1BS1A

Dethiobiotin synthetase complexed with dethiobiotin, adp , inorganic phosphate and magnesium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (DETHIOBIOTIN SYNTHETASE)
publication title Crystal structure of two quaternary complexes of dethiobiotin synthetase, enzyme-MgADP-AlF3-diaminopelargonic acid and enzyme-MgADP-dethiobiotin-phosphate; implications for catalysis.
pubmed rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1bs1A00
1IAQA 3I61A 3V9PA 3OFND 4B3GA 2REBA 2ZM5A 2IWHA 1XPRA 4QC2A 1Z47A 4QBGB 4B2LA 4A9AA 1MT0A 3IUYA 1XWIA 2MSCB 2FFAA 1P2UA 1W5SA 1XFAA 4QHSA 4JVSB 1R2QA 4OQLA 1N5IA 2F1JA 3DM5A 1M6NA 821PA 2XOKA 4M1OA 3TAHA 3ZD7A 4DSOA 4CEHA 3ONWA 3QG1A 1E2IA 4CF7A 1FP6A 1Q1BA 3KXKA 4BRWA 3SFVA 2W2TA 4MRRA 4HB3A 2C95A 4P4SB 4IVPA 1MO5A 4HAUA 3OEHD 3O8DA 5EXSA 5CLQA 1ZD1A 4ZV4A 1JQLB 2QBYA 2GCOB 1P5ZB 1W44A 3PCRB 2RHDA 4DT1B 3LNCA 5TDHA 2Q6TA 1NKSA 1R8QA 2G6BA 2QM8A 1FTNA 2RGDA 4URZR 1ZNZA 4DLRA 2AK3A 5EP1A 4DBLC 1US8A 2WJYA 3ZVRA 1G6OA 1KJYA 4CZ2A 4B3FX 3K70C 3MJRA 3W9YA 3MLEA 4AKGA 4II7A 2QPTA 1DADA 3K0FA 1E32A 3SHWA 2ORWA 1SGWA 2B7CA 2FGKA 1BKDR 3NHAA 2GAAA 1CR1A 3BOSA 2P6NA 5FPTA 5DISB 4MITA 4TLEA 1F6BA 1H8EA 2QAGC 1UBCA 2IHYA 3HWSA 2A9KA 2X19A 3QPVA 4JYBA 3RC8A 1EFUA 2KBFA 2WAYA 3EIQA 5G3YA 1HV8A 2B8WA 3ADCA 5IDVA 1Z29A 5EE9A 4C0JA 2UZ3A 4W5WA 1OHHD 3K0AB 5FTKA 1KZGB 1E98A 4QGGA 2GZDA 4BFWA 2XEXA 1NN0A 1NVVR 1XEWX 3KDSE 3UXMA 4E22A 2ZRAA 3A1VA 2VHTA 4B73A 1FMJA 1QHHB 4Q7MB 3WMGA 4JLJA 3FMPB 3RHFA 1RJ9A 4NH0A 4C4PA 3T1QA 3TGPA 3I62A 4O3MA 1CJKC 2VEDA 4M1WA 4PO8A 1ZC3A 1GKUB 1KNXA 1OYYA 1PV4A 3KFVA 4Q1DA 3IDQA 4RY2A 3WMEA 5J4LA 1XEXB 4RZ3A 1NF3A 2QMOA 4CIDA 4P32A 3U3RA 1YZKA 2AWOA 2O0JA 5KPDA 1COWA 4BEBA 1TX4B 2QMHA 3UANA 1HUQA 4PSAA 3TW4A 3CR8A 3LX8A 1WE2A 1DO0A 2ZJBA 4GMDA 4PPNA 4TQAA 5LD2B 3IEVA 4A2WA 1VHTA 1M34E 4NONA 2G77B 5IHPA 3GJ4A 1TQ2A 2OZEA 2ZQ5A 4KVAA 2V4ZA 2BWJA 1XTIA 4LJ4A 3C41J 3OAAD 3RLFA 2QMEA 4HEJA 4G01B 1N2CE 3QKRA 4BPBA 3B82A 3TK1A 5HZHA 2FDCA 1VYUA 2PEYA 1ZAKA 2Q9AA 1G8FA 2PCJA 2Z6VA 3RC3A 2C04A 3KKQA 3UG6A 5KHOC 3R7WA 3U3KA 3LW8A 2GK6A 1HYQA 2GXSA 1XNJA 1HH4A 3QENA 2CEAA 4HB0A 3TSWA 1IXRC 3Q3JB 2W6JA 4ITRC 1XMVA 5CB6A 2A7QA 2O5VA 2IXGA 2EFEB 1KKMA 3RRMA 2YWHA 5LB2A 2CLSA 3N2IA 2GEDA 2OM2A 1KYIA 3QKTA 2JDID 4JBXA 3GLFB 1I2DA 3EC2A 2XNSA 1TF5A 4RKEA 4B35A 2P6RA 4EPWA 3B1XA 5FBLB 1R5BA 3OE7A 1W0KD 2NOAA 2C78A 4BRUA 4JKIA 3VKGA 2RB4A 5TARA 1EESA 3ETLA 3ZZUA 3U3JA 4KJZA 4DDWA 5FTNA 1ZRHA 4W9MC 4X8MA 1XXHB 5DI3B 2ZANA 4OQFA 1OIVA 4XSGA 4UQOA 2WKRA 4PC6A 2VHQA 3W34A 1IHUA 3NHBA 2JCSA 4S2EA 4TMWA 1NBMA 1Z06A 3WHKA 3VX4A 3HPRA 3V4RA 2QI9C 1KMHA 4N1AA 3GEHA 3D31A 4A6XA 3Q72A 4RZXA 2VP2A 4TMZA 1E2MA 3AUXA 1VG8A 5C18A 1IJFA 4UNRA 1EX6A 2I4IA 2YOFA 4TT3D 4MQBA 4NYMQ 3C14C 3AF4A 4CGZA 2Z5FA 4Z1MA 4K46A 1II8A 2YWFA 1BH2A 2FX3A 1TQ6A 4CEHB 4L9SA 4RKFA 3B7GA 2HJVA 4G5OA 4DDTA 1II0A 2V54A 4M1SA 3BH0A 5ANRB 2WWFA 4C30A 1Z0DA 3A1WA 2CDNA 4B6EA 3L0PA 1GZSA 3LA6A 3K9GA 4GNKA 1TU4A 4MRVA 1YQTA 3GEIA 3L0OA 4OI2A 5DH9A 3CRQA 5BYKA 3NBZC 1ZCAA 1ZIPA 1KSGA 1S1MA 1NG9A 2O0HA 4MYUA 2O0KA 5CM9C 2YHSA 2WSSA 3EIEA 3AVWA 1KGDA 2A5JA 1US8B 1LY1A 1DG1G 2V7QD 3D8BA 3RABA 4C0BA 3ZQJA 1RVDA 4PQYA 5GJVC 4Q48A 2RGGA 2YNMA 4ZPXA 4EAQA 4TL8A 5AJZA 3R9WA 5J4YA 3TUJC 1EFTA 1W46A 1KO7A 3HDTA 1G5TA 4DLZA 4BE7B 4EJSC 2WSMA 2J7PD 5GJBA 1SVIA 1G18A 1J99A 1W4AA 2F1RA 3QY0A 2YOHA 3R20A 1B0UA 3CPJB 2PBRA 1SXJA 1CS4C 3DO6A 3VU9A 5JJLA 1JNYA 1KI2A 1Z0FA 3K53A 2EU8A 2QM7A 1VG1A 2CL0X 2V9PA 1OSNA 2ZSEA 3QXSA 1I2MA 5JLJA 1P2VA 2GETA 2QRNA 1L4YA 2J87A 4NCKA 4NCJA 2PH1A 2UZIR 3UIEA 4BFYA 3ZVMA 3B1ZA 1N6OA 1MOZA 1RRFA 3DZ8A 2ZI4A 4XWOA 4KITB 3ZVNA 3DKVA 3KTAA 5FTJA 1Z5ZA 1A82A 2GDJA 2PMKA 4X8LA 1RJ9B 2WWWA 4LPKA 1HQCA 4YMTA 3CPEA 2R6GA 1G19A 1LB1B 1E99A 2P3SA 1GNRA 1KO8A 2YV5A 4FXPA 1ZD9A 3ZS8A 2IYQA 4L5BA 1OH6A 2HLDD 2OAP1 3D6TB 3CM0A 1XJCA 2GJ8A 4TLDA 3W5IA 4C0AC 4FMBB 1P60A 3KQUA 1PVOA 4JLNA 3MWLA 1A5TA 1OF1A 1YZUA 2IF0A 2ZETA 2W83A 1G3MA 3UWKA 4B48A 3QXCA 1PUJA 1AK2A 2QG6A 1Y3AA 3PG5A 1KK2A 3A36A 1W49A 5FUVA 5L3VA 1II9A 4D25A 3AF0A 1KY2A 4AK9A 4OI4A 1ZNYA 3GLGA 2AD5A 3TUIC 1G5RA 3QKRB 2G0NA 4FMDB 1J2JA 4LV6A 3GFTA 4BUJA 1JECA 1JEEA 1AS0A 2J0VA 4I4LA 4ZKEA 2AD1A 3R7WB 1E9AA 1G5PA 2AXPA 4TYPA 4RFSA 2ZRJA 1CJVC 3LLMA 1OT3A 2JGNA 2W2XA 4IXMA 1KO1A 4QBHA 4B34A 2FSFA 4OHZA 2GRJA 2VP6A 2GJ9A 4E09A 5AUPB 5CYPA 2WAXA 3KXIA 1N6RA 5P21A 1XPUA 2XOKD 3I3SR 1TL7C 3QE0A 1KK1A 4B6FA 1LVGA 4M0LA 3W3ZB 5L3QA 3PXGA 2VP0A 3KQKA 5FOWA 3LH5A 3DMNA 3AP2A 1W36B 3OEHA 1QRAA 4DLXA 1UKVY 4IVQA 4BZQA 2OBMA 4Q1FA 1J8YF 1VYVA 4UXJA 1S4QA 4MDEA 4ACBA 2QY9A 2KJQA 2OLJA 4LC0A 4OKSA 5JWOA 4A8JA 2YVUA 3MRSA 2O8BB 2AHOA 4GI7A 4EPTA 5J4VA 3CO5A 1TADA 4NYIR 5CIQA 4N0EA 2BCJQ 2ZJ5A 2Q3MA 2Z4RA 1IBRA 1XEWY 4NYJQ 4IDNA 4FIDA 4URVR 1H8ED 4BFXA 2ZVQX 2WZQA 3RAPR 3Q85A 4G5GA 4N3NA 4KFRA 3WNCA 2A5FA 4Q9IA 3THWA 1P75A 2GWHA 1GL9B 3B60A 4HZUA 5DE3A 1OXVA 4B2PA 2ZYUX 1II8B 2VSFA 2WJJA 3CR7A 3FB4A 3VFDA 1U99A 1KAOA 121PA 1Q3HA 1V43A 5LD2C 3IHLA 5SZKB 1IY1A 1WA5A 3EZ2A 3AVOA 4Z8XA 6Q21A 1Q1QA 3CNNA 2GJAA 4HDQB 1U90A 3VR3A 1KHTA 5SZHB 1G9XA 3BB4A 4LBWA 3G5UA 4D2IA 4IOJA 1R0YA 2GZAA 1E2NA 5JCPA 1D9ZA 1W47A 1R5OA 5FOSA 1TUIA 1C4OA 1ETUA 3KFXA 1CF4A 3GJ6A 1ELOA 4BFZA 2GXAA 2VF7A 3FPAA 3QXJA 1M1YE 2DFKB 1AZSC 1ZW6A 2RGBA 5AWFC 4K8OA 5DNYB 3DDCA 1QHXA 2CLDX 1COWD 2P65A 4LI0A 3X1ZA 4OK6A 3BGWA 3KKOA 4V02A 1QG4A 2KWIA 1MR3F 2PZFA 2QMUA 3RRZA 3WNDA 3RSOA 2KBEA 1OH8A 2ERXA 4AYXA 1IONA 1KDPA 2BMDA 2CHGA 4LY6A 4NU0A 4MH0R 3SR0A 5A4JA 2XJ9A 4X8HA 1WRBA 3MD0A 4BLRA 1JAIA 3GLHA 1EFHA 2F6RA 1SXJB 2GF9A 3K0EA 3PENA 4LV8B 1IN4A 1ZD8A 3NEJA 4XTCS 3VU9B 4A2QA 4DWJA 3I32A 1AA9A 4E5UA 2Q21A 3CX8A 2WPDA 1GDDA 621PA 1CJUC 2BM0A 2OCBA 1U98A 1ZUHA 2D7CA 4DCVA 5C1BA 4KI0A 1XPOA 3R8FA 3KTAB 2NO9A 3B6EA 5DYGA 1XJQA 3TQCA 4KYIB 2XB2A 1XTSA 1XTRA 2W6JD 4NCIA 2FH5B 3FVQA 1UDXA 2VIIA 2DPXA 1VYTA 3VR6A 4M9ZA 1WB9A 4JBYA 1J8MF 3AKEA 1E2QA 1RC8A 2SHKA 5KYKA 3B9QA 2P67A 3AP1A 5TVKA 2ANCA 4P4SA 4V0OA 1U94A 1W36D 4U02A 1BS1A 4Y0VA 3OE7D 5FL7A 4BZPA 4HAWA 4LSGA 2H57A 4DT1A 5L3SA 2JLWA 2J5XA 1T0HB 2IYWA 5FOXA 3VR5A 1BMFD 3GLGB 3QIAA 4JZKA 2ZIAA 1Z2CA 3CX7A 3PEYA 4HLCA 2O8EA 2GCNA 2HDNB 2FNAA 3U7HB 2EFHB 3SBEA 2Z43A 1CIPA 1NBMD 4W7SA 1RPZA 2OFOA 4ZCLA 4EPRA 4TZ6A 1XMIA 1YR9A 5FOTA 1NY5A 3GLGE 3IIKA 1ZNXA 3WYGA 1FTSA 2KB0A 4U00A 2XXAA 1JR3D 2Y8EA 1YR8A 1T9HA 1AN0A 4EPVA 3AGQA 5FPSA 5H68A 1XTKA 4IOLA 4TQUS 1VECA 1LFDB 4QFMA 4RJLA 3BFXA 1OXSC 1P73A 2YC4C 2J59A 4KVGA 4ON9A 3DOEA 3NXSA 3H1TA 4UNSA 4WOPA 3G82C 4Q4LA 3TKLA 4TL7A 4LBYA 1C9KA 2IUUA 3U6KA 1QHHA 2OBLA 1MO4A 4FINA 1LV7A 3ADKA 3QF4A 2YINC 1ANKA 4AWXA 4B47A 4NKRA 2WSSD 3RVBA 2ZI9A 3ZVLA 2Q3HA 1G7SA 4HATA 4A8JB 4QGFA 4XSHA 2LKDA 5E95A 1E0KA 4XVRA 4QXAA 2ZE6A 1JALA 2OE2A 1E96A 2QGZA 3GJ5A 3CW2A 3FHTA 1G4AE 1E0AA 4M53A 2XB4A 3S1AA 5EP4A 4OK3A 1KSHA 3K9NA 2JLZA 1CR4A 4JVNA 5KTYA 3PR1A 1QHIA 4LWZA 3SE0A 4TYNA 3ZZTA 3THWB 1OXTA 5KO2A 3W8NA 4HZUB 1EX7A 1SXJD 2AN9A 3UMRA 2XGJA 3AP3A 5KNBA 4FWTA 4OJQA 2P6UA 1FL9A 1U8YA 4HB4A 3ZD6A 2RH5A 2A5DA 3MWKA 4C2TA 2ZRIA 1N5LA 1U81A 4NZYA 2PCLA 3QEOA 3B1YA 3G0HA 4GSYA 1RFLA 2MMGA 2AX4A 2FSGA 2ZJ2A 3CB4A 5EUMA 2FF7A 5KSOA 5DHAA 3T34A 5E7MA 5KDOA 4D82A 1G21E 2GVDC 4UXIA 1YR6A 2H5EA 3AVUA 2JA1A 2XX3A 4DVGA 2RCNA 2PZGA 3GFOA 4GZLA 4I1OA 1S2MA 4OQXA 1ZYUA 4ZCMA 1RIFA 1F2TA 3EZ7A 1M7HA 4Q03A 4BASA 2IS6A 2QT1A 5KU1A 2HLDA 4I1SA 3MGCA 3TRFA 3GLFA 1DAIA 1YKSA 5FR1A 2DFTA 4AURA 2N46A 1L2TA 3ZZ0A 4KODA 1FNNA 2XZPA 3LQQA 4M9XA 3J81k 3DZDA 3CIOA 1CU1A 3U7EB 1G6HA 1UBGA 2WBLC 1BIFA 1LF5A 4B44A 2ZR7A 1JPJA 3C15C 2HXSA 2JIZA 1W36C 2JLQA 4QGHA 2EFCB 2ODBA 5FUYA 5HZKA 5FBVB 1A2KC 4LHYA 3VNUA 2DHRA 4IOMA 3EZFA 3P32A 3CONA 3DKPA 2CL7X 3QKUA 4LHXA 1NIPA 2PLFA 3Q7PA 4RCYA 3LY5A 2AXNA 3GLHE 4ERNA 3O8CA 3IQXA 1GOTA 2IL1A 4MYHA 2QN6A 4IDPA 4XWAA 1XMJA 1TAGA 1LTQA 1YR7A 1UFQA 2GXQA 3SQXA 1C1YA 1FQKA 2G1JA 3IPYA 4FCVA 1QBKC 3AUYA 3RDPA 4OK5A 5ELXA 3BH6A 2WVJA 2AR7A 4DB2A 4XVQA 2CCJA 1NLZA 4KFSA 4ZDKA 3BE4A 1ZU4A 2CBZA 2OILA 3U3MA 4WIAA 2GXUA 2ODWA 3DL0A 4G1UC 3RNLA 4DLUA 1D2EA 4F92B 3SN6A 1ZM9A 3HR8A 3KJIA 3FKQA 1DARA 4G5RA 3U6BA 3F5FA 4GL2A 3CF0A 4MYTA 1T4GA 4PZLA 2FZ4A 3KB1A 5K8UA 5L3SB 1H65A 1T8TA 2E1RA 1E2PA 1UEJA 2BKUA 3W6NA 4CYMA 4BLSA 4LDJA 4IW3B 2PEZA 1TUEA 2L0XA 2YWGA 4JJKA 2YYZA 3M0EA 4MUBA 2O8EB 2GTPA 4QM6A 5UKDA 4A0FA 2N42A 2ZS8A 3FGNA 1N6KA 4WZBE 1CTQA 5KOYA 2BBOA 4TMVA 2ZRHA 3P4YA 5KSZA 1O87A 2IYZA 1GRNA 4DRZA 2TMKA 2XXAB 1NI3A 3IQWA 4NPHA 4OQNA 3EA5A 4O2LA 3ZJYA 1J7KA 4BLPA 4A0GA 2ZRBA 4OL0A 3BRWD 3VNVA 1BYIA 1KNQA 3Q8XB 4PAMA 2JLXA 1U0JA 3PQCA 4LV5B 1FZQA 3SC3A 4OI0A 1QHGA 1GKIA 1AM4D 3TLXA 2ZE7A 4TLAA 1SXJC 5B2ZA 4DXAA 1G8GA 2YKGA 4UXHA 4KFTA 1NN1A 2RGCA 4JMPA 3AVVA 2FPKA 3IEUA 3EIHA 1G64A 1ZM7A 3Q9LA 1ZP6A 5BN4A 3A1TA 3QF4B 4ASUD 1Z08A 4TYWA 1QHNA 2Q9CA 4MKGA 3PEWA 4AI6A 2UKDA 5CJPA 4DKXA 2JLVA 3JZMA 2QPAA 1AS2A 2QRZA 4PC7A 4A36A 4PXAA 2Z83A 2VH5R 4KBGA 2WV9A 3LXRA 4NYMR 3EWSA 2IS4A 3KQHA 3FMOB 4DIEA 3S1AB 4HDOB 1VIYA 1K5DA 4E07A 4PANA 3AVQA 2HT6A 4LYFA 5F2EA 3TVTA 3BAFA 5JECA 2FGJA 1XTQA 4MKHA 2JLRA 5TMPA 1GL6A 4OHXA 3R9XA 2YC2C 1GTVA 1JQJC 3FFAA 3HJNA 3DOFA 3PUZA 5CITA 2PX3A 2H92A 1DELA 3KJHA 3U4QA 3D7MA 4NBSA 1E94E 2GZHA 1F3OA 2WPDD 2ZRMA 2GESA 1N6HA 2AKYA 2IUTA 1BOFA 3FDIA 3AF3A 4KO8A 2FU5C 5FI1B 4DSUA 3FHCB 3ICEA 4G3XA 1WBBA 4L15A 1YVDA 4JBWA 4GRAA 3F8TA 4D81A 2DFLA 1R6BX 2ZSBA 4DCUA 3QXHA 5CK4A 4BECA 1Z6TA 2CL6X 2WKQA 2G0TA 4HAXA 5EE0A 3RANA 4JSTA 1Q22A 3QF7A 1T3LA 1VCNA 2ZS9A 5F3WB 3T61A 4JVMA 1I4LD 3FKSA 1R8SA 4M1KA 3SZRA 1F2TB 1YHNA 3X1WA 1HT2E 1G3QA 4O2RA 3VX3A 4B74A 4NHOA 4OJKA 1VTKA 3Q5EA 3RS5A 1AS3A 4O25A 1MRNA 3W3AA 2CVFA 1N5KA 3BORA 5JBQA 4ESVA 3U7GA 5FL7D 1GKYA 3B85A 3FTQA 1QHYA 4QJ4A 3AVPA 5FPYA 4RCZA 2ZSAA 2V1XA 3SQWA 2J41A 1VCOA 2DBYA 1W7AA 2GJSA 2REOA 1U0LA 2K5UA 4L8GA 2GILA 2R6FA 1CP2A 3WBKA 3GLFE 1SQ5A 4TLCA 3IKJA 1KK0A 1NSTA 3N70A 4Q18A 5DHFA 3ECCA 1WP9A 1BMFA 1XJ0A 1ZC4A 3A1SA 2IF2A 5G3ZA 1Q21A 3ZIAA 2O8BA 5CB8A 1A4RA 5K8TA 4MGKR 1HURA 2OFXA 3ZLJA 5JZVA 3AF1A 3CWZA 221PA 1RRCA 2O8DA 4JT2A 1XXHE 1KJWA 3KXLA 4A8JC 3B1VA 5EQTA 2C2HA 5SZIA 4ZI3A 1F5NA 1XF9A 4GDFA 1XMSA 3LBHA 1JR3A 4F4CA 2R8RA 2FEMA 4Q4AB 1N6IA 1R0WA 3MAAC 2VYFA 2ZI5A 1TU3A 1JI0A 1NP6A 4B32A 1T5IA 5J47A 2VF8A 1OB5A 1G16A 1FX0B 4GZMA 2OESA 2W6ID 1CULC 4PPQA 3RSLA 1YZNA 2PJRA 2GK7A 1W1WA 3TH5A 3FMIA 3WP0A 4UNPA 2C03A 2OAQ1 2BEJA 3B9PA 3KJGA 1IJEA 4I99A 2RKOA 3CPHA 3TSZA 2XTZA 4GOJA 4AKIA 4OHWA 3SDZA 4KSCA 1HE1C 3RS2A 2ATXA 3MJHA 3LW7A 3K09A 3TR5A 2ZUCA 1LF0A 2RGAA 5B30A 2NMVA 5EUQB 1KIMA 4CW7A 1PJRA 2FJUA 3GCGA 3FE2A 5FBQB 1NVXQ 1S0UA 1XRJA 2VL7A 3KUDA 3BB3A 4MA4A 4TMXA 3B78A 3PUVA 4FN5A 3IO5A 2WOOA 2EFGA 1KI8A 1OYWA 2V6IA 5JMTA 4PQFA 2CCKA 1X8JA 1KI1A 2QSZA 2AL7A 3QSYA 1QHSA 4FMCB 3TE6A 2I3BA 5E7JA 3PV0A 3CZPA 1G3IA 1NL3A 1IXZA 3E70C 2OCPA 2H16A 4M9QA 3HU2A 1X1RA 3QOFA 3WYAA 1SVSA 4TTPA 2OBNA 1KSJA 1R10A 1S3GA 3IBYA 3RRYA 4QBIA 5AJWA 3MG9A 2IC5A 2WIAA 1E9SA 2OLKA 3B13B 3HYTA 3AKYA 4Q19A 3IILA 1T3SA 4JLBA 5DN6A 5FUWA 1ZM3A 4M1TA 2NPIA 1KDTA 1UAAA 2CMKA 2IYVA 1SVOA 4F7WA 4GP7A 3NEYA 2C77A 2WJHA 2ZRNA 5IK2A 4ZIRB 2WTUA 1DAKA 5JJKA 4AKHA 2P5TB 1KI7A 2PT7A 1RRPA 3HP1A 5DYIA 1R0XA 1S3SA 4TTQA 4NYJR 4LJ9A 1KI9A 4A92A 1AJEA 4KYUA 2CJWA 2FV8A 1NMXA 4D80A 3KB2A 1OFUX 3K0CA 4PHGA 2ZJ8A 3BD9A 2QT0A 4CEIB 4JIMA 2V8OA 1E9CA 3H2YA 2LWIA 5JWHA 3QVUA 1E2HA 4AC9A 4M4SA 4PSKA 3VR2A 1A1VA 2GKSA 1VMAA 3O8BA 3WNBA 3ND8A 4NP6A 2JIZD 3FFBA 1KTVA 3EG5A 3EA0A 1G7TA 2OXCA 5D3MB 4IDHA 3EC1A 3C5CA 3U4QB 3LX5A 3T35A 1XTJA 1DAHA 2RMKA 3AB3A 3AKCA 4MGZR 1KY3A 2BMEA 2DR3A 1GL7A 2W2VA 2DCUA 2A78A 4C9BA 1VCMA 1E1RA 2J7KA 3CNLA 5JHGB 4HDCA 1XBTA 8OHMA 4JL5A 5L3RA 5E4FA 1OV4A 2BBTA 3X1YA 2HCBA 4KHZA 1IY0A 4TSFA 2CK3A 2MMCA 4PO1A 1XCPA 3DPUA 2QNRA 3NH9A 4US1R 5BYJA 2ZU6A 3GFPA 2V6JA 1YRBA 2FMXA 1CJMA 2IYUA 2ZYTX 2P2LA 4MRNA 3V00A 1X3SA 2J0UA 1HTWA 1Z6YA 1TPZA 1HQYE 2IYYA 2IYXA 2Q9BA 2QAJA 4PSVA 3CH4B 3EAQA 2OHFA 3LBNA 3WRYC 4CRWB 3VR1A 3UPUA 4EUNA 3SJZA 2XTNA 3EX7C 1CJTC 5HTKA 4H1VA 1W4CA 1VIAA 4URXR 4LYJA 1PLKA 4XD7A 1TEVA 2GAOA 1UM8A 2ZVPX 1E9EA 4LYHA 4DCNA 3CBQA 5DI9A 4BZXA 5AJXA 1VDZA 1DBSA 5J4KA 2X8AA 1ZUNB 1XZPA 2HF8A 2E87A 3NVAA 4IJMA 2EWVA 2YZ2A 4M2LA 2OFWA 5FH9A 2ZJYA 2O8DB 2PJZA 5AR1A 4HLDA 3UK6A 1DTSA 4LJAA 5H1YA 3FOZA 2NGRA 1SVLA 4IEIA 4QOSA 1NLYA 4Q9HA 3WY9A 5C2JB 1UJ2A 2MSDB 4LJ6A 5KDDA 1SKYB 4D4MA 1NBME 3F3YA 5B58C 5HR5A 1FW6A 4OBEA 5KSPA 1UBEA 2BMJA 3A8TA 1DAFA 3QPWA 5J5CA 1QZXA 2VP9A 4PHTA 5BN3A 4PQRA 2JJ8A 1XEFA 3MWJA 1JR3E 4W5JA 1SKYE 4LUCA 3CUEF 1L7VC 4WZ6A 2PMDA 1CR0A 1MABA 1Z0KA 4ASUA 3PIRA 4GBMA 1Y63A 3BFKA 3TBKA 5KSYA 2ZREA 5B64A 3C4JA 1RRGA 2XITA 3NBXX 3ZS9A 1F48A 3EZ9A 4L4UA 4Q66C 4DC9A 1QVAA 1MRSA 4PPFA 4KFUA 2Q0HA 3KJEA 4Q1BA 4B76A 4P33A 5HE8A 3AF2A 2O52A 4AG5A 4LOAA 4YXWA 4ACAA 3K70B 1Z83A 2VHCA 5DO9A 2NQ2C 5AJVB 1JAHA 5EXPA 1KAGA 1NN5A 1L8QA 5LBIA 3MCAA 2F3TA 2GBLA 1EGAA 3SNHA 2V1UA 1JXOA 2NZJA 1G20E 4D4KA 1CKEA 2W0SA 4DLYA 2ZI6A 1KI6A 2FN4A 2CE2X 1LS1A 2FOLA 2HF9A 4A0RA 1D9XA 2VP4A 3KKMA 1NIJA 1E6CA 4Q1EA 1JJ7A 2FSIA 2CHVA 4C0KA 4PZYA 1SXJE 4NCNA 3SYNA 1P4SA 3BJIC 4B3CA 2NO0A 4B71A 4FCWA 4DLVA 3QEJA 4IDOA 3LLUA 4V0LA 1U9IA 3EPLA 2Z4SA 1P3JA 1KI4A 2CJWB 2P5SA 3O47A 4KCGA 2J9RA 1DS6A 2C96A 1EFCA 3AH8A 3FKSD 1UKZA 4A4DA 4QM7A 3I72A 4Q4HA 4V0NA 4WBSA 1Z3IX 4JLKA 3ZDQA 3T5GA 3EPJA 4Q1AA 1UEIA 1ZJ6A 4ESHA 1IN6A 1MO6A 1DAEA 2J3EA 4DDVA 2FFHA 4PHHA 1AKYA 2AKAB 4CT4B 2XAUA 1FFHA 2ZSDA 4WXRA 5FR2A 3GJ8A 3SJCA 4HLUC 4OYHA 3IIJA 4XVUA 4U7DA 3FYHA 3WYFA 2OG2A 5EE3A 3KUCA 4MYCA 2D4HA 1AQYA 4Z51A 3ZIAD 2BDTA 5A5GA 5FFMA 1P61B 5EZ5A 1UDWA 3T12A 5KNCA 2J0QA 4LJYA 2ODEA 2NIPA 4PO9A 5KDLA 2QROA 4DLWA 3GJ0A 2J0SA 2HCJB 3GD7A 3SBDA 2QORA 1E2JA 4DUGA 3P1JA 4Q47A 1G4UR 1B23P 1PZNA 1G41A 1E9FA 3IGFA 2FWRA 4AIIA 1GUAA 3MSXA 3FMFA 2C5LA 2X2FA 5JEEA 1WDTA 4JL6A 3ICQB 1VG9B 4BFVA 3T1OA 2H8KA 2WIBA 3QUSA 4Q4JA 4D0GA 1XB2A 4EPYA 3OIWA 2FA9A 3I4LA 3O8RA 1X1SA 4LPSA 5IF9A 2W6IA 4FD2A 5GVSA 4CEJA 2J0UB 4WZAE 4E03A 1AGPA 1YZGA 2Q3FA 1E2GA 4RFVA 3SOPA 4ZCIA 1QF9A 2ZE5A 5FPHA 4DZZA 1E2KA 5JRJA 1S9HA 2BJVA 1FMLA 4U5XA 1IN7A 1KKLA 3R9IA 3E2IA 4LZZA 1D5CA 4YDSA 2ODNA 1QG2A 1IM2A 2JATA 1S8FA 3X2SA 5B57C 4P0TA 3I5XA 4DCTA 2GCPA 3NC1C 4KSBA 2NO1A 1K5GA 1CRQA 2JJ1A 5DSZA 2IHBA 2VHJA 4PC2A 3H84A 3B1WA 3FHOA 1HT1E 4JSYA 4F93B 3THYA 3N5CA 4EDHA 2QP3A 3A58B 4OHYA 3BXZA 2WWGA 1E0JA 3VKHA 1NVWQ 1G8YA 3A37A 2DY1A 2YOGA 3SYLA 3PJRA 1XD2A 2WMNB 1UPTA 1G291 5H70A 3WXMA 4RD3A 4JJZA 1OH7A 1F2UA 2FEOA 5DN6D 3ADBA 3KQLA 2QUZA 2KI5A 2C9OA 2EW1A 4B75A 2GNOA 4UJ5A 4M22A 1N25A 2FE4A 3TJZA 3QI2A 1CXZA 5IK2D 1IOZA 1W4RA 4HSEA 2CCGA 3SJBA 1MABB 4OI1A 5TB5A 3EPKA 4QG7A 2UVQA 3K1JA 4UKDA 3TSOA 4GMXA 1ZUIA 2ZI7A 1S9DA 4QBFA 4ZDWA 2G88A 2BBWA 1WCV1 4FMCF 3RS3A 5L8VA 2HUPA 4EPXA 5CDFA 1IY2A 4EQ6A 1NMYA 5G41A 4C0HA 5KPJA 1XZQA 3RS0A 3ASZA 1R0ZA 4IHQA 3OEEA 5BQ5A 2OT3B 2R6DA 4RD0A 1EK0A 1N3BA 2P0EA 2ZROA 4RVCA 1G8HA 5DIFA 3U44A 3UMSA 1M74A 2OO7A 1U2RA 4BWYA 2ZJZA 5FBWB 1SULA 5BXQC 1OIXA 1ODFA 2IYSA 3SHFA 2LKCA 2ZRDA 1SVMA 521PA 4QRHA 1G3RA 3DM9B 2B6HA 1RW4A 4POAA 1DAMA 4TZ0A 2QQEA 1KI6B 5CIWA 2CVHA 1A2BA 2FSHA 4YMWA 4B3XA 1E1RD 1E9BA 3AM1A 3OIYA 2PZEA 2V3CC 1I4TD 2BBSA 1FQJA 4D26A 1AZTA 3K8YA 3LBIA 5F9HA 3AV0B 4PR0A 4TSFD 3SEAA 2CK3D 3RS4A 3TQFA 1XU4A 1GITA 1T91A 4Q4AA 4TMKA 5GJWC 3VAAA 3LDAA 4D4JA 1N6NA 4C7OA 2RAPA 4Q4HB 1GWNA 3C16C 4IOKA 4WAUA 1D8TA 1FX0A 2D2EA 1P72A 5GADl 3CF6R 1M2OB 2CXXA 2FZLA 4GP6A 4HLUA 3A4MA 2JLUA 1JBKA 5EZ6B 2ZXUA 1KI3A 1OB2A 1E2LA 2IK8A 2A2ZA 4TMTA 3LRPA 5JSZA 2ZRLA 1XD8A 4FMDF 1TQDA 1P7CA 2GVZC 3WP1B 5JS7A 4I1UA 4TYYA 1E9RA 4M21A 4H9GA 1Q3TA 2WWIA 1P9RA 1HY3A 4XD7D 5D3QA 4BQSA 4YC7A 4JLDA 2IS1A 1JR6A 5JJIA 3HU1A 1XX6A 4PFSA 1FNMA 3GEEA 4R7ZA 3K09C 2FPLA 4Q9KA 4EFLA 2D7DA 3CH5A 2GA8A 2JEOA 2ZE8A 1EWQA 4QJ3A 1PLJA 1VKJA 2BEKA 2CLCX 1FUUA 4K81B 1Z6XA 3GJXC 1M7GA 3QBTA 2WOJA 2C8VA 1MO3A 1YZLA 4HAYA 3QQ5A 2WHXA 3SU8A 1GAJA 2ZR0A 4XTRA 1KK3A 1NVUQ 4JT4A 4EIWA 3LO5A 2D3WA 2F43A 4HAZA 4PC3A 3FWYA 4B3DA 1ZM4A 4Q4JB 5AJYA 5FOUA 5H8WA 2QP9X 2F7SA 5BN5A 3WBJA 2H7VA 4TL6A 4LJ7A 3QXXA 3ND9A 2R6AA 1D2MA 4CEJB 4QJ5A 5J40A 4C2UA 2PL3A 3AGPA 5JEDA 3CF2A 3L0SA 3HPQA 5EP2A 1E79A 1DEKA 3K0SA 3DVLA 4R98A 4ZIRA 4D4LA 1DVRA 3MFYA 2ANBA 1U8ZA 1H8HD 5C4MA 2VPPA 4R2IA 3U3OA 5C46F 3NKVA 2EWWA 3K9LA 1NLFA 2PX0A 1J70A 4H1UA 2EQBA 3OF5A 3W6OA 3UWOA 1KO5A 1XCGB 2OV2A 1JXMA 2WWXA 4M8NE 4DCSA 1E4VA 4PC1A 3CNOA 3THYB 1UKYA 2ZRFA 4MRPA 4CEIA 2NG1A 3BWDD 2X1VA 4NL4H 3I92A 4AYWA 4ILEA 3REFA 1IXSB 4WXPA 1GSIA 1ZM2A 3K0CC 3T1VA 3VQTA 4YXWD 5IT5A 2ZITA 1XD2B 4DSTA 3BB1A 3AVXA 2D2FA 2VLIA 3KKPA 5D3MA 3V4FA 1F2UB 3OHMA 3AQ4A 5EXXA 3QJYA 1W2GA 4LRWA 2IYRA 3H4MA 5AK0A 1K6MA 3K9HA 1AIPA 1WF3A 1ZCBA 2QTVB 3P27A 5AUQA 1E4YA 4QHYA 2HYDA 3GLIA 3IIMA 4ZI2A 4DLTA 2HT1A 3AKDA 5JRZA 3ASYA 5K8LA 5FOVA 1Q0UA 2BCGY 3TR0A 1NJGA 4A1FA 3LVQE 2QTFA 1NY6A 3RS7A 4QL3A 3L82B 2WM9B 3U61B 3THXA 1VG0B 4Q7JB 2VA8A 2PLRA 4EQ6B 1ESNA 2NZ8A 3GMTA 2MSEB 4UJ3A 1RYHA 1EG7A 2JAQA 1KDRA 5SZJA 4ZKDA 1NN3A 4PAQA 4S35A 1G7RA 3AEZA 1GRRA 3NDPA 3EZ6A 3ZYCA 3WHLA 1JB1A 4RD6A 1KJZA 2B92A 3T15A 3QPUA 3U44B 1YE8A 2QP4A 5CDFE 3BK7A 1Z22A 4JL8A 1OFHA 2EFDB 4MKIA 4GT1A 3DEFA 1GNQA 1Q1EA 3EWAA 3X1XA 4I81A 4A15A 4IVRA 2QTHA 1ZU5A 2KE5A 3THOA 4V0MA 2PT5A 1UF9A 4P4TA 2A5GA 4LJ5A 4XOIA 1VCIA 2BVNA 1IN5A 1NMZA 1N5JA 5EE1A 2G3YA 4YONB 3P20A 1ZBDA 3VTKA 3OESA 5HKKA 1A7JA 4DUGD 2OCYC 2F9LA 4UNQA 3W8RA 4LK2A 2ZSFA 3ZGXA 1Z0AA 1Z6AA 5F9FA 2QE7D 5FUXA 3R8CA 5JI3E 4URUR 2ZYWX 1SHZA 1CEEA 1NVVQ 4C7OB 2Z0MA 1NKTA 2ASEA 4LBVA 3L8YA 2FPMA 2WJVA 3A6PC 4LHZA 1ESMA 1BO6A 1Z6GA 4P3YA 4QNRA 4IXNA 5EP3A 5E7IA 5FTMA 1Z0IA 4Q1CA 1EFRA 2XNDA 1TMKA 1AKEA 1NG1A 1P62B 5CM8B 3I73A 2ECKA 5JI2E 1GIAA 4LGMA 5JSZB 1GVNB 4EKDA 2WMOB 1N0VC 2CNWA 1E1QA 3U2QA 3OZXA 4MUAA 4OQMA 1Z07A 2OCAA 4JLOA 2C99A 3BFVA 1OH5A 1KOFA 4A82A 1JJVA 5FI0B 2WICA 4XH9B 2JJ1D 4YDHB 4C0SA 5GJCA 4TTRA 1TF7A 3CRMA 2J46A 1F60A 4WVFA 1GFIA 3OIUA 2WWYA 2QBYB 3MWYW 4ZDIA 2QPOA 2BIFA 1OKKA 2RGNC 2DYKA 3N2EA 2W00A 4P4UA 1YZQA 1OE0A 1X6VA 2C9YA 4NMMA 4AD8A 1S96A 4MGIR 4URYR 3KL4A 1SVWA 2F43B 1G7CA 3LV8A 3M6AA 1AQUA 2XTMA 4Q7LA 1PUIA 2ORIA 2XSZD 3JZAA 1XCMA 3DMDA 4BFUA 1OPXA 4C3ZA 5LPNA 2BC9A 2QAGA 2G83A 3K0FB 4AY2A 3BH7A 3TMKA 1XD9A 4A0HA 5JWRA 2GBLC 4B33A 4Q9JA 3JVUA 4HUQA 4KBFA 1W2HA 3QBVA 5EE5B 3T06B 4IKEA 5F98A 1RYFA 4WW0A 1T6NA 4LHWA 2B21A 4FW9A 4Y0AA 1HEIA 2RGXA 3NBYC 5BW8A 2IXFA 3H86A 3U5ZB 3QKSA 4HUTA 4OHVA 2OUKA 2ZI3A 2IBMA 2A3RA 3VHLB 1U9IC 1X86B 5EXTA 3OEED 5TV2A 1R7RA 1E9DA 4JKYA 4C0LA 4FCTA 2WJIA 3PFIA 3AVTA 1OXXK 4RD4A 4M1YA 2ZRGA 1R5NA 2I1QA 4JLVA 2QU8A 1JEDA 4YMVA 4D0LB 4AYTA 2O8FA 3PEUA 4HYYA 4IFBA 2RHMA 4L16A 2R44A 2R65A 2C98A 3VHXA 4PAOA 1KO4A 4M9SA 2ZS7A 2ZR9A 4BLQA 2QENA 1LNZA 5K8IA 2CHQA 2JJ2D 1AGRA 4M1MA 1LW7A 1TEXA 1GRQA 3CKLA 3T5DA 2GEUA 1YZTA 2VTKA 3EPHA 4C0QC 1S1CA 3H0KA 4Q9LA 1DOAA 1E3MA 1T0JB 2QA5A 3Q7QA 4F4JA 1D6JA 1LS6A 3BC1A 4G0NA 4GOXA 4Q21A 3TUZC 3GLIB 3KZ1E 1XP8A 3GQBA 1W0JA 1DO2A 1K8RA 2F3RA 3SI7A 2H18A 2VP5A 2F1HA 4HAVA 1ZMXA 3C8UA 4JLAA 5GVRA 3L2OB 4TYQA 3EW9A 3THXB 3GLIE 2HXYA 1KDOA 4JLMA 3HYRA 2NO6A 2E9SA 2F9MA 1NSFA 1E2FA 1HA3A 2G1KA 3NG1A 3QNUA 4EFNA 3TW8B 1G17A 4FI3C 1Q1ZA 2ZAOA 3EXAA 4R71A 4YMUA 4G5SA 2J1LA 3OFNA 4LHVA 5CJ2A 5E3HA 3VMFA 3ZH9B 2ATVA 5A0FA 3SJAA 2EYQA 3BERA 5DLQC 4BLTA 1X8KA 1CLUA 3IPXA 2ZRPA 3MUFA 1ZIOA 3IHWA 3GJ3A 4DB4A 3GJ7A 4KU4A 5LDDC 4YQFA 4XJXA 3P26A 1CR2A 5HCNA 1EXMA 2IX3A 1GG2A 5HPYB 2ZAMA 3PUYA 4RZ2A 1U0HC 4DEYA 2ONKA 3IBGA 3VKWA 4NTZA 3CRVA 4HZIA 2W58A 4Q00A 3C5HA 2FFBA 1MH1A 3CX6A 2DWOA 2C9CA 2JASA 1L4UA 1E2DA 3NTUA 4L9WA 1T5LA 1N6PA 4RZUA 5CLLA 3SS8A 5FTLA 5CYOA 2AWNA 4V0ME 1OFTA 1ZNWA 4CT5A 1OLOA 4RD1A 1W4BA 5IRCD 3LD9A 2IS2A 4WA7A 1N0WA 4BLOA 4XWKA 1V5WA 4PHFA 4Q01A 2XJ4A 2IT1A 5JHHB 2R2AA 4HB2A 2R62A 2D74A 3NBFA 4BFTA 4NE2A 1TNDA 2F1IA 1N6LA 4LC1A 4EFMA 3TNFA 2O8CA 2RGEA 1KMHB 1E79D 2YJTD 4DSNA 2HYIC 1SZPA 5CK5A 1NNEA 1O3YA 2VRWA 3A1UA 3EASA 1H8HA 4PTLA 1FOEB 2VBCA 2DWPA 3WMFA 2FFQA 5FL3A 2HEIA 2DFNA 5M04A 3ADDA 2ZYVX 3LVRE 1FUKA 1TQ4A 5KNDA 3NDBB 2AFHE 1OHHA 2RGNA 4X8OA 4Z54A 3M1IA 4ARZA 2ZUDA 1P6XA 3OIVA 2XZLA 3PUWA 4AKEA 4KXFB 5TXGA 3A4LA 4PX9A 2JLSA 2B8TA 5G53C 2VSOA 3CLVA 4CVNA 3P4XA 4PPGA 3PEVA 2A30A 1WQ1R 3TAUA 4KV9A 1MKYA 4Q7KA 3KX2A 4UNNA 1Z8FA 3B2EA 4EJSA 1KMQA 4W5HA 2BJWA 1Z0JA 1SKQA 2QAGB 4IEEA 3T1TA 2OEPA 3U7FB 1GNPA 3MMPA 5C4GB 4DDUA 1OJLA 1GP2A 4HUQB 421PA 2IA5A 1DPFA 2ZEJA 4QGAA 3I8SA 3AVYA 4LJ8A 1FPMA 4TN1A 3UKDA 4DIDA 4HLQB 3UMFA 4Q5IA 4R9UC 2BKEA 5BWMA 3GPLA 3QKSB 1YRAA 5KUTA 3OAAA 3NC0C 1ONBA 1P9NA 2QQ0A 4IDQA 3E1SA 1QDEA 3B8HA 2R6CA 3QVVA 2IEYA 2O8FB 2AK2A 3L0IB 2LCFA 2ZRCA 2XZOA 1GILA 4RD2A 4B3BA 4FWIB 4TL9A 3D3QA 4KLZA 3U60B 4PZZA 2BV3A 3SYKA 3NWJA 4KLNA 3RWOA 4NYIQ 5JS8A 2ZRKA 2X2EA 3X1DA 2DWQA 3CWQA 1WBDA 4MDFA 4HI0E 5FPKA 1JPNA 2VQSA 1MV5A 3B5JA 2AFIE 2OXRA 4US0R 2JDIA 2ZJOA 4ZO4A 5HKKD 4JLPA 4MKFA 3CRRA 2NPFA 4Z8YA 2REXB 2X77A 2HJGA 3EARA 2GCOA 3F0TA 3W6PA 3CZQA 1XDBA 1Z63A 1W0KA 2D62A 3LWNA 4I1VA 5J4HA 3DHWC 2R9VA 5FBRB 2BHRA 2QE7A 3HU3A 4MRSA 3LAWA 2IYTA 2KSQA 3PUXA 3TIFA 3W5JA 3CRW1 2ZU0C 3KKNA 3W90A 3HR7A 1W48A 4ZDJA 3QG5A 4A2PA 1UADA 1DAGA 2F55A 4LX0A 1SVKA 4LYAA 2V55B 3IO3A 1D2NA 721PA 5HE9A 2WKPA 1EFRD 2XNDD 2GF0A 1YU9A 4TQ9A 2NO7A 2ONJA 4D6PA 1J90A 1SHKA 1CRPA 3UG7A 1CBUA 3KQNA 1PLLA 1RZ3A 2ZJAA 1TF2A 3I5YA 4RFSB 3RWMB 2OSBA 3PVSA 4QKQA 2ORVA 3ZQ6A 2CNWD 1E1QD 3BBPA 3BS4A 1G3UA 1UBFA 4US2R 3Q5DA 1Z2AA 4TT3A 4Z1MD 4YMSA 3NIBA 1T3HA 4B2IA 5L3QB 1W5TA 1U8AA 4JYCA 3K0AA 3I8XA 4NCHA 4DEXA 4NDZA 4CDGA 2H1LA 2BM1A 2HV8A 3GP8A 1IN8A 1OKKD 1DE0A 2H17A 1P2SA 3TVDA 4G5QA 2ZUBA 3E5HA 4F91B 2ZTSA 3K70D 2DB3A 3LQRA 5G40A 3JVVA 5EJEA 1G8PA 1FP7A 4JS0A 4MGYR 1ZINA 2FG5A 1E69A 1G1MA 3NH6A 1P9WA 2G9NA 2IEZA 4RSGA 1ZVQA 1Q57A 2XSZA 4GOKA 4TWZA 5DGXA 5TY0A 1OW3B 1XEXA 2GJKA 2V7QA 1VPLA 2ZPTX 2I1VB 1KSFX 2NTYC 4P31A 2N1BA 4URWR 2O8CB 1P2TA 4XIGS 1QVRA 1T8UA 4GPTA 1OFIA 2YWEA 4YLGA 2IYLD 2WWHA 4J0QA 3A4NA 3RYTC 2J7PA 4D0NA 2W0MA 2QL6A 4DLSA 4O0MA 4Q02A 2VSXA 4N0DA 3L8ZA 2GEVA 2CE7A 2JLYA 3RRNA 4R2HA 3REGA 1WXQA 3LXXA 2VO1A 3C7KA 3PITA 4LCBA 5AUNB 4F4IA 4QHTA 2EYUA 3SFZA 4ARZB 1Q44A 4V0KA 4GFDA 4BFSA 3M4YA 2J45A 4QNMA 2BMFA 1Q20A 1RKBA 1OIWA 1NJFA 4V03A 4BGDA 2VHUA 2B7BA 1TTTA 1X8LA 2D06A 1WMSA 3I1FA 5JFGA 1VHLA 1BYUA 2ERYA 2JJ2A 4ABYA 1OXUA 4F38A 4EJSB 1E2EA 5AUOB 1YJ5A 4DJTA 2GHIA 4KAXA 1DG3A 1GM5A 2EVWX 2QSYA 3VR4A 1I4DD 2IUSA 4TLBA 2BOVA 1N0UA 1HE8B 1W0JD 1EWRA 1UKEA 1M7BA 2IXEA 2QZ4A 4JVLA 3WRXC 4BEJA 4A6PA 1NRJB 1Q12A 2QEQA 2IW3A 4DHEA 1RE0A 4AG6A 3BIFA 4B43A 3GLHB 1M8PA 1R4AA 3L43A 5HCIA 1XXHA 3LFUA 4LBZA 5DI3A 1Z28A 1E0SA 4IRUB 1KZ7B 3UATA 1IQPA 2IWRA 2QGNA 2WJGA 5JCZA 2A5YB 5LB4A 4IFEA
chains in the Genus database with same CATH superfamily
3DW3X 1IAQA 1I5RA 3LE8A 3V9PA 4MMZB 3OQJA 4UEWA 5H5JA 1HZZA 4TKZA 4Z6KA 4F9TA 1TEZA 1XPRA 2HKIA 1H1DA 1GLGA 1R18A 2J4DA 3PDIA 4ODIA 4QBGB 4B2LA 2MSCB 2GPWA 3B3FA 5LYYA 1ZN2A 5LA6A 4C7VA 1OMOA 4X61A 4XR9A 1S7CA 1XJ5A 3GC6A 1N5IA 2F1JA 3HV2A 3DM5A 1M6NA 4OQLA 5SY9A 3WGJA 821PA 4QLBA 5GM1A 5KSOA 1ZIYA 4M1OA 2V6GA 1YCFA 4I4IA 4GX2A 2QX4A 4JJFA 5FP0A 1FP6A 2OKCA 3CG0A 3ZHCA 1ADFA 4MRRA 4AY5A 1ZD4A 4IVPA 2FPUA 3EUFA 3O8DA 2B69A 3UJ6A 3MXOA 2Z2XA 3U31A 3DOOA 4MVJF 2YHBA 4PFKA 4UDYX 1JQLB 2RARA 5CVCA 4ZV4A 1DJQA 1P5ZB 3CH7A 3B1JA 1KDYA 1W44A 4ZYZA 2ZDGA 3M3DA 4X63A 2RHDA 1TVKA 3LNCA 4DT1B 4GRDA 3BUSA 5TDHA 4ZYYA 1YA6A 1MA3A 4OH7A 1NNI1 5CEFA 2J9YB 2C4HA 2RGDA 3QVTA 4HEA6 3QY9A 4ECEA 1Z4IA 4EKGA 1PSDA 4BAUA 4YUXA 3IBSA 5T8KA 4J75A 2MINB 4RXMA 2B1IA 4QATA 4KYTA 3WL8A 4DG5A 4XIIA 2P79A 5AK6A 2B7CA 2VK2A 1KP9A 3VNSA 1UPAA 3BOSA 1H2RS 2P6NA 2H31A 3R1IA 4BBAA 1A72A 1SPXA 3GGJA 5JIBA 4YAFA 1H8EA 5AO9A 1LBQA 2VZEA 4G56A 2IHYA 1IWOA 1R16A 1VIVA 2X19A 3MT8A 3QPVA 4IMPA 2WAYA 1YS6A 2KBFA 3EIQA 4ITUA 3OKPA 2FPIA 2WHRA 3ADCA 5IDVA 4E2ZA 4MW1A 2X0EA 1PK8A 4J0FA 3RHTA 3USCS 5FTKA 1A9XB 1KZGB 1T6YA 1VLQA 3SLGA 1UAGA 3TZKA 1E6WA 3L4BA 4QGGA 1Q7TA 1GQQA 2RAVA 3JATB 4UQPA 5FKJA 5ICSA 2XEXA 3UXMA 5IJ0A 1XEWX 2FB9A 3E7DA 1C8KA 3LCUA 1S8NA 4HWPA 1QFMA 2Y05A 4WUTA 4Y1GA 2WHYA 1YS1X 3JYOA 1FLDA 2GN2A 3WMGA 3ZHUA 4ZU3A 2Q3CA 4MQ6A 3VPXA 2WIKA 1FDIA 2FTKE 5IVHA 2D1RA 5KI6A 3D2BA 4TV8A 2VEDA 4M1WA 1YFJA 1HKHA 1AGNA 1ZC3A 2C1EA 4IIDA 1GKUB 1OYYA 4L73A 4Q1DA 4WKGA 3QA3E 1XEXB 2PMFA 1HDEA 2QMOA 1PUXA 1IBCA 3U3RA 1YZKA 2X0RA 4HNAA 1DWOA 1COWA 2QN9A 2R5WA 2PDAA 3OZBA 1UJCA 3UANA 4QTZA 3PJFA 3VDXA 3AX6A 3ZKWA 3EZGA 4I55F 5KX5F 2H1RA 1U3FA 1N2CB 2XD9A 4EENA 1TCCA 4PPNA 4AICA 3IEVA 4UTOA 1M34E 4Z3DA 1I6LA 3EEIA 4QYIB 5B53A 2CLOB 5CHYA 3OECA 2X6QA 1TQ2A 3PWZA 5EVJA 4ER3A 3CWCA 5LXTF 5AVVA 2O2XA 5FA6A 2V4ZA 4XUEA 1ODSA 2DERA 4LJ4A 4D43A 4F5DA 3ET4A 3KZNA 3I9FA 4DSZA 4MKXA 2WTBA 2N75A 1BHO1 4JUFA 2ZQYA 3BGDA 3E9RA 2ZWOA 1DHRA 1YR3A 4QE3A 3KKQA 1XVTA 2IY7A 2HF2A 2IPNA 3DUWA 3R7WA 3UG6A 4L3OA 4G89A 3W8DA 3E8XA 3L6RA 3QENA 3DQQA 1JHMA 1CLEA 1H1TA 1TU0A 2GM9A 4D9JA 1EAYA 2UU9B 1B0PA 2W6JA 3LT5A 5D00A 5G0VA 3NWEA 4YV7A 2A7QA 3UW1A 1W8DA 2CUKA 2HRRA 4FX5A 3PNPA 1U0BB 3I6BA 1UK9A 1SWVA 5HKAA 2ZWVA 1RQNA 3PDUA 3UJDA 5I01A 1SCDA 5CCDA 2JH9A 1UBTS 1BQ4A 1Y42X 2XHEA 3ESBA 1KYIA 3QKTA 2JDID 4HMQA 4JBXA 5J3JA 3GLFB 4HX2A 2BONA 2HRCA 2K6GA 3DTVB 2X22A 2P6RA 1YRYE 3VBCA 5CLIA 1SO8A 3OE7A 3WBFA 4PFQA 1W0KD 1CF2O 5IXYA 2C78A 3FNIA 2VZ9A 4JKIA 3VKGA 1L7AA 3ROZA 3VR5H 3L0ZA 5IDXA 2DWUA 1EESA 3ZZUA 3TCNA 3WDLA 1CY8A 1NMSA 1AU9A 3D2LA 1ZRHA 1FYEA 1WF6A 1X7XA 1XXHB 1B14A 2EJCA 1T9KA 2H4JA 4QX6A 3KU1A 4COKA 2XQIA 3HK2A 3CZ5A 3LY9A 4OQFA 1OIVA 2JIQA 1FFSA 1XDWA 4P38A 1BVHA 2WKWA 2VHQA 2YH2A 4CLOA 5HFJA 4TSRA 3KWLA 4S2EA 5CFLA 1HI9A 2CDCA 2I80A 2P4EA 3VX4A 4GXQA 3V4RA 4RY9A 1PO7A 1W5FA 1KMHA 1FVOA 3GEHA 3CEPB 4A6XA 4JCOA 2VP2A 4TMZA 4KGZA 1VG8A 3JWJA 1ISRA 4UNRA 1RQPA 4X6XA 1U8UA 3BHJA 4DPKA 1AN9A 1ZZEA 2I4IA 2QQGA 1JKIA 3LFHA 3KD2A 4HDNB 3VGJA 7MDHA 2HU8A 2O2CA 2X4LA 3BTOA 2Z5FA 1TYEB 3E9NA 5HG0A 3C1AA 4K46A 2YWFA 2JA2A 1UMBA 1JG7A 2AC2A 2IIBA 2FX3A 4EKNB 4FDLA 4IVNA 4L9SA 4RKFA 4WPGA 3ANLA 3BGVA 1SZCA 1TIPA 1CE8A 4EY3A 2XCTB 1P0FA 4G9EA 3EMKA 4V1CI 2W6CX 2V54A 1XZAA 1NR1A 2UV8A 1P1BA 1PFKA 3C3YA 1GYRA 5C8YB 2GK3A 4BXOB 2P2CA 4TM7A 2CDNA 4B6EA 4DAOA 1XNRB 3HKDB 3K9GA 5BSMA 3L0OA 1QIDA 3G6KA 1QIGA 4WINA 5BYKA 1ZIPA 4B3IA 1S1MA 3GHYA 3P9KA 4MYUA 1YDFA 3V6LA 3EIEA 4NOMA 4IDFA 2A5JA 3EGXA 1F20A 3M70A 4X60A 1RJFA 1TRHA 1MDFA 5KC8A 4RM3A 3ZQJA 3D3WB 3UFBA 4JNKA 4G1VA 3T4UA 5GJVC 4BMZA 3FD8A 1QFJA 1ADJA 2YNMA 3JQBC 4RIGA 4BUZA 5C35A 3LZ6A 4RVFA 4BRSA 3UAZA 3L4JA 3HL4A 4MEAA 1LBIA 1G5TA 1FDTA 1CQPA 2WSMA 3KYBA 3L40A 5GJBA 4PRKA 4WLVA 1E5LA 1K5PA 4FUTA 4HGZA 1J99A 2F1RA 2ODTX 3R20A 1B0UA 1J20A 4ERXA 3HDJA 3CPJB 4OL9A 1EBFA 1TD1A 1XWWA 1JBEA 1CS4C 3DO6A 4HX9A 4JUAA 4XB1A 4QUGA 3VU9A 4BNNA 2XYGA 3FYUB 4MW2A 3T9BA 5ISMA 2EU8A 5IFLA 4R1PA 1VG1A 4YA6A 2ZSEA 2O9JA 2Q1TA 3ESRA 4DA8A 1P2VA 1S8OA 2QRNA 3KOWA 2J87A 2JW5A 1OBFO 2PH1A 3UIEA 1ORTA 1LK5A 3R6TA 3B1ZA 3DBRA 3A9UA 1PWEA 2GTHA 3DZ8A 3GCXA 4BB5A 2ZI4A 3R09A 4AMBA 2PZLA 4X1YA 3DKVA 5FTJA 2ZUTA 1HFWA 1NRXA 2J08A 3I2IA 3HB7A 3IVGA 1WP4A 3OTGA 1Z4OA 1C0LA 1CQJB 1V11B 1W9HA 1V26A 2V65A 3LX6A 4JD5A 1L5LA 2WWWA 1Z36A 3RVMA 4LF6B 5HRAA 4JYMA 2EJTA 5DYNA 4ZI7A 5KQPA 1IBKB 1I0LA 5EKXA 5BVGB 1GNRA 2A0UA 1EZZA 1KO8A 1U7TA 2YV5A 3CMCO 4WA8A 2OV6A 3KWFA 5AKEA 1E7QA 3V32A 3BZUA 4RH1A 3ILSA 2HLDD 2B4RO 4YIKA 3U81A 4TLDA 3LUFA 4Q6WA 3W5IA 1NP3A 3JAKA 5GZ1A 3BEOA 3KQUA 5DM70 1H0KA 2WQ6A 4S24A 2ZETA 3AUFA 5REQB 4B48A 3UWKA 3VOBA 3HXQA 4BY9E 2D3TA 1M83A 1YUNA 3FSRA 4AU1A 1EHYA 3QXCA 4FONA 3KVVA 3PG5A 1YC5A 3E9QA 4AUNA 1JZSA 3A36A 2JFYA 3KXPA 3QFCA 4G9GA 4JEIA 5FI3A 5LVAA 4D25A 2J3DA 5GGYA 3O2JA 4P98A 4NENA 5JDIA 3DLPX 1P1IA 1ZNYA 4J0IA 2G40A 3WV5A 3GLGA 2H2DA 2DJIA 2HA2A 4Q1VA 2WR8A 4IUYA 5TS3A 4YJHA 4KTTE 1MX1A 2ID9A 2XVMA 4BUJA 4OV6B 3TQHA 1IL0A 3OQMA 3N8DA 4TXMA 1KYYA 1E1DA 1E77A 1E9AA 1G5PA 2FEAA 3L7BA 4QZVA 2AXPA 2P90A 4TYPA 3WL5A 5A5DA 4M36A 4K6KA 3AR7A 4QUDA 4WXMA 1PJAA 1IM5A 2J48A 3DP9A 3LLMA 4I9HA 3AT1A 3UAWA 3H2ZA 3Q0EA 4IXMA 3VI4B 4D44A 1KO1A 1P29A 4WZAA 4DYVA 4OHZA 1AZWA 2GJ9A 2X7HA 2XOXA 1WSWA 4CETA 3QHPA 1XA4A 1XPUA 1DIGA 1QIJA 3I3SR 5LQUA 5ALHA 1I5EA 3QE0A 1KK1A 4MWCA 4YRJA 1WETA 3W3ZB 5AVTA 1T0IA 1EJ6A 4V1CA 1I9GA 2Y0PA 2D6FA 3KQKA 1QYWA 1YKGA 4ZQEA 5GV7A 3G2PA 4BNXA 2QB5A 2AKEA 4DR4B 3LH5A 2O0LA 2X23A 3NBUA 3STYA 1X14A 3OURA 2HTEA 2H5JA 3VOAA 3H9QA 4RA6A 3OEHA 1QRAA 3B6MA 3OJ0A 3OT5A 2FP4B 3BA1A 4IINA 1FFEA 2HO4A 3PYMA 5LJIA 5LWHA 4BGVA 3IQEA 5AVSA 1UKVY 3M83A 4IVQA 5A05A 4BZQA 1LJ8A 4EKYA 1U7OA 4JR0A 2OBMA 3C70A 4GWKA 3KE9A 4C89A 2HFKA 1JQKA 2NYVA 4F9GA 4H4DA 4UXJA 1YFLA 3TKAA 3OT4A 3P0EA 2ACEA 4FYYA 2FR0A 4LC0A 4I14A 4OKSA 4AX4A 1SU8A 2YVUA 5JMPA 5HIKA 2R7MA 4M0KA 2TMYA 3WQQA 4X3CA 4EPTA 5J4VA 2QTBA 2YMPA 3AESA 3DFZA 4UEKA 3KOZA 3UM9A 1N2JA 1V7PC 2AI1A 1O95D 4ZVRA 4C01A 5AESA 2Z4RA 3GH3A 1AHNA 1HETA 2ATIA 3CVJA 4AF6A 1FFWA 1XEWY 2BFPA 1KFJB 2W9XA 4IIVA 4XX0B 1H8ED 2YCLA 4LVNA 1JSZA 3DUFB 3ES9A 4N49A 1W34A 2VDQB 4KFRA 1W35A 4Q9IA 3WNCA 3ZDZB 1TZMA 3AYZB 4RH3A 3L4EA 4QQFA 1PNQA 3GDWA 3GP5A 2Q99A 4FVTA 1MTOA 2E4YA 1T1RA 1II8B 3FB4A 3PQ2A 5KYXB 3MUNA 4GW3A 1U99A 2ETVA 121PA 1WZIA 5BUCA 2DZDA 4Z8XA 1G21A 2WE8A 1GPH1 4MP3A 3U0BA 1Z33A 2NUTA 2ZXFA 4YRAA 2RFLA 5SZHB 1G9XA 5BW5A 5A02A 2H9YA 2Y1WA 1LI7A 2DFVA 2H0RA 1UC4B 2MHCA 2YZMA 5F3DA 4C4XA 2WSLA 4CN9A 3U7QB 4XCQA 4EY8A 2F64A 5JCPA 1D9ZA 3F6BX 3R0XA 1R5OA 3EVCA 1JPUA 1O96A 3WIOA 4LQLA 3ESXA 1FF9A 3KFXA 4TTAA 4U2FA 4IIJA 2L19A 4WJZA 2NXJA 1ELOA 1AO0A 1SOVA 3BCRA 3FPAA 2H2FA 2OQIA 3K96A 2E89A 3TDNA 4EH1A 2VJNA 1M8GA 2LCIA 3MRTA 4N0PA 2DFKB 3PQEA 5H3HA 2QJOA 1AZSC 1MB4A 1UPXA 2RGBA 1XIVA 4RK0A 2O5RA 3DDCA 3UT6A 1COWD 2P65A 1YJAA 3UN1A 3FPBA 1P2BA 4V02A 2QMUA 3GEDA 1N1DA 4J0CA 4YAJA 1K7XB 2IZ7A 2ZDHA 1G20B 2ERXA 5HDBB 2G5CA 2RDMA 3H9CA 2WUWE 4LY6A 1PQ4A 3G0OA 4YASA 5FWXA 1S4MA 1WR8A 1HBJA 3GT0A 4KMSA 3WWCA 1D4OA 3RQSA 2J3HA 1GTMA 1T1IA 3BG5A 2BFMA 4PYQA 5EXEA 1U1DA 2F6RA 1SXJB 3K0EA 4INPA 1HE3A 1IN4A 1SXGA 3AZOA 4IX9A 1JAXA 4ZC1A 4DWJA 1LLCA 4N8SA 1AA9A 3RTAA 5JJCA 4PV7A 3I2GA 1XNGA 2Y27A 3RU7A 1CJUC 4DCVA 2VQ3A 1GNTA 1ETHA 1UWKA 4MI1A 4YQEA 1C50A 1UQUA 1OWLA 1ZXXA 2YUTA 1SKMA 2BYTA 1E62A 1Y3IA 2GEBA 3E2PA 5DYGA 5F4BA 3GUVA 4CUKA 4KYIB 1A2OA 3R7SA 2XD4A 4X24A 4PYMA 5DP2A 1NDQA 1ZK3A 2ZAYA 1B76A 2W6JD 3N8IA 4DMKA 2XGOA 5F5NA 2QX9A 3CCCA 4IEFB 3S1LA 1EA5A 4CHGA 1TK3A 1OFUA 1KRXA 4LWQA 1KXJA 4S04A 1R15A 3WO1A 3G17A 3MGKA 5IUKC 1EUQA 1L4FA 1CRWG 2E6KA 3B9QA 2FPSA 2PJUA 4F2PA 4G81A 1HEUA 3AUSA 2AF4C 1P9LA 3WKDA 1ZEJA 5TVKA 3N6RA 1U94A 1VJ1A 3ORQA 4IFEA 1QJ4A 3OE7D 4O63O 8ATCA 2B34A 4MV0A 1LPAB 1PYOA 4TVKA 2C0QA 1P0PA 1VB5A 4DJ5X 4OGFA 4LSGA 3R7LA 3EGEA 4GR9A 3FF1A 4KO1S 4P3PA 5K01A 2P27A 3ZI7A 1L8OA 2IYWA 1HM5A 1JIXA 2NM0A 1C8LA 5L6MB 5FOXA 3HL0A 2FOIA 1BD3A 4H27A 3VR5A 2PN1A 2GD0A 2XE8A 3QIAA 1OYOA 3PGXA 3MWGA 4ALIA 5HM6A 2PVPA 2C3PA 2RG7A 3PD7A 4RMGA 4CNQA 5A9SA 1CIPA 3ZDYB 2GN4A 3RADC 1UZUA 1D2CA 1JS1X 2ZJ7A 1A7UA 2F8TA 1VBMA 1H0SA 1WHSA 3R5TA 5KYWA 3GLGE 2EWMA 1FTSA 4U00A 1JR3D 3L6UA 5TT1A 4H1WA 2AEMA 4JZYA 4MWBA 3NWBA 5CX4A 3B52X 5LKRA 3AJRA 3T4EA 1VECA 3NAQA 3LUKA 4ND5A 4AP9A 4XDZA 3BFXA 1V41E 1P73A 4J03A 2B35A 4LE1A 1P44A 4ENTA 1XCJA 2PPVA 2RHCA 2Q28A 4HEA1 1OBVA 1OXMA 3KYDB 1OTHA 3D7RA 5KYUB 4ON9A 1H2AS 5CT8A 3ZNNA 1OA1A 2BLNA 2Y3IA 3REQA 2CB0A 5ALPA 2DX7A 3TKLA 5GQSA 1M75A 4LBYA 1RT9A 2IUUA 3U6KA 3PYLA 1QHHA 1TM2A 1MO4A 2OBLA 2OCIA 2NYUA 1DC7A 2P9BA 2QR2A 1SURA 3E84A 3R6DA 4GQBA 4L6CA 4Y6PA 2FQXA 1XA0A 2YINC 3WQBA 4E31A 1ANKA 4PN3A 4XQ0A 1JFFA 2JFNA 3L3BA 2FEWB 4NKRA 2VS1A 3RVBA 4QTYA 2GM3A 3WLKX 3ZVLA 2GD6A 2EQ5A 4AX8A 4XSHA 3TM5A 4EUEA 3PXDA 2EV9A 1XVAA 4DV7B 2G5PA 3RYFA 1NW4A 2XYVA 1RXCA 4R8VA 5LA6F 4XVRA 4DVJA 1RBYA 4QXAA 4RJ2A 4X54A 2YNMD 2ZE6A 2IYFA 2FWNA 3BULA 3WZ2A 1ZQ9A 3FHTA 2WT9A 2AW3A 5EIBD 1RD4A 1ZN8A 4CCYB 2F3PA 4CQMB 1CG6A 4M53A 3E3OA 1HNXB 3BVPA 5EP4A 1MP0A 4OK3A 4AJ4A 2AA3A 2QMQA 4C4YA 3K9NA 4EA9A 2HWXA 4ZJZA 3PR1A 1P1HA 3HEAA 2M1XA 4LWZA 3ZZTA 4DJJA 3THWB 3D7KA 3T0IA 4HZUB 3UMRA 3ZCRA 2JZNA 4JI5B 1FYDA 5CFRA 5CFOA 5P8WA 5CAEA 4OJQA 3CRZA 1S2NA 1U8YA 4J2HA 3QGMA 4ZAWA 2DULA 2O3TA 5JANA 4C2TA 4MZDA 2CUZA 4OHPA 1AT1A 2PCLA 3BGSA 3B1YA 4IWNA 5K03A 1CQIA 1RFLA 1UWVA 1A98A 2BAGA 2JIRA 3V55A 2Y6UA 3E7XA 1ZA1A 2GH1A 5U4QA 4DNXA 5DXAA 1NUAA 2I9KA 3IAAA 3ZZNA 2GX6A 3EPRA 3I9KA 1PL8A 4CL2A 5TLSA 2YWCA 4RXUA 1P4HA 3K71B 2JRLA 2PS3A 2ZB4A 3JTMA 4N8DA 1G21E 3COSA 3KEOA 3LNTA 4MHOA 4UXIA 4RWZA 3QP9A 3AVUA 1MJHA 2RCNA 4QDZA 4TV9B 1KAMA 3GFOA 1R3DA 1KS9A 3EZ7A 1DT3A 5F78A 4BASA 3EXHC 1WXDA 2QLNA 1SR8A 3PUIA 4I1SA 3QTBA 3LK6A 4KH0A 3PFCA 4B85A 4YPOA 5E4YA 2DFTA 3EMVA 4AURA 4WBXC 4BKQA 1PJLA 3CS3A 1L2TA 4KODA 5ALMA 1SOWA 4JA2A 5C8XA 2J6BA 3TFWA 3MMZA 1CU1A 1JJFA 3U7EB 4AIRA 2RGUA 4EX7A 1UBGA 1GQSA 2WBLC 2ZCVA 3WB9A 5BPHA 1JPJA 3C15C 3AY7A 2HXSA 1G9SA 1IXYA 2WW8A 2JIZA 2YTZA 4KITB 2NAPA 1CUIA 2WIDA 1CEXA 2IITA 3A6KA 4LHYA 4KE6A 1YQDA 1YZFA 2RK4A 4IOMA 4RQAA 4J0DA 3H11A 3EZFA 3EXG1 1GN9A 2CL7X 3CLUD 4C87A 1JWBB 3LGAA 4MLPA 1CQWA 1A95A 3JW8A 1Y6RA 2P2SA 1IB6A 4Q05A 3O8CA 1M1NA 4YRLA 2ZBGA 1C14A 4QU8A 1GNVA 3HM9A 3FCYA 1C9JA 1V4BA 1ZJ5A 2QW8A 2FW7A 3DMPA 1TAGA 3DZHA 1GXSA 1OILA 1YR7A 4G67A 2L82A 2CBXA 2QVCA 2XW6A 5EIEA 1D1PA 1WSBA 2C3UA 3WA7A 1DX4A 2V3VA 1B0AA 5IF3A 1LPOA 1YUBA 3H5OA 3LRXA 4XVQA 1NLZA 2P69A 5IYZB 5KYGA 2FPPA 3BE4A 1JDBB 3LUHA 2NZ2A 1PKEA 4UU1A 5CT4A 4C4SA 1JEYA 1Z4KA 5JATA 1FNDA 4G1UC 3UUFA 2COKA 3TZQA 3GOHA 2W8BA 2CLKB 3HR8A 3KKKA 3AIMA 1Z3CA 4JQOA 4FPXA 2PSDA 3SCZA 5CU7A 3U6BA 4DDMA 3HE3A 3IAHA 3F5FA 3IP3A 2GR9A 1BE6A 5K8UA 5AVKA 1DRVA 2FY8A 4HS9A 2RAFA 4Z0TA 3IT3A 4DNQA 5GINE 1YVEI 2QPLA 1M72A 3GLTA 4IJ5A 4MARA 4YJFB 5ICCA 4XQCA 3EH1A 1VP3A 3DV9A 1K8YB 3QVMA 1MXHA 4IW3B 4L5CA 4LDJA 1K98A 4MUBA 4R84A 2YYZA 2XB6A 1VA5A 2GTPA 3IDZA 1JU4A 3AJEA 2R85A 2JK1A 1N6KA 4WZBE 3GDGA 4TXHA 2GZSA 2WZCA 1AOXA 2IZ5A 4P7JA 3JAWB 2BBOA 4N4AA 3W4KA 5AQ1A 2ZRHA 1PFUA 3FNFA 1O87A 4V24A 1JDUA 2DBVO 2EGGA 1VSUA 4ZCRA 2WFAA 3D2AA 4G0QA 5HS6A 5I4CA 5KB3A 2PANA 4KSYA 4OQNA 2OHVA 3OUTA 2CJFA 3EQ6A 4O2LA 3SJUA 4C76A 5SV2A 4KUHA 2D5LA 2QJFA 5AXBA 4BLPA 2ZBDA 3N0WA 4AZ0B 5JS6A 4G8CA 4GYYA 5HNKA 1BYIA 4PAMA 3KDPA 5JASA 5U1PA 4FQ7A 3GO4A 1JHPA 4LV5B 3SC3A 4LF7B 4QXOA 3M4XA 2VT6A 4BAZA 1AHIA 1YIDA 3PHCA 1AZLA 2QUIA 2ZE7A 4U4AA 1ZH4A 3ZEIA 5SYMA 4DXAA 2YKGA 7ABPA 5HUQA 1E63A 2RGCA 4XYMA 5EHQA 1RI3A 4QO7A 2XCIA 3A1TA 4N3BA 1NC1A 4HQOA 5A04A 3E5MA 3PKJA 3WL3A 1QHNA 1FMCA 1W4ZA 2P8JA 3DMFA 3EGDB 1BEZA 4AI6A 3H5RA 2UKDA 3WZLA 2QD5A 4XQEA 1IWPB 1J5XA 2QPAA 4G8JA 4LCJA 5TJ9A 5JD3A 3TCKA 4YRGA 2PUBA 1XZGA 4KBGA 1MAWA 2WV9A 1TECE 1VHDA 2FEKA 3HQ4O 3S5UA 5LMCA 4YRZA 1YQUA 3FMOB 3O3CA 1OI2A 1AKUA 4WOBA 2L18A 3K4HA 4HDOB 4YJ2A 4CKCA 2P3LA 2WNSA 2XUHA 4PANA 2VPZA 3QNMA 4XCXA 4RPIA 5JECA 4EUHA 1MH9A 3A32A 1LRKA 1QTQA 5IXJA 1BXRA 4YH1A 1Q7RA 1UZMA 3R75A 1BDMA 2G63A 3I9OA 3PGLA 1O5IA 1XPOA 1JQJC 2HU2A 3E9YA 4BMXA 5A4KA 1U0NA 3FFAA 1T3GA 3HJNA 3NEAA 8LDHA 4P8RA 4WESA 4LTMA 4R5MA 5BV7A 4RQUA 1QCZA 4KO8A 2AKYA 4M55A 4N5IX 2YV1A 1C3JA 4B3MB 3L41A 4ZQHA 1VP9A 2PGDA 3MCVA 5BYBA 3ZCVA 1WBBA 3ZHOA 3ZDBA 1F8FA 3UK7A 1VKZA 1R6BX 2ZSBA 2AN5A 3LRTA 3LT4A 2VEOA 3QXHA 5CK4A 3ZDAA 2EP8A 3JS5A 4BECA 2CL6X 1LWNA 4Q3BA 5EE0A 4EG1A 2Y77A 1NJ2A 4YRIA 1Z4MA 1J0DA 2DFPA 1GV1A 3F7TA 2NT3A 3AEKA 3QF7A 1HRDA 1T3LA 2ZS9A 1NT2A 2JGMA 3L07A 1T8RA 4KDFA 4AJHA 4JVMA 4AWBA 4BV2A 5F3WB 2P9TA 4OFBA 3K6KA 3SZRA 2NUAA 4GO1A 3VHQA 4UPEA 1YHNA 5GV8A 3VX3A 2XCSB 4OFXA 1OUMA 3GEPA 5G1PA 3QX3A 2O19A 2CVFA 1N5KA 4DDHA 5JBQA 4B0PA 2XUJA 4L02A 1E4EB 3B85A 4NMXB 3FTQA 3EGIA 2FX5A 3AVPA 1GGHA 5FPYA 4Q3LA 5DCUA 1T24A 2ZSAA 2W2PA 3FPSA 2CXTA 4R2WA 1NLUA 2V1XA 1A9SA 1RWWA 1VCOA 2CKMA 2DBYA 2H6EA 3WLIA 4E21A 4TKVA 1NURA 2BR5A 4L8GA 4YCJA 5LMUB 3QXGA 2XUDA 1NSTA 2LIPA 3VR5D 4D9IA 1G59A 2VAWA 3ZX5A 2NVUA 1WP9A 1U3CA 4UVEA 1PD1A 4Y7CA 3ZIAA 2SKEA 4GOMD 4OGKA 3JQ9C 3V1TC 1K8XB 1WIWA 2AUMA 2CLMB 1ZUNA 3G02A 3G1TA 4MW5A 5HSGA 5L51A 1CEQA 2Y1FA 2PGLA 1KQNA 3ZLJA 4DZTA 4QYMA 3AF1A 1K0FA 5JZVA 221PA 1FRQA 1UDRA 1NW3A 3Q7IA 1RRCA 3TD9A 2WP0A 2C3OA 1XZNA 2C2HA 1W87A 3FUWA 1XELA 3KZOA 1OLUA 1MORA 1F5NA 4BKUA 3Q0TA 4Z1OA 4JI0B 4H15A 3DMGA 2OMEA 4CF3A 1Z12A 2W6ZA 1R0WA 1DMRA 1H23A 2GYUA 2VYFA 1TU3A 3DB2A 4HWOA 3TSWA 2V8BA 4JP3A 4CGYA 5BUZA 3RTEA 4EJ2A 1NVAA 3JVIA 1J39A 1FCJA 1FX0B 2OESA 2H54A 1E5DA 3PCXA 5AKXA 2FRDC 2GK7A 2WHPA 3G13A 3JSAA 3WP0A 3QEBZ 2C03A 3KJGA 2BEJA 4PIMA 1H69A 1JEQB 3AR5A 3FIUA 4I99A 3PC8A 4O29A 1QSGA 4GOJA 4QULA 4AKIA 2EGUA 1X0XA 3D4NA 1RP1A 2A9RA 5DW0A 1KYQA 2G76A 1F4PA 4JP2A 4D98A 1WZ2A 3K09A 4MWDA 4U6SA 2NU9B 1QYVA 1J0XO 2IPMA 1ENPA 2I29A 3IT0A 3UJBA 2J6IA 1LF0A 5HW0A 1WCIA 4ZWNA 1FMTA 1KIMA 3UV6A 1SG9A 5A1TA 1EP1B 2BKLA 4RHXA 1XRJA 5CA0A 4IV0A 4WGFA 8GPBA 5GZ3A 3B78A 4DUYB 5JAPA 4E08A 3VNBA 5ICGA 2EFGA 3JQAB 5U4XA 4H0FA 4WKNA 1ZRSA 5TS2A 1KI1A 2AL7A 4G0ZA 1QV6A 4ZOCA 4N54A 4NNPA 1O4VA 2I3BA 4CMEA 1RAHA 4LNUB 1V7ZA 2JF0A 5E7JA 1IXZA 1X7ZB 4L6AA 1F2VA 2OCPA 3E05A 1YVUA 2H16A 2BW0A 2ON6A 2V4MA 3L46A 3LZCA 4M9QA 4ND1A 3PWSA 2B8NA 1FP2A 2EX1A 4GICA 4K9PA 4ARVA 3BMQA 4TTPA 4WDQA 4BU0A 2OBNA 1M9NA 3IBYA 3N07A 3NEPX 2X58A 4QBIA 1B15A 3BAZA 3MG9A 2WIAA 2P9QA 3R5SA 3NTVA 4M87A 4WXYB 2HH9A 4LXGA 3SIWA 3Q12A 3IILA 2JBHA 4JLBA 5K09A 1XOIA 4H7KA 1E7SA 1QQ6A 1ZM3A 5IXSA 1DJPA 2H9IA 1Y7TA 1KBZA 5GPBA 3WI7A 1KDTA 1WXIA 4U2DA 3GLSA 2G04A 3HCAA 4BGUA 3STWA 1LPNA 1Y81A 2XMBA 3PRJA 3TLAA 5JS2A 1UOQA 4ZIRB 4LDRA 5DBGA 3L8EA 3G8DA 3GDHA 2NTEA 1LBHA 1SMKA 3TL3A 2FWPA 4MS4A 3HP1A 5IBCA 4ZOAA 1T9GR 4GX5A 2OZPA 3ADOA 1QLWA 2YN2A 3NCTA 1KI9A 2A9FA 4LJ9A 3UYLA 3VA7A 3H99A 4R05A 1CF9A 4KIWA 2YHUA 1L7NA 2AMJA 5AHWA 3VSAA 4D80A 4DFDA 1OFUX 4PHGA 5ITSA 2R5NA 3OY7A 4UPVA 3ROMA 3MBOA 4JIMA 3ZGNA 2V8OA 1E9CA 4UCFA 4P3KA 5IHXA 1R66A 3GVPA 3HLTA 3ZIUA 4NZMA 3ISTA 4KXYA 2FAXA 3I2YX 4G9BA 3P7MA 4M4SA 3F46A 3ZU4A 1U4NA 4PSKA 1CD5A 3DL7A 3NUGA 1A1VA 3FHLA 5G0TA 3V8VA 1U2GA 4J9UE 5AI8A 2JIZD 5TQ2A 2VVTA 3IVCA 1DCMA 2C2KA 3EA0A 1U3UA 1FFYA 1IY9A 5M29A 3T35A 4QRDA 2P40A 3OIFA 1DAHA 3DBLA 1JBQA 4MGZR 3JQ7B 3TZEA 2HA6A 2W2VA 1SCNE 4B3JA 1NJ5A 1QIEA 3LPCA 4IIJF 3RVQA 2BPOA 2J7KA 2GVNA 3CNLA 3MW8A 1VKNA 4UW9A 8OHMA 2WU1A 1ADBA 3MILA 3NGLA 1DRKA 3SLRA 4YT2A 2O59A 4FU0A 3X1YA 4LXYA 2FR8A 1D3AA 3N6XA 3H2JA 1I3NA 2CNNA 5L7YA 4UNIA 1KVTA 2J9XB 2ZU6A 4Z9FA 1HKUA 1EJ0A 1UMDB 2BZSA 3N7UA 3Q8WA 2FMXA 3MJDA 4DE5A 3GL9A 5K4GA 3T5PA 4Y2JA 3BK2A 1LXCA 1OVMA 2OXFA 3HA7A 2J0UA 4R40A 1T2FA 2AN4A 1TPZA 2DM6A 1DBQA 2X76A 1DXYA 2GOYA 2QN1A 2VDWB 3LBNA 3WRYC 4LOIA 3UPUA 1EQAA 1VJ0A 4FFOA 1ODJA 4YRRA 3SJZA 4ENSA 4OP1A 5LP6A 4UMEA 3MS2A 3ZK7A 3RBAA 4DQ0A 5HTKA 4H1VA 3NYWA 3H5NA 2Q4EA 5BOSA 1NYRA 4XD7A 1TEVA 4XZ3A 4F4DA 3TG2A 4LFBB 2ZVPX 1E9EA 2YQ5A 3RHZA 4DCNA 3RVSA 2I6GA 1G66A 3HCCA 4LJKA 5J4KA 3A31A 1YONA 1ISHA 3LIPA 4EGQA 5IKXA 2E87A 4IJMA 1JYEA 4K7JA 5JQGA 5L9AA 3IT1A 5FH9A 4MV8A 1GCIA 1DJOA 4O4LF 4JI4B 2O8DB 2Q8PA 4K9KA 2QXTA 3PIDA 3C45A 4LX8A 1U31A 4C4OA 1RI2A 3K31A 1V0JA 1XQ1A 3TF5A 3UK6A 1DTSA 3K4PA 3HY6A 4PX5A 5ARDA 2NGRA 2VAPA 2OORA 2VZ0A 3R0VA 3WY9A 4EY6A 3N8HA 1TTQB 4P9NA 4HH4A 4O4JA 4KQGA 1MPXA 1L1QA 1UBEA 3H5IA 3I1JA 3IULA 4FZVA 3ONDA 4UULA 5K99A 1DAFA 2VRCA 3A06A 1OTYA 1QZXA 1GL3A 4MWGA 2M6SA 5J5CA 5BN3A 3QIVA 1RLOA 1EE1A 1XEFA 3GY0A 1J07A 5A0TA 3VVBA 1HDXA 4A7PA 1ISPA 4LUCA 5IBRA 3CUEF 3JRXA 2AFHB 3R6WA 1X39A 3DVRX 3LC1O 3QQPA 2YY7A 4KEAA 4QUJA 5BOVA 1Z0KA 3Q1KA 4GBMA 1Y63A 3C8DA 3QV2A 3MGBA 5DGTA 3TBKA 5B64A 5KSYA 1UM9B 4JI2B 5FWYB 3URMA 1DFGA 4E2FA 3C4JA 1XJWA 3BJEA 5DASA 5KTRA 2NP6A 1RRGA 1F48A 1DFHA 4L4UA 2EIHA 4Q66C 4DC9A 2BFWA 3PTAA 1Z5GA 4EFDA 2UXDB 3ANXA 1KJJA 2AOVA 3RKUA 1OOEA 1PK7A 2PRYA 4RHFA 3AF2A 2JGEA 2ZIXA 1F1BA 1N2SA 3DYIA 4IYRA 6GPBA 4HL6A 4I1YA 3DVSX 1XLTA 1RWPA 4H59A 3DMRA 2GARA 4Y9SA 4F6CA 2FQQA 2NQ2C 4XASA 1KAGA 3H4TA 3E8MA 1OROA 3KZCA 1DC5A 2GBLA 4BQRA 1T34A 3L8GA 3R7AA 1FUIA 1YQEA 4V0QA 3RU2A 1FRFS 1CKEA 3E82A 3R44A 1NXQA 3MMXA 2AE2A 2CE2X 1WSAA 4ONEA 1JE1A 2B7LA 2BUCA 2VP4A 2QZJA 3TRIA 4Q1EA 3PQ8A 4X20B 2I4MA 3U4AA 1JJ7A 3IP1A 4RDXA 2D2XA 1KH3A 1J8FA 2CHVA 2GAIA 3D4LA 2OGZA 4OOFA 5EWJB 3QOYA 3A0UA 3IVMA 3G7SA 4EEKA 3PHLA 3C3KA 3CO0S 5CYFA 1ABBA 3IRUA 5THQA 3SIXA 5LQRA 1Y9AA 5AK4A 5AW5A 4LYDA 4Q37A 3N3BC 3CF4G 4I08A 2Z4SA 2VNSA 4KCGA 4MROA 1DS6A 2IRWA 3BDIA 3MT9A 4MSUA 3SZMA 4A4DA 4DDKA 4Q6BA 2E4XA 2FZGA 4JXJA 2QY6A 3GRKA 4UAJA 3OA0A 3NTLA 1F12A 5F2NA 5EJ2A 1MO6A 4OXRA 5BVHA 4XWWA 4PHHA 2AKAB 5JROA 2F9FA 4WXRA 5L6LB 5FR2A 3R3YA 2C4VA 2HBQA 3DMYA 4HLUC 1KY5A 1QJCA 4J0JA 1NI5A 3IIJA 4WECA 3WYFA 4HXEB 1DC3A 4AJ1A