2A94A

Structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
total genus 114
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a94A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2a94A02
4M55A 2ZB7A 3OECA 2V65A 3D3WA 3FN4A 3UN1A 1B16A 3E1KA 4E13A 3WNQA 2OOSA 4BV9A 3DAGA 5A3VA 5CFZA 4J43A 1QXSA 4EITA 1LDMA 1HE2A 1NNUA 2GYYA 4H3VA 1RPNA 5IN5A 1GY8A 4IZIA 5L4SA 1LBEA 2QHXA 3H3JA 1QORA 1WP4A 1ZUD1 3HNPA 4Q39A 3VZRA 4XJSA 4ND3A 1AXGA 4II2A 1IULA 1I3LA 5H81A 3WYEA 2CDBA 3ANLA 4GX0A 3QVOA 1D7OA 4DQUA 5TJ9A 1HYHA 1MFPA 2ZIZA 4DQXA 1ULUA 3DTYA 1YQDA 1MUUA 3CKYA 3IUPA 1U3VA 2W98A 4ZU3A 4FCCA 2DT5A 2XXBA 4YR9A 4QQRA 1QYXA 3GZNA 1DBVO 4BKQA 3OBBA 4CUZA 4Z9FA 4DPKA 5JCXA 4NBTA 3T4EA 3L6EA 4IJUA 2YJZA 2PD6A 3GPIA 3NV9A 1XYGA 1NAHA 2V6BA 1VL0A 3FNHA 1LNQA 1YBVA 4P22A 4L75A 1QG6A 3E5RA 2PKQO 4IJKA 4KOAA 4ONEA 4L76A 3KYDA 2RH4A 2FPIA 3BIOA 1NFRA 4YAIA 1U8FO 3OF2A 4MKRA 4DGSA 5KJ6A 1EK6A 3GGGA 3LLVA 3JSAA 2OZPA 4M49A 1EEHA 3PIDA 4YACA 4Y6RA 3V8BA 2O7QA 2OORA 2ZCVA 1XU9A 4OMUA 3ZV3A 3FHLA 3ETGA 5T6BA 1PGOA 1R16A 4HUJA 5ICSA 5F1PA 3PYLA 1KVTA 5EIOA 5T8KA 4YVFA 4Z9XA 1RYDA 2OHXA 4MIYA 4Q3EA 3B1FA 4BOYA 3JD2A 3PQDA 3OQBA 2EKLA 1HYEA 1ZIDA 5FI3A 4J7CA 3I9NA 2ZB4A 2ZB8A 5KOIA 3LU1A 4JXKA 1G0OA 4JJFA 5DCUA 1SB8A 3CH6A 1MGOA 2PGJA 3WTBA 1NBOA 2O3UA 1BG6A 4TROA 1P1FA 4ID9A 3JQ8A 1BGVA 3CIFA 2AA3A 4DUPA 3OJ0A 4CMEC 1WXDA 3GEDA 3C1AA 3PIIA 4PLVA 1E7MA 1N1GA 4JP2A 3WBBA 2W2LD 2YDXA 1L7DA 1LI4A 3G3EA 1PJSA 5EL0A 4DC1A 4U6QA 3V5NA 4LCEA 2EJWA 1NHWA 1N92A 1ZJYA 3C7CB 3FRJA 3K96A 3LF1A 4LSWA 4WUVA 3PQFA 4NG5A 3PWSA 5JDIC 1JKFA 1WNTA 2HO5A 3BMCB 4ESOA 3L4BC 5G0TA 1D1TA 4WKGA 1LLQA 1HZZA 4BNFA 3HDQA 1E5LA 3ST7A 3IJRA 1LJ8A 5K6AC 1NP3A 3F9IA 3MTGA 5DOZA 4E32A 5U9CA 5GY7A 2EW8A 2NVBA 3UF0A 4DLBA 4BL5A 1Y8QB 1NPTO 4XGNA 3CZMA 2QW8A 3K92A 3BTVA 1TA4A 4NU5A 5AXDA 1P1IA 2DFDA 4PLFA 1ZXBA 3RFVA 1S6YA 3ANNA 3BMCA 4FJ1A 3VPFA 3F1KA 4I1IA 3PJEA 4UEKA 2UUOA 1XIVA 2X0NA 1X1TA 2SCUA 4GBJA 2ZYGA 4WEOA 3WLFA 3ZNQA 2AG8A 1LDEA 3P19A 4BB6A 1ZNQO 1YDEA 3DOOA 5BSGA 1A7AA 2AEJA 4YBZA 4IQ0A 4BNIA 1KC1A 6LDHA 1H2HA 4J1NA 2B4QA 3PWKA 4C4OA 4FW8A 3KZVA 1E92A 4RPHA 3VVCA 1SO8A 1MV8A 3ASUA 2XPCA 1Z7EA 1DIHA 3TWOA 5KJFA 3I1JA 1MB4A 1Z73A 1LSJA 4PFJA 3GZNB 3KEQA 1F8FA 1AXEA 3FNGA 2VZ9A 2B4TO 1E0DA 2ZK7A 3ADPA 4XKJA 4RF4A 5L7YA 3VPXA 5A9SA 4NFHA 3E8XA 3IUSA 5FEUA 5CDGA 4Y8VA 1WW8A 2AQIA 4EJ0A 1GQQA 4F3YA 2P4QA 3DC2A 4CLRA 5G2OA 1LLDA 2P91A 1J0XO 3ETDA 4LSMA 3RU7A 4D44A 1LC0A 3BHMA 4NNJA 1ISFA 3M2PA 2X8LA 4A27A 1DRUA 2P5YA 4CQMB 4BO3A 1GQYA 2HU2A 1J5PA 3RUAA 3O26A 4ZRMA 1IHYA 4J7XA 4MVJA 5IDYA 4PG7A 3TZQA 1NFQA 1DJQA 3I23A 3IKVA 4I8XA 4EI2A 2CUKA 4YQYA 2Z1NA 1JAXA 3GNTA 4OM8A 1H6BA 1D1SA 3PHHA 3INRA 4MKZA 1GUYA 2I3GA 3PJFA 2YW9A 3GMSA 5T67A 2DBVO 3KUXA 4K6FA 3UH1A 3UUWA 3JD3A 4AJNA 4CLOB 5CEFA 2LDXA 1C1DB 3PP8A 3GA0A 5JBIA 2A9FA 1VPDA 2BFMA 2E82A 1UAGA 4RVFA 2FWMX 5JDCA 4FC6A 2B37A 3RQSA 4EEXA 2QQ5A 3JYLA 2C07A 1UZLA 2AMFA 1JKJA 4Y9DA 4CLRB 3NEPX 4N5NA 3GEMA 4R3NA 2IZ1A 2I67A 1NYTA 2W2KB 3KYBA 5G4LA 2X9VA 2Y67A 4EUEA 1R37A 4HADA 1T26A 3V1UA 4YJFB 1DIRA 4PG4A 5JPIA 1XG5A 2RCYA 1LDYA 1M67A 2VCYA 3ZWWA 4D0SA 2FR0A 2VYNA 3E48A 1WDLA 1UAYA 3JQ9A 3GEGA 1UH5A 1I3NA 4NDNE 4XDZA 2ILTA 2R00C 4CM4B 5COBA 3TN7A 4R5MA 4JGBA 3TPCA 2PTGA 3DHEA 3FR8A 3FPCA 3P2OA 5FF9A 4PLHA 5TX7A 4OXKA 4NH4A 3WICA 3L6OO 4W82A 4BGUA 2G0TA 3E9NA 4RF2A 3HFSA 2HKIA 4E4YA 3G17A 5I7EA 4AJLA 1JDJA 4OOEA 4HP8A 3TQHA 2VRBA 2YFHA 4BO2A 3EC7A 4RVUA 3ZWMA 4PG8A 4TVBA 4BO1A 2HSDA 3EAGA 1P44A 3ZZNA 3WR5A 3KHUA 5F21A 3VDQA 1CYDA 3CTMA 3PFFA 3O38A 3PHJA 4MP8A 3GN1A 3WSVA 2DPGA 1GTMA 1E3WA 1UJMA 2G5CA 3PI7A 5T64A 4ALIA 1PR3A 3ZNPA 5L7WA 3IAHA 2EWMA 3INGA 1KS9A 4PLCA 3L6DA 4HNGA 1CIVA 1U2GA 3AOEA 4ZQFA 4CV1A 1SAYA 1GADO 5BQFA 1H0KA 2CVQA 4NBVA 3F3SA 3E9MA 3L77A 4KDFA 3RI3A 4ALJA 3RC9A 5EPOA 4GI2A 5G0WA 4WJZA 2VHYA 2EV9A 2FHSA 2O4UX 1BVUA 4WASA 2EJVA 1EE2A 2EIHA 5CG2A 5IN4A 1PS8A 2GR9A 4PVCA 4CMKA 2NQ8A 1TEHA 5IXYA 2O50A 1XQ1A 4CV3A 3OH8A 4W4TA 5JW6A 3TZCA 1CDOA 2Y1OA 3VKVA 1SC6A 3PDUA 3IMFA 3S2EA 2NU6A 2NVWA 4YAKA 3G1UA 3AUAA 1XR3A 3IS3A 3S2GA 1C1DA 3MTJA 4XDYA 4M8SA 1F06A 2DTDA 3IOYA 4Z6KA 4YTEA 3HJAA 2BH9A 3V2HA 4CJXA 5JXWA 1EUCA 4P38A 5THQA 2E49A 3EVNA 3GZ4A 3JTMA 1ZSNA 4XYGA 1R0KA 2CF5A 3TL2A 4BNXA 3S2FA 3PTZA 4ZJUA 5J23A 2UDPA 1EE9A 3D1LA 1NVGA 2NADA 4CLHA 1X7GA 2OMEA 3KLMX 4FPXA 3OFSA 5DOVA 3SJUA 5GZ1A 2Y1CA 2VYVD 2ZTMA 3OETA 1MFZA 1T24A 1HDRA 4FFLA 5TQVA 4YJHA 2WYWA 3LF2A 3NX4A 1IHXA 1N9GA 1QRRA 1W4ZA 1K3TA 4U6SA 3JYQA 4IIVA 2BD0A 3GRKA 4XQ9A 1JU9A 4B4UA 2A35A 4DIFA 4CM8A 3TZKA 1NR7A 2AEMA 2HLPA 4IIUA 3ZWYA 1B7GO 2X9NA 2JFHA 2WYUA 3AM3A 3ROKA 1N8KA 3JQBC 3DEYX 2FR1A 3MOIA 3TOXA 4RVSA 4IDDA 3GQVA 1UXHA 4O0LA 1E6WA 2FY8A 2H9IA 1I3KA 1P74A 3CZRA 3H7AA 3O9ZA 3RBZA 2Q99A 4RF3A 1DRWA 1WMAA 2VWPA 3C8MA 1T2CA 3I83A 4RZIA 5MGBA 1V0JA 5B4TA 5JAZA 3W8DA 2BELA 1QYDA 1RM3A 4WLNA 4FOOA 1YS4A 1LXCA 2EF1A 4CL3A 2I6TA 4LGVA 4DIBA 2WYVA 3PEFA 4GQAA 2ZTLA 1PGNA 2EP5A 3JQAD 3VH2A 4NU6A 2DKNA 7MDHA 1KVQA 2H63A 1WZEA 4UVIA 4R68A 3VVBA 1U7TA 4XQEA 2P4HX 4IQ8A 1CWUA 5KTKA 3LLSA 4YJGB 2ZYAA 3D4PA 5U4QA 1PZHA 3H65A 3RC2A 1C0LA 4J9VA 2WJPA 1BXZA 3QW2A 4BNWA 4LRSB 2HK9A 4HKTA 1MX3A 2TMDA 3JCZA 8LDHA 3H2ZA 4X54A 4LRTB 3H2SA 3UCEA 1PJCA 3H9QA 5C5IA 3WGQA 4DREA 1EBUA 4BGEA 2PY6A 4D45A 3JQDA 4AVYA 3H9UA 4E2YA 2B36A 2PZMA 2X6TA 5KCZA 1PQWA 3TRIA 3I52A 3TSCA 2Z1MA 1ZSVA 1P3DA 3DZKA 3H6KA 4DL9A 3GR6A 2O4CA 1T4DA 1I32A 3K5PA 2GPTA 3PVZA 4LVUA 3RUEA 3NGXA 5JSFA 3OIDA 3ZU2A 3KOUA 3PLNA 1SOWA 3F6YA 4ZVVA 1XQ6A 5HTOA 1OC4A 2WD8A 4I9UA 1ZK0A 3C85A 5I9LA 1PWZA 3ICPA 4JN6B 1I36A 3BAZA 1KETA 4CMGA 2I66A 3PGJA 4F6LA 2Q3EA 1I3MA 4YAJA 2D0IA 4CMHA 2X86A 4YRBA 3EUWA 2GN9A 3KSUA 2POQX 3WSWA 1JN0A 1IL0A 4BVAA 3A06A 4QT0A 2I5PO 4E2XA 2VTEA 4Q3CA 4YRAA 3FTNA 2HRBA 3L4BA 4XJTA 3W6UA 3GGPA 3QVSA 1ZJZA 4TMFA 2A4KA 4BNMA 3GY0A 5AOVA 3KEOA 3RAJA 2P5UA 5JC8A 1Q0LA 5COQA 3OJEA 3SC6A 3UVEA 4RJTA 1DSSG 1V6AA 1BTOA 2WEKA 5A04A 4TRMA 4K28A 4J1QA 2X9GA 2AE1A 3BMQA 3JQ7B 5H82A 3X2FA 1F12A 2EGGA 2DBRA 9LDTA 1P33A 2Y0EA 1TT5A 4FQ8A 2VUUA 1LA2A 1GQ2A 3BTOA 2WMDA 4IDGA 1Z45A 1DDOA 3SEFA 1IY8A 3JQFA 5IF3A 2YZ7A 1RKXA 3B6ZA 1QV6A 4YJDA 1YB4A 2Q2QA 2Q2VA 5DZSA 3U3XA 1K5HA 2IXBA 3VDRA 3AY7A 1HDZA 1Y9EA 3A28A 4HV4A 4BB5A 4DPMA 2UVDA 1LLCA 5JY6A 4PIVA 3BMQB 3JQ7A 3PHGA 2YDYA 1KIFA 4LN1A 3ROQA 4AJKA 4MIOA 5TT0A 1DHTA 2HMSA 4NK4A 2DBZA 3ENNA 3GRPA 3KM0A 3V2UA 1LRKA 2J5RA 4CLOA 2DU8A 4YQZA 5I9MA 4P8RA 3CE6A 2BF7A 1E7WA 2J3KA 4DIOA 3KYDB 5AYVA 2HK8A 1HXHA 1I0ZA 2O48X 5L45A 1MC4A 1R4NB 1Q0HA 5CP8A 1PTJA 2EW2A 1XLTA 2D5AA 4EYEA 1AGNA 4O63O 3U4HA 3WGHA 3NT4A 2VT2A 1IYZA 4WOKA 1LX6A 4BQPA 2FR8A 5JDIA 2YHUA 5KJ1A 1O8CA 3FCOA 1JVBA 1K2WA 1KVRA 5HBRA 3D4OA 3ONEA 3UGKA 2JJYA 1LSSA 4IDEA 3CINA 1XELA 4FDAA 3WB9A 1ID1A 4RDIA 3ZH2A 4IQGA 1H6AA 1KEVA 2QG4A 1LRLA 5EN4A 4MJLA 4XRGA 1Q7CA 3I9OA 1T2EA 4U7WA 4LCJA 4R1SA 4W99A 5JMWA 1N2SA 3LT2A 4ROSA 4DVJA 1GPDG 3GAFA 5BNFA 4CM6A 4GH5A 5FI5A 4R1UA 3MZ0A 3S55A 3VKUA 1UUFA 3G49A 1D8AA 2CDAA 3PPIA 1CERA 3WG9A 1DLJA 3H4VA 3OSUA 2CF6A 2VZ0A 4JK3A 2VYND 1PJ4A 4Z3KA 4GGPA 4GPD1 2WSBA 1YXMA 5TIIA 3U9LA 3WMXA 4D79A 3H9JA 2FZEA 4BS9A 1EVZA 1KBZA 1GUFA 4XYMA 2HK7A 4M89A 5ILOA 3BMOB 3SXPA 1VLLA 2EG9A 2VRCA 1LDNA 3WYCA 1H93A 3DTTA 1ISJA 1YDWA 2VHZA 4NHEA 1O9BA 1Q0QA 1T25A 3FNEA 4IZHA 1PZGA 4DLAA 4A26A 2DBQA 4WLUA 3GK3A 1YE3A 2DUUA 1HZJA 1E3IA 2UUPA 5ER6A 1MXFA 1GV0A 3DHYA 4H15A 4HX5A 3WIDA 1ZBQA 5CEJA 4KTVE 1GYRA 3WXBA 4WPGA 3A9WA 1YO6A 3RUIA 1M76A 2ET6A 4FR5A 4FFMA 4RO0A 1XGKA 3DBHA 2WWRA 1DOHA 3MCVA 3BXXA 3W8EA 1Z74A 2P2SA 1C3VA 5CDYA 4BNYA 2C5EA 4ZQBA 3TOZA 2B83A 1HTBA 5KVQA 1PR9A 1ZK3A 2CY0A 1PGQA 4FGSA 1B8UA 2O7SA 4KWIA 1BDBA 1TLTA 2D3TA 2JAHA 3DBHB 4GAEA 4R51A 1A72A 4A03A 2VOJA 2I99A 3JQAA 2I9PA 2WE7A 1XSEA 2FN7A 1U28A 5CHEA 4BNNA 1H9BA 4EEZA 3C7AA 4CLXA 5L95A 3RU9A 4O1MA 3V1YA 1CQIA 4MVJE 1NR1A 4ZA2A 4DYDA 2B0JA 4K6CA 1GZ6A 1P0FA 3AJRA 1T2DA 3VH3A 4CMEA 3E18A 3C24A 1VKOA 2OBYA 1HL3A 2B5VA 3P5SA 4G65A 4PZEA 4CUJA 3PJGA 1R4MB 3ZN2A 1ENOA 1H2BA 5DDIP 3ZU4A 2HAEA 2C59A 1K6XA 3D64A 4TRNA 4HFJA 2ZQYA 2PKRA 2IODA 1E1LA 4E3ZA 1F17A 1WPQA 5CPBA 2DQ4A 2JD0A 4E5PA 1O94A 1D4FA 3MWDB 4NFYA 2PA3A 1XEAA 3MJCA 1ZMOA 1Q2XA 2CVOA 3QVTA 3E6AA 1GL3A 4YT5A 3Q0EA 2FP4A 2IE0A 2Q46A 2BKAA 1E7QA 2YHIA 3TFOA 1OBFO 3FD8A 1BDMA 1DPGA 4PLZA 4IINA 1F8GA 1ENZA 1O5IA 1Z75A 2EERA 1X13A 3KSZO 4GGOA 3DMTA 1AE1A 4II3A 1E3EA 4W7HA 1PU2A 1YQXA 2G76A 3JQ8B 3U62A 1FDVA 3R0IA 4FOSA 1TB4A 2GRAA 4QXMA 4HFRA 3JD1A 1JWBB 4P4NA 1JVSA 3WYBA 2WD7B 3D5QA 5K0ZA 2B35A 1HDYA 4KZPA 1GCUA 3K9QO 4QEDA 1MG0A 1KEPA 3H5NA 3IDSA 4QUKA 4HFNA 1R4MA 1DIGA 1KEUA 3GFGA 3Q1LA 4J16A 2GGSA 2BFOA 4RPGA 1SEVA 1A9ZA 2HDHA 4TRJA 5AXAA 4B4OA 2NTJA 2O3RA 4LMRA 4UEJA 3HN7A 2VWQA 3MJSA 1MC5A 3OA2A 2EKQA 4PVDA 3F46A 4E6PA 1WAMA 1E7RA 4BNUA 3Q9UA 4QX6A 4KUGA 2PD4A 1U5AA 2J8ZA 4R16A 5B37A 1KEWA 1M6WA 1J6UA 3K2BA 1DIAA 3L9WA 4ND1A 3SC4A 3I9KA 4CMAA 1PWXA 2D2IA 4W7IA 5DP2A 2HRZA 4N18A 1PJLA 3IQDB 3F47A 2Y0CA 3KBOA 2R2GA 4BNKA 5B12A 1GAEO 2O3JA 1HE5A 3LVFO 4GX5A 5A5EA 4NBRA 2EXXA 2Q49A 2RIRA 2Y05A 4B8WA 5I8ZA 2Q45A 3DBLB 1I10A 5ENVA 4W9NC 2GCGA 4D46A 5L7TA 3NGLA 1E3SA 1MP0A 3IIEA 1YOVA 3D7LA 3DR3A 3W4KA 4NI5A 2UV8A 4KDEA 5IZCA 2GDZA 5EJ2A 4AJOA 3AFNA 4KQXA 4IDBA 2OP0A 4KWHA 3JQCA 2E6UX 5HWSA 2OUIA 2VHXA 3HE3A 1NX6A 4XWYA 5G4KA 4AJ2A 1GD1O 3IP1A 1D3AA 1GYPA 2C82A 4AFNA 1IZ9A 4I5DA 4PG5A 4U0KA 4ALLA 1DAPA 1R15A 3N74A 1SBYA 3CMMA 3TZ6A 1YOVB 2G17A 3BMNB 3R3SA 1H5QA 3UXYA 2PZLA 1DC5A 4BNZA 1ZO8A 3KO8A 1ZSYA 1JAYA 3NJ8A 4DTIA 1YL7A 1VM6A 2QYSA 2W2LA 2FOIA 1OI7A 2YV1A 3JYPA 4WLFA 5DBFA 3T7EA 3OICA 3I5MA 4OYRA 3HDJA 3ORFA 3ZV6A 1BXKA 2GNAA 4DA9A 4E33A 1P31A 1UXKA 1ZEMA 1ZCJA 3PRJA 4NBWA 4E0BA 4JBGA 2IDZA 4OH1A 2R6JA 3DOCA 3VPHA 5JS6A 4KUHA 4J2OA 1QSGA 4EDFA 3S1LA 5G0SA 1UP7A 4RF5A 3I4FA 1P45A 1Y6JA 4YAEA 4B4WA 3QWAA 1JWAB 1Y7TA 3AOEC 4LK3A 3GUYA 4FIZA 3ZV4A 3WGTA 2J6IA 3GF4A 3VPGA 1B3RA 1YB5A 2HMWA 4BMNA 3ROMA 2DTEA 3ZWAA 2IXAA 4L8VA 2R00A 2YUTA 3JQAB 5IFLA 1HDCA 1K6IA 3K2EA 3K8ZA 4WE3A 3M2TA 2BLLA 4BQRA 1VI2A 3QVWA 4MVJG 2WD7A 4CM8B 5BNIA 5DP1A 3DBVO 4NJMA 3DL2A 2QYTA 3DQPA 3EW7A 1LDGA 4BNTA 1ENPA 2DC1A 2WTBA 4YRDA 3ZWBA 4MVJF 2RAFA 5THKA 1VSUA 1BXGB 5A03A 3JQEA 1YBAA 5L4LA 1MXHA 5TC4A 4DWVA 3LSYA 1GU7A 4J7UA 4R4JA 4JCOA 4CMCA 3WNVA 1N5DA 4CLDA 2IZZA 3HDHA 3VHRA 3R1IA 1EUDA 1TI7A 3H9EO 2Y99A 2QRJA 4ZQEA 1R66A 3LT0A 3AK4A 2YQ5A 3JD0A 2CNBA 4UUPA 1TXGA 2PGDA 4ILKA 4FFPA 5HRUA 4YYZA 5ES3A 4QSMA 1M66A 2GASA 3RUFA 1R4NA 4JQCA 1YVEI 5ITVA 1QMGA 2PR2A 3HWRA 3P7MA 3WTCA 4ZICA 4IM7A 4WLVA 1BW9B 4GKVA 5A06A 4A5OA 3QY9A 4TZTA 3JYNA 1XHLA 4HWKA 4WLEA 3PZRA 4RDHA 4WK6A 1QYVA 4S3MA 4JJGA 5KIAA 1MLDA 3H3FA 2X7HA 5F1KA 3QVXA 2YQ4A 5IG2A 3SLKA 4BGVA 4A7PA 2PNFA 5EQDA 2YY7A 4YT4A 2VQ3A 1N1EA 3L07A 3GMDA 2FSSA 4CM3A 3RSHA 1ISIA 3WS7A 1AUPA 3DONA 3DMYA 1FDUA 2NU7A 5KNLA 2EKPA 2GZ1A 2PFGA 4BNGA 4GLOA 4AJEA 1P1HA 3UKOA 4FFOA 2Y68A 4C7JA 2IRWA 2EP7A 3ABIA 3OEWA 1K89A 5KKAA 3WX0A 2XOXA 3A14A 5B4VA 1J4AA 1CRWG 1FDWA 2GLXA 1DB3A 4ZRNA 3MJVA 5JMPA 3RCBA 5KJCA 1ZK2A 4Q3NA 1YWGO 1PJTA 5F5NA 4XRRA 5JAIA 2RH8A 5T5QA 4GWGA 1A5ZA 4JP3A 3KYCB 3MEQA 4CR8A 4MINA 2VT3A 2E4AA 3D4NA 3RKRA 3WQQA 1BW9A 2HMVA 3K6JA 5A4DA 1LSOA 5CDUA 4AJ4A 2BRUA 3GHYA 4RPKA 4RV9A 1E77A 1E1KA 1H94A 3PJDA 1W8DA 2C20A 3LC2O 4QFCA 1ZK1A 2X58A 4UUNA 3H9GA 3PLRA 4G2NA 1E3LA 3I6IA 4B7CA 4UVEA 2GZ2A 2AE2A 1T1RA 5FYDA 3KYCA 3F5QA 4WCDA 2GN6A 2ZJ0A 4LVCA 3DWFA 4J9UE 2Q2WA 1R0SA 1ZZEA 4MKXA 2C2XA 1L1FA 2X4GA 3R6DA 1QLJA 2CSUA 4FS3A 1PSDA 3WQSB 4B4VA 3OMLA 1NFFA 4BIIA 3Q2KA 1F0YA 1U1IA 1T1SA 1VL8A 1WZIA 4CL8A 4D3FA 3LT4A 1ZEJA 3UHAA 2VYVA 1UXJA 3OQ1A 5MDHA 5JYEA 2C0CA 4GSLA 1LUAA 1ZFNA 2Y66A 3BMNA 4EZBA 3ZWOA 4Q3DA 1B0AA 3L4SO 3ENKA 3JD4A 1UR5A 3AY3A 2X1HA 2NU8A 1HLDA 1HT0A 1P77A 5L53A 3MOGA 2GSDA 1ZK4A 1WVGA 3M1AA 4L0QA 5LDHA 1N9GB 3EHEA 1AHHA 2DM6A 4WEQA 5GZ3A 5L3ZA 1VE9A 4L4RA 3GDGA 1DC6A 1TT5B 5I8WA 1IPEA 1B14A 4UREA 1KOLA 1C14A 3ZV5A 1DAOA 4WCFC 4DXHA 3HN2A 1P1RA 4URFA 3X2EA 4DQVA 3ZHBA 4I9HA 3PYMA 1DFGA 4MO2A 3WFJA 1RM0A 4UUMA 1HKUA 2GD1O 3UFXA 4YAGA 1LEHA 4OL9A 3LZ6A 1SMKA 4BNVA 4Z3DA 1R0LA 5TF4A 4TVOA 3JQ6A 3ZW9A 2NSDA 4HY3A 4EBFA 4FC7A 2P9EA 2FPPA 3M6IA 5KVSA 2ZCUA 1E5QA 4JIGA 1PJ2A 5EQFA 3PWZA 3W4IA 1VL6A 2CZCA 2OBNA 3SX2A 1P1JA 3EY4A 1W6UA 2AW5A 4N7RA 4MP3A 4PLYA 3AWDA 3CPSA 3PYXA 2AG5A 2JHGA 1A9YA 3EDMA 1PS0A 2IEDA 4J3FA 3VC7A 3GFBA 3E03A 4GWKA 4XGIA 5CDTA 5TJHA 5IZ4A 7ADHA 4TKLA 4CQMA 1Y9AA 3MJEA 5KWEA 1FDSA 1PL6A 2NV6A 1HLPA 1PJ3A 1QKIA 2D59A 1LQUA 3I3OA 4JLWA 4XIJA 3S8MA 4YA6A 2NQTA 2GUGA 4E2ZA 5F1OA 2F00A 1NAIA 5I9NA 3ZWXA 3AM5A 1DEHA 3NYWA 4G5HA 1HSOA 2B69A 2EGHA 4EGFA 1NQOA 1GYQA 5IZCC 1XCBA 3GHHA 5K9ZA 1OZAA 1EDOA 1E3JA 4N5MA 3NAQA 4GX2A 3FF4A 3BA1A 1EBFA 2WM3A 4OQYA 2IYOA 3ZU3A 4E31A 5L51A 1PS9A 4LISA 1EQUA 4TWRA 5GMOA 4FD3A 4D0RA 5C7IO 5DCWA 4XYLA 5A02A 4PLTA 3GVIA 3RC7A 4RVGA 3IL2A 3FI9A 1JKIA 1UDCA 1FK8A 3KSDO 4AJHA 3AU8A 1EFLA 3RFXA 1NPYA 1KERA 5CG1A 4OAQA 4Z0TA 1NASA 2O3TA 1YONA 4MVJI 4KMSA 4M1QA 1U4OA 3RBVA 5BNTA 3QLJA 1HF3A 4XYEA 3TL3A 2PH5A 2HJRA 5TSDA 1Y1PA 3NKLA 1NHGA 4PZDA 2JCVA 4RLHA 1WMBA 4XR9A 1KVUA 2DLDA 2Q1TA 3NDIA 2VHWA 4J49A 3K30A 4AJJA 1KY4A 5IDQA 2JD2A 1PL7A 1SB9A 1ZKMA 4MVJH 2V7PA 5G4KB 3QSGA 1Q1NA 1U3WA 4GMFA 4JX8A 1BRMA 1HYGA 2JFGA 4OHUA 3WGOA 3RKUA 2ZATA 4DYVA 3S2IA 4YPOA 1RM4A 3CUKA 4ALKA 5GZ6A 3DZJA 3D3EA 5U1PA 5TT1A 1UP4A 3NJ4A 3RD5A 3JYOA 3O8QA 1EVJA 4BO0A 1OAAA 1G0NA 2O23A 1DXYA 1HE4A 4PN3A 4BO9A 1UXGA 3UCFA 5TGDA 3OHSX 3WJ7A 4J6FA 3ZI0A 3ZNNA 4ALMA 1O6ZA 4LMPA 4QO8A 4J2HA 2IYPA 2O3QA 3DB2A 4MVJP 2Q4BA 5L9AA 1X0XA 1Y8RA 1B8PA 1NM5A 3I9MA 3H8VA 1EK5A 1ZH8A 1C0IA 4C7KA 3DZGA 5I7SA 3KB6A 3CMCO 2VOEA 2VNAA 3U0BA 3FBTA 3QP9A 2D5CA 1PEDA 3ITDA 5DULA 1EVIA 1BMDA 3DMTC 5A1TA 4W9NA 1G1AA 3D0OA 4WNCA 2J5KA 4Z0PA 1YJQA 4UAGA 1Z82A 3RFTA 3U5TA 4XX0A 2G82A 1U8XX 3HB4X 3TNLA 1UP6A 3JQGA 3N58A 1O95A 3GOHA 3RC1A 4NZ9A 4PLWA 4I5FA 3KETA 1U3TA 1PJQA 4YEDA 3UICA 1VJ0A 3PK0A 5JCJD 3DFUA 4L4XA 3BHIA 5TS3A 3T7CA 4J4BA 5F5LA 1DC3A 1BXGA 1PGPA 3ANMA 2C2YA 3DOJA 4INAA 4A73A 4CLEA 4BO8A 2FMUA 4BUCA 4NJMB 2X0IA 3ULKA 5JC1A 3AM4A 4FB5A 4NMHA 4EJMA 2Y1DA 3IKTA 4CM9D 4PLPA 2NM0A 1O89A 1B3BA 2C7GA 2H6EA 1EVYA 2C7VA 5HA5A 4OQZA 1XWFA 4AJIA 4IJVA 2PK3A 1KYQA 5DF1A 3DXFA 4D3SA 4Q3AA 1U9JA 3A1NA 4TSKA 2Z95A 1M75A 2DUWA 2PLAA 4BKUA 3QWFA 2PWZA 3ZHXA 3NDRA 3NTOA 3PQEA 4RPLA 1M6HA 3BTSA 1E3WB 3N7UA 1U3UA 4YJHB 3TFQA 1QYCA 2ZKLA 1CEQA 3QV1A 5LDGA 2ZJ1A 4YCAA 3Q11A 2JL1A 3FTPA 3JQGB 2A94A 1NXQA 1GUZA 3OM9A 5BSFA 2I76A 4OOFA 3ZWVA 4QTZA 4WCFA 4IXWA 1V3VA 4ZQHA 5COAA 2O3SA 4BGIA 3EK2A 3H5AA 1OC2A 3AY6A 1P1KA 5DBGA 2X5KO 3OJFA 1GDHA 4BO7A 2W4QA 1W73A 4J4TA 4XA8A 3WIEA 2BI7A 5ILGA 1I2CA 5AVOA 4A2CA 3OJOA 1K0UA 1LC3A 4IMRA 4MP6A 3RVDA 4BHTA 3BMOA 1XKQA 3FSRA 1U7HA 1SPXA 2NACA 4RORA 3VTZA 4AG3A 2YV2A 4WCFB 3WQRA 4M87A 5T8KC 3VAZA 3TDKA 1H6CA 4IPTA 1JQBA 4CM4A 4R5HA 4I5GA 3HUDA 4WECA 5DBIA 4EUFA 2VNSA 4FFNA 5ITWA 4R9SA 1GR0A 1KC3A 1X7HA 3WGGA 4CM1A 1YB1A 1EQ2A 3NTQA 3LK7A 3JQFC 3Q9NA 2Q1SA 3CEAA 5C3MA 2P9GA 5FWNA 2X5OA 3GC6A 5JCJA 1YKFA 4IDFA 4RZHA 1QR6A 1SCUA 3F5SA 3ZDFA 5ENDA 4CV2A 4TZKA 1A4UA 3OQ6A 2VHVA 5HS6A 4AICA 3WOHA 3R3JA 3DZHA 3ICCA 3C3XA 1B26A 4J0FA 2RHCA 4DMMA 1SNYA 3SVTA 4CODB 4E5MA 3F4BA 3GVCA 4K26A 5I7VA 4DPLA 3GGOA 2OGUA 1DHRA 3NT5A 3WJAA 1WDKA 1GEEA 4R3WA 1PX0A 1DFHA 5TLSA 3EMKA 4JROA 1PL8A 1I33A 3QWHA 4B8ZA 4J1SA 3VH1A 4OXYA 4Q9NA 2NTVA 1I01A 1EDZA 1HEUA 4O59O 2EHDA 3E9QA 4R69A 4PZCA 1SOVA 1DO8A 4H7PA 1VJ1A 4AJ1A 4NFSA 4CMIB 4I08A 2NTNA 4R01A 4E5KA 5EERA 2HJSA 4JBHA 3PGXA 1HWYA 2D4AA 5TRTA 5G0VA 1I2BA 3C1TA 3UW3A 3L9XA 3CXRA 3EZLA 3RWBA 2UYYA 5DT9A 5JAQA 1ORRA 3SBOA 3RIHA 1CQJA 1HDGO 1Z6ZA 4MIEA 5ADHA 4UUOA 5IXSA 4Z0HO 1I8TA 8ADHA 1YBMA 4JBIA 3VZPA 2JFFA 3QA9A 2CDCA 3P2YA 4R1NA 1K6JA 3FR7A 1X14A 2YHIB 3FWZA 3U4IA 4YJFA 4ZD6A 3WWZA 2QRLA 1JA9A 2PZJA 3RROA 1UZMA 4ITUA 4Q3BA 5JY1A 2X5JO 3EZYA 1ONOA 2BFAA 3HDYA 4GMGA 3WWYA 1LTHR 2O2YA 1BSVA 4NBUA 2JKVA 4I5EA 3KTDA 2JCYA 5JAMA 4EUHA 1X7DA 2NUAA 4U5QA 3WGZA 4E5NA 4K1LA 3HB5X 2I3AA 3ROPA 4QFDA 2VN8A 4FGWA 1N7HA 4N54A 4RQUA 1I24A 1A71A 1GV1A 3DZFA 4BKPA 4CQLA 3OP4A 4TQGA 2W90A 1LLUA 2X0JA 3W4JA 5BSHA 1RJWA 1VSVA 3W6ZA 4IMPA 1ML3A 3DBRB 4E2WA 5A5FA 1G6KA 3LT1A 4L74A 2PGLA 3AI1A 3GVXA 2P9CA 1XU7A 3ASVA 1JTVA 1QV7A 3PHLA 1AHIA 3GN2A 1HRDA 2AXQA 5BT9A 4WOJA 3GDOA 4NQZA 3COSA 2QIOA 4CUKA 3G79A 1PQPA 1UDBA 4CR6A 1X15A 2P68A 1DLIA 4TRRA 3V2GA 2GZ3A 1BHSA 3UOGA 4BO5A 2WDZA 5JDCC 4F6CA 3RUCA 1WDMA 4R1TA 4E5YA 1CETA 2VUTA 3QWBA 4WLOA 5BSEA 1A27A 4J90A 4LW8A 3KV3O 3WDSA 2J3IA 3VPSA 4Y6PA 4BO6A 4A10A 2FRDA 2W8ZA 3IP3A 4OO3A 1IE3A 1N7GA 3RUHA 1CF2O 4IJWA 3U09A 2ZYDA 4EW6A 3AU9A 1UXIA 1VRWA 2BMAA 3AW9A 3GT0A 1HDXA 4XQCA 3ONDA 3QE3A 4B7XA 1V3UA 3I6QA 5HM8A 3JQ9C 3DBLA 4Y98A 3AUUA 1R6DA 3GNSA 2G1UA 3IJPA 3I9LA 4BNHA 3GG9A 4Z9YA 1NQAO 4XQGA 4CM7A 5A9RA 4RCVA 2CVZA 3PFWO 3KVOA 2PD3A 5KVCA 4L4SA 3INTA 5JLAA 5TNXA 1LU9A 1I2ZA 2Y1FA 4AJPA 1F14A 1DIBA 2DFVA 5F3RA 4P4GA 1HDOA 3ZU5A 2TMGA 1HETA 3L0DA 1A4IA 3KXDA 4IDAA 2NVUA 3NRCA 3VH4A 3RUDA 3TZHA 4PRLA 5G0UA 1A7KA 1SZJG 3OJLA 4D7AA 2AEFA 5AXCA 1Y5MA 1LDBA 4IXTA 5EINA 2PKQP 3ADOA 4XYBA 4CM9A 1UDAA 1FF9A 4CMBA 5DN9A 3I4CA 2JHFA 5LCXA 1MA0A 3GVHA 1T2AA 4NJOA 2D1YA 4JNKA 2CMDA 2HCTA 5EMHA 2AQKA 1KY5A 3PXXA 2GN8A 3JQBA 3M1LA 5I7FA 1ZMTA 3K31A 2A92A 4WNIA 3AOGA 1FMCA 1JLLA 2X23A 4QECA 4ZQGA 3GVPA 2AQHA 4IGEA 5A9SB 2NLOA 3BZUA 4YT8A 1ENYA 2UAGA 1L7EA 3ON5A 2Y93A 1ARZA 3FBGA 2QX7A 4F45A 4DMLA 3DDNA 5IDXA 2VWGA 3DFZA 4M54A 3NTRA 3G1TA 3H5RA 2E37A 2EEZA 4ZGWA 1QP8A 5HS4A 4P4LA 2CD9A 4XD2A 3HHPA 1C0PA 5JFOA 2CFCA 3F1LA 1XDWA 3WFIA 3ZWCA 2NNLD 4CMIA 1WLYA 2HUNA 2Q1WA 2HQ1A 3EYWA 3IC5A 4GSKA 2NU9A 2VTDA 4IGFA 5KJEA 2HMTA 3NUGA 3ZW8A 1RM5A 2AQ8A 3BTUA 1GZ3A 1YJ8A 1Y5RA 2DVMA 4XZ3A 4CQMD 5AQ1A 4KUEA 4R54A 4ZHSA 1S7CA 3NDJA 2PH3A 4RLSA 2ZTUA 1PGJA 3B70A 1GEGA 5CPFA 4NPCA 4FFRA 4W6ZA 2OP1A 2RHRA 4FN4A 1KVSA 1VC2A 3ITKA 1YRLA 4XB2A 3ZGYA 1H9AA 5L40A 1O0SA 3G0OA 3JV7A 4U0JA 5LC1A 4CMJA 3Q2IA 2PZKA 2V6GA 4IS3A 3DHNA 1FXSA 1P0CA 4AL4A 3OA0A 1P9LA 3T4XA 2QZ9A 1ZXLA 3F4LA 3HZZA 1GPJA 3GAZA 3LQFA 4XR4A 3UAGA 1QYWA 3BYZA 2IZ0A 3LYLA 4Y67A 5IAAA 1E1MA 1EFKA 4RVHA 1V8BA 1ZVMA 2AHRA 1ZW1A 4XIYA 1DC4A 4NR0A 4IUYA 3DZIA 1GCOA 1OOEA 6ADHA 4S1VA 1I30A 4BO4A 1WWKA 4XB1A 4R9RA 4BNLA 1ISHA 4N5LA 4YXFA 3GDFA 4QO7A 5K6AA 4MPDA 3HG7A 3VZQA 1IPFA 4J4HA 4D3DA 4RPJA 3E5MA 3WBFA 4E12A 2VUSA 3AFMA 4D42A 5CEEA 1ADBA 4ND2A 5CDSA 2V6FA 4GL4A 2PV7A 1E6EA 3EGOA 4RVDA 1YGYA 3SJ7A 3ZCXA 4BV8A 3OIGA 3B20A 1B8VA 3DBRA 4CPDA 4YDRA 4KP7A 3C7DB 4J1TA 2Y1EA 4BMVA 3B1JA 3EVTA 4B3HA 1PZEA 1MG5A 3GG2A 2E48A 1Q7BA 2FSVA 3I9JA 4CM5A 1NQTA 2D8AA 4ALNA 1Z7BA 3VTFA 4NK5A 3U4CA 4OIMA 2X22A 1E7SA 3WMWA 3ZWPA 5IJZA 1E7YA 4MOWA 3AUSA 3ETEA 4D41A 3FWNA 4U8GA 1GFSA 2YV3A 4B3IA 1ONNA 3PHIA 3ZNOA 1YL5A 3WGIA 1E6UA 1YQGA 2F1KA 3E82A 3GNQA 2J3HA 4GLLA 1HSZA 1BWSA 1Y8QA 4ND4A 5AXBA 2ZB3A 4O6VA 1U2DA 3VZSA 1ISMA 4JJIA 5A05A 2OXIA 2Z5LA 3DAFA 3W1VA 1X1EA 2OL4A 3UCXA 2I65A 3PZBA 2HMUA 4IDCA 1IB6A 3CSDA 4DRYA 3OIFA 4MVJM 4ND5A 2JAPA 5C7OO 2C54A 5ICMA 4OKIA 1V3TA 3RJ5A 2ZQZA 2BHLA 4HBGA 3QHAA 4FJ2A 5IDWA 5JYDA 1IUKA 2Q4EA 4HNHA 2DAPA 4MVJD 1GZ4A 4BMSA 1NPDA 4UVGA 4OSOA 4PRKA 1R12A 2NWQA 3RJ9A 1ONPA 4GVLA 3FNFA 2JCXA 3K73O 4RL6A 1XA0A 4NIMA 2NVUB 3MWEB 3DO5A 3QQPA 3RASA 4M86A 1T4BA 4A0SA 3GPDG 3KRTA 4UVDA 4F46A 1UZNA 3BHJA 3HFGA 3LC1O 3GH3A 1RWBA 1YL6A 1M2WA 5DNAA 4DLLA 5JNLA 1NVTA 1PIWA 1I5RA 2GN4A 3ZHZA 4OGWA 1Y81A 3A4VA 5B4UA 4HFMA 2B5WA 5B1YA 1W0CA 2DTXA 2J5QA 1ADCA 3ONFA 3V1TC 5KKCA 1U5CA 4FJ0A 1C1XA 1BVRA 1AN9A 1TVEA 1HE3A 1C0KA 2Q50A 2WE8A 4FBGA 5BR7A 5FFFA 5KVVA 3ZHYA 4UEOA 2Q1UA 2Y1GA 4KTTE 2VZ8A 1V9LA 1DFIA 2BFPA 4B7UA 3AI3A 4BNJA 3AUTA 4ZN6A 4YWJA 1X0VA 1NQ5A 1PJBA 1NTOA 1OFGA 1IOLA 1ULSA 3DAPA 3Q3CA 2H5LA 1NVMB 2W2KA 4RGBA 5C37A 4Y6SA 1EZ4A 4PGFA 5A9TA 1J49A 3QIVA 1CJCA 4DBVO 3Q6IA 4H16A 4OJNA 4DBZA 1LRJA 3MJTA 5L4NA 4GX1A 3SLGA 4WGGA 2RBEA 4OKNA 3TF5A 2BGKA 1EMDA 2JD1A 4I9NA 3GUCA 2O2SA 2DPHA 1QLHA 3MJ4A 3W8FA 4TKMA 4E21A 4KQWA 4O5OA 2C5AA 1B2LA 4DC0A 3LDHA 1OMOA 1C1XB 9LDBA 4CV0A 4YJGA 1PQUA 2BGLA 1VJTA 4CQLB 2YYYA 2VWHA 3WLEA 3HQ4O 2Y0DA 2V6MA 5H83A 4MDHA 1V35A 3U4DA 3PDJA 4UVHA 1NWHA 4RQTA 4B79A 3RBXA 3D5TA 2BI8A 1YH3A 2FPGA 1B15A 4OXNA 4XEHA 2LDBA 1ISGA 2GO1A 1FJHA 4R41A 1LQTA 2C29D 3QRWA 3QJ5A 1JW9B 3TJRA 2XF8A 4PG6A 3STHA 1DJNA 2FZWA 2OO5A 4FSHA 1NWCA 1T2FA 3U49A 4CR7A 4IBOA 2GERA 1DRVA 1RYEA 1TT7A 4YB8A 5EESA 2YFQA 4GVXA 2QRKA 3O03A 3DZBA 2OFPA 4B3JA 5DCYA 2BGMA 3QWIA 5A3JA 2J3JA 4IY1A 1Q7GA 4OSPA 2ZTVA 1FDTA 3AI2A 3LC7O 4UULA 5JO0A 3O8QB 3C1OA 4G81A 4PLGA 2B4RO 4EJ6A 2VRCD 4GKBA 4BKRA 1PZFA 3HADA 3O4RA 5ER9A 2H1SA 3GLQA 4E30A 1E1NA 3ZWNA 4D43A 3WGYA 3HSKA 4XGKA 3NT2A 4PCVA 5CAEA 1IZ0A 4XCVA 5JO9A 4J91A 5JE8A 5T57A 2XXJA 3D3WB 4IS2A 4HXYA 3B1KA 3VOSA 4BKOA 1EUZA 5C7LO 2XAAA 2GF2A 4YT2A 2QZZA 4L9RA 1ADFA 1U4SA 3OEYA 2X0RA 3FPLA 4L73A 4K9DA 4J0EA 3KLPX 2IEBA 1Y8RB 1H6DA 1LSUA 1ADGA 1VKNA 1SEPA
chains in the Genus database with same CATH superfamily
2W43A 4M55A 2V4UA 2ZB7A 4OATA 5KQGA 1XO1A 2PX6A 1M10A 3NVMB 3R3YA 4URUR 3D3WA 5C8DA 1AO3A 1B16A 2JATA 3GU3A 5GONF 1FFDA 3PA6A 5B1HA 2I4TA 1MRZA 2AN5A 3AIKA 3MWLA 3OOWA 5EZYA 4TXJA 3WHIA 4BV9A 4EH1A 5BYKA 4W5JA 4J43A 1F2TB 5FKJA 1JKXA 4X20B 1D0VA 1V1MB 1KTVA 3OFND 1RPNA 3UIEA 3UFXB 4EY7A 1TAGA 3EQ7A 2EYQA 4Q4DA 4UJ3A 2F3SA 5F9HA 3HNPA 4QFMA 4Q39A 4C0WA 4DJTA 1I13A 3WYAA 2ZRPA 5H81A 1MAWA 1OH5A 3ANLA 1K6MA 1J1UA 1G3UA 3ME5A 4DJFC 1IN1A 1QP0A 4IFIA 3LX5A 1F48A 1A77A 4YJ3B 5CW2A 3RJZA 3FUUA 4DQUA 3UYLA 2AMYA 1REQB 4MW9A 3DTYA 1P29A 4HMPA 2NQ2C 5HQ3A 5I01A 2W98A 4FCCA 5AIAA 2OFXA 5DISB 2XXBA 4X7RA 3L7IA 1DBVO 2H9YA 1LLFA 3Q8LA 2F9FA 4PHGA 4Q1EA 1F4VA 4Z9FA 1M5RA 3DMNA 3KFLA 3T4EA 5EKXA 1TFUA 5AW3A 3K6SA 5JYBA 4ASUD 1ILEA 3T5TA 1XNHA 2FVYA 2PH1A 3AP1A 1XYGA 3NV9A 2V6BA 1SCKA 3N2IA 3FNHA 1WIWA 1QQ5A 2PSFA 5SZIA 2BHRA 3MG9A 4L75A 3TRDA 1QG6A 4TTVA 4YO7A 4DJEC 1XPUA 5BSUA 2H4FA 4KOAA 4ONEA 3TXXA 3VHXA 2GZRA 4OMCA 3KYDA 4U2BA 4FHZA 1EXDA 5IT9A 2PUHA 2RFLA 4DA8A 3OF2A 2WT9A 5FBQB 1EK6A 2VJOA 3LLVA 4YH1A 1RRGA 3E9ZA 2OZPA 3COPA 4YACA 4B35A 2O7QA 2OORA 1XU9A 3Q12A 1KNQA 3ZDAA 2C77A 4LJ6A 4XH9B 2PBLA 3UATA 3E70C 4MAAA 3S2YA 1EX6A 1WLSA 2IEZA 1G2PA 3PYLA 5DYGA 3TAXA 5TEVA 5T8KA 4M7WA 3JWGA 4Z9XA 1UJ5A 3Q7PA 1S1CA 1MX5A 1CY7A 3L3BA 2FKAA 4TTPA 5ADVA 1RQPA 1U3CA 3JD2A 3PQDA 4TXMA 4JVOA 5H3HA 1HYEA 5B57C 4ENUA 2JGDA 2ZB4A 2XCLA 3AKCA 4KO4S 1G0OA 2XUQA 4JJFA 4B7AA 5DCUA 1SB8A 2HRRA 5CW1A 1MGOA 2PGJA 3WTBA 4I5IA 2VEDA 5HYVA 1YZNA 1WSDA 4GNKA 1RRCA 3WGNA 1BG6A 1NI3A 2G9UA 2OV4A 3EDCA 3UK2A 4ID9A 5FADA 5I7AA 3VUFA 2AYZA 2W8BA 3OJ0A 4N5IX 2VDKB 3KQPA 4MAMA 3WNCA 1II0A 5AUPB 3I2IA 3C1AA 1E7MA 2JKYA 3EDQA 4MQFB 5K05A 1XMXA 2W2LD 4V3BA 3V7UA 1VPEA 1L7DA 4KJXA 3G3EA 4NZZA 1K8XB 1LF0A 4U6QA 1AVTA 2G4VA 2ABWA 5M3BA 3ANXA 4OJYA 4O8ZA 5BORA 4WUVA 4EO9A 1NBIA 3PQFA 1ZESA 3I01M 3PWSA 2YJ3A 5JDIC 2BGGA 3AUFA 1MB3A 1DZ3A 2AKYA 2WIAA 5E7MA 2FSPA 1L5ZA 4AK9A 3HACA 4MUEA 5A7HA 4ESOA 5G0TA 2SCUB 3PL5A 4MGZR 5KX5A 3TJZA 5G02A 4RHCA 3CEHA 2QORA 5E6RB 3MTGA 3F9IA 4E32A 1KYTA 3HJRA 4HNAA 1VPWA 4R0NA 2HADA 3R7SA 3UF0A 4RZXA 4DLBA 2ATVA 4LXTA 4BL5A 4TMKA 1WX1A 1NRIA 4IEIA 3N3BC 3A10A 1GCIA 4NYIR 5IXSA 5HPYB 1U7UA 2Q4OA 3OZDA 3OHPA 4JJ4A 1P1IA 3HSSA 2JIMA 3UT6A 1ZXBA 2YZMA 3PJEA 4UEKA 1ODKA 4X7PA 2UUOA 3ZLTA 5DIZA 2SCUA 3N5CA 1O7JA 1OLOA 4I1SA 9MHTA 2YXPX 3P19A 1ZNQO 4G5GA 4OXQA 4YBZA 4BNIA 4D25A 1E63A 5F2EA 3E9YA 4ZT7A 2GBLA 3PWKA 4A6DA 4C4OA 1NC1A 3ESDA 2A0YA 1J0EA 3VVCA 4QU0A 1IBSA 3ZG6A 1SO8A 4CU5A 3UKJA 1MV8A 1WXIA 1AKVA 2I6SA 2QE7A 2RKBA 1ZBDA 2WAOA 3ASUA 4LDRA 4LQ4A 4ZWNA 4AY4A 2W6PA 1B42A 5U4XA 4R9UC 1RMYA 4OHKA 3BGVA 3VYTB 1DCTA 4NZOA 4FNGA 1PR6A 4MW7A 4DA0A 3PPWA 3U16A 1WMEA 3ZHQA 2B4TO 1E0DA 4Q5IA 2HWYA 3ADPA 2P9TA 4XKJA 6ABPA 4PGMA 3VPXA 5LYJB 3LDFA 2I71A 5DHFA 7GPBA 1QS0B 2F4VB 3IUSA 3Q10A 2P7IA 3L1VA 2O2JA 1IHDA 4G6ZA 2TMKA 4EJ0A 1WW8A 2OSVA 4HQFA 2ERXA 4OGFA 4UD6A 2P4QA 3K0CC 1JDPA 3IV6A 3O84A 4LZOA 3N86A 3H19A 4CLRA 1JLLB 5M04A 2EU8A 2P91A 3ETDA 2J5BA 1IH8A 4G5SA 2OYCA 5AM2A 3H75A 4HNQA 5LOVB 3EH1A 2QIPA 3N8KA 4M9RA 4B2PA 2M6SA 3W5DA 4CQNA 3K8QA 3M2PA 5HF9A 3S5JA 2X8LA 1Q92A 3DEAA 1GQYA 2HU2A 4GLBA 1J5PA 4MLPA 5KSPA 5BW5A 4YR7A 4J7XA 5IDYA 2CB0A 4PG7A 4DG8A 3RYCA 1JUDA 3D4LA 4EI2A 2CUKA 1SBIA 3CHYA 4RE5A 2JASA 3QG1A 4RJLA 3IP9A 4EG0A 2R60A 3WRXC 1R1DA 1M8PA 5DH9A 5TDHA 2YVKA 4M37A 3BF8A 1RZRA 3UB3A 3HI6A 1G9XA 4NATA 4QC2A 1E60A 3PJFA 4BUJA 1Q14A 1W75A 4HH4A 2Q5QA 4OYHA 1SQ5A 4K6FA 4HGQA 1RI5A 2VHEA 4FEGA 1ZN7A 2DR3A 5JATA 2W6ZA 2CW5A 1O57A 1B8OA 1C1DB 2GEBA 2ODBA 4QPDA 1SVOA 4F9TA 1OXKB 4I36A 5T6MA 4YRNA 1FMFA 1MAUA 3FX2A 4C29A 3KG2A 3QLUC 5B58T 1VPDA 2E82A 1ZRMA 3RYFA 3WI7A 1DAMA 2FWMX 5JBIA 2NSYA 1YJBA 2XA2A 3VKHA 1CF9A 4FC6A 1UBFA 1CIPA 3K1ZA 2C07A 1U0OC 4ZC8A 2X19A 4PE5B 2IYYA 4LY9A 4YQEA 2TECE 5SZHB 2WICA 2I67A 2IEAA 2COEA 2JPDA 4F6RA 3KYBA 4ZDWA 2YWHA 1QZZA 4JS0A 5EFZA 3EIUA 3WFZA 1A7UA 5E38A 1V71A 2BEWB 2H0RA 1H2YA 1UDRA 4M8KA 1R37A 1OI3A 2D62A 2DWUA 4HADA 4REQA 4EUEA 5J4KA 3V1UA 2QP9X 5CT4A 1KH3A 2AZDA 1JDZA 3OLZA 4QJ5A 3QXHA 3BH7A 1XG5A 2RCYA 4HRAA 4CF4A 1NRJB 2FJUA 2FR0A 4Q24A 3WK7A 2VKTA 3LI2A 2MOKA 3B3JA 1MB0A 3UZUA 1OHHA 1OWOA 1G21E 4QQNA 3AGQA 4CM4B 3G9XA 2GZSA 3FHOA 2GD6A 4R5MA 4AUEA 4BJ3A 3K5HA 1Y6ZA 5GINE 2YWBA 2HLNA 3MVEA 3FR8A 3WIUA 4R8KA 2HWKA 4MS3A 1YB7A 4NH4A 4G5QA 3PCRB 3T4UA 4BGUA 5BUCA 2DGDA 5JZOA 3R74A 5EAIA 3HFSA 3P0RA 4FHDA 2CB9A 4OMFG 4ZZIA 4Z86A 1RLTA 5E7JA 2AMJA 2HKIA 3W2GA 2D5BA 4B83A 3NU1A 1YE5A 2OPHA 1HL7A 5AK5A 3OZVA 2VRBA 3RFUA 3RU3A 3RRBA 4RVUA 1CVRA 2IWHA 5AKYA 2Y77A 1D7AA 2C4KA 3CWQA 3R5JA 4IDNA 4KPYA 3KHUA 1A76A 2EFCB 3CTMA 4MGIR 5F21A 2CE7A 4DMFA 4YRSA 2B5OA 4JI2B 1WJGA 3WSVA 1O94C 4EA6A 5GONA 4F96A 2O8BB 3I5YA 1I7NA 3PI7A 2G5CA 1VRCA 3OMXA 2PWPA 3FVRA 4NYIQ 1FBNA 2CLMB 6CHYA 3L0IB 4HNGA 3QUAA 1MB9A 3DVLA 1U2GA 3AOEA 1SAYA 4IMJB 2OXCA 1OILA 2WLTA 4H6XA 4KRGA 2L18A 5BQFA 5KYTA 2PNJA 4HNRA 3BC1A 2W6OA 1UK6A 4R71A 3E9MA 1E6LA 1YU6A 1YZTA 1XRMA 1O5OA 3M5DA 5EPOA 3RFCA 4WASA 3DCYA 2PS3A 1DWQA 3Q1KA 2CVPA 1N5MA 4M0DA 1UBKS 5JR3A 5L3QB 5JJKA 2PWAA 2XKBA 1J0DA 4DTCA 5IM4A 1EG7A 1PX2A 2OD7A 4A2QA 4HH3C 2GR9A 3GLHB 5TF0A 2QF7A 4PFKA 1ODSA 4F3RA 4CV3A 4D92A 3UMVA 2XUIA 2W93A 3TZCA 4ZDJA 2BFFA 1QPGA 3VR5H 5MF6A 1UBEA 2WJ6A 2GCNA 5FUXA 3S2EA 1YR6A 4DC9A 5JSHA 2QYOA 4MA0A 4OI2A 1OLSA 4I2VA 1QH0A 1CR6A 1X7YB 3DD1A 1R74A 4PINA 3GXBA 1QH1B 1ZH2A 4L5CA 4RBNA 4NL4H 1VYVA 5HF6A 1M72A 4YJ2B 5JS1A 1GRNA 3MTJA 1SVUA 1AS0A 1BEZA 4TXHA 5HRCA 4KLZA 1SD1A 1T4GA 2JNWA 2R1TA 1EP2B 2ZLBA 4Z6KA 3MCZA 4IL5A 4Q15A 4YTEA 4ZHQF 1UAAA 3GJYA 1VHLA 1V2HE 3AILA 4CJXA 2CXUA 1FQOA 3TQTA 3LYHA 4CKWA 1TJ5A 4KLRA 4X97A 3EVNA 1D2CA 3WWCA 3JTMA 4Z3OA 1RACA 1J06A 3HKDB 3DP7A 4RY2A 3GT4A 1EG2A 2PFSA 3HNRA 3QNWA 1IJFA 4G5XA 4YDSA 4ZOCA 1MVLA 1UK9A 2IUYA 1R3UA 2NADA 2UDPA 1X7GA 3EODA 4LJ5A 2R66A 2OMEA 3HCPA 3A31A 3KLMX 4FPXA 5DOVA 3I42A 3V4VB 2XZPA 3LW7A 2XUZA 3BFPA 3GPBA 4Q3OA 3GRZA 1SKQA 2VYVD 2A33A 3V4LA 5LOVA 1U0GA 2ZG6A 2PVCA 2O1SA 1T24A 3D0RA 4GYKA 5GOZA 2NUAB 4X1IB 3G9TA 3EQ9A 4UHJA 2R7NA 3NX4A 4FGUA 4LRWA 3K09C 4HXGA 3OTOB 4BWFB 1YJ5A 4EMTA 2CHQA 2LIPA 3W5BA 4E5VA 4CM8A 4QXRA 4I4IA 1V2GA 3CSSA 2HLPA 3SYRA 5IKMA 1G59A 1PE0A 1OYWA 2X9NA 2YMQA 3NHJA 2XY4A 3ROKA 3V34A 4DXDA 4BLRA 5AKZA 3MOIA 1AN0A 1G16A 4X1IA 1N6HA 5I9BA 1DQSA 5DYYA 7YASA 5AJZA 1UPFA 3TTUA 4IDDA 3GQVA 1IEQA 3N07A 4O0LA 3MNFA 2H9IA 2PZ8A 1MW8X 4K88A 1EJ2A 1FW8A 2V7BA 2OQIA 3AERA 3H7AA 4QWMA 2XNHA 3RBZA 4DEXA 4EGSA 1CQWA 5AVUA 3CCCA 4XVRA 1NMQA 3OI7A 1ZC3A 2I22A 4G97A 4ZEOA 4NOJA 3W8DA 3BQ9A 2BELA 3IT2A 1QYDA 1WVIA 1A5TA 1PW5A 4FOOA 4Y2QA 4RMJA 4Q9HA 4ZV9A 5ICFA 1QRTA 1JG2A 1RHJA 2EJUA 2NO0A 4GR4A 4ZPXA 2P3QA 2RHGB 2JJ2A 1BA3A 1RP7A 3W7AA 3VH2A 4PSVA 2H51A 5ICGA 1KVQA 2I6XA 1WZEA 2XE8A 2H2FA 2J0VA 4XQEA 1I1QB 3OPMA 2CMKA 1CWUA 4DHEA 5KTKA 4YJGB 5ADWA 5U4QA 2O8FA 1E61A 3ACDA 2BDTA 2REQA 2X3YA 1DBQA 1P2UA 1VCMA 3IB6A 2ZWAA 4H27A 5FTJA 4J0CA 4PC3A 2O5CA 4L5IA 4AAYA 3QPVA 4J9VA 4V1CI 4YLGA 2M2IA 4BNWA 3O31A 3K70C 2R6GA 1XZBA 4LRSB 1TGVA 3TI7A 1LWNA 3T7RA 2TMDA 2WJ3A 3L8YA 4ARCA 1TIPA 3C5WP 5DX0A 2GXSA 3PX2A 3UCEA 2ZPTX 3H2SA 5EIEA 4HWPA 4R83A 3WGQA 3KQNA 4DREA 1EBUA 5ARDA 3D2CA 2GMWA 4LJAA 3Q8XB 4AVYA 1OCEA 1D2NA 1T2NA 1ZJ5A 4LDQA 4DV7B 4JI1B 4DUYB 2YVQA 5KAPA 3U81A 1OXMA 4A9AA 3I52A 3ONNA 3DZKA 1OGIA 3GR6A 3H2GA 1Z0JA 2O4CA 1T4DA 2I4LA 3ZX4A 3L6UA 1QU2A 1C9EA 2HPVA 3P94A 3PVZA 4JC5A 3V9PA 5CA0F 3JWIA 2D7JA 3NGXA 5F2NA 5JISA 4M98A 2ZZNA 5ITSA 1YZQA 3R7LA 2GSWA 4XUGB 3EG9B 2R65A 3PLNA 3KHKA 5LMCA 2ZR7A 2BKXA 4J94A 3JASA 2FF5A 1HTWA 3IOEA 1XQ6A 1NR5A 2JZNA 3FDIA 4ROTA 4IHQA 1JHUA 1F8XA 2WD8A 1KTIA 3C85A 1XYVA 3OBIA 4HD8A 1M6YA 1AKTA 4TWBA 1JHRA 5JWHA 3QUSA 1EFVA 4F60A 3H83A 4JT8A 1KETA 3R44A 5G40A 2BVNA 2WYHA 3EGIA 1W25A 2D0IA 4AMUA 4C6SA 4ZI7A 5DBHX 4KDCA 4CMHA 4CEJA 1NN3A 1XX6A 5ISMA 3ENVA 2POQX 3WSWA 1HY3A 2AR9A 3OF5A 1DO2A 1IL0A 3CN9A 3K0KA 2JI8A 1B1CA 3Q5GA 4JYPA 4S2UA 3JPYA 4D81A 1G8AA 5BUZA 1LGYA 1AQNA 1TIBA 4A5SA 1JLKA 4INPA 2WY2D 4XJTA 2RGEA 1O97C 2C4UA 4JJEA 2DERA 4BNMA 1H85A 2RK3A 2G4CA 4QXQA 3B8EA 3GY0A 4ARUA 2I4IA 3QELA 3HO1A 3G8DA 5HXAA 3KLOA 4M9UA 3SC6A 2Z1DA 2WVAA 1AX9A 1DSSG 1K98A 5LJIA 2WEKA 2P40A 1OLSB 1SK8A 2AI3A 2RGNC 5CU7A 4TRMA 4F04A 4WNAA 2ORED 1YAJA 2X9GA 3EWNA 2JK0A 2XUOA 3BMQA 2DBRA 4GL2A 1X42A 1TT5A 2HEGA 4FQ8A 1AF4A 2WMDA 1Z6TA 3CZCA 1NBAA 4IDGA 5ECWA 3RIXA 3SEFA 3JQFA 4BQSA 5JCOC 3I61A 4CZ2A 3QBEA 1OHHD 2Q2QA 5IAJA 3NB0A 1RJ9A 3BFJA 3N6XA 1WEKA 3WGUA 4YUAA 3AY7A 3OAAD 4HPWA 3HCCA 1EWRA 3AEQB 4DPMA 5CGZA 2EX0A 2UVDA 3DWGA 2PMBA 4KXVA 5D6OA 2Y0PA 4KAFA 3BMQB 5B1EA 5BWCA 2QV0A 3O74A 3ND7A 4A0QA 3T54A 3QUQA 4BTEA 2BLNA 4W5WA 1WXWA 2VF7A 3BMXA 3LS2A 4KVGA 5EE0A 5TT0A 2HMSA 4NK4A 3W79A 3FGOA 5KC9A 2AFRA 2OCLA 5E4TA 2G06A 3GRPA 4J0GA 2J5RA 4CLOA 1UWCA 5I9MA 3KZMA 1UBUS 1DS6A 3D3QA 3R3HA 2NT3A 3UMSA 4AZTA 4GZ5A 1CNFA 2BF7A 1E7WA 1T35A 2J48A 5LQUA 1O0BA 1O5TA 5EZ6B 3CUTA 5G3YA 3BK1A 3DKPA 1I0ZA 3UMJA 2PZFA 3AR6A 3ESYA 2Q21A 1EGVB 2B4YA 5CP8A 4D99A 4UQLA 3LY5A 3UQZA 1Q0TA 2CZGA 1HE1C 1XLTA 4R8RA 1YR9A 4D6PA 3DLTA 1DAGA 2X41A 1VIVA 3MSCA 3SC3A 4QODA 3KT0A 1T8RA 5JDIA 1WF6A 2YHUA 4LYEA 1RFGE 2MSEB 5KJ1A 4P3KA 4NV1A 4C7VA 1JVBA 1KVRA 3PQ7A 2HREA 3ONEA 4X84A 4JIMA 1CYEA 3L7LA 1G8FA 3NHSA 2YIDA 1T1JA 2PMKA 1LSSA 1YULA 3GGDA 1ZKDA 4IDEA 4Q7QA 2Q7XA 3KZNA 3P4UA 1KR5A 3WB9A 4C87A 4F85A 3O1JC 2ADOA 4RDIA 5GIOE 1I7QB 4BBAA 4PSCA 5JJCA 2QTAA 1KEVA 1UEIA 2QG4A 4MJLA 4XRGA 1Q7CA 3I8SA 3I9OA 4LXYA 5DNCA 2L19A 3R7FA 2VDWA 4EYQA 4DV3B 2E18A 4HYEA 2JGDB 1BJRE 4JODA 4CGYA 4QOGA 5F77A 2QV7A 2ZWOA 2EDAA 1GPDG 2CXXA 1V9SA 3E2PA 4YGXB 3O91A 5CK4A 3R7DA 4Y1GA 4WHMA 3BD6A 3P26A 3NCHA 4R1UA 4RK0A 5FI5A 4YRJA 3S55A 1R6BX 1E2GA 1UUFA 2VDOB 3G49A 4U2GA 3L49A 2CDAA 2NO1A 3PPIA 1DLJA 3MOSA 2V0GA 2IYZA 3OSUA 3UAGA 3BN3A 2VZ0A 4UM8B 4DCNA 1UBGA 3NH9A 1KP9A 4GGPA 3BT7A 1N6OA 2Q9UA 4KV9A 1S4QA 2PMDA 4NESA 3O90A 1JQJC 3U9LA 3H9JA 4DV6B 3G7SA 3LNTA 1KBZA 3GNLA 4HTFA 3Q5DA 1MEEA 2HK7A 3EOBI 2G9NA 3E0XA 1PAUA 5ILOA 1ZONA 2F43A 3EXFA 2Z3ZA 1H93A 3DTTA 4ZV7A 4YHHB 5IJAA 4MV1A 2WMNB 2O0KA 2VP2A 3LRTA 3TW6A 3FNEA 1T25A 3M6FA 2H08A 1PZGA 3T5MA 1NM5C 3IYLW 4A26A 2DBQA 1W1IA 2EGUA 2EP8A 3NETA 4X8HA 3ROEA 4BX0A 4L0MA 1HZJA 4LX0A 1YDMA 4ZXPA 2GDJA 3DHYA 4RK1A 3TQFA 4R2IA 4HX5A 3WIDA 3WHLA 1X87A 4E4RA 2JLBA 2PXHA 4WACA 5DYIA 1KJ8A 3IPAA 4JU8A 5CEJA 4KTVE 3KT8A 3WXBA 3TMYA 3RVRA 1K8QA 3SSOA 3ZOKA 2WSMA 1SUEA 3RWOA 2J45A 4DDVA 3NMUF 2R6AA 1OUMA 1M76A 4BVFA 2ET6A 1J0AA 3NNNA 5LXTA 2GHIA 4DEVA 1XGKA 1Q1ZA 4RH1A 3N8GA 3X3HA 3RVOA 1SVMA 1DOHA 2C83A 3MCVA 2UUAB 4M99A 1MOQA 3W8EA 2YINC 2ONJA 3W1WA 2JFVA 4LKRA 1QE5A 2H18A 4H1TA 1KO1A 2C5EA 4Z7QB 2ZRLA 2AN1A 1NVXQ 5KYWB 3B12A 2ZI7A 1ZK3A 4P0PB 1E5TA 3QVKA 2RAVA 1BDBA 1FRZA 2JAHA 3VJLA 5H70A 1VMIA 3KKLA 1A72A 2HRQA 1V1MA 1XZIA 4POAA 4ZI3A 2E2WA 2CLIB 3KEMA 2JCSA 2UXBB 1RQ7A 4UDYX 2FFAA 4PNEA 3C48A 2P3OA 5F73A 3O93A 1KJJA 2QRNA 2WHRA 1L5NA 4F2PA 5BOSB 4LOJA 1U28A 4YXWD 1Z4JA 2C5HA 3D9QX 4CQMA 1FMLA 2SKCA 4HB0A 4O1MA 3UJ8A 2N1BA 3OZUA 4MMXB 1GPAA 3ITNA 1N7JA 4RVOA 4ZA2A 4PF1A 4DDMA 1JQ5A 2GK3A 1QQBA 4P81A 1G63A 4PO1A 3AVUA 1EBBA 5J1TB 1N8TA 4OHMA 1GZ6A 3AJRA 1T2DA 3E18A 3HY6A 1VKOA 1D2HA 2OBYA 3P5SA 4G65A 4TZ0A 4KSBA 1UBHS 3PJGA 1II8A 1JSXA 1IUOA 4OJTA 4G41A 1GJRA 3STUA 3ORYA 3V8MA 1XTSA 4PX5A 4DFDA 4ZAWA 1CSEE 3OCVA 1QZUA 2CC2A 5CX1A 3SVLA 1QIIA 2C92A 2GN2A 3O1LA 1GUDA 3BJIC 2FK7A 1NQVA 3IIMA 5EJAA 2EEPA 2G63A 3FFAA 2LIVA 3MJCA 4IYJA 1ZMOA 3HJTA 3IQGX 3HL0A 2CVOA 5EWMB 1A96A 4MLCA 4Y0VA 1GL3A 3GLSA 4OFZA 1Z34A 5CYOA 4IIHA 1ZAYA 4F46A 1JZSA 3B8HA 3IPYA 4TUYB 2VZEA 5FFMA 2JRLA 2GAJA 2BKAA 3O1HB 1E7QA 1OBFO 3BJRA 2FE1A 1BDMA 1E4VA 4PLZA 5C2JB 1F8GA 3W1VA 3ESCA 1YQXA 3LJKA 3H0EA 3PB3A 2E1PA 4QDZA 4DZRA 3EFHA 2P78A 3R0IA 3WADA 2ROQA 3U3MA 2GA8A 1VFPA 1GKIA 5CUQA 2VJMA 3JD1A 3C16C 4N1AA 2UYOA 1DVRA 1RZ3A 5EWMA 1JVSA 2V7UA 2XUGA 3ZCVA 1QVAA 3KIPA 3Q7EA 4MRVA 3ONWA 4KVAA 4RPCA 5DASA 4C0JA 3NW9A 3R6WA 4WIAA 1Y1SA 5EPEA 1GCUA 3ZHTA 5E0KB 1VQ1A 1VMAA 2ZIFA 4NARA 3GFGA 3QJGA 4J16A 2P3SA 4Q7MB 3EMDA 1PNRA 2ZU0C 2QTGA 3LCVB 2ZVPX 4TRJA 5KCMA 2D00A 1LKZA 1NZDA 1UKVY 1HORA 2WRZA 3UMYA 1MC5A 4IIYA 1Q1QA 2G5PA 3VR5D 4F91B 1Y3AA 4PVDA 5JRDS 5A6SA 3F46A 2OHHA 3FMFA 5REQB 5J40A 4E6PA 3BPSA 4QX6A 1KKMA 1XE3A 1UBLS 1JNYA 3PQ8A 2AJBA 2F1OA 5AVWA 1OE0A 1QFYA 1VDZA 2VPPA 1DG9A 4MVCA 4WGFA 4CMAA 1E0AA 2ZUDA 1R0CA 4KRXA 1TPZA 1G3IA 4KJZA 4RHUA 2X2FA 1Z2NX 2R2GA 4HEA6 1THTA 5FCDA 3L7MA 1NJFA 2BWJA 2O3JA 3D4BA 4BNKA 3FI0A 2PJUA 4U2DA 2OXEA 3UWDA 3IUMA 4QHTA 1SQ6A 2SBTA 2Q4RA 3N87A 4PZAA 1D6MA 1QYIA 2Y05A 4JLJA 2ID9A 3I01A 4QYIB 5ENVA 2P6RA 1YQ9A 3KHSA 5L7TA 1M54A 4MUXA 1MP0A 2VNKA 2YYAA 1CE8A 5H3LA 1XMPA 2AT1A 5JJBA 1EFRD 4NV3A 1O2DA 2JFNA 2GDZA 1THZA 2W9XA 1ZUNA 1G98A 3JYHA 4NZNA 3VSAA 4YCNA 1KK2A 4IG4A 2IQIA 5IKPA 4KO1S 1GYPA 3ZZTA 1E9BA 2FQWA 4O3MA 1TL7C 5K0GA 3E4CA 3OZAA 4PG5A 4OIFA 4EO4A 3MJHA 2ZE6A 1KXZA 1ST3A 2JAUA 3N74A 1DAKA 3O8DA 1VTKA 4M0MA 3BMNB 4YRGA 3SEQA 2J9RA 3UXYA 3D8NA 2LD4A 2PZLA 1DRJA 1DO0A 1ZO8A 1B00A 3NJ8A 3RTAA 4DTIA 1ZNYA 5C32A 2W2LA 2FOIA 3EF1A 3AG5A 2XT6A 3AMVA 4MWSA 5DBFA 3FCCA 1J2UA 3WB1A 1KMMA 1DG1G 2GNAA 4BMZA 3E23A 4UXHA 3P0FA 1CQZA 3OP1A 4NBWA 5DM60 5JS6A 4KXFB 1TCBA 4ZTBA 3DAHA 4X00A 4LJRA 1QSGA 2FSVC 4PYIA 1VCIA 1CX9B 3GFOA 5CDFA 1DTSA 1OB5A 1UP7A 3I4FA 1NN5A 1P45A 4D9JA 2VDPB 4CEHB 4YAEA 1Z5WA 4KWTA 3PKZA 5CFOA 3T1TA 1G7CA 1IRXA 2CFIA 2IOFA 3BRQA 5IAEA 2WFLA 5DM2A 3AR3A 2PKWA 1KZ7B 4GBMA 5LM3A 2V0NA 1R8XA 5EMMA 1N9KA 5E9AA 3GF4A 3QK7A 4BYGA 5AW0A 2VPWA 5E6SA 3ZLJA 2D6FA 4HDCA 4QU8A 3R5HA 3PNSA 3TIXB 3ZWAA 3W5VA 4P3OA 1TJNA 2GBGA 4EO7A 2R00A 1SFRA 1JIVA 1T36B 1JDTA 7REQB 1TCCA 1C81A 1HDCA 4JX9A 3STXA 4QUIA 2VHUA 2UZ1A 1M1NA 1A8PA 3IE2A 5E4JA 3OLXA 4ER5A 1WETA 3K8ZA 2C9CA 1KQPA 1ECGA 3H42B 3M2TA 1E9CA 4I4TA 4JR1A 4FGZA 1KJWA 4BN4A 4MVJG 4O4IB 2WD7A 4GMKA 5BNIA 3SR4A 1JG4A 2ZSHA 2XCTB 1IXYA 1RJGA 3C3MA 3DQPA 3AT1A 2JLXA 1KAOA 4L9WA 2HEIA 2RHJA 2HFJA 1K4KA 2DC1A 5AW1A 2HXGA 1J56A 3EC1A 3ZWBA 4YV1A 1RCFA 1IG3A 4Y0AA 4FYYA 3CNQS 2O0HA 3UMRA 5L4LA 2VDJA 4J7UA 1GU7A 2A9PA 4UNPA 4JCOA 4YMIA 3ZDDA 1VLMA 3ZQ4A 1ETUA 5FB3A 3VHRA 2A0FA 3R1IA 3LLCA 3ICOA 2IYAA 4YP0A 2Y99A 4B3MB 4DIDA 1L4MA 2OV2A 1E69A 1R66A 4P31A 3AK4A 4ABYA 1E1CA 3BRWA 4GF5A 5LBUA 2P4EA 1KF0A 1TXGA 3HABA 3I5AA 4DG9A 2P67A 2FHPA 4X1YA 3D8HA 5IDVA 4YYZA 1NMZA 1Z36A 5K0TA 4JQCA 3KT6A 4BAUA 1I7LA 1E2HA 2J0EA 2AFIE 5JCZA 2I0FA 1GAQA 3HWRA 3CW9A 3MWYW 2FA9A 4GKVA 5ALHA 2JIZA 4A5OA 4LFBB 3G2PA 1ELOA 2XNJA 4GI5A 4ZT2A 4EATA 5GQSA 3GO4A 5KTNA 3SU8A 1L4GA 3MGBA 4JJGA 4M0PA 3SZRA 3T9EA 1MLDA 5AVSA 2X7HA 2IXGA 1YMUA 1I2AA 1M1YE 1MO6A 3LKDA 3OG9A 2X0DA 3SLKA 2YY7A 4A7PA 5A4FS 4ZVTA 2VQ3A 2D0DA 1DKPA 1D1PA 1N1EA 2FWPA 2XE4A 4GI3A 4ZOBA 3ZGZA 3GMDA 3WWOA 4G0WA 4WW0A 5I7WA 5JZMA 4L8LA 3A6ZA 5TR9A 1KDVA 1ISIA 5AO9A 1AUPA 1BAPA 3DONA 1FDUA 2QZJA 3NBYC 5LMUB 2GZ1A 2PFGA 3JQPA 2OE2A 5BY2A 3M33A 2PSDA 3TCNA 3ZK9A 4WFQA 4BZZA 5A4KA 2TYSB 16PKA 2BEWA 2IRWA 4XWTA 3WKAA 3IFSA 1CRQA 4XLTA 3G5AA 5J1SB 3OEWA 3C4VA 5L3SB 2IUSA 1K89A 2FLWA 1H69A 3LUPA 5FA5A 1RAIA 3IKLA 1TCAA 3LIIA 3NRJA 5KJCA 1XK7A 5JMPA 5FBHA 2B30A 4OHWA 4YRCA 5KZMB 4ECAA 4L4YA 4LOHA 5JAIA 3EDOA 1UMBA 2RH8A 3KYIB 4PRZA 5T5QA 1QFJA 1D03A 2E9SA 3ZHUA 4JP3A 3BBPA 4EVSA 2DHRA 1C7FA 1M73E 4MINA 2ZJFA 4X3PA 2VT3A 2E4AA 1UKCA 3FZEA 1P6XA 3TNFA 3HM2A 1AV7A 3K6JA 1LSOA 4HYQA 1Q6YA 2JH3A 4AJ4A 1Y89A 2IQ5A 2QR2A 4BX8A 4AM8A 3THXB 4RV9A 1PO7A 1VKJA 3LC2O 3PL1A 2X58A 3LVBA 1V47A 3C5HA 1NVDA 4B7CA 2ZSJA 4CF7A 2WT4A 2G28A 1WD5A 4N3BA 5C4IA 2FPWA 2GJAA 1DWUA 1NULA 2G40A 2V5AA 2GN6A 4WCDA 3W3AH 4EHDA 4PCUA 4ZI7B 4LVCA 2GM9A 3TGPA 1UINA 1OVMA 13PKA 5JSKA 4A82A 4J9UE 1IAQA 2Q2WA 4Z1OA 2CL0X 5HKOA 2O20A 4IZOA 3H2YA 1X7YA 2X4GA 3ET5A 3R6DA 3RYIA 1QLJA 1CEXA 2QX8A 2YHBA 3FDXA 1PSDA 4P9NA 3WQSB 4A2PA 4BTVA 3OMLA 3VR3A 3LO8A 1OASA 3Q2KA 2F8LA 2QVGA 2REBA 4D3FA 2QVZX 3RTDA 2H1FA 2VYVA 1WSAA 2ATCA 1GRCA 3EQ2A 1TVCA 1G4HA 1VPTA 3WE7A 3O4GA 3A1WA 2Y1KA 1ZFNA 3MB8A 4Z1MD 5JYEA 3SN6A 1Q3KA 1ZD8A 4LF4B 1AKYA 2EZ4A 1C7IA 5LN1A 5THXA 4P7JA 4ZIRA 4R84A 4K81B 1L4EA 2GJSA 4JC8A 4CTKA 2GSDA 2VDNB 3M1AA 1A1SA 4EECA 5LDHA 2DM6A 1NXTA 2XB9A 4PNHA 1NVAA 1VGVA 3T9AA 4Z7OB 5B3KA 2QMUA 4TL8A 5B6IA 1BCSB 1HQDA 1NBEA 1TT5B 3F4KA 3IT3A 1B14A 4JKOA 4UM7A 1K08A 4UREA 1KOLA 1GDDA 1Y4SA 1V5FA 3FZNA 3Q40A 3HN2A 4EUSA 3U80A 2PQ0A 1P1RA 2GA9A 3QVJA 5FI1B 2X8JB 5KYVA 2IBSA 3PX7A 5IM5A 2ZRIA 1RHMA 2FP3A 3G5MA 4GFDA 1HNNA 1QO9A 4W5NA 1KFKB 4UUMA 4LRQA 2RMKA 1B6GA 3NFYA 4OL9A 4JB2A 3WBJA 4BNVA 4D80A 4Z3DA 1R0LA 3ZW9A 3Q6MA 1RP1A 3IEKA 3ETJA 4D3ZA 3A1CA 1XZFA 5AHWA 4FC7A 1Y98A 1S2LA 3M6IA 5KVSA 1GITA 3IIKA 4X71A 4D6XA 3A2KA 1L9KA 1PJ2A 1W88B 2JB9A 2WT8A 3CVJA 3IX7A 2IU6A 1NBHA 1QGOA 2OKGA 2CZCA 1T0HB 2P5TB 3MTAA 5CNJA 5EP2A 2R44A 3SX2A 2AW5A 3T06B 3DVAB 5I7HA 2WF5A 2GK6A 2C5SA 2FWBA 5IS2A 3GX1A 3M9LA 3D7KA 3RS5A 2IZ5A 3CPSA 1AKRA 3KYJB 3D8BA 3GFBA 1OLXB 2FWNA 4NCAA 3MK31 3LRPA 4D5GA 5TJHA 4JUBA 3HU3A 4FGKA 5TPZD 2XA1A 4HS9A 2B6HA 4IIXA 5A4MS 5C1BA 2CNOA 2R8BA 3B6JA 4P7FA 3MJEA 2AG6A 3CLHA 4OHXA 5GJVC 3CY6A 4OL0A 4XIJA 4D3YA 3S8MA 2VQ6A 3OIYA 1V5EA 4K9LA 3ORRA 3KWFA 4KIJA 1IM2A 1DRKA 3IB3A 4W8GA 5F1OA 3EPLA 5I9NA 1T1EA 2V9CA 4Y2PA 3AM5A 1C9DB 2AZ4A 3EEQA 2G3YA 1FTNA 3KCNA 1NQOA 1GYQA 1XCBA 3GHHA 1CUWA 3MTQA 1KEKA 1EDOA 4N12A 3NONA 4TMTA 4BX9A 4BXOB 1XPJA 4KFUA 1DAIA 2GHTA 3FYSA 3U4AA 1OJLA 3M6MD 1U31A 1JALA 3E5NA 4H7IA 4N3CA 1XCGB 3A1SA 2BIFA 4O4JF 4RKFA 3HJHA 1Q22A 2NYUA 2IYXA 1PK9A 5JU6A 4WNIA 3GL9A 3GBPA 3HR4A 5AVTA 1Z33A 3ICWA 1HI9A 3DMGA 5C7IO 4XYLA 2ATXA 2ZRHA 5I48A 5IKXA 4O2RA 3UC9A 5KYNA 3RC7A 3IL2A 1Z8DA 1MC8A 3FI9A 3G9ZA 3GJ4A 4RVGA 4AZ0A 2H5JA 5EYPA 3X43A 3GCDA 3MHTA 4HDRA 3S6JA 1Q1GA 1EFLA 1G55A 2F4NA 1RLOA 3CLTD 3NYQA 1DJPA 3HKBA 1WPXA 1EVKA 4J3NA 2W6IA 5FWXB 3TOCA 1EP3B 5CG1A 4FSXA 5IRCD 3TKLA 3KPVA 5CVJA 3IOBA 4RTSA 5JFTA 1E0JA 5AWFC 1WTCA 1E1RD 4D9EA 5BNTA 1HF3A 1UWLA 4PAGA 2PH5A 3DO6A 2VXCA 2VEOA 4G84A 5TSDA 3WVNA 5I5EA 5JEDA 5IJ9B 5CRIA 2ZW9A 3WB2A 4DILA 5FNVA 2WJYA 4JGGA 2PLWA 1JQ3A 3EIQA 4XLLA 5EYPB 1ZOOA 5FTLA 1TM5E 2JCVA 5AW9A 3F5MA 2FDCA 1Z6XA 2VHWA 4WKPA 1TJPB 2QQ0A 2IHJA 1G66A 3JR7A 5EIBC 2CL7X 3ZY3A 1U8TA 3N70A 1SB9A 1JR4A 1ZD5A 3G0DA 3FYHA 1HYGA 3A1DA 3RKUA 4FINA 1D07A 1LZLA 2G77B 3JZDA 3LSTA 3S2IA 3W5IA 4YPOA 2IWRA 2KSQA 3CUKA 4QDOA 4ALKA 1YRBA 1RWOA 3OD1A 1M2JA 1T3SA 2AEEA 3D3EA 1LW6E 5IM4F 4YJKA 2BFBB 2ZPUA 4L15A 4X1OA 3WQQA 2PJZA 2QM8A 3QOWA 1O4VA 1RKQA 1DNPA 1MAHA 4X66B 3ICVA 4IR7A 5IT5A 1ZG3A 5ED0A 1QNFA 3UUEA 3HWX1 3KAKA 4PN3A 5AK3A 1ZH6A 3RAEC 4ASUA 3A3KA 2YYZA 1YZVA 1UXGA 1Z5VA 2VL7A 2KLBA 2WUEA 1E2EA 3OHSX 4J6FA 4OK5A 4PFQA 2C5FA 2W22A 4EJSC 3S8EA 4LMPA 3PU6A 1GZDA 1GVHA 2ZVJA 4J2HA 4QG7A 1W46A 4RLFA 3S2SA 2IH2A 3FAZA 2BF4A 5LQMA 3I9MA 4R8LA 3ZGXA 2HW8A 3QYAA 4N41A 2V7VA 4C7KA 1AJEA 5D2CA 3P9NA 3EPJA 3BH0A 2ZAOA 4ZCRA 2VNAA 4PC7A 3FBTA 1GPMA 1AC5A 1J2YA 2D5CA 3DE7X 4L51A 5FUYA 3TSWA 4AO6A 2ZIXA 3PFGA 1JE0A 2ZIGA 1FNDA 2G71A 3GRFA 3YASA 5DNVA 1EIWA 1BMDA 1WBBA 3DE1X 5D01A 2ODPA 5DM4A 3MYRA 2QP4A 3CC8A 4DNQA 1G1AA 3D0OA 3GP5A 3S27A 3OY7A 2J5KA 4WNCA 3ZD8A 4BBZA 3HRIA 4EHNA 4EG5A 3I34X 1GU0A 4UZFA 4Z2AA 4E1BA 4OP3A 1U8XX 1CP2A 2QZPA 3A0RB 3HP7A