1HEIA

Structure of the hepatitis c virus rna helicase domain
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
443
structure length
443
Chain Sequence
NSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hepatitis C virus RNA helicase domain.
pubmed doi rcsb
source organism Hepatitis c virus (isolate 1)
molecule tags Helicase
molecule keywords HCV HELICASE
total genus 138
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1heiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA01
2V54A 4OBEA 2BBTA 4NTZA 2DWPA 4LHWA 3FFAA 1OXTA 4TYNA 2IXFA 5AUQA 1SXJE 3IDQA 3ZH9B 2W2TA 2GF9A 2NPFA 3W3ZB 1WP9A 1FNNA 2HJGA 3UATA 2GA8A 1GKUB 1MO4A 1W49A 4B71A 1YJ5A 4HAUA 4QC2A 1DAFA 2CLDX 5GJCA 4CVNA 3NH6A 1B0UA 4OHVA 4DSUA 3CB4A 1ZD9A 3O8CA 2XTNA 2GJ9A 1ZBDA 3IILA 3QBVA 3IQWA 4OJKA 1S3SA 1H8ED 1T6NA 3PV0A 5GVRA 2FH5B 2OBLA 3PUWA 4ACBA 4BFWA 3LLUA 4G1UC 4D82A 1KMHB 4UNRA 1VCIA 4HEJA 1GWNA 3BFVA 2ZR9A 1M7BA 4XTCS 2ZPTX 4Q01A 2QPAA 2E1RA 4L4UA 1UBEA 3RANA 3QF7A 4IRUB 2Z4SA 1KK2A 1XCGB 4PSAA 3BFKA 2DFKB 4LHVA 4V0OA 3WNCA 2FSHA 2CK3A 4XTRA 2ZRHA 1P7CA 2W2VA 4Q1FA 4QXAA 4TZ6A 3A1UA 3ZD6A 1JBKA 4O3MA 3W9YA 1DOAA 2BMFA 5CB8A 3OEHA 2C95A 2OCPA 1YE8A 5SZIA 4ZDKA 4LV6A 3EXAA 3C15C 4BZQA 2OZEA 3B2EA 3CRW1 4ARZB 3KKOA 1T3LA 4N0DA 1I4DD 3AKCA 1HURA 3NHAA 2PX0A 3GEHA 2XTZA 1G8FA 1OIWA 2ONJA 5DYGA 3U60B 3I92A 5H1YA 2ZRMA 4XWKA 1G3IA 5AK0A 3SS8A 4MGKR 1QG2A 4F93B 4F7WA 2D2FA 4L9SA 2ODEA 4QKQA 3GD7A 3SNHA 2A5GA 3ZS9A 3RRZA 1KAGA 1ZIPA 2ZU6A 4EFMA 4B6EA 1OFUX 3FMOB 2H17A 4LYHA 3ICEA 2EW1A 2C03A 2VSFA 4P3YA 1QDEA 1Z8FA 4TL9A 5FL3A 4A0GA 2WTUA 4JMPA 4S35A 2X2FA 1E1RD 2AD5A 1TEXA 2IYRA 4OI2A 4Q03A 4OYHA 2IYYA 4H1UA 4UXHA 2ZS9A 1LV7A 1U81A 2WWIA 1RRGA 2IBMA 2ZRPA 2GILA 3L0IB 2BM1A 2G1KA 1OYWA 2EQBA 3WRYC 2AK3A 4EJSB 2OV2A 2VP2A 2ZYUX 1TF5A 2NO6A 4G3XA 2IYUA 3H0KA 4Q1CA 4YMWA 2FJUA 4PC3A 1ZRHA 4NYJQ 521PA 4NKRA 2WWWA 8OHMA 3B1WA 5JI3E 5A4JA 2D3WA 3REFA 2FV8A 5KHOC 3PEUA 4NPHA 2R65A 4ITRC 4JLOA 1OKKA 3AVPA 3EZFA 3QPWA 1JQLB 3N70A 3F3YA 3KQLA 4JBWA 2J1LA 1Z6GA 1W44A 1FX0A 1LFDB 3PUYA 1PVOA 1W46A 1CR0A 1E2QA 1SULA 1YR8A 2FFAA 2W2XA 3BC1A 1G8YA 4AG5A 2J45A 4BLRA 1MO3A 4QGFA 1DPFA 3K70D 3U44A 4PSKA 4QM7A 2PT7A 3AF3A 5FBLB 5LB2A 1AZSC 3PFIA 3T06B 4PZZA 3L0PA 1U94A 4A8JC 2B92A 2X8AA 2IHYA 3SBDA 5GJBA 5CDFA 4LYJA 4Q4HB 1M6NA 1N2CE 1CJKC 4JVMA 4XIGS 1G8HA 1BIFA 1W2GA 2YYZA 3HU2A 4US2R 4RY2A 1XPOA 1E96A 1II0A 4TTQA 2I1QA 4QFMA 1HQCA 2XXAA 3FKSA 1GSIA 2ZSFA 4XH9B 2CL0X 3TR0A 1IXSB 3AVTA 4GMDA 4RSGA 1GRQA 1LY1A 5F98A 4BWYA 3KL4A 1NVUQ 3EZ2A 3BOSA 1BS1A 4M9XA 4LSGA 2P67A 4BFUA 1GIAA 3BJIC 3WXMA 1DARA 3HPQA 1E9AA 2F55A 4UKDA 5IK2D 3EPKA 4DB4A 4V0NA 4OJQA 3VR2A 4RD4A 2R6FA 1N6LA 2BCJQ 4DLYA 1KNXA 1LVGA 2C78A 3SHFA 4G5OA 5JEEA 4C7OA 2JASA 1NMZA 5FUXA 4EAQA 5KO2A 1ZAKA 3TK1A 1K6MA 3RS5A 4Q4HA 4AD8A 4HDQB 3QI2A 3NBXX 4RCYA 5J4KA 2DY1A 2FEMA 1SXJB 2A9KA 5DLQC 5DI3A 4A8JA 2FSIA 4IJMA 4PXAA 3D6TB 3TSWA 2C98A 4N3NA 1KY3A 4LDJA 5ELXA 2P5SA 3U7EB 3SYLA 2BMDA 3UMSA 2ORVA 4AG6A 1ZM9A 3B6EA 2RKOA 2BM0A 3SQWA 3TBKA 4DVGA 4QBFA 3H1TA 3NEYA 4LHYA 3LY5A 1OHHD 2O52A 4Q4LA 4QNRA 4F4IA 1ZNWA 1AJEA 2YC4C 1N3BA 2BWJA 2HLDA 3VU9A 4N1AA 4DCVA 4DUGA 2FZ4A 2G3YA 3TUIC 1I4LD 2Q6TA 3X1YA 2QEQA 1DAEA 2ZI9A 1YZKA 3RWMB 1CR4A 3IBGA 4PC6A 5KU1A 4JVLA 1Z3IX 3WYAA 1DAHA 1QG4A 2ZRNA 4L9WA 4V02A 3TJZA 4M9QA 3LO5A 4ABYA 4HZUB 2GXQA 4WZAE 4LV5B 2FFHA 1I4TD 3DHWC 2O8FA 2O5VA 2IC5A 2HXSA 4XJXA 1DTSA 2IF0A 1EWRA 3LBNA 2ZRLA 2KB0A 5AJXA 4DCTA 5J5CA 4MYUA 2AN9A 3THXB 3VKGA 4Q4AA 2J9RA 2IX3A 4HB0A 3PR1A 1JEDA 3EZ6A 4AIIA 3RS7A 2QUZA 1W36B 1GG2A 2ZRAA 3K0CC 4GSYA 4UNNA 4I4LA 2GZDA 4LI0A 3EWAA 3DO6A 2ZI5A 4I1UA 5CB6A 3TE6A 5JRZA 1ODFA 2IEZA 1G8GA 3UWKA 2CL6X 3O47A 2BDTA 2GESA 1CR2A 3LX5A 4KU4A 1G1MA 4CRWB 2GK7A 2F1IA 2PEZA 1P5ZB 5L3RA 2WJIA 2BBSA 2VP9A 4R2IA 5DYIA 3UXMA 4A2QA 2AWNA 1G5PA 1E79D 2DCUA 1Z0DA 1NY6A 1TF2A 5AWFC 1SVOA 2PCJA 1D2EA 2B7BA 2XAUA 4M22A 1IN4A 2ZS8A 3FDIA 3P32A 4DDTA 2CCGA 2DHRA 3SJAA 2V6JA 5CYPA 2ANBA 3IIKA 2O8FB 1E0KA 4G5RA 1GNPA 4M9SA 5AUOB 2WSMA 4JSYA 1G3UA 2PX3A 4JLKA 1AQYA 1Q57A 2ZITA 1Q22A 3AF2A 3RSOA 1FUUA 4IXNA 4R98A 4RFSA 2QSZA 1M8PA 3VFDA 1E2HA 2QM8A 3MWYW 3AVQA 1OYYA 1E9EA 4TLDA 4W5WA 4JVNA 2A78A 3T61A 2IL1A 4B34A 2F9MA 3EA5A 3QKUA 4M1KA 3OF5A 2ZRKA 2QBYB 2HT1A 3F5FA 1IQPA 1RFLA 5EUMA 4JL8A 3L43A 4IDHA 4ZI2A 1KNQA 2R6AA 4TYWA 4Q19A 1S8FA 5FFMA 1KZGB 4DCNA 1P61B 1QVRA 2GNOA 2WJHA 4HLCA 1KIMA 1EX6A 1M7HA 1M34E 1UKEA 2CEAA 1ZM4A 1E79A 4I81A 2QBYA 3IIJA 3SQXA 4DLRA 1YZGA 5DISB 4C30A 1M1YE 4CEJB 5L3QA 4US1R 2OE2A 5JEDA 3VR3A 2CXXA 2PMKA 3K09C 4AKEA 3GPLA 3DOFA 2A5YB 1UF9A 3DVLA 1G5RA 1U9IC 1KK3A 3NHBA 4O25A 5HZKA 4NL4H 5HE8A 5JWHA 1ZUHA 1T8TA 3KQUA 4ZO4A 1D2MA 1YKSA 2XITA 5BWMA 3QXHA 2O8CA 3GEIA 1W1WA 4D0LB 3BB1A 2W6JA 3I61A 1G7RA 2GJ8A 1E69A 1TQ4A 2G88A 1NVVR 2IYQA 3SE0A 3NDBB 1IN5A 5C18A 1R0XA 2DWOA 3NC1C 2QT1A 2FPKA 1N6NA 1NY5A 2NMVA 4U00A 4CT4B 3KKMA 1CF4A 2WVJA 1XTJA 4P4UA 4JYBA 1HUQA 4Q02A 1OFTA 1S4QA 2A30A 2ZE6A 1JR3E 4LV8B 3QG5A 2OXRA 2W00A 3OEED 2C9CA 4LRWA 3SFZA 1P9WA 3LRPA 4URUR 1ZNZA 4F4JA 4DLSA 1N25A 5FTLA 2D7CA 3B78A 4MGZR 4RFVA 5JJIA 4R71A 4BEBA 4ZCIA 3LQRA 4LHXA 2C5LA 4U02A 4TTPA 5G3ZA 1OXUA 3VKHA 1OKKD 3I1FA 2V3CC 1ZINA 2GWHA 4A92A 4W7SA 1VG0B 3U7FB 4WZ6A 3GCGA 4JLVA 5TARA 3N5CA 2A3RA 4HLQB 5KUTA 1L8QA 1PLLA 1M2OB 3CKLA 2QMHA 1R5NA 3PXGA 2PMDA 3REGA 2BKEA 1Z08A 1JPNA 2ZRJA 1XXHB 3A4MA 1EESA 3T1OA 1N6OA 4F92B 1U8YA 4QRHA 4HUQA 2WWGA 2AWOA 2ZVPX 1OXXK 5LD2C 4ZDJA 3FMIA 4B3CA 4LGMA 1G9XA 4JYCA 4EKDA 4QHSA 4AY2A 1NMYA 1GITA 2PT5A 4HLDA 1PLKA 1NI3A 1YU9A 4YC7A 1TAGA 2BV3A 3UPUA 5CDFE 2NG1A 5D3QA 4EFNA 4PANA 3KJHA 5F2EA 4YMTA 4Q4JB 4FCTA 1JECA 4A9AA 5HZHA 3LAWA 4TT3D 5J4HA 3ZYCA 3OFND 1P75A 3B5JA 1BMFA 2W6IA 4DZZA 3TMKA 1NIPA 2VHUA 2YWFA 2CHQA 4W5HA 3AUYA 3GJ8A 3I3SR 1E2LA 1P2TA 4NONA 5EP3A 3E5HA 2ORIA 1VG9B 4LCBA 1X86B 1R5OA 4I99A 4NE2A 3QEJA 1TMKA 3FOZA 5TMPA 2ONKA 4OHYA 2CE2X 5GJVC 1VCOA 4PQYA 4MITA 4Q9KA 3N2EA 1DO0A 2D06A 1XD8A 2IYLD 2RGAA 2CMKA 2R44A 2WHXA 4BFZA 1SVMA 2BVNA 1X1RA 1Z2CA 3TSOA 1GL6A 2CLCX 1GUAA 2C9OA 2Q9BA 3I8XA 4KFUA 1G21E 4QGGA 3V4RA 3TSZA 1XJCA 3CF2A 4UJ5A 4C0BA 4CW7A 2QE7D 1P62B 3KTAA 4PX9A 1UM8A 4R9UC 2ZREA 3BBPA 4MKFA 4C2TA 1IN8A 4Q48A 3MD0A 2JLXA 5D3MA 2RGGA 1ZMXA 4K8OA 2Z0MA 3K0EA 4RCZA 2ZSDA 1E6CA 2AXPA 3ZIAD 3I72A 5CK4A 1DAGA 3C16C 1QHNA 3KDSE 3GFPA 2MMCA 4P0TA 4DRZA 2PJRA 4KCGA 5KSYA 5H70A 4CZ2A 4PHHA 1WDTA 3AVYA 4II7A 4D4KA 4PAOA 1A2BA 2GK6A 1NKSA 2IWHA 3QPUA 5DO9A 3RYTC 3A1VA 4L8GA 4ASUD 1OH5A 3VR4A 4ZDIA 3EARA 3M0EA 3CIOA 1NKTA 1HT2E 4B3GA 5DH9A 3WYGA 3CX8A 1AKYA 1EXMA 3RC3A 4KITB 1JPJA 1T3HA 2ANCA 1Z47A 3U3KA 4DDUA 2DBYA 5CM9C 3A37A 4Q9HA 2P6UA 1E99A 1DEKA 1YZLA 2EU8A 1NL3A 2WWHA 4TMTA 1GNQA 2QI9C 4PO9A 4RJLA 2AKAB 1JAIA 5DSZA 3K9GA 3TVTA 3LDAA 1E2NA 1V5WA 1OH7A 1FP7A 2N42A 2OLJA 4IXMA 4FN5A 2DYKA 4HAXA 2WICA 2CVHA 2GXSA 1P2VA 2I1VB 2IHBA 1XX6A 5AUNB 2CVFA 3LXXA 2ZJ8A 5EE5B 1U0JA 4E03A 3TGPA 4CEIA 4Q9IA 4M0LA 1WB9A 3PUXA 3NEJA 2FE4A 1C1YA 4BLSA 4PPNA 3EIEA 4AI6A 3D8BA 1WBDA 1IN6A 5C1BA 3K09A 2FSFA 2FA9A 4ZCLA 2C77A 1QBKC 3CRQA 2CNWA 1JJVA 3ADKA 2ZUCA 2ZI3A 4MRNA 3T1VA 4K81B 5AUPB 3EW9A 5JHGB 3BD9A 5DN6D 3OESA 3CZPA 4URWR 3HPRA 5K8UA 3AB3A 2IWRA 4X8HA 4RZUA 2YHSA 2RH5A 4FINA 4YDSA 2JLWA 2VSXA 3KKNA 4Q7LA 2ZAOA 4CT5A 5K8IA 3PEYA 1XTIA 5JS8A 4JT4A 3VR6A 4TTRA 5JSZA 1S96A 1CS4C 3QSYA 4Q66C 1NBME 3W6NA 4FW9A 4MKIA 3CNNA 4PSVA 2VP6A 4PQFA 3ADBA 1GILA 3HU3A 4Q4AB 3T35A 5JCZA 3MGCA 1A82A 1KI2A 3K70C 3LW7A 5CM8B 6Q21A 3NBFA 3ZQJA 2IK8A 1H8HD 4JIMA 4OI4A 5E7IA 1G41A 2F43B 1A2KC 1FPMA 1JI0A 2OEPA 5FTJA 5JCPA 3X1XA 1MKYA 3PVSA 3FB4A 3WP1B 3U4QB 5D3MB 5L3VA 2SHKA 1DE0A 3SC3A 1E2MA 3T34A 4Z51A 3Q8XB 3Q85A 3VX3A 4PHTA 4BECA 1IHUA 2EYUA 2HV8A 3SFVA 1P9RA 3P20A 2WBLC 1RW4A 3UK6A 2QENA 4DHEA 2HCBA 2FDCA 3L82B 4LYFA 4V0ME 3TAUA 3QUSA 5DE3A 4KJZA 4G01B 4D4JA 4JS0A 1XNJA 3E1SA 2ZE5A 3IPXA 2P5TB 3TQFA 1GM5A 1US8A 3GLFA 5FPTA 4EIWA 1CJVC 1F6BA 3IBYA 2ZRFA 3U44B 3QG1A 5FPHA 5KYKA 3ZIAA 3X1ZA 1Q12A 2H57A 4I1OA 4IVRA 1LTQA 3Q7QA 3RS3A 1VYUA 3MJRA 4U5XA 1K8RA 4P31A 1IY1A 1E1RA 1EFRA 1SKYE 2HUPA 3K1JA 2GVZC 3BORA 4C3ZA 4DKXA 2P65A 2AL7A 3THWA 2G6BA 5JFGA 2JDID 3KKQA 4NYJR 4DIEA 1DADA 4ZCMA 4BGDA 3M1IA 2EFCB 1G18A 3GJ6A 3LV8A 3QKRA 2FFBA 4DSNA 1ETUA 3R9WA 2ZIAA 4NYIR 3H86A 3WMEA 2J7PD 1E2PA 5L3SA 3EASA 1YQTA 2OAP1 2F6RA 1CULC 4TYPA 1UEIA 2GCOA 2ZU0C 2OT3B 4BPBA 3I5YA 1G6OA 4JLJA 1IXRC 3QIAA 1QVAA 2WZQA 1J90A 1T3SA 2QAJA 4RKFA 3T15A 2J0UA 4B3FX 4ACAA 1YZQA 2ZI7A 1G7TA 1NMXA 4CEJA 1HA3A 1PLJA 2QP3A 3SOPA 1MO6A 1KJZA 3MSXA 3Q5DA 4AKIA 1E98A 3AF4A 1TADA 4LZZA 1NJGA 2JEOA 3RRMA 3WYFA 1TX4B 4P4TA 1W48A 3A1TA 2QAGA 5FTKA 2C96A 4TWZA 4OKSA 2ODWA 2V8OA 5CITA 5C46F 1GZSA 3DM5A 5FOWA 3U4QA 2ERYA 3DL0A 3T1QA 3A1SA 3X1DA 2ZE8A 4XVUA 1I2DA 4TT3A 4LC1A 3GLIE 3MRSA 1NLZA 1OE0A 3AGQA 1X8JA 1Z07A 2P6RA 2ZQ5A 2QQEA 3T1TA 1G8PA 2GKSA 2F3TA 4L15A 4YXWA 1KMQA 2VTKA 3AH8A 4F91B 4A0RA 4OL0A 3ZGXA 4DDVA 4KVAA 4C0QC 1XZPA 2V55B 2EWWA 2WMOB 4CDGA 1KK1A 3D7MA 5FOSA 4BLOA 5EE3A 1Z6AA 1KTVA 4G5QA 3LX8A 3A6PC 2FZLA 1KO5A 5FOTA 1Q21A 4BRUA 1BKDR 3FTQA 3LW8A 1AGRA 1PUIA 2QGZA 2QROA 2W83A 4M21A 2O8EB 4UNSA 3WP0A 3VR5A 4K46A 1S1CA 1F3OA 2PL3A 3BWDD 2GCOB 5KNCA 2WWYA 3NTUA 4M1SA 3DOEA 2CE7A 4OQMA 3AQ4A 3Q3JB 4TMKA 3HDTA 2VEDA 4X8LA 5BN4A 4TMVA 3CUEF 4HAYA 3O8BA 3OIYA 3ZS8A 1QF9A 1NVWQ 1TUEA 3OIWA 4JL5A 3SYKA 4KAXA 4EPVA 1L4UA 2QAGC 3OAAA 4C2UA 4ESHA 1G64A 2OBMA 4L16A 1WA5A 1UBCA 5GJWC 1CXZA 5CJ2A 1E2KA 3UIEA 3SJBA 4RD6A 5IRCD 1QHYA 2Z83A 5C4MA 1C4OA 4JLAA 3RDPA 5JJLA 3A4NA 1OHHA 1ZC3A 1MOZA 3EPJA 1KI7A 1NVVQ 2KE5A 2EWVA 4Q00A 5JRJA 4IOMA 2J5XA 2RGNC 4C9BA 2FEOA 4GOKA 4MGIR 2IYZA 1W4BA 1KSFX 4MA4A 5AR1A 2BEJA 1GRRA 4C0HA 4EPTA 1ZD8A 4PPFA 4M1OA 4QGHA 3GLGA 3CF0A 1F2UA 3O8DA 1R4AA 1IONA 2CL7X 1ESNA 2KSQA 1ZUNB 4N0EA 3W8NA 4TL6A 4AKHA 3KTAB 1LF0A 2CHVA 2WV9A 3U3MA 2MMGA 1W47A 1YR9A 1R0WA 3DDCA 4HB4A 3BB3A 1W0JD 4FMBB 1KSGA 3R7WB 3W34A 1RIFA 4MKHA 1FL9A 3MMPA 1E9BA 3A1WA 4JL6A 1VG1A 3AVWA 4LBVA 4P4SA 3DMNA 2ZUDA 4B32A 4BFTA 3AF0A 3LLMA 5EXXA 4YXWD 1OIVA 4R7ZA 4JLBA 4Z8XA 2RB4A 2J0VA 1Z06A 2GXAA 2ZANA 4FMCB 1EFHA 4B33A 1CKEA 3K8YA 4DSTA 3EIQA 4IOKA 1Z6XA 2WOJA 1NSTA 2IF2A 1UPTA 2GBLC 4UJ3A 721PA 1ZM7A 3BFXA 3JZAA 1TQ2A 4B44A 4D26A 4URZR 4BFSA 1XXHA 5E4FA 2FPMA 3CX6A 2NO0A 4WIAA 3BE4A 4OQNA 1KDPA 2QZ4A 4EPWA 2QMEA 2AK2A 2C2HA 4P32A 5FL7D 5FH9A 4KFTA 1UJ2A 1ZNYA 2UZIR 4TQUS 1Q1ZA 4OK5A 3PITA 4NU0A 4WVFA 4QBIA 1JB1A 2QSYA 2DWQA 5H68A 3SJCA 3EPHA 1SXJD 4POAA 5FOVA 1OV4A 3ZZUA 3TUJC 4EPXA 4JVSB 4B43A 4AK9A 4C0KA 4ZV4A 1Z5ZA 4YMUA 4FXPA 2FSGA 2HYIC 4OHXA 1GP2A 4ASUA 3KXIA 1Q0UA 1YZUA 2WJJA 4IDNA 1SGWA 1AGPA 5HKKD 4PC1A 1JALA 1E9SA 2NQ2C 4NYMR 1P60A 2B7CA 2HF8A 4B76A 2QTFA 1ZC4A 3MLEA 4M8NE 2RGXA 3AP3A 5BYJA 3H2YA 5EZ6B 5J4VA 5AJWA 2QTHA 3CNLA 1GVNB 2RGEA 3NBYC 1US8B 1X3SA 4IEIA 5P21A 5E3HA 2V7QD 2WKPA 3PG5A 2H18A 4IW3B 4WAUA 3ZZ0A 2QU8A 2UZ3A 3U5ZB 1FX0B 1E9CA 1N5LA 2H1LA 4H1VA 5FBWB 4BLQA 3HU1A 2O8BA 4MRVA 2LCFA 3WHLA 1FFHA 3PEVA 1WMSA 2F43A 4A6XA 2O8CB 1E2FA 1G5TA 5CYOA 3MWJA 221PA 4XSGA 2QM7A 1D9ZA 4I1SA 3H4MA 4BFYA 4G5GA 1SKQA 1U90A 1Z29A 5LBIA 1WF3A 4HLUC 5TY0A 2VHTA 4EDHA 1MH1A 1GOTA 2QTVB 3K0SA 2YOHA 3RWOA 1NLFA 2VHQA 4GBMA 1XEWX 3GLHB 2H92A 4LJ5A 1ZCBA 2ZROA 3L8YA 2KJQA 1DAKA 1E0JA 2ZI4A 3B7GA 4CIDA 3ZZTA 1J70A 1W36D 1Z0IA 4BFXA 1ZJ6A 1DVRA 4FIDA 5J4YA 5JS7A 2FMXA 1TQ6A 5FBQB 4URVR 2Q21A 1G7SA 4B74A 4CGZA 1H65A 1P72A 1FW6A 1F48A 2Q3MA 1M74A 2JATA 2ZJYA 1FUKA 4DUGD 1JXOA 1I2MA 1SHZA 4PZYA 1Z0KA 4WOPA 1BMFD 2W6ID 4PO1A 1XP8A 3SU8A 1A7JA 4OQFA 3EAQA 5BN3A 2JGNA 5HTKA 3WRXC 5F9HA 3P27A 1RZ3A 2Z43A 3UG7A 1VCNA 3Q9LA 1K5GA 1L7VC 2NZJA 4C0SA 1CU1A 2V1UA 3CONA 1O3YA 1GL9B 4B3BA 4DXAA 1E3MA 1TF7A 5DI9A 2ZEJA 1KDTA 3SJZA 3GLGB 1NN3A 3H84A 2QN6A 1KJWA 3SR0A 2J0UB 1VYTA 1U0LA 1C9KA 1LW7A 4FMDB 4GOJA 2V6IA 5IDVA 3THYA 2I4IA 3P4YA 1ONBA 4KBGA 1QZXA 1J2JA 1AS2A 3AEZA 1KAOA 5F9FA 2WIBA 4B35A 2E9SA 3A4LA 4U7DA 1S2MA 5HR5A 2GVDC 2XNSA 1GRNA 2QORA 3AKDA 4IDPA 3BERA 4KO8A 1NG9A 2QQ0A 3G0HA 4IEEA 1G4UR 3WHKA 5B2ZA 2XJ9A 3SEAA 3TQCA 1GFIA 2OAQ1 3ADCA 1CJTC 3L2OB 4IKEA 4Q7KA 3DKVA 4Z1MA 4TL8A 4LJ7A 1NIJA 1XEFA 3TVDA 4UNQA 3ZQ6A 5HKKA 1HE1C 1CBUA 3LVRE 4WBSA 3DZ8A 5JZVA 1WBBA 1N5JA 1Z0AA 4HUQB 3R9XA 1KKLA 5HE9A 2ASEA 2YJTD 3RRNA 3OE7A 4A36A 2OLKA 1ZW6A 4DBLC 3VNVA 2WJYA 3JVUA 3WBKA 4M9ZA 3ZVMA 1COWA 3TRFA 5FPKA 4GI7A 5E7JA 2EFHB 3LFUA 2XB4A 2BCGY 3EG5A 4TQ9A 1PJRA 5F3WB 4CEIB 4ZIRB 3C5HA 1TL7C 2RGNA 2VL7A 4DLVA 4LPSA 2AFHE 3I4LA 1RYFA 2X2EA 4URXR 4HSEA 2QRNA 3QF4B 1J7KA 2RGBA 3VQTA 3NKVA 2REXB 2JIZD 3FWYA 1XEWY 5FBVB 3LA6A 1M7GA 1XTQA 5SZJA 4YQFA 1DO2A 2J3EA 1DAMA 1E9DA 2ZJ5A 5TV2A 2VYFA 4XVRA 3EC1A 1GNRA 1DG3A 4NDZA 5FR2A 3B13B 2F9LA 2K5UA 2H16A 5GVSA 4GRAA 4MGYR 4C0AC 1KK0A 1J8MF 4DSOA 3OIVA 1BH2A 1XFAA 2H5EA 2IEYA 2YINC 3KUDA 1KO1A 5CIWA 1E2JA 1EFTA 1N6PA 2Q3FA 2IYXA 1YHNA 4AYTA 2HF9A 5JHHB 2OCYC 1W7AA 4BFVA 1XTKA 2QNRA 5JWOA 3FKSD 5EZ5A 3VHLB 1HQYE 3QKSA 1KI6B 1SXJC 2PZGA 3LNCA 2J7KA 3AGPA 3IKJA 2HT6A 3C14C 1U0HC 1R2QA 4FWIB 3IEUA 4Y0VA 4ZDWA 4LBWA 3CNOA 3UKDA 1OXVA 2NO1A 1OT3A 4QBHA 2QGNA 5FTMA 1Q44A 1WQ1R 4PO8A 2ATXA 3RS0A 3B1ZA 3GJ5A 2EFGA 3CRVA 3MWLA 4H9GA 4ILEA 4Q7MB 3QXXA 4JKIA 1WRBA 1XD2B 3MFYA 2ZRIA 2PEYA 3GLIB 4FCWA 3ZVRA 1AZTA 3Q5EA 5UKDA 1X8KA 4QHTA 3AM1A 1NF3A 1XBTA 2OESA 5DGXA 2KI5A 2GRJA 4A15A 2XXAB 1KO4A 4Q9LA 3I32A 2IXEA 5AJYA 3V9PA 1E0AA 5AJVB 4D81A 4DWJA 1ZNXA 1Q3HA 1IBRA 1N0WA 3AV0B 4CEHB 2EFEB 2L0XA 1ZYUA 3A36A 4IHQA 5KDLA 2ZSBA 3AP2A 1SVKA 1W4CA 1Q20A 5C4GB 3EZ9A 1T91A 1Z22A 1Z6YA 4BUJA 1IN7A 3KQNA 4Z54A 2CJWA 3CWQA 4DCSA 3N2IA 3CX7A 5DN6A 3P1JA 4JLMA 4NCIA 3LQQA 5CJPA 2DFTA 3U7HB 2WWFA 5FPSA 2XOKA 4B2IA 2OXCA 2WOOA 4O0MA 4D80A 3DZDA 1OB2A 2OO7A 4HLUA 2O8DA 1XD2A 1FZQA 5DI3B 4A8JB 4BRWA 4TYYA 3RHFA 1P3JA 2ATVA 1Y3AA 3FE2A 1ANKA 4PQRA 5IT5A 2B6HA 4RZ2A 2X77A 1KSHA 3GFOA 3IO5A 3M4YA 2D2EA 3MCAA 4ZI3A 1KGDA 3U6KA 1G3MA 2Y8EA 2YOGA 2F7SA 5FOUA 3W6OA 4MYHA 1SKYB 4GL2A 4EQ6B 2AXNA 2V7QA 5EXTA 1P2SA 3CZQA 4X8OA 4ESVA 4IFEA 3F0TA 4YONB 1Q1QA 1HH4A 1RYHA 3IQXA 2R2AA 1KI1A 1NG1A 2OHFA 2WAXA 2B8WA 1JR3D 3KX2A 1AQUA 1DELA 1E4VA 4KHZA 3S1AB 4LJAA 4XWOA 2X1VA 5GADl 4ZPXA 2J87A 4GFDA 1KSJA 2H7VA 2F1RA 3NG1A 1MR3F 2ZE7A 4EFLA 2ZYVX 1UKYA 1JR3A 1NBMA 3CO5A 4NCKA 5SZKB 4LPKA 5BYKA 2W6JD 3QXJA 1XCPA 1NN0A 3OZXA 1DS6A 4UNPA 2BOVA 5B58C 1VYVA 3LBHA 2G0NA 2YWEA 1II9A 3VX4A 2ZR7A 2QPTA 2H8KA 1EK0A 2IA5A 2WPDA 2ZYWX 2MSCB 1R0ZA 1WCV1 5B64A 1SZPA 2GETA 4NHOA 3BH7A 1MO5A 3QXCA 3U3OA 3U7GA 5E95A 2QY9A 1GDDA 4XD7A 1G7CA 1E1QA 1AKEA 2QMUA 1XCMA 1OH6A 1AIPA 1W5SA 3AVUA 3PUZA 4A1FA 2P6NA 1TUIA 4MQBA 4LOAA 2VHJA 2FGKA 3GFTA 4C0LA 4CYMA 1T8UA 1QHIA 3LXRA 5KNDA 3FHTA 1UBFA 4DEYA 4GNKA 1GAJA 3U61B 1HV8A 3QKRB 4X8MA 4RD2A 2GAAA 2JLYA 4GPTA 1XZQA 1XMJA 4JBYA 5BN5A 3R8FA 1G20E 3JZMA 4PHFA 4EPRA 5TXGA 3C8UA 3E70C 2CNWD 2R6GA 3CR7A 1XMIA 2XZPA 3VKWA 1T5LA 3A58B 4UXJA 4ARZA 2R62A 2ODNA 2P2LA 4BLPA 1LS1A 5DIFA 5KDDA 3C7KA 2CBZA 3V00A 1JQJC 2VBCA 4B2PA 2YVUA 4OQXA 3VMFA 1X6VA 3FFBA 1TU3A 2RHDA 2ZRDA 1RPZA 3RS2A 1UFQA 2BJWA 3UG6A 1OJLA 4Q1BA 1NLYA 4TMZA 4HZUA 4WXRA 3OEHD 3W6PA 2W0SA 2YNMA 5M04A 1VMAA 2IYVA 1H8HA 4HAWA 5G40A 4B47A 2CCKA 2W0MA 2VP4A 4D25A 3HYTA 1W36C 2QP4A 1KO7A 5J40A 4NMMA 5B30A 2QA5A 3R9IA 4B75A 1Q1EA 1NP6A 1XXHE 3AUXA 3B82A 1SQ5A 3DMDA 4P4SB 4TLAA 2P3SA 3AVVA 2BBOA 4TMWA 5ANRB 1KI4A 2J41A 1ZD1A 4MH0R 2IYTA 1XTSA 2XJ4A 2ZJ2A 5A5GA 4XVQA 3PUVA 1ESMA 3Q72A 4PTLA 3TW4A 3K0FB 3EPLA 1MRSA 3HR8A 2J59A 4LX0A 1II8A 3SDZA 3DEFA 2GHIA 2UKDA 3BXZA 4TYQA 1FTNA 1A4RA 2GCPA 5CLLA 2XOKD 1B23P 4TZ0A 1AA9A 4D0GA 1ZM2A 2FFQA 2GJSA 3DKPA 2GXUA 3HJNA 3Q7PA 2D4HA 4HDOB 2FPLA 3KJEA 2WSSA 1OXSC 4FD2A 2HYDA 3GLHA 1N6RA 2BC9A 4OI1A 1FOEB 1XMVA 3ZVNA 2KBFA 4A2WA 5KPJA 3BGWA 1TPZA 5L8VA 2WMNB 4LJ6A 1S9DA 3OHMA 2G83A 4AURA 4M53A 3CRMA 1RJ9B 1JAHA 3GMTA 3TIFA 1G17A 3EIHA 3MAAC 1XMSA 2QMOA 4Q4JA 4MYTA 5BXQC 2IUSA 3DM9B 4NCJA 2O8EA 3MUFA 1RRFA 2OCAA 4TN1A 1KDRA 1TQDA 5KNBA 2O0JA 5K8LA 2W58A 4C4PA 4MRRA 3GJ4A 2VP0A 3K53A 3QOFA 2BJVA 1T0HB 3U3RA 4A0HA 4YLGA 3PCRB 1U99A 4BZXA 1D9XA 1E9FA 1Y63A 4KLZA 3PENA 1OLOA 2GEUA 4MUAA 2V4ZA 4BEJA 2VH5R 3GLGE 3EZ7A 4FCVA 1E9RA 2CLSA 4KFRA 1OH8A 3NBZC 2DFLA 2KBEA 4W9MC 4IOLA 5EP1A 2FWRA 3CPEA 4Q18A 1YR6A 2GBLA 3K0AB 4RKEA 2O8BB 2GTPA 3TR5A 1E2EA 2A5FA 4BASA 3CLVA 5FBRB 5FL7A 4B3DA 3ONWA 4A4DA 4NP6A 2QT0A 4OQLA 2Z5FA 4LJ9A 821PA 1NVXQ 1F5NA 5FUYA 3U3JA 2YWGA 4FI3C 5K8TA 1IM2A 1Z2AA 2BEKA 2VO1A 4UXIA 2ZM5A 3ZD7A 2WSSD 1CJMA 2IXGA 2WIAA 1F2UB 4KYUA 3K0FA 1IAQA 1UAAA 3IHLA 3I5XA 5JMTA 3LH5A 2HJVA 2AD1A 2CJWB 2QRZA 1HY3A 1D6JA 1IJEA 1ZIOA 5EXPA 4MDFA 4TLEA 4AWXA 4NZYA 1SVWA 4BZPA 3CBQA 3ECCA 1W4AA 1XEXA 5BW8A 4DIDA 4CEHA 4NCNA 4PC2A 2ZR0A 2FX3A 3AKYA 4A2PA 1OF1A 2MSDB 4MRSA 4WZBE 1KOFA 4Q1EA 4DLZA 4W5JA 1AS3A 3QXSA 1FP6A 4LYAA 4HUTA 4IFBA 2OCBA 2OM2A 2F1HA 1Q3TA 2PLFA 4JLNA 1Z0JA 5DHAA 3SZRA 3FHOA 4DB2A 5FOXA 5TDHA 4D4LA 1U8AA 3KZ1E 1Z63A 2F3RA 2TMKA 1D5CA 1F2TB 1KI6A 2FF7A 4AC9A 3X1WA 1J99A 3IEVA 3C5CA 3DPUA 3VR1A 2WKRA 4KLNA 4Q21A 4DLWA 5JECA 5LPNA 4RD3A 1EFUA 2R6CA 3UANA 4JT2A 5EJEA 1SVIA 4WXPA 5HPYB 1KYIA 2FNAA 3NC0C 4FMCF 2PZFA 3KJGA 1U2RA 1S1MA 2NZ8A 1W0KA 2XSZA 1KI9A 3T5DA 2NOAA 1FQKA 2NPIA 4DJTA 4WW0A 2VRWA 3RLFA 2JDIA 3D3QA 4A6PA 3B1XA 2XB2A 2OG2A 1KDOA 3IHWA 4IDOA 4QG7A 4B3XA 1NN5A 3EC2A 2RMKA 1YVDA 1E0SA 2AHOA 2BBWA 2ZS7A 2OSBA 2D62A 4QGAA 1S3GA 3W5JA 1LB1B 1P4SA 4PAQA 5G41A 1XU4A 3ASZA 3K9LA 5KSZA 3B1VA 4NBSA 4QJ5A 1TEVA 3WNBA 4KXFB 1L2TA 2B8TA 3CR8A 3SYNA 4FWTA 2O0KA 1ZVQA 3B60A 5CK5A 1U9IA 2YKGA 2G1JA 5JSZB 2JJ1A 1AS0A 2IS6A 3ETLA 2XX3A 4S2EA 1E4YA 1EX7A 2FU5C 4JLDA 3TAHA 1HTWA 3CWZA 4GP7A 3F8TA 2JJ2A 121PA 4HI0E 5EP4A 3CW2A 1RJ9A 4XSHA 1SVSA 2XGJA 3R20A 1S9HA 2Z6VA 2VHCA 4YDHB 4QOSA 3NWJA 3G82C 3U6BA 2G0TA 2XEXA 3KB1A 1G3RA 4EJSA 2PH1A 1E2IA 3OEEA 5DNYB 621PA 4D4MA 3A8TA 2GF0A 4TLBA 4TL7A 3BK7A 4JLPA 3ASYA 4D2IA 2NIPA 3BS4A 2KWIA 5JI2E 3ICQB 3QBTA 2ORWA 1G291 1OIXA 1P73A 2C04A 4PHGA 5B57C 3R7WA 4AKGA 1BOFA 4QHYA 4TQAA 1ZU4A 4V0KA 4PPGA 3IPYA 2GEVA 4HAZA 3OAAD 5E7MA 1W5TA 3UWOA 2Z4RA 2ECKA 1XRJA 4DT1B 3U2QA 5AJZA 1OB5A 1LF5A 2CK3D 2IYSA 5H8WA 1P9NA 1P2UA 2BIFA 1U8ZA 2X19A 4J0QA 3SI7A 1JXMA 3W3AA 2WJGA 3CM0A 3T5GA 1JR6A 4IOJA 2NO9A 3GLFE 4B6FA 1FMJA 1KKMA 4OI0A 3S1AA 4DLTA 1UDWA 1O87A 2N46A 2QP9X 3WY9A 1N5IA 5FUWA 1R0YA 4HYYA 1H8EA 3TH5A 1UBGA 2WAYA 5SZHB 2GJKA 4BE7B 2JLUA 4IVPA 3RNLA 2XNDA 5EP2A 3B1YA 3IO3A 2FOLA 1KI3A 3QVUA 4NYIQ 1WXQA 1TU4A 2VQSA 2A5JA 4PC7A 1T0JB 3AKEA 4PAMA 3E2IA 1F2TA 2BMJA 4WA7A 1OPXA 5KTYA 4IDQA 2B21A 2ZI6A 4LJ8A 3BH6A 1IOZA 1R5BA 2AR7A 4GZMA 4NCHA 4EPYA 4PZLA 3HWSA 3O8RA 2JLZA 1ZM3A 3KFXA 1JEEA 1VDZA 1BYIA 4B73A 1FTSA 1QHXA 2ZJZA 4G0NA 4RD1A 1VECA 4M1YA 1KHTA 5EE9A 4FMDF 3SBEA 2OFWA 3QE0A 1Z28A 3L0OA 1RVDA 3B9PA 1NN1A 1ZCAA 4DLUA 2JA1A 4JZKA 2O8DB 2D74A 4XWAA 2ZSAA 3SN6A 1DAIA 2VIIA 3L0SA 3I62A 2Q9AA 1SXJA 4US0R 1CRPA 3K9HA 4GDFA 1G3QA 3R8CA 3OE7D 2V9PA 4LK2A 2IYWA 1F60A 3IUYA 3C41J 5FI0B 2VA8A 4OHZA 2BKUA 1LNZA 3GLHE 3ND8A 2ZTSA 2D7DA 2ZVQX 3LWNA 1KO8A 1EGAA 3VAAA 3J81k 3QF4A 2OBNA 2LWIA 4LUCA 3ZJYA 1XTRA 1NRJB 2JLVA 4UQOA 1Z6TA 1YRAA 4E09A 1R8QA 4LBYA 3FGNA 3VU9B 4DCUA 4LJYA 3GJXC 3VNUA 1SHKA 4MRPA 3BAFA 1QHGA 3CH5A 3OFNA 2VSOA 1QHHA 4Z1MD 3K70B 1D2NA 1EG7A 1JNYA 4JSTA 3THOA 5JBQA 1AN0A 4HATA 4ZKDA 2IW3A 4P33A 4B2LA 4AYWA 3B8HA 3P4XA 2A2ZA 1CRQA 3QVVA 3RRYA 4URYR 3X2SA 5KDOA 2NO7A 3NDPA 4KBFA 2AKYA 1VHLA 3GJ7A 4ZIRA 2VLIA 4GMXA 5EQTA 1Z83A 1DG1G 5J47A 1RC8A 5IHPA 4DLXA 2LKDA 3CRRA 3FPAA 4PFSA 2DPXA 1VTKA 3GLIA 1KI8A 4NYMQ 1AK2A 2OFXA 2Q3HA 5EE1A 3KKPA 3K0CA 4M1TA 3GP8A 1NNEA 4LBZA 2CDNA 3TW8B 1FNMA 3EWSA 2HLDD 1XPRA 2JJ8A 3KJIA 4AYXA 2GEDA 2YWHA 3EA0A 3RSLA 2DFNA 1TTTA 2NTYC 3KXKA 4Z8YA 5A0FA 5EUQB 3WNDA 1G16A 3QKSB 2J46A 3THYB 1YRBA 2GAOA 1VIAA 1VPLA 2LKCA 3ZVLA 2ZRGA 3GEEA 2P0EA 1Z0FA 2REBA 1QHHB 3B9QA 4Y0AA 1XJQA 2MSEB 2OILA 5FR1A 4V03A 3BIFA 4KV9A 2CCJA 3NH9A 1E32A 1GKYA 4HZIA 1RE0A 1J8YF 1E94E 2EVWX 1N6IA 1Q1BA 2ZJBA 1FQJA 3QENA 5LB4A 1CR1A 3CPHA 2GDJA 1N6HA 4MKGA 1MRNA 4JJKA 1OFIA 421PA 5C2JB 3BB4A 5JWRA 1A5TA 4M1WA 4KVGA 2XZLA 1FMLA 4L5BA 1VKJA 1K5DA 2REOA 5HCIA 4GP6A 3ZDQA 4R2HA 1BYUA 4LJ4A 3SHWA 4QJ3A 3K9NA 5IF9A 4B48A 4V0LA 1MT0A 1VIYA 5CIQA 3KFVA 4CF7A 5CLQA 3VHXA 1EFCA 4Q47A 2A5DA 4KYIB 1E2GA 4RFSB 1RKBA 4RVCA 4QL3A 3L8ZA 1ZU5A 2XTMA 2VF7A 2HEIA 3K0AA 2WKQA 1KMHA 2ZETA 1ZUIA 1RRPA 3AF1A 3IGFA 3ND9A 3QJYA 2RAPA 1UEJA 3P26A 1E1QD 4LHZA 4Q9JA 1CIPA 2E87A 2V1XA 4YMVA 3ZLJA 1OW3B 5FI1B 4QJ4A 2JLRA 4DT1A 1G6HA 4GZLA 3PEWA 4GOXA 2G77B 3TUZC 2ZJAA 4EJSC 5G53C 1PZNA 1N5KA 1NJFA 1XPUA 3PJRA 1AM4D 2RCNA 4OHWA 3RAPR 2ZRCA 1MV5A 1NBMD 3FMPB 2ZRBA 1GTVA 5JJKA 4DDWA 5TVKA 2ZJOA 2PJZA 1X1SA 2J7PA 2JCSA 5BQ5A 1RRCA 5KSPA 5HCNA 1PV4A 3G5UA 1YR7A 2R8RA 4HB2A 4C7OB 1XEXB 1HYQA 2FN4A 1T4GA 3I73A 2A7QA 3UMRA 1W2HA 3KB2A 3TNFA 3THXA 1CEEA 2YOFA 2AFIE 2ZAMA 2R9VA 3WBJA 3WMGA 1IJFA 3GJ0A 2JLSA 1QRAA 1D8TA 5DHFA 1UDXA 2WWXA 1IY0A 1YZNA 4TSFD 3W8RA 3LVQE 5G3YA 3RC8A 2IUUA 3QNUA 1MABA 1XB2A 3MJHA 2GZHA 1VHTA 4Q1AA 5EE0A 2IT1A 4JKYA 4M2LA 4ZKEA 1PUJA 1BO6A 1T5IA 1VCMA 4LY6A 4Q1DA 1JJ7A 3KUCA 3VTKA 2VF8A 2GCNA 3JVVA 1EFRD 2QAGB 1CJUC 2QG6A 4HDCA 4KSCA 1IXZA 2HCJB 1SVLA 4EQ6A 4HAVA 2ERXA 3AVXA 2XNDD 2EFDB 4LWZA 3UMFA 2N1BA 5JLJA 2JJ2D 4Q7JB 2JAQA 3D31A 5J4LA 2XZOA 2GJAA 5FPYA 3WMFA 4XD7D 4KI0A 3FVQA 1HEIA 2JJ1D 4OK6A 1G4AE 1KJYA 4E07A 4TMXA 1HT1E 3W90A 1X8LA 5KOYA 3TLXA 3OIUA 2VPPA 4M1MA 3FYHA 3KXLA 1CTQA 2BMEA 1LS6A 1VG8A 3W5IA 2G9NA 4PR0A 4BLTA 3PQCA 3QKTA 3THWB 4KFSA 4QBGB 2IS1A 1GL7A 4A82A 4RZXA 1DBSA 3LD9A 4JBXA 1ELOA 1W0KD 1OSNA 2BHRA 2XSZD 4C0JA 2ZYTX 1XD9A 2RGCA 3NXSA 2IUTA 4DEXA 4MUBA 2ZUBA 1R7RA 3T12A 2IS2A 2YZ2A 1UKVY 4I1VA 3RVBA 1KY2A 1II8B 4OK3A 2CHGA 2Q9CA 5LD2B 3HP1A 1EWQA 3GQBA 2F1JA 4O2RA 3KQHA 2WM9B 2RGDA 3TKLA 2YC2C 5EXSA 4QNMA 1HE8B 3RS4A 1A1VA 1L4YA 1R10A 1WE2A 2QL6A 2EYQA 2NGRA 3BH0A 4DC9A 4PPQA 1N0VC 1S0UA 2PBRA 1N6KA 2PLRA 3MG9A 2OFOA 4XOIA 5KSOA 4A0FA 4ON9A 4O2LA 4EUNA 4LC0A 2AX4A 2O0HA 1MABB 1G19A 2ODBA 1W0JA 3RABA 3KQKA 3FHCB 1UADA 2GZAA 2JLQA 3QEOA 4E22A 2HDNB 3EX7C 2RHMA 2IS4A 3QY0A 4Q5IA 5L3SB 1CLUA 4RZ3A 1KZ7B 5IK2A 4NH0A 1CP2A 2J0QA 3HR7A 1U98A 3M6AA 4M4SA 4KODA 2UVQA 1ZP6A 1E2DA 3MWKA 1NSFA 1IY2A 3IIMA 1W4RA 1XDBA 1YZTA 2J0SA 2QE7A 3FMFA 2HXYA 2DB3A 4RD0A 2FGJA 1GKIA 1XJ0A 1OFHA 1V43A 2WJVA 4D0NA 3B85A 2ZSEA 4G5SA 4TLCA 3QPVA 1P6XA 1UKZA 2C99A 1XWIA 2PCLA 2WPDD 4JJZA 4TSFA 4YMSA 5TB5A 4E5UA 1T9HA 5FTNA 5KPDA 4QM6A 4V0MA 4F38A 1XF9A 2JIZA 1R8SA 3FKQA 3NVAA 2VP5A 4BQSA 2QPOA 4F4CA 2ZXUA 3ADDA 4HB3A 3GLFB 4GT1A 3CH4B 2C9YA 1R6BX 3CF6R 2I3BA 3QQ5A 3HYRA 5FUVA 4MDEA 2Q0HA 4ERNA 3AVOA 4MYCA 5L3QB 4IVQA 3BRWD 3LBIA 1TNDA 2C8VA 3CPJB 2PZEA 2OUKA 3AP1A 3NIBA 1COWD 3I8SA 3C4JA 4D6PA 3GJ3A 1QHSA 2DR3A 1N0UA 2R6DA 5LDDC 3V4FA 3PIRA 4KSBA 2YV5A 2FG5A
chains in the Genus database with same CATH superfamily
2BGIA 4OBEA 3NAZA 5HRUA 4GM0A 1D0IA 2DWPA 4G85A 4LHWA 3FFAA 4RIIA 5BSGA 5AUQA 5I8WA 1VIVA 3IDQA 3TRIA 1JFLA 3ZH9B 4FYYA 3F8WA 2W2TA 3CF4G 2GF9A 1QH1B 3ETEA 2VWQA 2PRJA 3GEBA 1E1MA 3BWVA 4HFJA 5COBA 3UATA 2GA8A 3STYA 1GKUB 3DF7A 3NCTA 1VE7A 2BF7A 4U39A 4PYLA 1CUZA 2WI8A 4R84A 1EGQA 4PS0A 2YZMA 3ANXA 1F51E 2OWDA 4JI3B 1V8PA 4CVNA 1XJ5A 3P9RA 4H59A 2XGSA 3BVPA 4OHVA 4BKPA 1ZD9A 5SY9A 2GJ9A 4K88A 1SIWA 2CD7A 5REQB 2NU6B 1CUBA 3PXEA 5K2OA 3GH3A 2PMBA 3LHKA 4MKZA 5BSHA 4OBBA 4ACBA 4BFWA 3G0BA 2OBLA 1L7QA 1PR2A 1QZ3A 2HMYB 3HCOA 2QRVA 3R3WA 4R2KA 5KYUB 4DIOA 3IPLA 1EQAA 1VCIA 4XIFA 4HEJA 3OJWA 4D8VA 5L51A 4AY3A 2GKGA 3EH1A 3LC7O 4R4JA 1M7BA 1OLSA 1JDPA 4NG4A 4Q01A 3C3PA 5D86A 2GZ3A 2BL4A 1N33B 4AICA 4D3FA 4IRUB 5FLXA 5E2IA 1W35A 4B4OA 3HBMA 4IDGA 3TWOA 3T7AA 4XQGA 1GL3A 4WZAB 4G36A 5ALDA 1ABFA 1I6WA 3JZDA 1IL0A 1XRPA 4KIFA 2CK3A 4DS3A 2OTCA 2ZRHA 1P7CA 3KJQA 4H7IA 1NW8A 2EIXA 2GNPA 2BE9A 1G2IA 1OBFO 4Q1FA 1WNFA 3TDMA 4TZ6A 3OWXA 5CB8A 1ZMRA 5LYJB 2H6EA 1LRLA 2OCPA 2XWBF 1TCBA 3EXAA 4BZQA 2AG0A 3G3EA 3NTOA 3CRW1 4JBLA 5DM0A 4N7BA 3OM8A 1I4DD 1JQBA 1MRZA 1QQTA 4HG2A 3PFWO 4I8XA 2PX0A 2XTZA 3RV4A 4G81A 2ONJA 3HBAA 1JTEA 4AJ4A 4WK6A 3LCRA 2VJKA 3I5UA 3I92A 5DYGA 2ZRMA 5H1YA 1TK3A 5JU6A 2VUTA 4FD3A 5AK0A 5D7NA 2JLBA 4KDCA 4R1SA 1UMBB 5FI3A 3GPDG 1DPGA 4TRJA 2ODEA 3RBVA 4QKQA 1CT9A 1KAEA 1Q6YA 2XCLA 1RRMA 1VXRA 1KAGA 3GBSA 3P0EA 2OYRA 4INJA 4PSCA 1NM5A 3ZS9A 1ZIPA 2ZU6A 4MEAA 5TPZA 4LYHA 4HDKA 2EW1A 5DZSA 4P3YA 3DUFA 3WK7A 1Z8FA 1UC9A 3WKAA 2AQIA 3ZQKA 1DKUA 2RARA 3F5QA 3L6EA 4JMPA 2WTUA 2FTKE 4B80A 4S1OA 5A0FA 6AT1A 2IYRA 3H05A 1EGHA 3C5VA 1AUQA 4RMGA 5JAHA 2XD4A 1NX9A 2IY7A 4B4UA 2YHUA 2ZS9A 4J3JA 3G8CA 4EP1A 2WWIA 3QFCA 3EXHC 4LY3A 4NPAA 2GILA 3L0IB 1H05A 3M9LA 2Z2IA 1OYWA 3H2BA 3ICOA 4H17A 5U4XA 3TCXB 4B2YA 1BU8A 4OM7A 1ECPA 2BCEA 1XLTC 2DQYA 5BW6B 2FJUA 2WEKA 2WJAA 1U0SY 3EISA 4NYJQ 1UMCA 1P9OA 4PC3A 2WWWA 1AH2A 3NTQA 3PJEA 4BB5A 2VQFB 2JIQA 4JC4A 4FGZA 2ZAIA 3LT1A 4AMGA 4NPHA 1OKKA 3AVPA 1IN1A 3BHMA 3N70A 5KX5F 1BU5A 3F3YA 2OHHA 2V74B 5E8JA 1XSEA 4JBWA 3U4CA 3OECA 1Z6GA 2HPVA 2FP4B 5JYBA 3DEYX 5ETJA 1KFJB 2VCYA 4YCDA 1E2QA 2A9OA 2FFAA 4N3GA 3T3MB 3VYTB 3ZBPA 4BLRA 1NVKA 1XRRA 4GDMA 4QGFA 1V0JA 2VPWA 2YJGA 3LBYA 3KCNA 4WPGA 5DB4A 4NZ9A 2PT7A 4QM7A 5FBLB 3PDJA 3PFIA 3L0PA 2ZIZA 2X8AA 3H9JA 3ROXA 2X9GA 3D59A 1EDEA 1G59A 1SU6A 3EFHA 1Y6JA 3K5IA 4G5HA 3RG2A 1X87A 2EHDA 3HCFA 5F2OA 3A05A 3HU2A 4IICA 3FVWA 1YUNA 4WZZA 5IBCA 1E96A 3F4BA 3NW9A 5TQVA 4EBBA 4Z3KA 2YWCA 4XSVA 2XMCA 2YV1A 2XXAA 4ID3A 2XUKA 1NW9B 4XGNA 1THMA 1IZYA 1G55A 3AVTA 1DMSA 1H2WA 4JEHA 4GMDA 3RV3A 1NBHA 4QELA 4V1CI 1XQWA 1JDZA 1U0GA 1TKAA 1XNHA 1ZXBA 4LK3A 3Q98A 1NVUQ 4D8TA 2H1SA 3W3AH 1BS1A 4P3KA 2G4LA 2V7VA 3ZV5A 1P91A 1LV8A 3BJIC 2HA5A 4FDVA 3PVZA 4UKDA 1C4WA 4PSUA 2QN1A 3S44A 3IA7A 4WL0A 2E1PA 4I50A 1RQPA 3OQBA 1I3LA 4E5MA 4DUZB 1NBEA 1WDLA 4P53A 1HNNA 4K40A 1KNXA 1LVGA 2BLNA 3B1FA 1PEAA 1N0IA 5IDXA 5LUAA 4C7OA 2GPSA 4Y6PA 3DYBA 2XMGA 4JI7B 3UTDA 3I2GA 3MVEA 4ETNA 2O1WA 4LWQA 3W78A 2FZKA 4KREA 1WWKA 2R8PA 4Z0HO 3NBXX 1PGOA 3N74A 4S3MA 4E33A 5AW6A 1KDZA 4RCYA 4R1UA 2FEMA 1SXJB 1GPWB 2W48A 1I7QB 1C3LA 1M6HA 4LRTB 5DI3A 2JG3A 2DULA 4IJMA 4JQCA 1BE6A 3D6TB 3RK4A 5B2FA 3P9CA 3D54D 4N3NA 4LNUB 2R6JA 3U7EB 3SYLA 2J6BA 1NPTO 5HMMA 3B6EA 2VT7A 1ZWLA 1DC8A 2EJTA 3PXAA 4TKVB 2WF9A 1ZD3A 1W19A 3OUTA 1G5HA 1SCDA 4QBFA 4GGPA 4LHYA 3DZIA 4BJ1A 3LY5A 3N8DA 4UBJA 2Y3IA 2YC4C 3E35A 4B4DA 4ER5A 5K0LA 3EG9B 1IC6A 2BWJA 3ENKA 3IPAA 3MTIA 4DCVA 1RQXA 3CSSA 4EFKA 3D4BA 1YB5A 1KJNA 1SBHA 1SCIA 1DAEA 2GPBA 3PPYA 2ZI9A 3C98A 1L1RA 3IJPA 1NI5A 2XR1A 4IIUA 3RWMB 3EH2A 4N6OA 3ZGVA 4JVLA 2I71A 3UV3A 3WYAA 4V02A 1QG4A 3WBFA 2JFBA 1ICEA 2NUPA 2QTRA 4HN4B 1YA6A 5JYDA 1CP3A 3MGGA 4OTZA 1MA3A 3DXFA 4WESA 5AKHA 1KVTA 3R3HA 2PUBA 1TJ4A 1LC3A 4CM4B 5IBQA 2NXEA 4Z5XA 5CNJA 3LHIA 3GEPA 3ITNA 5KNCD 4W5TA 2HXSA 2JJMA 1T2FA 2VI5A 3S70A 5LP6B 1BHJA 3LBNA 3ZQUA 3V7NA 2ODAA 2KB0A 2ZUUA 1PR0A 3EMVA 5AJXA 4YJHB 3ZG6A 4UEJA 2YQZA 5CFLA 4JMLA 4KPUB 4KGDA 2C3UA 2J9RA 2L2QA 4R1QA 3U13A 4AIIA 3RS7A 4HK4A 1GG2A 4GSYA 2BM8A 4QARA 2R1TA 1RRVA 1UPUA 4Z7NB 1KEZA 2JB9A 1RXEA 5B7PA 1PR6A 3ZCUA 1SXHA 2ZI5A 4YP5A 1NP3A 2P5YA 3PUJA 3TE6A 5JBNA 5JRZA 3O47A 1JMKC 3LHFA 1MZVA 4MW2A 1LLDA 3DE0X 1F0KA 2G9UA 2XMZA 4QZVA 3STVA 1BKSB 1UDBA 2F1IA 2HUNA 3UXMA 1ACMA 3RAFC 3UAXA 1GKKA 2YFQA 2DCUA 2R00A 3HA3A 4QDOA 1FYXA 3LCUA 3ETHA 2YL2A 3I9JA 1Q2UA 1TF2A 2BD0A 3Q87B 4HMOA 2WD7A 2PCJA 3MF4A 3RD5A 2NAFA 2WRZA 1YFKA 3VTZA 4AJKA 1LUAA 4WHMA 1IN4A 3FCOA 1UQRA 4QA9A 2CCGA 2DHRA 4QYXA 3IIKA 1Y7PA 4K9DA 2M2IA 1SC9A 3FCYA 4QUDA 4CTJA 3IAS6 4HN2A 4JSYA 4NNPA 1AQYA 3MT7A 1KRXA 5CA0A 3O7MA 7REQB 2RAVA 2WU4A 3I2YX 2QSZA 2CWWA 1I8TA 4PLWA 1C7FA 3NAGA 1RWKA 4MV0A 1E2HA 2O2CA 3HLTA 1B4DA 1M2VA 3IDSA 4HGYA 5EZYB 3AVQA 5I9LA 3K96A 3ZE6A 4RFLA 2C20A 3EMKA 3O95A 5EVCA 4YT2A 2YJ3A 5CX1A 3TLZA 3UFBA 3PC6A 5EUCA 1DLIA 4JA2A 5EC8A 3EA5A 4MROA 5TT0A 3OZBA 3FNBA 4QO8A 1KOLA 2C92A 2PH5A 3PF9A 3QKUA 4UTRA 2DPHA 2P4HX 3OF5A 4C6HA 2H4WA 2QBYB 2LNDA 4P7KA 1I5RA 1B8NA 1IQPA 1RFLA 1U7OA 5EUMA 3ZCQA 4LSMA 4D92A 3IT3A 1KNQA 4CMGA 3WMXA 4Q19A 4UVDA 4PXSA 5AW2A 1S8FA 1WXHA 4TYWA 5FFMA 1M1YB 3AY7A 1B8UA 4XE5A 2A0XA 4MWDA 3ZHZA 5IJ0B 3AEUB 2GNOA 1PT9A 4S1PA 1ULZA 2ON6A 4C06A 1C5KA 1SM4A 1M7HA 2V4MA 2CEAA 5GMOA 1E79A 2C84A 4F86A 4UCXA 3TKAA 2OG1A 2I7VA 1A4XA 3WKCA 3SQXA 1STOA 3B48A 2X9QA 1V2GA 2AMYA 3CEMA 2L17A 3P2MA 4AN1A 4C87A 3LLVA 2JGLA 1V26A 4TUYA 2N9UA 3T0GA 3VBEA 5L9AA 4CEJB 2OE2A 1G20B 1DRVA 1GUDA 3LIPA 2OC9A 2CXXA 3MAGA 3QLVC 3MUEA 1LRJA 2WU3A 1R8JA 4HUJA 4L75A 3R9KA 5AESA 7GPBA 2A5YB 2QRJA 3N0TA 5LZ7A 1RWNA 2P40A 3TIVA 2QL7A 2ZVDA 4PYRA 3DMTA 3VH1A 1V16B 1GGEA 1T6YA 1U8TA 2EBHX 3M9WA 4GPBA 5DNEA 8AT1A 5EJ8A 3RASA 1TUBA 5HE8A 2G76A 1ZUHA 1KRHA 2AOXA 3V1UA 1V95A 3ELWA 3IEMA 2FDXA 1KP2A 1JIIA 5G1NA 3QXHA 3WQHA 3Q6NA 1FDOA 2W2KB 1JHMA 4F1KA 2Y9MB 4EMUA 3H1AA 5AICA 5ER6A 2VQ3A 1TQ4A 2IYQA 1ODKA 4MVJA 3N7TA 2NZ2A 2ADOA 2BZ0A 1R0XA 3IOEA 4E88A 2R7MA 3SOZA 5KQPA 3PHLA 3Q7EA 3UK2A 2WVJA 3C7AA 3JWPA 4K2HA 4MRMB 3B9RA 3UGTA 1Z4OA 2Q99A 3BTSA 3DEIA 4O1HA 1OFTA 1RLJA 1MD9A 1KY4A 4NY1A 4EYQA 4KMMA 4F3KA 1OU0A 1VPDA 2QS9A 3QYJA 4CNBA 4LF8B 4LV8B 5DGHA 4X66B 1VRVA 3OEED 1EB9A 4G1EB 1YQWA 4LRWA 5M34A 3ABRB 2OB2A 2ZYGA 4IX9A 5BOVA 3I01M 1Y8CA 3OZDA 4DCCA 5FTLA 2V9ZA 1DBRA 1ZY2A 3B78A 4NS4A 2P9EA 4MGZR 4RFVA 5CVVA 4LJSA 1KETA 5JJLA 4JJEA 4ZCIA 4LHXA 3LCMA 2X41A 4U02A 2XQFA 5G3ZA 4ALJA 1HT3A 1PHRA 3G9QA 3G9TA 3WG9A 1B16A 3E53A 1M66A 1Z38A 3DVAB 3U7FB 1J9ZA 4FW8A 3ZHYA 2F9FA 3JARB 3HXPA 2BFWA 2PRKA 3ND7A 5I7UA 5K0BA 5TARA 1FP2A 1Z17A 3AOGA 2VYVD 3SZMA 5JOQA 5KUTA 3KEQA 4M9RA 1YI0A 4BC0A 3S1SA 1GV0A 1M2OB 5IDYA 2QMHA 1G5QA 1R5NA 3QBEA 2PMDA 3REGA 2PG3A 3OT5A 3PTZA 4HRVA 3OQ1A 4XA8A 1EESA 3M5DA 4O8CA 3HQ4O 4RXMA 1U8YA 1LI7A 2WWGA 3WIOA 1CY2A 2JD0A 3ORRA 2PSJA 3DG9A 3MT8A 4LGMA 4N9QA 4BLVA 2R84A 5CA1F 4F11A 2B0JA 3PX2A 4U9HS 5JUWA 4HLDA 1PLKA 1TCAA 4MQ6A 4RHXA 1TAGA 4YC7A 1WTCA 3SHTA 5CDFE 4AMVA 4PLTA 1PCXA 3QUCA 3RG8A 1R15A 2ZIXB 4EFNA 3KJHA 2J3LA 2YBEA 1NNI1 2V58A 1ZCZA 4BNWA 2GK3A 4TGLA 3RIXA 3RTEA 3TSAA 4ANFA 4CLOB 4JXZA 4FCTA 2NYRA 1DV1A 2FCRA 4G8CA 5HZHA 3H17A 4K9SA 3PD0A 3GMIA 4ZZ1A 1ODJA 3A1NA 1I51A 2I4TA 2RFLA 2VOJA 3HSYA 1RKQA 3ACCA 3OBIA 2YJNA 4AQ7A 2OBXA 2UXBB 3FTPA 3GT0A 3K5HA 4I4IA 2ISCA 1NT4A 4CMBA 3R7LA 2RCYA 4DC0A 2YW9A 4FEAA 1JW9B 2H08A 5EP3A 3OF3A 1Y9AA 4GC5A 4H08A 2P7IA 3E84A 3GPIA 1OYOA 1T4CA 1I4OA 1YU6A 1MHPA 2RHOA 4X1IB 1TMKA 5BN5B 3NXKA 2ONKA 4I66A 4JENA 4OXXA 1HYBA 3I1IA 3P52A 5MGNA 2IPAB 3HDYA 4FFSA 5CCEA 2JKVA 1VCOA 2E5FA 2XMQA 2IP2A 3BCUA 4JLSA 1ES9A 1ZK2A 3P9IA 4MITA 5L7WA 1MVOA 1QZTA 4WNIA 3LY8A 2IYOA 1VE5A 4FB5A 1S4MA 2AC7A 2NVBA 4MV6A 2DXIA 1X1RA 1C0PA 4QOFA 4FM9A 4CM5A 3HYCA 4AKTA 2CLCX 4AM8A 1ZGHA 5GZ6A 3LQ1A 5HW0A 5CG1A 1IVYA 3QKIA 3CLUD 4K3VA 4KFUA 1JYSA 1E3EA 1GA1A 1QDUA 1UJ4A 3F73A 1XJCA 3V4RA 1OTHA 1PV2A 3H1BA 3WK6A 3RYCB 4EMTA 4CW7A 3NHLA 2P1RA 3HA5A 1VB5A 2JK0A 4R9UC 1G21A 4DM7A 2P91A 2BHSA 1M72A 5AT1A 4RK6A 2JVIA 3R7FA 4MP8A 4Q48A 2JLXA 5T6BA 3F3KA 2FLWA 1AMUA 5KQRA 3V6LA 2Z0MA 4RCZA 3V8RA 3X3HA 4JC5A 1L7DA 3BF8A 5AW0A 1MZPA 4NEGA 2AXPA 2D1FA 4YVFA 3JQQA 3SZLA 2EGGA 1X7YA 4FYHA 4C3UA 2RONA 3EC7A 4R5HA 2EJUA 3VZRA 2MMCA 4M55A 3PHCA 1VSQA 3ZLVA 4KCGA 4OJYA 4MWOA 5U9CA 4CZ2A 3X1KA 1QC5B 1T13A 3AVYA 3FUCA 5DGCA 3ZJUA 4D4KA 1U2SA 3FF4A 3N28A 2EL7A 4QDKA 4L4SA 5H3LA 4CF6A 4J9UE 2IWHA 1ZXXA 1RRKA 3RYTC 1QZZA 4I1PA 4L8GA 2GHTA 4MQ5A 4XYBA 1ZGCA 1I1NA 4WNAB 3EARA 2Q5QA 3ICPA 4JJFA 2GRUA 1Z6QA 3L7DA 4TLLB 5GONF 5PGMA 4MS1A 5BNZA 3R44A 3AQIA 2RGUA 2R86A 5H3HA 3U5TA 2J5BA 4KITB 1JPJA 1CDZA 1OGJA 1T3HA 4TT8A 2J9FB 1DT3A 1T6XA 2DBYA 2YHIA 1XVIA 3F8SA 5CM9C 5DTMA 3A6EA 1Y80A 3FPLA 1NL3A 2B2XA 2WWHA 4TMTA 4QTTB 4OHOA 4PIVA 1OX4B 2C5SA 4UARA 5FQNA 2YCBA 3MWDB 1P33A 2O2GA 1EK2A 1GR1A 4RJLA 1NR7A 2AKAB 3L93A 3K9CA 1TQHA 5AM3A 1UBJS 1NQVA 1G20A 3IT0A 1V5WA 3OFKA 3GDFA 3TZKA 1JIVA 1F6DA 3IOBA 1Y9JA 3JWEA 1DXQA 1OPRA 1LLFA 2CVHA 1R9JA 4BNFA 5AHXA 1N92A 5CJJA 1ZN7A 5I3CA 4QLOA 2FW9A 4LFBB 3FJOA 1JQKA 1VL1A 3DZKA 5HRAA 4MA5A 1TE2A 1ZK0A 2GYYA 1JDSA 1U0JA 5F7XA 4K28A 4PN3A 4A26A 3TGPA 3I37X 3NEJA 2FE4A 3FD8A 4BLSA 4PPNA 2C2YA 3H6HA 2FK7A 1UIRA 2Q46A 3I30X 3O8OA 5JZOA 3DDNA 3QUTA 3QQPA 3H42B 3K09A 4X61A 5EEGA 1DG9A 3CZAA 3I9MA 3CRQA 1ISRA 1N1MA 1QBKC 2BI7A 1JJVA 1O08A 1U28C 2CNWA 3CCCA 2WU0A 1EBUA 3FGPA 5JH7B 1Y6FA 3LNTA 2ODQA 2IVZA 1NZDA 2J6CA 3REQB 4EJMA 4FR0A 4IHJA 2CLLB 4CWAA 1YQXA 1M1UA 1ENZA 3IBTA 4RGYA 3WAJA 4ZU3A 3PGJA 4MRNA 5BN3B 4K81B 5AUPB 5E4JA 4GEGA 3GNLA 2V03A 4MUXA 4CN8A 5JHGB 1VMKA 1IB0A 2ZB3A 2VF5X 4R01A 2ZSKA 1YIDA 3CZPA 2WNIA 2AN3A 3SC6A 3G2NA 3AB3A 4BX2A 4X8HA 2A9QA 4RZUA 1A8IA 2YHSA 1HEUA 2ID7A 1USVA 1XTIA 5JS8A 3OA2A 2X0NA 4TTRA 4Z9FA 5JSZA 3LY7A 3WK5A 3KVYA 3INRA 3B53X 2ZJ7A 4BPRA 1NBME 3KZOA 3AJAA 3ROEA 1CUXA 2VBFA 3DHEA 1DHRA 4DMRA 3CNNA 1SQ6A 1J5PA 1NVAA 3X2FA 1GILA 5JCZA 4K05A 3TEJA 1S8AA 1NPDA 1KI2A 1Q7CA 2JH3A 2P2SA 4WDQA 3LW7A 5A4IS 5CM8B 1YDHA 2B83A 4K0RA 3NBFA 1N32B 4FDUA 2C94A 2Y1KA 3O26A 4O33A 4JP2A 1MO2A 4JIMA 1G41A 2AXQA 1JI0A 4TMYA 3X1XA 2NZXA 1MKYA 3CUKA 3UGKA 2OMEA 3PVSA 3DEJA 4CL3A 2WY2D 3U4QB 2HBRA 1XC7A 2DPGA 4UEKA 5D00A 2CWDA 4J29A 3RIYA 3Q8XB 4X1YA 2D6FA 3BM5A 2CMDA 4OCZA 4BWGA 1LQ2A 1RBMA 3SFVA 5B7GA 1GTG1 2RC6A 3QVJA 3LUAA 4BAUA 2QENA 2FDCA 3FAZA 2H9AA 4TTSA 1E7WA 2OCIA 2XDQB 2P9BA 1I0IA 4LYFA 4V0ME 1ESDA 3AI2A 5DYTA 4CDNA 3ZJVA 1XFDA 2JGDA 1MLDA 4G01B 3FNIA 4KE8A 1LDGA 3SMVA 2V7GA 1KOJA 3T54A 3ECAA 5EJFA 3E1SA 3IPXA 1GM5A 3OT1B 4RKWA 1US8A 4WCDA 3GLFA 5AD1A 2EP8A 4R7GA 3IBYA 2C07A 3K3PA 2FR8A 2VAVA 3LYLA 3GP5A 4FILA 1RAGA 4XEHA 3RUCA 2HO4A 3UH0A 4HVLA 5KYKA 1CUVA 2I22A 2HL6A 3UJAA 3OQ6A 5F78A 1LTQA 1M2HA 1BX3A 3TX2A 3RF7A 4R8VA 4YCJA 1L4KA 3UH1A 1E1RA 5CXXA 1SO8A 3E8XA 4MQLA 2ENUA 3NAMA 2RJ3A 5B37A 1QF6A 4ETIA 1EEHA 3RB8A 3STTA 16PKA 2ETXA 4M6WB 3FBTA 2QKYA 3SSMA 3FOCA 4Z7QB 5HUQA 4DKJA 2EFCB 5LKRA 4IHAA 3C4VA 2Q3DA 1G18A 3LV8A 3DD1A 3DDSA 1ST3A 3AIIA 1K92A 1BN6A 2Z4TA 4QU9A 4CKXA 4DLBA 5IHXA 1KP3A 1RBZA 5L3SA 2PKQP 3EASA 4K87A 1YQTA 1JKXA 4HJXA 1Q7GA 4RPCA 2CL5A 5IBPA 4BPBA 1A9OA 2WU8A 2ZU0C 4CN9A 4OHPA 1G6OA 3I5YA 1H0RA 1R0BA 3QIAA 4FUTA 1QVAA 4OSOA 5J2UB 2EZUA 2WZQA 3EVBA 3OCXA 2QMZA 3CJTA 3LGSA 6CHYA 3UGJA 4B3FX 3C4QA 2BFBB 3I09A 3FAKA 1MJGM 1XALA 2EQAA 2VDNB 3IAEA 2QP3A 5J5AA 1MO6A 3TX6A 1L4EA 3DE7X 4ZICA 3MSXA 5FHRA 4AKIA 3AF4A 4LZZA 3AZPA 1EQUA 3KPJA 2X0FA 1TX4B 9MHTA 5IJ9B 5D85A 3J7AC 2C96A 3DL7A 2ERCA 1RMTA 4OKSA 3L4BC 4B7AA 2OD7A 2ODWA 2PQ0A 2V8OA 4GLBA 4MMXB 1NE2A 3H16A 4GE0A 4KGVA 4FFWA 5FOWA 2OFFA 3T1QA 1X7ZA 2XRMA 5CH3A 1I2BA 2VVTA 3KLOA 3KWLA 1J56A 2G0AA 5ERYA 5IM5A 4XVUA 4JV5B 4Q3BA 5DX1A 4HTFA 4E46A 1YUMA 4ZTUB 5CD1A 2P6RA 2ZQ5A 3GT4A 3ZZNA 5IT0A 3WJAA 5T6MA 1LDYA 3MBOA 3W2EA 2FG6C 3T1TA 2GKSA 4CFYA 1Y7TA 3KK0A 4EKEA 3M7IA 3R3VA 1ADBA 1H2RS 2AQHA 4KVAA 4OL0A 4RU1A 4AN0A 5DCYA 4C0QC 1V4BA 4G4JA 1XQXA 1VBFA 4UPVA 2H8GA 4W99A 4YACA 3V4PB 1S8OA 1KTVA 2CXSA 3IALA 3N2LA 5B1HA 4JI5B 3KZMA 5DYYA 5JY1A 3PKJA 1KO5A 1OFVA 4ESEA 3PFKA 2RAUA 2E37A 3A9SA 5K3FB 1PUIA 2QROA 4AECA 1K1EA 4UASA 2MSNA 4L72A 2HIGA 1U8CB 1Q16A 3CIFA 3CURA 4M21A 4WOJA 2Q4EA 4CV3A 3UUWA 3WP0A 1BXGA 3VSDA 1RM5A 2JI9A 3H5OA 1SIUA 4R83A 4M1SA 1Y3BE 3OZEA 3AEQA 2CE7A 3Q3JB 4TMKA 4EK9A 4ED9A 4TMVA 1Q7TA 1ODSA 2QW1A 4AUKA 2ETVA 1C9DB 3TMYA 3ZE8A 1RQNA 3O8BA 1QCCA 3OIYA 4YQZA 4EO4A 4N5LA 4DMKA 3FYTA 2UXCB 5IDWA 4LY0A 3OAAA 1QIMA 2OBMA 1QJ4A 1POXA 2O57A 3NATA 4EVQA 5AFSA 1CXZA 3KQWA 2OD9A 2P5UA 4XYLA 2Z83A 5IUJC 5C4MA 3ZU6A 3RDPA 4JLAA 5KWVA 1LZLA 1XELA 2ZUVA 3T3IA 3ZGZA 1NMSA 1Z9BA 1NVVQ 3EPJA 1C1XB 2BRUC 4PQEA 3NASA 5JRJA 7ABPA 3U3XA 2O4CA 4U9UA 2ACVA 4C9BA 2FEOA 3LC2O 4MGIR 5D51S 1SURA 2C97A 4IJVA 4QQKA 1W4BA 1WMEA 1KSFX 1R0SA 4JR1A 1XRQA 5EZQA 3ZDBA 3V8NA 1V8ZA 2AZ4A 1ZD8A 4UD6A 3V8BA 2VNHA 1SRQA 4M1OA 1WZIA 4PLYA 3W8NA 4PCUA 1IONA 3FH0A 2KSQA 4AO8A 5G4LA 2R1VB 2H48A 4BY9E 3MM4A 5E9QA 3U3MA 1SEVA 4EAAA 1G0NA 1U1IA 1ZLYA 3MMSA 5KOJB 3PS9A 5LXTF 1W47A 1R0WA 3ZWOA 1UP4A 1Q0TA 1JHPA 2R7KA 3C3XA 4PLGA 3TTWA 1W0JD 3FYCA 4CMJA 3G49A 1ECFA 1SOUA 1ULAA 2XUFA 5IYZF 3UHAA 1IAVA 5K6TA 3E15A 1QQAA 1EE9A 1K66A 4PGMA 1J20A 2GAFA 3AVWA 3DMNA 2CZCA 2ZUDA 4ND2A 5DW3A 2R68A 1ZOLA 3WWZA 5HNKA 2Z56A 3VZBA 3TPZA 3A4YA 4Z8XA 1JTFA 4EY8A 1GAQA 1Q19A 3C3YA 1Z06A 2JHCA 2PVCA 2ZANA 4UBLA 4B33A 5HJ5A 1XNGA 4B45A 1NXXA 3GEMA 3K8YA 5LYJF 4OAOA 3ZJTA 3LHDA 4CF4A 4UM7A 4D6YA 1NQOA 1NSTA 3B6IA 1RQRA 3R0IA 3BUSA 3HDVA 3UHPA 721PA 4EEZA 3W2FA 1SU4A 2E18A 2XCQA 2FVXA 4MB2A 4BFSA 5E4FA 4XQ0A 3CX6A 1L5HA 1PG2A 2NO0A 2C88A 3BE4A 5FIUA 4D6XA 5HHTA 4EPWA 3NB0A 3QV2A 1PNQA 4P32A 2NO5A 5FH9A 3FI9A 1AURA 1TT5A 2D0IA 3EEQA 3OJCA 1RMYA 4GPEA 4MVXA 4PEVA 5BNWA 4TQUS 3EEFA 3PITA 5DNVA 4EHIA 2C5GA 1PSDA 3F7OA 1JB1A 3BXXA 5THXA 3SJCA 4FHEA 2OCKA 3I6BA 3LPAA 2M6LA 3TUJC 3WYBA 3FN4A 4UTZA 5T5QA 4JVSB 4OLJA 4ZV4A 4YMUA 4FXPA 2Y67A 4ASUA 1VFPA 3D8HA 2BDUA 1SGWA 2WPNA 4YCMA 4INAA 1CEXA 2V6MA 1AF4A 1P60A 1U7HA 4IWYA 4XI9A 3S3TA 2HF8A 3LUHA 3TR6A 3WDSA 1V6AA 2RGXA 1P17A 2GRAA 2I34A 2FQQA 3KPWA 5BSUA 3TQHA 4RMJA 3WGIA 1PJ3A 4WA8A 4TVKA 1HPLA 5J4VA 2DBRA 1K4KA 3NBYC 2AOWA 1TLFA 1DQYA 2GPAA 5P21A 3S4YA 5EYPA 2V7QD 4FT2A 3PG5A 1M34B 1VGRA 3O82A 4X6YA 1ATIA 2B3TA 3MINA 1DZIA 4GKVA 4OUDA 4JP3A 3EFBA 4F96A 4ZYUA 2IZ7A 4Y2YA 1E9CA 1RWMA 5FBWB 4BLQA 1UDAA 3HU1A 4FYMA 1DDGA 2PRSA 1UZUA 4MRVA 4UBOA 3ZK7A 3ZWBA 2JAOA 2F43A 3VSBA 4XWWA 4HHEA 2VXYA 3BFJA 3W7AA 4YYZA 4KOEC 1Y1SA 5DNWA 1B15A 4XIIA 4FOLA 1TD1A 4L1KA 4I1SA 3GR6A 5H0IA 4DLAA 4EL0A 1XYGA 1SKQA 1H9AA 1WF3A 4BU0A 4HLUC 1VI6A 1QLWA 3WLNA 2V45A 2CNNA 1RJGA 1WEKA 2J3QA 2VHTA 3V2HA 3W3AD 3ZWMA 5B4UA 4PNZA 5EJ6A 4CLXA 3K0SA 3R5TA 4OHFA 4GBMA 1XEWX 3GLHB 4INPA 1ZCBA 3VPAA 2AKEA 3L8YA 2ZSUA 4Q6WA 3V4SA 1KMNA 2W71A 2ZI4A 1H4QA 2B9VA 3TNLA 2I65A 3Q9NA 1Z0IA 3ND6A 4MEBA 4BFXA 1QAOA 4NULA 1MDFA 1I13A 1A3CA 2AIRA 2JFOA 1EWKA 3ASUA 3MLAA 4Q7QA 1QKKA 2UV8A 1GHTA 1TQ6A 3A26A 2F64A 4PZ9A 4CGZA 4L0QA 4UDXX 3PJRA 2HSGA 2ILVA 2ZFUA 5HIAA 2R5FA 4LRUA 3TNYA 4D1YA 2Z2ZA 4Q93A 3O8QA 4E2XA 3OU6A 4NBNA 4INZA 4L6AA 1M67A 3R40A 4X94A 3E61A 1Z0KA 3S8YA 3LKDA 4WOPA 3V7YA 4TTAA 4B6RA 4YV1A 3WJ7A 4DJEC 1A7JA 3SSOA 1IHPA 5F9HA 2JGNA 2IW1A 4HRAA 3RUEA 3WRXC 1RZ3A 2PPVA 4WOBA 4LDZA 1VCNA 5ICGA 1U9ZA 1QIEA 3BYZA 4LXGA 5KTPA 3WA7A 3K4HA 4NOKA 1C81A 2FWNA 4TV8A 2AQKA 3SVZA 4C0SA 3E58A 3CONA 1O3YA 3QLJA 2FSPA 4B3BA 4DXAA 1TF7A 3P2YA 2ZEJA 2X0EA 4JNKA 1KDTA 3L4BA 1SZJG 3GLGB 5GV7A 1NN3A 3MHPA 2I9KA 1IYZA 1JMVA 1NVDA 1OV6A 5E9WA 2XA2A 3AI1A 2BELA 1GQSA 2HK7A 1GYRA 2WTAA 2WUGA 5D01A 5LA6B 4GKKB 2Z1DA 1BVYF 3KV3O 2GN4A 3G17A 4KBGA 2P3LA 3OTQA 3ZX4A 3C8MA 1M6WA 2VOEA 3QJGA 3AEZA 2GCEA 5AOAA 5F9FA 2E9SA 4UAJA 3A4LA 4LAFA 1DBPA 1S2MA 4FFMA 4RIFA 7REQA 2GVDC 3LQKA 1GRNA 3AKDA 4GP9A 4KO8A 3BERA 3OUZA 1LNQA 4XAQA 2WHQA 3RQSA 3G0HA 3Q8LA 3QOWA 1I14A 1XZLA 3JQGA 3OOEA 4QE3A 3R9XB 3TQCA 1FJHA 5E2AA 1GFIA 5J23A 4GPZA 1YB2A 1QRRA 1J24A 3R0QA 4HNAB 4IKEA 2GCIA 4Q7KA 2QTAA 2X8WA 3RJ5A 4JROA 3N2KB 3ZQ6A 5HKKA 1HE1C 4JJ7A 1W9MA 1CBUA 2G9VA 2Q1XA 3EDRA 2II6A 3M6XA 5SY4A 4CKWB 3IIIA 4B84A 5IT4A 4RTKA 1WBBA 1BXRA 1Z0AA 4E4RA 5FUQA 2NQTA 4A36A 3LCVB 2OLKA 2GFIA 4X5OA 4QFDA 3MCTA 3U4GA 4DBLC 4Z9YA 1PT8A 2WJYA 3JVUA 3NRCA 4AWBA 2PKXA 5JMOA 5KVCA 3ZVMA 1ISMA 1T9BA 1W5AA 3JYPA 5JSKA 3TZCA 4BO1A 1P4JA 4DYHA 1QP7A 2DERA 1NW3A 2Q1YA 1AKRA 4CTNA 4OGGA 1THGA 4I9UA 5LP6C 1Q91A 4WCFB 3MK31 4LGYA 3C8DA 4ZIRB 5AMXA 1G0OA 4OOFA 3D2LA 3CY6A 1GYQA 4EA8A 2AFHE 3VV2A 2F17A 1LDBA 2JAUA 1YBMA 2CZGA 2JI6A 3DE1X 3PGVA 4F9GA 2CXNA 1PL7A 1J7KA 1JLLB 2DX7A 2LRHA 1WCIB 2RGBA 4UULA 4UVHA 3VQTA 3WWPA 2G07A 5AJTA 3T94A 5MFPA 3FCSB 5SZJA 1U1FA 3A32A 2HMSA 2J3EA 1DAMA 1NLUA 4IM7A 3L4EA 3FF1A 1Z4QA 3QA9A 3JD2A 3DMPA 3TS1A 4NCBA 1OILA 2D0OB 3WB2A 4BBPA 2GD2A 1DG3A 3GBVA 3M83A 1ZCJA 2CMHA 1L8OA 4RSHA 4IO0A 4BGVA 1RXYA 4DLKA 1KK0A 2CKDA 2A88A 3OIVA 3DLHA 1ORIA 2VK2A 4MP6A 4RA6B 4IJKA 1XFAA 3ESXA 2H5EA 3KC2A 4S1VA 1KO1A 1E2JA 2Q3FA 2BFEA 1F4PA 3MYYA 2IYXA 4MLCA 1J09A 4AYTA 2DKNA 1GPH1 1JT2A 3CF4A 1V6SA 3N2ZB 2J5RA 2PKWA 3A3NA 1T0BA 1HBJA 2BY4A 1HE3A 2DTEA 5BN1A 2ZUSA 2OCYC 2VAPA 1IQ0A 4MB0A 3AB7A 5CGZA 4BFVA 2DH5A 2XD9A 2IITA 3NHSA 1D6NA 2H2GA 3FKSD 3KOYA 1NURA 5EZ5A 5AVQA 2G5TA 3C1UA 3E7PA 4RHUA 3M81A 4G0PA 4V24A 2XOXA 4QTZA 5A6SB 3C14C 3ZDFA 4EM6A 4FWIB 1E6EA 3B89A 2H4JA 3ZZ1A 3OOHA 2EZ9A 3CJQA 3BKWA 3LYUA 4ZDWA 3CNOA 3JQ9A 5T57A 1GO2A 1ZK3A 2ICAA 5DU2A 3UKDA 3V9AA 1OT3A 4GI2A 1UCFA 3BJEA 4PLFA 2O3SA 1AV7A 3FMVA 3HL4A 1LA2A 1O94A 3LU1A 1SPXA 2QZZA 3KJZA 3EGIA 4PVCA 5DN9A 4AY4A 4XM0A 3CINA 3A9TA 5C7IO 2VJCA 2A0WA 1YQGA 3CRVA 3UAZA 4E13A 1ZH2A 2BFCB 1KYXA 3IP9A 4WJKB 2X2OA 4ILEA 1MGOA 3G0CA 4Q7MB