2A94A

Structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 114
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a94A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2a94A02
4D44A 5TLSA 3FR7A 2J3IA 3QWBA 2YFQA 3FNEA 2NU9A 2D5AA 1HZJA 2WWRA 4U5QA 4YRDA 4RPKA 3WWZA 2DC1A 2PD4A 4TKMA 1NWHA 2HK8A 4OSOA 5G0VA 4R68A 4X54A 5MDHA 2PA3A 4J1SA 1U9JA 2O3UA 4DQVA 3K2BA 2Z1MA 4AG3A 4W7HA 2VHYA 4IGEA 3RFVA 1GFSA 4F6CA 2DM6A 2IXAA 2BHLA 2GRAA 2YY7A 3K31A 3NAQA 1MC5A 3GVCA 3FR8A 2BFMA 3I52A 3OIGA 4QX6A 3WMWA 1E3WA 4H16A 1EMDA 2X6TA 5CAEA 2VWGA 4J1NA 3W8EA 4DXHA 1X13A 3ONFA 2JKVA 3UHAA 1D3AA 2HMSA 2YZ7A 4CM8A 3DFUA 5TT1A 3SC4A 2GUGA 4LCJA 1PGOA 4CLRB 3NJ8A 2W2KB 1ZJZA 4UUMA 3PTZA 4A73A 2FWMX 1T2CA 5A9TA 3X2FA 1Q0LA 4BOYA 2P2SA 5TJ9A 4QT0A 3WGGA 4DC0A 4PRLA 5AYVA 3U3XA 4M89A 3EAGA 3DTYA 2P68A 4J9UE 4CM9A 2C0CA 2VYVA 4Y98A 1Z75A 1A72A 4DVJA 4Y9DA 1W8DA 3EZLA 1HKUA 4BNWA 3JQ9A 1ADBA 5JPIA 1ZH8A 1MV8A 1XHLA 3AU9A 1M66A 2C29D 4MO2A 3HFSA 1RYEA 5I7VA 3DHNA 3DMTA 5EMHA 2F1KA 1EE9A 2B83A 1T2EA 4EI2A 4FC6A 3ZHXA 3KBOA 1DIAA 4BO7A 1B15A 4EITA 3EUWA 2H9IA 1SB9A 2PR2A 5F3RA 3DOOA 1M2WA 1QV7A 2O3JA 1QYVA 3G3EA 3P19A 3MJEA 4L4SA 2CD9A 1M75A 3COSA 1DEHA 4O63O 4PLFA 3OF2A 3CH6A 4IBOA 1E3WB 3WSWA 1HRDA 5TF4A 3VDRA 3U0BA 4BGIA 1PZHA 4Y8VA 1NR7A 3OJFA 4S1VA 4G2NA 4WLVA 4EJMA 1VC2A 1YB5A 2GN8A 1UAGA 2I3GA 2Q2QA 4K6FA 1XELA 2BMAA 2J5RA 1GCUA 5A9SA 3AOGA 2WYWA 4INAA 4XEHA 3OFSA 3OA0A 4GX0A 1NVMB 3OECA 3GLQA 3GVXA 4L9RA 3JQ8B 3PZBA 3RC1A 4CV1A 3L6DA 3PYXA 2PGDA 3ETGA 3LSYA 2NADA 2CVOA 1F0YA 1U3VA 3OICA 4KQXA 4WOKA 4YA6A 5CG1A 4BKRA 5BSHA 3WX0A 2VWHA 1KY4A 3GEDA 1NP3A 4JP3A 5TNXA 5GY7A 4O6VA 3K30A 4EW6A 4WCFC 4EGFA 2GGSA 3HUDA 1ZBQA 5IFLA 1KC3A 1QLJA 2NUAA 2FPIA 2R6JA 4MP8A 2WTBA 3ZNOA 1I24A 1K6JA 3MZ0A 3DAPA 4TQGA 3VAZA 5TX7A 1MP0A 2JFGA 3LU1A 1GYQA 1YQDA 1IZ0A 1ENOA 3EC7A 4R01A 3VKVA 1PIWA 4TROA 1TT5A 4CM7A 1ZZEA 1E7QA 4CM5A 4Z0PA 3I9NA 3F5SA 1LSOA 4P4LA 3BAZA 4LVCA 2DUWA 3R3SA 5DP1A 1ORRA 3TZ6A 4OIMA 1WDLA 1HWYA 2Y1OA 5JE8A 4JGBA 2QX7A 3AM3A 4Q39A 8LDHA 5ICMA 3ZU5A 4UVDA 4ZN6A 1ZK3A 3N74A 3RUCA 3H65A 4IDBA 1QMGA 5JDIA 1JW9B 3GAFA 1ZFNA 4L0QA 5LC1A 1NVTA 1GQQA 4J0FA 3UCFA 2J5QA 4HV4A 1I3MA 1LUAA 1ZK4A 2NV6A 4JQCA 3UKOA 2Q50A 5IDXA 1HZZA 3NT5A 5JAQA 4Z3KA 5ADHA 1B16A 1I2BA 4G65A 4R3WA 4FW8A 1BW9A 5KTKA 3H9UA 5L7WA 4MVJH 4GX2A 2X9VA 2D2IA 4CMBA 4FR5A 4OYRA 3MEQA 3L6OO 4W82A 4EUHA 5TJHA 2X7HA 4I5EA 4ZQGA 2UV8A 4IJVA 4R1UA 4YT5A 3JQAD 3T4XA 3TZQA 4BGEA 1HYGA 1RPNA 4P38A 3GT0A 4J4HA 4XIYA 2PH3A 3GGPA 1RM0A 3QLJA 4RPGA 5BSGA 2NTNA 4FFRA 1AGNA 3H4VA 3WXBA 1H2HA 2Q2VA 4CM4B 2B36A 4IIVA 4NU5A 3UGKA 4ID9A 4M86A 2FOIA 4D46A 4LCEA 1H5QA 4YWJA 5KKCA 4E12A 1NXQA 4IJUA 1HLDA 2X5JO 1YWGO 4AJNA 4QO8A 3OQBA 2AE2A 2D3TA 4G81A 3ZWYA 5JFOA 1KEUA 5IN4A 4BO0A 4E2ZA 3RBXA 5EINA 3L0DA 5A3JA 3FNHA 2YQ4A 1OC4A 5AXDA 1KETA 1SNYA 2X22A 4PG8A 4HNHA 5DOVA 5TS3A 3PPIA 2BI7A 4R9SA 3EGOA 1ADFA 3WYEA 1E6WA 5DCWA 1ZK1A 2UVDA 2GD1O 1DDOA 4B7UA 1R16A 1N9GA 3IKTA 5JAMA 4KUHA 5CDTA 3AFNA 3DO5A 4I9UA 2VQ3A 4DLLA 1IYZA 3GQVA 1E3JA 2GPTA 5CDUA 1Y81A 4EBFA 3CMMA 2VZ8A 2XXBA 2Q99A 3ZWAA 5BQFA 1LRKA 4WE3A 3WJAA 1N5DA 4DGSA 5C7IO 1LDGA 4TVOA 3C1OA 1E5LA 5T8KC 3TRIA 2O2YA 1NX6A 3ZGYA 1CIVA 5HRUA 2YW9A 4KUGA 4E2WA 3TDKA 4O0LA 4JBIA 3TNLA 4RL6A 3JV7A 4L4XA 5DCUA 4JJGA 4Q3NA 3GGOA 5A04A 1RWBA 1ISMA 2Q4EA 4IINA 1LA2A 2V6FA 4Q9NA 5THQA 5JMWA 4BQRA 4R54A 4CL8A 1NQ5A 2RHCA 3U4HA 3HADA 3AI3A 3NT4A 3PP8A 1H9AA 4BNKA 2Y1CA 4IDAA 1HDRA 2AEMA 3G1TA 5BSEA 1V3VA 2VNAA 1OZAA 2A4KA 4GAEA 5IXYA 3GDFA 4Z6KA 1KIFA 1PTJA 1H2BA 2RBEA 3ITKA 3Q9UA 4RPJA 5L4SA 3O4RA 3E5MA 4YPOA 3GNQA 3V1UA 4XDYA 4ZRNA 3D64A 2WSBA 2W90A 1JDJA 1S7CA 4E33A 3BTSA 1IY8A 3I83A 1E3IA 4LMRA 4MKZA 1PZEA 5K0ZA 5C7OO 3AUAA 4CLOA 3ASUA 4I08A 4KWHA 4AJIA 1K6IA 4ITUA 4DBVO 4GX5A 1PWZA 2F00A 1R66A 3F1LA 3ZU3A 4ZRMA 1B14A 3PIDA 2VTEA 3BHMA 3O03A 2ZJ1A 4MVJE 2Y0DA 3FWZA 1IUKA 1M6HA 4J49A 3Q9NA 3M2TA 2OXIA 1M67A 1XKQA 4M54A 3RC7A 3S1LA 5B4TA 4M49A 1G0OA 2H6EA 1LLUA 3I9JA 4NR0A 5CFZA 4XDZA 2PKQO 3C7DB 4DPKA 3ENKA 4J16A 3KETA 1LXCA 2X0IA 4RJTA 1ISGA 4GBJA 5DT9A 5TT0A 4ALIA 3GR6A 4WEOA 3W8DA 5AXCA 4HWKA 4OGWA 3UAGA 5HM8A 3LF1A 4MPDA 1VE9A 3LYLA 2NVWA 2VRCA 2AG5A 2Y1DA 1GAEO 1KY5A 3DMYA 1HE3A 5HS6A 3TZCA 2GN6A 1PEDA 1MG5A 1UZLA 2NU7A 2V7PA 4FC7A 1WNTA 4OMUA 1DC4A 1LLDA 1O95A 1YL7A 1SEPA 2Q1TA 5COBA 1EUDA 3ROQA 1CEQA 2J8ZA 3ZWVA 4U7WA 2DVMA 4J43A 2OO5A 1I30A 1PGQA 1Q7BA 4D45A 2HK9A 1YGYA 3ADOA 3DZIA 4J90A 4JIGA 1O9BA 5T5QA 1SOVA 1U8XX 4GX1A 1ENYA 2CDCA 3BTUA 4S3MA 1U4SA 3D7LA 1NR1A 3F6YA 3IMFA 4P8RA 1NHWA 1Z74A 3HSKA 4JROA 1U2DA 3ZHBA 5BT9A 1F12A 3G79A 1SAYA 2DBRA 2ZQYA 2PKRA 2WE7A 2FRDA 2FZEA 2VUUA 3OJEA 2VN8A 2PWZA 4RVHA 3RFTA 3R6DA 2OMEA 1GY8A 3V8BA 3WQRA 4CV2A 4DQXA 4CR7A 4HX5A 2FY8A 2NVBA 4WJZA 3MJTA 4WECA 1ZEMA 2BD0A 3IQDB 4PLVA 3ST7A 3V5NA 3OSUA 5JY1A 2I3AA 4PLHA 2QRJA 1YL5A 4NPCA 1IPFA 4B7XA 1GR0A 3BMCB 4XYBA 1PJ3A 2PZJA 3WNQA 3RC9A 1EZ4A 3GMDA 2IYOA 3E8XA 2BLLA 5TSDA 5IJZA 2O2SA 4OH1A 1YVEI 5KVSA 1D4FA 1DHTA 1DXYA 2Y66A 1MG0A 4CM9D 3GY0A 1JKFA 4XGKA 3RUDA 1VL0A 3A14A 4UAGA 3AFMA 3WMXA 1XCBA 2QG4A 4MIOA 4XB2A 1EEHA 1PJ4A 1T2DA 3O38A 4PLCA 4DREA 4YR9A 1WXDA 1HL3A 3IL2A 5L7YA 4FFNA 4E5MA 1R0LA 4FPXA 4IMPA 2OUIA 5T64A 2WYUA 3B1KA 4RV9A 1QR6A 5CP8A 5C3MA 2ET6A 1ONOA 3ZU2A 4FJ2A 2R00C 4H7PA 5B4VA 4UVGA 2P5YA 3QWAA 3U5TA 2JCVA 2YYYA 1GZ4A 3F1KA 2IEDA 3DMTC 4R3NA 5TRTA 2PH5A 3D3WA 3JQBA 4D79A 1GCOA 3PZRA 1O6ZA 2AQKA 2GZ1A 2JHFA 4B79A 1U28A 2BFOA 2E4AA 1BXZA 3UICA 4IMRA 2EW2A 4YB8A 3GZNA 5DCYA 4IDGA 4II3A 3KYCA 2EV9A 1YB1A 4E13A 1SO8A 2YQ5A 1GUFA 3E5RA 4J6FA 4MVJF 4YQYA 4L8VA 3PQFA 2HJRA 3ZH2A 3NT2A 4WCFA 4PZEA 3Q2IA 4WLUA 4CLOB 3TL3A 1A27A 4J2OA 5HWSA 3LT2A 2VOEA 2X58A 2X8LA 4DMLA 2H5LA 3QIVA 3ZWPA 2ZATA 2CVZA 4HKTA 1V6AA 1R4NB 1Y6JA 1OBFO 1HETA 4EJ0A 1R6DA 1DOHA 4WEQA 1N2SA 4XA8A 3JD4A 2O50A 3RBZA 4YJHB 4C7KA 4B4WA 5U1PA 1YJ8A 4IGFA 4ILKA 5JMPA 4BNMA 3JQBC 4ALKA 1X0VA 1JA9A 3OIFA 3RU9A 1HT0A 1MUUA 4JNKA 1FK8A 4QEDA 3E48A 4BKQA 1WP4A 3FD8A 3M1LA 1RKXA 2DPHA 3NDJA 5FI3A 4PLPA 2A94A 3JQEA 4OSPA 2NTVA 1MFPA 1Q7CA 3JCZA 5DDIP 1NHGA 5C37A 3DBRA 3IC5A 3QE3A 5U4QA 1YH3A 3PFFA 3KUXA 5C7LO 3TF5A 2J6IA 3BMQB 2VZ9A 4I9NA 4IDDA 3JQ8A 4YT4A 1XIVA 5TGDA 5BNTA 1CETA 5L51A 3UFXA 1I32A 3DZGA 4K28A 5F5NA 4N54A 2ZCVA 3SJ7A 3AWDA 3OJOA 4J4BA 3JQFA 3V2GA 3GHHA 3TZKA 3KSUA 2P9GA 4I1IA 5JAZA 2QW8A 3PQDA 4NNJA 2IE0A 3N58A 1HDYA 1U5AA 1JTVA 2DU8A 4R1SA 3Q0EA 4XGIA 5I8ZA 5I8WA 3GN2A 1PJTA 1T4BA 4EEZA 1IZ9A 1J5PA 5AXBA 3NV9A 2CVQA 2Q49A 5KJ1A 4BNIA 4XIJA 4WNIA 5IN5A 4CMKA 4J9VA 1AN9A 4N5LA 4FGWA 5KWEA 2HRZA 5B12A 2EKLA 3PDUA 4ND3A 1LQTA 3GFBA 4NI5A 4FFMA 4NBRA 1E1LA 2Y05A 3JD0A 2A9FA 2NU8A 3PJFA 3CSDA 3Q11A 1HF3A 1S6YA 1XG5A 3D4NA 4ROSA 1HEUA 4LSWA 4J1TA 3GRKA 4WLEA 3C3XA 1JWAB 1NQTA 2Y0EA 3H9EO 5FFFA 1ZJYA 3I3OA 3FPLA 4CLXA 4C7JA 1Z45A 2GERA 1KEVA 1A7KA 4XYLA 1NQAO 5DN9A 2EKQA 4YJGA 1A5ZA 3WGYA 3KTDA 2FP4A 1YB4A 1BRMA 1Q7GA 2VHXA 3ONDA 2HQ1A 3FHLA 4A2CA 2P9EA 1D1SA 2PK3A 3KYBA 2HU2A 3BTOA 1VM6A 2AG8A 4BNJA 5L53A 3VPHA 1GPDG 1QXSA 1Y9AA 4Q3BA 1GU7A 1IULA 1KVRA 2YHIA 2AQ8A 1CERA 3BHJA 3PXXA 5T57A 3JD1A 3PLNA 3RJ9A 1E6UA 2HK7A 4LRTB 3E03A 1M6WA 2AQIA 1ID1A 3LT4A 3Q3CA 2AXQA 2PLAA 2WD7A 2NWQA 4PRKA 1P77A 4RF2A 4RPLA 1VPDA 3QA9A 1EK5A 4OHUA 4J1QA 2C2YA 4YAKA 2PZLA 1P1RA 2QYTA 3VH3A 4R41A 3LT0A 4JX8A 1C1XB 2WE8A 4W6ZA 4JXKA 1P0CA 2QRKA 3TQHA 3OEWA 4QQRA 2IZZA 3GVPA 1E7WA 2O7SA 3OQ1A 1A7AA 1ISJA 1P9LA 4DYVA 2G82A 4A27A 4EUEA 4RGBA 1DIBA 3RI3A 1IHXA 3BMNB 4GGPA 2BGMA 4MVJI 3I1JA 3FSRA 2FMUA 3WICA 2Y93A 4NDNE 4UUOA 2O7QA 3RKUA 5FF9A 3NKLA 4OJNA 2VWPA 5A4DA 3EZYA 4CMEA 2D5CA 4JBHA 1J6UA 4RQTA 3ZV4A 1ZEJA 4XRRA 4YTEA 3PDJA 2XF8A 2O4CA 2ZYDA 4CMGA 1ZMOA 4LW8A 2C5EA 3ROPA 3K73O 1DHRA 1ZK2A 1K3TA 1EE2A 5A5EA 4MVJM 4CPDA 3W6UA 4BGVA 3B6ZA 3W4IA 4WKGA 4XQ9A 1V9LA 1PJLA 3C1TA 3IOYA 3N7UA 3KO8A 4IIUA 4PLTA 4CLRA 4AJEA 1UAYA 3JQGA 1T4DA 3E82A 4YXFA 2JAHA 4IQ8A 2IZ1A 4CQMD 1K0UA 3HDQA 3GUCA 1P1HA 1XA0A 4OM8A 4Z0TA 1PU2A 5DNAA 1I01A 3HNPA 4TZKA 1FJHA 3MTJA 2Y99A 1DRVA 4D41A 1W0CA 1C1DA 2FR0A 3PHHA 4AICA 1PJCA 2HAEA 4BO4A 1KVQA 1TT5B 4OKNA 5HA5A 1L7DA 4FS3A 1YXMA 2Y0CA 1DFHA 3PVZA 2GN9A 3LQFA 1NYTA 3TOZA 1B8UA 4UUPA 1E7RA 3RFXA 3NTQA 2Q1SA 4CMIB 4E5KA 1C3VA 2JFHA 3CMCO 3ZWMA 5KVCA 4D42A 2B35A 3LC7O 3VHRA 5I7SA 3A1NA 4NMHA 1PL8A 3AM4A 5ES3A 4XGNA 4ZVVA 4EDFA 3DBVO 3K8ZA 4NIMA 4YJHA 4FBGA 1AHIA 4WUVA 5EN4A 1GEEA 5JDCC 4CLEA 4XB1A 3GNSA 3IDSA 4R1TA 1H94A 4GI2A 3PHGA 4CQMB 2VYVD 3ZNNA 1GDHA 4E30A 3W4JA 5KNLA 2GCGA 3NGXA 3NJ4A 4LSMA 1T1SA 4RORA 3PHJA 4UEOA 2ZYGA 4KDEA 1D1TA 4Q3CA 1JKIA 2DPGA 4BNNA 4FD3A 1K6XA 2VHZA 4PG5A 4IXTA 2JD2A 3NUGA 4RVUA 4DIOA 3GF4A 2X0JA 3BIOA 4AJ4A 3HWRA 1TA4A 4R1NA 5DF1A 1E1NA 4WGGA 4MOWA 1ZUD1 4HY3A 4NFYA 3D5TA 2Y1GA 1DAOA 4P4GA 4GMGA 4GWGA 1UXKA 1EVIA 1ARZA 3ZHZA 4ZQEA 1O0SA 4BNVA 3DR3A 3ZI0A 5A02A 3FCOA 3WS7A 3QY9A 2ZTMA 1DAPA 3WLEA 4IJWA 1VRWA 5JO0A 2VYNA 1VKNA 1ZSVA 3OJ0A 4ZICA 3ADPA 1U3UA 4NK4A 2Q4BA 4XJTA 1HE5A 3C7CB 1DFGA 3PLRA 1YQXA 1DRWA 3O8QA 2P4HX 5A05A 4M87A 4W9NC 2B0JA 1YRLA 1TI7A 2ZIZA 1QSGA 5FYDA 3BZUA 2VT2A 4YJGB 1RM5A 3QWFA 4W7IA 3SLKA 3LF2A 1NAIA 2IZ0A 1QYCA 3PHLA 1UDAA 4AJ1A 2Q3EA 4M8SA 5JS6A 1W73A 3DHYA 1KS9A 2X9NA 2GO1A 2GZ3A 4RZIA 4XWYA 1X0XA 3VZSA 1HDXA 1EVJA 3WJ7A 2GNAA 1DFIA 6LDHA 3PHIA 4YQZA 1WMAA 1MA0A 5F5LA 5DULA 3LLSA 3K9QO 3RUHA 4NJMB 3OIDA 3ZWNA 1XU9A 4RVFA 3DAFA 3QVTA 4TRMA 2GF2A 4BQPA 3G17A 2YFHA 3E18A 5L4NA 1DC5A 1J4AA 2B4QA 4FB5A 3SEFA 2NU6A 3KOUA 4KQWA 3I23A 1DBVO 4DLBA 3JYPA 3INGA 3D4OA 4Y67A 2AEFA 1YJQA 1UZMA 1JQBA 2CDAA 5CPFA 1LI4A 3GPIA 4XQGA 2X0RA 3ANLA 3KLPX 3WIDA 4YAGA 2OP1A 4NJOA 4EYEA 1UXGA 1TLTA 1B26A 2FSVA 4RF3A 1I0ZA 2O3SA 1C0KA 1MFZA 3UW3A 4XYGA 4YRBA 1WLYA 4PG6A 5BNIA 2UAGA 1C0LA 3VC7A 2HMWA 4O5OA 4OQZA 1P31A 4KZPA 2WDZA 5EIOA 4OXYA 3TL2A 1XGKA 3TJRA 1PL6A 1LSJA 2VUTA 3LT1A 4BMNA 1D7OA 3CINA 1EQ2A 4OAQA 4DPMA 3DFZA 2C54A 1B2LA 1HXHA 2DQ4A 3I9KA 2EG9A 1L1FA 2RCYA 3IJPA 1GADO 1DLIA 4DLAA 1UJMA 4UVIA 3WDSA 3H5NA 4J7CA 3HJAA 3HB4X 5A9SB 5H83A 3AM5A 4DPLA 2EP7A 1HSOA 2WMDA 3MJCA 4NHEA 4XKJA 3VZQA 3S2EA 3JYNA 3I9OA 4GMFA 1U2GA 1BWSA 4TRRA 2LDBA 3LDHA 1QKIA 1PGPA 3F9IA 1OC2A 3U49A 5A5FA 1VKOA 3RU7A 2VZ0A 1QYDA 1QORA 4GSLA 3V2HA 3U4DA 4R5HA 4A10A 2G0TA 2Z1NA 1RM4A 4DYDA 1BXKA 4NBUA 1O89A 5THKA 4BKPA 3SVTA 3EMKA 2AHRA 4AJOA 3SBOA 1IL0A 4FN4A 1LJ8A 3HN7A 4JJFA 1E3LA 1YDEA 3DDNA 3IKVA 4MIYA 1NPYA 3OBBA 2BELA 3U4IA 2AW5A 5IDWA 4MKXA 3HE3A 5TQVA 5K6AC 3ENNA 1X7DA 1PSDA 4E21A 3GC6A 1GL3A 3FBTA 1Y5RA 4BV8A 5TIIA 2SCUA 1ZK0A 4IQGA 2WJPA 2QZ9A 3AK4A 4NG5A 2C59A 4KTVE 4PG7A 4UVHA 5JDCA 3INRA 1RYDA 3I9MA 4JCOA 4F3YA 1SPXA 1CDOA 3E9QA 3QWHA 1CYDA 2DFVA 4ZU3A 3B1JA 1JVBA 1X15A 2C82A 2J3KA 4LMPA 1UP4A 3V2UA 1KVSA 3KZVA 4OOFA 3JD3A 3ZHYA 2IDZA 2E6UX 4CV3A 1VLLA 3F4BA 1NASA 1YBAA 4B4UA 1V35A 1V8BA 2GDZA 2CF6A 3BMNA 5L45A 1H6DA 2CSUA 2NACA 3C24A 3JYLA 3R0IA 4ZA2A 3A9WA 4CQLB 1C0PA 5ER6A 1X7HA 2WYVA 1I2ZA 3U4CA 3SJUA 1B0AA 1C1DB 1PGJA 1Y5MA 3TFQA 3C7AA 4P22A 4BO6A 1LSUA 3AY7A 1WZEA 4GPD1 4F6LA 4A03A 3M6IA 1HLPA 1HDZA 3K96A 4ZJUA 3VPGA 4EZBA 4GGOA 1MB4A 3DXFA 5I9LA 4R4JA 1PQPA 4HFRA 3UN1A 5CPBA 3EW7A 4MIEA 1A9ZA 2VRCD 3IP1A 1NBOA 4DUPA 3QWIA 1OOEA 4DIBA 1VJTA 4UVEA 3EVNA 5T8KA 1HDOA 1UZNA 1ULUA 3W6ZA 5IDQA 3GK3A 1YBMA 4CODB 1J49A 1ZVMA 5IZCA 5G4KA 3Q2KA 5JW6A 1Z7EA 3X2EA 2PGJA 3MWEB 5B4UA 3D3WB 1IOLA 2PV7A 2O3RA 1IHYA 4ZQHA 4QTZA 5JYEA 4CQMA 3QQPA 4NFHA 5T6BA 4XQCA 2YJZA 3RUEA 3AI1A 2AA3A 5HBRA 5JC1A 4JJIA 5TC4A 1YS4A 1UH5A 1QG6A 4NBTA 1BDBA 1ONNA 2O3QA 2UYYA 3RC2A 3OH8A 2VYND 2P5UA 2G17A 3IUPA 3UOGA 4BO3A 1FDUA 1YOVA 3NDIA 1YL6A 4ZQBA 3TZHA 2E49A 4JP2A 4RQUA 1QLHA 4YAJA 1GTMA 2RH4A 1I2CA 5F21A 3TN7A 3LC1O 4TZTA 1YE3A 1G6KA 1OFGA 4XQEA 1HE2A 1XEAA 1PX0A 2XAAA 1TB4A 2X1HA 4NFSA 4BUCA 2WD7B 4ZGWA 2C20A 1DO8A 1LC3A 4HFNA 5LDGA 2JHGA 1Q0QA 5JBIA 1O94A 4CR6A 2IEBA 2H1SA 4YVFA 5I9MA 4BB5A 4BO5A 6ADHA 1N8KA 1I10A 4WASA 3E1KA 3H6KA 5CDGA 1W4ZA 7MDHA 4FCCA 3ZW8A 1I8TA 1PWXA 2HO5A 4Q3AA 4BO2A 4BNLA 4D0RA 2B5VA 2V6GA 4ZQFA 1KBZA 5KOIA 2J3HA 1F06A 3AW9A 4WOJA 4OO3A 2I65A 4MP6A 5KJCA 3E9MA 4AL4A 4MKRA 1OI7A 5A3VA 2DBQA 5T67A 4CMEC 4CMJA 3GA0A 3ZCXA 1PZFA 3FBGA 1NWCA 1K89A 3DBHB 3VTFA 1I33A 9LDTA 1LU9A 2NQ8A 3ZNQA 3MJ4A 5L9AA 4EEXA 4UUNA 2VWQA 3RKRA 2HKIA 4K26A 2CNBA 4J7XA 5AQ1A 3V1TC 1M76A 1LNQA 3JSAA 1R4MA 4RDIA 4FFOA 2V65A 3MJVA 1LLCA 1U7HA 3INTA 1WZIA 4XR4A 4NBVA 4NK5A 3ZV3A 3KLMX 4CR8A 3K2EA 3AI2A 2OHXA 2Q1UA 1DIRA 4ND4A 2DTXA 2RHRA 2EHDA 3QHAA 3SXPA 4CM6A 1ISFA 4FQ8A 1IB6A 1YQGA 3NGLA 3I6QA 3PIIA 4FJ0A 5CEFA 1E92A 1LC0A 3KEOA 1N7HA 3K6JA 4XJSA 1UR5A 4GH5A 4D7AA 3NX4A 1KYQA 3G1UA 3WTBA 1FMCA 4RF4A 2GSDA 4E6PA 2D0IA 1ZSNA 3GHYA 3PWZA 4PZCA 2EEZA 4YEDA 3E9NA 1CQJA 5GZ3A 1P3DA 5AOVA 1H9BA 5I9NA 4U0JA 1Z7BA 3ETEA 3GEGA 4I5DA 3LLVA 4JK3A 1PJBA 2AE1A 4BNTA 3A4VA 1FF9A 3B1FA 3FWNA 4XX0A 2B69A 3S2GA 3U62A 2DT5A 2CF5A 4BMVA 1PJ2A 3DBRB 4J91A 3VOSA 2IXBA 3BHIA 1Y1PA 4G5HA 1F14A 4IDCA 4MVJG 3DZBA 4HBGA 2PD6A 2FR1A 5KKAA 4O59O 3CPSA 2ZTUA 3FI9A 4N5NA 5G4LA 4A7PA 1P1IA 2EGGA 2R00A 3K5PA 3O8QB 4E4YA 5IZCC 1LQUA 2H63A 3RUFA 5ILGA 4YT2A 3GZ4A 4NQZA 1FDVA 2HLPA 2CFCA 3KB6A 3RJ5A 4L4RA 4F45A 4I5GA 1GYRA 4TMFA 4DMMA 4RPHA 3QRWA 1J0XO 4BNXA 2VUSA 4U6SA 4XCVA 4OOEA 4E3ZA 1HE4A 3NRCA 4Z9FA 5JO9A 1B8VA 1PGNA 4YYZA 2Q46A 1SB8A 1U5CA 3TOXA 2J3JA 3GH3A 1N9GB 5JCJA 1VJ0A 2ZB7A 5A06A 1B7GO 1LLQA 1WPQA 2B37A 3CE6A 5CDYA 2OOSA 3WWYA 2BH9A 4IPTA 1R4MB 4B3HA 2W4QA 4J7UA 4LN1A 1E7YA 4PVDA 1DIGA 2VOJA 3ZV5A 4IM7A 1YO6A 3UCXA 1Y9EA 2C2XA 4Z9XA 3ZZNA 1XLTA 2Q2WA 2HUNA 3CTMA 2NVUA 1UXJA 4CUKA 4DWVA 3DONA 1U3WA 4BGUA 3ITDA 1HYHA 5JC8A 1R0SA 3ABIA 1PR3A 4ND2A 3OP4A 1NPDA 3I5MA 4WLNA 1G0NA 2OZPA 7ADHA 5HTOA 1E3EA 1EK6A 1JVSA 1UXIA 3CZMA 4XYEA 4TKLA 4YRAA 4II2A 5JSFA 4GLOA 3DWFA 3LC2O 2W98A 1PJQA 1ULSA 5IG2A 4IXWA 2HRBA 4KP7A 1OAAA 3PRJA 4R5MA 5ITWA 1XQ1A 3RUAA 5JXWA 3WIEA 2JFFA 3TSCA 1NVGA 4A0SA 2EKPA 3DTTA 3HDHA 5A03A 1IPEA 4R16A 3DHEA 1HSZA 3H9GA 1UDCA 4J2HA 4N5MA 4U6QA 3WB9A 2BFPA 3RIHA 2AQHA 4HNGA 4KMSA 5C5IA 1Y8QA 1MX3A 4NU6A 2XPCA 4GSKA 4BHTA 5CEJA 1ENPA 4LVUA 4N18A 2O48X 3KYDB 4IDFA 3O9ZA 3WQQA 3W8FA 4WCFB 4K9DA 2HMUA 1A4IA 4GQAA 3FNGA 1UXHA 1A9YA 2YV3A 5G0TA 3JQ6A 4B3IA 1O8CA 4Y6SA 4E5PA 1U3TA 2X9GA 3T7EA 3QW2A 4I5FA 3JQCA 1O5IA 2BFAA 1V3TA 4OXKA 2Y1FA 1Z82A 9LDBA 2HMTA 1R15A 3D3EA 2DTDA 5JCXA 2QYSA 3OETA 1VSUA 2DAPA 1D8AA 2EERA 3GVHA 3DAGA 5JNLA 3WG9A 3VTZA 3BMOA 3DBLA 2HJSA 1WDMA 4UEJA 5KVVA 3WFIA 1JWBB 1C0IA 4KUEA 4HFMA 3CZRA 3WGIA 2G5CA 5COQA 4CUJA 4Z9YA 3AU8A 1PS9A 5FI5A 1AE1A 1I3KA 1Z6ZA 4UULA 1GQYA 4QECA 4AJPA 4BO9A 3JYQA 4JLWA 2ZB4A 1X1TA 3S55A 1OMOA 2O3TA 1BG6A 1P1KA 4PN3A 4PIVA 2NVUB 1R12A 1CF2O 3B70A 1EBFA 1NPTO 1I36A 1T26A 2FPGA 2ZYAA 5G0WA 3NTRA 2FN7A 3JQ7B 4MVJA 2NQTA 5L3ZA 3RQSA 3K92A 2RH8A 3E6AA 3KYCB 1U4OA 2BGKA 2I9PA 5A9RA 1VL6A 3GFGA 2TMDA 3AY6A 1MXFA 5JY6A 3D1LA 3UUWA 2HDHA 1VI2A 3C8MA 4KTTE 2YDYA 2C5AA 4B7CA 1A4UA 1QYXA 2QZZA 3KYDA 3PEFA 4KOAA 1KC1A 1PJSA 3G0OA 1GUYA 3TWOA 1JN0A 5IZ4A 4QFDA 5MGBA 1MLDA 2JD0A 2QQ5A 5L7TA 5HS4A 1Y8QB 1G1AA 3GPDG 3GAZA 1ZIDA 4D3SA 4E5YA 4ALNA 3OEYA 1AXEA 1FXSA 2HSDA 4LISA 2C7GA 2DUUA 3Q6IA 3DZFA 4AVYA 2VHVA 1VL8A 3R3JA 4U8GA 3PYLA 1NFQA 3D5QA 3U09A 3PFWO 4IQ0A 4WNCA 3PI7A 5L95A 3PYMA 3H2ZA 4PLYA 4XYMA 1L7EA 3EHEA 2B4TO 1I3LA 3IIEA 1E5QA 3OA2A 4R9RA 3S2IA 4WCDA 5EQDA 4FFPA 5BNFA 1YDWA 3BMCA 3GNTA 1NAHA 4RO0A 4CMHA 4IDEA 2V6MA 1PQWA 3IUSA 5LCXA 4NZ9A 1JAYA 2BI8A 1DRUA 3QVXA 5JCJD 1Q1NA 1CJCA 3L9XA 4D43A 5CHEA 1BXGB 1SEVA 3VKUA 4CLHA 4J3FA 4CMIA 1HDGO 4MJLA 3GMSA 4QSMA 4KDFA 1V3UA 2GYYA 3HQ4O 3QVWA 4M55A 4BNYA 4CMAA 4E32A 2EW8A 2UDPA 3OQ6A 4FSHA 2Z95A 3CKYA 3KRTA 1E77A 3VH4A 3WYBA 4RCVA 3L9WA 3QVSA 3F3SA 4A26A 4YJFB 1XWFA 1ZNQO 1AUPA 2OBYA 2VNSA 4IUYA 4RZHA 1JKJA 5IDYA 1YONA 5CDSA 2NLOA 5EPOA 2BGLA 3JQDA 3ZNPA 3PWKA 4GKVA 2W2LA 2JD1A 3WNVA 4CL3A 1FDSA 1T2FA 3KHUA 4FFLA 1EUZA 1LRJA 1Q0HA 3QJ5A 3BMQA 3G49A 1HYEA 1NQOA 3RSHA 5F1KA 4PGFA 1BVRA 1EFLA 1B3BA 1PQUA 2P4QA 4Q3EA 2PGLA 2B5WA 3JTMA 4CMCA 4TSKA 2DKNA 3RASA 2ZB3A 3DC2A 4L74A 3JQFC 2FZWA 4GLLA 5DZSA 3I4CA 4HADA 5IXSA 3FPCA 3EK2A 2PZMA 3P7MA 3ZV6A 3BTVA 1U8FO 5KJFA 3DZHA 1DC3A 1UDBA 3L6EA 1QYWA 1NFRA 2BF7A 3ZWBA 3V1YA 1DSSG 4RLSA 1Q2XA 1EDOA 2PY6A 3BXXA 3AOEC 4MINA 3DOJA 4DQUA 5G4KB 5FWNA 1ZSYA 2OFPA 3EVTA 3NYWA 3FTPA 1ISHA 3MOGA 5KIAA 1EUCA 2V6BA 1IE3A 2BKAA 2JL1A 3TPCA 4QXMA 4P4NA 1XQ6A 3DB2A 3EDMA 4FIZA 4ALJA 1LDEA 3QVOA 1U7TA 2JCXA 3OM9A 3FNFA 2OBNA 5DOZA 2O4UX 1QRRA 1C1XA 4WK6A 4XD2A 4MVJP 4PLZA 5GZ6A 5BSFA 2CY0A 3BYZA 3ORFA 4AJLA 4BKOA 3B20A 2X5OA 4ESOA 3WOHA 3KSDO 2DBVO 1LEHA 1GQ2A 4URFA 4DA9A 2Y68A 3OJLA 3ZWWA 1NTOA 1ZXBA 3DEYX 3H7AA 4W9NA 3H5RA 2IYPA 4WLFA 5U9CA 2E37A 5A1TA 1RJWA 1NNUA 1ZCJA 4ND1A 3JQAA 4CLDA 1EDZA 4PCVA 1ZO8A 3VPXA 4YCAA 3CEAA 4CV0A 3CXRA 1R0KA 4AJ2A 4YAIA 4RDHA 3BA1A 3A28A 3DBHA 3JD2A 4IZIA 3IS3A 4CJXA 4H3VA 1XU7A 3CIFA 3FRJA 3ULKA 3UXYA 3VVCA 4PVCA 3STHA 2ZTVA 1GEGA 1KEPA 1BHSA 5AXAA 5KJEA 3WLFA 3KM0A 3KSZO 4PLWA 2LDXA 5AVOA 3R1IA 4FJ1A 4LGVA 2IODA 2EXXA 1PS0A 3IP3A 2I67A 1LTHR 1CWUA 4HFJA 1E1KA 3ETDA 2JJYA 2A35A 3EY4A 2WEKA 1KOLA 1KEWA 2PFGA 3ICCA 3AOEA 5G2OA 1E3SA 3WGTA 2GR9A 1ADCA 3VDQA 3GZNB 3HN2A 4BL5A 5K9ZA 3WSVA 3JYOA 5JLAA 5I7FA 2WM3A 3HFGA 2PD3A 2OORA 2ZK7A 3VZPA 1BXGA 4JBGA 4DRYA 4U0KA 2I66A 5GMOA 1KVTA 3UH1A 4YT8A 1WAMA 3GOHA 5I7EA 3H3JA 5COAA 5KVQA 1K2WA 4DBZA 1CQIA 2XXJA 3ANNA 4MVJD 2GLXA 2GN4A 1F17A 3QSGA 4IS2A 5DP2A 1ZKMA 3FTNA 2PZKA 1K5HA 1PL7A 2YHIB 3GG9A 4HXYA 3PK0A 2R2GA 3L4BA 2GASA 4J4TA 4A5OA 5GZ1A 1JLLA 1TVEA 2E82A 3MWDB 1QP8A 3ZU4A 3WQSB 3OMLA 1MC4A 3VH1A 1SBYA 1Y8RA 4BNHA 3AY3A 4OL9A 4TRNA 4BNFA 2UUOA 5EJ2A 1LRLA 2FHSA 4FGSA 3GVIA 4BV9A 4LK3A 3ZDFA 1T25A 1LSSA 1TXGA 4WLOA 3VZRA 1YBVA 5IF3A 4B3JA 1GZ6A 1N7GA 1Z73A 1LBEA 3ANMA 3VVBA 3M2PA 1TEHA 1ISIA 1AXGA 2EJWA 3GEMA 2OGUA 4PG4A 2W8ZA 3KVOA 3D0OA 3RCBA 1C14A 3MTGA 1EBUA 4MP3A 4N7RA 5LDHA 2Z5LA 1VJ1A 1W6UA 1BVUA 1GV1A 2YHUA 3A06A 4AFNA 1N1GA 3GGGA 1YKFA 1R4NA 1Y7TA 2ZTLA 3ASVA 4CM3A 3DZJA 4GVLA 4RVDA 3H2SA 5DBIA 3LK7A 1UP7A 2CDBA 3RROA 1DLJA 1SCUA 4OQYA 2RAFA 2VHWA 2ZJ0A 5EERA 2W2KA 2Q45A 4BIIA 4DC1A 2RIRA 3L4SO 1JU9A 4C4OA 4FOSA 5G0SA 3FN4A 4AJKA 2BRUA 4BB6A 4E5NA 3S2FA 2PTGA 1JAXA 2EF1A 3DL2A 4TRJA 2NNLD 2J5KA 4XZ3A 1E7SA 3F4LA 4B4VA 5KCZA 2P9CA 3ROKA 4ALMA 1EQUA 1QV6A 4WPGA 4HP8A 3WTCA 1E1MA 5ENDA 3H3FA 4RVSA 2EWMA 2Y1EA 3WGQA 2E48A 4QFCA 3KXDA 2W2LD 5B37A 4W4TA 5ITVA 1E6EA 2D59A 3F46A 4BKUA 3S8MA 2NM0A 4BNZA 5F1OA 1MGOA 4O1MA 5JAIA 3I6IA 3ZWXA 1CRWG 2GZ2A 1X7GA 2WD8A 4L75A 1E7MA 2I5PO 1NFFA 3NEPX 1ENZA 2DFDA 3KEQA 4XR9A 3AJRA 3VH2A 5IAAA 2ZKLA 3GDOA 3O26A 4Q3DA 4GWKA 3HZZA 3P5SA 1VSVA 1NM5A 1Y8RB 2PNFA 3HB5X 1DJNA 2AMFA 3C1AA 2X0NA 4IJKA 4TWRA 2FPPA 4UEKA 3WR5A 4FDAA 5BR7A 3NDRA 1P45A 1P74A 2X86A 3D4PA 1DIHA 4UREA 2YV2A 1T1RA 2JCYA 5JDIC 4J0EA 3PJEA 2EIHA 2HMVA 3HG7A 3GDGA 5G0UA 3L4BC 1PS8A 2YDXA 4LRSB 2A92A 2FSSA 1GV0A 2YUTA 3WBBA 5EESA 3HDYA 4D3DA 1PR9A 2G76A 5ICSA 3TFOA 1GUZA 3GUYA 4HUJA 4QUKA 4L76A 1LX6A 3DQPA 4W99A 4MDHA 4BMSA 2YV1A 3QV1A 1X1EA 1E0DA 1P1FA 1XSEA 3GN1A 3JQ7A 3ROMA 3RVDA 2VCYA 1LDBA 4E2XA 1GYPA 5EQFA 3I9LA 4BNUA 4BS9A 1YOVB 4EUFA 3T7CA 4YJDA 1SZJG 5B1YA 4CQLA 1R37A 3UCEA 1N1EA 5CEEA 1HDCA 2EP5A 4R69A 3RAJA 2G1UA 2QHXA 3MJSA 5FEUA 4I9HA 2DTEA 1DPGA 1H93A 2CZCA 3U9LA 4E2YA 4RF5A 1BTOA 1WDKA 4PZDA 4BO1A 2I76A 4CM1A 3PWSA 3VPSA 4E31A 2HCTA 4B8ZA 4OKIA 2OP0A 2DLDA 3WGHA 2QIOA 4D0SA 1A71A 1H6AA 1BMDA 1V0JA 4JN6B 2VT3A 4Z0HO 1GPJA 1U1IA 2I99A 2NSDA 3DOCA 3L07A 2OL4A 4ND5A 5H82A 3JQAB 3PGJA 1P33A 3HDJA 3GG2A 1DJQA 1FDWA 5DBFA 4GVXA 4Y6RA 5J23A 1WMBA 1XR3A 2QRLA 1B3RA 3LZ6A 4CM8B 4XRGA 3SX2A 3ZWCA 2POQX 1F8FA 2X4GA 4EJ6A 1WW8A 1AHHA 3CUKA 1BGVA 3ZW9A 2EGHA 4BO8A 3IJRA 3M1AA 4NH4A 1ZW1A 3OHSX 3T4EA 4DIFA 4DL9A 1N92A 1WVGA 5H81A 1GD1O 1EVZA 3ONEA 3PJGA 5ER9A 3F47A 1P0FA 3RD5A 2B4RO 1EFKA 4YACA 3JQGB 3C85A 4NBWA 4IS3A 4E0BA 1ZXLA 1F8GA 2XOXA 3EYWA 5EL0A 1SOWA 1T24A 3VPFA 3W1VA 1T2AA 4CUZA 3UVEA 1DB3A 4NJMA 4Y6PA 4YAEA 3MCVA 4QO7A 2ILTA 4BNGA 3P2YA 5DBGA 3WBFA 3HHPA 4IZHA 2I6TA 2AEJA 3IAHA 1ZMTA 4AJHA 1WWKA 3H9JA 1ADGA 4L73A 4B8WA 1H6CA 3KV3O 4DTIA 5K6AA 1FDTA 3FF4A 1BDMA 2JAPA 1HTBA 2UUPA 3W4KA 5F1PA 1I3NA 1TT7A 4ZHSA 4GKBA 1XDWA 2ZB8A 3MOIA 2D1YA 4Z3DA 1KVUA 4M1QA 1BW9B 2VRBA 1XYGA 2C7VA 2CMDA 4K6CA 1ONPA 2C07A 2TMGA 1GZ3A 1UP6A 1I5RA 3AUTA 1H0KA 1MXHA 2PKQP 4IY1A 3ON5A 3RWBA 1BSVA 3BMOB 3DBLB 3ZWOA 4K1LA 4TVBA 1LDYA 3AUUA 1RM3A 1P1JA 3WYCA 3H9QA 5KJ6A 2O23A 3PJDA 2P91A 3UF0A 3WGOA 1LDNA 3ZN2A 4AJJA 2IRWA 3F5QA 4RLHA 3PGXA 5L4LA 2D8AA 4RVGA 3DZKA 3H5AA 3WGZA 4PLGA 1SMKA 2ZCUA 3Q1LA 4KWIA 4YJFA 3GRPA 1UUFA 2CUKA 1ML3A 1X14A 3RBVA 5JYDA 3SC6A 1B8PA 4B4OA 2ZQZA 4F46A 8ADHA 4H15A 4D3FA 3NTOA 3QP9A 4OXNA 3SLGA 1KERA 4FOOA 2VTDA 4ZD6A 2X5KO 4BVAA 3H8VA 2Y67A 2DBZA 1H6BA 4YBZA 3PQEA 4PFJA 1EVYA 3WFJA 3P2OA 1P44A 2Q1WA 3LVFO 2FR8A 4GL4A 2D4AA 3JQ9C 4ONEA 4R51A 2EJVA 2X23A 1LDMA 4YDRA 3AUSA 3ICPA 4ALLA 3I4FA 5ENVA 5L40A 5CG2A 1SC6A 1DC6A 4I8XA 5ILOA 2NTJA 1PZGA 3RUIA 4CM4A 3L77A
chains in the Genus database with same CATH superfamily
4LSZA 1E5DA 3C98A 5TLSA 2VHTA 5DNWA 4A9AA 3M83A 3LI2A 2RMKA 2AOWA 1N2XA 2JIMA 3DDOA 3KOYA 2GM5A 2VDVE 4XWAA 1IK6A 2NU9A 1HZJA 1JSXA 2ODBA 2WWRA 1MRZA 4QDOA 4U5QA 4YRDA 5C53B 3I61A 4TKMA 4MR7A 4FB4A 3D8NA 4OSOA 3O4GA 1AUVA 1C9NA 2HZ7A 4R68A 5ALGA 3NHRA 5MDHA 1WY5A 4O4LF 5LYYA 3UMGA 1SC9A 3K2BA 4DQVA 4M53A 4PR0A 5KTYA 1BS1A 1FSPA 1YIAA 1GFSA 4NZYA 4F6CA 5F2NA 1X7XA 5C4GB 2OE2A 3B5EA 1RRKA 2I54A 5AHXA 1VJRA 2HRRA 3WMWA 2V6IA 4H16A 3T94A 3AF6A 4EI9A 4JYPA 4NE7A 5AKHA 3MPUA 3UHAA 2Z98A 1MTOA 1GTVA 1XVIA 2HMSA 4ZWNA 3FB4A 3R3ZA 1OROA 4UZFA 3JAKA 5TF0A 5ECDA 1E6KA 1PGOA 1A9TA 3BRQA 1NQXA 2W2KB 1ZJZA 3NJ8A 3PTZA 4MI6A 3RV3A 4D9MA 3WYNA 2ZPAA 5K0CA 3O31A 4HEJA 1SELA 3LKZA 4QXRA 1Q0LA 2P2SA 3BD7A 5BOVA 1WKCA 2VHCA 4DSTA 4RH1A 3L4EA 2IYUA 2QSJA 1ZG3A 1N0IA 3DNPA 4IHJF 4UNRA 4I6JA 1Z06A 5FB3A 3RQIA 1SKQA 4M89A 1G5HA 3HXQA 2P68A 3E4CA 1W34A 2ZJ7A 4QPZA 1PVVA 1BHQ1 3HSSA 1JYSA 1A50B 2A9PA 3HRKA 1RYBA 1ZHFA 3GDWA 3E7PA 2ALJA 2J09A 3NPMA 2IS2A 3HCOA 4BNWA 1JEJA 4AZVA 2ORVA 1GZVA 1MV8A 3AHCA 3ZHRA 3AU9A 4C08A 1UBUS 1X9GA 4Q18A 2R7NA 4OG2A 4YUXA 2PAAA 1GT91 4YBRA 4MO2A 3MMXA 3KL2A 5I7VA 3IVMA 4NV3A 5EMHA 3T5BA 1RACA 3T41A 1OWPA 1XJWA 1FVXA 3KBOA 1CQZA 4H4DA 2RH9B 1Q20A 4AZTA 3C3PA 2EOAA 3IAS6 3EY9A 4GDFA 4OHXA 3DOOA 3TLEA 1XDZA 3MNFA 4OREX 2QJFA 1JHUA 1QO0A 2FSIA 3SWWA 5JIBA 4BJ6A 3PTLA 2R751 5CH5A 4EFKA 4WXRA 1KP3A 4EYGA 2VK1A 4ZIRA 1PBNA 1HRDA 3CH4B 4LZAA 3F4KA 2H2DA 5TF4A 2AFVA 3VDRA 4UHJA 2J59A 1MCZA 3SEQA 4BGIA 4DR4B 3ZUGA 1HQYE 5DBHX 1TAHA 3MXTA 1NR7A 4S1VA 4EJMA 1JDBB 4H1VA 1SQ5A 5IU6A 4O2RA 4LSGA 2NSHA 4Q03A 4QUDA 4BB9A 1A1VA 2Q2QA 5TMBA 4CTNA 4BCDA 5AHWA 2BMAA 3O7WA 3RSOA 3WJ2A 2J5RA 1GCUA 3BC1A 3LO5A 1MJNA 2PDAA 4TL6A 3OFSA 3OA0A 1U7ZA 4YQFA 5FO0A 1OXSC 3JWHA 3RC1A 4HQNA 2C5HA 2YWXA 3FKQA 3OFKA 2PGDA 3VXKA 2NADA 1TJ4A 3L1VA 3OICA 4KQXA 3GFPA 4BKRA 5ALOA 1E18A 5BSHA 3B9QA 1KY4A 4JBWA 4CF3A 5FBLB 1MT0A 4TSRA 2RKWA 1NP3A 2HIAA 1KQPA 2LWIA 2P2GA 4M0KA 3TQOA 1HEYA 4EECA 5KNDH 2A0WA 2GGSA 3VI4B 1ZBQA 1ZUNB 5E2BA 3O21A 4GYJA 4OHVA 5IFLA 1QLJA 2FPIA 5EP3A 5AW0A 1NLZA 2WTBA 1SUBA 1H22A 3SQWA 1I24A 1T0IA 1J8DA 1E96A 2PL9A 1OH5A 3IP8A 3NBUA 2C5SA 4TQGA 4CVNA 1T6ZA 1MP0A 3ROEA 1BCSA 4UARA 1MIHA 1XD9A 4ZAXA 1Q0ZA 4FFSA 1M5TA 2JJ1A 3H1TA 4R01A 4YWHA 1PIWA 1JPVA 3VKVA 1Q15A 1TT5A 2W2XA 2QX4A 3OWXA 4CM5A 4K40A 4EMTA 2QUIA 3AFOA 1DX6A 1LSOA 2YHBA 5HF6A 4DNOA 3HVJA 2X3YA 4LVCA 5GV7A 2DUWA 4O4HF 2E4VA 1UQRA 2G6TA 1WDLA 1UBSB 3BSYA 3FPGA 4JGBA 4GS5A 4Q39A 1KBQA 3ML1A 3ODGA 8LDHA 1FX0B 4KVZA 3K0BA 4UVDA 4YYEA 2HXYA 5ICMA 1ZK3A 2QUKA 3FTDA 3RUCA 3H65A 5I5EA 5B64A 1EFTA 3TG8A 2OD2A 4HAIA 2Z9DA 3ER9A 4ZC8A 2XBLA 1EI9A 2M6KA 3BGSA 2W58A 3D7NA 2CJXA 3L8FA 4RZ3A 1GQQA 2ZRFA 1I3MA 4MW2A 1M6EX 1LUAA 1P4HA 2I1VB 1JFVA 2NV6A 4QJIA 3AL3A 3UKOA 1Y3HA 1AIPA 2Q1YA 1O0CA 4TMKA 3VVMA 3I76A 4V0LA 4ZCLA 1H8HD 5ADHA 3K09C 4JU8A 1OGIA 1OBCA 1B16A 1EP9A 1HNNA 1LPOA 3DMGA 4G65A 4FW8A 2RBKA 2Y1KA 3H9UA 4LUCA 4M9QA 2FUG6 3DOFA 4GX2A 4HRAA 1NW8A 4CCYA 3PR3A 3UT5A 2A59A 4OYRA 1QH8B 1SVNA 3IDFA 3MEQA 4MR9B 2R3SA 4W82A 3L5OA 3VHXB 3W5VA 4ARVA 3A10A 2GSWA 1MHTA 3U3DA 4I5EA 5EJ7A 1QB8A 3R0XA 3T4XA 2V7BA 3CN7A 4P38A 4A2QA 1CC1S 3ROXA 4XIYA 4F3NA 2DWPA 3JY6A 3HFRA 4E11A 5MN5A 1RM0A 3QLJA 5I01A 5DTRA 2VJOA 3WXBA 1UINA 2QR5A 2Q2VA 3D7MA 3NJRA 4PW0A 1ZHOA 4FZJA 4IIVA 4NU5A 2HRCA 1REQA 2HBQA 3E9YA 4C3UA 4LJYA 1GTZA 4IV0A 4IGIA 4RNCA 1W59A 2X5JO 4S1PA 1NYLA 2JJ2D 4QO8A 1TKRA 4B45A 2YBDA 3C39A 4B43A 3O8NA 4NE9A 3LDGA 4GPEA 3WGLA 5J47A 4U39A 4DY6A 3JARA 3RBXA 3JTEA 3L0DA 3MUOA 1HM5A 5HW0A 1OC4A 2H57A 2E6KA 1GUDA 3H42B 4MMZB 3C6MA 1IY2A 1SJ9A 2L42A 2PMCA 1KI8A 4P81A 4FTWA 4ND8B 4HNHA 5IAJA 3RVRA 1U0NA 4BFUA 4DR5B 2XH8A 2H59A 4TYMA 2BI7A 1TCUA 4R9SA 2G71A 1UM8A 3H04A 1ADFA 3E2MA 3EGDA 3TS1A 3B48A 3BDIA 1D03A 3FPJA 1KYWA 4QUGA 1KFEB 5JBNA 3DKIA 4X3CA 2R6AA 2YVUA 3IQIX 5CDFA 3AFNA 5CDTA 5IM4F 3LBFA 4DLLA 1IYZA 4RTOA 3FRHA 3JYHA 2BL4A 4OTZA 2W00A 1FRNA 2PT7A 2GPTA 3OOWA 2LIVA 3I53A 3CMMA 3ZVKA 3RYTC 2Q99A 3ETHA 1LRKA 3H1EA 3M4ZA 2WJ3A 4TKVA 2WIJA 3FG9A 4R98A 4TVOA 1YCGA 4DDUA 4QTUB 2VCEA 3BCHA 2O2YA 4LC9A 4XGRA 2M6SA 1W0KA 5K3OA 1L3IA 2XOKA 3CKMA 4MKHA 3QXCA 4B8YA 4O0LA 3TNLA 4RL6A 1K8RA 4YUWA 4HGRA 3RFUA 2PUHA 3GGOA 4OI4A 1TADA 3VJLA 1ISMA 2Q4EA 1XTRA 4IINA 4JODA 4Q9NA 1LPNA 1NKVA 2YJNA 3OLXA 4WZBA 3ZOZA 1JDZA 2E21A 4GOMD 1NQ5A 4FK8A 4HYEA 1X3LA 3U4HA 4BJHB 3NT4A 1QGUB 3PP8A 3NWEA 1R0CA 3O84A 4HDNB 2Y1CA 4LY0A 1ZM3A 3MT8A 1V3VA 3I8OA 2YJGA 1OZAA 1P0MA 2A4KA 4NYJQ 3U39A 1W47A 5B7NA 1ORTA 2DE0X 1E4EA 1Y9JA 1PTJA 5CA0F 2G9VA 3ITKA 3Q9UA 4QG7A 3KPVA 1RLOA 3E5MA 4UBOA 3J7AC 3W5DA 2XWSA 4KXNA 3D64A 2WSBA 1S7CA 4E33A 3V4FA 5FR2A 4FNMA 5E1MA 3I83A 1R64A 2C2ZA 1YAJA 3BCSA 3QEMA 5DHUA 2H52A 4MGKR 3AESB 1THGA 1W75A 4KWHA 4AJIA 3NG1A 3VPDA 5A4KA 2VTVA 1FUKA 4N5DA 2F00A 1R66A 4W6QA 4MVYA 1XQXA 2H92A 2RHTA 3ZU3A 4ZRMA 2CJWA 4F91B 4N5IX 4DC9A 3CT6A 3SS9X 1Q21A 3NP9A 5K03A 2UVPA 4BFSA 4OMFG 3JR3A 5F64A 1W93A 3E5HA 3BDAA 5DK6A 1M6HA 4XE5A 3L1IA 2SKCA 5KYKA 5LPNA 1BGWA 4K3VA 3RC7A 4P5EA 1YFZA 1G0OA 2JFWA 2XITA 3AHFA 3IMEA 2H6EA 2Y1XA 3I9JA 3QLUA 4IRMA 4DA6A 5C8YF 1W36B 1ML4A 3FYDA 4ZYZA 5CFZA 3CLUD 3NS7A 4M0LA 1QIFA 2PKQO 1X8JA 4TVSA 2X0IA 3NNSA 3R5XA 1U80A 3BK1A 3SVZA 4ZARA 1S01A 4FSDA 3LF1A 4YRCA 2NP7A 4UHKA 3LYLA 4GP6A 4UC0A 2XZOA 4HZUB 2JDID 1YSCA 2Y1DA 4RD4A 2C2HA 3I6BA 4QBGB 3DMYA 3NI2A 5HS6A 1PEDA 1YR8A 5BYKA 1RQ7A 2MSWA 3D1VA 3KD2A 2XD4A 1AO3A 1N6NA 1TKBA 3Q88A 2C1ZA 2UZAA 3MWLA 3PTAA 2YVQA 3MYYA 1EUDA 1KSJA 4OXRA 1UZAA 5DNUA 1V96A 5DI9A 1MQ8B 4O1HA 1P81A 3ZWVA 1NOKA 2GOYA 6GPBA 1ZXXA 1I30A 1Q7BA 2VCHA 2ZXFA 1CS4C 3D6VA 1UT8A 3IVXA 3VHLB 1CP3A 1ESNA 1E1YA 2YX1A 3M81A 2P69A 4J90A 4RXTA 1JDPA 4TL8A 4N6NA 1U8XX 2QM0A 2WDPA 4YN3A 4OHKA 4XM2A 2CDCA 2XQJA 4HGNA 4MUGA 4S3MA 4U2GA 1IUNA 3D7LA 1XDBA 4CI0B 1NN1A 1DP4A 1EP1B 1M0SA 1QGZA 5KQPA 1XZHA 1Z3IX 3EEYA 1E1CB 4LTMA 3FPKA 5BT9A 4AUEA 4UATA 1FSSA 3H2JA 4I1UA 4D4MA 1NUHA 1YS7A 2O2HA 1PLJA 2PKRA 3UOWA 2HWWA 4F56A 2FZEA 3ACBA 3R6WA 1ZI8A 4RVHA 2WJ4A 4CV2A 4DQXA 1YR1A 3BKXA 4NCHA 3UAXA 1O5TA 3QE9Y 1J25A 2II6A 5MF6A 2CLLB 3MJTA 4R31A 3V5NA 4WFQA 4JYCA 1CUAA 2W6OA 2I71A 4H31A 2H5IA 4DS3A 2JGDB 4B7XA 1IPFA 3MRVA 2Y92A 3UY4A 2MHCA 1PJ3A 3F9RA 1IZYA 2J48A 4MRNA 2R86A 1EZ4A 2IYOA 1SBQA 1XF9A 1JHYA 1AUQA 1RHQA 4OH1A 1YVEI 2V54A 1XRRA 5KVSA 1D4FA 4FE3A 1MPTA 4I4TF 1I14A 3T52A 4A2PA 3RABA 2P9BA 4L50A 3LUCA 3GY0A 1JKFA 2A5GA 5CIQA 2H4WA 2FN8A 3IOBA 4HDKB 4RAQA 5AMXA 2FSHA 2V9ZA 1Z62A 5DI3B 2VYCA 3ODPA 1L5GB 1US8A 1XCBA 1E4YA 3O8OB 4KPFC 2JGFA 4XB2A 1PJ4A 1GPUA 1Y1KE 3O38A 4PPFA 3GIDA 4E7PA 1WXDA 1HL3A 4YR7A 1V43A 3IL2A 2JIBA 1P7PA 3LS2A 1KR5A 1J2YA 2D5BA 1OLXB 2WYUA 3B1KA 5CP8A 3C87A 1Y0BA 3A0UA 1DX9A 4H7PA 4JUAA 5BSMA 2PPVA 2P5YA 4EVSA 3QWAA 5AVTA 2N47A 1PR4A 2CHUA 4V38A 1VBKA 4LDJA 3KG2A 1IAVA 1PFVA 4LX0A 3I92A 1GZ4A 5TRTA 1GXSB 2FW6A 5KWIA 2PH5A 2GDJA 3GXOA 1EXWA 1GCOA 2KYRA 1QWOA 3FROA 3PZRA 4V0KA 1K8YB 1P1CA 2D3WA 2H0AA 4ZEXA 4D9CA 2VUIB 1BXZA 3QKWA 4YMIA 5FWAA 3D2LA 4RA6B 4YIHA 2OBMA 3GZNA 2HRQA 1V37A 3DKKA 1E1CA 3EZFA 3FMFA 4II3A 4MITA 4EG8A 4MTCA 2E4ZA 1L7NA 3K2QA 2DR0A 4O8ZA 3COJA 4OJKA 1JPUA 1SOAA 1YB1A 3G2LA 3OAAA 2VZLA 2M32A 3ORQA 3CGWA 1FJ2A 1FVFA 1NW7A 1U2EA 3E9DA 4IWNA 4KIGA 4YQYA 3MWGA 3CX4A 5EHZA 5IBCA 4KNYA 4L8VA 1EFPA 2HJRA 1B00A 1OXVA 4K1XA 4PZEA 3K0CA 4V0OA 3SHFA 4CLOB 3JWPA 3OZGA 2ZWPA 1A27A 4C0JA 5IYZA 4OLHA 3LT2A 1YCFA 1KYZA 2PO7A 2VOEA 4UZSA 2X8LA 5ES4B 1PK9A 2H5LA 5DXFA 4ABTA 1CW2B 2QMUA 3PGA1 3QIVA 4XDHA 2ZIVB 5FPYA 2NZYA 4I1OA 3NEAA 3T7KA 3M6WA 4IL5A 3O6VA 2GYUA 4OI0A 3HO1A 1R4NB 1Y6JA 1OBFO 1DOHA 4CFZA 3U7RA 4NBNA 3TZBA 1N2SA 1JP7A 2O50A 4EYOA 2MSKA 5U1PA 3OCJA 2PH7A 4IGFA 5JMPA 4BNMA 5AK0A 1M2FA 3TKAA 4BP3A 1OZGA 4ALKA 5CVVA 1JA9A 4EVQA 4HL6A 3S81A 1U28C 3LWNA 4QEDA 1FK8A 4YV0A 3FD8A 2R6CA 4TM8A 3EXAA 2X4DA 1Q7RA 3HKBB 4HOYA 4E15A 2P0AA 2PE5A 1EB9A 3DVRX 3G7UA 2DH6A 3MTQA 3JCZA 1RQPA 5DDIP 5TS2A 3VAAA 3RGWS 4B7AA 4COOA 5MN6A 1Y4AE 4DCSA 1JG6A 3DBRA 2XCSB 5UKDA 2XUPA 3PFFA 3KUXA 3LIPA 3S0JA 2P3LA 3TF5A 1OPRA 4M8NE 1Z47A 4R1OA 1RWKA 3KHKA 2JIZD 2QG9A 3EZ2A 1KZ9A 1Q1ZA 4QDTA 1XDGA 2G09A 2WIFA 2AEEA 3OE7D 4B0OA 4Z8XA 3BEDA 4KAJA 1X19A 4R84A 5AUQA 4J4BA 4Q7EA 4N8DA 1ZQ9A 5DGCA 4C2AA 5J2TA 2P9GA 621PA 5JAZA 4Q01A 2BR4A 2VTBA 1XZIA 4A7PA 2R1UA 1GP2A 2CB9A 2IE0A 3GLHB 3EGXA 1U5AA 1DAMA 3CRZA 5HQ3A 1C2YA 2BE7A 4ACBA 1MOSA 5FLEX 5I8ZA 5A0TA 3KB2A 1T4BA 4GKJB 4Z4CA 2WG1A 1TKCA 1NBME 5A7GA 1GN8A 4R6WA 3ICOA 1SCJA 1DQYA 3BUSA 3JWIA 3IELA 4MQ4A 2AVDA 3CQ9A 4GEKA 2ZJOA 4NSNA 3I8XA 4M4SA 2FWNA 2PT5A 2R5FA 4WSOA 4FGWA 1AA6A 2HRZA 1E6MA 2EKLA 4ZI7F 3AHJA 1LQTA 1X80A 2BUAA 1KQOA 2JIOA 3GFBA 4IF4A 2CWWA 1E1LA 3E0XA 3ISJA 3T4UA 3RG8A 1KI9A 3IXQA 2WM8A 4RHYA 1GJRA 3DE5X 4B31A 2NU8A 1GUBA 3CSDA 3PJFA 3B7WA 3ZHTA 1VPEA 4LSWA 1QVRA 3FNIA 4WLEA 3WIOA 3WGKA 4EH1A 1WNFA 1JWAB 3AIKA 3C3XA 5FFFA 4DT1B 1XMXA 2H4ZA 4HT3B 3FPLA 5IK2D 4C7JA 3N05A 4AURA 1JR6A 2C5FA 4M1SA 3PX2A 3HY6A 4ZJZA 4ZT3A 3I0NA 1NQAO 2CNWD 5DN9A 2EKQA 2NO4A 2OXTA 4ZCIA 1YA6A 1FLDA 3QU2A 2GILA 2CL5A 2IHZA 3A6JA 2XWPA 3T06B 1BU5A 1E9CA 1SU6A 4C6TA 4RZ2A 4D4KA 2VHXA 4H1WA 1O87A 4FE4A 4YY3B 3B52X 1E2JA 1UPTA 1E59A 2BV3A 2HU2A 1VM6A 2AR9A 3BTOA 1E94E 4YV7A 4RV5A 1T1JA 1GPDG 1QXSA 3AZPA 3IT3A 4KMMA 1NUTA 4PYMA 1B73A 3IAS1 4Q3BA 4ENPA 2YHIA 1PUXA 4PEVA 5CX4A 3C3AA 3P8ZA 1G5QA 2GF9A 3RO7A 1NU8A 4Y1FA 1G5PA 4DIEA 5LBTA 2V59A 1EGQA 1SCNE 4LRTB 4I9GA 3ORSA 3ZZ1A 1XPUA 1GCAA 2AQIA 4MQFB 2NP6A 1ID1A 3Q3CA 4M76B 2PMKA 4N4AA 4C4SA 3Q6MA 1O95D 4C7XA 1OI2A 4PAOA 4RVNA 3LX6A 1JWLA 3AR7A 3LW8A 2I80A 1DIOB 5L6MB 5GWXA 4KV7A 4ER0A 1GQSA 4GHWA 4QOJA 3CURA 1E2EA 3VH3A 3G5UA 2P1DA 1MGPA 3CCBA 3SX0A 4CG2A 4RTLA 1C1XB 1JA1A 2EF0A 1EKXA 3MTIA 4RK7A 2AYZA 2QRKA 2IP2A 2B1JA 4FYPA 3ZGOA 4H7DA 3BQMB 1UBCA 1WXEA 3VR5H 1AT1A 2IZZA 4P0QB 1JQ3A 3V1NA 5JNSA 3VOTA 3GFTA 1JXAA 1VFNA 4CCWA 4RESA 2QNIA 5CHYA 1SC3A 1ZAKA 2FFRA 4A27A 4I14A 1K8XB 1DIBA 3IV9A 3BAFA 4MTLA 2FKAA 3BMNB 3JWEA 5T4HA 2C7BA 2EJUA 5D00A 6REQB 3N39C 4QXOA 3I1JA 5H8WA 4X1IB 4W5TA 2R9VA 3JXEA 4QXPA 2MYUA 4KQFA 3O2JA 2YN4A 2O7QA 4P0PB 3RKUA 4R71A 3L7CA 4RHEA 3ZHQA 4OXQA 4ETIA 2VWPA 3EZYA 4HNSA 4JBHA 4Y2PA 2CE2X 2ZSEA 2QY6A 3ZV4A 4D9HA 3PFHA 3PDJA 3K4PA 5F35A 1ZMOA 1BQEA 2D6FA 5K0LA 4CZ2A 3OLZA 3K73O 2NPFA 2WUVA 2XBUA 1UBMS 4MVJM 4C3VA 3U7IA 1KIMA 4AJ9A 2OAQ1 1KJYA 3KAJA 2FZ4A 2E1PA 3GLGB 5LLTA 3B12A 1CZUA 3W6UA 3B6ZA 5BSWA 4ZYYA 4H6XA 2EYQA 4WKGA 2ZUEA 3JAKB 1V9LA 1GKKA 1PJLA 4BFWA 2C92A 3KO8A 1Z68A 4COKA 4D56A 4GUDA 2C2WA 1C3EA 3LRPA 3JQGA 1KDZA 1VYTA 3PD7A 2JAHA 4BC1A 1RCFA 2FFHA 3OY2A 4IQ8A 4OFXA 1QP0A 2QN2A 1SZDA 2PUWA 3H4IA 3N3AC 1RFGE 4MQEB 3O5AA 2D5IA 3EPHA 4GWLA 4YRMA 2QMOA 2UKDA 3MRSA 1T2NA 2VLIA 1R7RA 1UPUA 4MEAA 4GRIA 3TX2A 1L6RA 4DZZA 1DZIA 4G1BA 1KFCB 4M36A 4D41A 1N0VC 2R96A 3VYRB 1C1DA 3ZDXB 2FR0A 1J0DA 4TN1A 3GARA 2PR7A 3C45A 4MQFA 5IULC 1N1DA 1YZTA 5HA5A 1ODCA 3KR9A 3WLQA 1TCBA 3LQFA 4FIDA 2AB0A 3T9FA 1BEZA 2QTZA 5E7MA 5JAHA 2VA8A 4CMIB 4E5KA 4LF9B 2UZ3A 3THYA 4D42A 3H7IA 1U0OC 3T3PB 3K9BA 4NMHA 1G2PA 2DF8A 3AM4A 3HCNA 1XUOA 2PMBA 2OSBA 1C30A 5ES3A 4NIMA 3DMPA 3UPDA 1Z2OX 1ZGGA 2CLHB 1DDIA 1HUQA 3NBMA 3GWZA 4OHBA 4WZ6A 1AHIA 3HBLA 4WUVA 3DFMA 5EN4A 1K8ZB 1GEEA 1O1YA 2NZ8A 3G2HA 3I2IA 4HYTA 2Y77A 4JC0A 5JDCC 1WB5A 3F5DA 2ZJBA 1F0PA 3DT8A 1P62B 4TWBA 5JANA 1W4LA 3IQWA 5DSTA 3PHGA 4UBIA 3TLGB 4D9JA 4QYMA 3T1HB 2XUZA 4KJXA 1FS4A 3RSZA 3FAKA 5EE1A 2CWDA 2GCGA 4O4LB 1T1SA 5EXPA 1WZUA 1RXSA 3PHJA 4KMOA 1NVVQ 3OAAD 3FWKA 4PNZA 3NC1C 4UEOA 5T3UA 4P4TA 3KQYA 4C5BA 3UPTA 3D8HA 1XZEA 3HACA 3A1DA 3U3RA 1D04A 4OUKX 1FNNA 4FD3A 2VHZA 4PG5A 3SHOA 4IXTA 3ZY3A 4KHPB 4EMSA 1QG4A 1UL1X 3GJRA 3BIOA 4E03A 5I6DA 2G7ZA 4YP9A 4O2AB 4AJ4A 4TYWA 1E61A 1KDRA 3CX3A 4LOLA 1NW9B 4UU0A 4A0QA 4QKQA 4JOCA 4R1NA 5DF1A 3Q12A 5JWOA 4MOWA 1SUFA 4TTJA 3OQOA 1POXA 3NKVA 4U2CA 4Q7LA 1DAOA 4K05A 1L4YA 2QTRA 3N8KA 3DUFA 1Z8NA 4GWGA 4OUDB 2BIFA 1EVIA 2NZUG 3L0PA 2BHNA 3FMVA 1O0SA 3KTOA 5TPWA 2D4HA 2W70A 3MRXA 5A02A 4N3CA 2AC7A 3ASZA 4GKKB 3EDRA 4WXMA 4ZVMA 3T1QA 3GRRA 3JZAA 2XHEA 1VKNA 2WMOB 3GGCA 2ZSHA 2VUHB 4G5GA 4ND6A 4OI2A 4F84A 4FWTA 1T0HB 1V8OA 2GYVA 2Y1LA 2HY7A 3C7CB 2WTEA 3NBZC 4EGJA 2OZKA 3WMGA 2P4HX 2A78A 3TEFA 4IEFB 4D5EA 1TRHA 4M87A 3ZZ0A 1IY0A 3TI7A 1TEXA 1GGEA 4ZAFA 1ABBA 3BZUA 3IHTA 3MTBA 3O90A 3OHPA 3HO6A 1OZFA 3QWFA 3DEZA 1OJLA 3LX8A 2QLJA 2QK4A 4M1EA 1TZKA 2PUEA 2P2CA 1QHYA 1EWTA 2Q3EA 3IBGA 3AB8A 1US8B 2PLWA 4B34A 4XJVA 4M9ZA 3ZZMA 3D7RA 3DO8A 4QTTB 1HH4A 1QLWA 5JD4A 3T3OA 1EVJA 1SXHA 3D4BA 3D6TB 5KREA 1FU8A 5BXYA 1DFIA 1HT1E 3PHIA 2PCLA 4KNVA 4YQZA 1MA0A 1NT4A 3DMHA 3LLSA 5DULA 2WFLB 3OKCA 4UNSA 3D3QA 3RUHA 3EWNA 1JI0A 4LYYA 3ZBPA 3ZBQA 2B4YA 2YINC 4BQPA 4CEIA 1NXXA 3UT5B 3NDBB 2G08A 2YFHA 4H35A 4UM9D 4Y2JA 3L01A 4S2UA 3BMXA 4ZI2A 1PP4A 5JHGB 1ND5A 3SEFA 2IBTA 4IIJA 1NC3A 3JWGA 3ZEIA 2HLDA 3NHSA 4YECA 5E3HA 3RJMA 3C4QA 3HWWA 4YJKA 3RS2A 2YWGA 2ZT7A 1TF2A 4PWZA 3OOJA 1TFRA 2N1BA 1AQ6A 1DAFA 1RADA 4ZANA 1LBTA 1YJQA 3H13A 1DQPA 2PX5A 3AY0A 1GTG1 3V97A 2XMDA 2CDAA 3NEJA 3LPNA 3UMVA 1LI4A 1RPTA 1Y33E 3GPIA 3E3AA 5BQ3A 2P40A 3KLPX 2AWNA 4YAGA 3PX7A 4YAWA 3KUUA 4ZHQF 4WZAB 3RS5A 4GR4A 3HUTA 5TDHA 2FSVA 2GXAA 1I0ZA 1UJ6A 3B2EA 2YW2A 1VCNA 1C0KA 3G2QA 1EZZA 3KT6A 3AQIA 3HCBA 1OZHA 4MXDA 4QU0A 2QPAA 5CLFA 3ZDCA 5D5QA 5GIPE 1SWVA 1N2HA 1C0LA 4FFWA 4HDOB 1O54A 2FP4B 3DCNA 4OQZA 4AYXA 3BE8A 4TKZA 3B60A 4EF4A 4ZK6A 3TL2A 4LF8B 1PL6A 2FG5A 1UPXA 1BFDA 4OHRA 3O3OB 2X0EA 2GBIA 3A32A 4C7BA 1PDOA 3EB9A 3LBIA 1XOIA 2ZQ5A 1XDDA 1V45E 2C54A 3GJQA 5FWDA 2IV7A 5FV4A 4PQYA 4DR1B 5AKXA 4F2HA 2SCUB 4HWSA 3QEKA 4GC5A 4C9BA 4QT4A 4QM6A 1GADO 4IDOA 4U7GA 1DLIA 5FHQA 3WHIA 2LPMA 4HHEA 2XMZA 2QT9A 4LG1A 1PVOA 3K9WA 4BEWA 1PBTA 3RNLA 3HJRA 1Y3AA 4JT9A 1OFTA 1X3SA 2YWHA 3IR5A 5ESRA 3K0HA 2BTEA 2VAPA 4OHCA 3WAJA 3P2EA 3IMKA 1U7PA 2WMDA 4NHEA 4WFIA 1C3LA 2WJ6A 3I9OA 1TW2A 2VS1A 4ER3A 1XQ9A 2HX1A 3FUXA 3UUGA 1JQLB 2DPLA 1CLEA 4ICIA 1BWSA 1LNZA 2BM1A 2LDBA 4MB2A 3DXXA 3RTGA 1RPAA 3UB4A 4MYHA 2Y6VA 5IANA 1OC2A 2IS6A 2B98A 3ED5A 4OHWA 2O0MA 5A5FA 2XT6A 1QYDA 1Z2AA 1QORA 3VJMA 4FZ5A 1JECA 5F9MA 1DKMA 1T91A 4DYDA 1JDSA 1KZ1A 3KLOA 3O75A 4GYKA 4BEBA 1DI0A 2B30A 2YV4A 1Q2UA 1SXIA 3FDXA 2HI0A 1VIDA 4AJOA 3SBOA 2QQEA 2QL7A 3TMKA 1RKQA 3UJAA 4FN4A 4JJFA 2PMWB 1ZPDA 3KCNA 1COWA 3IJ5A 1NPYA 3OBBA 1K4YA 2BELA 3G68A 1F6WA 4DUGD 3VJKA 1DXQA 4J75A 5BQOA 4F11A 5K6AC 4A8JB 1X7DA 2XJ4A 3KDAA 2WWIA 1A8QA 2G1JA 3HB7A 4PBRA 3DLHA 2LZ0A 2WJPA 4KIFA 4W5WA 4NMXB 2GH1A 1LX7A 4OATA 1RYDA 1SPXA 4KACA 2E4YA 3ANYB 3SEAA 2B7LA 1X15A 5KDLA 5JH7F 3QLVA 2Q29A 1UP4A 1FPQA 3UTDA 4PHHA 4OOFA 4YDSA 1EGHA 4QIHA 2K2QB 4JSRA 3ZHYA 3KJEA 1NF9A 5FPHA 4B3XA 4E1BA 1A76A 3AR3A 1D0SA 1RLJA 4FX2A 4NCKA 3E7DA 1Y89A 2C0QA 3LHKA 1H6DA 2G07A 4XVRA 5L45A 3G2KA 3KHSA 1X1RA 1C80A 4I4IA 1JH8A 4BBAA 2EKZA 2H1CA 5CT9A 3RS0A 4PGGA 1NOIA 1TU3A 2YYAA 3SS7X 4HAXA 5IBPA 1TTQB 1IB0A 2ATXA 2UZ0A 5ALWA 2GZDA 1I6LA 1I2ZA 5FTNA 1JXOA 3TQSA 2JLZA 1B0AA 3MB5A 2BZGA 1L0BA 1K98A 4DWOA 3TFQA 4YDQA 4P22A 4BO6A 1LSUA 3AY7A 1WZEA 4GPD1 2HMAA 3UUEA 4BUZA 4A03A 5KWSA 3ZQKA 3CG0A 2QTHA 4EZBA 3B3AA 5KVAA 4E5DA 4YJ3B 1PQPA 4YUVA 4HFRA 4KAAA 3RWOA 4V0QA 3CVXA 2FUKA 5CPBA 2XMQA 1ZKDA 2BEWA 4ZZ1A 1B0UA 2JI6A 1CRZA 1OOEA 2QLNA 4DIBA 4MDEA 3E2IA 3AUFA 3VV2A 3HGMA 3GPLA 2DHEA 3W6ZA 4BPRA 5DM60 4EUKA 3TSOA 2FMHA 3BXOA 2W93A 1G66A 1ZVMA 4OF4A 2NGRA 3ZY5A 4OQDA 5K09A 4TMZA 3KQVA 5G4KA 1NZJA 1VKRA 4K9KA 5T7BA 3MWEB 2VQ6A 1BOOA 3KWFA 4LJSA 2J3DA 3V42A 1JE1A 3I0ZA 5AI6A 3A1TA 2X77A 3D3WB 4PYQA 2O3RA 1IHYA 4ZQHA 1OYYA 5JYEA 1FDIA 1F4PA 1R6XA 2WB4A 3O9MA 4IXNA 4WY2A 3ZGXA 3F74A 3D54D 3RNOA 4M2LA 1D9XA 3CRVA 3AI1A 3F9CA 1Z9BA 4HLUA 4JJIA 5CCDA 5KSZA 5TC4A 4Z7JA 1E2KA 5LQSA 1VCHA 1QG6A 1VG0B 3L1JA 4DIDA 4PYIA 2XSZA 1MOQA 4ZCRA 5I4CA 1CZLA 1BDBA 2P3SA 2JASA 1MH1A 3RC2A 3H9BA 3K15A 3UKJA 4AY6A 1XI2A 3QYJA 5FAXA 3S3TA 1R5BA 2VYND 1X38A 1YVUA 2G17A 4E4TA 4AMZA 4BO3A 2PSEA 5AT1A 1YOVA 2EZ4A 2VPXA 2P9JA 2AFHB 1RHUA 2IUFA 1KQGA 1N0UA 2TMKA 1SZCA 1YL6A 4RLQA 3MSXA 4KQ6A 3QPVA 2IIBA 1V7PC 2CNOA 2ZIGA 4BJ5A 3PQ8A 1OTHA 4FX5A 4RQUA 2VDWA 3M5PA 3SKVA 1TM4E 4JXXA 3SDZA 2FW8A 3A04A 5JZSA 1M5RA 3VPBA 1KK0A 2RH4A 4MI9A 5DW3A 5B7PA 1W88A 1E4VA 4TZTA 3W6PA 1SQGA 2CK3D 5AOCA 5K7SA 5KQLA 1XEAA 3C1UA 4DNFA 4Q47A 3CB4A 1GIAA 5J59A 3AFHA 3TPFA 3WKCA 5IUJC 2JIPA 2WU3A 3GB9A 3IP9A 3WWCA 3FJYA 3HR4A 3W9BA 4LHWA 1XJCA 4Y2YA 2C20A 1WPGA 3R3UA 3YASA 4FYVA 5HYVA 3SCZA 5E3IA 2JHGA 4QICA 1KOJA 4O25A 4WNAA 4GU5A 3RFCA 5DISB 4CR6A 2IEBA 2JJ2A 4OYLA 4YVFA 5I9MA 4BB5A 6ADHA 4LYJA 2GK3A 1BCSB 4FDUA 4XIGS 3WWEA 2EFCB 3A6FA 3LFUA 2E4WA 3PS9A 1SWWA 4LWZA 4OU4A 4PCAA 2AYYA 3CUWA 4WASA 3H6KA 1KAEA 3I2YX 1USKA 1W4ZA 4WTOA 3WIVA 5ALUA 7MDHA 1I8TA 4Q7MB 5F73A 3MCAA 2ZR0A 2ZUUA 1RLIA 3GJ4A 2C95A 3MGGA 2W6PA 3ECAA 4BNLA 4BO2A 2QMZA 1F6DA 3R9XA 2I2XB 4M1TA 4LHXA 4DAEA 3PT5A 2J3HA 3L7BA 4OO3A 1ZN7A 2W6CX 1F3OA 2LR0A 3ZE9A 4LF6B 4AL4A 3TSWA 5A3VA 4ON9A 4CMJA 3ZCXA 1WPRA 3IQXA 2CEAA 1K89A 3I42A 9LDTA 2AW3A 5AVUA 5LQUA 4L4YA 5J5CA 3U26A 1VDMA 1Y8ZA 3L8CA 5HF9A 3FPEA 1CRPA 1NDUA 1QQAA 3ZNQA 3MJ4A 3PUWA 1X77A 4CN9A 2GEBA 4P4SA 1BWQA 4UUNA 3E4DA 4MWSA 2HKIA 4WD3A 3ROZA 3BGDA 4M0FA 1EVEA 5A3RA 2J3EA 1O97D 3JSAA 3KTFA 3EBOA 1R4MA 4UOEA 2IPMA 4Z1MD 1TM5E 4TUYB 3CEJA 2JH9A 3WISA 1BCRB 1L4LA 1UPCA 3VSDA 2NOAA 1UM9A 1TYAE 1Y4DE 5KX5A 4URHA 1SUAA 3A9CA 4KR0A 5TPWB 2FVXA 4DJFC 2A5JA 5KQSA 3ZV3A 4CR8A 5FLKA 3AI2A 5LZ8A 3VSBA 3OIVA 5K4AA 1OREA 3D02A 1ACMA 2EHDA 3QHAA 3SXPA 3HTXA 2OPHA 1ATIA 1IB6A 1YQGA 3EARA 3I6QA 4MRPA 3RDPA 5G53C 4YP1A 3TXYA 4QPNA 3O3NB 2FQQA 4QEKA 4BVBA 3JRNA 4EL0A 3K6JA 1UR5A 2WF9A 4C4ZA 1P72A 1GGJA 3FSJX 3S44A 3NX4A 1NJ8A 5IVHA 3FTQA 3K0AB 4LHSA 2F59A 1Q3TA 2JLVA 4E6PA 4XFKA 5CD1A 1TM7E 1ZSNA 3GHYA 4LV6A 5KNDA 1EHIA 1S2NA 3EXFA 4AM8A 4PZCA 3TOCA 3MTEA 2EEZA 1XXHE 1L4FA 1A5AB 4MB6A 1KZ6A 3C3EA 4B3FX 1KJWA 4N3BA 1ZLYA 5I9NA 2C4MA 1ECBA 3CV3A 3ETEA 4JK3A 4KRFA 3MJHA 1WABA 3BWCA 3UA3A 1FF9A 1MH9A 3AKDA 1ZGZA 3REFA 3R7DA 2DT5A 2WABA 3LGXA 3DBRB 3FW1A 2IYVA 1L5MA 3AJEA 3BHIA 1N32B 1Y1PA 3N75A 5HIJA 1F14A 3GAAA 1QGUA 4IDCA 3KAQA 1H1DA 1QWSA 3CPSA 2LE0A 4MYCA 3GGSA 3WQBA 2EGGA 3K5PA 4KXXA 4AXBA 4I66A 4ZOEA 1SUWA 2R7MA 4CKZA 4YXWD 1HKHA 1N8NA 4G4SO 3RUFA 4NQZA 4X5OA 1FDVA 3QITA 3NETA 1FQJA 1THMA 2GK6A 4B44A 1FFXB 2WFAA 3CLTD 3KELA 2E3JA 2OO7A 3GEBA 3K1TA 3TTSA 2Y3IA 2YHAA 2XQVA 5EVCA 5J2UB 3LVRE 1QQ6A 4TKVB 3BIWA 2IY7A 3GFFA 4DOMA 5LMUB 1QRSA 3G1WA 1SRQA 3NRCA 4Z9FA 1F51E 3VNAA 2BOVA 1R4ZA 2XGGA 4M1WA 5BOSB 2Y2UA 4HS9A 3A11A 1YZHA 3ONVA 3F6PA 1CDZA 3NBYC 3RF6A 4DQDA 4UE2A 4YRJA 5EZSA 1IK4A 1F2VA 5EFZA 5EQJB 2AR7A 5JCJA 4U2EA 3CBGA 1S96A 1B7GO 1UM9B 2VPZA 1KI6A 3MN1A 3BRCA 4G1CA 3DEKA 1NJ2A 2D0PB 4JUFA 3DZ8A 3G5TA 3CE6A 1ZIOA 4A6DA 1L8XA 3CNBA 4N40A 4EABA 2A58A 1U2RA 3WWYA 4D99A 2DUNA 2CLEB 2R6HA 5EHXA 3O0TA 2GB4A 2HF9A 2O1XA 4J7UA 4LN1A 3STUA 1XF1A 2VOJA 1KPHA 4U9UA 3F78A 3UENA 1Y9EA 1T0PA 3K53A 3MFQA 2OAEA 1ODLA 3ZZNA 1NL3A 2PYDA 2Q2WA 3NHUA 2H3EA 4TTIA 5ALFA 1B1AA 3U1VA 3VYSB 1P5JA 5BVGB 5KDDA 4KBYA 4BGUA 1YASA 3ITDA 1ZMBA 3R40A 1ZUNA 4CHTA 5JC8A 3AUKA 2HV8A 3V33A 5LD2C 1HDIA 1I6KA 3ZE8A 1NPDA 3DAOA 1D2MA 3U9TA 5ALZA 2G40A 4KN5A 2OB1A 2Z83A 4TWZA 5JJ5A 5JSFA 4GLOA 2ZRDA 3FZQA 5DI3A 4Y6GB 2QTNA