1HEIA

Structure of the hepatitis c virus rna helicase domain
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
443
structure length
443
Chain Sequence
b'NSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV HELICASE
publication title Structure of the hepatitis C virus RNA helicase domain.
pubmed doi rcsb
source organism Hepatitis c virus (isolate 1)
molecule tags Helicase
total genus 138
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1heiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA01
1UADA 3FKQA 2G88A 2WJHA 2C9OA 2ZSBA 1OXXK 3IQXA 4C0JA 4ZPXA 4S35A 4PAQA 3Q85A 1IN4A 1US8A 2ZETA 4MGKR 4TYQA 3WNCA 1E1RA 4UXJA 2OCPA 1X8KA 5L3SB 1CU1A 3HPRA 2QMOA 3KX2A 3R7WB 1A5TA 3OEHA 2XXAA 2V54A 3GLGA 2RGGA 2ZUBA 2HCBA 3AF2A 2HT6A 3EASA 3M4YA 4I81A 1M7BA 4U5XA 4Q66C 3CX8A 1VG1A 3CZQA 3THXB 1E0JA 3U4QA 5FTMA 4LBVA 4XWKA 1EX6A 3U44B 3Q5DA 4MKFA 2ZJ5A 3R9XA 3T1VA 1N6IA 3QE0A 3D8BA 4W5JA 3KXKA 3IIJA 1W36C 1XMIA 1LF5A 2YV5A 1NVWQ 2BMFA 5DO9A 4X8LA 1BYUA 4ZI3A 3TMKA 3B85A 4Q9JA 2GWHA 3BB4A 4JLOA 4JSTA 2ORWA 4PZLA 1CR2A 1E99A 2IF0A 4URYR 1GM5A 4BFYA 5K8UA 4I4LA 3U7FB 1US8B 1J7KA 4NL4H 1V5WA 2PCJA 2ZRCA 5HE8A 1P9WA 3ADCA 1JNYA 2LKCA 1Q20A 2P6UA 3SEAA 2PT7A 1G8HA 2QPTA 1SXJE 2R2AA 4RD2A 4DKXA 3RS3A 3K09C 3CF0A 3W34A 1TQ4A 3X1WA 1G3QA 4URVR 3PENA 4TLEA 3N5CA 1XJQA 4LDJA 2QAGC 3QBTA 4M4SA 1Z0FA 2OXCA 2P3SA 3B1XA 5JI3E 3TGPA 2Q6TA 4E03A 1Z6YA 4CW7A 4NDZA 2R44A 2ZITA 1A1VA 4HATA 4KJZA 4YMWA 2MMGA 2WPDD 2DHRA 3EARA 1NVXQ 2XZLA 1X1RA 1TU3A 2EFDB 5AJVB 4TT3A 2FEMA 2IUUA 4DDVA 1XB2A 5EZ6B 4IVRA 3QXJA 5KSOA 2OLJA 1O3YA 3WMEA 1IN7A 2YZ2A 3AV0B 4OK5A 4UXHA 1LB1B 3FMIA 1WMSA 1GL6A 3E1SA 3RWOA 4M9QA 5KDLA 3A6PC 2ZSFA 4YMSA 1SKYE 4F4JA 1I4TD 3TSZA 4KO8A 1TUIA 2Q9CA 2QSZA 3HPQA 3MJHA 1T5LA 1KKLA 5KDDA 4A36A 4DLVA 2P65A 2QQ0A 5JFGA 2QL6A 1PV4A 4DIEA 3KUDA 3W5IA 1J2JA 2ZI5A 3OZXA 1QHSA 2GVDC 4Q1AA 4QGHA 1ZM9A 2XX3A 3SYLA 2IXEA 5BYJA 2AL7A 2JJ2A 4HEJA 4LC0A 2EWWA 3R9WA 1J99A 2O8DB 5FUWA 1CJVC 4HLUC 5J4LA 4DLUA 5HCNA 1OF1A 4DLYA 4MGIR 1T5IA 2YWEA 4FWIB 1GOTA 2CBZA 2GA8A 1ODFA 1Z0IA 3SHWA 3CO5A 1OSNA 4G5RA 4UNNA 3ZIAA 4AD8A 3L0SA 4LYFA 3TH5A 3TQCA 4DBLC 2WWHA 3G82C 1IN8A 4EFMA 3I8XA 1G291 2GCOA 3L0IB 1KNQA 3TKLA 3MGCA 2ERXA 3JVUA 2JLYA 2RGXA 1T3HA 1A2KC 4LX0A 4IVQA 4DEXA 2IS6A 2VSOA 1E4VA 4BASA 4GOKA 1D2NA 1Q3TA 4ZKEA 3F8TA 2W00A 1RRGA 2XJ4A 3EWAA 1KZ7B 1P5ZB 5IK2A 1ZAKA 5P21A 5JHHB 1JB1A 1RE0A 2JJ1A 2BBSA 3TLXA 1DPFA 4OK3A 4WXRA 1CXZA 1QDEA 2WKQA 5CM9C 3SOPA 2N1BA 3F3YA 1YJ5A 1OXSC 3C5HA 4L16A 3CKLA 3AF0A 4TYWA 4RKFA 1KHTA 3H1TA 4MRRA 5JRZA 1KDOA 1E69A 2ZI7A 4JBYA 2DWPA 2PX0A 2CK3D 2FFBA 1RRPA 1KSFX 2GETA 1P7CA 4RSGA 4C30A 5KNCA 3U60B 3VHLB 3PITA 1E79A 4PSKA 4G5OA 3HR7A 2ASEA 1JXOA 1P4SA 1C9KA 4PO1A 4GL2A 1IJEA 1II9A 3UG6A 4EPTA 2CHQA 3NKVA 5AK0A 4MQBA 1U8YA 1XXHA 3FTQA 3OEED 3CRW1 4US1R 1TAGA 2D62A 3QG5A 3VKGA 3U3KA 2B21A 4G0NA 3A1SA 3NVAA 1G5TA 2AD5A 2ZRGA 4AG6A 2X19A 2QEQA 4Q4JA 2FGKA 3I5YA 5E4FA 4LZZA 4TSFD 3ASZA 4D0GA 4IVPA 5J4VA 5H70A 1Y63A 4YQFA 4YLGA 2BBWA 2JLQA 2IXFA 2QNRA 4RD3A 1Z63A 1BMFD 1ZU4A 4R2IA 3AEZA 5IRCD 2NO9A 4ZDWA 3MWKA 2FSIA 1P61B 2QM7A 1NP6A 3F5FA 2OCAA 3A8TA 1XJ0A 4A1FA 4BLQA 1KY3A 4ESHA 1ZD1A 2GJSA 4L9WA 3AB3A 3EZ2A 4A0RA 3FVQA 4EIWA 1W48A 3FPAA 1S9HA 1YR6A 2P5TB 5JEEA 1H8HD 2QTVB 3OIYA 1Z8FA 3P26A 3W8RA 4LSGA 4AIIA 1T9HA 3QSYA 1G8GA 4P0TA 3SJCA 2J0QA 4MA4A 1XZPA 3U7GA 4BZQA 1E2NA 4I1UA 2YOGA 3M0EA 1TQDA 2VTKA 4M9XA 3TUJC 2YKGA 3UMRA 2WSSD 1ZNWA 2C9CA 3B1WA 2FOLA 2F1HA 1L4UA 1W36D 1VECA 3VR3A 5F98A 5DN6D 3FKSA 1II8A 2IF2A 3VKHA 2ZR0A 2C2HA 2Z83A 3E5HA 2HYIC 4OQLA 4M8NE 3AP3A 1U98A 3UMSA 2IUTA 3BE4A 1KO5A 3B8HA 4UQOA 5EXTA 1E9FA 3UMFA 3ZVLA 2P6RA 1H65A 2ZR7A 1G3UA 1ZW6A 4M2LA 3KQLA 3QKRA 4L5BA 1E1RD 3QF4B 3KKNA 3REFA 3B9PA 1NLYA 3NBYC 3DVLA 3UANA 3B78A 4TYPA 1CRQA 4P32A 2ZU6A 1Q22A 3IIKA 2AK2A 4PHTA 4KCGA 4QL3A 3QVVA 2P2LA 3ZD7A 4B2IA 2ZTSA 1AIPA 2C96A 3MWJA 4EJSC 1KDTA 1JAIA 1OYWA 1XNJA 3IHWA 5IT5A 1N6KA 4LHZA 4CIDA 4V0LA 2RHDA 1XRJA 3D31A 2BEJA 2D2FA 3GJ6A 3B9QA 3P1JA 4A92A 3K0AA 2GTPA 4ARZB 1G7RA 1TX4B 1LFDB 1U99A 3JZAA 4OI4A 2EWVA 4DRZA 5KNDA 3H4MA 5E7MA 5C2JB 4L15A 2GCPA 2R6DA 3GJ8A 3RHFA 3K0EA 3DKPA 4JJKA 5H1YA 2EU8A 3Q8XB 2DR3A 3QNUA 2VBCA 1TF5A 4B32A 1CR0A 3CNLA 3I92A 2RH5A 2BHRA 3I61A 4BRWA 3NG1A 4TTRA 2B7CA 1I4LD 2V6IA 4BFVA 2WKPA 2CVHA 4FN5A 2C77A 2VP2A 3QVUA 1Z2AA 5JWRA 4NONA 2DYKA 2ATXA 3OFND 1W49A 4QXAA 4LBZA 4DC9A 4GSYA 2O8EB 3NWJA 3LLUA 3IO3A 5JWOA 2XEXA 1MKYA 1QHNA 1XEXB 2W6JA 4V0ME 2QN6A 4HAXA 4PX9A 1JECA 2FPKA 1ZJ6A 4CDGA 5AJZA 3T1OA 1NN1A 1IY0A 1BS1A 2Y8EA 2ZR9A 4Q21A 5CIQA 4A82A 4YMVA 721PA 1NN5A 2ZAMA 3QIAA 5FBLB 4QKQA 3NBXX 3PXGA 1UEIA 3BB1A 4TN1A 3U6KA 4O2RA 2YVUA 2JJ8A 4BEBA 4RZXA 2GEDA 3QKUA 2BJVA 4S2EA 4RY2A 2CDNA 1TEVA 4A8JA 2FFQA 2A5JA 3AGPA 4NYIQ 3I73A 4PC3A 4RJLA 5AJYA 3UG7A 4WZ6A 2TMKA 3REGA 5D3MA 2ONKA 2VEDA 4DCVA 5CLLA 1Z22A 2CNWA 1ZNYA 1FX0A 3EA0A 2WSMA 2DPXA 3AVUA 1DBSA 2NPIA 4CEHA 2A9KA 1T3SA 3KKQA 5H68A 2ZE6A 1RJ9A 2FNAA 3GLHE 4P3YA 3QBVA 3B1VA 1ZD8A 2A5YB 1RYFA 1AGRA 1XZQA 4LBYA 4EFNA 1ZCBA 3T5GA 1E2PA 3PEVA 3MSXA 1S4QA 2WOOA 1BH2A 4PQFA 1D5CA 1U9IA 5GJWC 2DWQA 1XWIA 1FTSA 3DL0A 4US2R 3PCRB 2NZ8A 5FOXA 4W7SA 2O0KA 3FMOB 1MT0A 1BIFA 4KLNA 2VP0A 5B30A 1SXJA 3C41J 4C0KA 1Z0JA 1G16A 3I32A 2GZHA 3SR0A 3GJ5A 2SHKA 4A8JB 1G3MA 4JIMA 2WMNB 2IS2A 3LBIA 3WHKA 2BIFA 4KFRA 2QGZA 2F43B 1U8AA 4MDEA 1NMZA 4B6EA 3W8NA 4JSYA 3QPWA 2VSFA 3A4LA 1FX0B 3LVQE 3PUZA 2OBLA 2BMDA 4X8OA 2WWXA 4CEJB 4HDQB 2XOKA 4XVQA 2FSFA 1UKYA 4QFMA 1OXTA 1XP8A 4RVCA 4XSHA 4FMDB 1JI0A 4DCNA 2AFIE 1PLLA 2PJZA 2MSCB 2AD1A 2ZRIA 1DAMA 2WPDA 1GIAA 1Z6XA 1W47A 1F48A 4V0NA 4WVFA 5G3YA 4DT1A 3EIQA 4BGDA 3THOA 5B58C 4KFSA 2IW3A 2WV9A 4OJQA 3THYB 5IK2D 5L8VA 1XEWY 3BBPA 3AKEA 1OHHD 3FFBA 4LGMA 4P31A 2H17A 1Q21A 4F7WA 1AK2A 2R6AA 2ZREA 2J46A 3ZZTA 5G41A 3CPHA 1SGWA 5J5CA 3U7EB 4JMPA 3OAAA 3P20A 5DSZA 2QT1A 2DY1A 4QRHA 3K0CA 1JR3E 1DOAA 2KBFA 4W5HA 1G1MA 1F60A 3CF2A 1IXSB 3QEOA 1JPJA 2QRZA 5KDOA 2R8RA 4AYXA 1UKVY 3KQNA 3WRYC 5HTKA 4G5SA 3K0SA 1KJYA 1B23P 1DELA 4Q9HA 3ADDA 1OH6A 4AWXA 1W4BA 1ZM2A 3C14C 2IYYA 1NKSA 2NO0A 2NO7A 3X1YA 3OIWA 3HP1A 1O87A 2J41A 4NMMA 4DT1B 4LYHA 4LHXA 3BD9A 2CCJA 3LV8A 4HSEA 3GLIE 3SJBA 4C2UA 1X3SA 1CF4A 1NL3A 4LJ7A 2HJGA 1Q1EA 4BECA 2CJWB 4QHYA 1HY3A 1KZGB 1OFTA 1SKYB 2KSQA 1RIFA 4KBGA 4DCSA 1JJVA 2G6BA 3FDIA 3W5JA 4JKIA 3UIEA 1COWA 4GMXA 4JYBA 4C7OB 1G20E 2CLSA 1YKSA 5CB8A 2OILA 4ZKDA 1F2UB 2AR7A 1B0UA 4II7A 5HZHA 3SC3A 4Q00A 4B48A 3MAAC 3ADBA 2AWOA 2YWFA 1FMJA 4EPYA 1S0UA 1FP6A 821PA 1HE1C 1T0JB 3EW9A 3FHOA 5HR5A 1NJGA 2BKUA 2HCJB 2W6ID 3BS4A 4Q4AB 1TPZA 2OCYC 4AC9A 1DG3A 5FOVA 1E3MA 1D8TA 3ICEA 5TV2A 2H57A 3VNVA 5LBIA 2X2FA 3LDAA 2IC5A 2J7KA 2IA5A 2ZRFA 1E6CA 3FB4A 3KJEA 2ZVQX 121PA 2VYFA 3RS5A 3BK7A 1GKUB 3WP0A 4HUQB 2HF8A 2H18A 1GWNA 2CK3A 221PA 2D06A 4ZDIA 3AVTA 4URUR 4AKGA 1GNQA 3U7HB 2GZAA 1KAOA 4URZR 1G4UR 3SFZA 2BM1A 1G8YA 5TVKA 2VIIA 1YR8A 3V00A 2IYWA 4OI0A 1NG9A 4QGFA 1V43A 1JEEA 4IXMA 2QTHA 5C1BA 3KQHA 5H8WA 3NH9A 2G1JA 5DIFA 2Q0HA 2FZ4A 2PLFA 4LRWA 2O8FA 2DFTA 3QUSA 1KI6A 5AUQA 5F9FA 5G40A 5CDFE 3GLFE 4KBFA 5GADl 1FL9A 4LBWA 4B47A 1HTWA 1IQPA 4Q9IA 3RAPR 2A7QA 4C2TA 1P62B 5FUYA 3BRWD 1GZSA 3WYFA 1NN3A 1OLOA 2ZRLA 1EWQA 5FL3A 2BVNA 2JLZA 1SHKA 5HZKA 2EFEB 2H8KA 1FOEB 1R10A 4GOJA 2GXAA 3G5UA 3MD0A 2DB3A 3HU1A 4G5QA 3ZZ0A 5GJVC 4XVRA 4OHVA 2ATVA 2VL7A 2ZAOA 4Z51A 2HT1A 1P73A 3A1VA 4L9SA 4XTRA 1QHXA 1GUAA 1ZRHA 1LNZA 1F2TA 3ONWA 1MO5A 4JLKA 3SBDA 4TYYA 4AYTA 3EX7C 4DSNA 2GK6A 2F6RA 4HB3A 2WJJA 3GJ7A 1NMXA 1EG7A 1SVLA 2ZJBA 1P2SA 3LX5A 2WSSA 1OXVA 2BCGY 1CS4C 5KO2A 5FTLA 2WAYA 1MABA 1E9AA 2UVQA 1SKQA 4JL8A 5DN6A 5KPJA 2ZSAA 4BQSA 3AVYA 2J59A 1W4AA 2ZSDA 3PUXA 4YMUA 4TQUS 3IQWA 3W6PA 1N5IA 1HT2E 1LW7A 2J1LA 4BFSA 5KSZA 3AVWA 3RSLA 4KVGA 4X8MA 4F38A 4XTCS 3DZDA 3SYNA 1WDTA 5FL7D 1FUUA 5AR1A 3IPYA 5A0FA 3B7GA 1KSGA 3TRFA 3K09A 1CTQA 3HYTA 4WOPA 1W5SA 1F2TB 3PQCA 4HYYA 1G5PA 3MJRA 4BLTA 2IYSA 2FPMA 2IYLD 2QAGA 2CNWD 3CRRA 4WBSA 4FXPA 1ELOA 1L8QA 4BLPA 1SZPA 4UNPA 3VKWA 1E2MA 1S96A 2GEVA 3BGWA 5J40A 4TTPA 2ZPTX 3TR5A 1S1MA 4D4MA 3KQUA 2IS4A 5FPYA 3CUEF 1W36B 2NMVA 1EWRA 1RVDA 5KSPA 3ZVNA 2FFHA 2YJTD 4QJ3A 4AK9A 1LY1A 2WKRA 4ZI2A 4JLJA 1XMVA 2E87A 4OHXA 1YVDA 1SVMA 1QVAA 5AUPB 1KYIA 1Z83A 4R98A 1FUKA 2YC4C 4TMWA 4URWR 2ONJA 1FMLA 1Z06A 3IKJA 1FNNA 2OZEA 1E1QA 2Q9BA 2W2VA 1T91A 5TDHA 1U94A 2G1KA 3T1QA 1A2BA 2ZI6A 1SXJD 1NSTA 2Q9AA 1OH8A 2GJ9A 2CHGA 1KI8A 4P4SA 3U3RA 2XXAB 4DLXA 3GLGB 2OCBA 4TL9A 2ZUDA 2J0SA 3OFNA 1XU4A 3PVSA 4V0MA 3RC8A 1SULA 4NZYA 2QQEA 2ZYUX 3MWLA 1OXUA 1GL9B 4D80A 3BXZA 5EP3A 3U4QB 2ZYWX 1XMJA 3IHLA 3W6NA 3ZLJA 1KI2A 4ZDJA 4Q9KA 1GFIA 1EFHA 2XOKD 5JECA 3NTUA 4IDHA 4BUJA 2QM8A 4XOIA 4HLUA 3LAWA 4B76A 1KSJA 4H1VA 1D9ZA 2OFOA 4DLWA 2PT5A 3GD7A 4JS0A 1N6RA 4XVUA 2RGAA 3WRXC 2PEZA 3FHCB 3PG5A 1N5KA 2OG2A 3BWDD 3U2QA 1J70A 3MLEA 1ZIPA 3NBZC 4OHWA 4D6PA 1IY2A 4EUNA 2G9NA 2EFHB 1XMSA 1P3JA 3GPLA 1SHZA 4H9GA 4ZV4A 4EQ6A 1ZVQA 1KOFA 4KAXA 2NO6A 3OAAD 4AKHA 1Z3IX 3KJHA 3AVXA 1KAGA 1XX6A 1M7HA 2VHTA 2HXSA 4NCJA 2C04A 3CIOA 4TL8A 1W5TA 1QHHA 3U6BA 2D7DA 3AUYA 1XTIA 5JJIA 4RZUA 2XITA 4IOJA 1EK0A 2CXXA 3FE2A 5FPSA 1E9EA 3TVTA 2GBLC 4A6PA 3SQWA 2VLIA 4D4JA 1XTKA 2H7VA 3CH4B 3I8SA 1NRJB 1Z6AA 2OLKA 3X1DA 4LHYA 2NIPA 5AUNB 1AZTA 4U7DA 2IYXA 4JVNA 4QM7A 3I4LA 4C0SA 4D4LA 2X77A 4PQYA 1S1CA 2UZ3A 3EZ7A 4XIGS 1KY2A 1BYIA 2GZDA 3D3QA 3FYHA 3GJXC 4LYJA 1TF7A 2QZ4A 3ECCA 5JJLA 4KV9A 1I2MA 3GEHA 4FIDA 4NCNA 4XWAA 3RRYA 4P4TA 3T15A 2FF7A 2QY9A 3LRPA 4JVSB 2YOFA 4LPSA 5LB2A 1CLUA 1YQTA 4QGAA 5CK5A 1CR1A 4B2PA 5FTJA 5G53C 3EC1A 1COWD 1QRAA 5F9HA 2C03A 4FMCB 3HU2A 1QHHB 2EFCB 4PR0A 1FW6A 5K8IA 4CGZA 1AS3A 2B7BA 3IUYA 3SU8A 3M1IA 4GNKA 4AG5A 1FTNA 2QI9C 4Z1MA 1Q44A 2IEYA 2GAOA 2ODEA 2OO7A 3EAQA 1OHHA 4PHFA 2ZI3A 2VF7A 5K8LA 3B13B 1M8PA 3ZQ6A 3LW8A 1FQKA 2BCJQ 4KHZA 1U0JA 2WTUA 4NYJQ 4ZCIA 1DEKA 3EWSA 5EXSA 2AHOA 1W0KD 3NBFA 2BMEA 3SYKA 3KDSE 3ZDQA 2ZJZA 3SFVA 4C0LA 2RCNA 4FMDF 4TLAA 1KGDA 1C1YA 2D7CA 4WIAA 5JSZA 3CF6R 4HLCA 3UPUA 5B64A 4TLCA 2F55A 1VPLA 3PJRA 4TL7A 4LHVA 5FFMA 1G4AE 1VDZA 2WICA 2GCOB 3SZRA 2WJGA 1A7JA 2ZYTX 3K9GA 3F0TA 4RZ2A 3PUWA 4YC7A 4DCUA 3C8UA 1Z28A 1PZNA 4KSBA 3GLIA 2RAPA 4IFBA 621PA 1OIWA 1QHGA 3IDQA 1DAHA 5KPDA 1XBTA 2HLDD 3DO6A 4RD1A 2XGJA 1FZQA 1GP2A 1HQYE 3B5JA 1E98A 2OESA 2QENA 3QPVA 1FFHA 2WHXA 4LV5B 5C4MA 5FUVA 5L3QA 1OB2A 2Z4SA 3NH6A 1OKKA 2IUSA 1NBMD 3WYAA 1OPXA 2ZEJA 1JAHA 1XD8A 3ZJYA 4C3ZA 4ZIRA 1CKEA 1NBME 1QBKC 4HLDA 2CHVA 4A2QA 5KHOC 5AUOB 2ZROA 2BEKA 2JLXA 2KBEA 1Z6TA 2H5EA 1KMQA 2WWFA 1AS0A 1IHUA 2ZE5A 4B3DA 2WM9B 2DCUA 4A2WA 2BDTA 5FOUA 3WHLA 1UF9A 1XCMA 1W0JA 2NTYC 2V9PA 3Q9LA 4Z8XA 2W6IA 4M1MA 4EJSA 3GQBA 3LVRE 5C18A 4LJ9A 4BZXA 3IEUA 4HAZA 2DFNA 5J47A 3O8RA 4DVGA 1XXHB 5FOWA 1GTVA 4AURA 1UM8A 3NHBA 2JDID 5FTNA 4B34A 1KIMA 3CRQA 4QBGB 4MRPA 4ITRC 2GEUA 1RYHA 3A1TA 1EESA 2BBTA 3KB2A 4UJ5A 4Q4JB 3A4NA 4FI3C 5L3QB 3AKCA 4CRWB 1VIYA 2CL6X 3WXMA 1XPRA 2BM0A 1RW4A 4Z8YA 4DSUA 2QROA 2HV8A 3H84A 1Z47A 3LFUA 3U61B 1JALA 1P72A 1JQJC 3FOZA 1KI1A 2PZFA 3K70C 3W90A 2RGNC 4QJ5A 2P67A 3AQ4A 3VTKA 2ORVA 521PA 3TW8B 4MYHA 3GLFA 3WMFA 1OFHA 3FFAA 1VHTA 3TQFA 4CF7A 3C16C 4PC7A 4WAUA 2BBOA 4PC6A 4PPFA 1L2TA 2WWIA 3TVDA 4RD0A 3CX7A 3B2EA 3OESA 3QOFA 3RRMA 4QM6A 5HE9A 4C4PA 4GMDA 2ZRPA 2V1XA 4LCBA 4M9ZA 1R8QA 3SNHA 3BIFA 3RRZA 3QXCA 3CONA 2VSXA 1PVOA 1P9RA 2ZRAA 5BW8A 1ZM3A 2ZXUA 4Q1BA 1FPMA 1WA5A 4AKIA 1OH5A 2V8OA 4L8GA 4PC1A 1II8B 1E9BA 2P0EA 2D3WA 3DM9B 4DLSA 2PCLA 1VIAA 2YYZA 5FBVB 3TNFA 1IM2A 2A30A 4B75A 1YZTA 3LNCA 4A15A 4TMZA 4QHSA 5SZJA 3LY5A 1XF9A 5FPTA 4P33A 1E2QA 1GNPA 2I3BA 2IEZA 2YWHA 4PO9A 2ZJ8A 1ZU5A 4PQRA 1E1QD 2QMHA 4WZBE 3QKRB 3EG5A 1N3BA 4DB4A 2EYUA 3GFTA 4TQAA 2P5SA 3JZMA 4C9BA 5E7IA 2ODBA 1G8PA 3AVOA 4YDHB 3T06B 4W5WA 1G8FA 4ZCLA 1QG2A 3FGNA 3WYGA 2O8CA 2REOA 3DZ8A 3T61A 3GCGA 4V0OA 4KFTA 1G6HA 1N0WA 4XWOA 3AVQA 4PZZA 3VR1A 2E1RA 3SQXA 3VNUA 1VMAA 1ZP6A 3M6AA 4F92B 3K0AB 3JVVA 4CT4B 3O8CA 4DLZA 1Y3AA 4JL6A 1HT1E 2C99A 2WOJA 2AXPA 2HXYA 3MRSA 5FL7A 1OIVA 1XTJA 3GEIA 1A82A 1ZINA 3KKOA 3QEJA 2GXQA 4IKEA 4M1WA 1ZD9A 2FN4A 3BH7A 3TSOA 1M6NA 1J90A 4I99A 4N1AA 4US0R 3E2IA 3K9HA 4PO8A 3RRNA 3VR4A 1UFQA 2OXRA 1KO8A 3BC1A 5CK4A 2JEOA 2PMDA 2YOHA 3AVVA 5EE5B 1L7VC 3QQ5A 1KI7A 3OIUA 4LWZA 3VHXA 3GEEA 1G41A 4QJ4A 3IILA 2WWYA 2BWJA 4MKHA 4Q02A 3EPLA 4IHQA 4HI0E 1QVRA 4DDTA 5L3VA 3VR5A 2IYZA 3LA6A 3BERA 4GP7A 4OQNA 4K46A 4UNQA 5AJXA 1GVNB 3CNNA 3KTAA 1WP9A 4EPXA 1QHIA 4ACBA 4EDHA 1DS6A 3QI2A 1JQLB 1U0HC 5JCZA 1JPNA 2GESA 2RGEA 1HV8A 2X2EA 3AH8A 5K8TA 2XAUA 3C7KA 3B82A 2CLDX 4WA7A 2PJRA 1XD2A 2CE7A 1E2EA 1SVIA 2UKDA 1NI3A 1HEIA 2ZYVX 3N70A 4Q01A 2R62A 4V03A 2PEYA 1T8TA 2IYVA 5CYOA 4WZAE 3DPUA 1F5NA 3U5ZB 2F3TA 5D3MB 3QKSA 4B74A 1MOZA 1XDBA 5UKDA 4MYCA 3RS4A 4QOSA 3L2OB 2J5XA 1UKEA 1XEFA 3EC2A 4HAVA 1IXZA 1HYQA 4M0LA 4PSVA 5J4HA 3AF1A 4EPWA 4CEHB 3HDTA 2IWRA 5KSYA 1RJ9B 1Z5ZA 3PEUA 4X8HA 2NG1A 1WXQA 1YU9A 4PAMA 4B3BA 2QSYA 2A5GA 2A5FA 4PC2A 3RC3A 3U3JA 3OIVA 1ZM4A 4NPHA 2EFGA 3KFVA 3SN6A 3TSWA 3WNBA 5JEDA 1BKDR 1TUEA 2HF9A 3K8YA 4HZIA 4TLBA 1RRCA 2C98A 2ZM5A 2PH1A 4Z1MD 2QORA 3ETLA 2W2TA 4Y0AA 2DFKB 5TB5A 4E07A 3FHTA 1G21E 2ZRJA 4BWYA 2GKSA 2J7PA 2C78A 1SXJB 3EA5A 1ETUA 5DLQC 2JLUA 2ZJ2A 3NEJA 3BH6A 4Q7KA 4KLZA 1JR3D 1IAQA 1KJWA 1PLJA 4JJZA 4F4CA 3DMNA 2MMCA 3QENA 1SVSA 3DOFA 1KDRA 4DB2A 2QMUA 4LJ4A 1LF0A 5F2EA 3VR2A 3W9YA 4ZDKA 1YZUA 5FI0B 4B35A 4AY2A 4Q18A 1UKZA 3ZGXA 1M34E 1R5OA 3GFOA 2ANBA 3EZFA 3ZH9B 1E2DA 3L8ZA 4OQMA 3VX3A 2V6JA 2HUPA 3ZD6A 3TIFA 4B73A 1AN0A 1AKYA 4BZPA 2QMEA 5SZHB 3S1AA 2GRJA 2OAQ1 2YNMA 4J0QA 2G0TA 1D2EA 1IN6A 4IXNA 4TLDA 3SDZA 2FZLA 3RNLA 3KJGA 4JYCA 1HH4A 4TTQA 2V1UA 3PEWA 2D74A 4TWZA 5J4YA 1VCIA 3W3ZB 1VG0B 1OKKD 2OEPA 2H16A 5L3RA 2HEIA 1N6HA 2CCGA 2DBYA 3FWYA 3I1FA 3K70D 2OV2A 1E0AA 2QPAA 1RC8A 1HE8B 1OFUX 4HAWA 4LJYA 3HYRA 5FOTA 1R6BX 3OE7D 5HPYB 3GP8A 4O0MA 1BO6A 3Q7PA 1G7TA 3TE6A 1WBDA 2FU5C 1CIPA 1U81A 1JR6A 2QP4A 1W0JD 3CPEA 1R2QA 3DOEA 1XJCA 3X1ZA 3TK1A 4B2LA 1WRBA 3P27A 1LS6A 1EXMA 3QXHA 4A9AA 3C15C 1DVRA 2AKYA 1UBEA 1W0KA 4JL5A 3CWZA 5TXGA 1AJEA 1HUQA 1G7CA 5FPHA 4BFZA 4C0HA 4CZ2A 1G6OA 4G5GA 4BE7B 5CJ2A 1KI9A 1KK1A 5DYGA 3RANA 5GVRA 4A0GA 2WJYA 1T8UA 1E9RA 1CJTC 3VMFA 4DUGD 1CP2A 3I62A 4IW3B 4GZLA 1OH7A 4CEIA 1Q1ZA 3HJNA 5CLQA 2QU8A 2KI5A 4UXIA 4NH0A 4DSTA 5CYPA 1DADA 3K0FA 2V7QD 4PAOA 4PPNA 1QHYA 3C4JA 1Z29A 2HLDA 3BAFA 3VX4A 2I1QA 3A1WA 1E2HA 3KUCA 1KI3A 1EX7A 2JLSA 4DZZA 1NJFA 4KSCA 1VYVA 4GRAA 1K5DA 4MRSA 4JLAA 2VPPA 2YINC 4PSAA 4U02A 1NBMA 5C4GB 1TADA 3QG1A 4JLMA 2PX3A 2KWIA 2LCFA 4UKDA 1ZUHA 3GJ0A 3RS7A 2O5VA 3KKPA 1K6MA 3AP2A 2ZUCA 3B6EA 5DISB 1CEEA 4Q1CA 1GRRA 3ZVMA 2GCNA 1DG1G 4M1OA 4QBHA 1GAJA 2XSZA 4MKGA 4N0EA 5CITA 3ICQB 3BFKA 2RGDA 1CBUA 3AF4A 4NU0A 5LD2C 4DSOA 2R6GA 5DI3A 5CJPA 2IK8A 3IO5A 3NIBA 2IHYA 2NO1A 4FCTA 4GP6A 3NXSA 2JIZA 1NIPA 1I2DA 3CPJB 1F6BA 1XCPA 5EP2A 2JDIA 3UWOA 3V4FA 1P75A 4XSGA 3ZS8A 1Q1QA 1WBBA 2O8FB 1KI6B 2VRWA 1HQCA 2BMJA 2FMXA 1G7SA 2K5UA 3VAAA 1IBRA 3HU3A 2ZANA 5L3SA 4RCZA 2HDNB 4MYUA 1LV7A 2Q3HA 2GVZC 3L0OA 3ADKA 3LLMA 5GVSA 2ZQ5A 1JEDA 1KO4A 4Q19A 1QG4A 1KMHA 2GF0A 1E94E 5IHPA 1NY5A 1W4CA 1W1WA 4O25A 3NDBB 3BFXA 1EGAA 421PA 3R8FA 3THXA 3CB4A 4Q47A 2LWIA 2IYUA 2FWRA 1ESNA 3AKDA 3IPXA 3B60A 5M04A 2QPOA 1Q3HA 3EIEA 1Q0UA 2FGJA 2BJWA 1GSIA 4K81B 4Q7MB 3A58B 2Z5FA 4FD2A 2RGCA 5EP4A 1N6OA 3LO5A 4NE2A 1SQ5A 4XJXA 5DI3B 4JLDA 4OQFA 2CMKA 4E22A 3THWA 3RS0A 1IN5A 5EE0A 5B2ZA 2FX3A 3T5DA 3K53A 4GZMA 5IDVA 2WWWA 3VFDA 3E70C 1OYYA 1WQ1R 3P32A 4BFWA 5DI9A 2EVWX 1NY6A 2PBRA 1G64A 1MABB 4V02A 4B33A 3EXAA 4KODA 2FG5A 4B44A 4BRUA 3Q5EA 1N0UA 5IF9A 1NIJA 4KYIB 1D2MA 3UATA 1NLZA 1KMHB 1S8FA 3AGQA 3RSOA 5BWMA 3LD9A 5GJBA 4JT2A 2D2EA 3WMGA 1E2IA 2GJAA 1E2LA 1E2GA 3IEVA 1BOFA 4Q48A 1CULC 2HJVA 1G3IA 2QA5A 3MMPA 3NEYA 3P4YA 4LJ8A 2W0SA 1F3OA 4BFTA 4HUTA 1NVVR 1ZMXA 2EW1A 3TJZA 2OFXA 4DDUA 4D0NA 1P2TA 1VYTA 2OBNA 3THWB 2AFHE 2FA9A 5DE3A 4POAA 5FR2A 2A5DA 3PUYA 2JLVA 2QAGB 3BB3A 1SVKA 1Q12A 3NC1C 2RKOA 3OF5A 1ZC3A 1R5NA 3H86A 3PV0A 3R9IA 3T34A 4LJAA 4URXR 2GBLA 2WAXA 3H2YA 4KFUA 4LPKA 4LV6A 5D3QA 3RS2A 4MUBA 1YZNA 4LI0A 2BKEA 1R0XA 1P9NA 3H0KA 1KDPA 2X8AA 4LK2A 4MKIA 3PIRA 4ERNA 1R0ZA 3WY9A 3MFYA 3Q3JB 5DYIA 5JI2E 1H8ED 1T3LA 5B57C 4FW9A 4ESVA 3K9NA 4Q4LA 4AKEA 3N2IA 3LH5A 2ZJOA 1E9SA 4OKSA 2NZJA 4XD7A 2XNSA 2REXB 2WJVA 4M1TA 1NG1A 4WW0A 3R8CA 2GHIA 2J7PD 4NHOA 4TQ9A 4AI6A 5EUQB 2Z6VA 2XTNA 3ND9A 4OYHA 3GLHA 2CLCX 2PLRA 3RWMB 3TAHA 3UWKA 4P4SB 2O8DA 2G3YA 2W58A 3BJIC 5SZKB 3I5XA 4M21A 5JBQA 1RZ3A 4Q7JB 3CBQA 3EZ9A 1VCMA 5LB4A 4HDOB 4F4IA 2C8VA 4OI2A 5EE9A 4IFEA 4AYWA 1E4YA 1RPZA 2RHMA 5EP1A 2KE5A 3QPUA 1E9DA 2QUZA 2G77B 3TR0A 3WBJA 1Z6GA 4N3NA 4D82A 1GNRA 3PUVA 2QP9X 1TMKA 4FCVA 1ZNXA 2IL1A 4NTZA 3EPKA 1WF3A 3RVBA 1UPTA 2A3RA 1LVGA 4MRNA 2OE2A 1AGPA 3FMPB 1M2OB 1OW3B 2JATA 5FPKA 4H1UA 4NYIR 3O8DA 2Q21A 3TBKA 1TTTA 3KQKA 4R9UC 4I1OA 4KU4A 3KXIA 1X8JA 3CNOA 3EPHA 1FP7A 5FR1A 4BFXA 5KNBA 4EQ6B 1HA3A 4Q03A 3GLHB 2AN9A 1AZSC 1UBCA 2F9MA 1C4OA 2B8WA 1G3RA 2W0MA 5AWFC 1DO0A 3TUIC 1G17A 2DFLA 2FEOA 4UJ3A 1OB5A 5FH9A 4R71A 1XPOA 4IDNA 5JZVA 5JS7A 1EFUA 3C5CA 2YHSA 3PEYA 5BYKA 3A37A 2PMKA 4Z54A 4NP6A 1KO7A 4IOLA 1W4RA 1UAAA 2GXUA 3ZQJA 3SJZA 2ZU0C 1A4RA 1VHLA 4JLPA 5SZIA 4BLSA 5EQTA 4D0LB 4YMTA 2CVFA 2JA1A 2OHFA 1ZCAA 4PZYA 1X86B 4JKYA 3G0HA 1M74A 1ESMA 5EE3A 1JR3A 4E09A 3SS8A 1TQ6A 1MO6A 2JGNA 2ORIA 3LX8A 3QXSA 4QHTA 4ILEA 1GKYA 1UDWA 3CLVA 1ZUIA 2O0JA 4OHZA 2Q3FA 4Q1FA 3RABA 4LUCA 4ACAA 3LQQA 1Z0KA 4ASUD 2XZOA 1W2GA 2ZI9A 1ZIOA 3MG9A 2AK3A 5EXXA 1DAIA 5JMTA 5KU1A 2F3RA 2O8BA 1XTRA 5BQ5A 2R6FA 3KB1A 4ABYA 8OHMA 4PANA 3ND8A 3GJ3A 4GI7A 2ZI4A 1UBGA 4KITB 1ONBA 3PR1A 4IDPA 2FDCA 3UXMA 1GILA 4Q7LA 1DAKA 1OV4A 1XTSA 3AF3A 4I1VA 1R0WA 4BLRA 4QNRA 5BN5A 5KUTA 3QJYA 5DHFA 2VQSA 1U8ZA 3N2EA 1KTVA 4JLNA 2ZRBA 3Q7QA 2QE7D 1VG8A 4LY6A 4RFVA 1S9DA 2PZEA 2Q3MA 2RGNA 5AJWA 1TNDA 5JSZB 1UBFA 2OFWA 3NDPA 4RCYA 2J9RA 2OSBA 2GAAA 2ZRHA 2QP3A 3OE7A 4OL0A 1S3SA 2XSZD 3LBNA 5FBWB 4OI1A 4JBWA 4F93B 5JHGB 1ZBDA 5A4JA 2ZRNA 3IGFA 2O8BB 1S2MA 2V4ZA 2VF8A 5LDDC 2Z43A 1KNXA 1GKIA 4LOAA 1EFCA 1DO2A 2XJ9A 1PLKA 3T12A 2JIZD 2ZE7A 3EIHA 3GLIB 3WBKA 4B3CA 4JLVA 1EFTA 1WCV1 2EQBA 3CR8A 4RD6A 4FWTA 1IONA 2H92A 4MGYR 3QF4A 5A5GA 1II0A 2MSEB 2JAQA 5HKKA 1TL7C 4MRVA 5FBQB 5BN4A 3QF7A 5LPNA 4P4UA 1GL7A 5C46F 4KYUA 4ZIRB 4TMTA 2PZGA 4NYMR 4XH9B 3K70B 4B3GA 3SHFA 4ZCMA 4DUGA 1VTKA 2BOVA 3CX6A 4DHEA 3EPJA 3D7MA 4TYNA 2N42A 4IRUB 4LC1A 5FTKA 4B3XA 4YXWD 1D6JA 2E9SA 5CDFA 3X1XA 4ARZA 1N5JA 1TF2A 4EAQA 1DAFA 1VG9B 1YZLA 2V7QA 4KXFB 4GDFA 1E2KA 3AUXA 3BOSA 3I3SR 1CJKC 1M1YE 4EJSB 5ANRB 1K8RA 1N0VC 2WIAA 4TMXA 5JWHA 4A6XA 1G5RA 3DMDA 1U0LA 4NCKA 4GBMA 1OJLA 3VU9A 2GF9A 3AKYA 1Z0DA 5KYKA 1G19A 2YC2C 1MO4A 3BFVA 2JASA 1R5BA 1R0YA 2PL3A 3OEHD 1NNEA 2IBMA 1NVVQ 2VP4A 4TZ0A 4O2LA 1IY1A 3X2SA 1DAEA 1W2HA 3IIMA 2O8EA 5TY0A 4EKDA 3GLGE 1HURA 3A36A 1XEXA 1ZNZA 4C0BA 4JVMA 1G18A 3BORA 1AA9A 3U3MA 1Z08A 2IYRA 5DHAA 2GJKA 4PHHA 1UJ2A 1RRFA 2WMOB 1J8MF 4IJMA 4OQXA 2ZVPX 2WBLC 1MRSA 4V0KA 3GLFB 2QRNA 2C5LA 2WJIA 5J4KA 1KKMA 2LKDA 3CWQA 4TMKA 3O47A 3GMTA 4GT1A 2BC9A 4YONB 1Z07A 3ZVRA 2L0XA 3W6OA 1N6PA 2XTMA 3B1ZA 1XD9A 3J81k 1GRQA 4OK6A 2ZJAA 1E96A 2I1VB 1QF9A 2YWGA 2BV3A 1XTQA 1OT3A 3Q72A 3VU9B 2XNDA 4JLBA 1GG2A 2ODWA 1Q1BA 3ZYCA 3O8BA 4D81A 5EXPA 3LW7A 1RFLA 4G01B 2KJQA 1EFRA 4Q1DA 4JVLA 2FV8A 4D25A 2B6HA 1T4GA 2O52A 2QG6A 3QXXA 1DAGA 4A2PA 4W9MC 4JT4A 2REBA 4D2IA 3DEFA 1CRPA 1KK0A 4E5UA 4XD7D 1T6NA 1MH1A 1GRNA 5ELXA 2VP6A 1PUIA 3MUFA 4KVAA 1YZKA 2A78A 3KL4A 2RB4A 3T1TA 1WB9A 2QTFA 3KZ1E 5E95A 4KI0A 3HWSA 1I4DD 1KSHA 4MITA 1VKJA 3GJ4A 2FSGA 4TT3D 2F9LA 2IYQA 3KXLA 4UNRA 1KK3A 2F7SA 5DGXA 1IJFA 2O8CB 2EYQA 4MH0R 1XFAA 2F43A 4TZ6A 1M7GA 2JLRA 2WZQA 2W83A 1NVUQ 2ZS9A 3CRMA 3LXXA 4PTLA 3RDPA 1R8SA 2FFAA 4L4UA 4CEJA 5FBRB 5F3WB 1KK2A 1MO3A 1NLFA 1FQJA 2G0NA 3LBHA 4HB0A 1MV5A 1MRNA 4PHGA 2J87A 1N25A 1W44A 4FMBB 1XCGB 4YDSA 2OM2A 4M22A 1IXRC 4TL6A 4EPVA 3NC0C 2DWOA 3MCAA 2AKAB 1G9XA 2V55B 2VHCA 4HB2A 3W3AA 5JCPA 2XZPA 5CM8B 4PPQA 2N46A 4DJTA 2CL7X 3DDCA 2JJ2D 3SI7A 1VYUA 1E9CA 4B43A 4F91B 3THYA 5CB6A 4QBFA 1AM4D 2OAP1 1KJZA 4O3MA 1QZXA 4R7ZA 2IT1A 1CJMA 3AM1A 4G3XA 1JXMA 2VH5R 1YR9A 1H8EA 4R2HA 1R4AA 2ZS7A 3DKVA 1AKEA 4A8JC 3KTAB 2FJUA 1YHNA 1PUJA 2ECKA 4DIDA 3ZIAD 4PXAA 3MWYW 1DTSA 3VR6A 2GDJA 5JLJA 1KO1A 2RGBA 4UNSA 4LHWA 5EUMA 3I72A 2CCKA 1XD2B 2F1JA 2CE2X 4HAUA 4CT5A 4GFDA 2NOAA 2QBYA 1TEXA 1AQYA 1N6NA 4DWJA 4CYMA 3HR8A 3QKTA 4M9SA 4WXPA 2AWNA 3QKSB 1W7AA 4NKRA 4B3FX 1Q57A 1E0KA 2QT0A 3T35A 1WE2A 2B92A 2B8TA 4Y0VA 2ANCA 4D4KA 2VHUA 3PFIA 1U9IC 4D26A 4K8OA 3SE0A 3KJIA 4IOKA 3UK6A 2OUKA 2CJWA 2IX3A 5FI1B 1YE8A 4IOMA 2JJ1D 2R9VA 4RD4A 3WP1B 3R20A 2IHBA 1SXJC 2AX4A 4M1SA 4Q5IA 1NMYA 3LXRA 4C7OA 2J45A 5JJKA 1SVWA 4LJ5A 4RFSA 3K9LA 2GJ8A 2NGRA 5BXQC 4MYTA 2ZIAA 3DHWC 3ZS9A 2GXSA 4BLOA 1F2UA 5KTYA 2CL0X 3L8YA 4Q9LA 3A4MA 3DM5A 1JBKA 3IBGA 2OT3B 2IYTA 4HZUA 2VHJA 1X8LA 3CR7A 3CRVA 4GPTA 1E79D 4CVNA 2GNOA 4QBIA 3TUZC 2F1RA 4RKEA 4B6FA 1NN0A 1X6VA 3L43A 2QBYB 2ZRMA 4Q4AA 3CW2A 1DE0A 3EZ6A 3IBYA 2H1LA 1SVOA 3ASYA 3GFPA 4HAYA 4HDCA 4MDFA 2XB2A 2ZS8A 5EJEA 1VCOA 1LS1A 4U00A 5KOYA 2VP9A 4IEIA 1UEJA 1XXHE 2NQ2C 1ZYUA 5E7JA 5TARA 2GK7A 3L0PA 2KB0A 1RKBA 1Z2CA 3LWNA 4FINA 3NHAA 4HUQA 1UDXA 2ZSEA 1NF3A 4EPRA 3D6TB 4C0AC 2XTZA 2IWHA 2ZJYA 4M53A 4NYMQ 2O0HA 2QAJA 5TMPA 4IDOA 4BEJA 1FNMA 2QGNA 4G1UC 4GOXA 3CH5A 4RFSB 2W2XA 2A2ZA 1NSFA 3S1AB 3SJAA 1TU4A 4Q1EA 5CIWA 2HYDA 4LJ6A 1E32A 3A1UA 1KI4A 3K0CC 1CJUC 1XPUA 1VCNA 4MGZR 4HB4A 1X1SA 3U3OA 3V9PA 2R6CA 1E2FA 2WIBA 1N5LA 2AXNA 4B71A 2J0VA 2R65A 2P6NA 2VP5A 3AVPA 4FMCF 3FMFA 4HZUB 3RLFA 5HKKD 4NCHA 2VO1A 5EE1A 4FCWA 4ASUA 3KKMA 2FSHA 1L4YA 2GILA 1P6XA 4A0FA 5JS8A 3SBEA 2IXGA 1XEWX 4MUAA 4NCIA 1ANKA 3WNDA 4OHYA 2VHQA 3OHMA 4LYAA 1ZC4A 1CR4A 2ZE8A 4QC2A 4DXAA 4JBXA 4ZO4A 1LTQA 1P60A 4HLQB 3AP1A 4C0QC 4BPBA 2IS1A 1D9XA 3FKSD 3L82B 4OJKA 3ZZUA 3KFXA 5DNYB 1ZM7A 6Q21A 1PJRA 1E2JA 5E3HA 4LV8B 2G83A 4IDQA 4JZKA 1JJ7A 3P4XA 1YR7A 4TMVA 5FOSA 1YRBA 2ZRKA 4QGGA 4NYJR 5GJCA 1MR3F 1TQ2A 2QE7A 5EZ5A 4A4DA 2OBMA 4OBEA 1OIXA 1W46A 4PFSA 2UZIR 3OEEA 4IEEA 4DDWA 3B1YA 2RMKA 4NBSA 5BN3A 1T0HB 4M1YA 4Q4HA 1OE0A 2C9YA 2ZRDA 3UKDA 2J0UA 2I4IA 1AQUA 4BFUA 5LD2B 3TW4A 4TSFA 3BH0A 1K5GA 1ZUNB 1GDDA 1N2CE 2F1IA 1U2RA 2NPFA 1YRAA 2C95A 1N6LA 3QY0A 1BMFA 1DARA 2WWGA 3K1JA 4CEIB 1GITA 2CEAA 1R7RA 4PPGA 3K0FB 4EFLA 2JCSA 3CZPA 4DCTA 1P2UA 2Z4RA 5G3ZA 2JLWA 1OFIA 1YZGA 3CM0A 1J8YF 4DLTA 5DH9A 2Z0MA 2ODNA 3R7WA 1H8HA 4M1KA 2J3EA 4N0DA 2WVJA 1P2VA 3TAUA 1AS2A 2MSDB 3VQTA 1U90A 4A0HA 1IOZA 2XNDD 1S3GA 4RZ3A 2XB4A 2X1VA 4Q4HB 4QG7A 1NKTA 2VA8A 3LQRA 1YZQA 4I1SA 1EFRD 5HCIA 2J0UB 5FUXA 4YXWA 3RYTC 3U44A 4ON9A 2D4HA 2FH5B 2FPLA 4QNMA 3V4RA 2V3CC 4DLRA 2W6JD 1Z0AA 4DEYA 5JRJA 2ERYA 2FE4A 1E0SA
chains in the Genus database with same CATH superfamily
2BPOA 4LSWA 1UADA 1F6DA 3FKQA 3V8NA 2BSQA 2DMRA 2G88A 3EEQA 3HXTA 1Z5GA 1OXXK 2ZSBA 3IQXA 4ZPXA 4CL0A 5JBIA 5THKA 5DXAA 2ST1A 3Q0IA 5C7OO 1E1RA 2VJDA 3HWWA 4UXJA 3N6RA 1ZLXA 4RTPA 4MKRA 3TI7A 3RBVA 2MHCA 3GGCA 3IDZA 2ZUVA 3OEHA 1BTOA 2V54A 1DC5A 1RD4A 1LWOA 1Y8AA 2YJGA 4RM3A 1X38A 2V65A 4R7GA 1E3DA 2ZUBA 4YCDA 2O2JA 3V33A 4BCBA 3KETA 1T3GA 4MQEA 4P7GA 2HCBA 3U4DA 2HT6A 4H7PA 4U5XA 5TJHA 5IBCA 1QWSA 3RC2A 1SK9A 1U9ZA 4RK0A 2HXGA 1DMRA 3U4QA 4QU0A 2QAIA 2BFPA 4EGCB 3FCSB 2QM3A 4UE6A 4Z0HO 3TCNA 3ROZA 1JLMA 5KYGA 1DTEA 3O4FA 3Q5DA 4F3RA 1EIWA 4Z7NB 3K96A 1DX9A 4LA4A 1R0KA 2VJCA 3SCZA 3T1VA 3S40A 5IW8A 3R9XA 4TWIA 4W5JA 1IBKB 3IIJA 4TRNA 1XMIA 4K1LA 1F17A 4RQAA 1N36B 1MVLA 2CJFA 3DVRX 2YS6A 4A23A 1XJWA 4MDHA 2PU7A 4ZT5A 4ZI3A 1CUWA 4D9GA 4IDGA 1YSCA 4BWGA 3BB4A 4JJEA 2AZ4A 4LYYA 1E99A 4URYR 2CUZA 3ILSA 4FYYA 3RW9A 1E64A 2EHDA 1X0VA 5HBRA 3SZUA 3NHZA 5HQ3A 2I7VA 4L0QA 3OC6A 1BJKA 3OLXA 2JBAA 2CJYA 1Q0LA 1K2VN 1BG6A 1X8XA 2PT7A 2FPPA 2OCGA 2QPTA 1SXJE 2PY6A 2VDUE 4EF4A 4ER7A 4DKXA 2Z2ZA 5I3ZA 3K09C 3CF0A 3Q6MA 3W34A 1TQ4A 2X5OA 4G5YA 3X1WA 3U5TA 1G3QA 3DMHA 5DHSA 1FS5A 3H8SA 1NQUA 2QGFA 3PENA 3N5CA 4ZCSA 3V1UA 2XB9A 2IP4A 5B36A 4PX5A 3H99A 1RM3A 1YZVA 3Q1LA 5CCBA 1Z0FA 3DZCA 3GRVA 2OXCA 3B1XA 2QM0A 1YBHA 3NW9A 4IIXA 1WP4A 4K0RA 5E9WA 1PTKA 2ZITA 3EMDA 1FP2A 1YJBA 1A1VA 5FA5A 3GVXA 4U2CA 4ENQA 2V6BA 5CH8A 4FGUA 5BNWA 3EARA 1NVXQ 4JYZA 4U5QA 3GC6A 4CF5A 2IH2A 3I6ZA 1I9CA 3QUQA 1PKXA 3NIDB 3ZHVA 3PXBA 2UUAB 5K9ZA 5H4HA 2EQAA 3MRTA 1X2BA 4UQPA 1HDEA 1P5HA 2D5LA 2J3JA 4MPPA 3RU7A 4B3RB 3GRFA 3KDPA 1P29A 5FXMA 5DM70 1B1CA 1WO8A 2RD2A 1C4WA 2WSBA 4M9QA 5KDLA 2H4XA 4W9NC 5B5SA 1JEOA 4L27A 4YMSA 1ICEA 4F4JA 1SQFA 3HABA 4QEKA 4KO8A 5KDDA 3JSXA 5IH7A 4NFHA 4A36A 1H05A 2P65A 3H9JA 1VP3A 3D8SA 1RPTA 3SDBA 2HUNA 4I2VA 5F33A 5BT9A 1ADCA 1MT3A 2DUMA 2VTBA 4UM8B 3W5IA 1GADO 3OZXA 2CYBA 2GVDC 2P5UA 3FCAA 4Q1AA 3HVRA 1I80A 4RXMA 4FJ2A 2ZJ7A 1BKYA 4E13A 2EDCA 4KL8S 4PGFA 2HAEA 5K4AA 4UAVA 2JJ2A 3HXLA 1DTWB 2EWWA 1GQOA 1PCXA 9ATCA 3HM2A 3R9WA 1A5BB 1CJVC 1MNAA 2Z8ZA 1GPDG 3FI0A 4YAIA 1B6RA 1EXNA 5EWLA 1XU7A 2GZ2A 3WYEA 4DLYA 2KQUA 2ZTUA 5JANA 5L7YA 4JJAA 1PK9A 4L9RA 1ODFA 2EF0A 4QOHA 3CO5A 1RM4A 3FD8A 2P2GA 4G5RA 3K2QA 4UNNA 3WRVA 3ZWNA 1N1EA 4FLFA 5BSWA 3W2IA 3LFHA 3O4VA 2WWHA 4UZFA 3P8ZA 4K28A 5CDHA 3EBLA 3I8XA 4G1MB 3K4PA 3L0IB 3H11A 1JZSA 3TKLA 2OWEA 1Z4NA 3QXGA 3U4GA 4KR0A 2RGXA 3Q15C 2WZCA 4KNYA 1UJMA 1WUIS 1F9EA 2OOKA 3CVUA 1X0XA 2RI1A 3FUUA 3WYDA 1CY0A 1U2TA 1OAKA 1Z68A 3AJRA 4NZOA 1OWPA 3ESDA 1IZ7A 4ZKEA 5ER9A 1RMQA 3H6KA 4LGCA 2C0QA 4MW2A 4OAPA 5BORA 3CLUD 2P78A 4J16C 4L50A 2MYPA 1EINA 1OV6A 2F3PA 1W9MA 1ZAKA 4G67A 4KPUA 5IK2A 1NUQA 1ODIA 2OSVA 5JW6A 5LN1A 1X74A 2HBRA 3ICWA 1XVIA 2PQ2A 2JJ1A 4HLNA 2AH5A 3PDJA 4U3JA 3WMXA 2J8ZA 3STTA 2VPIA 1WSBA 1CXZA 2OCLA 2XT6A 1Z0SA 1M6HA 3DL4A 5FI3A 4PFQA 3EEBA 3EUWA 4O1IA 4ZYZA 4DXHA 1EM6A 1EB9A 3C5HA 3GRPA 3LGAA 1K88A 1U0SY 4G89A 2IRWA 4RKFA 4TYWA 4MRRA 2JGJA 1HYEA 1ECCA 3ZX5A 1N2SA 1G2IA 4E7PA 1KSFX 4RSGA 3H2GA 3OZVA 1L9KA 2X13A 1Z36A 1KVRA 2D1TA 4RX1A 4PSKA 5MF6A 4KO4S 3HR7A 5K2OA 1JXOA 2EJWA 3MHTA 3AHEA 2I71A 3KPJA 1WOMA 1OC4A 2CHQA 2IDKA 3NKVA 4XIJA 1YRLA 3ROKA 1AUOA 4O4HA 3OEED 1AUPA 3LCMA 4US1R 3JYOA 1UBSB 3L46A 3MLAA 1ABBA 1HSOA 3NTOA 1TJNA 4OKNA 3S29A 2EZ4A 3TFWA 3DFFA 3OA2A 4F0JA 2X86A 2ZRGA 3O6VA 1QF7A 1NLUA 5K4GA 4Q4JA 2FGKA 5E4FA 1GZUA 4UAGA 1C0PA 1KP2A 2PA3A 3D6FA 3T38A 1ZR4A 3V46A 4ZHQB 4BN5A 4IVPA 4CCSA 4D0GA 2A1UA 2X0JA 5H70A 1CUBA 1LJ8A 4E30A 4AJEA 3H0EA 2VDRB 4HNRA 4NK4A 1GQSA 2QNRA 1PJSA 1AT1A 1THGA 4RHXA 4UPEA 2WT4A 1C29B 3A4TA 4R2IA 4NJEB 4CTNA 2B36A 3AR6A 1DFHA 4ZDWA 3MWKA 1CNMA 4BS9A 3NNDA 1NP6A 3BJZA 3SM3A 4LRYA 3DLHA 1XJ0A 1B74A 2ILVA 3SLGA 4A1FA 1ZD1A 3VSDA 5LZ4A 2VSYA 2HQRA 3BMQB 3WGVA 2NV2B 1X70A 3AR5A 2P5TB 2QTVB 3IKLA 3OUTA 5IULC 2HI0A 2QW0X 4G56A 4AIIA 4DG9A 2NXJA 3F3SA 1CUSA 1OWMA 4RADA 3KM0A 4OAQA 4P0TA 4DY4A 4PLPA 2PX8A 4I1UA 1T4DA 2XRMA 4V0SA 1VE6A 2W90A 3FAZA 2HRQA 1H2BA 1WD5A 5FEMA 5TGTA 1M2WA 1U02A 1KXZA 3M4JA 2HV9A 3MWFA 3OJWA 5F21A 3IAFA 3UMRA 3J80A 1XYGA 4JJ4A 1KOJA 1WM1A 3VVMA 3GVPA 1T4MA 5DN6D 1DXOA 2NVBA 3C3YA 1II8A 2IF2A 1L4BA 2ZR0A 3UGTA 5A4KA 3E5HA 1KETA 2Z83A 4QOIA 2X4IA 3U3ZA 2HYIC 4JR1A 3AP3A 2Q0XA 3JATB 4QPDA 3UMSA 2W70A 2ZBDA 3ZLBA 3UBTA 2WA1A 2YYYA 3MZ0A 5HG0A 3BIWA 4EUKA 2X7HA 1K7FB 4BVJA 4IZOA 1IOVA 4WDQA 2WHPA 3GGJA 3PGKA 1CLEA 1E9FA 3MPOA 5EXTA 2QT9A 3TLBA 2BN4A 5AK3A 4BLVA 2ZVDA 2HNBA 4YHHB 1O08A 2GO7A 1E1RD 3DBLA 4L5BA 5LDGA 3QF4B 2A9OA 3V8PA 2FSPA 3B9PA 1QTQA 1E1DA 3DVLA 3G5TA 1TJYA 4TYPA 1CRQA 3HO6A 4OLJA 4P32A 3SZOA 2P9GA 1Q22A 3IIKA 5DYNA 3SKYA 4KCGA 4L8YA 2C5HA 1PIWA 2ZTSA 1RBQA 2VR1A 3FHLA 3QVGB 1YFLA 1CE8B 2EKBA 4QPZA 3ZCSA 4CIDA 3RUIA 4V0LA 4FC6A 1PI3A 4BO3A 2WHEA 2PWZA 3NTVA 3AKZA 3G17A 4CM7A 3GJ6A 4W8OA 3NWEA 4ARZB 3K0AA 1U99A 4OI4A 4ZAWA 4NQRA 3JZAA 4MS1A 3G0IA 2GK4A 2OV8A 3COVA 5KNDA 3H4MA 1O58A 3H9UA 5LLDA 2HLHA 1TKRA 2AEMA 2R6DA 1E60A 2NZ2A 3GJ8A 2AMLA 4H0FA 4L15A 3TAXA 3DKPA 2O5CA 1DC7A 3OZAA 1YA6A 4B32A 1P4JA 5AK6A 1TJ5A 1CR0A 2O1XA 3CNLA 2RH5A 4GGPA 4TMYA 3I61A 4F56A 4TTRA 5B4UA 3PVCA 1YL7A 1I4LD 1YH3A 3SSOA 4N8DA 2ZKLA 4HO1X 2EKLA 1T36B 4JEIA 2Y67A 3D0QA 4QGBA 4X61A 4BFVA 2C77A 3JQ9C 4GI5A 1EZ1A 3WKDA 5CEFA 2DYKA 3D5TA 3OFND 1ONSA 1Z12A 3I9NA 3M6XA 4UFNA 5C8YB 3IO3A 3H7IA 3K4QA 5JWOA 3K1AA 2GZSA 1I6WA 1YRYE 1ZGBA 2DCMA 2QN6A 3R0VA 4QDTA 2HQSA 4MV6A 5J1SB 4OFBA 4TTTS 1UEXC 1JECA 1LEHA 2B1GA 4B85A 5MN6A 4XYBA 2FPKA 3L77A 1ZJ6A 4CDGA 1O7JA 3ZJ5A 1OU0A 3VO2A 2WIKA 1IY0A 1GUZA 2INGX 2Y8EA 2P75A 3OX2A 1NN5A 2DPYA 2ZAMA 4HPJB 2ADFA 3TG2A 2NSYA 3T5TA 1SC4A 1UEIA 3BB1A 1VB3A 2QG4A 3EGDB 3IRUA 3OUZA 5CB4A 3ZXXA 3QX8A 2ZIGA 5DX1A 3NB0A 3T5BA 3TR6A 3VYWA 2B2CA 4S2EA 3LC7O 4WBXC 5IM5A 5A2GA 2O3QA 3V8BA 2AC7A 4LXXA 2CZQA 2HF2A 3HNRA 1XAGA 2A5JA 1Z6PA 3I73A 3QRWA 4PC3A 5AJYA 3UG7A 1NUHA 4FB5A 2TMKA 2ZYIA 2QX4A 1XK6A 2HQBA 3HI6A 4DCVA 1W8IA 5CLLA 2YV2A 1MHPA 1NDHA 1ZNYA 4N5MA 3EA0A 1NW9B 4HDMA 2WSMA 2DPXA 3WDKA 3ZUPA 4DBLE 1DBSA 5GIPE 2NPIA 4CEHA 2A9KA 1T3SA 5AXAA 1FRZA 4HGQA 4IQ0A 2C4KA 2Y0BA 4DL9A 4DW8A 3DTVA 1I7NA 2R6JA 3IHTA 4DWVA 3F49S 3CCCA 4LSZA 3QBVA 5IXYA 4HRYA 4C0WA 1T8RA 1L7NA 4V2IA 4IDAA 2PXAA 1XZQA 5K0FA 1DGQA 1HQKA 3W5VA 2WHRA 2QJRA 1LLFA 1Q7EA 2HFKA 1S4QA 1KQOA 1ECBA 1ORRA 2X2OA 2YFKA 3E9NA 3KPWA 2QUAA 4JDPA 4NCKA 2DWQA 1P1JA 4PQFA 4Q3KA 3BF7A 3DL0A 1QFYA 1W19A 3PCRB 4GWKA 4US2R 3HO1A 2W71A 1FFAA 3FR7A 5FOXA 5KHLB 1FCJA 3HDYA 3AU8A 4POOA 3WK6A 1PZFA 2C8LA 5J59A 4JBGA 3WGUA 3L1IA 3GFVA 4OQ4A 1YB2A 3I32A 3SR0A 5JBNA 5EJ8A 2X9QA 2WMNB 3HHEA 4HN4B 2IS2A 2QGZA 3DZFA 5JSKA 3D6MA 1NMZA 5DM2A 4MDEA 1A50B 1TTQB 1M66A 3WL4A 5TLSA 4JSYA 3LX4A 3PFFA 3QPWA 3RFFA 4CIWA 1GARA 5AKXA 2W2QA 4YAJA 4DE5A 2OBLA 3CGWA 4CEJB 2OV3A 1IM5A 1WCYA 2FSFA 4ZV7A 4RVCA 1HG1A 3C4VA 1ID8A 3ZDZB 2PRYA 2XAAA 1JI0A 3IAXA 2VZ8A 3H2SA 1JL3A 3K05A 3D2BA 2CXRA 2AUNA 2PJZA 3M5DA 1SXGA 2P0YA 1BU5A 4ZREA 3N0RA 5AW7A 1XGKA 1Z6XA 2BUCA 2HC9A 1HQDA 4UTVA 4FYPA 2AW3A 1UMBA 1VKHA 1AKMA 4MXDA 4C6HA 1QP4A 4KMRA 1F48A 3Q3CA 4DT1A 4DAEA 5IC5A 3HBLA 5DSXA 1F20A 1QCZA 4UAUA 4ZQCB 4X64B 3N05A 4GC9A 3PKIA 4HTFA 5FULA 5B58C 3O90A 4OJQA 1VMIA 4EY8A 5IK2D 3BBPA 1AKWA 3FFBA 4WASA 1I33A 2H17A 2J31A 3H75A 4WK0B 1Y5NA 3RJTA 1YS7A 1IZ8A 2OV1A 2R6AA 2AYXA 3JRXA 1DKQA 4Z9FA 5KTKA 3TJRA 2J46A 1Z8NA 4N5HX 3U7EB 2V6MA 2YVAA 1NP7A 4OB8A 4MGHA 2NU7A 3P20A 1B1AA 3OX1A 2PFGA 4WN3A 1ZK4A 2QT1A 3BMXA 4GP9A 4MIYA 4B7ZA 5I7SA 3NBQA 4OIFA 4FS3A 1TM5E 4O1MA 4COOA 1U2EA 4W5HA 4IMJB 2DQKA 2VDWB 1F60A 3CF2A 1IXSB 1ACJA 3QEOA 3B5EA 4UUMA 2CNLA 1UM9A 2QRZA 3WLNA 1EJBA 4XDHA 4AYXA 4E12A 1A72A 1QJCA 1BHQ1 3DMYA 3L7IA 2FQXA 4G5SA 3K0SA 4GICA 5IUNC 1B23P 5HNKA 1DELA 4Q9HA 3BHIA 4D8UA 3OPVA 2DP4E 4NRDA 4L4XA 4BBPA 3X1YA 2O3JA 2PD6A 3WLOA 5F23A 1FMFA 1K92A 5E4TA 4X1YB 2XXBA 5JYCA 1JHQA 3F2VA 4LHXA 4AZ0A 5L3RA 2E4UA 1RPNA 3SJBA 1SWWA 3FPEA 1NL3A 1YULA 1E7MA 3C1AA 2HJGA 1KWGA 5E3JA 1SH7A 2QV0A 1L5HB 1QYWA 1ZISA 3B2QA 1D0IA 1HY3A 3AOEA 4IJQA 4YT4A 4Z6KA 1ZJ4A 4JJ6A 4RDHA 4TZKA 3V1YA 1C0LA 3DVQX 3EXG1 2Z95A 3KT6A 3FDIA 2FPSA 2HSZA 4OHKA 3W5JA 3UIEA 3IBSA 1K6XA 3CH7A 2W2LA 2CLSA 1FXUA 2QD5A 3EGVA 1P4AA 2OILA 3DEHA 3SHTA 1F2UB 2FG7C 1GN9A 1U0EA 4GXQA 3QYFA 4JZYA 4L7VA 4QGSA 5HZHA 4Q00A 3CZ5A 1IZ0A 1JTFA 1WUKS 2Q3DA 4MWCA 5HK8A 3GLTA 4G1VA 3UK7A 4D56A 2VNAA 3ZNPA 3LX6A 1FP6A 1EQ2A 4KK3A 4L51A 4H16A 3EW9A 3EPRA 1XTZA 2C5GA 2Y1EA 3R6LA 2W6ID 3VZCA 3PFHA 4KIUA 5IJ0A 3JWEA 4FN4A 2ZP1A 4XUEA 2OCYC 1UCFA 3TRHA 2IIQA 3G85A 4KLRA 5LZ8A 3T3EA 4E15A 1DG3A 1ZXXA 2GFHA 4QUHA 4R16A 5DX8A 1E3MA 4KN8A 5AI4A 4KDEA 5TV2A 4C29A 2TS1A 3DHVA 1UPCA 4HNHA 4KMMA 4NV1A 2NTNA 1UXIA 1R5JA 2X2FA 1CERA 2YNMC 2Q3BA 2IC5A 3DBIA 3DAPA 3IEXA 3LDAA 4F6RA 4ZGBA 3D7RA 2BM8A 3EQZA 2PVPA 3KTDA 2VYFA 3QHAA 1H6AA 5IZ4A 1DZ3A 1OD6A 3BL6A 3AFNA 3NAMA 4OB6A 2D06A 4BGUA 5JQGB 2H9AA 3INNA 3OCVA 4ZAGA 4EHLA 1ZKDA 3D6AA 3F4BA 4YECA 1NNLA 2PR7A 4AKGA 1AHHA 1KAOA 5ESRA 4URZR 4BWFB 2OY0A 1DQZA 1NZDA 4HQKA 3ITEA 3TNDA 4CBVA 4ZYWA 3KHSA 3SZLA 1YC2A 3IR7A 1JE1A 1YR8A 2QKYA 2P5YA 2Y3IA 1Q6ZA 1NG9A 3AR9A 4QGFA 4IXMA 4EB6B 1UZAA 3QE9Y 2UZ0A 4TUYA 5LIRA 2C7RA 4M55A 4OQZA 4ENTA 4LRWA 2PLFA 2VFAA 1DEOA 3OSUA 5B4TA 2ZAIA 2O8FA 3ED1A 1JIIA 1KI6A 1EAYA 4EY3A 2L69A 5CDFE 1NXPA 2NN3C 4YDQA 2ZIVB 4U4AA 4NV3A 3QELA 2DTDA 4JY7A 4EA7A 1Z8DA 1IQPA 1U5CA 3RAPR 3SX0A 2ADOA 4O4LB 2NLOA 2FLVA 3TIIA 1JKJA 1U8EA 4AZVA 2DJ5A 4XJVA 1JV2B 1NI4B 2BVNA 3KLMX 3LQFA 1SHKA 5HZKA 2EFEB 1F14A 2PZAA 3ZN2A 4MVJF 4C6RA 4CF6A 4BCDA 1CZKA 5KNDD 2H2AA 4G5QA 4OA8A 4CMKA 3PDUA 3WAKA 4XVRA 1TVKA 1KZ9A 4OHVA 3G68A 2VL7A 4ND8B 2ZAOA 2HT1A 2CLKB 1G2OA 1P73A 3HMKA 3FSEA 1W85A 4D45A 1GUAA 1PN3A 4BO1A 1ZRHA 3ONDA 4UATA 1TA0A 1NNI1 1UPAA 1QB7A 5JS1A 1MJFA 5TF0A 3C98A 1J0DA 3FYUB 3QEKA 3S2YA 4LGVA 1XKXA 2WSYB 4D4GA 3L9WA 2DPMA 2CV1A 1QO0A 5ICFA 2SCUA 2F6RA 3QLVC 4HB3A 1NMXA 1JB9A 1EG7A 4DIMA 1TUBB 3LX5A 1NBEA 4DR3B 1DIRA 2FDRA 1CS4C 1J07A 4EWLA 2WAYA 1MABA 3WGJA 4O4JB 3FOWA 4WCFC 4B7XA 3EEIA 2MCFA 5B7NA 1L7PA 2XA9A 2ZSDA 3A6FA 2C2GA 5TQJA 1Z4MA 1DKRA 5CFNA 4CR7A 1NUSA 4FI3F 5JLAA 4TQUS 3QK7A 1UAGA 1U7PA 2J1LA 1PJLA 1RWBA 3RSLA 2HA4A 5CXSA 1SCUB 6AT1A 2D1SA 3KR1A 4XB2A 5E6UA 1C1DA 1HNZB 1GKKA 1XDWA 2IEBA 5DEOA 3SYNA 5KNBA 1LXCA 2OK7A 4KQEA 3UV3A 2RDMA 1FUUA 2VATA 1UWCA 2C4MA 1LDEA 4DA8A 2BY4A 1AGYA 3CLSC 3IPYA 3OQOA 1B6GA 5IZCC 3HYTA 2GNPA 4PEVA 3C3MA 4CR6A 1F2TB 4XB6B 3U62A 1RE1A 3PQCA 4HYYA 2YV3A 3MJRA 5FF9A 4DARA 9GPBA 4LF5B 3C48A 4JH0A 3CVOA 3CRRA 4N7RA 1U8FO 3Q5GA 4J6FA 4BLPA 1YUBA 3PGMA 1JDVA 2C59A 3RIMA 3BGWA 5J40A 1XTBA 3KV3O 3VKWA 2J3MA 1WZIA 3OQPA 5GQSA 4OX9Y 1YKGA 1HL3A 3KQUA 5AVOA 4HTAA 3RF7A 3RTDA 3UGJA 2IJGX 3IDSA 1JHZA 3OIFA 1LPAB 3OTOB 4B2YA 4AK9A 2WKRA 5JADA 1KKUA 4M1EA 3HJFA 4C4XA 1LNSA 2JAHA 4OHXA 5COBA 3HHPA 4BJ3A 3AI2A 1GDTA 1PFYA 3C97A 1FUKA 2R751 3JR7A 3OWXA 3P9SA 4OG2A 4RMIA 4TWBA 1ESEA 4JCCA 5TDHA 2Q9BA 2XMDA 1GQRA 2PZMA 2PH3A 4A6DA 1MJGM 1QRDA 1BU8A 5JNWA 3GZ4A 5K0LA 1H2ZA 3AG6A 3KAPA 1MC4A 1PP4A 4G5HA 1KI8A 3F96A 3MAJA 3IXQA 2J0SA 2ZUDA 1I14A 2A0YA 3VTZA 2W6CX 3OF2A 3RC8A 4ZOCA 3H1BA 3H13A 5G1NA 1HSZA 4MQEB 1QANA 2AS0A 3ADPA 3DVAA 4RVFA 2PPVA 1H6DA 1GL9B 1B0ZA 1LQ2A 3AZOA 3ZY4A 3BXZA 5HDBB 2W4QA 3U4QB 3CG4A 3MOIA 2XQKA 5HOQA 4ZDJA 4XUDA 1EFHA 5HRAA 3EFBA 1YV9A 2V7EA 2ZYHA 5DSTA 3RHZA 5BSFA 1EFKA 2D0DA 3Q88A 3R9XB 3LY7A 5EZQA 1U8XX 4M8KA 4HLUA 3LAWA 5JH7A 3FCYA 4H1VA 5DV9A 1FX1A 4YRIA 4DLWA 4RHUA 2ZUFA 3FNBA 3AQIA 1Z7BA 1IE3A 1U1FA 1TTPB 4FT4A 3KEQA 1N6RA 2QG9A 4IDDA 4Y9RA 5E2IA 5AQEA 3IR6A 1IPEA 4MW4A 4YJHA 4ZAZA 1K8ZB 2GZ3A 1PDOA 4NJOA 1N7HA 3MLEA 1L5YA 1ZIPA 5HQ3B 5C8YF 3A1DA 2BAGA 3O7MA 2G9NA 1IK6A 3GPLA 1Z88A 1SHZA 4H9GA 4EQ6A 2AJCA 2GBFA 2QIPA 4LZJA 4CU5A 2NO6A 1I51A 1N9GA 3CINA 3AVXA 4HJRA 4PBRA 5M7EA 4ED9A 5CD9A 1M7HA 2LXNA 3R0IA 5G02A 1J0BA 3C1UA 3PI7A 4UVIA 2HXSA 3ZGYA 3U6BA 1W5TA 1QHHA 2D7DA 3VR2D 1XTIA 4JGBA 3U7IA 1PQ4A 2GN0A 2XITA 3OICA 1EK0A 3FE2A 4JOQA 2JD1A 2D0OB 5FPSA 3O8OA 5IJ9B 2GBLC 4ZVSA 4WJLA 4RHEA 2X41A 4IG9A 3UXEA 3ZWMA 4II3A 5HEKA 2E55A 5KQSA 3SQWA 4S12A 4X44A 3DCNA 1GG8A 2DH6A 2VLIA 3IXLA 3W9SA 1GGKA 1H6CA 2Z6AA 3X1DA 1ZZEA 2BRUA 1AZTA 2OO5C 2YNMD 1FS4A 2RGWA 2ZBUA 3B36A 3IX7A 4IIFA 2FPIB 3LDHA 3RFXA 4C0SA 4YRMA 4F4HA 1I2BA 3E3LA 3K71B 4QM7A 2ZWAA 4X20B 5JJLA 3NVDA 4XI9A 5LQJA 5F3DA 3GEHA 3QE4A 4MW0A 1PX2A 2MYTA 1SC6A 4L95C 4NCNA 3R7BA 3JD4A 2YVLA 3PE6A 1DHTA 2HWWA 4FGZA 4FYIA 2YOFA 5LB2A 1RWXA 1WUYA 4QGAA 3T9AA 3DCJA 3SEZA 5G53C 3OTQA 4RMGA 2X5KO 3QLUA 1GUFA 1Y3CE 1QGYA 4C14A 2W2LD 1IQRA 5KX5B 2VTBB 1J0CA 1O1YA 2NUAA 1NQAO 4NATA 5KQMA 3NP7A 2IYEA 2C58A 2OZPA 2PZJA 5K8IA 1X7ZA 2B7BA 5IP5A 3MCTA 2DPGA 4BRZA 1YCFA 5JSYA 3LWDA 3INGA 2I29A 3SMVA 2GERA 2IEYA 2ODEA 2PNFA 1CQJB 3K92A 3B13B 1BAPA 3DW3X 5DYWA 4AP5A 4Z4GA 3LW8A 5JXHA 1FQKA 5EWLB 3D1VA 4GUAA 2YVQA 5HRCA 4P4LA 1IBMB 5A06A 1IL0A 1U0RA 2QTZA 3U3DA 3ZDQA 4BNZA 1WKBA 3LSTA 4K9KA 2O3SA 4FE7A 2H1CA 2RCNA 3D6HA 1MAAA 2VPYA 4C0LA 4FZ3A 3EK2A 2DQYA 3PLNA 5DT9A 3C1TA 2D13A 5JSZA 1BN6A 1YR3A 4PONA 1LU9A 5IN5A 2OXEA 4TLCA 3KZVA 2F8MA 4IHKA 1M8KA 2TMYA 3DBHA 3D6UA 3I5UA 1DT5A 4N6GA 5IT9A 1CIVA 2P62A 4ONEA 1NASA 3SZRA 3KSBC 4F5WA 3B48A 1DI0A 3K9GA 1BMQA 2C29D 4JJFA 4DCUA 3C8UA 1Z28A 3WLPA 4HH3C 4I4TA 1ZO8A 2HNAA 4R4JA 1V7QA 2B0JA 1QHGA 1G9TA 4U39A 5KPDA 3R7AA 4I8XA 3NOVA 2R7NA 1W5FA 4KPUB 2FW8A 2HIMA 3AINA 3BYZA 4I6EA 2QENA 3QPVA 4GKAA 5T7BA 3ZCPA 2IUSA 4U3JB 3WYAA 2CVQA 3P9IA 3LYHA 2XKJE 4CM9A 4CIBA 4MRMA 5CCXA 4DV3B 4CQJA 2QN1A 4Y6RA 1XCOA 4ZIRA 1I7DA 3UMMA 1CKEA 1I1QB 1NBME 2JGIA 3MMZA 4KQWA 3TLCA 4J1QA 3ZCUA 4LHSA 3KUUA 3II6X 1EMDA 2KBEA 1DIBA 1U7XA 1Z6TA 2JCYA 2IYAA 2G5CA 2H5EA 3JWHA 3R2JA 4O4IB 1AS0A 2QJOA 3TTTA 2ZE5A 1SBQA 3CLSD 2ZIWB 2C97A 4MPTA 3S55A 3EF1A 2DCUA 4UHFA 5CVTA 5I47A 1YL5A 2H65A 4E5DA 4FFOA 3H5OA 2P9TA 4A16A 1O8BA 4Z8XA 3G8YA 4EJSA 3A27A 4M1MA 1M1NA 3GQBA 3LVRE 4MV4A 4YAWA 2W2MA 1SAYA 2HMSA 3IEUA 3KHUA 4HAZA 4D9CA 2G5TA 1TYZA 2J3IA 1QO0D 3FLBA 1F4PA 4DVGA 2WJZB 4O4HB 4AURA 4N76A 4WXYB 1B6SA 3K3PA 3ZCTA 1N92A 4G9BA 2C88A 3CZCA 4ALJA 1U1DA 4KN6A 3A1TA 3C8MA 3WK4A 3KB2A 1REQA 4KIGA 4X1IB 3B8EA 4Q4JB 3A4NA 3FDJA 3CZRA 5JDCA 4MWOA 4JB3A 2A1UB 3FUWA 2BM0A 1LBQA 3GVIA 4H6PA 3CUWA 1RW4A 4DSUA 4CIXA 4KE9A 1OYOA 4MVXA 1P72A 1JQJC 4AJOA 3ZJVA 4J0CA 1WAMA 1IRIA 1PJBA 4JXJA 4QJBA 5AOCA 4HFRA 5H16A 3W90A 4HL6A 2P67A 4L6IA 5JNTA 5CFMA 1H3FA 1XJ5A 2F00A 1XWWA 3FPSA 4G4IA 521PA 3VPFA 4MYHA 1F6WA 4O2BF 3N3BC 2JS7A 1LLUA 4ZT3A 1VHTA 1V95A 1Y6JA 2I55A 1H2HA 1T2FA 5TT1A 1QIMA 2AQHA 4WAUA 1HT0A 1UBTS 1NE2A 2BBOA 1I3MA 2WWIA 4RENA 4K87A 5F73A 2Z5GA 2V6FA 4KIWA 1CEXA 4BAGA 1PJ8A 3VPDA 2L82A 1WNTA 1IN1A 1UWVA 1R8QA 1V1RA 5JQGF 3BIFA 3SHVA 3MINA 2B4TO 2PYZA 2V59A 2XUHA 2VSXA 2B34A 2XUGA 2ZATA 3M4XA 3QXCA 4GVLA 1ZM3A 1PVOA 4IQ8A 3W6ZA 1XCLA 4OA5A 4W5NA 5ALRA 3CNQS 1GPYA 1ENYA 3E7PA 4N3CA 4L08A 2AN5A 3KJXA 1OH5A 3MTQA 2ZWPA 4IDEA 4QT4A 5KYXA 4L8GA 1II8B 3DM9B 4EHJA 2JG3A 2PCLA 2PD3A 3C74A 5H82A 1UJBA 5BR8B 3BDAA 1C7EA 3TNFA 1XDUA 1W4LA 4EGFA 1MB2A 1PFWA 2A30A 1YZTA 2Z08A 3QHQA 4DJFC 4QO7A 1IULA 2WHPB 5FPTA 2H0QA 1E2QA 4P33A 1JUDA 1IIBA 2IEZA 4PQRA 5CCDA 4ZHSA 2QMHA 4WZBE 1JG2A 4LI3X 4LWPA 1N34B 4RW0A 1PO7A 2XUZA 5L45A 4KAFA 4BC0A 4TQAA 3PLAE 2YXLA 2CKMA 1Q7TA 3TTWA 1GUYA 1NQOA 2JGDA 3CRZA 2M6LA 3EAGA 1K1EA 1WMFA 1G8PA 1XZFA 4OXXA 4YJ3F 3S2SA 3IQIX 3QX3A 2O2HA 2H08A 1DX6A 4RF3A 1Q0PA 3AHDA 4B4DA 4PLFA 3TLMA 3LHKA 3QU7A 1BE6A 3NS7A 4E88A 1G6HA 1OX6A 2CDCA 3AVQA 4PZZA 1T5BA 3VR1A 3IE1A 2JGAA 4NMXB 2XMPA 5I7HA 2FR0A 4RCVA 3DAOA 3M6AA 3K0AB 1NVDA 4DLZA 3O8CA 2OL4A 4MI6A 4MS1B 2C99A 3ETNA 1PAUA 4J4TA 5ALKA 2QMZA 2ODAA 3E22A 3PUJA 4MV7A 1PBTA 2AXPA 3MRSA 4QTUB 4UHJA 1BX0A 1OIVA 1XTJA 1A82A 1ZINA 3KKOA 3VC3A 3WKBA 3JASA 1O57A 3QUBA 3BH7A 1M6NA 1J90A 2CZCA 2Q28A 4E5VA 3E2IA 4M0KA 1FFGA 3K9HA 4EW2A 4D74A 2WTMA 1EI9A 3VR4A 3Q3VA 2OXRA 4D57A 4EG5A 4BAZA 3PHJA 4O4JF 1UFOA 1F5SA 2A0KA 5ADVA 1KH1A 2IELA 3U7RA 1GV0A 3GRKA 2NYRA 4WNCA 1KI7A 3OPQA 1JYSA 5AMXA 1P2BA 1WTCA 2FLKA 2R8XA 4RBNA 2XWSA 2BWJA 4MKHA 1I2ZA 3L6UA 4IZHA 4Q02A 1TT7A 2HK7A 4XGNA 2PVCA 4X9XA 1QYDA 4AKSA 4IHQA 5JAZA 1OOEA 3L01A 1X13A 1Z5OA 4GLFA 1PSWA 2Q5HA 5K3CA 3VZRA 3WNVA 1YQWA 4GP7A 4UNQA 1YOVA 4L0DA 3KTAA 2Q5JA 1C8BA 4UBJA 4D8VA 4KJXA 2CLFB 3QI2A 4R9RA 1CYDA 2AB0A 5ALIA 3QMWA 4LYGA 3CEJA 4NMLA 3AH8A 4S1VA 5AIAA 3BZUA 2V97A 2XAUA 3B82A 1UK8A 4CQMA 2CLDX 1AQIA 3MJCA 4WA7A 5KNCH 2ORYA 1MGPA 4JQZA 1I30A 4BV2A 1SVIA 4G9EA 2BTEA 3S70A 4F84A 5I6DA 3VOSA 2BM9A 2GLXA 2I3GA 3O31A 4MKZA 3ZI0A 1T8TA 1TA4A 3PKJA 1F5NA 5J2UA 1EIZA 2QF7A 4NE9A 2WFZA 1JEYB 4BZWA 2JHFA 2YZKA 5E8RA 2C83A 4K9MA 3I1YA 3QLEA 2C7PA 4QOSA 3L2OB 2J5XA 1QSGA 4MR8A 4CCWA 4HAVA 3WRYA 1IXZA 1L1FA 1AHNA 1ZKMA 5B3LA 3DYBA 1R18A 2YDXA 1Q0HA 4CEHB 4ZEWA 1R0SA 2DFDA 1X80B 1YQXA 2WABA 3BREA 4V1CB 5KJFA 3WTCA 3PEUA 1PS9A 1X7WB 2JIBA 3LDGA 4X8HA 5FFNA 3TOXA 2GPJA 4PAMA 2QSYA 1CJBA 2A0FA 3AIOA 2A5FA 4PC2A 3JD3A 3OIVA 1ZM4A 5HIMA 1ZMBA 1ZOLA 4BP3A 1BKDR 5AM3A 3OZWA 3VAZA 2HF9A 4K3UA 1U0NA 3HG7A 3R3WA 1NQXA 5FEUA 4B45A 1RRCA 3AB8A 4RDCA 5B58T 2IIVA 1ATIA 2QORA 1SKUA 1U7ZA 1WD7A 3EDCA 5TB5A 2YCLA 4HEQA 2H9IA 2ZRJA 3MHPA 4FKMA 4XVHA 1Y7TA 2PQMA 2WEKA 3DDNA 4HEA1 4EL5A 2C78A 3EA5A 4GQIA 1DSSG 3HGQA 5HKBA 3IL2A 2V5AA 3OLWA 2NUTA 1R88A 1KJWA 5ICGA 1CEQA 2F1KA 4JJZA 4GKVA 4YLEA 4V0QA 4ND2A 4MVJE 4ER6A 1SVSA 3HB7A 1KDRA 5D5HA 2HREA 1RYZA 2QMUA 3CTPA 4JQOA 1BDBA 4G0MA 5F2EA 5A7GA 4BB0A 2H5LA 3VZBA 1T9AA 4B35A 1MXFA 4AY2A 3GMIA 4MUGA 4MUNA 1RU3A 2DHEA 2FUEA 4FEEA 7MDHA 3JYQA 4FW8A 1JMKC 2PRJA 4ZC8A 10MHA 3HN6A 5WRFA 2ANBA 4AB1A 4P98A 1E2DA 3L8ZA 4OQMA 3UAXA 4LY9A 3ZLVA 1IOWA 3JALB 4F7DA 4WOBA 2UXBB 1U0FA 2QJWA 3TIFA 4AROA 2JPDA 4RDIA 1AKYA 1EXDA 2QYSA 2WF6A 1PDWA 1UMBB 3S1AA 3W79A