 1NRIA 5L51A 4N76A 4JXKA 2Q6VA 3HEBA 4RF5A 1AQNA 4BE7B 3J81k 4P3OA 2ONYA 3LGAA 1VE3A 1M33A 2RJ3A 5FUXA 1I5OA 2OD7A 1UT8A 3ANTA 4HWGA 1BWQA 3BGSA 4EY8A 3SEFA 3OIFA 3TRFA 1FP1D 3U6KA 3FHCB 1C3XA 1MD9A 1T9KA 3UXHA 1L7NA 4P53A 5AQEA 1RP1A 2BKUA 1LF0A 3PG5A 5H82A 4IVNA 1NDUA 1SBNE 2NX2A 4O8CA 3GDOA 1NVKA 4ZO4A 3O8DA 3F67A 5EHNA 1J70A 1NNUA 4JOQA 1G0NA 4M36A 3UYLA 5IM4A 4AFNA 1PJCA 4ZAFA 3NYRA 2DFDA 1R0WA 4FYXA 2CVZA 2Q4EA 4L8YA 4E30A 2AUTA 4ABTA 4JUBA 2OK7A 2R8XA 1MVLA 4C4YA 1GU1A 2H1RA 2VBGA 4LJLA 5IASA 2QN8A 4MEAA 4Q7EA 2B2NA 4QE3A 2W2LA 1GZVA 4Q6WA 1W36C 4OP1A 2REQB 4K05A 1GEEA 4AQ7A 2EU8A 2F8LA 2Y76A 2DQSA 2LKDA 4ME6A 5EWLB 2ZIVB 1CS0A 2ZUEA 3MZ0A 2ZRHA 3P2IA 3BDAA 2NXJA 1Y6ZA 4PTLA 1DCFA 1SKYB 3AVPA 4UC0A 5J4LA 4R2MA 2VK8A 4EGFA 1FW6A 3SVTA 5D85A 3MJFA 1DIRA 1ONPA 4QTZA 3JV7A 1ZMXA 1LTKA 1NZDA 2OKCA 4NZOA 3QELB 5D5QA 5C80A 1SUAA 5CXUA 1NQWA 2B0JA 5KYXA 2X0RA 4HJRA 5LPNA 3UV3A 3AIMA 4ENRA 2CDNA 1JJBA 1FP6A 3M5CA 5ICSA 3LX8A 2A0UA 6NULA 4QDJA 4F9EA 1UJNA 3E3NA 2WM2A 1VKHA 1P19A 1WZUA 3E7PA 2VF5X 1ZWKA 1HOXA 4MWSA 4YWJA 5BQFA 2PJZA 4AJNA 1RRMA 4FEGA 4ETWA 4BO2A 3GLRA 3LXUX 3R8FA 3FJYA 3UMBA 4D9NA 2VUSA 1HT1E 1RXIA 3JD0A 1VKNA 5DKFA 3SXJA 3U4CA 2ZSHA 4GRIA 3EXHC 1GG9A 2RHRA 4TWAA 3JQ6A 5FYDA 5TQJA 3TNYA 4IJ6A 2QMOA 3CWQA 4Y2SA 2Q5QA 3PK0A 4CMEA 3HVUA 3K70C 4JI7B 5BMOA 1MF7A 2R85A 5CNJA 3FXAA 3VA7A 4C22A 3SF8B 1J25A 1I6WA 1LW7A 1P9RA 3LVBA 4UREA 2VS1A 3GYGA 1BWPA 5SZIA 3JZFA 3ZZ0A 3IEIA 3N2EA 3WK9A 1GU0A 3EQ9A 4M9ZA 5IAAA 1E7WA 1HNZB 3LUKA 2HBYA 3DAGA 3UKOA 4OEHA 2CJPA 4E09A 3Q8LA 2PKEA 5LLTA 4B4KA 1YDMA 2RGAA 2QKYA 3EVZA 3JQ7B 1JL3A 2G7ZA 5HZKA 2IWHA 4DG9A 3W2GA 4TKUB 4AMYA 5JADA 1HETA 2OMKA 2P41A 4DMFA 2BT4A 2OENG 3S81A 1XKXA 1ZIYA 3L0SA 5A1TA 2R8ZA 1E2PA 4EI2A 1Y3AA 2EARA 2EAUA 1U0OC 4FP9A 3EOZA 4PYNA 1ZHHA 2B1IA 3QNMA 4GZ3A 4KSBA 5K0CA 2HV8A 4N4AA 2Q8PA 4Q02A 2NSHA 5CX1A 4PLHA 4G5YA 4W8HA 3TN7A 2ZPTX 2CB9A 3QEOA 4L15A 2Y93A 1MPXA 3PCTA 4EG7A 4OQLA 1KOJA 1MFPA 1J2EA 4JXJA 2WWRA 3BK7A 2V65A 2A30A 3QNWA 3BK2A 4F8YA 4DXDA 4DSZA 2YXPX 4B87A 1OH5A 1XZMA 2FMIA 5D1NA 3TLJA 4KW7A 4JWTA 2JLRA 3QFTA 4QYIA 4RH3A 3RBXA 4V2IA 1A9XA 3LWNA 3FPEA 4FYPA 2WWGA 3L46A 3NIDB 3AL3A 3VH3A 1J0AA 3RTAA 1JBKA 3IYLW 2APJA 5F4ZA 4D0SA 4FU0A 5CYPA 1W9MA 2QTAA 3GHHA 3CZ9A 1M2VB 1L5HA 1JFVA 4PHCA 2I6XA 3W6NA 3W79A 5IJZA 2NAPA 3Q3JB 2ZUCA 2WIDA 3DR3A 1WNTA 3F0TA 3HXPA 2DSNA 3IOEA 4R8LA 1PT9A 3D1LA 4GBED 4CHTA 2VHVA 2LCQA 1JQ5A 2AMVA 1KZYC 4CMEC 3UUWA 1F2TA 3ELDA 3PJFA 3TNLA 1P2FA 4EEZA 4OK3A 3QF4A 2QX6A 1W1WA 1A9PA 3B3GA 1QH8B 4B9AA 1N1MA 2QI9F 1BFKA 2BGRA 4YDSA 2IYUA 4HTFA 1K3TA 4ZT4A 1NWHA 4BO0A 1XTJA 2WYIA 1R16A 3O8QA 3UCFA 1RBQA 3L1JA 2NAFA 2J0UB 4MQ4A 5IAEA 5BP7A 4CQNA 4Y1FA 1VJDA 4LRYA 3ENVA 2J5XA 2ZRJA 4KLZA 4TS3A 4AO8A 4RS4A 5FBLB 3I42A 3SHOA 2ZS7A 1AO0A 3V80A 3PA8A 2C1XA 2C5GA 3G2HA 1EEHA 2GBCA 1YQQA 1AUQA 2HJSA 4UEWA 1E4YA 1T3LA 2YNMA 4WV3A 4IJ5A 5CR9A 3T3DA 2ZXFA 4GM1A 5G4KB 1T8YA 4PLCA 2Z2XA 4ZZ2A 4MITA 2DMRA 3VTKA 1YCHA 3A6LA 2VP4A 3T4XA 3DAPA 1BA2A 1HE8B 4ZA2A 4DRYA 1EK1A 1A1SA 4IYRA 1RAHA 4ZI5A 1VPVA 2ZR7A 5KDLA 2GB4A 5JJBA 2ZPUA 3JASB 3OFJA 2QGZA 2J0VA 2ZU6A 1Z82A 3AEKA 4BL5A 1EK5A 4OMFG 4CM5A 3ETJA 3IALA 1DB3A 3RTGA 3ZK9A 5BPFA 3T9EA 4BEWA 3PPWA 2B37A 1B73A 2X0KA 3IVCA 4FZJA 4XDYA 5K8UA 4PANA 2ZCUA 3DYBA 4C6HA 2IP1A 1QIIA 1FFDA 2Q3HA 2JH9A 4WN9B 4NPCA 4PNPA 1A8HA 1ODFA 5AOVA 3ZWCA 13PKA 1TPYA 1SCDA 2DPHA 3GFGA 2ZJAA 5AK3A 4LOIA 3G79A 1X0VA 3HNPA 3UMJA 1VPWA 1HSZA 2ZIXB 1A50B 4YJ3F 1RMYA 2DBZA 3GDGA 2JAQA 3KKMA 2HMVA 1YR7A 2QZPA 1TK9A 3Q7RA 4OJNA 1QS0B 4OG2A 1MC5A 1JPJA 4K86A 1VPTA 4CTMA 2VJBA 3L79A 3V4LA 2TMKA 1GTMA 3U3RA 3U16A 1YKSA 3GLGB 1Y1TA 3K6JA 1EJ6A 3GFVA 4AKTA 1CIPA 1HLPA 3FSGD 5HKOA 4QQFA 5DM4A 1WMSA 4G5XA 3DZCA 5F3DA 1VKJA 3W3AD 1MAVA 1YDFA 4D9MA 1DG9A 3C3XA 4GOOD 3CPJB 4D1YA 5F1YA 4TMVA 1QYRA 4B47A 3S4YA 2QP9X 5HRUA 3NWBA 3TM5A 4M38A 3T3IA 3ZQUA 3K9BA 4OPMA 4FFBB 1GA6A 5IC5A 2VUTA 3L92A 2VYVD 4KPEC 4JGBA 3V55A 1YOVB 3RS2A 2DWQA 1OB5A 1OI7A 4KL8S 3U6BA 4LE2A 3SHWA 1TVEA 2YNMC 2QPAA 5E3JA 1XALA 2B3TA 2WJYA 2IITA 4IBOA 4OVKA 1XP8A 2PMEA 1A9OA 2ZT7A 1QH0A 3Q7EA 1WW3A 2RAPA 4IDGA 4XZ3A 1HMPA 1VZ2A 1KO4A 1TC2A 3TKLA 2F43B 2GPSA 1RBMA 3GLFB 5CJ2A 3LVFO 1M7GA 2PUJA 4X6UA 2F17A 5K8VA 4KVFA 3G8AA 3MC1A 1E2HA 4P2BA 3TUIC 1W0KD 1EEXB 3HYCA 3LC7O 1WTCA 4L6IA 1X7ZA 4LRXA 1I4DD 2CDBA 3ANYB 3HUFA 3TQTA 1Y4SA 5IAGA 1N36B 2P3LA 1W25A 3AVUA 2XDWA 1ZD5A 3OPVA 1ELOA 4R41A 4LY6A 1A95A 1N0WA 4IUBS 2CD7A 4WY8A 5IJXA 3V8BA 1VC2A 4K2HA 4QUDA 1J1UA 2BHSA 4M86A 5ICFA 1K6MA 1P8JA 2HYDA 3G8DA 1K63A 2NTEA 2QR3A 2XQJA 4GKAA 5IP5A 2C8JA 4FIZA 1FJHA 1CUFA 2BEWB 4WKNA 4JU9A 3L4BA 4QU5A 4F11A 1JR6A 1KQOA 1PVOA 1T1SA 1Z5UA 1KFCB 4M9UA 1ILEA 3NZEA 2NZ8A 3GMIA 2AMFA 4L0DA 3SXUB 4XVUA 1ANKA 3UJ3X 3HDHA 5CB4F 3I72A 1O6BA 5DIFA 2B1JA 5G2OA 1YNOA 5L45A 3C6KA 1GZ3A 1T29A 3G2MA 1JA9A 2BTQA 4FGLA 1ND5A 5DXAA 1HO3A 1LBTA 3MWEA 5I6DA 1CUDA 3OCYA 3WLJA 1HDEA 1Y1RA 2QY9A 5JXGA 1WUTA 1A27A 2WF8A 4KNWA 5LKAA 1SB8A 4GIBA 5HMLA 3DCJA 3HJNA 4I4TF 4CKEA 3OF2A 1YE8A 2CVQA 5E1DA 3T9AA 1CUAA 1A5BB 4JA0A 3VSAA 4E5PA 1QWOA 3V1TC 5C81A 5JECA 4IF6A 4UD6A 4WPGA 1GD1O 2WSLA 3NV9A 3RWBA 1SK8A 2I0FA 4M1OA 3Q40A 4HYQA 3IJPA 1F5SA 1QR6A 3SQNA 3HEMA 2AHRA 5C1OA 1ID8A 3VKGA 3W7VA 4I2NA 1RCUA 3CE6A 1ONSA 1A8IA 1WXXA 1QH1B 3EIUA 4F0JA 4YMTA 5LYJF 5EJIA 4EJMA 5CB6A 2OZVA 1SN7A 3H5IA 4UBNA 1AKUA 1TQ8A 1MJNA 2EC5A 2F4NA 2I2WA 2RKOA 2H9YA 2V7TA 1GZHB 3FCOA 2ODEA 2WIKA 3VI3B 4H1WA 4MVJG 5THXA 2IHTA 4GC9A 4JUAA 4YMWA 4F92B 2NTNA 3EMVA 3BIXA 3A27A 3KZKA 3OICA 5CXXA 3UWPA 1V5WA 2RGEA 3R6WA 3ZS8A 4EPRA 3ZD6A 3P9YA 3N5KA 2Z1NA 1FX0B 1EZ1A 3R0XA 5G1NA 1U7WA 2CFTA 3JWJA 4RU1A 5EWJB 4ZCPA 4F3RA 3A4MA 1B00A 3G2KA 3OZVA 3QWIA 4YCAA 1HYEA 1NTOA 2XD9A 2NUBA 3E48A 3HADA 1ZOIA 2E4VA 4KC0A 3RRMA 4ZAGA 1QONA 3W8EA 3ESCA 1MB0A 1IAVA 1J7KA 4N6GA 3L8HA 2YMMA 4ICIA 3WHKA 3VZDA 4AS1A 1J2JA 3L4BC 4XFJA 2GK6A 5AQ1A 4ZI7A 2JHPA 3EXIA 3B60A 3MEQA 4XYBA 4XDHA 5GAJA 2OG1A 3V6LA 1VYUA 1EGMB 3AC0A 3G9TA 4FYYA 4YHHB 1A5ZA 1PWEA 2QJOA 3H13A 5A6SB 5IDQA 3LPNA 2CEKA 1Z3CA 4XM1A 3TX6A 5B4TA 3G17A 3ZVMA 4CJXA 3B2QA 2JLAA 2HRQA 4Y8VA 3KT3A 3UQZA 1AGNA 1EP1B 1YRQA 2ORIA 4TROA 2YIVX 2I2FA 1GCGA 2OESA 2CNBA 3JWPA 3T1YB 3UJ9A 1J5EB 4HDNA 3SMQA 2QTGA 1Z8NA 5SZJA 4M0DA 2AR0A 3RFCA 1BS2A 2H4JA 1J0DA 3ABSB 3WIUA 1SXJE 1B8OA 3IOYA 2JDIA 4OQMA 1FS4A 1JPNA 1E9DA 4WBNF 4V0ME 4X1YA 3EZ6A 4YC7A 5DVZA 5IJ9B 2R65A 2ZT8A 4TS4A 4R1NA 2J08A 2PAAA 4Q47A 1M8JA 3OLQA 4FWTA 1QGAA 5BWBA 4M9QA 1J5PA 3TUJC 2ZJ1A 4K3UA 5TRTA 1IWBB 3DKRA 1Y80A 2KYRA 3MHPA 1ZONA 2HWYA 2PKQP 1KI6A 3QE0A 3ZBTA 2CLHB 2FH5B 3LSTA 2GN9A 2I3BA 2QMZA 2H0QA 1PFUA 4HDMB 1ZR2A 1OMOA 3AKYA 4AI6A 2X9VA 3D7KA 1JU9A 4BYGA 2X0DA 3WIVA 3ZQ6A 5IS2A 2WQZA 3NOXA 1OWMA 4JLVA 4RE6A 1PFKA 1MFZA 3WVNA 3GPDG 3A6JA 2GAOA 421PA 4L2IB 4EY3A 1HURA 2BE9A 2QUKA 3A3NA 3N8DA 5AXDA 5IVHA 2O8FA 3W4JA 2H9AA 5FEMA 4NYJR 3OA0A 2XF8A 4QXOA 1Y6QA 4P31A 2W58A 4R4JA 1EUCA 1GN9A 5CK5A 1FFYA 5I47A 2F3QA 1G0OA 1GYPA 2V0NA 1Y9JA 3O9VA 2X2OA 3F9IA 5LXTA 3L5KA 5FPKA 2WQ7A 3UYKA 2VOJA 2GVNA 4X24A 4ZQEA 5HUQA 3GLUA 1EUDA 4HB2A 5JXIA 1P81A 4AO7A 3PUHA 1BDJA 3OM9A 1SHKA 4JBIA 3B7WA 5F7ZA 4D4HA 1FDTA 3TSCA 3GOHA 3K30A 4MP3A 2Y1DA 3HBNA 1YDHA 1Y4UA 2B5WA 2QM0A 2X3YA 4YUXA 5K0GA 3OQMA 3TMYA 1EP3B 4TXNA 1I2AA 4IHJA 1XDSA 1ZG3A 2HD4A 4UTOA 5JHHB 5DCYA 1VPDA 3A6GA 3AWDA 3AF0A 4PSDA 3SLRA 4C3OB 3ADDA 1NOJA 1E9CA 2YUTA 2I66A 4UM7A 3LKVA 2HTEA 5ERGB 4E2YA 1CZKA 1YUMA 4CKCB 3AL0C 4OMDA 1YJ5A 2GZ3A 1TQ4A 2P69A 2PWZA 1QG0A 1YFKA 2OOKA 1LGYA 3JZDA 4O4HB 3NASA 2P30A 1RQ7A 2WU4A 1SUBA 1JAIA 1VHDA 4BQFA 3MYRA 3GMSA 1ZMTA 3K4QA 3UA4A 4MS3B 1PI3A 2AOUB 3NHLA 4CT4B 2ZM6B 1CUEA 1W59A 3QEKA 1DQZA 4L4SA 2FPOA 4D3SA 3CJQA 1R0KA 2PIAA 4JP8A 2DHRA 2PKQO 4M1MA 1H8ED 2X3UA 1F8GA 1EDBA 4NOMA 1LY1A 4J0JA 1WSDA 5CURA 3VPXA 4WX2B 4PCLA 2C5FA 2XDYA 4R3WA 1VCHA 4DEXA 1G3MA 3UUGA 2XLCA 4PFJA 5IF9A 1A8SA 1P3DA 4IDHA 1UMBB 3A28A 4HYTA 4NCXA 4LE0A 3QUQA 3V8NA 2XUOA 4Q1VA 5JC8A 1WXQA 5TB5A 2BGMA 2DT8A 1EJBA 3C8UA 1FQOA 1T1GA 1RI4A 4UPVA 1ZXLA 2EQ5A 1DAFA 3H7AA 1MP0A 3EVBA 4XA8A 4TRRA 2Y1FA 1RRKA 2CXOA 1ZW1A 3BS4A 3U39A 1J8FA 1UDCA 1BDMA 4LDQA 1Q44A 2RGBA 5EUMA 1DQYA 1JHPA 2Z9DA 4DCSA 1XRMA 2E4YA 4EBBA 4RA6B 3FVWA 1ZI8A 2DBYA 4OYRA 2VWGA 1GP2A 2Q2QA 5JSHA 3K15A 4XM0A 3STVA 2V5VA 3UC5A 5HYVA 5H83A 4DLKA 3IT0A 1I24A 3BRWD 1OI4A 4RD6A 3KETA 1CC1S 4MW5A 4CPDA 2GUWA 4M54A 1Q7GA 4TYQA 1NNI1 4B4OA 4NV1A 4ETNA 5DW0A 1TLLA 1UT5A 2JGKA 4U7GA 4W1PA 4BKPA 4ERNA 4FCWA 1GCOA 3DLIA 2FPGB 1VRWA 1SVUA 1KZGB 1BROA 1T4BA 1Q0ZA 1CNEA 2FUG6 3KLMX 4MRPA 2QM7A 3IR7A 5HM6A 4A0HA 1FSZA 2Y1XA 2PVCA 1TOAA 2ZITA 2GQ0A 2VNSA 4G0NA 4DR3B 3Q0IA 1KP9A 2IEGA 4GNKA 4K7JA 4Q7LA 4M21A 4EHIA 2EW2A 3BXEA 4MQBA 4BV9A 5JJIA 2C7VA 2VQ6A 4L8FA 2DLCX 3UATA 2M98A 1UT6A 3PXAA 1KIFA 1AZTA 3LA6A 3O95A 3FWZA 3G2PA 4EHBA 3TFOA 3NUZA 4LYGA 3PF8A 4TYMA 2HSEA 3KLOA 4J1QA 3UWKA 2R5FA 1U5BA 3BMQB 3HVJA 3TPCA 1ACMA 1QX4A 4WFJA 1GPBA 1K27A 4NTZA 5JJKA 1I3KA 2H2GA 4BO6A 4BDTA 3FG9A 1KFKB 1J07A 3RM3A 5AI9A 2ZE7A 4I4TA 5IRCD 4EYGA 1QAQA 2I6QA 3PR1A 2MR6A 3UAXA 4C0SA 1DWOA 2GM5A 3NUGA 4NE7A 1A04A 1WF3A 3N28A 2BDUA 2RCNA 2ZB8A 1KJQA 2PL9A 3EF0A 1WU8A 3I4CA 1LX6A 1P5HA 3TLYA 3OTQA 4QBKA 1XPUA 2LNDA 4UUAA 2POCA 2W2PA 2OB2A 3H6KA 2FFRA 2ZYAA 3E2MA 1UMCA 2PMDA 5JWRA 4INPA 4U9HS 4UDNA 4F5YA 1H6DA 5KWIA 3LGXA 2IEBA 2PMWB 2PD3A 2OV2A 1SCKA 2OPHA 1IUPA 1D7AA 2IPXA 2WI8A 3BL5A 2PRSA 4LF4B 2O5RA 4QEKA 1Y1KE 1XYGA 2RMKA 2WIAA 3DOEA 5E95A 3RAGA 2RDMA 5EWMB 5EKSA 2QN7A 1NL3A 5KYUB 2FF5A 4RTJA 1O89A 5CVVA 2GJ8A 3EX7C 4LF7B 1H9CA 4YS6A 1W6RA 2QLLA 3ISVA 4KG7A 3WIDA 3Q88A 2JB9A 3KKPA 3NIFB 4NMXB 1DRVA 4IGFA 2XCOA 4L73A 1FU8A 5CB8A 3RCBA 1N9ZA 3QU5A 3X2FA 2OCDA 1RLUA 3M1AA 1O77A 3SR3A 4C4PA 3K70B 1G9TA 1P60A 1XAHA 1KDOA 4M0CA 1NQVA 1R5JA 2B30A 3IAXA 4IJMA 5EQTA 4C87A 3HTXA 4RC9A 1DCMA 1NJ6A 4RELA 3TIXB 1SCNE 1SUFA 1SY7A 2ZREA 1Q0RA 3UMFA 2IOQA 3IB3A 3NXSA 4FHZA 1NFFA 4DJFC 2D2FA 3ZOZA 2O8BB 2BFCB 5HILA 8OHMA 3TRIA 1DELA 5JH7B 1U0LA 2ZU0C 2NZXA 3HJGA 4JASB 1UBRS 1QPZA 1EFKA 1KETA 4LI3X 4BNZA 1Z2PX 4R3UC 1KAMA 4YRSA 1SWWA 1E94E 3B6EA 4EDHA 1RC8A 2IBSA 3RKSA 1SU7A 1W93A 1QYIA 3C8MA 1I2CA 1K8XB 4RIGA 2V1XA 4JR2A 3RBAA 4BFVA 3AI2A 1IC6A 4HPWA 4YJHA 1E2KA 3OU2A 4GSKA 5KU7A 4QJIA 3U7QB 4MWEA 1QMGA 5K0ZA 1AO3A 1GLVA 2JI9A 4MV1A 1DUVG 4YJKA 5B3JA 2KMLA 3A1EA 4K8RB 5ER6A 4RTRA 2VJCA 1D2NA 3QG1A 5J2TF 5PGMA 2QL6A 1Z33A 2L2QA 2QRKA 3GJTA 2O3RA 5CD1A 2FN7A 3R75A 5BXQC 2M6LA 2HT6A 3ZVNA 4HB4A 4QM6A 1Z4KA 1W49A 1T8PA 2DUJA 2FN3A 4XWAA 4EQZA 1DKOA 1LJ8A 4NMLA 3IUQA 3PC3A 1VXRA 3PNYA 3WDMA 3MT9A 1VIVA 4HOYA 2VA8A 1GTZA 5E1OA 1GFWA 4RORA 3QEMB 1LCIA 4TKZA 4AURA 1E2IA 1GSHA 4PZZA 1OPXA 2H5JA 4QZVA 1PP4A 1H22A 4KQIA 4QGFA 2B4KA 4X60A 4JI6B 3W9UA 3WBJA 4POOA 1YO6A 1L4KA 2CL6X 5CK4A 3HKBB 1KQGA 4XIYA 3ZDDA 1D4ZA 2CLMB 2GPBA 3GU3A 1GL9B 1RWPA 4EG8A 4QOFA 3DB2A 2FFJA 3KOWA 3VDXA 3OZFA 4PG8A 3MS7A 4G5SA 3RB8A 1UM9B 4B6GA 2I2CA 5DWVA 2W42A 3S0JA 2Q6TA 4RZ3A 1EU1A 4FI3F 1VLQA 3HNOA 4TV8B 4TKLA 1P44A 1WB6A 2GWRA 2AW3A 2Y9PB 3PBKA 4HDOB 4NBWA 2EVWX 3HB9A 2FRDA 4F46A 4S1WA 5C7YA 1PNTA 4L8WB 1Z8HA 3PQ2A 4F21A 3VR6D 2YZ2A 2ZRNA 2RFLA 3M4YA 2JARA 1Z36A 5CM9C 2YN2A 2IW3A 3QX7A 5A5FA 4GM0A 4RTPA 2CNWD 2OZEA 2ZEJA 4IDAA 4X8HA 3TRDA 3L06A 4HBGA 2EG9A 4MPRA 5AKLA 4H6PA 3LWDA 3L4SO 5GY7A 3WHPA 1V5FA 5K09A 1KZ4A 2O0MA 3HZOA 3NGLA 2CDRA 1ZL2A 3DKVA 2E7ZA 4MR7B 3MNFA 2IU4A 2PS0A 3B20A 1JPUA 3UKJA 2VYCA 2WA2A 3QM1A 4PLVA 1VKRA 2QTNA 2XMQA 4C0WA 3SWWA 5F7JA 4EMBA 1LX7A 3MT0A 3PTZA 5TMEA 1KU0A 2ZSDA 3FYDA 4DL9A 4EO4A 5B3JC 4REOA 3TW8B 2QX4A 3RHZA 5C18A 5F1PA 3NYQA 4G0WA 3KG2A 1YZTA 2MYTA 1PFYA 3O8LA 4Q4HB 3QPAA 5AFSA 1U63A 2O8EA 1J8YF 5BNIA 3EXEB 4J8PA 3THXB 1RTKA 2FVXA 1C4XA 2JCXA 4W9RA 4YP1A 1HZZA 5E4TA 3H11A 4L51A 1SXJB 2EP8A 2G5GX 4U8HA 4ZP1A 2YBEA 4NDAA 4HX5A 2BTEA 1SOAA 1Y1SA 2UZ3A 2WJ4A 1Z5NA 5AVOA 5JWHA 3SYRA 1U8CB 3VNBA 1M74A 2VJNA 4M9RA 4YTEA 5CDYA 4QUAA 1YB6A 2YV2A 5LMNB 3BK1A 4JAVC 2HU7A 3AJDA 3NHPA 4PSUA 2QV0A 4QDOA 2PRZA 1KI3A 5BNFA 4LNAA 2FEWB 5BWNA 1RWVA 4TZTA 1P7VA 1ZEMA 2LUOA 1JKIA 3R5JA 5EQDA 5JD4A 2OFXA 4HVLA 3WBKA 4Q7MB 1XMVA 1HNWB 2QF7A 1P2UA 1UAGA 2YR0A 3G7SA 3MJEA 4J3JA 1X7HA 1HV8A 1XD2B 4IMRA 2XODA 1CY0A 1L8LA 3BREA 4GLJA 5IUKC 3V3TA 5I8PA 4C4RA 4HRXA 3KAKA 4MUGA 4HYEA 4Q3DA 5D51S 2RKWA 1T1RA 2PVSA 3M6XA 4H4DA 1F8XA 2FRDC 4MRRA 3IKVA 4KN6A 7ADHA 2H2WA 2PEZA 3R1IA 1SG9A 3FM9A 2XTMA 3L4KA 1TB4A 3VMMA 4EKIA 3QMPA 3CLUC 2CMKA 1SVIA 3EZ2A 5C8DA 1HTWA 4U2EA 3DMTA 3O4RA 4LOJA 5KUTA 4AMUA 1NLFA 1PR0A 1W75A 2X2PA 3GARA 3DLBA 1JZSA 2G08A 2C92A 3D64A 4QQ8A 4Y9UA 4NG5A 4U1RA 1AF7A 7REQA 3AERA 2VCYA 2F3PA 2RIRA 1OFIA 1PZGA 1G20B 1V1RA 1J22A 2WHPA 4PN3A 5BT8A 3G7NA 3PVZA 5E8JA 1D2CA 1EFRD 2VP9A 3IX7A 4YCBA 3BMNA 4OP3A 3BXZA 1E3SA 1DC7A 1LK0A 2BUBA 3AH8A 1C1DA 3HXMA 1E9SA 1CEYA 2NYRA 5FTMA 2LR0A 4I7EA 4BMSA 4HNAA 2QAGB 4RJKA 4JQZA 3L4JA 2JC3A 2WOOA 1FUYB 4JLNA 4YQFA 3GD7A 3WGIA 2O8DA 1XCMA 1HZZC 4KQ6A 1VMDA 3EVDA 4ZOAA 2X8LA 4IOLA 4KEAA 5T5QA 2J0QA 1YRLA 1PK7A 3MGAA 1NVFA 4JEHA 3WXBA 3AEUB 1JR3E 3ORFA 5AJWA 2PUAA 3HDGA 3LW7A 1T0JB 4TT8A 2ZW9A 2QG6A 5AI4A 4ENPA 5IEJA 2VF7A 2PZMA 2Q1SA 2R60A 4DCMA 3JW8A 4L4YA 3ETGA 3FNIA 3FZYA 4ZARA 3BT7A 1EDDA 1XIVA 3L1KA 5A4KA 1YFLA 1G2PA 3HJAA 4IO0A 4Y18A 5LVAA 1A4RA 4F91B 2V55B 4NATA 4KPUA 2ZBFA 5FDFA 2BFEB 4GFDA 2J5QA 4U6QA 5CDTA 3X44A 3OHPA 4BUJA 3TZBA 3R41A 4P34A 4ZXFA 3QWAA 5GADl 3C1OA 1J00A 1IXZA 1PQ4A 2AIRA 3HJHA 1KH3A 2ZUBA 1CFZA 4BEBA 1TM2A 2ZCJA 1P4SA 2C82A 1N0UA 4GYYA 1P91A 3FUCA 1UKEA 5KYNA 2G25A 3V4FA 2GEVA 5DHTA 2V03A 3AY0A 4X8MA 4E0BA 1DDOA 4K6GA 2Z3WA 2C8LA 3GQVA 2JK1A 4OYYA 4E6PA 3H2SA 3NNSA 2MYPA 5C51B 3AUFA 4I55A 3ZCQA 3P7MA 3DMTC 5HGJA 3EUWA 1N6OA 1Q20A 1DS6A 1BN7A 3NHAA 3MMZA 1NQAO 3NC0C 5LNK1 3K8YA 3FZEA 4G5RA 4AX8A 2NO4A 3KTOA 3D4OA 2XKJE 5KREA 5GONF 3AF5A 8ADHA 1UP7A 2JK0A 3LQFA 3U7HB 4D56A 4J0DA 4D4LA 2ZBRA 5DM1A 5HA5A 2VN8A 2XZPA 1JNXX 3L7OA 3R3VA 2IUFA 2MOKA 1HEIA 2WJJA 4YMUA 3RR2A 1RWWA 2PWBA 1E77A 1XMJA 4CF3A 4LSWA 3BC1A 4YT2A 3Q8KA 3BERA 3GVCA 4BGVA 1V4BA 4J43A 3EAGA 4H0CA 3V33A 1Y8ZA 2A9KA 5GVRA 2Y1OA 2VSOA 3GBSA 2QYHA 1FA9A 1SUEA 2ZAOA 4Y6PA 1XRJA 1KFEB 5A4AA 1YB1A 2WU8A 2MSDB 1KO8A 1OKKA 2ZSJA 3NVAA 3D0OA 3EGXB 4FW9A 4OHRA 5CIQA 2J7PA 4ZIRB 3WFIA 1WLSA 3LPLA 1OA0A 1Z0UA 3KWJA 1QO7A 3SNHA 2BBOA 2Q49A 4OKIA 1FUUA 2X8JB 5G0VA 5ADHA 3OPXA 3QUSA 5CVEA 5ALWA 1XA4A 3WA7A 4F2HA 3O47A 3H1GA 5JE8A 4CLHA 1Y5RA 1JG6A 5EY5B 2VIIA 4EW6A 3KPUA 2BFFB 4Y1RA 1CJMA 3IJ5A 5FBWB 2A7XA 4LGYA 1OXUA 3VPSA 5K4GA 2WT9A 1ZCJA 5LKRA 2HRRA 4QU8A 1KMCA 3HY6A 5FLKA 3P9KA 4RADA 5KTNA 1CVLA 3LY9A 1Q2XA 1XN4A 2XADA 2ZT6A 4MEJA 5BN5B 4EGQA 4B4DA 1ZJ6A 1XTSA 4ZCTA 1JSLA 2J9ZB 3KTFA 1CUJA 2YFQA 5EERA 1VI5A 4P4GA 3VR4D 1U9IA 3P4XA 3PJEA 4J75A 4L4XA 4R1PA 2PGJA 3JYOA 1C3JA 5DW3A 5G0TA 1KE1A 3KT6A 2ACVA 4NR0A 1F2VA 1RAEA 1U7DA 1COZA 1QQ6A 2Z4TA 3WLEA 3ORHA 3HUEA 1UBEA 2R97A 1FP4B 3MWDA 5IMSA 1WQ1R 1JFSA 4EENA 4IGIA 4M7RA 3ZCVA 1PNVA 5F9HA 1BSVA 1T5IA 4E94A 4J0CA 2G1JA 3C16C 2W2XA 4RHCA 1ZVMA 2ECPA 2JFGA 2J41A 2ZJFA 3T8YA 4BNLA 3PHJA 1MA3A 4C03A 5CYFA 2CVPA 2QK4A 3RF6A 3ASYA 3GRVA 3LHKA 1RRVA 3SR4A 1HG1A 1QOZA 4X20A 3TSOA 4ZZ3A 3D3KA 4ND5A 3DZBA 3OX1A 4FXOA 1CY4A 1NW3A 1TUIA 2R9VA 2EIXA 3O2SB 3AI1A 4QBIA 1YZYA 4BB9A 3GH1A 1E89A 5DFAA 2OXEA 3SI7A 2NU6A 3UT0A 2PRYA 2YH2A 2PSSA 4YAOA 1Z26A 2HIAA 3NGMA 1SIUA 1GTSA 1NE2A 2O57A 1GUBA 1ZS9A 2AFHB 1AXGA 4WNAB 5JPDA 4URZR 4XUEA 1X94A 1N1GA 1L7OA 1YI8A 3CGGA 3MTIA 4KBYA 1AGPA 5E1BA 3AUYA 3C7AA 5HCUA 3OOSA 3U48A 4GF5A 3P2EA 1NXOA 5AIAA 2QRPA 1I33A 3IBFA 4NLLA 2A9JA 4QOGA 5CVUA 2CHFA 3X1KA 1ECBA 3NORA 1JHRA 2XMGA 4BKOA 1GT91 1HKHA 3WLTA 1X80B 1SUPA 3E8SA 3MTGA 3Q7TA 5DEOA 1E0SA 3PQ5A 1J0CA 4HDQB 4U63A 3E7DA 3WMWA 1Z4PX 3ZNNA 2P9HA 3OQPA 1DJLA 1AKYA 3H83A 3ES9A 1O9BA 1BOOA 1JR2A 1U1IA 4KXUA 1YQEA 1U9IC 2IOFA 3HH8A 1MVNA 1PR9A 3E1KA 3RIEA 3DMFA 1WPQA 3KOOA 1CUUA 4QOJA 2FR0A 1LBIA 2NUAA 2Q4RA 3L2OB 3FF1A 2Q2WA 4CHGA 4YXWD 3UWMA 5L4NA 4RKFA 2AC7A 2H4FA 3QVGB 2V96A 4DREA 4HAUA 5B30A 1NKTA 1LI5A 2B69A 2V7VA 5DTIA 4W8OA 4NJMA 4FX2A 4GC5A 1PG5A 2IYTA 3C39A 3L7BA 3P71T 3II6X 1J33A 3N53A 5EAIA 3EVEA 3SGLA 4Z2AA 1P2SA 3GLVA 2JFXA 4L8VA 4ECAA 1O97C 1PR6A 1GM5A 2YRWA 2D8AA 2HA0A 2NXCA 4XVRA 3IPRA 1MO4A 4Q1BA 5H9WA 4EYEA 1F4VA 1FFHA 2Z2ZA 3IBSA 4Z9YA 1ESNA 5B3LA 1ETHA 1NQ5A 4OIMA 2QDKA 3DOCA 1GNPA 2RAUA 2Y0EA 3V1LA 2EZ9A 4G6ZA 3HVIA 3G82C 4DV0B 4O4JA 4B7ZA 1MN6A 1N5MA 1GA1A 2C1ZA 1L8XA 3T1VA 1WKVA 1AQLA 1O8BA 3GZNB 2H7XA 4P7FA 2EP7A 5ECYA 3C74A 4PYMA 4ND8B 4R2IA 3VYWA 1NIJA 1QLWA 1D1QA 1DT5A 1P80A 3FVVA 3MINA 4I1VA 2IYSA 4MVJE 2EWWA 2XT6A 4YRKA 3EPJA 1ZOPA 4N6OA 3S5UA 3ZJUA 1TADA 1SHTX 1HYHA 1I01A 2OZPA 5A1JA 1Z2CA 1BU5A 3U1TA 2XCRB 3G1UA 1KXJA 2XOXA 4JVSB 5EUCA 1WV0A 4RVCA 5IF3A 1CJSA 3B52X 1UC9A 3QVTA 4K9SA 2JGIA 1YOBA 3DE1X 2J31A 4DA6A 4LBWA 2PQ6A 3HU5A 3IP6A 3IQXA 1L5NA 3ZTWA 2D4AA 2XYHA 2Z83A 1BJTA 1QB8A 3FLMA 1CQXA 5HEKA 5LDHA 3A05A 3DBHA 3P8ZA 4A9AA 1GAWA 4WXMA 4CF5A 1OFGA 1NA5A 5DASA 5JRZA 1L1EA 1TCCA 3CB4A 1ZN2A 5A4IS 2A84A 3ILVA 1BRMA 5FAXA 1ISRA 3SE0A 4UHCA 2FE1A 3COSA 3KXPA 1ZK0A 2ZSKA 4KTTE 2WWVD 4BMPB 3B1KA 3FDJA 5AMXA 1VB5A 3GT7A 4YBRA 3LY8A 5AHOA 4YCNA 2NUPA 3P96A 5ITZB 3NNDA 1EVQA 1E2JA 4J1NA 3L8CA 2A0WA 1L5SA 1YUNA 3GEMA 4M8LA 5LOVA 2YN4A 3NH6A 4DR7B 4DDUA 2XE6A 1Z7YA 1D3AA 5JU6A 1FSFA 3F6CA 3WKCA 1MO6A 3I2FA 3NHRA 2OC9A 3DT6A 1UFKA 3N74A 1NBMD 3V1MA 1R4MA 2NO1A 2VZEA 3QWHA 3R3WA 4LOKA 2YXBA 2QD2A 1U7HA 2C83A 2UYOA 3OA2A 1HLGA 2D3TA 4ZDKA 3HKEA 4G8DA 4G9EA 3CUKA 3TLMA 3LT0A 1T9CA 1CZOA 3K6KA 4YGXB 4D9HA 1U80A 4B3DA 2ORYA 5KWJA 1KEVA 1OXVA 2CZCA 5FOUA 2GZRA 1PEAA 3KHSA 5KTKA 4MGIR 5H7XA 4UCXA 3FFAA 4U7WA 4RTSA 2OCGA 1KY5A 1TKCA 2ZKLA 2HNBA 4LJSA 3M6WA 4FDAA 1R0XA 2C5BA 3DFIA 2PWAA 5T57A 1TYZA 3MMXA 3CO0S 3VAZA 3A11A 2G67A 4KZPA 4TXMA 1ZIPA 4IS3A 1K8RA 1C2TA 3WL7A 5AM0A 3E84A 2YVUA 3LP8A 1YBVA 3KSBC 3VR5H 2EKLA 4CFSA 5KHOC 2HMYB 2PBFA 2PU7A 2R1TA 1HYQA 2C77A 1O1YA 1VL2A 3JZAA 4OV6B 4YLGA 5FBRB 2B4YA 1ZBDA 4KTVE 3OETA 3WL6A 4Y30A 3O31A 3VX3A 3O83A 4AWXA 1U4SA 3ZC3A 5KQLA 4WMLA 2I7XA 4QSHA 2CLIB 3O6VA 1P5ZB 1LQUA 2VH2A 4YRBA 1L2TA 4BAGA 3KXKA 4XKJA 3HJFA 2Q6KA 5JNUA 3K16A 1MB3A 1PIWA 3T5BA 5LWHA 3RU7A 1AH2A 4LYDA 1IG0A 2WP0A 2Z5FA 4B2YA 2GKOA 2F90A 1L9XA 2QG4A 3CEJA 5DZSA 2FETA 1CZLA 4RYDA 2FMXA 4OH1A 5ESRA 2VJDA 1C9EA 2BGIA 1T9DA 3E9RA 1TZMA 3RU2A 1HQCA 3QMVA 1A7AA 4IXWA 5AXBA 5FOVA 5HR5A 5JJ5A 4ZK2A 3IBTA 1BE1A 1NVUQ 3S27A 3NALA 4K9MA 2QW0X 3C41J 1WQ4A 4BLVA 2D6FA 1QYCA 1QFZA 2C5HA 1YU9A 2JAPA 4EX7A 3HRIA 5KJCA 2MWMA 4A0SA 4LDJA 1MORA 3KEGA 3SFTA 4OMUA 3U3KA 2OFFA 2QE7D 2I9PA 2KS6A 4H4CA 3B9RA 1SUSA 2SCUA 1UAYA 1TCVA 2H1HA 3LIIA 1ZRHA 4I8DA 4L22A 3BWYA 4ITRC 4MHTA 2VDUE 2ID4A 4IGAA 1GZUA 3LPMA 2PUBA 3NBQA 1SQ6A 2YQZA 2OWEA 3KHTA 4HQKA 2OFPA 2EEPA 1P1FA 3C70A 1T2VA 4UVIA 4U6SA 1OFUA 4Q9KA 4FMDF 3SHTA 4F72A 5BSGA 1L4HA 3ZDAA 4J1SA 2J5BA 3TLGB 3ZX4A 1ZAYA 3LUFA 4WCFA 3F3YA 5FCDA 1FTYA 3PS9A 2C4VA 2D62A 2JLQA 3ACBA 1VJGA 3KP1A 2J9YB 3ZJTA 3E81A 1JQBA 3I9FA 3RYCB 5KVSA 4CEHB 5KQSA 4L85A 2C3UA 2YS6A 4R0VA 2OBXA 2G71A 4DV6B 2X1VA 3HCFA 1F8UA 4LXXA 1C4KA 3SHFA 1IN5A 3ILYA 4JLOA 5D5HA 1Q7EA 2WSMA 3CX3A 1LA2A 5IC4A 2HQSA 1HTBA 1LPMA 2UVPB 3RNOA 1FXWF 1XRRA 1XZIA 4V2UA 5EEHA 4Q48A 2JJ8A 2V7BA 3JAMA 1Z7BA 3V8QA 5EJ9A 2XD4A 3QMWA 5AKZA 4WKOA 4G86A 5DB4A 4RF3A 3K20A 3RVMA 3NHKA 2Z57A 2G9NA 1T10A 1BA3A 1UOOA 4IIYA 2WNSA 4X63A 4UHFA 5DCWA 1L7DA 1AC5A 1UMKA 2JZOA 1IZYA 2QPLA 1BS1A 3B85A 3I2KA 2DQKA 4G5GA 3N76A 3TNJA 5ALUA 5JXHA 2Q6LA 1GTJ1 2POQX 3ECCA 2B61A 2W6QA 4V3CA 1Q3KA 5AW5A 2ZRCA 3KS9A 1IOVA 3LHFA 5FD8A 4JP2A 1ZGBA 1PQUA 2EFGA 3TR5A 5BYBA 4RTKA 1JEQA 2P6PA 1ZQ1A 2FK7A 8LDHA 1ISGA 1WEHA 4HBZA