4V2UA

Apo-structure of alpha2,3-sialyltransferase from pasteurella dagmatis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
386
Chain Sequence
SKTITIYLDPASLPTLNQLMHFTKESEDKETARIFGFSRLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
total genus 134
structure length 386
sequence length 388
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v2uA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v2uA01
2C84A 4R84A 2IY8A 2IY7A 2Z4TA 2EX1A 2IHJA 2IIQA 2IIBA 4V2UA 4V3BA 2ZWIA 2IHZA 2ILVA 4R83A 2II6A 2C83A 2IHKA 4V3CA 3S44A 2EX0A 4V39A 4R9VA 4V38A
chains in the Genus database with same CATH superfamily
4JMPA 2BC9A 3I0NA 4AWBA 3AF4A 4TTSA 1LX6A 3JX9A 3B2EA 4KKVA 4TSFA 4FYYA 4CODB 5JNUA 2PGAA 4R2HA 2F59A 4HAXA 3WKBA 1NU8A 2D59A 3UT6A 4O1IA 5FYDA 1JR3D 3QEBZ 4CM4B 3IELA 3UGTA 4E6PA 2PZJA 3DDCA 1YV9A 2CWWA 4FW8A 4TOIA 2ACKA 2VDOB 2XWJI 3TL3A 5F9FA 4EO4A 1X7WA 1MOQA 3G9QA 3VR5A 1R50A 1P8AA 5JAMA 3L0SA 2PZGA 4LF4B 1AKTA 1KH2A 2NYAA 1W8DA 1IXSB 1VDZA 4O2BF 3UXYA 5B2FA 2IX3A 2RONA 5JO0A 3EGCA 2FPGA 4OJYA 2ZRJA 4KO2S 4QD3A 4H6WA 1SBYA 1UT6A 3FPAA 5CXSA 4TWZA 3STWA 3ZDEA 4MGYR 4YJ3A 2NM0A 3RF7A 1WMSA 2X1MA 1KBOA 3PCTA 5H83A 3RVRA 3V1UA 5FDFA 3B1JA 3CX4A 3FZEA 2RC5A 1ONSA 3HSYA 1KDTA 1SAYA 2F8SA 3SK0A 1CZHA 3IIMA 4D9BA 5C7LO 4U63A 2PM8A 2ORIA 4BO4A 1I0ZA 1H5UA 1Q50A 5KQLA 1ZM3A 4CLDA 4D1YA 4BFXA 3A6HA 3NKLA 3KSUA 5HIIA 1PWXA 4TSFD 3H5VA 3H19A 1ZCAA 2VT6A 3CZRA 3GT0A 3L0ZA 4HEJA 3W5SA 1X38A 2F43B 5DWVA 3H1TA 3AF1A 2FN7A 4BB6A 3QVGA 4M86A 3ZCUA 1B8OA 2FN8A 4C06A 5IF3A 2QSJA 1V9CA 1P1IA 5ALDA 3VHXB 4BDSA 5K9ZA 3AVTA 1NJ6A 3S7ZA 3VR5D 5HS4A 2WNIA 1N78A 2H59A 2A84A 3R0XA 3N2GB 2QAGA 2BJVA 3B48A 3PIIA 2HLDA 4X24A 4HJRA 4YRMA 3V4RA 1OI7A 1J8YF 4LXTA 4PV7A 4XA8A 3P96A 3R9IA 1Y81A 5AJUA 4E2YA 4UNRA 1NL3A 1JDVA 4C14A 1S2IA 3SX0A 3ZD7A 4H3HB 3STXA 3EY9A 1NAHA 1XTSA 2AJLI 3EVEA 4UMDA 5GV8A 4M6WB 2Z08A 2PNJA 2WVAA 1N2SA 2ISCA 1K8XB 1UXJA 2NZVG 3CF2A 3P97A 4L5JA 4RZQA 1DKOA 4DCOA 3HYLA 1Y7IA 1EAYA 4U7DA 1QHYA 1JSZA 2I2XB 4EMUA 3M6IA 4BNZA 3HLYA 4TWIA 4QGAA 1WXQA 2GZ3A 4C4PA 2MYTA 1MKYA 4YYZA 1JLLB 1N9GB 4ZZ2A 2HIGA 1CS0A 2NP6A 4IYRA 2B7LA 4LJ7A 1C80A 3L1VA 1NF2A 5G53C 3FNFA 5ALSA 1W36D 1IB6A 2JD2A 2H9IA 1AHNA 1Z34A 2DJ5A 3FMPB 1ZN9A 3IA2A 2AN9A 1QIGA 3CF4A 3OT1A 1SCIA 2XE8A 2Y05A 4XLZA 4C9BA 4DYDA 3KEOA 2YMPA 4KLZA 3SYKA 1RQRA 3OPNA 2G82A 5KYVA 1AXEA 2HLDD 2WA2A 3V1MA 2ZB2A 2JKVA 1Z2AA 2BHTA 2CFRA 2G8LA 4RZIA 3ZTWA 2VDLB 1NSFA 3ICQB 3LY7A 1DX6A 4J91A 4N12A 4C04A 3KQUA 4JU9A 4PE5B 2FLKA 4IYJA 3O31A 2DULA 4J4TA 5TF4A 2I7DA 5IT4A 5C32A 1APBA 2HLHA 1HL7A 3V8MA 2ZSJA 4Q9LA 1EVYA 1ZWLA 3HVUA 3AWIA 1PZMA 4K6HA 3G8BA 5I9LA 1C9DB 2HIMA 3FUCA 1GARA 4L5CA 3WKAA 5JHGB 4PS0A 1QRDA 3R2JA 1WM1A 2GVZC 4BEJA 3B6EA 3UTDA 3WA6A 3FSGA 5HMLA 3DMNA 5KQMA 5CD1A 3GLHE 3RSCA 3OHMA 2QP9X 4LRUA 3TQRA 1T5BA 4B7ZA 2QQ0A 5CGQB 3D2BA 2I9KA 4OQZA 4P0PB 4XSGA 5B3JC 5LBUA 3CHYA 1J8FA 2YJ6A 2A9QA 5B7PA 2H29A 5ECGC 2H2GA 5AI4A 1TVKA 2HUPA 2DHRA 4JB8A 4RO0A 3IAEA 1X3SA 4IHJF 1QHHB 4P7JA 3HUUA 2P3OA 1DFGA 3JALA 5JAHA 2OXRA 2ZRAA 3KTAB 1WS6A 3ESBA 3G1WA 4HAWA 5IC4A 5JNLA 1ORHA 2FX3A 2R00C 3CPEA 3ESZA 4Z4GA 1AKEA 4R1PA 3T06B 2KYRA 1KAEA 4G24A 5K0NA 2ZRHA 3AINA 2YY7A 3X1JA 1PTJA 2YC4C 3RI3A 3T9AA 3HCRA 5F7XA 2WWYA 2WT8A 1QXSA 4P1ZA 1IUPA 1C29B 1YDHA 3MTDA 1XYVA 1CIVA 3DQZA 1LSOA 3WFZA 1FIUA 3WO0A 2ECOA 4M8SA 1UM9B 4ZO4A 3DKIA 3DWGA 4QPZA 1FS4A 1WUIS 1IOWA 2NSLA 4CQMB 1S01A 2G1JA 2G25A 2F00A 2ZVPX 3WV5A 4BFTA 4OHOA 2C9MA 1K4KA 1YQWA 2QUJA 3GLVA 3O8QB 4LF9B 3WMRA 3FSGD 1Q20A 2PIDA 1ZVKA 3JATA 3F5QA 4QLBA 3C8DA 2Y9MB 2H2AA 4Z6KA 1MD9A 3MWJA 5LD2B 3PFFA 3TS1A 4BQFA 5JXWA 5KYXB 4I1OA 5A9SA 4ABYA 2WZDA 3MUFA 3N3BC 3I64A 2NXJA 4KVAA 5AH0A 3QMVA 1JXAA 1RRPA 2AWNA 4RPKA 4BP8A 5JPCA 3A0UA 4XARA 3MWDA 3LPCA 5TV2A 1JKFA 4J0HA 3JSAA 4LMBA 2QJOA 5KINB 3AUKA 1XV5A 3I04A 2V7VA 4HZUA 2CEAA 2FEWB 2WMYA 3B8HA 3CSSA 1ZGCA 3MINB 1ZH4A 3R9XB 1QF6A 4KRYA 3Q10A 2X15A 4HWTA 4M83A 3PQ2A 3MTIA 2AKYA 1XTIA 2GWRA 1P3Y1 3F6SA 4B6PA 4BMPB 2JFPA 1KAQA 3IXQA 5FOQA 2YZNA 3QVWA 1N2BA 1FBNA 3CRZA 1MRZA 5GY7A 5CXUA 1T2EA 5J3JA 2RHLA 3UK6A 5FTNA 4YR9A 3IERA 4UE3S 3IV6A 4YUXA 1FRQA 1QH9A 3U1TA 3R0ZA 1NE7A 4S0ZA 5D85A 1CQPA 4XRGA 5IHXA 4EARA 2NV6A 3JWIA 1Z5PA 3OUZA 1Q95A 3NP7A 4LZWA 5F64A 5A04A 4A8PA 1U0TA 3BXZA 1EXWA 3TD2A 3ZD9A 3I0ZA 4E6EA 1IAQA 4ZI7B 1XTUA 2OV3A 2DECA 2W48A 2HK7A 2WMNB 4XGRA 5FL7A 1SXJC 1GPLA 3LZCA 5TGZA 3FX2A 5TMBA 4FHCA 3VSAA 3U0BA 2XT6A 1E2DA 4P84A 4YIKA 4LYEA 2P1ZA 1G55A 3VNSA 3GWGA 4DJAA 3H2BA 2G83A 2Q8PA 3EXG2 4OFXA 5E6SB 5JG7A 3T1HB 5EERA 3GP8A 4ZPXA 1E4EB 2WICA 3JYHA 3MNFA 5DPMA 2WJGA 4GAEA 4JYZA 5K3BA 2PZEA 4C6HA 4TMXA 1VI5A 5TY0A 3VV2A 1RWMA 4MV4A 2Q7DA 5FBZA 4YONB 3H7IA 3AKCA 2X3UA 3N8IA 1A7JA 3K0BA 4B4DA 3SF8A 1JDUA 4PPNA 3NYWA 3G82C 4X6UA 1AV6A 4HN4B 3B2QA 4EZEA 2D7JA 1J42A 2IXBA 2FMIA 3G8AA 3G1UA 3GLHA 3NJRA 3PDIA 4P3OA 4TKVB 4YC7A 3ZQUA 4EIWA 2PTHA 1CEXA 4K88A 1Y7TA 4PQGA 1YB1A 2XUOA 4KQWA 1I2DA 5CCXA 2XTJA 1C0LA 1BVRA 1KVQA 4MQUA 1DAOA 2IYNA 4X54A 3QU2A 3FYCA 1W1UA 2WYWA 3OOSA 3LUGA 2D4AA 2ES4A 4GU5A 5EPOA 1KYXA 3N0RA 5FL7D 2Q4BA 1NDHA 5AM1A 3VYVA 2G6BA 3CH4B 1Z17A 1H2FA 4Q18A 5DHPA 3SQOA 3W8DA 1J2UA 2Q7OE 1A50B 1CP2A 1VHJA 1AA9A 2JD0A 4OAOA 4TS1A 4XRRA 2YNMA 4ROSA 4OIFA 4JBYA 2XBLA 5EXTA 5J4LA 5AVZA 3N53A 4JROA 4Z9BA 5HX7A 1PL8A 1AXRA 1V8ZA 2IOFA 1FP6A 2PIAA 1GTRA 1J1UA 2GTIA 2H9YA 3BFJA 3BXEA 3PB3A 3H75A 4NDAA 5A7FA 4OHKA 1GUYA 5EUQB 2HWKA 5AK0A 3ZV3A 5B58C 3KSMA 4COKA 2I22A 1ATZA 4AY5A 1STOA 3EIUA 6YASA 3UJ7A 3AKDA 5F1KA 2XIQA 2VHEA 3UWMA 3FCXA 4YAEA 3L8CA 3ADOA 1PIWA 2FMKA 4L4RA 4WECA 1UBLS 2VHYA 1ZI8A 1QRRA 2PAAA 2C92A 1W46A 1BOFA 1S4QA 1U11A 2OG1A 3CX3A 3GWZA 4LJ5A 4QAQA 3IE2A 3QVOA 3ZHYA 3PUHA 4DSOA 1TFUA 4AKEA 3D2AA 2PXCA 4UU1A 1XA4A 4HNRA 3P7MA 2D54A 3BB3A 5I9SA 1M7BA 1VMAA 2VT3A 2OLJA 2I54A 1PK8A 3ZWVA 4DHEA 4WZ6A 2YFQA 1GL3A 1F6WA 3HFRA 3ZHBA 4MCIA 3KKPA 3G8DA 5G4LA 5SICE 2P9EA 4TRNA 4D2IA 2YNMD 1WY7A 2POQX 2QTLA 1TU4A 1EQ2A 3HZOA 3LP6A 5JDCC 1PBNA 1XMPA 2VP0A 2BMDA 2XQVA 4MUJA 3EJ6A 3I32A 2XNKA 3L4BC 2GAFA 2Q3MA 3TGPA 1U8FO 1RRVA 4XQGA 3DE2X 4D96A 2Q99A 5KX5B 4MGIR 1UK9A 3SIRA 3KZOA 4ETNA 3I73A 1D2CA 2XGMA 3GC6A 4KH0A 1M1NA 5IDWA 1JIXA 1DQNA 3K5PA 4EX7A 3KVVA 2HV9A 3Q8XB 3WHLA 1K68A 4B47A 4LS3A 5HM6A 1J8QA 4CCYB 5JEEA 1XTKA 2WJYA 3EGEA 2FPMA 3B7WA 3L43A 2Z04A 1LY1A 2O2DA 3P0HA 2UVPA 3KWMA 1BCRA 4E15A 3B6JA 3GRAA 5GMOA 3DTYA 4ADSG 1NRXA 1XYGA 3SE0A 1G6OA 2O05A 2GHIA 5AXBA 2OD9A 3P9KA 2UUAB 4GZMA 2RJOA 4K9NA 4RVOA 1KO1A 3ECSA 1R15A 3CO0S 1S6YA 2GKGA 1SZDA 3IMFA 2H51A 2JJQA 1V71A 5DN6A 1TA9A 3CLRD 5G3YA 5EHGA 2ISQA 3VPFA 1FZTA 1OMOA 2ZTLA 4KMSA 3A1VA 4GC9A 4D6PA 2ZBRA 3ABSB 3DWEX 4GLJA 1KP9A 4ZI5A 3DCJA 1MAUA 1Q44A 1RWBA 1OLXB 4QEKA 4N6OA 4BQQA 5MN6A 4C43A 1Z2DA 4FC6A 3VH2A 3UAVA 3DC7A 4BBJA 1U6KA 3FPKA 3OLQA 4MDFA 2JAPA 3AGPA 3F6YA 4G8DA 4BEVA 2ZI5A 1EP3B 4KXXA 4PVCA 2RHJA 1GKUB 5IWCA 2C8KA 2H1RA 5FOTA 2Q5LA 4GRAA 3RU3A 2BLNA 3HPQA 1C9MA 2H52A 1UAYA 4XM1A 4ZTBA 2JI6A 4GSYA 3D3EA 2C4HA 1QVRA 1QB8A 4FZJA 1BAPA 2IEDA 4BKQA 1CY2A 1Z22A 1TUBA 1XP8A 1C7JA 5BSGA 3E5MA 1E2LA 2X19A 2LIVA 1W5EA 4WCFA 2ZR7A 3W4KA 4X90A 5FUVA 3IXLA 4PIPA 2R7NA 3BAZA 4HDKB 2C8VA 2DY0A 3B82A 4X1YA 4XWGA 3ZEAA 4Z3DA 4QQ8A 4ES6A 4ETMA 4IVRA 2JASA 4IS2A 3ROXA 3KOZA 5DN6D 5GV7A 5C34B 2E4WA 1RPZA 2GKOA 1ZD1A 2N1BA 4HH1A 4EITA 4AY2A 1M8FA 3W5DA 1OX5A 4Y6LA 3CVXA 2NO1A 1FXWF 1GA1A 5JAOA 5T6MA 3HVKA 3OHSX 1I2AA 2C5FA 2CBGA 3M4XA 1ODTC 2VXYA 1QYIA 1JEEA 3PTAA 1E3EA 4BO6A 3AHIA 3N2YA 4K0RA 3USES 1QO0A 3L92A 3IALA 1KQPA 4D3YA 4LF6B 5I51A 2RHBA 4WNAA 5CR9A 5K8VA 5HKKA 4GLFA 2DM6A 4U2GA 2C54A 3SGLA 4OHXA 5ETJA 4YQYA 3TLBA 1A97A 4QULA 3WBJA 4ALKA 2DUUA 2Q3HA 4D43A 4UTOA 1KC3A 1JW9B 3LUJA 4L5AA 1DG1G 3T3EA 4FFSA 1RXEA 5JD5A 3K6SB 1C0IA 1KY3A 5F2EA 5JXIA 4BNYA 1V3TA 1VI6A 1BS9A 2EX4A 2ZULA 4LDJA 4MYRA 4R3UC 1I33A 4MKGA 2ONZA 2YVAA 2PRSA 1SBNE 3PEWA 1Q3HA 2VSXA 4H4CA 3ESRA 1Z5UA 3UJBA 3VJLA 3W5CA 4FCVA 3UJ3X 2B8JA 2HSGA 3WBBA 5CD9A 4WNIA 4FNGA 3TBFA 2VQEB 1RM3A 4YJGB 2BCEA 2VOEA 1E92A 1NW5A 4YVFA 4IIXA 4HJXA 4W5OA 4KQ2A 4P2BA 1TD9A 1QJCA 3WZLA 4CE6A 4G26A 1ANKA 1MZPA 3TD9A 2Q0SA 4MUMA 3D4BA 4LJYA 2EBWA 3A04A 2VK1A 4CMKA 2D6FA 4UHDA 3HDHA 4XDYA 5M3BA 4XYLA 2VTBA 4WK2B 1B6SA 1KBQA 3H2YA 4U7FA 3EXEA 1QO0D 2YVQA 4NG4A 4Y6QA 2ORWA 3GT3A 3TR6A 1PVOA 1RJWA 1NI5A 3P9RA 4TZKA 4WLEA 5A0TA 4E31A 3PHIA 5HKKD 4U9HS 3JW8A 3FYSA 4P6VF 1II9A 3PL1A 5E7IA 2IZ7A 3K1TA 4ZVPA 3W5UA 1T91A 1CPYA 5L53A 3PR1A 1UMBA 2FX5A 3WBKA 3GIDA 3QMWA 2WYHA 4PZDA 1CDDA 1FQOA 1SG6A 1A5SB 1I2CA 2G1AA 4WADA 3BSFA 4MUKA 1HPLA 2IC5A 1EFVB 1EHCA 1Y1RA 2NU6B 4Y6RA 4EB6A 2FOIA 3C2QA 1X1TA 2IFTA 3H4MA 2NQ2C 1PJBA 2C2XA 1VCNA 3R5KA 1WXWA 4LZPA 4DN6A 3WIBA 1QQ5A 1EXMA 4B80A 4FR5A 4M1EA 5ALEA 4PFSA 2G1UA 1N7HA 2HRBA 4MWGA 3M3PA 2Q4DA 4IHQA 3NJ8A 1JSRA 2IXGA 3SXUA 5CFLA 4IQ8A 1MW9X 1F12A 3D7NA 4P3PA 2OHFA 4M8LA 1FVXA 4OI2A 3D6VA 4YRTA 4RX1A 2WV9A 1N1GA 1EI9A 2W6QA 3MWYW 3ZZNA 3U3XA 1BGVA 1C3LA 1O4VA 2IHYA 3DZ8A 3H3JA 4QJ5A 1MEEA 2TMKA 5DYYA 5C8YA 2J9FA 2ZIGA 3C6ZA 3TNYA 4RFSA 2PNFA 2YW2A 3C48A 1IZ7A 4YAIA 3Q5EA 3ID6C 1GFZA 4MUIA 4OOEA 1ZOIA 1AS2A 4RTLA 1QU2A 2RD2A 5JMWA 1A71A 1RWOA 1XRRA 3I5AA 4L0CA 4LNAA 4Z5XA 3E7XA 5DXJA 1I6WA 2Z2YA 4F06A 3GP3A 2G72A 2ZWOA 2H2FA 4PG4A 1GRCA 1TVEA 1W73A 2I1LA 4RC9A 4Z1OA 3TZLA 1BQ4A 3K0KA 2B25A 4BVLA 1KVRA 3GRUA 3BWCA 4CT0A 1PF7E 2Z1MA 5EMJA 1MOZA 2Z3WA 4PG5A 2Q4EA 4INJA 5BW6B 1Y5IA 5B1YA 1T5SA 3S7TA 3M2PA 3RT9A 4KSYA 4I8IA 4Q34A 4CL3A 3A32A 4RHYA 3ZBQA 2ZT7A 4O5AA 2ODAA 2WY2D 2XA9A 3OIUA 1RYZA 1GT6A 4QM7A 1EUZA 2JEYA 4HZIA 1TGVA 2OHXA 3A4MA 1RRKA 4Q39A 1UPAA 3DAOA 3U26A 16PKA 3I12A 1EVEA 3MCZA 4UUBA 2QOEA 4Z9AA 3EZGA 2I2AA 1M66A 3K05A 4A8TA 3KYCB 3QEMA 4AJ2A 1V11B 5ALVA 1IIRA 2L18A 1U0FA 4K9KA 2W2KA 4TZ6A 2GLTA 2GNPA 1JG6A 4MH0R 3ZZTA 2V7WA 2PUGA 4ZGGA 3M1IA 4FZRA 4EGJA 4M9XA 3U3JA 1AF7A 2KB0A 3QBEA 1LCIA 8OHMA 1TXGA 4HNUA 4WKNA 1JYSA 5DYGA 1H2EA 3QUSA 3DNMA 1PNOA 1ZPDA 2Z2IA 3F7MA 1QYWA 1K08A 4QQFA 3HBAA 1NIJA 4M9SA 4RHTA 1U94A 2C98A 3PL5A 4CKBA 2WU4A 4P98A 1A9XA 1U8ZA 5ANRB 3OX1A 3SMVA 2M2IA 4MA4A 1PR0A 3QENA 1SQFA 4UOEA 1RZRD 3GH1A 3ON5A 1X42A 4X1KA 3DEFA 4BZQA 2Z2XA 3CTMA 3WGKA 2O2EA 4F45A 1QMGA 1ZUHA 2A9FA 4FYKA 4ZMSA 3EA5A 2ZIEA 4RELA 3RK1A 1SZCA 3HV2A 4GSLA 3RIGA 3S2YA 5LOVF 1F8XA 1M8GA 3OWOA 1XDWA 4D98A 1NP3A 2BDUA 3G5TA 4M8IA 5DGCA 1FFAA 4MV9A 2R3SA 1GUFA 2I2DA 2I8CA 2WJIA 3N0WA 3O1JC 4KK3A 4CKYA 3X2SA 1ZJ4A 1UT5A 3KKMA 1ZOPA 2ZT6A 2HWWA 2J0VA 4ND2A 2COKA 4HTFA 1OVGA 2GUGA 1QDLB 3WQSB 3S70A 2OM6A 2IU6A 5CJ2A 4C89A 3VHXA 1I94B 3PX7A 4HD8A 3ECCA 3ILHA 1TIKA 4H77A 2HCFA 1J9EA 2X7HA 3G2OA 3PDCA 4HVTA 3RHZA 3SHQA 5KTNA 3PTLA 4Q7QA 2WT4A 3S68A 3E61A 4OOFA 2P1DA 4W4TA 4WX2B 1QS0A 2V3WA 2VRNA 3I52A 1N4AA 4FOSA 4BTVA 4ZJPA 1NHWA 1ISGA 1L4NA 2FR8A 1DOHA 4JBXA 2UZAA 5J1SB 2B98A 4GOLD 1IPHA 2ZYDA 3FCSB 4F56A 2J41A 3NUQA 1IPFA 4G81A 1XKTA 4O3FA 3ETLA 4BKMA 2AEJA 3O4RA 2M32A 1I7NA 1L5LA 1BEEA 1LI5A 2WNHA 5KNBH 2HJRA 2VNSA 3PKZA 3D3KA 4XSVA 4PZEA 3DZKA 5CFZA 2UZ0A 1J24A 1JXOA 2J7KA 4UVIA 3V9AA 3BZWA 5IG2A 1MABA 2O0HA 4KE7A 1P74A 1CFZA 1W4AA 1JLLA 5CAEB 3IRUA 4YY3B 3KOUA 1DS6A 3P52A 4TMFA 2HB6A 1XZKA 2X3FA 4UHKA 4M9CA 1XZCA 1S3GA 2MINA 3W90A 4NH4A 4ENTA 2J31A 3IEUA 1VFPA 3LFTA 2WE8A 4HXYA 3A6PC 4AAYA 4E46A 4CEJB 4IGAA 4MIOA 4DFDA 1CP3A 4IINA 4F9FA 3VOAA 5COBA 3G59A 3T15A 1JTVA 1G8PA 1Y42X 3VI3B 5CM2Z 4YAKA 3AYXB 4JT9A 4LJAA 1HZZC 3K92A 3K70B 4KR7A 3CNEA 2B61A 1NXWA 3FFAA 2QRUA 3AZPA 3EXFB 4G2TA 4JJAA 3EZ7A 3UMCA 1W581 1KVTA 1UZNA 1KEKA 1H3FA 4OK5A 2VHCA 8GPBA 3MLBA 3S2ZA 1M5TA 3B1XA 2GK6A 3C3PA 2FSGA 1USGA 1L0BA 1OVMA 1PDWA 3HA5A 3FWPA 2XUZA 4IDAA 3QEAZ 1WUHS 3UA4A 1OGJA 3PHLA 5GPBA 4MR7B 2Q0XA 3QZUA 3WDMA 4M88A 3VYSB 4EY7A 3BULA 1E5DA 1MIOB 1M67A 3KL2A 2C4WA 4MUNA 4GPEA 2JKZA 1ZGBA 3SS7X 1WQ4A 2NNLD 3Q3EA 3DZBA 1Q0TA 3I92A 3D54D 2HJHA 5ALRA 2JLZA 2NQ8A 3AW9A 4Z7QB 2YWFA 1JG7A 1O5OA 1NBOA 1PV4A 3KKZA 1O96B 3DOJA 4BLRA 1M2HA 1A5AB 2GCPA 2BTEA 1P0FA 1ZITA 3HJCA 4E1AA 1HDYA 3BJMA 1XL1A 2GN6A 3FROA 1XCMA 4N3CA 4GI7A 3GRYA 1L1QA 3KTAA 3ITDA 3R1IA 2P5SA 1S89A 4U2EA 2XEXA 4UTZA 1RP1A 2VG8A 1TO2E 5CA0B 4LHSA 1C7FA 1O3YA 1BE8A 3BF7A 4ZAZA 3SJBA 4A8HA 4NEHB 1XLTC 1GTL1 1E2NA 1JZTA 4LE0A 5T64A 3TRJA 1E1QD 1HDGO 2AMLA 4JH0A 3UQYS 5KSYA 3ENWA 3KTOA 2XTZA 4TN5A 2KM1A 3WNBA 3SI7A 3CF6R 5BP7A 4HAZA 1IOZA 1THTA 4IDNA 4P7KA 5BVGA 4EVIA 5ENZA 3I5YA 2YX1A 4XPIA 4Y2JA 5KBYA 4Z0HO 3CR3C 2GX6A 1XHEA 2EQ5A 3UK0A 5F1OA 2ZUTA 1L9XA 3MLEA 4AIRA 3DFFA 1I4DD 3OTWA 2F9FA 1I3CA 3IHTA 4MDHA 5EN4A 1QGOA 2XF2A 3P2OA 4WGGA 3ZBTA 3FZQA 4X6XA 3EGXA 3D3WA 4O3MA 1WCIB 1L5WA 4REMA 4JI6B 2X5JO 3DAHA 4QSHA 1ONBA 5AVYA 1E9RA 3M0EA 3IO5A 5K8TA 3QX7A 4V0KA 1ZR4A 1DPFA 1ZKMA 2D2VA 3A05A 1JIIA 2Q2OA 3N74A 4LYJA 3GBVA 1PQPA 2VJMA 5B6JA 5EHZA 4H7FA 1QF9A 5DWQA 3H5LA 1YOBA 3AXSA 3HKEB 3MINA 4FOOA 4UFPA 1GN9A 3K1JA 3N9IA 3UKOA 1PJCA 2XYPA 3L4EA 3R44A 1BKDR 4Y98A 3S2GA 4AC9A 2YR0A 4AK9A 3QWFA 1MZVA 4Q6BA 2IWHA 3IT1A 1XCPA 3ORFA 2JJ8A 3AHJA 4E21A 3G5UA 2C1EA 5AHWA 3G7NA 4BNNA 3MHPA 3I6YA 4EA9A 3GH3A 1YSCA 2DPXA 3LXXA 1N8KA 1OFHA 3ELWA 4LRXA 4MB6A 3KFVA 1DHRA 1GEEA 5LWHA 3EAGA 3D8NA 2ZVDA 2XRZA 3PK0A 4J2TA 1GKYA 4PCUA 1DDOA 5EKDA 1ZU4A 1IWOA 4KQGA 4IUDS 3JQBA 3DFZA 3ZV6A 2GERA 1ITZA 3U1BA 4LQ4A 5DP2A 1JKXA 4D8YA 4HZGA 5LP6B 5LPNA 2GZAA 3RS5A 2OGTA 4ZI7A 5JJCA 1P7ZA 4BO5A 1KEVA 3IAXA 4LRSB 4R1MA 2HREA 3WRXC 4KN5A 1LBHA 2QTAA 4Y2UA 3VDXA 4BFZA 2CJXA 1FRVA 3TG2A 1AM4D 2B4YA 3MBKA 3T3PB 1WU8A 2JJMA 2BUBA 3A58B 2H4FA 4EHKA 3QPDA 1CUDA 2I6XA 1NVBA 2X6RA 4EY3A 2PX6A 2ST1A 3ZCVA 4CMGA 1ZH2A 3LQYA 4ZO7A 1LFDB 1AHIA 4PXAA 1TNDA 1VLLA 3QHPA 4FHGA 2GBCA 4P32A 1GYQA 2H1IA 3VU8A 2OENG 4RK0A 5F9MA 4TKVA 2RGRA 2DFTA 2HSJA 4BQOA 3L6OO 4EMTA 1ZD9A 1M0SA 3K4HA 3HG7A 4QYIA 4ZV7A 5I48A 3TF5A 1QVWA 3M1AA 4OSPA 5CM9C 4CRWB 2VZ8A 3PHCA 1NW9B 5TJ9A 3TSYA 4ZIRB 4RL4A 3U7FB 1L5OA 2C04A 2YY6A 1TMGE 2Q45A 1GGFA 3L02A 1WMFA 4V38A 1BVYF 1F2TB 1GG9A 2L17A 3D0KA 3FPFA 1RIIA 4LQLA 4FM9A 2ZIWB 2HRRA 4J29A 2H2IA 5CW1A 3TIFA 2OC4A 2WVGA 3OZTA 5C35A 1GLGA 4O6VA 2J7PD 1GOTA 2C7QA 2D00A 1R5NA 2PWBA 2PPLA 3EGVA 1ZC3A 1YMUA 3A3KA 4Y7DA 3I62A 3KWFA 2CLFB 1YAJA 2V6BA 2WKSA 1USWA 5ER6A 1QP7A 4Q3KA 2DQYA 4NBRA 4PO8A 4R9SA 2I3DA 2RI1A 3B3GA 3AF2A 3GA0A 4KUEA 3UAYA 4EJSA 2C5GA 1T26A 1DLIA 4H7PA 4JJ8A 2IODA 1KDOA 2I4IA 3DXZA 3L7JA 5HYVA 5JSFA 2VP9A 1R4MA 4O4LF 1OH5A 1I2BA 2WDZA 3WMWA 1EGVB 1K7EB 2FPPB 2GCOA 3IJPA 1A5TA 5I5GA 1ZVVA 1ZL2A 4AXBA 1X74A 1KMMA 3BSWA 1OH7A 2WILA 4QNMA 3WK4A 3NHJA 1Q0LA 1V9LA 2GN8A 3KTDA 3KQHA 3D0RA 4CIVA 1R6AA 1MPXA 4S1PA 1XJCA 1HX7A 3RLIA 1EDDA 2A5JA 1X1SA 2QRVB 4UBNA 5HBGA 4E07A 2ERXA 3C0KA 2MHCA 3GT4A 3OX4A 4I4TF 1MOSA 5M7EA 1A9OA 1FDUA 3DR5A 4FSHA 1UWLA 3N87A 4ZC1A 4CCAA 3IE1A 1EESA 3RGWS 3ELBA 4QOSA 5E7QA 1XVAA 5EKXA 2W2NA 3T3OA 1KBZA 4A1OA 2Y1DA 1V3QE 1OF1A 1ZUNA 4EI7A 3DFKA 1AHHA 4YJHB 3HXPA 3OZ7A 3H9CA 3R41A 4GYWA 2HIAA 1PX2A 4A26A 4BO7A 3OEYA 4JHLA 1JLRA 2RMKA 4B83A 1DWOA 1XGKA 1CRPA 4ERXA 3OZWA 2QUKA 5BQPA 4TYPA 1SD1A 1PJ4A 1T9HA 3OSZA 1KO7A 4WBXC 1IZYA 1B0AA 1OPXA 3AUFA 4G9EA 4X85A 4JT2A 5JASA 1ZGGA 3LPMA 1DVRA 2IBTA 2PQMA 2X1HA 1B2LA 3WIOA 3EC2A 2CXQA 1CHNA 3PNQA 1VE5A 1ZA1A 2QJWA 2VWHA 3FUTA 2HWXA 2YINC 4IPTA 1TQDA 3NBMA 3R4VA 2R96A 4II3A 4HVCA 2C2KA 2Q5QA 2EARA 1JXMA 4GZ5A 5L4LA 4B2YA 1DTWB 1IEVA 1GUAA 3KKLA 3KHKA 3UMGA 4DSNA 3IP1A 4RGQA 3RAPR 3RK0A 2PYIA 3OBBA 4R2JA 3BXFA 3PD0A 4BJ6A 2QN3A 4YWHA 4BFCA 4D6YA 3HYCA 1PWZA 3RKSA 4BV3A 1SU8A 1XXHB 1R0WA 1T5TA 2OY0A 3WLMA 1HLFA 1VE3A 2CN1A 3A1UA 1YD7A 1CUGA 4U7PB 3S3TA 3USZA 3QU9A 3CIFA 2AXQA 4ND4A 5L8VA 3TECE 1SCQA 3FGOA 4ZAYA 1OLXA 1RHJA 2BZ0A 1JQDA 2BFDA 2W93A 1M76A 4BJ1A 4D3XA 4NEGA 3VVMA 1R0SA 4ENRA 3AR9A 3RASA 5FPQA 4TRMA 3KAPA 1C0PA 3GYBA 2C3UA 2X1LA 5A5EA 3TO5A 1JR6A 1X70A 1XEWX 5EA2A 1SD2A 1U0RA 1XD9A 3A6EA 4X8MA 3EIOA 3A3PA 3RJ5A 3VPBA 3WICA 1RIFA 1SC4A 1CDEA 1N1EA 3IP6A 4MQ4A 4Q24A 4F2HA 2XMRA 3Q5DA 4NCNA 5KWEA 1QG4A 3ZGNA 1LNZA 1DQZA 4M0LA 1V8OA 4FGUA 5EJ5A 5ED4A 1BNCA 1CQJA 5FO1A 3K16A 2RGGA 4PG7A 4Y0NA 4ZMRA 2N75A 2OVBA 2XKJE 4S2UA 5AKZA 3UWPA 3MMNA 1ZRMA 4PZAA 3D3QA 3V4ZA 2LD4A 1COWA 1V5FA 1DXOA 2BZGA 3FMFA 3KJNA 1R6BX 4LOIA 4R16A 4B8YA 2IYLD 2AI2A 4IUYA 4JLVA 1AC5A 3A1WA 3S8YA 1O4WA 1LC3A 1C8BA 5LQCA 3DXYA 3KKNA 3P0IA 1BDBA 2FZGA 2XMDA 4Y18A 4DT1A 4E2ZA 2ZRBA 2R84A 4RULA 2GD1O 2V9PA 3BX1A 3ROMA 1X7ZA 3DBLB 5FPKA 2Q6VA 2QVXX 5DGTA 1PUIA 1YZGA 1O89A 5ES4B 1H69A 1T9AA 2G36A 3E22A 3JQDA 4YQZA 5I9NA 4FSDA 3LF2A 2GZSA 3NNSA 1K8QA 1AXGA 1KERA 4UBOA 2X2EA 4WESA 2IPXA 1VIAA 3ENQA 1QPGA 4YAJA 4A0RA 3ABOB 2C4UA 2WHPB 3KOXA 3TTSA 3ZLBA 1I7QB 4DV7B 1LDBA 2REBA 3VJRA 2C1ZA 4RIIA 1NF3A 2Z95A 5DDIP 4CYMA 4DCNA 4EG8A 1NYLA 3DOFA 2V4UA 3AMVA 2ZBUA 1REQB 4YT2A 1FS5A 1PR2A 1BGWA 1MHTA 2OHVA 1COWD 1X39A 2ORYA 4IOJA 3JQ9C 3DTVB 4G1FA 4MWBA 2VP5A 4O4IF 5JVDA 2R85A 4RVHA 3U7QA 5C7YA 5KYKA 1IXZA 3CC8A 1LD3A 1WL8A 3P9IA 1C30B 1E9CA 3NNNA 1CJSA 4PNHA 4CQLA 1F8FA 4G9GA 1M5RA 1F3OA 3U31A 2Q8QA 2QQEA 4E88A 4Q66C 4HWKA 3RJMA 1U4OA 3E1KA 4O63O 3BWVA 3ENZA 1NR1A 1RI4A 2BBWA 2WP8J 3RIYA 1GHTA 1Z15A 4R8KA 3BD9A 3O90A 2A5FA 5DH9A 421PA 2C2MA 2VJDA 3DUWA 4KYUA 4KV9A 1T2UA 4LWPA 3SQNA 5A4JA 4L74A 5EXPA 4C2BA 3L40A 1MDBA 3N2EA 5KSPA 5ALGA 5C52B 2O8VA 5DGHA 4Z1MA 1CY8A 1UF9A 2HF7A 1K63A 2WFLA 4QA9A 2ZVJA 4WL0A 1AU9A 1Z07A 2M6LA 3ZGZA 1PR1A 3DPUA 3IKJA 3RTEA 3IR7A 1CXZA 1VSUA 1Z6TA 3PZRA 2B1IA 1UBMS 3JR3A 4IGIA 4JLMA 4Q4LA 5BV1A 4XW2A 4AQ7A 5CUQA 2Q5OA 1KI3A 1KI6A 4EF5A 1C1YA 2BZSA 5JFOA 1CFJA 2JI7A 2QN1A 4ZT2A 5C3UA 3N0XA 2JG3A 1GGHA 2UYGA 4OSOA 5AJTA 2CNNA 4C4YA 1L7BA 1LNQA 2ZSHA 2VZ9A 3F2IA 4CTOA 2Y6UA 2WLTA 3OLYA 3GVCA 2ZZMA 1NT2A 4MJLA 1PQYA 1T25A 3PD1A 3K1ZA 1UPCA 4ZI2A 5B37A 3BC1A 4S1VA 2X4DA 1ZOSA 1EP2B 2QPOA 4H1UA 1VA5A 4DWJA 1PR6A 4P82A 5E3IA 4GOOD 4UBMA 3GAAA 3KYDB 3HYNA 5E6UA 4MS1A 4W5WA 5MFPA 1Z83A 2C2GA 5CFNA 4G25A 3EK2A 2AW5A 4AZWA 3DXXA 4HDAA 3U3DA 2PT7A 3I2IA 2YJ4A 1BX1A 3BT7A 1YNOA 3GQVA 4EGAA 3BUSA 4B35A 4Z1MD 1BX0A 3SLKA 2WUDA 1BS1A 1RC1A 2ZIZA 3DDUA 4LY6A 3A2MA 4BXOB 1FNDA 3BH0A 2VZ0A 3MT0A 2ZYTX 3GF4A 3JWJA 1K0UA 2FKAA 3EEQA 4M3NA 4N7BA 3ANTA 1C3EA 4TMKA 3WGQA 1Y5MA 4YMHA 3ODPA 2J4FA 1DKRA 4X63A 5AVRA 1N6NA 4JXXA 2H1OA 3LOUA 2NOAA 1ZD5A 2R2GA 3RSQA 4R40A 4IFBA 5FTMA 1ACLA 5HEKA 3OQHA 5HTKA 4DPLA 2QUAA 3R8CA 5FTWA 3P2IA 4KFCA 4TLMB 3RVSA 3IVXA 1I3NA 1US8A 1RM0A 2ZE7A 4MHSA 5A4AA 1HUQA 1NAIA 1UDWA 3HNRA 4TWBA 2ZWVA 3ZHZA 1QOZA 3AFHA 3UYKA 4DLKA 4WOJA 4B33A 5JT1A 1YR3A 4X7PA 3THXB 4C3OB 3HI6A 4NQRA 3WTCA 5E0KB 3NHRA 4WLNA 3SJUA 3OZEA 3LH5A 4RKFA 5GINE 4R2XA 3UIEA 5K3CA 4EYSA 4MKFA 5DTQA 2FWPA 1LWOA 2OPBA 4WT7A 2FWAA 4EFDA 2HZBA 1K3FA 3KYCA 2IU4A 2HU2A 1V11A 3CLSD 5CX1B 2XOEA 3C8UA 5C1OA 1Y8AA 3PD7A 4ZDWA 4NAUA 4PNZA 2C03A 2XCQA 4DW8A 2I65A 1NOKA 1LB1B 3QOWA 4KO4S 1G5IA 5FUYA 3EE6A 5I4BA 4I55F 4YJ2A 1Z6PA 3PUZA 3LA8A 4JVMA 2HHJA 2QTWB 5AKYA 1L7PA 4NAVA 5HQJA 1Z2PX 3N8NA 1GKIA 2ILVA 1FP4B 4G5QA 1WBBA 3OX3A 3J81k 3AVPA 2VPWA 1L8AA 3L7DA 4WN9A 3QOXA 4JBGA 2RH5A 2JFNA 4YASA 1PZHA 5SYAA 4DIMA 2QG6A 4MYUA 2I9PA 3HKCB 5A1TA 2D74A 2CWDA 3ZJTA 4HQRA 1NDQA 4GKKB 3QWAA 1PV1A 1IEWA 2WIFA 5AUPB 3MS2A 1CUXA 3B8EA 3WK6A 5GZ1A 1ECGA 3ISJA 5FI3A 1JI0A 3H04A 1IJBA 4F2DA 3ABIA 4X60A 1IN4A 2HY7A 4CJXA 4ACBA 5IK2D 3GQBB 3MHTA 2QUIA 5IC6A 1KE2A 3X2FA 1C4OA 2PXXA 4DPKA 3MD9A 4F5ZA 5ABPA 2CDBA 4FCWA 1PEYA 1E2MA 1P80A 2H1VA 2Q46A 1JQJC 3M6AA 5F35A 3GEMA 2YBDA 3AR5A 1IBCA 3UJ6A 5EPEA 3RROA 5EP3A 5FH9A 4UAUA 6GPBA 2ZSUA 1NPDA 3PITA 1OBOA 4N76A 2WIJA 1RAIA 4BV9A 4MVWA 4S1WA 3QSGA 3UFBA 4CU5A 2BCJQ 9GPBA 1I4TD 3H9UA 3NRCA 4KE6A 1JPJA 4XYEA 3TZKA 4IJUA 3IVMA 3K1YA 1DXHA 1OYOA 2EP8A 3HCBA 1EZZA 1Z4KA 3IBTA 2OGZA 4ER7A 2J3QA 3OFVA 4RF5A 5KNDA 1WB5A 8ADHA 2ZVQX 3F96A 2PVCA 3L6BA 3T7KA 3UHFA 4BBZA 4BE7B 2ZUFA 5LIPA 2IS6A 3W3AA 5IMSA 2B7CA 5B4UA 1EX6A 3NT2A 2VCHA 2VRBA 3G68A 4Q4AA 2OFXA 1E7YA 3PWZA 4WRRA 1ZJYA 2ZYUX 1WPGA 1G3RA 1GNTA 4C21A 3W7VA 2C2OA 3JYPA 3WLPA 4DA6A 3OIYA 4TV8A 3IDAA 3DAYA 3OM8A 1OREA 4KO1S 3W6NA 3F6CA 3E81A 5T8KC 2VQ6A 4Z4CA 4AKHA 3LUFA 3GGJA 4K86A 1R12A 5H3LA 3LHFA 1KDYA 4D8VA 3WAKA 3LM8A 2F55A 2BFWA 4YUZA 3DVAB 1RQPA 2YMLA 1RBZA 1CJTC 4EGQA 3HJGA 1M2VA 1X3LA 3GFSA 3I01A 3TLJA 3FETA 3W3ZB 3SU8A 3NFRA 1WU7A 1E3IA 1BXZA 3I6MA 2E1PA 1K5HA 3NYQA 2B35A 1G4HA 5L7WA 3GNSA 4ZZ3A 1O77A 3HL0A 2FSVC 5CLJA 1RI2A 3DYVA 2ZXFA 1R64A 3L07A 4OBXA 3SYNA 2EZ8A 3B78A 5KNDD 4KREA 5D5HA 5FOXA 1KI7A 4ZO6A 1DAFA 4JJFA 1NC1A 3W3AD 1EFPB 1K2VN 5KSZA 5IAEA 1GTVA 2I0FA 4N0MA 3IODA 4C87A 5ARDA 3UJDA 2ESRA 5J4YA 5JSHA 4OGKA 1H1TA 1W5SA 3F0TA 1H8EA 4X1IB 2EU8A 1YVEI 4E5MA 3T7EA 1R6DA 4MPDA 2HBYA 4JBNA 4MVXA 2OP1A 4FBMA 4DG8A 5JISA 1V8PA 2PT9A 3F2VA 2WYVA 4RVUA 3AB3A 3KB1A 4L5YA 4ETWA 3EXIB 3L04A 2Y4NA 2L69A 3AXTA 4MR7A 3SY8A 1VGQA 1JBEA 1LJLA 1FU7A 3NIBA 4KN6A 4HAIA 4KMRA 5BW4A 4JLPA 3HU2A 2FFAA 2QTFA 1H1LB 1OYVA 1NQWA 2AF4C 2DCMA 2O5RA 2PWPA 3UKJA 4FW9A 1DRVA 5CDHA 1TIPA 2VLIA 3BOSA 9ATCA 1H6BA 2JAXA 2XGOA 3G0OA 2Z98A 3JASB 4MP8A 3L4KA 3L05A 1Q1ZA 1D6JA 1FJHA 1Z3CA 3URMA 1R0KA 3MMZA 4B81A 3F5DA 1FEZA 1RBYA 1CLEA 2Z2JA 1P3JA 2PRJA 1XRQA 1VZ2A 1U7HA 2BEWA 2OV6A 3G0BA 3WLJA 1YZQA 4H9GA 3V8PA 4D25A 4AP6A 3MAGA 3M1LA 1NX9A 2PZ8A 4V2UA 2JI4A 3QF4B 5K0ZA 3U4HA 5CA0A 1WDLA 1L4EA 1YBFA 2H7VA 3COYA 1YASA 2J6IA 3C98A 4QU8A 1H8ED 1QMPA 1VOTA 3BKWA 4F60A 5HZKA 1JBKA 2ZSDA 4PGMA 2QX8A 4M1OA 4UCFA 4DL9A 5TQ0B 2O3JA 1N8SA 3OCUA 4DV5B 2J3DA 3V8RA 3G2QA 5J9FA 4MIEA 1BO6A 1EDZA 1IDOA 1VIMA 2PSHA 1JFFB 4LFCB 2WD8A 1OH8A 1FDRA 1VYUA 4IJQA 4QHYA 2D1SA 5EG5A 4GWGA 1OI4A 1DKLA 3ZZMA 4JXJA 1INLA 1EINA 2ACWA 1RNLA 1R37A 2O3UA 2PKWA 3CW8X 2PL9A 3G79A 3E6AA 1PR4A 2RGWA 3KM0A 3PQ6A 4HDOB 1T1SA 3KWJA 1ODLA 1WZNA 4GEKA 4RDIA 4UAGA 1MA3A 2ZOSA 2UXCB 3E03A 1R0ZA 2XUHA 4G1UC 4PX2A 1AK9A 2Y0CA 3K5WA 3VPCA 1ZK0A 5IAJA 1J70A 1MH1A 2HLNA 1LBIA 3LQ2A 4JP5A 3X1ZA 5BV0A 2NUTB 1OAOA 1P2SA 5E2AA 5GONF 3OLXA 4JX9A 3HK2A 1RKBA 2JFZA 2DU8A 3PP8A 5K0BA 4GM1A 5JZVA 3J81A 5EJ4A 1PGNA 3ZJUA 1WSBA 1IH8A 1Z8HA 1NBME 2P6MA 3C5HA 2SHKA 1YU9A 5G0WA 2BUCA 3U17A 4ZANA 1NV9A 1XVVA 5LZ8A 2EKQA 1WZ2A 4PR3A 2YYZA 1NPYA 1PSDA 5IMBA 2ZBQA 3PVZA 4EGCB 4NZYA 2OXEA 1TJYA 2WM2A 3ER6A 3QY9A 3O2QB 1E3LA 4Y6SA 3TGLA 5HIAA 3QVLA 1DARA 1XCGB 2AOXA 5CJPA 3QVSA 4BFUA 4PO9A 2XODA 1W2GA 4X7RA 2IBMA 4YJ2F 2FHSA 2IH4A 4XTRA 4UQPA 1SBZA 4NF2A 1O2DA 2NT3A 3SOPA 4FIDA 4R31A 2IZOA 5HFAA 1U90A 4JBHA 1U0GA 3TIVA 4LHYA 2FHPA 3U4DA 5IVIA 2F9LA 3MMXA 3TTYA 3OH8A 1E63A 2LWIA 4DREA 1DXYA 5B36A 3AESB 4HNHA 2WTMA 3O94A 4M37A 4GR4A 2CNKA 4MQLA 2VVTA 4TLEA 2P4UA 3KETA 2XDAA 1VGRA 4RYLA 1ZJWA 1D04A 5A2GA 1V5WA 4XQ9A 1C3OB 4W7HA 2XKAA 2WTBA 3RTAA 4C7BA 4UZEA 4F84A 1KK2A 2OCKA 3KOYA 4ENVA 4F4HA 3OUTA 2Q1YA 3DCIA 3ZY4A 4EMBA 1MBZA 1LA2A 3SM3A 3DVQX 2QMUA 1GPKA 5KZMB 3DKKA 3TR0A 4F71A 3QX8A 4HGOA 2VK4A 3P9XA 2HXGA 5AK4A 2DFVA 4HBGA 2X8LA 4KBGA 4RTQA 1GL6A 3BFXA 4LSMA 1MMFB 4BNXA 1R8JA 4IMIB 4ZQEA 1SK9A 4UXJA 5DCYA 2Q49A 1KEZA 4C0HA 1DKMA 3RYFB 2FWRA 5JD6A 1ISFA 1BDMA 3KEMA 3CW2A 1KS2A 3KTFA 4FQ5A 1QTNA 4P4NA 3LP5A 2B8NA 5AI8A 5E8RA 1MLDA 2JFYA 1DZIA 3WL5A 3UT5B 4CIYA 1QFXA 1CC1S 4ND8B 1L5QA 2G9VA 4DNQA 1F9EA 4EKDA 3P0EA 4IJWA 5L7TA 1E6KA 1RSZA 3NR2A 1DC7A 1BN7A 1L4LA 1QC5A 1TMKA 4LWQA 5FKJA 3SZOA 3ZY6A 4NENB 5G0TA 4N0QA 1B0PA 2HIHA 1TM7E 4GIBA 1VL5A 2FPPA 3SLRA 4CG1A 4EECA 1BWRA 1QDEA 3MK31 1F2VA 1NLMA 4UUAA 2YWBA 1R27A 3P2EA 1SCBA 2DQSA 4UUQA 3ITKA 4PFQA 2B92A 1XJWA 2FH5B 4UM8B 5A6SB 3WGLA 2YRFA 1H85A 1RYHA 2XBUA 2AMFA 2TRSB 5FLKA 2IY7A 2FKNA 5K09A 3SR4A 4E5SA 4BNWA 4DR4B 2C96A 2Y1FA 1T24A 4KAXA 3PZBA 1YRHA 3FDIA 3LBYA 5IYZB 1G38A 1RQ7A 2G1PA 1YHYA 4QXAA 3VR6H 4EO7A 2BFEB 3G2KA 1DEAA 4ME6A 5A62A 3AFMA 2L42A 2WTNA 1U2DC 3PCXA 5IJ0B 1JEJA 4C2UA 1PDOA 3KR1A 1HYBA 1SUPA 2FPSA 2H5IA 5LB4A 5BY2A 5IBCA 1YRLA 1JG4A 2R8PA 1RXWA 2XA2A 1QWSA 2HWUA 1QIHA 1YUBA 2QRGA 2XOKD 3CEJA 4J9UE 4KVZA 4YJHA 5A5VA 2V7EA 1NBMA 4UMEA 5H9WA 1RADA 2Z4TA 4ND3A 1SD5A 2Q3JA 3WIUA 4YRKA 1MB0A 3E7WA 4EKEA 5LQNA 5KTOA 1I4OA 1OPRA 3DEAA 2NG1A 4U39A 4UULA 5GWXA 1AMNA 1SQGA 1XUOA 2QUBA 1LK7A 3IBSA 2QJRA 4R1UA 4UHBA 4CHTA 2ZWAA 4YUVA 1F7VA 1Z33A 3F46A 3GRVA 3UK7A 3QHAA 5TF0A 3LUPA 1ZIPA 4HWPA 4NEQA 2XDQA 4QUKA 5DI9A 1PTJC 5C8YF 3KQQA 4Z9YA 1MC4A 5MFZA 5F51A 1AZTA 2HA2A 5H70A 1BW9B 3KLBA 2OOSA 2ET6A 2V7QA 3AHDA 2K4MA 3O91A 4DEVA 4MW6A 3IMKA 2C9BA 2FA9A 4C4AA 1J5PA 3R3VA 4G89A 1EX9A 3IQFA 4DDMA 4JQSA 3PXBA 4PM4A 3C41J 1EK1A 3ISVA 1Z26A 1FFGA 2Y92A 2R25B 3GBSA 3K15A 3H42B 3U7IA 5KREA 2AEFA 2QR3A 2QLBA 4AJPA 2W90A 2JI8A 5CB4F 1Y9AA 4AMZA 4LQDA 4ZDIA 5FWXA 1R9JA 3ESQA 2ZJ6A 1NBMD 2BGJA 3TBHA 3A0RB 4KVFA 2E37A 1Q92A 1C8VB 1VJ5A 4MPRA 1NKVA 4YP6A 1YL5A 2PAFA 4BNTA 4IDBA 2PMDA 1T4CB 2PWYA 5F4ZA 1CUYA 4QLAA 1MEJA 1TQ8A 1MQSA 3GOHA 1T5OA 3C8MA 3E9DA 4FQ8A 3ZK9A 3RBAA 4UZSA 1HT2E 1ABFA 2IY8A 1SUAA 1F7UA 2NVOA 2XHEA 1P19A 4I1IA 1NXSA 2BD0A 4C4RA 2V7QD 2XUJA 3TSCA 2Q5IA 4FZ3A 5CDYA 4I9NA 1J5XA 3RUHA 1L7QA 4D79A 4S12A 3K30A 4TKUB 2Q07A 4G1CA 1LVUA 4YI3A 4ONEA 4KC0A 3VMFA 3T4UA 5KTKA 3GLFB 5FX2A 5JAUA 3RARA 2JGDB 4TTTS 4CFYA 3TM5A 4HGZA 2ZT8A 3NEPX 3TRFA 1M2OB 4V1CB 2NU8B 4LXHA 2XUGA 3BGVA 1SWWA 3I2GA 3OCXA 1EEXB 2O7RA 4BUCA 5DTJA 4BPBA 1DBRA 3HWRA 3AB7A 3E48A 1ZLYA 2AK2A 3H4IA 3QQPA 1P5JA 4OMCA 4Q4JB 2J3MA 2W6IA 3FR8A 1RKXA 3B52X 3LX6A 4Z7NB 2KQUA 2OFFA 1D2HA 1YO6A 1KJNA 3TTWA 5D87A 3NPMA 5BW5A 3DAPA 1YS2X 2C3MA 1XD2A 3H8JA 3LTNC 3L8FA 3D1LA 1XMXA 3U0VA 2ZW9A 4CL0A 5C1DA 1GPBA 1U28A 1GG2A 1TJNA 3M6MD 5EIXA 1Y3BE 4XUCA 1ZG3A 1RM4A 1ZM4A 3U7GA 3PQFA 4XR4A 3O3OB 1YACA 1VBFA 3IP8A 3U2QA 3RTGA 4EDHA 4FJ0A 5A4KA 5CVVA 1HT0A 1CUZA 2H4XA 4LYDA 4A8JB 2H00A 2P6OA 2HV8A 3EGDB 2ZUWA 2F4VB 1YZHA 4DLXA 2PGDA 1EDEA 1RHQA 2XUQA 1UL1X 3WMFA 4EPVA 2Y1OA 1N9KA 3BMCA 3DLCA 3GJ5A 2A1UB 1Y5NA 4HS9A 4NCJA 3THOA 4PPFA 2FW7A 4MI9A 3LT0A 3L6UA 1J7KA 3IT3A 3RTDA 2B2CA 1KJIA 1GXSB 1A88A 4IMRA 1KZYC 5HKOA 3T8YA 1TUGA 1USKA 2W6ID 4Q3BA 3ZU2A 4B6EA 3IUNA 5L45A 3WS7A 4WACA 2JGRA 3W1VA 1P1HA 1GWNA 3FSRA 1M6NA 1QH1A 2A9PA 3GJTA 3PUJA 3V2UA 1Y6QA 4JC0A 1O8BA 5LKRA 1GPJA 3CF4G 1L4YA 3GXBA 3NLLA 1HM5A 4MK4A 1P2TA 4TXJA 3SQMA 3TUIC 4PNPA 4Q02A 5CYGA 1EFCA 1XXLA 3ZU3A 5AI0A 1S4MA 1V6CA 4JASB 3CYFA 5EP2A 5AKEA 3SPXA 1B8NA 2JIZA 1HQYE 3I6ZA 3D0OA 3E23A 2MTBA 4EB8A 3RWOA 2PX0A 3OLCX 3IESA 3I53A 1DFIA 2JFHA 1UBRS 4UD6A 2J08A 3RFFA 5IXYA 4WFKA 4ZJUA 2JGLA 1FK8A 2BTQA 1XCJA 3DS8A 3ZD8A 1XCOA 4YLYA 7ADHA 3RRXA 1U3WA 2Q3CA 1O03A 3CZPA 2PBRA 2ON6A 3TN7A 3CLRC 9LDBA 4I2VA 1GCOA 1X1AA 5LZ5A 3SM9A 3CVJA 3PLAE 1NRIA 1TOAA 3JQAD 3L3BA 3GPBA 2R6JA 1DBQA 3KXPA 4L51A 4J0CA 3IOEA 1S8AA 4I8XA 3H5RA 4BL5A 3HN7A 1MOPA 3FIJA 5ALQA 2VNHA 4LC1A 4FNAA 4HVAA 2E5LB 4C7OA 3N1UA 4GGPA 3ZWCA 3I05A 4JA2A 4IICA 4E3WA 2BM1A 5KMGB 4GHWA 3QVXA 3B60A 5FI1B 4EPXA 2VYFA 1C1XA 2ZYVX 3EW9A 1QH8A 3UB2A 4X00A 4EATA 4ER6A 3MWLA 1F4PA 2JIMA 4C30A 2JIZD 4EA8A 1U99A 2J30A 4QWMA 3LIPA 3VFDA 2Z56A 1ZZEA 5C80A 5H7XA 3LHDA 4LX0A 2FFQA 4MQ6A 5I7SA 1CB7A 2HQBA 1IWBB 2R4TA 1V4BA 5DMXA 1V1JA 3KO8A 5EJ8A 2WAYA 2HC9A 4DB4A 3CT4A 5A3JA 2ZBFA 3R0QA 1DJQA 4RAOA 1V39A 2O3TA 5KYUB 5AJHA 1TCVA 1NMYA 2YHIA 1WP9A 2X2FA 1BFKA 2NUPB 4Y6PA 1MO5A 1Y7HA 2I6QA 4DUGA 4HB4A 4E3ZA 4EK9A 3HABA 3A9SA 3VZRA 5FCDA 5LUAA 4MJ7A 3RFXA 1CEQA 2QZ9A 2V6FA 2WPNA 3V6LA 5FQNA 1ORRA 4FGJA 1QM5A 1ZAKA 2GZ1A 4XVHA 3UB3A 5BMOA 1T8WA 2EDAA 2F9MA 1HGXA 4PLTA 1SU4A 2V55B 2HU5A 4I0WB 3I4LA 4LYAA 4MQFB 5ECWA 1C5KA 4B3HA 2UYCA 3C3MA 1LLFA 2X5XA 1DQSA 4LHEA 3BA1A 4AJKA 3HKBB 4N5NA 4Z99A 3SFZA 4KOAA 1F2UB 1KEWA 2IP4A 1SQ0A 3MTAA 4WKCA 5KKCA 3UJCA 3ANMA 4WCFC 3KPVA 2DB3A 1MP0A 1RZUA 1XA0A 2PS9A 4LBWA 2P77A 2EFGA 3CNHA 4BFSA 4FLFA 3ZCRA 5F1YA 4J7XA 1ICEA 4Z8XA 2C5LA 4FYPA 4CT4B 4W9NA 3ZGYA 1KNQA 2C20A 1FMCA 3HKCA 2CLOB 3BFKA 3T5MA 3U3OA 5LLDA 1CJBA 2DWPA 4FEAA 5DT2A 3TBKA 4CV0A 4EI9A 4XUEA 1Q6YA 3PX2A 4V0SA 5DGXA 3WY9A 5DNUA 1X14A 1U0SY 3Q98A 3QVKA 3OQOA 1JP7A 4W9RA 3ANSA 1RTKA 4MYTA 1UXIA 3RVLA 4K2AA 2GAOA 2XT0A 2P2YA 4BMOB 2AZXA 2X3YA 2GM4A 1E2KA 3AIMA 3KR9A 5DOVA 4FPXA 2WB2A 3K9CA 4ML3A 1IEQA 3V2GA 5IUJC 1NSYA 1B1CA 4RWEA 1CHDA 4WQMA 3WJ2A 3Q3GE 4BNMA 4EMSA 5LBIA 2XXAB 2H9AA 2IUEA 2JCVA 3AR8A 4OD0A 4TKZA 5SZIA 4E22A 2Q3BA 4DDTA 4ZI7F 1BDIA 1T4MA 2PX8A 5FNVB 3UNXA 1TPZA 2B36A 1RLUA 3DFIA 4KGZA 3IKTA 2EBUA 4G97A 1IY8A 4DLAA 1Q0UA 3ZDQA 4POAA 4CDRA 2JKYA 4XJTA 2CNLA 1KO4A 4JOSA 3ZLVA 4S0XA 1SBCA 5BNZA 5ESRA 3FM9A 3WWEA 2XQKA 2PH3A 2CE2X 2ODQA 2PUVA 3E53A 3VTKA 5HKAA 2OFOA 2J85A 3M33A 5DM1A 2GN1A 1VPLA 2W2VA 3K31A 3TMAA 4KPYA 4F5DA 3HWSA 5AKIA 2CXRA 1Y89A 1GO2A 1UXGA 1J09A 1U3VA 1Y3FE 2P35A 3F47A 4NC9A 3PQ8A 3EWNA 3SC3A 2R97A 2JLVA 5D01A 1GT91 2EYUA 5TEWA 3R40A 1E61A 2ZRDA 4R2MA 5DHUA 5BR7A 1FY2A 2NVUB 1E1CA 1QIIA 1O0SA 1RAFA 1IHYA 2B6HA 3DEKA 4MGHA 4KGVA 5EHNA 2JGNA 4WBNB 3ZX4A 4JI3B 1HL3A 4MRMB 3WB9A 3ABQB 4KXLA 2XA1A 3KYJB 4TXLA 5EINA 3HU1A 4LGCA 1T2FA 4MVJE 4AO6A 4ZV9A 4CF5A 5EIEA 4LEIA 1DIGA 3OI7A 3TQHA 1KO5A 1DX4A 5E9AA 5LZ2A 4NZ9A 2R1ZA 5EZYA 4LTDA 4RHEA 2PXAA 4P5DA 3HXMA 4X94A 2IS2A 2I3AA 3LT2A 3L06A 4OQNA 4PPYA 3VR1A 2Q4RA 3L7IA 4B79A 3RG8A 2J09A 3COZA 2I4MA 3CX8A 2GMWA 4QFDA 1EB9A 5G0UA 1Y3IA 3L0PA 2QGZA 3DW3X 1R4NA 5AM5A 4L2IA 4QUBA 1XTVA 4DDVA 2H0QA 1DO2A 2EKLA 4W1SA 5G4KB 4DA7A 3FNHA 1RHMA 2QT0A 4G5RA 1W34A 2QD1A 3ZWOA 5T4BA 2FNAA 4PHCA 1FFXB 2V8OA 1M7GA 4I3HA 2WTUA 2IOHA 1W19A 2BSXA 3C3CA 3LOPA 3QGMA 4YV7A 2EFEB 2I7TA 3H8WA 4P4SA 3LCMA 3WBFA 1H9CA 2R4QA 1FQWA 5K6TA 1GAXA 1HFWA 4PWYA 2VDWB 4TRJA 1TEXA 3WXMA 3KV3O 1NQ5A 1PJRA 2I3GA 4YCCA 1QK5A 5AUOB 5DZSA 4DCMA 1EZ1A 1WKVA 4IY1A 3I5UA 2IVZA 4Q47A 4DSZA 3S8EA 3E84A 2LNDA 4DR6B 1E89A 5HA5A 5CXQA 1BMFA 2J9YB 2PSDA 1JDJA 2R60A 4XJVA 3G9TA 1HSOA 2P9ZA 3OKPA 4IL5A 4Q7KA 2CCJA 3V2HA 5BQ3A 4O2AA 1Y37A 1T34A 1ZOOA 4ZXPA 4YRNA 4IEIA 2IEAA 3KVYA 3DLAA 1YBVA 3GDHA 2PL1A 4IO0A 4ALJA 4D9FA 1TIBA 1HT1E 4YMVA 3INYA 2DR2A 3E3NA 3WNZA 4BE9A 5DNYB 4BB0A 2ZEJA 2WYIA 3HUFA 1NVDA 4PSVA 5AW4A 5HCIA 1A7AA 3TQSA 3UCFA 1V7ZA 5KX5F 3BD6A 1ZJ6A 2ZE6A 2AUNA 1GL9B 5TQ0A 1AB6A 1OJ7A 2ENUA 3E9NA 3S2FA 3EODA 3QKIA 1NBIA 1UMCA 3ITNA 3AZOA 1RLIA 5AI5A 3VPSA 1JFFA 4C0SA 3WC4A 4CMAA 2P9QA 1QPZA 1UC5B 3E70C 4RPIA 2BONA 3LT4A 4Y67A 2CMGA 3K5HA 5IN4A 3HLTA 2DMRA 3AETA 2P2SA 1BMFD 4GX5A 5CB0A 1CZOA 1W9HA 2JLSA 1TZ2A 2W2XA 1Y8RA 3L0BA 4BMVA 5F2NA 5TJHA 3O4JA 1KSGA 4CLHA 3P2MA 3LA6A 2QE6A 1E2PA 3CONA 1K8ZB 4KX3A 3M3HA 4O33A 3VU0A 3W04A 4AZ0A 3R7NA 3HSKA 3AL0C 3SIPA 1SHZA 4AN0A 4F04A 5C0OE 4LRQA 1TYZA 4EYGA 1EG2A 1PP4A 1GAWA 1KGSA 3JWHA 3OOEA 4XLLA 4BPRA 3GJ7A 2CD7A 3EQ6A 4MRPA 3PGJA 4F6CA 5JSUA 1SVLA 1ZD2P 1NJSA 2EHDA 3DBOB 2LE0A 2RAUA 3D81A 4IIJA 4OSEA 2V7BA 5E95A 2J3JA 4C7MA 4TS3A 4BIMA 1NKSA 1EP1B 1ID8A 3BMXA 4Q9AA 1H2HA 2Q6OA 2QROA 4I1SA 5CT4A 4DIDA 1G20E 3QTLA 3CNNA 4K9PA 3I5MA 2QTHA 1CYDA 3ASVA 4IEFB 1P7WA 1YS7A 3PXEA 4MVJA 3T61A 3RC3A 3F8SA 5CVUA 5EQTA 4C7JA 3FJYA 1I7SB 1FLDA 3HQ4O 2XDWA 1K9VF 2H0RA 2PGXA 3D6FA 5L4SA 4HDRA 1D8TA 3LFUA 4K46A 3WJ1A 3BJIC 3OZDA 4A03A 3RRMA 4ZOLA 3EMVA 4PLZA 3S1SA 1XC7A 2B4RO 3F6EX 3PRYA 2H63A 1N2OA 2OK7A 4J0IA 1XF9A 2VHZA 4Q7LA 1EG7A 4J0EA 1RPJA 2XKBA 4O4JB 4GMDA 1E1RA 2I3ZA 1YKGA 2NVBA 3PFKA 3WNDA 5IVHA 1N8NA 1IY9A 1GAJA 4KQXA 1X92A 2HA3A 3GJZA 2MWMA 1XZDA 4HDSA 4TRRA 3TUJC 4DZRA 1O6CA 4X44A 4N39A 1NASA 3A1CA 5DI3A 1VM6A 3LUDA 1GAQA 2FF5A 2DOKA 1TYAE 4AYXA 1JAIA 1FW6A 4B6QA 1CUHA 1RCTE 4OKIA 4NV0A 3N6XA 3RCBA 2FLVA 4LGVA 1XFAA 2MSEB 1E6EA 1Z08A 4WXMA 1K6MA 2V8BA 2P3QA 2IUFA 3CX7A 4PANA 4MXDA 4V03A 3JR7A 3QLEA 2IOFK 3IPLA 1Z68A 4FGKA 4MVJD 5KWIA 3STUA 3G0CA 3P1JA 5JI2E 5LDDC 1OW3B 1T6ZA 5ECDA 2O06A 1KFCB 2Q1XA 2GBFA 4EHFA 1J0BA 1L3IA 4B3IA 4DDUA 3S28A 3DB2A 3PVCA 4C4TA 2FN3A 3FCEA 2B5VA 2WWTA 3C3YA 2G5PA 3CURA 2AH5A 3R23A 3UA3A 4MWOA 4YHHB 4B3MB 1I5EA 1VSQA 2I8AA 4NBUA 3O2SB 4NU5A 3EVDA 1MAVA 1YQ9A 3K0FA 5DB4A 3TD6A 4YFYA 3RSLA 3KYBA 3UG7A 3QFHA 1Y4AE 2Z8YM 3BCHA 1HQKA 3UT5A 4ZRNA 4M98A 1N7JA 3GLFE 2I3BA 3OICA 3GHYA 4W8GA 4MLDA 3NAMA 4L9RA 1SXJE 1RMQA 4RUKA 3H4VA 4CM8B 4IG4A 1IQUA 4FN4A 3R6TA 4L8VA 4OIMA 3RG2A 3R5JA 1EUDA 3W78A 1CRLA 1QU3A 3UJPA 4QC2A 1L5HB 4TLAA 1PGOA 2QQFA 3M3DA 5BSRA 4NYIQ 1O57A 1SEPA 3FUWA 5DCLA 5ALJA 4BE4A 3C15C 4G0OA 2ZPTX 5JSYA 2WAXA 4ZHQB 5AVTA 5JRZA 3BGOS 1J25A 1OQAA 3N59A 4TL6A 1VJGA 2VPTA 3R6DA 2C9CA 2V45A 4U9UA 5HF6A 4OM7A 3L7BA 3HO6A 4C3UA 1HEUA 4DQ0A 4DKXA 4G41A 4RA6A 2VQFB 1M1UA 4X65B 1HA3A 4BP1A 1NLFA 4OVKA 3EH2A 3VZCA 1XDDA 2Q2QA 4EYKA 1D6MA 3O3MB 1T6NA 1BTOA 2B5OA 2ZYWX 1DSSG 3GPDG 3IUBA 3U5TA 3EVTA 3FTDA 1KFEB 4ZZIA 2IDJA 4G8BA 4H1TA 2CUKA 4WKPA 2VPIA 4P86A 1A0OA 3JU3A 1O08A 3IKVA 3LYHA 1OT5A 2BP7B 4RF4A 3DLHA 2XIJA 3OJOA 2VKTA 1YCGA 5HCUA 1JDBB 2X13A 1RC8A 2WLSA 4JCOA 3D6JA 1G20A 4TYQA 3RABA 4OV6B 4QRIA 4AVYA 2QDXA 2FN9A 1P9RA 5AKXA 1PWHA 1V1MA 1XA3A 4OM8A 1N4DA 3GLQA 3TW8B 2P4QA 1SHJA 4OLHA 3VOTA 4D9NA 3TOXA 3X0DA 1KI8A 5KPJA 1V2HE 4A0FA 5JW6A 5E9WA 3WL4A 4XDGA 4V3CA 2RGUA 3K09A 5EJ6A 5KTTA 4LOHA 1IU9A 4IS3A 4K81B 4BVBA 3HBLA 2C7VA 2FPLA 2Y0EA 1M6HA 4R8LA 2R6CA 3H5OA 3IC5A 4MR9A 5BPHA 1TI7A 1Z9BA 1UBKS 1XZBA 1C4KA 1M2JA 1S2GA 3AY0A 3SS9X 4DM4A 2XXAA 2D1YA 2X22A 4BVKA 1VJRA 4E4RA 5LD2C 1FMTA 1YMQA 2VHTA 3BMQA 3QXGA 2OBXA 1ZK2A 3OKCA 3EBLA 3U44B 3CG4A 4PICA 3NHAA 2Y27A 3HGTA 2PPVA 5ALNA 5ER9A 4ZTUB 2K6GA 2ZR9A 2IHNA 3CEPB 4J0KA 4BC1A 1M34E 1G3UA 3U62A 4ZYUA 2ANBA 5FPPA 2ZJOA 4XFKA 4LAFA 3BFPA 2NZWA 3V42A 2WJHA 4JU8A 4LW8A 5ITZA 3GZJA 4G5GA 3O8CA 2REQA 4CKZA 4J4HA 3TXAA 3O84A 3PNMA 4Q1VA 3HI4A 1BVUA 4RE5A 4DQKA 4BLVA 5KKNB 1OWPA 1PL6A 1WIWA 2PZKA 3AFOA 3NHZA 4TTPA 4HDMB 1KMNA 4JN6B 2D1QA 1XE3A 2O2YA 4GXQA 4XVRA 1SCUA 4D46A 4ZYYA 1NLZA 1MRSA 2PKRA 2CHUA 1QOQB 2GDZA 2QPAA 2H1LA 3OZSA 5D7BA 3VR3A 1P2UA 1UJ5A 2OHIA 3G9ZA 3FTFA 3GLFA 2QTNA 1I3LA 2JEZA 4M1WA 2PQ2A 3D3NA 2AHRA 2OWEA 1AKRA 3JQBC 3RDPA 4DA4A 1SXJA 2FRDC 2ZJ0A 5F1PA 3IHKA 1TYBE 1M2OA 2V0GA 3X3HA 1KOLA 3E82A 4L8GA 1W49A 1M8PA 2CHVA 1CK4A 1TUIA 3CM0A 1N5MA 3RUIA 3T5DA 3WGHA 3EVCA 4IFTA 1JEYB 1DINA 4IZHA 4PAGA 2RAPA 3O8LA 1T9ZA 4X7BA 1HFJA 5DLYA 1NVVQ 3TIGA 5KI6A 3VGJA 4BVJA 4OL0A 1DEKA 2IIBA 1T3HA 3NT5A 2F1IA 3HUEA 2P6UA 2YZ7A 3PJRA 1E2EA 2Z58A 3H83A 3I4CA 1ZUIA 4Q93A 4ZREA 1RLTA 4WZZA 1KDZA 2Q4TA 5K2OA 1SKQA 2YICA 3ADCA 1NVAA 4OTZA 1TK9A 4HMPA 1P5HA 1U8AA 3FVQA 5JBIA 3VUEA 5ALOA 4MB2A 4FXOA 1FTQA 1RYFA 4G0XA 4F2GA 2KJQA 5GJBA 1XELA 1NQTA 1U1DA 5IU6A 1DAMA 4MLZA 1MU0A 3V8NA 5K3DA 3VR3D 1QHNA 3TMKA 3RVQA 1VKRA 1GR0A 5AVSA 1WABA 4LOKA 5CTAA 1J8MF 4PY2A 3PEEA 2C8LA 1Q84A 2YZGA 3DA8A 3AHEA 3FBTA 4HO1X 4LPSA 4NPCA 3X1MA 1HE8B 1UC9A 1SXJD 2HNKA 4GOXA 4B6JA 5JO9A 1KZ7B 1P2GA 4PONA 3R8FA 2A1UA 4MR8B 1SOVA 3MOIA 3BRCA 1ZRSA 4OH7A 5FR2A 2W43A 4ZVTA 1R4ZA 1QFSA 3PGXA 4RKRA 4EB3A 5IJ9A 3ZXIA 1RI5A 1GXSA 1H23A 3HNPA 3KFLA 2QL7A 3DMHA 1Q17A 2RHTA 2JFFA 1YR9A 2QR5A 3EARA 3IR5A 3FMIA 3IV7A 1E4OA 3OPYB 2NZUG 4ZOCA 3PSHA 1WKBA 2NZXA 2RJ3A 3P8ZA 8LDHA 5DISB 1ULSA 1JKMA 1KC1A 5K45A 4HXFB 5FWYA 1V7QA 1YQTA 5LN1A 2CB0A 2IYSA 2VNJA 3C8ZA 4JXKA 2G04A 4OYYA 3ZWWA 5WRFA 3BN3A 2I2BA 4QGHA 4E33A 3G2PA 5LC1A 1E2JA 2CUTA 2I7VA 3KB2A 1QG6A 4F4CA 2TMDA 2XF8A 2WJ3A 1V5IA 2JL1A 4JBIA 3R6WA 1QK3A 5CYPA 3WYFA 4BN0A 4W1PA 3F7TA 5HZGA 1GUBA 4QUEA 2C7BA 2W2QA 2YMQA 5TX7A 5JECA 1Z45A 3QOYA 5JADA 1GQ2A 3NUGA 1M34A 2HTFA 1SUFA 2FB9A 4KLAA 5HPYB 2IDZA 2ZDQA 2GEFA 2IYFA 3HUTA 1ABBA 5J4VA 4CXMA 4AZTA 4AS3A 5KOHA 3BE8A 4N5LA 5KVAA 5JDCA 3WJAA 1ZEJA 1H6DA 2HCBA 2OAP1 5DNAA 3WGZA 1QE0A 4Z49A 5JFGA 3L4SO 4TUYB 1KJ8A 1RR6A 1P1CA 2R1VB 2ZCUA 2ZXEA 3MXTA 5EVJA 1W2WB 3R7LA 1NXOA 1W4BA 2PSEA 1DRWA 3P26A 4UDXX 5HRUA 3FGZA 4G36A 4OLJA 4R1LA 3TEFA 4PSUA 1IDN1 4XOIA 2W4IA 3QNWA 1Q7RA 1S3FA 4BLQA 4BO3A 1J56A 2OXCA 4TWJA 3TTTA 3FDZB 3IBFA 2CVHA 2ACVA 2DG2A 3CPHA 3TZCA 3H2GA 3VV3A 3ZLTA 1WDMA 1NUUA 3CR7A 2RHGB 5CVCA 4EG4A 4LNHA 1TCAA 1VMIA 1CVLA 2Y76A 3PGVA 4BWVA 3A7EA 2P9JA 1B93A 2GSDA 1F0NA 3FB1A 2W22A 4RHFA 1XWFA 4MGEA 5AVVA 3RSHA 1Y9ZA 2FEOA 1JBQA 2FW0A 4C0BA 1SGWA 5IUNC 2P2LA 1L5MA 3RU2A 2B1RA 3JQ8B 5CA0F 4KIUA 4HWGA 3G2HA 3I58A 1YXMA 4CNBA 5A4FS 3ZBPA 4BNHA 3C7CB 2J3EA 2GM3A 1X87A 2W83A 3DEZA 5F76A 2I62A 1J2EA 2Y71A 3K53A 4E5VA 5HQ3B 2GBLC 4JKYA 4TLLB 1XNHA 3I9KA 3I9V6 4O2BA 4XB1A 3PXDA 4Q9JA 3AM3A 4YT5A 1JKJA 4FEYA 3BK7A 2QV7A 3BCSA 5H3CA 3WYAA 1JHQA 2EKBA 1BA2A 2ZQZA 3JAWB 1FSZA 1OXUA 1PJLA 1VQ1A 2QIOA 3D1VA 3ETJA 3CCCA 4LDAA 5B3KA 1PWYE 2K87A 5I7EA 5T7BA 1ZBQA 2VDUE 3NVKI 3JS5A 4Y2XA 1H2WA 1PG2A 4YH1A 4DM7A 2A9RA 2GB4A 2BSAA 1GPH1 1YJQA 4YJFA 2I4TA 3LSYA 4MQFA 2M6RA 1DKPA 2MYNA 1TKBA 3NHBA 3DCYA 3DC2A 4KGDA 2X14A 1GAEO 5FA5A 3I61A 1T0PA 4DIKA 2LV8A 1F2UA 3MJEA 4UREA 1WBJB 1UZMA 1PU2A 3R3WA 4U5QA 2E4VA 1JS1X 2IYQA 5JYBA 3PJDA 4PCAA 1YFLA 4X6YA 4YP5A 1GZ3A 4QPNA 4GP9A 2D8MA 2EBFX 2X86A 4A91A 1UANA 1F9AA 1GLNA 1ZM2A 5D1NA 5BW8A 3T3GA 2C3YA 3N2NA 2WF9A 2HSEA 4HXGA 1KJYA 1P7VA 4JEUA 3KOOA 5HDBB 4TQUS 2I8LA 1BWSA 4UHEA 2D5IA 3CUVA 4UMVA 1GSHA 3DO6A 3W5HA 2AXNA 2GETA 2H5EA 2GASA 3FHOA 2FZWA 4R7ZA 5FPTA 5C18A 4KN9S 1K4MA 5CNJA 5E4FA 1NYTA 3FHJA 4CR8A 4ZQHA 1SC1A 3EUAA 1XPJA 1QBGA 3HM9A 4ZVVA 1FFHA 2Y68A 4CF4A 1WXXA 1HDZA 3D7SA 5L95A 4MYDA 3CUYA 2X8JA 1X15A 1XZJA 3L8EA 2C61A 3GJ0A 1ZI6A 2QB5A 4HWRA 2Q6KA 4A0QA 5DHRA 4W5NA 5D2CA 3UV6A 1GVHA 1BDHA 4HQFA 1O9BA 4WOKA 2X4LA 5CEFA 2UYQA 3R3HA 3S4YA 3W2TA 1CQXA 4UM9D 3HKDB 4Q48A 4R8SA 3VQTA 1ODFA 5LQAA 1R3DA 4HL6A 1TCCA 1WDWB 5DMHA 3UWKA 5ICSA 4K9DA 1NFFA 3DV0B 4F3NA 1TD1A 1Z8FA 2QV0A 3I1IA 5H81A 5BO5A 2V5VA 5BWCA 1U4SA 4FX5A 2P2ZA 4LVOA 3TCXB 1V9SA 1SIUA 1X7XB 4URYR 3UTCA 3LYAA 4IQ4A 2F3RA 5KJ1A 2V3CC 4WE3A 4IDFA 1N6PA 2PYZA 4PU0A 1YAHA 3PC7A 2JFWA 3AILA 2QL9A 1FUEA 3CSUA 4QT0A 5L3ZA 3WYNA 4URWR 5GZ3A 3TOCA 5LVAA 1JH9A 3Q0EA 3G2LA 2FDXA 3QELA 2V7XA 3CE6A 4LV6A 6Q21A 2CV1A 3H2ZA 2GAJA 3WG9A 1UFQA 4Y1FA 3WXBA 1NNEA 3O92A 2Q41A 1LEHA 3ZH2A 1HURA 3GVHA 1FNMA 3K9GA 3N28A 4R3WA 3THWB 2EKDA 2NVUA 2PLRA 3K8QA 1FYDA 4ATNA 5DASA 1A1VA 1CT9A 5J4HA 3E7PA 2QHXA 3JQ7B 4X93A 1EA7A 1RYBA 4R2IA 3E9MA 3H2SA 3QUTA 3ND9A 3A3OA 3LRPA 1MB9A 4HLDA 3TTXA 5K6RA 4MV1A 3C5VA 3MGGA 1J21A 1P9LA 3LXMA 2WMOB 4HYYA 4Q4HB 4WW0A 4RPCA 1X7DA 4C2AA 4LC0A 2GEUA 1CJKC 5I7VA 5EUCA 1E69A 5BQFA 5D1HA 2B3TA 4MUFA 1IY1A 4XFDA 3WLOA 4B6RA 1KEEB 1JF8A 2A9VA 5BSEA 1TC2A 2W8BA 2NYVA 2X0FA 3RYHA 2N47A 2CY0A 1C1HA 4P53A 5DHQA 2XB6A 1H4QA 1EFRD 2G0TA 3BWBA 2C9YA 1TMOA 2R62A 3QIVA 3ZX5A 1A98A 4BNDB 1KAHA 2ZSFA 1FFXA 2A3RA 3EVNA 1AE1A 2GA8A 5LLTA 1JE0A 3ME5A 3UQZA 2P5UA 3LQRA 2XRMA 1G3QA 2PH1A 4DEXA 4ARCA 2ZRNA 2Q3EA 2O8EB 4G5XA 4BNLA 2G5TA 4R1NA 4FHFA 4H4EA 4KKXB 3QA9A 2HSWA 1EHYA 1R18A 4K1XA 2LVBA 2WVJA 2RGNA 5FB3A 5PGMA 1UM8A 4RTJA 1H0KA 3OM0A 1OXMA 2BGTA 2GBGA 3G2MA 3KJIA 3PV0A 5ALYA 4RQTA 1SNYA 4ZXFA 4C0WA 1XZNA 2HQSA 3GL9A 2IXEA 4JOQA 4Q01A 4A36A 2QRHA 3AUAA 3QU7A 3QFSA 3ESCA 1E1YA 1LTKA 3BGSA 2MYPA 3GG2A 3KB8A 3C6YA 3SEQA 1OROA 1VHLA 1VMKA 4RHXA 4XEHA 2O0LA 3GZ4A 4INPA 4FDLA 3TMYA 1U3DA 1WEHA 2PQ0A 3VNVA 1Y1TA 2AMJA 4KWIA 4QYSA 3HYRA 2C8JA 4UCWA 5EI5A 2FFJA 1RI3A 3DF7A 3WISA 5EVCA 2XMQA 2B30A 4B44A 2ZJAA 1K6JA 1DHTA 5GTDA 5U1PA 1ND5A 3GCXA 4IKEA 1LVHA 4B43A 5TMPA 3MFQA 1WHSA 3DGEC 3ZQJA 3KRTA 4DXHA 5JPDA 5LUBA 4KYIB 1JQ3A 2A5DA 3HRIA 3PX3A 2J48A 4IJKA 1Q77A 1T3SA 5CDSA 4BLPA 3VR4A 5AW8A 5JR3A 2GQ0A 3PBKA 1DKQA 3ANYB 3UCEA 1GTZA 2WD9A 5FNVF 2P5TB 3LJKA 1E1KA 1NI4B 3DE4X 4MQBA 1X80B 2FZ5A 2YJTD 4ALLA 3QE4A 4XIYA 3T3DA 3LHSA 3O47A 3ZW7A 3PE4A 2CCGA 3CEMA 1NXTA 4YRLA 4ZD6A 3CLTC 4D4LA 5JNVA 3R5SA 3DO8A 1RAAA 5AYVA 1U6IA 2RBEA 5E6RB 3W5JA 1WZCA 1K5PA 3LKZA 1IY2A 5G1OA 1YVUA 4JFRA 2RKWA 1GPWB 3DG9A 1W1WA 4P4GA 3DNPA 4WKOA 2AYYA 4H6VA 4YLEA 1UJCA 2AZTA 1JDNA 2CNBA 2YWGA 1DAIA 2WQZA 2IHTA 3UUWA 3LX5A 3L7KA 2HMYB 5AW0A 1EXVA 2UAGA 3B1KA 3V4FA 1IMOA 1QHGA 3SQLA 1TRKA 2E1RA 3V33A 5BUQA 2H6EA 2J3KA 3PXUA 1B73A 2RE8A 4HNAA 2R2AA 2CT8A 2YFKA 1UQRA 1SOAA 4I81A 4YUYA 2ASVA 3VR4D 2WYUA 2IZ6A 3HY6A 3SZRA 5LYJB 2YW9A 5IXJA 2BAGA 3FVVA 3PIDA 1YQDA 5EJ7A 4HH3C 1GCAA 1MQ9A 2DPMA 2OLEA 3DSRA 4HK4A 4RY9A 4QREA 4WLUA 1HFEL 5FOWA 2WQ6A 4A15A 3FF4A 2VO1A 3KD3A 4RD6A 2WM8A 1V4NA 4M1QA 2IP2A 3FSJX 4XCXA 4OLFA 1OWMA 4PQFA 3WNQA 2B4KA 3EVBA 2IP1A 1W30A 3DBRB 4K1LA 3ROFA 3U4AA 1UWCA 4DUPA 2JK0A 2ZCVA 1VKZA 4N41A 2Z5LA 2FTKE 2HBZA 1A9TA 3N0TA 3PPIA 5DTEA 4YMGA 4X97A 4XH9B 4GW3A 5DSTA 5HK9A 3EC1A 3NWOA 1W93A 3WR5A 3ZWMA 3H8VA 5ALXA 5NULA 2J4DA 3L01A 5REQB 1YGPA 2NT4A 2QD2A 4UUPA 4AUMA 4LY3A 1LK0A 5EJ9A 4ZEXA 1GITA 2BEVB 3RC8A 2P0EA 1V5GA 1MTZA 1ADBA 2MSCB 2YZMA 2QRJA 1SUIA 3DVSX 3DXFA 4UC0A 3BCUA 5KVQA 3TLGB 4PGGA 1SPBS 5JARA 1NMZA 5DLPA 1G3IA 3T3NA 4FYWA 4OYRA 4C76A 1GA6A 4DMUB 4BWYA 2ZPAA 3FTPA 2F1RA 1Q57A 1SBQA 1NFQA 3M9WA 2MCFA 3WB2A 4B87A 2QG4A 5BWNA 2CXHA 5KPDA 5EWJA 3VKWA 1GKKA 4R5MA 4Z4HA 1JEQB 1VHTA 3TPCA 4Y2PA 3EOAI 1NUSA 4YQEA 3KSZO 2G7MC 3EDRA 4L57A 4ZT4A 2N1MA 2G0NA 4NNJA 1TLLA 5EZSA 1JG1A