1BS1A

Dethiobiotin synthetase complexed with dethiobiotin, adp , inorganic phosphate and magnesium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PROTEIN (DETHIOBIOTIN SYNTHETASE)
publication title Crystal structure of two quaternary complexes of dethiobiotin synthetase, enzyme-MgADP-AlF3-diaminopelargonic acid and enzyme-MgADP-dethiobiotin-phosphate; implications for catalysis.
pubmed rcsb
source organism Escherichia coli
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1bs1A00
3F8TA 2HXYA 2G3YA 4B75A 4FMDF 4NHOA 2XX3A 1Q21A 4JLAA 2O8CA 3V00A 1E9AA 4IOMA 4NYIQ 3UG6A 2HYIC 4TMZA 1O87A 1G3IA 1ZIPA 1T0JB 3CF6R 2IWHA 3K9HA 3ZD7A 2IXEA 2OXRA 2ZRJA 3IEUA 1G16A 4QGFA 2ZRPA 4RD2A 5AJWA 3KFXA 5CYOA 4DJTA 2F6RA 4D80A 2EFCB 4KBGA 3FKSA 4PPFA 3R8FA 1KMHA 2FGJA 3OZXA 4HI0E 4RCZA 3U44B 4M1TA 3DPUA 5TARA 5JFGA 3SHFA 2YVUA 2FV8A 3B9PA 2GVZC 1AGPA 1BOFA 5FBLB 3SJCA 1QBKC 4AKGA 1YQTA 1D8TA 1ELOA 1UBGA 4EFLA 1OXUA 1ZUIA 4BLPA 4HB4A 4OI4A 5HE8A 1EFRD 4DUGD 5B64A 3K0FA 3K0CC 1ZU5A 3I73A 3NH6A 2GCPA 3AVPA 5BQ5A 1AZSC 3ZZ0A 5IK2D 2XITA 4M9XA 4PFSA 3T61A 4RCYA 2GCOA 4Q00A 1T5LA 3LX8A 1W7AA 2O0HA 4NTZA 4ZV4A 1E2HA 1EGAA 4XTRA 2GJ9A 3W34A 4RD1A 2YKGA 1BMFA 1JEEA 4QBHA 5EUMA 1U9IA 2XTMA 5JJKA 4B2LA 4NE2A 5G40A 1IN8A 3IBGA 4U02A 3NHAA 1T8TA 2XB2A 1EFTA 2J0UA 2D7DA 4O2RA 3KQLA 2VPPA 3WRYC 4H1VA 4Q1CA 4V02A 4PC2A 4KITB 4CEJB 2Z43A 1F5NA 1TPZA 2OG2A 2OLKA 1R2QA 3P4XA 1Q20A 4ZCIA 5J4KA 3V9PA 1ZNYA 1ZW6A 1NVWQ 3QVVA 2P6NA 3WMFA 2GBLC 2JA1A 1VG0B 1WBDA 2QP4A 1QG2A 2IUTA 4G1UC 4JVMA 4DDVA 4QHTA 1CR1A 2IYYA 1P4SA 1YR8A 4X8LA 1ODFA 1KI9A 1CEEA 1P9WA 1DS6A 2X8AA 3N2IA 1XPRA 1HE8B 3EZ2A 4A6PA 2O8BB 1VHTA 4LJ9A 1ZM2A 3C16C 2IUUA 3NG1A 3ADBA 4GDFA 5FUXA 2O0JA 3EZ6A 5EE0A 1HA3A 4BRUA 4OI0A 3QF4A 1AS3A 3U6KA 3K09C 5FOWA 3T15A 1Q1QA 3EX7C 2ANCA 1IXSB 5DNYB 2R6GA 4MGZR 4XVUA 4Z8XA 3DL0A 3A4NA 1L7VC 1X3SA 1E99A 2C99A 2ERYA 4LWZA 2QPOA 1DVRA 1KO4A 3BH7A 4CT4B 1PUIA 2A2ZA 1ZIOA 3TUJC 5FL3A 1MT0A 5B57C 2PJRA 4IRUB 2FEOA 2GEUA 5JI2E 1IXZA 2IYWA 2XB4A 1FQJA 4Q1EA 1QVAA 1XDBA 1CJUC 5GADl 4W5JA 5AUNB 4ZIRB 2GAAA 2QMOA 4WW0A 3UMSA 3L43A 2EFDB 5BW8A 2GTPA 4LBZA 4GT1A 2YINC 5A0FA 2W6IA 3TBKA 3KB1A 5G3ZA 2AK3A 3LA6A 4ARZA 1XCGB 2VP2A 3U2QA 2RB4A 421PA 4FMCF 2QTVB 1JQJC 1AM4D 1NLZA 2BCJQ 2CE7A 5EUQB 4EPWA 4O2LA 1G7TA 1W0JA 4PAMA 3LNCA 4NYJR 1QDEA 2EFGA 2JJ2A 3VQTA 4B47A 1G19A 3U4QA 1V43A 2ZJ8A 4A9AA 3QPVA 1G6OA 5CDFA 2NPFA 1CJVC 2FSFA 2QM8A 2O52A 4LBYA 5DIFA 5FOUA 2XZOA 2F43B 3QKUA 3U7HB 1D9ZA 5GJCA 1GRNA 2WJJA 1H8HD 1JXOA 4MUBA 2WIAA 2GXUA 1HURA 2PH1A 2ZE8A 2CBZA 3WHKA 3OE7D 3X1WA 2D74A 1NJGA 4AG6A 4YMSA 4A0GA 3OEEA 5TV2A 3U44A 4Q7LA 3BORA 2FA9A 4C0KA 2GZDA 1AKEA 3AH8A 4Q9JA 2RGEA 3QVUA 4ZI3A 2ATVA 5LD2B 3I61A 5DI9A 1R6BX 1XD8A 5KU1A 5BN3A 2OXCA 3U5ZB 3MRSA 1RRFA 2H16A 2ZQ5A 1Z6TA 4TTPA 4M53A 3THXB 3MG9A 1GRRA 2H8KA 1YKSA 1VG1A 4DUGA 1EFRA 2BOVA 4BPBA 3MJRA 4HB3A 5JMTA 4AI6A 5IK2A 4YMUA 1HV8A 3DMDA 4HEJA 2JJ1D 3DVLA 3BOSA 4Q47A 2YZ2A 3B1WA 2OUKA 3U61B 1GL6A 2CL7X 4FWIB 4JLNA 1D2NA 3KL4A 1WBBA 4G0NA 1ZRHA 5FPHA 3I32A 4U00A 3K70D 1M34E 1X1SA 1E6CA 1M1YE 3ICQB 4DSTA 4L8GA 1OV4A 4V0ME 4AYTA 3WY9A 3AF4A 3QPWA 5FI0B 1TADA 4P31A 3OIYA 3SN6A 4CEJA 3ADDA 4L9WA 3S1AB 4HYYA 3UPUA 4HAVA 3IEVA 2J7KA 1RKBA 1ANKA 5CJPA 2F3RA 2EVWX 3MWLA 4ZI2A 4AC9A 2GHIA 4WOPA 2PJZA 4ASUA 2RAPA 4CVNA 1N2CE 4UJ3A 3WYGA 3AGQA 5J47A 1P75A 1FNNA 2XJ4A 3RHFA 2GJSA 3P27A 4V0LA 5J4LA 1E79D 3D8BA 1TUIA 3SYLA 3REGA 1OXSC 1PLLA 4C0LA 2O8BA 2V7QD 4Y0AA 1NKTA 4LZZA 3U7FB 4GOXA 4LOAA 3B9QA 4IDQA 1S9HA 3BERA 2KSQA 4Q48A 4UNQA 2XTNA 1P61B 2ZJBA 3GLHB 4CT5A 5FI1B 4KVGA 4D4JA 5HKKD 2BVNA 2EFHB 2JDID 4DCTA 4ZKDA 5AUPB 1E0AA 2P5SA 1I2MA 1JQLB 1SKQA 5AJVB 5AJXA 4LJ5A 1WB9A 3AQ4A 2HLDA 1YZLA 3Q3JB 3EIHA 4R9UC 2BDTA 2FMXA 3CRMA 2ZRFA 4CEHB 1N0UA 1UKEA 3EIQA 2BWJA 5C4MA 1E98A 2QI9C 2ZJOA 4WBSA 4Q1BA 4N3NA 4EPVA 2ORIA 3ZVNA 3QIAA 4E09A 4N0DA 2FOLA 4Q4LA 3FFBA 3FMPB 2D62A 4PZZA 1B23P 3TSOA 2UZIR 4TL6A 4ZIRA 3RSLA 2R6DA 2R44A 2A9KA 3PEUA 2NO6A 2P2LA 2AL7A 2Q0HA 4NU0A 2DFNA 1DG1G 4C0JA 3PUYA 4JJZA 1DBSA 3K70C 3MWYW 4HDOB 4NL4H 3RYTC 4B73A 2BEKA 1R0WA 2A7QA 1T91A 5SZKB 2ZAMA 1KSGA 4QJ3A 3RC8A 4ILEA 1VHLA 1XX6A 3QXSA 4GZMA 1YZTA 3THWB 3B1YA 1FFHA 1IXRC 1GTVA 1X8JA 4P33A 2BBTA 4MRVA 1IN4A 1E2DA 3TRFA 1NBMD 3A1WA 4I99A 4B6EA 1ZNZA 4IVQA 4NCKA 2F43A 4FCTA 2IBMA 3AVUA 4TMWA 3AF1A 4JLKA 3MMPA 5E4FA 4KODA 2G88A 2ZXUA 3VNUA 3MCAA 3TLXA 2IX3A 2YOFA 1H8HA 2PZEA 2JLVA 1LNZA 2WAXA 1P72A 5CB6A 1IONA 2DB3A 2KI5A 2GXSA 1DAFA 3BGWA 5KPDA 3LVQE 3DZDA 1V5WA 1YZQA 4MGYR 4ACAA 3NDPA 4EJSB 1XJ0A 1KY2A 3U3KA 1GL9B 3EAQA 5BXQC 4I1VA 3NBZC 4NCNA 1EG7A 3ZD6A 3WXMA 4HLQB 2R2AA 2C8VA 721PA 2VO1A 2REOA 1NG9A 4QNMA 5KSOA 4C0QC 3THXA 2C95A 2E87A 2IYVA 4G5RA 3VKGA 1II8B 4AY2A 1G3UA 2H5EA 5HTKA 1VYUA 5EP1A 3T06B 4XVRA 5JCZA 3AKYA 2KBEA 3TK1A 1G5TA 1CLUA 4MKGA 4DEXA 3IDQA 1W36B 4JBWA 4IKEA 4BFTA 2A5GA 1GZSA 2VRWA 4QJ4A 2CLSA 3EASA 2JJ1A 4JL6A 1F48A 2VP0A 3LVRE 1TF5A 5GVRA 3PEWA 1MO3A 3EPHA 3IHWA 1RC8A 2VQSA 5KDLA 1RPZA 2WWIA 3PG5A 1XFAA 2VSOA 2OAQ1 5KO2A 4UNRA 1IOZA 4II7A 3WMEA 4GMXA 4QRHA 2XOKD 1P2SA 3R9XA 5J4HA 3S1AA 1U81A 4Q4AB 4PC1A 2FX3A 1ESNA 2HF8A 2J1LA 3BWDD 3RS2A 3W5IA 2YWEA 3FMOB 2CK3D 1GNRA 2JLZA 1OB5A 2CL0X 2FFQA 3LX5A 1R0YA 4EQ6B 4DB2A 3KKMA 2GJAA 3U7EB 2DWQA 3B82A 2GNOA 4QG7A 3GLFB 3C5CA 3VFDA 3H0KA 3VR1A 3UK6A 1VCIA 3WNDA 1ZP6A 1KJWA 2F7SA 3IQXA 1OXXK 1Z0JA 1Z08A 2FE4A 3CPHA 4CGZA 4PQYA 1E79A 4HZUB 2WWXA 2HJGA 4IOLA 2MSCB 2V55B 4LYAA 2RGGA 5BWMA 3P32A 1R7RA 2RGCA 4UXJA 2HT1A 2QSZA 2ZRDA 2ZSBA 4OKSA 3SFZA 4EPYA 4Q1DA 1QHSA 4NMMA 3RSOA 3GJ4A 2D06A 5HR5A 4LV6A 4RZXA 3RANA 3AUYA 3GLHA 2BMFA 4LSGA 4Q9IA 3ND9A 4B32A 2D2EA 1X1RA 4PHFA 1KSHA 1OF1A 3RABA 4BZPA 2B6HA 4Q1FA 1UEJA 4TQ9A 3EPKA 2Q9CA 1UJ2A 3UMRA 2VHQA 2WWGA 4B48A 3QOFA 1Q3HA 3PEVA 4DXAA 4RKFA 5J4VA 4CEHA 1D2MA 1G8PA 3L8ZA 3MWKA 4OQMA 1OFUX 4NZYA 2VF8A 4LX0A 4KSBA 2CCKA 1RJ9B 2ZI3A 2UZ3A 2UKDA 1W49A 2IL1A 3DMNA 1FTSA 1E0SA 1S9DA 1KI1A 3B7GA 4JLDA 4MKFA 2BCGY 4IDOA 1LF0A 4B3XA 3G5UA 4E22A 1DO0A 2NG1A 4RJLA 5CB8A 3EZ9A 1W44A 2OFOA 4GOJA 3FVQA 2OBLA 4CZ2A 1KYIA 3E1SA 3KB2A 1UDWA 5E95A 3Q8XB 3K0FB 2OLJA 1F6BA 3I92A 5F98A 8OHMA 2Q9BA 1JPJA 2GZHA 2Q3MA 4LBWA 4LJ6A 1OPXA 3CNLA 1FX0B 3LFUA 2WSMA 3LH5A 4N0EA 2VLIA 1E9BA 1JJ7A 3UG7A 2QTFA 3THWA 3CH4B 1TMKA 4YDHB 2ZI9A 1G7SA 4Q9HA 1US8B 1NL3A 3CO5A 3EA5A 4RVCA 2IYTA 3LD9A 5E7JA 3KDSE 4M1OA 2FJUA 2QN6A 3BIFA 4OK3A 2NMVA 3QQ5A 5DSZA 2GJKA 4R7ZA 1MO5A 4JL8A 3L82B 4J0QA 1CF4A 4ABYA 1KZ7B 2AN9A 3GJ8A 1QF9A 5IHPA 2AFIE 4QHYA 2IS6A 4PC6A 2PCLA 3W6PA 5JRJA 4BZQA 1ZD9A 4EJSA 2CE2X 3MGCA 1GILA 6Q21A 3A4LA 5DI3B 3RWMB 1WQ1R 5EQTA 3GFPA 4YMVA 4WAUA 4XOIA 2QP3A 3AVWA 1BKDR 3AF0A 2BBOA 3BRWD 4BLSA 2WSSD 4C0AC 2GDJA 2OILA 4IVPA 1VYTA 1II8A 1NSFA 2QT1A 3K53A 3O8CA 4M1MA 2O8FB 1KKLA 2RMKA 5GJVC 4DLRA 2FDCA 2ZANA 1SVOA 2OBMA 4JLVA 5LB4A 3AVXA 1N6OA 5G3YA 4BLRA 2NQ2C 4IOKA 4BGDA 4JKYA 4WXPA 4P0TA 3W8NA 2F9MA 1XJQA 2MMCA 4V0MA 4GL2A 4DSOA 1E2MA 1E2NA 1QZXA 3BFXA 5EP3A 2GF0A 3HPRA 2P65A 2ZROA 4LJAA 1MABB 4URWR 4B74A 5FOXA 2JAQA 2BC9A 2QMEA 3C14C 3PUZA 4Q4AA 4YMWA 1G3MA 4BFZA 1G1MA 3KKQA 1HY3A 4LHXA 3VHXA 3AP2A 1XNJA 3GJ7A 2AD5A 3VNVA 4LGMA 1KI2A 1EFHA 3SZRA 3FMIA 3G82C 2X2EA 2CK3A 2ZSFA 3P26A 3EARA 1F2TB 3PVSA 4Q1AA 2REBA 1MO4A 2Y8EA 4IDHA 1A82A 1ZBDA 2C78A 2RGDA 2ZRMA 3KUDA 3AUXA 3RRZA 3GLFA 4DLWA 2DFLA 1EX7A 2NO7A 1ZNWA 4KFUA 2A78A 1EWRA 1L4UA 4GI7A 4HZUA 1OYWA 5B2ZA 4CIDA 1T6NA 2QE7D 1MRSA 3K9GA 2GAOA 3ZS9A 2ONKA 1XD9A 3CX8A 4KBFA 5FBRB 1G3RA 2QGNA 3VKWA 2ATXA 2BV3A 1PUJA 4B76A 2ZE5A 2Q21A 1N6NA 1K6MA 2C96A 2OE2A 1K5DA 1LB1B 4AG5A 1DAKA 4KVAA 2RGAA 2B92A 5BYJA 3KXKA 3NC0C 1UEIA 1Z63A 3OESA 1G8GA 1E2LA 2IS1A 2H1LA 2EU8A 5FL7D 1UFQA 2DCUA 2QPTA 3KKPA 4TTRA 4PSKA 4AIIA 5K8LA 3C5HA 3MSXA 4ZDJA 1ZYUA 2ZYTX 1CJTC 3UKDA 2YJTD 1RJ9A 1XMIA 1E9RA 3DKPA 1QHNA 4HAXA 2V1UA 3Q7PA 4M1SA 2GESA 5C46F 3GMTA 4FIDA 2F1IA 3BJIC 3W3AA 4FD2A 1HTWA 4P32A 3CBQA 2OFWA 4KYUA 1TL7C 1RW4A 4DCNA 1II9A 1UAAA 5IT5A 2OAP1 4DDTA 2QM7A 2IYLD 5JI3E 3H84A 5FBVB 4BLTA 1P62B 2ZVQX 4DLUA 1MKYA 2JCSA 1ZU4A 2BBSA 1N0WA 3R8CA 1CBUA 3CX7A 1ZCBA 3EXAA 4TT3D 3SQWA 2PZGA 2V3CC 1FX0A 4FMCB 5JWHA 4Q01A 1ZCAA 2RHMA 4G5GA 3IGFA 2G6BA 4OYHA 4CF7A 3R9IA 2ZAOA 5L3RA 1US8A 5EXXA 4C3ZA 3ADCA 4C9BA 3CNOA 3U6BA 1P9NA 3C41J 4UNSA 3ZVMA 2VHCA 2EQBA 3OFND 4V03A 3T5DA 2DBYA 4TSFD 2X2FA 1TQ4A 4YLGA 1F60A 4XIGS 1VECA 2JLWA 2W6JA 2J0QA 2NO9A 1ETUA 2QRNA 4YONB 3TJZA 3GPLA 4LYHA 4KXFB 1GSIA 1FUUA 3MLEA 4D4MA 1KSJA 1FNMA 4OHVA 3LLMA 1OH5A 2ZSAA 1YZNA 1VKJA 2WJYA 4L16A 4WZ6A 1RRPA 4NYIR 3RC3A 5H70A 1JB1A 1LVGA 1Z2CA 2YNMA 5JWRA 5DI3A 5FTNA 3SC3A 2I3BA 3A8TA 4NYMQ 1NVVQ 2YWHA 4PC3A 1R8SA 1R0XA 5AK0A 2E1RA 4F7WA 5AJZA 2F1RA 1VMAA 3CRRA 4WVFA 3I8XA 4Z1MD 1G8FA 1NVUQ 2D3WA 3KKNA 4HDCA 3B1VA 4QM7A 2O8FA 2G0TA 4FCVA 1NY5A 1Q57A 1JR3E 1OH6A 1GM5A 2H92A 1E4YA 1D2EA 3VU9B 3K8YA 2J7PD 3GLHE 2HCJB 1S2MA 2FPMA 1IN7A 5EZ6B 2IYUA 1DARA 2RGBA 4M22A 4RZUA 4A82A 4HAYA 2E9SA 3ASYA 1NSTA 1JECA 1L4YA 2GILA 3CONA 3K0CA 4ZCMA 5P21A 1Z0DA 1CR2A 1SVMA 5CIWA 4BLOA 1IY2A 1MABA 5GJWC 3VR2A 4QM6A 1NN1A 1XMJA 1D5CA 4MRRA 5JRZA 3UIEA 1M6NA 4CW7A 4DIDA 3GJ5A 1WA5A 5B30A 4HB0A 4L5BA 1JAIA 2BKUA 4DLXA 2ZI6A 2C9OA 3GJXC 5J5CA 1F2TA 1S3GA 5BYKA 5IRCD 4EDHA 1KHTA 2W2TA 2Z6VA 5FTLA 5DGXA 4URUR 4XH9B 1NLFA 2OM2A 3CPEA 1JR6A 4URXR 4D0NA 4C2UA 4HZIA 1S4QA 4LK2A 4Y0VA 2VEDA 4W5HA 5F9FA 1GFIA 2J45A 2YOGA 1NVXQ 1VG8A 2RCNA 1E2PA 4K8OA 1FQKA 4DLZA 4F38A 2RGXA 4GBMA 2XSZA 3CRQA 1SXJD 3PFIA 4JSTA 1Z5ZA 3R20A 4WZAE 5D3MB 1Z6AA 2CCJA 2JEOA 4KLNA 3LY5A 1DG3A 1AA9A 1RRGA 1W5SA 1XWIA 2CL6X 1G5RA 2GBLA 2IT1A 1S3SA 2IF0A 1EK0A 2VP9A 1ZUHA 5EP2A 1DEKA 2QZ4A 2WKQA 2ZJYA 3L0OA 3O8BA 5TXGA 5KHOC 5DHAA 1NBME 1XTKA 3AEZA 3L2OB 1KO5A 4OQNA 5L3VA 2JLUA 3AGPA 4B2IA 1RYHA 1L8QA 1E2KA 4PXAA 3LWNA 3H1TA 5CIQA 4E07A 1J99A 2JLYA 2HDNB 1OIVA 5SZJA 2ZREA 3L0PA 3FWYA 5F2EA 1OIWA 3C7KA 4C0HA 4IDNA 3EPJA 3QI2A 1Z29A 3K09A 3QSYA 4YMTA 1NMZA 2H7VA 1TQ2A 4W9MC 4AKIA 1Z6XA 5JBQA 4ESHA 5BN5A 1R4AA 4BWYA 1Z2AA 2VHTA 2FSGA 2OEPA 5HE9A 2FN4A 3NIBA 3E70C 4V0NA 1SULA 3REFA 3IO3A 2REXB 4DHEA 5AUOB 1XTSA 2QA5A 3KKOA 5JEEA 4D0GA 1W0KD 2NIPA 2VA8A 2WMNB 4DSNA 2HT6A 1KI3A 2QSYA 1Z47A 1QHXA 1KKMA 4K46A 5C2JB 1RRCA 3B6EA 4H1UA 4EPTA 2AK2A 3RRMA 1XF9A 4LHZA 2J59A 2GCNA 4S35A 1A7JA 2QNRA 4HLUC 4Q5IA 2MSDB 1W2HA 4Q4HB 3LBHA 5H68A 3THOA 1ZINA 3CH5A 1UKVY 1UKYA 1EWQA 2IC5A 1BYIA 2UVQA 3A58B 5A5GA 3SEAA 3N70A 4H9GA 4LC0A 3K70B 1TF2A 4TSFA 3NC1C 3LQQA 2NZ8A 1Q0UA 2ZUBA 3R7WB 5FPKA 4M9SA 3LBNA 3TIFA 3W6OA 2Q6TA 1E32A 4JT2A 2V8OA 5LBIA 1Z07A 1RZ3A 1JXMA 4DVGA 4MKHA 1YR9A 1TNDA 1S8FA 1UDXA 2PX0A 4B3CA 5EXSA 2QROA 2J3EA 3RS4A 1XEWX 1KNQA 2ZU6A 1COWD 1S1MA 3CW2A 1SXJC 2PT5A 3F5FA 2FPLA 3X1ZA 2ZSDA 4E5UA 3NVAA 5EP4A 1NN5A 1SQ5A 3GLFE 1FPMA 1ONBA 4M1WA 5IDVA 4K81B 1XBTA 1UF9A 2ZR7A 2PEZA 1ZM7A 3AP1A 3AVYA 2DYKA 4YXWD 1LTQA 3RVBA 4PAOA 4TYNA 3W8RA 1JR3D 2ZUCA 4Z8YA 1TU4A 2W58A 3D6TB 5G41A 2GXAA 3EA0A 1GP2A 2V6JA 4Z1MA 4MGKR 4US1R 4UNPA 3NTUA 1E4VA 2P3SA 1BO6A 1NMXA 3VU9A 2Z4SA 1MR3F 3HJNA 1KY3A 4IFEA 4B43A 5IF9A 4NKRA 4BECA 1R10A 1TU3A 3FMFA 3FHTA 2J7PA 4UKDA 1H8ED 1VYVA 4LPSA 2ASEA 5J4YA 4JVLA 5KSYA 2AXPA 2CLDX 1NIPA 4PSAA 1J2JA 2JJ8A 3IILA 1Z8FA 4JJKA 4C30A 2ORVA 4L4UA 1XXHB 4GP6A 5DO9A 3PR1A 2R8RA 3A4MA 1CU1A 1T4GA 3PUWA 4TLCA 521PA 2FWRA 1UBFA 1W48A 4XWAA 1XTIA 1GDDA 1MV5A 2W83A 2CHGA 4QC2A 4A36A 1LS1A 1Z0KA 4GNKA 1ZD1A 1KNXA 4S2EA 2ZUDA 3KXIA 5LDDC 4LDJA 3AV0B 3GJ0A 3OIWA 1ESMA 1ZM4A 3WYAA 1M7HA 4JYBA 4LJ4A 4TLAA 3BK7A 3SBDA 3UWOA 4CYMA 4DDWA 3EZ7A 3QJYA 4L15A 1PZNA 3WRXC 1GOTA 2IHBA 1XZQA 1G8YA 1YRBA 1PLJA 4OK6A 2QL6A 3PUVA 4GFDA 4P3YA 4CRWB 3DOEA 5EE1A 1DADA 1DTSA 1W5TA 1YHNA 2LKCA 4RD4A 4UXIA 3RLFA 4D6PA 3IO5A 5D3MA 4E03A 4Q03A 2DWPA 3CF0A 3T1OA 4A8JC 4MH0R 4EPRA 1C9KA 4MITA 2WWWA 2ZYWX 3A36A 4D81A 4DIEA 2O5VA 3GJ3A 2XEXA 3WNCA 3KQUA 1G7RA 2FZLA 1E2GA 1KAGA 2Q9AA 1QHYA 4I81A 4IW3B 3KFVA 5CLLA 1R0ZA 2YHSA 1DAMA 2IS2A 3KZ1E 3R9WA 2RH5A 5HCIA 4R2IA 3AP3A 4RD0A 2IEZA 1LV7A 4PZLA 1KJYA 3K9LA 4OI2A 4O3MA 4XVQA 3BB1A 3OIUA 3X1DA 1KOFA 3M4YA 4Q7KA 2Z83A 3E5HA 4M8NE 2LCFA 5CITA 1OHHD 1U99A 3OE7A 2FGKA 3F0TA 5FBWB 1KTVA 1II0A 4KFRA 3WMGA 5KPJA 4EUNA 5ELXA 2FPKA 3IBYA 4OL0A 2IW3A 2K5UA 2ODWA 4IJMA 5KSPA 3IIJA 1X8LA 2TMKA 3BBPA 2A5FA 4URZR 1Z0FA 4LI0A 3CZPA 1T3SA 4D4KA 4MRSA 2ODBA 4OQFA 3ASZA 2J87A 2WMOB 2FNAA 2J5XA 2AWOA 3E2IA 4ERNA 2EYQA 2VBCA 3ZJYA 1HUQA 1Y3AA 5DN6D 1KJZA 2LKDA 2VH5R 2W0SA 2QBYB 3ETLA 4RSGA 4Q4HA 1PV4A 4TLEA 2ZI7A 2W0MA 5K8IA 1HH4A 1G9XA 4MGIR 4MRPA 1XD2A 4JT4A 2QRZA 4LJYA 4NCHA 4AK9A 1NP6A 1P2VA 4P4TA 4BASA 3U60B 2XJ9A 1KZGB 4RY2A 1E69A 1T0HB 2P6UA 2QAGC 4CDGA 1EX6A 1UBCA 4PO1A 4P4SB 3MWJA 2AFHE 2PBRA 3L8YA 2HYDA 1NIJA 3R7WA 4G01B 1SHKA 2QORA 1JEDA 1HT2E 4JYCA 2I4IA 4B3GA 4BUJA 1DE0A 3HYRA 1U8YA 3DKVA 4WA7A 1BS1A 3SNHA 1W4CA 3EPLA 4A92A 3VR4A 4C4PA 3U3JA 2N42A 1W4RA 4B34A 1M74A 4KAXA 1K8RA 2HEIA 4Q21A 4G3XA 3CNNA 4DC9A 1SZPA 2PLFA 3EZFA 3QXHA 5FFMA 1E9SA 4YXWA 1SVSA 1FTNA 4Q66C 2V7QA 4FINA 4B3BA 1JR3A 1KAOA 2YWGA 4JBXA 3HU3A 4F4IA 1W4BA 3ADKA 3KQHA 1I4LD 2RGNC 3GLGE 3AVOA 2JIZD 3VAAA 2BM0A 1RVDA 2C04A 2EWWA 2XZLA 3TW4A 4EPXA 4A0FA 3FHCB 1N5KA 4BFWA 5HKKA 3KQNA 2JDIA 3I72A 5FUYA 2XXAB 4YDSA 2WTUA 4PC7A 2OESA 2HCBA 4XWOA 3HWSA 1W46A 3RS0A 5KNDA 3KX2A 1WF3A 4QFMA 2BJVA 1G8HA 1C4OA 1XXHA 2HUPA 3B60A 3C4JA 4B33A 5L8VA 4NBSA 1AS0A 1ZM3A 1AQUA 4LUCA 5KSZA 2ZETA 1FOEB 3RRYA 2IA5A 3TNFA 4D4LA 1CIPA 4L9SA 4PO9A 2OBNA 3ZYCA 4DCSA 3I1FA 5FBQB 2O8EB 1NN0A 1GL7A 4OQLA 1R8QA 1XCPA 1Z0IA 4DEYA 2QGZA 1WDTA 4XSGA 2FF7A 3AVTA 1XU4A 3UWKA 1Z3IX 1G5PA 3FKSD 1F2UB 3C8UA 5EE9A 2G83A 3RS3A 5JS8A 2A5DA 5FTJA 2DWOA 3BFKA 5JSZB 2CLCX 3QNUA 4MA4A 1E1RD 1G4AE 2FSHA 4XWKA 3X1XA 3UMFA 3NBYC 3FHOA 1E2IA 3BFVA 1Q12A 3KJEA 3KTAB 4FMDB 4FMBB 3KJIA 2OFXA 1IM2A 2J9RA 1AZTA 1NBMA 1Z06A 1TQ6A 4RZ3A 4GZLA 5CK4A 1EFCA 2QENA 4BFVA 2F1JA 4IEIA 3NKVA 1Q3TA 4JLMA 4NCJA 2BM1A 2A30A 5UKDA 1YR6A 4LV8B 2XGJA 1GUAA 3IUYA 1AIPA 2F1HA 1B0UA 1E94E 2F9LA 3ZLJA 221PA 2IXGA 3AKCA 1BMFD 4QGGA 4HAUA 4AYXA 1YR7A 1KO7A 1E9DA 2WJHA 3QKRB 1KGDA 4TMTA 1OFHA 1G64A 2WJGA 1TUEA 4TMVA 1N6IA 3CPJB 3MUFA 4DLSA 1T9HA 3QF7A 4QKQA 2GWHA 5CJ2A 2YOHA 4TL9A 5KOYA 3SJAA 5FR1A 3ZVRA 1D9XA 5A4JA 2GVDC 4TQUS 1OIXA 4TLDA 2NPIA 3O47A 1FL9A 1DAEA 1JPNA 1NY6A 2PMKA 4W5WA 4UNNA 2ZRCA 2KWIA 4TYQA 1XEXB 2L0XA 4OJKA 3MJHA 2G1JA 4TWZA 2ECKA 1X6VA 2NGRA 1JBKA 1U0JA 2WIBA 4G5SA 5KDDA 2C03A 2QBYA 2ODEA 4LV5B 4X8MA 5DN6A 4OI1A 1QVRA 4QBFA 2GF9A 5GJBA 1VIAA 1IJEA 1E9CA 2QEQA 4C7OB 2IHYA 4PTLA 1KDOA 1OXTA 3K0SA 1N6RA 3AB3A 3TW8B 2GZAA 1P5ZB 1S96A 4P4SA 4ON9A 3VR6A 4MYUA 3ZQJA 3QG5A 3K9NA 2DR3A 4BFSA 5AR1A 1A5TA 4NH0A 4KFTA 2J0SA 2XOKA 5EE3A 3FB4A 3PENA 3GFOA 5JEDA 4IXNA 2D2FA 1XEFA 5JHGB 4JLPA 1OKKD 2ZRAA 2MMGA 2WAYA 2ZRLA 1XRJA 2WZQA 1DAGA 1CXZA 4JS0A 4QNRA 1ZD8A 1T8UA 3NHBA 2OSBA 3FDIA 3T34A 2B7BA 2C2HA 2ZYUX 3SJZA 5M04A 2HXSA 1OXVA 3WBKA 4A0HA 5HZHA 1DO2A 1E2FA 4BFYA 2OO7A 4N1AA 2DPXA 1OFIA 3SFVA 2QT0A 4Q4JB 3OIVA 4EKDA 3NDBB 1XMSA 2FZ4A 1M8PA 4LCBA 3A37A 3CR7A 1DAIA 4A2PA 4W7SA 5KDOA 1SXJE 3GLGB 4HSEA 4BFXA 3A1UA 1CTQA 2BMJA 1U9IC 3TVTA 2RHDA 1I4DD 4OHYA 2ZJAA 1R5OA 1RFLA 4QL3A 3UXMA 1ZNXA 4PHTA 3W9YA 2XXAA 1CULC 2B21A 5JCPA 2VP6A 5DLQC 2ZM5A 1OYYA 2C9YA 1W0JD 3FYHA 2JJ2D 1ZVQA 2OCYC 4R98A 3U3RA 1ZC4A 5DE3A 3B13B 2W2XA 3A6PC 1TEXA 3CWZA 1Y63A 2D4HA 4NONA 1NNEA 1XPUA 4QHSA 1TEVA 2IK8A 1NF3A 3QENA 1FW6A 3BE4A 4PR0A 1SVKA 3N5CA 2O8EA 4QGHA 1M7GA 2JLXA 2EYUA 4AWXA 1N5IA 3DEFA 4DLVA 1I4TD 3RDPA 3TKLA 3CR8A 1T3LA 3K1JA 1NKSA 2QMHA 4ESVA 1SHZA 4EFNA 2NTYC 2EFEB 3MAAC 1F2UA 5GVSA 4UQOA 1IAQA 1GWNA 2YC4C 3OEED 3NH9A 3OF5A 2QPAA 5B58C 3SU8A 2NO1A 2WWHA 3GLIB 5FUVA 2ODNA 3ONWA 5JSZA 3AVVA 1E2QA 5C4GB 1WRBA 1OH8A 1DOAA 2ZIAA 3FKQA 3IQWA 1EFUA 3QY0A 1E1RA 2PLRA 3KTAA 3AF3A 1SKYE 3BD9A 4C0BA 4ZO4A 4M0LA 1LY1A 2V1XA 3RS5A 3CRVA 3SR0A 4MYHA 2QY9A 2QMUA 4BRWA 2BJWA 2WWYA 3CLVA 3PQCA 1NI3A 3WNBA 3O8RA 1YZKA 4JBYA 2I1VB 4LYJA 4B35A 3ZS8A 1E96A 3HU1A 3A1SA 5FPTA 1KK2A 1U94A 4D0LB 1MH1A 2CJWB 1P3JA 4DSUA 3P1JA 4IHQA 1XTQA 4FW9A 3QKRA 3PIRA 4TQAA 3ZQ6A 2HV8A 1U8AA 1G17A 3FPAA 3FGNA 1E2EA 4HB2A 4MYTA 3X1YA 4DCVA 1Q1ZA 4G5QA 1W2GA 3GD7A 1HYQA 2DHRA 2GEDA 1G21E 1CR4A 1U90A 1WXQA 2WSSA 2ZS9A 3OEHD 3RWOA 3SS8A 3N2EA 4ASUD 4M4SA 1XEXA 1G18A 1GNPA 5EXPA 5JJLA 3TR0A 4NYJQ 2IF2A 1JAHA 1N6HA 1CJMA 1TX4B 4C2TA 4BZXA 3LDAA 2QTHA 2QAJA 4PPNA 5CM9C 1J70A 2YWFA 2ZI5A 2WHXA 4YC7A 4LY6A 2IYQA 3AF2A 1WCV1 4F91B 4XTCS 2WPDD 1ZJ6A 4B44A 4HATA 1JI0A 4C7OA 2ZRGA 4O0MA 4U5XA 4OHXA 4URVR 1HEIA 2YYZA 5JECA 5FOVA 3QKTA 4BQSA 1OT3A 4LYFA 4PPGA 2BHRA 3Q72A 3QBTA 1XXHE 1OLOA 3IKJA 5C18A 3QUSA 1ZC3A 3TAUA 4TMKA 4ZDWA 3B78A 1BYUA 3ZDQA 4AKEA 1EXMA 2ORWA 4WXRA 5AJYA 1KDRA 1AKYA 2HLDD 2OCBA 1FMLA 1Q44A 2RKOA 3OAAD 3QXJA 5JHHB 4LJ7A 2GJ8A 1OKKA 1KDPA 3B8HA 1ZMXA 3O8DA 3P20A 1FP6A 1P2UA 2BKEA 4LHWA 4LPKA 3BAFA 4QBIA 3QG1A 2B8TA 4HLDA 4IDPA 3DM9B 5CM8B 4DB4A 4Q4JA 4GOKA 3HDTA 4X8OA 4PAQA 4D2IA 2N46A 1AS2A 4TL8A 3JZAA 1ZAKA 4PZYA 3LV8A 5FTKA 3RS7A 4B3FX 4AKHA 2ERXA 2QE7A 1SGWA 1HQCA 2OT3B 3L0SA 4ZDKA 1SVIA 3M0EA 1SXJB 3GLGA 3PJRA 3H86A 3I5YA 4TL7A 4NYMR 1NVVR 3EIEA 1Z22A 4A2QA 4QJ5A 3WBJA 3CRW1 4JVNA 4PO8A 4GSYA 4I1SA 5H8WA 2ZITA 2A5YB 2Q3HA 1W4AA 3DZ8A 4GMDA 4XD7D 5FL7A 4HUTA 2AHOA 3GCGA 4I1UA 3LO5A 3T1VA 3BC1A 621PA 4CEIB 3W3ZB 2HJVA 1FMJA 3SDZA 3A1TA 1G6HA 2WBLC 4KU4A 3H4MA 5JZVA 3EC1A 1QG4A 2ZJZA 1IJFA 2H18A 3U3OA 2WJIA 1P60A 1HQYE 3RRNA 4LJ8A 2J41A 3WP0A 1CR0A 1DELA 2ZS8A 5EXTA 3TAHA 5F9HA 2XZPA 3RAPR 1C1YA 1XB2A 2ZRBA 2ZS7A 4DKXA 3TMKA 1KI8A 2BMDA 3GQBA 2R6AA 5EZ5A 5KNBA 2F3TA 4A2WA 2W00A 3U7GA 3TSWA 4TT3A 3GLIA 2VL7A 3PITA 3PV0A 5SZIA 4HAZA 4US0R 2VF7A 1X8KA 2FFAA 1TAGA 4A6XA 3W90A 3Q85A 1LFDB 2BIFA 2O8DB 4LC1A 1T3HA 1SVWA 1GRQA 1OE0A 1VCNA 1WE2A 2VSFA 2JASA 1G291 1NMYA 5KYKA 1XD2B 5K8TA 3DOFA 1SKYB 1QHGA 1FZQA 1P7CA 4OHWA 1G41A 1U8ZA 4B6FA 2QG6A 3OFNA 1M2OB 1JNYA 1O3YA 3QXXA 4LRWA 5JS7A 1KMQA 2CDNA 4TYPA 4QGAA 2FSIA 1A1VA 3BXZA 2ZRIA 3ZZUA 5SZHB 2AX4A 5FR2A 4EAQA 5F3WB 1KK3A 2PT7A 4AURA 4MDFA 3IHLA 3NXSA 4M1KA 4HUQB 1WMSA 2GK7A 1XMVA 2C77A 4A8JB 4DWJA 2CJWA 5L3SB 3JVUA 3L0IB 1J7KA 3NEJA 4OJQA 1AK2A 3CWQA 3B5JA 3T12A 3DO6A 1GKUB 1N6KA 3TUIC 4Q9LA 2NZJA 3G0HA 2QU8A 1IN5A 2WWFA 2FU5C 3LLUA 3VX4A 4I1OA 4URYR 4WZBE 3ICEA 4QXAA 3GEEA 1SVLA 1E1QD 3QE0A 4O25A 3TH5A 821PA 1K5GA 2XNSA 2KB0A 2NOAA 3PUXA 2CEAA 2P67A 3OEHA 1AQYA 1FP7A 2X1VA 4OQXA 2IYXA 1N6PA 4Q18A 3HPQA 2WM9B 4PX9A 2I1QA 4JLOA 1P73A 3TSZA 2V6IA 2DFTA 2J0VA 2FG5A 2IYRA 2ZRHA 3EWSA 3FFAA 1MOZA 2KBFA 1N0VC 4M21A 4A15A 2B7CA 2IXFA 1E0KA 2JATA 2WPDA 4OBEA 5HCNA 3IIMA 5D3QA 2DFKB 4Z54A 1Q1BA 3I8SA 4KI0A 3U3MA 3EG5A 1P2TA 1UPTA 4PANA 2CXXA 3W6NA 3QPUA 4DCUA 1GKYA 3SOPA 3VTKA 1XZPA 1YRAA 1S0UA 4RZ2A 5LD2C 3K0AB 4HLUA 5DHFA 3T1TA 2F55A 4Q9KA 4RFSB 1J8MF 2AXNA 3GEHA 3TQFA 3DDCA 3DM5A 3LQRA 4Q7MB 3WP1B 3W5JA 3OAAA 2QAGB 3HYTA 3CZQA 3F3YA 2OZEA 4FCWA 1VCOA 4IVRA 3TGPA 1R5NA 2FEMA 4AD8A 2GXQA 1U2RA 4KCGA 1J90A 1YVDA 3KJGA 2Z5FA 5H1YA 1KIMA 1CKEA 4GRAA 4IOJA 4NPHA 1T5IA 1EESA 4XSHA 1YZUA 4FI3C 2IS4A 1QHIA 4A4DA 1XP8A 3CKLA 4WIAA 4JLJA 4HAWA 4A0RA 1SXJA 4MUAA 3AVQA 4B71A 4LHVA 1GVNB 1KI7A 1XTJA 3TE6A 4BE7B 2ONJA 3ECCA 2QUZA 1GKIA 1HT1E 2IUSA 4DLYA 3P4YA 4UJ5A 4DRZA 3A1VA 4PQFA 5DISB 3B1ZA 3DHWC 5TDHA 1WP9A 1RYFA 1JALA 3Q5DA 2PMDA 2W2VA 4CEIA 2GA8A 4M9QA 4XD7A 3SQXA 3AKEA 2GK6A 2PL3A 5DH9A 2GEVA 4ZPXA 3M1IA 2R65A 2H57A 1VIYA 2CVFA 2R9VA 5L3QB 1XJCA 4RD6A 1HE1C 3T35A 2WV9A 5TY0A 2FFHA 1PJRA 4HDQB 3WYFA 1YE8A 1LS6A 5KTYA 4X8HA 4TN1A 2G9NA 1CJKC 1JJVA 2VHJA 1J8YF 4F4CA 1XPOA 4B3DA 3GEIA 3EWAA 3IIKA 4ZCLA 3PEYA 1UM8A 1KK0A 2OHFA 3JVVA 1Z83A 5KNCA 2OV2A 3FE2A 3D7MA 1KDTA 4FN5A 1E9EA 1W0KA 3UATA 4JSYA 3B1XA 4D25A 4LBVA 2O8DA 1ZUNB 4RKEA 2CHVA 2IEYA 2R6CA 1TTTA 1DAHA 3BH6A 1KI6B 4RFVA 1A2KC 2GETA 3D31A 2XNDD 2R6FA 3MFYA 1UADA 4TMXA 4MQBA 2R62A 4TZ0A 2VP5A 4IEEA 1W36D 3I62A 3QBVA 3BS4A 3KJHA 3QKSB 4I4LA 3WHLA 1A2BA 4DT1B 4DZZA 3BB3A 3X2SA 1AN0A 2A5JA 2J46A 4KV9A 4R2HA 2JLQA 3J81k 2VP4A 3GJ6A 2OCAA 2C9CA 4HUQA 5JWOA 4A8JA 5LB2A 3V4FA 1XTRA 4F4JA 5L3SA 1IBRA 2QQ0A 1N6LA 2IYZA 2PX3A 4MRNA 4BLQA 4JMPA 1RE0A 4DBLC 2NO0A 1COWA 2ZU0C 3SI7A 5FUWA 3Q5EA 1F3OA 1CP2A 2FFBA 1NJFA 4BEBA 2C98A 4JIMA 5E7MA 1CRQA 1LW7A 1OH7A 2ZI4A 4TYWA 1IHUA 1IN6A 2AD1A 4RD3A 1GAJA 3BB4A 3ZIAD 2ZR0A 1E1QA 1D6JA 2AKAB 4XJXA 2V4ZA 2IWRA 5LPNA 4D26A 1DPFA 1H65A 2FH5B 1AJEA 4OK5A 2WJVA 5FTMA 2IYSA 1VCMA 1KSFX 2CNWD 1TF7A 3CF2A 4PSVA 3SJBA 5AWFC 2Z0MA 4DLTA 4JLBA 2EW1A 4BFUA 1KK1A 1QHHB 3GFTA 3TUZC 1A4RA 1LF5A 1UBEA 1ZM9A 2ZYVX 3IPYA 1N25A 2ANBA 1H8EA 1FUKA 4G5OA 1Z6YA 2P6RA 3THYB 2VHUA 2ZEJA 1E9FA 5FH9A 4PQRA 3JZMA 1Z28A 1GNQA 3VHLB 1W1WA 2G1KA 2Q3FA 5JLJA 2G0NA 3KUCA 3VR5A 2QQEA 4EJSC 4TYYA 2YC2C 1TQDA 5G53C 5CDFE 2O8CB 3K0AA 4JKIA 1W47A 1KI4A 2P0EA 3K0EA 2VTKA 1NRJB 3T5GA 3VX3A 2Z4RA 4RFSA 4P4UA 3B2EA 3QEJA 2KE5A 2X77A 4POAA 3LXXA 2AKYA 2QAGA 4M1YA 3CIOA 4QOSA 3LXRA 5HZKA 1G4UR 1N3BA 5FOSA 4QBGB 1PLKA 1KMHB 2O0KA 1W36C 4F92B 5E7IA 3GLIE 5DYIA 3LRPA 5J40A 3ND8A 2ZTSA 2BBWA 1CS4C 1BH2A 1GITA 2VSXA 1P6XA 1VPLA 1G3QA 2ZRKA 3SYKA 5EJEA 1IY1A 4M9ZA 2WKRA 2VIIA 4BEJA 3IPXA 4R71A 1GG2A 5K8UA 3Q9LA 1CRPA 1VDZA 1IQPA 2LWIA 2ZRNA 4GP7A 2WKPA 3H2YA 4PHGA 2B8WA 1I2DA 1OW3B 3VMFA 5BN4A 2GCOB 3EW9A 5FPYA 5CYPA 1N5LA 3AKDA 3ZZTA 5ANRB 3CUEF 2HF9A 1E3MA 3RNLA 1KO8A 3ZGXA 1Q1EA 2AWNA 2AR7A 2WICA 3HR8A 1BIFA 4FWTA 2RGNA 4JVSB 3LBIA 3KQKA 3SYNA 2W6JD 2G77B 3SBEA 1Q22A 5L3QA 5E3HA 4ZDIA 4KFSA 3I3SR 1OHHA 4U7DA 3PXGA 3VR3A 1OJLA 2PEYA 2ZE6A 2J0UB 2JLRA 1MRNA 1U98A 2KJQA 3FOZA 4MKIA 1NG1A 4KLZA 2D7CA 4ZKEA 3AM1A 4GPTA 5TMPA 3FTQA 3MD0A 4UXHA 2H17A 1U0HC 4LHYA 5FOTA 1OB2A 3PCRB 2ZSEA 2YV5A 3V4RA 2ZJ5A 2V54A 1N5JA 1XEWY 1NN3A 4PHHA 2ZJ2A 4NDZA 4JZKA 4D82A 2ZVPX 1PVOA 1G20E 1UKZA 3OHMA 1KI6A 3VKHA 2DY1A 2A3RA 1M7BA 1P9RA 3NBXX 3B85A 3TVDA 2SHKA 1R5BA 5EE5B 4KSCA 4ITRC 4KO8A 2N1BA 3QXCA 4KJZA 4V0KA 5TB5A 1XCMA 4F93B 5JJIA 1VTKA 2XNDA 4ACBA 4PPQA 1OSNA 1YJ5A 3BH0A 3M6AA 1Z0AA 1RIFA 2PCJA 3HP1A 3NEYA 3QKSA 4KYIB 3Q7QA 4DT1A 2ZR9A 2GRJA 3QF4B 4V0OA 4KHZA 1S1CA 3I4LA 4IXMA 3C15C 2VYFA 5AUQA 2V9PA 3ZH9B 1OFTA 3KXLA 2P5TB 4EFMA 1U0LA 1E0JA 2QP9X 2PZFA 3NBFA 4IFBA 2ZE7A 2JGNA 2WOJA 3SE0A 3HU2A 3GP8A 2CHQA 1VG9B 1QRAA 2WVJA 5CLQA 2WOOA 3TR5A 2OCPA 3UANA 4Z51A 3LW8A 1YZGA 2MSEB 4MYCA 1IY0A 2XTZA 3SHWA 2EWVA 5C1BA 2CVHA 5DYGA 3CM0A 3CX6A 4AYWA 4US2R 4MDEA 5FPSA 3ZVLA 2BEJA 2BMEA 1G7CA 4TZ6A 4TLBA 3ZIAA 5TVKA 2W6ID 3HR7A 2CCGA 1L2TA 5KUTA 4NP6A 2JLSA 2CMKA 2ZPTX 4Q7JB 4DDUA 3I5XA 3D3QA 4A1FA 4EQ6A 3NWJA 4C0SA 121PA 4ARZB 2CNWA 1YU9A 1KO1A 2X19A 3QEOA 1NLYA 4Q19A 5HPYB 2XAUA 3TQCA 1QHHA 1X86B 3LW7A 2JIZA 4EIWA 1AGRA 3T1QA 3LAWA 4YQFA 4FXPA 4JL5A 4TTQA 3THYA 1GIAA 1E2JA 1Z6GA 2XSZD 3EC2A 4OHZA 4NCIA 3CB4A 2GKSA 1MO6A 4HLCA 4M2LA 4Q02A 4B2PA 5CK5A 3U4QB 2C5LA
chains in the Genus database with same CATH superfamily
3F8TA 1V9LA 2NUAB 4TVOA 1I13A 3D8SA 5CR9A 3IDZA 1RWBA 4AZ0B 2XX3A 1MQ9A 1JZTA 2NXWA 4JLAA 1J0XO 3DVQX 5FYQA 1E9AA 4IOMA 2Q6VA 4Z3DA 3V00A 4H35A 4EKEA 4LQ4A 5LZ4A 1RMYA 2G67A 5CB4B 2GK3A 2UAGA 4AJJA 4LOLA 6AT1A 2I4RA 3CF6R 3NKLA 4J91A 3K9HA 2WI8A 1DMRA 3IQHX 3B70A 2ZRPA 5DBGA 3CC8A 3KSDO 1HX7A 1T6ZA 2F6RA 3HVJA 4PE5B 4D80A 4TKZA 3ZXXA 4MCAA 1DBRA 3FKSA 4FOLA 4YK7A 1OWMA 2XY4A 3H7AA 2FGJA 4FGJA 2OG1A 4E21A 4J0CA 1ZH0A 3E3MA 4MPJA 4QXMA 3UK2A 4MYSA 3OKFA 2A33A 3SHFA 2YVUA 3AUUA 2FV8A 2TRSB 1EK1A 3DGFC 2CV1A 2P9BA 1BOFA 5FBLB 3LUDA 3SJCA 2A58A 2YH2A 3M1LA 1KBOA 1FMTA 2BJHA 3FRIA 3EVEA 3GMSA 1UBGA 1NVTA 2VXCA 4IX1A 4QU0A 3L8CA 5H59A 1OXUA 4EFLA 4B3TB 2EEPA 4C43A 2V6FA 2W2NA 5B64A 3K0FA 4IUBS 3K0CC 1TKCA 2WM3A 5A05A 1MC5A 3OOEA 1DWPA 3BHIA 4XRGA 1TAUA 1R0CA 3KJZA 3ZZ0A 1P1RA 1PT6A 2XITA 3AESA 2QRHA 1ISSA 2ZJ1A 4EVSA 5JSQA 4Y67A 5HNKA 3OX2A 3DF9A 2IOFK 3ZUGA 1SD1A 1NJ1A 3LX8A 3ONVA 1B41A 2HWKA 3EFEA 2D13A 3JZFA 3NS7A 4HTAA 4WINA 4ZV4A 3P9NA 5K0CA 2BSQA 1K0FA 4G0WA 3KQOA 3B9BA 2QJOA 2NSJA 2OZLB 3L77A 1GGHA 4V3BA 4R40A 2YKGA 1O9GA 4ZALA 4CLRA 5EUMA 2ZKIA 4YYEA 1NXPA 1TUGA 5E4JA 5G40A 4KGZA 4QUEA 4IWXA 5JJ5A 4IY1A 5IAOA 1N2OA 2XB2A 1EFTA 2J0UA 3RTAA 1W2WB 3EVZA 3K7EA 3BJEA 3KQLA 1EDOA 3SPXA 3B51X 2PU7A 4Q1CA 4KITB 4CEJB 1PR3A 1TPZA 2X8WA 3KP1A 1A27A 3AONB 4YQEA 3FPEA 4ZCIA 5K6AA 3LGXA 4MWEA 2JVKA 2OWEA 4R05A 5DBFA 4EF4A 1ZW6A 3PC3A 1I0ZA 3GGJA 3UAOA 1TZBA 3PKZA 4MCJA 4YUXA 1G20B 4KQKA 4WQMA 2W8ZA 3BD7A 4BN5A 1JDUA 1EB9A 4ISCA 3IA2A 4G1UC 4DDVA 4QHTA 2O50A 1P4SA 1ACLA 4NSNA 2DERA 1CEEA 1FFBA 2Q28A 3KQYA 3ONNA 4XOUA 5HJEA 2NZWA 1HE8B 3GHYA 4ZFNA 4A6PA 1VHTA 2HJHA 4NC9A 3ADBA 1OBCA 3NLLA 2O0JA 3AG5A 1HORA 2J9YB 3PGJA 2VT3A 3JRNA 4ID3A 1AH2A 3QF4A 3IP9A 2WA2A 1C3XA 1Q1QA 2YHIA 3G68A 1IXSB 1YHYA 2R6GA 1MB9A 1MEOA 1SUBA 5D86A 3DL0A 1JSLA 3OC0A 1S2IA 4H1WA 1F0NA 1X3SA 1E99A 1U3UA 3QMPA 4WASA 2ERYA 4MDHA 3QX3A 1JXQA 1NV9A 2ES4A 3SIPA 1UBLS 1P1FA 1PUIA 1TJ3A 5THKA 3T7AA 3ZDFA 2GD0A 4CLDA 2PD3A 4XIIA 5AVUA 1L3CA 1Z5GA 3GB9A 1T0IA 3Q2OA 4F9GA 1V1RB 1WJGA 5CH8A 2I3ZA 1U8CB 3KALA 2HN9A 3WX0A 3ZCUA 4FFVA 5B57C 4TS1A 3AHFA 1YRHA 3I34X 4X1IA 2VT6A 3HCDA 3GOHA 1Z4OA 3JZIA 1BMTA 3SGLA 1ULSA 2IYWA 1S3IA 1FQJA 4Y1GA 2H1OA 1OC2A 2BR3A 4Q3LA 4YLYA 4OG2A 3WLRA 4EUSA 2M98A 5GADl 3FBWA 1MC1A 5AUNB 2OGUA 3ESYA 4ZIRB 2QMOA 2R5FA 3NFYA 3R09A 4WW0A 4RK4A 3UMSA 5JQGA 3K9QO 1P31A 2H1IA 1NW4A 2Q8PA 1XZJA 4YRKA 2F59A 3LI2A 1IM5A 1T24A 5JUWA 5LZ5A 1MB2A 3LTEA 4ARZA 3EUAA 3NIDB 1ULZA 3PHGA 3U81A 2VTBB 2RB4A 1B42A 3GN2A 3QOXA 4RIEA 2BKXA 4FFDA 2XCUA 3PNBA 2OWDA 1ECFA 4EYOA 1V37A 3D0QA 1BS2A 5DNDA 1JG3A 1GSOA 2CDCA 3IAM6 4AS2A 1BE8A 1Y5LA 3BHMA 3VYVA 3S6JA 2CE7A 2BCJQ 3MQFA 1A9TA 5FJIA 1QDEA 2EFGA 2JJ2A 2PGLA 2Z04A 4B47A 1XLVA 4B83A 4NXMB 1GCAA 1V43A 4EVQA 1FXWA 3H9EO 1AMOA 2HRQA 3PU6A 3QPVA 5HFJA 3DAGA 1W8IA 2G8LA 1UIMA 3A1DA 4MA0A 5CDFA 3PSHA 4ZT2A 1X7GA 5CUQA 2O52A 2VNHA 4PFQA 1U3VA 1UPAA 5AI8A 3E7DA 1YQWA 3FBTA 5DIFA 1GD1O 1FVFA 1VLMA 3N0WA 4RM2A 5DV9A 5GJCA 1Q7BA 5KZMB 5FWYB 2YTZA 1JV2B 2ACEA 3T7RA 1U2GC 1Y48E 3HFGA 5DTEA 3UT5A 2NP6A 4ZO9A 1F8YA 3GCXA 1JIQA 3E9NA 1H0KA 3NVKI 3JD0A 1P7PA 3V1MA 1GTG1 1HURA 5DGDA 5K3BA 3RGWS 2FSSA 3T4UA 1N7JA 3LWBA 1MC4A 3OP4A 4B45A 3WHKA 4PCVA 4AG6A 4ZAGA 1NJGA 3KR0A 1UMDA 4YMSA 2FG7C 1CCWA 3LQYA 1PT5A 1RT9A 2HWUA 3D4NA 3LPMA 4Q7LA 2ZK7A 3BORA 3NW9A 3NHWA 1WXDA 1JU9A 3DAFA 3HM2A 3ONEA 1Y1KE 1ZOOA 4UU0A 4BNIA 3S2GA 2X3FA 2XWJI 1W96A 4FB5A 4Z7JA 5ETJA 4O29A 1I1HA 4ZICA 1E7MA 1W5BA 4NECA 3RYHA 5T6MA 3MRSA 1U7OA 1WW3A 4D98A 2PUBA 4R2KA 4TTPA 3E22A 3THXB 5JS1A 2XUDA 4IIHA 4OXYA 1OBOA 5GOZA 5AD1A 3IBSA 4TWBA 2BOVA 2BTQA 2JAHA 3SXPA 3RF6A 1X7YA 3ILVA 4R1LA 5F5XA 5IX8A 2QL5A 4YMUA 3K32A 3ZV3A 2XHEA 4U0JA 1S8AA 3DVLA 3BOSA 4YRBA 4XIFA 4FGKA 3TEJA 2P3LA 3GLFB 1TA9A 2OUKA 4XM1A 3ZU4A 3WWZA 3KL4A 1E0DA 3HZRA 1UWVA 1M6VA 3FZQA 5CNMA 3K70D 1M34E 4CE6A 1QQ6A 3VZRA 1M1YE 1VE5A 1I33A 1YRWA 1QG0A 3JWPA 4GMHA 3E7WA 2FEAA 4IHAA 3K9BA 2BZ0A 3WY9A 1Y33E 3AF4A 5EMJA 1FDVA 2CLKB 4BHTA 4UFPA 4EAAA 1ODJA 4L4RA 2X9GA 1ZMOA 5FI0B 4PVCA 1H4TA 1RWQA 2APJA 2RCYA 4H7FA 4E5KA 5SYMA 1LDNA 2YZMA 3W5SA 3A3NA 3S1AB 5F21A 5J3JA 1T8PA 3UAWA 1DCFA 3HFRA 4CI9A 4PU0A 1NHWA 2LR0A 4HNSA 2CN1A 4HAVA 4LI3X 5T7BA 1HNXB 3IEVA 5EGNA 5CJPA 4JP3A 5CA0F 1OLSB 2EVWX 3AR8A 1H1DA 3E81A 4FX5A 5K3DA 2ZW9A 1WD7A 1FRNA 4MV5A 3FFXA 4A27A 1UT5A 1NNLA 3BXXA 1FNNA 1CJBA 1U6KA 4KQ1A 5AFSA 1VMEA 2GJSA 3P27A 4ZARA 2YYYA 1TUIA 3UMVA 2O8BA 1XHFA 3EXG1 4B9AA 4P4NA 5DTIA 4OXXA 2DF8A 3FXAA 1KYVA 2DH5A 2WU3A 4NFLA 4OGLA 1HNNA 1XI2A 5FB3A 1QR2A 4KIWA 1Z34A 3RT1A 2ZTLA 1VA4A 1PQYA 4Q48A 5AP9A 2LP4Y 3V8VA 1K08A 2XTNA 1T1JA 1D2AA 1GAQA 2J5RA 1GFWA 1YR1A 5FI1B 1AQ6A 5HKKD 2JDID 2I99A 2BF7A 3DZBA 1C8KA 1YAHA 3MAJA 4MV7A 5I7UA 1B93A 1KMIY 1MC8A 5MGNA 1LRKA 5AJXA 5JIBA 4JXZA 4RK5A 1IMJA 2HOQA 4JK3A 2JAUA 2F64A 1WB9A 3AQ4A 3IBTA 2VPTA 1Y6FA 1BXGA 3OI7A 3Q3JB 2BDTA 4JBHA 3DOJA 3HL4A 2EBWA 3RBXA 1V16A 2ZJOA 4DGSA 3BTUA 3N8GA 4FGUA 4FJ0A 4AUMA 2LZ0A 3ZVNA 4TXHA 4UTXA 4E09A 1E2UA 2EKBA 2QQGA 3UC9A 2O2IA 4ZHQF 3LCRA 2ZFUA 4IP0A 5JG7A 4XDGA 5CIYA 1UP4A 3V4LA 3RSLA 1JKMA 3HI4A 4BO6A 1G6KA 2F8TA 1C7QA 2H7CA 3H2BA 2VJQA 2P2LA 2AL7A 3WO1A 2Q0HA 4EARA 5KYYA 2UU9B 3JXEA 4RDIA 1CJSA 2GH1A 2AA3A 4UZEA 4MP8A 3COPA 5DTJA 1NLUA 1AKNA 2ONZA 1RJDA 2DETA 2Q3EA 2VK4A 4Y3UA 2HIAA 2Z08A 3PUYA 3HKCB 3T5MA 2P7IA 5BW4A 5C51B 2BFCA 3RYTC 2BEVA 3KHTA 1RCFA 3I1JA 4QYIA 3TLAA 3L49A 2NV6A 3U37A 3AIOA 4Y18A 1JDTA 2ZAMA 1KSGA 5FUQA 3RC8A 1LSUA 3JATB 1Q2XA 4B3RB 1E62A 1VHLA 3QXSA 4CQMA 4WXYB 4DXHA 2VXYA 3B1YA 4TROA 5D85A 2FN9A 4R5HA 2BMAA 1S2OA 5AK3A 4KDCA 1X8JA 3M89A 4P33A 1MX1A 3TPCA 3BCRA 1P9LA 3U7QA 4CM5A 4JENA 2UV8A 2I76A 1ZNZA 3CLSD 3C3XA 3Q12A 1A5SB 4NCKA 3I9OA 2HEGA 4CM3A 3ADPA 4Q1VA 5LQJA 3MGGA 3AVUA 1JAXA 3MMPA 1J09A 3CUWA 2CV2A 3MXTA 3NALA 5JMOA 5KWSA 2ZXUA 4N5HX 2VH1A 3FPFA 3HLKA 2WP0A 2IX3A 5D1HA 4L1KA 1VCHA 3RHTA 1V96A 2BHLA 3N07A 1YR3A 4L5AA 2XUAA 4Y9RA 2JGEA 4PV7A 1OUMA 2GXSA 3ZLUA 4F9TA 1P2FA 4XFDA 3NETA 1NI5A 4MGYR 3NDPA 4EJSB 3R23A 4B7CA 5J63A 1NR1A 1NW3A 2F3QA 1GL9B 3PK0A 4MS4B 4ZAZA 5IKPA 1ZOPA 4A3SA 4LISA 4ZQFA 4GLFA 3IUPA 2CEKA 4HDRB 4NCNA 5EY5B 5KHAA 3ELWA 1BE0A 5B1DA 2NQTA 2VJOA 4QNMA 4C0QC 1FLDA 4L50A 4JUBA 2DLCX 2JHFA 2Z5GA 2B2XA 2IYVA 5E8RA 1ZA1A 1II8B 4J3NA 1RI4A 1VYUA 5E8JA 3HDHA 1Q50A 2ILTA 3SX2A 5JCZA 2KBEA 2M1ZA 3TK1A 4DEXA 3TIGA 2XBMA 3D3KA 2O2GA 3DXZA 3IDQA 1KU0A 1U7WA 4J0EA 4ND8A 3T3OA 3V4VB 2HRBA 4BFTA 3R40A 5IASA 1GZSA 3MRVA 3UGKA 4XLLA 2VRWA 3G0GA 2E37A 2CLSA 3JALB 3LQFA 4UOEA 3JD2A 3AV3A 1IYZA 4IZ6A 1HKUA 4NDNE 4MV3A 3PEWA 3EPHA 4O2BF 1M34B 3IHWA 2HQBA 3DBLA 4X6UA 3WB9A 1M1YB 1TIKA 2H1SA 3GIDA 1SIOA 1I14A 4GBJA 1RPZA 4D9HA 4OX9B 1XFAA 2VSOA 2XADA 5JAUA 5LXTA 3B6IA 1IOZA 2C9BA 2D8AA 2AV6A 2R47A 3GLRA 3Q7TA 3RPEA 3TOZA 4HRAA 3WMEA 2IPLA 3RRFA 1P1IA 4PC1A 2DPGA 2BTEA 1K97A 3NJ4A 4MUEA 4ZVRA 2HF8A 1IWBB 2J1LA 3IA7A 4DG8A 3A4YA 3RS2A 2CFRA 4V1CI 1SHUX 2CK3D 3CMCO 1CY1A 1RMTA 1G38A 2JLZA 1OB5A 1Y7HA 4G81A 2F62A 2AOUB 1ACJA 3LX5A 4C4SA 1G42A 1R4MB 1FSFA 3PI7A 1QP7A 3KKMA 4TS4A 3U4DA 1A3CA 2PRSA 3AZPA 2W8BA 5K0SA 2YIDA 1NF2A 3SBXA 2RH4A 1MOQA 3T9FA 1J1ZA 2YVQA 3I53A 2EF0A 1EE1A 1T29A 3UK6A 3VR1A 5C5IA 4PCLA 1O9BA 2PZLA 2ZBRA 4DRXA 3MGBA 1ZRNA 4CGZA 3BHJA 4EF6A 3QU7A 4M0UA 2MSCB 3C7CB 3H2SA 2XYRA 2RGGA 3DLIA 4HGQA 4WCDA 5LYJA 3HU5A 1H2RS 2VAMA 3NOVA 4Q1DA 1TGVA 3B6JA 3GJ4A 1GKKA 3MCWA 4M83A 3RVKA 1E6MA 3OCCA 1O6GA 1NJ8A 5KVQA 2AC2A 4BVFA 5KWJA 4LSGA 4Q9IA 5TRTA 4JEIA 4OTZA 1KSHA 3II6X 1XRNA 3FNBA 2OO5C 1LWNA 3L1HA 3PXBA 1N7IA 3W04A 5HOEA 3UNXA 5JZOA 5BPHA 2B6HA 1JKJA 1PEDA 4C08A 4Q1FA 2HMWA 1QGUB 1ACMA 3EPKA 4WECA 2Q9CA 3MTEA 2Q46A 2VHQA 5TMEA 2PK3A 1Q3HA 1LX6A 2FX5A 3PEVA 3QOFA 3AFHA 2PXAA 1C5KA 1JFVA 1G8PA 3L8ZA 3MWKA 3ODGA 4CEHA 3FOWA 2WRZA 2VF8A 4LX0A 2IQ5A 1SC3A 5GZ6A 3VU3A 1FY2A 2GUGA 4QQ8A 1GEEA 5BVGA 2O8VA 1K75A 2JFHA 2ZPAA 3DMNA 1E0SA 1UDCA 2B6NA 3EG9B 3SIXA 4YX9A 1PRYA 4X63A 2HU7A 5DX1A 1LF0A 3H1BA 3FFWA 2FWMX 3V1TC 2YXEA 4E22A 4RJLA 2R7KA 2BKVA 3EZ9A 4W8GA 3ZDCA 4UFOA 5IP5A 4O4LB 1QPZA 3E1SA 2OORA 2VAXA 3KB2A 2GN2A 3OJCA 3QTLA 4UBOA 5EMNA 1SPBS 1LSOA 2OLJA 5CAEB 5F98A 3DCNA 2I6QA 2JH3A 8OHMA 2GZHA 1JHYA 2P75A 1TZMA 3IPCA 4LJ6A 3VHRA 3EIXA 1KIAA 3CNLA 2WYWA 4AP9A 4N47A 3X2FA 4BMOB 3TPZA 4BNXA 5CTJA 1QE5A 3GMDA 1MB3A 2C0QA 3OCWA 2R25B 1ULHA 4YDHB 1PYDA 2ZI9A 1ZGJA 3DDZX 2I2BA 1UJCA 1ZOSA 4JX8A 4GLBA 4L5CA 3S8EA 1NL3A 1L4EA 3TYXA 4RWEA 3ZNQA 2RJ3A 4RSMA 4YUYA 4KXVA 1F06A 2XLCA 3BIFA 2DHEA 5LUBA 2NMVA 2IOYA 3WLMA 1N32B 3CRZA 3M81A 3HXKA 5HQ3A 3DWFA 3DC2A 1CF4A 3PC6A 4B82A 3JS5A 4MQFA 4L6IA 3E5RA 4Z6KA 3K2IA 4L2IA 1K89A 3PHIA 5EL0A 4ZCSA 2X86A 3D6AA 4MPPA 4WXEA 4NZMA 5JFOA 2O9JA 3QVLA 3PNMA 4F1KA 1UOPA 3ZNOA 2IS6A 4U2KA 3CJQA 1QKKA 2PCLA 3EK2A 4PC6A 1GTRA 1Z26A 3LLVA 1QH9A 1B6RA 5JRJA 3HTXA 2XOXA 4BZQA 2Z95A 5SY6A 1ZK0A 4FGLA 5I45A 2CE2X 4XYMA 3FYDA 4MV1A 3MGCA 4P4LA 5KKAA 3HGQA 3IOEA 3PFNA 1KEVA 1XMPA 1LPMA 3QFTA 2QP3A 1YRLA 2GZ3A 1J22A 4FS8A 3AF0A 5THXA 4CM8B 4ARCA 4C0AC 1CZRA 4Y2GA 1LI7A 3T7CA 1Z8HA 4IVPA 1EHYA 3SM3A 1QM5A 1N3IA 8GPBA 1TM3E 3QBJA 2QLNA 1KKLA 3ROKA 1FYDA 2C8LA 3AERA 1DCMA 1NW7A 4PBTA 3OLQA 3HXQA 2WUWE 1SVOA 2ZANA 2FDCA 2OBMA 3WBFA 3D5QA 3HCBA 1WQ4A 3Q3CA 3B12A 5G3YA 4YUAA 3MAGA 5AHRA 1P0MA 2YHUA 2QRUA 4MPTA 2ZZMA 1EWTA 3N28A 4JN6B 2ODPA 3FROA 2XIQA 4IOKA 3ENNA 4L07A 1HT0A 1KARA 3SK0A 3D59A 3V80A 4MQMA 2CLOB 2HJSA 3HDYA 5CU7A 3GJTA 5JNTA 3PNKA 1DX6A 3N53A 4UBJA 4QASA 4A0SA 5C1DA 5LOVF 1T5DX 2HDWA 4OMCA 2V7UA 4IAOA 4F04A 1J0AA 1SG6A 1R8YA 4DSOA 5AXAA 2PH5A 1E2MA 4R81A 3O9ZA 4JJ7A 4LRSB 5CHEA 5G0WA 5EJGA 3HGTA 3KTOA 3PFKA 4PZUA 3C1OA 4O8ZA 1DIRA 1VI6A 3C14C 4NG4A 1YTUA 3N0RA 3HBNA 4NFSA 1W93A 2PUVA 3MCVA 1SEVA 4F5DA 4LHXA 3MXOA 2H85A 2DQZA 3GJ7A 3VNVA 4LGMA 4DPKA 1LBEA 1EFHA 1KR2A 3FMIA 4LF6B 2CK3A 2ZSFA 4Y1RA 3TRHA 4CKBA 2GS9A 5L9AA 5KS2A 2HX1A 2Y8EA 1OBHA 3LP8A 4UHEA 3GLFA 5K01A 2QZ9A 3NYRA 5T4FA 2IGBA 2PSSA 4NCBA 2OCGA 2Y67A 3U16A 3P5SA 1KVUA 4GI7A 4HZUA 4AJEA 4X7RA 2OKGA 3O4JA 2A0XA 3IUBA 1IZ7A 2JFOA 1A72A 4XR9A 5I9LA 2IZ5A 2VZ9A 3TXAA 2O3SA 2JCYA 4PSCA 3UEOA 3KNZA 1B74A 2R85A 4ANFA 1PUJA 3BGOS 3LOQA 3OZVA 4QGSA 3F47A 2B8EA 3IAAA 2RGAA 3ROXA 4ZCTA 2W5UA 2B92A 3KXKA 3NC0C 1UEIA 3Q3GE 3I12A 3OESA 1L7PA 4QFDA 1KR5A 2EU8A 1XPJA 5EVCA 2X8JA 1GSAA 2DCUA 3KKPA 3CVJA 3MT8A 4PSKA 3C5HA 3KKKA 3MSXA 3QUTA 3KSAC 5HJ5A 3HKEA 2YJTD 2FDXA 1QJ4A 1R6AA 3FYUA 3PHHA 1AQIA 1RCTE 5J2TF 3WL8A 2ZATA 1UZAA 3Q7PA 3R5JA 2HA2A 1DTWA 4M1SA 4NJMA 2C7VA 3BJIC 3W3AA 1P9OA 3DULA 1O7JA 3KD3A 2CSXA 3WJ7A 1SMKA 4KYUA 3UN1A 4NR0A 2OGTA 5JH7F 5LIRA 1II9A 7REQB 2OAP1 1Q7EA 4P4GA 3ED5A 1JB9A 4QRIA 1P62B 1J33A 4RHUA 1CQPA 1MKYA 5BNTA 4KREA 1DWOA 2LV8A 4XWTA 4J6FA 1KDZA 1ZCFA 1O6BA 3CQ9A 2PV0A 4LCJA 2X1LA 1ZJZA 5DYYA 1QRTA 1CBUA 3AUKA 3JVIA 4BNJA 1ZCBA 4WLNA 4ZVTA 4PAGA 2O0MA 3EGOA 1JH8A 1FX0A 1G5QA 4PLCA 1UQTA 4JODA 4HH1A 3GU3A 3P71T 3R6DA 4JJ4A 3JPWA 1ZCAA 2RHMA 3P97A 4G5GA 3IGFA 4Q01A 5BUQA 1KZ4A 1NXSA 1OZ0A 4OMDA 3C6XA 3HCAA 2HNBA 1KERA 3NORA 4QDJA 5FLEX 2FWBA 2OK8A 3NMUF 2Y77A 4FR2A 3ADCA 4Y9SA 1RYYA 4B3SB 2Q7OE 3C41J 1B6SA 4V03A 1P4GA 1Y7IA 4NY1A 1F1JA 1Z7GA 4DQUA 5EFZA 3MUOA 4BKPA 3QW2A 1G2QA 1CV2A 3MHTA 2AN4A 4CMIB 3U4GA 1IIRA 4XWWA 1KEWA 1XCBA 4MP6A 4N0QA 1M2JA 1N7HA 3KT3A 1GSIA 5AK6A 1FUUA 4JEUA 3MLEA 5WRFA 2VQFB 5KVCA 1MXHA 4KZKA 3QITA 4OHVA 3BCSA 1GKLA 1I6KA 4HNGA 2ZSAA 2OCLA 2XA9A 4HCJA 1RRPA 2ZJ0A 2MT9A 3G88A 4TV9A 3QKIA 1LVGA 4HADA 1JDBB 2VHYA 2ZR8A 1PV2A 2DPHA 5NLLA 5DI3A 4AM8A 5JYBA 5FTNA 5GP1A 2E5WA 4KYTA 4PC3A 5ILQA 2EJCA 2Q2NA 2E1RA 4C4OA 1Y4ZA 5AJZA 2B4YA 3JQAA 3I04A 3NONA 1D07A 4WVFA 2DFPA 4JCCA 3HDJA 4UAUA 3P0HA 1TCCA 4J0FA 1PTJC 4ZV9A 3MELA 1H3FA 5ESWA 3IEMA 2G70A 2OV1A 4L0MA 1OH6A 4JX9A 5A9RA 3FTPA 2H92A 1D2EA 1EEXB 2XUPA 3R75A 3K8YA 5HZMA 4BGUA 2J7PD 3H97A 1ODCA 2HCJB 3OUTA 3AXSA 4PYRA 5EZ6B 1Z18A 1JPUA 3AL3A 1SBIA 1T9GS 1YJXA 1CE8A 2RGBA 4TKMA 4QVKA 4KACA 1WCWA 1GGMA 4IUCS 1QYDA 4P3PA 3PXXA 1L4YA 3LHDA 4EENA 5JD5A 3K0CA 4OQEA 4AMZA 4DMMA 2E5LB 1IN1A 4I1IA 5P21A 1NLMA 3W7BA 3AETA 1H9CA 2GFHA 1MABA 5GJWC 1V9CA 2XBLA 4MUXA 4PNZA 4Z9XA 4RNDB 4QM6A 3NYWA 5LNK1 1L4GA 1JDPA 3GMIA 2AZ4A 4HN2A 2VJAA 4MRRA 5JRZA 3GJ5A 5REQB 3P2OA 4YJ3A 3ZHCA 2RC5A 4L5BA 5KYXB 1EUYA 1JAIA 1DXQA 3RODA 4Y6OA 3WWEA 2QRVA 3WWYA 2R7AA 5DM60 3TPFA 2ZI6A 2C9OA 2ZJ7A 3GJXC 1VC2A 3EEBA 1QAOA 2GVNA 3M2TA 3N8DA 2CMFA 2FRVA 1S2LA 2JI9A 2X9VA 2ASVA 5E4YA 2B2NA 3CPEA 5A5VA 5LQMA 3BTOA 4UEJA 2D0DA 3SQMA 4LK2A 3ZV5A 1T36B 2NNWB 2JGRA 1Z17A 2ICAA 2VEDA 4IDHA 1M6EX 1VB5A 4Y0VA 5K3SA 3RTGA 4DBVO 4YXFA 4D5EA 2RCNA 4JMLA 1CUZA 3NP9A 2IP4A 3WIOA 4KKVA 2FMTA 4CLXA 2WWTA 4XYEA 1V1MB 2XRZA 4BNDB 4GBMA 2XSZA 4JSTA 1RXVA 3QA9A 3COYA 3DTTA 1BRMA 2W93A 3EHDA 4XPIA 2JEOA 3AI7A 4BV3A 4KLNA 2QK4A 4U7FA 3UWDA 3WZ2A 4DIKA 1RC0A 2TS1A 3QVSA 4EHNA 3L46A 3C6MA 1EK0A 3QVJA 1ZUHA 6ADHA 2P2NA 2QZ4A 4IL5A 3CN9A 5TXGA 3RFFA 3LBYA 1N2XA 5DVZA 1NBME 3PRHA 2EC5A 1KO5A 3L2OB 1YOVB 3AGPA 1VP3A 4YRCA 2VPYA 5KSWB 4RJKA 4UUQA 4HT3B 2XNJA 4JAVC 2I80A 3FI0A 4IGFA 2JLYA 2HDNB 2FHPA 1OIVA 3FZYA 3G2JA 2ZREA 3NAQA 3FWYA 3G49A 2YXLA 2V8BA 3C7KA 1LV8A 2IITA 4M9CA 3QI2A 4AX4A 4F9EA 4X00A 4Z4QA 2V0NA 4NPAA 2IY9A 5C4IA 1OLXB 2J08A 5A6SB 4YPOA 1U7PA 2DUJA 3TQIA 4ZYWA 1R4AA 1UXOA 1E6EA 1Z2AA 1NR7A 3L7DA 2FSGA 2FN4A 2NPOA 4PYKA 4V0NA 5EJ9A 1MHTA 3E7PA 4YROA 3IO3A 3N87A 3REFA 2RAFA 1CUGA 3R0XA 5J2UA 4XGQA 4NDAA 5BRNA 1KPIA 1Y9EA 5C81A 2Q45A 1XTSA 3AR4A 3O8QA 4BQIA 4GI2A 5JEEA 1CQJA 1W0KD 2W11A 4TXLA 4UCFA 1QF7A 1U0FA 3HH8A 1RHKA 3AK4A 4KQJA 2WLSA 4NJEA 4GM0A 3SR4A 3NTRA 1U9ZA 4QPDA 3N6RA 5C2JB 2G5PA 5AOBA 5KBYA 1ATZA 2DBQA 4R8VA 4YMIA 5EEGA 3S5JA 2AK2A 4Y7CA 3RRMA 1N4AA 3MB5A 4AQDA 2VDVE 3NDRA 4HLUC 1NMSA 2PD6A 3THOA 1ZINA 4MWZA 1HNWB 4FKZA 2AOTB 3P9YA 2IC5A 1E1CA 3NHPA 2AYYA 4C4AA 3A58B 1EWQA 2EZ4A 3IOCA 3SEAA 3N70A 4ZHSA 1HFEL 2O7NA 2NYRA 4N7JA 4LC0A 3TJMA 4Y2TA 4JYMA 4EA6A 4I5FA 3Q1LA 4JI4B 3NC1C 4WA8A 3IBFA 1PL8A 1YSCA 1D2GA 4C2AA 2ZUBA 5JBIA 3V4SA 3T3DA 2ZULA 3LBNA 1HI9A 1JG4A 1E32A 4JT2A 4RMNA 1MJFA 4UMVA 1JXMA 1GLVA 1ZOIA 3KG2A 3SZUA 2QUKA 2PX0A 5CEEA 3QU2A 4B3CA 2C20A 4DHWA 3B5IA 3BHNA 1DXOA 2J3EA 3RS4A 3Q8MA 1Y6JA 2MWMA 4IYJA 3DEHA 4CKWA 2X1MA 4NU5A 1S1MA 3CW2A 3I9KA 1SXJC 2VPZA 5CGZA 2IDZA 1M54A 3X1ZA 4RTSA 3NBQA 4M49A 1LBHA 2ZWIA 3NVAA 2W6QA 4RVNA 1L5KA 1NN5A 3IP3A 3CZAA 5HA5A 5AVVA 3VM6A 2CNOA 4XB1A 4NARA 1Z68A 3W1WA 2ZR7A 3AC0A 5A7HA 4M55A 4ZYZA 3AVYA 1U2GA 3DH0A 4ZAVA 3DT9A 1MX5A 4RNCA 4KTVE 1XAHA 4JQCA 3EGXB 2MINA 3CINA 4HMOA 1JR3D 4CTJA 3V1KA 5TIIA 1A7AA 5MDHA 1X1TA 2AI1A 3UT6A 2X22A 1GP2A 2V6JA 3LA8A 1KETA 1QTNA 4MGKR 4AJLA 3F46A 3J81A 1BO6A 1NMXA 1KY3A 3D8HA 1GU1A 1DAPA 1ODIA 2ZUVA 5EHQA 5U4QA 4N65A 4TTTS 3FHTA 2J7PA 1H8ED 2VQ6A 4LPSA 1SBCA 4J2HA 1ISIA 3PX3A 4D6YA 4B7ZA 5J4YA 4JDPA 4BIMA 2CLDX 2VQ3A 3H13A 3IIEA 3UF0A 1WVGA 1Z8FA 3GZNA 4D5GA 5D7NA 2A0YA 2CV0A 1SUCA 3PVZA 4AMVA 2GPNA 2WHPB 4PG7A 1XQYA 2W4QA 4M0PA 5DO9A 5CXUA 1QXSA 2ISQA 2RGYA 4DKJA 2CHGA 4K9QA 5A3VA 3OTQA 4LEIA 1V7QA 1AD2A 1ZD1A 4S2EA 4GBGA 3KXIA 2GHQA 2OBBA 3PB3A 4OUDB 3AOGA 4NG5A 5TEVA 3GJ0A 4F2HA 1P4RA 1ECLA 5JNWA 1JTVA 1Z45A 4ND5A 4JYBA 4LJ4A 5D1NA 1DUSA 3OZRA 3SBDA 4CYMA 1AU9A 3EZ7A 1F3LA 1PZNA 1GOTA 5BNWA 2HXGA 3RIEA 1NF8A 1WLYA 5F64A 4QOIA 3B3GA 5C1PA 5IARA 1Q14A 4K2HA 2P79A 4KGDA 1RXEA 1GQFA 1YHNA 2LKCA 3FOCA 4D6PA 1QK5A 4E03A 4DR2B 3K1TA 3CF0A 2IY8A 3FIJA 4E7OA 1NX9A 5LBUA 3K5PA 4ZI5A 3WTBA 4MITA 1N2ZA 4CXMA 5IJ9B 2HQ1A 4OVKA 4HPJB 5T4EA 2X6RA 3WNCA 2VA9A 3LUPA 3TFOA 5ED4A 4H7PA 4M87A 1W5FA 1F4VA 2AC4A 4ALKA 1FP2A 3HDQA 1Z88A 5K03A 1R0ZA 1RHRA 4RTPA 5FCDA 2YHSA 4F6RA 1QONA 4V2UA 3VSBA 5EJ2A 3JYPA 3TQTA 5JZMA 1SU4A 3KZ1E 3OOYA 1WPXA 4R83A 5CEFA 5HCIA 2IEZA 4JEHA 2R8PA 3HKBB 4PZLA 1IU9A 4IJWA 1C0KA 4OI2A 5I9MA 4E13A 2ID4A 1XYVA 3D3WB 3BB1A 2WVAA 3FRJA 3JRXA 4RMIA 2RKBA 3P94A 4FI3F 4GIBA 4ZCQA 1OCEA 1EA7A 2LCFA 1A0OA 2X5NA 4L02A 4ZHQA 4C06A 3E18A 1YJCA 3EJWA 4H2DA 4WX2B 3SJ7A 2BZSA 3WMGA 3OE7A 2QTLA 1JEAA 1MO2A 2P2SA 4QBTA 3CF4A 4OL0A 6NULA 1CUBA 5E1DA 1U0SY 5JT1A 1BJRE 2ODWA 5KSPA 5JW6A 4FBGA 1XUOA 3IIJA 4HDKA 5FQNA 3MJEA 3ULKA 2P9HA 4PZAA 3NNNA 3IRVA 3NBAA 1Z0FA 3C8MA 4X71A 1U9YA 3CZPA 3EMDA 1T3SA 1Y9ZA 3UB4A 3ASZA 4AUEA 2J87A 3LLSA 5GIOE 1TJNA 5I3ZA 5LLDA 3VBEA 5IYZB 2I2CA 3E2IA 4PW0A 4ZOAA 3GF4A 5M34A 3TSAA 3A7DA 1KJZA 2LKDA 2BI4A 3CHYA 2B8JA 4AMYA 1AB5A 1EJ0A 1E4EB 2ZI7A 5K8IA 1CHDA 1HH4A 3RR2A 4Q34A 3CVXA 2JA2A 2QRGA 4ALNA 4BX3A 1I5RA 1ZZEA 3F9CA 4P4TA 1TT5B 3MGKA 1L1QA 1D03A 3P5BA 4QLOA 3U60B 1SR8A 4BFVA 2P11A 3AEYA 2R6R1 2O5EA 1ADBA 3EOZA 5C35A 2VWQA 3GDOA 3QVWA 4IIBA 3F5QA 4P4SB 3R1IA 5IBPA 2AFHE 2PBRA 1U2QA 3B5EA 5CDSA 4G01B 2ET6A 2PD4A 3B3JA 1M9NA 2HKIA 1A1SA 2QORA 3Q9SA 3PWSA 2C2XA 5TMBA 4GNRA 2OGWA 5F1PA 1PQPA 1IZ8A 2XUFA 4RF4A 4AS3A 4PYJA 1XA3A 2E6KA 3CU5A 1IUKA 1DE0A 3RVJA 4OBXA 3BZUA 3EY9A 3UUFA 5KVSA 4MVJE 4WA7A 3EXEA 1W4CA 5KAMA 4A92A 3BE5A 3CGWA 4N5DA 1DC8A 2M6RA 3VR4A 2R1TB 1HQKA 3O0TA 5BSUA 4CG2A 1PG2A 3E05A 1CHNA 2A9FA 1Z7EA 4LQDA 5SY9A 4K05A 4O2AF 2C2MA 1OYOA 3I9V1 5DX8A 5LP6F 3KUKA 4F3NA 5HVNA 5FFMA 1E9SA 4I8DA 5FRDA 1LPBB 4FINA 3FF1A 4G23A 1JR3A 4JXKA 5EIBC 5I7RA 2YWGA 4JBXA 1JHRA 2VDUE 1ORTA 5CNIA 2QIOA 1UK7A 5GV8A 3B7WA 4TVKA 3O3CA 3S28A 3RAEC 3ADKA 1XQXA 4E12A 1IZYA 1Q3KA 2AI2A 2H1HA 2X0RA 4E32A 5BWOA 5IM4A 4LCEA 1JIVA 1M75A 1Q92A 3OP1A 3DONA 1X7XB 3R0JA 4W1QA 3C5VA 3C6BA 1YULA 1DC4A 2EWWA 2F1OA 2P68A 4X84A 5ALZA 4UM8B 3DZKA 1RDFA 4K6HA 2NUPB 2J3QA 1Y5NA 1YK0A 2WTUA 4AIRA 5KVAA 4PC7A 3HWSA 1W46A 3D5TA 4CMAA 1GQQA 1HF3A 1WF3A 1TZJA 2XDQB 1OVGA 1C4OA 5L8VA 3DEKA 4B33A 3IQDB 1E5XA 1ZM3A 4TLMB 4PNEA 4HYQA 2CJXA 5KSZA 2E7ZA 5GONF 3EXIA 2G9QA 4ZC1A 1K66A 4TUYF 3ZY6A 3FUWA 4ISBA 1RI3A 5F2NA 3TNFA 1CIPA 4UDNA 2OBNA 3GWZA 3LYHA 3VGPA 2Q1XA 5FBQB 2O8EB 1U3WA 1NN0A 2O14A 2CJYA 4RV5A 5ITZA