1HEIA

Structure of the hepatitis c virus rna helicase domain
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
443
structure length
443
Chain Sequence
NSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV HELICASE
publication title Structure of the hepatitis C virus RNA helicase domain.
pubmed doi rcsb
source organism Hepatitis c virus (isolate 1)
molecule tags Helicase
total genus 138
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1heiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA01
4HLCA 3GLGE 1JPNA 3G82C 4ZV4A 1W49A 2F1IA 2AD5A 4BFWA 5FPKA 1XPUA 2EQBA 1N6NA 4M1MA 2FG5A 2Z6VA 3MWKA 1G1MA 1N6KA 3UMRA 1Z8FA 2Q9CA 3T06B 4D26A 4JJZA 1NI3A 3VR5A 4JLOA 3CR7A 5HTKA 1IN8A 3Q72A 1HV8A 3PFIA 2BBWA 4XWAA 4V0KA 4AKEA 4JT4A 1FUUA 1GAJA 1WP9A 4C0AC 1EX6A 2VEDA 3GLHE 5J4HA 1T8TA 2N46A 1JALA 1OE0A 1M74A 2H18A 2ZSDA 3SJAA 2WJHA 3DM9B 3E5HA 1TF2A 2H1LA 1ZUIA 1Z47A 3EW9A 2IW3A 4CDGA 1H65A 3K0CA 3DOEA 3R8CA 3C8UA 2Z43A 3KB2A 4NDZA 4OK6A 1XTKA 2GCOB 5HPYB 2IL1A 4M1YA 2QROA 4F4JA 1W4AA 1US8A 4P3YA 1E94E 3VR4A 1E2QA 4DHEA 3QXCA 1XEWY 5AUOB 3LLMA 5FR2A 1TPZA 4ZDIA 1P2SA 1GKYA 1W0JA 2VSOA 2CJWB 2NZ8A 1F48A 1C9KA 4Q18A 3B8HA 5FOTA 2QBYB 2PBRA 3D3QA 2ASEA 1A82A 3CZQA 1FPMA 1QDEA 2QRNA 4OL0A 3ZQ6A 4C4PA 3K8YA 2XXAA 2XITA 3D8BA 3SHFA 1DPFA 1FFHA 1MKYA 3I1FA 3PXGA 4F4CA 4GP6A 2FDCA 2QMEA 3EPLA 4PSAA 2JJ1A 5LPNA 3BS4A 3TUZC 3K70B 4BUJA 2ZRAA 4MUAA 3BE4A 1YZKA 2QGZA 3IEVA 2DPXA 3IDQA 5FL7A 1NIPA 3L0IB 4GT1A 3VR6A 3BBPA 1SZPA 4X8OA 4M9SA 5G41A 5B30A 1P6XA 2B92A 2AFIE 2QN6A 1T5LA 4OHWA 1FW6A 4RKEA 2WTUA 2EFCB 2ZI6A 5CM9C 3K09C 1GZSA 2OESA 3OZXA 4Q4HA 2A3RA 3FKQA 1QHYA 5JMTA 1E2EA 1CLUA 5JRJA 2J41A 1Q1BA 2DFKB 4DCSA 5EE9A 4I1VA 1W4CA 1DELA 4EUNA 5TDHA 4PPFA 2PZFA 3B6EA 4TMVA 3TW8B 4DLYA 2G83A 2YOGA 3ADCA 2GVZC 4DSNA 1R8QA 3C14C 2ZVPX 3LX5A 1PLKA 3QBTA 4OQFA 4XWKA 3VMFA 4F91B 4NPHA 5J47A 2NTYC 1VPLA 1E69A 1BIFA 2ODNA 2ZRNA 3T5GA 4RFSA 4B3DA 4QHSA 5KOYA 2ZI5A 2OEPA 3R9IA 4GDFA 1NN3A 1GFIA 5FTLA 1G16A 4DRZA 3PEVA 1E99A 3KDSE 4JVMA 2QAJA 1ANKA 1VIAA 1S8FA 4ACAA 4EPRA 3RNLA 2MMCA 1NBMA 4O0MA 3NEJA 1U81A 2HJGA 5KPJA 3VNVA 1BH2A 4TSFA 4YXWA 1E9RA 4NCIA 4LJ5A 5KSOA 4QM6A 5E7JA 1R0WA 4FXPA 4JLJA 4DUGA 4PAMA 4LHVA 3QSYA 5KSZA 1W5TA 3BAFA 3T15A 2J45A 2KBEA 4DLXA 3ZQJA 5FR1A 1P2TA 3KZ1E 4QM7A 5KNCA 2O8DB 2W58A 1N2CE 1JBKA 1M7GA 3C5HA 5FBQB 5E3HA 2AR7A 3A36A 1PLJA 3K1JA 2VHTA 2YWFA 3ADDA 1OIXA 2A5GA 3LBNA 2C77A 2MSDB 3L8YA 5KNDA 2J7PD 3AKDA 3LVQE 2ERXA 3ZIAD 3R8FA 1AZSC 3GJ8A 1ETUA 1UBCA 4NU0A 1N3BA 2JLYA 2C03A 1VCIA 2ZJ5A 2OXRA 3GLFA 3VFDA 3HP1A 4RCYA 4BZPA 3RHFA 1N0VC 3GJ5A 2O0HA 5C4GB 5IRCD 4CRWB 2CCKA 2O52A 1BO6A 2ZRCA 1GNPA 2BJWA 1MT0A 5B2ZA 2QE7D 4TQUS 1XCMA 1W0KD 4HSEA 3RS2A 3IBYA 3OIVA 1CRQA 4HB3A 1ZIOA 1Q20A 4LV6A 5FBVB 2JLUA 2R44A 1KIMA 2AKAB 2BMFA 1D5CA 2BVNA 1ZM9A 4CVNA 3KKPA 4LHWA 1OYWA 2ERYA 2G0NA 4HDOB 3GLGA 3NH9A 1VG0B 2TMKA 2W83A 2D2FA 3T5DA 4TWZA 1IY1A 1OXSC 1E2DA 2RB4A 4P32A 3SC3A 1Z6XA 4EJSA 4P4SA 1XEXB 3CRMA 4AC9A 1DO0A 4KJZA 2ANBA 2J1LA 3KXKA 1TU3A 5FBLB 5JHHB 4RKFA 4PXAA 4NONA 5A5GA 5EXPA 3B78A 2XNSA 2XSZD 2VTKA 2EFEB 3I92A 4KCGA 5G3YA 1CR4A 2DFNA 2V9PA 4BLQA 2CHQA 4ERNA 4JL8A 4JKYA 5UKDA 1UKZA 1E32A 5CB6A 3BRWD 4FWIB 3AF2A 4TL8A 3U7HB 3N5CA 1SQ5A 4JBXA 4DT1B 4P33A 5TARA 3PV0A 1DAGA 4DLWA 2ZIAA 2R6DA 1G8PA 2OILA 4K8OA 5K8LA 2YWEA 1D2MA 2GETA 5JCPA 3N2IA 2FZ4A 3KUCA 4W9MC 3W8RA 3T12A 5H8WA 3W5JA 1O87A 3CX7A 3AEZA 3TSOA 1JEEA 1U98A 2BKUA 3AKEA 1DADA 2HJVA 2V55B 1QHIA 3NC0C 3B9PA 3A1WA 4QBFA 1ZD8A 3TAUA 1CS4C 2W6JA 2FGKA 4B3CA 2ZJOA 2IBMA 2H7VA 3OE7D 4LWZA 1CEEA 1J99A 4H1UA 1N6HA 1Q0UA 3TK1A 1JR3E 2FMXA 2ZUDA 3SDZA 2JCSA 3WRYC 3T1VA 5CYPA 4A2PA 5JECA 3CF2A 3KFXA 2EWVA 3ZD7A 3VKWA 3MJHA 1UFQA 4PHFA 3CW2A 4IOLA 3TVTA 2P65A 2DWOA 3AVPA 3JVUA 4FMDF 1JAIA 1Y3AA 3PUXA 4OJQA 2RCNA 4IW3B 1TL7C 1OXTA 2VHCA 4PSKA 4HZUA 4Q1AA 1RRGA 3VHLB 2ZJ8A 4JLMA 3PUVA 3IIKA 4C30A 1QG2A 5F9HA 1UBEA 2WOJA 4M8NE 4TMWA 4LYAA 1CXZA 2RGXA 3QF4B 4MGYR 1UM8A 5EZ5A 4JT2A 4QGFA 1F3OA 2FFHA 1XMJA 4MRSA 1H8EA 2CL6X 4TL9A 4ARZA 1YR7A 1KNQA 2EYUA 3OFNA 1U8AA 5HR5A 2WOOA 3TQFA 1NLYA 1ZUHA 2X2EA 3BWDD 3N70A 1CR2A 3H0KA 3TSZA 1P2VA 1IAQA 3AQ4A 1W46A 3QNUA 5BWMA 1XD9A 3NBYC 4NCJA 4PPQA 5EZ6B 2J5XA 4WZAE 3UANA 1S0UA 4F93B 3QUSA 1E9CA 2JLWA 3JZMA 1NG9A 5CB8A 2V1UA 1Z0AA 5L8VA 3THXA 4PC2A 3ND8A 1KMHA 4ZCIA 1F5NA 1X1RA 3U60B 4LRWA 3EZ2A 1QHXA 4LPSA 2RH5A 2ZUCA 3QPWA 4POAA 1KAOA 5DO9A 3Q8XB 5GJWC 3BXZA 4A2WA 3EA5A 4OHVA 2ZJ2A 4IOJA 2RGCA 4V0LA 4HUQB 3D6TB 2P2LA 2HXYA 3QXHA 4NYIQ 5DHFA 2IWRA 1NKSA 4HDQB 4Q7KA 1OXUA 4QBGB 1IXSB 5AK0A 4OJKA 4BEJA 3WMFA 3FOZA 1JQJC 3ICEA 1G8HA 1IJFA 3NDBB 1Z0DA 3KKQA 5AJYA 4IEIA 4MYHA 2WIBA 1XXHA 5L3VA 2GRJA 1M7BA 2QG6A 4MGIR 3KQNA 4D6PA 3FKSD 4JLVA 4RFSB 1N6LA 2BHRA 3VAAA 3VNUA 2ZR7A 1Z08A 2HCJB 2X8AA 1AKEA 1XZPA 5G53C 2GZDA 3WP0A 2WKQA 3KXIA 4NYMQ 4C0BA 3QVUA 1RZ3A 3TAHA 1HTWA 2R8RA 4J0QA 1WRBA 4E03A 3GJ6A 1E1QD 4RJLA 2GHIA 1RFLA 4QBHA 1XTIA 2W2VA 4RZ3A 3RS0A 4AD8A 1UF9A 1SVSA 4GNKA 5B64A 4C0HA 4G1UC 1Z0JA 4A4DA 1N5JA 1UKVY 2B21A 1E96A 5FI1B 4B3FX 4DDVA 2GVDC 4HATA 2VP4A 2ZI7A 2IYQA 4HB4A 4EQ6B 1KAGA 2WJIA 3MWLA 4LI0A 3EPKA 2QP9X 1I4DD 1XTSA 2A5YB 2XZPA 2YVUA 3NBXX 4GMDA 4ASUA 1NVUQ 2REBA 4PTLA 3HU2A 3QKSA 3AGPA 4TT3A 1J70A 2WWHA 3LRPA 4PSVA 1RJ9A 4MQBA 1P3JA 1P60A 721PA 3ECCA 1SVMA 2QAGA 5EXXA 2BOVA 2JDID 1SXJA 4IHQA 4TTPA 1R0YA 3KJGA 3B82A 4QGGA 2CXXA 2AN9A 1GRRA 3LAWA 1SHKA 2BJVA 2PJZA 1VKJA 4QOSA 4X8LA 1BYIA 1TADA 1OFIA 3WNCA 3OAAD 2ZQ5A 1D6JA 5FTNA 4KV9A 3AF1A 4GRAA 4JYCA 3UK6A 4DIDA 2CLSA 1NVWQ 1QVAA 3S1AB 4DLUA 2AXPA 1XMVA 5DSZA 3KKMA 1JECA 4B74A 4IFEA 4JVSB 3K0CC 4C0JA 2B8WA 3SZRA 2DR3A 3ZJYA 4LBVA 3T1QA 4CT4B 4RZ2A 4D80A 4TYPA 3B7GA 3HYTA 4XVRA 4BFTA 2RKOA 2J0UB 5CLLA 4OKSA 4Y0VA 4OHZA 2JLXA 2QP3A 3V4RA 3FHCB 4CEIA 1IN7A 1U8YA 2OLKA 4JKIA 3B1VA 4DZZA 4LJ8A 2PT5A 3M4YA 2O5VA 3CO5A 3DDCA 2NIPA 3A1VA 2C98A 2F3TA 2WJJA 4PQYA 5LDDC 3O8DA 3FGNA 3EC1A 5JSZA 3GD7A 4NYMR 1ZC4A 1E1RA 3P4YA 2BBTA 3IPXA 4I4LA 4ESVA 1COWA 4Z1MA 1FP7A 1SVIA 4ZO4A 3W6OA 5JCZA 4AI6A 2ZRFA 4TN1A 4AK9A 3BGWA 4IOMA 5ELXA 2KJQA 1R0XA 1R10A 1GWNA 3QG5A 4FMCB 4QHTA 4LC0A 1G8GA 4PC7A 4OBEA 1VMAA 4O2RA 2G0TA 3TE6A 3TR5A 2YNMA 1HEIA 1EK0A 3DHWC 4G01B 4G5GA 2A5FA 3CWZA 4GPTA 4C0SA 3KKNA 4MA4A 3EIQA 2WIAA 4M0LA 4AURA 2IK8A 3MG9A 3ZZ0A 4BLPA 5EE3A 4NKRA 1XTRA 1NN1A 4DLSA 3RC3A 5JEDA 1AJEA 1P9RA 4BASA 4BPBA 4I1OA 5KO2A 4TZ6A 5FOSA 1TMKA 3H86A 1N6PA 4V02A 1C1YA 1W4BA 2Q9BA 4MYUA 1XCPA 5FUYA 4M1SA 3W6NA 4A6PA 3OEEA 4TYWA 5M04A 2ZRLA 1EFRD 1ELOA 4LJ7A 3H84A 4GOKA 3F0TA 4LYJA 1XD2A 2F9MA 2GZHA 5E4FA 1ZNZA 2VSXA 4FCVA 4DLTA 2NPIA 4P4TA 1IM2A 5KHOC 2JJ2D 2J0QA 621PA 1VECA 1G7RA 3QVVA 4QNMA 5FPTA 1ZD9A 2WKPA 1CJTC 1FX0B 2BM0A 2FWRA 4U5XA 3IQWA 5E7IA 2NOAA 2QUZA 1G3IA 1WCV1 3CONA 2UZIR 3EIHA 4MRVA 1P2UA 2O8CA 2OBMA 5KDOA 2GNOA 5CJ2A 2IS6A 4Q47A 1DAEA 4BE7B 4QL3A 3GJ3A 3Q3JB 1CULC 2Y8EA 5J4YA 1PZNA 2ORIA 4BGDA 1ZM7A 1OH7A 2IYWA 3C16C 2KSQA 2OCBA 2CEAA 2A2ZA 4H9GA 2OT3B 3FYHA 2AFHE 4UNRA 2QT0A 3QE0A 1M8PA 3HWSA 1PVOA 4GP7A 4CT5A 5KPDA 2PZGA 1KDRA 4A8JA 1R4AA 2I1VB 5JEEA 2REXB 1ESMA 1Q1QA 3DZDA 4HLUC 3GJ0A 5JJKA 2H16A 4RZXA 4AKHA 4NTZA 1OKKD 4QJ3A 4M53A 1FMJA 421PA 2R6FA 2QTFA 5DI3A 3GLIA 1EWQA 2RGGA 1XPOA 5L3QA 4FIDA 3U5ZB 2CDNA 5JI2E 4WBSA 3U6BA 1P9NA 4IDHA 4OI0A 1DARA 1JEDA 1P73A 1E79D 5GVSA 3SI7A 1WBDA 3ZS9A 1GUAA 3GFPA 1NMZA 3LX8A 3CBQA 2WSSD 2NGRA 5K8IA 1K5DA 2D3WA 4Q02A 1NSTA 1DEKA 4YMSA 1NVVQ 1SGWA 1ONBA 1R8SA 1KI6B 2HLDA 2XAUA 5FPHA 4EPWA 4BLSA 1OHHD 1G17A 3L82B 1CBUA 1Z6GA 2D2EA 2F9LA 3ZVMA 4I1SA 3LBIA 1II8A 2REOA 2KI5A 2ZS9A 4KLNA 4M9ZA 4DCVA 1BS1A 4B76A 1G41A 1G3QA 1OFTA 3NEYA 2FU5C 5C2JB 1B0UA 3NH6A 4CF7A 1AS0A 1XX6A 5AJWA 2JLZA 3PVSA 4W5JA 1SKYE 5EUQB 5HE8A 2CK3D 1UEIA 1QZXA 3WXMA 4MKHA 4DCUA 3RDPA 1XWIA 3AKCA 3CX8A 4JLPA 5JS7A 5DLQC 5BN3A 3PUZA 2CHGA 3LFUA 3QEJA 2GEVA 5FBWB 1Q3HA 2GXSA 1BMFA 3RSLA 3ZS8A 4C9BA 4C7OA 2F43A 5JJLA 3KXLA 4W7SA 3GJ4A 3SBDA 4E07A 1E0AA 2XNDD 4EDHA 2ZAOA 2ONKA 2JA1A 2ZRBA 1YZTA 4Q1EA 2BMDA 2V6JA 4PQRA 5SZKB 4YMVA 1FL9A 1XP8A 5HZHA 1ZAKA 5AR1A 3QKSB 2QTHA 3BOSA 3TUJC 2O8BA 2P67A 4GZLA 5G40A 1S3GA 4RD3A 1KO1A 1ZU4A 4LJ6A 5EXSA 2YWHA 1YZGA 3QKRA 1EWRA 1MO5A 3O8BA 1KMQA 1LW7A 4JS0A 3V4FA 2QAGB 4IVPA 4TZ0A 2YWGA 5FI0B 5FOUA 1KSGA 1ZNWA 1MRSA 2JIZD 3K0AB 4DWJA 4RD2A 2HXSA 4Q03A 4XJXA 3I5XA 1E2JA 1AS2A 2XX3A 4K81B 1MO3A 2V7QD 2I1QA 2Q6TA 3ZLJA 1L4YA 1W7AA 4D0LB 1F2UB 2V4ZA 3DVLA 2YHSA 2IYRA 3K9GA 4LOAA 2I3BA 1LS6A 1R5NA 1TU4A 1YR6A 1Z29A 4TYNA 1QHHA 1S9DA 1NVVR 4RZUA 4D25A 3OF5A 4CEHA 3CRQA 1YRBA 3T34A 2J87A 4LX0A 1VG9B 2OFXA 2YJTD 3MLEA 1N5KA 4NHOA 5D3MA 2FPMA 4B47A 1GITA 4Q48A 3EX7C 3SQWA 3PR1A 4WZBE 3VHXA 2IX3A 1YU9A 2GAAA 1LF5A 5L3RA 2WPDA 2ZYUX 4E5UA 2AX4A 1NLFA 2FJUA 4WXRA 3C15C 4MKFA 5FL3A 4QGHA 4FN5A 4QBIA 2EYQA 2G88A 3KKOA 1ZM4A 3QENA 4AIIA 1KY3A 3CPJB 3L0PA 4RD4A 1Z2AA 2G1KA 4XOIA 1G291 5JS8A 3UKDA 3AVOA 1U9IC 1XJCA 2IXGA 3FFAA 2C9CA 3HPRA 1E2HA 3TQCA 3ZYCA 1Z07A 1KSHA 1EG7A 2WJYA 5IT5A 2KBFA 2X19A 2QQEA 1D2EA 3QKTA 4JBYA 4UXHA 2CLDX 3SFZA 5BYKA 4D4LA 2WAXA 1AS3A 2IC5A 1R2QA 1G7SA 2C9YA 4S2EA 2ZRPA 3NC1C 4A82A 1U0JA 2FX3A 3EZ9A 4KVGA 2HCBA 3EXAA 2LKDA 6Q21A 2BMJA 2A9KA 2D7CA 2DY1A 2ZRMA 3U3KA 2E9SA 2WJVA 3TMKA 4N3NA 2GBLA 4B33A 3E1SA 4R2HA 2PL3A 3PITA 3RVBA 4OHXA 2ZS8A 2O8FA 2G9NA 4R7ZA 2CL0X 5DN6A 4QC2A 2ZUBA 1EXMA 4RY2A 1AM4D 4OK3A 2OLJA 4IFBA 2J7PA 1N6IA 1LVGA 4G3XA 5AUNB 2BDTA 1CJUC 1D2NA 2FSGA 2YOHA 2A7QA 2ZRHA 2JJ1D 2ZANA 2A5JA 4URUR 3RYTC 3DKVA 3DKPA 3PEUA 1XEFA 2VHJA 4PZZA 1WE2A 4OI1A 3AVTA 4Z51A 2IYZA 1TEVA 5FL7D 3W34A 3SYKA 5AJZA 2EVWX 1L8QA 2G77B 3PQCA 3GP8A 2D74A 2YZ2A 1JQLB 3T61A 3VR1A 4DJTA 4LHXA 3MJRA 1TQ2A 4U7DA 3AB3A 4LUCA 5FTKA 3AVYA 2FEOA 3U7EB 3BB3A 3ETLA 2XOKA 1W0KA 4JLKA 3THOA 1X8KA 1Z22A 2ZI4A 2EU8A 1E2LA 1A1VA 1QVRA 1Z6AA 4Q9KA 4HYYA 1OH8A 4ZI3A 5IHPA 2RMKA 4JBWA 2Z83A 4JZKA 1Z6YA 4Q00A 4B6FA 3PUWA 4DEYA 3N2EA 2IWHA 1KKLA 2R6CA 2J0VA 5BXQC 5K8UA 3U44B 4IOKA 5LB2A 4RD1A 1MABA 5C4MA 3RS7A 4NYJR 4JLAA 2AKYA 3TW4A 3KJEA 1YR8A 3WBKA 4DSUA 3GEHA 4MDEA 2VP5A 3B85A 2QAGC 3VKGA 5EUMA 4P0TA 1Z83A 4FWTA 2PCJA 4C0LA 1HE8B 3HR8A 3BIFA 3QQ5A 1SXJC 4WA7A 2XB2A 2O8EA 2NZJA 4TTQA 2ZSBA 3PCRB 1NBMD 1W2GA 2WMNB 1J8MF 1DBSA 3ZGXA 4B73A 1QF9A 5EE5B 2JAQA 4TSFD 4YXWD 3TUIC 1LS1A 1N5LA 3B9QA 4ZIRA 1ZBDA 2QMHA 1AA9A 4ZDWA 4DUGD 5L3SB 4M2LA 2FV8A 1ODFA 4HEJA 1FQKA 2ZRDA 1NSFA 5FBRB 2VP9A 1EFUA 2W00A 1CTQA 4KBGA 4UNPA 1KK2A 1AIPA 1G8YA 1W2HA 2EW1A 4N0EA 1OPXA 4IDNA 4NE2A 4PC3A 1EFTA 4YLGA 1K5GA 1KI9A 1ZVQA 2ZEJA 3EWSA 2NPFA 4XH9B 3CNOA 4BFZA 5TMPA 1G18A 2QSYA 4UNNA 5HCNA 1U90A 4DIEA 4CIDA 3T1OA 2RAPA 4II7A 4BWYA 3GLHA 2ZJBA 5CLQA 1P75A 3HU1A 3A1UA 3NHAA 3W9YA 1R0ZA 2FSHA 4CYMA 3WP1B 1K6MA 3CB4A 1HURA 2GDJA 2IXFA 2VF7A 5J4KA 1HQYE 1XMSA 4GBMA 5H1YA 1NRJB 1U94A 2V6IA 4TLDA 2R62A 2DCUA 3I8XA 2WWYA 2QZ4A 3CRRA 4PO9A 4FW9A 3ONWA 1IBRA 2F1JA 1RVDA 5FFMA 2WHXA 2ZR9A 2FN4A 1W47A 4LZZA 1GNRA 4D0NA 2FE4A 5CM8B 4Q4JB 1LB1B 1RKBA 3RABA 3FE2A 4F92B 5CITA 3A58B 4I81A 4F38A 3C7KA 2Z5FA 1W36C 2ZROA 2GCPA 4A0GA 2ZE7A 1VYTA 2OCPA 2VL7A 2PEZA 3OIWA 2QMOA 1XCGB 2GILA 2ZRGA 5TXGA 1IY2A 3EPJA 1FP6A 2B6HA 1X3SA 3QG1A 1SVKA 2ZE6A 1U0HC 3TR0A 1D9ZA 2VLIA 1GIAA 2NG1A 4C0KA 1P4SA 4FCTA 2FFQA 2OE2A 4JLDA 3U4QA 4B2IA 2AD1A 1G3UA 2QENA 1N6OA 3OHMA 4TYQA 4DLVA 3FHTA 2G1JA 3SQXA 4G0NA 3KL4A 1US8B 4BRWA 3B5JA 3MAAC 1F2TA 1HT2E 1VHLA 2VF8A 3H2YA 2QU8A 1O3YA 2F1RA 2ODEA 3AUXA 5CIWA 1Z3IX 3MMPA 3CLVA 5JBQA 3CH5A 3SYNA 1J8YF 1QHHB 3EZFA 1TTTA 2IA5A 3K0SA 1N25A 2CNWA 1G5TA 1OW3B 1KHTA 4IVQA 2OM2A 5BN5A 2ZSAA 5D3MB 3R7WA 3FPAA 2XXAB 3NWJA 1KDTA 4AKGA 2PMKA 2NMVA 4QG7A 1IXRC 1U0LA 2W6JD 5CDFE 5TY0A 5F3WB 3CRW1 2PLFA 1KTVA 4A8JC 3KB1A 2V3CC 1NVXQ 1HY3A 2ZJAA 2DB3A 3TNFA 2RGAA 4DC9A 3P1JA 4A92A 3GEEA 2WWFA 4KYUA 2FSFA 1V43A 2GTPA 4Q4HB 1DAFA 1GG2A 2VRWA 4IXMA 5EP4A 1XFAA 1UDWA 5IK2A 3GFOA 3UXMA 1A2KC 3QJYA 4LHZA 2NO6A 5AJXA 3FMIA 4XTRA 3PJRA 3OEHA 5D3QA 1VG1A 1W44A 5SZJA 2ZSEA 2HYDA 2SHKA 4TQAA 3QPVA 2JLRA 2IYLD 2C96A 2FGJA 5FTMA 1XMIA 1XTQA 3A1TA 3EA0A 3VQTA 2JASA 1ZM3A 2BMEA 1M6NA 5H68A 5FUWA 2OHFA 1FNMA 1XEWX 4NCNA 1W1WA 1UADA 3BJIC 2O8FB 5EE1A 1H8ED 4WOPA 4DB4A 3A4NA 4GI7A 5JZVA 1OH6A 1E4VA 4KSCA 3OFND 5EP3A 3THWA 3AKYA 2O0KA 3I72A 5EP2A 1Z0KA 1XPRA 1FNNA 3LNCA 4Q9IA 1GL6A 1FTNA 3PEYA 5FOVA 3ZZTA 4Q19A 1S4QA 1JB1A 3GEIA 5E95A 1VYVA 2CE7A 2DHRA 2IUTA 3THYA 4JSYA 4DLRA 3I3SR 1DAHA 3ND9A 4UXIA 3CF6R 5LB4A 2QGNA 5DYIA 3EWAA 3MUFA 1KDPA 4IDPA 4A2QA 5HKKA 2H57A 3L8ZA 3ASYA 1XRJA 2E87A 4XSGA 2ZYVX 4TL6A 5AUQA 4OQXA 1JXMA 2P3SA 1YQTA 3W3AA 5KU1A 4O2LA 1Z28A 2AK3A 1VCOA 2R9VA 1II0A 2IXEA 3L0OA 4KAXA 4KODA 4OQLA 3LVRE 1NLZA 1TX4B 2I4IA 2ODBA 3ASZA 4IVRA 4TTRA 4D81A 3SYLA 4DT1A 4LBWA 4TLEA 1NMXA 1P61B 1SVWA 3HU3A 4LJYA 3RANA 2PX0A 4TYYA 4JSTA 1LFDB 1LNZA 3QXXA 4KFRA 4XD7A 3GLFB 5H70A 1QHNA 4TMXA 2HF9A 4IKEA 1KI4A 3TSWA 4GSYA 4OHYA 3IO3A 3LDAA 4S35A 5JFGA 3HJNA 1VIYA 4Q4AA 3RS3A 4AG6A 2ZM5A 1OJLA 1YE8A 4UNQA 2W0MA 1MH1A 2R6GA 4YDSA 2AK2A 3OIYA 4BFYA 2GJAA 2ANCA 4LSGA 3TJZA 3LXXA 3KFVA 3A6PC 3RRZA 2V8OA 3NKVA 4PQFA 4EPTA 3WY9A 2GCOA 3V9PA 1GRNA 2XZOA 4PHGA 3P27A 3IHWA 1A5TA 3QKUA 3GLGB 4MH0R 2VPPA 2YC4C 1NIJA 1OYYA 3W3ZB 1EGAA 2IT1A 1OFHA 1IN4A 3B60A 2QA5A 3PENA 4ASUD 4A1FA 4EJSB 4V0ME 4P4SB 4HUTA 1S2MA 2GEDA 2CJWA 4PHTA 4TT3D 2LWIA 5HE9A 2Z4RA 2QBYA 2IYXA 1JR3A 3DM5A 3CIOA 1GL9B 4NCKA 3GPLA 3CF0A 1P9WA 1KKMA 1H8HA 3AP3A 1QHSA 2IHYA 2ZI3A 4B71A 1J7KA 4N0DA 1YHNA 1KK1A 5GJVC 2WAYA 3Q85A 1KOFA 1SXJD 2UVQA 1LY1A 4BFUA 2ZPTX 1B23P 1KO7A 2L0XA 3IGFA 2YYZA 2ZXUA 3IHLA 2P0EA 2Q9AA 1KI8A 1QHGA 4ACBA 4PZLA 2QEQA 2QM8A 2AWOA 5ANRB 3KTAA 3W5IA 3WYAA 1X1SA 4JLNA 3SJZA 1U99A 1TUEA 4ITRC 4URYR 1KI7A 3KJHA 3CUEF 2OXCA 1G4AE 2F6RA 1AQYA 2C9OA 3QBVA 5J4LA 3K0FA 3CWQA 4AY2A 2QL6A 4MRPA 1M34E 1G21E 1G5RA 2WICA 1GNQA 2WJGA 3NHBA 1T0HB 1QBKC 3OIUA 2GBLC 3UIEA 3SNHA 1XJ0A 2F1HA 2OO7A 4RSGA 1Q3TA 1XNJA 4BFVA 3CH4B 3RLFA 4TMKA 4FINA 3KUDA 4WZ6A 4A6XA 4DSTA 3B2EA 2BCGY 2W6ID 2WM9B 2XTNA 3ZH9B 4B43A 1E1RD 1LF0A 1OLOA 3GQBA 2X1VA 5B57C 1FUKA 2HDNB 1JPJA 1GP2A 2ZE5A 1COWD 1S3SA 3DZ8A 4RVCA 4Z1MD 1LTQA 4Z8YA 3X1XA 3KQUA 1IY0A 2PEYA 4HZUB 4DSOA 3R20A 1UPTA 1YJ5A 3U3OA 2OZEA 3ZDQA 2OFOA 3NG1A 2IF0A 4AYXA 2OCAA 2VP2A 3AVQA 4JIMA 5KDLA 3A8TA 3ZD6A 2GCNA 1YVDA 4B34A 2NQ2C 1EESA 1X86B 3D31A 4FI3C 4X8HA 1W36D 1ZMXA 5DISB 2O8DA 3L2OB 4PAOA 1LV7A 2PLRA 2QM7A 1OHHA 1HQCA 4DBLC 1E2GA 4ARZB 1CIPA 1XD8A 3SJCA 3R7WB 3RWOA 1ZIPA 5J5CA 4BLRA 4QNRA 4EFMA 2B7BA 3BFKA 3MSXA 4P4UA 2CE2X 2FNAA 2ZSFA 3U6KA 3OEED 4UKDA 5CIQA 2IYUA 1W48A 4D82A 1U8ZA 3Q7QA 2FSIA 1Y63A 4OI2A 3TIFA 1RRFA 5BW8A 5IF9A 3UATA 2GESA 2QPAA 2BBOA 4D4KA 4YC7A 2FH5B 2ECKA 5HZKA 3THXB 4QFMA 5EE0A 1KMHB 2VP0A 1SHZA 3OESA 3CKLA 4URZR 1MV5A 2D7DA 1NBME 4NL4H 4ZI2A 2QORA 4IXNA 1HE1C 4TLAA 3KQLA 5KSYA 3EARA 2N1BA 4YMUA 1WF3A 2ZJYA 2VIIA 4B32A 2ZREA 2V54A 1KO5A 5DNYB 3U3MA 5IDVA 2WBLC 2F7SA 2Q3MA 4URXR 4V0NA 2WWXA 4LDJA 4YMWA 3SR0A 4ILEA 5F2EA 3SHWA 1E2KA 3RSOA 1UAAA 4JLBA 3CX6A 3AF0A 1AN0A 2ZI9A 2FFBA 3UG7A 4RD6A 1XXHB 3LY5A 2HT6A 3DOFA 4A0RA 1VYUA 4EJSC 2JJ8A 4Q1DA 1KO8A 2O0JA 2UZ3A 3LQRA 1TNDA 5JHGB 4KBFA 3VX3A 4US0R 1Z0IA 1OXXK 2KWIA 1ZC3A 4R2IA 4L5BA 2QP4A 2BM1A 4V03A 2XTMA 5FTJA 4EFNA 4M1WA 1G7TA 2CLCX 4DVGA 2B7CA 1NY5A 3NIBA 3AF3A 2YC2C 3GLFE 4HAYA 2GJKA 4L9WA 1D9XA 2VQSA 5JI3E 4B3XA 5LD2B 4RD0A 3SN6A 3WNBA 3THYB 3T1TA 1OB5A 1G4UR 4Q21A 221PA 3UMFA 3SBEA 3FTQA 1MO4A 5J40A 3QI2A 4IDOA 4MYCA 4HDCA 3TH5A 2DBYA 2C8VA 1IN5A 1A4RA 2QRZA 2PT7A 2HLDD 3REGA 1RJ9B 2Q3HA 3FWYA 3AUYA 1WBBA 4DEXA 1AQUA 2DFTA 1FMLA 1Z5ZA 1KJYA 3GCGA 2ONJA 3X1YA 3H1TA 1TQ6A 1GM5A 1SXJB 2QQ0A 3IUYA 1JXOA 5AUPB 4XIGS 1OFUX 3CPEA 4QRHA 2AXNA 4M4SA 4DCTA 4ESHA 5FOWA 1NG1A 1OT3A 4BFSA 2RGBA 4A36A 2OG2A 1KJZA 1KSFX 1L7VC 5DE3A 1N5IA 1FQJA 3K53A 3K9HA 5JLJA 5BN4A 4GZMA 4DDWA 4Q4AB 3QOFA 1TF7A 2J59A 4FMDB 5B58C 1DG3A 3QY0A 1HH4A 3A37A 1N0UA 4NBSA 5A4JA 3UPUA 4DDTA 1DAIA 1CR0A 4NZYA 2G3YA 1P62B 2MSEB 4JVLA 5EP1A 3WNDA 4B2LA 1TEXA 1MRNA 1YRAA 3AVXA 1XDBA 1IOZA 4HLDA 2QNRA 1E98A 2WV9A 2JATA 4G5QA 1NN0A 2ZTSA 1BMFD 3E2IA 1Z63A 3LA6A 3D7MA 3Q9LA 4MUBA 3ZVNA 4CEIB 1G6HA 3CNLA 4A0FA 4LPKA 3LD9A 4YMTA 1NNEA 1KZ7B 2FPLA 3BH7A 3AP2A 5FUXA 3QF4A 4NYJQ 4US2R 2FEMA 2IEYA 1YKSA 2WWGA 1DAMA 3UG6A 4DDUA 1Z06A 2H17A 5JSZB 4YONB 2DWQA 2ZYTX 4LHYA 1RC8A 4D2IA 5G3ZA 4UNSA 1X8JA 4D4MA 2ORVA 5P21A 1RE0A 3KQHA 3C41J 4E09A 2ZITA 3EC2A 4TMTA 2BEKA 3SEAA 3R9WA 3LO5A 4L16A 3F8TA 1ZP6A 2CHVA 2HUPA 4MGZR 5JWOA 5K8TA 3M0EA 1P7CA 4FCWA 2LKCA 4NMMA 1PJRA 4HLQB 2AHOA 4QKQA 2WVJA 1ZCAA 2C95A 4TLCA 2E1RA 1W36B 3KTAB 3WRXC 4B3GA 4MDFA 1Z6TA 4FMCF 1BKDR 2QSZA 4PZYA 1PLLA 5DGXA 2CMKA 1W0JD 3SFVA 1G3MA 4JMPA 4XTCS 3EIEA 4HUQA 1WXQA 2KE5A 2IF2A 2A5DA 4C3ZA 1CP2A 1FTSA 2B8TA 2ZJZA 2FZLA 4I99A 3K0FB 3WBJA 4BEBA 3IILA 1I2DA 2BV3A 1E6CA 3IBGA 4L9SA 5DH9A 3ZIAA 3QXJA 3NBFA 3Q5EA 4A9AA 3RRMA 3WMEA 5FPSA 1G20E 2NO1A 3BFXA 3QPUA 2H92A 2X77A 5EJEA 4TQ9A 1KI3A 4XWOA 1XD2B 2VHUA 2WPDD 3EZ7A 4A0HA 1T3SA 1S96A 4EPVA 3RS4A 3AVVA 2W2TA 1OXVA 4LGMA 1S9HA 4DB2A 4HB2A 4HAZA 3PG5A 1OIVA 4MYTA 3TGPA 1RRPA 2IUSA 4LBZA 2QE7A 2O8CB 3B1XA 4PFSA 4CGZA 1GSIA 3NVAA 3TKLA 5LD2C 1YZLA 3RRYA 2IYSA 2ZRIA 2X2FA 4PAQA 1KSJA 3DPUA 3HPQA 3RAPR 1CR1A 1XTJA 3KJIA 1VCMA 4KYIB 1ZYUA 2GF9A 2A30A 2Q21A 5CYOA 3AP1A 2VHQA 2ZS7A 3IEUA 4U00A 4EQ6A 1T0JB 3IO5A 1BOFA 2Q3FA 1UJ2A 3AGQA 4HAVA 4Q7JB 4R71A 4M1OA 1XJQA 4A8JB 4I1UA 1UBGA 3NBZC 1Q44A 4ZCMA 1M1YE 2RGEA 4NH0A 3EAQA 5DN6D 1XXHE 2BC9A 5C1BA 1AKYA 1UEJA 2OAQ1 4HLUA 2EWWA 4BLTA 1ZJ6A 3HDTA 4H1VA 3W8NA 2YINC 5DI3B 2RGNA 3W90A 3GLIB 2XSZA 1KDOA 5L3QB 3BERA 3LXRA 1KK0A 4LV5B 4BLOA 3H4MA 3M1IA 4BQSA 2OFWA 2ZU6A 2HYIC 2FA9A 4LYHA 4O3MA 1RIFA 4PR0A 2MMGA 4QXAA 1ESNA 1J90A 3HYRA 1G6OA 3S1AA 3P26A 1E0JA 4EPYA 1CRPA 1VHTA 1TF5A 3P4XA 3RRNA 3I61A 2FOLA 2XJ4A 4LBYA 4ZKDA 4URVR 1SVLA 3BH6A 1C4OA 2FF7A 2XOKD 2GJ8A 3WHLA 4CEJA 3MWYW 1II8B 1XBTA 1HT1E 2GK6A 1KNXA 2IYVA 2J0UA 3B13B 3OE7A 3BC1A 3DL0A 4AKIA 2OBLA 2BIFA 3BH0A 1NP6A 3L0SA 1KI2A 4LK2A 4KI0A 1XZQA 4AWXA 1CF4A 4Q1FA 1GKUB 4JVNA 3LW8A 2J9RA 3VX4A 1T8UA 2FPKA 5CJPA 1KYIA 4GMXA 1SXJE 4NCHA 4M1TA 1DVRA 1Q12A 2QI9C 4TMZA 3PEWA 3WHKA 1NN5A 4XVUA 2WWIA 4DLZA 3K70C 1ZD1A 3REFA 2ATVA 3EG5A 4ZDKA 3MWJA 2GK7A 3TBKA 4B48A 1DE0A 1RRCA 4LV8B 4KFTA 1CJKC 2CBZA 1WB9A 2F3RA 1P5ZB 4C7OB 3TLXA 5KYKA 2F43B 5F98A 2IS4A 1AK2A 3AVUA 1ZW6A 4MRNA 1NMYA 2IYYA 5DYGA 5GADl 1VTKA 3SJBA 4Q01A 1T9HA 1G5PA 2QMUA 2ZRJA 1QG4A 4LJ4A 4PC6A 4TLBA 2RHMA 3AVWA 2P5SA 4GFDA 4QHYA 3AF4A 3IIJA 5C46F 1EFCA 2O8BB 2HEIA 1JI0A 1CJMA 1NY6A 3R9XA 3X1ZA 4EPXA 1ZNXA 4W5HA 2IYTA 4B2PA 3QKRB 2QY9A 3LW7A 2BBSA 1W4RA 4Y0AA 1ZINA 1G19A 2XTZA 4JL5A 3G5UA 2PZEA 2IEZA 3FMFA 4QJ5A 2A78A 2VSFA 4ZCLA 1G3RA 4PHHA 4UJ3A 1XU4A 4Q4LA 2OAP1 4M22A 2NO0A 4HB0A 4E22A 2GJSA 3CPHA 1G64A 2KB0A 4NP6A 5GVRA 2JLSA 4L4UA 1TQDA 1EFHA 3MCAA 4L8GA 2ATXA 1FX0A 5AWFC 4WIAA 5TV2A 1KI1A 1NL3A 4G5OA 2XB4A 2D06A 121PA 1A2BA 1G9XA 4CEHB 1V5WA 1XF9A 1EX7A 1TUIA 4K46A 4GL2A 4OQMA 4OK5A 5LBIA 2OBNA 4B35A 3I32A 3BB4A 2G6BA 3ADBA 3O47A 1S1MA 3I5YA 821PA 2ZETA 1WMSA 5SZIA 4O25A 2VBCA 5E7MA 3CR8A 4HAWA 4N1AA 3FKSA 3AV0B 2JGNA 3W6PA 3RWMB 1P72A 2IUUA 3F3YA 4ZDJA 3RS5A 2IS1A 3GMTA 1T5IA 3NTUA 2QTVB 4TL7A 5TVKA 2YV5A 1E9DA 3UMSA 1E1QA 4A15A 2J0SA 3FMPB 3X1WA 2H5EA 4BRUA 3VU9A 3SU8A 1NF3A 1RW4A 1U9IA 2FFAA 4PO8A 1UKEA 1PUJA 4Q9LA 3K09A 5DI9A 5FUVA 1ZUNB 4L15A 5KUTA 4FD2A 2CVFA 1W5SA 1S1CA 3V00A 2V1XA 3WMGA 1YZNA 4MKIA 1E3MA 1I4LD 2RHDA 3FMOB 4CZ2A 1PV4A 2W0SA 2WSMA 3RC8A 4M9QA 2PX3A 4F7WA 2J3EA 5KTYA 3K0EA 2ORWA 3MRSA 1MOZA 4WAUA 1OF1A 4MKGA 1GILA 4MGKR 1KI6A 5J4VA 1K8RA 1YZUA 2CNWD 1ZCBA 4OI4A 2BCJQ 4EIWA 1GVNB 3JVVA 4Q66C 2JDIA 1Z2CA 3P20A 3IIMA 1AGRA 2IS2A 3E70C 3ZZUA 1WA5A 2N42A 2NO7A 1Q1ZA 4G5RA 4BZXA 2DWPA 4Q5IA 4US1R 4DKXA 1YZQA 2QT1A 1U2RA 2CL7X 1E0SA 2VA8A 4IEEA 2ZVQX 3U2QA 1IJEA 3OAAA 1GKIA 1RYFA 3L43A 1DG1G 4M21A 3K9LA 3GJ7A 2ZR0A 2ZAMA 3QEOA 3UWOA 1NJFA 3TRFA 1D8TA 1NJGA 3GLIE 1JJ7A 2XZLA 4JYBA 1AGPA 2ZE8A 3A4LA 4C2TA 3I73A 1T6NA 1SULA 1RPZA 4HAUA 1G7CA 1II9A 1I2MA 3A4MA 4AG5A 5JRZA 5IK2D 4F4IA 3GJXC 2GXAA 2PMDA 4GOXA 4Q9JA 3NXSA 5GJCA 3VTKA 4KITB 1ZM2A 2BEJA 2NO9A 4Z54A 3OEHD 2OCYC 4XSHA 3BORA 3G0HA 2IHBA 4XVQA 1KGDA 1GDDA 521PA 1G8FA 1MABB 4HZIA 2AWNA 4QJ4A 4WXPA 2W2XA 4KFUA 5FOXA 1KJWA 4IRUB 3DEFA 3U3RA 2VP6A 1T91A 2CCGA 3B1WA 5C18A 1L4UA 2C2HA 5KSPA 4KSBA 4EAQA 3M6AA 1SKYB 1QRAA 3IQXA 4B3BA 4DCNA 4BFXA 2O8EB 3WYGA 3F5FA 1BYUA 3VR2A 4Z8XA 3K0AA 3MGCA 2OSBA 3Q5DA 4BECA 2DFLA 2HF8A 2Z0MA 1AZTA 1R5OA 3CM0A 5KNBA 2GKSA 3IPYA 4ZIRB 5EXTA 5JWHA 2K5UA 4LJAA 3ADKA 3EZ6A 5HCIA 3FHOA 1J2JA 1TQ4A 1X6VA 3K9NA 4QGAA 2P6UA 4M1KA 3TVDA 3X2SA 1HYQA 1F2UA 4U02A 5HKKD 1E0KA 2XEXA 2JLVA 4X8MA 2HV8A 4FMBB 4ZPXA 4PPGA 1UKYA 4WW0A 1M2OB 4Q9HA 4CEJB 4B75A 4NYIR 5SZHB 1A7JA 1Q21A 3AH8A 5AJVB 2C78A 1SKQA 4KU4A 1EFRA 4OQNA 3GLHB 1E2IA 3ICQB 1JJVA 8OHMA 1E2NA 2EFGA 4XD7D 1SVOA 2JJ2A 2R6AA 3CZPA 1IN6A 4CW7A 2P5TB 3QXSA 3QF7A 2W6IA 1FZQA 1E9AA 4UJ5A 1OSNA 3C4JA 4D0GA 1GTVA 3HR7A 2LCFA 2YKGA 1CU1A 2H8KA 5DHAA 1JR6A 1JNYA 4MRRA 4YQFA 1DS6A 4HI0E 1TAGA 4UQOA 1KK3A 1CKEA 3PUYA 4PC1A 2ODWA 3NDPA 2JLQA 1KZGB 4PO1A 3I4LA 3QIAA 2F55A 4GOJA 1Q57A 2PJRA 1JAHA 1T4GA 5A0FA 5CDFA 4V0OA 4R98A 2BKEA 4AYTA 4KLZA 2Z4SA 2EFDB 2XJ9A 3U7GA 4JJKA 1OH5A 2BWJA 3B1ZA 1OKKA 2DYKA 4RCZA 2OUKA 1E9BA 1JR3D 2CCJA 2XGJA 4MITA 1XB2A 4C0QC 3MD0A 3X1DA 3VR3A 3U4QB 4OYHA 1H8HD 4DXAA 3DO6A 1MO6A 1IXZA 4LC1A 4ABYA 1R7RA 3PIRA 1MR3F 3K70D 2WKRA 1OV4A 4IJMA 4IDQA 4JL6A 1F2TB 1E79A 1OIWA 1E2PA 3Q7PA 4UXJA 2ZRKA 1E2FA 3CNNA 2WSSA 1VDZA 1DO2A 1F6BA 3CRVA 2J7KA 1UDXA 2D4HA 2WZQA 4HAXA 5FH9A 1ZU5A 1IHUA 1Q1EA 2QPTA 3IKJA 2HT1A 2VYFA 4BZQA 4D4JA 4URWR 2VO1A 1M7HA 1L2TA 1HUQA 1I4TD 2PH1A 1YR9A 2MSCB 2Q0HA 4Q7MB 2P6NA 1OB2A 1IONA 1X8LA 4ZKEA 2PCLA 4KHZA 2OV2A 1KY2A 5CK4A 3O8RA 2EFHB 2GF0A 2GAOA 2AL7A 1DOAA 3U44A 4Q7LA 3LV8A 2J46A 5CK5A 3LBHA 2CK3A 2WWWA 1UBFA 2GEUA 4KFSA 3U61B 2RGDA 3VKHA 3U7FB 1Z0FA 1E2MA 3VU9B 1DTSA 2RGNC 4AYWA 1PUIA 1FOEB 2R65A 1E9SA 2P6RA 2YOFA 3B1YA 4KO8A 4P31A 3FDIA 3AM1A 5F9FA 1T3HA 1VCNA 3SS8A 4KVAA 1ZRHA 3ZVLA 1CJVC 1N0WA 3A1SA 4B44A 3T35A 5KDDA 2GXQA 1ZNYA 3O8CA 4B6EA 2CVHA 3EPHA 3C5CA 1F60A 2XNDA 1GL7A 3EASA 4LCBA 5L3SA 2ZU0C 1WDTA 1R5BA 1WQ1R 3BK7A 3BFVA 2GXUA 3DMNA 4LY6A 5BQ5A 4LYFA 4PPNA 1GRQA 1E9FA 2UKDA 3BB1A 3ZVRA 3MFYA 4PANA 5FPYA 3DMDA 1NKTA 4YDHB 3UWKA 1E4YA 4G5SA 4Q1CA 3SOPA 1XEXA 3KQKA 4EKDA 1N6RA 2QPOA 4LJ9A 2R2AA 3LLUA 2C5LA 3THWB 5GJBA 1T3LA 3P32A 4EFLA 3SE0A 2VH5R 3KX2A 4C2UA 2C99A 2JIZA 4PX9A 1HA3A 3GFTA 1Q22A 2ZYWX 5TB5A 3FFBA 2GZAA 4KXFB 4ON9A 4R9UC 3U3JA 3LQQA 2JEOA 4M9XA 3FB4A 5BYJA 5JJIA 2V7QA 2GWHA 5JWRA 3I62A 3I8SA 3WYFA 5DIFA 3LWNA 1RYHA 4W5WA 1DAKA 1GOTA 1IQPA 3JZAA 3J81k 2GA8A 2D62A 3FVQA 1E9EA 2GJ9A 3LH5A 2WMOB 5EQTA 1VG8A 1R6BX 2C04A 3BD9A 4WVFA 1KO4A 4Q1BA 4RFVA 4Q4JA 4V0MA
chains in the Genus database with same CATH superfamily
5CRIA 2EQAA 1JPNA 1YZYA 3H9GA 1S2OA 1RHKA 1W49A 1YUBA 2F1IA 2NU6B 3QVWA 2GCIA 2EQBA 5ETJA 4B17A 4BFWA 5K6RA 5LOVA 7REQB 2FG5A 1XU7A 2OV3A 1ZVJA 2WYWA 1N6KA 1W93A 3COSA 2M2IA 4PLWA 5E9AA 5IJWA 4MIKA 4INPA 4OQDA 3URMA 3EXHA 1NI3A 2Y0PA 2FWMX 2ZDQA 1H94A 3FAZA 4JLOA 5DHPA 3CR7A 3WIEA 1L9KA 4CIBA 1XTUA 3DAHA 1YL5A 1Z4QA 3OQHA 4IX9A 4Q6WA 5DU2A 3VO2A 3L1VA 3NRBA 3S2GA 3MTAA 5DTQA 3X2EA 1ACJA 4MWTA 5EZYF 5FEUA 2XT0A 1AQJA 2AN1A 2N46A 4EMBA 3SJAA 1A4XA 2VTBA 5K20A 4HH3C 4UHDA 1H1TA 4YRSA 4LOHA 2XTAA 1H65A 2CYBA 4DQXA 3GYBA 2Z43A 1TAHA 4LIPD 4NDZA 5IEBA 3IXMA 1RS0A 1TLFA 4Y2HA 2QROA 2F8LA 1WCXA 3MLAA 1RYMA 4DS3A 4UEWA 2QE6A 4PGMA 3UT6A 3H9BA 1OYVA 1ONPA 1RCUA 5ILGA 2VPXA 2O05A 2Q2VA 4LCJA 3OZRA 1TPZA 2PX8A 1E7MA 3ABRB 1DTWA 2ONCA 2KMLA 1RFGE 2VSOA 3NT5A 3LHDA 1N7GA 1C9KA 4Q18A 1AVTA 5FOTA 1SB8A 2Z5GA 1L7XA 1JHUA 1EK1A 2PBRA 3CZQA 2IP2A 4HPWA 1O54A 4NIMA 4RXTA 5AW3A 3FMVA 2XITA 1JF8A 3HXLA 3T9AA 2YASA 3RK1A 1EKXA 1NATA 4N01A 3SHFA 3I1FA 3TS1A 1ATZA 5K09A 1JU3A 1YMUA 2V9ZA 2FDCA 1DJQA 2QMEA 4MHOA 1BJTA 4PSAA 3AC0A 3BS4A 3T7CA 3TUZC 2ZRAA 4DJJA 4MUAA 5JISA 2JAWA 1VE1A 1VJTA 2FQWA 3O03A 3E5RA 1UMDB 3IDQA 3DQPA 2ZDGA 3L0IB 4GLBA 3VR6A 3ROEA 4XUGB 3ZDXB 3SC2B 1X7HA 2CW5A 4X8OA 1WQ4A 1P6XA 2CDAA 4J0JA 5G41A 2I67A 3QW4B 4I8XA 1Y6RA 3OJOA 4I66A 3TPCA 3UHFA 1FW6A 4RKEA 1CE8A 1L5SA 1GGHA 2ZI6A 5CM9C 3K09C 1L4BA 4D9GA 4J1TC 2G4CA 1Q11A 3FKQA 1F17A 3D7RA 3SQOA 5IVKA 1CLUA 1HFKA 5HFJA 4BO0A 1PFYA 2G09A 2PRZA 1XPOA 5CFLA 3BHJA 2IQIA 4I1VA 2C3UA 2ATIA 3W1VA 3B6EA 4MR7B 2NUPA 4Q3BA 1L3IA 4DLYA 2GARA 3ZGNA 2YIMA 4QDZA 5ICSA 2GVZC 1YS9A 1P18A 1R8QA 1NP3A 3L6BA 3EG9B 2BP7A 2ZVPX 3C14C 5A9RA 4F91B 3U7RA 8ADHA 3VMFA 4NPHA 3E9NA 2NTYC 3CN7A 2ODNA 1LQTA 2I4LA 4DMGA 1YBFA 3NAMA 4WZAB 3UBMA 4RX1A 5A7GA 5ENZA 4U2KA 2O0LA 2OEPA 2ZI5A 4F46A 1YF3A 4C6RA 4IH1A 1GFIA 1CVIA 3BZUA 5JARA 4L22A 3V32A 2Y92A 3F3KA 3PEVA 4IVNA 4R1OA 1ENPA 1YZFA 1ANKA 4GR4A 3HJAA 3PDHA 3TZKA 2YZNA 2E4WA 4J91A 4G1VA 2Z56A 4K88A 3IJEB 4YRJA 2IH4A 2VCYA 3NEJA 3REOA 1BH2A 4YXWA 1O95A 2P9YA 3WWZA 4Q6BA 1TCUA 3IAS6 5E9JA 1T2CA 4PAMA 1UC8A 1PWZA 3QSYA 4FEGA 4KPGA 5FWDA 4MIEA 2FSPA 5DP2A 5KOIA 3T15A 4BV2A 4U6QA 5CTJA 1LDGA 4ZVOA 1Z56C 2VBIA 2W58A 3FSEA 1N75A 3C48A 1ZXBA 3AHEA 1M7GA 3C5HA 1Y1RA 1D6NA 1DIOB 1XVVA 2AR7A 4UFNA 4NBWA 4YNBA 3AIOA 4AQDA 5KC8A 3ZU6A 3OCZA 1DHTA 3WICA 2PTGA 3UMMA 4E0BA 1F14A 2VHTA 2W2OA 1DX4A 3OZEA 3ADDA 2JCYA 1RI3A 1OIXA 1WHTB 4HBGA 2O4UX 2PU5A 3ZV5A 5KNDA 4RTRA 1D2RA 2ZYDA 1AE1A 3UJ3X 2PXCA 3TZQA 3ZIAD 1LJUA 5L6LB 3R8FA 1JN0A 3RU9A 1HTBA 1AZSC 3EVNA 2GBIA 1ETUA 1Z2PX 2QN1A 3LX4A 3K8OE 4NEHB 3MMXA 1FE8A 1ULTA 3VJKA 2JLYA 3IODA 3WGLA 1PJLA 2WLSA 2CEKA 2UZ4A 1NNI1 1R8YA 1G5IA 1VSQA 3EGXB 3HP1A 1K2VN 4Y9RA 5AJUA 4RCYA 5CCDA 3RYIA 4C87A 2CMHA 3BGSA 4BZPA 5D7BA 2QQ5A 4D96A 1SC3A 5ICCA 1JQDA 4CMEA 5IRCD 2PXHA 5AK6A 2O52A 4Y2QA 4YN3A 3GNSA 4NU6A 1G8MA 2QXYA 4CLDA 4H7HA 4Z3KA 3ZNPA 4M54A 1XCMA 3TOXA 4CV0A 3OX2A 3MUEA 3RS2A 1I3MA 1IBCA 1LLDA 5JCOC 1RP1A 4OMCA 2HMYB 3LT5A 4C06A 1V39A 1TCBA 3X43A 1VKOA 2GVNA 1JU4A 2BVNA 4B7UA 1ZM9A 1ZNQO 3KKPA 4XGKA 3K5IA 3F47A 1T3GA 3PNBA 5E4TA 2WB2A 1O94D 2XKJE 2JGDB 3MC1A 2D2FA 4MP8A 3T5DA 3ILYA 2BI7A 2FJ0A 5E8RA 3SVZA 3MGGA 1MCZA 4MICA 1Y5MA 1E2DA 2G5PA 2X42A 3D4BA 4P32A 2WSLA 3EGIA 4RHYA 5ES4B 3REQA 4EJSA 5B2EA 4P4SA 3AUAA 4AC9A 1DO0A 2IEDA 3GFRA 1BDMA 1MAWA 4S24A 3G2OA 1I33A 5FBLB 3MD9A 2P77A 1HE2A 3NO4A 1ZJYA 5JXHA 4ZEXA 2GN8A 4GOLD 5A5GA 5CX1A 5TQ2A 3ABOB 5LLTA 2D1YA 4LDRA 5DNCA 2CNKA 2WIKA 1YWGO 2QKYA 1VZ2A 3O84A 1VPVA 4KQJA 4RWZA 5ALIA 2JAUA 4HXGA 5G3YA 2DKNA 3EGDA 3KT3A 4ERNA 4LE1A 3QVMA 4FDUA 5DCLA 3BWYA 3X2FA 4EG4A 3A27A 1GGMA 4FWIB 2P4UA 2O06A 4JBXA 4JODA 4IIGA 1P2GA 2XCOA 5TARA 2HO4A 2XCTB 1DRUA 3E05A 3IFSA 1QFXA 5FPQA 3D7LA 4F5WA 1GA6A 1TO2E 3DHYA 4DIFA 3RT1A 4ZALA 4A16A 2G80A 1CUUA 2VPIA 4K8OA 4O29A 5JW6A 2YWEA 2GDZA 2GETA 3LGSA 3ZLBA 2XA1A 2D59A 3KUCA 4G9EA 3KZCA 3PNVA 3EDMA 2AG1A 3W8RA 4W9MC 4JQYA 3TSOA 4J9UE 4NV1A 3A9RA 4K0RA 2GBPA 1V5EA 4JY7A 1DADA 1ZK2A 2HJVA 1QHIA 2V55B 2J3MA 1FYWA 3B9PA 4PFJA 5J2UF 4CM8A 1YA4A 2FGKA 3KR9A 1KJ9A 4N18A 3FNBA 2H07A 2H7VA 2R8YA 3NHSA 5BSGA 4CM3A 1V45E 4QARA 3DUFA 3TK1A 1JR3E 3C43A 1UKCA 1F9EA 2R7KA 3IE2A 5BN4B 3CLRC 3M33A 3L49A 3GRYA 4JSRA 3SDZA 3T1VA 5CYPA 3IBSA 2XDQB 5CVCA 3V3TA 1L5OA 2C3MA 4LK3A 4OLHA 5JECA 2R1VA 2HGZA 1SBCA 3FFTA 3IQDB 1HQKA 3IBCA 3OVMA 2WIJA 1MN6A 4ZANA 3NAGA 2W6QA 1R0LA 4AJOA 3AHGA 3K5WA 4V1CA 3SZOA 3TVTA 1A9XB 2CMFA 2RHHA 4LRSB 4DQLA 2XRFA 1Y3AA 3I34X 3PUXA 4U2FA 4OJQA 1POXA 2OB2A 1TL7C 1OXTA 2VHCA 3ND6A 4UD6A 3SSAA 5DK6A 2ZJ8A 4MUKA 4JLMA 3E2PA 2EF1A 4NBUA 5FLKA 2O2DA 1JXAA 3LTNC 1K75A 4Z9BA 4GEGA 1SCUA 1CXZA 2AZDA 3V55A 4DRXA 4O3FA 3QF4B 4MGYR 5B37A 3TLMA 1OWPA 3PHIA 5BUZA 1OAOA 5F5XA 1G20A 2CFRA 1I0LA 4MRSA 2DAPA 2XLBA 1MNQA 4Z3DA 1MNAA 3IMFA 3BE6A 2HB6A 3AETA 4PGFA 1YB4A 1LTHR 3H99A 3TQFA 1Z62A 1P3Y1 3N70A 4JA2A 4UQPA 9LDBA 3H8VA 3M3HA 2Q3BA 5KWVA 3ISTA 4AECA 4EF6A 3IALA 1Q92A 3PC7A 3PC4A 1XE3A 4NCJA 1EDEA 3IR5A 1A69A 4O4JB 5EZ6B 1S0UA 4OUKX 2RI0A 1E9CA 4GAEA 4K6CA 3JZMA 2Y66A 4L50A 5CB8A 2QYOA 3DBRA 3VZPA 2IY9A 4DUZB 2ODPA 3OJWA 1B8VA 3TKAA 4ZCIA 1F5NA 1X1RA 2FSSA 3U60B 5B1IA 3MQ4A 5K4AA 4HNTA 1QHXA 2QS9A 2ZUCA 1EX1A 1U80A 1KAOA 3I04A 1U8FO 3TL2A 4A2WA 4R0NA 3R41A 1KS2A 4OHVA 4LQLA 2HAEA 3MQFA 4JX8A 3H83A 5IABA 1EUCA 4Z4GA 2CDCA 1G4HA 3BMQB 2COEA 3IR7A 5FUQA 4G86A 5C5EA 2PS3A 2QZPA 2YMPA 4OBWA 1GJRA 4QBGB 1EFPB 4OJKA 5AK0A 3WMFA 5IULC 1JLMA 1NR1A 1RXYA 4MV5A 1WUYA 4XE5A 1ODLA 1Z0DA 5AOVA 2UUCB 3NDBB 2CYAA 2FWPA 4X1YA 2BFDA 3KVYA 4MO2A 5B3JC 1I7DA 1HM5A 2IPNA 4MW4A 4JP5A 2IV3A 3U5TA 1M7BA 1O96A 1KIAA 3TM5A 3TTUA 3UPTA 3FKSD 3KB6A 1VE3A 3MMZA 4RFSB 2QTZA 3GCXA 2ZR7A 4ZZ1A 2AN5A 1TIPA 3MWDB 4FLFA 4OLBA 2AR9A 3WLIA 2NZXA 3WP0A 4TS4A 3LY9A 1VL2A 2PL5A 2VJLA 1HTWA 2R8RA 4Y30A 3RFCA 1CUXA 3GJ6A 5JY1A 4HJXA 3FHJA 4RSRA 4RJLA 3M81A 4QBHA 2WWTA 2HQRA 3ZW9A 3U3XA 1TKBA 1UF9A 4RYLA 3FY4A 5B64A 3BD8A 4FEAA 1HWYA 2WFLB 2E4UA 1R0RE 4S3MA 1K68A 3A14A 4XSVA 4C0HA 4E4YA 4QULA 5EINA 3BA1A 4RESA 1E6LA 3QMPA 4K9PA 2B21A 2Y9PB 2HZ7A 4OQYA 1MP0A 4W6ZA 4HATA 3RB8A 4X20B 1SUAA 3K96A 5LXTF 1VKNA 3K6KA 2D1TA 4FIZA 5BOVA 4B8ZA 4DA8A 1B0AA 4JUAA 3NBXX 3JZFA 3PXXA 2P2SA 2B4AA 5BO5A 4KLAA 3BVPA 1HMPA 1U2QA 1P8AA 3AGPA 3E7PA 4TT3A 2ERCA 2R11A 2Q5OA 5WRFA 3LRPA 1A2QA 4MQBA 1ECFA 2X4GA 1Y4ZA 1YL6A 1XTZA 2ZYIA 4G37A 3AT1A 3WMXA 3QLEA 2QAGA 1HNXB 1O2DA 4ZICA 3D8TA 3VSDA 2ZQYA 4MW7A 4FDAA 2FSUA 4HO1X 1V8OA 2VNSA 1JE1A 1TUBB 2FOXA 3LK7A 3R3XA 4TTPA 2Q41A 3B82A 2CXXA 3PQ4A 1WL8A 4P0QB 1IK6A 1QPGA 2BJVA 1PR6A 1K7XB 1PV2A 2OWDA 3C6QA 3TGWA 2B35A 3KEOA 5E4JA 3AF1A 3ITDA 3E7DA 3TI9A 3UK6A 2CLSA 3JATA 4I0WB 1SA0B 1QVAA 3R3JA 2AXPA 1SVUA 4OFXA 1XWWA 3T5CA 5LU8A 1P0CA 1ZIDA 2WD7A 4P08A 3JYHA 5TIIA 1QAOA 3A6JA 3G7UA 4GX0A 4IFEA 1WZ2A 1JKMA 1WY7A 4OGWA 1BX1A 1DDGA 2B8WA 2HRQA 1D7AA 5JZSA 3DGFC 3VVBA 2W4QA 4FGLA 4CT4B 2V5AA 1X9HA 3PEFA 4XWWA 2CB0A 4D80A 3LBAA 2YIDA 3B7GA 3CX4A 4Y1EA 3GUVA 1ZN9A 3EDYA 4Y0VA 1P1FA 1CUBA 2QP3A 4CEIA 4RC9A 1Z4JA 3E8XA 3UT5B 3JVEA 1XVUA 2PT5A 2NXCA 3GGOA 3JVIA 4LJ8A 1Y8RB 3OI7A 5G4KA 5TJ9A 3A1VA 4X7PA 2WJJA 4ZVKA 4UBNA 4KXWA 4PE5B 3HKCA 1WO8A 4UM7A 3FGNA 4NYMR 2ZSKA 1RD4A 1L8XA 1AKVA 1XLWA 1ZC4A 2BKLA 4UZSA 5DHRA 3WGJA 2EJVA 3IPXA 3L3BA 2HMUA 1DIHA 1FP7A 3W6OA 3ENKA 2GFHA 4H3VA 3C98A 1QJ4A 2HTFA 4I55B 4AK9A 3A6LA 5KTKA 3G6KA 1QCDA 3ANXA 3K0HA 2KJQA 2YQ5A 1EE2A 1HI9A 3I52A 2I3DA 4LTNA 3U4AA 1G8GA 2FF5A 1PW5A 2XMPA 1YR2A 4J4HA 4ND2A 5JS6A 4WKNA 3WHIA 5BSKA 5LM3A 2YNMA 1HEIA 1EK0A 4G01B 4ZVSA 3VU8A 5LP6F 1DDIA 4DMFA 2YVAA 4FR5A 3EIQA 4IZIA 3VZQA 5L4SA 5KNCH 3ZZ0A 3ZDZB 4BLPA 5EE3A 4FYMA 1DQZA 3NMUF 3D3WB 3FF4A 2W6ZA 3I42A 5DULA 4KJXA 1QOQB 1ZKDA 1P4GA 2HMVA 3WYCA 1QGUB 4JLSA 3KVNA 2CF5A 5KO2A 5LL6P 2BFWA 1TJNA 3CTMA 2QN9A 1N2ZA 1N6PA 4O1IA 1J2YA 4V02A 2JHAA 4E13A 2RHJA 4BJHB 5FUYA 3A6GA 4D3DA 1NZJA 4TYWA 3WL3A 2BGTA 2XB6A 2I7TA 1EFVA 5KYYB 3PGJA 2EBUA 4YFYA 3DNPA 4EEXA 3L46A 4IJUA 5GOZA 4HWTA 1UWVA 3F8SA 1SUBA 4HP8A 4LJ7A 3H84A 5DM0A 1KETA 2OECA 2R751 3BIJA 3F0TA 3ZGYA 2VSXA 4DC0A 2WILA 2XD4A 2EW2A 2QUHA 1F38A 3BUSA 3L7IA 5A6VA 1VECA 4EX6A 3MVEA 5FPTA 3BREA 1B00A 5I7AA 1ECJA 3M6IA 1CJTC 2D3TA 3NGXA 2J6HA 3RODA 5IYZA 2OCXA 1C1DB 2QUZA 4YFVA 3ZY4A 4QLBA 4QYIA 4TV9A 2O8CA 2Z1DA 2GNOA 4H08A 1Z39A 3EMVA 1VLHA 3IT3A 4P3OA 5CJ2A 4LE2A 4TXJA 4HRAA 1RWPA 2PL1A 4HQ0A 5AKEA 1A7UA 4BQQA 2NVUB 1DBWA 4UTPA 3JQBC 1NXOA 4KQMA 3Q3JB 4DXDA 1K89A 2ZYSA 3DMRA 3O7WA 3SXJA 1GCAA 4Z54A 5ARBA 1Y8CA 3OE4A 4L73A 4KRGA 4TUYA 1C2TA 3C16C 2KSQA 2O0MA 1Q0QA 2A2ZA 2CEAA 2Z9BA 4HSGA 3S29A 2CMDA 3ORFA 2OT3B 3FYHA 1Z45A 2AFHE 5IARA 1IZ9A 2QT0A 3V8RA 4Y2SA 3L05A 2JRLA 1PJ2A 2OXEA 5D1NA 3ECSA 2X7JA 5CP8A 2I7DA 2LP4Y 4A8JA 1N1GA 4OJNA 4ALLA 4BKMA 4DA4A 3DZDA 3H5RA 3V8PA 1ODIA 4RZXA 1UODA 3CLRD 4GI3A 4C4AA 1ICEA 4I5IA 3OD5A 4CM9A 4M53A 4D56A 1NDHA 1NW4A 1FMJA 3KTOA 4RKRA 3Q87B 3EHEA 1V3VA 3NDJA 2QTFA 1ZH8A 4J7XA 3KQSA 5COAA 1SCKA 2Y93A 3U5ZB 5HFAA 2LE0A 2FWJA 4BLWA 4Q16A 3GUZA 4OI0A 3VPFA 1H23A 1YCDA 5B3KA 5E2IA 4DV0B 1SHTX 4FN4A 4HXEB 5F5LA 5HOQA 2ID8A 1H1DA 5EGNA 4KXMA 3STHA 5LFAA 1WBDA 4LF6B 3HKBA 2VHVA 4PLZA 5INTA 2NGRA 5K8IA 2D3WA 2I29A 1CIVA 1NSTA 4MA5A 4PHCA 4YMSA 5EIOA 4B0PA 1S2NA 3KUUA 4EPWA 2IHJA 2HBZA 2NAPA 3DZKA 1G17A 3FWHA 1V8BA 4K26A 3VO9A 3A2KA 1Z6GA 2D2EA 1U1FA 3A06A 4U9UA 1U7HA 3ZVMA 3T9BA 4QODA 5A4IS 1RQPA 4I1SA 2ET6A 2R8OA 1II8A 2ZS9A 3ELWA 3M6XA 3TZCA 5I8PA 1GRCA 5AI5A 2QW8A 1J2RA 3ZHBA 1PL7A 4B76A 1PHRA 1SNYA 4N5LA 1RYZA 4B83A 2VTEA 2BGRA 1XEAA 3NEYA 1XXLA 2W2LA 2G4VA 5C2JB 1PFWA 1A9QA 1B0UA 3GX1A 4LN1A 5HFNA 4FC6A 5FBKA 1KQGA 4G0PA 1Q95A 4W5JA 1VLMA 2B94A 3RC7A 1WZCA 1K0FA 2EV9A 3B51X 2CK3D 3D3KA 5F7OA 3CTPA 3K1ZA 4L5JA 4WK6A 4OATA 4F4HA 1JH9A 1RYDA 3NKFA 5ECYA 1WPQA 5H0IA 1VBNA 4QTUB 1BFUA 5E38A 5ERXA 2NV0A 1X1DA 1XWIA 3RDPA 5JS7A 3H8SA 1TJ5A 1BFKA 1X7YA 2CHGA 3H2SA 1E7RA 5AM0A 1Z0UA 4BJ1A 4XPIA 3C4VA 3UKOA 1ZAYA 2WTAA 2GXSA 3AEQB 1PL6A 3LL7A 3ZS8A 1V9LA 5G02A 1LDYA 3ILSA 4FI3F 2DVMA 3PTZA 4YCBA 1N0HA 4PLFA 1X7DA 4AAYA 4MPPA 4HHEA 1IUOA 1VZ3A 2FPIA 4UUQA 4EDHA 1A9SA 2ONKA 3KSRA 5KCMA 3T5BA 5SZKB 3DJFA 4YMVA 4PQRA 4FJ2A 4FGSA 1DCMA 3V80A 5AR1A 1E3QA 3AWIA 4EL0A 4EHAA 4WN9A 2C4HA 3U3DA 4F9EA 1EUYA 3TUJC 2B1JA 2O8BA 1CZKA 2P67A 2VVTA 1M6EX 2CZGA 3GWZA 3PNMA 2QLTA 4RD3A 3LLCA 1GZDA 2JIBA 2Y6UA 4LJ6A 4P82A 3QKRA 4G1EB 1X1TA 4NAUA 4JK3A 4TZ0A 4U7WA 2Z5LA 1YC5A 4M3NA 5FOUA 1DBQA 5E1BA 1XA4A 3UJ7A 1MRSA 1X74A 2IUEA 1Y1PA 5BSFA 1RZVA 3CG0A 3OETA 3U4GA 3ESAA 3DZJA 1E2JA 3NTRA 4H35A 2C2KA 1KXZA 1LDMA 5CFMA 3USES 2W2KB 5HW0A 3IT0A 1D1SA 3E03A 5F4ZA 1NBWB 3JRXA 4L0CA 2Q6TA 5HGXA 1Y8QA 1Z5OA 2I03A 1PS0A 2NUBA 3E3LA 4Q82A 1P7WA 1BX3A 5DM70 4FT4A 1HRKA 2M1XA 5HVNA 1E64A 2F3UA 4QLOA 1F2UB 2V4ZA 3DVLA 2IYRA 3KWJA 1T35A 4QDKA 5ALNA 2ACEA 3ZWOA 4D43A 1MOSA 1KJIA 1R5NA 2PWBA 3DCYA 1QHHA 1S9DA 1JSCA 4N8SA 5JVDA 1W581 2F9FA 1OD6A 2HJSA 1L4GA 3CRQA 1WMDA 1YRBA 2YVQA 4FEEA 3VH1A 2HN9A 2Q5IA 3DLIA 3JV7A 5B53A 1IXYA 4MGHA 1VG9B 3NJ4A 5D3MA 1E3JA 2H4ZA 1HYEA 1GXSA 3TLCA 2EJCA 1WVGA 4RHXA 2JD1A 2RJOA 3ND7A 2IX3A 3KOWA 1GG9A 2GAAA 3DZBA 3HUTA 5L3RA 1VA5A 1A9TA 2FG6C 3OMLA 1NLFA 2FJUA 2W4IA 3UHAA 1ONOA 5KQLA 1CZUA 2UXBB 2C7GA 1G38A 5CNMA 1YQGA 3VR5D 4AIIA 4AZWA 1L1FA 5I9LA 1B14A 2J48A 3L7AA 5IASA 1LFAA 1WVIA 1WW2A 1Z2AA 3EC7A 3WLJA 4UU0A 2X6QA 4A27A 5AK4A 1XJCA 4YJGA 1FDVA 2AI2A 2C9CA 2IXBA 3FWNA 3QV2A 3SXUB 3D2CA 1C9JA 1GV0A 3NTVA 3ZWXA 5A6SA 4BO2A 1MGPA 1A5BB 1M3SA 2NV2B 5GZ1A 5KVCA 5IT5A 2KBFA 2X19A 4UXHA 2HHJA 3K2IA 4KQ9A 2XCIA 4MUEA 3T4XA 3W2TA 4R0MA 1NM5C 2OG1A 4ZJYA 1AS3A 1G2PA 1QGOA 1X9IA 2O6LA 3EYAA 4YH1A 3WTBA 2XYVA 4L76A 2C8JA 3D59A 1U0JA 3EZ9A 3HUEA 3N74A 4LDQA 3WJ7A 5A7FA 2YYAA 1JR4A 7MHTA 1W1UA 3TMAA 2LKDA 1K4YA 2EZUA 3IIEA 1HK7A 3IP3A 3LK6A 2NQ8A 5HQJA 2E9SA 3IVRA 3N76A 3TMKA 4DA9A 2GBLA 4X71A 4I19A 4B33A 1VHWA 4R2HA 4LQ4A 1Q1GA 4OHXA 4E5DA 1ZOOA 4C03A 1VRCA 1ZVMA 2H1CA 4ZGBA 1YDEA 4J94A 3WAGA 3ZWYA 4OK3A 3OCVA 3I23A 3L0BA 5DLYA 2J7PA 2RKWA 3KOUA 1X38A 2G7ZA 4ZI7F 1LVGA 1IJBA 3KQWA 4GLOA 5AUNB 3LPAA 4IFTA 4DAOA 1B42A 1D2NA 1UOOA 4LDZA 2YOHA 3DP7A 1L3BA 3PDIB 4JQZA 2VDPB 3HKDB 3GRVA 5BT9A 1GPDG 2PSDA 3PEUA 1XEFA 4OH1A 5IKOA 5BYBA 3WKAA 5IWCA 1SUSA 4P3PA 2IYZA 5FL7D 1XDDA 1ORVA 4IRMA 5KBYA 3WLRA 5AJZA 4ZT5A 4KVFA 1TO6A 5T3YA 3AEKB 2G77B 3PQCA 4ZAWA 3GP8A 3JTEA 3T61A 1YQQA 2JH9A 3VR1A 3FNQA 4G5XA 2K7ZA 1TQ2A 2P4SA 2NLOA 2FEOA 1P8JA 1QK5A 5FX2A 4JLKA 3RVRA 3THOA 3R7FA 4CKWB 4UC0A 3P9XA 2ZI4A 5AICA 2A84A 5C9ZA 3DE2X 4U7HA 1Z6AA 1YB2A 2JKVA 2AZ4A 4H6PA 4J43A 4TV8F 4GM1A 2X4LA 3QVLA 3IVCA 4W9NA 5EIBC 5ESDA 3HO1A 1NUAA 2PNFA 1RAFA 1HBJA 2WK1A 1Z6YA 1PJSA 4GP9A 3JQEA 4B6FA 4Q00A 4X6YA 1M2EA 4QECA 2IWHA 4EUEA 3VRHA 4IOKA 3BILA 2PUVA 1MABA 2CV2A 2ZRQA 3DXZA 2I1LA 1BGXT 3MA0A 3G13A 1Y3HA 3GEGA 3WBKA 3OPYA 4G0QA 2VP5A 2OLEA 4HQFA 3KEGA 5EUMA 3LBYA 2PCJA 3GB9A 5DWQA 2WHRA 4GQBA 1HE8B 2F3PA 3HR8A 4WA7A 4JI5B 1R9MA 5CD1A 3MW8A 4YRBA 4AW9A 4BX3A 2Y1GA 3N2GA 5K3DA 3PCRB 4RMIA 4NJMB 5H80A 2WMNB 4DTIA 5JALA 4LNUA 1WXEA 1DBSA 3C0KA 1XIVA 2NVWA 2ZBQA 5K8VA 4G0UA 4MAMA 2JAQA 5ALXA 4A7PA 3VAZA 2PRJA 3V4OA 4DY6A 3BSWA 4FYKA 1HSZA 4O4HF 3RBAA 4N6GA 2QMHA 4DUGD 3V1MA 3O91A 1DQSA 1EFUA 3N58A 4C7XA 5KB3A 3RT7A 3PXUA 1FSGA 1JDZA 3EUEA 1CTQA 2YHBA 3FCYA 2ZLBA 1KK2A 4KBGA 4YUZA 4E6PA 1W2HA 2VC2B 3HP4A 3PEEA 4PC3A 1EFTA 1NTOA 3EY9A 4YLGA 1M2OA 2GKOA 5DVZA 1ZHHA 2NPFA 3WO0A 2HY7A 1LSUA 4F96A 1BDHA 1U0FA 4HAIA 4DM7A 5IT4A 3WIBA 4CIDA 4DILA 3QVTA 2PKYX 3P9NA 2V7EA 4MVJG 2OHOA 1T1GA 2FCAA 1P75A 1RBZA 1XKLA 3A1UA 2GPSA 2CUZA 1R0ZA 3NHUA 5ALKA 3WP1B 1QAMA 3HSSA 1K6MA 3IE1A 2Z8YM 4NFLA 3PGKA 4JUIA 1NU6A 2FYTA 5J4KA 3O21A 3IAXA 3IDOA 1E5LA 1XMSA 4C4RA 4DNXA 2P91A 4PYNA 3AYXB 5F23A 3QX8A 1CK4A 1DFIA 2JIRA 3HBJA 4OIMA 2B69A 5FLEX 4HNGA 2DCUA 3E9ZA 4G1FA 2QZ4A 1HOTA 3EFOB 1K88A 5AHRA 4KXYA 1ZMRA 1B3RA 3G0GA 3I9OA 3NRJA 1PQ4A 1L5NA 1SOMA 3H3JA 2HU5A 3ESYA 1RVDA 4D8UA 1E63A 2WHXA 2ZR9A 4UUPA 5FFMA 1W47A 2HD4A 3R6LA 1E7YA 4Q4JB 1YFKA 1V48A 3HGMA 3N5KA 4R4JA 1SCAA 2GN9A 4DDMA 4F92B 1KZ4A 3A58B 3GRUA 1IWOA 3OLXA 1EFKA 1JS1X 2WHEA 2MYUA 3NTQA 2Z5FA 4RF2A 4EB3A 2Q9UA 3DFUA 3EZGA 4K2HA 5HM8A 3C3YA 3L92A 1C7RA 4BNMA 5ALVA 3ZX4A 1FNBA 3MYRA 2ZE7A 4K9NA 5DNEA 2PEZA 2QMOA 1V7QA 1W8IA 2ZRGA 1IY2A 1J42A 4HMQA 2I87A 1X80B 3DL7A 2L82A 3U1TA 4Y6QA 5CB0A 1VBMA 2QTBA 2OZPA 1GUBA 3D3NA 1OXKB 3A9VA 5A9SA 1NHGA 2P5UA 1P4SA 1ECCA 1JEYA 2V59A 1N3IA 3DNMA 2AFIA 4B2IA 1RAEA 2QENA 2Y4OA 4DYDA 1SCJA 5A4DA 4TYQA 4Z1OA 3EWNA 1JVSA 3UXHA 1V7ZA 3GARA 4IGIA 1LDNA 4BRWA 4FGWA 2VF8A 3H2YA 3G2NA 4CI0B 2AH5A 2D2IA 3I9JA 3ERCA 2QU8A 3P9KA 2ODEA 5K99A 4OHUA 2E49A 1PF7E 3ED5A 3W2HA 5A1TA 3ER9A 1SWWA 1FUEA 3SYNA 3H17A 2Q5CA 5LYJB 3CPSA 4L8VA 1TQHA 4PG6A 2XWSA 3S7TA 3ER8A 1BXKA 4REQA 4W1PA 1KHTA 2XXAB 4RKWA 2XUAA 3FPAA 2ZQZA 4EB6A 2V7UA 5GMOA 3NHMA 1ES9A 2FR0A 4O2BA 1PFUA 1B6GA 2Z4TA 2HK6A 3O8QB 3PX2A 1G5HA 5L7TA 3G2LA 1PG2A 4Z53A 4QG7A 1IXRC 5F3WB 4HTFA 5TY0A 4BO8A 2PH3A 2M9MA 2PLFA 4B3TB 1CDZA 1LA2A 3RFFA 3S40A 2TECE 4EGQA 1NVXQ 3OQIB 2OXFA 2QI9F 3AEXA 3PNOA 3FOAA 4KAJA 1MB9A 2A59A 4DC9A 4UTVA 4DOMA 2B37A 3M5CA 1FSFA 4A92A 1MJHA 1IUNA 3CCBA 4DBVO 4P5EA 3H1FA 1FFDA 1ZMBA 4WE3A 5EP4A 2VRWA 3PYLA 4FBLA 1FU7A 3GEBA 2X0FA 4FFSA 1GGEA 3GFOA 1YFZA 3LFTA 5I9MA 4WLEA 3OU6A 1TB4A 4JI3B 1H0KA 2IP4A 3R2JA 5AJXA 3RFXA 3SLGA 1MZPA 4ZOAA 5IJ9B 1X7WA 1ZH4A 4G36A 1VG1A 1HYHA 4E2ZA 2J0EA 3WJ1A 4BNFA 1BQEA 4OV6B 1GPAA 2CHEA 2FKAA 3A6ZA 1UJBA 5KQRA 4GRDA 4JOQA 4TQAA 1CS0B 3FUXA 3LRTA 2VYND 1YB1A 3DTVB 4L0QA 3WK9A 2XF8A 1VLVA 3KUXA 1XMIA 1USVA 1X7ZB 3A1TA 4XR9A 1TZKA 2JASA 1SUWA 1U3GA 5I8WA 3OZWA 2OHFA 2C4NA 4MW9A 5THKA 1UADA 3BJIC 3EODA 2O8FB 5EE1A 1H8ED 4DB4A 4IIVA 1G6Q1 1RKVA 4I8DA 4XAQA 3ZJ4A 3JU3A 3WIUA 4XPZA 4KSCA 3OFND 2OGWA 1PK9A 4KPFC 4JI8B 3AKYA 2O0KA 4I46A 4MVJD 4X7MA 5B12A 1VC2A 3F2IA 3NFRA 2VNJA 1XPRA 1R12A 3N28A 1GL6A 3JAKA 1OTXA 2Z95A 5FOVA 3ZZTA 2V96A 5KHLB 2ZBPA 4HEHA 5EJIA 3RUEA 4RPJA 1L5WA 3BE8A 3TRDA 2IUTA 2G9ZA 3OU7A 3THYA 2ILVA 4MQEB 3I3SR 3KT8A 1V6CA 3KYDB 3Q8LA 2HLNA 4Z4FA 3O4JA 3L7DA 4LXQA 1UT6A 5DYIA 4BO9A 3FNRA 1QIGA 3L8ZA 3R0IA 4EGAA 4QIHA 2Q2OA 3AOGA 2HNBA 1EEHA 3A05A 3CR3C 2HV9A 5AUQA 4ZVMA 3IEMA 3ULKA 4OQXA 2P3SA 1YQTA 4FQ5A 5ES3A 2R6ZA 5LCXA 4B09A 5KU1A 4L5IA 2XY4A 1Z28A 2AK3A 3L0OA 1GLGA 3WQQA 1D0SA 3NASA 2JI4A 2PGDA 4IVRA 4D81A 1SC6A 1AH2A 3GDFA 1NI4A 3SYLA 5B7GA 1W2WB 5BSVA 5JD5A 1P61B 3ADPA 3HU3A 4G0VA 4TYYA 1SG9A 1LFDB 3VPGA 2JNWA 4COOA 2Y1KA 4F9FA 5EZYB 1E7SA 2NO4A 5DHUA 3HSKA 3GLFB 3AQIA 4IKEA 5I8ZA 3LT1A 5DGTA 3IO3A 4HVCA 3LDAA 4X0EA 3GNTA 1J7JA 1TZ2A 1EA5A 1VIYA 2CNLA 1Y5IA 2ZM5A 3IP9A 1YE8A 1YS1X 3NGMA 4Y3UA 3KQPA 1O0CA 4ZU6X 1ICIA 2R6GA 3TDKA 1KEEB 1RWMA 3IDFA 5K05A 2GJAA 4Q05A 1RPNA 4GI2A 3EDRA 1OWOA 3PKZA 1KS9A 2CVZA 5FR2A 1A96A 1YJCA 5BWCA 1WPGA 2OAGA 4QELA 1PE0A 2C31A 4EPTA 3WY9A 2WMDA 4ZODA 2H1OA 1T6XA 4WLOA 3IHWA 3EGVA 1WJGA 3QKUA 4NG4A 2JI7A 1D03A 4MH0R 5EIBD 5H3LA 2YC4C 1B1AA 1EGAA 4BNVA 4CLXA 4LRUA 4AMVA 3ZWPA 3V7YA 1TTHA 2AFVA 4XWGA 1YVUA 3RKSA 4Y6PA 3U7QB 3W04A 4A1FA 2RCYA 5BNIA 2YWRA 3BKWA 2CJWA 1L5FA 1NHWA 4WI1A 4PHTA 3PNQA 3EIOA 1IOLA 4G8DA 3IP5A 2LWIA 3JWPA 3R09A 1VBKA 3FSGD 4OGFA 5CUQA 1EAYA 4JI1B 3SAJA 1G2QA 3CIOA 1IULA 3N6RA 2H0RA 5JSFA 5LLDA 3CF0A 5EJ2A 2I3ZA 1P5HA 1KKMA 5SYMA 4Z0TA 3RUIA 2X0IA 2HREA 1TT7A 2WAYA 2PX5A 4OXIA 5AVVA 2FPOA 3V1NA 4G2TA 3PSHA 3W8FA 5A2QA 5KJ1A 2Q5HA 1LY1A 1Z9BA 1B23P 3DL2A 4DJEC 2J6IA 4LMBA 2L0XA 3MLBA 2HK7A 2BHLA 2ZXUA 2Q9AA 2VDRB 1H1LA 2JCVA 2YHIB 4AKTA 1KBZA 3E61A 3CEMA 1C1HA 5AK3A 4QUDA 5E6SB 3EHDA 3FXAA 4RADA 3CF4A 3KTAA 1V26A 4ZVQA 1M10A 1TUEA 2CWDA 2Z8ZA 3S8MA 4E7PA 1RM5A 1SRQA 4WOJA 4ITRC 1FP4B 1NF8A 2C7PA 2JBHA 4COKA 5EFZA 4A8TA 3KJHA 4B46A 1Y3FE 4BQOA 3WISA </