5A4AA

Crystal structure of the osk domain of drosophila oskar
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
b'GHTSGTYNDSLLTINSDYDAYLLDFPLMGDDFMLYLARMELKCRFRRHERVLQSGLCVSGLTINGARNRLKRVQLPEGTQIIVNIGSVDIMRGKPLVQIEHDFRLLIKEMHNMRLVPILTNLAPLGNYCHDKVLCDKIYRFNKFIRSECCHLKVIDIHSCLINERGVVRFDCFQASPRQVTGSKEPYLFWNKIGRQRVLQVIETSLEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of the Drosophila Germline Inducer Oskar Identifies Two Domains with Distinct Vasa Helicase-and RNA-Binding Activities.
pubmed doi rcsb
molecule keywords MATERNAL EFFECT PROTEIN OSKAR
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 69
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17182 OSK OSK domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 5a4aA00
1ZMBA 1PP4A 1ES9A 1YZFA 5CD9A 1BWPA 3RJTA 2Q0SA 1WABA 4IYJA 3DT6A 3P94A 4JHLA 3KVNA 2WAOA 3HP4A 4PPYA 1Z8HA 1U8UA 4JJ6A 2HSJA 3W7VA 2Q0QA 4K40A 2W9XA 4K3UA 4M8KA 3DT9A 4K7JA 4RSHA 5BN1A 4DEVA 1ESEA 1FXWF 3BZWA 4OAOA 2WABA 1VYHA 4H08A 1DEXA 1FXWA 1K7CA 3DCIA 1BWQA 2APJA 1BWRA 2VPTA 4RW0A 4NRDA 4XVHA 3DC7A 1JRLA 4I8IA 4Q9AA 4JJ4A 4K9SA 5HOEA 5JD3A 3SKVA 4JGGA 2O14A 4JKOA 2WAAA 3SLRA 3MILA 5A4AA 4HF7A 3C1UA 4Q7QA 4LHSA 4HYQA 1ESDA 4OAPA 1V2GA 4TX1A 3U37A 5B5SA 1J00A 3DT8A 4S1PA 3PT5A 1DEOA 1VJGA 1IVNA 1ESCA
chains in the Genus database with same CATH superfamily
2AG5A 3DFMA 4FGUA 2IYPA 4MUNA 4EHAA 5TY0A 1DAEA 4B46A 3B1JA 2C07A 3VYVA 4EHLA 4ETWA 2B7CA 1M2FA 2AB0A 2XUOA 3IDFA 3LO8A 4DNQA 3EASA 4Q37A 3U7RA 3ZHOA 3HEAA 3F0TA 3P52A 1I8TA 3LXMA 2ZUCA 3L4BA 4TV8A 5C4MA 4CETA 4HB4A 1J0AA 1IB0A 1PQPA 1S0UA 1T15A 5KTSA 2QN1A 4L7QA 3K53A 2VHYA 2IXDA 5FI1B 5AVTA 2P62A 3DW3X 4BEJA 2O7VA 2ZBVA 5HVNA 3FDXA 3JVEA 2P2GA 4QQKA 4X41A 2J3EA 3FNIA 3I52A 4ZAXA 2WHXA 3SKYA 2JDIA 4JELA 1Q44A 1H2BA 2RSLA 5I9SA 1M8FA 1U2GC 1I1HA 4K9PA 5WRFA 1RYEA 3RUCA 4AI6A 3S29A 3ZNNA 1ACJA 1WTAA 3EK2A 4TM8A 2HQSA 1CYEA 4IXMA 2X9NA 4M0PA 3T1VA 2AVDA 3OY7A 2WF5A 2X86A 2EFYA 2PMDA 1VFNA 3UK2A 2JZNA 3I6MA 4M0LA 5HF8A 4MJLA 3UO8B 3FLEA 1JEAA 1XB2A 2RHGB 2XQIA 5E9AA 3LCJA 4JFAA 4S24A 2FA9A 5HJ5A 3BMNB 3RIGA 1SIWA 1IM2A 3G8BA 1FK8A 3IKVA 4E31A 1H94A 2PM8A 4RA9A 3QHPA 3ZC3A 3JQRA 3GAAA 3T9BA 5IUNC 2UUCB 4YPOA 2D13A 4KAAA 2C5GA 1WCWA 2VQ6A 1Y4ZA 1BROA 2X1LA 3G89A 3QJGA 2UYQA 3R7NA 4ZCRA 5CAEA 1F9EA 1ORHA 2R9VA 4C3ZA 3EUFA 1U7WA 3ZPXA 5MGNA 3USES 3KZMA 1EXWA 5IT9A 1H85A 4Z2AA 4CM3A 3LQ1A 1BAPA 3FOWA 3V8NA 2CNLA 2FW9A 4FOPA 3JQ9A 2DC1A 4JBGA 1ZA2A 3AESA 4WBSA 1NU6A 2GLUA 5COQA 1Z22A 2ZREA 3DC7A 2EZ8A 4TV8B 2R5NA 5EE3A 3A0UA 4GI5A 5GV8A 4JR2A 2MSKA 3V2UA 1UAAA 1P4HA 1JFRA 3QVKA 5EIFA 3TEFA 1C7ZA 2P0EA 2O2CA 4MIEA 4CODB 2ZE8A 4ZV7A 5JRDS 1ULSA 1OFTA 2Z2YA 1EFLA 5EKSA 2O0KA 2JIBA 3I9NA 2FUG1 1YJCA 2IPAB 4FQ8A 1ETHA 4Q9DA 4RJKA 2JVJA 2QSYA 4JB3A 4PWYA 3X1YA 4I4IA 4B33A 5EIWA 2ZRGA 3EXFA 3PLRA 2JFQA 4WZBE 4BPBA 3DYBA 3PQ8A 2G7MC 3MAAC 2XHEA 3GLFE 4Y6PA 3JR7A 2WQZA 4ZYYA 1JQ5A 2AWNA 1VJDA 3KAKA 4ETIA 5U9CA 2PXCA 1UC9A 1YJXA 2BMAA 3LWBA 1E62A 4NU0A 2IDKA 1QIMA 3R40A 2BF7A 4J2HA 5A7HA 1SVIA 4RA9B 3UTDA 1R4AA 2QN2A 4OHOA 2LGJA 3N5KA 1M2OA 1UJ4A 2V1UA 5CAEB 4KXQA 2F1RA 1G16A 3J7TA 5DM0A 1EVLA 1PT9A 4IOLA 4D57A 3T9CA 1UBGA 4HAZA 4XB6B 2SICE 4RPLA 5FNZA 3TSWA 1GEGA 1G1AA 3E7FA 2Q4DA 1FP2A 1Q1AA 1XROA 4YI5A 3D4BA 5C51B 1KBOA 4YTEA 3AESB 5IFLA 2QZPA 5LVAA 3OTOB 4OK3A 5EQDA 3AGPA 1G59A 1NPYA 3LPMA 3T3HA 1ZSYA 1GYRA 2I65A 5DHAA 3WRXC 5LM3A 4FBLA 4QG3A 1AU9A 2Q1SA 2JH3A 2CLSA 2OGWA 3CY6A 4RD2A 5IAGA 5KQMA 2BI4A 1AKEA 1C4OA 2BVNA 5LZ7A 3AHFA 2HDWA 3MERA 1PLJA 4JC8A 5IABA 3DEHA 4MUAA 3HLTA 4Y2VA 1Z0SA 3DGEC 4XARA 1QM5A 1PJZA 3GLUA 4GOJA 2NTJA 4QDXA 3EXFB 4RM2A 4JI4B 1RXCA 1GUFA 1PZXA 3FHLA 1T0JB 4MGEA 4CRWB 1O94D 2VT2A 3DFKA 2VP5A 2PL3A 3FF1A 5JDCC 4NONA 1J5PA 1KDZA 3ZV4A 4NX2A 2P5SA 5D6NA 1VI6A 2GM4A 2GSWA 1ZQ9A 3HUTA 1KR5A 4RSHA 3TFOA 1TRKA 2WKPA 1WZUA 3F98A 3AVXA 3H17A 5IVDA 3EFEA 3ELWA 3IJEB 3UATA 1RPTA 1FFAA 1M2OB 4GUAA 4S1WA 4QT4A 2ZT7A 1X42A 5I9LA 2DLNA 3TIIA 2ZWIA 3HDYA 2JCVA 2QVXX 5T5QA 3E8MA 4DCUA 2VPWA 3MWLA 1CJTC 3HJGA 2GBCA 4WCVA 4PN7A 1Z82A 2NSDA 3MCWA 5ESRA 2ZRBA 2DPGA 3V6LA 2WE7A 2R00C 2GPSA 5KPJA 2B30A 4FN5A 4W9MC 2J3IA 5EP2A 4PXYA 4PC7A 2WM3A 3EIWA 3QE2A 1TIPA 4FB5A 5HZHA 4MVWA 3QEJA 4E14A 1THTA 1U1FA 3CLUC 4Q9KA 3IBSA 1MENA 1WB5A 3A31A 3NLLA 3ZUGA 1PCXA 4DEYA 4HBZA 3E1GA 3QNWA 2C2KA 3I05A 3V3TA 3BIJA 3GFBA 1BE1A 1WW2A 2WZDA 4V0ME 1WTCA 2AMVA 3WWYA 5HOEA 1STOA 3DBIA 1CG6A 3CCFA 3QMWA 4GT1A 1P7YA 2O05A 2POQX 7REQA 4MV6A 1G8AA 1NVVR 2BDEA 1RQ2A 3KO8A 4LI0A 4O0LA 3WQHA 4BP3A 2JD0A 2BHLA 1O57A 5EEHA 1USVA 3ESAA 1JR3A 2VHEA 3V8VA 1N5RA 1RXSA 4LBZA 1NW4A 4C89A 1I4TD 4ND8A 1ZBQA 1SIUA 4QTUB 3ILXA 3RANA 5G1NA 5I3ZA 1HOTA 4ZMBA 4FS3A 4MYDA 4JFRA 3GP3A 1ADJA 1EFKA 2KLHA 1ZP6A 3OAAD 4WT7A 1M8GA 3ZYZA 4D4HA 2KM1A 1Z0IA 2X6QA 1FX0A 4BQSA 2I2FA 3C45A 6ABPA 3CCCA 3A32A 2YHBA 2H2DA 1MD9A 2IHBA 3C5VA 3KHUA 4LXQA 4XM0A 4ZQIA 3WJAA 4U02A 4B09A 4BBAA 4KYUA 1JJAA 5FF9A 2W70A 3OFVA 3BG5A 4C29A 2GDJA 3ZWMA 5F12A 3O8DA 3RJ9A 3MQ2A 5F1PA 4AJ1A 2B5VA 1P1FA 3LL4A 4LDRA 3ZCUA 5A5EA 1A9SA 4KQCA 5B2ZA 2D7JA 4TN5A 1BA3A 1X1EA 2V8OA 3HKDA 4MVJH 1GL6A 3EVDA 2B2NA 2H2AA 3PTZA 5DN9A 2E6UX 4HMOA 4J49A 2FPSA 1HTWA 3OE1A 4TKMA 3KJFA 5AJXA 4AN1A 4E4TA 2AV6A 3K0HA 4GP6A 3RU3A 1A50B 3MQ4A 4HPWA 4D4KA 3ABOB 4F5WA 3AR4A 1Q0LA 2GWRA 3FFBA 4K81B 2O3RA 7REQB 4L76A 2JIQA 4LV5B 1EPUA 1QE5A 3FNRA 3OM9A 3F97A 1S7CA 4M37A 1ZR4A 1VSVA 5K45A 5ALKA 3ZDDA 4Q5IA 3RSZA 2V3WA 1SRRA 4QUHA 4D3XA 2AG8A 3ANMA 2VJKA 1SKQA 2CXQA 5DNDA 1CRPA 2KE5A 4FS8A 4MW1A 1JAYA 2X77A 4KVAA 1E2JA 2QLFA 4ND8B 2XZTA 3GZ4A 4PNZA 1Z16A 2ZQ5A 1G2QA 2Y1FA 4UASA 1QWSA 1C4KA 1JN0A 3LTEA 4L3WA 4OATA 3MGAA 3WNCA 1BYIA 4D82A 4DE5A 1L5LA 4BO2A 3BE5A 3S8EA 1FUYB 5TF0A 5EE9A 4JUDX 3ZXSA 3KTDA 1B8VA 1M1YA 2YZGA 3KUKA 4O2RA 2YN4A 3GA0A 1FX0B 1A5SB 1NVFA 2G71A 4R68A 5AI4A 2XYVA 3FZGA 3JQGA 4OFBA 1JLHA 2FLWA 3QKSA 4NAHA 4QBTA 1MGOA 1NE7A 1YA8A 1MAWA 1SUSA 2Q07A 3ICQB 1T2UA 2BUCA 3OA2A 2WU0A 2AMYA 5AW2A 1COWA 1DEXA 1SCDA 2H00A 2QD4A 4CV3A 4WIAA 1E7YA 3UH0A 2CSUA 3EVNA 1PN3A 3HFJA 1OFUA 1SXIA 2FQXA 3WIBA 1I3CA 1X13A 4C4XA 5AVWA 3HKDB 1C7QA 4J4HA 4EHBA 2E7ZA 3QVVA 4F5ZA 4LFAB 3VU9A 1RAEA 3AB7A 3G9ZA 3D5QA 2F59A 3PYMA 1W88A 1NBAA 2Z0MA 2O8EA 1K68A 2WHYA 2HBYA 5JTTA 4R1NA 2PUTA 3KKEA 4UNNA 1ZGBA 2W5UA 1EDDA 4J3FA 1DXOA 2I67A 2C2MA 2HRBA 4Y3UA 2C4NA 3ENZA 4RPGA 4OQLA 1GU7A 2JFUA 4LMAA 1O6CA 4DLPA 1K75A 4CTJA 2V7WA 2WYWA 2ZE5A 1ST3A 3I6QA 2CHQA 3PIRA 3S1LA 1EUQA 4LBVA 5LP6C 1A4RA 1XNHA 2YOGA 2HWXA 3CINA 3V7WA 4AO8A 4YALA 1F20A 4L3VA 5KYXA 1W2HA 3CH4B 1YBVA 5ESXA 4MQUA 4NV0A 4FGZA 3HB4X 4ITUA 2MJLA 2WJYA 2X1VA 4XIYA 3V7UA 2XIQA 5HCUA 1WE2A 4AO6A 2WHPA 4NE9A 1LX7A 3FCXA 3G0BA 4BTEA 4CKXA 1QOPB 2QP9X 1M1YB 2I34A 4E03A 4PZAA 1JAXA 3GMTA 3VR0A 4DMUB 3OU7A 1KQ3A 3H11A 4V2UA 2WD9A 4BYGA 4U8HA 3UK1A 2YHUA 4L7VA 2ZRAA 1YI0A 5IH7A 3AHIA 2D4HA 3JQGB 3I2JA 3QKSB 4BP9A 1LA2A 3Q3GE 5BUZA 4BLSA 1T9ZA 5I5EA 2E6KA 5L4NA 1QVWA 1NTRA 5FWXA 5BV0A 2ZRLA 1CUZA 4PXAA 1SCBA 4ZCQA 2HCJB 3SF8A 4GAEA 1ZG3A 5GMOA 1QF6A 1UMCA 2GZAA 3HY4A 3PWZA 1HLDA 2Q6IA 3U60B 1QHGA 2Q1UA 4YWJA 3EVZA 3IE1A 3DG9A 1GU0A 2PBRA 2GNOA 1X7YA 1D4OA 3U9SA 3P7MA 2RGNC 2BR3A 3JWGA 5AW1A 2X6RA 4Y1RA 3VU9B 4DZTA 3LQFA 2VDNB 3PUWA 4MROA 5JW6A 1H5QA 1W88B 1JHZA 1SHKA 2QEQA 1O0CA 2O8EB 3N2ZB 3PRKE 2OOSA 3V7NA 1MJNA 3N70A 3ONEA 1T4BA 4LMPA 4A15A 1WSBA 2WWRA 5FBWB 5AVSA 3ASVA 4KXYA 3JPWA 3WGLA 1SXJD 1XJQA 3FAZA 4RF3A 1RP1A 1RWQA 4Y6GB 3UYKA 4O4HF 1Z8NA 3CHYA 2V7PA 1M5RA 2NSLA 4JJ7A 5ELLA 1J6UA 3AVWA 2C04A 1FU7A 4W99A 4DLWA 5KYXB 3BD6A 4OQDA 4PRZA 4Q47A 3VNQA 4X90A 4TN1A 3PR2B 1XTRA 3GRAA 4G0UA 4PYIA 3UJ7A 1GARA 4PQGA 1LVHA 3G5MA 3R3UA 4OXIA 1FBTA 4X00A 4TUYF 4BLOA 1VE3A 2WHPB 2UXCB 1ZR2A 5F1KA 4RYLA 3BSWA 4LJYA 4YCCA 2Z2JA 3DPUA 4BDSA 2ZI4A 1GDHA 1YQEA 1JR4A 1MG5A 2BTQA 1Q14A 3H11B 4HRVA 3GR6A 4H77A 4WADA 4WESA 1I4LD 1DL5A 3V80A 1N7JA 3VH1A 3KR0A 5ENVA 2E18A 3GELA 4KSCA 2Q4RA 1JQAA 1O5OA 2CNOA 2WFMA 4I4CA 3A6KA 2M6SA 3TW6A 4CL8A 2Q2NA 3H9UA 3A26A 1A9RA 5FWXB 2DE0X 3I8SA 2HI0A 3E05A 5EWMB 2I7DA 3SF8B 1A1VA 3CRVA 4FDLA 1ZRSA 1UMCB 3VSBA 2PPLA 2IPOA 4RY9A 4XYGA 4CU2A 1FFYA 3NIDB 4EG7A 3UWOA 1RJDA 4NS4A 1X7YB 4WLUA 4BO6A 2BHTA 4J6EA 5A03A 3L0YA 2Q2VA 5GONF 2IU0A 3A6LA 5AVXA 2H31A 4Y1RB 1YZYA 3VV3A 3MD9A 2F8TA 5HE8A 2CFIA 1AVTA 2NXNA 3KR2A 4X64B 4B44A 4BVHA 4IX1A 5BSUA 3QP9A 2VR1A 4XEUA 5CLJA 4A5SA 4KWCA 4KR2A 4QXAA 3UWSA 2OHFA 2PPVA 1C2YA 4YJKA 4FZJA 5H9VA 3AF3A 1ECJA 2V9PA 2Q6OA 4J9UE 4RLQA 5DK6A 3WV4A 2BCEA 1J90A 3JVIA 2DH6A 4MVJM 1W4AA 1BQ4A 1YZKA 2R6DA 1MPXA 5CT6A 3CW2A 2CE2X 2UUOA 4Y2UA 4EZBA 1FQOA 2EU8A 1Z6ZA 3KTFA 1HE2A 4OFZA 4F5EA 4URVR 3LVQE 4D99A 2R65A 1SC6A 5KNBD 2FOLA 4MUBA 2AD5A 4WXYB 5JI3E 2W37A 1R5BA 5B3JA 3ZNPA 4QJ3A 1Q16A 1RYBA 2J5BA 5IWAB 5CFMA 1RLTA 1W49A 1Z17A 5DGIA 4BVJA 1JFTA 2JGNA 2BTQB 2Q50A 3H1FA 4IF4A 4WESB 4OB7A 1GPWB 3LQYA 2PQ0A 1TO1E 2IYQA 1ABEA 3OQIA 4YO8A 5FEMA 1EA7A 1IONA 2VRCA 4MQ6A 3C3AA 1LQ2A 4BNWA 2CFSA 4HNTA 2I2CA 3QKTA 2EIHA 5EJ7A 1ZNWA 1SQFA 2NZJA 4DLSA 1WF6A 3PYXA 1DEOA 3CLSC 3GHHA 3OLZA 3AUSA 4PXSA 4X7MA 5FO0A 5THXA 1M66A 3UPDA 1HDIA 3T7SA 5FTWA 3ASYA 3EBLA 2JA1A 3G6WA 3SJBA 2X4GA 2CYBA 1XFAA 3Q0EA 4GPD1 1XQWA 2EKBA 3UHPA 4LZLA 2VBCA 1MH9A 3ILVA 1EGQA 1TOAA 3VU3A 3OQMA 3T5BA 4NR0A 3V1NA 2BELA 3Q3VA 3QELA 3U4IA 4Q4JA 1HL7A 1EKXA 1NR5A 2VJYA 4MVJP 1HG1A 5LIRA 4DLYA 1ZW1A 4EO4A 2PMKA 2WSSA 4BV3A 5A4MS 1RYHA 4I6JA 3H5NA 4WBXC 1KDRA 1T5BA 1QQAA 3RRJA 1ZUD1 4C4AA 4WASA 2D74A 4E4RA 1PR3A 5JBQA 2MYTA 5B58T 2F90A 3LV8A 5J1TB 2YXDA 1VI2A 1H2YA 2PH7A 5E38A 5P8WA 4R6WA 1M72A 2W2KA 3WIVA 2GB4A 3C87A 3DAOA 5L7TA 3VNVA 4I5GA 1QKKA 2DQYA 5EIBC 3E5NA 5IKXA 1EA5A 1CUYA 1KY3A 2IC5A 2XKBA 4B73A 2IHNA 2X8JB 4I5IA 2VAWA 2XVZA 1J24A 3OWXA 3U3KA 4IY1A 3BCHA 4W8OA 3CS3A 3V8RA 2YN0A 3FTDA 4KRYA 2YWDA 2F43A 3OQIB 1LGYA 3LLVA 4R8LA 1NVBA 1YDGA 3R3XA 1NXPA 3ZWOA 3ZD8A 2QMQA 4GQAA 2PGIA 1YUMA 2Z5FA 1U2PA 1H4SA 5FOXA 2QUAA 3LO5A 3PGMA 1LSOA 1UJ6A 1N9KA 1WCV1 4GSLA 2NX2A 3C5EA 4NESA 2QIPA 3KOMA 5EJ9A 2PN1A 4RTRA 2ZSFA 3R24A 3A1WA 4BO8A 4YYZA 2FJPA 4ZOBA 1X1RA 2N75A 3UOAB 1TIKA 4RY2A 3NUGA 5FI3A 5JCZA 1WDLA 1M1ZA 3QELB 3IKLA 4MR7A 4Q4JB 1TLTA 4CM9D 5ALDA 4K46A 4WNCA 4PBSA 2JLAA 1EI9A 1KR2A 4IIJA 3KWFA 1ZGGA 5JSUA 4UW9A 4UM5A 2CVZA 3CJTA 4C22A 3VNSA 5LZ2A 3NEJA 3R8FA 1KNXA 1T5DX 3RK4A 4X95A 3UKOA 1HQCA 3RTGA 3OJXA 3EXEA 1JW9B 2IYUA 1WBJB 3AQIA 3WGGA 5SZJA 3KX2A 2W2KB 4KUEA 3RTCA 4HL6A 5DYYA 1NI5A 1GZDA 4YMWA 5JMWA 3ELUA 2Q3FA 4C04A 4F7WA 5CXQA 4MV9A 3N0RA 5LUAA 1CY2A 3L0ZA 5FWAA 4G5XA 5KNDD 2Q5HA 1FLVA 4XDYA 3RREA 4O4IA 3LQ2A 1MJHA 3A9UA 1IZYA 3BQMB 2CXNA 3NIBA 4N40A 4DGSA 1UP7A 1PUXA 4UUPA 1K1EA 1T6NA 2F43B 1MO3A 2J46A 4N7BA 1JBQA 2A59A 4YIKA 1TJ5A 5TMBA 5JFOA 5MN4A 3EDMA 4N54A 1V48A 5EXDA 2GFQA 3EULA 3HGQA 4BNHA 4DWJA 3ZV7A 1JAZA 2CYCA 4LWQA 2FMUA 3X1MA 5ICMA 2QR3A 2XTZA 3JALA 3ILHA 4P54A 3NHPA 5FBVB 2AWOA 3QA3E 4PW0A 5JEDA 4L4SA 4WRRA 1IIBA 2QLBA 5GTDA 1GTG1 3O9ZA 4JQCA 4EEZA 5FAKA 4WE3A 4I1UA 3F9CA 4PTYA 5E3JA 2Q5CA 5IFKA 4B32A 5JXGA 5BV8A 2XE8A 4MR7B 3ZQJA 3LRTA 1Q3HA 4PZLA 5CLGA 5E8JA 5LD2C 2NO4A 2B8WA 2X4IA 2Y1EA 3KUXA 4IIJB 5IK2D 4KXWA 5C31A 4MICA 4U2BA 1N2GA 3RFUA 2DFKB 3KSDO 3K1JA 3QMPA 1Z2OX 2JL1A 3GFVA 1XVAA 1S96A 2CZCA 1S8FA 2H1VA 1UBCA 1N5LA 2UYOA 3EXEB 4NCKA 2QKYA 3DMTC 4FDMA 3CKKA 2WV7A 5A4DA 1E1RA 1ZL2A 4MULA 4P3OA 3RWOA 4DV5B 2QJTA 3KPWA 3PFWO 4GL2A 2JJ1A 3FPSA 1U2EA 2IHYA 1KOJA 3DE7X 3E3AA 4K9NA 4MTLA 1JNXX 2H92A 3OZGA 3I9KA 1KEPA 2GASA 2VWQA 3VAYA 5IM4F 5LP1A 3EEYA 4D0LB 3L77A 1LK5A 3SIXA 2GXSA 4HNQA 4QD3A 1MP0A 4O4IB 1HDYA 1LDBA 3TBHA 4AS2A 1KFBB 2JNWA 2V45A 5KYUA 1KI3A 1FDTA 4D9GA 3FZEA 3DV0A 1UJ5A 2P9TA 5HS4A 2JGFA 1PV1A 2MIIA 2FEAA 3SYKA 5CRIA 4V1CA 4TMVA 4HATA 1W36B 1PV2A 2XUAA 3F5DA 4LRWA 4P7GA 1LLFA 3K0EA 1NNLA 5SZIA 4G9GA 2HCBA 3CB2A 5K0SA 2J3MA 4OAQA 2JGLA 4IDBA 1N2CE 5J1SB 2ZYHA 3JALB 3AI2A 1YKSA 2HZBA 3A4LA 3GRKA 4E21A 3NT2A 4Z54A 1VCNA 1UF9A 1JEEA 4H6WA 4LCEA 4NBUA 3UANA 2QW1A 1A4XA 2X5KO 1TCVA 1NR7A 2IIBA 3O7MA 1O6GA 2VTKA 1N8NA 3IMKA 4JP8A 2YZ2A 3H5OA 4DSZA 1KAOA 1F2TA 3IQHX 2Q8QA 3FGOA 3HR7A 3JATA 4R31A 4YROA 2OLEA 3N3BC 4LQCA 4XB2A 5EVJA 3OEED 1QHNA 3Q98A 4IFTA 3OIUA 4KHZA 4L74A 5JCOC 2YKGA 5IKPA 3WNVA 1XTQA 5TS3A 1LI7A 2VCHA 1H42A 4ZVKA 4ZTBA 3CEHA 3IUMA 1QP0A 3MTBA 2FFHA 3CUUA 1PVDA 2EZ4A 4EGAA 1EX9A 1HGXA 3ACDA 4ZU1X 4I3HA 1M7GA 4OQEA 1QYWA 1Z2DA 4Q1VA 4B7ZA 3HDGA 3M6FA 4TRNA 3ORFA 2ZIVB 4QASA 3GVPA 1ONPA 1DX9A 1DFGA 3MILA 2ODPA 2NIPA 2DSTA 3QVJA 1UWCA 3UMVA 1F0YA 1M5TA 1EK5A 1Q3TA 1UFQA 2DFLA 3UMJA 4HUTA 2C92A 2YYYA 5KYUB 3PPYA 3FBGA 4BHTA 1II0A 1U3UA 3DV0B 3BGWA 2VT7A 2XAUA 1X8JA 3AI7A 1ZJJA 3LGAA 3L1VA 2D06A 3IV6A 3SQWA 4A1OA 1V2GA 2ZFUA 3CJQA 2BHSA 1MR3F 4V1CB 1ZX1A 4LXTA 1J99A 5FTMA 3O75A 1PJ8A 4FGSA 1T25A 4BC1A 3AF5A 5CNMA 2DX7A 1E2HA 1R6AA 3GCDA 4MAAA 3E58A 2ONKA 1RZVA 3R3JA 5C8DA 5IHXA 3UA4A 4TT8A 5F5NA 2V9CA 1G5HA 1BEEA 4BJ1A 5DN6A 4E88A 1M75A 2FMIA 3K05A 1RLIA 4RKFA 2BFNA 3FPKA 1F2TB 1VHQA 2H1HA 2FGKA 3JATB 1VMAA 1Q0TA 1I5RA 4LYEA 1GNTA 2FWBA 2AN4A 3I23A 2QTCA 3O82A 1PW7A 5D00A 4KNYA 1QCYA 2HHLA 4C4RA 3TL6A 4II3A 1C0EA 1G7SA 5JAOA 3OKFA 3WFJA 3RYTC 3UUFA 4NYJQ 3FHJA 2B4AA 3OJEA 3S2ZA 5T8KC 4EPXA 5EFZA 1X1BA 4UE6A 5JDIA 2AXEA 1SO8A 1KO4A 3C3BA 5JAIA 3RD5A 3E5MA 1J0EA 2Z8YA 4RIIA 1DCKA 1Z6PA 2FUG6 3NHYA 2VYQA 4ND4A 1PR6A 4US2R 3VJRA 2WU1A 1GFIA 2XSZA 2ZRCA 3K9BA 3K92A 1C9NA 1I7PA 3KP1A 3BH0A 3MYYA 3HXMA 2AF3C 5DYNA 4GE3A 4DV3B 1AQYA 3MN1A 2HLHA 1XNRB 2H4XA 4LS3A 1TDJA 1RMQA 1AF7A 1NJ2A 3COZA 4A1FA 4DLTA 1M0SA 3KXIA 3OF2A 4Z3KA 1C1YA 3FTCA 1YAHA 2ZE7A 4KVZA 4ZU3A 2Y2VA 1G0OA 2NNLD 3P19A 3BL5A 1G8KA 3STTA 2KMLA 4DCPA 4LBYA 5EG5A 3MS2A 2JZOA 1SCAA 3H2SA 3QENA 4FNGA 3FN4A 1KF0A 3G0GA 2EP5A 1WXEA 3EH1A 4KE9A 1RWBA 2WA1A 4KQEA 5ESWA 2ORIA 2VDKB 1F7UA 2FPUA 1H2HA 4J29A 2AE1A 3SXPA 2GZ2A 4YRZA 2RI0A 1VCMA 1GNLA 4DMKA 4L6IA 4BGIA 2V5UA 1QQBA 1E8MA 2HCTA 2HJVA 3DKPA 4HB0A 4INJA 1R64A 4QUBA 2AH5A 3UK0A 4FHZA 3HFGA 5B7NA 2OCDA 4Q4HA 3FGPA 2Y0DA 1E94E 2IEGA 2RGUA 3BHMA 3PX2A 3LP5A 4AIIA 1Q7CA 4DLAA 5J4KA 4R1UA 3KEFA 3NEAA 4X61A 1BW9A 2ZJ5A 3NVAA 5FT9A 1MGPA 1WW8A 4FK8A 3ZU2A 1JFVA 1R8XA 4HADA 2GXUA 721PA 3OZIA 2AVNA 4Q3LA 1R00A 1MVOA 5AICA 3WI7A 3JYLA 2EG5A 5CH8A 3INYA 4FMPA 1UJBA 1RIFA 2FMHA 1MIOA 2IELA 2W2OA 2I3BA 3Q72A 2DH5A 4G36A 4RZ2A 4U2KA 5KSOA 1OFUX 1EFAA 2PL1A 3MIZA 3P20A 5E4FA 3ENVA 2F55A 2IS2A 5H9WA 2EDCA 2ZEJA 4JX8A 2F00A 1XLUA 4GIBA 2X8LA 4HYQA 1FNSA 2QY6A 3MT8A 1J22A 4H1UA 4NZMA 3GDGA 4FOTA 2H59A 2OHOA 3SG0A 3CVUA 2GPNA 5B6JA 2TS1A 1XP5A 4HFJA 3WLKX 4LJ4A 5DSTA 4F11A 3ENNA 2AZ4A 2QW8A 4D4LA 3A36A 3F46A 3IUQA 3WIDA 3RYHA 1JDVA 2JW5A 1SZCA 1IBRA 1O3YA 3EIXA 3ZEIA 1Y4SA 2I0FA 2JGJA 2OORC 3PX7A 4FCTA 1QU2A 1UXIA 2B7LA 3PBKA 1G63A 5KAMA 3ZGOA 4JBWA 4AKEA 5GINE 2FZKA 2AN3A 3MUFA 3PJFA 2D1QA 1GGJA 2Z5VA 3KQSA 5AHKA 2Q49A 4LIPD 1BYUA 4JI6B 4B43A 3I9V1 3A6HA 3ROFA 3STVA 3L7JA 1H8HA 1NLZA 2XLBA 1MQSA 3HDVA 3L02A 2VUIB 2ZPAA 4MVJD 4U2GA 5BRAA 5KTYA 4B9EA 4IDFA 7MHTA 2D6FA 2AJTA 4Q4HB 3RK0A 3EGEA 3H8WA 5B30A 2OHGA 2BZGA 3CVJA 2GD1O 4F71A 1EM6A 2A88A 3TR0A 4I19A 3TW8A 3SJ7A 2CY0A 2EHJA 4J43A 1BW9B 2AXNA 3WHIA 2Y2UA 2GAIA 3WZLA 5T7BA 1P62B 4MHOA 1E6WA 2QAJA 2XE7A 5CB4A 3IPXA 4N0MA 2HPHA 3UJAA 4K6CA 1H4VB 3U09A 3DE6X 4NABA 4R8KA 5C4IA 4UATA 4JOSA 1MIOB 3ORYA 3WGKA 3LI2A 5JCPA 5EOVA 3MG9A 3PHHA 4BNXA 4DOMA 5JD6A 3E82A 5HHTA 2WV9A 1J1IA 2GHIA 1QIJA 3BERA 4RK6A 3FFXA 5FYDA 3PYLA 4TTRA 2FXIA 2I22A 3OLYA 4HDNA 3MLBA 4NH0A 4BEVA 3U1BA 1ESEA 1RT9A 2IJGX 2PA0A 3TLXA 1RWXA 3IIJA 2V54A 4I1PA 5KDLA 3JCZA 3KOXA 2PZKA 3RYHB 1ZLXA 2O2HA 4N41A 1CQZA 3W3AA 5CT9A 4YQEA 1WZ2A 2BCJQ 2QRHA 1AHPA 1H9CA 5HTKA 4ITRC 3OUZA 3WTBA 3WE7A 4C4TA 1E3JA 2QA5A 1P80A 3OBBA 3ZDFA 3HKEA 1XNJA 1I7NA 3VOBA 1CTQA 3K1TA 4PTLA 3UQYS 4D9JA 5DU2A 4W5TA 3WOHA 3WWEA 1QRAA 5G53C 1HH4A 3HMKA 1ZCJA 5HFJA 2AZDA 1WQ3A 2JBWA 3ZVRA 3TL2A 2DUJA 1E2LA 5AHRA 5KHAA 1A8SA 3BXFA 3D3EA 1W1WA 3L01A 1X1CA 2IZ1A 3Q0TA 1YGYA 3HJFA 4JLMA 3TLGA 3B7GA 2VRBA 3ER6A 5DIFA 3QLVA 3TW8B 4DNOA 4CI0B 2IT1A 2JLXA 1UK7A 3PKIA 1WQ4A 1NWCA 1JIKA 2NSJA 1P9LA 2OO5A 2V0CA 3D8RA 1D9XA 3INNA 4FWIB 5CB4B 3VPSA 1DJPA 1E9VA 4RV5A 3DMRA 3OVMA 3K72B 1EVZA 3K09C 2N47A 4Q15A 5DYWA 1NRJB 3C3MA 2NW6A 3DEJA 3KXKA 3BSFA 3LBHA 3QX8A 4D0NA 2QJFA 1UJCA 2YIMA 3D2AA 1SUAA 4C1NA 3TOXA 4YCDA 3FYTA 4HDNB 4JLJA 4E5DA 4H6XA 3NS7A 2I4LA 2LKCA 2R1ZA 4RNCA 5DTEA 4ZAZA 4ZI5A 3IPAA 3WBFA 5B55A 1ZINA 4RHCA 3A4YA 2BGGA 4ZT3A 2XA9A 1A88A 3RT1A 3J80A 1R66A 2Z5LA 4EM6A 3A4VA 4CVNA 1O58A 1P73A 1BXZA 1S4MA 2BEUA 1F8UA 2G0AA 2VJDA 3LIIA 1VIDA 5DV9A 3VUFA 2VHZA 3WB9A 4AMVA 3PFGA 1NW7A 3BE6A 2ZKLA 1GPNA 3SN6A 3VPXA 2WAMA 1JR3E 3HKEB 3PXCX 2FEKA 4HQKA 4KXVA 1E3IA 1T1RA 4AKSA 1C81A 1IXKA 2GLTA 1M5UA 3LQQA 1XJCA 2B1GA 3CNLA 1ZGZA 4MLCA 4MHSA 5FH9A 5JYDA 1FP7A 1G5IA 1NW3A 3GJSA 1UKEA 3I6ZA 3NYWA 3PT9A 4KO2S 1K63A 4G3XA 3V1YA 1WXIA 5K8CA 3U5TA 1XK6A 3FD8A 1T34A 4G8CA 1LJLA 2B82A 2GN2A 4MUEA 1ORDA 4NYIR 4BBJA 3BIWA 2A3NA 1JVBA 3TLGB 1RRFA 4C4SA 1M2HA 1JP7A 1JG3A 1XI2A 2HJGA 2QRVA 4P7FA 3ORSA 5GAJA 3NM6B 3B6ZA 3AL2A 2IEBA 1B41A 1AKMA 2ZS8A 4XQGA 3TLAA 5H1YA 1NSTA 5B58C 3O90A 1R9NA 2HSJA 2IXBA 1Z0KA 4P4TA 2GPYA 1NY6A 3DE3X 5CG2A 1OKKA 4Z4EA 2CVQA 2JVIA 5HUJA 4DV7B 3ZLVA 1VJRA 1TMKA 2FKAA 1HURA 2R62A 4PGAA 3N59A 1ECBA 1KSFX 3PJDA 3UIEA 4A0FA 1X39A 1UK6A 1ZVJA 2PO7A 2IDZA 4KCGA 1ZSVA 3A70A 1PAUA 1KU0A 4TSKA 5KAPA 3P8ZA 4YXWA 5TPWA 5DM60 3O1IC 1HK7A 1IZ0A 1NI3A 3FFTA 4L1KA 4OA8A 5KQLA 3TG2A 3ZJUA 1ZK4A 1DSSG 2BEUB 2V6GA 3BXOA 3EWSA 3KALA 4Y0VA 4ENWA 5FWDA 1YZ3A 4U2CA 3PF8A 5K3OA 4PC3A 5COAA 1MT0A 2KB0A 1RKUA 2JK0A 4LQLA 2OGTA 2XT9A 3WO1A 5JLJA 1D4FA 1PG2A 1BCRA 4NAUA 4IWYA 3C7CB 4WOKA 3ROPA 5A06A 1DRVA 3IDZA 1ABBA 3R0JA 3Q9UA 5A3VA 2OBBA 3RUFA 1TJPB 1NXTA 2D59A 2VDJA 2DBVO 2D5IA 3MUEA 3DE2X 3ULKA 4AP6A 3TF5A 4OJKA 4WX2B 4YP7A 4FOSA 3AXSA 4G25A 4Z7QB 4Q82A 1Z15A 2HEGA 1N9GA 4P8RA 4M8SA 4U00A 3LC7O 2Q1TA 1C14A 1EUYA 2YWGA 3C48A 3WR5A 4OO3A 2QRVB 4R5MA 5GIPE 2P5TB 4FM9A 5FFMA 1M8PA 3BWYA 1G9XA 2PWBA 1R7RA 4D80A 3PQCA 2ID9A 1D5CA 1VJCA 1O5IA 4DKXA 2PXAA 2WAAA 1EUCA 4FHGA 4CDNA 1N5OX 2WJ3A 4X7BA 4FCWA 3FOBA 4B3XA 3NDBB 1NRIA 1OX5A 3RG8A 3D02A 3ZTYA 3RDPA 3KSBC 3CLUD 4OOEA 4TQUS 2LBPA 3K70C 2DOKA 2IHTA 1F1JA 1HV8A 1NUSA 1XMPA 2LNDA 4QYIA 5FUWA 1YJAA 1YS2X 1TVMA 5J58A 3Q9SA 4KSBA 2FMKA 3N2IA 3NZEA 2R8EA 2OM6A 1OXMA 3PXEA 4PQFA 2RHHA 3TN7A 5F9FA 2WHQA 1XZLA 2WJHA 4E07A 4F84A 6Q21A 2O3SA 3RO7A 3H2KA 5TMPA 3SI7A 4H7HA 1U81A 4PZ0A 2P27A 1HDXA 3LS2A 3I6YA 2B35A 4KXFB 4JGIA 1QYVA 3HVIA 4IUBS 3M89A 3HP7A 3T9AA 3U0VA 2VJPA 4C87A 1BCRB 3CE6A 1MIHA 4QZVA 1W0CA 3TRFA 3AFOA 2UYHA 5G40A 2R66A 3UMSA 1LBQA 2I8LA 2XUDA 5TJ9A 3RVLA 5A1TA 2HY7A 1A2QA 3U1VA 3ETGA 3LRPA 4EK9A 2EERA 1W73A 1AXGA 1CFZA 1N9GB 4KQ6A 5CVCA 3WLAA 4JEHA 1CUCA 4MK4A 4LJ8A 4WEQA 2D5CA 5EPUA 5DK4A 4XFJA 1Y0BA 2XNCA 3LYAA 4KXLA 2ANCA 4ASUD 1JHRA 4NFYA 5JMOA 2C5HA 2O8FB 1PJTA 5IEJA 3EEBA 3IHWA 4S04A 2PGLA 1QG2A 3WKDA 1EUCB 1WUTA 4XKJA 3V4RA 5I3CA 1P5HA 1CJMA 1NP6A 2YL2A 3JQ9C 4B3DA 5I7AA 1UP6A 2Q41A 3CNOA 1CUSA 3DTVA 1Y1KE 4JKIA 4FR2A 1J7KA 1GRNA 4QYIB 2WE8A 4TQGA 3RVOA 1MFPA 1C5KA 3G2MA 1DXHA 4LMRA 5JC8A 3DMNA 4IVPA 3GCGA 5JYEA 2QT0A 1KMHA 5AM4A 1QO7A 4F97A 2JFYA 1XD2A 3PSHA 3RYCB 1XZMA 2CVFA 2OB1A 3PQFA 2WTEA 1PT7A 3GFRA 1U11A 2V74B 4YJGA 1YCFA 1CF9A 1UDAA 2O0JA 2YWXA 4LJSA 2PSSA 4BZZA 1NQ5A 1SQ5A 4MA5A 3RG2A 4B71A 2PO5A 3W77A 2OZPA 5AW6A 3QVLA 3UXYA 4TVSA 1KQOA 2R7LA 2R6FA 3QVOA 4QVKA 4EA6A 3K9WA 4Y9SA 3DKVA 3OX3A 1VP9A 4L5YA 5FBLB 4A6EA 1GG5A 2YW2A 1AXEA 4FGKA 1RNLA 3E9EA 4OL0A 4BKMA 2PS3A 3U4CA 5CD1A 3Q4GA 3H1EA 3CW9A 3RABA 4Q4DA 2FPIA 3OCJA 3S2FA 2PWPA 3SSOA 4OM8A 5LJIA 4FFVA 2YHIA 1DG9A 2HK9A 2HOQA 1U9YA 3PXAA 3GBSA 3GPIA 3JRNA 3KC2A 3ODGA 3AU9A 1CJCA 2R7KA 2JI9A 1GAXA 3L2OB 2LD4A 1R4NA 2QYTA 1ZQ1A 2VO1A 3T5GA 4ZZ0A 2XI4A 1FLNA 5AI6A 4UFPA 3SU8A 2BFOA 3FVQA 3MWGA 4WY5A 3DTVB 3MUOA 1KEUA 2ZI3A 5A0FA 1AOXA 1COZA 2GKSA 4IVNA 5ES4B 1SGWA 4LPSA 3GEEA 1I3NA 2GA9A 3DE5X 4OB8A 1E1MA 3KXLA 4XEHA 1QIEA 4G0OA 4BRSA 1T8YA 3A6PC 4QPPA 3VZBA 1VZ2A 4OLAA 3MT9A 2VATA 2GN4A 3M6MD 2PL5A 4GX5A 1KMHB 3N8IA 5FTJA 3C15C 1XD2B 1YE5A 1VGVA 1VLVA 2EOAA 2YDYA 3A1CA 4NP6A 1XA4A 2YIDA 4M87A 4PPFA 3K8ZA 3BXEA 4YJGB 2DRIA 2B36A 1XEWX 5CA1A 1MC8A 3TO5A 5FBHA 2HSZA 3WGQA 4E5YA 2I6FA 4QUKA 1IRIA 2A92A 3KOZA 2VNIA 3OFND 2GMWA 1KEZA 3H7IA 5EZ5A 3PEFA 2BL4A 3KS9A 3EVGA 4MUMA 3LCMA 4PTZA 4ONEA 3TGPA 1MHTA 5IXSA 5CLLA 4ZANA 2WQ6A 4G0QA 4S1VA 4JLUA 3PNLA 3GFSA 2Y4OA 3F7MA 3OO1A 2JEOA 3VZSA 3VTKA 1KDVA 4Q02A 1ZSNA 1TQ4A 3D31A 2FPIB 1KOLA 4N49A 2E82A 4RHXA 1E2QA 1RC0A 4AROA 2QRPA 2XQVA 2RKOA 4M0FA 4Z49A 2YHIB 4MV3A 2AK3A 1DXQA 2PUJA 4E51A 2NGRA 4R9RA 2I66A 1B0ZA 2XMPA 1DQNA 1F8GA 1TK9A 4B2PA 1U2ZA 3L4SO 4IHJF 4XCQA 4X6LA 4K9LA 5ULLA 1Q0SA 5DOVA 4FFLA 3WGOA 4EARA 2R97A 1EFCA 1DRKA 4TKUA 5FTLA 4WVLA 1VHWA 1R4NB 1KOGA 3GG2A 1JSXA 2YUTA 1N1GA 2ODEA 5FLXA 1QV7A 5KNLA 1RDFA 2VQFB 3DD5A 3Q5EA 1AGRA 1SOUA 1SVKA 2O57A 3A1VA 3CT4A 5LNK6 3L6UA 5JAHA 3ILYA 1JWAB 2VSXA 1N6NA 3IYLW 2PT6A 1EP3B 1U3WA 4KWIA 3VYTB 2HADA 1R74A 3U3ZA 4HFMA 5L4LA 4UOZA 3H99A 3M6XA 3CZAA 4UUAA 2VVTA 5BSTA 3SHTA 3R8XA 1USIA 3CF6R 2IXGA 4V02A 1J0XO 3KUDA 3TZLA 2GPBA 1XTBA 3U80A 3PCRB 4RCYA 3DOOA 4BLWA 3G17A 1YIDA 2DLDA 3IE0A 4IFEA 3M1AA 5ALJA 4HX5A 2ZRIA 4AUEA 5CA1B 4RJJA 1TA4A 2QSUA 3HSSA 3FI9A 5CVEA 2GRUA 1G8JA 3P0EA 1W5AA 2A0YA 2VPYA 3KHTA 1KZGB 3VC7A 2RHJA 3NNSA 1RC8A 4S3MA 3FMGA 5K0EA 4MYTA 4CIDA 1Z4QA 1ISIA 1CZHA 1BMQA 2GERA 3A2MA 3BS4A 4X1KA 5T67A 4C2UA 1ADBA 2O1SA 3NTRA 1QQ7A 1V7ZA 4G81A 2G4VA 2P6NA 1R6TA 2XV1A 4M0EA 5F2OA 5HBRA 4F9TA 1U7PA 4U7HA 1UC8A 2YXPX 3HU3A 3G3EA 1QHYA 3E0XA 2DHEA 3FOCA 3HLKA 3K15A 2RIPA 4TT3A 4DAOA 3MJRA 3OZCA 2H08A 2XNDD 1VKZA 2FSVA 1G8MA 2QQFA 1DB3A 3LW8A 4QUIA 3WSTA 2FNAA 5M2QA 3K3PA 2C7PA 1XPOA 5FUMA 1IJBA 3DMDA 3EWAA 4HAIA 1HRDA 3SYMA 1GILA 2WINI 4BU1A 4YHBA 4JYAB 5TQVA 4TKUB 3M49A 1PR1A 1T2EA 5CW1A 3PJRA 1D1PA 1OW3B 1RRMA 5DLEA 2E37A 3C98A 1N3BA 3DWFA 4IV8A 4A0RA 1O6FA 4KC0A 3TNYA 1M2KA 3SYRA 3E2MA 1PSZA 2ZYRA 1KY2A 1G7CA 1T3GA 4CIVA 1QHSA 2OXFA 4KZKA 3QIAA 5EHIA 2WT8A 4C78A 1GQ2A 2GK3A 3E9MA 3HZRA 4QNRA 2ARKA 3ROMA 3ZN2A 3OC0A 4C30A 3JZAA 2H7YA 3R7SA 4GMDA 2WAYA 1B43A 3NFYA 4JYBA 1G5TA 1UKAA 1E32A 2C5SA 2DY0A 1Z0UA 3KE9A 5DH9A 2F62A 2PYIA 4L9RA 1K9SA 2NV0A 1OFIA 4HEQA 1IM5A 2GPAA 4PIVA 3F7TA 1JHQA 3PHCA 1F0KA 3WO0A 4WACA 2ZITA 4X1KB 1ZFNA 3TDKA 3CGGA 3RAJA 4N8DA 4BPRA 3ABQB 4GS5A 3A1UA 3ZD9A 2QR2A 3K9LA 1I6MA 1GPKA 1XVVA 4KX5A 1Q22A 4AJEA 4XVCA 3UJPA 3VO2A 4A36A 1D7AA 2BUBA 4Z99A 1W581 2CDCA 2OVFA 3BUSA 3KR1A 1VJ5A 3QG1A 4FHDA 3FCUB 2PFSA 5K3CA 4RTLA 5CFOA 1CR6A 5EE1A 1XQ6A 1MABA 1MEOA 3TSAA 2HAEA 1QHEA 3H2ZA 4TGLA 3HDQA 4J91A 1RXWA 2JH9A 1IHYA 2JD2A 1RQNA 3ND5A 4GM1A 4EHJA 3S6JA 3SS7X 3UGJA 4IDGA 3LRXA 2KBFA 3QFCA 1U98A 2FPGA 2RHOA 3VDMA 1OAOA 2D2XA 3O6VA 1R18A 4MGYR 2ATIA 4YRTA 2F48A 2ORYA 3DL7A 4H16A 2ZYIA 4YRNA 3GGDA 2XQJA 1T43A 1U80A 1JTFA 1L8OA 3DEIA 3GB9A 4HDSA 4J7XA 2XB8A 4IUDS 1HFWA 3A4NA 1JQBA 3K96A 5LZ9A 3G49A 4E2XA 1ZVKA 1IFXA 2PZ8A 3N1UA 3QBVA 2SKDA 5CNIA 3MD0A 2B99A 5EJ2A 2GCPA 3L07A 3VOSA 1G2PA 3HL0A 4FYHA 2DULA 1YE8A 3TOSA 2FSSA 2QVCA 3SBOA 3TRDA 3N2KA 4BLPA 5C7YA 4CIAA 1YB4A 1MA3A 5LMZA 2BFCB 3FLBA 4MUJA 3ZU3A 3BCSA 2ICAA 1VECA 5DX1A 3OQOA 1W59A 1ISJA 4IRUB 2CT8A 1CUIA 2V3CC 2C4UA 2FKNA 3B7PA 4Y1GA 2BI8A 3NBKA 5EIBD 4G67A 1G3QA 4U0KA 1NQVA 1SHLA 3O21A 3GLHA 1KK2A 4UBLA 1PBNA 2WAXA 1P3Y1 3D43A 3S5UA 2ATEA 1CVIA 2JHCA 5FL7D 4EYQA 2F8SA 3AL3A 1ZI6A 4EGSA 3EGOA 1KETA 4DSOA 1GQSA 3CWZA 1G3MA 1POWA 2A84A 3AM3A 1TEVA 1JHDA 4DANA 2A78A 4HTAA 1R0YA 1DC3A 1MABB 1TYAE 3RLIA 1QF9A 1H4QA 3QFSA 3N53A 1BDJA 2QMOA 3M3HA 3QI7A 3CH7A 3QQ5A 1CQXA 4OGGA 2I8AA 5I9IA 1CR0A 2A35A 2HD4A 2JAOA 2NYRA 2P1RA 3L7IA 4GPTA 3ZH9B 2FPGB 3Q5GA 1R0SA 2OZKA 4OQMA 3WL5A 5JFGA 3UFXA 2H2FA 2XCOA 4ETNA 4ARIA 1WBBA 2ERXA 5HZGA 3G8YA 1VE5A 4RABA 4DXAA 3PQ5A 4GP9A 3E81A 3CN7A 1PR9A 3VVCA 4PLZA 2D5BA 1QB7A 3S8YA 4HDSB 1E3EA 1SPBS 2C7RA 3P0IA 2WOJA 1YV9A 4QOFA 5EKUA 3LPCA 3CISA 2C4TA 2XYPA 4YV7A 5K2MA 2J3HA 3L9XA 3ZX4A 1PZMA 2CJXA 2QU8A 3KXDA 3WK4A 4YMVA 2AC7A 1GAEO 3K7EA 3FLMA 3EPHA 2GN1A 3PPVA 4RZHA 5LQKA 3KJQA 3SYNA 2F64A 3DCNA 3D0RA 2B2CA 2BGRA 4DCVA 3N2KB 4RA6A 3QITA 5E7QA 3NNNA 1V9CA 2DPXA 5H4GA 2BJWA 4I9HA 1W29A 1H93A 2CZGA 4FZ3A 1QO0D 3JWPA 5CK4A 2Q27A 5DP2A 5EQFA 3C3DA 4D9MA 5K01A 3CSSA 5M29A 3G2KA 3WLMA 4F1KA 1Z47A 1W5EA 4R3WA 5F4BA 3BXHA 1W4CA 2QXTA 3GLHB 1P8JA 2MOKA 4DA7A 5ITWA 1AO0A 2ZIWB 2DF8A 3L5KA 4L28A 4P5PA 2BGNA 1OR8A 1SU6A 1TYBE 1H2WA 4GRDA 3C24A 1WVMA 1L5QA 2GD0A 5KMGB 1RQGA 1KJZA 3NM5A 4QU0A 4BVGA 4IIBA 1W94A 1Z68A 4QU8A 4QARA 3RS8A 1FNMA 4LF8B 1AA9A 4JZKA 4BV2A 1JYEA 1WABA 2QU7A 3UFXB 5JRZA 1X94A 1UT6A 2BKUA 4OKNA 1IATA 1Z3CA 3WGUA 1E1LA 1WB4A 2O8VA 1O94A 3G8AA 5KJ1A 2C98A 1BHQ1 3KT6A 4JBIA 3ZZNA 4OI1A 1KAMA 5JS1A 1G55A 2I03A 2DECA 4P32A 1EQAA 1FVXA 1Y1SA 1DBPA 2VZ8A 1FSGA 4K86A 3HGTA 2VN8A 2B5WA 1V7CA 2XKJE 2ZVDA 5KSZA 1ZCZA 3OPQA 4I14A 1FDUA 1BKSB 5H5JA 1QJ4A 2DUWA 3BIXA 1EDBA 1YDEA 3DDUA 2ZI6A 3H42B 2PKYX 2IHZA 3GWZA 3IQIX 1ONNA 2I2AA 3PE6A 3G0DA 4OB6A 1KERA 1PKEA 4JA0A 4RA6B 2EKZA 4Q9IA 5JZVA 4N7MA 2J67A 5PNTA 3U4DA 3NXSA 4MQFB 1Y9DA 4MTCA 5TT0A 3QVMA 3ZI0A 4EKIA 4ZT5A 4TZ6A 1KJQA 2QJOA 1BX1A 4KQ1A 2JGMA 1G3RA 4MGZR 5HGJA 1ST2A 1WU7A 1WIWA 4Y2PA 2DR0A 3HBJA 4TTAA 3PE4A 5HG0A 1U0JA 2X0JA 3ZWDA 5AM2A 2BE7A 4NU5A 2A5DA 2BAGA 3RTEA 4TMKA 3VTZA 4FFDA 4KL8S 2MMCA 3I9V6 3HM9A 1AIPA 1IVSA 4BMXA 1ENZA 4CF7A 2FSIA 1MHPA 1RYZA 2LZ0A 2VSFA 3HI6A 1T13A 2H4YA 3L7LA 3MGKA 5FQOA 4EFLA 3W79A 3WBKA 1DBSA 4R1TA 4OX9B 3IVGA 4YAFA 1YC5A 4M1ZA 5IKEA 5I9MA 3VDRA 5M7EA 4WZAA 3SQNA 1WXGA 1ZOOA 2XTNA 3VO8A 3JPYA 3HVJA 2R6AA 2J3LA 4GXRA 5J5VA 4QULA 4TWAA 1ZUIA 2NVUA 1O8CA 3QVWA 1DKLA 1SB9A 1ZGAA 4HGYA 2XB2A 1S8OA 1X77A 2FSHA 1N2JA 2CBXA 3UWMA 4HS9A 5JSKA 3BTUA 3PDCA 1E1NA 2IYRA 5EIAA 5L51A 3OAAA 4IQGA 5BRNA 2VOJA 3O8NA 3OCCA 5CNJA 1ZESA 2WR8A 5AJUA 5JY1A 3C1OA 3BYZA 3LP6A 1TQDA 4D74A 2PS0A 5D5HA 2F1IA 4CV1A 4JJGA 4ZODA 4Y9RA 2HNAA 3E7PA 1EVEA 1BFDA 1Z45A 2XWSA 1AA6A 2IX3A 4MQ5A 2G4CA 1WLSA 2O8CA 3U0BA 4UMEA 4OH1A 4B2LA 3W78A 5FX2A 2GEFA 4PVCA 1OX4A 1YAJA 2XUQA 5ALLA 3U37A 1P6QA 1NSFA 1FC0A 1PKXA 4D3FA 1E6MA 2IYSA 5HUQA 3B6MA 2C3OA 3A0RB 5ALGA 1FXSA 2H29A 1XNGA 3VYRB 5KSPA 4F4DA 1LCIA 2OQIA 3V9PA 3ICCA 3NVDA 1IM8A 1YR2A 2ZRMA 4PZUA 4IRXA 1T9AA 4JMLA 4TWIA 5M34A 4IGAA 2NPFA 3GJRA 4BN5A 1HPLA 1VLZA 1VA4A 1ZK3A 1S9HA 2BEVA 1QG6A 4ARZA 2GBPA 3FCSB 1NW5A 4GBGA 4O4LF 5T4BA 2C9CA 1GIAA 3RUAA 4FZ5A 1HDCA 1QFXA 1TYEB 3F8WA 3FG9A 5B37A 1D0VA 2QSJA 4PX9A 5CDUA 5LQAA 4PRYA 4WZAB 3HJUA 3JQ7A 4EUEA 4U6NA 4I55A 1OT5A 4GRAA 4J1NA 3RSOA 4H27A 3ABRB 4F21A 2DM6A 4G0WA 2VQDA 4KKXB 2NVUB 4PU0A 1O9HA 3T4EA 4RADA 2OCGA 2EW2A 2W6CX 3O3CA 5GWXA 4AF7A 1BOOA 2OBYA 1SUCA 5E7IA 5JXWA 2QVLA 2Q5QA 5LQNA 5IX8A 5KJFA 4QQNA 2E4YA 1EAMA 1GCAA 5JWHA 1QYXA 4ID9A 3E70C 2PX8A 2JFGA 2PSFA 3ANLA 4HI0E 5LWHA 5HRUA 1HBJA 1SUEA 3WLEA 4DA9A 3BTVA 1VSQA 2K87A 2Y0PA 2HW8A 2O8CB 3W5AA 4IMIB 2BF4A 4ISBA 1KJWA 2OBFA 1OX4B 4DUYB 3MMSA 2KWIA 1IOWA 4POAA 2VXYA 4KXUA 4WLVA 3T3IA 1U0GA 5DYTA 1KP9A 3DO5A 5ALXA 2FSPA 3I12A 2VNKA 3DP9A 1SXQA 1IBKB 5ECGC 1MKYA 3IIEA 3JZIA 2EKPA 1EHIA 1MO4A 2OAQ1 5KTTA 1TEXA 1CR4A 1GGEA 5SYAA 2QR5A 4G9EA 1E9AA 3LUPA 4XB1A 2P75A 2WU3A 3IR6A 2BEVB 1LPPA 4ARZB 5J47A 4JP5A 3K5PA 1L7QA 4R2MA 5JMPA 3SX2A 1L5WA 1VSUA 1XC7A 2A9OA 2OGUA 4TV9A 2APJA 2R11A 1LK0A 2CDBA 2FSFA 4BE9A 3QXJA 1X7GA 4PYMA 4ZA2A 4DLZA 4F7DA 1LRKA 5HKKD 1RI1A 3QPCA 3GPCA 1EJ2A 3JQ7B 4JEUA 5DGCA 4I55B 2ECQA 1W30A 2XMCA 3O4RA 2AQ8A 1IQPA 3SEZA 4M8IA 5E8RA 2IEDA 4FE3A 4Q05A 1IQ0A 1PW5A 1W5FA 3HKBA 4COOA 4RZXA 1XLTA 4EJSA 2EJBA 5ICFA 1YXMA 4JVLA 5JTUA 1HEUA 1WRBA 1GGHA 3AFHA 4KG7A 3UAYA 3ANYB 1WMEA 1GCGA 3I58A 4WEOA 5I51A 2JJMA 1R1DA 1R3DA 1SKBA 4IYRA 4RK5A 2J85A 1BS1A 3ZDAA 3LL7A 2HDNB 3CV3A 3WC4A 2KW5A 2HXSA 3MB8A 4CQNA 1PQWA 1WXWA 3HBNA 1KWGA 4IX9A 3L8ZA 5YASA 4PPNA 1OI2A 3GLGA 2X2PA 1L5OA 3ZZTA 4CHGA 2B4RO 2GJ4A 4ZVVA 4FGJA 1U5CA 3QV1A 4NG4A 2Q9CA 4X44A 3GA5A 5IVHA 5FPHA 2AI1A 2DMRA 1Y1TA 3W6NA 4GO1A 1UM9A 2XGOA 4F56A 2PY6A 3L0PA 4FE7A 2C2YA 2R25B 4KE7A 5AM5A 1CJKC 4KR7A 3WX0A 5BT8A 2WFAA 1PTJA 4RELA 2PKQP 4YRRA 4S1PA 3RYFA 5ABPA 1DDOA 3KD2A 2VUUA 1F4VA 3L7KA 2VKQA 3V48A 2HX1A 1SY7A 4Q7LA 1UJMA 4IVRA 3K8OE 4UTNA 2NVBA 1Z4JA 3GV0A 3HLYA 4TV9B 1U0EA 3GN2A 4X7PA 4DIMA 2V7GA 2YVAA 4NZYA 4AKIA 3H5IA 1YB7A 3ICPA 4FZRA 3WB1A 3H2JA 2PT9A 2HSEA 1SXJA 3CNQS 1Z7BA 4IJUA 4LCBA 5F64A 1YRQA 2XOEA 2I4RA 1XKQA 1UBFA 4LYAA 3FKJA 1NVWQ 2QSZA 4JENA 1EQUA 3N07A 3D81A 1TRHA 4C0AC 2O2JA 1SQ6A 1XCBA 3HKBB 4EJSB 3QKUA 3O2QB 1F6WA 1Q1QA 1VLHA 4BZPA 1RQRA 3I2IA 4U8GA 2PQMA 2I7XA 5CJPA 2QRNA 1SCKA 1FSFA 2JB9A 3IODA 3B53X 2DJIA 2QS9A 4Y6RA 1NLMA 4M7WA 3SEAA 2J6HA 1IXSB 1PNTA 1T1JA 1CP2A 1MO6A 4WY2A 5IJXA 1XWWA 3FSJX 1E7MA 4DQVA 2PGDA 1ODKA 4BZQA 1IYZA 3GLGB 2Q0XA 1Z0ZA 3TM4A 1RBYA 4LZWA 4QO7A 5EUCA 1YS9A 1UDBA 1MMFB 1TEHA 2IQ5A 2O3TA 1TJ4A 1GUDA 3W2GA 5FFFA 3CMCO 1UM9B 3F3MA 3FBWA 1TB4A 3N6RA 3NR2A 2Y77A 1FEZA 1N6LA 2ZT6A 3AM5A 4CV0A 2OWEA 3FHOA 3RYFB 1XWIA 4J1TA 3GQVA 4UBJA 2J9YB 1TUBA 2QQGA 3AJDA 3E9YA 1E9SA 3JRXA 4TMXA 3RVDA 3UG7A 1KBQA 2Y6VA 5L6MB 2O8DA 2JFWA 2P9YA 4J0IA 1BMFD 2H18A 2DWPA 1Q91A 3EQZA 3MTAA 1IMOA 4OQFA 1JWBB 1YH3A 4IHJA 1VIMA 1VIYA 4ABTA 2GVZC 3AVOA 4NTZA 4BB5A 1AMOA 4WOBA 1SXJB 4XXHA 1FP1D 1ATZA 4RIHA 1KP2A 1EG7A 4W6QA 3C14C 3PGKA 1HKUA 1GUYA 3TKAA 3GRRA 3OUUA 3UMRA 4TL6A 2R8OA 1NXSA 2H0AA 4IIHA 3RC3A 4EA9A 4F2GA 2IWHA 3K0CC 3Q6NA 5KNBA 2G5GX 4DJTA 3ZVMA 4DR1B 2FZEA 4RDHA 2WEKA 1IPEA 1U3VA 3IAM1 3L49A 3U2QA 4DIOA 5JNVA 3QQPA 3RI3A 2YUIA 2ZQZA 4RY0A 4YMGA 1PT8A 1RCUA 4RDIA 5TQ0A 2KS6A 4P3KA 1OYOA 3LUJA 1Q6ZA 2LE0A 1QUEA 5BPFA 3N0TA 1GL7A 3RRMA 1K6XA 5D85A 4AK9A 5AI8A 2DQZA 4DMGA 3KFLA 2NO7A 2X9LA 3JY6A 5LLDA 1PIWA 2II6A 4BB0A 1RS0A 2O2IA 4R1LA 3TJZA 1VI5A 4B6GA 1AQUA 2HEIA 2EFDB 2YS7A 3DVLA 4EG3A 3Q12A 3KCNA 3P9ZA 4C7JA 2OBXA 1V39A 4WXRA 4GQBA 4X66B 3M5DA 1N4DA 1AGNA 1DBRA 3HCOA 5DM2A 4B5KA 1ATIA 1Z5VA 1TUBB 2HBRA 2HMSA 2WHEA 2ZXEA 4H31A 1NHGA 1S3GA 4LSWA 4P2BA 4RD6A 3SD7A 2O8DB 2H5JA 1U7TA 2G8NA 4E5SA 1N5KA 1PR0A 1IVNA 4D9EA 5JSHA 4E13A 2VTVA 5JD5A 1UT5A 3J81A 4IHJB 1OFVA 4IJQA 3JQEA 5JXHA 3E9DA 4O3FA 1A8HA 1JIXA 1E9RA 1YB1A 2VLBA 2ZYAA 4CBVA 4E6PA 1R8JA 2DTDA 3G0CA 3H6HA 1XXHA 2VCEA 3MVEA 1ZMBA 3MAGA 1OGJA 3OJOA 5DBHX 3ZTTA 4B0OA 3FYSA 1X0XA 3UK7A 1V25A 3ECCA 2OVBA 7MDHA 3DEZA 4LHVA 2RCYA 1Q50A 1U0HC 4JJZA 4NVRA 5KTPA 4CCSA 5JMTA 5KREA 2AW5A 3P9IA 3TR6A 3O0TA 3Q15C 2ACEA 4G6ZA 1HQDA 3VH2A 4ZTZB 2FWAA 2Y1WA 4GGPA 4KO4S 4KQMA 1DKUA 4GHWA 5ELMA 3L0BA 1YVRA 4MLZA 1I10A 3PD1A 1JBKA 3CNNA 1AUPA 5TQ0B 3RVNA 3S1SA 3NUQA 3O3OB 1VBFA 1Z6XA 2CBZA 3RRNA 2AE2A 1E66A 4N5HX 3RUHA 4JJIA 1QPBA 2QPLA 3H86A 1OLXA 3C6KA 3W1VA 4YACA 2Z6QA 2B6HA 2HU8A 1OASA 3OPYA 4A5OA 2XBMA 1VJTA 2YIVX 1ZHOA 2IUTA 3NWEA 4F0JA 5LR6A 1P33A 4G37A 1JSLA 4X92A 2EZUA 4FD2A 1WHTA 4JITA 3X43A 3ZXYA 1S5PA 3GUCA 3ETHA 4C0WA 1TZJA 5AKLA 1AQLA 2AYXA 4RC9A 5I7OA 2ZSAA 3TFWA 4TYPA 1NMQA 2WM2A 1F2UA 2ZWVA 3E7WA 3BK1A 3M82A 4CM9A 2HSWA 4KMOA 2YMLA 4GC5A 1PU2A 1Y3CE 2NUAA 3EH2A 2W2QA 3H2GA 3NEPX 4BX0A 3BMOA 1YQQA 1B8NA 5DBGA 3IAFA 1IOLA 3FNFA 5IZCA 4TS3A 3AM1A 1EFUA 4G0VA 1XUOA 1TYCA 2RG7A 5KQRA 3WA7A 1XXHB 3ERCA 3DVSX 1H6AA 3HJAA 4JA2A 3PUXA 5TNXA 4EYEA 5H68A 1G6KA 1XEWY 3AVQA 4B75A 5EA2A 4ZI7F 2GARA 1LNZA 3IO5A 3EFOA 5BWNA 1BTOA 1TKAA 3FGZA 2EATA 1RU3A 4LVOA 5KNDA 4JSTA 3HUDA 4U2EA 3TI9A 2AOUA 3M4XA 4AWBA 3A3YA 3UMBA 4E6EA 5FPKA 1DQRA 3PRYA 4LV6A 1UBMS 2A33A 5AWFC 3U48A 5A9RA 1P1CA 5H3LA 4YPFA 1VIAA 3ZW7A 2GETA 4JROA 1JKFA 1JKIA 4OXXA 1GLNA 3KQLA 1LQTA 1MAUA 5K3FA 2X76A 1V3TA 1OLXB 4L6CA 1I7QB 3BZBA 1BMTA 1IAVA 1RJ9A 1DOAA 3OPYB 5DNUA 1RAHA 2K5UA 4D8WA 4HDRA 3JR3A 4KN6A 3HJBA 2HA0A 1N0IA 4AJPA 3WAGA 1WHTB 1XTIA 2Y93A 4K26A 4MQBA 3QWBA 5AKZA 1MB9A 2OZVA 3RNLA 1FTWA 1NUAA 4FSDA 4N8EA 3WOVA 1RI4A 3HFSA 4LW8A 4OQ4A 2W48A 4BBPA 4V0OA 1AGYA 4GF5A 3ROTA 1F2UB 3CJRA 3VV2A 1H3FA 1UR5A 2Z2ZA 3FETA 4FDAA 4QFBA 5CYGA 3SBXA 3KEGA 4IIGA 4W5WA 5EHZA 5LWQA 3QEKA 3LG2A 1TUGA 2NUAB 1OXXK 5IK2A 3K70D 3BMOB 2E5LB 3FIUA 2ZTSA 2D3WA 3ZIAD 1PQUA 4DLLA 4DCJA 1VKOA 2NTEA 4GLBA 3TW0A 1LC0A 2AEJA 1T2DA 5MDHA 3AUXA 3IXQA 1W6RA 4PYNA 1GKLA 3GJ0A 3AP2A 3BRSA 4G2NA 1H8ED 4OVKA 2V5AA 2EGUA 4TQAA 2XYGA 4JBXA 3EFOB 1E7SA 4ZHSA 5KC8A 4CLDA 4F8YA 4E3WA 1Y48E 1YBFA 2CJWA 3L4KA 3EODA 3LQRA 1Y1RA 3M1IA 2WWHA 3FMIA 4GYWA 3Q7RA 4TLDA 4F06A 5CFNA 3R0VA 1D2CA 2ZXUA 3U9LA 3P94A 2AOUB 2RONA 2XMGA 1OCEA 1M73E 3FNQA 1NR1A 1KS2A 3MT7A 4QXRA 1SCJA 3IBGA 3NXKA 5A9SA 2VAMA 3HXQA 4TLMB 3OHSX 4X3PA 3WLPA 3IDSA 1LH0A 3LLMA 4MW7A 2IWRA 4D4IA 1ICIA 5K3FB 4HRXA 5CCDA 3H6GA 5J4YA 1N92A 2HWWA 1AHNA 3LDGA 1B0AA 4RHFA 1B6SA 1RJ9B 3DGFC 1L4HA 3MRSA 4J8PA 5DP1A 5AOBA 1JXQA 4OGFA 1G9SA 4HDRB 2C7GA 2ONJA 3FWHA 4LHZA 3B1WA 2ZSDA 4ZREA 2YIJA 3TKYA 2JAHA 1TTHA 3HR8A 5BN1A 3V1MA 1I36A 1QHFA 3KQWA 3QWIA 2ZM6B 3SEQA 1ADFA 4Q93A 4B79A 3U56A 4LC1A 1C7EA 2ZTUA 3W7BA 2I7VA 1XZJA 3ZI7A 1UEXC 4HGRA 3VVMA 1U2TA 1WEHA 3QVUA 3OEEA 5TB5A 1IQRA 1H2XA 1XRLA 2D4AA 3IOYA 1SRQA 4YI3A 3QSYA 1YASA 2AOXA 4ZO7A 1Z6QA 1S7GA 3HV2A 2CMGA 2BFAA 2C4WA 2J08A 1D1QA 4UVDA 4ZOLF 1NBIA 1U8EA 2YYSA 2OGZA 2KHZA 1DV1A 3I64A 2BFMA 2W8BA 2JGDA 4TLCA 2LCQA 5DNWA 4F2DA 4C1BA 1WDMA 2P1ZA 3CKYA 4NBLA 4LCJA 2ZRFA 1ISPA 1M2GA 3U4MA 2BC9A 4H4DA 4N5DA 2E55A 4PLTA 1QMGA 2ZBUA 3DFFA 3SE7A 5ER6A 2CJWB 1SHZA 4WCFC 4Z5XA 2N0SA 4IZHA 5KQPA 2VUTA 2PD4A 4PONA 4EHHA 3H1PA 4MWBA 4YP0A 3WYDA 4EJFA 3FPLA 2H16A 3L8DA 4JP1A 4POOA 4YRKA 5A9SB 4MR9A 2ZTHA 4MI6A 3KWJA 1EGVB 4RWZA 3DDOA 3B6IA 1DRUA 5AR1A 5KCMA 4ENSA 4ZHQA 3J81k 1Z7EA 5B64A 5HZKA 3FYUC 4LE0A 1TYDE 3TFQA 3ICOA 3UGQA 3F6YA 5JATA 3R6GA 4YJ2F 3S8MA 5IKOA 5KWJA 2W0SA 5FA5A 4KAFA 2ZIGA 4U4AA 3W2HA 4HLUC 2RBKA 3MYRA 1E0SA 1I01A 3IHLA 4GPBA 2PAFA 2YRFA 4CLXA 1Z74A 1U28C 3WWDA 3TIFA 1ECLA 3KKPA 1RLUA 3PGA1 1B42A 3QG5A 3G2JA 1U1IA 1X9GA 1XU7A 4FE4A 3RFFA 1E1DA 3LWNA 2LPMA 2QYSA 4AMBA 2OZLA 1OC4A 2IF2A 3P9NA 4O2BF 2YRXA 4AQDA 4MLPA 5JYBA 3U3RA 2A1TR 2HO4A 3DQZA 2AUTA 2KX7A 3U7IA 2WJZB 3I0ZA 3U3XA 3GCZA 5TF4A 1JQLB 1E60A 1NVMB 2JCGA 2Z98A 3AZQA 4RM3A 2W8BB 1IUPA 2JGDB 3HHEA 3ROEA 8OHMA 3GW8A 2R3SA 2QROA 3FY4A 4PLPA 1OLUA 2XT0A 3OEHD 4WJLA 4CEIA 1SBNE 1UOPA 3U26A 5F21A 4PYKA 3BH6A 2H06A 3CO0S 4J1QA 2ATXA 1GZ5A 3LT5A 5CVDA 1UBUS 3WGVA 4AJOA 2OXEA 2QVGA 3G85A 4NOJA 1RAFA 3B51X 2VG8A 4YECA 1E4YA 5HZMA 2VUSA 4LDPA 1HZZC 4YAJA 1UBJS 2EP7A 1XMXA 1J8VA 4LYGA 4MR9B 1NZJA 1WVGA 4UZSA 5ECDA 1M6VA 3UNXA 4B76A 1A27A 1MC1A 2ID8A 4E46A 4ZHQB 1H3EA 3DDSA 2IITA 2RKWA 4F1JA 4J7UA 1D1SA 4DNXA 5B4UA 1U8UA 4WKPA 1HYEA 3OFJA 2YMQA 4M99A 1P44A 1NW8A 3W7AA 1VYVA 4AJHA 4B6FA 5C81A 3QKIA 4M21A 1G7RA 3HBMA 5JBIA 3SQXA 2GCGA 5JROA 2ZUSA 3C70A 3D54D 3MXOA 4MV4A 3H9EO 3IKMB 3JQAD 3OQPA 5L40A 3UXEA 3PNVA 4S35A 3HA2A 3RF7A 3RV4A 4F5DA 4R7ZA 2IP2A 4H1TA 3B13B 5CNKA 2PWAA 3HXLA 1UWVA 2Q29A 5IBPA 3NHBA 2OZLB 1A82A 2QV0A 1DJNA 5FTNA 1ADYA 1TAHA 4MUHA 1ZJ4A 1SD2A 1VKNA 1IUOA 2C7BA 2QL6A 1TFUA 2YNMC 3CONA 3FCOA 3G2QA 4K6FA 8LDHA 3D8HA 2JKYA 1K88A 4IR7A 1GFZA 1ADGA 2W4MA 4BFUA 1PJCA 3KVYA 3LVRE 3NC4A 4X3OA 1USKA 5C80A 1CRWG 4ZARA 5J5AA 3KPJA 1D3AA 4YRBA 4CEIB 1S02A 3ZCTA 1OLUB 4OGKA 3HJCA 1Y1QA 2FCAA 4DKJA 1ZGCA 2QMZA 4MUFA 3BD7A 4QOGA 5I7RA 5LJLA 1ISFA 4TTQA 1ZHFA 4K03A 4NRDA 4IIUA 4Z0PA 4GMKA 4ZOCA 5P21A 3HZOA 2RGDA 3ADBA 5DGTA 1ZCAA 3T35A 2HU5A 3EUEA 1OYYA 2YJNA 5C8ZA 1EAYA 1U63A 3LUBA 1NKTA 4JIGA 3BAZA 2A9KA 2FI1A 5KU7A 1T8UA 1GWNA 1M6VB 2RGCA 5JCXA 2ZXFA 2IYWA 4M9QA 1HY3A 1MJ5A 5K3EA 2JK1A 3BE8A 3GLHE 4FD3A 4O29A 4QVIA 2Q2WA 4AZVA 1VGQA 2PH3A 2J9ZB 3GT0A 1QPZA 5A71A 2I7TA 3H8SA 4J9VA 1NUPA 3DEAA 3HKCA 4BASA 1I7SB 1T8TA 1GUZA 1MF7A 1RPJA 1CB0A 1XFDA 3CIOA 3GNLA 3P2YA 1OBCA 3Q6IA 4W8HA 4AJKA 4CTOA 2VJAA 5DGHA 4YR9A 3IUJA 4I6GA 3W9BA 3X1ZA 1ESDA 3R09A 3N0XA 4AS1A 2PU7A 1F8FA 3C74A 2F1OA 1TT5A 2JGEA 4QVGA 1RYYA 4RVCA 2PKRA 4JB2A 3GPDG 5CK5A 4EGCB 3SR0A 2X23A 2XEDA 4LOHA 1WNTA 2CFCA 2PZAA 3VC3A 5C52B 2N3ZA 2QNBA 2Y1GA 4MVJA 4RVGA 1TM7E 4D6PA 1HDOA 2CV2A 1HXHA 3V2HA 5C7OO 3IOEA 3IEMA 1MDBA 5EWLA 1BD4A 2NZ8A 5JZSA 4EWLA 1IHUA 2RBEA 1ZUNA 4B17A 5ALVA 4DR5B 2EYUA 4WBNF 1LTKA 4RVNA 2XGJA 3DH0A 5HNKA 2ZIXA 3P2IA 1JIQA 1G5QA 1VYUA 2WC1A 3HCDA 3PFHA 3UHOA 1OAKA 1YR8A 2JVKA 4C6TA 2UUAB 4N76A 1VPDA 4R7TA 2AUMA 5GVSA 4EFMA 3C6ZA 3IP5A 2RGXA 2WUVA 2JLCA 4NI5A 4M0CA 3USCS 1H0SA 2BGJA 4HDMA 4GOMD 4B35A 1N32B 1IY0A 1E5VA 1XZNA 6AT1A 1VPLA 1NP3A 3AFIA 1WOYA 3WP1B 4PNPA 1K06A 1V16A 4BGDA 2Z2KA 1SUBA 4KDEA 4P86A 3U61B 4IVQA 2NYUA 3PUJA 3AH8A 2PZGA 3IEUA 3IQZA 4YLGA 5FULA 2O19A 1SVSA 4Z4HA 4HS4A 1LC3A 2XEXA 3HKCB 4CDGA 1E0KA 3T3MB 3LCUA 4GLJA 1FP4A 3PC2A 3QNMA 1VTKA 4PIMA 4TSRA 4EO9A 5EP4A 1QTIA 4F6RA 1E98A 4RLSA 3UZUA 3I5XA 1N33B 3PCXA 3PG5A 3I2FA 3NJ4A 1TT5B 1QIFA 1U2GA 4RZIA 3DWIA 2PBFA 3RUEA 3Q85A 2F3RA 4DBLE 2AX4A 4JJ8A 3U7QA 3KB6A 2P4HX 3LUHA 1X74A 4A4DA 2WUEA 5I6DA 1R4MA 3H1BA 2OO3A 1EVJA 4R0NA 1PF7E 1VYHA 3EYAA 5EWLB 2WSMA 3LF2A 1ZUNB 1IY8A 3N2GA 1NP7A 3NC1C 3AJ8A 4XOUA 4KVGA 5FD8A 3S2EA 3V1TC 4BFWA 2P30A 1RSZA 1PJ3A 2VZEA 4URXR 2ZIXB 5HJEA 3A6EA 5I45A 4C6TB 1BHO1 1DAMA 1IZ9A 3LHSA 4K87A 2BEKA 3MLAA 3Q1KA 4FFOA 1E79D 3LY7A 1NW6A 3FZQA 4HDMB 4XDZA 5JSQA 1BXKA 4YRIA 3QEBZ 4PLVA 1AGXA 4B3RB 4IDCA 3R5KA 3WL8A 1NKVA 5GGXA 2H2GA 4AG5A 2GEVA 1V16B 2SBTA 5LC1A 4U5QA 2HNKA 3T1YB 2Z8YM 4JGGA 3T7DA 3RIXA 1J8MF 2X2FA 1J49A 2HXGA 3V4ZA 3SE0A 1CZUA 1XD8A 3V5NA 3T12A 4B80A 4JI0B 4R9SA 5JWRA 1IEVA 3Q7EA 1NBOA 1QQ5A 2CLKB 3M33A 1FP4B 1K2VN 2AF4C 1G19A 1O2DA 5AOCA 4NCXA 3RH0A 1T6XA 3NRCA 3PR3A 4JR0A 1BC5A 1YT5A 4XQCA 4F6RB 3SNKA 4PG5A 2GTPA 1CNEA 1SIBE 1YO6A 1QP7A 1USWA 3QY9A 4AD8A 1FCJA 3QZUA 4WZAE 4OAPA 3TK1A 4TKZA 2YXEA 2Q62A 2NQ8A 2VWHA 4V0KA 4RE6A 1SVOA 1J0CA 1L5MA 2R84A 1HUQA 3CFYA 2Y1OA 3U7QB 3B8HA 1EE9A 1Y3HA 2GGSA 4BTLA 5C1OA 2DHRA 5KO2A 3L1HA 3JX9A 1ZAYA 1UMDA 1K8QA 2KLBA 1R4MB 3KEMA 1A76A 4F3TA 4QEKA 3ESYA 3QXCA 3GY0A 1JR2A 1GTL1 4LF9B 1TW2A 4EGFA 5BSFA 3N2GB 2OA0A 1P7PA 2C9BA 1AT1A 1CRZA 3WGZA 2GF0A 2JGAA 3O93A 1L8QA 1YBMA 5FPYA 1GQQA 1W4ZA 1X1QA 2ONCA 2RMKA 3A1DA 4LC9A 4QXQA 5ESDA 4EH1A 1J06A 1XEFA 3GPBA 5DHQA 5AD1A 5AI9A 5EMKA 3TRIA 2DBQA 5J4VA 3Q2OA 3ST7A 1YZFA 1KPHA 1NATA 2PH1A 5H3HA 5EP3A 1PQ4A 1SCUA 2D5AA 1LBIA 3GFPA 3DOIA 3UT5A 1KMCA 4YT4A 1YU9A 3MMPA 4LJ5A 4DHWA 3C7KA 5GY7A 3C3WA 2HUPA 1TQ8A 2ZSHA 4FC7A 2PV7A 2ECOA 1KMIY 2PX2A 4FNOA 4BFYA 1HOXA 3WRXA 1I2AA 1YI1A 2Q0QA 4LV8B 3ZX5A 5IYZA 1YDHA 3P2EA 3P96A 1P4JA 5EXPA 2C1ZA 3GLQA 2Z95A 4RK0A 4FZVA 3S2GA 4JNCA 3C3YA 4GKBA 4II7A 2AZTA 4KR9A 2C5AA 2GLXA 4PO1A 3EF1A 4FYJA 3NAZA 1HT0A 2BM8A 4MUKA 3LWZA 1DJQA 4P0TA 3RKRA 1ZWLA 1XDBA 3TQIA 2B92A 4TVOA 1DQZA 1U9ZA 1VM6A 5IJ0A 1UBKS 1MJFA 2ZYGA 4R84A 3SIRA 2C1XA 2I4IA 2H9IA 1FY2A 4D4MA 2CN1A 2XCRB 3AF1A 1UMDB 5JDCA 3QXHA 1CYDA 3EARA 4PFQA 2D0IA 4RO0A 5KPDA 2GT1A 3ZBPA 3DF9A 2XZLA 3KKLA 2I29A 4XWYA 2GRJA 5JE8A 2HRRA 5KOHA 2G9RA 2A5FA 3IALA 3KIPA 2P7IA 3MS4A 4Q16A 2MHCA 5TMDA 4UJ5A 2OV2A 1PL8A 2OUKA 2ZYWX 3CT6A 3L1IA 4JCCA 5BWOA 1I4EB 1XKLA 2OZEA 2QL9A 4IJWA 5ALIA 3DCIA 1SQGA 3IVAA 3IVXA 3R75A 2NLOA 4GM4A 4MJXA 2C96A 3SR3A 1CUAA 1X7WA 1E0JA 2E4WA 3HQ4O 4XUEA 3M6IA 4QRHA 1VL6A 3KDAA 2VSQA 5IAJA 1QTNA 5D01A 5KB3A 4H59A 2H57A 3C8HA 3OJFA 3P26A 1SCUB 1VB3A 3QEMA 4KFSA 1GTZA 3UT5B 5DZSA 2V7BA 4NBTA 4NOLA 2VRWA 2XKKA 3TKLA 3QJYA 1Z56C 3THSA 3IDAA 3JQFC 4O08A 4A7PA 3GFOA 5E95A 2AI3A 3MRXA 1GSIA 4BB6A 1X19A 4UUMA 4UVIA 2DFVA 5IYZB 1WMAA 3HABA 2Q4BA 4NMHA 1G5FA 4DL9A 1QH9A 4P81A 4DCMA 2IRWA 3CX3A 5J2TA 4OTZA 3R2JA 3WLFA 4IEIA 3OPVA 5AP9A 1Y63A 2JHAA 2C8VA 4TPKA 5IJ0B 3SQMA 1GPYA 3OCXA 1KYTA 1MVNA 2ERCA 4XSVA 4GMXA 5BR4A 2HT1A 1KMNA 2V6JA 4TTPA 4EYOA 3HN2A 3X2EA 1DG3A 4ZZ2A 3Q9LA 2FY8A 5TX7A 4BZXA 1T6BY 3SIPA 1GR1A 5K3SA 4D44A 2V1XA 4HNHA 1A9OA 1TAGA 2BM0A 2O5CA 5KOHB 1OMOA 2ZAMA 5EKDA 2K7FA 4BRUA 3ACBA 3VX4A 4DZZA 5AK3A 1U02A 4ADSG 4NMWA 4OCZA 1TUIA 1EBFA 2RHMA 2IZZA 2J0UA 2WG1A 3WKAA 4Q03A 3D64A 5K3BA 4WNAA 1D5WA 1U0LA 4X5OA 5K20A 1L4YA 3AOGA 1QTQA 1TU4A 4ASUA 9GPBA 3GLGE 3EOZA 3TINA 2QTNA 1AKNA 1CCWA 1OILA 1X7WB 3N58A 2GVDC 2L69A 4G1BA 4HQOA 2WNSA 4B8WA 4DA8A 4CTNA 1BD3A 3CF4G 1BVYF 1R12A 3A27A 1H0HA 4YAWA 5ERXA 4ABYA 4C0HA 3MOIA 3QEMB 5AESA 4GKKB 2VH5R 3NHWA 1FDRA 3RSLA 1PBTA 2OG1A 3RHFA 3P2JA 2RB5A 3QFFA 4FCVA 4V2IA 1QIIA 2R68A 4JQZA 4BE7B 4DJAA 2OC9A 3IPCA 1V0JA 3IAM6 4MMYB 4M88A 3SXUA 2CV1A 4G0PA 5TARA 3FRIA 2E4UA 2FMTA 3LF1A 3FMVA 3AEQA 1U1GA 3F96A 4BMSA 4JVSB 3VMFA 3SDBA 3SM3A 5J2TB 1T6YA 2IIVA 3OUTA 1VMKA 3LA6A 2BIFA 1SXJE 1UQRA 1H2EA 3JXEA 4GPEA 4CMCA 1IHDA 1D6NA 1QG4A 2QLJA 3QYPA 4EFKA 3CWCA 4EY4A 1U0SY 3HY6A 2VIIA 1JMKC 1T9DA 1OTYA 1OXVA 3B78A 4OUKX 5HGXA 1OB5A 2H07A 1L0BA 2EBWA 4B74A 3H6KA 2P3OA 4PAOA 3BZWA 4N3CA 1QRTA 4FFNA 1C3OA 5C1PA 1EIZA 2A3RA 5F52A 1M6HA 2QX6A 4IJ6A 1RKBA 1A7UA 1VPVA 1GN8A 1NASA 2JI4A 2PMWB 1W25A 1TK3A 1DBWA 2WKQA 2J0UB 2YICA 4RENA 1YZLA 5K8IA 1P5RA 2OCPA 1GGNA 1O4VA 2E5FA 3BGDA 3PPXA 4WNAB 5NLLA 3TLJA 5CGZA 4NWIA 1AK2A 3CLHA 1Q92A 1YONA 3PRHA 3EQ7A 4K9DA 4MOWA 4RFSA 4BMYA 4ER0A 4UTZA 2CLFB 2O5VA 5KOYA 5LQCA