2A94A

Structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Structure of Lactate Dehydrogenase from Plasmodium vivax: Complexes with NADH and APADH.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 114
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a94A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2a94A02
3PLNA 2I66A 1JAXA 4ZVVA 4ND2A 1EFLA 4YJHB 3EVNA 4WKGA 1LSJA 3EY4A 4KWHA 3CZMA 4YXFA 5JDIC 1F17A 1PGNA 2DPGA 4PCVA 1Q1NA 1D3AA 2OP0A 1UH5A 1VL8A 3GNSA 1E3LA 3IUPA 4FDAA 4IQ8A 4NU5A 4XGKA 3ROKA 2VRBA 4PG6A 1R4NA 4MDHA 2GF2A 4YJGA 3VH1A 2DM6A 4F46A 1XSEA 1F8FA 1PS0A 5I7EA 1YS4A 2GN9A 1RKXA 4MIYA 3QVOA 1PGPA 4MIEA 2X1HA 4IIVA 4GQAA 2Q2VA 4BO1A 1SC6A 4MP3A 4AJNA 4YT4A 5IFLA 3ZV5A 3BA1A 3D4PA 1T25A 3H3JA 1YDWA 4R9SA 5T64A 5HS6A 5IZCC 5KVCA 1U7HA 3N7UA 5JMWA 2HJSA 2OL4A 4L8VA 2C0CA 3F4LA 3PPIA 4RO0A 5HTOA 1E6UA 1WWKA 1I3KA 1M2WA 1NVGA 1QYCA 1Y6JA 3E48A 4WGGA 1F0YA 2D8AA 2PD3A 1VSUA 1XCBA 4BKPA 3BIOA 3GVXA 3JQGB 3IC5A 4BQRA 3TL3A 3OP4A 3GPDG 4IDGA 2EW2A 1QYXA 3IMFA 5JDCC 1GUZA 3CE6A 4FFPA 1BRMA 3W8FA 3DZJA 4BNYA 5A3JA 3KHUA 1N9GA 3QWHA 3QWBA 1U3WA 4D0RA 1GADO 1OBFO 4FW8A 4W9NC 4XQGA 4XD2A 4DVJA 2EJWA 3VC7A 3PLRA 1I3MA 1R66A 3JD2A 4MVJG 2W4QA 3VOSA 1E3WA 1A9YA 3ZW9A 5KCZA 3NEPX 4K28A 7MDHA 5K6AA 2POQX 3EHEA 4J2OA 3OF2A 3KEQA 1PJCA 3S55A 4J91A 4K9DA 2DBRA 5JCXA 2H63A 5JY1A 3B1KA 3GLQA 4YDRA 4P38A 2EERA 3IL2A 4II3A 4Z3KA 3RC1A 4FQ8A 5AXCA 1ADBA 1I2ZA 2NVUA 3IIEA 4XGNA 1ORRA 4J43A 1OMOA 5A04A 2CZCA 3S1LA 5THQA 4IXWA 2WTBA 1EQ2A 1YQXA 2J6IA 3E9QA 1JU9A 1VL0A 5JY6A 3VH3A 3WNVA 4OGWA 3WWZA 4BKQA 1HE2A 4CM9D 2PZKA 2VN8A 4BVAA 3ZNOA 3VPFA 3VDQA 1MFZA 3RUCA 1LDYA 1YKFA 1AN9A 1V9LA 5J23A 1P9LA 3EAGA 4NK4A 3BMQB 3WBBA 2YV2A 4S3MA 5LDGA 1OZAA 1UXGA 5CPFA 4IJKA 4A27A 1LRLA 3D3WB 1H6DA 3PQDA 1HEUA 3ZWWA 5JCJD 2Q49A 3A28A 2X0JA 4C7KA 3FPLA 1O5IA 2IODA 4WEQA 4NPCA 4PG7A 1ZVMA 1M66A 1AE1A 2C59A 3C7AA 1LDMA 3BZUA 3AY7A 1GQ2A 1EK5A 2HO5A 2X23A 4B4WA 4IS3A 4YT5A 3E9NA 2X9VA 2YY7A 3I4FA 4J1SA 2PH5A 1JKFA 3GN1A 3JQAA 4FGWA 3HWRA 1SB9A 3E03A 1PZFA 5H81A 1M67A 4L4XA 1HE5A 5T57A 3JD3A 2RHRA 1DFGA 2X5JO 4CV2A 3JYQA 4CMJA 2CDBA 3KETA 3HSKA 1LDEA 3H65A 1ONPA 2WDZA 3ONFA 4BO4A 1Q0LA 5BSHA 1LU9A 4Q3BA 2Z1MA 4GMGA 4DMLA 4EJMA 2VUUA 4Z9FA 3DEYX 3PHGA 3RROA 1NFQA 1RM3A 1Y1PA 4J2HA 1F14A 2DLDA 1LTHR 4J9UE 4D41A 4YWJA 4J49A 2Q4BA 1HDCA 3PYXA 3K5PA 5B4VA 4YRAA 4J1TA 1KVRA 4B4OA 1KYQA 1WDKA 4PN3A 3H5RA 4EZBA 2B36A 4WECA 1LLCA 1KIFA 3CIFA 3K6JA 1XYGA 4LCJA 4XQEA 2GDZA 1NPTO 5KKAA 2ZKLA 5ER6A 1PIWA 1UP7A 4MINA 2JFFA 1XIVA 3DWFA 4JJFA 5JFOA 2IE0A 4DRYA 1YXMA 2C82A 2Q4EA 4FCCA 4Z9YA 1OC4A 4OAQA 4CM3A 1PTJA 1DIHA 4NI5A 2XXJA 3GMDA 4AFNA 3PIDA 4CR8A 4CLDA 3ZI0A 2NNLD 3FD8A 2SCUA 4BGEA 1B3RA 5EL0A 4IGEA 5AYVA 2DTXA 1UJMA 4URFA 1ZW1A 1RPNA 1V3TA 1V0JA 3KYCA 5BNFA 1RM5A 3TWOA 3FBTA 1XELA 3G1TA 1A7AA 3BHMA 3DHNA 1ADGA 4QQRA 1PU2A 1UZLA 1WP4A 3AK4A 2YDYA 3ITDA 1ARZA 1Q7GA 3ADOA 4Q3AA 1CYDA 3NT2A 3RIHA 4BNTA 4E3ZA 3LSYA 1ZBQA 4MP6A 4MVJE 1H9BA 1EFKA 4DBZA 1GPDG 4BKUA 4JXKA 3S2IA 2WD7A 3ZU2A 1WDMA 3S2GA 4EEXA 3DMYA 5JXWA 3MOIA 3FPCA 2D59A 4IDEA 3OA0A 1BGVA 1U5CA 4KDEA 4RPKA 2H1SA 2J3KA 3JQ9C 3S2EA 4BGVA 3WGQA 1A7KA 1I10A 2X9GA 1H2HA 3WFJA 2OXIA 3FI9A 2I67A 3LF1A 3WQSB 3PYLA 3ZH2A 1R16A 1T4BA 3O38A 4QFDA 4BO6A 5TC4A 4J4HA 4TRRA 3ONEA 1Q7BA 3WYCA 5L7TA 3QVXA 2X0RA 3Q11A 4WCDA 1DFHA 1GCUA 3BTUA 1NHGA 2GN6A 4AJKA 4YT2A 1A4IA 1LC3A 1EK6A 1ISGA 2VZ0A 5C37A 2VWPA 2VYNA 1KVTA 2YV1A 4JN6B 5K0ZA 3NKLA 3TFQA 1OC2A 5A5EA 4MPDA 2JCYA 1WVGA 3WGGA 4QX6A 1JDJA 4GMFA 4F3YA 4RPGA 2QRLA 4K1LA 2P9CA 3HFSA 4NR0A 2YDXA 4R16A 1RJWA 2G76A 3WFIA 2VZ9A 4WCFC 2FR0A 2IEBA 1NP3A 2P2SA 1O94A 2ZYGA 4TRMA 1Y5MA 4YT8A 3CXRA 1DIRA 5L3ZA 4CLRA 3I9OA 1QYWA 4RLSA 3ZHXA 4B7UA 3FNEA 3U4HA 2DAPA 3VZSA 1Z73A 3NV9A 4C7JA 3U5TA 4RGBA 5IDYA 4AJJA 1LDGA 2HMVA 3PTZA 4TRJA 4CL3A 1A5ZA 1DSSG 3GQVA 4HFRA 5T5QA 3T7CA 4DTIA 4I8XA 2VNAA 1K3TA 1HE3A 4QT0A 1NFFA 3L6DA 1I36A 3AUTA 3NTOA 4AJ4A 3PYMA 3UH1A 3DTTA 4LVCA 1B2LA 3ZNPA 1E0DA 3E1KA 4GGPA 4LVUA 2PZJA 3TNLA 2WJPA 4D43A 1YL7A 2P4HX 2VQ3A 2Q3EA 4NQZA 4W7IA 5DNAA 5JYDA 4MJLA 4O6VA 4CLHA 3LDHA 5F1PA 4YCAA 3PK0A 4IXTA 1ZIDA 4YJHA 3PWKA 4TKMA 3WWYA 1C0PA 1NAHA 5LC1A 2WSBA 2D5CA 2QG4A 4MVJF 3HDYA 3ST7A 2RH4A 4Q3EA 3SLKA 3FR7A 3PDJA 5JMPA 1FDUA 4OOFA 3AI2A 4RVSA 1PJ2A 3VPGA 1SZJG 5TSDA 1HDOA 4YQYA 3EMKA 5DP2A 2O4UX 3KRTA 4PG5A 3GEMA 2EF1A 1B8UA 3FSRA 3HN2A 4RJTA 1X7DA 4HXYA 1PSDA 5CP8A 4TWRA 3PJGA 3BAZA 5KKCA 1NYTA 2B5WA 2Y1GA 4W99A 4XCVA 4OXNA 2DFVA 3LC2O 4HWKA 1H6AA 1KEUA 4YYZA 1G1AA 1UDBA 1ULUA 3D3EA 2Y66A 3QSGA 4WNIA 1ZUD1 3ABIA 1DIBA 2HMUA 3N58A 2FHSA 1NTOA 1ZJZA 2GYYA 3AM4A 5I9MA 4NK5A 1ISJA 1ID1A 4IDBA 3OQ6A 4MKZA 3JQGA 2FOIA 3EC7A 1LRKA 2GN8A 4WASA 4FN4A 1QP8A 4H3VA 5HA5A 5B4TA 4FFOA 1KC1A 2WD8A 5COQA 4S1VA 2Y0CA 4BMVA 4CUZA 3TPCA 3UAGA 3SVTA 2FR8A 3ETEA 3AFNA 1J49A 3W8EA 1I3LA 4ZRNA 4BO8A 1JLLA 3DZKA 2GN4A 4JGBA 2QQ5A 1FF9A 1H94A 4ALKA 1KVUA 1U7TA 3TOXA 4E2YA 2VTDA 3KV3O 3DTYA 1KY5A 2EJVA 1R0KA 4CV0A 2PY6A 2YV3A 4R3NA 2NU9A 4GWKA 5L4SA 1PR3A 4PLVA 3DBHB 4YJDA 2F1KA 2E49A 4C4OA 3GA0A 3GOHA 2VRCD 4L75A 4ZICA 5A03A 5TS3A 1YWGO 3HHPA 1T2FA 4NFSA 5I8WA 2TMDA 1VRWA 2TMGA 3DHEA 3Q3CA 4RPLA 3RUIA 3K2BA 5GZ1A 2BMAA 5FYDA 3NDJA 1GUYA 5BSGA 5FWNA 1YQGA 3KUXA 2NU6A 3GNTA 4A26A 3VPSA 3OM9A 3W6ZA 4Y67A 5F21A 5JPIA 2OMEA 1MB4A 3JD0A 3LZ6A 3ASVA 2BELA 5G0VA 3BMQA 3TN7A 3IS3A 2J3IA 2O50A 3P2YA 1ZH8A 2FPPA 3GZNB 3ENKA 3D3WA 2P68A 3GGOA 3WXBA 1QLHA 3D5QA 3FBGA 3JSAA 1Q0HA 2V6FA 3D0OA 4NFHA 1UZMA 3TOZA 3M1LA 2Y1EA 1GCOA 3EZYA 3VTFA 3WG9A 3M6IA 3EZLA 4QXMA 1I2CA 2OHXA 1FDTA 2HDHA 2OO5A 3RD5A 1FMCA 3LLVA 4D3FA 4ZD6A 3UICA 1PJTA 4NBVA 3G1UA 1IPFA 3TQHA 3ICCA 5KJFA 1DAOA 4IMPA 5L40A 5TLSA 4OIMA 3I3OA 4DPLA 3GVCA 2CD9A 4GL4A 5FI3A 3DZIA 1GPJA 2FP4A 4IINA 2ZTVA 2DBZA 3DONA 1DC4A 3PJEA 2AQHA 4E5MA 4UEJA 1ZJYA 1JA9A 1Z45A 2JCXA 3ZHZA 1FDVA 2C20A 3FF4A 1JWAB 1P1RA 1T1SA 3F1LA 3X2EA 5KTKA 4XEHA 4NHEA 2IZ0A 3K92A 4HNHA 1RWBA 3QE3A 3W4KA 2PR2A 4XDYA 4OQZA 3VAZA 5DBGA 4HUJA 4EITA 4RDIA 3RUAA 4QECA 5CPBA 5JE8A 2Z1NA 4XYLA 1IULA 5G0TA 1HYGA 2IDZA 4JJGA 4ZA2A 3VH2A 3ZU4A 2VT2A 4XKJA 1FJHA 1MG5A 2BGLA 1X14A 2EP7A 2FR1A 4JNKA 3L9XA 4PZEA 4ZN6A 3TL2A 3F46A 4CV3A 4CODB 2P91A 1PWZA 3STHA 1ML3A 3UFXA 4YRDA 1BSVA 4J7XA 2J3HA 1I5RA 1BMDA 2Q1WA 4GI2A 4MVJI 4U0JA 3DZGA 1KBZA 2D1YA 3NJ8A 4P4GA 4RF4A 3PQFA 4Y6PA 5JO0A 3UKOA 4J4TA 3L4SO 3WLFA 5KOIA 2WEKA 5JSFA 3NTRA 4YTEA 4MVJP 1P33A 1CRWG 3BTVA 3M2PA 2G0TA 2OBNA 2AG5A 4N5NA 5G0SA 5G4KA 5JAZA 3HN7A 4QO7A 4CQMD 4JP2A 3TFOA 3ETDA 1U2DA 1HE4A 3EK2A 4E2WA 3PDUA 4FFMA 1Y9EA 3AUAA 4NG5A 4Z0PA 4J4BA 4WOKA 1VKNA 3NTQA 2V6GA 1W0CA 3Q1LA 3WGHA 2DTDA 1PGOA 4J1NA 4CM9A 4NJOA 4ONEA 4PLHA 3D7LA 3OJ0A 3I52A 3U4IA 1JVSA 2ZTUA 5KJCA 1N7GA 1HF3A 3JQ8B 3V1TC 2WWRA 1EUZA 3GFGA 4KDFA 2QHXA 1KVSA 5JW6A 1DDOA 4IQGA 3DXFA 4KMSA 2J3JA 4IS2A 3L9WA 1AHHA 3PHJA 1HZJA 1UXHA 5U1PA 3O9ZA 3MCVA 4Q3NA 4LSWA 4E21A 3WYBA 4YAIA 1KEVA 2EHDA 3PHLA 4U6QA 4HFMA 1ZMOA 5HBRA 4DC0A 2JD2A 2BFPA 3IJPA 2P9GA 2Q45A 4KQXA 2R00C 3KYBA 3EW7A 3ORFA 4G5HA 4D3SA 2NSDA 2ZCUA 4PZCA 2E37A 3RJ5A 3R3JA 3G3EA 4BNHA 5ILGA 1KOLA 1SCUA 4EUHA 4R1SA 4IY1A 4NMHA 1B8PA 4F6LA 1EQUA 1WZEA 4X54A 1ZKMA 4I08A 1E3IA 1HDYA 2QYTA 4XJSA 2XF8A 3PGJA 5K6AC 2JKVA 3QIVA 3HZZA 4E4YA 5L45A 3W4JA 4KUHA 3F47A 3T4XA 1SO8A 2X86A 4N5MA 5EQDA 3RJ9A 2P9EA 1F8GA 4RVGA 5CG2A 1DB3A 3BYZA 4LW8A 4EUFA 4WLFA 4A03A 3GMSA 3ZDFA 2PH3A 4YAJA 3KZVA 3FWZA 5F1OA 1E92A 4BO0A 5JDIA 5TX7A 2PWZA 2P5YA 1BXKA 3RVDA 5IZ4A 1HDGO 3OECA 5LCXA 3KVOA 3VH4A 2GUGA 4M54A 3QQPA 1X15A 3NAQA 3OBBA 2UDPA 5I8ZA 1QV7A 4RQTA 1YOVB 3DC2A 1MUUA 2QIOA 1HLPA 2QZ9A 2ZJ0A 2CUKA 1MXHA 4NBUA 1LQTA 4WOJA 1FXSA 4PLYA 1LNQA 3QVWA 3GAZA 1XA0A 3C24A 4UVDA 3ZV3A 1GV0A 3PIIA 4RF5A 2ZB8A 1WPQA 1ONNA 1GZ6A 3RC9A 3MZ0A 1JAYA 2Y1DA 3HDHA 3DAFA 1J4AA 4HNGA 3RWBA 2NUAA 2HKIA 3G79A 4WLVA 3RSHA 3I9JA 1H2BA 1E7WA 2BFMA 2WYWA 4HFNA 1VC2A 5T8KA 1ZSVA 2NQTA 1E77A 3OSUA 4LMRA 5T6BA 2YFHA 3I23A 4UAGA 3E82A 4ZQFA 1DLJA 5L7YA 1PGQA 5EJ2A 1X0XA 3JYPA 3AUSA 3S8MA 3Q6IA 1SMKA 4CQMB 1N1EA 2IEDA 5I7SA 2HMTA 2E4AA 5EMHA 3SX2A 1E1LA 1X7HA 4BS9A 3IP1A 1R0SA 4UVHA 4CL8A 1EDZA 1XQ1A 2HMWA 4ALIA 3ASUA 1SEPA 3TDKA 4DA9A 3P5SA 5KVVA 1GU7A 4B8WA 2FSSA 4W9NA 2EGGA 4BO7A 2VHXA 2GRAA 2FY8A 4FBGA 3UF0A 1N92A 1PZGA 3V2UA 2YHUA 1D1TA 5BNTA 4TVBA 1LDBA 3D5TA 5DCUA 4PLFA 4HKTA 1XHLA 3ZWXA 1U4SA 1NR7A 3Q2KA 5ICSA 2CMDA 2OP1A 1IL0A 4Q9NA 3K9QO 2AG8A 3UCXA 4D46A 1VJ0A 4RZHA 5A9SB 3I9LA 4J90A 4E5KA 1OAAA 2RBEA 1EVJA 3GFBA 4CLXA 4FFLA 1U5AA 5DF1A 1I30A 1LC0A 4MVJM 3S2FA 4BKOA 3F9IA 4TZTA 3HUDA 3JQEA 3GDOA 1O9BA 3NT5A 1AUPA 4FJ2A 2BGKA 4KZPA 1N5DA 5TGDA 3UCFA 4R68A 4U5QA 3BXXA 4IDCA 4W6ZA 3RFTA 3CZRA 2GPTA 3VVBA 4QSMA 3C1AA 4BQPA 2PKQO 1C1XB 1YONA 4CMGA 3WTBA 3DB2A 1RYEA 4DWVA 4NIMA 2GASA 4YQZA 3U62A 4BNNA 3UN1A 3ZW8A 2ZYAA 3AOEC 3E6AA 4B4UA 1KERA 3CH6A 3DO5A 4CM8B 4DQXA 2Y1FA 2RIRA 4E13A 1NQOA 4M8SA 1SOVA 2IZ1A 2D5AA 1EE9A 3INGA 1J6UA 1CQJA 1TA4A 4H16A 3SJUA 4U7WA 2NWQA 3HFGA 3V2GA 1M76A 3A1NA 5JNLA 2NTVA 3AM3A 3KYDB 4A7PA 3F3SA 4JBGA 3DBHA 1I8TA 1YL6A 3DZFA 4I5EA 3ROQA 3B1FA 3LT0A 4ALNA 2DVMA 3KTDA 7ADHA 4A73A 3TF5A 3L6EA 1UP4A 4CMEC 4DPMA 2CVZA 2PZMA 3DOOA 5TJ9A 3WQQA 1PL6A 5GZ6A 3DBLB 3BMOB 4YRBA 5JAIA 4WLUA 2O3TA 1EBUA 3Q2IA 5BSFA 1TT7A 4PGFA 2ZCVA 3AUUA 4YJFB 4DMMA 3B20A 2BKAA 2Q50A 3LVFO 1ENZA 3V1UA 1P1KA 3F4BA 4BO9A 5JYEA 4DXHA 1ISHA 2DPHA 2V6BA 1DHRA 3WOHA 1T1RA 1WZIA 2DUWA 3E8XA 3ENNA 4AJOA 1Z7BA 4RDHA 1L7DA 3RBXA 5BNIA 3E5MA 1DRWA 1X1EA 3RASA 3V8BA 2YUTA 2YFQA 1LX6A 2AW5A 5FEUA 1M75A 5L7WA 5DOVA 4OM8A 6LDHA 3VKVA 2O4CA 3IDSA 1E3SA 1VJ1A 1F06A 2IYPA 3U49A 2A94A 4NBRA 1LUAA 1UAGA 5AOVA 1U3TA 1LDNA 1PJQA 4BNMA 3DAGA 3EVTA 3F5QA 5G2OA 3UVEA 3OMLA 3AI1A 3FHLA 3OIDA 1EMDA 3U4DA 1P45A 5BSEA 2H6EA 4D44A 4M89A 5AXBA 4WLNA 2ZB4A 4EI2A 4HX5A 4L76A 2JL1A 1PX0A 2DBVO 3GG2A 4M55A 3PI7A 4JROA 5I9NA 1KC3A 4M86A 4E33A 2O48X 3OHSX 1E1KA 3D4NA 1I2BA 3FNGA 5G0WA 5G4LA 1QSGA 5B37A 5COAA 2OZPA 4CM4B 4CQLB 4J0FA 4JK3A 1VSVA 3WSWA 3DR3A 2PNFA 4BNVA 2C2YA 3WNQA 1TT5B 3RKRA 4DYDA 3G17A 1A4UA 2OOSA 3FNHA 2JCVA 3RBVA 1E3EA 2YQ5A 3RU9A 3CTMA 3ZV4A 4AJ2A 4ZQGA 4BMNA 4IDFA 4LRTB 4D3DA 4D45A 5H82A 4ILKA 1GTMA 4IZHA 3VVCA 1UDCA 5DULA 2FWMX 4GSKA 3PRJA 4K26A 4GWGA 3ANMA 1SB8A 3GT0A 4EJ6A 1L1FA 2P4QA 1XU7A 1IOLA 4E5NA 3WSVA 1TXGA 3JQBA 4BMSA 1PS8A 2FZEA 2QRKA 2ZQYA 3PJFA 3QY9A 3KXDA 3ANNA 2EGHA 1YO6A 4GLOA 1PQWA 2Y93A 1Q7CA 1FDWA 4EYEA 1DHTA 4TVOA 2PLAA 3WJ7A 2I65A 1P1JA 5ENVA 3H6KA 2CSUA 1ZCJA 1K5HA 3JQ9A 5L9AA 5DCWA 4EUEA 4RQUA 3BHIA 1I3NA 5BR7A 3TJRA 2O3QA 4J1QA 3ZCXA 4BNWA 1WDLA 3OIGA 1XDWA 2HU2A 3CKYA 4K6CA 1C0KA 2CF6A 1TI7A 3RFVA 1LBEA 3DOJA 3OQ1A 1OFGA 3VPXA 2Q2WA 3Q9NA 3GUCA 4RPHA 2ZB7A 3T7EA 2JJYA 3HADA 2BI7A 1UR5A 4BNGA 3BTSA 4Q39A 2EIHA 3I5MA 2VHVA 2HQ1A 4WPGA 4CM1A 1FK8A 3JQFA 2X7HA 3JD4A 4TKLA 1XGKA 1MLDA 3AU9A 3I83A 3RFXA 1UDAA 4A2CA 4ZHSA 3H5AA 3F6YA 1X7GA 3NT4A 3PJDA 5TRTA 3JQ8A 2YQ4A 4NZ9A 8ADHA 2VHZA 3NRCA 1E7QA 2CFCA 4UUPA 4GPD1 3ZNNA 1NWHA 2PGDA 1YRLA 1GY8A 3RUDA 4AG3A 1EE2A 4ZJUA 1DC6A 1LLUA 3RI3A 2HUNA 4TZKA 3K30A 1ENPA 2ET6A 1DPGA 5CAEA 1PS9A 2NLOA 1NNUA 4OOEA 3LU1A 1Y8QB 1AXGA 1SAYA 1GR0A 5AQ1A 3ETGA 1CERA 3L77A 2FMUA 3ZWMA 3HDQA 2ZQZA 1TEHA 5DBIA 1HZZA 4XYEA 3M1AA 4BUCA 1HSZA 3ZWAA 1E5LA 1RYDA 3OEYA 4JQCA 1Z82A 4CMIB 1K6IA 3JQDA 4WEOA 4Y98A 5DT9A 2WE8A 1C1DB 4XWYA 3ONDA 3U09A 1IZ0A 3OJFA 3H9EO 5EERA 3A9WA 3UUWA 3UW3A 3SLGA 4GVLA 3QWFA 4U6SA 2VWHA 3WX0A 3EYWA 3CMCO 1G6KA 1R6DA 1IPEA 1NFRA 1ADFA 5F1KA 2PGLA 1HSOA 3GVPA 2A92A 1E7RA 2P5UA 4FS3A 1GYQA 2Q1UA 5GMOA 3HE3A 3QA9A 2AEFA 2B0JA 2HRBA 2I6TA 3LC7O 4FPXA 1X13A 2DBQA 3JQ7B 1VI2A 5IAAA 5TF4A 3DZBA 2UVDA 3GRPA 4MO2A 5IN4A 1I32A 2D3TA 4J7UA 2I3AA 1UUFA 2PKRA 4B8ZA 3GDFA 2G82A 5AXAA 2X0IA 2YHIB 4OSOA 4J6FA 4Q3DA 4LN1A 1A72A 1YOVA 3GDGA 2AMFA 1H5QA 1BTOA 3ZWCA 1YH3A 1O8CA 5JAQA 3U3XA 1IYZA 1A27A 3DMTA 3MOGA 4R5MA 2NV6A 2VYND 1VLLA 4O0LA 1A71A 3O8QB 3A14A 2VHYA 4GX1A 3GAFA 4GX5A 5IDQA 5F5NA 3H8VA 4CR7A 4Z6KA 5KJ6A 4ALLA 4DL9A 4NNJA 1DBVO 1KS9A 1B26A 2QX7A 2F00A 2PD4A 3C7CB 3OFSA 2W8ZA 2B83A 1Y5RA 1T26A 1B7GO 3C8MA 2BFAA 2I76A 5C5IA 1SBYA 2RHCA 3TSCA 3ZGYA 2GGSA 3OJEA 4FFNA 5CFZA 5AXDA 3W4IA 2GR9A 4CM5A 3FRJA 4HY3A 4CQMA 4EJ0A 4L73A 1GDHA 2X4GA 3FTNA 4PIVA 3QW2A 5EQFA 1HXHA 1IHXA 2RAFA 3MWEB 4J0EA 3JTMA 4A5OA 1VJTA 2C54A 4E32A 1PQUA 3C3XA 4N18A 1UZNA 1MC4A 4DGSA 1IB6A 4JLWA 4AJEA 1EVZA 1B0AA 1R37A 4KTTE 1KEWA 3DL2A 2AQIA 3L07A 1BVRA 2I3GA 1K89A 1KEPA 2O3JA 4DIFA 4CMBA 2QZZA 3H9JA 4F45A 2Q46A 2Q99A 4FFRA 4PFJA 3AY6A 3TZKA 3E5RA 5JAMA 4Z9XA 1T4DA 3TZ6A 2J5RA 4R01A 3HJAA 1QV6A 4UEOA 5U4QA 1NQ5A 4J9VA 4MIOA 1LA2A 3K73O 3VZPA 1YB4A 1E1NA 4IBOA 1GEEA 1KETA 1PGJA 4IJUA 4WLOA 4A0SA 3PXXA 4DREA 3R3SA 3L6OO 3IJRA 1ZXBA 3NDRA 2PGJA 4FD3A 1HDXA 3PWSA 3IKTA 1WXDA 2JD0A 2PD6A 1KVQA 1JKIA 4W82A 3COSA 4G65A 3VTZA 4DBVO 1E5QA 4E2ZA 2GLXA 2Y99A 4WNCA 3SEFA 1I33A 4L74A 4XYMA 1SNYA 3BHJA 2VWGA 3KBOA 1P77A 3ZWOA 4IPTA 3ZHYA 1PJBA 1C1XA 2GD1O 5JS6A 1NPDA 3GHHA 4EDFA 1M6HA 1B15A 1J0XO 5IXSA 4XQCA 4QFCA 3KO8A 2WM3A 2VWQA 4NBWA 1Y8RB 4G81A 2E6UX 5L4NA 3WDSA 4CM8A 2GCGA 1YBAA 3P2OA 1ZFNA 1TB4A 2JFHA 3DFUA 4CJXA 4WJZA 3L4BA 2ZATA 5CEFA 1ZO8A 1D1SA 1U8XX 1I0ZA 3UHAA 1H9AA 2H5LA 1Q0QA 3WGYA 3FTPA 3LQFA 2GZ3A 3RUHA 3H7AA 3KYDA 1QLJA 4GKBA 2JAPA 1LLDA 1ZK4A 3BMNB 4BNIA 5A1TA 4OQYA 2O3SA 2GZ2A 5K9ZA 2W90A 4PLPA 1WW8A 1C0LA 1ZZEA 1J5PA 2NVBA 3OA2A 3E9MA 2CF5A 1AGNA 2UV8A 4JJIA 1T24A 3DBLA 3BMOA 5C7IO 1XWFA 1R12A 3H3FA 2VUSA 4E30A 4YJFA 3GF4A 1ZK3A 5DN9A 2VOJA 1C14A 4KWIA 3LLSA 3GK3A 4BO3A 3KB6A 1BDMA 3PP8A 2WE7A 1DOHA 2W2LD 1BW9B 4GGOA 4PLGA 4CUJA 2Y0EA 3ZWVA 3CMMA 1LXCA 1QR6A 4WE3A 3ZU3A 1YQDA 3OJLA 4XX0A 3PFFA 4DYVA 1S7CA 2B37A 2NM0A 2VNSA 1YL5A 2CNBA 1PJ4A 4DLAA 2CVOA 3KEOA 3U0BA 4FR5A 4XZ3A 1SPXA 3O26A 1WNTA 4DQUA 4BB5A 2JFGA 4OSPA 1P1IA 2XXBA 1ISMA 4R9RA 3KM0A 4G2NA 3D64A 3KSZO 4CV1A 1EBFA 4U0KA 2O2YA 2UAGA 3DFZA 1MXFA 3WLEA 5I7VA 2AE2A 2YJZA 2DU8A 2JHFA 3AOGA 3PHIA 1VM6A 4O63O 2DQ4A 1QORA 5JCJA 2E48A 2NTJA 1BXGB 4WCFB 5KNLA 1RM0A 3WMWA 4UVEA 2YYYA 1I01A 4YACA 4ITUA 4PVDA 3H5NA 4PLWA 5CEEA 4CLOA 1QRRA 3OETA 2LDXA 2X8LA 3GHYA 3GEDA 1YBMA 3QHAA 2VYVD 1CEQA 4RVUA 5F5LA 4JBHA 4CM4A 4L0QA 4CQLA 5JO9A 4BO5A 4WUVA 3NGLA 4UREA 3D4OA 4BNKA 1C3VA 2X5KO 3NJ4A 5CDSA 1TT5A 4PG4A 1Z75A 2EKLA 3UCEA 1QKIA 3WGTA 4XRGA 3AJRA 5CDTA 2ZB3A 2XAAA 4XJTA 1KY4A 2XPCA 4NU6A 4PZDA 4TSKA 3WR5A 4ZRMA 3JV7A 4E31A 2EKQA 3RC7A 3CINA 3WMXA 1XLTA 3ULKA 3WGZA 5EINA 1GD1O 3ICPA 4OO3A 3INRA 2NVWA 5T8KC 3AWDA 2J5QA 3VZRA 5DZSA 4IIUA 4ZQHA 1GV1A 2VOEA 2ZTLA 4Q3CA 4H7PA 1MP0A 4FC7A 4OHUA 3DQPA 1HTBA 3HB5X 4ALMA 1EUCA 4JIGA 1IY8A 1BXZA 4GLLA 3QWIA 5MDHA 1X1TA 1LLQA 1LRJA 4NBTA 2R00A 4ND1A 2HK9A 1JKJA 4ALJA 4OXKA 2DTEA 4HP8A 3V2HA 4UUNA 3DBRB 3IUSA 5IZCA 1W4ZA 4ND5A 2I5PO 4MVJH 3PHHA 3MWDB 3DAPA 2HK8A 1PEDA 3LK7A 4ND3A 4D0SA 1T2AA 2EP5A 3LF2A 2W2KB 2GO1A 2PFGA 4EBFA 4BIIA 1EEHA 1QMGA 3PFWO 1M6WA 5COBA 5T67A 2AEMA 4RVHA 1U8FO 2GSDA 2BRUA 4H15A 4MVJD 2Y1OA 4YAKA 5IN5A 4UVGA 1NM5A 1B14A 5JDCA 3SBOA 2C5EA 4Y9DA 1LEHA 1O6ZA 1R0LA 1IZ9A 3Q0EA 1Q2XA 1PL8A 4W7HA 4HV4A 3GUYA 4NJMB 4ZQEA 1GL3A 4R1NA 1ZEJA 4FSHA 5I7FA 4DLLA 4OMUA 2O3RA 3RAJA 1Y8QA 2C5AA 2ZK7A 1ZK1A 4L4RA 5IF3A 1AXEA 4CLOB 1DAPA 3SXPA 3M2TA 2ZJ1A 2D4AA 4FOSA 5L4LA 4NDNE 3QVSA 3EDMA 5ADHA 2PV7A 3VDRA 3PEFA 3W8DA 1ENOA 5JLAA 3OIFA 4BGIA 1GFSA 3HG7A 3MEQA 4CMIA 3MTJA 1P0FA 5BT9A 1C1DA 3NGXA 1LSOA 4IZIA 3OICA 5FFFA 2Z5LA 1MG0A 3OH8A 3ZWNA 2IZZA 2OFPA 3H9QA 1ULSA 1MX3A 1O89A 1PJLA 3EGOA 1PR9A 2FSVA 3GGPA 2Q1TA 5KVQA 4P4LA 4D7AA 4KUEA 4XYGA 1UXIA 4D79A 3LC1O 2A9FA 2H9IA 4IM7A 4PVCA 1YJ8A 2IXAA 5A5FA 1W8DA 3OEWA 4N5LA 1ISIA 2X6TA 4D42A 5FF9A 1Z74A 3I4CA 3GPIA 3KOUA 4BNLA 3RQSA 5ITWA 3JQ7A 4CMAA 1PQPA 3ADPA 3AM5A 3KLMX 5L51A 5TIIA 5AVOA 3DBVO 4BV8A 1B16A 5KWEA 5CDUA 1I24A 2O7SA 3PZBA 1NX6A 2BF7A 3KLPX 2OORA 2YHIA 1HRDA 4ROSA 4AL4A 3A06A 3ZV6A 3Q9UA 3W6UA 4OH1A 2HMSA 2I9PA 4RF3A 3LT2A 3HNPA 3FCOA 1DRVA 2EXXA 3O8QA 4HBGA 5ENDA 2DFDA 4EW6A 1OI7A 3PZRA 2Q2QA 1H0KA 1BG6A 2NU7A 4FJ0A 4GX0A 1PZEA 4HADA 4R5HA 3UOGA 2O3UA 3NX4A 1G0NA 3QP9A 1UXJA 2HK7A 3ROPA 4YA6A 4E6PA 3H9UA 4KP7A 3RUEA 3WTCA 4TQGA 1ONOA 2ZIZA 4OKIA 4OYRA 1ZMTA 1SEVA 4PLZA 2RH8A 1LSUA 4ND4A 3OQBA 4GAEA 4R4JA 4JCOA 1V3UA 2HCTA 3BMCB 4MOWA 4Z0HO 1IE3A 4AJIA 5ILOA 4J7CA 1HLDA 4BNUA 4E2XA 2OUIA 1K0UA 4BHTA 1U1IA 3K8ZA 3VHRA 4RLHA 3N74A 4RCVA 3O03A 2Y0DA 3GN2A 4PLTA 2PA3A 3HDJA 2ZYDA 1NWCA 3ITKA 3KSUA 3GZNA 3T4EA 5A9TA 4U8GA 2A4KA 3AOEA 4BNZA 2V6MA 1WLYA 1CWUA 2OBYA 1Z7EA 1R4MB 1D4FA 1E1MA 2EW8A 3GR6A 4J16A 3GVHA 3D1LA 1D8AA 1T2DA 1EUDA 4NFYA 3BTOA 5G4KB 4CMKA 1EZ4A 2O2SA 2X5OA 1QG6A 2JHGA 3GH3A 3H9GA 4KQWA 1DXYA 3RUFA 4MKRA 4E12A 1Y9AA 4YPOA 3AY3A 5ICMA 5TT1A 4XR9A 3C1OA 2HSDA 5DDIP 4XA8A 1GYPA 5HM8A 1E7MA 4AVYA 4DQVA 1IHYA 3LT4A 1P0CA 1LI4A 1P3DA 2C7GA 3E18A 4CMEA 1WMAA 2CVQA 2EV9A 2R6JA 4XGIA 3VZQA 1CF2O 3WQRA 2IYOA 4GBJA 5CDYA 3ZU5A 4I9UA 1XEAA 4IDDA 4XB2A 3JQBC 3FWNA 1U4OA 2QYSA 2G5CA 1E7SA 4GKVA 4E5YA 1Y81A 1NHWA 4A10A 4P4NA 1QXSA 3DDNA 2E82A 1Y8RA 1JQBA 4GSLA 9LDBA 1NBOA 3FN4A 1IUKA 4W4TA 1LSSA 2WMDA 4O5OA 3CUKA 1R4NB 4YJGB 1D7OA 3AW9A 1ZNQO 2EG9A 3JQAD 4DC1A 2YZ7A 1HDZA 2DC1A 1VE9A 3X2FA 3UGKA 1JWBB 3C1TA 4CLEA 5A9RA 4CMHA 4RL6A 3RC2A 1UP6A 1H6BA 3JD1A 1HT0A 2Z95A 1P74A 3CSDA 3BMNA 4I5DA 2VUTA 1V8BA 4QO8A 5IDXA 4IQ0A 1AHIA 3I6IA 4R54A 1G0OA 3PWZA 1ENYA 1VPDA 1NVTA 4OL9A 5THKA 3GC6A 4BL5A 2C07A 3JQFC 3GZ4A 5B4UA 2XOXA 2ZTMA 2QW8A 3WIDA 5MGBA 3WBFA 3F1KA 4KTVE 4PLCA 1X0VA 4L9RA 2J5KA 2X9NA 3ANLA 3U4CA 1CJCA 4AJPA 3K31A 4CR6A 1YJQA 1NQAO 1N9GB 2VRCA 3MJCA 3FNFA 3K96A 5A3VA 5IJZA 1BW9A 1XU9A 4IMRA 1HL3A 3HB4X 4JP3A 4Y6RA 1GEGA 2Q1SA 2HRZA 3B6ZA 5LDHA 4LISA 2O23A 2OGUA 1E3WB 5EESA 3C85A 4QEDA 4XB1A 4Z3DA 5ER9A 3ZWPA 2EKPA 4IJVA 4O1MA 4XYBA 4Y8VA 3ZWBA 2DT5A 3GEGA 1PL7A 3K2EA 1H6CA 3JQ6A 5CHEA 2B4QA 3HQ4O 1PZHA 3I9KA 1NVMB 2J8ZA 1N1GA 1U3UA 4OKNA 2VZ8A 2WYUA 1T2CA 1DJQA 4BNXA 2JAHA 2UUOA 3PQEA 6ADHA 2V7PA 2FPIA 2Y1CA 1WMBA 1YVEI 3LT1A 1N7HA 2NVUB 5DP1A 2VCYA 4DUPA 5C7OO 5B12A 2VT3A 3H4VA 4FOOA 1BXGA 4WCFA 4KUGA 3MJEA 5ES3A 2WYVA 5HRUA 4IUYA 2GERA 2PTGA 3ZHBA 1DC3A 2I99A 4AJHA 1R15A 1NPYA 1P1HA 4RV9A 1GZ4A 2BLLA 1DFIA 3V1YA 1H93A 3IAHA 2D0IA 1A9ZA 4J3FA 3RKUA 5U9CA 5CG1A 4R1TA 3AI3A 3WJAA 3INTA 4RVFA 4XIYA 3TZCA 4INAA 2HLPA 1MFPA 4YR9A 1K6JA 1P1FA 3TZHA 4IJWA 2QRJA 2V65A 1SOWA 1NAIA 1GQQA 2AXQA 2UUPA 3R0IA 4PRLA 1U9JA 4XIJA 5GY7A 2VTEA 1DC5A 4LSMA 3DMTC 4IGFA 3MJ4A 5DBFA 3ZN2A 1N8KA 3TRIA 5ITVA 4YAEA 1CETA 1BWSA 1WAMA 5DCYA 3ON5A 1K6XA 3MJSA 3JYNA 5IXYA 3RBZA 2C7VA 2PZLA 3RU7A 4DLBA 5EIOA 1EVIA 4PRKA 3GG9A 5KJEA 2X0NA 3QV1A 2RCYA 4BB6A 1HDRA 2IXBA 3JCZA 4YBZA 1GZ3A 4BNJA 1YE3A 3ROMA 3F5SA 1E7YA 4LCEA 3JQAB 3U9LA 1DEHA 1L7EA 3GY0A 5G0UA 1XR3A 5KIAA 2C2XA 1BHSA 2NQ8A 4HFJA 3PVZA 1DJNA 3SJ7A 5A4DA 5CDGA 4BV9A 4FJ1A 4WLEA 4XRRA 4BOYA 2HAEA 4KOAA 5DOZA 2D2IA 3DHYA 3WYEA 3G0OA 5TNXA 3ZWYA 1MA0A 1BVUA 1N2SA 5I9LA 1NQTA 3CEAA 4NH4A 3L0DA 3QRWA 4YB8A 3DBRA 4L4SA 4N54A 3TZQA 4R1UA 2CY0A 9LDTA 4RZIA 1W6UA 4IDAA 4ESOA 5JBIA 4CM7A 1V35A 2AQ8A 2W2KA 3EUWA 3I1JA 1MC5A 4RORA 1V6AA 3IP3A 1V3VA 2Y67A 3KSDO 4RPJA 4EEZA 5JC1A 4I5FA 2Y68A 1YB5A 4UVIA 4B3HA 1YBVA 2NACA 1ZK2A 1QYDA 5BQFA 2W2LA 1JW9B 4B79A 2UYYA 3GNQA 3AU8A 5H83A 3ZNQA 2NU8A 1O0SA 4P22A 5B1YA 3R6DA 1NASA 3ZZNA 1HKUA 5EN4A 1GAEO 4B4VA 5HS4A 1DIAA 4NJMA 1GYRA 3NYWA 4MP8A 1C0IA 5CEJA 4B3IA 4N7RA 4R51A 4UUOA 4B3JA 4OXYA 5TJHA 5TT0A 1CDOA 1E6EA 4GX2A 2PK3A 4P8RA 3WIEA 4AJ1A 1HYHA 1T2EA 2CDAA 4ZU3A 2B4TO 4R3WA 1DIGA 3WGOA 8LDHA 1PJSA 1TLTA 2AQKA 2G1UA 4AJLA 4F6CA 1U28A 2AE1A 4M49A 4ZQBA 3B1JA 4XDZA 4PG8A 1PJ3A 1UAYA 3GGGA 1DO8A 4UUMA 1HYEA 4DPKA 1MV8A 4M87A 4EGFA 4M1QA 1S6YA 5A9SA 4RVDA 4YVFA 4YAGA 3GVIA 3RCBA 1ZK0A 4TROA 4BO2A 1ZSNA 1XQ6A 2FZWA 3KYCB 4AICA 4GH5A 5IDWA 2BD0A 3L4BC 4TRNA 4I5GA 3JQCA 3JYLA 1OOEA 4UEKA 1B8VA 3LYLA 4QUKA 1YB1A 1DRUA 1E3JA 4K6FA 1YGYA 1BDBA 5FI5A 5IG2A 1EDOA 3H2SA 3C7DB 4TMFA 2VYVA 4XR4A 2BI8A 5HWSA 2B69A 4JX8A 4FC6A 2G17A 2WD7B 1W73A 2W98A 4Y6SA 2BFOA 3MJTA 5EPOA 1O95A 1VKOA 4LGVA 3QJ5A 4ZGWA 3VPHA 2GNAA 3FR8A 2HJRA 4RF2A 2B35A 1QYVA 2NADA 3R1IA 1ADCA 3QWAA 2YW9A 1FDSA 3JYOA 2DUUA 1K2WA 2AHRA 2DKNA 2R2GA 3SC6A 5C3MA 1RM4A 4CM6A 4BKRA 2BH9A 2ILTA 4E0BA 4FIZA 5GZ3A 3G49A 3DOCA 2JD1A 4JBIA 5A05A 2CDCA 1P31A 2B5VA 1JTVA 5KJ1A 3QVTA 3I9MA 4DIBA 3P19A 4UULA 1P44A 3IOYA 3O4RA 5KVSA 2FRDA 1UXKA 3CPSA 3UXYA 4BGUA 3H2ZA 5C7LO 1LJ8A 4GVXA 3I6QA 4YEDA 3VKUA 3IKVA 1ISFA 2A35A 1E6WA 3NUGA 1U3VA 3P7MA 4LMPA 4II2A 5L53A 2EWMA 4BNFA 1JN0A 1GUFA 2O7QA 2LDBA 2X22A 3BMCA 3AFMA 4R69A 4B7XA 5JC8A 2C29D 5F3RA 3WICA 1ZSYA 2B4RO 2VHWA 2FN7A 4I9NA 4OJNA 3DZHA 4Z0TA 1CQIA 1NXQA 1XG5A 4QTZA 4LRSB 3IQDB 4B7CA 1DLIA 3WGIA 3V5NA 4LK3A 5L95A 4XQ9A 1TVEA 3SC4A 4CLRB 1B3BA 2NTNA 2AA3A 4CMCA 1LQUA 1MGOA 1HETA 2Y05A 3B70A 1ZXLA 1VL6A 4MVJA 1R4MA 2EEZA 3A4VA 3W1VA 3WS7A 2AEJA 5A02A 4FB5A 3QLJA 2X58A 1U2GA 1JVBA 1XKQA 2BHLA 3MJVA 5TQVA 3MTGA 4E5PA 4WK6A 4R41A 1ZEMA 3PGXA 1Y7TA 4DIOA 5A06A 1NR1A 4I9HA 2PKQP 1CIVA 4FGSA 2FPGA 3NDIA 1F12A 3GRKA 1Z6ZA 2GZ1A 3I9NA 2BGMA 1HWYA 4MKXA 3OJOA 1EVYA 4O59O 3WB9A 4CPDA 4I1IA 1YDEA 2IRWA 1GQYA 4CUKA 1PWXA 4ID9A
chains in the Genus database with same CATH superfamily
5F33A 1DEOA 2I66A 3RRYA 5HMMA 1VG0B 1TO2E 1UJ2A 3G0IA 4ZVVA 3O92A 2F4NA 4ND2A 4TN1A 1YB6A 2XRFA 3EVNA 5F4ZA 1EAMA 4JQOA 1LSJA 3DYBA 3CZMA 2HJ9A 4FLEA 3W8RA 4ND7A 3AONB 5JDIC 5FL3A 3BH7A 1MZPA 3GGSA 1Q2UA 2OP0A 1E3LA 2XMDA 4IQ8A 2ZUEA 4WA7A 3ML1A 2XWPA 5K1ZA 1XD2A 1C3LA 4PG6A 1W52X 1XZIA 1VPVA 4R9NA 4MDHA 4YJGA 5AKLA 5ALKA 5DNVA 3VH1A 4ZZ0A 3BJIC 2AJ8A 4F46A 4YDSA 1XSEA 4OHFA 1F8FA 3I72A 4MAAA 2A0YA 5I7EA 4KBGA 1RKXA 4JFRA 1BA2A 4IIVA 4ETWA 4GQAA 5H70A 2FWIA 4XFJA 4D3ZA 1U8EA 3VAAA 4ZMRA 3V32A 3TRHA 5LFAA 2C58A 4NICA 3D4PA 2WOOA 1SG6A 2YTZA 3KVVA 3TOSA 3SZ3A 5C81A 4YECA 2PRSA 4OJQA 5IZCC 1XZGA 1D7AA 2OAGA 3NQ41 3ZDDA 2DHEA 4NOKA 3N7UA 2Z8YM 1K3FA 2SECE 3TTXA 5DGXA 3DXXA 3ANTA 3F4LA 2W6QA 3M4JA 1L5FA 5ALQA 2AYYA 3KEFA 3UAGA 2YQZA 1E6UA 1WWKA 4QIHA 3R76A 3WO0A 1ZESA 3B51X 5ALIA 4D6PA 1NVGA 3E48A 3EVEA 3KK0A 3UJCA 1THTA 2ZULA 4G37A 1YA6A 2BFBA 3Q7IA 4HS9A 2BONA 5AHOA 2EW2A 3IMFA 3WL5A 3CE6A 1BCRA 2TECE 1OLUB 1O96B 1R88A 1U9CA 1TX4B 2ROQA 1J33A 1OKKD 2ZITA 3D0QA 3DZJA 3GB9A 1T1EA 3E7XA 3AR2A 3QWBA 4D0RA 4WAUA 5CK4A 3ER9A 5CNIA 4XQGA 2WF9A 4XD2A 2E2WA 3VC7A 1VG8A 2APJA 4TYWA 3KAJA 2XR1A 1GNVA 5LJLA 3KKZA 4LZNA 4S0XA 2RI0A 3KUDA 3ZW9A 4PPNA 4JA0A 1WM1A 4RA6B 1ECPA 3FRIA 4K28A 2VUIB 2C2WA 5AW9A 5EJ5A 5KCZA 2UZ4A 2POQX 3OF2A 1QF9A 4LRWA 5JXJA 3CZQA 3S55A 2HZ7A 2O8EB 2Z8ZA 2H63A 3U0VA 1R7RA 4MYDA 2PNJA 1KJJA 1L7OA 3FVWA 3B1KA 3GLQA 4EG3A 4P38A 2D54A 1RFLA 4II3A 3D6HA 2J41A 4IHJF 1MOSA 3E9RA 3RC1A 2ZYRA 5TB5A 4BU1A 3TM5A 4DADA 1ADBA 1I2ZA 1QMPA 3IBSA 1P62B 1XLWA 1QHYA 1FSGA 2WF5A 1OMOA 1NRIA 1Z6GA 3ER6A 5KMGB 3U3DA 3CYFA 4EZIA 2F1HA 5THQA 3RR2A 4IXWA 1N32B 1G9TA 2JAXA 3EZXA 3AX6A 1CUYA 2J6IA 2UKDA 4MV6A 4XGQA 1PV4A 3R5KA 1XYYA 4OX9Y 1BROA 1J7JA 4BKQA 3DYIA 1ZPDA 1P7VA 2CXPA 3CRMA 4QYTA 3TW4A 1OGYA 3NOQA 2X1VA 3EBOA 1IN4A 9ABPA 4EG0A 1EHYA 5FNZA 3F3MA 1LDYA 5K5EA 4C1NA 1TJ5A 5C7YA 1SUAA 4HZUA 4JKIA 5FPHA 4EHLA 3ZHQA 4BRUA 1WHTB 5GQSA 1PQ4A 3EAGA 3FPKA 2G06A 2FPUA 2OCBA 2QP9X 3ESCA 4JLVA 1SKAA 3WBBA 1VE7A 1C7RA 2H0QA 2QZSA 4Z4HA 2W37A 2J32A 3R23A 1V1RB 1FZTA 1W29A 3PQDA 3D3JA 4JELA 2Q49A 4DEYA 1JQJC 1MRZA 1H2XA 4HGZA 5JCJD 3ITEA 3MGGA 1GVNB 2GCIA 2NZJA 1O5IA 1R8XA 2NXCA 1YZHA 2WPDA 4LBYA 4NPCA 3GJYA 3RREA 1N5MA 1MTZA 2XUFA 3VV3A 3C7AA 4OHOA 3BZUA 1XCMA 3AY7A 3IE0A 5E8JA 2HO5A 1L7BA 3TSAA 4BBZA 3DJFA 4IS3A 4NU8X 5LQAA 3I4FA 4R2WA 4J1SA 1U0NA 2PH5A 2ZSDA 4AP6A 1JKFA 3WWDA 1HK7A 3MPOA 2H1IA 4WMLA 2XRMA 3DE5X 4JC8A 1DDIA 3DMPA 3AO0B 2Y9MB 4EO4A 4LF4B 3FPJA 1PJRA 4HQKA 1SB9A 3WLSA 2J4CA 1PZFA 5DN6D 1E8MA 1F0NA 2FP4B 2HK6A 2VK1A 2JGNA 3DKVA 1S2NA 3HB0A 1HE5A 3JATA 3M8KA 4PGGA 5FBZA 2Q5FA 4UBIA 2A9VA 1PAUA 3H17A 3JYQA 2OYRA 3KETA 3ZVKA 2QJFA 4NCKA 1BMQA 4C7OB 2UXDB 4D92A 5CA1B 2GSWA 3UHJA 3LX6A 4KSYA 3FLMA 1G291 4U7TB 3ODPA 4RZQA 5BSHA 3K9HA 4Q3BA 2OCLA 3GLIA 4G85A 4C76A 4ENQA 1JDTA 1FPQA 1GNSA 4WZ6A 2LUOA 4GMGA 5K99A 4EJMA 1QHEA 2Z56A 4Z9FA 1IXKA 3AGQA 5AD1A 1WETA 3PHGA 4YCDA 3CGGA 4J2HA 4YMWA 2MDTA 4AWXA 3AG6A 4N6GA 2GF9A 1O5OA 2PRZA 1KZ9A 3BD6A 4J9UE 1MT3A 4NATA 2UZ1A 3W5VA 1CJKC 4D2IA 3JAMA 3MA0A 5ALDA 4EELA 2IP1A 2XZPA 1CE8B 2NZ2A 5F35A 4DE5A 4G0QA 4C2UA 3DQQA 4L4ZA 1XZBA 5HCUA 1XHEA 1YQWA 5IAEA 2Z08A 1D03A 4F0JA 1WDKA 5F7OA 1P0QA 1Z2EA 2L82A 4PYOA 1DNPA 5FTWA 2XV1A 2GN1A 4WECA 5AI4A 5BR8B 3CIFA 3K6JA 4LYAA 5C1IA 3L8EA 1XYGA 3MILA 2QTNA 3K0KA 1YZLA 3EC2A 3RVBA 4D9EA 1CB7A 2OKGA 3LCRA 5J40A 3AV0B 3JR3A 5CYFA 3KUKA 1U2EA 5TPWA 3EHDA 5JFOA 3DWFA 4JJFA 4UATA 2ZM6B 2IE0A 4QPJC 5EMJA 4FCCA 3PHCA 2QU8A 4TV9A 2OC9A 1PTJA 1DIHA 4J7AA 3N28A 2XXJA 5REQA 1NF9A 5DYNA 4GRAA 4AFNA 1E9CA 1PT5A 3CN7A 5AI5A 1AQJA 2M6KA 3QOFA 3Q7RA 3C16C 1VQ1A 4DWJA 4DIKA 4A1FA 1DTWA 1U9IC 4E4TA 3CRW1 3VC3A 1RYFA 4WY8A 1CJSA 1XTTA 1ZW1A 2ZRGA 4H7JA 2FUEA 2IOFK 1QQ7A 4O08A 4EHAA 4GYKA 2I4LA 5JZOA 2Q3DA 3R4VA 4L5IA 3BHMA 3STWA 4KQEA 3K0HA 1ADGA 1PU2A 1OASA 3MINB 4HNQA 1NVXQ 2QXUA 3ADOA 2PYDA 4YXWA 1C3XA 4L7VA 3E7WA 4MA0A 4MP6A 4OYLA 1AMUA 3L7CA 4N0PA 1H9BA 5TE9A 3LUAA 1LVUA 1HQDA 1P60A 2R8YA 2IW3A 3I34X 3FKQA 2H57A 3D6UA 4YTEA 1E79A 1KO8A 5ARDA 2BCJQ 5K3BA 4GKKB 1EFRA 1A8SA 4DILA 1O2DA 2OHHA 3FPCA 2V7GA 3BREA 2D59A 3A58B 1XLVA 1KQGA 2XCLA 1WZNA 5DHTA 4ER6A 4UM9B 1M1ZA 2PX5A 4JT8A 3SDBA 2QORA 4ZTBA 3FLBA 5HEKA 1TW3A 3KAQA 3KT6A 5ALWA 4BRWA 2ID8A 4BWFB 3QBTA 5HQ3A 1H2HA 1FCJA 2Y3IA 3RQIA 4R2MA 2EP8A 5D6OA 2GHQA 3WFJA 2Q8NA 5L8VA 5BNZA 1VDMA 4PZZA 5YASA 2PUVA 4M1MA 2CFIA 3UHFA 5EHQA 3UB4A 4Y30A 4CGYA 5K8LA 1JHYA 4LSGA 4IEFB 2PS0A 3Q72A 1QM5A 2IXFA 2VATA 4BO6A 3QVLA 1GM5A 1EWTA 2WR8A 2Q6LA 3MMXA 1YZKA 3LFTA 2VQEB 1RDFA 2XZOA 4NAVA 4HD8A 4WCDA 2HT1A 2V0NA 1ZR2A 4AJKA 2GN6A 1Z0JA 3D5EA 1LC3A 2EWVA 3HGMA 3T1OA 4HAWA 1VCHA 2A0WA 4U7JA 1E2LA 3IVXA 1DG3A 1NA5A 3RDPA 5IFKA 1VMAA 1RZ3A 4ZI7F 3BMXA 2CC2A 2OBMA 5K0ZA 2NXWA 2RGNA 2ZS7A 3NKLA 3PXEA 4YP7A 4DAOA 2ZYTX 4MRPA 1SD5A 3UG7A 4A8JA 3I01A 2MYPA 4HQLA 5HBGA 2JCYA 1KFKB 2AOUB 3WGGA 5JZ9A 1JDJA 2HM7A 2QRLA 5KYUA 2TRSB 3T5BA 4LJYA 3D43A 4NR0A 2YDXA 4R16A 4V0SA 1AK2A 1ZW6A 3OOSA 2Q1YA 1O94A 3ACBA 2IL1A 5DYWA 3IEUA 1FLDA 4X60A 5K8CA 4A0HA 3ICOA 1C3OB 3SX0A 3I9OA 1QYWA 3ZHXA 1Z25A 2FX2A 2R1TB 3K9LA 4YMHA 4WI1A 2OBLA 2GBLA 5CB4B 1YQEA 2P1RA 3BL6A 3I3SR 4R1LA 3F73A 1A9SA 5IDYA 4JYCA 4ZZ3A 1O08A 2HMVA 3IURA 3TQRA 3GQVA 5T5QA 1UFOA 3DNMA 1U6JA 2PMCA 3PXAA 4DTIA 3E84A 3LCVB 1PT7A 3E8MA 1N6IA 3NTOA 1V8ZA 3PYMA 4HNSA 3CM0A 3DTTA 1G41A 1FU4A 3FRHA 3FX2A 4BX9A 2NUAB 1B2LA 4MV5A 3E1KA 4GGPA 4N65A 4UM7A 1E9BA 1FQJA 2PZJA 1QH8B 2ZWOA 3KPYA 4XAQA 5CLLA 3TNLA 1S96A 4EG6A 2IY9A 5JZMA 4MCIA 3OWXA 4NQZA 2VRWA 5DNAA 3O82A 1V8DA 4P93A 3NYQA 1D1QA 2YY6A 1Z35A 1Z4JA 2D3WA 4O6VA 1KPHA 3ENZA 3LDHA 4GRIA 2I6QA 4Y1FA 3WAGA 2D0OB 3KKMA 1M8GA 4IXTA 1RAGA 1J06A 4PBRA 4XVQA 5SYMA 2W48A 3CRZA 5E3IA 3REOA 2RG7A 2FQQA 4FDVA 4F3TA 3QMVA 4MVJF 3HDYA 2MMCA 2AWNA 2WMNB 1KJNA 1SU6A 1WKBA 2ACEA 2H4HA 1P91A 3ABRB 2E5WA 1XRRA 2RHBA 2F9MA 2NSLA 4OOFA 1L0BA 3RS4A 3I42A 2FPRA 1HFEL 1HDOA 4YQYA 4JOCA 3DZ8A 1ILWA 1HQCA 3EMKA 4PC3A 2O4UX 4BMYA 3FCUB 2CZGA 2MR5A 3Q9SA 2COEA 3GEMA 2BBWA 1G3IA 1B8UA 2XB9A 3FSRA 3K53A 2FE1A 4IFTA 3C6YA 4ZAXA 3BQNB 1X7DA 4ZOBA 3T12A 3FWPA 2R5NA 3CNEA 4HXYA 3HFRA 2YWBA 4TWRA 2W70A 3EIHA 4TMVA 2B5WA 5CLFA 2N47A 4MS4B 2Z2XA 1G19A 2FMIA 4OXNA 1KGDA 5D3QA 3HXPA 3HLKA 1O57A 4HWKA 3V4ZA 3O4VA 4YYZA 3LRPA 1D6SA 5I4BA 4IAOA 5CFQA 2Y66A 1FUEA 3HKDB 4WNIA 4P7FA 1ZUD1 4JR1A 5JHHB 1DIBA 3A25A 2QRMA 2P9FA 3N58A 3RRBA 2EZ4A 5FWAA 1ZJZA 2QM0A 1IK6A 3AM4A 3DH0A 3UJ8A 1XMXA 2OG2A 5FTKA 2B1GA 1ISJA 4NK5A 1ID1A 1KK3A 3ZK7A 3OQ6A 3C41J 4MKZA 1OPXA 1KU6A 3KVNA 5HA5A 4DA8A 2EU8A 3UV3A 3I0MA 1JXOA 3U39A 1OLUA 2WB2A 2HOQA 1KRXA 1GG9A 1JL3A 3U7RA 4ADSG 4S1VA 1H05A 2XNDA 2Y0CA 3TCKA 1D6NA 2A67A 3CU5A 5ALHA 5KAPA 5WRFA 8MHTA 1MH1A 2D1FA 3K16A 2OT3B 1DRKA 3A1CA 3M1YA 3M3PA 4HLUA 4HL6A 5DMXA 3EDQA 3SVTA 2XI4A 1QFJA 1UC8A 4B74A 2ZJ6A 3T8YA 3AFNA 1J49A 2PMKA 3QI7A 3W8EA 2WZQA 4RA6A 3LDAA 1LI7A 2GAJA 4ZVPA 2QLBA 1J39A 3DZKA 5EY5B 2IVFA 2PV0A 1FF9A 2MOKA 1T10A 1PSZA 2B82A 4BLOA 1U7TA 3AM1A 2X4DA 5JQGF 3BS4A 2ZJZA 3UB3A 1KJ8A 4X7BA 5EWLB 2UVPA 1G7CA 3QG5A 1E2GA 1TAHA 1VCMA 1XDSA 2GAFA 2PY6A 2XCIA 4CKWB 4R3NA 4DJ5X 1L7QA 1YFLA 4GWKA 4TTIA 1U0HC 3AR9A 3SHWA 4BQIA 1OFUA 2N42A 2E49A 3WISA 2JDIA 3UJAA 1XWWA 2VRCD 4HVCA 5KMGA 5GGYA 3P94A 1DMSA 1WF3A 4DNFA 2CUNA 4AS3A 3TW0A 1JSXA 1FFXB 1TU0A 3Q3CA 2W0MA 2YYZA 4PAQA 4GM1A 3KKKA 3J81A 3UPDA 3EEYA 2JLQA 5DHQA 5FYDA 3CONA 1J2EA 3NDJA 4ZVTA 4JB3A 4AZSA 1UANA 4KXVA 5DSXA 2FOLA 2WILA 1KSFX 1XMSA 1A7JA 3KUXA 3MLBA 3MWLA 3GQBB 5EEGA 3G9XA 4A26A 4OQXA 1U80A 2PVPA 4WKPA 4D96A 3ORSA 5F21A 1MB4A 4ZT4A 3JD0A 3BWDD 3T5CA 1JLSA 1NKSA 3JVVA 2NO1A 1WHTA 3LZ6A 5HTKA 3ASVA 5DTIA 5EHIA 5G0VA 3C6BA 4KQIA 5IEJA 5UKDA 1PQYA 3PX3A 3COJA 4LWPA 4MLPA 2AF4C 3WXBA 1AKQA 4DLNA 3QEMB 1Z0KA 1V1RA 5IWAB 1WCXA 3LYUA 3JSAA 1U65A 1ZGCA 2V6FA 1UC9A 5AP9A 4AIRA 3TR5A 1LBHA 3TOZA 1G4AE 1KK2A 3BUSA 2OCAA 5ELMA 4HMQA 3EZYA 4EGSA 4NYMQ 3EZLA 4QXMA 1I2CA 2OHXA 1K7SN 3KQMA 4FUTA 4PM4A 2OO5A 3K1JA 3RD5A 1FMCA 3LLVA 2BUAA 2VCEA 1R5NA 3T9FA 1CCWA 2BTEA 5AICA 3V8EA 3ICCA 3OE1A 2VF8A 5ED4A 1T1IA 4XVRA 1PDOA 1C4WA 5LP6C 3PI6A 1I7DA 3CNQS 3TAXA 3BJMA 3DEJA 1QP0A 4RHTA 1H5NA 3CLSC 4YJ2F 3L41A 1TM4E 3TQQA 3TCNA 4PE5B 1CNMA 3L4JA 2PXHA 2G77B 1JHQA 4DPLA 3TXYA 4UHHA 1NMQA 2ALJA 4Q18A 3DZIA 2FP4A 1E1QA 4N8SA 3FZNA 2HJGA 2D5LA 3DONA 1DC4A 1F0KA 2Z4SA 1U3DA 3PKIA 3QF4B 3R3VA 1TTQB 2VJYA 1YQ9A 3K0CC 4C7OA 1ORDA 5CA1A 2JCXA 1G8HA 1ZGJA 1DEAA 1DJLA 3FF4A 1JWAB 1Z8NA 2Q0HA 4LJ7A 1G5QA 4Z49A 1GQSA 3X2EA 4CETA 4MULA 3AVPA 3CEPB 4N8EA 4CU2A 3R3HA 4HNHA 3W4KA 1Z2NX 3D3NA 4WXEA 2P5TB 2G5PA 3BULA 5DBGA 3MMPA 4HUJA 3PR2B 2UZ3A 1LPPA 2IWHA 1HLGA 3C14C 5CPBA 1JR2A 1YQTA 1PG2A 1R2QA 3E7FA 4NH0A 5G0TA 4JJGA 3VQTA 4XKJA 1FJHA 1CE8A 5LN1A 5JVDA 3D3KA 4Y2YA 5E9JA 8AT1A 4DBLC 5C0OE 2IDMA 1U04A 3W2IA 4DG8A 1XL1A 3FJ1A 2JLCA 1K06A 3IP5A 4IG9A 1CY4A 4ZN6A 3F46A 3QFSA 4W5RA 2WZDA 2P91A 1PWZA 3KLNA 4AMGA 1OFVA 3NWPA 3W5BA 1KBQA 4RMIA 1ML3A 1C7FA 3V8QA 2IUTA 3HL4A 4OMDA 2Q1WA 4GI2A 1JLHA 2IF2A 3ILSA 2QPTA 5ALFA 1TYCA 1UBRS 2HTFA 3T3OA 1WSDA 4YT8A 1M8PA 1W7AA 5CX1B 3L4SO 4IVNA 2LCQA 4CVNA 4C3ZA 5HYVA 2ECQA 3NTRA 3AP3A 1VGVA 2YJTD 2AG5A 4N5NA 4EPXA 5AI6A 2H18A 4KQ6A 5DNWA 1RLUA 4XW2A 5G0SA 5LXTB 2IS2A 3VNRA 1UJCA 3HN7A 4JP2A 3VR3A 4HVTA 1MD9A 1QE3A 3EK2A 3AUAA 3ZBTA 1NZFA 4J4BA 2B6HA 3U4QB 2AN4A 2H85A 1WR8A 1UEJA 4KWEA 2AMJA 4QDZA 5FO1A 1QO0D 1ZGZA 5FBVB 1QIDA 3Q1LA 1TF2A 2CK3A 1GGHA 1PGOA 3D02A 1XBTA 2YN2A 3MINA 4WN9B 3FHCB 2P35A 3I2HA 4LDJA 2MIIA 3G2OA 2EATA 4EQZA 4JUAA 5G1NA 5K2OA 2I9KA 4RTKA 1VB3A 4NJOA 4OHBA 1YU9A 4KFSA 4U6NA 1VYHA 3L3BA 1LPAB 4BE9A 1FUKA 3ISVA 2D1RA 2ZTUA 16PKA 3HCCA 4HWSA 1N7GA 4X8MA 4XPIA 2B34A 4DABA 1BC5A 2JFYA 2ZSJA 1RBZA 4R98A 2Q3CA 4LTDA 2PJZA 2JFVA 5AWFC 1E94E 3N53A 4FWBA 4JKOA 2O2JA 3A6HA 5JLJA 4IS2A 4OI4A 2LIVA 2ZRMA 3FSJX 4LZPA 2BEWB 3IKJA 3FNRA 3D2BA 3QKRB 4JB8A 1HZJA 3O9ZA 5TQ0B 3MCVA 4FMCB 4RL4A 1XTSA 3WYBA 2BEJA 1G2OA 2EHDA 3AKYA 1GZUA 2DHDA 4XCXA 1YDHA 4ENUA 1CNEA 5HBRA 2JD2A 3IJPA 2XKBA 4MNTA 2OKCA 4F1WA 2P9GA 2JIQA 2Q45A 4UQLA 3J81k 5HIJA 5A4JA 2Q28A 4KR0A 3H2HA 1MEEA 4PZCA 3R7FA 3L79A 4RK4A 5LB2A 2QN1A 4U2DA 2ZUCA 5ILGA 4EI7A 1GSIA 4CQNA 1SK9A 1ULZA 1ZJ5A 5ILQA 1Z06A 2ZSEA 3PRKE 4F6LA 5I7HA 5LR6A 1FL9A 1ZKMA 2JBAB 2ZI4A 3LBFA 4JBLA 2BGUA 4X54A 1HDYA 1RHUA 2QYTA 4XJSA 1TFRA 2V54A 4DUGA 2XF8A 3W5CA 5K6AC 1QVAA 4BZPA 3ONWA 2DH5A 5HZGA 1N7JA 3W4JA 4R2KA 5A02A 1UPXA 9ATCA 5MFZA 3TCXB 3LQ4A 1G42A 2AOUA 5DWVA 3DVRX 1F8GA 4GBGA 1CVIA 4RVGA 3A9CA 1ZHHA 3S2YA 1V39A 5CG2A 1G20B 2DXIA 1XAHA 2Q1XA 2XSZA 3ZUPA 3TEFA 3UV7A 1Q1ZA 1CEXA 1THGA 1TKBA 5M29A 2PH3A 2KHZA 2PRKA 3KZVA 2J08A 3FWZA 5LLSA 2C00A 4KQCA 1OE0A 4CIVA 4E14A 6Q21A 1PG0A 2AJDA 2X8JA 2Z1DA 3FMVA 3HNOA 4AP5A 2P5YA 3RVDA 4B4KA 4BO0A 2ZWMA 3OFNA 1C3OA 5D5HA 5LBTA 3HPRA 2R1TA 1IBRA 3AV3A 5A7HA 4AG6A 4CBVA 1MUUA 2J9ZB 5CB4A 4Y6QA 3DXZA 1E2KA 2QIOA 4LKRA 4J0IA 3JPWA 5F1YA 3GLFB 1MXHA 4NBUA 1L5KA 4C3VA 4P3OA 4WOJA 1U0EA 1FXSA 1SXJC 3QVWA 4B3GA 2QPLA 3GAZA 4Q4LA 2RKOA 4NHOA 5JECA 3C24A 1P1BA 2A14A 2QLJA 4MCAA 4UVDA 4JLKA 3C48A 1E1RD 4DXDA 1MNAA 1R8JA 2W2NA 4D02A 4YR7A 4PX3A 1IEVA 3PEUA 3P26A 4YNBA 1L1EA 3DAFA 5CLHA 1J4AA 4MI6A 3RWBA 1CQWA 2NUAA 1KH3A 1B8OA 2WTEA 4WLVA 4OAOA 1H2BA 1E7WA 2OD9A 4P7BA 2WUWE 1VC2A 4QQNA 1QH8A 3STVA 2NQTA 4MCJA 1E77A 4LMRA 1ZJ4A 2X40A 1DX4A 1OD6A 4M9ZA 5T6BA 2YFHA 1N4AA 3SKYA 1SBIA 4ZQFA 4AURA 1VMEA 4G0UA 1PGQA 2H2WA 1MDBA 5LP1A 1VTKA 2XDAA 1XD8A 5D1HA 5JSYA 1N1EA 2ZJBA 3HWSA 5EMHA 1ODKA 3SX2A 1E1LA 4CL8A 5I01A 3IP1A 1R0SA 4UVHA 2PLNA 4X7RA 4IWNA 5AKKA 5AM4A 3N2ZB 2ECKA 2ESRA 1RHMA 3WK8A 1L1RA 2W7TA 4L8YA 3SQDA 1SEPA 4DA9A 3I2JA 3UGTA 3S81A 1FW6A 4CXMA 1MQ8B 4LF9B 2FW6A 1IVSA 1INLA 2EGGA 3REFA 2ZSUA 2PLWA 4BO7A 2VHXA 1G16A 5C8YB 1KJIA 3HCOA 5K51A 4TVBA 5C46F 3WYFA 5I3ZA 2AMYA 1IBSA 1M33A 1J2RA 3M6LA 1E2JA 3AVTA 3E15A 3UATA 1RKBA 2D00A 3GFQA 1NR7A 3IAEA 4G1MB 4LZWA 4KYUA 3B1VA 3LUFA 3PFKA 3QEOA 4K7JA 2NGRA 3K9QO 4HI0E 4KO4S 4MS4A 4WXHA 5LBUA 3W8NA 3DMGA 3H8JA 3X1XA 1RW4A 3PGKA 1X80B 4X62B 3A2LA 5KB3A 1CUIA 1ESMA 3HKDA 5J47A 2RBEA 4CLXA 4X6XA 1JPJA 3VYRB 1I30A 5DISB 1KQ3A 2BF4A 3S2FA 3TUIC 3U5ZB 1N57A 3GJQA 4TZTA 1TD9A 5F98A 2AS0A 2G88A 2Q5CA 2VDPB 3GDOA 5BV1A 2VVTA 1COWD 2CXOA 2P6MA 3HYTA 3NTVA 4I3GA 4Z4IA 1CULC 4MVYA 1RHRA 3T4UA 4BN4A 1UQTA 2CV0A 2IK8A 2JNWA 2YVUA 3Q7QA 5DI9A 1V9CA 4IFIA 4R68A 4DMUB 2BI4A 2PE5A 4W6ZA 3NS7A 3CLUC 1WCV1 2XGSA 1NYQA 2PKQO 1UWVA 4M1WA 4W6QA 5DM4A 3R3WA 3FPBA 1NV9A 5A2GA 4DWVA 4NARA 3U19A 4UU7A 5HOQA 1P4RA 2GASA 3JVIA 3U62A 4UW9A 3HU2A 4LJRA 2XBMA 2ZYAA 4L22A 1G4HA 3ZE2B 1JBKA 1KERA 3FUCA 3QJGA 4DQXA 1LBQA 4BCDA 2Y4OA 3Q2OA 2Y1FA 2RIRA 3SYTA 4M8SA 4E13A 4J16C 1JDPA 4XB6B 1D5WA 2CBZA 3T5MA 4RHCA 1EE9A 1J6UA 4MITA 4F96A 1AD2A 1YRBA 3TPZA 2AXNA 1A50B 4U7WA 5EWLA 3V2GA 1RACA 7REQB 4MHOA 3TIGA 3TX2A 4L15A 3KYDB 3UMGA 4EUSA 4JBGA 4K03A 3MW8A 3K70D 1I8TA 3SQNA 1W36C 4I5EA 3K6RA 2AZ4A 4DSZA 3IQEA 2DVMA 3KXLA 2FTKE 1M5UA 4DYHA 1C8BA 3PRYA 3MK31 2IYRA 4MW1A 2ZXEA 3OEHD 1KF0A 1FFXA 1NVVR 1N0HA 2JEYA 2WKSA 2WF7A 2NUTB 3PQ5A 2CVZA 4G84A 4UNQA 4BAZA 4CMEC 2PZMA 1S1MA 2SICE 4HDAA 5TJ9A 4MTCA 1II9A 2P8SA 1PL6A 3JALB 5C51B 3DBLB 1H65A 5JAIA 2G07A 2QP4A 5GM2A 5IHXA 3GQBA 3GAMA 4WLUA 5BSFA 2Y77A 2K7FA 2ZCVA 4DMMA 2IH2A 2YXEA 2BKAA 3IV9A 3X2SA 4ASUA 1P1KA 3VOTA 3MCWA 4UCWA 4YUVA 4EJSC 1V26A 1X86B 4XWGA 1LVHA 1QDUA 4D8TA 4LJ9A 1IN8A 3WOHA 1VHJA 4XFDA 1Q3HA 2DUWA 4BJ5A 3E8XA 4PW0A 3EVAA 5CT9A 2I8CA 2DQSA 3QEMA 4R05A 4HMPA 4OREX 4Q03A 1Z36A 4XX0B 4UOEA 5BNIA 1YFKA 1K8YB 4PS0A 4Y0NA 4P54A 4DR1B 2A9KA 1X1EA 2WJWA 3V8BA 1MX9A 2YUTA 2NTYC 5CJ2A 421PA 4PBSA 2Q6IA 4Z86A 4JV5B 1MOPA 1PN3A 3VDXA 5L7WA 1C4OA 5EUCA 1XNJA 4DG5A 2O4CA 1DQNA 4LJ4A 4CG3A 2LCIA 4NPAA 3MAGA 3U49A 4UMFA 3IT3A 4UCFA 5E2BA 3ND5A 3GCGA 1L8OA 4NBRA 1N8NA 1UAGA 3UTCA 5HZHA 5AOVA 4RZ3A 1JQKA 3OCUA 4HWOA 3DAGA 3F5QA 5G2OA 1XLUA 3UVEA 3OMLA 3A6FA 2CWDA 2WU8A 4IGAA 5I47A 3X1KA 3NYRA 5BSEA 4D44A 2H92A 1QIKA 2ORIA 4KGZA 4M89A 5AXBA 2ZB4A 5JG7A 4HX5A 1WDTA 3PIRA 5DIFA 5AK6A 3GG2A 1NXVA 2JFNA 3QF4A 4QGBA 3C4VA 2P67A 1KC3A 4M86A 4QTXA 4D8VA 1PYOA 3NU1A 3U6BA 3LKZA 4FXOA 4JD5A 1E1KA 1I80A 3AL3A 1HL7A 2GRJA 4LY9A 5G4LA 1BX0A 4U5XA 4MQ5A 4QARA 1YR1A 3GUHA 4PGHA 1IBKB 4CGZA 2WPDD 3EDRA 3I2KA 1HNZB 2HCJB 1N7IA 4FDLA 4JK3A 3VPCA 221PA 3OQVA 2O2DA 1G38A 4RV5A 3ETJA 3WSWA 5AVSA 2PNFA 5K4AA 3RW9A 5LZ7A 1PEKE 1TU3A 3WNQA 4DYDA 3U4AA 1T1JA 1JHUA 4G4SP 1A4UA 1BE8A 5BW6B 4D9FA 3ZV4A 4GZMA 3RU9A 5AW6A 1PFVA 1EYZA 4B80A 2HO4A 5DGTA 3BD9A 3WNDA 4D3DA 1A0OA 5JD6A 1OI4A 1X7YB 4ILKA 5BPFA 4IZHA 3VVCA 1UDCA 4PQRA 4I50F 2FWMX 1AQ6A 3NGMA 1FLNA 4F06A 1NUAA 2GT1A 1VI5A 3GOQA 5JH7B 1MC8A 4EJ6A 1OBOA 3OCJA 1QZ3A 2P4QA 1IJFA 4FDMA 3W2EA 4EHIA 1XU7A 1QG2A 5IANA 3WSVA 4BMSA 1PS8A 2QRKA 1Q0ZA 1R8SA 4H4DA 4TWBA 3OY2A 4ZRDA 1U11A 3UMJA 2WUVA 3KXDA 3PQ3A 1VIVA 4P2BA 1Q0RA 2Q5OA 3B82A 5ED0A 4EB0A 4OBBA 1DHTA 1NJ2A 4NENB 2INGX 1UKZA 2FX5A 2IQIA 3D7RA 1V2HE 4AF6A 4E4RA 2HEIA 4E5VA 1ZCJA 4MV4A 5CX1A 3ZD7A 1QK5A 5ICEA 5J58A 3EBLA 4JYPA 3SZOA 5T4BA 4FEYA 3R7LA 3E3OA 1EUCB 3JWPA 3U40A 2WNHA 4QVGA 4ZAFA 2NPOA 2PT5A 3ZCXA 4DJJA 4K9QA 3S28A 3VZDA 1YGPA 4BNWA 1WDLA 1FFYA 5LXTA 2OD2A 3H1GA 2AC7A 2I55A 4K6CA 4FFBB 2WY2D 4L6IA 3WKAA 4KX5A 1B23P 4UNSA 1LBEA 3DOJA 1OFGA 1HV8A 2C0QA 3U4QA 2PEZA 3EIWA 2XZTA 1XAGA 4J2TA 2ZB7A 3OZXA 5ELXA 3HADA 2BI7A 3VU3A 1GP2A 4C30A 1CY7A 1UR5A 3HY6A 4BNGA 1L9XA 3CUWA 4WN9A 4KRYA 2GH1A 4XM1A 2X19A 3GGCA 2RH9B 4CM1A 5K0JA 3PR1A 3JQFA 4MVCA 4TKLA 5JT1A 1D2RA 1Z5GA 1IMOA 1REQB 2EJCA 1XGKA 3OMWA 1VOTA 2FE4A 3FJOA 1YSCA 4NCNA 3RFXA 4D9IA 5JJCA 2WLSA 4ME6A 3ZI4A 4BQOA 3EQ9A 3M70A 2OV4A 2WFZA 3N3BC 3QYFA 4V0KA 4UEWA 4WOBA 4EFNA 5B3JA 4ZYUA 2VHZA 3NRCA 4BTEA 1Z2DA 4UUQA 1VZ2A 3KKQA 1U6IA 2CFCA 4A16A 3WMRA 3M5CA 1XTRA 3ZDEA 4LHWA 1N6OA 5KINB 4JHLA 2OCPA 2W2XA 4X1OA 1GY8A 2BEWA 3HEBA 2E6KA 4HLCA 6YASA 4ZJUA 3QKRA 3B89A 1T0UA 1LLUA 2Z6AA 2XKAA 2QTZA 3FDJA 4K3VA 4Z9AA 5TQ0A 2RC5A 3CQ9A 1DPGA 4RJJA 1PS9A 3A37A 4HMOA 4IDOA 1HEIA 1Y8QB 3VR4A 5FUMA 4R8VA 1GR0A 2JIPA 4F2WA 2IU3A 5SY4A 2FMUA 2JGAA 2BDTA 3PNOA 3HJHA 4IOKA 3FAKA 4GBED 4XYEA 4DR6B 2G0NA 5KEIA 4R6XA 4KLZA 2QVCA 2ZB2A 4DB2A 1ZOIA 4EBBA 1SXJB 5IABA 1B4DA 3OEYA 4K1XA 4Z54A 1FFHA 3NM4A 3HLYA 4WEOA 4G25A 1UPCA 1C1DB 1E79D 1M8KA 2WE8A 2CNOA 2JBAA 1IZ0A 3OM8A 4FTWA 2IKSA 3H9EO 1RTKA 2NSYA 1EFRD 1MPXA 3A9WA 5EERA 3SVZA 3UUWA 3W0LB 4XIFA 1A2BA 1UJBA 2XNCA 4U6SA 1GNLA 3ZWDA 4RTQA 5HF6A 1R9MA 1ZJ6A 3CMCO 4W63A 2AV6A 3I92A 3RVPA 3F3YA 1XZFA 4YCBA 3RYFB 2O7RA 2E4VA 4TMTA 4ISBA 3I61A 4BVHA 3SBDA 5F1KA 2HEGA 4BLVA 4YRMA 5BSWA 1VSQA 1GYQA 5GMOA 3T7DA 1G20A 3QA9A 2XHZA 4WBSA 2AEFA 5ESRA 2I6TA 2Y4NA 2JFXA 3LC7O 1QFYA 3JQ7B 1QTIA 3SZLA 1IWBB 1VI2A 3A6DA 4RZSA 3W3AH 2ATIA 3OWHA 3TSZA 2VA9A 1LX7A 3GRPA 2JFPA 4FGZA 5TF4A 1X70A 2D3TA 1E98A 2I3AA 4OGFA 3LG2A 4XPZA 2OYSA 1UJ5A 2J0EA 2B8WA 4FS8A 4FT2A 1L7RA 5AXAA 4C07A 1BS9A 4RTJA 2A5DA 1H8HD 1MC1A 2HNKA 4EFDA 5F4BA 3NHYA 3HVRA 1RCFA 2ZAIA 1CX9B 2K5UA 3GLFA 1YH3A 1AVTA 1GSHA 3U3XA 1A27A 1LWNA 4FGJA 1A71A 1UM8A 3LLUA 4CW7A 3A14A 3BGDA 5SICE 4GX5A 3HPQA 3A4TA 5F5NA 4LJLA 2OGSA 4BLQA 1SCNE 4HRYA 3VR6D 4F5YA 4QYWA 1UM9B 4DZRA 1M2OB 3P0RA 1OSNA 4GKAA 1DBVO 4XUCA 1B26A 2RD2A 3ET4A 3C7CB 3GWZA 1YAHA 4QQ8A 1QF6A 3K1YA 3L46A 4IV8A 3I4LA 1NW8A 1O94D 4IUCS 5C5IA 1X74A 5EVJA 1GGMA 3AF5A 3ZGYA 1JGTA 5CFZA 5JS7A 2YYSA 1G7TA 2SHKA 2G4VA 3KQVA 4QNMA 4AS1A 3LECA 5EIWA 2JFQA 1GDHA 1UF9A 3GELA 4LXIA 4V1CB 2F1JA 2QMHA 2CL7X 5ARBA 3QW2A 5JBQA 3RAFC 4OATA 1KDZA 3TNYA 4JVLA 4QREA 1T8SA 4XVUA 4PFSA 1KE2A 4E32A 4ZFNA 3L1JA 2YV5A 4XM0A 5C8YA 4YRIA 3PVSA 4AJEA 3MWFA 1JJAA 2XMPA 1SULA 4F4CA 4KTTE 1KEWA 4OXXA 1EDBA 3IUNA 1X1SA 4F3RA 4XWKA 3NORA 4EM6A 2QDKA 1KJ9A 4JOBA 2C8VA 5DBHX 3BWXA 3I01M 3GPBA 4DIFA 3GJRA 3H9JA 2Q46A 4PFJA 1UOEA 4QG3A 4OLBA 1SKYB 2EJBA 4YAUA 1T4DA 3U2QA 2J5RA 3D8TA 4UZSA 2YJ3A 1QV6A 4DY4A 1X1QA 2CDRA 4FR2A 2V5VA 1BJTA 3T06B 2ZLBA 1CUHA 4J9VA 4OQQA 3T38A 3K73O 2J7KA 2BKXA 2OGZA 3GROA 4HQFA 2IELA 1YB4A 4IJUA 4LC9A 4L8WB 1PGJA 5K0NA 4OHRA 2FG6C 5EHXA 3PXXA 2EX0A 2FRDC 4DREA 1YJCA 3FFTA 2IUFA 3L6OO 1P0IA 3S40A 1OTYA 3FCAA 3QXHA 5MN6A 1NOJA 1WXDA 2JD0A 2PD6A 1VLQA 3IE1A 2IH5A 1EWVA 3VTZA 2QAGC 1XV5A 4QASA 1M10A 2DWOA 2GLXA 2D0DA 4HGYA 2ZUDA 3HO1A 5KYNA 3CNNA 2IA5A 1SNYA 1YDFA 2XDWA 4EATA 1ORHA 1HEYA 3KBOA 3ZWOA 5IVKA 1L3IA 3MIZA 4Q93A 2OFFA 1FY2A 3UWSA 1A2KC 3GFPA 1NY5A 2VNIA 2XYGA 2GD1O 4YCLA 5JS6A 2X2OA 1AGRA 5TPZA 3U1BA 3AB3A 4XQCA 4MLDA 2HD4A 3DKIA 3KO8A 1VGRA 3SE0A 1ZH0A 3ZWQA 3WDSA 3W34A 4DEVA 3C8ZA 4RTRA 4CJXA 1TB4A 4WJZA 5CCBA 1AY0A 3DWEX 3VSCA 1U8XX 3BB1A 1H9AA 3QA3E 4TT3A 5C8VA 1Q0QA 1H3EA 1U2DC 7REQA 3RUHA 3QMMA 2KWIA 3KYDA 1OR8A 2OZVA 1MAWA 3KELA 1TKAA 3IXLA 4BNIA 2QI9F 1E9SA 2O3SA 3KOMA 2GZ2A 3QI2A 4KO8A 5K9ZA 1TMOA 2G3YA 3R41A 5BVHB 4NNPA 4UHJA 1A9PA 3FSGA 1C0LA 3MF4A 4BV2A 3K94A 1GPLA 1U7XA 1E66A 1OXVA 2VJKA 3D6AA 3B5EA 3L8MA 4HB3A 4GMKA 3RRZA 1J5PA 2NUTA 3P2IA 2NVBA 5DSTA 1E63A 3T54A 1SHJA 5I7OA 2WSIA 5DGIA 3JALA 1AGXA 3T7TA 1T9GR 3IKMB 3OZVA 3DBLA 3PQ2A 1NT4A 2YWDA 5C7IO 5ISMA 4YAOA 1DAKA 3H3FA 3KB2A 1Q95A 3GF4A 4H4EA 3B52X 4W5TA 3K0CA 2HN9A 3M5PA 1JT9A 1VPEA 4X93A 1VPTA 3B3QA 1SXHA 1Z34A 4C2BA 2J6HA 3NPMA 4DJTA 1BW9B 1PCXA 3B9BA 5KNDH