2A94A

Structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a94A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2a94A02
3ZWOA 1LLDA 4IUYA 4U0KA 1JTVA 5H83A 3WG9A 1KEVA 4BNGA 2VYNA 4I1IA 2P9GA 3E5RA 5TIIA 3KM0A 3UXYA 4AVYA 3AI1A 4R9SA 2Q99A 1L7DA 4KTTE 3KYCA 1XQ1A 1PWXA 5KVSA 2P2SA 3PPIA 3ROMA 2Q1WA 4J90A 5HA5A 1O5IA 1LUAA 4LVUA 3IS3A 3AY3A 1DIGA 3AWDA 3GZNA 3PWZA 1RM4A 4GSLA 4FN4A 1MC5A 2DBZA 4HBGA 3DC2A 4LRTB 3VZQA 2FPIA 2W2KB 3PQEA 3RJ9A 3WBBA 2VHZA 4CPDA 5A02A 3G3EA 4II3A 4UVDA 1DRUA 2EWMA 3ENNA 1GEGA 1VM6A 1EDZA 2VT3A 4WLFA 4BNLA 4M8SA 3WJAA 4OJNA 4AJEA 1GPDG 2GF2A 2QRLA 3KHUA 1NTOA 1CDOA 5EN4A 3S2FA 4FJ1A 2HMTA 3DBVO 2WDZA 5CHEA 3GAZA 1U4SA 4ZQHA 3ONFA 1DIHA 5L7YA 3AY6A 1LNQA 1R12A 2EGHA 4NBUA 3K31A 3UAGA 2H9IA 3FPCA 4WOKA 3G49A 4JX8A 1W6UA 5EQFA 4E21A 5T8KA 4OSOA 1PJ4A 2BELA 2PKQO 2RIRA 5TJ9A 1MC4A 1XR3A 1WMAA 2O7SA 3NGXA 1R16A 1YKFA 1Y8QB 1T4BA 1OAAA 3OM9A 2DBVO 3P19A 3LLVA 4R68A 3EVTA 3PHIA 3HE3A 4BKPA 5THKA 3GG9A 4OXYA 3U5TA 1NQAO 4E5NA 2R00C 2YUTA 4DIFA 3QE3A 2CUKA 4GLOA 4WK6A 4GMFA 4NBRA 2IEBA 4A73A 4FC7A 1FDWA 1U3TA 1LRJA 2E48A 1PL7A 2H63A 3RWBA 4BQPA 4TWRA 2CDAA 2LDBA 2YHIB 2W2LA 2WD7A 3MWDB 4DA9A 1OC4A 2XOXA 5L4LA 1I33A 3F9IA 1PJTA 4XYBA 3TRIA 4XX0A 1IHYA 2Q2VA 4EW6A 1GQYA 2X8LA 5CFZA 4M89A 1LRKA 5IDYA 1M6HA 5G4LA 2DT5A 1X1EA 3JSAA 2OFPA 3E8XA 4NH4A 2OO5A 5DP2A 1T26A 3O9ZA 1BWSA 5DP1A 3OBBA 4N54A 4H3VA 2IZ0A 4P4LA 1J5PA 4CM8A 5KIAA 1HDZA 3P5SA 1H2HA 4NDNE 4Q3AA 1I3LA 3EAGA 3ZU3A 3OIDA 5JFOA 3TDKA 3FD8A 3WGIA 2NVWA 1R0LA 2Y05A 2NVUB 1ISIA 1T2EA 4CM1A 4IJVA 2ZK7A 1LDNA 1NHWA 1K3TA 4FFLA 4XGKA 4BV8A 2P5YA 3ZWPA 2Q46A 3ZV5A 4H15A 3TZ6A 3S2GA 5DNAA 4J1QA 4BNYA 4XA8A 1IULA 4JBIA 5CAEA 4IQGA 3D7LA 2X86A 4ONEA 3O38A 1D1TA 3ETEA 3TZHA 2BFAA 1OBFO 4NI5A 3IUSA 3H5RA 3OQ1A 1O89A 1Y81A 2CDBA 2DPHA 4KMSA 4YA6A 4J2HA 5T67A 4YR9A 1GUZA 2YHUA 3JD1A 3VZSA 4MP3A 1LTHR 2BHLA 5JO0A 5IF3A 1F14A 1KETA 1PL6A 4UUNA 1DC4A 1R0SA 2Z95A 3PIIA 5COAA 4R5HA 1OFGA 1YDWA 1YXMA 9LDBA 3VTZA 4IMRA 5COBA 3W4KA 3GVCA 4PLGA 3DBHB 4U8GA 3D5TA 4L9RA 5JS6A 2DFVA 4J7UA 5CEJA 3OEWA 3OFSA 2NQTA 4TQGA 4W6ZA 1T2FA 3KUXA 3N7UA 4FPXA 3KVOA 4P4GA 3L6EA 3C7AA 4ZD6A 1YBVA 2FZWA 3E9NA 2B37A 1PJQA 3RBXA 1LX6A 2CVOA 5H81A 4E31A 3A1NA 1H6DA 4J6FA 4L74A 4MKZA 1GUYA 1B3RA 4JJGA 3HN7A 3HJAA 4EJ0A 3AU8A 1P1IA 4DRYA 2PY6A 1GYRA 4KOAA 4U6SA 4Y9DA 5T57A 1BXKA 3PWSA 4LVCA 3FF4A 1T1RA 1U3UA 4FJ2A 1D1SA 4WLUA 4PLHA 1RJWA 1A9YA 3EZYA 3K8ZA 2UUPA 1GYQA 2Y67A 4NJMB 1OOEA 3EZLA 1HDCA 4EEZA 5CEEA 1NQOA 1N1GA 5CDGA 1O8CA 1X1TA 1XDWA 2SCUA 2VHWA 4CV1A 2PD4A 3EW7A 4R4JA 1ZK4A 2UVDA 1WZEA 2TMGA 5DULA 2V6FA 2YYYA 4WOJA 4L75A 3JQ9A 4BO3A 4J4BA 4BS9A 1UJMA 1KERA 2X9GA 4KDEA 4NR0A 2NWQA 3L4BC 4WE3A 3GRPA 4URFA 4WPGA 4TROA 2Y0DA 2WYWA 1HE5A 4ZU3A 3U4DA 2NADA 3AK4A 1NAIA 2X58A 3VKUA 5THQA 3GEGA 1ZJYA 4MOWA 1LI4A 1PEDA 3L9XA 1VRWA 2D4AA 2X5JO 4RJTA 1C0PA 3GDGA 1UXJA 3ORFA 2FR1A 4F3YA 1DFHA 2FRDA 3VZRA 3DOOA 4XZ3A 2NTNA 3OQ6A 1LLUA 3WLEA 5ITVA 1AE1A 1IHXA 1U7TA 4MVJI 1DSSG 2JHFA 2Y68A 1Q7CA 1YONA 4DBZA 3D0OA 1KVSA 3GRKA 4CLXA 1V6AA 2GPTA 2QYTA 1DB3A 4AG3A 2V7PA 3V1YA 4E5PA 1Z82A 4GX0A 4RPJA 2XXBA 3T4EA 1K89A 4KUHA 1SAYA 1B7GO 1EVYA 1R4NA 3NX4A 4YYZA 2HMVA 3ZW8A 2GUGA 4Z0HO 1ZMOA 1PZHA 4W9NC 5K6AA 4PRKA 1HWYA 5TJHA 4QSMA 4DMMA 5A5FA 1PU2A 3BZUA 3WWZA 5HTOA 2PV7A 1G0NA 3WB9A 2EJWA 1M76A 2C7VA 3BMCB 3RROA 5BR7A 4UUMA 4NHEA 2YV3A 1YQDA 1NFQA 3UN1A 3ETDA 2B4TO 3GT0A 1ENYA 3WXBA 3IOYA 3WIDA 1PGPA 1RPNA 1HSOA 1DJQA 2HKIA 2O3SA 2NM0A 2P5UA 1F06A 3RU7A 3L4SO 4GH5A 2HJSA 2Y0EA 4B7CA 5AOVA 3GAFA 2JCYA 4D0RA 3E1KA 4WEQA 3IJRA 4Z3DA 4A0SA 1JW9B 1QR6A 3BHJA 1WVGA 4CM9A 3FN4A 3WICA 1LDYA 1C1XB 1ZNQO 3E9MA 5A04A 1C1DB 3QWBA 2Z5LA 1GR0A 1KEWA 3TZKA 3DXFA 4IDAA 4ZICA 5CEFA 1X7GA 4AJNA 4UVEA 4XYGA 1K5HA 2Q49A 2FN7A 5F1PA 1R0KA 1MP0A 3PZBA 3RSHA 4UVIA 4CR6A 3GUCA 1QYWA 1LDBA 2AQKA 3QJ5A 4B3IA 4BGVA 3JQ8B 5MDHA 1NPYA 4MKXA 4BNIA 4FB5A 4Q3NA 4R69A 3S2EA 5G0TA 2ILTA 2JHGA 2WMDA 4MVJF 4OOEA 5LDGA 1X15A 4TRMA 1GCUA 3JTMA 3I9JA 3K96A 1FF9A 1W73A 2D2IA 4OKIA 1GUFA 4NK4A 3PHLA 3NUGA 2BH9A 3RKRA 1FDUA 1XLTA 1ZKMA 1SZJG 2J3KA 1J49A 3CMCO 5KWEA 2OZPA 1P0CA 5KTKA 1VSVA 1ZH8A 2BF7A 1X7DA 2JCVA 3AOGA 1ISJA 1PJLA 1RYDA 1VJ0A 1RYEA 5IN5A 2X0RA 2GR9A 3ZWCA 1BSVA 1T2DA 1U3WA 2C82A 3VH4A 3LF2A 3VTFA 4J91A 3L0DA 1NFRA 1UDBA 1YQXA 2ZJ1A 1UAYA 3ZWYA 3NAQA 2Q1UA 2Z1NA 1IL0A 1A7KA 3NTOA 4NNJA 1Z6ZA 3DZJA 3QY9A 2VRBA 1E7MA 4PZDA 5C5IA 5CDTA 5C7LO 1ZVMA 4R1SA 4D79A 4N7RA 4ALMA 4AJLA 1IUKA 3C24A 2J6IA 2HUNA 1HE3A 3CMMA 4CUZA 5BQFA 3D4PA 4BOYA 1ISGA 3NKLA 1TI7A 1VJ1A 1QYVA 4CQLB 2FR0A 5H82A 3U4HA 2RH8A 3PDJA 2IYPA 3ZWVA 1P1KA 3EC7A 3TQHA 1N9GA 3H9UA 4KDFA 3VPXA 1PZEA 3SEFA 5IDXA 2X4GA 4FFPA 4BKQA 3ZNOA 2UAGA 2NVUA 1SC6A 4E5KA 1XG5A 2H1SA 4DYVA 4ND4A 2VWPA 3GVIA 3RKUA 4GPD1 5HRUA 4FFMA 2EXXA 1DJNA 4YVFA 3CH6A 4GQAA 2OHXA 3CINA 3F47A 1EZ4A 4L8VA 2GYYA 3DBRB 1PJCA 3R3SA 1TT7A 4QX6A 4GAEA 3FBTA 3GQVA 2IODA 1ML3A 2AG8A 4CJXA 1BMDA 1HDYA 2VQ3A 2ZIZA 1PJ2A 5I7FA 3E18A 4B7XA 1UZLA 3LC2O 5F5LA 4CM8B 5KKAA 3TFQA 2D5CA 3WYCA 4OQYA 1M2WA 4CMCA 5BSFA 4BO1A 4Q3BA 3ZV4A 4X54A 1VI2A 5T5QA 2X23A 3H7AA 3M6IA 4YDRA 2Y1DA 4BKOA 2WE8A 4YAGA 1V3TA 1GTMA 4GX2A 3WYEA 3EUWA 4CLRB 1AUPA 3ASUA 3I5MA 2EW2A 3DBHA 2ZTLA 4JK3A 2ET6A 1X7HA 3ZV3A 4WLEA 1DOHA 4P22A 4OOFA 3PQDA 2A4KA 3I4FA 4ZN6A 2W2LD 2OOSA 1UH5A 1IYZA 4KP7A 2ZTMA 4W7IA 4AJOA 5KJFA 4BNFA 4C7JA 2BGKA 3G0OA 1HYHA 3GNSA 3BHMA 3UOGA 3ANNA 5KOIA 1JA9A 4CMIB 3P2YA 1ZFNA 3E9QA 1K2WA 4DIBA 1KBZA 1NASA 3L07A 3UHAA 4TKLA 1VKOA 1I3KA 4EGFA 1NR7A 3FPLA 3K5PA 3TSCA 3QVWA 3H9JA 5EINA 3S55A 2IXBA 4BV9A 3D1LA 4JP2A 3WTBA 3ZGYA 5TT1A 3F6YA 1PS9A 5CDSA 2LDXA 4HFJA 3PYLA 1O9BA 3BA1A 4OSPA 4XKJA 5KJCA 4XB2A 1HXHA 1UXHA 4WKGA 4WECA 3TNLA 4I9NA 4UULA 3WGGA 4EJ6A 3OJOA 1DFGA 1CRWG 2WD8A 1GCOA 1ORRA 4BHTA 4H7PA 4N5MA 2ZB3A 3AOEC 2J3IA 3KZVA 3WBFA 1EVZA 4U6QA 3C8MA 1IE3A 3AFNA 3F4LA 1B8PA 3O26A 4KZPA 4Q3DA 5KVQA 5JCXA 3GGGA 4MVJH 3JQGB 4FS3A 5T64A 5EERA 2VWHA 4RQTA 3IDSA 3SLGA 3ON5A 1UP7A 3U09A 8ADHA 1H6AA 5IZCA 3B1FA 3COSA 3EYWA 1HDRA 1NVTA 3U0BA 4CQMB 4G5HA 2X5OA 4JN6B 1EUCA 4NU5A 5U9CA 4ND1A 1EEHA 4M1QA 1ZSVA 2PH5A 4IDDA 2BKAA 2C5AA 2X1HA 3QHAA 1WZIA 3KLMX 3ST7A 4JNKA 4JJIA 1AXGA 2WEKA 4PRLA 1KIFA 1Z73A 4G65A 1MFPA 1MV8A 1GQQA 9LDTA 4B3JA 3N58A 1M67A 1U8FO 4XQ9A 3CPSA 3GGPA 3WGYA 2QRKA 3UUWA 1HSZA 5EQDA 1L1FA 3I83A 4RVGA 1YB5A 4ZVVA 2PGLA 2WJPA 4R1TA 5ILGA 3PFWO 3H8VA 4HNHA 2XXJA 2O3TA 1UP4A 3GMSA 1D3AA 4PG4A 2UV8A 2O3UA 3CEAA 2HAEA 3AM5A 4ESOA 2H6EA 3CE6A 1XSEA 1CYDA 3W4IA 1LSOA 2RHCA 3AUSA 1J6UA 1I5RA 5ENDA 4DREA 3BMCA 2VUTA 2NLOA 5G0VA 2I67A 2PD3A 3FI9A 1DDOA 1TT5B 1S6YA 4FFRA 4HNGA 3MZ0A 2I99A 3H2ZA 5EMHA 3M1AA 4XD2A 5DCWA 1SEVA 4A03A 3S8MA 5FWNA 2EERA 2I66A 2C20A 3HUDA 2H5LA 3ENKA 4ZRMA 3GR6A 3PK0A 5ENVA 5AXAA 2AEFA 4U0JA 1JU9A 4F6CA 4WEOA 1N1EA 1NPTO 3AFMA 4RZHA 3VPGA 1LSSA 3HN2A 3PGXA 2HCTA 5L40A 3WLFA 1B8UA 3I1JA 2J8ZA 3LQFA 4LRSB 1I01A 4HADA 2QX7A 2TMDA 1UXKA 4JIGA 1B14A 1C1XA 1C1DA 2QQ5A 4K28A 1Z7BA 2IEDA 5F1KA 1AXEA 4QTZA 3GFGA 1VL6A 1YO6A 5JC1A 2E49A 3TOXA 1EFKA 1P3DA 3DZHA 5G0SA 2O2SA 3V2GA 5HS4A 4IM7A 4J3FA 3KRTA 2QG4A 3GHHA 3JQAA 4DBVO 1GFSA 4GLLA 3JQ8A 4HFRA 4XCVA 4BO6A 1NHGA 2EJVA 4IJKA 1P33A 2AE2A 3RC9A 5BSGA 1SOVA 1JKIA 1E1LA 3DBLB 3LZ6A 1QYXA 3RQSA 5CPBA 4B7UA 3K6JA 5TF4A 1A4UA 3OICA 5AVOA 3RUFA 5JDIA 1PGJA 3R3JA 4YT5A 5IDQA 1VJTA 2IYOA 4NBVA 2A35A 4RVDA 3KTDA 5JMPA 2V65A 4CMAA 3ZWBA 3JQBA 1I8TA 1UZNA 5TX7A 2ZCVA 1XWFA 4LSWA 1UXGA 5JMWA 4M55A 3ROKA 3NEPX 3FHLA 3JQ6A 1VLLA 2AHRA 1BDMA 4INAA 4DQVA 3FNHA 4FOOA 4BO8A 4AJ2A 4XQGA 4BB6A 1TVEA 4FBGA 4OH1A 1NFFA 4CL8A 4E12A 3S2IA 2ZTUA 1UR5A 1ZCJA 3KV3O 1LDMA 1Q7BA 1PS0A 2Y1EA 4QQRA 1EUDA 3WSWA 1GQ2A 1LSUA 2HMSA 4EBFA 3ZV6A 1XGKA 5B4TA 2RH4A 5ICMA 3QVXA 3GEDA 4RL6A 4S1VA 3RUIA 3KETA 2YW9A 5DDIP 4YJDA 4Z9FA 5L4NA 5DOVA 1NYTA 4E6PA 2GNAA 1XHLA 5A1TA 4IGEA 4YT8A 5BSEA 2PZKA 3L9WA 4R3WA 5IZ4A 3WSVA 4CQLA 4O5OA 4YQYA 4CM9D 2V6GA 3QRWA 4D43A 1HE2A 3ZNNA 4DPLA 4IIUA 1P45A 2HO5A 4YJHB 2I65A 2R6JA 4YQZA 1N7GA 2W4QA 1EBFA 4YAKA 4K6CA 3FTNA 2JFHA 4L4RA 3FWZA 4PG8A 1FK8A 2YQ4A 1PSDA 3TPCA 1V9LA 4GMGA 5IN4A 1MGOA 1MLDA 1E7WA 1NPDA 2J5QA 1Z74A 5CG2A 4TRNA 3DBRA 1K6IA 3FSRA 2OGUA 1PQWA 4YAIA 1HLPA 3NRCA 4IMPA 5U4QA 3WMWA 3TZQA 3EDMA 4CMEA 1PIWA 1PQPA 1ZMTA 2W8ZA 1I2ZA 2NACA 4NK5A 3NTQA 3A14A 4ZGWA 2QHXA 2J5KA 1F17A 1N9GB 2NUAA 3Q1LA 2IE0A 2NU7A 4D41A 1I2BA 1LC3A 1BRMA 3PYMA 1DC3A 2GN4A 4Y8VA 2HMWA 4J4TA 4DGSA 4WCFC 4CLRA 2P68A 1F12A 4DQXA 3Q11A 3GC6A 4Y98A 2VRCA 3EY4A 1UAGA 1JN0A 2Z1MA 3UVEA 1E3LA 1H9AA 4LMRA 4RLHA 3ZWMA 3T4XA 4PLWA 4A27A 1XCBA 2GASA 1YRLA 3LT0A 3P7MA 1SB9A 1FJHA 3DB2A 1J4AA 2DTXA 2Q3EA 1RWBA 5JAIA 4CMIA 1ISFA 4KTVE 3BIOA 3PP8A 5AXDA 3PWKA 3DZBA 2VYVA 1GU7A 2X22A 4CLHA 2UDPA 1U8XX 2VHVA 1ZZEA 1HLDA 2ZJ0A 4RCVA 3LC7O 3GNTA 4MO2A 4CM5A 3ASVA 1QLJA 5JYEA 3OF2A 1N5DA 4YCAA 4AJPA 5L7WA 3WOHA 2EKLA 1ZO8A 1GZ6A 3KB6A 1Z75A 1WDMA 1N2SA 3SC4A 2VCYA 5JCJA 5TQVA 5IDWA 2VTDA 7MDHA 1KYQA 3AUAA 1VC2A 1EUZA 4CUJA 2D8AA 4CMBA 4YEDA 2HK8A 3VDRA 1V35A 3Q2IA 4RDIA 4S3MA 3JQGA 1TB4A 3OMLA 1E5QA 4LCEA 4BNTA 4QUKA 5AXBA 4J43A 4XJSA 2Q2WA 3D3WB 3V1TC 4JGBA 1DPGA 2V6MA 3M2TA 3OIGA 4YRBA 1JWBB 2FSVA 4RO0A 2O3JA 1C14A 4CMKA 5C3MA 1GL3A 3RI3A 3ZW9A 4CQMA 2XAAA 5JBIA 5GZ6A 1YH3A 4AJJA 1DRWA 4IQ0A 2VZ9A 3RC7A 2VOJA 3FWNA 2ZKLA 2ZQZA 3JQFC 1NXQA 2Y1CA 1HT0A 3WGHA 3B1KA 1UDAA 1FDSA 1ZK2A 5L53A 4M49A 5G0WA 4C4OA 5IXSA 4E5YA 4R01A 3DMTA 2PKRA 4IGFA 4BQRA 4CLDA 1ZSNA 2O3QA 3PJDA 4MINA 4AICA 1KEPA 1I30A 5CDUA 1DO8A 5JNLA 1XIVA 4RVFA 2IZ1A 2C2XA 1YJ8A 2PR2A 3KEOA 3QP9A 3WQSB 3VH3A 4EI2A 5A5EA 1CF2O 2CF5A 3DO5A 3JYNA 3UFXA 3JYLA 3OJEA 3A9WA 5MGBA 5EPOA 4NPCA 4LISA 3C1OA 2AEMA 1KVQA 1UXIA 3CIFA 3GVXA 4GKBA 3U4CA 3GUYA 4HX5A 1QYCA 4L73A 1E7SA 2CDCA 1XU9A 4FGSA 3QA9A 2Y66A 3GLQA 4I5DA 3HB5X 3WQRA 4XR9A 2NU6A 1J0XO 1IY8A 2NSDA 2PWZA 2WSBA 4AFNA 1Q1NA 1TT5A 2HDHA 3AUTA 3GA0A 2DLDA 4R3NA 4NU6A 2VNAA 1A27A 1LRLA 4MVJD 4LSMA 4RF2A 1SNYA 1LBEA 4JQCA 5JDCA 1W4ZA 1PS8A 4B4OA 4NFSA 1Y5MA 1LC0A 3ZU2A 3F46A 4LMPA 2VNSA 1NM5A 4LN1A 1WNTA 1DLJA 1PJSA 3H9GA 4UEKA 4BMSA 3QVOA 1PL8A 3RUDA 2ZQYA 1U28A 4ALIA 5JY6A 4RLSA 2GD1O 4HP8A 3VDQA 4W4TA 2WE7A 1QG6A 4MVJE 4PLZA 4QFDA 5GZ3A 1HL3A 1IPEA 2O7QA 4PFJA 3CTMA 4O1MA 4H16A 4JBHA 3K2EA 2VOEA 4O6VA 3RUHA 3D4NA 4WGGA 2YV1A 4TZKA 1L7EA 1P77A 3ZHXA 3L6OO 2PLAA 1EVJA 2ZB4A 3OSUA 4IDGA 1NVMB 3OP4A 2FPPA 1B15A 2JFGA 4TRRA 3E03A 4R54A 1ISHA 3DBLA 3C85A 3DZFA 4XQEA 2G1UA 2YFQA 4IIVA 4QXMA 5ER6A 5L9AA 2D59A 4FJ0A 4YTEA 1TLTA 4UEOA 3K9QO 2JKVA 4TZTA 1KOLA 2BFMA 2CMDA 1XU7A 3DDNA 2AE1A 3OECA 2EV9A 3H2SA 4BNHA 2YDXA 5KJEA 4NQZA 4D45A 1I10A 2I9PA 1H5QA 4ALJA 5BNFA 4Q3EA 2P9CA 1GDHA 3D5QA 3ZHBA 1ZK1A 2G5CA 2GN8A 4KQXA 1GADO 3F1LA 4HFMA 3HZZA 3MCVA 3SJUA 1I0ZA 1HYEA 5L4SA 5LDHA 2ZYGA 5ILOA 1VL0A 3IC5A 1RM3A 5CDYA 1PR3A 2YV2A 1Q0QA 2O50A 2QZZA 3JQAB 1QLHA 1QKIA 3G1UA 4PLPA 2ZYDA 4WASA 1E92A 3QWFA 3L6DA 1NX6A 5TNXA 1K0UA 1HDXA 3PZRA 1Y8RA 1YWGO 3QWAA 1EQUA 3CZMA 4RF3A 5B12A 2AEJA 4HXYA 5BSHA 1E5LA 2DM6A 3DHYA 3T7CA 5L7TA 2CSUA 3MJVA 5L95A 4RPHA 3AUUA 3NJ4A 4I5EA 3PTZA 4D42A 3RUAA 1TXGA 4GKVA 5I9LA 3PYXA 3PJFA 5LC1A 3BMOA 4BMVA 1C0LA 5IAAA 2B69A 4EYEA 1Y1PA 1KVUA 3HFSA 2YZ7A 3GPIA 1JAXA 3GK3A 4ND3A 4RPGA 1QMGA 1QV6A 3WDSA 2GERA 3BMNB 3PI7A 1JWAB 2VN8A 3KLPX 4E2XA 1I32A 2EF1A 1E6EA 1VSUA 3IL2A 4QEDA 3U62A 4IZIA 4NFYA 2DTDA 4ND5A 3LT2A 1E1MA 4YJHA 3W4JA 2P91A 1N92A 4UUOA 4IDEA 2VYND 3ROPA 2F00A 4R1NA 4XRGA 2R00A 5C37A 1QRRA 3PVZA 4JXKA 2C54A 4P4NA 4TRJA 3T7EA 1LDEA 2JL1A 4FCCA 4IDBA 2QIOA 2IXAA 4E13A 4OHUA 2BFPA 3BMQB 3PDUA 1AGNA 5DOZA 2OUIA 4J1TA 4LCJA 2UUOA 1OZAA 5DF1A 3ITDA 3UGKA 1WDLA 4EUHA 4PLYA 4PGFA 3VH1A 4XB1A 2D0IA 5TSDA 4DIOA 2O4UX 4WLOA 2DUUA 4KQWA 3UF0A 4CV3A 2WM3A 4IS2A 4R9RA 4M86A 4Q9NA 2EKQA 4GVLA 5A3VA 2OP1A 3I9MA 4PZEA 1Q0HA 3IKTA 5ES3A 3W8DA 4U7WA 1WAMA 5C7OO 4B4VA 4GVXA 3DR3A 1P1RA 1NP3A 1V3VA 4I8XA 2GN9A 4DLLA 2E37A 2EEZA 2X9NA 1MG0A 5GMOA 3VVCA 3RC2A 2I6TA 2X0IA 1DIRA 3PRJA 4PLTA 5EIOA 2NVBA 1JDJA 1MUUA 2DFDA 3LT4A 4W99A 2FHSA 4AJKA 3KSUA 3PEFA 3HB4X 1VPDA 4WCFA 1N8KA 2HRBA 2CNBA 3DFUA 3JD2A 4ND2A 2DTEA 1WW8A 4RPLA 3UKOA 4G81A 3IP3A 3NT2A 1ONNA 3KO8A 4YB8A 4TMFA 1R4MB 4Z9YA 1VE9A 4J7XA 4XJTA 5I9MA 5JYDA 4B8WA 3QVTA 1MFZA 3H3FA 5C7IO 4HY3A 4J1NA 4NG5A 3K92A 4NBWA 3ADPA 1UP6A 5JAMA 1P44A 3C7DB 3DAPA 2RAFA 3M1LA 5T6BA 5A06A 3KBOA 2BFOA 1S7CA 3P2OA 1EQ2A 1UDCA 2P9EA 4HUJA 4PLVA 2ZB8A 6ADHA 1JLLA 1V0JA 1YS4A 4FSHA 1ENOA 2IRWA 4OGWA 3GDOA 5F1OA 4YACA 1TA4A 4JBGA 4UEJA 4GI2A 1SEPA 2B0JA 1CERA 1DHTA 4ID9A 4JJFA 1U9JA 4CM4B 3OETA 1BGVA 3D3WA 1PZFA 1B16A 1ZIDA 5A4DA 1PWZA 2FR8A 3OJFA 4KWIA 4BNZA 1C0IA 2OXIA 1XEAA 2Q4EA 4BGIA 5IG2A 5TGDA 3UCEA 3E5MA 4Z6KA 4E2YA 4N18A 4QECA 5FI5A 1YB4A 2PKQP 4GSKA 1QV7A 3GG2A 5EL0A 2WYVA 1LDGA 2YY7A 4MPDA 4PVCA 5JLAA 3JYPA 1Y6JA 4OM8A 5AYVA 4NJOA 3JD4A 3H9QA 4Y6SA 4AJHA 5I7SA 1BTOA 4XEHA 2OL4A 2VRCD 2JAPA 2VTEA 1E3SA 2EGGA 3MJTA 3W6ZA 3HG7A 4RF4A 3LVFO 1O6ZA 4RPKA 2DBQA 1PJ3A 1U7HA 5EJ2A 1MG5A 2B4QA 3DMYA 4D3SA 3L77A 2E82A 4CV2A 1YL6A 2AA3A 1UZMA 3B1JA 3CSDA 5TT0A 3TL2A 5A9SA 2BI7A 5A9TA 3DAFA 3PHJA 1KY5A 2AQHA 3L4BA 5FF9A 3ZWXA 4EEXA 5B4VA 2OBYA 2VYVD 3TL3A 3C1AA 4E33A 2D5AA 3IIEA 1ONOA 4L4XA 1DC6A 3LT1A 1BXGB 5L45A 5A05A 2FPGA 2PZLA 4QFCA 5JO9A 4E2ZA 5DZSA 3PLRA 1HRDA 3WYBA 2QZ9A 2NNLD 2JD0A 4GX5A 4BO4A 5GZ1A 5FYDA 4XYLA 4YRDA 2JD1A 3N74A 1YOVB 4XR4A 2RBEA 2Q1TA 1A5ZA 4Z3KA 5CG1A 4PG6A 3JQ9C 4PZCA 1P1FA 2B5WA 5DCYA 1NQ5A 4MP8A 3WQQA 4PLFA 3RJ5A 3FBGA 4MVJP 4J9VA 1YJQA 3NDJA 4B79A 3ZH2A 1HZJA 1EE2A 4J7CA 4PG7A 4QT0A 5JPIA 4BO0A 1DEHA 1T1SA 4W9NA 4XWYA 4TKMA 2PFGA 1KEUA 2HK7A 3WTCA 1E0DA 3DZIA 1LSJA 1XKQA 5JW6A 3ONEA 3NYWA 4K26A 3X2FA 2J3HA 1DAPA 3OA0A 4BO5A 3OEYA 1ZJZA 1DBVO 4O63O 4DYDA 4IDFA 3V5NA 1ISMA 4B4WA 4WJZA 3JYOA 4XYEA 1U2GA 5KCZA 4GBJA 1E7YA 4YAEA 4RF5A 1PGNA 4XGNA 2YQ5A 2EP7A 1U5AA 3UCXA 4FQ8A 3VHRA 3DAGA 3GPDG 4G2NA 5K6AC 3O4RA 4BNVA 2B4RO 3F4BA 4BMNA 3ZU4A 3IKVA 4OKNA 3FNFA 4RV9A 3GHYA 3WS7A 5JSFA 3WGOA 2JCXA 1A71A 1BW9B 1O0SA 4FR5A 2DPGA 3WWYA 4IS3A 3LK7A 2NTJA 4ZJUA 3Q9UA 3QWHA 4BB5A 3FR7A 1M75A 4IJUA 4OO3A 5HS6A 1IB6A 3HQ4O 2RHRA 3B6ZA 4MJLA 2VWGA 5KKCA 1JAYA 1A72A 1E7QA 1HZZA 3NT4A 4JP3A 1LXCA 4ROSA 4D3DA 4PIVA 4RVSA 3O8QB 5CP8A 3R1IA 4D46A 2GCGA 2VT2A 3TN7A 1EK6A 2NQ8A 1N7HA 3PIDA 4UAGA 2DC1A 3BMNA 3ZHYA 5HM8A 2BLLA 1YL5A 2WWRA 3DOCA 2EP5A 1ENPA 4CR7A 4YBZA 2FSSA 3MJEA 4LGVA 3OJ0A 4F6LA 4OXNA 1I3NA 4J2OA 5JAQA 2POQX 1Y8RB 4DTIA 3QQPA 1ZXBA 2I3AA 4IXTA 3OH8A 1I3MA 5A9RA 2HRZA 3UW3A 1P9LA 1DFIA 3VH2A 5JAZA 1E3IA 4D3FA 2BD0A 1HYGA 1T4DA 3A28A 4Q39A 1R37A 3S1LA 2O2YA 2FP4A 4BO2A 3BMQA 3I3OA 1FMCA 1ZEMA 3W6UA 5HWSA 3BMOB 4CMJA 2ZCUA 4GGOA 2GO1A 4RORA 4FGWA 1KY4A 2AQIA 4P8RA 1WWKA 5I7EA 1Z45A 3Q0EA 4FOSA 1D8AA 4XYMA 3AI2A 4ALNA 3DHNA 3MEQA 2Y99A 3H9EO 1KC3A 2PD6A 3IAHA 3D64A 5K9ZA 5KVVA 3FR8A 1U2DA 3GN2A 4XDZA 1MXFA 1R66A 1SCUA 3PQFA 1A7AA 3OQBA 1W0CA 1RM5A 2AXQA 5F5NA 4CMHA 3NDIA 4BVAA 5ICSA 3PGJA 1ADGA 1PR9A 1WP4A 1EK5A 3NV9A 3OIFA 4Y6RA 3RIHA 4HKTA 2O3RA 3PHGA 3EHEA 4I5GA 1Y9EA 1GD1O 3MJ4A 3DEYX 4IPTA 4YJFB 3TJRA 4AJIA 1NAHA 4K1LA 1I24A 5JY1A 2DQ4A 3D3EA 3KEQA 3RFTA 2PZMA 3STHA 2B5VA 3I23A 4UVHA 3W1VA 4RGBA 4XIJA 4MVJG 4CODB 5TS3A 3TWOA 1X0VA 5DCUA 2J3JA 3DTTA 1JKJA 3ULKA 4EDFA 3U49A 3NGLA 1E3WA 4EITA 1R4MA 4EJMA 1HKUA 3ZWAA 3NDRA 4R51A 3WGTA 1PZGA 4DVJA 1H0KA 1LU9A 4LK3A 3SBOA 5COQA 3UCFA 1MB4A 1E6WA 3QSGA 1DIAA 1SBYA 3KSZO 1ULSA 4FFOA 2HQ1A 1Q2XA 3I9NA 5FFFA 2Y1OA 3ANMA 4J16A 4E3ZA 3SLKA 4A10A 2C2YA 2HK9A 2VZ8A 4D44A 4O59O 2FY8A 4D0SA 4TVOA 4OQZA 1M66A 4YRAA 4WCFB 4P38A 4W7HA 3LSYA 3FNEA 4FDAA 4UREA 1ID1A 3PHHA 4BGUA 1VKNA 4AJ1A 2D1YA 2NU8A 4ZQGA 2CY0A 4DMLA 3SX2A 3ICCA 4ZQBA 3HADA 4NZ9A 4CM4A 3AI3A 4DLBA 4E4YA 4DPMA 4O0LA 1XQ6A 4EUFA 4HWKA 4Z9XA 4A7PA 4YAJA 4IJWA 4I9UA 1DRVA 4RDHA 4W82A 4E30A 2FOIA 1V3UA 3GN1A 4DPKA 1NNUA 1KVRA 1AN9A 2CFCA 3R6DA 2GN6A 1ADBA 4UUPA 1YGYA 1ADCA 5FEUA 2BRUA 1DIBA 2XF8A 2P4QA 3AM3A 4RQUA 3JQ7B 3LYLA 4GX1A 3SC6A 1PGQA 4KWHA 3B20A 4Q3CA 1C0KA 1H9BA 3ROQA 4CLEA 3WJ7A 5IFLA 3M2PA 1X14A 1QP8A 4J0FA 4OYRA 2GZ2A 3DONA 3INGA 2Y0CA 3AY7A 2RCYA 5TC4A 5L3ZA 1W8DA 4RVHA 5TLSA 1YVEI 4FC6A 1YDEA 1BG6A 2AG5A 4WNCA 1PJBA 1HETA 2Q1SA 3ADOA 3AU9A 2CZCA 2FMUA 4RZIA 1NVGA 5DBGA 5B4UA 3AOEA 3KYDB 3WGQA 4CMGA 4OMUA 1BVUA 3ZU5A 1BDBA 3GH3A 3GMDA 1WXDA 4Y67A 4E5MA 4EUEA 1Y9AA 3CUKA 1E3JA 3ANLA 1RKXA 5AQ1A 3BTSA 3JQDA 4WUVA 2GRAA 1P31A 2Y1GA 4JLWA 2PA3A 1PQUA 1ADFA 3QVSA 1AHHA 5F3RA 4F45A 2UYYA 3SVTA 2Q4BA 1BXGA 1DHRA 1YBMA 2PGJA 3ZI0A 4DC1A 4J49A 2HJRA 1A9ZA 4U5QA 2HLPA 2YDYA 5I7VA 4CLOB 1QSGA 2QRJA 3K30A 4Y6PA 1T25A 1E1NA 2E6UX 3WIEA 3FRJA 5G4KB 3VAZA 1SPXA 3GGOA 3HWRA 5F21A 3GEMA 1YOVA 3INTA 3H6KA 4J9UE 4QO7A 2DKNA 4J4HA 1CQIA 1B8VA 1WDKA 3Q6IA 3HHPA 2G17A 2I76A 3DZKA 4IBOA 1B0AA 4Z0TA 1YB1A 5A9SB 4MKRA 1GAEO 5FI3A 1SB8A 1NR1A 3FTPA 3R0IA 1B2LA 5IZCC 1QXSA 3WNQA 5G0UA 5J23A 1E1KA 5DN9A 3EGOA 4IXWA 3GVPA 4WCDA 3TZCA 2EKPA 1M6WA 3KOUA 2X9VA 2BI8A 3C1TA 3A4VA 1D4FA 2Q45A 2ZYAA 3O03A 1U4OA 3DZGA 2A92A 3RVDA 1U1IA 2G0TA 2GGSA 2BGMA 5KVCA 4A26A 3G79A 3RASA 1MXHA 1B26A 1CEQA 3F5QA 4NIMA 3VZPA 3PLNA 4Z0PA 1IPFA 4BL5A 4K6FA 2C59A 5B37A 1E7RA 4BNMA 3V2UA 4JROA 5DBFA 3Q2KA 1NWHA 5JC8A 3VVBA 5JXWA 3JD3A 4GWGA 3V2HA 1ENZA 2CVZA 2C7GA 3VPSA 1X13A 1BHSA 4QO8A 4BNKA 1BW9A 3ZHZA 2B83A 2C07A 4CM6A 5CPFA 3G1TA 3LF1A 1HDGO 3WMXA 4WNIA 3BYZA 4YJGB 3DTYA 2AQ8A 2NU9A 3MTGA 4WLNA 2AMFA 1JKFA 1ARZA 3IP1A 4II2A 1HDOA 2JAHA 1YL7A 2P4HX 3IQDB 4YXFA 2FWMX 2X7HA 1LJ8A 3TF5A 4K9DA 1YQGA 3RUEA 1ZK0A 4MIEA 4PG5A 1EDOA 3O8QA 2A94A 3HSKA 5IXYA 4I08A 3I6QA 4N5LA 5DBIA 2PGDA 3LC1O 4LW8A 3ZZNA 1ZSYA 3KXDA 5DT9A 1GEEA 3CKYA 2X6TA 2XPCA 4HV4A 3DQPA 5BT9A 2C5EA 2W2KA 4R41A 2J5RA 2GSDA 1EFLA 1WLYA 3PXXA 3RBZA 4CR8A 2I3GA 3OHSX 3VOSA 1P0FA 3WR5A 3NJ8A 4BNNA 3WNVA 1F0YA 3AM4A 3ZN2A 1WPQA 1NBOA 1E77A 1H6CA 1SMKA 1Y7TA 4ZQEA 2FZEA 3EMKA 4CUKA 5TRTA 4GGPA 3JD0A 2CVQA 3GFBA 1HEUA 3U9LA 1A4IA 3KYCB 1UUFA 4CM7A 1T2AA 5JDIC 2F1KA 1LQTA 3WX0A 1PGOA 4DQUA 4L0QA 3UICA 4YT2A 1DC5A 5BNIA 2B35A 4BIIA 4ZQFA 4DUPA 3E6AA 3JQBC 3GZNB 3E82A 1KS9A 2GLXA 4B3HA 4BO9A 1SO8A 3QIVA 4YPOA 5A3JA 3I9LA 3E48A 4N5NA 3IMFA 3KSDO 3U3XA 1U5CA 3I52A 3H5NA 5G2OA 2GZ3A 4XQCA 1GY8A 3OA2A 3ICPA 3VKVA 3K73O 3JCZA 2VHXA 3I9OA 3TFOA 3EVNA 3ITKA 1LA2A 1JVSA 1ZUD1 3U4IA 1H94A 1Y8QA 4MIOA 2BGLA 3OJLA 3V1UA 2G82A 2AW5A 3JQAD 2DUWA 4M87A 4YJFA 1OMOA 1SOWA 3BXXA 1DAOA 4J1SA 4JCOA 4CM3A 3RFXA 3FCOA 2EG9A 1Z7EA 4OAQA 1XYGA 5T8KC 1HF3A 5I8WA 1CWUA 4PCVA 3HDHA 3RD5A 1OC2A 1LQUA 2D3TA 3EK2A 3ETGA 3BHIA 1V8BA 2VWQA 1P1HA 1EE9A 2HU2A 2Q50A 1Q7GA 1ULUA 2EIHA 2YHIA 3G17A 1WMBA 1FXSA 3DHEA 3LLSA 4ILKA 4ITUA 1GPJA 2JFFA 4BNJA 4R5MA 3RCBA 4EZBA 4IQ8A 2CD9A 1P1JA 3MTJA 2HMUA 3WFJA 4NBTA 1IOLA 2Y93A 1R6DA 3GDFA 1ZXLA 3DL2A 4DL9A 3PFFA 3AW9A 4R16A 4MVJM 5L51A 4XDYA 5BNTA 3VC7A 1CETA 1JQBA 4DC0A 1GV0A 1U3VA 3GNQA 3BAZA 3JV7A 4PLCA 4UVGA 1IZ9A 1HE4A 4BNWA 2BMAA 5K0ZA 3LDHA 1O95A 1FDVA 4DXHA 2WD7B 5EESA 4CMEC 2I5PO 3DOJA 5IJZA 1E3WB 2OBNA 4IDCA 4B4UA 5U1PA 2VUSA 3MJSA 4HFNA 1PTJA 3UH1A 4ZA2A 3RC1A 5ADHA 4IZHA 3AJRA 1P74A 1H2BA 3NTRA 1I36A 1F8FA 1KC1A 4BKRA 2YFHA 3Q3CA 1MX3A 3NT5A 3SJ7A 3LU1A 4BKUA 4B8ZA 4XGIA 3CZRA 3F5SA 1VL8A 1RM0A 4FD3A 3JYQA 3JQ7A 1E6UA 4I5FA 2DU8A 2IDZA 1GV1A 1H93A 1EVIA 4IY1A 5LCXA 3HDYA 5B1YA 3H3JA 2IZZA 2GDZA 3H5AA 3BTUA 2ZATA 3MWEB 3HFGA 1GZ4A 3WGZA 4BGEA 2QYSA 1T24A 1Q0LA 1T2CA 3VPFA 6LDHA 1LEHA 3QW2A 4AL4A 2CF6A 1H6BA 2OMEA 4MDHA 4ZRNA 5ITWA 2Q2QA 2WYUA 3KYDA 3C7CB 3VPHA 1D7OA 1DXYA 4BNUA 4MIYA 2G76A 4DWVA 1YE3A 3PJEA 4OIMA 2PNFA 1G1AA 3D4OA 3RUCA 2X0NA 2VUUA 4YWJA 7ADHA 3K2BA 2EW8A 4IINA 4YT4A 3W8FA 2X0JA 2VZ0A 3B70A 2NV6A 4NMHA 5ER9A 4I9HA 4E2WA 3KYBA 3PJGA 2WTBA 3IJPA 4KUGA 2ZB7A 2W98A 4BNXA 4ZHSA 5A03A 4OL9A 2E4AA 3BTVA 1MA0A 1YBAA 3JQEA 4AJ4A 5KJ1A 2B36A 4CLOA 3JQFA 2O4CA 3JQCA 5HBRA 3HNPA 4ALLA 2PTGA 1ONPA 5G4KA 2QW8A 3I6IA 3I9KA 3ZDFA 4MVJA 1Y5RA 3TOZA 4NJMA 3RU9A 3IUPA 3ZNQA 3ZWNA 2DVMA 4KUEA 1LLQA 1CJCA 1K6JA 1NWCA 1ZBQA 4FIZA 1TEHA 2R2GA 4PN3A 5GY7A 4C7KA 2ZTVA 1ZK3A 2NTVA 8LDHA 3H4VA 2OORA 1KVTA 3ZNPA 1CIVA 2C29D 1EBUA 1QORA 2A9FA 4D7AA 2GZ1A 3INRA 1OI7A 4NFHA 4E32A 4F46A 4XRRA 3DWFA 2YJZA 3F1KA 3HDQA 4A2CA 1IZ0A 2JD2A 3Q9NA 3CXRA 4M54A 3F3SA 3C3XA 1I2CA 1CQJA 4ALKA 1K6XA 2HSDA 5JCJD 3DMTC 4J0EA 3RBVA 1ZW1A 1PX0A 2Y1FA 3QWIA 3ABIA 4WLVA 1GYPA 3W8EA 1F8GA 2DBRA 4TVBA 1BXZA 3RAJA 4E0BA 1EMDA 3WFIA 3ZWWA 4FFNA 3MOIA 3DFZA 5KNLA 1GZ3A 1XELA 3GF4A 4BO7A 4CL3A 2JJYA 3GY0A 4L4SA 4BUCA 4DLAA 4L76A 4CQMD 1E3EA 1R15A 3SXPA 3H65A 1ZEJA 1G6KA 2PZJA 4TSKA 1LLCA 3GVHA 1DLIA 4PVDA 2V6BA 1XA0A 3QV1A 1G0OA 1O94A 1C3VA 3GZ4A 4YJGA 1BVRA 2EHDA 3RFVA 4FW8A 4GL4A 1X0XA 2VHYA 3GOHA 1NQTA 5JDCC 2O23A 1AHIA 2PH3A 3FNGA 1FDTA 1B3BA 5I8ZA 5I9NA 1JVBA 3I4CA 1QYDA 4MP6A 4CV0A 2X5KO 4R1UA 5AXCA 3A06A 2DAPA 1HTBA 3HDJA 2O48X 2C0CA 2PK3A 3V8BA 2OP0A 5KJ6A 4OXKA 4GWKA 4RVUA 4A5OA 3ZCXA 1R4NB 3MOGA 4XIYA 3X2EA 2W90A 3MJCA 3QLJA 3BTOA 5JE8A 3ONDA
chains in the Genus database with same CATH superfamily
3B1YA 3WWDA 3ZWOA 1JE0A 4KVGA 4U0KA 5AK3A 5C31A 3OHMA 5CCBA 3CUEF 2K2WA 1QX4A 1E4VA 1HLFA 4B4KA 3IELA 1RRPA 4C14A 4D81A 2VYNA 4O4HB 4ZODA 4DSZA 4BV8A 2XNCA 3E5RA 5TIIA 2PL3A 3WMFA 3UXYA 4AVYA 3D0KA 1DAHA 3Q8LA 2H4JA 3RVPA 5IM5A 2Q99A 4DM4A 1L7PA 4KTTE 1ESNA 1W9HA 5CFNA 3D43A 2YWEA 3L8GA 3WK8A 1BX3A 5F33A 3WAJA 2GAFA 2A7XA 4KJZA 2ZBDA 3SJZA 1EEXB 4J90A 4MUXA 1LUAA 4B75A 1U94A 1WOMA 3DOFA 2Z2ZA 4EVIA 1BE0A 3GZNA 3W6NA 1H8HA 1XDZA 3IRUA 1ECBA 2VF7A 4JBXA 1AM4D 4WXPA 4EW1A 2PGIA 3L7NA 1U11A 3BRWD 2IUEA 2JRCA 2DBZA 4IILA 1GCGA 3DC2A 3N2LA 2XW6A 2R9VA 1FW8A 4O4IF 4S24A 3PQEA 3VZQA 3QYAA 3P97A 5DE3A 1IXZA 4YXWA 3JAMA 3ACCA 4CPDA 3CZAA 5A02A 1PLLA 1KO5A 3KC2A 4F9EA 4PX2A 1T6ZA 3C5HA 4YONB 1WXHA 4QLAA 4WLFA 2BCJQ 3BBLA 4DXAA 3WJAA 4BE7B 1SCQA 4KLAA 3T1HB 3DBOB 1VG0B 5JADA 4M7RA 2QRLA 3JW8A 4AMUA 2YS6A 1P17A 4OKSA 1TAGA 5AW4A 4RDXA 3DBVO 3EZ9A 1B8NA 1DTEA 1E8NA 2R47A 1N2OA 5CHEA 1QOQB 1FDIA 4JHLA 4ARVA 4RA6A 2GHQA 4TL6A 2EGHA 3K31A 2I6UA 2VH5R 4QDTA 3TLZA 4B84A 4DABA 5FPQA 4QGFA 5KU1A 1G3QA 4PY2A 3G49A 1WKBA 1EXDA 2QE7A 5EQFA 4DCGA 3KOZA 3LDGA 4M36A 1BS1A 2EX1A 1Q77A 2BELA 4OV6B 2XD4A 3GRCA 1MC4A 3AILA 4ER6A 1WMAA 2O7SA 3BHNA 3PFCA 1CZNA 5SY4A 1N5IA 4KAJA 4OMDA 1OLXB 2YNMD 4OHKA 4BX2A 4RULA 4UBIA 1X9HA 4KQIA 4N5DA 4OUDA 2D7DA 1V9SA 4YRRA 3LLVA 3ZTYA 3PHIA 1L4HA 3FDZB 4R1QA 5THKA 1N2CE 3IEVA 3U5TA 1NQAO 1WR8A 1NVVR 3VYUB 1VE6A 3P0RA 4DIFA 2X9LA 4GLOA 1O08A 3X1XA 4DVGA 1Z83A 3NB0A 3QNWA 1II8A 2IEBA 3I0ZA 2BTEA 3TM5A 3OX1A 5FQNA 3G7UA 4PZUA 3DNPA 5FIUA 2BY4A 2VJQA 3LPNA 5CXSA 1FDWA 2YOGA 3EXEB 3PGVA 2C3OA 9ABPA 2C1ZA 3AKZA 2C99A 3W2FA 4LNAA 5JH7B 3KLNA 3RWBA 1CLEA 4BQPA 3EQ6A 1FRNA 4L4YA 1CW2B 4JC8A 1ZUNA 3LTNC 2OC4A 2HF9A 3F9IA 1RXYA 2XUOA 2XYQA 3DDWA 1AZSC 4XYBA 5JD5A 1YE5A 4GOXA 1OIVA 1JEYB 3LWZA 4XX0A 1QF7A 4MRRA 4QBGB 5LKRA 3EA4A 2X8LA 4KXMA 4LJAA 1Z4JA 5IDYA 3HXMA 2AI1A 2J6BA 4S2UA 1X1EA 4C0QC 5KBYA 1T26A 3Q2OA 4LHXA 3MWYW 1FIUA 1BWSA 5L3SB 5GV8A 5DP1A 2UVPB 3B6IA 4H3VA 2NO4A 1G6HA 1SA0A 1P60A 3FFAA 5EZYF 3T12A 4HVCA 3ISTA 1ZGBA 1HDZA 1MMFB 1Z8HA 3A6ZA 1H2HA 1DXHA 4AS1A 4DZTA 1HOXA 2Z58A 3T61A 4R83A 5INTA 4QTXA 3TDKA 4UM8B 2NVWA 1R0LA 2Y05A 4CM1A 1T2EA 3MMPA 4IJVA 4CEIB 2XYVA 2ZK7A 4OHVA 2FDRA 3B7GA 1EDDA 1K3TA 2HA3A 2ZSFA 1QCDA 2REQA 3IUJA 3OZVA 4RENA 1V7CA 5G1OA 5K3CA 2IWRA 3ZX5A 4Z49A 5JT1A 3BDIA 3G2HA 1F7UA 3R9IA 5FD8A 1OGYA 1GGMA 3ORRA 2WPNA 1IULA 4JBIA 5ILQA 3J7TA 5LLSA 2V7XA 3D7LA 2X86A 4OXXA 3MM4A 4JKIA 2JFXA 4G1VA 4A92A 4GOND 1OBFO 1C3LA 1GCAA 3IUSA 4L50A 5I9BA 3QG1A 2IOFK 3MAJA 2FUCA 3UMGA 1EP3B 1IN8A 3CN9A 3VU8A 3FB1A 3FSGD 2CDBA 2RHDA 4YA6A 4KMSA 2ZUFA 1QYRA 1VE7A 2YWXA 4J2HA 5T67A 3QUSA 2OECA 3C87A 5JRZA 2OXRA 2YHUA 3JD1A 1TQHA 2DFTA 2V3CC 2ZAYA 1Q95A 5AM4A 1WB5A 4IRXA 1J39A 1YS2X 2XNSA 2YY5A 3F8WA 1DC4A 3EQ2A 4U63A 5EWJB 3GRAA 5COAA 2D0PB 1PDOA 1P75A 2I33A 5DLDA 3ZJ4A 4BLUA 3WNBA 1GRCA 5HKKA 9LDBA 3VTZA 4M22A 2WP8J 1FLAA 5I6DA 2A9KA 1YCFA 3S8EA 1MNQA 4MAFA 3CWZA 4L9RA 5F9FA 2WY2D 1KMCA 2DFVA 1GUAA 3BZBA 3OEWA 3OFSA 3IT0A 7ABPA 4TQGA 2X8JB 4W6ZA 3CF6R 3FX2A 5JBNA 1Z0ZA 3TTUA 1SCJA 3FMGA 4OHYA 1OY1A 2VJOA 2W5UA 3Q5DA 1YZ3A 1D04A 4R8VA 2ZXUA 4PSVA 2C2ZA 2SECE 2W2MA 1AV7A 4JB8A 2WTNA 4MS1A 4I3HA 3TQQA 1KYYA 3N8KA 2OESA 4YMSA 4GPTA 3WLPA 4B35A 4DJ5X 4H6PA 5TEVA 1HT3A 4E31A 4Q34A 4J6FA 4L74A 4LF7B 4YCBA 4MKZA 4Y2TA 1EVEA 3LUCA 3HN7A 1E1QA 4J0IA 5E9WA 1HMYA 4IF4A 5JFTA 1EGHA 1LB1B 4KQCA 3M6MD 4QELA 2W6MA 2Z4SA 4U6SA 1R0YA 3VR5H 5T57A 3ZYZA 4KGXA 1BXKA 3PWSA 4P08A 2BSXA 3LRPA 4P4SB 4EKEA 4OB7A 1YFJA 1FPQA 1VKJA 3NYRA 4PLHA 1IQPA 1L5KA 3PFIA 1A9YA 3DFMA 1KWGA 4L5IA 2UXBB 1COZA 2P9BA 4EGQA 3GH1A 1W85B 4MGIR 4EEZA 1NQOA 2VHQA 1X1TA 1XDWA 4K46A 4KFRA 1TUBA 4M9QA 2X1LA 2VHWA 4JI4B 3KZNA 1G2IA 2I6GA 4IHAA 4XFDA 4ZAXA 1ZK4A 3CLRD 2O2GA 1WZEA 4H0NA 3UXMA 1RAIA 5KTSA 1Z37A 1GU1A 4XJVA 4WOJA 5D5PA 1UPAA 3EN0A 3SIXA 2XI4A 3MRXA 4S0ZA 3D2BA 2ODPA 1O3YA 4FXPA 4J4BA 2P30A 1DCMA 4C6TB 2R6AA 2X9GA 1Y7IA 4NR0A 4R8MA 5AWFC 3L4BC 2QN8A 1E60A 1DIOB 3D7NA 4WE3A 4WPGA 1AJEA 3AVPA 2JFWA 2OD2A 4G6ZA 2WYWA 1U6KA 3CH4B 3V9PA 4EIWA 4J7AA 3R5SA 2X58A 3UT6A 3HO6A 3IAFA 3U61B 4OA8A 1HV8A 1K6MA 1VRWA 1WQ3A 4BV3A 3EH2A 2P3QA 3EF1A 4DIDA 3LX4A 3OOWA 4B34A 1DFHA 5T4FA 3FZYA 4XZ3A 5FI1B 2Z2JA 1QF6A 1LLUA 2A1TR 4BRWA 2VHTA 2W42A 5I45A 1DXOA 3QOFA 3NXKA 3NUQA 5B5SA 4DBZA 2QUJA 3GRKA 4B47A 1H1LB 4CLXA 5JRJA 4OAPA 3UQYS 5KQLA 4RKYA 2GPTA 5EKUA 2Z8ZA 3HU5A 2QYTA 5KJ6A 1E79A 3GDWA 3D2AA 4C0AC 4CN9A 2CZQA 3R6GA 1ESEA 3F4KA 3T4EA 5A4AA 1W2GA 1H05A 2G5TA 1B7GO 1EVYA 2NGRA 2RGNA 3AIIA 3NX4A 3QU4A 4LEIA 4RK6A 1Y1RA 4YYZA 2FP3A 2XUPA 2Z9DA 4U9IS 4AURA 4EHDA 1CUXA 2GUGA 1GPMA 2EKDA 3CGGA 4LYGA 4ZYZA 3PPYA 4N0EA 1ZMOA 3I8OA 3IRVA 5REQA 3ZW7A 4C20A 1F3LA 1R18A 3ZG6A 1COWA 5B7PA 1GPBA 3P2JA 4PRKA 5TJHA 2PSEA 3D1JA 1WMFA 3S0JA 1YDFA 3UK0A 1ZC4A 1VG9B 1PU2A 1G42A 3MSXA 4O4HA 3WNCA 5EJEA 2FAXA 1MX1A 3QITA 5CX4A 1DC8A 2PV7A 3HACA 2EJWA 3UJBA 6NULA 5FUQA 5IK2D 3DO8A 3QX8A 3B1XA 3ORYA 3DULA 4MLCA 2YV3A 4NHEA 4X45A 4MAMA 4S1OA 4AP6A 4S35A 2VAVA 3UN1A 3UBTA 2B4TO 3ZY6A 1JKMA 1M0TA 1J07A 1AMOA 3IOYA 1OWLA 3CE9A 3HV0A 1PGPA 3R0VA 2ZRCA 3GJTA 1AKEA 4WOCA 1DJQA 1SD1A 3RS2A 4HWPA 2XVXA 4C22A 3U44B 4XVRA 2NM0A 1KMHB 3CLUD 4EFDA 1QQBA 3KWJA 4EO4A 1CRZA 3L4SO 1K9SA 4GH5A 1EGAA 3SHTA 1JIQA 3F49S 2PQ2A 4OHFA 4A0SA 3JWIA 1JW9B 1W75A 1GNRA 2DHEA 4HGNA 3A9VA 2PGNA 3OEEA 3E9MA 1OXVA 4QNRA 1C1DB 5A04A 3Q85A 2ZYHA 1KEWA 3IR6A 1J2TA 1NMYA 2HUPA 4RXMA 3VR6A 2GWRA 2RDMA 5B7QA 4C4TA 4RKQA 5CEFA 1X7GA 4AJNA 2HYIC 4UVEA 1ORIA 3F7OA 1Z2CA 1GT6A 1WUIS 5F1PA 3BEDA 4NKRA 4ZOLA 3PZBA 2GEVA 3RSHA 1KFCB 2AFHE 4UVIA 4TX1A 3SZMA 5IC4A 4G0QA 1X70A 1VPTA 1RWPA 4M1KA 2AQKA 5IM4A 4AIRA 1BN7A 3GFFA 4Z4FA 1L5RA 4Y2SA 1SBHA 2BMJA 2ZTSA 3PUXA 1Q7EA 4Q3NA 1PFUA 5F76A 4F72A 1K75A 3BWXA 5DYTA 1FNNA 5CXXA 4DA8A 1NRWA 1HL7A 3ZLJA 4MVJF 4OOEA 3C3KA 1L5LA 1GCUA 3AV3A 4WXHA 4YFYA 4CU5A 2FWPA 4F60A 2Q9UA 5D84A 1F1JA 2JDIA 3EVGA 2R6CA 2VPQA 2PLWA 3PHLA 2O5EA 2QPTA 2AW3A 1XRPA 1OLXA 1LK7A 3A9UA 1YDMA 4OXQA 4ZQCB 5FT9A 4B0OA 5HMLA 5LNK6 4L9WA 1TC1A 3ACDA 3NTVA 4MV8A 3U31A 1BKSB 3CMCO 3TW0A 3FDZA 4EY3A 4PQEA 4KX5A 4WXMA 3VNAA 4ATNA 1U7DA 2WVJA 5JWHA 3B3GA 3WNZA 4WTOA 1JTFA 2DLCX 3NZEA 1N6OA 1CV2A 1RYEA 5CYPA 3VPCA 4YI3A 1S3FA 1T2DA 1U3WA 2ZS9A 5AP9A 3LF2A 4UNQA 2IBMA 1OKKD 1E2LA 1U2PA 2ZJ1A 1YQXA 1CS4C 2QLJA 5FNVB 2YICA 3NAQA 3NBMA 1KZGB 2Q1UA 3ZWYA 5JH7A 5B6PA 5ARCA 1Z5NA 4M1MA 3B3JA 3I2GA 1YZQA 4NNJA 1Z6ZA 3JASB 1P4JA 1FY2A 1M8GA 2ZPTX 3H8JA 3HKBB 5LQUA 1WQ4A 3I6BA 1E7MA 1RP1A 2CWDA 3O95A 4M6WB 4PZDA 4FYVA 1QRAA 2IHUA 3T9AA 4C0XA 4FB4A 2QVCA 3FPBA 5ALOA 4R1SA 4D79A 4MQFB 4BN0A 2QV7A 4N7RA 4P4UA 2L19A 2VPTA 3BGSA 3W5SA 2PAFA 3V8QA 1FP1D 3A6EA 1HE3A 2WIKA 3S1AB 4YJ2F 3TIXB 2ZVDA 4CUZA 4HT3B 5BQFA 4F4JA 4JDPA 2W2PA 1KJNA 1W1WA 2UVPA 2P79A 3D4PA 5L3SA 3NKLA 3L1IA 1FQKA 1QYVA 3U4HA 3LFTA 3WNDA 3ZHVA 4QGAA 4M1ZA 3TH5A 4K9SA 1DKQA 3H9UA 1G66A 2MT9A 2I7VA 4FMBB 1U0FA 1UBMS 1C4WA 3ZNOA 4FCWA 6CHYA 2F1RA 4PNHA 1SC6A 1PUIA 4JI3B 1NBWB 3WIVA 2H1SA 4IG4A 3RRFA 2PEZA 2FOLA 3KNZA 5KOYA 1GNLA 1N1MA 3GVIA 4QTUB 3HJRA 4UBKA 1DXQA 3RRYA 4FFMA 1DJNA 3CH6A 1Q57A 4XGQA 4GR9A 4GQAA 3IV7A 2L18A 4X6XA 5F73A 5KZMB 3K70D 3F47A 1HGXA 1EZ4A 4IJQA 3OUUA 3HI6A 1OVMA 4TLAA 4I4NA 1JPNA 2BFNA 4GAEA 3JY6A 2PYIA 2WIGA 3AHFA 4JP1A 1H1DA 4MCJA 1FLDA 2VC2B 4M2LA 2CLFB 2SNIE 1XE3A 3RV4A 3TBFA 1HDYA 2VQ3A 1MVNA 2XOKD 3GCGA 5FNZA 1Q84A 4C6RA 3E18A 4OBWA 4B7XA 1M2NA 4LBWA 4LHEA 2AN5A 1RFGE 2Z9BA 4CM8B 4DNXA 1IONA 4X8LA 5KKAA 2P9YA 5IAOA 3NHFA 5K99A 1M2WA 2HRRA 4G63A 4CMCA 3F6SA 2XUDA 1JZSA 4QUHA 3KVNA 3HMQA 4HNUA 2YIMA 4X54A 1VI2A 3H7AA 3M6IA 4BCBA 4BNDA 1O87A 1Q0SA 5EWJA 3G7SA 8ATCA 3RARA 1GTMA 4GX2A 1Z07A 2VDPB 2XDQB 3OZ7A 4RLFA 3PS9A 4Q1AA 3WYEA 3H13A 1A69A 1MDFA 2JFUA 3I5MA 4UOZA 3AR5A 4JLSA 4P58A 4BMOB 1FYEA 1X7HA 2J32A 3ZV3A 1U0SY 2NO7A 4P22A 4NZYA 2YWGA 2X8JA 3ND5A 5C7YA 4ZN6A 2IZ7A 1IB0A 3AB7A 5AI8A 1LK0A 5FOXA 4DE5A 4G9GA 3AP2A 4H4DA 4KP7A 5KJFA 5C53B 2ZIXB 1V48A 4QPJC 4BNFA 3IIMA 1L7NA 3L8YA 2I91A 5LNK1 2FN9A 2BKVA 1NRIA 3GNSA 4YO8A 5EHXA 4WY5A 3VYTB 5FXMA 3DMNA 4CF5A 1AKYA 4S1TA 4YFVA 1K2WA 2XKKA 4DIBA 1MGPA 4Q0MA 2YCLA 4MKFA 4TKLA 1I3KA 2CHQA 4BFVA 3GLKA 4EGFA 1JMYA 1H8ED 3FPLA 3WA7A 3TSCA 1N25A 3EPJA 3PUIA 3QVWA 2HGSA 2XDWA 4P4SA 2IXBA 2LXNA 3C3MA 4BV9A 2GK3A 3WTBA 1H69A 2P2YA 4UDYX 5DTEA 2GPYA 1O9BA 1NKTA 2EWVA 3BA1A 4MW4A 5DX0A 1IXRC 3M6XA 2RGEA 2XMQA 1W85A 4XB2A 5DH9A 5KJCA 4I8IA 4I9NA 5JDCA 1PVOA 5IVIA 3EASA 4EJ6A 4GR5A 1IZZA 4YN3A 1GCOA 2EFYA 4Q03A 3SXJA 4H7PA 5IANA 2ZB3A 3P45A 4UHHA 1V9CA 3OJCA 1EVZA 4U6QA 4WJKB 3WBKA 4EA9A 3O26A 4L8GA 5JCXA 1KDTA 4FS3A 1F0KA 2OAEA 3N75A 4FZJA 1I4TD 1WL8A 1GU0A 3BG5A 3MIZA 4A8HA 4C6TA 5JTTA 2GXAA 3IDSA 2RH5A 3DUFB 3ON5A 4WSOA 1D6MA 2A58A 8ADHA 5KINB 5IZCA 1ZLXA 1WCWA 5TGZA 2OAGA 2QRZA 5DHSA 1ORWA 1HDRA 1NVTA 3A6DA 1C4XA 3GRUA 1BDHA 1KNQA 1EEHA 1QGZA 2VYQA 4M9CA 2PH5A 2AC4A 1HG0A 3VSDA 2ZSJA 3C97A 3QHAA 1FFSA 1DKNA 1TOAA 3ST7A 3W9YA 3HU2A 1QF9A 5K0CA 3BPSA 3AUKA 4BLPA 3HR8A 3ENZA 2VQ6A 3NC0C 2IH4A 4O1IA 3N0TA 1H1LA 2GKGA 1EFDN 3PA6A 4XQ9A 1XNGA 2VNKA 5FTWA 2RGXA 4M37A 1FTQA 2J7KA 3W3AH 3UUWA 5EQDA 1QRUA 4KQGA 3QHQA 3UFXB 3OTOB 1XK6A 2JIMA 4HNHA 2W6NA 3ICWA 3GUZA 1M6YA 1D3AA 2LE0A 1A5TA 5CMLA 1L4MA 1NLUA 1ZC3A 2O3UA 2MOKA 3MCTA 4IJMA 4PR3A 4WHMA 1SOUA 2HAEA 2WD9A 2H6EA 3AM5A 1Z26A 4N5IX 1ZCAA 5SYAA 4OX9Y 1I5RA 4BFLA 3FY4A 3WLMA 1XZCA 1HPLA 1PW7A 2HWKA 1A2KC 3WWPA 1JQEA 2PD3A 1W5BA 2XGOA 1NUUA 1KAMA 3C2QA 3KXKA 2EZ8A 1S6YA 2AMVA 4FFRA 4HNGA 2JNWA 3O73A 3H2ZA 3QH4A 4R6WA 2Q5IA 3HABA 3M1AA 4HWOA 1IVNA 4XD2A 5DTQA 2YKGA 1NBME 3OFNA 2C20A 4E5DA 3U44A 5AICA 3GR6A 5AUPB 2XUHA 2CK3A 1JU9A 5EXDA 4O02B 3BJRA 2H2FA 3E9EA 1T13A 2BHRA 1SKUA 1LSSA 3T7RA 5KPJA 4BFTA 3I1JA 3LW7A 2IW3A 1CQWA 3BWDD 3MGCA 5DHFA 1EPUA 1RYNA 4HADA 3SJCA 1UXKA 5CA1B 1B14A 1HRKA 2MDTA 1C1DA 1T9BA 1X3LA 2GVZC 3FOWA 4K28A 4YJ3A 1P91A 1PFVA 3G9TA 3AVQA 4QTZA 2XE7A 1VL6A 1BE8A 2E49A 3CUYA 3P9KA 4YECA 4JUCA 5G0SA 2O2SA 4CT4B 5IARA 3V2GA 5HS4A 4IM7A 2JFOA 2PO7A 4AG5A 1XVIA 3FNIA 2GFIA 4N3CA 1VE5A 3C3JA 4BEVA 1S7GA 4E3WA 4BO6A 1QO0D 3IVAA 3CJQA 3NHAA 1PD0A 3O21A 4FNAA 4MI1A 1P33A 2AE2A 2M6SA 2FPPB 2Q5EA 3DKPA 4CIXA 3BXZA 2LIPA 3DBLB 1J0BA 3OPXA 1QYXA 2Q7DA 4OU5A 4B7UA 1ODKA 2B82A 2C4VA 1A4UA 2HQBA 3A05A 2R8PA 3LDUA 5AVOA 4Q24A 2GRJA 4YT5A 4BX9A 4ZT7A 5IDQA 1VJTA 1RRGA 3NV7A 1EX1A 2A35A 4ITVA 4R2KA 3PI6A 3NTUA 2V65A 1UFRA 3O8DA 3E61A 4GMXA 4MUGA 1O57A 3U7RA 1F48A 1K7CA 1RXIA 2O0MA 3BE4A 2ZCVA 1UDWA 1VG8A 4LJ4A 4Q9KA 4X60A 4PW0A 1UXGA 5CK5A 1DKUA 4HB0A 5JMWA 1TAQA 4M55A 3ROKA 3NEPX 2GXSA 4Y30A 1OWNA 1FSFA 1FJXA 3MRTA 4YDQA 4OGGA 3LY7A 3PGLA 4TV8F 4WZAB 5DBOA 4FOOA 4B74A 4BO8A 4KPEC 4UM9B 4FBGA 4OH1A 3TL6A 4I4TB 2QTWB 4HYQA 5FNVA 3TVYA 3WDMA 4CL8A 4E12A 5BV8A 3Q8WA 1H9CA 5DNCA 2ZTUA 3JASA 3WL7A 1ILWA 1XCMA 4P82A 2A5GA 1WVIA 3HKBA 1EUDA 1KMQA 5EP3A 1AZTA 3TW4A 4M6WA 4XM1A 1NQWA 4M8LA 5A4JA 4EBFA 2ZVPX 4RBNA 5B4TA 1LX7A 2O1WA 5ICMA 1FL9A 3QVXA 4MQFA 3N53A 4QOFA 5CTJA 2CLIB 3KETA 3IQWA 4RL6A 4S1VA 4K3VA 2YW9A 5KDLA 1ZOIA 2O2EA 1EFHA 4YJDA 4EUKA 1A9RA 1XXLA 2ZYRA 3ELUA 1MX5A 4G1FA 2W70A 1XHLA 2C2KA 4GBED 4GM0A 4QEZA 4AECA 5BSEA 5BUQA 3GI1A 5BVGB 1L7BA 3DCIA 1T43A 2CC2A 4DW8A 3HO8A 3AIOA 2OB2A 1YDGA 4O5OA 3QRWA 1NVWQ 1PF7E 4YCNA 4WFKA 4OKIA 4J6EA 1W0KA 1PV1A 2K6GA 3AKEA 3HA2A 1U3FA 2PU7A 3LCCA 3MLBA 1OWOA 3PIRA 4IIUA 4Q66C 4RD6A 2G6BA 3OT4A 3TCXB 1DAMA 2PRIA 2P77A 2HIAA 2VNJA 4DLUA 3KPWA 4JA2A 1JILA 1RRCA 2R1TB 3DDCA 3FWZA 2G1JA 2V97A 3P0EA 1FK8A 2QJOA 1T5HX 2K87A 4V0ME 3PITA 4OHOA 1MGOA 1LCIA 3KYIB 3UJPA 4X91A 5AVYA 1EXWA 2BTQA 4KVZA 1XZKA 1H42A 1NE7A 2A0FA 1K6IA 2PWAA 2P1RA 3HJNA 3KQVA 1F9EA 1ZOPA 2X2OA 3HP7A 1YZVA 3HXKA 1HLPA 3S2IA 1G63A 1II9A 4TL9A 3T0GA 4IMPA 1ODFA 1E5XA 1IRIA 5LUBA 5KYXB 2ATIA 2W8ZA 4BTVA 4V0KA 1FTGA 3UFBA 3DEAA 2WM8A 4JWKA 5I5GA 1MRSA 1NJFA 5EIWA 5C8DA 5KYUB 1RZRA 2YIJA 2J5KA 3WYFA 4YMGA 1JBKA 3KX2A 3CZ9A 2Y0PA 2G70A 2WWXA 5BSMA 5I7RA 5KWVA 2E21A 4K0KB 1UFVA 2BAGA 1DC3A 1USWA 4OHRA 1E98A 4IDOA 4Y8VA 5C1IA 2JH3A 5IRCD 1M3SA 1VZ2A 4J4TA 1P2VA 4Q9AA 3PSAA 5C51B 1MH9A 3L1VA 4QDZA 1AQJA 2FG5A 2XDQA 4AY6A 4C4XA 4KNYA 1K5PA 2R7KA 5I7UA 4P0PB 3Q11A 1SURA 1XZHA 1SBNE 2O7VA 1AQUA 2VRCA 1DUIA 2FN3A 3NP7A 5CURA 1O95C 3WWEA 4RLHA 3ZWMA 1R0BA 3B53X 2P8JA 3D6VA 2P9QA 3FFBA 3NNDA 3SHFA 3T4XA 5AI5A 4MJ3A 1PTJC 4J8PA 2ZIXA 3HEAA 4FE3A 3O3CA 3P7MA 4UMDA 2XSZA 5FWDA 1KO7A 1NLFA 2HY7A 1J4AA 1VCIA 4B6QA 3NU1A 5TF0A 3WO0A 1BJRE 3W9SA 3WLIA 2BTOA 4CE6A 1DJOA 1AU9A 4H1VA 1U98A 4HD8A 2PCLA 2JH9A 4JUFA 5FV4A 3RTCA 1JL3A 4IIGA 3ROZA 3KJHA 3QUAA 2VYVA 4X94A 1Z0FA 3QELB 4CLHA 2WSSD 2R6DA 3IEUA 2UDPA 3COZA 3K1JA 1X6VA 5CA0F 3OCZA 2GEBA 2D13A 3GNTA 4MARA 1VRVA 1JFSA 1G3UA 2ZDQA 5JYEA 3IOEA 3OF2A 1XRMA 4YC7A 4AJPA 3PV0A 1MW9X 4U7GA 5CD1A 1ZIPA 1U6JA 1ZO8A 3GLTA 4DLXA 1GZ6A 3F97A 2V9PA 3SC4A 5JCJA 2BFFA 2IPLA 1EX7A 2O9JA 1UC4B 2VTDA 4GPIB 2PX4A 4QPCA 1RXEA 4BEBA 4MI9A 7MDHA 4NYJQ 4CUJA 2D8AA 2FZGA 2WUEA 2JJ2D 3KD2A 4CGYA 2P9TA 4G9BA 2Y4OA 2WKPA 2GEDA 5CFMA 3VDRA 2Q6IA 4S3MA 5A0FA 1TB4A 3HUEA 4GWLA 1E5QA 1W46A 3GLUA 4LCEA 3HJUA 4WUTA 4ZO9A 5AXBA 1ZUIA 1P2BA 4U39A 3V55A 3PXCX 4XWOA 2O0JA 4DA7A 3W1EA 4YRBA 4C7BA 4YAUA 3NVDA 5DX8A 1JKXA 1G8AA 1POWA 3O83A 3SF0A 5K8VA 1D5CA 3C3EA 1GL3A 5GOTA 3G2KA 1N7IA 3FFXA 3OEHA 5JBIA 5JSQA 3AGPA 2AIRA 3RPEA 2EKBA 1F0NA 3GJXC 4AJJA 3OLZA 1TM3E 3RC7A 1HQYE 1JSXA 1HX7A 2D1TA 2FE4A 3FWNA 3KEFA 4GNRA 2CEKA 1NXQA 1XQWA 2JAOA 2Y1CA 3L3BA 5FLKA 3WGHA 4EUSA 4WBNB 4X1IB 1B1AA 5K3SA 2D1SA 1XMVA 4RHFA 1WM1A 2PXHA 3NG1A 5LQSA 1V26A 1R5JA 4CLDA 4C7MA 1ZSNA 2O3QA 4G97A 2J7PA 4MKGA 2FWNA 4A82A 5CDUA 5MN4A 2G06A 2Q2NA 3N87A 3K20A 2ZRKA 8OHMA 2C2XA 2V5UA 3BILA 1M5UA 1R3DA 2PR2A 3OZAA 3WQSB 5A5EA 3LX5A 1CF2O 4JL5A 3DO5A 3UFXA 1A50B 2PLRA 4Y9UA 1OYOA 5JANA 4XD7A 1L7AA 2QL7A 1K86A 1N5MA 1SOMA 4HQRA 1UDRA 4MRSA 4NPCA 3C1OA 5KTRA 1VJRA 2XNHA 2IXDA 1GLNA 3BXPA 4NG4A 1UXIA 2BZ0A 3A3KA 3ER6A 3PQ3A 4OHWA 4OIFA 2IYFA 3D4IA 3VVLA 3TMYA 5IAGA 1HK7A 4L73A 1ATIA 4G4SP 5EP1A 1JHVA 3GDHA 4FGSA 4CNBA 2QDKA 2JLWA 1LNSA 5F7OA 3GT3A 2CXOA 1FVOA 1U3GA 2C5FA 4YAFA 1SXQA 3RVRA 2EG5A 3AUYA 2I4TA 2YJ4A 5LA6F 4IP0A 4A0GA 2B98A 3GA0A 4R3NA 1RP7A 2P2NA 3I3SR 5CJPA 3LVBA 3K1YA 1NN3A 1A27A 4MS4B 4PAMA 2QWXA 2WJZB 1F2DA 3AERB 4PNPA 4F8JA 1LBEA 2PKEA 4JQCA 4JT2A 4UE3S 1TKRA 1B2RA 2CNOA 2IFTA 2XUFA 2OCXA 2C8JA 4NFSA 5IMBA 4B4OA 5JXJA 1LVGA 1QIJA 3RU3A 3CT4A 2O8EB 4LN1A 3WVNA 2NNWB 1L6RA 1PJSA 1WU8A 4HB4A 4XFJA 3UB3A 3L7CA 4JLAA 3H0KA 3QVOA 2R8YA 4FDTA 3RUDA 2VBCA 1CJKC 2QM3A 3KBBA 5JNSA 5JY6A 4LRYA 5CA1A 5AVJA 2GD1O 3CONA 5SICE 4HP8A 3LXMA 4C6SA 2WE7A 3U7QA 2RGAA 3FHJA 4B43A 1YS7A 4M21A 3QKWA 2ETVA 2PYZA 4QFDA 4RFVA 4JI5B 5KI6A 5AVSA 2O7QA 3OX4A 3V34A 2OWEA 2PHZA 4GBMA 2ACWA 5IJWA 4O1MA 2P78A 2X7XA 1IN1A 5LPNA 1ZD8A 4PGMA 3RUHA 3ILHA 5D3QA 1RI5A 1YMVA 4BMPB 4WBSA 4EF5A 3D4NA 2BEJA 2FXIA 2C2OA 1P77A 2PUTA 4WGGA 1RQRA 2ZUCA 1U90A 4TN5A 2R6ZA 3L6OO 4ZRDA 1EVJA 2DR0A 2R66A 2WZCA 1NVMB 2ZSKA 4ZVPA 3G9QA 1T8WA 2FPPA 1KEZA 3P26A 3TX6A 3W6OA 5JEDA 5JMTA 1JLRA 4R54A 3DBLA 3OLWA 4EG8A 3FPAA 3H9BA 1STOA 4IIVA 1AUQA 2ZSUA 2OY0A 1K92A 2ZT5A 3P2EA 2D59A 4IIJA 2QZSA 1OZGA 2A57A 3K9QO 3LPMA 4TZTA 5FB3A 5IAEA 5KNBA 3OECA 2PWYA 3CG4A 2EV9A 1DX9A 3H2SA 2YDXA 3Q3JB 1P39A 4FK8A 3U3MA 2HV8A 2YWRA 5G02A 4KW7A 5BNFA 1GARA 4DMCA 1QU3A 5LQJA 1VXRA 2IJGX 1GADO 2JEOA 1EA5A 3HZZA 2EQBA 3MCVA 3SJUA 1I0ZA 2M9MA 3V9AA 4A0HA 5KQGA 5ILOA 4AX8A 4N6NA 1YVDA 1PI3A 2QJWA 2FGJA 3QPCA 1T15A 1QKIA 3G1UA 3PCTA 5K2MA 4EBBA 1C9NA 3EUEA 3A36A 1K0UA 3PZRA 1YWGO 4FQ5A 1DCFA 2JZOA 3TOSA 4HXYA 3OZXA 5I8PA 3ZZ1A 4MUMA 2I34A 2DM6A 3DMRA 5L7TA 4B83A 1ECPA 3MJVA 1JZTA 4JJ4A 2XRZA 3DT8A 3NIFB 4GOJA 4P5EA 4L16A 2ZEJA 3F8SA 4RSMA 3W90A 1N34B 4GKVA 2H7XA 2FJUA 2F3UA 1N0UA 2E1PA 3FGPA 3CF0A 5DV9A 5LC1A 5I9LA 3K70C 4BMVA 1F6WA 1C0LA 4B76A 2IQ5A 3HHEA 3V4LA 3KK0A 1EP9A 2QKYA 3GK3A 4PQFA 3QTBA 4RCZA 4BN5A 2PZ8A 2VDVE 2WMOB 3TTVA 4HQOA 3D9QX 1PQYA 1JWAB 2ENWA 4ARAA 4UFNA 4R71A 2A0WA 4I8DA 2R97A 4LA4A 3B1ZA 2EF1A 5C32A 1Q92A 1VSUA 5FR1A 4A0FA 3TG2A 2JFBA 3S1SA 4ND5A 2ZYTX 2HBZA 3LT2A 4FDLA 4IXMA 4JELA 5DTIA 4PAQA 3M9XA 1N92A 3MTEA 1SK9A 1FP2A 4UUOA 1N2BA 2VYND 4GXTA 4L1KA 4WA8A 1CPYA 3ROPA 4F8EA 4F93B 2BSQA 4N47A 5C37A 3DEIA 2R1TA 3K53A 5GADl 1ZJWA 1PTKA 1DQSA 3BE6A 1TJ4A 2JL1A 5FADA 4IDBA 4DMFA 5F2NA 1WETA 4CKWB 2Y71A 2FP4B 5FUYA 1ORDA 3SEQA 2G9QA 3BMQB 1I1OA 3CVOA 3SICE 1U0EA 4UU7A 3EA5A 3K8OE 4MRMB 5TS2A 4I2VA 4RW0A 2A8YA 2NPFA 4A8JC 4EUHA 5D7NA 2AZTA 4PGFA 5KYXA 2O4UX 4KQWA 3LSTA 3SGLA 4YXWD 4R9RA 1XTIA 4FE7A 1LPNA 2EKQA 2V0CA 4HLUC 5DYNA 4NCBA 1M9NA 4R1PA 4GLBA 5CJJA 3I9MA 4KQEA 4PZEA 5DI9A 3SYNA 5ES3A 2OXFA 3W8DA 5G3YA 1WAMA 1L5MA 4WACA 4GVXA 1XNQB 3V8VA 3VR2A 4PIPA 2ES4A 1SUSA 3KR2A 4NHOA 4DFDA 3BXFA 4LI3X 3ZCSA 2YFKA 4PEVA 1ATZA 1G7TA 1QWSA 1M7BA 2KLHA 2PKYX 3O4HA 3DCNA 3KL4A 3ERCA 1BC5A 3A6FA 5FORA 5LBIA 4C7VA 1KORA 1LGYA 3HMKA 4IIBA 2X0IA 4P34A 3RC2A 5K51A 3CNNA 1DIRA 3CS3A 4F2GA 3D6HA 3UMMA 1H2ZA 2ADMA 3L01A 4W99A 1KYTA 2HQOA 3LT4A 2MYTA 4PX5A 5EUQB 1PWHA 4UHKA 4YIKA 1QM5A 3RTDA 3PEFA 1DU4A 5IKEA 3E0XA 3HP1A 1N8KA 2XTJA 3ANSA 4BFYA 1Z7WA 4RUKA 2WWTA 5LMZA 5CH3A 1DX6A 2VP4A 2XTZA 4RPLA 3PC4A 4KBGA 3DE3X 5CH8A 4G81A 1X1AA 2VJKA 1K66A 1KTIA 3KO8A 4NZOA 4UHEA 4YB8A 2NUAB 1R4MB 2NU7B 4Z9YA 1V39A 2IW1A 2JIBA 4ZHQA 5C80A 1QHXA 2CHUA 3QELA 1TIBA 2XNDD 4ZZ1A 1L5FA 5C81A 3GA7A 1MFZA 4HX2A 1GG2A 5C7IO 4HY3A 4J1NA 3MTAA 4YRFA 1JAHA 4EY7A 3M4XA 4RJLA 2H2WA 3ADPA 4NCIA 2BWJA 4V1CI 2OHFA 1T9DA 2G07A 4Z5XA 2VRNA 2GZAA 5KYWB 3B1VA 3HCFA 1SQFA 1SXGA 3BF7A 3P2OA 1VIYA 3W06A 1W29A 3IHKA 4HUJA 5ITSA 4TYWA 2YC2C 1VJDA 3I0MA 4HMPA 6ADHA 1JLLA 2QP4A 5EJFA 3TW6A 1V0JA 1YS4A 4JCCA 4FSHA 1ENOA 2IRWA 4YAWA 4TQ9A 1YCHA 2H2HA 4OGWA 4PF1A 5CM2Z 2IDKA 2LVBA 3AF5A 4JU9A 1ZMBA 5BV7A 1SEPA 2B0JA 4MW7A 5TDHA 2HN9A 4DILA 2CHVA 1CERA 1AURA 4L51A 3EF0A 3ZY4A 4YRGA 5CIWA 3AX6A 2IPAB 2JK1A 3GGJA 3TUIC 5ARDA 4YYEA 3ZZUA 1KJWA 1YBFA 4QYSA 4ID3A 1NATA 2J3MA 1PR1A 3E8MA 3HXQA 2ZB2A 2X5NA 2CL5A 4BQFA 2NZ8A 4K0RA 4HQ6A 1I94B 1ZIDA 1DNPA 3ZCUA 5A4DA 4BBZA 2Q3CA 3FVRA 4EL5A 2QQEA 4ZAGA 4ZYTA 3NC4A 1L8QA 3M34A 1NOKA 3WDLA 2MR5A 1N2IA 5TMEA 2OXIA 1XEAA 4C2BA 3BM5A 5BW8A 1GTSA 3HUUA 3QXHA 5HIIA 1JE1A 3JRNA 1I1NA 3DMHA 2CDNA 3UCEA 3QK7A 1CRLA 5AD1A 1U0LA 5FRDA 4YRPA 3A4MA 3FF1A 1YIOA 5AJUA 2G3YA 3KFLA 4WBXC 4E03A 4WBNA 2ZZNA 3W5UA 3Q6MA 1XEXB 1NSFA 4X1IA 5KDOA 4CCWA 3Q1KA 4LE0A 5KSPA 3X1KA 2EBHX 3HL4A 4HNVA 1FMFA 3EGDB 1X2BA 2X7JA 3L1JA 1TPYA 3LKBA 1RWMA 1ZRMA 4Y6SA 2VCHA 1O6GA 5K2OA 2R4QA 4O2AF 2GFHA 1BTOA 1T9HA 4B44A 2JAPA 1QP7A 1KBQA 2VHUA 2WOOA 3BMXA 1R9MA 2QTTA 2H06A 3VGJA 3MJTA 4RESA 3RFCA 1VLQA 3SR3A 4U7DA 3LVFO 4LWPA 1VSBA 4X62B 3KAKA 2WQ6A 4RPKA 3V8PA 3FSEA 2DBQA 1OR8A 1FX0B 1U7HA 5BWOA 2QVYX 1KS2A 1U1DA 2E82A 4EGAA 1FYXA 4X20B 3KSAC 4P7GA 3UUGA 3VR0A 4DWWA 4X7BA 3B6JA 5KDDA 5BY2A 2HLDA 2VFAA 5DGHA 2R8OA 1KY5A 3L4BA 4O2BF 1L5NA 3VMFA 1OFVA 2X2PA 3E1GA 3Q87B 4ABYA 3A6HA 2VXCA 3CF4G 3ZOKA 3E9YA 4HDRB 5FUBA 3C1AA 5M7EA 4E33A 1SQ0A 3IIEA 2RG7A 1ONOA 4BAUA 4HDMB 2V6IA 5DBEX 3K0KA 1T8PA 4G23A 1QHEA 4P5PA 3T4UA 5HKKD 2WWHA 2Z3WA 2JLQA 3ETLA 4X1KA 5TGTA 3BDAA 2UYOA 5A05A 1Z2AA 5HF8A 4MS4A 4DWJA 2AJBA 5JO9A 5DNEA 2Z6VA 4ZJZA 3AERA 1VCOA