4V2UA

Apo-structure of alpha2,3-sialyltransferase from pasteurella dagmatis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
386
Chain Sequence
SKTITIYLDPASLPTLNQLMHFTKESEDKETARIFGFSRLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
total genus 134
structure length 386
sequence length 388
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v2uA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v2uA01
2IHKA 2C83A 2ZWIA 3S44A 4R83A 2C84A 4V3CA 4V2UA 2IHJA 2ILVA 2EX1A 4V39A 2IHZA 2IY7A 2II6A 4R9VA 4R84A 4V3BA 2EX0A 2Z4TA 2IIBA 2IY8A 4V38A 2IIQA
chains in the Genus database with same CATH superfamily
4KGVA 1C2YA 3EFBA 4FFNA 4IW3B 4RVNA 2CDBA 2PEZA 1NLYA 3R8CA 1EUYA 4I9GA 3P2OA 3K2IA 1R0CA 4LY6A 1PFQA 3T15A 1C30A 4MWBA 2I7TA 2O0KA 4TSRA 3WOHA 1MGOA 2IF2A 1D2CA 1GKYA 3BSYA 4HP8A 5FDFA 2Q7XA 5AW4A 1PHPA 1K8RA 1Q91A 3AHJA 1EP3B 4MVJI 4E2YA 1OD6A 1DADA 4B3XA 2G0NA 4UTPA 1QIHA 5EQTA 1OHHD 5C1OA 1Y8AA 2FR8A 2PA0A 2MOKA 4O33A 2JD1A 1N7HA 3PEUA 2DF8A 4K05A 1QGYA 2PBLA 4UDYX 5D5HA 3R77A 3X2EA 4A3SA 4RHCA 3N05A 1XKTA 4BGDA 2CEKA 2CWDA 2FEOA 4HCJA 2GS9A 3N76A 4TN5A 4C7JA 3PUIA 3L49A 1JVBA 2E4WA 4JKIA 2OLJA 3EFOB 2O23A 3RRXA 3TTTA 3RTAA 5CA1F 2W2OA 1QUEA 2CKMA 3THXB 1QIMA 2J31A 1ZXLA 1X14A 1Z6YA 2BEKA 8ATCA 2KBEA 3QY0A 4NONA 1HC7A 3TI9A 2O1SA 5GM2A 4ZI7F 1BDIA 4ML3A 3KHUA 1JG4A 4LNUB 3FW1A 3HCBA 1V1JA 2XE6A 3EXG1 4HEQA 1NJ6A 4BUJA 1RI1A 2PX2A 1YS2X 2BFDA 1Q7BA 2IZ1A 1SCNE 1XSEA 3JQQA 3DL4A 4IO0A 5K3BA 4IQ0A 4JU8A 2YCLA 3IBYA 1XQ9A 4TLEA 1W5EA 3DMHA 4ZVUA 4D4IA 4ER7A 2OHVA 1CQJB 2WICA 4NV3A 4OJTA 1QMGA 3HFSA 1A8QA 1E5QA 2EJBA 1WXDA 2P2NA 2QMQA 1IXRC 4BZXA 4EGQA 4BKRA 3EVCA 1OXSC 2YWXA 1G7TA 2B25A 3LH5A 1MX3A 2GFQA 3GP3A 2FYTA 1YB2A 2QNBA 4HWSA 4MUGA 4QELA 4RKWA 5D7BA 4YUXA 2XNDD 3CX4A 2XCTB 3AZPA 1MO2A 2HR1A 1VGQA 4PS0A 2QE7A 3BWYA 2DWUA 4RO0A 4ZQCB 1IM2A 4S1NA 1R6VA 1V6SA 2V3VA 4F5EA 4CMAA 3R5KA 2XDWA 4I1VA 3PFFA 1HE3A 2RD2A 2HYDA 2WY2D 3STWA 4EW3A 4YDQA 3DV9A 3E2PA 5B3JC 4IJWA 2GEDA 4RY9A 1EWYA 3T5DA 1QHIA 1DAIA 2B30A 3HE3A 1D2GA 1WULS 1T8WA 2IYZA 5CA0F 2B69A 4FOPA 4LYFA 1YR6A 1XN1A 2FEWB 1BD3A 1NJFA 3GNSA 3LFTA 4EM6A 3TL2A 2QTAA 4EHHA 3ERCA 2O8EB 3QKRB 4KGXA 2O4UX 3QPAA 1IJKA 2EW2A 3G0HA 2BFEA 1BYIA 3AOGA 4INAA 3ZGVA 1E5TA 1TYZA 3UGQA 4AN4A 1M10A 2FWMX 3H1EA 2VQDA 2WVAA 3UA4A 9GPBA 4DXDA 3SVLA 3QKUA 1LRJA 4KL8S 1FSPA 3BGVA 1DAEA 1QYCA 3OHSX 2WF5A 5ALPA 1X7WA 2RHDA 3B6JA 3TIIA 4JUFA 3CPJB 3V3TA 3G1WA 3ZWMA 3TE6A 4LZJA 4C43A 3KOUA 3ESXA 4MQFB 2H65A 2OB2A 2SKDA 3QUQA 1LPOA 1PDVA 1YL6A 5G41A 1P19A 1K75A 1M2VA 2APJA 4JT8A 1VIYA 1FA9A 2C9DA 2FPPA 2EU8A 1GXSB 2XWJI 4J0QA 5IUNC 4HGZA 5FNZA 2IHJA 1L7BA 3IEXA 1VI5A 1U3UA 3C70A 4MH0R 4GL4A 2CJYA 3MJRA 4NBWA 2F2TA 2JFHA 1Z8DA 1DOZA 3JPWA 4L9RA 4KKVA 2QMYA 4OBEA 5H5JA 4QIHA 4DABA 1FP4B 2Q6IA 1A0OA 1EFPA 2KW5A 5DMXA 5B4VA 2ZRCA 4Q9DA 1T9BA 2VCHA 1HXHA 1VDMA 1VHLA 3CX7A 3K0EA 4IS2A 4QG7A 4BNZA 2XR1A 1DRVA 2FN3A 2VK1A 3UAVA 3PVCA 3WNDA 4LBZA 4DR4B 3ZWBA 5J4HA 4J90A 1NIJA 2HM7A 3IJEB 2GLTA 2D4HA 3CNBA 3CCFA 3D8RA 1NPTO 3F49S 4KGDA 3SJUA 2YIMA 3R3XA 3RJ9A 3GBSA 4Z5XA 4IICA 2O2EA 3IBGA 1ARZA 5DULA 2NU6B 3UUGA 4JB0A 1AGNA 1IY9A 2YN2A 3IX7A 1IN4A 3BVPA 3AYXB 3QP9A 4P80A 1DXYA 4OU5A 1U04A 3L7DA 4OQZA 5DLYA 5L4SA 1EIZA 1EK6A 2CSUA 2PJDA 2VDWB 3A7DA 3QQ5A 5ALEA 3A25A 4RFLA 3SYRA 5KNCH 3MMNA 4L4ZA 1XRNA 1NVTA 4BUCA 2NTVA 3MS7A 4P3PA 1E69A 2C57A 2EP7A 2YUTA 3GQVA 4YEDA 3AFMA 4TV8F 4DG5A 2QKYA 2ESRA 1G5TA 4M8IA 5AVWA 3HWSA 2BEVA 3FMPB 1RU3A 5EP3A 4J1SA 3HCAA 3LXXA 3JYOA 3N2GA 1SUAA 2PUJA 2ET6A 2P8SA 3ZE0B 1J8DA 1AQJA 4CUJA 2JGLA 3ZE8A 2X0IA 4L8VA 3SQDA 2NPFA 4RJ2A 1PR1A 2OQ2A 1WEKA 3KZVA 1YL7A 1JH9A 1KJZA 1PJZA 2D1FA 1PR0A 3FA2A 3NGMA 4JCOA 4RZSA 3AGPA 4GPTA 3IT2A 9LDTA 1GPJA 4ND4A 5M3BA 1CFJA 4ZVTA 3AB8A 5FUMA 1TQ8A 4IF6A 3ZHSA 4LHVA 4XEHA 3B7PA 4XVUA 3IQXA 5K8TA 1P4HA 4JASB 1NAIA 2EG9A 1QHYA 4HAVA 2AFHA 4J16C 1SIUA 3RJTA 3IJ5A 4QODA 4D3DA 2J4FA 4KOAA 4UXIA 2FKAA 4QM6A 1ULHA 2JKYA 4IL5A 3RRFA 1F20A 1J56A 4F93B 3G3EA 1KI1A 2NXCA 1YQUA 3BRWA 1G8FA 2H1CA 4HVAA 3ND7A 4KDEA 2WD8A 4MS3B 4Q34A 5A4JA 4PYJA 2C0PA 4UE6A 5KX5A 3HDYA 2XBMA 5FF9A 1GUDA 1X70A 1M76A 1VKOA 1SOUA 3LVRE 5C8XA 4BNKA 3C1OA 1RP1A 2IPLA 5KJ1A 3I30X 3MGBA 4HVLA 1PZGA 1S3IA 2XTMA 2AN1A 2KM1A 4QNNA 4YY3B 1Z68A 1YI1A 3BE6A 2W6MA 4F9FA 3EXHB 2VWGA 4Z9BA 1WZIA 2Y1DA 4D9GA 2BMFA 1AXRA 1X38A 1UCFA 1MB9A 2ZUTA 2AK2A 1Y3CE 3A1FA 3BF7A 3JAWB 3L82B 3WR5A 4RZHA 3PNPA 2YMLA 2HLDD 3E8SA 3P97A 4U63A 1DC3A 1WPRA 2WOJA 4J94A 4PHFA 4Q37A 4JNCA 3Q1KA 1HLFA 4UCQA 2C03A 2C2OA 1NSFA 3GGDA 3LO8A 3M6FA 4JWTA 3FWYA 4URHA 1IVYA 2V5UA 2GXUA 1I51A 1ESDA 3E2IA 2UUAB 3K96A 4L8GA 4ZI5A 4AF7A 4FHDA 5JQGB 4CWAA 5K8CA 4FOOA 4E14A 4MP6A 1WVMA 4Z6KA 2C58A 1XQXA 5FUYA 2Z57A 4HRAA 4WOPA 5CP8A 2A35A 1Y89A 5H68A 4DC1A 1JBEA 4DLLA 5A04A 4B0OA 5JUWA 1CUJA 4PSVA 2VKQA 2R1ZA 3TK1A 1IHYA 5CNIA 3WSWA 5T4FA 2FZKA 4PXSA 5K9ZA 3NS7A 2NLOA 3FTPA 1OX4B 2VAXA 1S2LA 2FX3A 5CTAA 2YS6A 3G79A 3OJXA 4HEJA 3HABA 5COBA 4E5KA 4KEAA 5FB3A 3OQHA 4WZBB 3I1IA 4BEBA 1KAEA 3TGLA 4NCAA 1LPPA 3EGCA 5JQWA 1EGAA 2WJPA 3DXFA 1FNBA 2RONA 3G7NA 3H04A 3LPMA 4C7MA 1O7JA 2ZYRA 3SP1A 3JZMA 3JD2A 1GL6A 4I3FA 4DY6A 5IH7A 1NBMA 5K03A 5BV8A 1JPNA 2JH3A 2C5BA 2KPOA 2W2VA 1NE2A 1UBRS 1UQUA 3CPHA 3K8OE 1G7SA 4N5MA 2RHWA 4HAXA 4KPUA 5G3YA 1H4TA 4OQEA 1ZOSA 2AB0A 3NBAA 1FY2A 1TMKA 2JEZA 4GOOD 3RS9A 4CI0B 2BLNA 2UU9B 1W4ZA 2EYUA 2Z8YA 4CKZA 2H48A 4N5HX 3OTIA 1C8VB 5CDSA 1E6LA 2BBOA 1E9DA 2Q41A 4OM7A 2PSEA 5H02A 4AMVA 4QTYA 1CF9A 1HQCA 2R0QC 3L7JA 1F0PA 1EX9A 3K6KA 4ZTZB 4Z0PA 1LPNA 3B3GA 3FFWA 4FCWA 2OESA 3I09A 2Q5QA 5FLYA 3MRVA 3NHAA 2JLZA 3EIXA 3UXMA 2H4WA 1ISSA 2QUBA 3DV0B 1PJRA 1NBIA 1Z6PA 3CEJA 4WNYA 4CXMA 3T4XA 2A94A 1D8TA 4HAYA 4PG8A 4RX1A 1AHHA 1QZXA 3DJYA 2FWAA 4M2LA 5A7GA 3JQBA 1A77A 5BYBA 2A86A 2WFLB 3GDOA 2GB4A 5EJGA 3NVDA 1IY2A 5LP6B 3AETA 4MNTA 2E18A 2E49A 4R2MA 5TY0A 2D2VA 1TYEB 1B8NA 1NYQA 2YY7A 2ST1A 4JZKA 5COAA 4R68A 4MAAA 1HX7A 3PFCA 1K0UA 2RFLA 3VDNB 4BX0A 5EPUA 4PHTA 4X45A 3LCVB 1RKUA 3L41A 4RHTA 3JQGB 4K9NA 1ZNYA 4TL6A 4Z9FA 5C8YF 4QGBA 4B3JA 3F3SA 2FPSA 1E4OA 3UJ9A 5JYCA 1GNQA 1KQOA 5FPPA 1QX4A 4GYKA 2R4UA 4JP1A 4F8EA 2XF8A 3K6SB 1CRPA 1EFRD 2UYGA 2EFGA 1X86B 3GJQA 3QX9A 1WY7A 1CZKA 1VMAA 1YL5A 5KTMA 4RIHA 5K3FA 5LOVB 1L4YA 2Z5FA 3HLKA 3DPIA 2XHZA 2HCJB 1GGHA 3NH6A 3RU2A 2XYQA 3NO4A 2RHRA 4O4HA 4DHWA 1H5QA 2VO1A 3EPJA 1T8RA 5JS8A 3PUYA 1J1UA 5CB6A 4IJQA 3KJXA 2YZGA 5JSUA 4K7JA 4EP1A 1W36C 4HJRA 1JIVA 2I66A 2CE2X 3C8DA 3SJZA 2ACVA 1ZM7A 2WJVA 3VU9A 1QV9A 2P9EA 2QVXX 1BMDA 3USCS 2WMOB 1WF6A 4MW4A 3R0QA 1C0KA 4URZR 4YDHB 4EF4A 1QWOA 3EXHC 1XEFA 2C1EA 2I99A 5EIBD 5IBPA 5FL7D 1YFJA 4FBGA 2BJVA 3A6KA 2YJ6A 2A0UA 1SJ9A 4II7A 1N2GA 3RSGA 2GDJA 3UT6A 2F00A 2FE4A 1G4AE 3D6AA 2HTEA 4CV1A 1IHDA 4F91B 3VJRA 1DCKA 3OY2A 2JLUA 4FJ2A 1JKMA 1FUKA 4XSHA 1XRMA 3GT4A 1LDGA 2P90A 4Q3BA 5C5IA 3U39A 1WXXA 4DV6B 3ENZA 4KNYA 1KRXA 4Y8VA 3RNOA 4HRXA 3KXPA 1R1DA 3IP3A 4C08A 1CZNA 5TNXA 3RJMA 3ENNA 4ZYTA 4OK5A 1KL7A 1QDEA 4DV4B 4JLNA 4Y18A 4W5WA 3SJAA 4TWBA 3WADA 1ULAA 4HY3A 1HBJA 3AFOA 4DCCA 3SD7A 4ER6A 4V38A 1SWVA 1K3TA 4R98A 4ZO6A 1Y6ZA 1QNFA 2CDAA 1K7SN 3R0JA 4C0SA 5LLTA 4D0RA 2CZGA 3R0VA 1DX9A 1MDFA 2IYFA 3K0CA 1QG2A 1B15A 2A3RA 3CFYA 4ZVNA 5IUKC 4G2TA 5D84A 4IEFB 2YFYA 1TPYA 4IWXA 4D82A 4LW8A 2I6FA 4YJ3F 4LFAB 1I32A 1N7GA 1ZIPA 5KNBA 4UPVA 5F4BA 2GAFA 2PSFA 2XUPA 4CEJB 2QPTA 3DKKA 2EF0A 2VDPB 1WEHA 1Z17A 2CN1A 3LWDA 1O9HA 1GAWA 1QK4A 3GJXC 2IHYA 3TXAA 3C6YA 2C95A 4MUKA 1R0SA 4DCVA 1EXMA 1RLJA 3B5JA 4P92A 2HMYB 4HLUA 4OA5A 4EIWA 4PBTA 3BTUA 4W9NA 5C18A 5AXCA 3LHKA 1I6MA 3R0XA 3KWJA 1E0SA 2BKXA 4M55A 4N03A 5AOAA 4QUHA 1VRWA 1LF0A 3RIXA 3BM5A 2C59A 1TO6A 1R6BX 2CCKA 1O5IA 2BI4A 2Q5IA 3AWDA 4ZARA 2PWZA 1M2OA 4BQIA 3A2NA 5ILQA 3GBVA 1T2FA 1BJRE 1KP3A 1LI4A 2X7XA 4HGQA 1OX4A 4Y2JA 1T13A 3VGPA 1K08A 1NURA 1GLNA 1M6NA 1RI5A 1JSRA 3B8EA 3PIRA 1B3BA 4I5FA 2A5JA 2XZDA 1QH9A 1YMVA 2PS0A 3C1AA 2VWHA 4FGJA 4MINA 3RO7A 4C2AA 3BDVA 4Y2RA 1SBQA 1ZEMA 5TQVA 1DKLA 5HTOA 5TVGA 3WAGA 4Z4EA 4KK3A 3BDIA 3D5QA 3GFVA 1FBTA 2ECPA 1OC2A 2XDYA 3LV8A 4EY7A 3HPQA 5JATA 5KQGA 5CHEA 4LMRA 3OZAA 4OXQA 4UARA 3AFNA 3OM1A 1D04A 4ZI7A 5EEGA 2JIBA 4PO8A 1FNCA 5JIBA 1PZEA 2NT4A 3HEAA 4Z51A 3X1DA 2YW2A 5DNVA 5HKLA 5A2QA 3CKMA 3EPHA 4D41A 1LD3A 1HTWA 1UPAA 1Z36A 3QPBA 1LPBB 3W5UA 2VBGA 4ECAA 3B3QA 3FNFA 2X2OA 4TMXA 2V9PA 2OP1A 2OCLA 1V7PC 3MOSA 2PE5A 2IODA 2OCYC 1ZK1A 3L1JA 3OOWA 4G1CA 4BNWA 1WBJB 3L8YA 3LBAA 1M2HA 5JO9A 2VHXA 4BRWA 2FN4A 2VZ0A 3PYLA 4DSUA 1VHWA 1KY3A 2O3UA 4YDRA 1PDOA 1X3LA 1EE2A 2ODEA 5C1BA 1ZUHA 1M34E 3D4BA 1FS5A 3BQMB 1I9CA 1YVDA 2REQB 3V8PA 3P71T 2EIXA 1TKAA 1YZFA 4AJJA 4E5NA 3TZLA 1AO0A 1GG8A 1M66A 3KUXA 1EUCA 1BD4A 1ULBA 5FBKA 4EB6B 3Q8KA 1NP7A 2YHBA 3SI7A 2WTUA 2HWXA 2D1YA 2O1XA 3B3JA 2QV7A 3AEQB 1E99A 3NT5A 3Q3EA 4AI6A 1N0VC 2CNKA 4RQUA 3R9XB 3GDHA 1EG2A 4TKMA 5MFPA 4RKRA 3JALA 2EKQA 2QGNA 3MEQA 4YROA 1Y9ZA 2HUNA 5EJ6A 4FLMA 2BELA 1NVVQ 4E94A 5K6AA 3W5JA 2UVPA 3RUPA 1DFGA 1X2BA 3GVIA 5C32A 3ILHA 2BI7A 2RI0A 5BORA 1DL5A 1XLVA 2WYOA 5ALIA 5GVRA 1LDNA 1WMAA 4OQPA 1M2KA 1NI4A 3PPVA 2NZWA 5DLDA 2ZVJA 4P35A 3S6JA 4BP9A 4DF3A 2NGRA 1DTEA 5BPFA 1OU4A 1M5RA 4PPNA 3OMWA 1TD9A 2NIPA 2ATVA 5FT9A 2QN6A 3S8EA 5ALTA 1QH8B 3S28A 2QX4A 5FFNA 5JZMA 2RGBA 2FX2A 3L7NA 3MSXA 2F9FA 2VQ3A 1CFZA 4XI9A 4B7XA 3RVQA 5A0TA 4I08A 4AN1A 1PI3A 5EJ8A 4DYDA 4BRZA 3DE6X 4UBNA 1UJ4A 2IEYA 3IAS6 1JA0A 1ZD1A 2C3MA 2JI9A 2HQOA 3V80A 4JLOA 4Y2XA 5KB3A 3GLIA 1ZCJA 4MGIR 4RZ3A 2QRMA 1L7XA 5HX7A 2BY4A 3HKDB 2JAOA 4PSAA 4REQB 3NOVA 1J1ZA 4LVCA 3USZA 2JBAB 1U7HA 2YWFA 1A8IA 1MRZA 4Z4IA 1T24A 3DF7A 3EZYA 5EHIA 1HO3A 3COJA 1DBSA 1K8XB 3H2KA 1ORWA 3RSCA 4YTEA 3DTYA 1GLGA 2QW8A 1VE6A 1FW8A 2LV8A 3HYNA 2XVYA 4M83A 4HDCA 3HJBA 2QE6A 1BYUA 2EGUA 3LKBA 4QREA 3PDJA 4R8KA 4MHOA 5EGNA 4FLEA 1KDOA 3CURA 2A88A 1A50B 3VOBA 1ONNA 1RWMA 3WHKA 4Y98A 5C37A 5G0TA 1SFRA 2IY7A 3DNPA 4P0PB 2DHEA 4YT8A 1P33A 1WMBA 4Y3UA 4DILA 4P93A 3AU9A 5K0BA 2FQQA 1RRFA 4N3NA 4M1OA 4YX9A 1FYDA 3VKHA 3OJLA 3VNSA 4BVEA 1WB9A 3VPHA 3LQRA 1MJFA 3FIJA 3K5HA 2D00A 1ZGHA 2ZIVB 3Q98A 2BFBA 4RTLA 4CV3A 3C7CB 3I5UA 3OQIA 4E2FA 2CVZA 2ODPA 2E2WA 2O0LA 2P7HA 4C78A 3HFRA 3GB9A 1NG9A 2PZKA 1TU4A 4A0FA 1ILEA 2PAFA 1E96A 1MT3A 3OMXA 5C53B 3L1VA 2Y76A 3MCVA 2A58A 3OI7A 821PA 2GLUA 2NTNA 3UPDA 4NU6A 2OYSA 3BKWA 2Q8QA 4RNCA 1SVNA 1W0JD 1QP0A 1JE0A 1BWRA 2JFPA 2XKBA 3AHCA 2Q7OE 3OOHA 2CY0A 3SGLA 4EHFA 4W5TA 5BXQC 4RA9A 5EC8A 5JG7A 3UPUA 3TWOA 1AGPA 4IFBA 2RMKA 3KKZA 2GN6A 3H5OA 4F5ZA 3TIXB 1O54A 4H6VA 2ZTMA 4J2TA 3TBHA 3CG4A 3AHFA 5LZ5A 1MA3A 4PNEA 3VYSB 5IAGA 3M5WA 2PRIA 1ZJJA 3LY8A 1KZ1A 1A8PA 1W5TA 1W88A 2QTWB 2R8OA 2W2XA 4Q3OA 4M8SA 5HDBB 4B35A 5KWJA 1DFHA 4MV0A 3GLSA 2HHLA 4HGPA 4QYSA 2IS4A 2SICE 2PRZA 2WAXA 3VTAA 4LC0A 3DMNA 4TX1A 4B6OA 1J70A 4LF7B 3QZUA 4HRVA 4C06A 1Z6QA 2BC9A 2EIHA 5DVZA 3GLIB 1BU5A 4DCGA 2XDQA 1DJNA 3VSEA 1NXSA 4PS1A 4BU1A 5JSHA 3H0KA 1E2BA 4UAVA 4NENA 3ZBTA 4B46A 1D7AA 1HZJA 2WJZB 2K7FA 3VKFA 4H77A 4CGYA 3VZRA 5FFFA 5DM1A 3FVQA 4GI7A 1SD1A 4EI7A 3DT8A 1QVZA 1BG6A 2GKGA 2G67A 1MVNA 1M1NB 3RRJA 2DYKA 3AW8A 1GDDA 3LBNA 3HPRA 1KMMA 2H2AA 1VOTA 3F98A 3OIWA 1NNI1 3EODA 2E1PA 4KVZA 4MWDA 4WTOA 2ODAA 4Z4FA 2FMKA 1GSIA 1I3LA 1X94A 3IQWA 4FYHA 4ZQBA 3UJ6A 4D6PA 3FCOA 4UUNA 3O3CA 1CUVA 1YSCA 2GEKA 4US0R 2JHFA 4UVDA 3O3MB 4YXWA 4QUJA 4MJ7A 2PKQP 1G1MA 3TD6A 3RABA 3TKLA 1U4SA 5ALQA 3L06A 3CGGA 4CM9D 3GT7A 3JWEA 3ESCA 4U9IS 5JHHB 3F6SA 3SZRA 3U4GA 2ZJ8A 1I2ZA 3OURA 2HZ7A 4D9EA 1X8KA 3BGDA 4PAGA 4F4FA 2JLSA 5F5XA 2W2PA 2ID7A 3I9LA 1F8XA 8ABPA 3DE1X 4FEEA 3NANA 4NE2A 4QJIA 5KVQA 4XLZA 1VLZA 1XRJA 4JP8A 1XFAA 1YK0A 3RFTA 4AZWA 2J87A 1D4FA 3BMQB 2IPMA 3IPRA 3KXDA 4IHJA 4KXXA 1ZRSA 5HZKA 4K9SA 3PTAA 1FS4A 3C2QA 2OGZA 1K4MA 3E23A 1XV5A 4QU5A 1B16A 3W1WA 3ESDA 2OQIA 1E9EA 2QV0A 4NFYA 1F1JA 5K51A 3TOXA 4QGFA 4BX8A 5HUHA 3ORYA 3RK0A 5KO2A 2QZ4A 4MRPA 3LGXA 3E9CA 5CW1A 3ZCSA 1BHJA 2PUFA 1G291 1NE7A 2V7PA 2VP6A 2WF7A 3EOBI 1NZJA 1YR7A 3IDZA 1HRKA 2XQKA 2ZITA 3ACCA 1P0FA 3QVLA 4I2VA 2OL4A 4I50F 4PCLA 4PSDA 3VSBA 1EB8A 5KWSA 2F4VB 1XA3A 1NPYA 2JEOA 2ZE8A 4E4TA 3OFND 3QVSA 4ARBA 3EA5A 3ZCQA 3GJ3A 5EIOA 4X6LA 5JVDF 1GP2A 3Q8WA 1IUKA 1FQOA 2RDMA 1ZW1A 1OXKB 2DBVO 2EJCA 2PMFA 3B1KA 4JGBA 3MHPA 1M1YA 3GFBA 4RMGA 3ZR4B 2YUIA 1ZRNA 1MB3A 2Z0MA 3C98A 5IJ0A 3NPAA 1OA0A 1KDPA 4HNRA 1IQPA 1RJGA 2QB5A 1Z75A 2YFHA 4RA6A 5I51A 1RAIA 1Z22A 3DPSA 4EFMA 4RPHA 3SKVA 2ZYIA 2ACEA 4YPOA 2O5EA 3QMMA 1ULTA 1GKIA 2HOQA 3H5VA 1CP3A 4MP8A 1YNOA 4CIAA 5KTRA 2JFYA 1L5RA 4UUPA 3VH4A 2FGKA 1NT4A 2GRJA 5LQSA 4R54A 1C3VA 3UQZA 1XQ6A 1HNXB 2FPMA 3FNBA 1ZZGA 3AINA 3DOCA 4RFVA 1GCOA 2O57A 5I6DA 3DC2A 1IY8A 3MT9A 1OXMA 3LP8A 2GAOA 3TX6A 3W8DA 1TRKA 3P20A 4U02A 5I4IA 4ENTA 1QLHA 3S1SA 2VPYA 2ZB8A 3U13A 5ADVA 3LTEA 3VPBA 3TIVA 1BX1A 1N1MA 4JFAA 4IGKA 2F3TA 4UM7A 2NU7A 3E61A 3ZDAA 1P80A 1GNRA 5A5DA 4NHEA 3ELDA 2ZJBA 3IRVA 2O5CA 1RIIA 1WSBA 4UD2A 1LZKA 2D1SA 3UAOA 3NTUA 1S7GA 2RHOA 3BB3A 1J0AA 3PT9A 4J6EA 3VVCA 5K8JB 2QN1A 1JDPA 2WKWA 2D0PB 3QLTA 1HTTA 1VFPA 3TZCA 3UAYA 3OWHA 2QNIA 4GRDA 3ZWXA 1FC0A 3HXOA 1M1YE 2G7ZA 3GU3A 4JJ6A 2G63A 1UF9A 3FWPA 3FWZA 2ZJ6A 3GO4A 3VVLA 2Q50A 4BFSA 4POAA 1U9IC 1CE8A 1UPXA 1KARA 3JRNA 3ZWDA 9ATCA 4HDSB 3P2YA 3HJUA 4BLSA 3LT1A 4R8VA 3HP7A 1KMCA 3AESA 1E2DA 3IAEA 5DGCA 5BOSA 5I4CA 4FQ5A 3ICOA 3L7CA 1O95A 3A1UA 2O14A 2VA8A 1E6MA 2ARKA 3N8GA 1FDTA 13PKA 1SUPA 1U8ZA 2VA9A 2HUPA 3GD7A 3QMWA 3V7FA 3U19A 1QIJA 3R3ZA 4MYDA 4KWTA 4CM4A 2JFGA 1E9AA 2B37A 2CF5A 4IRUB 4O4LB 4E12A 4JMPA 4MR9A 3UV7A 4L5YA 3IV9A 4D92A 1WWKA 2WF8A 2IHBA 3UN1A 1MUUA 5JJLA 2FQYA 3C7TA 3L9XA 4AU1A 4DPLA 3K6JA 2B35A 4UKDA 3C3AA 3RHTA 1EINA 4D42A 3I23A 1I13A 5TQJA 4HR7A 2BGJA 3EGXA 2WSSD 3GCDA 5AXAA 3C16C 2QHXA 2HU2A 1ZJZA 4FQ7A 4TZTA 5BSUA 5HYVA 2XYVA 2FUG6 1QLJA 2BD0A 3H8JA 3CJQA 3VI3B 2KE5A 3MNFA 4Q82A 5CR9A 1IDN1 1SVMA 5L3ZA 3ZUGA 2R2GA 2NYUA 4BU0A 2CV2A 4TM7A 3NCTA 2DBZA 3K16A 4LJLA 4XIIA 3R0ZA 3OWOA 2XNHA 5EMMA 2AHRA 3WLIA 2WQZA 1X15A 2IGTA 4LE2A 4XYGA 3TTSA 3MYRA 1UC8A 4D8XA 2Q4RA 4R6XA 4ZQEA 4EHNA 2Z9CA 4TWRA 3VZBA 3FUTA 2I1LA 1RQRA 2ZK7A 2C4MA 3JQ8B 3ZU4A 4MJXA 1D2HA 2E85A 3H5WA 2HMSA 1OIXA 1FPMA 1Y48E 3PVZA 5CDUA 1A96A 2CWWA 4BB9A 3ZGZA 1VL2A 3TW0A 5CDFA 1V8ZA 4J6FA 3TTVA 1ZITA 1G5HA 1XELA 2MMGA 3NHMA 2JIZA 4YAOA 5CVVA 1IWOA 3KQQA 4Q7LA 4WBSA 4CQLB 4OB6A 1E3EA 3A7EA 4KQKA 1B43A 1Y9JA 2X77A 1EK0A 2FEPA 1NJ1A 3FKSD 5EP2A 4BO9A 2RKOA 1B3RA 1ZDMA 4ZVLA 4ZO9A 5FFMA 1PGPA 1U2DA 2C3PA 4EG4A 3JRXA 3Q6IA 1JFFB 2C00A 5L8VA 3LTNC 1NVMB 4M38A 1QHEA 2HB6A 4F2HA 3B5IA 1KR2A 2B5OA 2DWCA 5SYNA 2QUAA 2EHDA 2XUAA 2A0WA 4XM0A 4B3CA 3G23A 3C3MA 1ZGAA 2LR0A 1SQFA 3RROA 2ZBUA 1JQLB 3M5DA 2YTZA 5J59A 4LJ9A 1E3MA 5KOIA 4ZP1A 3PQ2A 1QG4A 4MIEA 4PGMA 3CW9A 4N9WA 2GBLA 5T4BA 4P81A 3UMCA 3ETJA 3LIPA 4CKYA 1HK7A 2HTFA 2IZ7A 4GLOA 2IL1A 1O6BA 3KWLA 1VL0A 5D2CA 2HSJA 2YHSA 3FCAA 4MRAA 4ILKA 4BIIA 4HZGA 2IA5A 3DBLA 1EBUA 2IDKA 5LP6A 2UZ0A 4FR2A 4JP2A 2W22A 4JLDA 4UBLA 2Q3CA 3CH4B 1ZGZA 1N5LA 2OVFA 2VAVA 3LUCA 2IJGX 4A10A 3BJEA 4MI1A 4D9MA 3WQRA 5B6PA 3JAKA 4BQPA 3ELYA 3GRAA 1C5KA 1PD0A 4RC9A 1B93A 4AW9A 1CJUC 5JD3A 1FUUA 3FTEA 1O6ZA 2YY5A 3T7DA 3WNBA 4B8WA 4DLAA 5ULLA 3IPLA 3R23A 4HNSA 4QICA 1M2WA 2BTQA 2ZSIA 3JSAA 3P8ZA 1ZJWA 4B7CA 4UHHA 5MGNA 3FPFA 1T4DA 1TMYA 2X9LA 3SJBA 1OIWA 1J09A 3EYWA 3OPQA 2C8JA 1P5JA 2CDRA 2YWBA 4HKTA 4BLWA 5KOYA 5AVZA 1PTKA 2V5VA 1FCJA 4E07A 3RH0A 4C2UA 2DVMA 2ZETA 4YUAA 3TE7A 4KBYA 4GL2A 3X43A 3FHTA 3S2SA 5LUAA 2YC2C 1R0KA 4KPUB 5AHOA 3A4MA 1VE1A 2JK0A 2I6GA 1IOLA 4DL9A 1DUSA 2XSZA 2Z5GA 3DXYA 121PA 5JCJA 2HADA 1DSSG 3IYLW 4F4CA 1YI8A 4A8HA 3FE2A 4X1KB 2QL6A 1XUOA 1T6ZA 3A9CA 3GJ6A 4RHEA 4DCSA 1CJCA 5AKHA 5K3EA 3O8DA 1Q50A 4DQUA 1IJFA 2UVQA 3PXAA 1WXGA 1ADGA 1K3FA 3F5FA 4G1BA 2PGIA 1NJ8A 1X6VA 1DIBA 2ZQYA 4ZQFA 4UNSA 3RNLA 1IQ0A 2D62A 2QJFA 3PX3A 3VXKA 4E30A 1N6OA 2CLFB 4BLUA 1LBHA 5GOTA 5BNZA 2C7PA 3PNSA 4HDKA 3QNUA 3IKJA 3OZTA 4HATA 4MW5A 1GILA 1G63A 2REBA 3WGKA 1FFDA 5LA6A 3PNKA 5FA5A 1FSZA 3MTIA 3WAJA 2E87A 2E4VA 1IL0A 1L1QA 1YBAA 3KPYA 4HPWA 4CMJA 2XADA 5HF6A 4Y6OA 3IOEA 2PT7A 3OEED 4N5NA 1NN3A 4FUTA 1SZDA 3FSEA 3HU2A 3QVGB 4S1VA 3IQDB 5CM8B 3V8MA 1WB6A 4DDTA 2XA9A 5JS6A 2L2QA 2G28A 3BMXA 3PS9A 3REFA 1LF5A 3WKEA 1SUIA 2KHZA 2Q9AA 5KNBD 4MKHA 3GUVA 1N1GA 3OMLA 1SK9A 2AR9A 3R3UA 4ZU3A 3O82A 3VHLB 4Z0HO 2O9JA 4MRVA 1GQFA 4A8PA 4RCVA 2W48A 2LGJA 1PJAA 3FHLA 2CB9A 5TPZA 3PKJA 4EMSA 3SYLA 4L4YA 2NZXA 2XTAA 3T7IA 4YRCA 4QUEA 1THTA 2OOSA 1OBCA 1NQ5A 3QXCA 4GI1A 1VPEA 1ISRA 2QLTA 1FDVA 2ZAOA 1QHHB 2IYAA 2OBYA 5DX0A 4YDSA 1PCXA 2YNMC 1GKUB 3C0KA 2JAUA 3EZFA 3LX4A 4RJKA 3DAFA 2IUSA 4Q1FA 2Y9PB 2NTJA 1J5EB 3A1NA 4Z8YA 4RK7A 5FAKA 3CUUA 2FY8A 4OATA 3R6WA 3NJ8A 4LQCA 4IUYA 4UEQA 6CHYA 4C0LA 2QZZA 3QSGA 3OZXA 4K3UA 2VUIB 3B9RA 2A9JA 3T1TA 1W4LA 4BVHA 2O8CA 3OQBA 3VMFA 3TZBA 3U3KA 2Z5LA 1BROA 4BVAA 5EIAA 3OX4A 2CKDA 2DKFA 4HAZA 2JIOA 2R1TA 4G8CA 1ZCFA 3E18A 1RAHA 4OBWA 4X1KA 4XQCA 4KB5A 2PWBA 5B1HA 4UM9B 3F1KA 3ICQB 3KEOA 1JXQA 5EXXA 2VNAA 2FPOA 3GY0A 2RGEA 1CLEA 4L5CA 4Q9JA 1BXKA 2YHAA 3BRSA 1P7CA 4Y1GA 3TVTA 3JY6A 4RTSA 4HYYA 3COPA 2QXYA 3UAGA 1R7RA 3ND9A 4MPDA 1R8JA 3K09C 2GPTA 2AG5A 3H97A 4LYHA 2OKCA 3E5MA 5LUBA 4QT4A 3TG8A 4QBHA 4DYVA 4C3OB 1ZXXA 1G8JA 1T1SA 4RZIA 1E1LA 4BGVA 5H7XA 5E4FA 5CB4F 4Q4AA 2Z4RA 3ZV3A 4LF4B 5A05A 1JT2A 1JECA 1JQ5A 2Q3MA 2WUWE 2P2ZA 1ORDA 3MT0A 1XNRB 2PNJA 5A4IS 1Q3KA 2AFIE 2I4TA 3HNRA 5E9JA 4U7TB 3STYA 2Q6KA 2KMLA 4Z86A 5EHQA 1SXJE 3AHEA 4P3XA 2BKAA 2ZIAA 4CLRB 1UBSB 1CUGA 1USVA 3LWBA 1GADO 3GUHA 4LG1A 1APBA 4OVKA 4I50B 3SIRA 2QX8A 3UHFA 1CRQA 5J1SB 3BZUA 1N6HA 1Z47A 3QWHA 4GUAA 5JNLA 5KYWA 4BO2A 1T9ZA 2LBPA 3S2IA 5KNDH 1BFDA 1WZEA 4YBZA 4ZEVA 2EAUA 2AFHE 5IW8A 1UXGA 3OZVA 4BE9A 3MGKA 4CL3A 1D6NA 2ONCA 1QTQA 3DMDA 1N5OX 4YJGA 4LNHA 2AV6A 2IBMA 4LQLA 2FMUA 5C4GB 1EE1A 1EU1A 2ODTX 3H2SA 2Q28A 4ZYXA 3HCPA 2GK3A 2IC5A 3P0JA 4WFKA 3RUCA 3T1OA 1I0IA 4LOKA 2ZRJA 1I2AA 3F9RA 2NX2A 2MSWA 4AX8A 3BMQA 1UIMA 2NV6A 4IHJB 5BSRA 5A1JA 2JFNA 1NONA 4PBSA 2XMZA 4P4TA 3JV7A 1TLTA 1Z88A 4QWMA 4KQMA 4ZV4A 5DTRA 1H85A 3NX4A 1T2EA 4D9BA 1SR8A 2W2TA 5E38A 3RYFB 2AKAB 3BXXA 1FU7A 4Z4QA 2Q9CA 2GNPA 3IAUA 5IDXA 3QA3E 3ZHQA 2BF4A 2NZYA 1MP0A 1KVRA 4GM0A 3HRIA 4JEHA 3T5GA 1ZNXA 5H3LA 1PJ4A 1T6XA 1KSGA 1DXQA 3H6GA 4PRZA 3I62A 5I9LA 3R9WA 1LDBA 3U31A 2CBGA 1NHWA 4JCCA 5IVPA 1WXIA 5JH7B 4JJFA 5FPTA 3QTLA 1KMHA 1QYVA 4M99A 4UPDA 1KBZA 3PDHA 5MHTA 1OPRA 1ULUA 1OA1A 5DXAA 2WZDA 4EKEA 2EP8A 4FUQA 4V0SA 1W8IA 1YZ3A 3JX9A 2XNCA 3VM6A 5ABPA 3RSOA 2QZ9A 4DQKA 2NOAA 1DNPA 3ZDQA 2M9MA 3MTQA 4DQLA 4Y1RB 4MQ6A 3NWEA 3KTOA 2BGNA 4CM8A 4HYQA 3OCVA 1OAAA 4KSYA 4J4HA 1NMEA 5F1YA 3EDMA 1PJ3A 1LPMA 4D3SA 5EKSA 2B4KA 5F9FA 3QEJA 1JEDA 5IAKA 3PTZA 1XPUA 3O8OB 1JR2A 1NQOA 4QDXA 5KVAA 3TTUA 1P9RA 4GZ5A 2POCA 3V4LA 4UTRA 1UZLA 3DHNA 1FYVA 2OFFA 2XF2A 4P5PA 3ZHZA 4CM4B 4HV4A 1HDRA 2H63A 2NVUA 3PXEA 4RMNA 3T06B 4V0RA 3DLTA 3BD8A 1IY0A 4EYQA 4HDQB 2D2FA 3ZX4A 3T41A 4UNRA 4B71A 2G4CA 2A7QA 5ALJA 5IM4F 4FSDA 1RHRA 3AK4A 2XGGA 4B83A 2ZIFA 1W6UA 3SF8B 5KQMA 1EK1A 3F2IA 3U7JA 1W4CA 2JI7A 2E37A 4WV3A 3NNDA 2UZ1B 2GWHA 1S96A 5FA8A 1WY5A 3N75A 3G9TA 4FEAA 2AWNA 3R41A 4KO8A 4XUGB 4B76A 1WHSB 4JA2A 3AXTA 3DE0X 1CY7A 2IU3A 2WM3A 1ID8A 2BDUA 2A1TS 4UHFA 5BR7A 5E6SA 1GRNA 2PXHA 1D1QA 1I3CA 2GM9A 2OHGA 2QZJA 2VNKA 5SZKB 5DMHA 1Z2AA 3GJTA 5DLQC 4CG0A 5KYUA 4UCXA 2FN8A 2R7LA 4XCQA 5HK9A 4G5OA 1TM3E 3QFRA 1SKAA 2PKQO 1N1EA 4GOJA 2FZGA 1DO0A 5F77A 5AIBA 2JFFA 5CX1B 3UHOA 1S2MA 4U3JA 5ALYA 4D8VA 1RAGA 2V45A 4IDFA 4M0EA 2WYUA 2J0EA 5JD4A 1IUPA 1KDRA 1EJBA 1NVXQ 3QJYA 1TZCA 3D3WB 4ZWNA 3W5AA 3K9HA 2H54A 3F78A 2V3WA 1JRLA 1N8SA 3DP7A 3H1AA 2QL7A 1QVRA 1DWUA 2ZAGA 3FPLA 4JOQA 1DTSA 1TB4A 5FL7A 4ZVKA 1GU1A 4A7PA 4DCOA 3C6KA 2QGFA 421PA 1NBWB 1U0HC 4B43A 4D46A 3C48A 1PL6A 4IOJA 4PBRA 5E2AA 3BRQA 4A26A 3SQLA 3QRWA 4DR7B 2HWUA 5LIRA 4XIGS 4H6XA 3GRUA 4YMSA 4C4XA 1RRPA 3WNQA 2B7CA 2BEJA 4NR0A 5IC5A 1PIWA 2ZATA 4N0PA 4D9NA 3TIGA 3W7AA 5JLJA 1H2AS 3QTBA 4GKKB 3K0FA 2OGWA 5ILGA 3O74A 3MJHA 4JYBA 3D7RA 5LMNB 2CK3A 4NCIA 4W9RA 4DLBA 1JP7A 1PO7A 2G9UA 5GV7A 4EKDA 4E6EA 1RT9A 2P2GA 4QYIB 3AVUA 4G3XA 4RWEA 1I2MA 2JK1A 3KJIA 5TV2A 3G6WA 3F6BX 4WVFA 3R76A 3VO1A 2O3JA 1IAVA 3ADPA 3HUFA 1Z34A 4N3BA 2R5FA 4TLAA 5TS3A 3SFZA 1FTGA 4OO3A 4NXNB 3V4RA 3PI6A 2P6PA 3CRMA 2DZDA 1C3LA 1U2TA 2K7ZA 1IU9A 1V1RB 3KB1A 2CMDA 2HQRA 4G1EB 4RIFA 1A9XB 4CKWA 4XWWA 1F3LA 3BE4A 1NVKA 2OUIA 2QEQA 3GRZA 5CXUA 2WE7A 4V0NA 1MX1A 1ZQ1A 3KVVA 4R1TA 4EI8A 4B09A 4F3YA 5LNK1 4GRIA 1JDBC 1KQ3A 2OLEA 2HA7A 3B6KA 3KVOA 4FU0A 4OXIA 4B84A 2GBFA 5LN1A 2EW8A 3NU1A 4JH0A 2ZWMA 1HWYA 3MJCA 4EWLA 3SXPA 1RNLA 1T1JA 3EWNA 3L02A 3JYPA 2AW3A 5D3MB 4J3FA 1B14A 4D97A 2G77B 4Y7DA 1SUCA 5KMGB 2IKQA 2C2HA 1NZFA 4WZAE 1YE8A 5JFOA 2G72A 4URWR 2IXBA 2ONZA 3GF4A 3P9SA 5BT8A 2G5TA 1ZG3A 3AV3A 5GJCA 4RS3A 3V6MA 5BPHA 4O8ZA 4MS1A 1TU3A 2OV3A 4PGAA 1X7HA 4A91A 1FMCA 1AKUA 1L5QA 2QT9A 4FFLA 3KSDO 1U8TA 4LYDA 3KXLA 3MS4A 3PU6A 4M1WA 1M1NA 4ZCTA 3U4IA 1LW7A 1QCZA 1U28A 3DKVA 3F46A 4KC0A 2IDMA 4MQEA 4Y1RA 4A6XA 5FTWA 4US1R 1E63A 7REQA 4EW2A 5TPWA 3T1NA 2R84A 2Z56A 1UZNA 1PYGA 2J3DA 4GOND 3A6EA 3TLMA 4CMEC 4MW1A 2Q3LA 4QYTA 4G01B 4R31A 3LK7A 1BE6A 5HHTA 4G0YA 5CFPA 2AMFA 3N3AC 1IQUA 1USUA 2DKNA 1PZMA 2ANBA 2OC9A 3H9BA 4QXPA 3JWHA 1LBSA 2GN1A 4M0FA 4UXJA 3RUIA 3W7VA 4B6JA 4TMWA 2PKXA 2AWOA 1ZR4A 2G4VA 1U5CA 3NHYA 3PC8C 4P98A 2FSHA 1IM5A 4LNAA 4IWNA 1SA0B 3BFVA 4OGLA 4PRKA 4V3CA 4JP5A 1XMSA 4HN4B 2CD9A 4GSKA 4WWHA 5KCMA 4AO7A 1F38A 4WKBA 1BHSA 2GSDA 1T0BA 3HYLA 4KR9A 3AF2A 3ZGOA 4X65B 1FX1A 3DNFA 3FYHA 3N2NA 1PT8A 5AW3A 4UCWA 3B3FA 3GLHE 2H3HA 4EPVA 2O19A 2IXGA 1WSDA 3ONFA 4IG9A 2C8KA 5JH7F 4OD0A 3JR3A 5HBGA 2ZUCA 1JNXX 5DYWA 2GHQA 4QBGB 3WK6A 1FDSA 2VCYA 2W8BB 5FD8A 5ALNA 1NRXA 5HRCA 1T5LA 4K26A 3IDQA 3BD6A 5BURA 5AJXA 2R8ZA 1GNSA 2C9ZA 1PG5A 4ZDKA 2Z09A 3O5AA 1AS0A 3IB3A 3EZXA 4MV4A 4WLVA 5L3QA 3I3SR 4V2UA 4KE8A 3DS8A 2R8EA 2NP7A 3GH1A 4KV7A 3HYCA 4Q4LA 3CNHA 2Y4NA 4K6CA 5LR6A 2B1GA 4MV8A 2ZBVA 1RLMA 3N5KA 4OLJA 4J7XA 1DVRA 1VHQA 1Y7LA 3KQKA 2FWIA 1Z29A 4MDYA 3H75A 5B58T 4ZMRA 1VSVA 4AZ3A 2QD2A 4LDPA 3C85A 4URFA 1G9XA 1H2EA 3H6HA 3DBOB 3NYWA 1NOJA 3OTOB 3OZCA 4UVHA 1SBIA 5A0VA 1OYOA 1C0PA 4MJLA 3AUSA 5FBLB 2AQIA 3QHAA 1A3CA 1WW2A 1EFVB 3VR4D 3QJ5A 4JVOA 4A5SA 1OBVA 2PJRA 1I10A 2YWHA 1GEEA 2DWPA 2IUYA 3IURA 3A9RA 3USES 3BRWD 4U2DA 2HJSA 3ZCUA 3V2HA 4CHGA 3MPOA 3BIXA 3K94A 4QLAA 1MW8X 2X6RA 3HVUA 3U4DA 2AK3A 4JQSA 1EVEA 1FNDA 1T34A 3IEPA 3TPZA 1T1RA 4FYKA 5IG2A 1ODFA 4A6DA 4BVGA 4OMUA 3TRJA 1M2JA 2Y27A 1EFHA 2IHKA 3KT3A 5BWMA 4KN6A 4KXVA 1XZEA 5E6UA 3WKDA 3GL9A 4KDCA 1E6WA 3HA2A 3LKDA 1UT6A 4MKZA 4MUIA 4UDNA 1JYEA 3GXBA 5LBUA 5T8KC 1A4XA 2HNAA 4EB3A 3R1IA 2VDLB 4JELA 3EGWA 4DIBA 2H07A 1N5MA 1BFKA 5JCPA 3GLGB 4QNMA 4Q39A 4M1SA 4P3KA 4CFSA 3HHEA 1VXRA 4XVHA 1N5JA 4G23A 3QENA 4XGRA 5ALOA 5J2TF 4B48A 3FZEA 4TS3A 1S1CA 2QDKA 1KE1A 1ORIA 4QUIA 1UDBA 1WUTA 5AUOB 4YRTA 1E0AA 1U2SA 1RYYA 1FOEB 3KU4A 5FOUA 1T2UA 3WICA 2VDJA 5DCYA 2Y1CA 3A31A 4RLHA 1E2FA 5JANA 1RWOA 2PUWA 3AIKA 3WJ1A 3D3QA 5DOZA 3NXKA 1RRVA 2O4CA 2EKBA 3INYA 3CG0A 5EEHA 3JQGA 3TG2A 1EUCB 4DOMA 4EB6A 1A2OA 1H93A 2OBXA 4FFVA 4PZZA 3VR1A 1V11A 1TT7A 4ZT2A 4U5QA 1JGTA 1YRYE 3BHJA 4JBGA 1LX7A 4QAJA 1PJQA 1QXSA 2YMPA 5J43A 2E5LB 3KQWA 4UJ5A 3HK2A 4P3OA 2QMZA 2ZULA 3QWBA 4XJSA 5FHRA 3I5XA 1VHDA 1E79A 4OHKA 1X1DA 1UKAA 2VSYA 2ZZKA 3D8UA 3FB4A 3U81A 3W5CA 1ISIA 4FGSA 1GPDG 4FXOA 4PLHA 5LA6F 4C5BA 4DZRA 1KYVA 4JSYA 1NXXA 2VQFB 3FPHA 2ZPAA 4IJMA 3HTXA 2IS1A 1PV2A 3R5HA 5F1OA 2QTCA 3ESRA 1JHDA 4HFRA 4DSOA 2PV0A 4DGQA 3UB3A 2BFFB 4OHPA 3TGWA 4YRMA 2QD5A 1XF9A 3FRHA 1EGVB 3M2PA 4IH4A 1N0UA 3U7FB 2QENA 1Z5PA 1YU9A 4L8YA 2YRWA 2WT9A 2V54A 2AZDA 2HWWA 3IALA 4KDFA 1NQVA 3ELBA 3SPXA 3GLHB 1DXOA 2QYOA 3Q9UA 1XTTA 3ODPA 4EG8A 4YCCA 1Q0HA 5AHWA 3Q85A 2VRBA 2VSNA 3O4GA 5TEVA 3RVKA 4LHWA 3S2UA 4AJ2A 1YS7A 1H2XA 4BN5A 4Z7NB 1PGJA 5IF9A 3MGAA 4O63O 3U49A 3UMSA 4FDLA 2P5UA 1FPQA 2EGGA 3AXSA 3CBGA 5DW3A 4X1YA 4IYRA 3UFBA 2JKVA 2AN3A 3A4VA 3KS9A 3OQVA 4J49A 2H5EA 3ZWQA 5DHFA 2DOKA 4HQNA 1Y1QA 2VAMA 1GD1O 4BNJA 4CQNA 1HDEA 4YXWD 3QIVA 4NEHB 1JLLA 4WINA 4S1OA 3QBVA 3QFTA 2XITA 3H87A 4EG3A 2X5NA 2Y1LA 3OEHA 5K0NA 3DDUA 3DOUA 2EJUA 1HYGA 3I5MA 4ZI2A 2NNLD 1V16B 2BH2A 1MPXA 1QU3A 1OH7A 1YR9A 3P5BA 1YQDA 1WOMA 4NZNA 1L3IA 2HRDA 4X94A 4CEJA 1D2RA 4PQEA 2Q2WA 4ENSA 1NNUA 1V5WA 5I7AA 3CBQA 3STUA 3B6ZA 4AZ0A 3HCEA 1P61B 3PQ8A 3RS8A 5JZOA 1XHFA 1EZ1A 3SX4A 2POQX 4C4RA 5HQJA 3WK9A 2NSDA 4NMLA 1UP6A 1D0IA 1QH1B 2DCUA 1VCNA 5JJKA 4LZOA 4RADA 1S2GA 5BO5A 5J9FA 2N1MA 1UJNA 2JVIA 4MARA 1NT2A 4RMHA 4IXMA 2RGNC 3LC1O 4BNVA 5JCXA 2GJAA 1E77A 2Q6LA 3H18A 3N8DA 2BBSA 4ZVSA 4KREA 5AK3A 3EGOA 5JALA 4PG6A 1JHRA 3RV4A 2QM0A 3BGSA 3LYUA 4UE3S 3NC1C 4A8JA 1JHOA 3Q3HA 5EMHA 4UDOA 4OHXA 4GQAA 3U7QB 1R4MB 1PR2A 3FOZA 4OGFA 2Z6AA 4LF8B 3GRPA 3L7YA 2A30A 2I6QA 4U7FA 2A84A 1CUSA 1SIBE 3H4TA 4F9GA 3DZDA 3OCUA 4WI1A 5EN4A 4BO6A 5JYBA 5A4KA 3ABQB 3M70A 3U37A 3K92A 1NIPA 3TLGA 4C7KA 1E7QA 3CRRA 3QI7A 2Y1WA 2ZI6A 1RXSA 1T9CA 3ZPXA 5LSAA 1G60A 1NQTA 1Q22A 1K6MA 2J3QA 1YBVA 2I65A 2A5DA 4CKBB 5TIIA 3RAEC 3ZJVA 1VRVA 4A2WA 1SHUX 2QT1A 2H1OA 5DK6A 1CUAA 2YZ2A 4FYVA 3I58A 1ZJ6A 1GG5A 3AF5A 2LVBA 1RPJA 3NWPA 4YRDA 3JQ9C 4NF2A 3SY8A 4CKBA 4U2KA 2KI5A 3FSJX 1QE5A 3HSSA 4B4OA 4MGZR 4AMUA 1P4JA 2C1XA 3FYUA 3NUGA 4LBYA 4ER0A 3QLVA 2HA6A 3TLGB 5LB2A 4F7DA 4EDFA 1SVSA 1XYGA 1Z5GA 1V8PA 1UP7A 1Q21A 2A1IA 2HXSA 3A9TA 5ELLA 1MO4A 3QK7A 4CR7A 2LE0A 5EMLA 1IBMB 4NBSA 1L4EA 3C39A 3OA2A 4U7PB 1Z74A 1M74A 3MUOA 4UM5A 1P7VA 3MAJA 3QOXA 1JR3E 2C3YA 3G8YA 4K6KA 1R9MA 2ID4A 4CIXA 5L4NA 5FOTA 1HQKA 4H2DA 1ESNA 5ESDA 3WNVA 1MEOA 2TMGA 4Q9IA 5KCZA 4TQUS 4DMHA 4YALA 2E5WA 2GZDA 4AYXA 4RLQA 5DM70 3A10A 1G3QA 3WSTA 1QRDA 4GS5A 2PX6A 4RKYA 4TLDA 2OQRA 4IDGA 1F17A 3U1BA 4X7BA 1RYZA 2VPXA 1E2EA 3OCYA 1V5IA 4CM6A 1XE3A 2Z04A 2BLLA 3HLTA 1SOMA 8LDHA 1QQ5A 1YUNA 2EWWA 3NR2A 3PQ7A 3QLEA 4QOEA 5CH5A 4FDUA 3NFYA 1OR8A 4MV3A 1Q7CA 1SBZA 1ZD2P 2H2WA 4HUQB 4C1NA 3EIFA 4QARA 5D1HA 1W1UA 4GWKA 1YFKA 4QQNA 3P52A 2EDCA 1Z16A 3FDZB 1XQ1A 3H13A 3QPDA 4IMJB 1P77A 1SXJA 3DFUA 3OAAA 5TT1A 2IOFK 4YMWA 3C3WA 2Y8EA 3DUFB 1E1QA 1N6LA 2JBHA 3GRVA 3WYNA 4UTNA 5BV1A 1WDWB 2FP3A 4DWOA 1JQDA 1KFJB 4KO3S 5A9SA 5UKDA 1E6EA 4JYAB 3KQMA 3WGTA 5A4DA 5J23A 3D6VA 2DR0A 1L3CA 1KKUA 3CLRC 1UT5A 4FNGA 1VBFA 3ZVLA 5DNYB 1DUVG 2IELA 3C74A 4OK6A 3I34X 3V4SA 3N6VA 4BVKA 1XEWX 2WMDA 2H7YA 1PR5A 1B23P 1J7JA 4G1VA 1T2VA 2ZRDA 1IE3A 4D8UA 2FPGA 3PC8A 5JO0A 2AMYA 3I9KA 3RS5A 1W2GA 4NYJR 4BMDA 5JS1A 1QX3A 1NUUA 1XTUA 4FHGA 2IPNA 3JS5A 1O9GA 4O2LA 4YJHB 2RG1A 1N4DA 4G09A 3WIBA 4EGCB 4NY1A 2QRUA 5CCEA 1XTJA 2ZROA 4U7HA 4P58A 2LD4A 4J1QA 1V4NA 3KHKA 1JHMA 4S1WA 1EAMA 5CNJA 4RW0A 2VJYA 3DTVB 4TV9B 1SKQA 1W19A 3B60A 3F96A 3G5TA 3PJFA 4HTFA 5IJAA 2XHEA 3FLEA 4BLVA 1VLQA 5JQGA 4BV2A 4L08A 1W9HA 1JEQB 1ECJA 1MC8A 2V97A 1X80B 4QC2A 4EFDA 4ZGWA 5JHGB 1WAMA 4XW2A 2IYNA 4C4TA 4CJXA 4E2WA 4F96A 4AS1A 4HC4A 2YWEA 1P2SA 2R00A 4MCIA 4PXAA 1KEEA 3C6QA 1K98A 1X92A 4GVXA 1CHNA 2OENG 3TEFA 1PUIA 3GHHA 4BQNA 1GV0A 4H7IA 4HDNA 3NDRA 2H6EA 3PUKA 1DV2A 4G5RA 2RG7A 3ZHVA 1XMIA 4PR0A 4HDMB 4O08A 4JC4A 2QTGA 3VDRA 1RC1A 2VJMB 2IEGA 5F1KA 5A3RA 1DIAA 3BIJA 4GUDA 1I4DD 2PIAA 3X2SA 4A15A 3MAAC 3KUUA 4JV5B 4JL6A 3EIWA 4QPZA 1FL9A 1GA6A 3TMYA 2QUZA 1SC3A 2WFAA 1BA2A 5B1DA 3MWJA 2I2XB 2ZQZA 4KTTE 4QUBA 4KSBA 5GMOA 1JKXA 1RCFA 2D54A 1R5BA 2QAIA 3D4LA 3KOMA 2XIQA 3OPNA 4IJUA 4L16A 2EX0A 1GY8A 5EUMA 3GDGA 1E9BA 3IDFA 4CIBA 2XZLA 4FI3C 1KORA 4LXYA 2MT9A 2FE1A 1AF4A 5LDGA 1VPLA 2DFKB 1XD9A 3BD9A 5AJZA 3G0DA 2CFSA 2NO9A 3ONVA 4ZD6A 5I5EA 2DE0X 2JIMA 1OCEA 3PLAE 2Z98A 1Y6GA 1DWOA 1X1RA 4L3WA 4AC9A 4FC6A 1QKJA 4DLVA 1D6SA 5EMJA 3PGKA 2I1WA 4HGYA 3H5AA 4IQ8A 3U3XA 3P1JA 1SB8A 2RAVA 4GM1A 1N2ZA 1V9CA 2IXAA 4Y9TA 2EFHB 2GJKA 3F1LA 2O7VA 3K1AA 4KDRA 1E7WA 2WV7A 2X3YA 4P36A 1BOFA 4IG4A 4E11A 2X0KA 2GKSA 2A9RA 1VSBA 2FNAA 2ILVA 3P0EA 2C9CA 4J0DA 3QE3A 1NRWA 1VP3A 3FRIA 1NVFA 4B3RB 2P0YA 2WF6A 4CV0A 3PFBA 2PRJA 3R7AA 1YC5A 1SPBS 1J23A 2GZHA 3HRHA 5BNFA 2IV7A 3X1ZA 5H8WA 3UH0A 1WKCA 2AFIB 4GLLA 1FYEA 2WWFA 2XV1A 3NBZC 4R8SA 3ZLTA 3AONB 4ZAFA 3LYLA 4C7VA 1WPGA 2VUUA 4KYTA 4MZDA 4ZCIA 3I2IA 5JPCA 4IZHA 1PJLA 4HTAA 5K09A 3PZRA 3IBTA 4BAGA 4ED9A 5LQKA 3V32A 5AVJA 1W46A 3LPNA 2MR6A 3L9WA 3MTEA 4QDUA 4ADSG 3OD1A 1W34A 3SDSA 3CNEA 3KJHA 3WL5A 4B47A 2O2SA 3IUEA 5LVAA 2IYYA 1NMXA 1EVQA 3TO5A 4P7GA 4WJKB 3CV3A 1TJ4A 2H5LA 5DSXA 4CCAA 1G3UA 2FK7A 3FPEA 5U9CA 2WB4A 1DEXA 4P82A 1GFWA 2V7UA 1I94B 4MKFA 2IDZA 3GNTA 1WUIS 3D9QX 1SPXA 2P9BA 3BFKA 4F8JA 1WW3A 1QRSA 1DC6A 3GFOA 4QTZA 2G40A 2P1DA 3D3WA 1MLDA 1P4RA 1G5QA 1FFCA 4B40A 2WIFA 3I9OA 4CL8A 5I48A 2WC1A 3VRHA 4FYIA 4YRBA 3ZG6A 5I7RA 1P2VA 2Q6TA 1C7FA 4OQQA 2OXTA 1JEQA 1UDXA 3M3HA 5BSKA 1RHQA 5KX5F 1CQPA 2DH5A 4HAOA 1O94C 3DWFA 5ICCA 2XT9A 1ZR2A 1HDCA 1ZISA 2V7VA 2QLFA 3G5UA 1BVYF 4EO4A 4YCNA 2Y71A 4HXFB 3DVSX 2ZJ7A 4J76A 4R0MA 3MILA 2FZ4A 3GXOA 3FUCA 2WDZA 3RAPR 1GL7A 4HDKB 1WMFA 2IZ6A 2YXPX 4LHZA 3MUFA 5BW8A 1IN6A 4JLBA 2LCIA 2XMSA 5AUNB 5J4KA 3JD4A 3ZKWB 2VJLA 5IZ4A 4JXKA 4RXUA 3IAM6 3ZDXB 2OCAA 3C3BA 1COWD 4XGQA 1MEEA 4XWTA 5L7YA 3F6CA 4LRQA 4DDUA 1M6WA 1N8NA 2MR5A 1Y80A 2QD3A 3TTXA 4GICA 4ALKA 2C4VA 1FDOA 2Y1XA 1DU4A 4MKRA 3P96A 3DCYA 3K31A 5TJ9A 1G8PA 2EJTA 3M4YA 4URYR 5A9SB 4ENUA 1C1HA 4F9EA 3KYBA 3QPWA 1VECA 5G40A 4F4IA 4QOFA 3RC1A 1RIFA 1KIFA 1B00A 4WLOA 4KYUA 1XA4A 4LOAA 4Y6SA 2XA2A 3VDMA 3U3OA 1A88A 1T3SA 3FG9A 4RQTA 2GXAA 1CR4A 3K9WA 3FGOA 1SCKA 1YCFA 1U7UA 4IIXA 4UNQA 4D7AA 3D3NA 5KOHB 1P0CA 3HUTA 2XNSA 2VH5R 3ANSA 3QEBZ 2CZQA 2QUHA 4MW9A 1R64A 4GU5A 2PUGA 4NMXB 1SU6A 3NOXA 2I54A 4NZ9A 3FD8A 2E4ZA 2W42A 3C8MA 3D8BA 4N3AA 1JKJB 3LRXA 3R3VA 1XTRA 5E6RA 4C7OA 3TCNA 4KBGA 5I45A 3Q7IA 3HGTA 1CCWA 2I2WA 4UHKA 3VA7A 1ZX1A 6REQB 4LJ4A 3G9QA 5IP5A 4ZFNA 1DAMA 1TM2A 1YOVA 3NXSA 3UMMA 1XA0A 1IHPA 1WX1A 3URKA 4DDMA 3QVOA 4JVLA 4BYGA 4M1KA 3GJSA 2Q62A 1G42A 2GR9A 2WG2A 3SQXA 1LI7A 1JAXA 1SBCA 3FOAA 5LPNA 4P9NA 1BXRB 4HPJB 5D5QA 2GF0A 1OAOC 1C81A 1T6YA 1UJ2A 3M1AA 4GHWA 1HL7A 1OWPA 3AUUA 3CIFA 1T2NA 3KKQA 4M0MA 1F60A 3LDUA 3O4VA 4CMIB 2HHAA 1DAHA 1DMSA 2QR2A 7ADHA 1HOXA 3OETA 1PEDA 3B3AA 3KPVA 4XR4A 521PA 4CCYB 4W5QA 3ETEA 4MUNA 4PX2A 3U60B 3BZWA 3LD9A 4Q05A 1XCLA 1DBWA 4AY6A 4I1IA 4RVGA 4F6LA 2BFDB 3ZV5A 4GX1A 3PUHA 4MUAA 4IVQA 1V5GA 3A3KA 4ROTA 3HVRA 1BGXT 1JYSA 2DTDA 3ID6C 4OXKA 5BW4A 1KO1A 3LKZA 1ICEA 2CL0X 3NH9A 2GBLC 2G1UA 1E9RA 2Q49A 1U0TA 1W76A 2AYZA 2FR8C 3B9QA 5FJJA 2DJ5A 4JI6B 3SQOA 3IIJA 2XGJA 4I8XA 1RWVA 2ZI5A 4ITRC 5FOSA 1PE0A 5HM6A 5BN5A 1U3TA 5ED0A 1OBHA 4ZT5A 4Q1VA 4CNBA 5ENZA 1KZ9A 2WHXA 2IYWA 3WGNA 1AM4D 3VKVA 5SV2A 1IEVA 1KKLA 1XZKA 5AKXA 6ADHA 1Y4DE 4AUNA 2WPDD 1O94D 1S7CA 2H2IA 4DEXA 4AF8A 1AU9A 4EUEA 5LQJA 3EH1A 5CDHA 1MNAA 4ID3A 3J7AC 4KQFA 3W4IA 2XCIA 2IEDA 4IKPA 3UHAA 4CM9A 3AMVA 1C80A 1DX4A 4KAXA 3WSVA 3BAZA 1DWQA 2WZBA 5BSEA 2BHTA 3I73A 1DTWB 1P91A 2GBPA 1N25A 1ZZEA 1J9GA 1R9JA 3MFYA 4H4DA 4LMAA 4MKIA 5H9VA 3N5CA 3AT1A 1AIPA 1ZOIA 3PNQA 1NRJB 1I4OA 5BSVA 2X2EA 3OU2A 2NYAA 3S99A 1TQ6A 1EFKA 4KH1A 3KB6A 3SMQA 1FLDA 4EKGA 1VRCA 1DHTA 2H51A 1P7WA 3PEEA 4AFNA 5EPEA 1J9EA 1C7RA 1Z0DA 4GR4A 4W6QA 3TXXA 1J2UA 2WMYA 5EHGA 3WHIA 2HRQA 5HCUA 4NYMR 1NXVA 2QN2A 3VISA 2FQXA 1QHXA 3DMYA 2CNDA 3CUSA 1EWTA 2OCBA 5B1YA 3FUUA 2P4UA 3ECAA 3HC7A 3DLHA 3IH5A 1DT3A 1MVOA 1XI2A 3O2NA 1XTVA 4J0EA 4MJ3A 2N47A 2DTEA 4MV5A 1E3WA 3PGMA 3ADCA 3A05A 3FPGA 3WJAA 2ACKA 1P6XA 3CZ9A 3TQCA 1OH5A 4A73A 4C14A 1GIAA 4Y9DA 1ODKA 1X1EA 2G83A 1TGYA 3BTSA 1VHJA 3IO5A 3ONWA 4K1LA 3OE7A 3A27A 4HD8A 5HUQA 3ZGXA 3H8VA 4D44A 3EYAA 3FWKA 2BZ1A 4RAOA 4TXNA 4JWKA 3WKAA 3JATA 4TMYA 3ZIAD 1TEVA 5LBIA 1J00A 1M8GA 9LDBA 4Y2PA 1PP4A 2V7BA 3ND5A 1R4NA 1C7IA 4RJIA 4PW0A 4GWLA 1IIRA 3I05A 1L5HA 3M5CA 3R09A 2WUGA 3SS8A 3KV3O 4AJ4A 3GLQA 1JDUA 3ZNNA 4GDFA 1D6MA 1Q92A 1GITA 2CFTA 3WMWA 4D2IA 1DEHA 4IZ6A 1FRZA 2GA8A 2VRCD 3IXMA 2O3TA 1Y1KE 4G1UC 1QP8A 5K3CA 3SHFA 1R2QA 2VZEA 1I7PA 3WIOA 4E4RA 4NCKA 3U4HA 3IULA 1HDOA 3GPDG 3I9FA 4XD7A 1RRKA 2HK7A 1AN0A 2GK7A 3RGGA 3EZ9A 3OAAD 3UT5B 2V1UA 1KWGA 1V6AA 2CUZA 4KRYA 3DAYA 3RYHA 1OW3B 3A37A 4F3CA 3DLBA 1KE2A 2EQ5A 2WE8A 4W7IA 3X44A 1O5OA 4KV9A 4NS1A 3ZOZA 3ZIUA 4RV5A 2WYIA 1JR6A 1I7LA 1XRPA 3PD7A 4M54A 2PUDA 1AZSC 4RORA 4E03A 5BVHB 3OLQA 3AIIA 4PFSA 4PFKA 1UOEA 1H8EA 1ZM3A 2X58A 4TL7A 5A03A 4ALNA 1CG6A 1ZSYA 1DCFA 2JFBA 2WLSA 3ND8A 2QLJA 4Q3LA 4U5XA 3JARA 4BVJA 5GONF 2EW1A 2J7PA 3ABOB 5DX8A 5KDLA 4HYEA 1X77A 3HXQA 2OTCA 1NR1A 4KIFA 4PICA 3RRMA 2DFDA 4F9TA 2H17A 2G71A 3WRVA 4ONEA 5JCOA 2FSGA 1LNQA 1VSQA 3DULA 3G2LA 3WGZA 2AW5A 2AI3A 3VR6A 4BMVA 4CLOB 1X9GA 1RJ9B 1TTTA 3CUTA 2JH9A 5D3MA 4M1YA 4GC5A 4MPRA 1A9PA 1EMDA 2GA9A 3OZEA 3UUEA 4BZWA 2WIAA 4LN1A 3VNBA 2GM5A 4U4AA 1PLKA 5CK5A 4YMIA 1EUZA 2D3TA 3AJ8A 2HF7A 2WUEA 2K4MA 3L46A 4UDXX 3BK2A 3VBCA 5FBVB 1TW2A 4QHTA 1AKWA 1H22A 1TTQB 4DMLA 1YB1A 3BL5A 3OOEA 4PG5A 2GM4A 5J58A 4QXQA 1XLTC 3R3HA 5HIIA 4BY9E 2CXTA 2ZIXA 3C4QA 3EGDB 1DO8A 1L4MA 1N6PA 1BNCA 2DMRA 2H9AA 2O7RA 2P2DA 3E0QA 1R37A 4LRSB 2G9NA 5MDHA 5JTTA 2EP5A 4C04A 1W2WB 3UOWA 3HP4A 2IH5A 3O38A 2B98A 4EX7A 2WNIA 1HMPA 4DUPA 1BFUA 2CHQA 3DH0A 4ZT7A 3R5FA 4LXIA 4TTRA 5KNCA 5KYYA 4O8CA 5M34A 1OU0A 2JRLA 4Y6GB 1H42A 1AV7A 1BMFD 1S01A 5JWOA 1Q7GA 1OI4A 3S8MA 1F8YA 3BCRA 2HCBA 4IHQA 5E9WA 5JU6A 5HNKA 1G38A 4MYUA 2ZYHA 1I33A 2CXUA 4GE3A 1S6YA 4FHZA 4UTXA 2VS1A 4CMCA 2ANCA 3OKCA 1B74A 2OZPA 4LY0A 1CNMA 1PZNA 2O2CA 2I2FA 2OG2A 3DEAA 4M4SA 3EPLA 3GMTA 4FI3F 2KLBA 2F48A 2LWIA 4S24A 5EJIA 1Z9BA 2ERXA 4DUZB 1HV8A 3IQIX 3KFXA 4WFIA 3RUEA 2HZBA 5FWXB 2H18A 4M9XA 1A95A 1X1BA 4CDGA 1VJ0A 1Y4ZA 1Z33A 1IBSA 4KUEA 4QGSA 1C4KA 1UH5A 1YIOA 2OO5A 3BXGA 2ZDQA 3PFGA 3DE4X 1JW9B 3EY9A 1PLLA 1K5DA 2W43A 4MW6A 1JB9A 1MQSA 2OZLA 4RTOA 3TR6A 1COWA 3VR5D 3BDAA 2VHWA 2J48A 3RHFA 1HKHA 3M34A 1CQWA 4GXTA 4MRMA 5EZ6B 2OK7A 2WOOA 3KZNA 5IH3A 1J7KA 3GJRA 3UYLA 1M7GA 4KK4A 4L57A 4ZDWA 4MWGA 5C8ZA 1ILWA 3SJCA 4LOIA 2JHAA 4L76A 5HPYB 1DQPA 1QV6A 1U0NA 3A1CA 5DP2A 1JDNA 1XJQA 3LUAA 5AVKA 1HLGA 5AJHA 3QKWA 2YV1A 1Z37A 2WJJA 3VR3D 2J59A 5EHZA 2HQ1A 2ZAIA 1J4AA 4IDCA 4RM3A 3UXYA 3EEYA 2IVZA 3R0IA 1P1CA 1O1YA 2PYZA 4OA8A 1KZ6A 1F1BA 1FFSA 3WYBA 4F5WA 1H9CA 2HLPA 2OBBA 3ZVRA 1WHSA 4QO8A 1DKMA 2R96A 5CJJA 5I7SA 2M1XA 1Q0TA 3FTFA 2NQ8A 3LLUA 2QUIA 1KXZA 5JECA 5AKLA 1MGPA 5AVTA 3LMKA 4NOLA 3ZC3A 4P08A 4UHEA 1SQ6A 3H4IA 4B7AA 3HJGA 2VN8A 1DKOA 1DARA 4Q1DA 3HS3A 1RMQA 1GPMA 1QQTA 2OT3B 1X7ZA 2J1LA 1XD2B 2QRHA 1B0ZA 2CUTA 3R3WA 4CLHA 4LCBA 1DDIA 3KQYA 3UKJA 4PZ0A 4BV9A 4KVFA 5EJEA 3N8IA 1M6VB 3SQWA 5AESA 3T9DA 3CEPB 4TMTA 4ZPXA 3HZZA 1R9GA 3NCHA 4XXHA 1LTQA 4HZUB 1AY0A 4AX4A 4F60A 2Z08A 5CYPA 2GASA 1R18A 2IYUA 4I4CA 4JP3A 4B6EA 1F7UA 3B7GA 4AO6A 4DN6A 3G49A 1UPCA 5GINE 1BDMA 1OTXA 3U4AA 4JJAA 5LMUB 4WY8A 1SXPA 4D8WA 1O8BA 3PR1A 3WRXA 1GZHB 2QVYX 3WO0A 3KK0A 2V4UA 4INOA 1AA9A 5ADWA 3E1GA 1F0KA 5F64A 2CL5A 1EIWA 4LTNA 4DM7A 1LSSA 4OXRA 4XWYA 2P5SA 3TZHA 4WVLA 3T7RA 1VG0B 3I1FA 4UHBA 5DNWA 5TXGA 3WIDA 4E7PA 3V4VB 1GZDA 1TIPA 3AERB 1BCSB 4OGGA 2BEWA 4FGKA 2Z9BA 1G2PA 4TLBA 1NPDA 3AM4A 1K86A 3A0UA 3G59A 4IXTA 1LJLA 2Q29A 5BRNA 4RE5A 1Q7RA 1QM5A 3DFKA 5JAQA 3SEZA 3C5HA 4CCWA 2ZYSA 4PNZA 2H9YA 3WB0A 4DCUA 3P9ZA 2PUAA 4N12A 4FM9A 3RBXA 5CIQA 3A6ZA 5CDTA 1W9MA 4QFDA 3ESZA 3Q2KA 1TVCA 1H69A 1BS9A 3KL4A 2W9XA 1PSDA 5LZ2A 2XQIA 1KNXA 5KQLA 1E4VA 4OU4A 2W6JD 3AJRA 4PHGA 4YK7A 4LXQA 3VJKA 1QO0A 4RTRA 2Y9MB 3D8HA 3TZQA 2AG1A 3IA2A 3MWKA 5JNWA 3KSZO 4JI0B 4QYWA 4M0KA 1WQ1R 4PSUA 3NJRA 1GCAA 4C6TB 1J6UA 1F8UA 1YRHA 3A32A 5DTMA 3VTKA 4DC9A 4FX5A 5DIZA 4B31A 1NOIA 3LT0A 5KBYA 3AHDA 2WW8A 1XTZA 2MSCB 1VZ3A 3OPYI 1ZD9A 5GTDA 3E22B 4CKWB 1EDBA 1VCHA 4BFTA 3FAKA 1RXUA 3D0OA 5IVDA 3H9JA 3L6EA 1I4WA 4L74A 1OWNA 4ALIA 2GVZC 3GBPA 5ADUS 1ZGGA 2PD3A 3GLRA 5FOVA 1ZESA 1Q19A 3MFQA 2DUMA 1A4UA 2AYYA 2R7NA 3CNOA 4OKIA 2WM2A 4TVOA 4UZSA 5GONB 3GLGE 5KKNB 3GIWA 3IDSA 5EP4A 5DBHX 5TGDA 2ZSAA 2XZOA 4TQ9A 4IDBA 2R6DA 1E79D 2ZSBA 4IKOA 3HBNA 4H1HA 3JYHA 2ZWPA 4Z1MD 1X7XB 2QJTA 2QVLA 3TLXA 3EXEB 4EJSC 3KG2A 1KETA 2QQFA 3EXHA 3HCOA 3N0RA 5ICMA 2ZRBA 4I4TB 1ZVQA 4C6TA 3T3IA 1U5BB 1GG2A 1M7HA 1M3SA 5T6MA 4YAJA 4CMBA 3WA7A 4G9GA 2C42A 3FFBA 4PGHA 5BSFA 4EPRA 4ER5A 4V0LA 4ZHSA 1NLFA 3L05A 2W2LA 5JBNA 1NXWA 1P4AA 1UBTS 3DGFC 3GC6A 4DMRA 2VSFA 4MS3A 4AG3A 1Q1EA 2PFSA 4Q9LA 5D86A 4DLXA 1UWCA 1NJ5A 4MUYA 3OTQA 3ZU2A 2GJ8A 2VP5A 2A0XA 5EJ9A 1UADA 3ZJYA 3BB1A 1TD1A 5L6MB 1IG0A 1K06A 4XQ9A 3IELA 2W70A 3KYDA 1EG7A 3AUAA 4YNBA 4J9VA 3LVBA 3IXQA 3K8YA 1X7WB 3H42B 4RESA 5FAXA 3ZVMA 1Z38A 4IY1A 5JISA 1GN9A 2PZJA 4BCDA 3LYAA 5BWNA 4QFBA 1XWWA 4ZO7A 3WQBA 1NUPA 2ZE5A 2X0FA 4PX9A 3TW4A 1FX0A 4ZEWA 3ZHCA 4Y6LA 1Y34E 3BCHA 1SVIA 4QGHA 3C6ZA 5AXDA 2YKGA 2R2AA 3ZDBA 3GCZA 5FI0B 3JVEA 3ADDA 3IVXA 1JHAA 3A4YA 3PNYA 4CIDA 5BSMA 1X39A 3E4DA 3PRJA 4PPYA 4LYAA 3FKJA 4UBOA 1O0BA 1CY1A 1PR4A 1EHIA 2NU8B 4EY8A 1N32B 3OZWA 4D4HA 1S2IA 4PLYA 3FNIA 3INTA 4BFYA 3JWPA 6YASA 4XSGA 4HLQB 2CXOA 5EJ7A 4QEZA 1KP2A 1SBNE 2D0OB 4FMDB 4PV7A 4DIDA 1RWWA 3L7IA 5EGSA 3TSYA 2DXIA 2O2GA 3LBIA 4HWPA 3RFFA 2R11A 2PLFA 1SCAA 2QTVB 2DLNA 2YCBA 3EK2A 1KY2A 5CTJA 3TNFA 2I3DA 3EISA 5ARBA 1QR6A 2BHSA 2VI5A 3V8RA 4COOA 1GGVA 4WN9B 3A1WA 1EM8B 1XDDA 2JLWA 3LOPA 3DBRB 1OHHA 4RELA 4RA9B 4ZYZA 3J81A 1CUIA 3PHJA 4HGNA 1ZUIA 2W11A 3ZHYA 3WRWA 2Q4EA 4M22A 1JJAA 3H6KA 1RQLA 1P2GA 4E3WA 4F6RB 3IMFA 1FMJA 2O6LA 1XYYA 3I37X 4IDNA 3RUAA 2MSNA 1CS4C 1RQGA 4JEUA 1O87A 5AVOA 3T34A 3V2IA 5JAMA 1Y4UA 2E4UA 4YP0A 3MBOA 4A5OA 3NAGA 3G2HA 5AW8A 4O4IA 2ZSHA 4LY9A 2B8NA 2AI1A 3ZHBA 2EZUA 2C2MA 2XQFA 4OV6B 3T3MB 4WN3A 1MO6A 3RC7A 2P91A 1FX0B 1GPYA 4KN8A 4MUJA 4B79A 1OYYA 2G5GX 1R0WA 1C4WA 3CZCA 3RI3A 2NTEA 2L69A 2QSJA 3D02A 3H8WA 3COVA 3K9LA 5AM0A 5TT0A 4J0KA 2OXIA 1XROA 2FJPA 2VXOA 4H9GA 2B1QA 3I8SA 3WXMA 3S5JA 1GVNB 1F2TA 2XAUA 1O95C 3EUEA 1M6YA 4X6UA 4D0SA 4WZAB 4K1XA 2XZPA 1N2JA 1XPJA 2CW5A 2RIRA 3QG1A 4ENQA 1UKYA 3AVPA 1K9VF 4YRFA 4PX3A 2NUPA 3DAPA 4AZ3B 4AKGA 3KYCA 1W35A 2BONA 2IXEA 1Z5ZA 3FIUA 3R8XA 3W7BA 3AVYA 3O26A 4XPIA 4MOWA 3ZEAA 1GSHA 2O8VA 4L73A 2HX1A 3U3ZA 4I4TA 4Q48A 5J5CA 1C7QA 2HT6A 4RU1A 3DEKA 1Z28A 2OV1A 3L07A 3I9MA 1G3MA 2XE7A 4IUDS 3HXTA 3EZLA 5LYJF 5AH0A 1CSEE 4EJSB 1IEQA 2FB9A 5DHUA 1NQWA 5HK8A 1I3NA 1KDTA 1ZOPA 2O1WA 5ESXA 5IC4A 2FR0A 2NXJA 3LVQE 4BOYA 4GGMX 3SDBA 1V41E 3MLAA 2R86A 1AJEA 2FF5A 3Q5GA 2C5AA 4DS3A 4AZSA 3T3PB 5EYPB 2UYYA 4X63A 4DCMA 4JD5A 4Q3EA 1FU8A 1CUHA 4F84A 1P62B 2JGNA 2XUGA 2ZAMA 1N2EA 1T8YA 2XXJA 2C5FA 2ZJAA 1KC1A 1CJVC 2HFKA 2PH3A 3H9GA 3FCCA 2QTBA 4IS3A 4M88A 5EIWA 1RE0A 5ECYA 3PQDA 4Q7MB 4Y2YA 1XC7A 2C96A 1H1TA 3QFHA 3VFDA 3FY4A 4YI5A 3E6AA 4EYEA 1ZK2A 2H4JA 4MTCA 2HV8A 3DZJA 1YB4A 3VNAA 1VJRA 1XZGA 2HC9A 2YFKA 4ESOA 3IIKA 2G4LA 4FIDA 4TKVB 5CCDA 1JG6A 5K20A 1SNYA 2VPQA 1NYRA 1XL0A 1IEWA 2ATEA 4QULA 2VT3A 4AULA 2PQMA 4ZJUA 3U6KA 4X60A 1XP8A 1P4SA 4BFWA 3GH3A 4MQ5A 2XX3A 4O3MA 1XPRA 2VHCA 3RWBA 1VMKA 2HT1A 1RQXA 4P34A 6AT1A 1F0NA 3E9QA 1GTVA 2WPNA 2BKLA 2V98A 5I7WA 1YBMA 3ZVNA 1AV6A 2HSGA 4FWBA 4ZALA 4ZC1A 4EHJA 1A9OA 4HSEA 4DMKA 1Q15A 2FUKA 3IKMB 3FH0A 4H6PA 2JW5A 3Q15C 1XTQA 3UQYS 3VPGA 3T5AA 4NH0A 3CZ5A 1JZSA 2NSJA 3A1SA 3B5EA 4G2NA 4M60A 2GPBA 2GFHA 2G6TA 2NSHA 2X7HA 3CPSA 3LE8A 4BO5A 4RDHA 2LDXA 4MDEA 5DISB 2R4QA 4H0FA 5AQEA 1EFTA 4MSUA 4QJ5A 2F1IA 2ZTVA 3OZGA 5F21A 1W0CA 1BEZA 1L7QA 4MPJA 2EFEB 2XDQB 1LW6E 1VA4A 4MVJD 4ESHA 3JQ9A 1TZKA 5I9SA 2JI6A 1K6EA 1VB5A 4TXLA 1XCJA 5C3UA 3RWOA 4ME6A 4N3GA 3WL7A 1QZTA 4CM5A 2Z9DA 3IOYA 3M6VA 5IRCD 2WRZA 2PS9A 4X24A 4FJ0A 3CUVA 1WCWA 3MD9A 3QNWA 2X8WA 1GZ6A 1E1RD 1T8PA 4NRDA 1J25A 3GGGA 4HYTA 1P2TA 4Y0AA 1SG9A 4MQUA 4MYSA 1BOOA 1I9GA 1LNZA 2VF4X 2AGVA 4NK4A 4OQNA 4EHKA 3KQNA 1FTSA 1JHPA 2DBQA 4EUKA 2NM0A 1ECLA 1O58A 3PXDA 4GXRA 4ND8A 2P8JA 3VJLA 1M2GA 1ZLXA 3OKPA 3ZQUA 3EG9B 2D1QA 3ENVA 4JBIA 5DM2A 3BCUA 3D81A 1LUAA 3OEHD 3CSUA 1C3JA 1YJBA 1VHTA 1GARA 1T15A 2BE7A 1G41A 2V6BA 4R9RA 5J2TB 4CEIA 4NG4A 1EVLA 4JSTA 5E4JA 5FXMA 2CFIA 4FS8A 3UJDA 3RS2A 3NHFA 3PENA 2JFWA 4IXWA 4XGNA 3H2JA 2F90A 2VTDA 4PPQA 4D4JA 3UENA 3K73O 3O21A 2I34A 2ZCVA 4N47A 4B3TB 1QR2A 1Z4LA 3INRA 4WOCA 4ZCPA 1U65A 3H7AA 2VJKA 3WTBA 1OV4A 4AJNA 5IZCA 2ZJOA 1YU6A 2JVJA 1GPUA 3A1EA 1QGED 1NYLA 2WAOA 3L4KA 2KQUA 1X0XA 1IDOA 3TUIC 4CR8A 3P94A 1JAIA 3TEJA 2ZIGA 1NU8A 2GKOA 2ZUSA 4I55B 4Q18A 3HKBA 1S8NA 1GUZA 3D31A 4BFLA 3DBIA 1WRBA 1Y1TA 4UEKA 4JOBA 1IWBB 1U0OC 5FEUA 5KTSA 2IU6A 4X66B 4KWEA 3H84A 4TWAA 1EKXA 2XRMA 3OEYA 2B20A 4HNGA 2J9RA 3W2HA 1X19A 3O3OB 3WLKX 3KSUA 5IABA 2P9TA 2W5UA 3KETA 3AVVA 1GA1A 4IH1A 4LRTB 3V55A 1TC1A 3CE6A 4L3OA 3GAFA 2GUGA 5JXIA 4UREA 3MT8A 3K8ZA 1Q0LA 5CD9A 3WK7A <