4ZK2A

Structure of acetobacter aceti pure-s57d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
158
Chain Sequence
APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVDAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Serine mutants of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 49
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4zk2A00
5C5DA 5CLIA 1O4VA 5CLJA 5BOSA 1U11A 2NSLA 2FW9A 3TRHA 4YCCA 2FWJA 3OOWA 3KUUA 4Z7JA 1QCZA 4GRDA 4YCDA 2FWBA 2FWIA 4B4KA 4ZJYA 4ZK2A 5BORA 5CLFA 4YCBA 5CVTA 4JA0A 5BOSB 2NSHA 1XMPA 2H31A 3OPQA 3RGGA 2FW1A 1D7AA 2FWAA 2YWXA 4YCJA 4AY4A 3ORSA 4ZMBA 3LP6A 2FW7A 2NSJA 5CLGA 4ZC8A 3RG8A 2ATEA 2FW6A 5CLHA 2FWPA 5CTJA 2FW8A 4AY3A
chains in the Genus database with same CATH superfamily
3BJIC 1C7QA 2FOLA 3OQVA 5CB4A 3P9IA 3LUAA 4HXGA 5EWMB 2R1TA 3QWFA 5DMXA 1UL1X 3THOA 4DXHA 13PKA 1EDZA 3IMEA 3KLOA 3VR4D 3VYUB 1LA2A 2BIFA 1Q21A 1Z0DA 1WXWA 2OFXA 2WF8A 3KFXA 4ZVVA 4IJKA 1O54A 5JVDF 2ZI7A 4AI6A 2DYKA 1JKXA 3II6X 3RSHA 2GJ4A 3N6VA 1N2EA 3BB3A 3ROXA 2Q0QA 3OJEA 1D0IA 2D0OB 3GAFA 1XZ8A 1TCUA 3ZLTA 3H9BA 3PUHA 4K88A 5IDWA 1PF7E 2X0FA 5YASA 2GA9A 4PXAA 1ZL2A 3QEMB 5HK8A 4GMKA 3E2MA 4XIFA 2VEOA 1PJAA 1NIJA 1O95C 3NVDA 5DI9A 1UFOA 3SIWA 1J2JA 1PUXA 3BSYA 3N2GB 3AW9A 4ZDIA 1KQOA 3FDJA 1LDEA 1JFTA 4WZBE 3VZQA 2HCJB 4ZT5A 5BSFA 2X8AA 3BPSA 1DWQA 1SQSA 5K01A 2QTCA 4BFTA 2HNKA 4REQA 1W30A 2Q8PA 2VHUA 4BQFA 1ZMXA 4BNUA 4PG7A 1RD4A 2XCTB 1SCKA 2NVOA 2C5GA 2RJNA 1A9XB 4ALNA 1WF6A 2EFCB 2ZFUA 3I9KA 3ROEA 1XOIA 3OQMA 2CB0A 1XLUA 4Q3CA 4D6PA 3P9ZA 2WFZA 3WLKX 5I4KA 5LNK6 3Q8LA 3KKLA 3PR2B 3UG6A 3GDOA 5JYDA 4H3SA 2Q4OA 4C03A 1SUEA 1XXHB 3F7NA 3KV1A 1O2DA 4N01A 4YONB 3WKDA 1KXZA 4DA6A 1I8TA 3P2YA 2YNMD 2WNHA 2A4MA 1PJRA 3ANMA 2OYCA 3OEHD 3CURA 1SCBA 4BN5A 2QM8A 1QIFA 1R6AA 1E1YA 2DT8A 2P9BA 4PXSA 4NMLA 5LLTA 4IDAA 4WBNF 2OV4A 2LCQA 3GJSA 2J30A 2WYHA 3U44B 2BL4A 3DF9A 4KGZA 4DB4A 2D2EA 3LM8A 3FNRA 4LY6A 3TTSA 3PUYA 1W29A 3C1TA 2PGXA 1OBOA 1DUIA 3F4LA 1YD7A 3KL4A 4HAZA 3Q98A 2FPIA 3QG1A 4LRWA 5DGDA 4U2KA 3GN1A 2NXCA 4UPEA 1K3UB 4X97A 4F5EA 4M8SA 4S05A 3PQ5A 2PKWA 5B2ZA 4FGJA 4Y2UA 1KSGA 4PCAA 1R5NA 2ETXA 1T1IA 4QDTA 1T1SA 1SA0B 3FOBA 4RZ3A 2OO5C 2QYTA 2WWWA 2WJGA 1KO8A 7REQA 1SBCA 2FWPA 1K5DA 1M9NA 2XKJE 3N07A 1PFKA 3ML1A 4XB6B 2AN5A 1L1EA 1NMSA 3CKLA 2RGEA 3QKWA 1HYBA 1TCBA 1W6UA 2BFPA 4URXR 2QA5A 3E18A 4Q47A 3C5HA 2R6AA 5ALMA 4DEXA 2GKSA 4IVRA 3K0EA 2FZ4A 4GVLA 3FM9A 3GRVA 3QPUA 1YA6A 2IQIA 3DD1A 4NG5A 2B78A 4B31A 4GPAA 3AERB 3LUKA 1N2HA 1XZGA 1FYXA 3ADKA 3AJAA 1ZR4A 4FFNA 5C8ZA 1KOGA 3JZAA 3DPIA 5LB2A 1DG9A 3QU7A 1QVAA 3M89A 1GPWB 4J29A 1GZUA 2C20A 2ZIFA 3C48A 3CA8A 3D7LA 3U0VA 5JSFA 3TWOA 3DV9A 1DKRA 2DR3A 2WSSD 3RUCA 3T99A 1YFZA 3DONA 3HSKA 1V16A 2GO1A 1MUUA 3IYLW 4IG9A 2VHYA 4M22A 2PLWA 3O75A 4MICA 3DL0A 1KIFA 2COKA 3GJXC 1ZGAA 3H17A 4X93A 3LUCA 1L8QA 4FMDB 4IXNA 1H2YA 3BXXA 2GB4A 4K3UA 4P36A 2NO0A 3KTDA 3HCNA 2W8BB 1P29A 1RQLA 3Q2OA 1Y7PA 3PQ8A 4LRTB 2V5AA 5E0OA 3NHBA 4RPHA 1RMTA 1R5OA 4JSRA 2XB9A 1J2RA 4OYLA 5K3FA 1T24A 1QFYA 3DBOB 4S24A 3KQLA 2FEMA 4QNNA 5ETJA 3EIOA 5TQ0A 1ZAYA 2DLNA 3LC0A 3X1KA 4ASUD 5CYFA 1O77A 3HNOA 4A6PA 1Z2NX 2VBGA 5BR4A 4WW0A 1BDMA 2O20A 4TRMA 4U7FA 1QRRA 4DN6A 1Y8RB 3VZCA 1P73A 2BSXA 2ID8A 4K9OA 4Q48A 4D3YA 4YI5A 4E03A 1BNCA 1INLA 3KV3O 5CJ2A 1NVWQ 5J43A 1XB2A 1VLHA 1PGPA 3ZDCA 3BOSA 1F8GA 3R0QA 5EXEA 2JIMA 2BC9A 4E6PA 2WZBA 4PX9A 2HWYA 2ID9A 5C81A 4NEGA 3F5MA 3D81A 1RZRA 5IX8A 4MI3A 4F71A 1G21E 5CBPA 1Y0BA 5HS4A 4TKVA 2CFSA 1N1MA 4M1TA 1AK1A 3HJRA 2I6FA 3NIDB 1N7GA 4Y0VA 4P5PA 3L0SA 4XQEA 5AUOB 5A5VA 4DHWA 4M38A 4CLOA 2JA1A 3NHFA 3R44A 4H7FA 4LI3X 2FZVA 1MO6A 4HCJA 4XH9B 3ITNA 4JB2A 3A37A 1E3TA 1VL8A 4UATA 5D87A 2GJKA 3CJQA 3SG0A 3D8SA 3VBCA 1FDRA 1LDNA 3R77A 1C1XA 3A3NA 1FFEA 2FE1A 3TUIC 4TXHA 2CXOA 3K5PA 3OM1A 2B8NA 2P69A 2E85A 2VDOB 3EAFA 4PLCA 4QGFA 4IO0A 5LCXA 3PWKA 2OTCA 3ZE7A 4DCNA 4F72A 5CBKA 5FLXA 3WLOA 1XZQA 1V71A 2QX7A 3OPMA 4DDWA 3AL0C 2R2GA 3RQSA 3BBPA 2OGWA 1X80A 3ENVA 4RPGA 5B58C 5SYNA 5HM8A 4O4JB 5AXCA 4D9BA 1ACJA 3VR3D 2WC1A 4BVJA 3FNIA 5JJCA 4Z4HA 1UXIA 1Y1PA 1ONSA 2A78A 4KE7A 1JLHA 3GLIE 1YHZA 4YX9A 1PYDA 4JFRA 4YUXA 4AUEA 1NTOA 4UUBA 5ENZA 5K99A 3KEFA 3CPHA 4N7MA 1A2OA 3KLBA 3Q5DA 4XDHA 2R86A 3RK1A 3ASVA 1U8UA 1OFTA 1WBJB 4QODA 5AMXA 4ND8B 5FRDA 3NTXA 4V0NA 5FD8A 3RUFA 1ADGA 3H5WA 4QXPA 3PPXA 5CJPA 2QK4A 4YAEA 1T9DA 1OXTA 4TTQA 2V0GA 1FNBA 2OKGA 3WKEA 3C3BA 1KVQA 2H52A 1YBMA 1YJBA 4I0WB 3OFKA 2RG7A 2RH4A 4JI4B 2XDWA 4DG5A 4ADSG 1Z6TA 1XVIA 2WWGA 4ZAZA 8ADHA 2EKPA 4BOYA 2NYAA 5F1YA 3L6DA 4HJRA 1LFAA 4ZCRA 2GMWA 2HK9A 2PRSA 1K97A 3FWNA 3KNZA 3Q3JB 1IY0A 3SIPA 3H83A 1BQ4A 1NF8A 5AVRA 3VR5H 1CRQA 4K0RA 1P9NA 3PNPA 4RCYA 3MMPA 1W85A 4S1WA 4E22A 3OH8A 4FVTA 1WHSA 2AYZA 4RDIA 2IH2A 1IMJA 1ZC4A 4KQIA 2UYHA 3GYBA 3A4VA 1W4BA 3AEQB 1YIOA 2VK8A 1Q20A 1K98A 1M8GA 2Y93A 3GARA 2PKQP 4UU7A 4H7IA 4ZEXA 3M6UA 4ZT2A 1UINA 5FQOA 3WP0A 1EWTA 3KTAB 5AI4A 3DXZA 1RXSA 3BAFA 3DMFA 4QPZA 3OZRA 4JT8A 4UBJA 1AMOA 4AKHA 1R50A 4HGOA 4JX9A 1GXSB 2WVJA 4IH1A 1TJ4A 3H75A 4JLOA 3WADA 2D5AA 1KFBB 4H18A 2FPPA 3HYCA 4NV1A 1UKZA 4DPMA 5FPTA 1NXPA 2AXNA 5FP0A 4I1YA 5E38A 1C0KA 4FYIA 4IJWA 2C2GA 4WBXC 3RC7A 3CEMA 3KQPA 4AURA 1SXJE 4PSCA 1C2TA 2LW7A 5AESA 2D2IA 1Y3BE 3OZ7A 3PFKA 2QAGC 2XQKA 3A2LA 3GFBA 2RGDA 3PNMA 2BI4A 3UK7A 2PV0A 2JGKA 4OXQA 3RHSA 1FFCA 5BSWA 4N12A 4MVJP 4MQ6A 5CP8A 3DP9A 3TCKA 2BISA 5C5CA 1NDUA 1FW8A 1KO5A 4EF5A 3MGBA 3A9TA 1D1TA 4M46A 4XFKA 1UWKA 2LDXA 3AVWA 2UZ1B 3PYMA 2I4NA 3IBTA 4RV4A 3D4BA 3ZY4A 1HDCA 3EOZA 1I32A 2JLXA 4OBXA 4Q05A 1KI6A 1XVUA 5FOQA 3MWGA 1ZUIA 2FXIA 3AWDA 4WIAA 4EL0A 3H16A 4JELA 1ULHA 4C6RA 1C8KA 4OFXA 4F91B 1I51A 4MITA 4J7UA 5KS2A 1QAOA 1OI2A 1NKSA 4LYYA 4C7OA 3C4QA 1KO7A 1VZ2A 2SKCA 3ADCA 3ETLA 4K2AA 1CUEA 3C7KA 3UT5A 1YQ9A 5CVUA 4DM7A 4DSOA 5KCZA 2IF0A 4HX5A 1UM9B 4ZOEA 3SSOA 3E8MA 1DDIA 1JWBB 1KQ3A 1JF8A 5B1YA 4O1HA 3ZE1B 2YIVX 1GZHB 2I1WA 4ZVPA 2D06A 5JZSA 3RIGA 1MCZA 2E49A 2IW1A 4C22A 3H6HA 1UJ5A 2QVGA 3KQMA 2VPYA 3PEYA 3W2HA 2RK6A 4OEHA 3MMNA 1PS0A 1M0SA 1P2GA 3CEHA 1PR6A 1QQTA 3GT0A 4GMHA 4Q7MB 4R54A 3D2AA 1MJGA 3I2YX 5AOBA 3CGWA 3WRWA 1M83A 3RBVA 1JT2A 3H19A 4AUKA 3E9MA 1H6AA 4J0QA 4UXJA 3TIVA 3H4IA 2VHEA 2B21A 3ITDA 1RYMA 2DUWA 3CKKA 3M49A 4CL3A 3SM9A 5AH0A 3CFYA 4RK7A 4OGLA 4AG5A 1N7JA 2IOFA 3M5PA 1GL9B 4EY3A 4F4IA 1VXOA 1Y5IA 2P5TB 4JLBA 3IOMA 4TS4A 3I6MA 4RVUA 4DNXA 2A67A 1HURA 4KDCA 3DVQX 1AC5A 2GK4A 2MHCA 3PHJA 4PU0A 3WICA 3K9FC 1SUPA 1IOZA 3IV7A 4MRRA 5ITZB 1IHPA 2XZOA 1YB1A 3BILA 1RT9A 4L8FA 4YWHA 1V6AA 4DBLE 1IBCA 1OIXA 3DVAA 3GGDA 1K3TA 4WASA 4ANFA 3QOFA 3SJAA 3TQSA 2NAFA 4EGQA 1R0CA 2W2PA 2ZAMA 1EFCA 1P77A 3K9CA 3MWEA 1C7RA 2UZIR 3OZIA 4TMXA 4B4VA 2A0YA 4YRKA 3IV6A 2KE5A 1Y9JA 5HF8A 3L0BA 3L7DA 3OQPA 2ATEA 3B9RA 4IDGA 1Z6QA 2D7CA 4RFSA 3ER9A 1PJCA 1P80A 1SVNA 2HNAA 1NRJB 3A1VA 3IB6A 2ZBQA 3GFQA 3JALA 3KD3A 1PTJC 3OJOA 3QWHA 4IS2A 2BHNA 2D62A 1WMAA 4QUEA 5ALLA 4BLVA 3GEPA 3RJZA 2AG1A 3NVMB 5K09A 4X20A 1KEEA 3GNTA 4Q4AA 2RHRA 5KU1A 1LTQA 1QBGA 1RLOA 1ZN9A 3ZBPA 4J1SA 3JD0A 1FFXB 1JG6A 1REQB 1SCQA 1X70A 5BUCA 4B75A 2DFDA 3KKMA 2JIQA 4DJEC 4WY8A 4BNNA 2JIPA 5CT8A 2GFIA 2OAQ1 1L7MA 2FZWA 3M70A 3I12A 4I4NA 1STOA 3COVA 2WUEA 3DHNA 2DT5A 1KMCA 3GDHA 1OYWA 4ZMBA 5JROA 1TUBB 2ENUA 4YC7A 1CLEA 4P4TA 1NI5A 1F7VA 1OZHA 3E22A 3KALA 4LOJA 2UXCB 2YJ3A 1ML4A 5IT0A 3PQ3A 4MVJG 4P31A 2UAGA 3B6EA 1TZKA 5BRAA 3QBDA 5L40A 3QE0A 1J56A 3W7BA 3BAZA 1S2DA 2H2IA 2ZSEA 4HEHA 1MQSA 4K9QA 3WB0A 4AZVA 3QGMA 3PIDA 2JFBA 1K86A 1JKJB 2RB4A 1YL6A 3A4LA 5BT9A 4DZTA 2QTBA 3H3XA 5BYJA 1QM5A 3Q12A 4KQFA 1FFYA 2YHUA 4LC9A 4PIMA 1ZUD1 1M34A 1PWYE 4BIMA 2ZS9A 2PGJA 2VAXA 3NQ41 1U3GA 4W7HA 5F33A 5FQNA 2WWHA 5H59A 4DCPA 2H48A 2R0QC 2GZ2A 2R6DA 4K8OA 1RM0A 1W4ZA 1EGHA 1E66A 3QUAA 1DELA 3I37X 3QTBA 4OXYA 4RVGA 4CKCA 4DRXB 5AW8A 4YXWD 2D8AA 2NT4A 1JFFA 1TL7C 1JQDA 1Y3IA 4I4CA 5C8YB 1ZI8A 3B1ZA 3UCEA 1R37A 1YA4A 2ZWIA 2RB5A 1N57A 3ENQA 3FWKA 2WM2A 1MX3A 2YYYA 4H17A 1ZVKA 3AI3A 4AMUA 5A5GA 4OHUA 5L9AA 2FFJA 1GUFA 4DLTA 4GM0A 3T0FA 1ZH2A 4CKBB 3C3YA 1L1QA 1ZISA 4G4IA 4OHXA 4QIHA 4IHJF 3IURA 3NHUA 3AEKB 3IP9A 3TPZA 1Z4MA 2AXPA 2E4YA 3VC1A 3RYCB 1TVKA 4KJXA 3CH7A 5G40A 4HTAA 1VLJA 3WQHA 1VIDA 1Y80A 3WB1A 2GNPA 3WP1B 1FNMA 1PZNA 4XLTA 1G1MA 1BX0A 4ML3A 4ZO9A 4EI2A 1Q0HA 1TI7A 3BE6A 4HNUA 5K51A 2DSNA 2DQZA 2FR8C 1KNQA 1J00A 4FT2A 1TC2A 1HT3A 1LC0A 3EFBA 4TV8B 5GJCA 1TF5A 1CRLA 5EJ8A 1ZH0A 2BUBA 3NASA 3J7AC 5CITA 1J0DA 2D0PB 4LUCA 5ECGC 3B60A 1BQEA 1PK7A 2YZ7A 3F6PA 3IVXA 3V8PA 2QRPA 1Z0KA 5DF1A 4BP1A 1JHAA 3ZWMA 1WCIA 5T41A 2P35A 4FYJA 1M5TA 1GKKA 4KYUA 4F8EA 3K05A 4DF3A 1R88A 1XMPA 3CG4A 4A8HA 2X5KO 3O6VA 5IJ0B 5LUAA 1W44A 5KKCA 1O5TA 5LQMA 1CRZA 3OZAA 3FYUB 4J1TA 1V1RB 3BUSA 4P3PA 3AVVA 1WP4A 1WVMA 3R24A 2QT0A 4K8RB 1QQAA 3O1JC 3ZU3A 5KYNA 5CW1A 4LGVA 1NR5A 3K2IA 2WIGA 2VRCA 1VPDA 4PE5B 1BA3A 1K06A 2BDEA 3NAQA 3A0UA 2J5XA 5E4YA 4BJ6A 4CV0A 1Q2UA 4IDEA 3AQ4A 5ARCA 1G5PA 1VKRA 3FKSD 2G17A 3WSTA 1ZCJA 2GA8A 1RU3A 3HVIA 5L95A 1JT9A 1YGPA 2AR0A 3TFWA 1GL7A 3PHCA 2G9UA 4FDUA 3BWVA 5C7IO 3RSSA 2CXRA 5CVTA 5KWEA 3EBPA 4X95A 4K9DA 4PRKA 5B4UA 2H1OA 4FLEA 1H85A 3TSAA 4DRYA 5CVVA 1SUIA 3C70A 4E5MA 2R8YA 2WINI 3CEAA 4EHJA 2XX3A 3DO8A 3GP5A 3MJTA 1KU6A 3QZUA 2X76A 1X3LA 2AYXA 2HREA 1GTRA 4YUWA 1WM1A 2QW8A 4RH1A 3U1TA 3F7OA 5LXTA 2VT3A 3QQPA 1KS9A 3RJMA 3AGQA 1G8JA 2Y71A 2X6QA 5CH5A 5IANA 1HG0A 5I9TA 1ZN2A 2EEZA 2QG9A 3LC7O 3DBLB 5F5NA 3CX6A 3KEGA 3TQOA 2VDPB 3G82C 1DKMA 3L9XA 1GRCA 4HNQA 4K7JA 5FBZA 4BVLA 4MUYA 2PGOA 4E0BA 2Z8XA 3D6NB 1ZM3A 2H2HA 1P4HA 2QSZA 3T5TA 3TZKA 3EIXA 4ZZ1A 2YC4C 2DHCA 1BMFD 4CEIA 4OX9B 3DC7A 4G1UC 4TZKA 2OCXA 4Y30A 3TSZA 4CMBA 1BXRA 4GZ5A 1UBGA 3GUYA 3RVMA 3W0LB 4H2DA 3V33A 5D3QA 3RUHA 1F6DA 1MBZA 3FWHA 4LJYA 1JAXA 3FB1A 3F73A 1GU1A 2V6FA 5LU9A 3T3NA 1EH5A 4HH3C 3OZSA 3CH4B 3TIFA 1T1JA 3QF7A 5BQ5A 1CD5A 4P5DA 4RD6A 3A6DA 4WN3A 3DC2A 1KOJA 2QMYA 2W2LA 1JV2B 2Q9CA 3FWPA 5L3RA 4YDQA 3ANTA 5JVDB 3ECSA 1EKXA 5H3HA 3W77A 3DLTA 1U7HA 2B4TO 1TA4A 2J59A 3AEUA 4O6VA 3I3SR 1FJXA 4AY2A 5JRDS 1Y5LA 3AU9A 5T6MA 1RAFA 4H4CA 4NZNA 1U8CB 3FMOB 4OJTA 2XCRB 5GMOA 5TVGA 4PANA 1O94A 3IHTA 4AX8A 4RD0A 2VAVA 1FNSA 4HWRA 3D6HA 9LDTA 2GBLA 3VR6D 3DBHA 4OFBA 4BRSA 5JNVA 3WMFA 4D8TA 1LS1A 2D1RA 5H68A 1OX6A 3K30A 4W99A 3SHVA 5E4JA 2BKLA 5BN5B 4BMPB 1HMPA 3ELDA 3ZOKA 5E3IA 5FADA 4C4XA 1E20A 1LQ2A 1ODTC 3FTCA 2VXOA 4TV9F 3RADC 3A9WA 5F2KA 1YE3A 4C5CA 1UMCA 4K6GA 4M1YA 4JQZA 1IMOA 3TINA 4B7CA 5IW8A 3AVOA 4BEJA 4CV2A 1QOZA 5G4KA 3U9TA 1IQRA 1V5GA 2F1KA 2L18A 4AIIA 1Y6ZA 3GQBA 3ZUPA 2XRZA 1MJFA 3EWSA 2Y27A 4PHFA 4LJRA 3M6AA 4G4GA 4WK6A 4FZ5A 2FN9A 4HWGA 1E32A 4OQFA 4PG8A 4BP8A 1YB5A 2G9VA 3WK6A 2ZJ5A 3WAGA 4WBNB 3SSMA 4ZDKA 1RYZA 2P0YA 5E95A 3ZI7A 4NFSA 2ILTA 3EPKA 1W46A 2NUPA 1OWLA 1PWZA 1KDYA 3O21A 4B79A 1SBHA 5J1TB 3EXIA 3Q3EA 1C41A 1M1XB 1YUMA 2NGRA 2JJ1A 2OO3A 5AJWA 3ZKAA 5BSEA 2B4AA 4GW3A 4HRXA 1SBYA 4NNOA 5IFLA 1TOAA 4WADA 1C2YA 1LF0A 3C3AA 2OZLA 1XYYA 5IARA 2O3QA 2X7XA 5GADl 4JGGA 1IY1A 1DUSA 4DILA 1OWPA 3GHHA 3QYJA 1E98A 5FEMA 3W05A 5DN6A 1OCEA 1CDEA 1UBCA 4L2IB 4ZJPA 2FFRA 5U4QA 2I4LA 4XPIB 2Q0HA 1X87A 4P38A 1Y7HA 4BQSA 1EWKA 1P7WA 1IC6A 1THMA 2FTKE 1A5TA 3BL6A 3ENNA 3FOAA 3GVXA 4DTCA 3WRXC 4D9MA 2Q3EA 3GEBA 3UENA 2R7LA 4FI3C 1BKYA 1JI3A 1DT3A 3L8GA 1SRQA 2I2BA 3UJDA 3QXGA 4YRMA 4DR3B 1IVNA 1NPDA 3ZX5A 5EZ5A 4G84A 4YAUA 3Q0TA 3FOWA 1GNQA 1PYOA 3FHLA 3ISJA 3LUGA 1D6NA 2CBXA 2P67A 5DNYB 1TZBA 1WJGA 4RHTA 2JIZD 2CNKA 4YMSA 1KEPA 4CKEA 1ZPDA 4MQUA 4QTZA 3E15A 1A98A 1WZEA 1XF9A 3E5MA 3PCRB 8ABPA 2W0MA 1NQWA 3K1YA 1VYUA 1CR1A 2ONZA 4YP6A 4ILKA 4BHTA 4ZI7F 1B0AA 4IXDA 5I9NA 3JS5A 4HMPA 4XTCS 1G20A 1OFIA 4PLFA 2N46A 4AO7A 1JU4A 2X40A 3UB4A 5D3ZA 5M2QA 5CDHA 3OTQA 3NNDA 4DJAA 4MS1A 3QF4B 2A58A 4RXUA 1ECLA 4HH1A 4IIJA 4RF4A 4Z86A 5EIOA 5HILA 3PEWA 3A6PC 3JQRA 4ZVRA 1XJQA 1W1WA 3OG9A 4GDFA 2BZSA 1KYQA 2FR1A 2JGFA 4ZK2A 5D86A 1TF2A 1QHFA 4FUQA 5EXTA 2JEZA 4B6JA 5B5SA 2JA2A 2EFDB 1RXYA 2G4CA 2FAXA 1AUVA 5HGJA 4DDHA 3X1ZA 2GH1A 4RMHA 2H17A 1Z7BA 3SKVA 1FRVA 4KUHA 1PEYA 2BHRA 4JVOA 4MR7B 4DSNA 4EJMA 9MHTA 5IN5A 2VJKA 4FFVA 1DBQA 1VHLA 2PUWA 4D26A 4NS1A 1DAKA 2NZWA 3TW8B 2AWNA 3L8FA 2G07A 3GEHA 3PJFA 1ZD9A 1JEOA 3CWZA 2I9KA 1UZAA 1A95A 2HF2A 2Q45A 1XNHA 2QEQA 1JG1A 3NP7A 4IL5A 4ZOLA 4F5DA 1YS9A 3TMYA 1OI4A 5F9HA 4N5HX 1CJSA 4MO2A 1XRNA 3MAJA 3NZEA 3UJPA 5FULA 2YR0A 5KTMA 1ODLA 3OQOA 4D9FA 3BH7A 4GZ3A 4TYMA 3VH1A 4RIHA 4L8YA 3T06B 4TVKA 1OXKB 4WNIA 5L4LA 1YB4A 4FX5A 5DCLA 1U3FA 1VHJA 2DBRA 2OLJA 4OP2A 2HX1A 1I0LA 4BGUA 2VAPA 3ZU2A 2DBYA 2VUTA 1QMGA 2PY6A 4GX1A 4FCVA 1EXDA 3L7MA 1LH0A 4MS4A 4Y6OA 3S55A 4DIBA 2NSDA 4E14A 1Q50A 1U5BB 2ODWA 3ETJA 1ZNYA 3O38A 4JLDA 1CUFA 1SQ0A 5SZJA 3ZCSA 2VLIA 2X8BA 2XVZA 3GWGA 1GGKA 4WJKB 3S1SA 4UUQA 4U00A 1A3CA 3G9QA 4OLJA 4W5OA 1HOXA 3F6YA 4C7BA 4U7DA 2L82A 4AZ0B 1T4CB 3WMEA 7GPBA 3TRDA 3WBKA 3WIUA 2BMEA 2NU7A 3LHSA 3NIGB 2WOOA 4NBSA 4K86A 2R00C 2VF8A 2UZ4A 2HV9A 3GO4A 2J0EA 3E5NA 4I8IA 3AB7A 3CLUC 1HPLA 2EHDA 1Y8CA 2Q9BA 5B4VA 1XD2B 3ELWA 3QVUA 3U5ZB 3UANA 1V3QE 1LDBA 3FDIA 4AJKA 3CZPA 1AO3A 3CT4A 1U94A 3HKBA 4GSYA 1H9BA 2HFKA 3R0IA 1J25A 4X8OA 4KBYA 4NYMR 4HO1X 3LX4A 4URWR 2IHTA 4MCHA 1IULA 2JD0A 3H2SA 4BX8A 2G82A 2NTNA 3VBEA 1Z74A 3AEZA 3UHOA 3HB5X 4HDQB 5CCDA 3PIRA 4G2TA 5AJZA 5GONF 2ZCJA 1MRZA 3SYNA 4ZYXA 6LDHA 4MIOA 4PRYA 4ZVOA 1BWRA 1MPTA 1WEHA 1ZSYA 5DX0A 2DXIA 2AH5A 3P1JA 3KJQA 1DU4A 3OX1A 4PAWA 4G1FA 2CJPA 2HDHA 2I5PO 1SZJG 4ZC1A 4L5YA 3ND5A 2D1SA 3BICA 1U2GC 3EOBI 1T35A 4BB5A 3I9FA 3EFHA 3MTJA 5AKKA 4IF4A 1UZLA 2IGBA 3FMFA 3JQ6A 2O8CA 2W83A 2PX2A 3IH5A 4FWBA 4R9UC 1Q3HA 1RBMA 1P2SA 1XCGB 3S7ZA 4DT1A 4EUKA 1PV4A 1I3KA 3G7NA 4OB8A 1QGAA 3GGOA 1USGA 3WNDA 5K2MA 2FSFA 3UT6A 1Y5RA 1WS6A 4HRYA 1KAOA 3ZV7A 4I9FA 4FWIB 3N0XA 2XPCA 3CR8A 3KHKA 3H11A 1CY2A 1S9DA 4LXQA 5GP1A 4EA8A 4FKZA 3WSWA 5M04A 1HEIA 2IPLA 3U7EB 4EGAA 1ZD8A 1IVYA 2NX2A 1ORVA 3FOCA 4XI9A 3QX7A 4RHUA 4WNCA 1PWXA 3I2FA 2WZCA 3QLTA 2YWDA 4F84A 3WRVA 2ZJFA 2AOXA 2Y1XA 3JPWA 5EE1A 4L8WB 2QTVB 2ZULA 1ZU4A 3CHYA 3F6BX 1QC5A 5K0BA 4PR0A 3A2NA 1VZ3A 3E1GA 4GYYA 3JVDA 2WD7B 3GROA 3NRCA 1XMIA 2PH7A 3ISTA 4JY7A 3PNOA 1Q44A 3IDZA 2I2WA 1JHVA 1U7PA 1F2UB 3N2YA 5CA0A 2POQX 3LBAA 4G8JA 4DJJA 3EIFA 1QCYA 2CW5A 1HE3A 2YX1A 3D7MA 4OXIA 4IW3B 5I7RA 3PNVA 4BYGA 4AL4A 2ZB2A 1NWHA 2WTMA 2NZ2A 3DEZA 2QMHA 4I8XA 1TU3A 5F52A 1DWPA 2WJWA 5A0FA 3VO2A 2WTUA 1MRSA 4HAOA 1H9CA 1ZR2A 4B5LA 1GSIA 2ZTHA 2QN3A 3KB6A 2I2XB 1A4IA 3BIXA 2OQVA 4NPHA 1SG6A 1ZVJA 2AFHB 3D8HA 3P5BA 4P2GA 3NOOA 4TMTA 4NOJA 1KP9A 3VTKA 3KEMA 4C0XA 3SC6A 2IYVA 4MLDA 4PV7A 1CS0A 1FQJA 3RYIA 1U1IA 3AFGA 1MH1A 1FS6A 3QG5A 2NO4A 3AOEA 3U4CA 4DLXA 5BUSA 3O9ZA 2D5BA 1DOZA 2AOTA 2CUKA 2VNIA 4WNAB 1QFXA 4RPJA 5D5PA 5HCIA 4C0HA 3GDFA 3C7DB 3WNBA 5IBCA 1XALA 3VUFA 4ARZB 1GPJA 1FP6A 2GZMA 2JGJA 3G1TA 2O7NA 4WKPA 4X7PA 2ZE7A 2PR2A 3RGWS 3G5MA 4MJ7A 1SZCA 4CNBA 2HF8A 3UW1A 2BF7A 1MB9A 3D3JA 1O6ZA 1S3IA 1WOYA 2YOFA 3UK2A 1BQ3A 3SYRA 1KYWA 4G86A 5LU8A 3KQHA 1F4PA 1K8QA 2YRXA 1K2VN 3NV9A 4FS3A 3JQ7B 4Y2HA 1JEEA 2HK6A 2P2GA 2QWXA 2FGJA 1LSOA 4R8KA 5EJFA 2X9NA 2FMIA 4RMIA 2OY0A 5LQAA 1F60A 1OSNA 2ZDQA 3NYRA 3VJLA 1XMOB 4AWAA 1OC4A 1DC3A 3LUPA 3ZHQA 1AG9A 3T5CA 3WGGA 2ZZNA 2VN8A 1TM1E 3DM5A 3DL7A 4FXOA 3ZQ6A 1Y6FA 5AKLA 4N8DA 1H3NA 1JX6A 1PT9A 1PZFA 2DPMA 2IHUA 2WIAA 3C3MA 4QDXA 2PJRA 3DLHA 4FFMA 4P1ZA 1NU6A 3B78A 4UBMA 3CG0A 3GEMA 4NV3A 3ELUA 3D3NA 2WPNA 4CRWB 2P6RA 2F4VB 4GYKA 3OLQA 2C9CA 4TKUB 3NUZA 2XGOA 4WCVA 1HDYA 4C0JA 2GUWA 5A62A 5K5EA 4OBBA 4YCLA 2E4XA 4LISA 3C41J 1IIBA 4MW5A 2FQXA 3MWKA 1VE3A 4ZIRA 1Z33A 3V4LA 8LDHA 2I7DA 4BWFB 1N5OX 4WOJA 1ODCA 1SUFA 3D6JA 1KJQA 3BA1A 4IQ8A 2ZBEA 4LYGA 1FTGA 1ND5A 1EVZA 3V46A 5AW7A 1CUWA 3A25A 5CLGA 3GP8A 4OKSA 3IR6A 1NXWA 1FBNA 1I36A 1Z68A 3W4IA 3PEFA 4UVEA 2P3QA 5F3RA 3LDGA 5J2TA 4DCSA 3B9PA 3FSRA 4XE5A 1VTKA 1UPBA 2HBZA 3ESZA 3D8UA 3MJSA 3QYFA 4Q3NA 1EP3B 2RH8A 4X54A 3VC2A 1G8SA 1JLLA 1QPZA 2QI9F 3COZA 4AT1A 4JUDX 4KXWA 1L4KA 2BI8A 5HOQA 1FX0A 1YAHA 1V37A 2ZYAA 5IEJA 3S2UA 2P6OA 4DADA 1HEYA 4KE6A 4MQMA 2P27A 5HOEA 3OQ1A 4S0XA 1PL8A 3SQNA 2OHXA 3UK1A 1M1ZA 3F8WA 3F6EX 5DHPA 5TPWA 3ETHA 1XNQB 4MYTA 5EXXA 1Z4QA 2V59A 3CJRA 3L4JA 1NT4A 4YRLA 5H9WA 1LD3A 3MOGA 5JFTA 2FOXA 2P9HA 3VNVA 3GRAA 1U7WA 5CMLA 1L7BA 1DEXA 1P1FA 3FTPA 4GGOA 4RA6A 4TSFD 4EH1A 2C3YA 4QZVA 5IBRA 5K0ZA 1P4GA 3KKKA 3S2ZA 4LKOA 1DTWB 2PUCA 1G1AA 4B3SB 2E6KA 2PSEA 4BLPA 5HPYB 2QLNA 1QIGA 1H23A 4WACA 5KTKA 3IEMA 4PO9A 3O4RA 2I66A 2ZAYA 3DF7A 1X8XA 3I01M 2P65A 3AK4A 4MW6A 4WCFB 4QICA 1T6ZA 4G23A 1WZ2A 3CB2A 4RM2A 4KQGA 3HYSA 3KPWA 4IIUA 3EGVA 4IINA 3CX7A 4WN9B 2H65A 1JMYA 3FCOA 4ZCMA 3OBBA 1R4MA 5ALJA 5E8RA 2VQ3A 4CMEC 4INZA 4C30A 1JQLB 1G60A 3OPNA 2E7ZA 4CIDA 2ZPAA 3EXAA 2ZU6A 1Y8AA 3MJDA 3M1YA 2VJAA 1AKTA 5SICE 4KG7A 1H94A 3P96A 4BQQA 2IS2A 3N0VA 1YZVA 4DQUA 5K8VA 1SBZA 2ZIGA 1L7AA 4CFYA 3UAVA 2Q6TA 5FLKA 5FBVB 1FLAA 1LXCA 1AZSC 2P90A 1E1QD 2BAGA 3C6MA 4FHZA 5DGCA 3WO0A 2I29A 4D56A 1YTUA 3RQIA 1LBHA 3EY4A 3RKRA 1F8XA 2P8JA 3HKCB 5A9TA 3KETA 3WMXA 1GNTA 3O73A 3ZV5A 3ZIAA 5L8VA 4KTTE 2WHYA 4XVRA 1JE0A 1NXXA 2CJWB 3IKVA 1WXGA 2NV0A 3JZMA 4CLDA 2V0NA 4IMPA 1Z4IA 5CFZA 2VDWB 1MB3A 5AR1A 2GAAA 3JQAA 5ARDA 4C9BA 3MMZA 2XNDA 3JD2A 3DAOA 4KX3A 4RY9A 2ZRIA 1BHJA 1LCIA 4NULA 2PLNA 2VDVE 1WZUA 5P21A 3RVNA 2BDUA 4WXMA 5FTMA 2XE7A 4RJTA 3KPJA 1N2JA 2EBHX 4HB3A 1TGYA 3DD5A 3KJXA 1CUDA 5ADWA 2HA4A 4O1MA 1P0PA 4H7KA 2Z58A 3K6RA 1FP4A 2CL6X 3N53A 4LJ7A 3GJ5A 4BNZA 1CEYA 1YJAA 1KRHA 3RE1A 4I6EA 4A6EA 3LWNA 1VP3A 2O8EB 4EGFA 2GOYA 4AMYA 4A8JA 1QGUB 2WD8A 1OT3A 5AM1A 5CR9A 3ZHUA 4CL8A 3OECA 2HCRA 3OHSX 2FKNA 1G291 2PG3A 3FCUB 1B0UA 1K6MA 2HPHA 4Q3DA 4V0OA 1C5KA 4MROA 1PUIA 1EIZA 4MH0R 1NJ2A 2HA6A 3HU5A 1XCMA 2IP4A 5JARA 3KOMA 4EB6B 1MGOA 3AWIA 3KEOA 4YFVA 2CHEA 1YOVB 4MI1A 2B4YA 3FTDA 3G6KA 5BOSB 5JMWA 4B3MB 4POAA 3DFFA 4XX0B 1EJ6A 3MXOA 1G4AE 4I3GA 3CX8A 3KR2A 3T5DA 1EESA 4HWPA 1XZBA 3AR5A 4ZI5A 4LVNA 1RWPA 2A57A 5A06A 3IDAA 1DFHA 1VDMA 3C8MA 1LWNA 3JARA 4YRRA 5DXAA 1VSVA 2MINB 3AXTA 3NJ4A 1Z06A 4XUCA 4OG2A 2FSGA 3K35A 3O9MA 4EJSC 4DWOA 2FEAA 5KQRA 3G9XA 3IUEA 2REOA 4A0HA 2A8YA 3TE6A 2ZIEA 2DUNA 3H1BA 1R3DA 3ZE8A 1II8A 2JHCA 2Q46A 1G2OA 2OR3A 2O2CA 1GPAA 4UE3S 1BE8A 1OA1A 3WFJA 3MLEA 5E1BA 1U81A 3MFYA 1C9EA 1MV5A 1A82A 2C4KA 2GEJA 3KYCB 2PAFA 2PMCA 5LIPA 1NXSA 3GRYA 5TIIA 4FR0A 4KQ6A 1A7AA 3IEIA 1RACA 1T5OA 2UVPB 4ENSA 3IMKA 5A4FS 1MAAA 4HT3B 1I7PA 5KBYA 5B7GA 2YJ4A 3UJNA 1C8VB 1FC0A 3HR7A 3M6FA 4I08A 5T8KA 1Z35A 1ZQ9A 4RY8A 1SHTX 3PXEA 3GZNB 3Q8WA 4JB3A 3NCHA 3PSAA 5IABA 4MKZA 1PG2A 2NSLA 1E4EB 1KU0A 4UBNA 2GD0A 4RTLA 3BCUA 2NYVA 4KO8A 3N59A 5IT9A 1HBJA 2AFIA 3UK0A 4B84A 2HA0A 3JV7A 4JLPA 1ZCBA 3KHSA 1EQAA 2DF8A 3RF7A 1UZNA 2ACWA 2WABA 3VHLB 1JDUA 4G25A 3LD9A 5EWJB 2ZJOA 2VI5A 1EZ1A 2DY0A 5EL0A 3T35A 4EJSA 2J31A 1ISMA 3CQ9A 3T41A 1KI7A 1LPMA 4I5GA 1B74A 4G89A 3NHPA 3TR5A 1XU4A 3G0GA 1JYEA 3CLSC 3RUDA 4BJHB 3Q72A 4F7DA 3GEEA 1KJ9A 1NONA 1YAJA 4GOMD 1AKRA 2IU6A 1J1ZA 1W0CA 4TLEA 3SOPA 5LL6P 5LM3A 2VJLA 3GJQA 2BM1A 3GNQA 4R01A 3E23A 4LHSA 4MW2A 4DLKA 3BL5A 2I4MA 1KDVA 3R5HA 4JMLA 1ZD4A 4LHYA 2BH9A 1JYSA 1OWMA 4LWPA 4LI0A 3VR5A 2IDMA 3ETCA 5GGXA 4QJBA 3EX7C 4EY4A 1EK0A 2VXCA 2YXNA 5JCJA 3ZH9B 5C37A 5IMSA 5EPEA 2WBLC 1QXSA 3L8ZA 1K5HA 1BXKA 2QPOA 2P62A 5LP6B 1KDRA 4P3KA 3DOFA 2GN6A 4PLPA 2VDJA 4MUNA 2XCSB 3MQ2A 1CQJA 5EZYA 5J5CA 3DT9A 4MV7A 2WK1A 4TVSA 221PA 3X43A 3VQTA 3T4UA 4RTNA 3FZQA 3Q0EA 1XTKA 2DZDA 3D4NA 4HJXA 4NC9A 4TV9B 5AKJA 3UUWA 1O0BA 4MO9A 1Z5PA 4UBOA 2OC9A 3TLGA 1RXCA 3QYAA 3FWYA 1L4GA 4BO5A 4M1QA 2YNMC 1IBRA 3JQCA 4S2EA 4I4TB 3Q6IA 3QQ5A 5JQGA 3FNHA 1ZKMA 2J9RA 3RDPA 4XSVA 4WRRA 4L51A 5KHOC 4M0MA 2H1FA 1KBQA 3DEAA 5DULA 3BKWA 3ZV6A 2EP5A 1FYFA 1WD7A 2AOVA 1JPVA 3E3AA 2AMVA 1E2MA 5EYPA 4D0GA 3F6CA 1M0EA 4QT0A 4DLLA 5J4HA 5F7JA 1YJXA 2R9VA 1MAVA 2XTMA 2XXBA 4G0MA 5AVTA 3R9WA 1QQ5A 3NT5A 5JMPA 3BK2A 3WHPA 1V1MA 5T57A 4MW1A 3ZCXA 3ROFA 3KOXA 4HLNA 2RHMA 3ZDBA 1Z9BA 2VT6A 1C3OB 4QQRA 2ZRPA 5KJ6A 1YB2A 2I6UA 1Y8QB 2O3JA 2EV9A 2I1QA 4MR8B 4PQEA 3T7EA 1ZVVA 1E0DA 3G1UA 1QE5A 1MX1A 4IGFA 1Q12A 5LOVA 1VG9B 4JVMA 4QNRA 2XWSA 3OY7A 1RQPA 4GYJA 1NVBA 2RGBA 3I8XA 2XA1A 1SK9A 3ASUA 3FPJA 3RC2A 1ZH6A 1E6EA 2OK7A 3INGA 3ME5A 3HL0A 2P9EA 2ZUVA 4MQFA 2B3TA 2RHOA 2Z1MA 4ZCSA 4MVJD 3O2JA 1FVXA 1E79D 3OIYA 3ESDA 1V11B 4MA0A 1DIAA 4XZ3A 1OB5A 2GJSA 2VH1A 1E2KA 4PAGA 1GPYA 4GM4A 1H5QA 3IP3A 1Z17A 4D79A 3A1WA 3CVUA 1UPTA 3I1IA 4RH0A 4OYYA 4JI5B 1RBQA 2PUHA 4AP9A 4U3JA 5HZGA 5DIZA 3WIVA 1Q7GA 3JQ8A 3T3IA 5BORA 2JF0A 3D5EA 5AD1A 2WHPA 4OQMA 4EOGA 5I48A 1C4WA 2PS1A 4N8EA 1JDJA 4HSGA 3WRYC 4ES6A 1NJ5A 3AGPA 1BG6A 2Q7XA 2WLTA 1T0BA 2Y68A 3AUSA 1NI3A 4MAFA 3EIWA 4NIMA 2BLNA 3OE1A 5KIAA 4IRUB 2HRZA 2PXAA 2R8EA 5JC1A 1Z07A 2H0QA 3WZMA 5JOQA 4G24A 3NHLA 1PR1A 2UYOA 1M0WA 2NTJA 1N0WA 2QMUA 3Q9SA 3Q3CA 4MW9A 1ZXBA 4R1SA 1I6MA 1ORWA 3IAXA 3WWOA 1P6QA 4HVTA 4FNAA 421PA 2Q6LA 4GI3A 2EEPA 4X65B 2BGLA 1FUYB 3OZTA 1RJEA 4HBGA 2KQUA 3VNBA 1G7RA 3QVMA 3W5VA 4DMKA 3L8HA 1P4SA 4AG3A 4E70A 4OQDA 5EGNA 2QP9X 4N41A 2EX4A 3AEYA 1XJCA 2BN4A 1VE7A 5K3EA 3N76A 3K20A 1RYDA 1POXA 2FI1A 5DCWA 4FHCA 3QH4A 3TKLA 1X92A 4FJ2A 3WLRA 1IB6A 1PBTA 1PR2A 1NUPA 2V6IA 3BWYA 3UMJA 5JH7F 3FA2A 2Z3VA 1MNQA 3TFOA 3C7TA 2X7JA 5DM1A 2IBTA 2YBDA 1YL5A 1LW7A 4Q00A 3NEAA 2E21A 1CUXA 3HBJA 4ZDJA 3UFXA 1CX9B 1SD2A 1EMDA 4H6VA 5IM4A 2P7HA 3GH3A 4OJQA 1NG9A 4IWNA 4YYZA 1BGVA 4KRFA 4IFBA 3EXEB 3QXCA 3NHKA 1JR3A 1KQPA 4TTVA 5FPQA 3R7WB 3TCXB 5C7LO 4F6RB 2PSDA 3T34A 4A27A 4IIYA 4C3VA 1E61A 2XSZA 4Z6KA 5ALSA 1PJ8A 3TQFA 1VBNA 5CD9A 1MFZA 3LPAA 4MUBA 4CU2A 2JI9A 2WYUA 1G41A 4X92A 5DBEX 4ZI3A 2QZ4A 1KO1A 2VZEA 1JBEA 4GPIB 4ZYVA 1WRBA 1ZOPA 1T6XA 1E3MA 3BFVA 5KNDH 2Z2YA 4CN9A 1SJ9A 1SHLA 4EJFA 3CCFA 1F9EA 2JJMA 1NVGA 3FSGA 1O89A 3DFKA 1NAIA 1DXQA 1YR9A 2WIKA 1CNFA 3CIFA 3N70A 4JNKA 4W5JA 4A6XA 3TPFA 4EEZA 4F8JA 3OHMA 2F8SA 2DFKB 2BZ0A 3T0GA 5FWNA 2EG9A 1WXFA 2BFCB 2DUJA 2A9OA 3G7UA 4WECA 2HDOA 4F9GA 1GILA 2NYRA 4PO1A 1XN1A 4IWYA 3SBXA 3U16A 2GZDA 1ISIA 3N7AA 4B8ZA 1O8BA 3TS1A 1SVWA 3KS9A 3QP9A 2HQSA 1WX1A 1RTKA 2ZIVB 3AUUA 1T2AA 3BA6A 3PYLA 5AW2A 4JXXA 1P5ZB 3I23A 4AWXA 4YCNA 1JU9A 4P35A 4D6XA 1J8DA 4MVJF 4B3RB 4L8GA 1I2BA 4MNTA 2PPLA 1AKNA 4J0EA 4JJ7A 4NZMA 1HE1C 2B37A 4CU5A 2ZSAA 2BGRA 1NMZA 2P0EA 4HGZA 2J87A 4TQAA 2B94A 2HCTA 3VU9A 2JLVA 1DEKA 1KMMA 3ON5A 2JI8A 3P9QA 3OD5A 4C01A 4ARSA 3AR8A 3O8OB 5FJIA 1UAAA 4JU9A 2J3MA 3UZUA 1Z18A 4F92B 2JAOA 2GZ3A 4ZODA 4EIWA 5KMGB 4EENA 5AJHA 4OUDB 4H77A 3QVXA 4RD3A 1AOXA 2PBFA 2X7HA 3D1VA 4DSUA 4BQOA 3BTOA 2FPGB 3LWZA 5DHRA 2DBVO 2D1YA 3CF2A 4BNJA 1YFJA 1CR0A 4TYQA 2F67A 4L8LA 5BN1A 5CEJA 4D45A 4CLRA 4JS0A 1FYWA 2EJBA 2EGGA 4PONA 2IYFA 2YWBA 3C14C 3DCNA 3UQZA 4NYIR 3TRJA 1R5JA 4QD3A 4LYFA 3FHTA 5CVEA 3AZOA 2ZRHA 2H9AA 1GAWA 1XQ1A 4YT8A 4C05A 4XARA 5CCEA 1RJ9A 2RHDA 4CM7A 2J3LA 2G0TA 3G2JA 4US2R 2EBUA 4FMBB 2OBFA 4W6ZA 1E5DA 3REQB 4A26A 4EQZA 1QBKC 4BP3A 2GPBA 2IYQA 1CC1S 1JI0A 3BE8A 1KVUA 1GGNA 4JP5A 4JU8A 3GMTA 1RWQA 5E1OA 4JDPA 1S8FA 2H1IA 3KVNA 2J3EA 2ZG6A 2YW9A 3GT4A 4XM1A 4K87A 2Q5HA 5E7QA 3CSUA 2I67A 1Z0SA 1QWSA 3DUFA 3H1AA 3KWFA 3LBNA 4IY1A 1F17A 5IXYA 4FINA 5JATA 1EK5A 2NZ8A 3F9RA 4G1MB 5C18A 2BJWA 4LSGA 3ZY3A 4DAOA 5CFNA 1WD5A 4P0PB 2NT3A 2TMYA 2VSNA 3KUUA 1LV7A 3A27A 1KTVA 1KKUA 1S2GA 2XRFA 2ZWMA 3EWIA 2WA2A 1DDGA 3OQ6A 2AHRA 4WCDA 4B4OA 5BW4A 3FPFA 2BEVA 1Q83A 1SO8A 1V4VA 1W1IA 1BVUA 2J8ZA 2V54A 4R40A 4RGBA 4EY8A 2PX4A 2AOUA 2ZRJA 4H7JA 3OPYB 4U6SA 4CI9A 1F8FA 1U0SY 3IXQA 1DTEA 3G2KA 3AKCA 3HRHA 3QX9A 1M2WA 3GVPA 4GPEA 4H7EA 1H0RA 4RENA 3UC9A 4XLZA 5AP9A 4GQIA 1H3EA 4MW0A 1IU9A 1TT7A 1VPEA 2VUUA 3GD7A 2MT9A 1M8JA 4HI0E 4BNYA 4BVEA 4CETA 3HUTA 3LQYA 3LLCA 2YXPX 4AJIA 4ARBA 3AX6A 2RHBA 2C4UA 3I3OA 3ILYA 4N39A 4YJGA 4IIXA 5J2UF 1D1QA 4BV3A 3ESRA 3PUWA 5FLYA 3QA9A 4CMKA 4IS3A 3L1IA 5GZ1A 4NDNE 1E3SA 3FW1A 3LLSA 3THWA 1DAEA 2YJTD 1U99A 2EBWA 2GILA 3R0ZA 3T1YB 5IMBA 4FM9A 3JASB 1LUAA 1QIKA 5A4KA 1NNSA 3V6LA 5CB4F 1XLVA 1YB6A 3TNLA 4C0LA 3LUHA 4BVHA 4IDPA 1AV7A 3GUCA 4AKIA 1GOTA 3EC2A 5EEHA 4ZO7A 2CLHB 1XGKA 2FP3A 2OCDA 4LOIA 4XIYA 4HH4A 3SXPA 5L3VA 1O0CA 1T2CA 3NH6A 3PNBA 4LK3A 4RIGA 4TXMA 3TLAA 3W2GA 1SC9A 1S5PA 1SG9A 1YJ5A 3SP1A 4CDNA 4D7AA 2DLDA 4HGNA 4EF6A 3IJ5A 3QFTA 4R83A 3GLFE 3MWJA 1AHIA 2AZDA 4KQHA 4WWHA 4ZAGA 4BEBA 2QAIA 1PRYA 1TEZA 4M21A 3IMGA 3GHYA 1K8ZB 3MFQA 4MAAA 2JCSA 2FWBA 1KFJB 3VYWA 4C5AA 1T8SA 16PKA 4ZN6A 4DUPA 1K27A 1H1TA 2IYTA 1EE9A 2AMFA 1KVRA 1T36A 2F1RA 2PGAA 2Q1SA 1S3FA 3C43A 3FRIA 5HJ5A 1P2DA 1F20A 1HFWA 1VSBA 3T95A 5DASA 3PC8C 5GM1A 3GJTA 2FZKA 1JJ7A 2E4VA 3GJ8A 4YRBA 4OLBA 3ZVKA 1PG0A 1VBFA 4P34A 1B2RA 4Q66C 1FPQA 3E9CA 3JSXA 4MRSA 4E09A 2A6PA 2G0NA 1Y3AA 2G1KA 1T3TA 3E8XA 2FPXA 3IPRA 1VP9A 2XGGA 1AXEA 2ZRFA 4YH1A 3ZWKA 1FZTA 3H9GA 3DKRA 1PHRA 3QW2A 4MEBA 1QOQB 1XF1A 1M6EX 1HZJA 2EQBA 1HR0B 3G2HA 3IEUA 5EVCA 1UK9A 3UJ8A 1RZVA 4BN4A 1QV6A 2C54A 2F1JA 4LHWA 4FFPA 1N7HA 3RH0A 3K4HA 5A9SB 5TPWB 3NTQA 3E5HA 1KI4A 2I6GA 4LOHA 2FSHA 2J6IA 4DGQA 1RBYA 3JCZA 1QU3A 2FPRA 1ENYA 2ZYDA 1G2PA 4Q4DA 3I6QA 2O8DB 5DEOA 5HDQA 2AF3C 1JXMA 4X3PA 1N9KA 3DHEA 3K9LA 3TIIA 2RCNA 3UCXA 2CF6A 4TVBA 3C1UA 2XUOA 1ESZA 5BNIA 2B8WA 5D5HA 4ZQFA 1SEPA 1AE1A 2Q6OA 4G5QA 4HQRA 3JQBC 3PGXA 2VJMB 2F3SA 2V1XA 2OENG 1L5LA 3IERA 2P9CA 1KORA 2Q6IA 5DW0A 4GRIA 1W73A 4BLWA 4OMDA 3DBRB 2B36A 1SOWA 1S3GA 4B2LA 2E4WA 4FU0A 4CMGA 3RS4A 2FCAA 4MZDA 3G17A 5J4YA 3DHWC 3G2NA 4P33A 2I78A 2X0IA 2XIQA 1JQJC 1BFDA 1UAGA 1Q0QA 1ZJ4A 1IBKB 1TEXA 3WGKA 4P0QB 1SCUA 1GCOA 1H0SA 1ETHA 1JQ5A 3FY4A 5AI0A 3QVOA 3UOAB 1ZG3A 2N1BA 4EX6A 2UU9B 2ATIA 2NU9A 3EMBA 3DOEA 4A0FA 5ERYA 2BCJQ 2ZBPA 4Q93A 3KT6A 5G41A 4CG1A 3SHOA 5H3LA 3TB6A 5I9BA 3LA6A 1KWKA 3A0RB 3TI9A 1Z4PX 3TAHA 3UV3A 3OCZA 1M6YA 1UBTS 4HXYA 4NFHA 1DRUA 2K7ZA 2POCA 3D7SA 1PLJA 1R0SA 1ZK1A 4GOOD 4E3ZA 4MHOA 3R3YA 4B4UA 1OQAA 2MSCB 2R97A 3AKEA 4TPKA 2J4CA 3ODPA 1U8XX 3KQUA 3BRCA 3UYKA 2FSIA 4HQFA 1FUKA 1HT2E 2Q1TA 1XXLA 4MUEA 3OJWA 4II3A 4D2IA 1WBBA 3W3AD 2B4QA 5JDCA 1IATA 3SU8A 1W2WB 4S04A 4EBBA 2ZRBA 2ACVA 3OOWA 2ERXA 4F9TA 1DLIA 1FQOA 4HDKA 5HQ3B 2OCYC 4YA6A 1RPNA 1WUYA 1UJMA 5FR1A 2AKYA 1TUGA 4B6OA 4Y1FA 1XTIA 1JILA 3DE5X 3EVNA 5AOAA 2XVYA 2X15A 3HA3A 5E9WA 3QVGB 4HDNA 1QCDA 4HV4A 1XKTA 1WUHS 4CLHA 5IPFA 1CY1A 4LZLA 4KR9A 4HR7A 2Z30A 3P2JA 1YRAA 5KC9A 4UAUA 4M9XA 1RE0A 4R7ZA 3IBFA 1Z45A 5DTJA 4IMIB 4CI0B 1AKMA 3C6XA 1H65A 4FN4A 2G67A 5D7NA 2JLWA 4HKTA 1D2RA 2JATA 3UAYA 2FJUA 3QK7A 4WY5A 2NACA 3SF8A 2EKDA 3SC2A 2AG8A 4JT2A 3PD1A 4YVFA 2HMWA 5FAKA 2RGNA 4RVCA 3IKTA 5G4LA 2IHBA 3OOHA 5F2EA 3V4PB 1B3BA 3STVA 3W5BA 1MN6A 3WBFA 1X7ZB 1UBNA 4LW8A 4Q9IA 3ZW8A 3BDIA 1HYEA 1ZZEA 4JOSA 3PNKA 1MOPA 4RPLA 4D8WA 1XQ9A 3BGIA 3N5KA 2B2XA 1BDJA 2EFHB 3PP8A 4XM0A 1TM4E 5LZ7A 3L46A 3A4YA 4C88A 2GCIA 2PMFA 4NICA 1E3WA 1XPUA 4EB3A 3GELA 2CL7X 3BMNA 4KO1S 2PO5A 4I9NA 1XTTA 2XOKA 3HU3A 4ACAA 3UAGA 2I8CA 1JSCA 1E8NA 4IUYA 4CM9D 1S89A 2O8VA 1AKEA 3ZHVA 3LHIA 1V3TA 4NE7A 1L7VC 2I03A 3GDWA 2XMQA 2ZR7A 2GBGA 4WESA 3G0IA 2QJWA 4H59A 1A9YA 1H22A 3MIZA 5K3DA 5BVHA 3ZU6A 4IGEA 2EZTA 4YCCA 1X39A 1SUSA 1VMKA 4ZVUA 2DBQA 2AJTA 3V48A 4DIMA 4L76A 5DI3B 2R8RA 2J07A 4F96A 4YCSA 5GOTA 4D4GA 1NUSA 2CYBA 4WFJA 4AJPA 1LLFA 2NOAA 3O0DA 4JP3A 5DRYA 4WZBA 3RHZA 4DMUB 3QNMA 2EQAA 1FFDA 2C7VA 2IUYA 4ZT6A 3TB4A 1OC2A 3NW9A 4QHTA 3CTMA 3NJ8A 5SYMA 2P1ZA 3RS8A 3TM5A 2PFSA 4NBKA 3R5TA 4P4UA 5KX5A 1F3LA 3VSEA 5FB3A 1Y48E 5T4FA 1R8QA 2P68A 1OLSA 4PG6A 2FW8A 4J7AA 4Q7EA 4Z99A 2FUNB 2G0AA 3KUDA 4WJZA 3WBJA 4YLYA 1Q3KA 4Q9LA 1V8FA 4FP9A 4TLMB 5JSQA 2RBKA 4UHEA 4JJGA 3A1UA 4XYEA 1YBHA 4FEGA 1M1YB 4QT4A 3B20A 1OREA 4W9NC 1RLUA 5FWAA 4KPUA 3ONVA 3TTTA 1W88B 4EHAA 4EJ0A 2A3NA 2VKQA 3A3YA 1MJHA 1V48A 4MLCA 2I3BA 1TCVA 1I24A 1MT0A 1PTKA 1KAEA 2PZ8A 5JPIA 1QK3A 4LAFA 4ZEMA 4E15A 3ZCVA 5CGZA 1KJJA 4HNHA 2D2XA 4FD2A 8ATCA 3GBPA 3HO6A 2H07A 3ZZ1A 2PUBA 3I9NA 3NR2A 2HH9A 1B4DA 3E5RA 5HKKD 1IXRC 3O8QA 4KLNA 1W48A 3KXIA 4DDMA 2D3TA 2UDPA 4O2RA 3V7YA 1IUOA 2R6HA 1TAHA 2BEWB 4EFKA 5I8ZA 2PUTA 2BFBA 1JAHA 2QMOA 4HAVA 4L9AA 5JWOA 1EWQA 4DUYB 1JMKC 3FAKA 1T13A 5REQA 4C2TA 3NDBB 1DIRA 1DINA 5SZHB 1KY4A 2A9FA 4PX2A 2XYVA 1QIJA 4ZV9A 1NC1A 3P9XA 1GQSA 2PL9A 1BXGB 1QR2A 3CPSA 4AKEA 2NPOA 1EIWA 2EGHA 3DMNA 3FOZA 1YKSA 2CCGA 4X7BA 2OK8A 1EVQA 3DR5A 4QU0A 3DBLA 1L7RA 2GNAA 5J59A 4C3ZA 1VDZA 5IC4A 4MPJA 3MG9A 2XT9A 3DBIA 4WZAA 1GGJA 3UKDA 3EDCA 3GVCA 5KSWB 3WS7A 4TS3A 2Z08A 4B8WA 1VCMA 1ZH8A 4US1R 5PGMA 1H42A 2QQ5A 1U4NA 1FSPA 2Q6KA 2QTLA 4AN4A 5BV0A 1IDOA 2P3LA 3R5SA 5LBUA 3RM3A 1DL5A 1SHZA 2RGRA 4RKQA 1EAMA 1N2IA 3VC3A 1LX6A 4S1PA 2PMBA 3K4PA 2IJGX 1BC5A 4M88A 4LXUA 1U7TA 4PFKA 4X91A 4KGVA 3HM2A 4Y1RA 3V1YA 3JQ9C 4B82A 4DBZA 1JDPA 3ORQA 4N9QA 1BGXT 1M73E 2HTFA 2E89A 3B8EA 1RWMA 4B34A 2R68A 4TYPA 5GZ3A 1EFAA 2IWRA 4L6AA 2ZIUB 1COZA 4G26A 1Z38A 5IXSA 2W2XA 1W36C 2ZS8A 5HG0A 2L19A 3ZHBA 1EGAA 4WK2B 3ZY6A 1QRUA 2ZI9A 4IIVA 1ABBA 1XRMA 1LEHA 3M6XA 2VPTA 5KU7A 3DCYA 5DTMA 3OIVA 3BFXA 5AOVA 3UFBA 1X7HA 1CEXA 3JTMA 3PGJA 4ZI2A 3ZJTA 1YMUA 3OCXA 3WFIA 1PYGA 4GECA 2IXAA 3VZBA 5BQ3A 4ZKEA 3WDLA 2XI4A 5IDYA 3VO1A 1DQSA 4PWYA 2QENA 3U1BA 5I7SA 3MN1A 2WYVA 1AA6A 3V4SA 5DPMA 1TKBA 4DEYA 1G21A 4FNMA 2SHKA 3OURA 2W7TA 2WWYA 5K1ZA 3HH8A 1KDOA 1MRNA 1RRPA 3GA0A 3M3PA 4RCVA 4GI2A 4O4HA 4R1LA 5IU6A 5JUWA 3TUZC 1H0KA 1XRSB 3RHFA 1RWBA 1A9OA 4KLZA 4LZWA 1CEQA 4X90A 1CJTC 5EFZA 2GRUA 2BFMA 3I5AA 4MCAA 4DWVA 3I6YA 2CLCX 4AP6A 4BNHA 1PK9A 4FHFA 3HG7A 5M34A 4Q15A 4PZAA 5K0JA 4N5LA 5DBFA 1IRIA 3W1VA 1XC7A 3W90A 4TRJA 2YWHA 4V0KA 5BVGA 1PFQA 1WXHA 4H15A 4LDJA 1W9MA 4P2BA 4QRDA 1LY1A 3GK3A 1EM6A 3OM9A 1BHSA 4F4JA 2W2VA 2PE5A 2R6FA 5CJJA 4XQ9A 1I2MA 3DO6A 4LGCA 4EZEA 5I4IA 1JEYA 1OOEA 3D2CA 2NADA 3NI2A 2YFHA 2VYVA 4F60A 2JFFA 1NVMB 4R68A 1GTJ1 1U8YA 4FOTA 1GYPA 3ENWA 3NC0C 1UP6A 4H9GA 3HSSA 2CN1A 4R41A 1UMBA 4FYMA 5EKSA 1ELOA 1YQGA 2PRKA 1M1NA 5DOVA 4QELA 2NXJA 1SCNE 2WVAA 1G7SA 4Y2YA 3L0IB 1TO2E 3FI0A 3GLIA 2R7MA 5LYJA 4CXMA 1NUUA 5FUYA 3DMTA 5T4BA 1JRLA 2AZMA 1N75A 1AN9A 2HJ9A 4U02A 2R4TA 3PD0A 3SC4A 4JXJA 1AB6A 1PE0A 2HDWA 4IDCA 3K32A 4WXRA 2PVPA 1MO5A 3BG5A 4YAFA 2QX9A 3ZWOA 5IZCC 1M2OB 3RUAA 4ACBA 4TSKA 4CF5A 4JXZA 3ZG6A 2EBFX 4HLCA 3IAUA 1JS1X 4GR9A 2VHQA 1R4NA 3M9LA 4U0JA 4ZHQF 1XK7A 2QM0A 4XWGA 1EK2A 3KX2A 4EY5A 4UJ3A 2IUUA 4ZU1X 1I6WA 4M8NE 2DTDA 1U02A 2JG3A 1QK4A 4FFBA 5FWXB 2DHDA 3LCVB 3VDMA 1K89A 2X5XA 4G5XA 5FTJA 2RJ3A 1ZRMA 2J09A 1W25A 3EQ2A 1J5EB 1FYVA 3FGOA 3ZDZB 1C1YA 1PGQA 1H8EA 1RLIA 1Z2EA 4AJOA 4QBTA 1YZKA 2BFOA 1NP6A 3U60B 2YMQA 3TVYA 1W5FA 4NSNA 4MB2A 3O8CA 4IUBS 2V7XA 1QYVA 4IGAA 4L75A 4AXXA 1JLKA 1R15A 2D8MA 1JE1A 2H51A 2XYHA 3DZDA 5EP4A 2PA3A 4GPBA 5JBQA 2EDCA 4Z4QA 4CEJA 2IX3A 3BD7A 5WRFA 1QP8A 4N54A 2FY8A 3PD7A 1CHNA 2VUHB 2XMZA 4MWCA 3BBLA 3VYSB 2IXBA 1KO4A 3N8HA 4BRZA 1NNI1 3KSZO 5DLQC 4TZ0A 2BR3A 4NDAA 1B73A 3DAPA 3PS9A 2R85A 4JBNA 5NLLA 1M6VA 4KR3A 3ZE0B 2HF7A 1D5WA 4B45A 4BO2A 4MR7A 2RE8A 1B6SA 1LPOA 1T9GR 1U28C 2W2LD 2GX6A 2PFKA 4R51A 3NXKA 2XNSA 1BYIA 2O14A 3NORA 3NAMA 2J9FB 4N8SA 3WL4A 3E61A 4HQLA 3L06A 1WNFA 3GRCA 3HVJA 4JMPA 2OXRA 4ONEA 3R9IA 4J0KA 5HQTA 4L1KA 1SXJA 5CCBA 1XEXA 3WV5A 3SHFA 4BBPA 1XDGA 5IYZA 1IPEA 2AJLI 4WKGA 1O94D 3ZDXB 3FCYA 4IICA 2B8TA 1NJ6A 4L9SA 2PKRA 3TOSA 2PBZA 4J4HA 3UWKA 1SXGA 4KWCA 2HK8A 1G18A 1ID1A 4ECEA 1Y8ZA 5JZVA 1JDBC 3P19A 2PNFA 4I66A 1LSSA 2DVMA 4KUGA 2OQRA 2ZT5A 3IUYA 5DTRA 4AS3A 3R40A 2W90A 1O7JA 3OQIA 3HA7A 3KD2A 1F1BA 1GSAA 1I6LA 1YC2A 5CPFA 5IULC 3EXG1 2NMVA 3EFOB 2CXNA 1PLKA 1K4KA 1U0GA 3GR6A 3QFFA 1XN4A 4NAHA 4BO4A 4CMJA 3RAFC 3DM9B 4ED9A 1G64A 4BQIA 2QQFA 2NIPA 3C3JA 3FB4A 4UTVA 1USVA 4LQDA 3AZPA 3MQFA 3TLMA 2V9CA 3JD4A 4QUAA 5IC5A 5HKOA 1ZW6A 1B1AA 3HEBA 2P78A 3L6UA 4TWAA 1T8TA 5A71A 2RIPA 3DLAA 3WGMA 1Z6YA 4XJTA 3LBYA 1C0EA 3OA2A 4MRNA 4Z9XA 5A0TA 3NVAA 4ZMRA 1FIUA 2XMPA 4LKRA 4H08A 1T4GA 3RTCA 4AD8A 4DR2B 3DVRX 4FMCF 3KSRA 3HXOA 1W94A 2YL2A 4U2FA 3UN1A 1K7XB 2OVFA 1SUWA 3W4JA 1TMGE 1ARZA 4RVOA 3WMRA 3NGMA 3JYHA 5C32A 2AQ8A 1WXDA 1P2VA 1X9IA 3OD1A 5ED0A 4B76A 1RKBA 3RVSA 2Y2VA 3UG7A 1KKLA 1QO0D 2IC5A 3L6BA 4HZUA 4LMBA 3RASA 3V9AA 1G8KA 5I9IA 1GPDG 2CHUA 5D1NA 3RRNA 4EY7A 3CVYA 2J85A 3ANXA 3NNSA 1QV7A 4RY2A 3BWDD 1TA0A 2X13A 4PAOA 3QLUC 2VNKA 2VTBA 4YR7A 5C51B 1T2UA 3T7TA 2GQ0A 4MEJA 2WW8A 4MIKA 4E2ZA 3OEWA 5DN6D 4G37A 1BJTA 3AUYA 4N7BA 4S1TA 3OU6A 4XUEA 4LZZA 4BFLA 2QNIA 1RZ3A 1LJLA 5TEWA 1SQFA 5DZSA 5IAJA 4P80A 3GJ4A 3VA7A 4CHGA 3E7WA 3OZXA 1R4ZA 2D4AA 2GD1O 4OIMA 4TWJA 5LXTF 3RU2A 4KXYA 4HDCA 3VTAA 2JLQA 3LTEA 4IFIA 4HNRA 4ZQEA 4N5MA 1FDVA 1ZQ1A 2DX7A 3DMYA 3VHXA 3L77A 4GM1A 2CVZA 4YAGA 1GEEA 3G5LA 1GFZA 2QY6A 1BW9A 2WUWE 1QHHA 3JSAA 4HFJA 4UFOA 1XHFA 3L1VA 1VMAA 1J33A 1E4OA 2BGNA 4DFDA 4R0MA 1WDTA 4PZLA 3RIMA 3WYBA 4RTRA 2Q0XA 5G3YA 1EAYA 4HLUC 2QP4A 5E2AA 4HTFA 2ZE8A 3KRTA 2FK7A 3QX8A 2Q5FA 4BMXA 1X7XA 5IAOA 2FDCA 1C9YA 4Q1BA 1VBKA 2XE4A 2O6LA 2PU5A 4LMAA 1YR8A 1MIOB 1D3AA 1FE8A 2QLBA 2GEUA 3QJYA 3ZJUA 3GLRA 1N92A 3QXXA 1T4BA 1X8LA 3S2SA 5CB4B 3JX9A 3WAJA 2J0UB 2H7VA 2R1TB 1FRZA 4YRTA 1J9ZA 2FB9A 4K81B 5CXQA 3VV2A 2Z8YM 3FBTA 1P61B 3QELA 2VK2A 5B6PA 2ZYTX 4KLCA 2V3CC 3RS0A 1QOPB 1UXGA 1Y1QA 2BV3A 2XWBF 2Y6UA 3LGXA 2NP7A 1NURA 2O2EA 4C87A 1XTPA 4DLAA 4KQJA 1FFBA 3WV4A 5K4AA 3LQ2A 1LPAB 3DAYA 1TU0A 3H3JA 1C9DB 2JB9A 4M9ZA 3NTVA 4XA8A 2EJUA 3DL2A 3Q9UA 1O95A 3VMMA 1E2UA 4AG6A 1DC6A 1XRLA 5I8WA 4H31A 1QP7A 1Y7LA 2Q4BA 4TM8A 3L0OA 1PJ2A 5B1DA 4A9AA 2C4TA 3GGSA 3R4CA 2HIAA 4Y9DA 5C80A 3K0SA 3NONA 3TMKA 3VNSA 3D7KA 2QYOA 4REQB 3K2EA 2JH9A 3FH0A 4IH9A 4JUFA 3PLNA 4DC0A 2OWDA 4X9XA 3H99A 4HZIA 3CYFA 4YRDA 3SZGA 3H6KA 3FZYA 2VR1A 5ALVA 5LA6F 3T7KA 4LFAB 1YK0A 1EFRA 3SZ3A 3V55A 4KH0A 2UXDB 1N8KA 4JD5A 3HC7A 2GHQA 4URVR 4MQ5A 3UK6A 3AF5A 4R2WA 5KO2A 2WFAA 2RAPA 1I5RA 3FFTA 3Q2IA 3BMOA 5FI0B 1ZGBA 3EB9A 3GJ3A 1D2HA 2CNLA 1W59A 3I09A 3KK0A 3MBOA 4JHLA 4YV7A 1CZHA 4D82A 3ACDA 3ZWQA 4HWKA 4EKEA 2QL7A 3EDYA 4YAOA 3EGEA 3IBGA 4H27A 3MXTA 4IYJA 1EEHA 1RPAA 3D6MA 2WMOB 4F3KA 1IN7A 3N86A 5IHXA 1Y4AE 3DNMA 2XUGA 2FEWB 4RJKA 4NCAA 3KBBA 4C2AA 1ZUNA 1H3FA 2IDKA 3I62A 1U3WA 2FPIB 3AG5A 3RUPA 4B81A 4YTEA 1CRPA 1JW9B 2WJVA 1UPXA 2ZS7A 3KPYA 2IU4A 4HNAA 4O2AA 3RVQA 2JARA 3T12A 4AO6A 3B8HA 3HUUA 4KYTA 4DW8A 1ZESA 1IPFA 3F8TA 2C8JA 3EA5A 3MB5A 2NO7A 1K8YB 3I2IA 3M82A 1WR8A 3DR3A 3JZFA 2OO5A 1KYZA 5ADVA 3RSZA 5JSYA 4I50F 1IONA 2VWHA 4ITRC 7REQB 2I8AA 3D3WA 1RQNA 4A8TA 1NI4A 1N25A 3WL8A 1TNDA 4V0LA 4C4AA 1VA4A 4RZ2A 1Q1GA 1XYGA 4GSLA 3ZZMA 1UKEA 1HLFA 2ZUWA 3PRYA 3WWEA 5HIMA 1F38A 4HBZA 1N34B 4L78A 4PYQA 2F3QA 3GIDA 3SYLA 4TWIA 3TTYA 3CKYA 4DSTA 5HM6A 3EEQA 3PC6A 2WD9A 2BMDA 4TTJA 3VYTB 4JYAB 2A1UB 2PRIA 1CUJA 3L93A 4BVAA 4NQRA 4O4LA 1DV2A 1QHEA 1NASA 3QE4A 1KEZA 3IA7A 5F9MA 1PN3A 3L8YA 1FK8A 1MC8A 3X0DA 3FPLA 4D80A 1KETA 5HFJA 4R8RA 4PYLA 2C84A 2DOKA 4HEJA 4WGFA 4V0SA 1V16B 4I9GA 2FQQA 2J5RA 1ACMA 2FA9A 3BTUA 4KEAA 1RNLA 1QUEA 3IHWA 1UXHA 2HMVA 3BFKA 3OPQA 1GLNA 3D0QA 1L5HA 3CGGA 1JYFA 3PQ7A 2CFTA 3CWCA 3B6JA 4NU8X 1H1LA 2NN3C 4DQKA 1ZH4A 3G0OA 2CKDA 4RTMA 2YS7A 3OEED 2IYNA 2ISQA 4OQNA 3H1PA 3FZEA 1SR8A 2AKAB 3PQEA 1LPBB 1EXNA 2A86A 1LPPA 3IAM6 3O1IC 3Q3IA 4M1KA 5K3FB 3WQSB 2GZSA 3IOEA 1U80A 3IODA 4IHKA 4L74A 5L7YA 1Y1KE 3LKDA 5TQ0B 1QFJA 3TL2A 3JTEA 4Z4CA 2GZAA 1TLLA 1WDMA 1ZNZA 1J2UA 3ICOA 3IS3A 1F48A 1WP9A 1XLWA 2DUMA 2R6JA 2IPOA 2DKFA 2REBA 3JQFC 3JVVA 2X5JO 4HWOA 4IPTA 4ZOLF 1E60A 2PSFA 3WGHA 3IRUA 4AF6A 2ODAA 4AN0A 4E4TA 1QPBA 4ITUA 2JFWA 4EG7A 1P7VA 1DHRA 2YZNA 4MHTA 5CBPB 1LGYA 2XUZA 4GQBA 4TKVB 3NBKA 4JBIA 1O57A 4LHVA 4M7RA 4MGKR 4IXTA 4JC8A 1FUUA 4IKOA 1PFVA 3IIEA 1GCAA 4C4ZA 2VYFA 4CLOB 2ZJ1A 4AF7A 1RBZA 2PD3A 4TM7A 4EGSA 3KJEA 4J0JA 1GKYA 2Y2UA 1F1JA 4RHCA 9GPBA 1DBSA 3FDXA 1ULZA 1TPZA 5E9QA 3KYIB 4PRZA 5FO0A 1HNWB 2BKEA 3FHJA 1ORIA 1C1XB 5B3JC 2CL0X 4KCGA 1XEFA 2YCBA 3JW8A 1JHOA 4UD6A 3X44A 4C43A 3RCBA 2BSAA 4FTWA 3HBFA 1JECA 4KB5A 5DM60 3OIDA 5K8TA 3FUUA 3ZDEA 3C15C 4JWKA 4PC1A 1RAHA 3T52A 4XGIA 5JE8A 2C3MA 1Z6AA 4EG5A 5U1PA 3PEEA 2XECA 3R0VA 3RAEC 3F49S 1GIAA 2G9RA 2OILA 2QJTA 3DWGA 2CEKA 3M0EA 4GR5A 1X80B 4IWXA 4LK2A 1Z5ZA 3I45A 3IA2A 3GRUA 3IVCA 2BUCA 2C7QA 1K4YA 4ZU3A 2OYSA 4QOIA 5JXIA 1I5OA 1T8WA 1QYDA 3BB1A 3MNFA 3PBKA 3WQQA 4J0DA 4DQLA 1U8TA 1H6BA 2RHHA 2IHZA 2X86A 3FR7A 4N65A 3HLTA 3WYFA 3OCJA 4BRWA 1AKWA 3H7AA 1QANA 5AK5A 3TVTA 3AJRA 3IT0A 4WXPA 3DGFC 5A3SA 4MTCA 5D85A 5J47A 1PJ4A 1P9OA 4W4TA 2ZZMA 4G01B 1YWGO 5ILQA 2SBTA 3RS7A 1I13A 2YRWA 5JTTA 4ZZ0A 3O3CA 4CT5A 1I7NA 1BWQA 3WQBA 2ZI5A 2GHIA 4P81A 1A7KA 4F5WA 4LDRA 3AKZA 3VR4H 5ESRA 4ZOBA 1G3MA 1TECE 1WXEA 1U2DC 5CDSA 1VMDA 3VH3A 1E2DA 4N6NA 4PS1A 1JALA 4WOPA 3ABQB 4REMA 3V8QA 1I7QB 4L4UA 3I1FA 1QB7A 4DIUA 4B6GA 2W58A 5ILGA 3FRHA 1U90A 2WTAA 3UWDA 2JGEA 2VL7A 4W5TA 1K66A 4PCVA 3P4YA 4KZPA 4K6OA 2TRSB 1KY5A 2WF6A 1PGNA 4FZVA 4BL5A 2AR7A 4BJ3A 2J0VA 3VSAA 4U39A 5B3LA 1D4AA 5AXAA 2JGNA 2X19A 3SQOA 4M0DA 3IFSA 3OTWA 1E62A 3HE3A 4LVCA 3UTCA 4JEHA 3VJKA 1HDZA 3I9V1 4JB0A 2UUCB 4M2LA 1W85B 2B83A 1ATZA 2YW2A 2ZQ5A 1WHSB 3LWDA 2Q3FA 4JJ8A 3JQ9A 4MGHA 2C5FA 1A9TA 3A05A 4RLHA 5K7SA 1H4TA 2A0FA 4MGEA 2NG1A 2QW0X 3T7IA 2AE1A 3GVIA 4C7JA 1KAMA 4XDYA 4CG2A 4N5DA 1GG9A 3OPVA 3KQOA 5CIWA 1Z6GA 3V97A 4EVRA 2WE7A 3WOHA 2DWPA 4MGYR 3TRHA 3ZXSA 2BZ1A 2ET6A 3BE4A 5CA0F 2CXTA 3T7SA 3IE1A 2UVPA 4KBGA 3JAKA 1G17A 5DMHA 4J7CA 4WE3A 3WYDA 2XDQA 1D0SA 3C1AA 2V65A 5KNDD 3FBWA 2JKZA 2FPPB 3V42A 4IX1A 1WPGA 3IT3A 1A04A 1PT8A 4EKIA 1QHXA 1ORHA 1DQZA 4X7RA 4ZVQA 1XHEA 4JR2A 4R5HA 2QAGA 2WG1A 1MKYA 4FW8A 2DETA 5B2FA 4LV5B 3WB9A 2ZI4A 2Y92A 3IUSA 1PQWA 3A6KA 1LW6E 4NEHB 3H9UA 2XKKA 3AHDA 2JJ2A 4DV7B 1U6KA 1KJYA 3INYA 2GRJA 4BU1A 6AT1A 3NBXX 1TW2A 2QP3A 2YHIA 1AKVA 4D3DA 5IKXA 4M3NA 3SZUA 3MMXA 4ZRDA 2I7VA 5K4HA 1NXOA 4GC5A 5KYTA 4DQVA 2JI4A 4TWRA 3ONEA 4M9CA 4A0SA 1LLCA 2VPZA 2OCPA 5KQGA 3KC2A 2CZQA 1B43A 2L69A 3NOQA 2Y3IA 4BB9A 1VKNA 3AONB 2UKDA 4JC4A 1DO0A 3GGGA 5GZ6A 1KI6B 1NTRA 2HN9A 1XWFA 5EUQB 1V5EA 3ZCTA 5ISMA 4NE9A 4FN5A 3VSBA 1WAMA 5JPCA 1CP2A 1F2TA 3U4MA 3LQKA 3UTDA 4B87A 7MHTA 4KDFA 1U4SA 1DKUA 5KKAA 1QIMA 5CTAA 1P2TA 1QE0A 3DMGA 1U31A 5INTA 2B7CA 4C7OB 1L4NA 1WXIA 4KLRA 1WPQA 3UT5B 1Z5WA 4PTYA 3A10A 4MKRA 1E8DA 1PT7A 2C8LA 3VU1A 2CHGA 1F5SA 2ACKA 2EWVA 5FFNA 5IJZA 3AQIA 3M1IA 1CCWA 1FEZA 1BH2A 3GW8A 3LE8A 4JLWA 2P1DA 2WJYA 4RH3A 4XOUA 2PUAA 4F7WA 2VSXA 5HKBA 2V1UA 3K09A 2XNDD 3H97A 1U9IC 4Y2QA 4PPFA 2ORYA 4FEYA 4JBWA 1I1QB 3PHBE 4U63A 5LNK1 1RKVA 3DT8A 4IOLA 3RFTA 1GGHA 4LXYA 4LZJA 4NK5A 1DCKA 2JAPA 3FFAA 4M55A 2OYRA 2JCXA 4JBHA 3UW3A 1VG0B 2C0PA 2IIVA 4WZAB 4I3FA 4XW2A 3QKRA 3RG2A 1LK5A 3A2MA 5K0NA 2OB1A 3IQEA 4LXXA 3IEVA 4IOMA 4QU9A 2VTEA 3ZWAA 2IYXA 4OLFA 1M76A 2ZYWX 4RADA 4IZ6A 3F74A 1NVVQ 4LX0A 3T5MA 3HU2A 4C0QC 3U9SA 4QAJA 3TDNA 1WU7A 4J94A 1W87A 9ATCA 3KE9A 1RW4A 4CIAA 5L7WA 4PLTA 5K3AA 3IOCA 5FUWA 4AKTA 1WB9A 5DHTA 3B1FA 4DANA 4F1WA 3HEMA 4RVHA 3S44A 5B4TA 4UEJA 3D6AA 5K45A 1TAGA 4BLOA 2FSVC 2GESA 3DV0A 3H5TA 4BV9A 3DVAB 3EULA 3HCAA 4UDYX 3T7AA 4NATA 5MDHA 4RTJA 3PTAA 1XZAA 3I2JA 3H8SA 2PUEA 1PJQA 4LF8B 3MWEB 3DCIA 5LZ5A 4YXFA 2MR6A 4QEDA 1OX4A 3FJOA 1FDIA 2OBNA 4GPZA 3SJZA 3M4XA 4NMMA 2JLYA 1H4VB 2QVXX 3TLCA 3C3DA 3ESYA 2OECA 1VIVA 3EUAA 4RFSB 5FORA 2G1PA 2V03A 1PTJA 1JDNA 1FDUA 3JWHA 1PGJA 3JALB 3QMPA 2OZPA 4YIKA 1R0WA 1ZONA 3CUKA 2KPOA 3OQBA 4MCIA 3BX1A 3TKAA 4BCCA 1KEEB 3HY3A 3PTZA 1Z73A 4ID3A 1TD9A 2CL5A 4Q4AB 1ISRA 5TSDA 1I2CA 4F45A 1UJ4A 4K1LA 1BVHA 2JKYA 1IPHA 3F5FA 1MW8X 1M6WA 4D41A 4KMMA 4BWGA 2QLTA 4LOAA 1SU7A 2GAJA 1VJGA 3AY7A 4UPVA 3EZ2A 4YY3B 2Z6QA 3TAUA 4AZSA 1DIBA 4Q5IA 2UUBB 2A94A 4D6YA 4XRGA 2W43A 3KG2A 3KYDA 3I64A 4C7XA 2XITA 2CLFB 2ASEA 2I33A 2G25A 3E22B 5J4LA 2CWWA 4GOND 3QUSA 1SN7A 1I1OA 2MR5A 1KARA 2XRYA 5D8DA 4X8MA 5HUHA 1Z5NA 3H0EA 5IAKA 3WGUA 2V7BA 4JSTA 2VATA 3QVKA 4CPDA 4UHDA 3AY3A 3TK1A 4H3KB 4I46A 4NKRA 2PX3A 1V6SA 1T9HA 4UOEA 1MPXA 1E0AA 3HWX1 5MF6A 5KYUA 1TLFA 4RPIA 1HLGA 1GWNA 3CRZA 1IHDA 1Z28A 2C83A 3QV2A 1M34B 5D84A 3CZMA 2VYQA 4PGAA 5CA1F 2A5YB 2VNJA 4OYHA 2F3RA 3H13A 4DL9A 1R6VA 4IXWA 3OP4A 1X14A 4UAJA 2YV4A 4CKCB 3ZDQA 1R6TA 4KGXA 1I9GA 2D4HA 1FVHA 2XOEA 3WJ7A 1JFFB 1JIIA 1RPTA 3R20A 1AUXA 4RAQA 4OPMA 1VHTA 1KI9A 1VCOA 3FCSB 1E2QA 5HF5A 4MRMB 5H82A 2Z2XA 5EHZA 1YU9A 2QD2A 4YCBA 3GBSA 3IP1A 1GKLA 1GPLA 3DWFA 3M5CA 1PFGA 1MZVA 4G0PA 3LMKA 1XMXA 2IHVA 1XCJA 3C6ZA 5KEIA 2QL9A 1QHSA 4PZ0A 4RF3A 4Q18A 1T0IA 2DQSA 4HQNA 1KK3A 1H5NA 1UP4A 3PUKA 4H1HA 1G42A 4O4IF 2VKTA 1LSUA 5AOCA 1S1MA 2NXWA 4PCUA 4KQEA 5BW6B 3SYKA 3ZEAA 2EATA 1SCAA 2G1JA 1IBSA 4FCWA 5A6SA 2FR8A 3I0MA 4KN9S 4B09A 3LLMA 2B25A 5H0IA 3BIWA 1Y9AA 5HFAA 3N75A 3EJ6A 3Q10A 4PYOA 3HV2A 3RLFA 4BBAA 1GQ2A