2A94A

Structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 114
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a94A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2a94A02
2JD1A 1V3TA 3I1JA 2JHFA 1FK8A 1GZ4A 3M1LA 2E48A 2GO1A 2I76A 2HO5A 3FR7A 4F46A 2EF1A 5T6BA 1K6IA 1PJBA 3UICA 1EE9A 3V1TC 3PGJA 1UXIA 4XDZA 1Y1PA 1JLLA 5EQDA 4M1QA 1HE2A 2J5RA 1WMBA 4FN4A 4GPD1 1HYHA 4GGPA 4B3HA 3ZH2A 3RC7A 4CV3A 1I0ZA 2D4AA 2CF6A 4FS3A 2YFHA 1PQUA 5F1OA 1RM5A 1K89A 4MDHA 3IKTA 4YT4A 2E49A 4BO7A 3ONEA 3B20A 4IJVA 4PLFA 3HB4X 3QY9A 1P0CA 4R51A 2Y1EA 3LT1A 1Q0LA 1P1KA 1YQXA 2C29D 3IP1A 3KSDO 4DWVA 4BGEA 1S6YA 4YAIA 1A4UA 1T4BA 1ZSVA 3E82A 3EUWA 2HMUA 4INAA 6LDHA 2X86A 1L7EA 4OYRA 1BSVA 1HDXA 1F8GA 4R01A 4RGBA 4RCVA 1TVEA 2HMWA 3BHIA 3HUDA 3IMFA 3RUEA 5B4TA 3ROKA 1GL3A 4D3FA 1T2DA 4BO6A 1XU9A 3RVDA 1RYDA 1GEEA 1IHYA 3T4EA 5CPFA 4CMEC 2O2SA 4J9VA 3SLKA 1GFSA 2Q1UA 4MVJG 4F45A 1DJNA 4FIZA 3TNLA 3C8MA 1MG5A 2OOSA 4CM9A 3AOEC 3HB5X 4A27A 3V8BA 1YB4A 1E3SA 2HDHA 1NFFA 3PHIA 3HDQA 4IXTA 2FR0A 3DONA 1GUFA 1I5RA 4DPKA 3RUIA 1N9GA 3NAQA 2PZKA 5TJ9A 1QLHA 4B3IA 5JO9A 2ZTLA 1X7HA 2VQ3A 3H9UA 3MJEA 5COAA 1R37A 4WLFA 5L7YA 5T67A 2V7PA 3PJEA 3KYCB 1NHGA 1SEVA 1T24A 2B4TO 4GWGA 4RPJA 2X9GA 4OQYA 4L4RA 1PGOA 4ZA2A 3BAZA 4BNKA 1LUAA 9LDBA 4XQ9A 1NWCA 3PP8A 5DOVA 1N5DA 2D0IA 1LDBA 4TRJA 3H2ZA 3CZMA 1PJ2A 2JAHA 2E37A 5DCYA 4IZIA 1PJ3A 2DTXA 5FWNA 3ICPA 4PG6A 1JA9A 2ILTA 1IPFA 4Q39A 5DOZA 1I3KA 2C07A 2I3GA 4XWYA 4K26A 2JCXA 2ZIZA 4E13A 4CM1A 3W4KA 3H3JA 3IC5A 3ZW8A 1VJ0A 1T1SA 3D3WB 3I9MA 1PZEA 3L4SO 2BFPA 4OSOA 3RU7A 3WSWA 4BB6A 1R4MB 5KTKA 4BNNA 3GK3A 2ET6A 3F5QA 3HWRA 3JQAD 4IXWA 4M55A 4QQRA 1NPYA 2O3SA 4UVDA 2Y66A 1J0XO 4PVDA 2VTEA 2EXXA 1DC6A 4PZEA 5G0WA 4E2XA 1HXHA 4N5MA 1GQQA 3U09A 3C1TA 5DBGA 5BSFA 1K0UA 3L0DA 3N7UA 3KYBA 3EAGA 2H6EA 2IODA 3DAFA 1ONPA 4I5FA 4BNZA 5HA5A 5JW6A 3VOSA 1DDOA 5ICSA 2BGLA 3FPLA 1E7RA 4BIIA 4HNHA 1TA4A 1QORA 2BELA 3L4BA 3C7DB 3U0BA 2O4CA 2I9PA 4PLVA 3DOCA 5TGDA 4I08A 2W2LD 3F9IA 3M2TA 4WECA 4OXYA 1GEGA 2JD0A 1C1DB 5DBIA 1NBOA 2G5CA 2EHDA 3CKYA 3RUDA 5BSHA 1HZJA 1BDMA 2JFHA 5JMPA 1HT0A 3TRIA 1ENZA 2NVBA 2C7GA 4FBGA 4RF2A 3I9JA 3JQBC 5JDIA 2BFAA 2X8LA 3DMYA 4CMKA 5L9AA 2A94A 3JYLA 1LSUA 2NU7A 5J23A 2BRUA 5KJ1A 2GRAA 5KIAA 3ZWBA 4I5GA 7MDHA 3AI2A 5BSGA 3RBXA 4CLRB 3F3SA 1O5IA 4CM7A 4BO0A 3LSYA 2NTVA 4H16A 2TMGA 3CIFA 3FWNA 3TWOA 2B0JA 2HRBA 1IE3A 4XYEA 3TPCA 2ZQZA 3NTRA 1EE2A 5FFFA 4W4TA 1JKJA 2Q50A 2PKQP 2PD4A 1WDKA 2X9NA 1PIWA 2VNSA 3F1KA 1ISJA 2Q1TA 3ZGYA 3SEFA 3GLQA 3WDSA 3CH6A 2X0NA 5CDUA 2H5LA 3GAZA 1QXSA 3RCBA 3TZHA 2I99A 1ENOA 5JFOA 2JKVA 4E6PA 1CDOA 4XIJA 3CPSA 1UXKA 3PQEA 4CM4A 3DOJA 4D41A 3ZWMA 4DLAA 5G4LA 5CDYA 4OOEA 1B15A 4K6CA 3NDIA 1X0XA 2EGHA 1KC3A 4GX5A 1UDAA 2V6FA 1KVUA 1P1FA 1DRUA 3ENNA 3S2IA 4XD2A 3DO5A 5JY6A 1DC5A 3UOGA 3EGOA 5JY1A 2QHXA 4JBIA 3R3SA 1WW8A 4CV2A 2X4GA 2ZKLA 1LC3A 4UUNA 2YYYA 4TKMA 4OO3A 3UH1A 4YYZA 2Q49A 1KVQA 1UDBA 2BFOA 4KQWA 1EK5A 1DC3A 3DBLA 1I3LA 2X58A 4MVJP 3JD2A 3U5TA 4KDFA 5THQA 1YJQA 2NVWA 2RHCA 4IDGA 4CLDA 4RVUA 2X0RA 4W9NC 4YBZA 5EN4A 3RUCA 1QKIA 1OMOA 1WP4A 3UKOA 5JS6A 4UAGA 4W7HA 5GMOA 3GAFA 1Q0HA 4R1TA 4TWRA 1Y6JA 1ZJZA 2EKQA 1W73A 3KEQA 5TLSA 1Z75A 1IULA 2DLDA 3KLPX 3U4IA 3OIGA 3I6QA 4DQUA 4FGSA 2DPGA 3LZ6A 1A4IA 2ZATA 5A03A 1HE4A 2WWRA 1WNTA 3LU1A 1J6UA 3QVWA 4RZHA 1BXKA 3MJTA 2VWHA 4JJIA 4CPDA 5HS4A 4DQXA 2D5AA 3JYPA 1GYQA 1GD1O 3ITDA 1Z82A 5K0ZA 3GGGA 4LMRA 1X7DA 4GQAA 4R1SA 4BO3A 1DFIA 3QWAA 1R15A 1M76A 4MOWA 2J5KA 5JC1A 4F6CA 1NYTA 3DFZA 4IZHA 3NJ4A 2P9EA 2YY7A 2ZB7A 5EERA 1PGNA 2HSDA 3A06A 3M6IA 4OXKA 1AXGA 5C7LO 3WOHA 2W2KA 1PX0A 4RF3A 3EHEA 3ZN2A 4NJOA 1F12A 2EWMA 2O3JA 3ZV3A 3WJ7A 1P1JA 2NU6A 1ONOA 4MINA 1P1RA 1LSJA 3W1VA 1RPNA 4WK6A 3H9GA 4ESOA 4JJFA 2PKQO 3BMQA 4EGFA 3ZDFA 5JC8A 2PH3A 5JAIA 3RUFA 3C7CB 2XXJA 4CQLB 3HN2A 4RPKA 3PHGA 3OJEA 1E6EA 2NSDA 1LEHA 2GR9A 4C7KA 1FJHA 5B4VA 1MFZA 4FOOA 3OHSX 3RC1A 3PHLA 4IDAA 4GBJA 5DBFA 4DBZA 3CZRA 2UUOA 5MGBA 2HLPA 4JP3A 2VHXA 3DHNA 4QT0A 3GPIA 4HFNA 4NJMA 2AQHA 1C0PA 1E0DA 2CVZA 2GZ1A 3NUGA 1TT5B 3WR5A 5I8WA 2PY6A 3AJRA 3BMOA 2EIHA 1M6WA 4MKXA 5LDHA 4LISA 3E48A 3GRKA 4LMPA 1DRWA 5A9RA 1DO8A 3FF4A 2NVUA 5KWEA 4G81A 4AJIA 4P4LA 3DQPA 1H93A 1LNQA 4D45A 5CHEA 5L51A 1HETA 4KTVE 4BNJA 1LJ8A 1JVBA 1SEPA 3KHUA 3QVSA 4LRSB 5HWSA 3UCFA 1KVSA 5KVCA 1QYVA 3V2HA 2O3UA 4BNYA 4P4GA 3WBBA 2VN8A 3O9ZA 3PQFA 4D3DA 2VZ0A 4LW8A 3RI3A 4KDEA 1LDGA 1YVEI 4CV1A 1RYEA 1JAYA 3ZWAA 2HRZA 4R3WA 1V35A 3CUKA 3OSUA 2NU8A 1IOLA 2O3TA 3GG2A 4YJHB 3WIEA 3WNQA 4CR7A 4TRNA 4RPLA 3RC9A 5IZCA 3AU8A 1P45A 4M8SA 4DIOA 1JQBA 5BSEA 3Q3CA 4R41A 5C5IA 4OOFA 3DWFA 1PZFA 3ULKA 1A9ZA 2J3HA 5K6AC 1YL6A 1DB3A 2D2IA 4H15A 2Q99A 4CQMB 4KUEA 1GU7A 1MLDA 3VH2A 2D3TA 1M2WA 3QVTA 3RFTA 3G0OA 2CVQA 2XAAA 3ZWCA 1BW9A 4NFSA 1JVSA 3L6DA 4YAKA 3E9NA 3LK7A 4W7IA 1CF2O 4XYBA 3EZYA 4WLUA 2VTDA 5AQ1A 2NM0A 1ZCJA 3GY0A 5HBRA 3DAPA 4WNIA 1IZ9A 4I5EA 5DZSA 3EVTA 4G65A 3RJ5A 3NDRA 4MP8A 4DQVA 1F14A 2BKAA 5GZ1A 3TF5A 2A4KA 3JD1A 3WTBA 5A5EA 3DR3A 1ENYA 4XKJA 4GX1A 2EJVA 1XR3A 3D1LA 4Z9XA 3RIHA 2YHIB 3M2PA 4JXKA 4YCAA 3WGYA 4IPTA 5IDYA 1YS4A 3CINA 4K6FA 2EP7A 3HFGA 3GGPA 3NGLA 3PPIA 3O8QB 4UVEA 3HJAA 5KOIA 3IS3A 1C0LA 1ZXBA 4PLPA 4IM7A 4H3VA 1PWZA 4M87A 1DIAA 4B4OA 5JYDA 3ZNNA 3EZLA 1LBEA 2X23A 4YR9A 3AU9A 1XELA 3IKVA 1UJMA 4B8WA 1PL8A 2D1YA 4Z0HO 3C1OA 4QO8A 4GGOA 3R0IA 1UP6A 4YQZA 4CLOA 4BNTA 3DBVO 2G17A 4YJGB 1LTHR 4FFOA 2VYVA 3GMDA 1YOVB 3K9QO 5TNXA 5I7FA 3RROA 2AHRA 1P77A 3WGQA 1PJ4A 2FZWA 4XYLA 3EMKA 3LF2A 5THKA 3JV7A 4DLBA 4RJTA 2BGMA 2OZPA 1SO8A 4UUMA 1LSSA 3NX4A 2EW2A 2QYTA 2FMUA 2P4QA 3WX0A 3EDMA 4WLVA 2WSBA 2J3JA 3EVNA 3PWKA 1HZZA 1EEHA 5TJHA 3ABIA 2WYWA 4L76A 4XCVA 5KVQA 1EBUA 4PLZA 4IQ0A 4FJ2A 3ETGA 1RJWA 1TI7A 3ZWNA 2B4RO 1SB8A 3HADA 1ID1A 3ZWVA 5LCXA 3GN1A 2R00C 4U5QA 3UXYA 1X13A 3PHJA 1DEHA 2O2YA 4J7CA 1DHTA 1GUYA 4R9RA 3HFSA 1AXEA 3LQFA 3MTJA 3ONFA 4CMJA 3CTMA 4OIMA 3TQHA 3VZRA 3ZWYA 4CMEA 3C7AA 1LRJA 1ENPA 4TROA 1GZ3A 4O5OA 4E5MA 4CLXA 3GPDG 4ND4A 3BZUA 3PIIA 4WGGA 4XQGA 4J7UA 4YJDA 3AOEA 4OSPA 5JCJA 5CG2A 5GZ3A 1U3WA 3WJAA 4TVOA 3KTDA 5FYDA 1D7OA 3IQDB 3IOYA 1XEAA 2X5JO 1NQ5A 1WZEA 1I30A 1CJCA 4O0LA 1ZSYA 2Q1WA 1A71A 2HK8A 4O1MA 2P2SA 2W4QA 4OKIA 4MVJH 2PGDA 3TZ6A 1FDTA 3S1LA 1PL6A 4RVGA 5I7EA 1BTOA 1R6DA 4Z0PA 4AJ1A 1OFGA 1VKOA 4BL5A 3WYBA 3HDJA 1R66A 1LX6A 1KEWA 1J4AA 1NX6A 4RV9A 4IDFA 5L53A 2LDXA 3WTCA 3DBRB 2ZTUA 3WSVA 2E6UX 3ZNQA 4CM8B 3QVOA 3UHAA 4PZCA 1C1XA 1K2WA 3DMTC 3KYDB 3T7CA 4L4XA 4E0BA 3JQFC 4RDIA 1HYGA 4FC7A 1Q7GA 4J16A 3MWDB 3BTUA 1VL6A 1JAXA 3KSUA 2RCYA 4L8VA 4LK3A 3T4XA 1HWYA 4OHUA 3MOIA 3U62A 2CY0A 2GN6A 2HKIA 1GADO 1PJQA 1XKQA 1EVIA 2QYSA 3F6YA 3JQDA 5AOVA 3EW7A 2E82A 2RAFA 3FNFA 1LDMA 1B7GO 1XWFA 2Z1NA 3OM9A 5DULA 4HFJA 4XR9A 2R6JA 1Y8QA 3H5RA 4ALJA 4DTIA 4OAQA 4J4TA 2OO5A 3JQGA 3G17A 3SJ7A 1RM3A 4JX8A 4NU6A 5KJ6A 4ONEA 2AG5A 4N54A 2VHZA 4MIYA 1Y8RA 4BNIA 3OBBA 4PCVA 1IZ0A 4Q3CA 4E5YA 1MFPA 5F5LA 5T57A 3WYCA 1ONNA 3OQ6A 4CM9D 3DDNA 3SC4A 3K30A 3H9QA 1NAHA 2EKLA 2GN4A 1L1FA 4YPOA 4N7RA 4CMGA 1Q1NA 1SCUA 1CYDA 1Q0QA 1EDOA 5DP2A 4N5NA 4Q3DA 1G0NA 5G4KA 1EZ4A 4KP7A 1VJ1A 3JQBA 4D0SA 2VUSA 5DP1A 1HDRA 3JQCA 2JCVA 2NWQA 2Y99A 3VZPA 4JNKA 4WOJA 2BLLA 3Q9UA 3TL3A 1E3JA 2O3QA 1PR3A 2YV2A 4D42A 1LRLA 2CNBA 4L9RA 4PLCA 4NI5A 4FB5A 3GVCA 4ZJUA 4JLWA 1HEUA 3VVBA 4G2NA 4UREA 3H8VA 4XYMA 4BNMA 4NBVA 1XU7A 5AXAA 5TRTA 1MB4A 3I9KA 4Y98A 5A3VA 1LRKA 3KUXA 1PZHA 2PH5A 4ND5A 4BUCA 2JFGA 4XA8A 1FDSA 4EJ0A 3GG9A 2ZB3A 4OMUA 4JK3A 2VCYA 5IJZA 5L95A 4PRKA 1EQUA 4BNVA 1OC2A 4C4OA 2J3KA 3JSAA 4GMFA 3DXFA 1U8FO 4QSMA 1T25A 2W98A 1N7GA 1E92A 1AHIA 3C24A 2V6MA 4PRLA 1EK6A 1R0LA 3D5QA 2IZZA 1P1IA 4FJ1A 4D0RA 1H6BA 2WM3A 2QRKA 1K3TA 4CL8A 2WTBA 1SMKA 1UAYA 1Y7TA 2IDZA 3SC6A 3ZNPA 2EG9A 3PYMA 4AJJA 3P5SA 4Y8VA 3QJ5A 1W6UA 3LF1A 4OL9A 2VT3A 4RZIA 3OH8A 2DTEA 2FPIA 3G79A 3QV1A 4J4BA 1N7HA 4EJ6A 4QFCA 2C82A 5ES3A 1NQOA 1EUZA 1MC4A 1NASA 3WFIA 4FW8A 5KCZA 2P9GA 1NHWA 3SX2A 3OJLA 4BV8A 1PSDA 1E7SA 2Q2WA 1PS9A 2YV3A 3DB2A 4U6SA 4W9NA 1B8UA 2JFFA 3PJFA 3RSHA 2OBYA 1ZZEA 1BXGA 4M54A 1QMGA 1V8BA 1HYEA 1JWAB 2ZTMA 2PTGA 5CDSA 2WD8A 4KWHA 3U49A 4A7PA 1OC4A 2Z1MA 4GLOA 3VVCA 1NAIA 3KM0A 3GMSA 2Q2VA 3WXBA 2F1KA 2C54A 4UVIA 4W99A 1P74A 2VHVA 3AWDA 5B1YA 4QEDA 4CMIB 3R3JA 5C3MA 1B26A 1Z7BA 5F3RA 3F47A 1PTJA 1ZJYA 2OMEA 4BNLA 3L6OO 1JN0A 4EUEA 3ZHBA 2DBZA 4CLEA 1T2FA 3ANLA 3H3FA 3KRTA 3I5MA 4YWJA 3ZWWA 1KERA 1XYGA 1IB6A 4MJLA 1O6ZA 3ZV4A 5KVVA 4XEHA 1BVRA 1NQAO 4R5HA 4KMSA 2A35A 4WLOA 5G0SA 4XGKA 4Q3BA 4NQZA 1U2DA 1Y9AA 4CR8A 1RKXA 5H83A 3TDKA 1MC5A 3E8XA 2VUUA 4FFMA 1T2EA 1DPGA 4QUKA 5U9CA 1DIHA 3W8EA 1CETA 5TC4A 2XF8A 4DIFA 5AYVA 4NK4A 3VZQA 5ITVA 1UAGA 2FR8A 4P38A 4CUKA 1U7TA 4IBOA 4AJHA 5IAAA 3CSDA 3UFXA 2HJSA 1J49A 4J43A 5I8ZA 1H0KA 1LC0A 4R68A 4FC6A 1BVUA 1GV1A 1E1MA 3VPXA 5DCWA 1W8DA 3PXXA 4YAJA 4D43A 4DC1A 1TEHA 2I67A 3O03A 4IJUA 1V3UA 1DC4A 3WBFA 1E1NA 4KOAA 3G1UA 1YB5A 5IN4A 2O4UX 5A05A 1C3VA 4R69A 2GZ3A 2DVMA 1LLQA 3LDHA 2Y1OA 2O7QA 1ZIDA 2V6GA 2QZZA 3DAGA 4B7XA 4BGUA 3ZHXA 3MJCA 1N9GB 1SNYA 4O6VA 5CDTA 2FPPA 1U5AA 2PNFA 3DZGA 3PFWO 3K6JA 2CDCA 5COBA 3AM4A 4IUYA 9LDTA 1Y9EA 3KBOA 3KO8A 4L75A 4XGIA 1R4NA 5IFLA 3FSRA 1MA0A 4A10A 2Y1FA 3S2GA 3S8MA 1VI2A 1NP3A 1E5QA 3OECA 4F3YA 3DC2A 3VPSA 2LDBA 4OQZA 1E77A 1B14A 3LC1O 4IQ8A 4CLHA 4IS2A 4HFMA 2YDYA 3K5PA 1PJSA 3HDHA 2FHSA 5JYEA 1SPXA 5I9MA 4A26A 4J1QA 3P7MA 4UUOA 4EDFA 1QYCA 3AM3A 1CEQA 3Q9NA 3RKUA 4CUJA 4YJFA 1PQPA 3QLJA 1O8CA 2YQ5A 3UW3A 2GGSA 4CM5A 1B3RA 1B8PA 1H5QA 3COSA 1DLJA 3K96A 2G1UA 2VRCD 2AG8A 5TT1A 3JQ7A 3VPHA 1QP8A 3ZV6A 3V5NA 5L7TA 1A7AA 3CEAA 2Z5LA 3L9XA 5AXBA 1LDEA 1N8KA 5A9SA 4CQMD 4GVXA 3KXDA 5L45A 5L7WA 4CV0A 1BRMA 4AJKA 3WLEA 1VSUA 1YJ8A 1LQUA 2HK9A 2OFPA 4GLLA 4NZ9A 4TRMA 4AJ2A 1QLJA 3NTOA 4YT5A 5A02A 3ASUA 3B1KA 3U9LA 2VT2A 3PDJA 1AUPA 1A72A 2Y93A 4AJNA 2NQTA 2QRJA 4HKTA 5BNFA 1FXSA 1HDZA 4A5OA 1PGJA 1VSVA 1Y5MA 1SC6A 2OORA 4J0EA 1U9JA 5EPOA 4NFYA 2PR2A 1AN9A 2VNAA 4R4JA 3VZSA 4DMLA 2X5OA 5ER6A 2PFGA 3GF4A 1T2AA 3ZV5A 3LLVA 4HBGA 1XDWA 1ZH8A 4B7CA 4BO8A 3BXXA 4E32A 4R3NA 4GKBA 4Y67A 2ZJ1A 4ROSA 4UULA 4ID9A 2P68A 3P19A 3BMCA 3JQAA 4JBHA 4DREA 4N18A 3C85A 1D1SA 2VWPA 5CP8A 3G49A 3OFSA 3ANNA 4CMAA 3GH3A 1E7YA 1QRRA 1RWBA 4J2OA 1ZXLA 3BHMA 4PGFA 3RFXA 2AEFA 2Q4EA 1XCBA 3ZW9A 4AG3A 4QXMA 3D5TA 1N1GA 4BOYA 3BTOA 3ICCA 1Z74A 2V65A 3PEFA 4P4NA 2ZTVA 3NT5A 3AUSA 1YKFA 4CM4B 1DBVO 5KKAA 3STHA 2IE0A 2FPGA 1ZSNA 4E30A 1GDHA 3GNTA 2FSVA 5CFZA 3LC7O 5EL0A 4YQYA 2W2LA 4DMMA 3GDOA 3RD5A 3E18A 2R00A 1H9BA 4H7PA 5CDGA 3E9MA 1VRWA 2Z95A 4PG5A 3DHEA 4FDAA 5FI3A 2OXIA 4RQTA 1K6XA 2DFDA 1HDYA 3LT4A 3VH3A 1M6HA 2POQX 3IP3A 1BGVA 3W8DA 3MJVA 5LC1A 4DYDA 4GWKA 4MIEA 4IJWA 1ZW1A 1DJQA 5L3ZA 3DBLB 3F4BA 3E5MA 3VC7A 5I7SA 4EJMA 3SVTA 1H94A 4XQEA 1E3WA 3PJDA 1FMCA 2WE7A 4YRDA 3K2EA 3WG9A 4AVYA 4IDBA 4DXHA 4DBVO 1RM0A 3QP9A 1O9BA 3GNSA 4M49A 3WGTA 3AUTA 1NNUA 1UP7A 2Q4BA 3ZCXA 1E6UA 1U5CA 1I10A 2FY8A 4FFLA 1XQ1A 3QRWA 1PS8A 1Z73A 1GQ2A 3AI1A 2FN7A 1T4DA 1ADGA 3ZWPA 1CWUA 1DHRA 3V1YA 3H65A 2AW5A 1KIFA 4NBRA 5KVSA 4I1IA 1IY8A 2QRLA 3VHRA 3OEWA 1AHHA 1NVMB 4NIMA 3RU9A 3JQFA 2B83A 4D79A 5AXDA 2EERA 2NQ8A 3NEPX 2AQIA 5EESA 1UR5A 2GN9A 3GVIA 4J0FA 1KY5A 2B5WA 1BHSA 3WFJA 1IYZA 1X14A 5T64A 1JU9A 1OZAA 1X15A 1D3AA 2NLOA 3W4IA 1U4OA 3JQ9C 4WLEA 1MUUA 4MVJF 1OOEA 1EBFA 3FD8A 2AEMA 4LVUA 4E12A 1B2LA 1UDCA 2C20A 3S2FA 4KQXA 4I9UA 3JTMA 4QO7A 5JDIC 4J2HA 2V6BA 4DIBA 1V9LA 4NMHA 4ZD6A 2DU8A 2VWGA 3BMQB 4KTTE 2UYYA 2X22A 4MVJD 3H6KA 5JCJD 4B7UA 4CMBA 3TJRA 1PEDA 4E31A 3JQ6A 4BKOA 3F46A 1T26A 3D64A 3HQ4O 2EGGA 2Q45A 4ZQHA 1ZVMA 3ASVA 4RLSA 2GF2A 1QG6A 3FTNA 4I9HA 1DFGA 2P5UA 4NJMB 3ZHYA 3DBHA 4NK5A 4GSKA 5IG2A 4KWIA 4ZHSA 4JN6B 4BO5A 3AY7A 2FOIA 3BMOB 2BI8A 3I4FA 2OL4A 2WD7A 2DFVA 3K92A 1UZNA 1YH3A 3GC6A 3TSCA 3N58A 1MGOA 3H7AA 3JQ8A 4J6FA 4E3ZA 2G76A 2NVUB 1I36A 3AUAA 3DTYA 1MX3A 1ZMOA 1NPTO 4B4VA 4LCEA 3QWBA 1ORRA 5B37A 3HZZA 4URFA 2H1SA 2WYUA 3BMNA 5JE8A 2PV7A 3OETA 5KKCA 3IAHA 3AFMA 2WDZA 1P3DA 3ANMA 1GTMA 3OQBA 3IUPA 1E7MA 1EDZA 3OP4A 5A5FA 1EVJA 1KEVA 1MV8A 1I3NA 1LU9A 3WQSB 2EKPA 2OP0A 1CRWG 2QQ5A 4J3FA 3PHHA 3GT0A 2DBQA 4YAGA 4D44A 1GV0A 4PG7A 1O89A 3FI9A 3WS7A 2O50A 1GYRA 2CD9A 1LA2A 1FDVA 3JD0A 2X1HA 2O48X 3OIDA 3I3OA 4JJGA 4B4UA 2IYPA 1XQ6A 3WGIA 1CERA 4U7WA 1U3UA 2EV9A 2FSSA 1UZMA 3ZWOA 3ZU5A 4ND1A 2HMSA 4ZICA 1U28A 1BW9B 1HF3A 5JDCC 5DNAA 3ZU3A 2VWQA 3EY4A 4GH5A 3ZWXA 2WEKA 2BMAA 3V1UA 2BH9A 3RASA 1ISFA 3H2SA 2BHLA 3I6IA 3RBVA 2FWMX 2YUTA 3WMXA 4RVFA 2DAPA 4CR6A 2I66A 3GZNA 3VAZA 1E3EA 2VOEA 4BO9A 1A5ZA 1IUKA 2RHRA 1WDLA 4NPCA 5BQFA 3VTZA 1VE9A 4TKLA 4FFPA 1Y5RA 2Q3EA 2I3AA 4OJNA 3RFVA 4CM3A 2C7VA 3WNVA 4LSWA 4PIVA 2Y1CA 1YQDA 1H6DA 2CUKA 4ZVVA 3DZKA 3I9NA 1LLUA 2D5CA 3Q0EA 4UEKA 5HRUA 3INTA 3ENKA 4CODB 1WLYA 1B3BA 3PQDA 3ZU4A 1R0KA 2CZCA 2YJZA 2VYND 3K2BA 5A4DA 3IUSA 2ZJ0A 4CLOB 3ZHZA 3S55A 3DHYA 2IZ0A 3M1AA 2CSUA 1VJTA 4IMRA 2JHGA 5H81A 5ICMA 2FRDA 3DZJA 5COQA 2W90A 3PDUA 1MG0A 3OA2A 3UCXA 3JYNA 3QSGA 5EJ2A 2EEZA 4NH4A 5TQVA 1XIVA 4RPGA 3WQQA 2C0CA 2IXBA 5JO0A 5JAQA 3LT0A 2CF5A 3QHAA 2Y0CA 3TFOA 1ML3A 5EINA 2BGKA 2PZJA 5IDXA 1V6AA 4FPXA 3D4OA 1B16A 3GNQA 2AE1A 3DFUA 4TSKA 4XQCA 1WAMA 2AQ8A 2YV1A 2O23A 3NDJA 4PLWA 5FF9A 3DL2A 3NJ8A 3GVHA 4J4HA 2WYVA 1ZKMA 1O94A 1H2BA 3LLSA 4LVCA 4JBGA 1G1AA 3OJOA 4G5HA 4GVLA 1C0KA 3B1JA 5A9TA 1F8FA 1CIVA 3OICA 3OEYA 4GL4A 1ZK1A 3I9OA 1O0SA 4GMGA 1ULUA 3SJUA 2IEBA 2YFQA 4FCCA 3VH1A 4BO2A 4IINA 3JQEA 3GFGA 4AJPA 4IMPA 4DVJA 1MXFA 3GHHA 1HKUA 3NGXA 4CUZA 5I9NA 3WGGA 2QZ9A 5JCXA 3CE6A 1PR9A 2YHUA 1S7CA 3LYLA 1QV6A 3FWZA 3PJGA 4XJSA 1M66A 5L40A 1PJLA 1VPDA 4NBWA 1BWSA 1EUCA 3MJ4A 3K31A 4NBTA 3TOZA 3MJSA 4RQUA 2H63A 4J7XA 3GOHA 2W8ZA 2H9IA 3NYWA 5IXSA 5L4LA 3V2UA 2WJPA 4WCFB 2B37A 4PZDA 2B35A 2P4HX 4E5PA 1KC1A 4PLGA 4OM8A 3KZVA 1KS9A 5U1PA 4QX6A 3F1LA 8ADHA 5K9ZA 1E1KA 1UXGA 2GERA 3DTTA 3I9LA 1C1XB 5CEJA 1HE3A 4BNFA 5A3JA 4PG4A 3BIOA 3W6UA 3UF0A 2IXAA 1I2BA 3UN1A 4B4WA 3BHJA 4K9DA 5G0TA 4BB5A 5FI5A 4NHEA 1DSSG 5BNTA 4XX0A 3JCZA 3VKVA 4Y6RA 2FZEA 1GPDG 3PWSA 2E4AA 5TSDA 1QYWA 4I8XA 2A9FA 5ENDA 2EJWA 1DOHA 2JD2A 3ZI0A 1IHXA 2Q1SA 1PL7A 1N1EA 4Z3DA 2IZ1A 3JYQA 1Y8QB 3O26A 4U0KA 1HSOA 1EQ2A 3JQGB 2TMDA 3C3XA 3KETA 5JPIA 3WWYA 4YA6A 1J5PA 4Q3AA 1Q2XA 4BV9A 4I5DA 1Y8RB 2EP5A 3QW2A 4U8GA 4E21A 1FDUA 1Q7CA 1N2SA 2Q46A 2QIOA 3KEOA 1PJTA 3H9JA 1QSGA 4R9SA 5GY7A 2O7SA 2X7HA 4WUVA 3KYCA 5GZ6A 3VKUA 2NTJA 2ZCUA 3GGOA 4J1SA 4LGVA 5C7OO 3HHPA 3PYLA 3DZBA 4BKRA 4KUGA 4K28A 5G4KB 1KETA 4Q3EA 2O3RA 3K73O 3F5SA 4OXNA 1V3VA 5JAMA 1YQGA 3RUHA 3GRPA 1YDWA 4CL3A 1TLTA 2I6TA 3UUWA 3QQPA 2UVDA 2HU2A 3GEMA 4B79A 1HDOA 1UXHA 1ZNQO 4ALKA 4ZN6A 1IL0A 3D3WA 4RVDA 2GUGA 2GYYA 2QW8A 4XRGA 1HDGO 1OAAA 1GCOA 3GVPA 3FN4A 5DF1A 3WLFA 1R4MA 1B0AA 1PGPA 3OQ1A 5C7IO 4BS9A 4L74A 5T8KC 5L4SA 5ENVA 3IJRA 1QYDA 4DGSA 4E2YA 4ZGWA 4GAEA 2PZLA 1QYXA 3ST7A 1KYQA 3DOOA 1YB1A 1P1HA 3X2EA 1L7DA 1Q7BA 2UV8A 4A2CA 1FF9A 2P5YA 4YRBA 3QWFA 5JMWA 2BFMA 4EEXA 3BTSA 5EMHA 3U4CA 5MDHA 1U3TA 2HJRA 4DLLA 5BT9A 4EYEA 1DIRA 4M89A 1EUDA 1YXMA 2DBVO 1VL8A 1M67A 3TZKA 5BNIA 4RO0A 1KVTA 1SOWA 1WDMA 1C1DA 1R0SA 2B36A 2Y1DA 5EQFA 2GNAA 3FNHA 4AJEA 1BXZA 1LDYA 1YL5A 1ZO8A 1NFQA 3WGOA 1DLIA 3VPGA 2F00A 2Q2QA 4O63O 3A9WA 1HLDA 1DAPA 5EIOA 4UEOA 3INRA 4MVJI 4R5MA 1V0JA 3RJ9A 2ZQYA 4ITUA 4WCFC 4X54A 4ALMA 5KJEA 4J9UE 4TQGA 1E7QA 4WLNA 1I24A 5IDQA 3PTZA 4BNUA 1CQIA 2DUUA 2EW8A 1BXGB 2GDZA 3PYXA 4D46A 1F0YA 4CLRA 4J1NA 3A4VA 4Q3NA 4B8ZA 5JNLA 4J90A 4IS3A 4FGWA 3GFBA 1PWXA 2NV6A 3PK0A 4BNGA 2PWZA 4BO1A 4Z0TA 1YRLA 4Z9YA 2NADA 2X9VA 3VPFA 4XZ3A 1AE1A 1BDBA 2UUPA 4Z9FA 3UCEA 4IDDA 1ARZA 3BYZA 4Z3KA 4RF4A 1CQJA 3CMCO 4W82A 5G0UA 3INGA 1GPJA 2P9CA 1PJCA 3WICA 4HUJA 1NWHA 3A28A 2XXBA 1NPDA 1H2HA 4PVCA 3SXPA 1I33A 1UH5A 5HS6A 2JJYA 4MP3A 4PG8A 4LN1A 3EC7A 3NKLA 2BF7A 3NRCA 2GZ2A 1I2CA 4I9NA 4BMSA 1G6KA 4EBFA 4TZKA 1AGNA 1X1EA 3JQ9A 3ITKA 1LI4A 2IYOA 1WZIA 3I52A 2PZMA 3PFFA 4FOSA 4YT8A 1X0VA 3V2GA 3RAJA 2C59A 2VHYA 3EK2A 4IQGA 5DDIP 3IIEA 4P8RA 5IDWA 1ISHA 2PD6A 4NDNE 2QX7A 4C7JA 5TS3A 4OH1A 3Q2KA 3ROQA 4A03A 4GX2A 3T7EA 2YQ4A 3O4RA 4L4SA 4XJTA 2VHWA 3GDGA 4HV4A 1E3IA 3JD4A 2J8ZA 1YL7A 1Z6ZA 2X6TA 4IIUA 3MCVA 4BMVA 4U6QA 3I4CA 4R16A 3AOGA 2BD0A 4DYVA 5B4UA 3AM5A 1D4FA 2OBNA 4DRYA 4XDYA 4DPMA 1ZFNA 3I23A 1ISGA 3MEQA 4RVSA 1BMDA 5H82A 4E5KA 5A1TA 5JSFA 1MP0A 3PZRA 4MIOA 2NACA 1R4NB 2AQKA 2WE8A 5LDGA 5A06A 2AEJA 4AICA 4RORA 3ZZNA 2OGUA 1ZK0A 2GN8A 4R54A 4BO4A 2BI7A 3MOGA 4J49A 4EUFA 3ONDA 4PLTA 3E5RA 5CAEA 1PQWA 3QWIA 4Q9NA 1VLLA 5ER9A 4WE3A 2JCYA 4FFNA 3L07A 3TFQA 4XB2A 1O95A 4S1VA 3FBGA 5ILGA 3PVZA 1LLCA 5F5NA 3U4HA 3KOUA 4WJZA 1MXHA 1RM4A 4K1LA 5DCUA 3GUYA 4MO2A 4F6LA 1YBMA 5JAZA 5JXWA 3KLMX 4L0QA 3N74A 3U4DA 2VZ9A 2DUWA 4E4YA 1SB9A 3QE3A 4FFRA 4YACA 3RUAA 3FRJA 4YJFB 3HE3A 3KB6A 3OIFA 1NM5A 3OA0A 7ADHA 4W6ZA 1LLDA 3PRJA 3E6AA 2CVOA 1JKFA 3JQ7B 4QFDA 1P9LA 2AA3A 2AXQA 2PLAA 4ND2A 4YRAA 2A92A 4GX0A 1H6CA 4IY1A 1TT7A 5JLAA 4CQLA 4YTEA 5F1KA 3OJ0A 1SOVA 2IRWA 3HNPA 1U1IA 5A9SB 3ADPA 1UUFA 4N5LA 1P31A 5JDCA 3FR8A 2OUIA 5AXCA 4A73A 3LVFO 2WMDA 4ZQEA 2Y68A 2FP4A 1H9AA 3E1KA 1YBAA 1ZK3A 1YO6A 1WPQA 3GUCA 3W6ZA 4CMHA 1TT5A 5A04A 1ADBA 1R12A 3Q6IA 3ZU2A 2HK7A 3JYOA 1E7WA 1QR6A 3GVXA 3LC2O 5G2OA 1YONA 4NBUA 4RDHA 4MKZA 3RC2A 2ZYAA 3W8FA 3IL2A 4J1TA 1YWGO 1KBZA 1OI7A 2J6IA 2CDAA 4S3MA 1ZK4A 3AY3A 1XA0A 5TF4A 3UVEA 3GDFA 4A0SA 2DM6A 1GYPA 3BTVA 4HADA 1QV7A 3AY6A 1WXDA 4DUPA 3G1TA 2VZ8A 1ZMTA 2I5PO 3X2FA 4OKNA 5B12A 2GD1O 3BMCB 1NVTA 3JQAB 4YJHA 1DRVA 3U3XA 4HWKA 1K5HA 4BQPA 2GCGA 4GSLA 4PLYA 3WGHA 1GQYA 2VRCA 3TZQA 2P91A 2RBEA 4YT2A 1UZLA 1NR1A 4MPDA 3OJFA 4II2A 5G0VA 3JD3A 4GKVA 4CQMA 2VYVD 4IJKA 1DXYA 4NG5A 5CG1A 2GPTA 4LRTB 1K6JA 1ZEJA 4LSMA 5CEFA 1KEPA 2XPCA 2C2XA 4BNHA 3G3EA 1ADCA 1F06A 3DMTA 3IDSA 3L4BC 1ZEMA 1UP4A 4L73A 4UVHA 1BG6A 4WPGA 2YZ7A 4AJ4A 3TN7A 4EZBA 4M86A 5FEUA 2YDXA 3UGKA 3GN2A 4E2ZA 1D8AA 3RWBA 4KUHA 2B69A 4JP2A 4UEJA 1HL3A 1A27A 1T2CA 1U8XX 3RBZA 3WWZA 2YHIA 3ETDA 3DEYX 1LSOA 2FR1A 2DTDA 2W2KB 3FPCA 3PLNA 2X0JA 2C2YA 2D59A 1H6AA 3HG7A 3O8QA 3NV9A 4DPLA 1GY8A 2HMTA 2J5QA 2Y1GA 2ZB8A 1U7HA 2DPHA 2VUTA 4FR5A 2PGLA 1E3WB 4WOKA 4U0JA 2PK3A 2QG4A 5AVOA 5BR7A 2NUAA 3PWZA 4D3SA 3DZHA 4IGFA 2C5AA 1DAOA 3OF2A 1IPEA 3RQSA 3NT4A 5DT9A 2PGJA 3R6DA 4BHTA 1GAEO 4OGWA 4YJGA 3OMLA 5HM8A 1ISMA 4MKRA 2GSDA 1YOVA 4AFNA 4BVAA 4PN3A 4AJOA 4BKQA 4WEQA 2DC1A 1GUZA 1TXGA 2B4QA 1ISIA 1A7KA 5IN5A 4YAEA 1YBVA 3UAGA 1ZUD1 1A9YA 1U3VA 3TZCA 1E1LA 2C5EA 2J3IA 2PA3A 3D4NA 3F4LA 1T1RA 4IDEA 3WGZA 4NU5A 3L9WA 5F21A 1F17A 4DL9A 1YE3A 3HDYA 4WKGA 4ZRNA 3AI3A 1SAYA 2HUNA 1HDCA 4YB8A 2OP1A 1G0OA 4BNXA 2OHXA 3HN7A 3GQVA 4ALNA 1LDNA 4BMNA 3R1IA 3VDRA 5IXYA 1XG5A 4AJLA 1LQTA 1C14A 2UAGA 5KJFA 4IGEA 2JAPA 3Q2IA 4FQ8A 4R1NA 3TOXA 4DA9A 4DC0A 1XHLA 4IDCA 1XLTA 5TT0A 5ILOA 2PKRA 2VRBA 5JBIA 3VTFA 3D0OA 4ZQFA 4YEDA 1PGQA 1KVRA 4E5NA 4TMFA 3PIDA 4WASA 3GR6A 5IF3A 1XGKA 4JQCA 3QVXA 1Z45A 3AUUA 1D1TA 4CMCA 4XRRA 2ZYDA 4RL6A 1I2ZA 4CJXA 4BQRA 3B70A 3EYWA 1E3LA 2ZYGA 1NXQA 5KJCA 2DBRA 2Y0DA 4BKUA 1EVYA 1B8VA 3PGXA 3QWHA 3PZBA 2HAEA 4Y9DA 3L6EA 5I9LA 5CEEA 3B1FA 2AE2A 1PS0A 1W0CA 1FDWA 2UDPA 3DBHB 4PFJA 4BKPA 4QECA 3LT2A 5DN9A 4YXFA 2G0TA 4RPHA 4JCOA 2YW9A 1GR0A 1R16A 3AK4A 3D3EA 8LDHA 3ETEA 3DBRA 2WD7B 3D4PA 3P2YA 4YDRA 3JQ8B 1HRDA 4P22A 5T5QA 4CM8A 1JKIA 3HSKA 4RF5A 2IEDA 4Z6KA 3GEGA 3Q11A 3KYDA 4PLHA 4EI2A 1U2GA 1X7GA 1Y81A 4HFRA 3BMNB 1P0FA 2RIRA 3QIVA 1GCUA 1UXJA 1HTBA 4D7AA 3S2EA 5T8KA 1I3MA 2NNLD 3KV3O 5I7VA 3WB9A 3WYEA 2GASA 2HQ1A 1HSZA 3WIDA 3MTGA 1SZJG 3VDQA 5CPBA 4HY3A 1VL0A 3H5AA 1U4SA 4ZRMA 4QTZA 4HXYA 3P2OA 4KZPA 4XB1A 2X0IA 1VC2A 4AL4A 1EFKA 4MVJA 4TZTA 1P44A 1P33A 4FSHA 3AFNA 1EFLA 4WNCA 5TX7A 1ZBQA 1DFHA 2AMFA 3FBTA 2B5VA 1EMDA 4JROA 1NTOA 5K6AA 2RH8A 2Y67A 3WMWA 4E33A 3ORFA 2X5KO 3FNGA 2XOXA 4NR0A 4BGVA 1I32A 4JGBA 4R1UA 4FD3A 6ADHA 1LXCA 4B3JA 4RVHA 2CFCA 2JL1A 4CM6A 3E03A 3PLRA 5C37A 2G82A 1WWKA 1I8TA 4XR4A 3BA1A 1I01A 3PI7A 4J91A 3GZNB 4WCFA 5F1PA 4WEOA 3MWEB 1E6WA 3GHYA 1JTVA 2VOJA 3GEDA 1KY4A 3QA9A 3FCOA 3I83A 1N92A 1OBFO 1WMAA 4XGNA 3ON5A 3A1NA 2R2GA 4HP8A 4ALLA 3Q1LA 1X1TA 2I65A 1XSEA 4ND3A 1HLPA 4YVFA 2DKNA 2NU9A 1WVGA 1EVZA 4ILKA 3GA0A 4HX5A 2D8AA 3KSZO 4ZQGA 2CMDA 1JWBB 4NFHA 5IZCC 3B6ZA 1KEUA 3K8ZA 4NNJA 5U4QA 2SCUA 2PD3A 1HE5A 3FNEA 3TL2A 4II3A 2DQ4A 1KOLA 3SBOA 3DZFA 4FJ0A 1TB4A 1ULSA 2ZB4A 3E9QA 1E5LA 3ROMA 3NTQA 4TRRA 1VKNA 1JDJA 1PU2A 3GZ4A 1ZK2A 3MZ0A 3RKRA 3WQRA 1NR7A 3IJPA 4XYGA 4RLHA 3ROPA 3CMMA 4E2WA 1Z7EA 3H4VA 2HMVA 4XIYA 4GI2A 4UVGA 5IZ4A 5HTOA 4ZQBA 4Y6PA 4TVBA 1NQTA 2GLXA 3ADOA 3O38A 3FHLA 3H9EO 3H5NA 1GZ6A 4HNGA 1JW9B 1M75A 3C1AA 4O59O 3W4JA 1PZGA 2DT5A 3L77A 1ADFA 3CXRA 2CDBA 2ZK7A 3ZNOA 4MP6A 2Y05A 4MVJE 5ADHA 4EUHA 3D7LA 5ITWA 3DZIA 4JIGA 4BGIA 1YGYA 1DIGA 2HCTA 4Y6SA 1VM6A 4MVJM 4EW6A 3KVOA 1NVGA 2ZCVA 4UUPA 1DIBA 3AW9A 1YDEA 3NT2A 2NTNA 4WCDA 3SLGA 5KNLA 5TIIA 1NFRA 4BNWA 1C0IA 4LCJA 5L4NA 1W4ZA 2RH4A 3VH4A 2VYNA 2Y0EA 1SBYA 3FTPA 4ALIA 3A14A 4CMIA 4EITA 4ZU3A 4IIVA 4EEZA
chains in the Genus database with same CATH superfamily
2DWPA 2QN7A 3T8YA 4Q7MB 1USIA 4N48A 5JOQA 2JHFA 1FK8A 2PDAA 4QGFA 1ECFA 1GZ4A 4HNQA 5DGDA 2GO1A 3HJUA 3UT6A 1RKVA 3FR7A 2XWBF 2AFHB 3VR4H 1N2CB 5T6BA 1C8VB 3Q5DA 2P3LA 4F6RB 1JG4A 3PGJA 1GILA 1HRKA 1I4DD 1V3QE 3H8SA 1JLMA 3H3XA 4M1QA 4MDFA 5JZOA 2J5RA 2XTNA 4PBSA 5EEGA 3SM3A 3W5DA 4G23A 1EG2A 4FFSA 2GPNA 4NE2A 3ZH2A 5CFOA 4CCSA 4FS3A 2YFHA 4TL8A 4AUNA 1HZZC 2OSBA 4IRUB 4KPUA 4LE0A 3OPYI 2Y9MB 5GONF 4MDHA 4C29A 3IKTA 1NZFA 4M0EA 3O1IC 3WL6A 3IEMA 3WISA 3OX1A 3VHXB 2WZQA 2ZPTX 1QHEA 1JDNA 4PLFA 1CY1A 3IT2A 1QG0A 4R51A 1WXWA 4YDHB 5LQNA 1DE0A 1JH9A 1NV9A 3LT1A 1Q0LA 1P1KA 2C29D 3M4NA 4HR7A 5MGNA 4TMTA 4BGEA 4TQ9A 3HBFA 2GT1A 1RLMA 2WIBA 2PCLA 3E82A 1USKA 1UF9A 3S7TA 1GDDA 2PT7A 1SUCA 2QY9A 2WFAA 2X86A 1RFLA 3F9CA 1B6GA 4I3GA 5CDFA 4YGXB 4RCVA 3BHIA 2HMWA 5I48A 3B82A 5AICA 3IGFA 5J43A 1II8B 1H23A 2VDWA 1GL3A 3HVJA 3NHFA 1AF7A 1ZOSA 2JLSA 3CS3A 1WNFA 3FTCA 1T2DA 3KTAB 3ME5A 4RHEA 2E18A 3RVDA 2Z6QA 1IHYA 1XDDA 3T0GA 1HK7A 4YAUA 2VF8A 2NZYA 2ZSAA 3GELA 1EX1A 1SVIA 1TA9A 1GFSA 3W9BA 3C3KA 4IIJF 1DJNA 5AVYA 1TK9A 1MG5A 2BC9A 2ECFA 4GBMA 3BJMA 2G1PA 1KYTA 1ABFA 2OFWA 1QNFA 2P78A 3ZV6A 4OHWA 2VYQA 2HHJA 3PHIA 5J2TB 3HDQA 5F2KA 4Z4IA 4EGQA 1FY2A 3DONA 1R5JA 1FP6A 1NJ5A 2VH5R 2EJUA 3C43A 1CY8A 1Q14A 3IILA 3PC2A 4PHGA 5FOXA 3RUIA 1L4BA 3L7LA 5JO9A 2JAQA 4RTLA 2RGYA 3Q7EA 3N3AC 4CI9A 5COAA 4MQ4A 5L7YA 5T67A 3OM0A 1XTJA 3K1AB 3Q8MA 3UJ8A 1SEVA 4MV6A 2B4TO 2FPIB 4BXOB 3P9PA 2AJBA 2FMHA 4OQYA 4ZMSA 1JFRA 3ELYA 1EK2A 1MNQA 1V8ZA 4YRMA 2RE8A 1O6BA 2PO7A 1W1WA 2KM1A 3C5WP 3ZHUA 1L4MA 1C7JA 3PP8A 4MV9A 3H2ZA 2EKZA 2JAHA 2XY4A 5AI4A 4K9OA 4XFDA 5ALXA 1VB3A 3HDGA 3OE7D 4PG6A 4JI1B 1JA9A 1N0HA 2WP0A 4Q39A 4WV3A 5E1DA 3UAVA 2CJYA 2ACKA 1I3KA 3S2SA 3ELWA 2PG3A 2ZIZA 4O2BB 3IALA 4CM1A 4R3UC 3W4KA 1TK3A 3ZW8A 4B73A 2OAP1 3D3WB 4C3ZA 3CHYA 4OSOA 4IDHA 1RWOA 2BAGA 4KXUA 2XNCA 2RGGA 3JQAD 3QX8A 4DLNA 4RZQA 2XGMA 3OQPA 4O4HB 1OXSC 3R9KA 5DNYB 1NU6A 1EWQA 1NXWA 1KRWA 4BBJA 1IIBA 3PNBA 2ZWPA 1Y4UA 3Q9LA 3A37A 1V48A 4PZEA 2XWSA 3Q7QA 3CLUC 2HADA 2HHAA 2XMBA 5G0WA 2IZ5A 2R1VB 1HGXA 2NT4A 4LGMA 1GQQA 5LJIA 5LU8A 5DBGA 5BSFA 2FB9A 3BFVA 4BMPB 1XU4A 3CUWA 3EAGA 3E9YA 1Q1EA 1ONPA 5JW6A 2JFNA 3O47A 2ICAA 5FDFA 2BGLA 3FPLA 3L1HA 1G16A 4WZBE 4BVBA 4HNHA 1BA3A 3ZJUA 3AUJB 1K75A 1VECA 1NN1A 2R86A 3DAHA 3BFJA 4UHDA 4WFQA 4ARSA 5BOSA 3H42B 3I28A 2GXQA 3EYAA 3KQOA 4UCQA 4Q9HA 3TTUA 3UAOA 3W6NA 2IZ7A 3WLIA 1F7UA 2FUCA 4L15A 1ZL2A 2WJ3A 2NXNA 2ZIVB 5AKHA 3F9IA 4OXYA 1GEGA 1K5GA 1IWPB 1C1DB 2JD0A 2PLNA 2RCNA 3DO6A 2GN1A 3CKYA 1QHGA 4G3XA 4TN1A 5DBIA 1R8YA 1QIMA 3ILHA 1ZGCA 2OTCA 4ZVOA 3RYTC 2QRVA 1N1DA 5JMPA 4ZIRA 1QP7A 2P6NA 4QU5A 4AIIA 4L5BA 1ENZA 2NVBA 1XRNA 5D3KA 1X1AA 2VLBA 2ZJ6A 4RK7A 1TPZA 3T41A 2CGEA 2HCRA 4HNVA 1JHPA 5MN4A 3R3WA 1H0HA 5BW8A 3QGMA 1ZRHA 1OH7A 1TZJA 2JHAA 2NU7A 2Q7XA 2WF9A 4IYRA 2KX7A 4LI3X 1ZZGA 5CLLA 4ZXFA 1IZ7A 1WDWB 1REQB 2VJMB 5SYNA 2GRAA 3UGQA 5J23A 5EIXA 4CTMA 1NU8A 2ZRQA 3QFTA 1Z9BA 2H5JA 4TGLA 1T6NA 1YZKA 5JH7B 1WB9A 3NASA 5AT1A 1WBBA 3RBXA 3T7SA 3EIOA 4CLRB 1O08A 1ZOLA 2B5OA 3ABRB 3K16A 4H16A 4JELA 1Q7TA 3OLQA 4JX9A 3AO0B 5EZSA 1SVUA 3H2HA 4D9GA 1T5OA 2ZQZA 1MPTA 1WXHA 2HPZA 2VTVA 3GB9A 3IQFA 4FN5A 1ZN9A 4Y2VA 4G8CA 2SECE 1KMHA 3QA3E 2FPLA 1M2KA 2CXXA 2V1XA 3P0IA 4NLLA 3SEFA 4V0RA 3N39C 4FEYA 2X0NA 5CDUA 1K68A 3GAZA 1BVHA 1QXSA 3K0FA 2MSCB 1ENOA 5JFOA 4E6PA 2RAPA 2DLNA 4XIJA 4GIBA 2IS1A 4MNTA 1CQJB 1TDJA 3DOJA 3S1AB 1RWXA 3K3PA 2MSDB 3BM5A 3BXEA 4YNBA 3ADDA 5T4BA 5ESWA 4D41A 3UT5A 4DLSA 3A04A 1HLFA 1X0XA 2EGHA 4IJMA 5J5AA 2QGNA 4B85A 2XQGA 1UJ4A 2GEVA 2CLKB 1UDAA 1Z6GA 2EW1A 3DMRA 2DJIA 1I6LA 5FBKA 2OGSA 5K0NA 4DNXA 1P1FA 3VO9A 1KZ6A 3EZ6A 1ORHA 3F7NA 3TW0A 1KR2A 4AG6A 4XD2A 3L8CA 2FJUA 5JY1A 1SM4A 4CV2A 2X4GA 2DOKA 3MK31 4B6OA 3SC2B 2YYYA 5ALUA 1PNOA 2LIPA 2WWGA 4OO3A 2YS7A 4YYZA 4Q1CA 2PL3A 1TTTA 2F64A 3MM4A 3UPDA 4DJJA 1UBNA 1DC3A 3R09A 5FNZA 1I5EA 3UUFA 2RGCA 3QBVA 3U5TA 3LI2A 3OLXA 4KDFA 1E98A 2HWWA 1FP4B 2WSLA 4YIHA 1IQUA 1WG8A 2HHCA 4IDGA 1UC4B 1C7EA 1X8JA 3NIFB 4RVUA 2X0RA 3UYKA 4W9NC 5HF9A 3MUEA 4ARAA 4ZVRA 5E0KB 4GRAA 4XPZA 4ZC8A 1NN0A 5GMOA 2C42A 4DT1B 4MH0R 3OU7A 3FCEA 2R65A 1Y6JA 2ILVA 1TYCA 1DKLA 3FI0A 1W85B 4W5OA 1SVKA 1IULA 1F60A 2DLDA 2XVAA 1JFLA 3A6HA 3FKSD 3U4IA 4EIWA 2OEPA 2F8MA 2QL6A 2ZI5A 1RTKA 1YZUA 3FYUB 2ADOA 3C14C 3PXUA 3Q7TA 3SHFA 4G67A 7REQA 3U7GA 1R6AA 1WP9A 3SIRA 2OV8A 4MYDA 3LZ6A 1QHXA 3S5JA 2FWJA 4MW1A 5CA0F 2ZATA 4QDUA 3QIAA 2GVDC 1SHTX 5IS2A 1G20E 3D6UA 3D3KA 1J6UA 3GGCA 4PTYA 1BXKA 4RMGA 6REQA 2IUEA 2VWHA 1N0VC 2I7DA 3H1BA 3LE8A 4Q4AA 5HS4A 1NNEA 3IVRA 5G1OA 2GHQA 3A1FA 4FZJA 3B3JA 4ZAXA 3KUDA 2XE6A 3RTDA 1OIVA 1OY1A 3EMDA 4X1YB 3SXUA 4LMRA 4AF6A 4GQAA 4E7OA 5EZYB 4WN9A 2J5KA 2P41A 3FDIA 3JZAA 3PNPA 4YMVA 2BFEA 5CAEB 4IZHA 3IQWA 1TMKA 3Q3IA 1KI8A 5ALPA 3UHJA 4F4HA 1PLLA 2YL2A 2HHHB 2B1QA 3K32A 3M6IA 1DQPA 4Q66C 1XT6A 2CCJA 1AXGA 3MMSA 1Q77A 2JZCA 2QMQA 2W2KA 3KE9A 5ELLA 1C50A 4D81A 5E9JA 1P81A 4HDSA 2Y2VA 5E6SA 2HA4A 4FEAA 4I55A 3VC1A 3ZN2A 4CTKA 3KLNA 3EPHA 5B3JC 3DG9A 2C5LA 3WO0A 2PZ8A 3RK0A 3OM8A 3WJ7A 4HAWA 3UXMA 1P1JA 2R8XA 2W6CX 1GGVA 2XAUA 4BN0A 4EW2A 2W8BB 3T06B 4WK6A 4QU9A 3H9GA 2CXOA 2X2EA 2PKQO 1JR3A 2WD9A 4CNBA 4OGGA 4QKQA 5JC8A 2OBFA 4G86A 2SNIE 3HKDB 1YNSA 4BWFB 3G89A 2BE9A 4JDPA 3WWCA 4FHGA 4DDVA 3OVMA 4Q6WA 3PHGA 3TRJA 3QPUA 5K0FA 1E6EA 2Y92A 5IAEA 5GV8A 2VAXA 1YUBA 1F5SA 1RIIA 2CJPA 5B3AA 1I94B 2PJZA 4IF4A 2A5YB 3U3OA 5ALZA 3WIOA 2D54A 2FPWA 1WOYA 2HLPA 3O8NA 2VHXA 2MSKA 1P19A 3RSQA 1CQWA 3ANTA 4Z51A 3EF1A 3OZDA 2HWYA 1BDIA 1E3TA 2D1SA 4UBMA 2CVZA 4A92A 1URPA 4NH0A 2GZ1A 2REQA 3LXUX 3EDCA 3NUGA 4JVNA 2YCLA 3OPVA 2CFIA 2EIHA 1OGJA 2FPSA 4MKXA 4QXOA 5LP6B 3MAGA 1GG2A 4BE4A 2VSXA 1ZM7A 1M2VA 5E2BA 3V42A 2W9XA 1CK4A 5L51A 5CHEA 1RABA 5FO0A 3E7WA 4TXHA 1TQHA 1XP5A 2A5JA 1JVBA 1SEPA 2F7SA 4MQBA 4R1LA 1RJGA 1P2FA 1N6RA 4UQLA 1KVSA 2ZI6A 3QYAA 4NU8X 4XB6B 3LIPA 2O3UA 3N2ZB 4ED9A 4REQA 3C6ZA 3WBBA 1X3SA 1U31A 5FEMA 4CT4B 3PDIB 4D3DA 1EU1A 4N76A 1US8B 2H4JA 4R9UC 1JR4A 1LDGA 4NAHA 4B80A 1YMVA 3T7DA 5GIOE 3I73A 1NP6A 5CT9A 4BNDB 1FW6A 3ZWAA 2OGTA 3CRZA 1V35A 3DHVA 1UOQA 1XZPA 3ESRA 3OSUA 4CTNA 1Q1AA 1W25A 4U00A 3IA2A 4TRNA 1J9ZA 1Y4ZA 2BUCA 1Z5GA 4RPLA 5IZCA 2QT9A 1P45A 3AIOA 3IMGA 2B7BA 2YJ6A 9GPBA 3Q3CA 3V46A 2OBLA 2WOJA 3QU5A 3PUIA 3QVVA 1MIOA 1VIVA 2XKJE 4FYKA 5C5IA 3ULKA 5F76A 5EZ5A 5AI9A 4DLRA 2JA1A 1DV1A 4N4AA 3FAKA 2CXHA 3FUVA 4D96A 5H5JA 2Q99A 2IIVA 1QU3A 3NVKI 1KEEA 1GU7A 3VH2A 3LQQA 2IHBA 2D3TA 3LVBA 3NWJA 2IXDA 1W29A 4KH1A 4O4IB 3RFTA 4N0PA 5IMSA 5ELMA 3PNMA 3PE6A 2FZGA 1XYVA 2WJZB 1C3XA 2B1RA 3LBYA 4JOCA 1ECBA 4AMVA 4WIAA 1SURA 1CF2O 2FSGA 4NVRA 4XYBA 4A23A 4OQPA 3H0CA 4ZCMA 1LLFA 5AQ1A 2D0OB 5KCMA 2NM0A 3LX6A 3H11A 1QGOA 3C0KA 3EXAA 3OE4A 1A2BA 1IWBB 1EVLA 1UJ6A 1RZRA 4G65A 3RJ5A 3TF5A 2G6BA 1F14A 4DQVA 3JD1A 1DG1G 5FI0B 4TZ0A 2WYIA 2J9XB 1ENYA 2ALJA 2HDNB 3CJQA 4XKJA 5JQGB 3NWEA 3EPJA 1P2SA 2EJVA 3R0QA 5I7OA 3ILSA 1A9SA 1V5GA 3STXA 1C80A 2K2QB 2V3CC 1MMFB 3CWQA 3WGYA 2ZRMA 3BILA 1QCCA 2EP7A 1WUJS 1Y48E 3GGPA 3AERB 3HFGA 4TKUB 3RVKA 5KOIA 4OFWA 3K05A 1MD9A 1PKXA 1CUAA 4LXUA 2ZJ2A 3FGNA 2P75A 5DYNA 4NKRA 5C32A 1VKRA 4QPPA 5JYDA 3ZNNA 3IE0A 1WS6A 1AKWA 3OZBA 3UOWA 1LBEA 1KH2A 1XELA 3IKVA 2I3ZA 1M5RA 5CM2Z 4Z0HO 2NUAB 5GTDA 3IAAA 4AY2A 4GGOA 1EGHA 1QWSA 3UJHA 5HK9A 1UP6A 4LECA 4YQZA 4GT1A 2AJCA 4BNTA 3K9NA 3HABA 3V55A 1YOVB 1MW9X 4TTSA 3KKOA 4G1VA 4HYEA 3RROA 4WN3A 5LJLA 1Z0SA 1P77A 3ZWKA 3DZ8A 3WGQA 1X92A 3EMKA 1RP1A 5AI0A 3VC3A 2HM7A 4XUEA 3JV7A 1A5TA 4F1KA 4Y2XA 3SIWA 1SO8A 1P7YA 2PKCA 2YWJA 4ER7A 4Z7NB 3K0BA 2P4QA 2B8EA 2F2TA 5KYVA 2WSMA 3B2NA 4PPFA 2CE2X 4GLJA 1PHRA 3ABIA 2X5NA 5ALEA 3GFTA 2R1UA 2V7QA 4UMVA 1I0LA 4IQ0A 1OT5A 4TL6A 1PSWA 1U3CA 5B55A 1EXMA 4IEFB 4L57A 4UD6A 3UJBA 3K9GA 3A2KA 1NRJB 3OOEA 3ND9A 2DUJA 3QXGA 5CXUA 1ZD8A 3QEOA 2R00C 4EAQA 4U5QA 3LUAA 2HYIC 2HNAA 3W3ZB 3UXYA 5KQLA 1X13A 1PNVA 1QC5B 2R9VA 4P32A 3MWEA 2R44A 4MKGA 1CR6A 4J7CA 1DHTA 4HYQA 2BEUB 5JD4A 2HCBA 2W6QA 4BUJA 2GKOA 2VDQB 4C0HA 2QN6A 1N34B 3ZWYA 1BFDA 1RIFA 3VZRA 3C7AA 3S3TA 3ZTWA 2D06A 3OTOB 5FL7A 2JPDA 1LRJA 2QTCA 4TROA 2Q9AA 5LYJF 1TVKA 4P4SB 4EY6A 1MIHA 3GPDG 2PMDA 4HEA6 2A2ZA 1DUVG 4OMFG 4QT4A 2ZRDA 4X8MA 1NUQA 3G8CA 3C5CA 1XZ8A 3WE7A 1ZR4A 1OH6A 3QVGA 1L4FA 3ISTA 1D7OA 4IIGA 2JB9A 3IDOA 3JAKA 1T2VA 4JC0A 4ARBA 1I1OA 2C8LA 1SUWA 4CCAA 3LCVB 2KB0A 4DHEA 1NQ5A 1I30A 3HNOA 3R9IA 4JUBA 1M2FA 1WABA 2C4KA 5FOTA 1C9YA 1QBKC 4ZHQB 3P0FA 3W78A 1SC1A 3KXLA 4UHJA 2NW6A 1Z56C 2O06A 4ZYYA 2PGDA 1CUGA 4J94A 1HA3A 2IU3A 4X6YA 1SY7A 4KOEC 2NO1A 4G97A 3U37A 4TUYB 3AF5A 1BTOA 2KI5A 2LTAA 2CBXA 3CF4A 3PE3A 3P4YA 3JARB 1J0DA 4PO3X 3UG6A 1WCIA 3HDJA 4KSCA 4NBNA 3RSFA 2B94A 4CBVA 1LX6A 3EGWA 4G0WA 2I2AA 3E7FA 3V3KA 4BTLA 1NX6A 1J4AA 3SCZA 3EAFA 3EA0A 1XD2B 1QTRA 4FYVA 1WQ1R 2LDXA 4QXRA 1MT0A 3OU2A 1SBNE 1NOJA 5L53A 2ZWOA 3GU3A 5AVKA 2E6UX 4EYGA 3ZNQA 1XP8A 3F73A 3EXEB 3UHAA 2V5UA 1NTRA 1OYYA 2MDTA 1C1XA 3F67A 1TYBE 2JLBA 3Q2OA 2ZXEA 3DDOA 3JVIA 4L4XA 3UB2A 3TNYA 3THXB 2BJWA 2F9MA 3KWJA 3PDHA 2H7XA 3BTUA 4J16A 1LNZA 3QFFA 4LK3A 1XZEA 3TSZA 4YJ2F 3FCYA 1V1RB 3HXMA 3BSSA 1Q0RA 2WSSD 3MOIA 2CY0A 1OPXA 5FPSA 3LDGA 1CUUA 4C07A 4L6AA 4B3FX 4PXYA 1XKQA 3IBGA 4H17A 4DUGD 1NRIA 3EW7A 3WLRA 3PC6A 3BOSA 2Z1NA 1SWWA 1XWFA 3EC2A 4UBLA 3WVNA 1ZIPA 5EQTA 4HFJA 2WAAA 2R6JA 4UUAA 2FU5C 5ULLA 1WMFA 2OO5A 3JY6A 2IKQA 5DN6D 1I4OA 3SJ7A 5K7SA 3FYSA 4KO1S 4Y9TA 3QENA 5CYFA 5A6SA 5KJ6A 4ONEA 4M1TA 1YGPA 2DPXA 3QTLA 1ULAA 3LMKA 4QQFA 4JJ6A 3OBBA 1ODIA 2H06A 4Q3CA 5F5LA 1IN7A 1GSHA 1JSLA 3OQ6A 4DY4A 2EQ5A 1F9EA 2OLKA 2OPBA 3GNLA 3HYCA 3K30A 3MWGA 1XJ0A 5IH3A 3PEYA 2GN4A 3VR5A 3DP7A 4ZOLF 2ORWA 3GCXA 4D4LA 1ND6A 2NZWA 2IX3A 4JI2B 3OOJA 1EDOA 4H7DA 5EE0A 4N5NA 5JWHA 1RI4A 1B00A 4RMJA 3EXIB 1JDBB 1XDSA 3ZUPA 1XAJA 2B34A 2HDWA 5JMOA 3GZJA 3JQBA 3ZJ4A 4D0SA 4MLCA 4KSBA 3TUJC 5KPJA 3ZW9A 1Z5NA 1HDRA 3BIXA 4JASB 3E2PA 1M1ZA 2JCVA 5BW5A 2QB5A 3TYXA 3VZPA 3OQJA 4JOSA 4PRYA 4JI8B 2Z57A 2FSIA 2H8GA 2EFGA 2WYOA 4NOLA 2JLUA 1B8OA 2IUSA 2BKVA 4NI5A 5LDDC 1YTUA 3KZ1E 3KQYA 1ZNXA 2K7FA 3DB1A 3RYCB 5T7BA 4U2KA 3PL5A 1DQRA 5KVAA 1XWIA 4G2NA 4WGFA 4JOBA 4XYMA 2P1RA 1XU7A 3ZJYA 3V8VA 1BH2A 5ALTA 3RTBA 5BQ3A 3E9DA 1E2QA 5KSWB 5ECWA 2NU9B 2XT6A 4L2IB 4ADSG 3D59A 1E79D 2OVFA 1ZMBA 1HTWA 3AIMA 4ZAYA 3NHUA 1VP9A 4QC2A 4PRKA 1UMDB 3UEOA 4D3YA 1E5TA 1UWLA 4YJ3F 4G1UC 3VPAA 1MC1A 1XRMA 4GMFA 3C5EA 1U2RA 2W98A 4TKVB 1EGMB 2HSJA 2I4TA 3C24A 2PWAA 3E1SA 5JI2E 1U3DA 4AUEA 2R7KA 2W58A 3REGA 3D5QA 4FJ1A 4LGCA 3PV0A 4DMFA 2XE7A 5ALSA 5AO9A 3SGLA 3TRFA 4E46A 4ISBA 1D6MA 3MXTA 2ATVA 3KVNA 1PWHA 1PK8A 4HPWA 5IM5A 5BVGB 1EFVB 3V3TA 4PYJA 3B51X 5F2NA 4DDKA 3P5SA 4GYYA 1W6UA 2BHRA 3ILXA 3LF1A 1CR4A 4OL9A 2XUJA 1P0IA 4QGBA 4RZIA 2K87A 4EFNA 5KWSA 4NJEA 1VHWA 5GINE 4LHSA 5IAGA 1JI3A 1L5SA 1ZICA 4X3OA 3EZ7A 3G79A 3HKCB 3K0HA 1YI0A 3ENWA 1S02A 4J4BA 1SU7A 4EJ2A 1MB2A 5JZSA 3AF6A 3QSYA 2CL5A 4EY3A 4QFCA 4MV1A 1MC4A 4FSXA 4MS1A 4BZZA 3WFIA 4WMLA 2QKYA 4QLOA 3FDFA 4M2LA 4OM7A 1FP1D 5FUVA 1NHWA 3IH5A 1HMYA 2WABA 1OPRA 3FHJA 1MQSA 4GYWA 4OTZA 2PGXA 4Y1RB 2V9CA 3E9CA 4M9CA 1B8UA 1RI3A 2B0CA 1T0IA 2JFFA 1ZZEA 2RKBA 3RSHA 3VU9B 2YJ3A 3PTAA 5HFJA 5HCUA 1QMGA 2BYTA 3FWHA 4ZALA 5HQTA 1GGHA 2EX4A 2G8NA 2QL5A 1EM6A 4A7PA 1EDEA 1WZUA 4DF3A 1NAIA 2P35A 3GMSA 2PT6A 2VC2B 3M89A 4KXNA 3WXBA 1LH0A 2F1KA 2PUHA 5K2OA 3M7IA 4B45A 5DISB 1P74A 4XWWA 2VHVA 3AWDA 5LQMA 4CMIB 4WUTA 4G0ZA 5BN5A 1EJ2A 1NLYA 1XRJA 5C3MA 1B26A 2I62A 5F3RA 1BE8A 3R7AA 1X42A 4HDKB 2I8LA 1EFDN 2DBZA 4D4HA 4YH1A 1VPVA 5ESXA 5KX5A 4UUBA 4CLEA 3H3FA 2H0RA 3AR2A 5AHRA 1EFTA 5KU1A 3OZVA 3TSYA 2WJWA 2ZRBA 3Q1KA 1TW2A 3MWLA 5K4AA 4B2YA 2PFKA 1JLLB 4G9EA 4LOLA 2Z3VA 1RYNA 2CYAA 3MB8A 1BN6A 5G0SA 1ZIYA 1V41E 5HZGA 3PICA 3PTLA 3ADCA 2R8BA 5JJCA 1Y9AA 2PKWA 2IDKA 2MSEB 4HBZA 3TDKA 2IGBA 2ZWMA 5IWAB 2VUUA 5FTKA 1SXIA 5HKKA 1GGKA 4FMBB 4QOEA 4QUKA 3C48A 5CDHA 1DIHA 2AIRA 1X7ZB 3W8EA 1ZH6A 1YVDA 4X90A 1G42A 4EKGA 4DIFA 2OO3A 3L8MA 1A3CA 5HFNA 2I2DA 2X19A 1Y3DE 3W5HA 2JBAA 2FR8A 1AQNA 3DV0A 4HN4B 1YDMA 1RHMA 2O2CA 4W9MC 3AJ8A 4Y9RA 1S8OA 4J0GA 2XWJI 3G9TA 3PCRB 4H7EA 4JUFA 4G5GA 3B8HA 1SVMA 1MEJA 1DG3A 3SYTA 2KE5A 4X92A 3E9RA 1GV1A 1T91A 3VPXA 2AOUA 2O0MA 4YAJA 2H52A 1SHZA 5DCWA 3LWDA 1N2GA 3WRVA 4IJUA 2I67A 3FWYA 3O03A 3QLUC 3VNRA 3ZCSA 1DC4A 5NULA 3NATA 5K3FA 3VR6A 1RU3A 2IHNA 2CJWB 2DSNA 3GD5A 3UJ9A 1SRQA 5A05A 1C3VA 1O9GA 1UCFA 1AA9A 1W36B 2RSLA 2PBFA 3RSGA 3T3NA 2K2WA 1XQWA 3LCJA 1ZIDA 4YGYA 2QXYA 2Q6KA 1GTZA 3ZHXA 4RY0A 1N9GB 1SNYA 2A4MA 3I2YX 5I9IA 4ARUA 2PKYX 2CXTA 5CM8B 1U5AA 4XD7A 2AFIE 2PNFA 3PFWO 3BE6A 2GD2A 2O1XA 3WBFA 3V7YA 4E03A 1H1LB 2ZSUA 1F2DA 3BQ9A 2O2GA 4LJKA 5COBA 2QMZA 3AM4A 1Z25A 9LDTA 2IKSA 1ECPA 3CJTA 3KO8A 3RC3A 1KYYA 2HF8A 3FSRA 1C30B 4LVNA 5B1DA 4YMUA 4GLBA 3S8MA 4NNOA 1NP3A 3R75A 3DC2A 3AR4A 2KYRA 2LDBA 4JJ7A 2XNHA 4J0DA 5LB2A 2QP3A 3OM1A 2VQFB 4FX2A 1KXJA 4IQ8A 2WB4A 4CLHA 5C8YF 4HFMA 3C6KA 3AVYA 3GCGA 4XW2A 1NKSA 2QM8A 3K5PA 3L1UA 1PJSA 4G6ZA 2J0SA 4ACBA 3CBQA 2HYDA 2G5GX 3AVUA 2Z2ZA 4J1QA 4UUOA 3I2KA 4EDFA 3AJDA 2IPLA 1CEQA 3Q9NA 1E4OA 1GU0A 4A0QA 4PQFA 3UK7A 4IAOA 4MA0A 3W5VA 2ANCA 2QPTA 3QLJA 2ZCJA 5EP3A 5AVTA 2Q41A 1T8TA 1B8PA 1N2EA 1S01A 1DLJA 3VPHA 2G1UA 2VRCD 4II7A 1IXKA 4OXXA 2YCBA 1QP8A 2CLOB 2AXPA 2W2XA 3VV3A 3ORHA 3BSFA 4Q93A 4WVLA 5B5SA 5L7TA 1EA7A 3BVPA 3H2JA 4HUQA 2H0QA 3TOSA 4CQMD 4GVXA 3GUZA 1BRMA 5FJIA 2R84A 1B0UA 2JBHA 1VSUA 1YJ8A 1LQUA 2OFPA 1AURA 1TJYA 1VZ3A 4GLLA 1Y80A 5EUBA 1M1NA 2Q4DA 3NTOA 5B1HA 1VDZA 3WLMA 3GLGB 5DNWA 4DW8A 2GFHA 4M46A 2C99A 4HDNA 4LF7B 1XLWA 4I99A 3FGZA 2HIGA 4K87A 3K70D 4OLBA 3CRW1 1E5XA 2Y93A 4FZ3A 3I53A 2AL7A 3IMCA 4XPIA 1VLVA 1HDZA 1XTUA 4A5OA 4JA2A 1GAWA 3GV0A 2OORA 2ZVQX 1CZRA 1U9JA 1EB9A 2VA8A 1XQYA 1AN9A 4R4JA 1L7XA 5EVJA 3WP0A 2X5OA 2Z2JA 4TTJA 4Q4DA 3HVUA 2PFGA 3GF4A 1ZGGA 1O4WA 5DHTA 1VLHA 3QBTA 1TF7A 4XDHA 4I81A 4HBGA 4B7CA 3RJMA 1AVTA 4LHWA 1DBWA 4UBJA 3GGDA 5E38A 5JAPA 1UBLS 2VBGA 4ZP1A 1Y33E 4CIYA 4EG1A 4R3NA 3IVMA 3LV8A 3TFWA 5CNIA 1Y5NA 5EOVA 2HBQA 4KXMA 2P68A 1NJGA 3MT8A 4NRDA 2GBPA 3GLIB 1LJLA 1VFPA 2CVFA 1BNCA 4IP0A 3HCCA 3LQYA 1JHVA 1X9GA 4B3DA 4MRMA 3A4NA 1LY1A 5E0OA 4BASA 3QPDA 3TGLA 3KWMA 2PXAA 3WYGA 4QWWA 1YCHA 3ANNA 5GONB 1EP2B 1YFKA 5G02A 3UV7A 2EAUA 2PBZA 1JKJB 3BQMB 3WL3A 4QDJA 3G2KA 4E70A 3AILA 4C6TB 1XCBA 3IE2A 5BWBA 4QJ4A 1GU1A 1S8NA 3EUFA 1T0BA 4HL6A 2G9NA 3L7OA 1FTYA 1IEWA 3WHIA 2QLJA 3BTOA 3CRNA 4PNZA 3R7WA 2W22A 1PR0A 4JI0B 3IEUA 4P4NA 1UMCA 2RHOA 4P4TA 1VIAA 2P6OA 1B93A 1FNNA 2RDMA 2BISA 2NV2B 3AUSA 3IPYA 3EXHA 4OLFA 3CCBA 4LMBA 5EGNA 5ERXA 4EPYA 4QICA 1N2ZA 2FPGA 2AZXA 1MJ5A 3GNTA 2FSVA 4MB2A 3BBLA 3GRRA 1ODLA 5EL0A 4BBZA 4YQYA 3EGDB 4DMMA 3UNXA 4FB4A 3FJ1A 4IIJB 2NXWA 3MMXA 1BCRB 1E1QD 4IDNA 1H9BA 4XLTA 1QFJA 1C41A 2L0XA 1PF7E 2IU6A 2CVPA 2C7QA 2QTBA 1WY5A 2X8WA 2EJTA 3K8YA 1L5HB 2CSXA 2C04A 3BEOA 4RQTA 1RZRD 1X80B 2ZU0C 4F7WA 4MZDA 2XLBA 3G68A 2POQX 1IXYA 1CU1A 1GL9B 3C45A 3IP3A 3W8DA 5LC1A 1H3NA 2Z0MA 4GWKA 1T5IA 1N2OA 2NV0A 2Q6OA 4IJWA 4AURA 1BGWA 1QIIA 4P3KA 1ZW1A 1M0SA 4UHFA 3C70A 3F4BA 1BD4A 3VQTA 5CB4F 1CY7A 4JLBA 3PJDA 1ZGBA 5K2MA 3RTAA 4IRXA 3DT9A 1NF9A 1MRNA 3WP1B 3NZEA 2Q3MA 2XYHA 4G89A 1QIDA 1QCYA 2EBFX 5TQ0A 1T8PA 2F4NA 2PRKA 2VIIA 2VP6A 3B3GA 4IDBA 1U90A 4N8DA 3QP9A 4L3WA 4RSGA 1O9BA 4MUEA 1J1ZA 1YS1X 3GNSA 4OHZA 1TAUA 1EVEA 1UP7A 3A3OA 4XEUA 3UFBA 1Z2EA 3IVGA 3H2GA 1R0BA 1U5CA 1YUMA 1OI3A 2DQZA 2XGSA 4A82A 3O75A 1I10A 4NICA 3S68A 1F7VA 3P8ZA 1M2OA 1NQVA 1BCSA 1QVAA 4QG3A 5I7HA 1UKZA 2HA3A 5LZ5A 1OFUX 1ADGA 2FX5A 2VUIB 4G25A 4QUAA 5F64A 4A2WA 1RC1A 1LWNA 4X5OA 1DHRA 4QJ3A 2A88A 5ALJA 3R76A 2AW5A 1Z47A 3BXOA 4URHA 1QF6A 5JT1A 2PH7A 4LY6A 1QB7A 1U0HC 1V4NA 4ER6A 2EJCA 2MYTA 2RKOA 1LBQA 5EKSA 3K20A 2VHEA 4OX9Y 4BJ6A 1AHHA 1UWKA 2X3FA 5DSXA 3ND5A 4JQSA 1OU4A 2OCDA 4Q21A 5EUMA 2WF7A 1WZNA 2V7QD 3SS7X 4C4SA 5DSTA 4JITA 2V1UA 2AQIA 4F4DA 1WLSA 3EWNA 4Q0MA 2QAGB 4OFXA 1OHHA 3MTQA 1I2DA 1Y3FE 3CLKA 4O4LA 1JU9A 1OKKA 5T64A 5EHNA 1X15A 1D3AA 3HWSA 1QO9A 2NLOA 5FQNA 1U4OA 4D8XA 2O8EB 2ZEJA 4U2EA 4WLEA 2KW5A 3REOA 1MUUA 9ATCA 4MVJF 1OOEA 1EBFA 2FCAA 2OHJA 3FD8A 2RD2A 1YDGA 1RXEA 1B2LA 3H04A 1JPNA 1T3ZA 3DNMA 1P9WA 4G07A 2PRSA 4KQXA 4M0UA 2Q4OA 1XMIA 1JSRA 2JH8A 3EOZA 4FWBA 4J2HA 4Z9AA 4A2QA 1F2UA 4YCNA 4DIBA 4EZIA 4EZEA 1JQJC 4KN8A 1M34B 4MVXA 4FXOA 3IKJA 1W47A 2NX2A 5AHOA 3TI9A 3WGUA 2Z4TA 1OXXK 4S0ZA 3LVQE 3H6KA 3QHPA 2GAFA 2PL9A 4TXLA 4C0XA 2NZVG 2OM2A 5BSTA 1ACLA 1U5BA 5EE3A 3TJRA 2DEUA 5CD1A 4E31A 2KLHA 3NH6A 5DHFA 3HP4A 1NJ2A 2KMLA 1U1DA 2YWBA 1ZVMA 3ZHOA 5HHTA 2VAPA 3ASVA 5KYYA 2GF2A 4CKCA 1QWOA 2VHUA 4JLDA 3MSCA 2JJ8A 3UHOA 4TLMB 1U7XA 5CVDA 3CLSC 3ZHYA 1GQOA 4YXWA 1B2RA 2GAOA 2OV2A 1PD1A 4DHWA 3FSGD 1E2EA 1QPGA 1IAQA 2EVWX 5KZMB 3QEAZ 3LCCA 3LTEA 1X1RA 3BMOB 3CCFA 3MIIA 2QRHA 3OOHA 3OZUA 2I1WA 2Y6UA 3DMPA 3H7AA 4J6FA 2PL1A 5E6RB 2G76A 2CD7A 3AUAA 4EBBA 1MX3A 1ZMOA 2QTHA 4B4VA 4DCOA 1KS2A 1U63A 4K2HA 2GN2A 3TAUA 4EPWA 3RODA 2JJ1A 2WYUA 3ODPA 1R10A 4I4LA 1DKQA 4KE8A 4M0PA 3TJMA 5KTRA 2AOWA 1P3DA 3TINA 1GTMA 2ATXA 3NBYC 3C3WA 4KE6A 4MI9A 2VBCA 1E7MA 1EDZA 4JJAA 4EKIA 5A5FA 1EVJA 1NL3A 4DCVA 5HILA 1MV8A 2CYCA 3PXCX 1KMNA 1RACA 3NQ41 4UU7A 2P4SA 5D86A 1CRWG 2QQ5A 2VDLB 2HLDA 4J3FA 3KB2A 2NU8B 2GEKA 4GO1A 3OC0A 2PUFA 4D44A 1R8JA 2JH3A 3FI9A 4FFVA 2O8BB 1OJ7A 1XDBA 2D1FA 4S2UA 2CD9A 5I9TA 4HEA1 4RD6A 5I4IA 1FUYB 3M82A 3G2NA 4KXQA 1J09A 4Q47A 3SS9X 5EJ5A 3FFBA 4HZGA 3BCRA 4OCZA 3ZY2A 2UUCB 1D03A 5BR8B 1OB5A 2J7PA 3Q7RA 1YC2A 3DVSX 2VF7A 2EV9A 1EXDA 3T35A 1Z4PX 4N5DA 3ZU5A 1JZSA 2GMWA 4QL3A 3DJYA 3F3YA 4ZICA 1U28A 3LOPA 1UJ2A 1VE1A 4MGIR 2PS3A 2RHDA 2Z2KA 3FPEA 3NHSA 1I9CA 4BFLA 3CF0A 2B25A 3EY4A 3SAJA 3ZU3A 5CT4A 3A6KA 4GH5A 1SXJA 2BFBB 2ZB2A 1CZLA 3OFVA 1M0EA 2PX3A 1YHNA 2BH9A 3H2SA 3I6IA 3RBVA 2CN1A 2YUTA 5K6TA 4L07A 3LFHA 1EINA 3GZNA 4TV9B 3RS7A 3AETA 3VAZA 1E3EA 2XMGA 5BSUA 1NMEA 1NX9A 5AVQA 1JZQA 1YIOA 1YU9A 1Z28A 3RGGA 3IBSA 2DFTA 1U1EA 3VTZA 2AGVA 5EYPA 2QQFA 4TKLA 1DXQA 2O1SA 2Q3EA 4JLNA 3BWYA 3HY3A 2C7VA 2DHRA 2AT1A 4JVLA 2C61A 1MEEA 2XADA 3LUPA 5I6DA 4DR6B 3DZKA 1LLUA 4KFUA 4UEKA 1HQYE 2PU7A 3SF8A 5SYAA 5JECA 3SZMA 4TV8F 2H7YA 2W2QA 3MCTA 4CKEB 4CKZA 1PSZA 3AL0C 2JGKA 1ZVJA 4KRGA 3ZU4A 2CZCA 3TVDA 2OCGA 4GRDA 1TIBA 4BX9A 5A4DA 4I8IA 3COZA 3Q72A 2P2GA 1GRRA 5TV2A 4IFIA 1D04A 1H42A 1Z4QA 3S55A 2JGAA 3TBHA 1NXTA 2IGTA 3PGMA 1WULS 3K7EA 5H81A 1RD4A 2FRDA 2A30A 5COQA 3DDZX 2GWRA 2B6NA 3KSMA 3L0SA 2H0AA 3OA2A 4JR1A 5BWMA 7AT1A 1WXXA 1FDRA 2M9MA 1XRQA 3FVWA 1GTRA 3JYNA 3QKWA 2XQKA 5EJ2A 2Q3LA 4NH4A 2W4MA 4HB3A 5TQVA 3RU2A 3UWSA 1II9A 4EMUA 4MDEA 1C9JA 2GZHA 2IH4A 3UUEA 4HNAA 5ALHA 1ATZA 1G8YA 2IXBA 4MGZR 5ALQA 5JAQA 3MFYA 5CHYA 5JO0A 1LPNA 2RBKA 4IVNA 1T1JA 1JKMA 2CF5A 3GAAA 2Y0CA 3KDSE 3R23A 1ML3A 5EINA 2BGKA 2MWMA 4DA4A 1JF8A 1IEQA 4PX3A 3GGSA 121PA 1RAIA 1PV1A 3D4OA 3VDNB 3WK8A 2O23A 3DL2A 4KBFA 4WA7A 1SKBA 5FUBA 3I76A 3PNLA 4YAOA 5JSZB 5HPYB 5C7YA 1NONA 5AJVB 3WGLA 3HH8A 3KR9A 1UJ5A 5E3HA 4LVCA 3R2JA 5FFMA 1TLLA 2IOYA 4JZYA 1HC7A 3A32A 3HR8A 1PDWA 2FPXA 2ZRFA 3GFOA 3OO0A 3L5KA 4UXIA 3I9OA 3NW9A 3QKRA 1IVSA 4RENA 3KAKA 4C7VA 1OV6A 1KQFA 1IN4A 2CFTA 2YFQA 1SXJE 4FCCA 3M6MD 3MWKA 1THZA 3JPWA 4Q4JB 4YHHB 1FMJA 3TXXA 1E64A 1UJCA 3PXDA 3PQ4A 4IMPA 5D5PA 5FBZA 3IQGX 3WL5A