4ZK2A

Structure of acetobacter aceti pure-s57d
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
158
Chain Sequence
b'APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVDAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Serine mutants of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 49
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4zk2A00
2FWJA 4ZK2A 2FWIA 5CTJA 5CVTA 4YCBA 3OOWA 3KUUA 3ORSA 4ZC8A 2FWPA 5BOSB 1XMPA 2H31A 5CLIA 1QCZA 2FWBA 2FW1A 1D7AA 4YCDA 2FW9A 5BOSA 4AY3A 2NSHA 5CLJA 5CLFA 2FW8A 2FW7A 5CLHA 3OPQA 2FW6A 5CLGA 4YCCA 2YWXA 1U11A 1O4VA 2FWAA 5C5DA 4GRDA 3RG8A 4B4KA 4ZJYA 3TRHA 3RGGA 2ATEA 4ZMBA 2NSJA 5BORA 3LP6A 4AY4A 4YCJA 4JA0A 2NSLA 4Z7JA
chains in the Genus database with same CATH superfamily
1I6WA 3AGPA 3T95A 2IYTA 4C01A 3BWVA 1CETA 1VIAA 1VPEA 3GEBA 3EF0A 3NRJA 4DIMA 4MV8A 3USZA 2EP8A 3WYEA 2HI0A 2GJ8A 4WKNA 3KFLA 5FAKA 1XRQA 2ANCA 3AJ9A 3GRYA 4E4YA 2FWBA 1U7ZA 2XA2A 2ZITA 3DC2A 4YH1A 4E88A 3M6MD 3FOCA 5JE8A 4NK5A 3VPXA 4TKUA 2RFLA 2PCLA 2XY4A 3B5IA 3Q6IA 3T3OA 4RZHA 4FD2A 4QQRA 4X1IB 2V03A 1ZD3A 3PIDA 2GUWA 1RPNA 4D9KA 3EPRA 2AG8A 5GY7A 5HZHA 5FJIA 2MMGA 3OKAA 4D4GA 3ND6A 1CJCA 2ZBVA 4LXXA 5DW3A 4ZARA 3VV2A 3CYFA 3IIEA 2C8KA 3OE5A 4LZOA 2IYSA 4NMMA 3PE6A 5EJ4A 4I1YA 5KU7A 4L74A 4MV9A 4F2HA 1Q84A 3FB4A 4CKWA 4BNGA 2QMYA 1CUWA 1VBFA 1YUMA 2NU8A 1MTZA 1THZA 3KAQA 3O0DA 4MIEA 1QQTA 3ZLVA 1E2JA 1H4TA 3HA3A 1OOEA 1KQFA 1W2WB 3U7FB 2CNDA 3STTA 2P2NA 5CLHA 3PNMA 5A9TA 4N48A 3FPBA 4L8VA 1TKAA 3IGFA 4Q3KA 4B46A 1LX6A 5TQVA 1N0WA 2XCUA 3T5AA 1P4AA 2Z56A 3D6HA 4RELA 1YB2A 2HRDA 1AUOA 2XTAA 2PWYA 3ITEA 3JVUA 5LYYA 3ZC3A 4WN9B 5EFOA 3TM4A 1WKBA 4YCNA 1DWQA 4MVJM 4TKLA 4TLMB 1DDGA 1ORHA 4HMOA 3AYZB 1PIWA 3ETCA 4I5FA 5H68A 2A7XA 1XZPA 2R3SA 4Y9RA 3V1NA 1MDBA 1GPYA 2FRXA 2GJSA 4PG5A 4LWZA 2X9NA 4PFKA 2G67A 2ZT8A 3EVFA 3ER8A 1KARA 5H1YA 3L92A 3I6MA 3KO8A 4X92A 1E5XA 3ZHYA 2XE4A 4INOA 2NZXA 2BFPA 4Q4JB 2B1JA 3C39A 3F5QA 2EYUA 1NFRA 5DYIA 4F85A 3F73A 5CYPA 2ZW9A 3EEIA 1YI1A 3D1VA 4L28A 4O33A 4JKIA 3CZQA 5EMLA 2PRYA 1Y3FE 1J9ZA 4COOA 2HPZA 4M37A 4YCJA 3S1AA 1QGYA 3JPYA 1ENPA 1SWVA 4DQLA 3UCEA 1BS9A 1YU9A 3H9GA 3D6MA 1O6BA 4QLBA 2PLAA 3ABQB 4JU9A 3ITDA 1EHIA 2Q49A 1XZGA 5JXHA 1TIKA 3UWSA 4QICA 2R4UA 1YVUA 2BZ1A 1QVZA 2ZWVA 4NULA 2D2IA 3F7TA 3TI7A 1RXWA 1G41A 1KF0A 4M4SA 4YALA 1E2GA 1Q11A 4DA9A 1ONBA 1J24A 3R3SA 5CX1A 4A23A 4X62B 3TFQA 2HGSA 4EG6A 2G6BA 4WBNF 3CSUA 3Q2KA 4KMRA 4NMLA 2YQZA 2A5JA 4P36A 2ETXA 1O9GA 4GW3A 4KQEA 1JGTA 2I6XA 2QB5A 2XQFA 5ALIA 3KJEA 3HB7A 4OUDB 2BH2A 4HTFA 1SKBA 4X20B 4R2XA 5H5JA 3RSGA 2F4NA 3ODGA 1HE5A 4NE9A 1YCHA 4FYJA 1I7QB 1YB5A 1IHXA 4JBIA 4U7TB 5KNDA 3QFHA 3SLGA 5G2OA 5HBGA 1VBMA 4ABTA 1C9NA 2WM9B 3WLAA 3P2EA 2P2ZA 4A73A 1GN9A 2X15A 1GTJ1 4BAGA 2XB6A 2WU4A 2WIDA 1QH1A 3EEQA 1JPUA 1Y8AA 2HIGA 3M3DA 1KVRA 4YMTA 5AHRA 1VCOA 5CYFA 1SB8A 1TI7A 1WPGA 2VBGA 1TGYA 2OENG 4HX5A 4XX0B 3G2PA 4ARVA 2J0EA 1EUYA 3OD1A 4OFWA 2PS3A 4NDAA 5ICEA 3LSYA 1YE8A 3VTKA 1UJNA 2NGRA 5DCUA 4YMLA 1H6AA 1B0ZA 3MAGA 1IM8A 1TT7A 1N8SA 4KUEA 4RKYA 2BZSA 4NV0A 1VFPA 2OKGA 3JR7A 3H5RA 1L4YA 3K0CC 5EOVA 2I4NA 3OT1A 4FIDA 3RFFA 1G59A 4HNHA 4TKUB 1U8XX 2CLFB 3C8UA 1VPWA 4FD3A 3P2OA 3WQRA 3MTDA 2AN9A 2I9KA 2G70A 4MLCA 3VRHA 2C2WA 3AX6A 1MO6A 2AI2A 3G13A 4YPFA 3F1KA 4M3NA 1L6RA 4JI0B 2H4XA 3MTBA 2CUNA 1E6EA 2O2IA 1U81A 2V1XA 3LKVA 3M5DA 1TX4B 3CURA 4OATA 4PGMA 4DM4A 2V3VA 2H08A 2R47A 3QEMA 5JATA 4BMNA 2LIVA 3SQWA 4RY9A 4HNAA 4U6NA 3VBCA 3VHXB 3U4GA 1U3VA 3U9LA 1YR2A 1HK7A 4G56A 4DSOA 2X22A 5EN4A 3AUUA 3BFVA 2TMDA 3GIWA 4V2UA 1U8AA 2ZT5A 4IM7A 4TVKA 2CXSA 3MC1A 3M6XA 4J3NA 5CLIA 1NBMD 1UCFA 1XEWX 2OCXA 1GGVA 3K9QO 4JJ6A 2DG2A 6REQA 4V38A 1YAHA 2JBAA 2WA1A 3DT8A 1DWOA 4MSUA 2FW8A 1SXJD 2ZSBA 1G63A 4H1VA 4KK4A 1A8QA 1WUJS 5F51A 5G53C 5SY9A 2IXBA 1TIBA 5T57A 4LMAA 3SWWA 3KUKA 1ADFA 1QVWA 4I9NA 1MUUA 4IFBA 1C80A 4FQ5A 2VDLB 3KSZO 5CH3A 4ARAA 1O0CA 5JASA 3PRYA 4QYWA 2OCGA 4WNYA 2EF0A 1RMYA 2CVQA 4YV7A 1MZVA 2MWMA 4ZOLB 5AI0A 3L7AA 1L8XA 2FN4A 4D9EA 1AMUA 4JL8A 5FLXA 5BN1A 1HL7A 4PQEA 4B4UA 3A58B 3IEMA 1W36B 4TV9A 4B6FA 1R4ZA 1QE3A 4G26A 2AW3A 2OZEA 2QTMA 3B3GA 5L7WA 1ELOA 2X9LA 4YFYA 3P2MA 3WK7A 4KFTA 4W9NC 3E70C 3GZ4A 4ZRDA 5B2FA 1G5RA 2NO6A 4LBZA 1G8YA 1OF1A 1K86A 1IQ0A 3WBFA 1VBNA 3IHWA 3L6UA 2CLEB 3NH9A 3PPIA 2G36A 3HDQA 1J8DA 4MP8A 4ZREA 1I7PA 4NYMR 3R7SA 3TOZA 3L4KA 2NNWB 5BPFA 3T9DA 2QUAA 3JQPA 4PSKA 3O74A 4H0NA 2VCEA 4MZXA 2QG4A 3N2IA 2W6JA 4MW4A 3OMWA 2KS6A 4YCBA 4D4LA 1JHQA 1GZ3A 4KQ1A 4AJIA 2VF4X 3QVTA 4M9ZA 1Z36A 4Q7MB 1K97A 4YV0A 4X3OA 3DEYX 3DV2A 4RGYA 2WZDA 4ZP1A 3S29A 1H1LA 3FVVA 3QWFA 5EQJB 4F9EA 1OI4A 5CB4B 2H2GA 4UBJA 2QRKA 4EI2A 1EAMA 3O8RA 5AJUA 4NMHA 1QHNA 1R0YA 4FYWA 5JD3A 5JCXA 1JQDA 1LPAB 2ZPTX 3EGDA 2J08A 5E6SA 4AZ3A 2NWQA 2XBUA 4BNUA 5ICFA 5L3VA 5FPYA 2OCYC 4AN0A 3W1WA 4BNWA 5BN5A 2P11A 2C2GA 1J90A 1WABA 2AJDA 1SEVA 3IAS6 2EFJA 2QTFA 1U7PA 4PTLA 4CZ2A 4XWOA 3JQGB 3R7FA 1I14A 4ZOCA 4FS3A 5COBA 3U7GA 3DDUA 4WK2B 4RL6A 5A2GA 4H6WA 1BJRE 2D4HA 2G71A 2F43A 2OG2A 2QT0A 1KR2A 4C4OA 3FTNA 3MWDB 2AWNA 1YFZA 4PNZA 3AY7A 4P7GA 1UPTA 2FEXA 5HM8A 2C7PA 3G68A 4UEQA 1MXHA 1XZEA 2DGDA 2O23A 4PGFA 2GFIA 2MSNA 2OGUA 3MAJA 2CNOA 5NULA 4UNIA 3BJEA 2EX1A 1GZ5A 1Y98A 3WTBA 3W6UA 2ZJ8A 2Y0CA 4WV3A 4Z4GA 2C9YA 4OAPA 5CGQB 2QJWA 2NU6A 3W8DA 5FQNA 3LUFA 3HTXA 3HJGA 4OGWA 1WRBA 4X24A 1I3LA 1I33A 4EF6A 3HO8A 5F9HA 2ZAOA 2GB4A 4I9GA 1WX1A 1F38A 4P53A 4YJHB 4EHAA 2CLIB 2AXQA 2O19A 1WBJB 4YRCA 3TCKA 1QWSA 3W5HA 2NYAA 1U0HC 1CV2A 1S3FA 2O8BB 4B33A 1X8JA 2ZJ0A 4XJXA 2ZUBA 3STUA 2EJTA 3WQHA 2OCBA 3QEMB 4RKRA 1EE9A 1JDPA 1QYRA 2GEJA 2OZPA 1NLFA 2YXPX 3L6BA 5ARDA 4ACBA 4OPMA 5I7OA 5JS1A 3WBKA 2O3UA 3VR3D 4BLRA 1ZH8A 4ZGGA 1LQUA 2ZTMA 3H16A 1KP3A 4F92B 4RNDB 4FQ8A 2UXCB 4UAGA 5BN3A 2R66A 1WCYA 2F3PA 2RI6A 5FQOA 2AMJA 5LQNA 2CD7A 2CXOA 2YXBA 1B1AA 4J16A 3EPLA 4YMVA 4BRSA 3DNPA 3AUAA 1CR6A 3DD5A 3JWGA 5KOIA 4UBOA 4KACA 2VDKB 4UU1A 1KMQA 4GYKA 4P3NA 3G0IA 4OGFA 4BO8A 3LQKA 1XV5A 3AL3A 5GOTA 4MAMA 4BCBA 4R7ZA 4HAUA 3HABA 2FRDA 3HYSA 2HWWA 2K6GA 1FUUA 1F14A 1RM3A 2YJ6A 4OHRA 3ROEA 5I9LA 1RPAA 1QC5A 1Z12A 4NAVA 2Z1MA 1XK6A 1SUFA 3RARA 3ZHBA 2ODPA 3LXRA 4DB2A 4LYGA 1NN3A 3CVOA 3D43A 2HTFA 2HSGA 3NAGA 3CNHA 3I2JA 1PVDA 3QELA 3SKYA 1VLMA 4ZN6A 2BI4A 2WE7A 5SICE 3TLZA 3S8EA 5DM1A 4CNBA 4DL9A 4DR7B 2JAUA 5EJ7A 1KGSA 4Q01A 2COKA 4HLNA 4CLEA 3EX7C 2LXNA 4CR7A 4R2KA 2D00A 3F8WA 3V1KA 3PJDA 1EG2A 3BD9A 4R3UC 5B3JA 4GF5A 3C6KA 2W2KA 4GL4A 3ORSA 3RKSA 1C1XA 1PZMA 1S2NA 3MJRA 3FMVA 4L85A 2QTTA 1NSTA 1PQ4A 1P1FA 4RNCA 5IM5A 3T8YA 3UG7A 1U5CA 2DU8A 1CUCA 3GFVA 4OHZA 3CB2A 3W8FA 4B1FA 1X7XA 4XJTA 1THTA 3TOSA 1N3LA 4RFLA 2I91A 3FBTA 4UM5A 4Z2AA 4Z9BA 1ID1A 4KG7A 1NSFA 3IP7A 1KK2A 3CZAA 2AOVA 3EZNA 3WWDA 4QELA 1YR1A 4B4OA 1A1VA 4Y6PA 3OSZA 5KYYB 3C8MA 4MQMA 4TZ6A 1UBKS 1AOXA 1J8QA 1KZ1A 1MG0A 4O4LA 5JXWA 5KTPA 1OFUA 1D8TA 2BMAA 2P1DA 4H3KB 5KBYA 2P6OA 4YRIA 1UK9A 3FMFA 4GMHA 4YAJA 2FY8A 4M98A 1SXIA 1ISHA 1OXMA 4I55A 2Z2JA 4L7VA 3WNQA 2XYQA 3AOGA 4F8YA 3NBAA 2RJOA 2HKIA 5E6SB 3EGDB 4AZ3B 1JVSA 3OKPA 5DBIA 2B78A 1DCKA 2CXRA 1RXIA 4ZOLF 1L5WA 4AMBA 2C9BA 3FN4A 1TK3A 4XVQA 1V9LA 1PDWA 4WFJA 2ETVA 4A2WA 3RRBA 1TUIA 4UPEA 3U9TA 4GNRA 1W581 4YUVA 4BYGA 4F5DA 2P2CA 3HM9A 1ZVVA 3DYIA 2VT2A 2F43B 3DOEA 3I4FA 1ZJZA 4Y8VA 1GFIA 2H4YA 3E8SA 1MO3A 2CK3D 4RXTA 1BAPA 2J32A 1VYUA 5KO2A 4ABYA 3VTFA 4NXNB 2Y6UA 3A9WA 3PYMA 5JWOA 2O8VA 2XD4A 1PTJC 5ALQA 5LBTA 3DH0A 3SDBA 4LKRA 4PX2A 5C7YA 1EAYA 2NUTA 4BNKA 4KR2A 4I9FA 2OYSA 1GPKA 1N1MA 1PSZA 1ZDMA 2X1HA 3MAAC 4UHHA 3T7SA 1BHJA 1KDOA 3AF4A 2LW7A 3B8HA 3F8TA 4X1YA 5DEIA 1WUIS 2NPFA 3SBEA 1IWOA 3RROA 1D03A 3GN1A 4FC6A 4WKPA 2PK3A 2FG5A 3ESXA 1Q3KA 1SEPA 1BGXT 4M21A 4YP5A 2BH9A 1GYQA 4ZCRA 5EJGA 1Z0DA 2WSIA 4OJMX 4Q4LA 1J07A 1SQ0A 1CQIA 2F3TA 2QQGA 3EZ9A 4UEOA 3ZDRA 2EIXA 3LC7O 3PNBA 1T3ZA 1L1FA 1US8A 3UFBA 3V8BA 4DA0A 1C7EA 4KITB 5TGDA 2YN0A 1L0BA 1OH8A 3VQTA 1GGNA 4P32A 2FR8C 1Z7WA 4L50A 4A0HA 3TIFA 4A27A 1V11A 4DMHA 2IIQA 5ADWA 3H0KA 1X38A 4ICIA 5F1YA 4CLRB 1NVMB 2BIFA 3BDAA 3ZBQA 4F3KA 5ADHA 1MG5A 3LG2A 2JNWA 1Z2OX 2E4ZA 1Z5NA 1EGQA 3MMXA 4DQKA 1PZHA 5D5QA 1O87A 2AC2A 3M81A 4MUJA 4NFHA 2QV7A 4PAQA 5AJTA 5IMSA 3IBSA 5JHGB 1T3LA 2V45A 5BN3B 5I9SA 5IC4A 2L82A 3TNFA 1J4AA 1JHYA 1QTIA 1F2TA 2EAUA 4IOJA 5FFFA 5CUQA 4ZV4A 1LJLA 2BMJA 4E33A 3RABA 2YZMA 2BE7A 3AFNA 3F96A 4X8HA 1DQSA 1P9OA 1PUXA 4WACA 2AXEA 5IDYA 4RV9A 3FYCA 2YHIB 3V1LA 1J2JA 2XMZA 1AHNA 4QX6A 2YDYA 4B6OA 1XEWY 1E7SA 5K0JA 4OH7A 4OYHA 2YS7A 4HUQB 3ND7A 4M99A 1NXWA 4QWWA 3I6IA 1MX3A 4MR8B 3R7LA 5JTUA 2Y3IA 2QRHA 2EOAA 5A04A 1NF2A 2A84A 1GV0A 1UOQA 1ZW6A 2RGUA 2WB4A 3RTGA 4D9HA 1CZKA 4TYNA 2FDCA 3RAPR 3E82A 4QBGB 4FONA 1I2MA 1ISMA 1DRWA 1BQEA 1JLSA 1QE0A 2B8WA 2WAXA 1E69A 3L6CA 4GECA 4GZ3A 3MLBA 2KM1A 4G1CA 3RQIA 3AM1A 1HDCA 3QY0A 4QGHA 1CZUA 4W9MC 3AEXA 3K9WA 4IIYA 4UU8A 1X8XA 3EQ8A 2P8SA 5ANRB 2AEJA 4UMEA 4EAQA 3NFRA 1KWKA 2V6FA 4ZEXA 3YASA 2ONJA 1RE0A 4F6CA 1CG6A 5IBCA 4EARA 2Q2OA 1ISIA 3NW9A 1ODFA 3Q5EA 4M1KA 3V1MA 4IJWA 3TNJA 3TG8A 2OD9A 4YT4A 3NB0A 4KQGA 1K5GA 1SMKA 2QUJA 4F5ZA 3AEZA 5EMMA 3TDKA 3E1GA 1KJIA 1T3SA 2ADFA 2VTDA 4MV0A 2BKXA 4MPRA 2R68A 4B5LA 1WB9A 1T8UA 3LUDA 4LJAA 2PWPA 1L5YA 3S70A 1FYEA 1S02A 4O4LB 4XTCS 1DAKA 4DVJA 3PUVA 3TTSA 3UTCA 5LLSA 5IAOA 9GPBA 1MA3A 1NRWA 1CVRA 1B0AA 2OD2A 3A2MA 5EUBA 2QM0A 1O95D 4W5OA 2OP0A 2QLMA 1JB9A 1AUVA 2WU1A 3HFJA 2EDAA 3QZUA 2B1GA 4IS3A 4KAAA 2BGLA 2AXNA 1V9CA 1C7FA 5TY0A 3K31A 1T10A 3U1TA 4ZCTA 1NM5C 4CF7A 1D1QA 1SXJA 1F0KA 3LHIA 3K09C 4D3ZA 5JEEA 1STOA 5ALFA 4NCBA 1ENOA 4ZAGA 2DRIA 4BZXA 4W5TA 1W73A 2E4VA 2ZUCA 3D2LA 2Q4TA 1DCMA 4CM8A 4QT4A 1VYHA 3PYXA 3KYBA 1DUVG 4OA8A 3QFFA 1NDUA 4XQCA 1LW7A 1DQRA 3EXHC 4G1FA 1E6CA 3P9ZA 2ASEA 4D0RA 3URMA 5AVXA 4RXUA 1G1AA 4CF6A 2PX4A 1P4GA 1X39A 3DL7A 2DB3A 1FMLA 1PYGA 2J5KA 4BFXA 4AYWA 2CSUA 1UM9B 3ZHTA 3IOYA 3A6LA 2GRJA 2KYRA 1Y1KE 3GHHA 2IYFA 3FM9A 4INJA 3MCVA 3P94A 3C7AA 5F9MA 3MD0A 5AVTA 2A67A 3FB1A 4B3BA 2IPXA 2NUTB 3QJ5A 1GUZA 4D6PA 4E14A 1TU3A 3VYWA 4ES6A 4L57A 1C50A 5IJ0A 1PG5A 2BONA 3DXXA 4JYCA 5DNEA 3DQZA 1YDHA 4JQSA 4X1YB 3RR2A 2GCIA 4JB3A 3T3DA 4HB3A 2BDTA 3VYSB 2P7HA 2Q3FA 1BNCA 3EW9A 1W1IA 3S5UA 3DLHA 4WXMA 2VHYA 1JIIA 4HK4A 1VMDA 2PL3A 4LYJA 3MHPA 2OESA 4FCTA 1X6VA 1CQIB 1TUGA 4RD3A 4R1UA 1MENA 2BHTA 3N1UA 5BO5A 5JU6A 2XKBA 4IV8A 3JQAD 1G8JA 1P74A 4II3A 4BLTA 5K0ZA 3TEJA 3GA5A 1GPNA 1M2VA 1V11B 2IY9A 4UM9D 2P62A 5HF5A 4F38A 4JC4A 2WFLA 3V2IA 1EWKA 4HVAA 1J21A 4BPBA 3EWAA 2NN3C 2O5CA 5BYJA 4YP0A 1UJMA 4M36A 4XYMA 3ISTA 3L7JA 3L07A 4MPJA 4OXNA 4IV5A 4CW7A 2GDZA 2IXEA 1GNLA 4C4PA 1X14A 2PVSA 1M6WA 1F2DA 3AM4A 4K9RA 1G16A 3D9QX 4ALKA 5K8VA 1XRSB 4L4RA 2WSMA 5KKCA 4BNJA 1XRMA 2OTCA 1CUXA 1JJ7A 3DZCA 2FZWA 3LL4A 3IKTA 3W5DA 5CR9A 5JYCA 2PIDA 2BD0A 4OJYA 1IONA 3WX0A 4DZTA 3BXOA 3WZMA 3R20A 1PR9A 4ALJA 4KL8S 5IS2A 3NS7A 4URUR 5DJ5A 4OQPA 4WADA 3UWDA 2X0FA 3SLKA 3W6OA 3K6SB 2X0KA 4RYLA 1LY1A 1YQEA 2IDJA 3OJLA 2JIQA 4X60A 1Z56C 3RIGA 3ZGVA 1ONSA 2NSHA 1X2BA 3K9HA 1CHDA 3W9UA 3PK0A 3ELBA 3UMGA 1GFZA 3I1IA 4PLCA 5A5DA 2CLDX 3I53A 1II0A 1R4NA 1D5CA 1IZZA 4W8GA 5TC4A 3S1AB 2FI1A 3PRJA 4DR5B 3EDQA 2QD4A 1E5QA 1Z9BA 1FX0A 2PKQO 4UREA 3SVLA 3BSFA 3S6JA 3DEZA 4B2YA 4MGYR 4BY9E 4JOQA 1QZTA 2AYYA 1M1NA 3DQQA 3ICPA 2VHZA 4LVOA 4RS4A 5CVTA 3ZWPA 3KVYA 3Q0EA 1RMTA 3ZWYA 4PONA 1R0RE 4CIVA 1D4OA 2H31A 1I6MA 2B82A 5ITSA 2X2FA 3WQBA 2I8LA 5B1SA 3DLAA 4KH1A 1OGJA 3VR3A 4EVRA 2AN3A 3HKBA 4GI2A 2D1TA 1MIOA 1ZI9A 2MSWA 4IILA 5JHHB 2X4IA 5IAKA 5C7OO 5HNKA 3I2YX 4ZKEA 4PHCA 3AWIA 3FNGA 3ZGXA 1HFKA 1IATA 3U1BA 3TR5A 1CUFA 3VPCA 1MAVA 2AG1A 2QM7A 5CB0A 1N7IA 3OE7A 3LFHA 4CL3A 5HRUA 1T4BA 1KVUA 2BLNA 2AJBA 3AEYA 3CUSA 1RJDA 3DD1A 3I64A 3KVRA 5DSTA 4WCFC 1GQSA 4FDAA 1P7YA 3FNHA 3FW1A 1S9DA 3QWBA 2OSVA 3IEKA 2C4UA 1SVUA 2QZJA 4O4JA 4ND2A 4R1QA 3URKA 4MEJA 4EY8A 1FNDA 3WP0A 4CG1A 2R1TA 2RB5A 3RJTA 4E08A 1QGOA 2A6PA 2O7RA 1HSOA 3GP3A 4L22A 2XVMA 4QHSA 1K4MA 4DCMA 1D4AA 1IM5A 2EGGA 3OCCA 1EK0A 3QYJA 4K26A 4QJBA 4CQJA 4L2IA 2BFOA 4ESEA 3QKRA 1E3JA 1OT5A 1F2VA 2AMFA 2VSXA 4LOLA 3GZNA 3LFTA 5AJZA 2Y77A 4Z3KA 3LXXA 4B3FX 5HCIA 2GA8A 3R76A 5BW5A 2K5UA 1Z8DA 4DLNA 4WX2B 5IJ0B 1RI1A 4C21A 2X5KO 3GUHA 5G41A 3FYUA 4O2BF 1T0JB 3T5BA 4H7HA 3C70A 4IIJB 2AYXA 2HLNA 2O1EA 1JLLB 1CDOA 4YRBA 1WEKA 5LQJA 1EI9A 3VR6D 2ZQYA 5FCDA 3QMMA 3KWLA 3HBNA 2QQ5A 1TYDE 3FD8A 4MVYA 3DBOB 1RZUA 4JHLA 1ESNA 1OVGA 5E3IA 3V1TC 3VDQA 2OM2A 4E09A 1J8FA 2VQEB 2B5VA 1C3LA 2PRIA 4FC7A 1XNHA 3ZDYB 1B14A 2YC4C 3AR7A 1YUNA 4PSAA 1RS0A 2NU7A 3U3MA 4E5NA 1K88A 3CEPB 1QIEA 1M2VB 3C97A 4RZQA 5EE3A 2WFLB 3MOGA 4LRUA 4P34A 5ALKA 1I9CA 2E9SA 5F4ZA 1Y8CA 4BJ6A 2OHHA 4P4GA 3ZI4A 4DDWA 4R0VA 1XRRA 4NOMA 2DULA 5AJYA 1JKFA 2DWPA 1UXOA 2RAVA 2VHXA 1V8PA 3V80A 1O97C 1XRPA 4E1VA 3KQNA 5GINE 2HBZA 4BJ3A 2CVFA 2DT8A 3NWEA 3K72B 1LC3A 1VJCA 2OXCA 2P40A 3LA6A 3T1OA 2G9VA 3JD1A 3DAYA 2WFMA 5JNRA 2R751 3VR4D 1R6TA 3RV3A 2LR0A 4DR2B 4KU4A 1UBLS 3RSHA 1PVVA 1B26A 1YVRA 1CIPA 1EXMA 3BJRA 4B73A 3NT5A 4DPKA 1LBHA 3LS2A 1NW6A 3GRFA 5AI6A 2CK3A 3SQXA 4Y2RA 4IXWA 5SZKB 1TA0A 1MGPA 1CZHA 2F8LA 5B6PA 4MVJF 2QQ0A 4K5QA 3QW2A 4TZKA 4ZI7F 2CEAA 3OQMA 4ZCSA 1M2JA 5E4FA 4R5HA 3KQOA 2X19A 5A03A 2G5CA 1KVQA 4DMGA 1QM5A 2H1FA 3K0FA 4KC0A 2IDKA 3F47A 4B17A 4JI4B 1MBZA 2ZAMA 4XVCA 4LYDA 3C24A 2FX2A 5C32A 3BIWA 5DI9A 4MMXB 3VKVA 2BWJA 5HGXA 2QM8A 2GJAA 2FSPA 1R4NB 2CEKA 2JHGA 3OU2A 1P1CA 3AB8A 3HB5X 5EFZA 4HYQA 3CH7A 4PZAA 5SY4A 4ZVKA 4W5JA 1FX0B 1V4VA 3RVLA 1V39A 3S2IA 4OLBA 4I6GA 4EJ6A 4AP5A 4XCVA 3ZZMA 1YH3A 3GPDG 3MT7A 4BQSA 3DZGA 4KN5A 2I7TA 1CQJA 1H1TA 1Z22A 2GK6A 4HEJA 4F4IA 1D0SA 5BV8A 2GPYA 1GARA 1D6SA 4DWJA 3EEBA 4E4TA 1Y1RA 2DUNA 4U5QA 1QFZA 2HA5A 3T7TA 4PE5B 1U2TA 3PICA 1BOFA 1VJ0A 2DWCA 2IHJA 2KLBA 3HKBB 4ZVSA 5K3OA 5F9FA 2BMFA 1TLTA 3V55A 1UZLA 1HDYA 2KBEA 3NDJA 4C9BA 4M38A 4GR4A 1O7JA 3MSCA 4K9PA 4NESA 3ZX5A 2WB2A 1L4EA 1MVNA 2K87A 5CT9A 1TC2A 2WP0A 4CL2A 5T7BA 3FDFA 3I2IA 3JZAA 1Z5UA 4MWCA 4Q1CA 4BBJA 3A37A 2CVOA 2RGNC 3PB3A 4K9LA 3LP6A 4LRYA 2POCA 4ZT2A 3Q7QA 1I0IA 3CINA 3KR0A 3EXIA 1TF2A 4YGXB 5GPBA 1RIIA 1KDPA 1RPJA 3MPUA 5EHQA 3CKYA 3IR5A 1UAAA 3I09A 4PLHA 4O4JB 1RAAA 4KX3A 3CY6A 1VLVA 2OFOA 2O4CA 3KZXA 3CN7A 1GO2A 4HDQB 2FP4A 3DEFA 4JLOA 3MN1A 3TLGA 4RJTA 1PJQA 4MUBA 4DV3B 2NXCA 2W90A 1TRKA 3EAGA 2O8NA 1G3MA 4PXSA 4ILEA 4W5WA 4L2IB 2VO1A 4NBKA 2VWPA 1ZMRA 4GS5A 2WYOA 3RFVA 3WY9A 4TTIA 5IT0A 3R7AA 3GZNB 1T8WA 4LBYA 3R7WB 3RHZA 5LUBA 1C81A 1ZJYA 2G6TA 4R2HA 5BRNA 1ZR4A 1EBBA 1WQ4A 9ABPA 3QLJA 3DEHA 3EC1A 3SX2A 3K0AA 1QGDA 1ABBA 4M0UA 2XF2A 3PDWA 3PENA 4OHUA 3PUHA 1YBHA 5GGYA 2GZ1A 4L8YA 4WRRA 1XWIA 2ISSD 2VUUA 2W2PA 2HT6A 3PJRA 1TZMA 3ZQ4A 2QX8A 4B44A 3U19A 2RHMA 1JN0A 4RZ2A 2QRQA 3DXZA 3HKCA 4QU5A 3TZCA 1EUQA 1G3UA 2VSYA 3BD7A 3EXAA 2IIPA 3FKSA 4Q3LA 3ED5A 1NXSA 3LY7A 3DHNA 1IMJA 5JFGA 5BPHA 1TM5E 2VDWA 4OMUA 1ZKMA 2Z09A 3JTMA 5HUHA 1KGDA 1KZGB 2PCJA 3OQIA 3R5KA 4MCJA 3T4EA 2O5EA 3PEFA 4G4SP 1CF4A 1J9EA 3ELUA 2XODA 3DO5A 3MRSA 4H15A 4GYJA 4ZOBA 4B80A 5JH7F 3M9XA 1SXQA 1EFAA 2K2WA 4EKNB 1JYSA 1FFXA 2HADA 3LUBA 3F6SA 4GZ6A 5BV1A 1MC4A 3JQ6A 1KAEA 1QNFA 2X76A 4M0CA 4M86A 3X43A 4X1KA 4F12A 1Y8RB 4CF3A 1TAQA 1KI6B 2XQVA 1H2YA 1YZGA 3FGOA 4OXIA 5AI5A 2ZWAA 5JXJA 1KJWA 1ONPA 1NYLA 2QN8A 1DWPA 3C5EA 4YLGA 5KNBA 2GWHA 4BZWA 1NG9A 2OQVA 2OLKA 3WYAA 4EO7A 4HDNA 3K9LA 1KO5A 4I1IA 2F6RA 2IP1A 5FTKA 3EIQA 4M1MA 3CEHA 4GPIB 2QLNA 1EE1A 3WYCA 3E7DA 1Y6QA 1Z38A 2QAIA 2PGIA 1LBSA 3C3EA 4MYTA 5FHQA 2E87A 3DE6X 3QHAA 5SY6A 1DAPA 4QM6A 1P5JA 3K0FB 4C14A 1WO8A 3WL5A 1EVZA 5PGMA 4D56A 4ECAA 3NMUF 4XWGA 1TQ8A 1YBMA 2C54A 3HY6A 3E1KA 3IXQA 1F12A 5HJ2A 5BNFA 4HSGA 3WFJA 1LPBB 5K1ZA 3TLAA 4MA5A 3OKFA 1V8FA 2ZS7A 3PC7A 1LVUA 4ZCMA 3F4KA 3A1SA 4JXKA 3K1AA 3W9YA 5U9CA 1UPAA 4F1JA 4NF2A 3D6AA 1ODKA 2ZSJA 1V96A 4L5CA 4U4AA 3LUHA 4FUTA 2D74A 5K0LA 4B8ZA 4Q4CA 3QNUA 4BKOA 3KPJA 3MSXA 4GAEA 1CB0A 4UJ3A 3HB1A 3JQAA 2ZDGA 1PD0A 2CFIA 2YYZA 1NJGA 2F8SA 1WDWB 5CXXA 3AUKA 1IXSB 4TV8F 1OH5A 2CV2A 1V5EA 1FSPA 4RGBA 2XKAA 3AG5A 4L0DA 1ZRMA 3NKLA 1XNGA 3IH5A 4BQNA 3DS8A 5LOVB 3I6QA 2BGMA 2XCLA 1Y82A 3CC8A 4Q3OA 4PO9A 2O8CA 1FXWF 1YS2X 1PWZA 1MX9A 2VHQA 4H7PA 4PX5A 3RVRA 3LTEA 1XA4A 4QG7A 2CXUA 1N25A 5KSPA 2XMBA 4HMPA 3PQ8A 3QUQA 2DPYA 4N03A 1N8NA 3AJEA 4GMKA 1F2UB 1C1HA 1ZONA 1VYVA 1YZQA 4BQPA 4M9XA 2EBFX 1RHQA 3GJ6A 2ZT7A 4JU8A 4PBTA 3DONA 4FMCB 1DUIA 4R4JA 3KSAC 4YBRA 3TRJA 4J75A 1WAMA 3L0DA 1I2DA 2QX6A 1USWA 1IQRA 1Z2NX 1W19A 2R2AA 4DV4B 1YI8A 4GM4A 2E6UX 3LP8A 3DKVA 3DOOA 3HUFA 3IKMB 3DFFA 2FP4B 4UM7A 4X64B 5KSYA 1P1JA 2GTHA 2ID8A 3BXFA 4UVHA 1W36D 3CISA 5TGTA 4COKA 3UWOA 3FUTA 1DLJA 1JDZA 3OJEA 3DYVA 1IVSA 3K6KA 2QSZA 3DHVA 1T8SA 2HTEA 2V5VA 3STYA 3OFJA 5FYDA 2WF9A 2ZIGA 3NM5A 5FLYA 3EUFA 3WFIA 2UXDB 4BVEA 1NBOA 4KMSA 4O2RA 5DM2A 4GGMX 1FFWA 3GNTA 3K0AB 2CYBA 4RCZA 5FTMA 1ZISA 4D8WA 1QGUB 3GJZA 4Q9JA 2A35A 4Z51A 4XVRA 1A76A 5BSFA 1RYBA 1Z18A 1ZU4A 3RWOA 5AUPB 1R8QA 3KPUA 4F86A 3HKCB 4LDQA 3G2QA 1GLGA 1LTQA 3R0VA 3AF1A 1MJHA 2QAGA 4XD7D 2XUHA 2NV2B 1IBMB 3F6RA 4R83A 1I6LA 3N7UA 2G1AA 4IIHA 1NPYA 2VDWB 5DYYA 3OQIB 1MO2A 3GF4A 2JVKA 1A2OA 3GLKA 3Q3IA 2X7JA 1UEJA 4KRGA 3USCS 2P5TB 1I1NA 1RMQA 4G97A 4K9OA 4WBNA 1V45E 2VPZA 5AFSA 4O25A 1AH2A 3PDUA 3RI3A 4AO8A 3MS4A 2YBEA 1UUFA 1IBLB 1FFXB 1I36A 1EQUA 1QLWA 1V25A 2XQJA 5P21A 1J42A 4XDZA 2P9ZA 4TXNA 4U9UA 1Q2UA 4TTAA 2Z3ZA 2IOQA 3CEMA 3DMNA 4P9NA 1V1RA 2G9RA 4JEHA 2GVNA 5FOUA 2OGTA 1PJLA 1ZK0A 3FUUA 3PHCA 2WKPA 3UJHA 4IOMA 1QK4A 3UG6A 2KX7A 3LLUA 3DTVA 1CX9B 2WMNB 5AJHA 4UD6A 3S40A 3U5TA 4I1UA 4OP2A 5A3RA 1RKBA 4OI0A 2PKWA 2VA9A 5EXSA 4DWVA 4LSWA 3INRA 3MMNA 3L4BC 5K3FA 5TPWA 5A4IS 3V4VB 2C82A 1HZZC 3E0XA 5AKHA 2VXCA 1PN3A 4MQEA 1B2LA 5E95A 1UIRA 2ZIFA 3SFVA 4ZK6A 1JIJA 1IYZA 2OO5C 3RIYA 3DBRB 3GVXA 1E1KA 1SOMA 4LY9A 4DR1B 5DULA 3WLLA 4BN0A 1NMEA 3DMTC 1E2KA 3KV1A 2FWAA 4QVGA 2V4ZA 1QQ5A 1V5GA 1VSQA 1OAOC 4W5RA 1J2YA 3E8MA 1GG5A 4XM1A 3R5TA 4DUYB 3BWMA 4J2HA 1Z4OA 4LTMA 3H5VA 5LQRA 1KC1A 3CVUA 3QMPA 3VR6A 2GVDC 3H9JA 4OQQA 4IF6A 4DA7A 3QVXA 4HRXA 1I4EB 4HLUA 1GNSA 1OT3A 1X7WA 1Y3BE 2JZNA 1ZXXA 5EEHA 1KH3A 3AM5A 1ADBA 3PJEA 1TZCA 2R1UA 2ZE5A 4JLAA 2FQ1A 3I52A 1NC1A 5FKJA 3F49S 2CLOB 2Z1DA 3NEYA 5KMGB 5I7WA 2ZUFA 1BE0A 1XZFA 2HK9A 2Q5JA 3I42A 1QYWA 1QR2A 2JHAA 1H2WA 4QUEA 2I99A 4YRRA 2O8CB 1L7NA 2FMIA 1L7QA 3FHCB 4FDUA 1HY3A 5KTTA 3GP8A 3WLRA 3RC8A 5CT5A 4BP9A 4N8EA 2HO5A 2C4NA 3GRPA 4QQNA 2YQ5A 1AXRA 5EZ6B 5IU6A 1P39A 4F45A 1OILA 4F97A 1HWYA 2UYYA 5DM0A 3GLIA 3QHQA 2A33A 2PM8A 2H8GA 1BHSA 1UXKA 2QN7A 1D0VA 3H99A 4FN4A 1KRWA 1TTTA 2FMXA 4CMEC 4QXMA 3N5CA 5MN4A 4JYBA 4O2LA 1SXGA 4S1PA 4WNIA 3O1IC 3DVQX 3ELDA 1SVOA 2R96A 2GRUA 4OQEA 4KO2S 2ECPA 4P22A 5HILA 2BELA 2HRZA 1C7ZA 2PQ0A 3NDPA 5J47A 3HDGA 4Y6GB 4B8WA 4CTJA 1P1KA 4XCXA 4BO2A 4JQOA 4ZC1A 1UZNA 2X6TA 1XXHA 3LYHA 3RC7A 3GDHA 2G06A 5K0NA 5IHPA 3B89A 1E5VA 3ERCA 2A78A 1RWMA 4JLDA 1H22A 2EWMA 3WS7A 3P9PA 5D00A 5LOVF 3V8RA 4OP1A 3DEKA 2GYUA 4KV9A 1A3CA 1EM6A 5EHNA 3O4JA 5M7EA 4LZLA 3HL4A 2O8FA 1ZBQA 3KKEA 5KVQA 1UZUA 2RHCA 4HLQB 3ZV7A 1NWCA 4MI1A 4UD2A 5P8WA 1VL6A 3ZY3A 3PXDA 1PHRA 3U44B 1UWCA 2G1KA 3ZDAA 1MEOA 4QLAA 1GZSA 1RZVA 3DJYA 3DFZA 5EWMB 2I3AA 3N28A 3GZTB 4AXBA 4NR0A 4ZZ3A 5AVVA 5SV2A 4RVFA 2UUPA 3P26A 2G17A 4P3YA 3KJHA 3MEQA 1HMPA 2Q5OA 1Y0BA 3EA0A 1UBNA 5JADA 1ZD1A 2LNDA 2J3KA 4BU0A 1WETA 3LMKA 3EZGA 1VP9A 2VHWA 1MV5A 3OP4A 4Y7DA 3ZV5A 3TNLA 1CRQA 4C7BA 2JIZD 2GLTA 4KPGA 3BMNB 5ALJA 5KINB 1JFFA 2VLIA 4OMDA 4UATA 4C22A 5HQ3B 3DTVB 4XUGB 1Y9JA 2PRSA 4YAGA 1C29B 2PSDA 5JAOA 5DBFA 4RM2A 1M6HA 3K9NA 3AIMA 4XASA 1OW3B 5TPWB 1XDUA 2FA9A 5K3FB 2HU7A 4E70A 1VLLA 1N1EA 4P83A 3QE9Y 4GQBA 3GJ4A 1P1IA 1Q0LA 2PX2A 4AL4A 4JBWA 2RDMA 3KP1A 5BR4A 1MVLA 1S8OA 1XCOA 4IDHA 1TEXA 2CUZA 2PMEA 1IL0A 3KYCA 4D4MA 4R0MA 1DO2A 3X1YA 3HVJA 2HRRA 2YWRA 1XYYA 4K0RA 4KVFA 2G77B 2G8NA 5F76A 3B1YA 5MFZA 4MDYA 2JATA 2JCXA 3QVLA 3LO5A 1BRMA 1F20A 4E94A 1GU7A 3T4UA 4IJKA 3CH6A 1HFJA 4YXWA 4BLUA 2I4OA 3G2MA 4QNRA 1KRHA 3LPMA 3K2IA 1FBTA 1RYMA 2A92A 4PYMA 5FHRA 3RT9A 2IX3A 1JPJA 3Q9LA 5GADl 3COYA 1HE8B 1JTFA 1VJTA 1X7WB 1Z47A 1NXPA 2FPSA 1AQLA 1BGVA 4D6XA 3RTAA 1Z0UA 1ZCZA 2C2XA 2BGUA 1WCXA 5EESA 2RHOA 2JFOA 3OKCA 3N2NA 4QL3A 3K0SA 3H1EA 1PFYA 4L95C 4LHXA 1BX1A 1HUQA 5J58A 4F4JA 3A2LA 4LWOA 4HNVA 5IKOA 4Z6KA 1EP9A 1OREA 3C8ZA 3EVCA 4LF6B 4BNDA 1DXOA 3OPNA 1O0SA 1QV6A 4FU0A 2OUIA 4BJHB 3EVBA 4AJ2A 2PGJA 4PZZA 4QGGA 4JLBA 4JLPA 2KQUA 3ZKWA 3F6BX 3LYAA 3AP3A 4UW9A 3SC4A 1QDEA 1SZJG 2RCYA 4QDXA 3BRWD 1FQKA 1R5OA 3IPRA 5LQDA 1IVYA 5A05A 1JLMA 3H17A 1LWNA 2H8KA 3OA2A 4KQHA 3EOZA 3GW8A 2VF2A 1URPA 2C5GA 3PVCA 4M1EA 2Q07A 5DLDA 3O8CA 2J41A 1KVSA 2V6BA 3IDFA 3LCRA 4RCYA 3R6GA 3QJYA 1G3RA 2B5WA 2V7PA 2YY7A 1JU3A 3NATA 4JJIA 2RAPA 1KFBB 2XUDA 4ZO7A 5I8WA 1J8MF 5D3KA 2JFPA 4F3YA 1QO7A 1YR9A 5E9QA 3G0HA 1G8FA 1R0BA 5HKKA 5K03A 4RTKA 2PANA 4YHBA 4PSCA 1II8A 1SCDA 1PW7A 4MWBA 2W6QA 1V1MA 1A98A 3AHFA 3M2TA 2R8ZA 2WKQA 4RL4A 3V7UA 3EQ7A 1ZD2P 4M53A 2CXPA 4UFNA 2ZRMA 3P0FA 3D8UA 3I28A 3QI2A 2HJVA 1AS0A 5ELLA 4BZPA 4F56A 1K89A 3HFSA 5CURA 1JG7A 1V26A 3BREA 5JAQA 1BDIA 2AUTA 3UOWA 3C74A 3FZGA 2O8FB 3KXLA 1K8XB 3D5EA 2Q99A 1GG9A 1YT5A 4EECA 1X9IA 1O8BA 2SKDA 1H2XA 2NYVA 2PBZA 3I37X 1KSJA 2Z95A 2HJ9A 1X9GA 4DCUA 2WWXA 3FPEA 3PA8A 4MIYA 1PV4A 3I05A 3ZCTA 1I51A 2DZDA 4MAAA 5J23A 3FSRA 4GD3Q 3TSCA 1A4IA 2XNDD 3E84A 4URXR 1YDEA 2V65A 3HA2A 2V6MA 3KELA 2B21A 5E8RA 1Y7IA 4NH4A 4Z0HO 3TGPA 4MS1A 1QFJA 2P1ZA 3AHHA 3LY9A 4CF4A 3ICQB 3ZQUA 5JS8A 2NXWA 1EK1A 1ZITA 2E4AA 2X14A 2GM9A 5AKJA 3GJ7A 5AIAA 4R1NA 1GXSA 3CSDA 4R31A 4YR9A 3MTAA 4PYRA 3SJZA 3K0BA 4WKOA 3L1HA 2OFWA 1SVLA 5KJEA 1TQ6A 4UHEA 1KPGA 2QS9A 4EBBA 1CYDA 4EUHA 3I3OA 4MJLA 5L95A 1BE1A 1W5FA 2Z5VA 3RSOA 3SYKA 4RYDA 3BBLA 1N92A 3FI9A 4PCAA 5F3DA 1JFFB 4K6MA 3HXLA 5TMPA 2RG1A 1SK9A 3I8SA 1IN1A 4MVCA 4A9AA 2VJNA 1KEUA 1XHEA 4JEUA 2XGSA 3DDHA 1SIBE 3H65A 3KEGA 2G25A 1PFQA 4N9QA 5G0VA 2P4UA 5JOQA 5EJIA 1T5DX 4X6UA 4IIXA 5LUAA 4KMMA 3MT8A 1Q21A 5BQ5A 4DLVA 4WK4B 3M5PA 2O3TA 2MINB 1YGYA 4MVJD 3RADC 4NKRA 1E2DA 1T1GA 2ZBRA 2WJPA 4P3PA 5CITA 3DOUA 1ITZA 1CKEA 3U39A 2CE7A 1JEAA 2PVCA 5GGXA 2HHAA 4J4TA 2FJPA 3QE2A 5EJMA 4FKBA 4FR5A 1C30A 4L6IA 2OA0A 3T61A 1O89A 3P4YA 2Q4BA 1W9MA 5DGIA 3SFZA 3H1TA 3EZFA 3I8XA 2CVZA 2O3JA 3KSMA 4LTNA 4YUAA 4FUQA 2BYTA 3I01A 3MBOA 1EFRA 4OYLA 3WLMA 3JQBA 1PR1A 5ALMA 4M0KA 1B1CA 3DEAA 2XTNA 2Z5FA 4UASA 3K8ZA 2QLTA 4JB0A 3JPWA 2CSXA 2IW3A 2PAAA 3GP5A 4LAFA 3MK31 3QTLA 5CYOA 4KVGA 2QD5A 4ROSA 1NJ5A 1ORDA 3HSYA 4WCVA 4EG1A 1KA9H 2UYQA 2QPTA 2R5FA 3BULA 4ZQGA 3GR6A 1XROA 1J8VA 1O5TA 4M7RA 1H23A 3HKEA 2C83A 5A3SA 3QPAA 1PK9A 1QZ3A 2X1MA 4DLTA 4GYYA 2ONKA 3L8MA 3WIBA 3ZJVA 2OK8A 3GEEA 1DPGA 3HCPA 3QFTA 1MRZA 5LB4A 3KQWA 2HR1A 2J0UA 4WXPA 1BQ4A 1W96A 3NRCA 1R0XA 5D3QA 2Y66A 4E6EA 1YB4A 2A58A 3OFND 5TEVA 5IM4F 2ZJBA 2QQEA 4EYSA 3LCUA 4EGFA 2W8ZA 3V4SA 5IDWA 3O6VA 4HCJA 2HYDA 4JT8A 1TEVA 2PN1A 2HJWA 4MS3A 4Y6LA 4QULA 1IULA 2RHWA 1E9SA 4EW2A 3BRCA 1E3WA 1USGA 1AB6A 4ISBA 4JJZA 4KQCA 3UMVA 4N3NA 1KHTA 1QYCA 3TQIA 1M0EA 1CJMA 1FW8A 1ECFA 2GEBA 2GWRA 3D3QA 3BGWA 2G82A 1CC1S 1Z7GA 4QBKA 2R00A 2QTBA 3H5AA 5J40A 2PJUA 1L9XA 1H5QA 4UTPA 1Z6PA 2VWHA 5IVDA 3TQOA 1NATA 3PGLA 1V1MB 1T9KA 2KI5A 2IPAB 1CQZA 1NOKA 3H13A 3O4FA 1QIMA 4RCVA 2EL7A 2QENA 2PSEA 4S1TA 5L40A 1SCUA 2P9HA 2HPAA 1FXUA 3IT0A 1BKDR 2C20A 3OF3A 2FRVA 2AA3A 4RH3A 1K4KA 1O95C 1UBTS 2WYWA 3BB1A 2FZCA 2HK6A 3HR7A 2VYFA 1SK8A 1TECE 1Z73A 4MR9A 4OL0A 4WVLA 4NBVA 4NY1A 4R68A 2VFAA 1FU4A 5ILOA 1PT8A 1K8ZB 4JLVA 5DF1A 1QWOA 4JVSB 5A4DA 1KJNA 1YV9A 5EKTA 1QCZA 4CG2A 5KOYA 2PZGA 1ZHOA 5SZJA 1LBIA 2YZKA 1QIKA 4PSVA 4GO1A 1LF5A 2Y9PB 1LNQA 2HSDA 3HZZA 3GT3A 3AEKA 3Q3GE 1MAHA 2JFVA 2JGRA 3HXTA 5JRDS 3ZCXA 3RG2A 5EIAA 4OP3A 5CAEB 1TM4E 3TOVA 2H2IA 1JE1A 1ICEA 1JYFA 1QKKA 2ZRLA 4OEHA 1L4HA 4CKZA 4DZRA 1FQOA 4KXQA 1AS3A 3WKEA 4UTRA 5KNLA 4FEYA 1H1DA 1L7DA 4IFIA 2NZWA 3UT0A 2XCSB 1ZZGA 4QPZA 1RLIA 1WXXA 2XUPA 1Q44A 3RS4A 4X6LA 4EB6A 4B3XA 3AMVA 3UOAB 2YUIA 4DSNA 3IOBA 3WYBA 1SOWA 4ZZ2A 5JSZB 4TUYF 5FORA 3BMXA 4BP1A 3WGYA 2VA8A 2DAPA 3FOAA 2JLBA 3Q6NA 1CJVC 4L8GA 4MWDA 1Q7BA 1PJ8A 4II7A 3PEVA 4S3MA 2Q7XA 3SP1A 4UZEA 3NWPA 3DOJA 3UYKA 1LBQA 2BGTA 1RLMA 1F0NA 1T5LA 2D3TA 3D8HA 3HJHA 2CN1A 3LE8A 1GU1A 3UB4A 3U60B 4WY5A 4AIIA 2GGSA 4X61A 4JQCA 1VCHA 2PGLA 3G8CA 5DVZA 1VM6A 3E5NA 4FFDA 4C6TA 4DQXA 1NXVA 3IODA 1RXYA 1CZRA 2IXTA 1C30B 2CXXA 3CE6A 2PKRA 1RZ3A 1P9NA 3AFIA 1RJFA 4BJ1A 3IVRA 3OIGA 2DTDA 4LRWA 5AXCA 1NI4A 1WPQA 3VPBA 5L9AA 3SYLA 3ECCA 4MGIR 3V8QA 4MEBA 4UAJA 4H7EA 1JMVA 4RMGA 4GYWA 5COQA 4QYTA 1XTRA 3MUFA 4HAVA 4OQFA 2VDNB 4DAEA 5CYGA 2H4JA 4BOYA 2JFYA 2F55A 3N39C 2Z8XA 4JI2B 2AC7A 2B61A 1U7HA 2ACEA 2PSJA 4GX2A 4WZAE 2NXJA 5LC1A 4TTTS 4NG4A 4G0YA 4RZSA 1FDIA 1ZHHA 1WPXA 5DT2A 4NFYA 1QHIA 2ZI6A 4DSAA 3DZJA 2B2XA 1QX4A 2B98A 2VHEA 2VNIA 1IHDA 3HYTA 2FUG6 5ALSA 5JVDF 5FBWB 1TUBA 2Z9DA 4YUZA 3I9V6 4AQDA 2JLSA 1RM0A 3HKEB 2J6HA 3QLUC 1Z6ZA 3D4OA 3U6KA 3RAEC 1IZ7A 4RK0A 1XLTA 1FC0A 4XD2A 2W9XA 3HCDA 4BTLA 4E1BA 2J0UB 1VPDA 1NBWB 2FN8A 4R41A 1EDBA 4WEOA 3M82A 1XBTA 1YOBA 2CDAA 4JIMA 4MKXA 4JI1B 5A3QA 1GAWA 3UCXA 3WL4A 5AWFC 2MSCB 3DB1A 5BR7A 4S05A 1EK2A 1S8FA 5ALOA 3T1NA 1N5LA 4RHXA 1TKCA 2C5FA 1M8FA 4D43A 2IUTA 5EJ5A 2HQOA 4QREA 1KNXA 1Q0QA 4Q03A 4WZAA 3KDAA 3ODPA 4Z9XA 3WKCA 4JR1A 2BGNA 4PNEA 3RNLA 3FCOA 3LUCA 4JEIA 2C61A 5JO9A 4OKSA 2NUAA 3U4MA 1L7VC 4B6GA 1KEVA 1X7ZA 4KI0A 3ADOA 4XWYA 5M5BA 1E32A 4RDXA 2PH1A 2CL5A 4Z8XA 1DX6A 2GZ2A 4N8DA 3THWA 1NKTA 2OVFA 4AP9A 1XOIA 1ZL0A 2L0XA 3H6KA 2ZUSA 1KKMA 3CUVA 4QOGA 5IJWA 2UZIR 1G18A 3EMKA 4MYRA 3KR9A 2GXAA 1P7CA 4ZHQF 5K6AA 3AVYA 1PJSA 3BEDA 3T41A 2RGXA 3RYCA 4I2VA 5IKXA 1KAOA 3FVRA 4RV5A 1T0HB 3EWIA 4RJJA 5MFPA 4G81A 3BWXA 1YULA 3B9QA 1KZ4A 1C9YA 4TVBA 5GMOA 1WSAA 2PQ2A 4QOFA 2MT9A 5AJVB 4BQEA 5BY2A 3P97A 1U0OC 3AILA 5B3KA 2GN2A 1BWPA 2P2SA 2Q6OA 1QSGA 1UMKA 3A6EA 3ENNA 4FP9A 4FX2A 5BMOA 4O1IA 4WY8A 3HCEA 3IXLA 1G21B 1ISRA 2PV0A 4BUZA 3DLIA 3MJHA 4PLVA 5ADUS 1ZXBA 4RQAA 5JXGA 2H4ZA 1MQSA 2QD3A 4JI6B 4Q9HA 1E9RA 3TQFA 4ZAYA 4WMLA 4JLMA 3PD1A 1KC3A 1YJ8A 4BE7B 5B3AA 2ROQA 2O2XA 4Y2QA 3FAKA 3C6BA 2G28A 4PPYA 1OFIA 2C92A 2VSFA 2WTMA 4FDTA 2RKWA 1RJWA 3STXA 5J2TF 4RLQA 4DCTA 1ZMTA 2D1QA 2F3QA 3RAJA 4MARA 4L4SA 4EB6B 1D5WA 5LMCA 3A8TA 4CLXA 4LNAA 1T36A 3NEJA 4I6JA 2JJYA 1AZWA 5JY1A 1DQYA 1RI2A 3GJYA 1WMEA 5C8ZA 4C2TA 3UF0A 3PSAA 1NNEA 2Y68A 4IXNA 5KC9A 1ESCA 1Z83A 1F8XA 1H0SA 1HA3A 1YC5A 1GPMA 1ZNQO 3AF0A 3EODA 4J76A 3RFCA 2DERA 1Y81A 4K86A 2HQ1A 1ZQ9A 3R77A 4RULA 1NBAA 5ELXA 1D2CA 3LX6A 3LAWA 1KQGA 3BICA 1MQ9A 3CM0A 3MJCA 3MS7A 3M0EA 1IHOA 4NATA 4RJKA 1KS2A 5KAPA 4C6TB 5M04A 2B4QA 1PDVA 2JGNA 1NLUA 2Q3DA 2B99A 3DZKA 4MVWA 4BBAA 4BKMA 5TT1A 2JCVA 3K6JA 4OX9B 2VCYA 2A2ZA 1H85A 3C3DA 3J7TA 4WKGA 1P7WA 1U2RA 4FT4A 3KQKA 4DJDC 3GL9A 1UT8A 4OXXA 4QNNA 2IYNA 1O6ZA 4CCAA 1B6RA 4DEYA 4AURA 5BR1A 2OHVA 3QU2A 3K96A 3N2GA 1T2VA 4AVYA 1P3JA 2VDUE 1NVFA 3IUQA 4YQYA 1GZUA 2O7NA 4XM2A 4N0EA 5EINA 4GPAA 4D4JA 4ZEVA 1DIRA 2JCBA 1BW9A 3BG5A 3B70A 3ZXUB 4O4IB 1BCRA 4ZDIA 4D5GA 4FSXA 1JALA 5AM4A 3CX3A 9ATCA 5ITWA 3UXEA 4EKYA 3E03A 3LQRA 4EHHA 1K66A 1GEEA 4GE3A 4S0ZA 1E2EA 1ANKA 1FFCA 2YZ7A 1WDKA 4A26A 3OI7A 2WZCA 1DTEA 1ZUNA 3VC7A 2PA3A 4Y2XA 4IMPA 4TPKA 5ALTA 1WZCA 2B8JA 2H1HA 4XAQA 1RWBA 5EG5A 3ZX4A 1A8HA 2HMSA 2K4MA 5JJIA 1R9JA 1ZJ6A 2CFTA 1MAWA 2EEPA 4S12A 5TMBA 1DE0A 3O4RA 3S28A 3RYTC 3WP1B 4AKGA 3KEQA 3QX8A 3F5SA 4QIHA 5FFNA 2P30A 4XPIB 4BV3A 1QQ7A 2BC9A 3SDSA 3WA7A 3QXCA 4Y9DA 4AJKA 2YV4A 1RBMA 3IPAA 4WZAB 1J20A 1BX0A 3L0BA 2IWRA 3C1UA 4UULA 3DF7A 2NUAB 1VHLA 2F1KA 3PL1A 1P9RA 2HSWA 2XADA 1E9VA 4H18A 4CCSA 4BIMA 4QYIA 1XDDA 2SKCA 1FA9A 3AKCA 5ESRA 5EZQA 3LM8A 4H3SA 3W78A 1IEXA 1F3OA 2VF7A 4NBSA 4CQMD 2YWHA 3C6ZA 1W46A 3ZLBA 3P45A 2BGJA 2HBQA 3HPQA 3HZHA 3OZDA 4J94A 4XUCA 3KLNA 2IEDA 3L6OO 4QASA 4TLDA 3RWBA 2FEPA 2RB4A 1Y9ZA 1IOZA 3TRFA 4NDZA 1KERA 3QLEA 1JECA 3PKZA 4QOHA 4DJEC 5IW8A 5KDLA 2FPOA 2GEDA 3PNPA 1TMOA 4UDNA 2W71A 5ESWA 1UFOA 3PUIA 2C3PA 2Y4OA 4HAXA 4GXQA 4HQRA 4QBIA 4RACA 5K0FA 3T4XA 4K7JA 2TS1A 4H7DA 3DE5X 1Z16A 2DFDA 3DLCA 3EZ7A 4XVUA 2WF6A 4MJ3A 4BPRA 4LUCA 3V4RA 2ZM6B 4PFQA 3ZNNA 1D6JA 2V8BA 1HX7A 5IZCA 1COWD 5H59A 3PFNA 1VA4A 2Q8PA 4R6WA 3WG9A 2YS6A 4QDJA 4V0MA 3QTBA 4PLYA 4HNUA 4ZPJA 3HBAA 1JXAA 3VJKA 1CY0A 3HBJA 2UKDA 2QD1A 4J2TA 4R1TA 3LXMA 1QG2A 2NM0A 3G1UA 3O91A 3OFNA 4RC9A 4ENWA 1Z0IA 4DCJA 1V5FA 2JCSA 1KETA 4XYGA 1E59A 3S2EA 3C4JA 3U3XA 4IDQA 2G07A 4JGGA 5ALWA 4GOMD 1P9LA 4K6GA 4Q12A 4A16A 1EVLA 1PG0A 1RWWA 1K8RA 2VBCA 3I5AA 3W5SA 1KH2A 3LI2A 9MHTA 1NIJA 2FOLA 4I4IA 3ZZ0A 2PLWA 4BB9A 5LZ7A 1MB2A 3UUEA 1T4DA 1N2SA 1SQ5A 1D0IA 2GR9A 2O1XA 3CLSC 2YZGA 3R0QA 4CETA 3SF8B 2QYTA 4WOBA 5KOJB 5A2QA 1QBKC 1G98A 4WE3A 4PW0A 3T99A 4ZEOA 1S3GA 4AJ9A 2VP9A 1XE3A 2ZE7A 4UMVA 4CIBA 5KQGA 4JC0A 1PJBA 3JV7A 4F4DA 3B7GA 3KUDA 4BUJA 4G0NA 2QRUA 4NYIQ 2YX1A 5EKDA 2R8PA 3ADCA 1UBFA 4EO9A 2DR0A 5LR6A 1SAYA 5FOXA 1EFUA 1M2GA 3CZ4A 1E7RA 3WDLA 3DMRA 4C03A 2A9QA 1KY4A 1A77A 4KIUA 3JASA 4NE7A 1PJZA 2GYWA 2QTAA 2OBXA 3OJ0A 1GKYA 4PZDA 4Q3AA 5F52A 1XL0A 3ZUPA 5A0TA 1F4LA 3UT5A 3U3OA 3MFQA 4IDPA 1NQWA 3M5WA 1L8QA 5B2ZA 2IX9A 1DO8A 1EFVA 1HE1C 1L5VA 3L8CA 4Q3EA 1QRSA 2FZ5A 2HH9A 3KT8A 1HH4A 4N8SA 3N2GB 4U2GA 4XLLA 3TZHA 3GNQA 5JLAA 1TAHA 2VZEA 3CEJA 3FNIA 3EVEA 3FVQA 1KY5A 3TQQA 1V16B 3CLUD 3L49A 3EIOA 5FLKA 3F3YA 2W2VA 3A26A 4I3HA 2KBFA 1Y37A 2R1ZA 1R1DA 3C1AA 1ZM9A 1J0BA 1SA0A 2O3RA 5GQSA 3WK4A 1AKTA 1W85B 5JH7A 4LECA 3KWJA 6PFKA 4XGIA 2G7ZA 1ISPA 4ZODA 6ABPA 1YD7A 3W79A 1QAOA 2VH2A 2JJ1A 5IHXA 3L84A 5FR1A 4DB4A 3PSHA 4B74A 2EGHA 1MV8A 3GGSA 3NHWA 4KN6A 4TQ9A 5JWRA 4CYMA 2YY5A 4GX1A 5FPTA 2FSVC 3T1YB 5D1HA 1XNQB 3UA3A 3VMFA 1TU4A 1JWBB 2B35A 1QG4A 1OXKB 2Q2WA 4P0TA 2WG2A 2A9OA 3T3GA 3ZGYA 3M6WA 3LY8A 4GL2A 2JEOA 4KPUB 1TE2A 1UC9A 3HYNA 2FW9A 3D4IA 3EGOA 1F5SA 5JZVA 3HRIA 1EXNA 1VRCA 2AOXA 4PO8A 3WJ1A 4JUDX 3CRNA 3HYRA 4HL6A 1YZHA 4JLUA 3ZWNA 1NFFA 3U13A 3WVNA 1UBCA 2AF4C 1NUAA 1E4OA 3SGLA 3DMHA 3I30X 1A5BB 2BFNA 3STVA 4BKPA 2E89A 3R24A 3OO1A 1NWHA 4PZLA 5ALLA 1VG1A 4XGRA 3L8EA 5AW9A 2ZYWX 2QR3A 4M49A 3LYUA 1NR5A 1TUEA 2O48X 2QRGA 1XZHA 5KWSA 3HXMA 4MKIA 1W9HA 4MUMA 3VR5H 2W11A 2XDWA 2QRZA 5J4VA 1LS6A 4FOPA 3PNQA 2PUWA 4KFRA 2AUNA 2LDXA 4RVGA 1BD4A 4BQQA 1YJAA 4TS1A 1GGKA 3WSVA 5CFRA 5TVGA 3FOWA 1N2BA 1SHTX 3RDPA 2VJDA 3GZJA 4HQ6A 5AKIA 5CD9A 3NIDB 5G3YA 3S7TA 2CFCA 2FCAA 2I7CA 3W2FA 3EZYA 1CUEA 1EVYA 1G5PA 1Z6AA 2V7VA 3CG4A 1JSLA 2FQWA 3KDSE 4RVDA 4TTRA 4W7HA 3B1KA 3GAZA 3GPLA 1WSBA 4G4IA 1M83A 2DPHA 3KL2A 2FLWA 4NOJA 4Z4HA 2OXFA 5DN6D 1V0JA 3OOHA 2I0FA 1Q3HA 4JIGA 4RY8A 2D0IA 2E7ZA 1W36C 4URVR 3OX1A 1PFKA 3JQFA 3ON5A 5CJPA 1TT5A 5F7ZA 4BX8A 1Y4DE 2HWYA 4GP6A 5J2UF 3SX0A 1MOSA 1N8TA 4ZQBA 1O8CA 3IP8A 1SU7A 1DJNA 5EC8A 5HMLA 1GRRA 3ZDDA 3PUYA 2NO0A 4FYKA 1HR0B 3IC5A 1D4FA 1UBRS 2R7LA 4X6XA 2PH5A 1FP4B 4LZPA 3OAAA 2BFCB 4BC0A 1R0ZA 1B3BA 1T4MA 1XQ9A 3OY7A 2R4TA 2B6NA 3Q3HA 4U2FA 3L7IA 5K3AA 3SJCA 1JL3A 1Z34A 1T24A 2VK8A 4BNNA 1IXZA 2FPPA 2WU0A 3M4ZA 3MGGA 1IY2A 4Q7JB 3D4PA 3TLYA 3VTZA 2PXHA 2PS1A 2H52A 5E4TA 1JDBB 2ZANA 1SHJA 3UKOA 3RASA 2AXPA 4HYYA 2C77A 2QG6A 1UIMA 4A92A 3IO5A 2W2MA 2XUAA 2EFEB 2YVQA 1H3FA 3O8BA 2CVPA 4L16A 3NTRA 4ZMSA 3H7AA 3PUJA 4KDFA 3KYDA 4BN5A 2JHPA 4RIGA 1TOAA 4GPEA 4UQOA 1H6CA 1T5TA 2R85A 2XMRA 1DFHA 1IWPB 1M1YE 1PBTA 2J4CA 3T1VA 1JPNA 2KSQA 3IP5A 4UU7A 1OZGA 4DBLE 1X74A 3UT5B 3IQHX 1E64A 4S24A 2VJKA 5CCBA 4HN4B 4IJVA 4MQ4A 3FOFC 4IWXA 3V9PA 2C8LA 2AE1A 1YTLA 2G1UA 4YJKA 2WPDA 4LG1A 3FSGA 4ENSA 3AHEA 4X3PA 4RF3A 4GBJA 1XPJA 3ZXSA 4WXRA 2VNJA 2UZ1A 2ERCA 4WQMA 3B13B 5H4GA 4LFBB 1KDTA 5EUCA 2DY0A 3Q85A 4QUAA 4EYOA 2W6CX 5T3UA 4JOCA 4TSFD 4XA8A 5T41A 1SA0B 1Q1NA 4EPYA 1J70A 2X1VA 1XVAA 2V59A 5J5AA 1Z5WA 4ZVQA 3KCNA 2C96A 3Q3JB 2J85A 1R50A 5D2CA 1E2QA 4YMGA 1M1YA 4L9RA 4YJ2F 3N2ZB 3SZOA 1O94A 2F1JA 3JYQA 3JW8A 2WJ4A 1LLDA 2LZ0A 4KBGA 1GFWA 1LLQA 1COZA 2HUPA 2IE0A 3GLGE 4XB1A 1EWTA 4MJXA 4RUKA 1QRDA 3KOWA 4MUFA 4AZTA 1PNRA 5G1NA 3SHTA 3KB8A 4AJPA 3FZEA 2EP7A 2VK1A 3CX6A 3CVVA 1BDHA 4KE6A 5C51B 4MKGA 1YIAA 2VYQA 1VMAA 4YJ3F 3D7SA 4ZHSA 2VDOB 1JILA 4X8OA 1W29A 2I78A 2FG7C 3EISA 4A6PA 5G0WA 4MDEA 4PHHA 5IAGA 3S2SA 2J48A 2DQKA 2XKKA 1KQ3A 1T5OA 1VLZA 1U2PA 3TGWA 3U40A 1RTTA 2BR4A 3VUFA 2DKFA 2RIRA 5K0BA 5AR1A 3O21A 2TECE 2MYNA 3A10A 3TI9A 1ZWKA 5AD1A 4FB5A 3Q12A 1G38A 1F6BA 1A4UA 1Q77A 3PP8A 3QU7A 2IZOA 3I4LA 3GLGA 3ZWBA 4DTCA 2GRAA 5KVCA 2XCRB 1NUPA 3HCAA 4MYCA 2A9JA 3W2TA 5FBRB 2D2EA 1XU7A 2A30A 2DOKA 3LQ4A 3L77A 3QEOA 4LNUB 4M87A 4B3CA 4AWAA 5L51A 3U16A 4ESVA 4K6KA 1YASA 3M1IA 4CV0A 2P5YA 2P91A 1VKHA 2YJZA 1A5TA 1SBQA 2WZQA 3A70A 3E48A 1B6TA 1B8OA 3ETEA 3V46A 5TE9A 2BUAA 3SYNA 4BX3A 3W5BA 2AZXA 2VQ6A 5CNJA 2FW6A 1M67A 2RSLA 3G9ZA 4RTPA 3ZW7A 3P27A 4G4SO 2YMPA 4YIKA 5KYXA 3WK8A 3LC0A 5LU9A 5U4QA 3HCOA 2QN2A 2WHRA 1V5WA 3R3UA 2ZSIA 1TT5B 2W70A 4ID9A 2OORA 3BA1A 4DM3A 3EW7A 2FSUA 3JWJA 3NCTA 4I7EA 4CIXA 2ZVPX 2PUDA 1EK6A 3B36A 4UDOA 2ZUTA 2PL9A 1IUKA 3LU1A 2EZ4A 1TKBA 3LHFA 4GBED 3PXUA 2BN4A 4CT5A 2QAJA 4KHZA 1TTPB 1YR3A 2BFWA 2DTEA 1NVEA 2FF7A 3B1XA 3GLRA 4F2PA 3I5YA 1MFPA 3IL2A 1DAOA 2WMOB 3QV2A 1J5EB 2Q6TA 3DWEX 1NYRA 4Q82A 4W99A 4YJDA 4AS3A 1IDOA 4IQFA 5FUBA 2FPPB 2QY9A 5HZKA 1VJRA 3PHLA 4YDRA 3HP4A 6NULA 4D9JA 1SVSA 2PPLA 1Q0UA 2BTOA 2WM8A 1FMFA 5FWYA 4DW8A 3CNNA 3LQFA 3A4TA 1J0EA 1NAHA 2P9EA 2VXBA 5CG2A 2IW1A 1DARA 4R2MA 1L3IA 3KYDB 2ZI4A 1HRDA 4WWHA 2DMRA 3K94A 3TS1A 1LV7A 4EAAA 3KUUA 2HYIC 3TRKA 5CVUA 3S2YA 1Y1SA 1ZN9A 5K01A 1AUQA 3HUEA 4YB8A 3VU0A 3BA6A 1G8GA 1L7EA 2V74B 3ESZA 3UZUA 4B3MB 3GUYA 3GOQA 3OZIA 1E9FA 3ZWOA 2JDID 2VAXA 3ONWA 1VJ1A 3KKOA 1K3FA 5L3QA 2ZJ2A 1MDFA 3R8FA 3DAHA 1FS6A 4S2EA 1WQ1R 4Q15A 2CBGA 3KETA 3W8EA 4BECA 2FPGB 1UDWA 3WLNA 4GI3A 3MWYW 3EF3A 4WEQA 3SQDA 2JW5A 3TCNA 5HUJA 4GMFA 4Z4QA 2WIFA 3SC2A 5K0EA 5KB3A 5FBZA 1ODLA 2BFBA 2I8CA 1BXGA 2O1WA 4A82A 4UDYX 3LRPA 1N2ZA 2LIPA 1OBOA 3N2EA 1GL6A 4A8JB 2EKLA 3RW9A 4TMZA 5K6RA 1PR0A 1BJTA 5C1OA 3RREA 1U63A 4Q1FA 1M1YB 1PR4A 1NQVA 2GK7A 3DO6A 3LDUA 4IMJB 4OH1A 5JQGF 1N36B 2WHYA 2XMDA 4JS0A 1MTOA 1YDGA 1RYFA 4R16A 3QLTA 3BIJA 1NUSA 4HI0E 4QARA 1EHYA 2JBWA 2RBEA 1JE0A 3GMIA 5E1BA 2P5UA 1QRAA 3IRUA 4OFZA 1CNFA 1I0LA 3UC5A 1NTRA 1V7CA 3JZMA 3RF6A 3U4AA 5EJEA 2QIPA 4TQUS 5JALA 3BJMA 1U8FO 2VF5X 4IEEA 1VHJA 3K2QA 1FUEA 4OM7A 4REQA 1EDZA 3TIIA 1R6DA 5FTLA 2B20A 4ZPXA 4D9MA 1Y7PA 5AW0A 1AN0A 3CLHA 5BYBA 4F4CA 1C3OA 1TO2E 2ECKA 2LPMA 1E3IA 1KKLA 1Q1EA 2BJWA 2PS9A 4OF4A 1QORA 1J99A 2HJGA 3BGDA 1P33A 1FJGB 1HURA 5CBPA 5DTIA 3AVQA 3MPOA 1C8BA 5JS2A 3MNFA 1UFVA 1EEHA 1A8UA 2XDYA 4MV5A 4R81A 3CKMA 3Q7SA 4DPMA 5KPJA 5LNK6 1Q2XA 4ZQHA 1H69A 1DUSA 5AVKA 1ZU5A 3NETA 3RBZA 2ZAYA 4ACAA 1PZXA 2XUQA 3GLGB 2O2ZA 3IEXA 1OV6A 1N1DA 1OC4A 2JFGA 3HUUA 5CK4A 5JCPA 5A5VA 3IVXA 3MIZA 5D7BA 1AA6A 2O0KA 3T06B 1PEAA 4ZOEA 4FE3A 3PX2A 1JZTA 2E4WA 1JMKC 2ZXEA 4M9SA 3RYHB 4BRZA 3ZVMA 3K70B 4JDPA 4O3FA 4EDFA 4AY5A 4YMSA 4NBLA 3RC9A 4KAFA 2ATVA 1G2IA 4D8XA 4UPDA 1U28C 2IODA 3L8DA 4D4IA 2GFQA 4B3GA 2HRCA 4DUGA 1JKMA 4F1WA 1H8ED 2C9ZA 2Q3EA 4QFCA 3FTCA 4FB4A 3ZD7A 2A0FA 4KXYA 5HJEA 4E5SA 5CB6A 1QIFA 1Q0TA 2Q5IA 3MUNA 4IQ0A 1EDEA 2RJNA 1DMRA 4QTZA 1BQ3A 2OB2A 1B4DA 4XPZA 4KHPB 3S8MA 1K5PA 1GL9B 1YSCA 4ND3A 4PICA 5DXFA 5FBKA 5LDDC 4F4FA 3CWCA 4G5HA 1KYVA 4R7TA 1ADJA 1XTZA 1YIDA 2CBXA 2E82A 5CJJA 2NU9A 4ZVTA 4GWLA 3W05A 3LQQA 5HKAA 1GUFA 3LSTA 1E2UA 3AF3A 3R9XA 3EPPA 1HYHA 2EXXA 2VP4A 3O84A 4LRSB 5KTKA 4YV2A 2YKGA 2RHJA 3LWNA 3QA3E 1C3EA 3GC6A 1ODJA 2B2NA 4LMPA 4JBGA 1ORVA 4PANA 3AIIA 2PMBA 3ISJA 4JENA 4DNFA 4YMUA 3BFXA 4OK5A 2C5HA 2WG0A 2RGYA 4J1NA 4DV5B 3U56A 3OJWA 2UDPA 2Q8NA 3IUEA 2HOQA 3KSRA 4HUTA 4NZMA 2B25A 3LLSA 1L4UA 3PFFA 3PIIA 4LYYA 4N54A 1BH2A 1ISFA 3L6EA 5IK2D 3KXKA 3AKYA 4UNQA 3R3HA 4B3JA 1QIDA 2GN0A 3OQHA 3DBLA 1BRTA 1HTWA 2CF6A 3U61B 1RSZA 3UVEA 2P9TA 3MT9A 4NAUA 2VEDA 1IU9A 1LQ2A 3EDMA 3LD9A 4PRYA 3UHFA 2JF0A 4BNFA 4NPCA 1OU0A 5BWBA 5L3SB 2ZXUA 2HAEA 2WNHA 2IL1A 2VXOA 1GRVA 4DJJA 3ZXXA 1E79D 2V7QD 2AQKA 3H05A 3W3AD 4BMZA 3KAPA 2BAGA 4KKXB 5DGDA 3D8BA 1BDMA 1NQOA 4PYJA 3UMRA 2AR0A 3EGCA 3O94A 3U3KA 3N8NA 3VZBA 1FFBA 4Y0AA 2X9GA 3LCCA 5EKXA 4QDUA 3VNUA 3L46A 2BFBB 3W5UA 1NV8A 3OF5A 4HXGA 4D74A 3B2EA 4JKYA 1JI0A 3ETGA 1E4VA 3D3WB 3AI3A 4UFOA 5FWXB 1FVOA 1XZJA 3IJ5A 3F5DA 3SSAA 4S1OA 2CNBA 5IPFA 1PNVA 4KNWA 4B0OA 1QIGA 2Y92A 1DWUA 3PA6A 5TPZD 5BSKA 2J9RA 4RADA 1NTOA 5HFNA 1PR6A 2X5NA 2YRFA 4HNSA 1XZIA 3OJXA 4CU5A 3GPBA 4HRVA 1YKSA 2PNFA 3KB2A 1CEYA 3LVQE 3ZOKA 3AWDA 4PG7A 3ZGNA 4EG5A 2GD2A 2WLTA 4GLLA 3KQQA 2WVGA 4REQB 2B92A 2ECQA 3F3MA 4GC5A 4U7FA 2EKDA 3ZY4A 3WB2A 1XTBA 3AZOA 1Z2PX 4W5NA 4FGJA 2IYLD 3TAXA 1PWXA 2WU3A 1C3OB 2FZKA 2H85A 3EAQA 1GD1O 2BE9A 3T3IA 4JC8A 4E12A 2HF7A 1NNSA 2FMKA 2G9QA 3L79A 2C1XA 4BNVA 5T3YA 2CCGA 5CBPB 5E6UA 1G42A 4CEHA 3EXG1 1S2IA 1FU7A 1HQKA 1OXSC 2O2SA 1TA4A 1XLUA 3TMKA 1UFKA 1VDMA 3BD8A 4X45A 3IDZA 2PMFA 4TZTA 4DLRA 3UT6A 4DNOA 3AI1A 4ZVUA 2JFNA 1OLSB 2QN3A 5K99A 5IRCD 5HEKA 5CD1A 3LL7A 3IIKA 1AUXA 4Z49A 4C7XA 3VNSA 3BTVA 3AR2A 3HSKA 2UUBB 2D3WA 3OVMA 1W2GA 2FFBA 4RQUA 3KB6A 2H7VA 4I3FA 5I4IA 5TQ0A 2R97A 2P4QA 1I32A 3M1AA 4O5OA 4W8OA 3PEEA 3M89A 4C06A 4CM3A 2D06A 4LSZA 1MN6A 3L1UA 1TEZA 2OV3A 1SBZA 1ZGJA 4RGQA 3V32A 4HFRA 3NEPX 5ULLA 4I66A 5HUQA 2I71A 4L3OA 4MB6A 3G2OA 1C8KA 5JAPA 4F3TA 1JDVA 2F90A 2VH5R 4RK1A 3LBAA 1QFXA 2O20A 3WZLA 4OX9Y 1PLJA 1UOPA 4Q18A 4O29A 1WMBA 1OE0A 5C2JB 1ZMOA 1MQAA 1KEKA 5IM4A 4I4TB 2J5BA 3HNRA 4ZTBA 4DIBA 3TECE 2GXSA 1PZGA 4R9RA 3B1FA 2ADMA 5AJWA 2IY8A 4AY4A 1U3FA 1JUDA 4GUAA 3T12A 3ILHA 1RWVA 3PUZA 3R9XB 1P2UA 1DKPA 3KLBA 3COWA 4CTMA 1DGQA 4AN1A 5KYTA 1IUNA 1GZ7A 3CA8A 1BEEA 4Q19A 5JMPA 2VCHA 3Q40A 5JCJD 2NZVG 2F3UA 2YR0A 3AERA 5DGCA 4CM7A 4O2AA 3AI2A 3QJGA 1XLVA 1P61B 3PWTA 2EQ5A 3CR3C 4C6HA 5C9ZA 3DR3A 4KEAA 2Z0MA 5AKYA 3DKIA 4TTVA 4PG4A 2JBHA 2DBZA 4MO9A 3DOHA 1SKYE 3AJDA 3C8DA 3HS3A 1DV2A 2HPHA 4XFDA 3WNDA 1LZLA 3V4ZA 2TSYB 3PGJA 4JYMA 2JD0A 3O8LA 2JIOA 3B6EA 3AUSA 1OHHA 3DBLB 5DGHA 4BX9A 3K9CA 2EERA 5AK6A 4U7DA 1GQ2A 5EWJA 1QYVA 2VIIA 1GPJA 1QHGA 2PRZA 4MW2A 5DU2A 1Z4QA 1H5UA 3EDCA 4Y3UA 5U4XA 5LQAA 4ND5A 4NEQA 1XN4A 3CLVA 4FOLA 4CEJA 1DG9A 2VOEA 1B3RA 2ZVJA 3GQVA 4KLZA 4OOFA 3RS2A 3WB0A 3WWYA 1CK4A 4NCAA 4QUHA 5ADVA 2DQYA 3QW4B 1Y63A 2NT4A 2WP8J 3C85A 1BMDA 1K0FA 3OWXA 5TQ2A 1ZSVA 2AOTA 3N8HA 1MT0A 3B3JA 1BGWA 2DBVO 1NQ5A 2V7EA 2HU5A 4G86A 3JR3A 1HI9A 3PD7A 1E92A 3UJNA 2BY4A 2QPAA 4XKJA 4ZEMA 5TVKA 1XO1A 3GB9A 1L5HB 1PWYE 2DCMA 4WT7A 5ER6A 3GA0A 1KVTA 2D4AA 2BFDA 2HDHA 4YEDA 1LNSA 2DBQA 5EP2A 5COAA 4DLWA 3UK1A 2Q9UA 2NSLA 5GZ3A 1VMIA 4X7PA 1DKMA 2IOYA 2IQIA 3JZIA 4J6EA 1GA1A 1VRWA 2X6QA 3RYFB 2BDEA 1NW9B 2FR1A 4KXFB 3ZWAA 4LOIA 4QQFA 1AQUA 3UUFA 4FEGA 1YZLA 2AVDA 4B48A 3O9MA 1QIHA 1WNFA 1VRVA 3ADKA 3TUJC 2JGKA 1FF9A 1WHSB 2IIBA 2XIJA 3HI4A 5EHXA 2OT3B 1N6LA 2OQIA 3CJQA 2Y9MB 4RA6A 3GUUA 3ILYA 2B4RO 5CLQA 3F9RA 1JQAA 1ZGGA 1WXWA 4MK4A 3CUYA 5DHPA 4XFJA 2EG5A 3MMPA 1JP7A 1JR3D 2QX4A 3OPVA 4MLDA 4PRLA 4QUGA 1LDEA 2O4UX 3EVNA 1YRAA 3FHJA 3VC1A 1JMYA 2GJ9A 3TD9A 5AIBA 4CEHB 2UVPA 1KOLA 2F8TA 4P3OA 4JP5A 4A03A 4FLMA 3P0RA 1R4MA 4RPJA 1CJKC 2V0NA 2X9QA 5AYVA 1PU2A 1QF9A 3JU3A 1AK9A 2W2LA 2ZIUB 4JLNA 2OXIA 3WGNA 4HYEA 4QQ8A 5KTOA 1B16A 1I24A 3CW9A 1DKOA 2NZYA 3ASUA 3ZE7A 1I3KA 3ZHOA 3ZHZA 4B09A 3LX8A 3T6KA 4BLVA 1E4EA 2XE6A 2Y6VA 2YNMA 3C6YA 1WUYA 3INYA 3LOPA 4YRFA 2OFFA 4CG3A 1AB5A 1M54A 1BKYA 2AE2A 3LPLA 2C29D 2YTZA 4LHYA 2H5LA 4GBMA 4WHMA 1RQLA 3R0IA 4YP1A 1GZHB 4E5UA 2AZDA 3JQ9A 5CDYA 3REOA 2VP0A 3CQ9A 2EGUA 3H9UA 4E2FA 3Q7TA 5I01A 2NSDA 3O1HB 3CUKA 4M88A 4BMXA 2NQ8A 2Y0EA 1U0TA 1NP3A 1PE0A 4HDSA 4MW7A 2OAGA 5M3BA 2IUSA 2Q28A 3TZQA 3UV3A 3ZCVA 1O6CA 4FOOA 5KPDA 1L4BA 5A4AA 2NZ2A 5KTSA 3COPA 4X85A 3IDOA 4HDMA 5JXIA 3FNQA 3ZU4A 1AD2A 3D7MA 4K2HA 2IUFA 4IUCS 1ESEA 1ZN7A 3AXSA 2VRCD 2IK8A 3K4HA 4NQRA 1F06A 1K4YA 1MU0A 4R9SA 3A06A 5AK3A 5F1KA 5K9ZA 1XZ8A 3MZ0A 1E7QA 1RLTA 5LQKA 1ISSA 3ROFA 2ZKIA 3E1SA 4EB3A 3QQ5A 3EXG2 1WV0A 4FFOA 2QIOA 2N9UA 4EI9A 3CONA 3N86A 2VYNA 4BMOB 1QE5A 2YOFA 1P7VA 3TUIC 3MELA 3AERB 4LY3A 4QUBA 4O2AB 3D7RA 4F21A 1W4CA 4EP1A 3O9VA 2VZLA 4KI7A 4KQMA 3ZJTA 5REQA 1XFDA 1CRPA 2MYPA 5AK0A 1DJLA 5ED0A 2Z6AA 2GARA 3HVIA 3KTFA 1HETA 2OWEA 3RVJA 1YQGA 4HEA1 1ETHA 5KYGA 1F0PA 2ORYA 3KKQA 4TRMA 4BQRA 4Z53A 5JDCC 4DCCA 2DFKB 2QTWB 3TSOA 5KOHB 3UJCA 1DIBA 3DM5A 2J6BA 4O4HF 1BS1A 2QP9X 2YVUA 4EG3A 4ZICA 2YYSA 1AKRA 2ZRBA 5C3MA 1N7GA 1U6IA 5EWJB 1PT7A 3TIGA 4PYQA 1U7TA 3BFPA 5LZ2A 3J81A 3DKPA 2P9YA 3GFGA 2GX6A 4LW8A 4RA9A 1JIQA 3IMKA 1I80A 2HF8A 3OQNA 4CEJB 3G0CA 4IHJA 2Q1TA 4DFDA 1U2GA 1HDOA 4I4TF 1IBCA 1V47A