4V2UA

Apo-structure of alpha2,3-sialyltransferase from pasteurella dagmatis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
386
Chain Sequence
SKTITIYLDPASLPTLNQLMHFTKESEDKETARIFGFSRLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTMEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
total genus 134
structure length 386
sequence length 388
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v2uA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v2uA01
4V3CA 4V39A 4R83A 2IIBA 2IY7A 2IY8A 2IHKA 4R84A 2ILVA 2C84A 2ZWIA 2IHJA 2Z4TA 4R9VA 4V2UA 3S44A 4V3BA 2EX1A 2C83A 2II6A 2IHZA 2IIQA 2EX0A 4V38A
chains in the Genus database with same CATH superfamily
1ZP6A 5BW6B 3C14C 2V6FA 4N40A 1T5OA 1VGRA 2YY6A 2VJYA 4TXLA 3VR4A 4BNVA 3RLIA 4DVJA 4EYQA 2Q9BA 3HXOA 5FPYA 1P0QA 4DREA 1S2IA 3IQXA 4KW7A 1EMDA 3GCZA 1EU1A 3AYZB 3K30A 5AM4A 2WLTA 5E95A 3L7IA 2C7RA 4L5YA 1XZFA 4J90A 3IHLA 3U6KA 5JAPA 3P4YA 4P7JA 1U28A 1YDWA 4HWPA 3FOWA 2FWPA 3OQ6A 2JGDA 4F4UA 1ADBA 1WBBA 2G77B 1P4GA 2A9FA 4GG1A 4IXMA 1BE0A 1CR4A 1O6ZA 2C9ZA 2Q27A 4D0RA 4G1UC 2WP0A 4EB3A 4KHPB 5KPDA 2C7QA 2CFRA 1S2GA 1F6DA 4CM8A 2X4DA 4I4TA 3R09A 4W8HA 4JCCA 1OAAA 1VI2A 3STXA 4B4UA 1Z2CA 1XV5A 3GLHB 4L72A 4OIMA 4CM4A 3MGKA 1WSAA 2XR1A 3CF6R 3FNIA 4XJTA 2VF8A 1IHXA 2WNHA 3H5TA 3HBAA 4H1UA 3SYMA 4B34A 2BMVA 5KOHB 2CZGA 4XWAA 3TVDA 2CDNA 2Q45A 1L5NA 4I66A 3GP8A 4KQKA 1LC3A 1XBTA 4TKMA 4B3GA 2VK2A 1TM2A 1N78A 1T0BA 2ZRAA 4EMBA 2PD6A 4EJFA 4NQRA 4F86A 1ZNXA 4FLMA 3ACCA 4HXFB 2ZS7A 3FMPB 3P4XA 1JQBA 1JZTA 1NJGA 4PNEA 5IAOA 4R8VA 2PZMA 3FMGA 1SVKA 1J0AA 2OBBA 3D6TB 2O8DA 1NOIA 2QPAA 3QLUA 1M6HA 1QGYA 3ESAA 4TYPA 4EWLA 4BTLA 4WQMA 1XQWA 3NWJA 4A0GA 5I7RA 4D96A 2P6MA 1SXJE 4ND2A 1GIAA 1UPUA 3ZZUA 1EIZA 1N3BA 2B8TA 2O50A 3ANNA 3PUZA 3HYSA 3ZKWA 1H8HA 2HBZA 3CTMA 3AJEA 4EGQA 2DP4E 1BDMA 2IRWA 2F1RA 5DNEA 3W78A 1I2MA 2YFHA 3WZ2A 3CNQS 1Y37A 1N6IA 2J33A 2OAGA 1QHIA 4I1YA 4DY6A 2KI5A 2V8OA 3ILXA 2HA2A 2PIAA 2ZRFA 3RUEA 1I7LA 5A0FA 5LPNA 1REQA 3O83A 1NWHA 1JHMA 4R2KA 4Q48A 3TOXA 3D2AA 2OCBA 4XGQA 4HT3B 3E22B 2C29D 4DCNA 1IK6A 1RM5A 3JQGA 4TV9A 2BUBA 2ZJAA 2QSYA 5ALWA 1YB4A 2YMLA 4NEHB 1C3LA 4UXHA 3WGZA 2MMCA 5C1DA 1SAYA 4OY3A 4H6PA 1WPGA 4IV0A 1OWOA 2NO7A 3FAKA 4L9AA 4ZOLB 4C2AA 3WNZA 1GUDA 2JGAA 4YT4A 1WHSB 4AMUA 4MVJG 2PZ8A 2FW8A 3JPWA 3N0VA 4DMKA 3W6UA 5HTOA 3LYLA 1H1DA 4YX9A 3SSNA 3NC4A 5AW2A 4TLEA 3WO0A 1NJFA 3ESXA 2J5QA 3RS2A 3S70A 1VBKA 1I30A 2GZRA 3CUSA 1N6RA 3HL4A 1KQGA 3S2GA 4FJ1A 5C37A 4NONA 4ZXPA 2OD9A 3DR5A 4RE5A 3QFRA 2XB8A 3G9TA 1FMFA 1U04A 4DCJA 4KNWA 2GVZC 2M6KA 5LB4A 3ESBA 2ZBQA 2ZJ2A 2O3UA 2PUAA 4PCLA 4HY3A 3DUFA 4NK5A 3EIQA 3RIEA 5F5XA 3M6UA 4IDBA 3RJTA 3MINB 3PHBE 1E79D 1YJXA 3GJZA 4OHPA 3EF0A 3VJRA 1OJ7A 3I4FA 1O97C 3AV3A 3AR2A 3L4EA 4LHVA 3SYKA 4BB9A 1BS2A 1JA1A 4AKSA 3OEHD 5LP6B 1LBQA 4HZUA 2YHAA 4FCVA 3R9WA 1CEXA 3VDXA 5HK9A 1SOAA 2Y76A 3GFFA 3BKXA 3M1AA 4YQEA 3WK4A 3NVAA 2OVBA 3NPMA 1HLPA 1ACJA 4ZODA 2I80A 4ILKA 3ECAA 1MPXA 4LJKA 5K3FA 4CLOB 1MIOB 3ZWPA 1PNRA 4Q1DA 1CCWA 4GIBA 4U2DA 2PUHA 2A59A 3LDHA 5IVDA 3LQFA 2M6SA 2FSHA 2HJGA 1VI6A 2QJWA 3L7OA 2EJCA 5IBPA 5JMTA 4DNPA 2VF5X 4YJFA 2P8SA 3WYEA 4DQ0A 4EP1A 2Q5IA 4CF6A 1SD5A 2I7TA 4F4JA 5K45A 1Y0BA 3NC1C 3TR5A 4BZWA 2XWSA 3GFGA 3QPWA 3VNBA 4UASA 5JXHA 2V0CA 4QVGA 4JASB 1B74A 2JASA 4EKIA 1TU3A 2XQJA 5J4KA 4YRDA 4JI1B 1WSBA 1LQ2A 3G8BA 4OLJA 2QBYA 1FJGB 3PVSA 5JSYA 3NHWA 4PR3A 4D9IA 2JIMA 1L5MA 4YBRA 1YONA 5AJYA 5CDSA 3BFKA 3KQUA 2WUDA 2Q4TA 2QRUA 2C2MA 3DT8A 5EIBC 1G7SA 1T5SA 3VGJA 1GKKA 2J5BA 3KQLA 1YE8A 3VBCA 1F4VA 3DF9A 1P81A 4TLAA 4YXFA 1EUYA 2PRIA 2CZCA 5G3ZA 4BB0A 1LB1B 5AVRA 5L4NA 2ZG6A 7ADHA 3LIIA 5FLXA 3L07A 1OZGA 3T6KA 3ORYA 2XVYA 4F4DA 3O8DA 1DRUA 4UARA 5J58A 1MORA 4G4SP 4PAGA 5TV2A 3FNFA 3TLGA 3A6FA 3E0QA 3NNSA 4F2WA 3PCXA 2N75A 2PGIA 2ZZMA 4XDGA 2A3NA 4BLWA 1IN7A 4N5MA 5IAAA 3I58A 3OE7A 4Q3NA 4ESVA 5DGTA 2GM5A 2D2EA 4JOCA 3P9PA 3TMKA 2RC6A 3WGQA 2VRNA 2VNSA 3Q15C 3KJQA 5FPTA 4ZOBA 1JVNA 1R15A 5F35A 5GWXA 1XHLA 4NOLA 5CVEA 3ZVRA 2GPAA 4UUAA 1YDGA 4BPBA 4D4LA 3PQEA 1J8QA 2ZBEA 3DOCA 3O4JA 1YVRA 4WTOA 3RRYA 1YA4A 3G79A 3ROEA 3ER9A 4H4EA 4MQ5A 4F4FA 3FKSA 5C4IA 1CUJA 1NDHA 4WESA 4AWAA 2DCUA 3FVRA 2MMGA 3HXMA 2QD1A 1U3VA 2C58A 3QVLA 3USCS 2W22A 1H0HA 4QU0A 1IIRA 3I83A 4I55B 4KDEA 1PS8A 1O1YA 2CK3A 3UIEA 3VR4D 3DW1X 2HBRA 4B3RB 2LBPA 2H7VA 3BJMA 3MWDB 4KLNA 3K2BA 3SQNA 1VP9A 3D1VA 1UEJA 4YR9A 5IZCC 4W9RA 1LK5A 1Z4PX 1N0HA 4K9NA 1ZK0A 4FFMA 1YJCA 5HJ5A 1BNCA 1D2NA 3K94A 1R7RA 4DB4A 1K63A 1FP6A 3C6QA 1UBLS 3ZV4A 4LNAA 1HE2A 3OESA 4QPCA 1SRRA 3VR3A 4CBVA 3WMGA 4JXXA 2B4KA 2WHQA 4EHLA 4XIIA 3SBOA 1YQTA 4JU8A 1Z62A 4ZKDA 1RZVA 1LQTA 1Z7EA 4XLLA 5I7FA 3QYJA 4Q21A 1I80A 1SIOA 2F1IA 3WJ7A 4F04A 3S44A 1GCIA 4EYKA 1Q11A 3AJ8A 1XN1A 5CA0B 1N1DA 1SFRA 1JHDA 1KEZA 2RHTA 3B82A 3KSZO 5BY2A 2JG3A 3KZOA 1EJ2A 2QMOA 1SCAA 2TMDA 2BDEA 2XXAA 3U9SA 4GBED 4E15A 2JLVA 1AQYA 1FFWA 5HFNA 1KERA 2QTZA 4AMVA 1B6TA 1ONNA 1NY5A 1ULAA 1CNEA 4IDDA 3FB4A 4OJMX 1EZ1A 5K3DA 4BQSA 4Z6KA 4XB6B 2A1TS 4PM4A 4AJPA 2XNDA 4HL6A 2UUCB 1QDUA 2OE2A 4TTTS 4HQNA 3UB3A 4ZXFA 4C6HA 4U7HA 3VC7A 4CR8A 5H9WA 2O3TA 5FQNA 1F0PA 3EOAI 3RARA 4X24A 1WCV1 1DP4A 4G56A 1Q95A 3HBJA 5EHGA 2O2SA 1ZM4A 2HWKA 4B6EA 2OENG 1GT6A 4OA8A 3FZYA 3M6WA 4IGEA 3HVKA 3P26A 2P3OA 4F8EA 1RTTA 3KS9A 5HZHA 3VSEA 3T41A 1K97A 4J16C 4XYMA 2C3MA 1FNCA 5JNRA 1FB5A 2J9ZB 3RVRA 1P1FA 4IF4A 4QL3A 3Q9LA 4HDMA 2E4UA 4K7JA 5AHKA 3H7IA 2XTAA 1RADA 3RGWS 1DXOA 1FC0A 1E0KA 1LA2A 4LXYA 4R40A 3LX6A 2VQSA 1EHIA 3SFTA 4ZJUA 3KVNA 4JOQA 2PGOA 3NHYA 4GPAA 2ZWPA 2H59A 2BV3A 3E2IA 4RV9A 5DZSA 2QYHA 3C6YA 3TPZA 5AUOB 5KCZA 4ZVQA 4IGAA 1IY9A 3BICA 3DVAA 4HATA 4UTXA 1R0SA 2NQ8A 3VHXA 4OQYA 3UHFA 1AJEA 4GI2A 1ZI8A 3M6XA 4TL8A 5LJLA 1FXWF 3SF0A 1DVRA 2NVUB 3ZDXB 3ZDQA 1RSZA 1JQ3A 3ER8A 2REQA 1NVVR 1NBEA 2W2LA 4ZRNA 1JIXA 4DQDA 4AKIA 4R05A 3ZGOA 5H3CA 5CVUA 4XGIA 2DETA 1XEXB 1XZLA 4KP7A 3OZFA 3HFJA 1HL7A 4O4JB 4E3ZA 1YUNA 3PS9A 5KNBH 1DSSG 2D1FA 1P9LA 4OSPA 1BROA 1J23A 1OI4A 2JZNA 2JIRA 3HVIA 4O4HF 4YRFA 4A91A 2GS9A 2Y1FA 4OLAA 3P45A 4KPUA 2IHBA 2IXTA 1OHHA 1JQLB 3D0KA 4HMPA 1CLUA 3CLUD 4LS3A 4YCMA 4HLUC 1NN1A 4LJ6A 2PX6A 1I6MA 3INTA 3ZH2A 2D1QA 3LSYA 4CV2A 5AI4A 3B7PA 3U7QA 2R8XA 3PICA 4IGKA 4XJSA 1X6VA 5AW4A 4DBLE 3LUFA 2C98A 2MYUA 3RVLA 2OQVA 3UWPA 1A7KA 2C9MA 2NSJA 1F3OA 4PC3A 3O4FA 2UUAB 2IS6A 5AK6A 1I2AA 4FEYA 5C1IA 2O8BB 1KI9A 1WE2A 1XR3A 2ECQA 3TB6A 3ITKA 3QBVA 3WQHA 4TT3A 3G5MA 1CC1S 1I2ZA 2ZAGA 3GMDA 3MWYW 3OBIA 4HGRA 4RQUA 1KIMA 3RD5A 4C6RA 4FSXA 3EEFA 3W3AD 4AJOA 5FUQA 1GGEA 1QYIA 2GZ2A 3BWVA 4O4LA 2AJLI 2OVFA 3PDHA 4ZDWA 2JBWA 1M6VB 1XNQB 2VNAA 4G5HA 2C77A 5EMLA 4C4RA 2P2ZA 4ZO8A 4L0QA 4MKGA 4IV8A 3GLKA 3IBCA 2BSQA 3BS4A 1Y3HA 2FN7A 4PZAA 2P79A 4B79A 3D5TA 3MCTA 1SC9A 2ONCA 3PNVA 5FBWB 2Q4EA 1BU8A 1C3OB 1P1IA 2L2QA 4AK9A 3EASA 3FFWA 4X1KA 4Q19A 2WF5A 2V59A 4Z3DA 5TT1A 3OQNA 2CFSA 3SHVA 1H4QA 1PR2A 1S89A 1J6UA 3V1TC 4FK8A 4MMYB 4QPJC 2B7LA 2JKZA 2VP9A 2VQEB 2W6IA 3V6LA 2V65A 3UGJA 1ORHA 3L0OA 1LPNA 4WDQA 1RVV1 1UZUA 3CF4A 3RYCB 1AGXA 4WX2B 1KGSA 2WI8A 4Z4GA 3FE2A 5LQJA 2QSJA 3KLBA 5KQPA 3K09A 3BGWA 4RTNA 1FUKA 3OJFA 1PLJA 3C45A 2HN9A 1F4LA 1I1HA 2PQ2A 1WZIA 3GROA 5AWFC 4GKAA 4JUIA 1KYVA 2WWRA 4H3SA 1V7QA 4FFRA 4HADA 3BHJA 5DW3A 2H1LA 3P9NA 3BGIA 4DC0A 3K0KA 4QASA 1TYAE 1Y8RA 2A1UB 3LP8A 2GD0A 3VU0A 4P4TA 4XPIA 1FFGA 4P93A 1CV2A 1XKQA 5ITZA 5KJ1A 4QOJA 1SOVA 3AQIA 5JDCC 3H1BA 5D3QA 4EG5A 1SQ6A 1G5TA 3EPJA 1GZ4A 4ARAA 3Q3CA 1YBFA 5JS7A 1RMTA 1JTFA 3EGVA 3JQ7A 1PL6A 1Z07A 1NW9B 4JLJA 3L9XA 2V7GA 4PYRA 4TZ6A 2ZBUA 1SXJA 4FC6A 1BCRA 2BFWA 3WLTA 3TS1A 5C1PA 4AQDA 2PKYX 1UJBA 3QU7A 2WQZA 4G41A 5KNCH 3AHIA 3KQYA 3U7HB 2PS3A 3DE7X 3TZKA 3OE7D 3E27A 5JSFA 1FU4A 1QLHA 4M0FA 1JDVA 1R9JA 1UBSB 2YZMA 1KP2A 1KQPA 1H65A 3HB4X 3JTMA 3AKCA 3PI7A 1GAEO 3UTDA 2C4NA 1KAQA 4GQBA 4OHUA 1TU4A 4E1BA 1N3IA 1GZSA 1W94A 3G89A 3NATA 3KQHA 3OLYA 5FBQB 4OQDA 5E8JA 4FFPA 3GIDA 3O6VA 3PUYA 2WDPA 3IVXA 3DGFC 3FKSD 4MKZA 4B1FA 3PA6A 3U4QB 1VGQA 2D7DA 4C5CA 4MI9A 4RESA 3QEKA 3DQZA 4RH0A 2JHAA 4HV4A 1QWSA 1BWQA 4MQEB 2QIPA 3P0EA 4OFWA 1KDVA 2ZVPX 2CK3D 4DTIA 2BFCB 1OROA 4EPWA 1G8PA 4RTLA 2F3RA 3O3MB 2KBFA 5CFPA 2HIMA 3EHEA 4DAEA 1E1LA 1U8AA 2AUTA 2GOYA 3LGSA 4I08A 2V7QA 4X3OA 2HRCA 1SQSA 4D9FA 3AFMA 4RZSA 3WK6A 3A1NA 2OG1A 2GMWA 4C07A 1ACMA 5GOZA 3OTOB 1G9TA 2YWBA 4I1VA 4MUJA 1JWBB 3NBFA 3T7EA 3VZDA 5JQWA 4OL0A 1IBSA 3E9DA 4FBLA 4PPGA 4R69A 4FMDF 3C41J 3J7TA 4GMDA 3STUA 1Q0TA 4M6WB 5K4HA 1KI1A 1UMCA 2VDPB 2WU0A 1AXRA 1TD9A 1F12A 2I71A 1O5OA 3QW2A 3OOJA 4QNMA 4ZJZA 4AY2A 4AJ1A 1Z25A 2ZVQX 3DFZA 4G0ZA 1T4DA 5BV1A 2SKDA 5IJ0A 3EUWA 3EZGA 4W9NA 4GL4A 2O2GA 5SICE 3FHOA 3UJ7A 5EZYA 1L4FA 3WYAA 5A62A 4M8NE 1ZM9A 2M2IA 2XF2A 3EQ7A 3PITA 2UZIR 1ODCA 2QUKA 2V7VA 1FPMA 4WH0A 3FA2A 3O9ZA 3SKXA 1AKEA 3VDQA 5H7XA 2BTQA 2BMDA 2XNDD 1QIFA 5SZHB 5BVHA 1A04A 1XRNA 3KVYA 4DY4A 1Y3BE 3GCWA 4D82A 2OC4A 2ADOA 1RIFA 4C76A 3PXBA 5J2UF 2JLWA 2FXVA 3F5DA 3WLOA 1NJ8A 4YRZA 1BX0A 3GNQA 2ILTA 5D7BA 1ZK3A 1BMDA 1XE3A 5LLTA 2DQ4A 5IJ9A 1AKWA 3IS3A 3CN7A 3WNBA 1GNPA 4LI0A 2X7HA 4M54A 4HGQA 3A3OA 2CW5A 3R5JA 5JD6A 3CX3A 2ZIGA 1RFGE 3BILA 2A5GA 1XAHA 2BEVA 1OXVA 2PMFA 1E64A 2QMUA 3EQ2A 2CWWA 4HWKA 4I6EA 3OOSA 2IWRA 4X94A 2DXIA 1PX0A 1JJ7A 3R6GA 5H1YA 3D4NA 2Z56A 2X0DA 5ILGA 1J2RA 3ICCA 5TPWA 4QFCA 2O2DA 4MQ4A 1ICIA 4ZP1A 4EVRA 5JY6A 5F51A 1QVAA 4C0WA 5KSYA 4DABA 1U2GC 2EV9A 1YRHA 5DI9A 2PT6A 1H2HA 3OUZA 2WYIA 4HRVA 4MVJH 3MMZA 5AW6A 4KN8A 3HY3A 1QCYA 2P2NA 4V0OA 5LDDC 1S8AA 4BEVA 3OG9A 3T3DA 4D4KA 2QJOA 2QT1A 1J90A 1U3DA 3B8HA 3SS9X 2H92A 3PGXA 4EHAA 1KWKA 4YBZA 1BXGA 3BWXA 3JQCA 1U0TA 4L6CA 5I9SA 3UHAA 3N9IA 3NKLA 3UCFA 4GWGA 4H2DA 4EY8A 2PO5A 4QPZA 3E2MA 3IQIX 4MV3A 3OZBA 3GCGA 3FUWA 3IIKA 2DQSA 3K5PA 4IEEA 3WGTA 5JLJA 1KEEA 1ZPDA 2IOFK 4K8RB 1WSDA 2WD8A 1OHHD 2WYVA 3L1HA 4F3KA 3ILYA 3ZHBA 1D04A 1RLJA 2EQBA 2IU3A 2W2XA 1A82A 1F1JA 3DBOB 4NVRA 4MUEA 3S2ZA 2G9ZA 4RA9B 3N8HA 4ALJA 4K9OA 4DV7B 3DTTA 4R3UC 5EXSA 1KHHA 1QAQA 1KI6A 1PLKA 2KW5A 2W6JA 4MHOA 5HS6A 1ZD5A 1GQFA 3C16C 1MTOA 2VKQA 3LT4A 4CF7A 1IRXA 1YC5A 3DJFA 3KCQA 3TDMA 4Z3KA 3KJXA 1M1UA 1B15A 1M34B 2A9VA 3DAHA 1BN6A 1GCAA 3EFEA 2JAWA 5JVDF 4TT3D 3ZJTA 3M9XA 4O29A 4F7WA 1SKQA 4N3BA 4RSGA 2NSDA 3ZW9A 1DX6A 6YASA 2P30A 5DHUA 5JECA 3A4TA 3PEWA 5LLDA 3HA7A 4M8SA 2PD3A 2NU9B 3T12A 1WUJS 4KMRA 4I3GA 4XDYA 4B82A 2NYVA 4C6TA 1O96A 1DZIA 4AFNA 3W5IA 3WVNA 1VFNA 4FQ7A 3JWPA 5DNWA 5EEGA 1E5TA 5KYXA 4RD1A 2C94A 4PZYA 3KDPA 4C0QC 1R10A 4Y67A 4QXPA 4A2QA 1LPBB 1PZXA 1Y4ZA 1YRYE 3IQDB 3MWLA 3MJSA 4RE6A 3AL3A 1VLJA 2J7KA 5AHXA 1KKLA 4ZAWA 2H7YA 5TJ9A 2PEYA 3P2YA 3D7KA 4ND1A 3AEKB 3G2PA 3NVMB 1WHTB 2WYUA 1E96A 3IUJA 2W6ID 3MF4A 4H3HB 1HKHA 2G0NA 4R7ZA 4KXUA 4E14A 2L17A 2I1WA 1WAMA 1P7CA 3V6MA 2OPBA 3TXAA 3JV7A 2PKQO 4D3FA 2VHTA 4I46A 1CZOA 1PJTA 3LW8A 5LQCA 3L4JA 3VR6A 3EGWA 1TMGE 4C20A 3B78A 2Z5FA 4M3NA 4N48A 5CTJA 1KJIA 1UBMS 1P4RA 3KJNA 4IMJB 4P86A 4ZRMA 3TQRA 4E2WA 1MMFB 4FOOA 5JI3E 4LVUA 4RK0A 5DI3B 1R8YA 3SIXA 3HR4A 3GYGA 3JQBA 3ND7A 4AKHA 1A7JA 5H16A 3DMFA 2A94A 1TTTA 3F5FA 3WB2A 1C3JA 4DV3B 1RXVA 4GI3A 5AK3A 1J33A 1SJ9A 4Y6RA 3MT7A 4OMFG 5H81A 5AD1A 1W19A 1QS0A 2H1VA 1B3RA 1BZYA 1Z38A 3L6CA 3MBIA 3FYUA 5FP0A 3M3DA 1E9RA 3AF2A 5KYUA 3ZLJA 3FPJA 4UULA 4I8DA 4DA7A 3IKMB 1ECGA 3HL0A 4ZT5A 5TGDA 5KYTA 1P3JA 1SXJD 1EWKA 2HDNB 3WKDA 4P81A 4PU0A 2D3TA 3WDMA 1XTKA 5IT9A 2XECA 6LDHA 2XRZA 1NLYA 1T36A 2PUBA 5IUJC 1ETHA 2RK3A 3GLTA 1IMJA 3SOPA 4BL5A 3Q5GA 1OJLA 2A7XA 2G1AA 1RRMA 2ZI9A 3O8OA 1PNVA 4LVNA 1FBTA 1M2HA 1V1JA 1IAVA 2FWRA 1GYPA 1VPTA 4C0BA 4WXEA 1YMVA 1RZRA 3DQQA 3IKLA 3TJMA 3WB9A 5LZ2A 2B5VA 3NXKA 1WEHA 1OT5A 1G17A 1EWTA 3EXEB 1UXGA 5IXJA 2F8TA 4BYMA 4MGYR 1MHPA 2OKGA 4A1OA 1CUBA 3UC5A 2HT1A 1MQAA 1LS6A 3NHJA 5BNZA 1DUSA 4JBHA 3V2GA 3BIFA 4JJFA 4CN9A 5E0KB 2XNCA 1QBKC 3BE5A 5JNTA 1KFJB 3HE3A 3PJEA 2JH8A 4MR9B 5K8TA 3G5TA 3WO1A 4UTNA 2FX3A 1VDZA 2CLIB 3I09A 4OV6B 1BDJA 4X3CA 1H6CA 3DEFA 3SHOA 4DA4A 2G25A 5KMGA 2DPLA 3R8FA 2V7QD 5JISA 2XIQA 4P53A 2BMFA 5ADUS 2WTNA 3CCFA 3EXG2 4HDCA 5CW2A 3FBGA 4E08A 1N5DA 1CRQA 1K98A 4IHQA 4UM9D 4EKNB 6ADHA 4ID9A 3N2GA 2NU8A 4MQFB 5K9ZA 4PN7A 2Y1KA 1RC0A 2HRRA 3GGDA 4PQEA 1DIGA 1Q3KA 2RHJA 1QK3A 3DFMA 4XGNA 2OXCA 2XJ9A 1LZLA 2OO7A 1EG2A 4RTSA 1RDFA 4HAWA 1HZZC 4XUCA 3SJZA 3P9CA 1N2EA 3O4HA 3FTEA 5B3JA 2YX1A 3AB8A 4OQPA 1OYOA 1PZEA 4WCDA 3EPRA 3DDNA 1GRNA 1TYBE 5FEMA 1QF7A 2PRSA 3V8EA 4WD3A 2P4HX 3G2LA 1LBEA 1U2DA 5TVKA 2HV9A 3QV1A 2I91A 4M0UA 1W1UA 1WEKA 3EVFA 4EVQA 1KI3A 1L5ZA 2L42A 2LDBA 3BMQA 1Z5WA 3SHQA 4TYYA 1LTHR 3F6PA 3OZ7A 4XLTA 1WMSA 4FIDA 1WS6A 2IYUA 1XTTA 3AP1A 3KUCA 3TFQA 4CCSA 2OFXA 4HGNA 4FONA 4KWCA 2IWHA 3U3RA 2OUKA 4IHJF 4AUEA 2VA8A 3KYCB 2CVPA 3BQ9A 5KWVA 1QQAA 1UM8A 1AXEA 2QM8A 4H6VA 4HYQA 2B5WA 3GT7A 3ABSB 3V8PA 1IVSA 3FCXA 1G7TA 2F8LA 3ESRA 2X0IA 1A50B 1P2DA 1QHGA 4FNOA 2FQXA 2JIZA 4JMLA 3H16A 4N1AA 2IUEA 3FDXA 1AZTA 4LYYA 5H68A 4WLVA 1MH9A 2ZYUX 3QPVA 2WAXA 1R4NB 4IQ8A 4Y0AA 3ZWMA 1CUUA 5GZ6A 3VMMA 2L69A 1BH6A 1FFHA 4MW7A 2HPZA 1JH9A 1VHDA 1NN0A 2CUZA 2R8OA 1L7RA 3OCVA 4PYQA 4XQCA 4YP5A 4B3SB 3ZQKA 2VTBA 4BRSA 3F2IA 3WMXA 4PNHA 3FCCA 3RYIB 1YV9A 3QYAA 4I7EA 5LOVB 1GTRA 5DK4A 1T26A 3DM5A 1RQGA 1ZI6A 3H9EO 4PC2A 1S5PA 4QVIA 3E48A 1YS2X 3NDBB 1CE8B 1FYFA 3SQXA 2GFIA 1DEKA 2NUPB 2W4QA 4IXDA 4ZPJA 4FOPA 4UXJA 4TMXA 1GTJ1 2RE8A 5DM70 1QJ4A 4TT8A 5AICA 2GN2A 2ODBA 4MXDA 1A5ZA 4IEIA 2Q41A 3ZWNA 1GPMA 1O9BA 4PRZA 1SXHA 4PYJA 2VXOA 4PIVA 1LLUA 4YUXA 2PSJA 4RYDA 1Q7EA 1UMKA 3FVVA 3FOEC 1EK5A 1FRNA 1Y4DE 4L57A 2AKYA 4PNZA 4RD4A 3X1WA 5CD1A 3L77A 3KQKA 4J94A 1KI2A 4MVWA 1EE2A 2OGWA 4ISBA 2Z9CA 4O33A 1N0VC 5LBTA 3KHUA 4GP6A 1NOKA 2EWMA 2W6JD 3TD2A 5AHRA 5LQKA 3VOAA 4D74A 1U0BB 3MCVA 2HUNA 1R5NA 1WXHA 1ZKDA 1I0ZA 4PCAA 4X41A 1ABEA 3PYMA 3QUSA 3DLIA 1FYVA 5TE9A 1LJ8A 1V8PA 2QLLA 3RUIA 2IJGX 2GKSA 1QIKA 1XB2A 2DSTA 4OTZA 3T3NA 3SN6A 1EA5A 4FGUA 4AP5A 2A4MA 3BFXA 5J43A 3SVZA 4KQIA 2IOFA 4RKWA 2HX1A 1RMQA 1Z0IA 3EULA 5BYJA 1YMQA 5DYYA 2ZZKA 2J9XB 4F9TA 1M67A 1UEXC 1K0UA 2W48A 3GH1A 1D0IA 1UK8A 4AZSA 1X94A 5ALJA 3TGWA 4FIZA 2RC5A 4ENTA 3GIWA 3D02A 4JLUA 3FG9A 4PLYA 3S2YA 1JKXA 1TKCA 3QA3E 1SVNA 3LQRA 3C5EA 1OX4B 1GQSA 5J2UB 2QW8A 2ZPTX 4D4IA 1WW8A 2XY4A 3IMKA 3FBWA 4ND8B 4DPKA 5ED4A 4DV1B 4INPA 2OGTA 3PR2B 1USWA 2TMKA 1TL7C 1D1QA 9MHTA 3OLZA 1G9XA 1ZY2A 4R9NA 2RJOA 2X9NA 2O8VA 5DOVA 5AJWA 3NM4A 5DWDA 5EC8A 4J0EA 2YN2A 1NJSA 2G4LA 3KUUA 3LHDA 4OXQA 3IR5A 5FTKA 4AD8A 3PL1A 4QO7A 3WA7A 4DEVA 4MTCA 2VC2B 1LLQA 4PHGA 3CXUA 2VSFA 3VR6D 1EFHA 1M66A 3PT5A 4LRQA 3GNTA 1RQLA 1JHOA 1TGYA 1VPEA 4UTPA 4RTOA 2A1TR 2CYBA 4FUQA 1YUMA 4NZZA 4Q05A 5JSZA 1G2QA 1XJQA 1Z5GA 3O4IA 1WKCA 3E9RA 4FZJA 4YRLA 1I2DA 3RRJA 2XEDA 2GPBA 5FOQA 2O54A 1N5MA 3MERA 2WK1A 4EG8A 3OPXA 3KOMA 4A2WA 2ZTUA 3EGIA 1LRLA 4DQUA 1A76A 2WIJA 4YJGB 3PPVA 3RFCA 2PBZA 3SQMA 4L5JA 1BW9B 2IZ5A 3QFCA 1XG5A 3W5BA 4Q6WA 1T5LA 2EHJA 2QRMA 3MLAA 3PFFA 4N0DA 3P0FA 2NU8B 3WMEA 1HF3A 4A5OA 1Z6PA 1IQPA 4QKQA 1WULS 3CGGA 5CT6A 2NO4A 4CEHA 2O7RA 4GO1A 3E53A 1VKHA 3RBAA 4ZT7A 1UT6A 2PEZA 2H4WA 1ZJZA 1A4UA 1NX6A 4L8VA 1EK2A 3WRYC 1QFSA 1QRDA 4JVSB 1Q19A 5JATA 3B2EA 3Q6NA 1BTOA 1ND5A 1CJCA 1E7MA 5BQFA 3OZXA 2VCYA 1VZ2A 3CT6A 3M49A 3ZWQA 3L8MA 2QT0A 2W11A 3KT8A 2DWUA 1U7XA 3FD8A 4TUYF 3TI9A 3IL2A 4YFVA 4OHXA 3K6JA 3Q1KA 5HKOA 2OY0A 5HILA 2GERA 5M5BA 2WKQA 3QHPA 2D1RA 4IR7A 3LHIA 3VDNB 1U9IA 4OHMA 5K0FA 5K8CA 4D8YA 5C3MA 2X2EA 3PDIB 5A7HA 4B3IA 3F98A 4JZYA 3KSRA 5KWJA 1PJ2A 4BFUA 5G1NA 3MTJA 1N33B 3KXKA 2AK3A 3E15A 4MLPA 5EUBA 1N5RA 4CTKA 1ZN9A 4W5WA 1K75A 1YFLA 6REQA 4CQLB 5TVGA 2WICA 2AEEA 2ZUDA 3A0RB 1N5LA 3OQ1A 3TXYA 3VR0A 4WKNA 4IZ6A 4HVCA 3ZGNA 2W5UA 3ICWA 1B6SA 2IUFA 2JC3A 2XLBA 4ITRC 1VG9B 2F1JA 3EXHA 3F6BX 4NE2A 3W77A 5KAPA 3PI6A 3W34A 3EXIB 4D8VA 1OXMA 1D9ZA 2XUJA 2B2CA 2ZRKA 1BA2A 1LDMA 2VSNA 3GDOA 3OIDA 1YCGA 2GEUA 2JRCA 4LDJA 4V39A 3UKOA 4ZHQF 3STWA 4IDAA 3UJCA 2JW5A 5L3ZA 3O92A 1NURA 1QIMA 4UOEA 2WTMA 4UEWA 4B5LA 2BISA 1GLNA 1SWWA 2AZDA 4ZU3A 1QVWA 2PR2A 2VYQA 2ZR0A 2CWDA 2DY0A 5C4GB 2V0GA 5I4KA 2FPXA 4JBGA 5AKLA 3EK2A 2GHRA 1CJKC 4CN8A 4UMDA 4HSGA 1BMFD 3ECCA 2VRWA 1M0WA 2AW5A 3HC7A 1A9SA 4PHFA 3CRW1 1XIVA 4I2VA 4HTFA 2IHZA 3QTLA 1TLTA 4RKFA 1WOYA 2FWAA 3EXG1 3RYHB 1YE3A 4EARA 4Q00A 5GV8A 1ZL0A 2XRYA 4MZDA 5BO5A 2QL7A 2VPYA 3P0RA 4IIHA 4DR3B 5JDIC 2PUCA 2EF0A 3EEIA 3JYNA 4NNJA 4BKPA 2Q4DA 1XP5A 3GRZA 4S1PA 4I1OA 1DXYA 1X7ZA 1FRFS 3LIPA 2JIZD 1AZWA 2BE9A 3NIWA 3TAXA 2XOEA 3D8RA 2ZJ1A 4KJXA 4RVFA 3CUTA 2BFEA 2O8CA 4QBIA 1QB7A 3LS2A 2C2GA 3PXXA 2JLRA 4PHTA 3RC1A 2W6NA 4M53A 4EJSC 1KIFA 2BW0A 5E3JA 4GXRA 3ZQUA 4HDRB 3U37A 5HDQA 3RBZA 2O59A 1A5TA 3D7SA 1ZS9A 3R8CA 2ZCUA 1M2WA 1EVLA 4QD3A 2CYCA 3CR7A 3WNVA 4A8JB 1GL3A 2AH5A 5CCBA 1W1IA 1K66A 3NW9A 5IVHA 3KIPA 1XYVA 3ZZ0A 3DC7A 4P5DA 3OQHA 1BHO1 4MKXA 3VX4A 2BN4A 2BF4A 2O3QA 5FOWA 3CR3C 1RW4A 1Z0JA 3ENKA 1O0BA 3U3MA 2F4NA 1E2MA 2HWYA 5E8RA 1AH2A 2B0CA 4Q03A 5E2IA 2XUQA 3GQBB 4QRIA 1WVGA 4BQQA 5THXA 1SVSA 3OZTA 5E6RA 4MNTA 3UMCA 2L82A 1JJIA 3MJCA 3LXMA 4ZRDA 1U8FO 1LCIA 1ZQ9A 2OXEA 3WKBA 3CT4A 2RONA 4TPKA 4PPNA 3GBVA 4DBZA 1W6UA 1KVTA 1XZ8A 2HU2A 5L51A 2PQMA 1G2PA 5JNWA 1KYIA 2HRBA 2QL5A 3ZWVA 5AOCA 4C7VA 1IM2A 1CZNA 3IVCA 2G1KA 1KIAA 3UPTA 4ND3A 4NS4A 1GCGA 5LUBA 2IS4A 3L1IA 4HDAA 3FTFA 1IOVA 3L1UA 3I0NA 3PUVA 3JD0A 4HQOA 2WIAA 2PO7A 1O89A 4HYYA 4JMPA 4PQFA 4WOPA 4WZAB 3RUHA 4C7KA 4YV1A 4KRFA 5LQUA 3CLSC 1N1MA 4RANA 1J39A 2IU0A 4ER0A 3KO8A 1T1GA 4IIBA 3W8FA 4ZEMA 1Z8FA 2Z30A 3SHFA 2I7CA 3G6KA 4HS9A 3OT5A 4RMIA 1R0XA 5P21A 1ZI9A 1CQPA 4WBXC 3V4VB 4MCJA 4DSOA 3VFDA 3JZIA 1H1LB 2IZ0A 3M7IA 5IULC 2V3WA 3Q5EA 1OB5A 4LXGA 1XOIA 1GTSA 1JXQA 1UDRA 2ZYGA 5KWIA 1M74A 1JQ5A 4HNUA 4AX4A 1QH8A 3HU1A 5DGDA 1H2ZA 3CB2A 2PZGA 1AKYA 2GEKA 2WF8A 3OQIB 4LDNA 4P22A 1W7AA 4CFYA 3DE0X 4BNWA 3HYCA 2ILVA 2J3HA 4C4SA 1E18A 1UMBA 4P7GA 1EDBA 1SY7A 3KQMA 3TVTA 1NMSA 1VC2A 1Y5IA 3DEJA 3DOOA 1GNLA 3OTGA 4TVSA 4DNQA 3MXTA 4B3CA 1FOEB 1R66A 3KPYA 5F98A 3PXAA 1ZCFA 3BCHA 3LLMA 1TZKA 1HX7A 1OFVA 3TTSA 3UT5B 1QE3A 2MR5A 1W9HA 3UBTA 2V54A 3OCXA 1NV9A 4G5OA 1KYXA 2P1ZA 4JBLA 2I8LA 1TUBA 1DBRA 4UKDA 3UPDA 3T38A 3JRNA 3QGMA 2IPXA 1JXMA 3B1KA 4A6XA 4EHIA 4X1YA 3TAHA 2WJIA 3U2QA 1W8IA 1HYEA 1VHQA 1ODLA 2BEUB 2C3OA 4Y6GB 3RWMB 4CR7A 4YIHA 1L4GA 4G67A 3BORA 2M6LA 4D0NA 4Y1RA 1EFCA 4U2GA 2JHFA 1EUQA 1RWQA 2WRZA 4GX5A 5K4AA 3K5WA 2Z0MA 4ZOCA 3TIIA 1Y7TA 4C4XA 4MINA 2IBSA 1YS7A 4PLTA 2BRUC 4HN4B 1YD7A 1Z0DA 1NNI1 3WQRA 4DEXA 2BBTA 2ZXFA 4KC0A 1XLTA 3RODA 2CV2A 1EP1B 4JLDA 4WWHA 2JGKA 4R2MA 1XMXA 4E2FA 2NZJA 1NBME 4GXTA 4DEYA 2I66A 4AL4A 3I72A 1U1EA 3KV3O 4LMRA 1AS0A 3PIRA 2AFHE 2GUWA 2Z4RA 3PC7A 4EA6A 2C7PA 2ZBFA 2OORA 1I1NA 1DJPA 4IFEA 5EGNA 4NL4H 1QG2A 1CS0A 2TRSB 3I2FA 3GEBA 4R68A 3W2GA 2WHXA 4UCQA 4UMEA 5JZBA 2VYVD 5LQAA 4MRMA 4YECA 5CRIA 2RJ3A 4X91A 2R66A 1A2BA 1Z4MA 2ZAOA 4I9HA 5F1OA 2J3IA 5LM3A 4FZ3A 3FDIA 4CDMA 1RC1A 3ICOA 3O0TA 2LV8A 2ZREA 4RSMA 1TD1A 3SR0A 3WLSA 2H1SA 3BERA 3PG5A 3MNFA 3UH1A 5CH5A 5DYNA 4BGEA 3R3SA 2W37A 5IDQA 5I8WA 4M86A 2JBAA 4ND5A 3GI1A 5B2ZA 1L7EA 2RGNC 1ZC4A 1ZIDA 3L0SA 1JFLA 5F2KA 2KB0A 2OMKA 4IQFA 4BB6A 1OGYA 4TXMA 2PXXA 3T4EA 5IJZA 3QXXA 4MIEA 3HR7A 1P2BA 4WLOA 3EVCA 4WVLA 4NNPA 4Y18A 2ZSIA 3WOVA 4D6XA 1GNVA 2FW6A 3GGJA 4D97A 5FR2A 2ZI7A 1X8LA 3HO1A 4UBJA 4P4SA 1L5RA 1NHWA 1RI2A 3MRVA 2CB0A 4M1EA 1NC3A 1U1CA 4QULA 3WHPA 3I1YA 4FHZA 3T7SA 4NC9A 1KMHA 4KDCA 1OVGA 4RY8A 3F6SA 4KREA 3KR2A 4HH1A 5DSXA 2PFGA 1XRMA 4HTAA 5B4VA 1Y1RA 2B4RO 1M2GA 3Q2OA 4ZI7A 4F8YA 1LGYA 1T6XA 3NPAA 1GO2A 3WDKA 1L4EA 3EMDA 1E5LA 2VIIA 1V4NA 2QB5A 4QG7A 3RI3A 2JLCA 3G88A 1P0IA 1AUPA 4AWBA 4XW2A 5TT0A 2IZZA 3BTSA 3GLHE 1QGUA 4MHSA 2IU4A 3KHKA 4CG1A 3AEUA 3OLCX 1UDCA 4YRRA 1VG1A 3C3AA 2OCXA 1TVKA 2R68A 3A58B 2UYQA 4EMTA 1N9GA 2HHCA 4KK3A 3TL3A 1OR8A 3PUKA 5I9IA 3M4NA 2WAOA 1I5RA 3AEXA 3JD4A 3TTYA 3VTZA 1WXGA 3ZWCA 4YFYA 5E7QA 4KGXA 2B36A 3A37A 4J1TC 2XOXA 3L7CA 1GG5A 1SURA 1X7GA 2XMBA 4DBVO 1XLUA 2QVCA 2HDHA 1B8OA 1RXIA 1GITA 2JAHA 1ZZGA 1P0FA 1Z7BA 4UUBA 3S2UA 1FY2A 1HOXA 3VNUA 3DKIA 1OD6A 4Z7JA 1WUYA 1JE1A 2YHBA 1Z5NA 3HJAA 4DLPA 2Z2KA 3BB3A 3Q5DA 3V9AA 1ZITA 2ECKA 4YRIA 4KMMA 4D02A 3DBLA 3VYRB 4OQ4A 1W75A 2VWHA 4DUPA 5ICMA 1J1UA 1UWLA 2AOUA 4OH7A 1M1NB 1XCBA 1IU9A 3KQSA 4LSMA 1XTUA 4AVYA 2QRZA 1X1DA 1RQNA 1JEQB 4Y2UA 5U9CA 3CVWA 3M6FA 5F4BA 3FHJA 1D4AA 3Q7IA 4FFBB 2PZEA 5CUQA 2CXHA 1N2GA 1NXQA 1SHUX 2Y68A 4BBZA 2QVZX 4ZO6A 5BUQA 2AJCA 1U02A 2FQWA 4FYHA 4L15A 2H6EA 3DEAA 4FXPA 3ZJUA 1O9HA 3CNNA 4FWIB 3VR5D 3EWIA 4ZOAA 1Y4UA 2F9MA 4M8KA 4NBNA 2CDAA 1SZPA 2UKDA 2ZTVA 2FCAA 3GJ7A 4JJ6A 4MUKA 5JC8A 4COOA 4RA6A 3ED1A 1L1EA 4NBKA 3CMMA 3G0OA 1FCJA 5KDDA 1IPHA 2ZXEA 1RI3A 3FHCB 1F48A 2FXIA 5IBQA 2G0AA 2FMKA 2A9JA 1XNJA 1GQ2A 2VBFA 3AC0A 3VAZA 5K6RA 2CHUA 5CCXA 1O8CA 3MOGA 5JOQA 3RE1A 3LM8A 4WXYB 4PAMA 4PLZA 1JKJB 2GASA 4LI3X 3OA2A 4D79A 3O47A 4ZQGA 5FBKA 2FPGA 2WZCA 2WFLB 3K32A 3WTCA 2D4HA 1L5GB 4NCNA 4B8YA 5HW0A 3QQ5A 1X74A 1Y3DE 5AK5A 2RGYA 1RCTE 2ZTHA 1MF7A 1MO3A 3D9QX 3W7AA 8MHTA 3B70A 1Z8DA 2PMKA 4RBNA 5CEEA 4JAVC 2O3JA 5TLSA 2PGLA 2ZYHA 2O7SA 4KE9A 3PT9A 1B1AA 4N3AA 1T3TA 1GVHA 3IV9A 1D4ZA 2JANA 3JWIA 4ZHQB 2MYPA 2NSYA 2ZRGA 1GQRA 4TWBA 2HFJA 3GRAA 4X71A 1BWPA 1KJYA 1MX9A 1WPQA 3LCJA 2ZKIA 2N42A 3Q0EA 1HFWA 4NJEA 1Y7HA 5BR8B 4K2HA 1QE5A 3JYOA 1OY1A 2R1VA 3WP1B 2R1TB 4M38A 1VIAA 4QX6A 3EGXB 4W5NA 5JIBA 1VKZA 3BJRA 3KYBA 3LT0A 1G16A 5HQ3B 4AS1A 4LFCB 4R01A 4G1FA 4LWZA 5HVNA 4LJRA 3HKDB 1JEYB 3LC0A 1KOFA 4XUGB 1IN1A 3GMSA 3M5DA 2W2MA 4BU0A 3U3XA 4BX0A 1X39A 1IN6A 3NH6A 1UZLA 2G06A 4P2BA 3N2NA 4CKWB 4YPOA 3REGA 4EF5A 4QTUB 4Y9DA 3U4GA 1YJ5A 2FPRA 1HV8A 4NY1A 5JD5A 2DT5A 3OY7A 2G82A 3ELWA 3INGA 4XUDA 1OZHA 1H6BA 1ZUIA 3EZNA 2GZMA 4E4YA 4YP0A 3R7WA 1IZYA 4KPGA 4GPD1 2QNRA 2PH1A 5HE9A 3VAAA 3VOTA 4RH1A 4HG2A 3WMFA 4V38A 2K7FA 1BVYF 1SUSA 2ON6A 3NWEA 4UNSA 1FS6A 1YB7A 5JAIA 2E4XA 1DU4A 3QXGA 3UATA 4PSKA 3SDZA 3ID6C 3D3WB 4KUGA 4R51A 2PBRA 1MC5A 1RQ7A 2FG5A 4NMLA 2OZLB 2I4TA 1X7YA 1XCPA 3MD0A 2QTFA 2ZCVA 3D1JA 1PD1A 3GN1A 3NRCA 5ECDA 3UQZA 4BVBA 2WYOA 3DXZA 4ZMBA 2SKCA 4RFSA 1HDYA 2AXPA 4JYCA 3SICE 4FFVA 3ZQ6A 4DZZA 2I3AA 3PJRA 2F8SA 1U0GA 1QHHA 2RSLA 1XTIA 3OQJA 3V55A 1YMUA 5FUYA 4K9MA 3F8SA 2CJWA 1ZNQO 4FILA 1PZHA 1QTRA 2MDTA 1PYGA 2CLEB 3TL2A 3V80A 5BWCA 4JJGA 1E1QD 2OEPA 2ZB4A 4MMXB 4J16A 3FCUB 2FZWA 2ZIWB 1BH2A 5EPUA 2HA7A 2JCVA 4WN3A 3MA0A 2FRXA 2RGUA 4DR2B 4OXIA 4PS0A 4X5OA 2C4WA 1JHYA 3PDUA 2NQTA 1WW2A 2B98A 2SKEA 3OETA 4H0FA 1Z74A 2FN3A 2G70A 2IKSA 3KOXA 4B3DA 3TBHA 5FUMA 2PTHA 1F4PA 1QH0A 4X9XA 2HJHA 3PRHA 1RWOA 3W05A 3GRYA 2Y93A 5D01A 2Z6VA 5HR5A 1DTSA 1PVVA 2CNKA 2EFGA 5EINA 5L7WA 2FJPA 3BK2A 2VP6A 3GG9A 4HS4A 3S1AA 1WJGA 2F43B 4FS3A 4WXHA 1I33A 4XFDA 4IQ4A 1QH1A 1W2GA 4YC7A 4CM1A 3NX4A 3U7GA 3GT0A 1UAAA 3M2PA 3BH7A 1GV0A 3UBMA 3GDFA 2OBNA 3CNBA 1GL6A 3O1LA 4NK4A 4CWAA 3KAKA 2TMGA 2YFYA 5BOSA 3NEPX 4W5HA 1FDUA 4X84A 4OG2A 1W85B 5I7VA 2QAIA 3BL5A 4GU5A 5BOSB 2HT6A 3IMCA 4IJMA 4EOGA 2H8GA 3UAXA 5COBA 3OTQA 1KR2A 4GKKB 4LCBA 2B6NA 4XE5A 4P83A 4R81A 5T8KA 3KR9A 5CIYA 4TV9F 3ZCVA 3DMTC 4FD3A 1TIKA 2J9YB 2RI6A 2VWGA 3LT2A 4P31A 4BX2A 1HNWB 2ZJ4A 3I32A 5DHAA 4KFRA 2EFHB 4HLUA 4V0QA 3ROMA 1KWGA 2RHCA 1JNXX 3DXYA 3V32A 2FZGA 2GM3A 4BJ3A 4EBBA 5IPFA 3GFSA 3K0AA 5JZOA 1U2ZA 2AD5A 2HCBA 2IE0A 4HAYA 5HRCA 2Q3LA 2ZQYA 2I2AA 2MCFA 1NL3A 1NP7A 4FW8A 3T0GA 5BQXA 2PWAA 3R3ZA 1CY6A 1M2OB 2EAUA 5HWSA 3OO0A 3MN1A 4GKVA 3PWKA 1C1DA 1UIRA 4ER3A 2XKKA 3VZQA 1UKBA 2MYNA 1XQXA 4NZNA 5DN9A 3ZHSA 4XWTA 5MDHA 1J8YF 1G5FA 5FO1A 1CHDA 2PVPA 4AIRA 4BIMA 4AZVA 4JGGA 3OE4A 1QFJA 1XZNA 2BBOA 3BYZA 4DWOA 2AFRA 3H5WA 3BSYA 1EFVA 4FC7A 4DYHA 2AOTA 4N0MA 4ZVSA 5EKXA 4B71A 1KK2A 4PHHA 2AG5A 4ARSA 1E3MA 5DLQC 2ZTLA 2YJ6A 1VXRA 4Z9BA 3FVQA 1GZVA 4BC0A 4D92A 3LZ6A 2MR6A 4HNSA 4L6IA 4B32A 2W8BA 3SC2A 3GOHA 4QFMA 1JIUA 3PHHA 3D31A 5GM1A 3GVCA 4FMCB 1SRQA 3ESDA 3QFFA 1TC2A 4RHTA 4F6RB 2SNIE 2RKOA 5GAJA 4IJKA 2WNSA 4MGIR 4Z0NA 1QQ6A 2VYFA 1UK7A 3E18A 4HQKA 4MV6A 2WWXA 3KR1A 2C9CA 4X1IA 3UMFA 1LNQA 2G28A 3GFVA 3TLEA 2VSXA 3EC1A 3DYIA 3IVMA 1ZQ1A 3PGA1 1RLUA 2QSZA 2X15A 1DPGA 3RVDA 1L5OA 1L5VA 3L7MA 1V8ZA 1W25A 4WT7A 3NTLA 3T7JA 4CMBA 4R9RA 1R27A 2O8EA 2DHQA 4MWSA 1U94A 3CKMA 3Q88A 3CNOA 3D3KA 3QVTA 2NNWB 5T4FA 3TPCA 3W5VA 4ZYVA 2VJMB 3ASYA 4C01A 2WU4A 3ZLUA 4HAUA 3KVVA 1M1YB 4IL5A 3LQYA 4OJKA 1G20B 4OBBA 4WRRA 1GV1A 4FXOA 2Z8YM 1JDTA 3M9LA 5G02A 1EP2B 3EFOB 3GBSA 4KO3S 4RVNA 4E5SA 4R8LA 3HCOA 5KNCA 1BYUA 2FQQA 1K6XA 1RXSA 5JDCA 2F67A 3ZLVA 2AFHA 3RAEC 3M1YA 1A2KC 4UXIA 3WRWA 1ZGHA 4OKIA 3CLVA 1K4KA 1UP4A 3LBFA 5A5FA 5I48A 4OP3A 3DCYA 1TM4E 1OYWA 4RF2A 4QU9A 3JAWA 1AZSC 1FMLA 2I2WA 2WKWA 3WAKA 3Q72A 3LWNA 3AI1A 1V8FA 3OM9A 4KXMA 3STTA 2J6BA 4BNDA 5DRTA 4UTOA 3EC7A 3PX3A 4J0FA 4W99A 2NVOA 2P5UA 4ENVA 5BR7A 2WWHA 2EQAA 3FTQA 3OMWA 4GYKA 4EO4A 1NBIA 2Z3VA 3FFAA 5KBYA 5EXXA 1NLFA 4XB1A 4N0PA 4C7MA 1NXPA 4K0KB 1R0KA 2WM8A 4OGFA 2QZ9A 2DTDA 2QOEA 2FCRA 1S8FA 4RVSA 5BMVB 1ZSYA 2C2YA 1RWKA 1G5QA 1WUIS 1YASA 1VSTA 1NVDA 2ZSKA 3D8UA 4WAUA 4A73A 2XOKA 4D42A 1NHGA 2FZVA 1EK6A 4K1XA 2J07A 1NP3A 1P4JA 2HMSA 4FZ5A 4H0NA 4INOA 1DG1G 1ZINA 1SKYB 2CNWA 4JR2A 1VBNA 4YRJA 5EJ9A 3LUJA 1WO8A 4US1R 3FBTA 4ZVPA 1I7NA 4IDNA 3W5DA 2FG6C 4TV8B 1CKEA 3O7WA 4HAOA 4G5GA 5FH9A 5GINE 3L6RA 3CPEA 3LP6A 5EUMA 1CZRA 1QHYA 3EIXA 3W6PA 3PD0A 3TEMA 2JRLA 1LBSA 1DNPA 4ARUA 4Q9NA 1DT5A 3LU1A 4HJRA 4F97A 1KK1A 1KYTA 3DE4X 2V74B 4DN6A 5CLFA 4DMCA 1B6RA 5CDYA 2DB3A 1XTQA 2CHEA 2XNSA 3AHCA 3GLHA 3L2OB 3ND6A 4L5CA 3H6GA 5G0VA 4C7JA 3EZ9A 1HY3A 2XGJA 2I3BA 5JALA 5CNKA 2Q0QA 3GEPA 2OP0A 2DPXA 4FYMA 1RPNA 4NMHA 4PTLA 3KJEA 5ER9A 4F71A 5C18A 4FYKA 1J0EA 3FMIA 1F17A 1QQ5A 1I7SB 3PU6A 3TTWA 3N53A 4B4KA 1PEAA 1Q0ZA 2ZYWX 5TF0A 1IBCA 1WZCA 5FBZA 1PJBA 1P60A 1V1RB 1E60A 3BWYA 5KYNA 1CUFA 1BGVA 4C4ZA 2NSLA 1WVMA 4TLBA 2V5UA 4HLQB 1VPLA 2KS6A 4RPJA 1HDGO 2RHWA 3F4LA 3A04A 4N01A 2HLDD 4XKJA 2OXRA 4ZC1A 1Q74A 2ZSFA 3VH3A 2ONJA 3SWWA 1ZA1A 1RXWA 3SEFA 2CY0A 4IEFB 4MWTA 1M1XB 4UCWA 3J7AC 1AV6A 5JYEA 2B92A 3GDWA 4C29A 3PE4A 1S2MA 4JENA 4F9EA 4C06A 1RQRA 3AZOA 3AHJA 3RC8A 2G1UA 4KR6A 1W2HA 4CQJA 1Y1KE 1P19A 4HPXB 4IWXA 1TXGA 3URKA 3I37X 4A10A 3MUEA 1JQDA 1CJMA 4CGYA 3PV0A 2EFEB 3OIFA 1PD0A 4MVJA 1RRGA 2VDWB 5TR9A 1JSZA 3OLWA 3ZXSA 5T6MA 1K5GA 3ZWBA 1G7CA 1RAHA 1SXGA 1L6RA 3HB7A 4IIDA 4ZOLA 2XKBA 5KNBD 1XDBA 2IDZA 3X1KA 3ZE8A 5F76A 1M8PA 1T43A 1WHSA 1KO8A 4LDPA 4UPVA 1G64A 1U0RA 3ND8A 3DLTA 2YFQA 4KXXA 3TYXA 1QKIA 1XZIA 3IQHX 5JCPA 2Q2WA 1UPCA 2WDZA 1B42A 5HOEA 2O8NA 3KLMX 1R6AA 2XBUA 3QX7A 1DIHA 3ZD8A 4NDNE 1Z3CA 1AUXA 1OI3A 1OIXA 2AUMA 2VOEA 4MV7A 2HSZA 4YCLA 5CYPA 2Y1CA 3R75A 1TMOA 1JALA 4YAFA 3ZHZA 1JVBA 2AQIA 3KL2A 2CKDA 1OLUB 1XWFA 2ALJA 2FPWA 3PK0A 2BKUA 3D3QA 4IFIA 1DE0A 2R1ZA 1E6EA 4PAOA 1A9PA 4PG6A 1US8B 1XA0A 4PRYA 4K28A 2BAGA 2XUZA 2WJJA 3MINA 1R0LA 5AKJA 3KU1A 4M1OA 3I2GA 2RKWA 1X19A 2X2FA 5JCOC 1T4CB 4IIJB 1JQEA 4CTNA 3FCYA 2XYGA 4HBZA 5LP6A 2J9FB 4YP9A 4L16A 5TRTA 1WXIA 2A0KA 3HJNA 4FFNA 2ZRJA 4P1ZA 3HV0A 3ETHA 1L7PA 4QBHA 3VC1A 1NOJA 4N39A 4NFLA 4JI3B 3FPFA 1V48A 4CLOA 1D8AA 4JA2A 3ROXA 4ARBA 4B45A 2TS1A 3IBGA 3ZJYA 4Q7LA 2DU8A 4ZK6A 2V7WA 5LBUA 3UMGA 3HDVA 3DMGA 3E23A 3PFCA 3B7WA 3QE3A 2C61A 3RS8A 4QAJA 4FZRA 1H8EA 1K7SN 4TGLA 3HN7A 4ZMRA 1GGHA 2F8MA 2DR0A 2YQZA 3I9FA 4K03A 5D3KA 2REXB 4BE4A 4TZKA 1EFUA 3HHPA 2ZIAA 4RGBA 2P4SA 3WSWA 2Q6OA 2BFFA 4FDMA 1V5WA 3E03A 2FW1A 3K0SA 1HLGA 3DZJA 1WB9A 1KRWA 4O4LF 2IGBA 4W5OA 3RR2A 2F64A 2O2EA 1ZIYA 1YBHA 3VVMA 3WLMA 3BMNB 2GYVA 4YT8A 4DRXB 1ZN8A 1D0SA 2QP3A 3D54D 1QQ7A 1R6DA 1T2EA 1UDXA 2B8NA 1WNFA 1GZHB 2JD2A 2QW0X 3AB7A 4D4MA 3NALA 1U2QA 1CSEE 1ANKA 1JH8A 5TEWA 2FEMA 1N1EA 4X1OA 2C78A 4CKCB 2PBLA 4CKZA 1IAQA 1MQ9A 4WK2B 2VHVA 3DSRA 4B81A 4BFCA 1E3WB 3HHEA 5ITVA 2GNPA 1NZFA 1GU1A 1FXUA 1ZGGA 3K16A 3TLAA 1NVMB 1LKZA 4KE8A 4MH0R 4UQLA 2C42A 1TJNA 3U4CA 2VP3A 3ONFA 4GR9A 4RWZA 4IILA 4KVAA 4XWGA 5B3LA 1JHXA 3IAM6 3BTUA 4IINA 3IEMA 2YVLA 2VP2A 3PIDA 2D00A 4GPEA 4OAOA 2OZVA 4DM4A 3GP5A 3IODA 4OLHA 4JXKA 1W73A 2ZRLA 1MDFA 2JHCA 4S1OA 3TR0A 1YTLA 2QTMA 5KNCD 3HKCA 4EAQA 1LX7A 2EJTA 2VNKA 4OGGA 3V1LA 3T15A 3UWKA 3O3CA 4Z53A 5JARA 2PLRA 4GKBA 4IDGA 3DD5A 2ZYAA 4Q1FA 3VPBA 3WLKX 5C80A 4LV5B 4S04A 3QKTA 3L4BC 2GD2A 3AOEA 2GHQA 1KXJA 3A9WA 1JU3A 2PSEA 4OQMA 4Q7EA 4WEQA 4BO8A 1TRHA 1UT8A 2XNKA 1IVNA 3HCNA 5D6NA 5B1IA 2WWFA 3B9BA 1SKMA 3BC1A 4FUTA 4ZO9A 1C7ZA 3ADBA 1FS4A 5ANRB 2XSZA 4EF4A 4ENWA 4NG4A 4KQJA 4V3BA 1M34E 4JI6B 3LA8A 1YC2A 4V1CB 4D3SA 1BG6A 1V8BA 4JBWA 3ORQA 4NWIA 1JV2B 4R1UA 2FR8C 1SG0A 3BMCA 5H80A 4I55A 2UYHA 2LW7A 4Q66C 1AKVA 5LQSA 4BN4A 3DH0A 1U0HC 1BEUB 4DW8A 1G1AA 2HM7A 2PANA 2SCUA 2HZ7A 1T8WA 3KOZA 4X7BA 2ZULA 4C30A 3SMQA 2QTWB 2B7CA 2PL3A 2XMSA 3KSUA 3QI7A 1CWUA 1UKVY 4KH1A 5AXDA 3SVLA 3ZG6A 2CNWD 1S7GA 2YJGA 2QD3A 3U09A 3C1TA 1QGAA 4FMPA 2IFTA 2HNAA 4JC4A 3KQTA 3ZE9A 4DLUA 2GPWA 1PFKA 4TZTA 3JRXA 4AY3A 2ZAYA 3K15A 3JRWA 3U1TA 3UUWA 4BQEA 1PF7E 1DC6A 1EXWA 3KKPA 1LK0A 3BIXA 1L5YA 4IZIA 1Y9ZA 4PLHA 5CA0A 4Y6OA 5GM2A 2O7NA 3FPLA 4UU0A 2JAXA 1WWKA 5CLGA 3HFGA 5IVPA 2Y1EA 3D3EA 3X2FA 2I4NA 3CCCA 4MRRA 4OP2A 2W43A 1ARZA 3V4ZA 4AXXA 4AP9A 5EMHA 2BMEA 4IGIA 1ADGA 3QWAA 4CMIB 3VC2A 1MJ5A 1KPIA 2PT7A 4Z9YA 4G0WA 2EJWA 5DTMA 1CY7A 2N9UA 1BRTA 2V6GA 3I8OA 3N59A 4RC9A 1TM7E 1USKA 3BCUA 4C87A 2EDCA 4K3VA 4MPPA 3CZ9A 4IG9A 4FFLA 4QHSA 4QODA 2WABA 3OU6A 3WADA 4JC0A 3T7KA 3H18A 1QP8A 2AFIE 3QHQA 4YPFA 2C5SA 3DDHA 5FR1A 4BMYA 4RLSA 2WF7A 3QM1A 4KQ2A 1PDWA 2PJUA 4ZQCB 3ZUGA 4FEEA 1QUEA 5ER6A 5I9BA 4KTVE 5G4KB 5CTAA 1BQ3A 1IK4A 3OTWA 3VKWA 4YJDA 2PX5A 5BVGB 3IESA 3JVDA 4R71A 1AQUA 3KEQA 1V7ZA 4H1TA 1DCFA 5EZYF 3UK7A 1VCNA 4Z4HA 4LXIA 2AN1A 2NIPA 4EB8A 2YWEA 1DBPA 1LS1A 2HL6A 1JFFB 1UBCA 4I1IA 3D8BA 4YQFA 4M1QA 2YN4A 3T5AA 5JNLA 2EC5A 3N07A 4N5DA 1VHWA 4H4DA 2GSDA 2HW8A 1S2OA 2QZSA 2NVUA 3D4IA 5L53A 3TIFA 2EGHA 1HT3A 5CCDA 4QDZA 2QSUA 2W58A 2KHZA 4E30A 4MVJD 3S99A 4QUAA 3LA6A 4QUIA 2X3UA 1J0DA 4WE3A 2C96A 2FW7A 1MNAA 2REBA 3B9PA 1XEXA 4UEOA 3WWPA 4L27A 3C98A 4UD6A 5JQGB 1XELA 1AB5A 1OREA 1VMAA 3I0MA 3JAKB 1S3SA 4R8SA 1DRVA 5FTNA 4O4JA 3UG6A 2R6CA 4QGFA 3TOCA 1C80A 3R5HA 4BV8A 2OFFA 4C43A 1DIOB 4EGFA 1TO6A 4WOJA 3PYXA 4LE2A 2X1HA 3A28A 3WX0A 2O4UX 3DCIA 2YYAA 4C4YA 4WL0A 1JHQA 1TRKA 4QTXA 4B5KA 1XRJA 3OQMA 3AG5A 3KAPA 3KPVA 2Q1UA 3PQFA 1VKOA 1KO7A 2CFIA 2G83A 1HT1E 4ZDIA 1KQFA 1C7RA 1N36B 3N7UA 1XU7A 3COPA 4V0KA 1V16B 3N58A 1YHYA 1ZD4A 1BSVA 2WT4A 3HCEA 2BPOA 3I1FA 4KE7A 4YUVA 5TS3A 5T41A 2XTZA 5BWOA 3HA2A 2YASA 2XQFA 3C7AA 5FTJA 1CW2B 1DAMA 2H7XA 4MWBA 4QT0A 4CGZA 5JYCA 2GZ3A 1Z56C 5T64A 3I34X 4NCIA 2O8BA 4JVMA 1GDTA 2LVBA 3OH8A 2Q0HA 5LDGA 2PXCA 3QXJA 3TDNA 3ETEA 4LPSA 3WP0A 4WESB 4Q9LA 3KEOA 1FUUA 1T8YA 4DCCA 1ISIA 2GHTA 4A5SA 3KZVA 1UBHS 2E5LB 2DFKB 4AF6A 5HE8A 5IFLA 3AMVA 1NU8A 4L4XA 4FW9A 1M6VA 2HSJA 4H7EA 3ZE7A 4FGLA 4X20B 3PNLA 2AZXA 1R6VA 3GU3A 4EI9A 5THKA 3BSFA 1AK9A 1PE0A 2YICA 3GJXC 5JWHA 2N1BA 2FEAA 3UJ3X 1C3OA 3GAFA 4JC8A 4MVJI 2JZOA 2Y1LA 3F71A 3LBHA 4KK4A 3OPQA 1YCHA 1E6UA 1N6PA 1Q1NA 3R6TA 4ZZ1A 4LMBA 3KBBA 5AK4A 1G42A 1RC8A 1PFVA 1CUGA 3REFA 3PHGA 2W83A 5EY5B 5L7TA 3A7DA 3NV9A 4Z51A 3ZQ4A 1IJEA 4YMVA 3VSAA 3KETA 1E6KA 1WXXA 1YRWA 4MUNA 5B5SA 2Q6VA 2XCIA 3KKZA 3O2SB 4LXUA 2BGNA 3RG8A 2PAAA 2QX6A 5DNAA 3RYCA 3BE6A 3R5KA 2CL7X 1E5XA 2HCTA 4ZGBA 3NHPA 1BFUA 3HJTA 5HGJA 4F4CA 3ZVKA 3L6UA 5AKHA 4MKHA 1U5BA 3VH4A 5JBQA 1JL3A 2YIJA 5E9WA 3ZTYA 5IM5A 3HDHA 3KT0A 4MYRA 1GSIA 1IUOA 4AMBA 1YI0A 1QB8A 4B6FA 3RAFC 5FOTA 4HGPA 1M54A 1EBFA 4MO2A 1E7WA 2A1UA 3VVCA 2XADA 4HR7A 5DB4A 4U7FA 2DQKA 4Y9TA 2O20A 3MUNA 2QAGC 2EZTA 2C84A 2GN9A 1L7NA 2NZ8A 4BDSA 1YA6A 5J5VA 1U63A 1TYZA 1AXGA 3LPNA 3QNMA 4G0YA 1KL7A 1A1VA 3T7RA 2YR0A 2CNDA 2QTVB 3TLXA 2IELA 3D3JA 4WUTA 3THRA 4D9EA 5FBHA 5C51B 2EWWA 1HEIA 2FR0A 1RLIA 2X8BA 3P9ZA 3AR9A 1AKUA 3LJKA 2AQKA 1RXEA 4X8OA 3MCAA 2ESRA 1WD7A 4AUKA 3CVVA 4AJ9A 5EWMB 2OP1A 1LC0A 4BNTA 4Q1BA 5DASA 4F3RA 1NW8A 3ENQA 5BN3B 4DCPA 3PQDA 4TTQA 3A4IA 4P2GA 1KNQA 5EERA 4MP6A 1QZUA 3DV2A 4PO3X 4QTTB 1IFXA 1KY4A 1PNOA 3V5NA 4RUKA 1NW3A 2XSZD 2IV7A 2ZJ0A 4F4HA 4KQEA 4XLZA 3U4QA 4ZU6X 4YGXB 1CUIA 4HDQB 4LBYA 5TMEA 2DTXA 5IDXA 4F3CA 4KXFB 1B6GA 5CM9C 2XZDA 2G0TA 3PQ5A 2AW3A 4MQEA 1N75A 1NPTO 2IIQA 2OHHA 4NZOA 2BEWB 3BGOS 3I2YX 2BFCA 1GR0A 3A10A 2AXNA 3PA8A 1R50A 4M1YA 4M37A 5SZIA 3VQTA 1XJCA 3MVEA 4G23A 5CB6A 5IG2A 4FYPA 4ZI3A 2A30A 4ZQHA 4I8IA 3UMBA 1I4TD 1P2UA 4RJ2A 5HUJA 2P2GA 5DX1A 1BOFA 1XL0A 4O0LA 4H1HA 4YIKA 5CK4A 5TSDA 4RMHA 2DHRA 4YP1A 4RYLA 1QAOA 4BNHA 1NSTA 1IMOA 5CFRA 5JS6A 2PSDA 4GI7A 5B4TA 1UJ6A 2F59A 5FPSA 4M6WA 3SU8A 2VHUA 3QKIA 1SIUA 5D85A 1ZGAA 4FX2A 3EAGA 3PRJA 3VSCA 5A6VA 2ATIA 1M10A 3VKGA 2EZ4A 5F73A 2XXJA 3W8NA 2X9GA 1TK9A 5EHZA 1NUAA 3WRXC 1PT7A 2J9RA 3VPGA 4LAFA 3I5XA 3CINA 3WGJA 3ZCQA 1NJ2A 2FZLA 4A8PA 4ZFNA 3JX9A 1WSWA 2OV6A 3HCCA 4H18A 1D2MA 4FT4A 3EA5A 4KU4A 4U2EA 3T7TA 3VHRA 3D5QA 3HVJA 2VZ9A 1F3LA 5KYKA 4KAXA 4O4LB 1XCJA 2IV2X 1B7GO 1Z2PX 5FIUA 4Z54A 3EGOA 4GP7A 4FBGA 5EQFA 2PMCA 2IPOA 4JLWA 3MQFA 3Q10A 4JCOA 1D9XA 4XCVA 2Y66A 1YBVA 2EW1A 2ZYTX 3VYVA 2ORIA 3H1AA 5AOAA 1UZMA 3R0QA 5AI8A 3ZDYB 3NEAA 1UDBA 3WIOA 1JGTA 2P41A 1E2NA 3HGTA 4C5AA 2DPHA 1V25A 3GT3A 1YIOA 2PX3A 3K31A 5IC6A 4BAUA 4DV2B 4Q1AA 4F4IA 1X9GA 2DGDA 3TD9A 4M22A 1I2BA 3VVBA 1PJZA 4TYWA 2NO6A 2ARKA 1M6NA 13PKA 2BWJA 2CHVA 2FP3A 3UFXB 3ORRA 5A05A 4EJ2A 4JUBA 3TMAA 1T15A 3GVXA 4E4TA 1Z28A 3EBOA 2OOSA 3AR3A 1JAHA 2XTJA 3HJRA 4HLDA 4WY5A 1V8OA 5GMOA 3RIGA 4KFUA 2HLNA 1O0SA 3L49A 3TX2A 1JF8A 4J7UA 2CNOA 1W44A 3QBEA 1ISPA 2VQ3A 1OC4A 4LDQA 4XEHA 4N7JA 2A84A 4YUYA 1GA6A 3HUDA 2OYCA 2WJGA 2UYGA 5AT1A 4JI5B 3CF4G 3M33A 2P69A 1BYIA 4JIGA 3D6HA 1HRDA 2UYOA 2KE5A 3GCDA 4RY9A 2IYQA 5ALRA 2EU8A 3ZY5A 4EA7A 5KYYB 2W90A 3C3KA 2G7ZA 3MPOA 4BP9A 4XWOA 5LD2C 4ZYLA 1ZR2A 5EXDA 1SWVA 1E2IA 4A36A 2H5LA 2HSDA 3HACA 2AYYA 4IUCS 3S5UA 4UHJA 3QMPA 1U3WA 1J42A 3KB1A 2PUTA 2GCOB 3ZY2A 3CXRA 1ESZA 3IULA 2IHNA 1DS6A 2MSWA 2RAUA 2P3QA 3DWIA 1SBHA 4R98A 4RA9A 3SIWA 5BNTA 4RL4A 3UPUA 5J63A 4BVEA 2Q2VA 4C4PA 2VHWA 2BMWA 3DOIA 4D44A 4XEUA 2VPTA 2FUCA 3T5PA 2BGTA 3MB8A 4OSOA 1ZONA 2QKYA 4EYEA 3KSMA 1M34A 1JJFA 3PNMA 4Y0NA 2NGRA 2NLOA 3QKSB 5BSUA 1GNQA 1OTXA 1M0SA 5BW8A 3A6DA 3ZCXA 3AM3A 4J0GA 5FADA 3AU8A 5F7JA 3LYAA 3QY9A 4Y9RA 1D09A 5L4SA 1K9VF 3Q3VA 1XD2B 1Z0AA 1GGFA 3AG6A 1XRSB 2RBEA 5DNVA 4N7MA 4UNQA 1PG0A 4M1ZA 3F7OA 2WVJA 3GJYA 3GRRA 3X1MA 3ZHOA 3LYHA 1BN7A 5DHRA 4AB1A 3VU1A 3O4RA 4HMOA 2FKNA 2HV8A 4XM2A 4B44A 4RABA 1E3QA 2MOKA 4RGQA 4TROA 1TZJA 5F2NA 2FW0A 5IKPA 1XU9A 1D07A 1EEXB 4PVDA 5J5AA 1DIRA 1XTVA 3HI6A 4U9HS 1U0LA 2J7PA 3ANXA 4TQGA 4XDHA 2IA5A 5JANA 2VCHA 3AEKA 2IY7A 1WHTA 1U9ZA 3QVOA 2GUGA 1JTVA 2YINC 4RZXA 2PUFA 4MP8A 1LW7A 4JHLA 2JCSA 2EX4A 2NU7B 3I9JA 3QJGA 1NYLA 3OEYA 2PBFA 4OHRA 3R44A 1JYSA 1JKFA 4TTPA 5EZYB 4ZT3A 3AW8A 3KC2A 4N5HX 1E69A 1YZ3A 4YY3B 5CT8A 4L76A 1D2RA 2AQHA 4OI0A 1GUZA 1Y1TA 1EGMB 5BRJA 3NAZA 1Q0LA 3KQVA 3WNCA 4OHCA 5DI3A 3OPMA 5HUQA 3V7NA 3HYTA 1URPA 2FEXA 5KQLA 4IDCA 5EFOA 1TZBA 1A5AB 2AFIA 4QJBA 5IF3A 3E1SA 5F1YA 3K9WA 1IHUA 2Y99A 3TLBA 4PZ9A 1PJ3A 4OEHA 1ZC3A 3ISTA 4DQLA 1E4OA 1MENA 4Y6QA 4EZBA 2YMQA 3C43A 4JX9A 4QEKA 2XBLA 3I0ZA 2OQRA 1VE1A 1JLHA 2LUOA 3GA5A 5CIQA 1S2LA 1MVOA 1YB6A 2BEJA 3E3AA 2IP1A 2X22A 2PZBA 1OPXA 3AUAA 4GRAA 1ID8A 2AEFA 2W6OA 4BKOA 2CE2X 4RTMA 5I9NA 3TW4A 1W5AA 3EVZA 4EFKA 2A0FA 3H7AA 1EVIA 5BSTA 3RHFA 3T06B 1KE2A 5E7IA 1T3SA 3DLAA 5K0NA 1YJAA 4CPDA 4F60A 3JYPA 1L1FA 1KAMA 3EHDA 4IHAA 2COEA 1PGJA 4Q02A 2BEKA 1CLEA 3OKFA 3R40A 2FSSA 3WLRA 3QPAA 1U5CA 4FHFA 4P4NA 2IPLA 2FOLA 3R5SA 4Y2VA 5JHHB 2XKJE 1EDDA 1IEXA 5B2FA 3EXEA 4LC0A 4D9NA 1ML3A 3G2NA 4LYAA 4ETNA 4F91B 1I7DA 3KFLA 4B8ZA 1E1KA 1RJ9B 4K6MA 1JA9A 4NDAA 2CXTA 3A4MA 4WZAE 4BMPB 1CB7A 4KQ9A 4ZCLA 2E37A 5DTRA 2OHVA 1ZCZA 4HN9A 4YQYA 1PJQA 3E3NA 4D57A 2RIRA 3I05A 4EI8A 4FI3F 4MR9A 1ECBA 2NM0A 4LNUB 4M9XA 3CVYA 1EGVB 3SQLA 5C81A 4QOHA 4RU1A 1GNRA 1Q92A 4X6YA 2Z95A 1IIBA 3OJOA 3VKFA 3U7JA 4C3VA 2YNMC 3NHUA 4F5YA 1QFYA 5GOTA 1YU9A 4MCIA 5HCNA 3AY7A 5D86A 4W1QA 1DWUA 4TRMA 2JLSA 3R0IA 3O8NA 5FUXA 2QG4A 1W4CA 5LYJA 4UAUA 4BC1A 1TF2A 1RI5A 1N4DA 2RGNA 2BHTA 2R6AA 5ULLA 2WV7A 4PX9A 2LCQA 4YV2A 3WGMA 1AURA 2ZDHA 4X62B 5E7MA 3WDSA 1ZD1A 2COUA 4PO9A 5EZ5A 1XXHB 3SC6A 1TIBA 1Q50A 1R0CA 2P9QA 1ADYA 1DDGA 1ZMTA 1GPJA 4KR9A 3IEUA 3VKVA 1P75A 3AZPA 1L3IA 1KJJA 2JIPA 1P5HA 2LIPA 3LPDA 5FBRB 4J3NA 2CC2A 4REQB 3FF1A 4LJYA 4CIXA 1NQ5A 2F90A 2WMOB 1ECLA 1UFOA 2AJBA 2NZ2A 3K2EA 3UJ8A 2FPUA 2WZBA 4AY4A 4C6TB 3EGCA 2GJKA 4MVJP 1U4SA 4BLUA 2GK4A 2P2LA 3KJZA 4MW9A 3GVPA 5KKAA 1M3SA 1RKXA 3DFUA 3JQEA 3R3HA 1Y6JA 2J67A 3E7XA 3V2IA 4TZ0A 2RHRA 1L5FA 3SJAA 3C3XA 3KYCA 2B9EA 3UB4A 3IKTA 4EY5A 4LVCA 4GX2A 4ABYA 1LDGA 2QTRA 2B4QA 5EMKA 1T5BA 4Y0VA 1S9DA 4ZEXA 1HDOA 4KBYA 5K0JA 1EINA 1VKRA 3ZY4A 1MRZA 1KH3A 4HH4A 4A2CA 4HEQA 1W5EA 5FI3A 4C78A 2DBRA 2ZB7A 4UUNA 1BFDA 1N2SA 3GHYA 2A5JA 3ELDA 4NH0A 2ZT8A 3RVKA 4NOJA 1INLA 4ZV7A 1ODKA 3OM1A 1SN7A 3HRHA 4RCYA 2RAPA 4WCVA 4BVAA 2NO1A 3SPXA 4GR4A 5KTYA 5LDHA 2Q9CA 4QPDA 5EJ2A 5LOVA 4IX1A 2J46A 4YLYA 1FNNA 3M89A 4WZBB 3GY0A 2W8ZA 1SCDA 4X8HA 2QU8A 4Q4DA 1EXDA 2XNJA 4DLLA 3AM1A 1CE8A 3HP1A 2ETXA 4A0FA 2HJVA 2HZBA 4HQRA 1O94A 3NUZA 1SUCA 2YRWA 1SC4A 2NUPA 3QUQA 4YCBA 4KVZA 3STHA 3ABRB 2WU1A 2WEKA 1IPEA 1DB3A 1MN6A 2A88A 2H7CA 2PD4A 4MVJM 2FFRA 2YYYA 4Q18A 5IAKA 9LDBA 5KREA 4KSBA 2RGBA 1WA5A 2Z8ZA 1YO6A 2JFPA 4GE3A 2FN8A 4TMKA 2F3TA 1HLDA 3HSKA 4O25A 5DM2A 4FM9A 1JJAA 2PUDA 4NU0A 3Q3GE 2FRVA 4LYEA 1JLLB 2BY4A 1FBNA 2X8JB 3KB8A 3QX3A 1B8UA 1I4OA 3N87A 3S7ZA 3BXXA 4KSYA 3JYLA 3TZLA 4PC6A 1WDWB 1BDIA 4QGSA 3ZJ5A 5DP2A 1FFEA 3LL7A 4CRWB 3VAYA 2W6PA 3QWFA 4IYJA 2H4ZA 4LW8A 5CB0A 2VDNB 3AFNA 4MV0A 4YONB 3RANA 3YASA 1VBMA 3PJDA 1OH8A 1IZ0A 5KVVA 1SPXA 3CPSA 2EGGA 3IEXA 4OK5A 4TMYA 5BN5B 4W1SA 1BMTA 3EQZA 1Q12A 1LTQA 4YALA 1Z17A 2PYDA 4TSKA 4OKNA 4BNGA 4JT4A 4RIIA 4WKCA 1K68A 3COJA 3QF4B 1MW9X 1SNYA 3CN9A 3KT3A 4W5RA 2BGWA 5EIXA 2H06A 2VT3A 1E2BA 1EM8B 2C4VA 3RF7A 4MDYA 2WIGA 3FSJX 4WN9B 5LSAA 3WL6A 4KRXA 2BJWA 2X4LA 3I6IA 1E66A 2RG7A 1OFHA 1KS9A 1KY2A 2OCKA 2BI8A 3VI3B 2RHBA 1VJ1A 1VSVA 1UPXA 4AS2A 4WJKB 2VSOA 3DT9A 4ZOQI 4LGYA 2DBYA 3CLSD 1IXSB 1Y6ZA 3L0PA 2JFZA 5AOBA 1NXXA 1E8NA 2C9OA 4M89A 4Q3BA 5ELLA 5FX2A 5IVKA 3PR1A 5HKAA 3ZVNA 4YT5A 3EUAA 4IUDS 3L1KA 1CR0A 4L2IB 4FZVA 5ERGB 5CFMA 2X19A 4MROA 4DS3A 1X2BA 1OX4A 3CEAA 5J2UA 4OFZA 1IXRC 1KSJA 1LSOA 4A0SA 1FDTA 2HO4A 4IRXA 4Q1CA 1J07A 4QJ4A 2MSNA 2F2TA 1OLXB 4RH3A 5ENVA 2J7PD 5FYDA 4BYGA 1YVDA 2PGNA 3P2OA 1KMIY 1NMXA 1RQ2A 3EISA 4KZKA 1F6BA 1ZXXA 3F3MA 3BFPA 4P9NA 5GIPE 2QI9C 5ISMA 4J7XA 2IXFA 5CLLA 3NXSA 4ZYTA 2Q62A 1MB3A 2XCLA 3VUFA 1J8VA 3AF1A 1G5HA 1MP0A 4GZ6A 1JNYA 1RXYA 3QFHA 3THXB 1UAGA 2GB4A 4LDAA 4JB0A 3EW7A 2JCGA 3ILHA 3C1UA 5IM4A 1OXUA 4GHWA 1DWPA 2BH2A 4G85A 4DV5B 3CW8X 3NP7A 3PX2A 4KHZA 4M9ZA 3F49S 4OAPA 1VDMA 2POQX 3S2EA 3R1IA 4MPRA 3HADA 2HF8A 1N9KA 2Q1YA 3OZRA 5K8LA 1NMQA 5EMNA 1ZGBA 5IT5A 4KBFA 3H1FA 4J07A 1BW9A 2I03A 2YV3A 4E5MA 1IOZA 1UFQA 1W6RA 2ZR7A 4UDOA 1M2NA 1Z73A 1S96A 1JSLA 3RVNA 1RKQA 2YN0A 1NVXQ 1K5PA 2IXEA 1R6UA 2OAP1 1UAYA 3MBKA 3PQ4A 1BXRA 3ETDA 2HQ1A 1TVCA 5JPCA 1GPH1 2H54A 4LV6A 4XD7D 3RKRA 5AKGA 3LK6A 3DHYA 5EEHA 1OSNA 1PUJA 2VH1A 1LPOA 2RH5A 3S0JA 5BQOA 3PZRA 4II2A 4U7WA 5CBKA 3F6CA 2FWNA 4DMGA 2B2NA 2KYRA 2C5BA 3I9MA 3CURA 2IEDA 3ESQA 3PE6A 4J4BA 4MITA 4KFSA 1U1FA 1Y7PA 1KTVA 4FR0A 3R7DA 4A0QA 1S9HA 3OJCA 4K3UA 3H3JA 5AJTA 1D1SA 4MYHA 4ZT6A 1VRWA 3PKJA 3P9RA 4RHEA 3L6EA 1ADFA 1OH7A 3ZTTA 3NHKA 4J3FA 5I9LA 2DWQA 3QVSA 4RGYA 4TKVB 2EFCB 4UHCA 1OC2A 1U6JA 3RAGA 1GZ6A 2G04A 2WJ6A 1XQ6A 3PDIA 3AV0B 2HHJA 1ZLXA 5ERXA 3VDMA 1M6WA 4Z4FA 3ACBA 3DCNA 1WMFA 3NHLA 4ENQA 4D81A 1N5JA 1P1RA 1S2NA 3RVMA 1AHNA 4HDNA 2BP7B 1NM5C 4URHA 1MW8X 3TTTA 5JNVA 1A88A 4CQLA 1NUTA 2GEFA 1YSCA 4J4HA 1KEPA 1O95A 4L02A 4AU1A 1BRMA 3KZMA 1LBIA 1WDKA 2O0HA 4UVEA 5AUPB 2JJYA 3PGKA 4Q12A 1ONPA 2GXQA 4UBMA 3H05A 4B2PA 4DGQA 2Q6IA 4IMPA 5EWJB 3EXIA 2OBMA 3WBKA 4QWMA 2QV7A 2YWHA 5DGIA 1WZ2A 2E5WA 3BGVA 4DMMA 3HG7A 4QICA 4ZA2A 2FDRA 4J2HA 3J81k 2SECE 3VU8A 4WK6A 2XBMA 3PCTA 4RJLA 4Z9AA 4EW1A 3KG2A 2Y1XA 3TCKA 1AHHA 1AK1A 3FCAA 5CH3A 5DN6A 1I4EB 3EG5A 5JWRA 5F12A 2QY9A 4I5IA 4DNOA 2Q3DA 4WJZA 1OBFO 2NV6A 1RLMA 2HIAA 1OFTA 1B43A 1J7KA 2Y05A 2JGJA 5UKDA 4GX0A 3WISA 2GA8A 3DMTA 4Q9DA 4WVFA 4WW0A 2X8LA 4ZO4A 1R6XA 3AUXA 1JKIA 1GFSA 1W4LA 2XA9A 3I28A 4D5EA 4QFDA 3UAVA 3ZXYA 4TM8A 3QPDA 3H8SA 3RYHA 4ASUA 4WINA 1NULA 3QITA 3G3EA 3NAMA 4RNDB 3C74A 2VRCA 2LZ0A 1EFAA 4ML3A 4F2GA 1QTNA 3FLMA 4QECA 4YRSA 1TUIA 1ZH4A 2I6TA 4GLFA 1PFQA 3FAZA 1TT7A 3A1UA 4KXYA 3C70A 3C8ZA 2IC5A 3VZRA 2WVAA 4RQTA 4L78A 2IP4A 5DF1A 1NQXA 1P17A 2WPDA 1R6TA 3ASUA 3H6HA 1YZQA 4CKXA 3LXXA 4MIKA 1G9SA 2YC2C 5FYQA 3IQFA