1HEIA

Structure of the hepatitis c virus rna helicase domain
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
443
structure length
443
Chain Sequence
b'NSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV HELICASE
molecule tags Helicase
source organism Hepatitis c virus (isolate 1)
publication title Structure of the hepatitis C virus RNA helicase domain.
pubmed doi rcsb
total genus 138
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1heiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA01
2MMGA 5JS8A 2FEOA 4ZCLA 1T8UA 3THYA 2IL1A 2NIPA 1EX6A 2ORIA 2OE2A 4KAXA 1KJZA 1HA3A 2ERYA 3DHWC 3B1WA 1LB1B 3FMIA 1W0JD 3FHOA 4LUCA 4WW0A 2JLWA 1G5PA 1WDTA 3K0AA 2CVHA 1G17A 3NHBA 3PEWA 2GAAA 3V9PA 5L3RA 5K8LA 3BAFA 3GD7A 4Q4HA 1K8RA 3MUFA 5D3MA 1OXTA 4PHTA 3GEIA 1KJYA 1XD2B 4JBXA 1H65A 3SJBA 2GILA 2IXFA 2QSYA 1GNPA 5FI0B 4IKEA 5HKKA 1UBFA 1DG1G 3Q7PA 4BLQA 3T61A 3BWDD 4KODA 4EJSC 3EZ9A 2DY1A 4WOPA 3PUWA 4NCJA 4ZCIA 1OKKA 3AB3A 1UDXA 1N5LA 1FTSA 2GKSA 4O0MA 1R5NA 2BWJA 4NONA 3NTUA 4KSCA 1VYTA 3UWKA 4NZYA 5CIWA 3VNUA 5C2JB 4RD2A 2IHYA 2EFEB 1UKYA 1G41A 3A1WA 2G88A 3TUZC 3KKOA 4LBYA 3UXMA 3NC1C 3QE0A 3U3RA 2A9KA 4MRPA 4MDEA 1CJVC 2AXNA 2V1XA 5FOVA 1B0UA 1GP2A 3OIYA 3LW7A 4A2PA 1HY3A 4BFWA 3VFDA 1H8ED 3EC1A 3QKRA 1WQ1R 4JBWA 3LX8A 4AK9A 1W0KD 2GESA 4MYTA 4Q7KA 2JDID 5E7MA 5FTJA 1DARA 3KTAB 4MKIA 4BRWA 1Q44A 4AKEA 1EESA 3K9GA 4HLUA 4I1OA 5KDOA 3WMGA 4ASUA 2J7PD 3MWYW 4HAWA 4BGDA 3U7FB 2IT1A 4PO1A 4DSTA 2BCJQ 4QGHA 3K09C 5DIFA 2OV2A 3W34A 5JFGA 4B3GA 3VX4A 1UKZA 5IHPA 3U4QA 2F9MA 2JAQA 3GLGE 2FSHA 3MD0A 3TR0A 4V0NA 1KNXA 2Q3FA 2QG6A 2D2FA 3B1YA 4M1MA 4O2LA 4QXAA 4TZ6A 2ZSDA 3B85A 4RKEA 4CT5A 4P4SB 2XNDA 4ABYA 2IC5A 3GLHB 1D6JA 2GEDA 5DYGA 5SZHB 1XMVA 2RGNA 4EJSA 2ZI9A 4YXWA 3AVOA 5FBWB 4NU0A 3ZIAD 4CVNA 4HUQA 2VHJA 2D62A 4LHVA 1I2DA 4MGZR 4KSBA 2XITA 4IVPA 3TVTA 1ZNXA 4C0HA 1Q21A 1QHXA 3R8CA 1Z0IA 3LWNA 3W5JA 1YVDA 1Z0DA 3R20A 3RRMA 2AD1A 1CR1A 3UWOA 1CRPA 5BWMA 4KVAA 2IYWA 2K5UA 3PJRA 4QJ4A 2A30A 4I99A 4OI2A 3B1VA 3KQUA 4KHZA 5JEEA 2QNRA 4MYHA 1AM4D 1QG2A 2G0NA 3NDPA 3ZLJA 3R9XA 1EFRA 3AKDA 1A2BA 4TL9A 2PX0A 2IYXA 4MUBA 5G3ZA 3OE7A 4Q48A 1KGDA 4DUGD 1S8FA 4AD8A 4DEYA 2KBEA 4XSGA 2GJAA 5DNYB 5SZJA 2JASA 1X8LA 5F9HA 4IFBA 5KHOC 2VRWA 1YZTA 3QBVA 4Q00A 1FNNA 2F1HA 1ANKA 3EA0A 3PFIA 4PSVA 3DVLA 1C4OA 3RLFA 1VCIA 4GFDA 5KUTA 2O8EB 1E2LA 1HE1C 4OL0A 2P5SA 4LHWA 3FHTA 1DVRA 1JJ7A 4GP6A 5FOXA 2DB3A 3IEUA 3ZH9B 4Q4JA 5FBQB 5LB4A 4C30A 3VNVA 4Z8XA 1KO1A 1SVWA 2P5TB 3NBFA 4WZ6A 5AJXA 3BE4A 1S4QA 1J8YF 4E07A 2PMKA 4OHXA 4OJQA 2NQ2C 2V7QA 4IXNA 4PSKA 1GL6A 2XXAB 1I4TD 2IXEA 1GUAA 1HH4A 2EU8A 3U3MA 4MDFA 5TVKA 2FMXA 3SS8A 4AKGA 1TADA 5FPTA 1DAHA 3OFNA 4KBFA 5J4KA 5HTKA 2HCJB 4Q21A 4YMVA 2CCJA 2FX3A 1R10A 1Z2CA 4G0NA 1HURA 1QDEA 1W1WA 2W2VA 3FKSA 1XBTA 3BORA 4U00A 5FTNA 4OHWA 4A2WA 2KJQA 1IBRA 4EUNA 3QXCA 1NJGA 2XB4A 3KUCA 3PR1A 5FBLB 2BBSA 4YMUA 4CEHB 1IOZA 2QI9C 5JSZA 1UPTA 1XJ0A 3TJZA 4P4TA 4R9UC 5EP3A 4Q01A 2NGRA 2QP3A 4JVMA 2WZQA 1NVVQ 3QF4B 3H86A 4IFEA 5A0FA 3UATA 4Y0VA 4TLBA 2FNAA 4P33A 1II8A 2VPPA 2D74A 3EARA 1P62B 5JEDA 1X1RA 3VR4A 2W0MA 1FTNA 5KTYA 2IYRA 2PZEA 3FKQA 5L3SA 4TMKA 2YOFA 4WZBE 1IN8A 3EG5A 2XXAA 4CEJA 3A1VA 3O8RA 5F98A 2IBMA 4KCGA 4DLTA 4DLSA 2BMDA 1E1QD 1G8PA 2FSGA 3GP8A 4M1KA 3MJRA 3AVWA 1DG3A 4GZLA 2GBLA 2H7VA 2IW3A 3ADKA 1S9DA 1Z0JA 3AF3A 3DMDA 1JQLB 4AG5A 2QU8A 1YHNA 3A1TA 4KBGA 4O2RA 2NMVA 4N3NA 3WMFA 1NMYA 1OXUA 1OT3A 1ZCBA 2BIFA 2EWVA 5CYPA 3B2EA 3L82B 3RANA 1SQ5A 1LNZA 5FL7A 3BB1A 1U90A 4PPNA 2HLDA 1OYYA 2PZFA 2V6JA 3BD9A 2JJ1D 3I5XA 3MLEA 3PG5A 2ZRDA 2QN6A 1EK0A 2JATA 1G8YA 2QSZA 5GVRA 5CITA 5JI3E 1BKDR 2F55A 1P6XA 1AN0A 4PPQA 2ZYWX 1II8B 2Z6VA 4K81B 1CJMA 4DT1B 4E03A 1D2NA 5KYKA 2JLUA 3SHWA 5TY0A 2JLXA 2EWWA 2ZVQX 2J7PA 4G5GA 5IT5A 2J0QA 3OEHA 1E4YA 1EWQA 1G64A 1F2TB 2PLRA 3T34A 3SYLA 1SKQA 1P4SA 2QAGA 2C5LA 4NCHA 1XWIA 3RDPA 3R7WA 4A8JA 3OHMA 3OIVA 5CB6A 2DYKA 4MKGA 4F4CA 4HSEA 4I81A 4DLYA 4BLSA 4LV8B 3HDTA 2GF9A 5FUYA 3ZS9A 5JECA 1JAHA 4IDNA 3IPXA 3QXJA 1Z28A 3GEEA 3FTQA 4JYCA 2J0UB 2A2ZA 4PC7A 2DPXA 3AVTA 3WNDA 4LPSA 4I1VA 2YHSA 3L8YA 2DHRA 2IYVA 2Z43A 1Z3IX 2EVWX 4ZDIA 5K8TA 2RGAA 5FUWA 4URYR 2RHMA 1Z6TA 2ZSEA 3BXZA 5JRJA 3U44A 1CEEA 1KI8A 1D9XA 1KHTA 1NY5A 3F3YA 2FH5B 4WXPA 1X3SA 4MITA 2XB2A 4LZZA 3SR0A 1UF9A 3QKSA 3OF5A 5BN4A 3AKEA 4Q03A 3I1FA 1K5GA 4OK3A 2XEXA 2FFAA 4XOIA 1NMXA 2E87A 1XFAA 3QKUA 4HLDA 1W2HA 1NRJB 3ZVMA 1OLOA 3IHWA 5AJWA 1UJ2A 2VP5A 4MUAA 5F2EA 4DEXA 821PA 1A1VA 2CVFA 4A36A 1NLZA 5KNBA 1GSIA 1S3SA 4QBIA 1BH2A 2H17A 1G1MA 3TW4A 3Q8XB 1ZM2A 3UG6A 1KNQA 4RZXA 1DTSA 3L43A 2ZRLA 1AQUA 3UMSA 4V02A 3OFND 4YDSA 2RGNC 4BLPA 3CF6R 2FN4A 1AGPA 2YV5A 1BYUA 2GJSA 1XEXA 4Q7MB 4V0ME 3SJCA 4AIIA 3AH8A 1GWNA 4LHZA 2BBWA 4PQYA 5CB8A 3CLVA 1KZGB 1HTWA 1N6PA 1KDRA 3WHLA 3CF2A 3W6OA 3X1WA 4F93B 3LD9A 1T0JB 4WAUA 4C9BA 1ZC3A 1P2VA 1EFTA 5DN6D 4W9MC 3WNCA 2ZRGA 3ECCA 3GJXC 4PHFA 3THOA 4BFZA 2XGJA 4GDFA 2CL0X 3THWA 2YWGA 4KI0A 3ZZUA 1YZLA 1GILA 1XZPA 1TAGA 4ESVA 1Q1EA 4GRAA 4B2LA 3VR1A 2VHCA 1UM8A 5AWFC 1II0A 5J4LA 2BHRA 3B1ZA 5LD2C 2WSSD 2ZXUA 2RHDA 2B21A 2ECKA 3M1IA 1N5JA 2VP0A 5BN3A 4B2IA 2ZITA 4R7ZA 4QBGB 4URWR 2G1JA 2WOJA 4QHSA 4QL3A 2C2HA 3RS2A 3P4XA 3U6BA 4JT2A 2WAYA 3P20A 2C04A 2IHBA 1UBEA 1Z2AA 5D3MB 2WSSA 3U6KA 5DHFA 3LFUA 2OXRA 2V7QD 1YJ5A 2QMHA 5HCNA 2A5DA 4J0QA 2KWIA 2EFGA 4TQAA 4FCVA 3TQCA 3TSZA 1UDWA 1NVVR 1NL3A 1DAGA 1QVRA 4ILEA 4EQ6B 3KXIA 2J0UA 3L0OA 1TQ2A 2CLCX 4KV9A 1JEDA 5EXXA 1SKYB 4RVCA 3Q3JB 1T6NA 4H1VA 3VU9A 4DLXA 1DAMA 2ATXA 2BBOA 4MKFA 4URVR 3C8UA 3ICQB 4L8GA 4ACBA 3MJHA 3K9LA 2GDJA 5JSZB 2DFLA 3OE7D 2DFTA 4BFTA 2GJ9A 4HUTA 4TL8A 3GJ8A 5ELXA 1XEFA 1YZNA 4RD4A 5H68A 2LKCA 1O3YA 4LHXA 3X1XA 4G1UC 1IN5A 3G5UA 3JVUA 3WP0A 1E2EA 4DDTA 2G1KA 1WMSA 4Q7JB 2PEZA 2I4IA 2XJ9A 1JEEA 1Z6AA 3BH6A 4MGIR 4QKQA 2XZPA 2QPAA 3F0TA 2OFOA 2O8DA 4RD3A 3PCRB 4JIMA 1N3BA 3VR5A 3U5ZB 1F2UB 3KQNA 1S9HA 2AL7A 4C4PA 4DHEA 1XTRA 5L3VA 2RGXA 4RY2A 4NL4H 3KQHA 1R7RA 5J40A 1VCNA 4D0NA 4PZYA 1AIPA 4Q4HB 3A4NA 1G18A 4OHZA 4LJ9A 1Z0KA 1RRCA 4M1YA 3OAAA 3REGA 1I2MA 4U5XA 3L2OB 3SBDA 1ZCAA 3SOPA 2UZIR 3GMTA 5J4HA 1NN3A 2RGCA 1IHUA 4NKRA 1T91A 1KZ7B 3U7EB 4IHQA 4PO9A 1SVOA 3WP1B 3AVVA 4R71A 3IQXA 4Q9HA 1G291 2C95A 1N25A 2W00A 5FI1B 1KSJA 5G3YA 4QBHA 1E6CA 1P9WA 2VTKA 3HU2A 2XOKA 2IWRA 1F5NA 2FV8A 3LBIA 2QQEA 2X8AA 4D26A 5AJZA 2P3SA 1G3RA 1OW3B 2O0KA 3K1JA 5GJVC 1JR6A 3I61A 4DT1A 3GJ4A 4JLDA 3ADDA 4X8OA 3K0FA 2TMKA 1JPJA 3LRPA 4PHHA 2GXSA 4ZPXA 1HQCA 3BOSA 2JIZD 1ZD8A 3UMRA 1S3GA 3E2IA 2HF8A 4R2HA 1XEWX 4C0KA 1OH7A 3ND9A 1XCPA 1VG1A 2WTUA 3Q5DA 2OCPA 1HQYE 2V3CC 1E0JA 1OYWA 2CCKA 2QBYB 1KO7A 3EA5A 2KBFA 1OKKD 4M0LA 4YQFA 1FL9A 1NSFA 3DDCA 3IUYA 421PA 1ESMA 1W36D 2PJRA 2HT1A 2QRNA 2REXB 4I1SA 4P31A 4IDPA 3IILA 3KB1A 1KOFA 4URXR 4BPBA 3HYRA 4FW9A 1YRAA 3RS5A 4A92A 2JJ8A 1QF9A 3BERA 4RD1A 2EFCB 1WBBA 2QE7D 1E2JA 2C99A 2NO6A 3SFZA 2JJ2A 1AKEA 4ERNA 3C4JA 4JL8A 5FUVA 4UXJA 1XPUA 4GT1A 1W36C 2YC4C 2J45A 4OK5A 5DH9A 1TTTA 4EAQA 4Q4AB 4EKDA 2Q6TA 1Z83A 4FMCF 4LGMA 2FZLA 3QEOA 1OHHA 3L0SA 4F7WA 3QSYA 4KFTA 3QF4A 3O8CA 4DLWA 1UKVY 1G3UA 1OSNA 2FFHA 4AY2A 3LXXA 3LO5A 1W0KA 2MSDB 4M2LA 4NP6A 2BDTA 2ZR0A 3FVQA 4Q7LA 1JR3E 1Z47A 3TGPA 4QGAA 4TTRA 1XXHA 2AN9A 4P0TA 3TAHA 2HJGA 3I8XA 2IXGA 4EPTA 1KY3A 1RRPA 4LYAA 3MAAC 1NP6A 3HPRA 1PLJA 1KSFX 1E1RA 1GKIA 1W49A 2CE7A 2VF7A 2ZS9A 4LC1A 2IS6A 3EPLA 3SYNA 2ZEJA 1R5BA 3RRNA 4UNRA 1Z29A 4ZV4A 1W5TA 1PZNA 4D2IA 2REBA 1S2MA 3FB4A 2BEJA 721PA 3I5YA 1WA5A 4JKYA 1H8HA 1NJFA 4ESHA 3PUXA 1MO3A 4PFSA 1E2HA 4NBSA 1XMIA 1Z07A 2IUUA 5AUPB 4JLMA 2ZJ2A 2P6RA 1QBKC 3GFTA 2OO7A 2O8FB 1E2IA 1TX4B 1E9EA 1E9BA 3QOFA 4JVSB 1UEIA 3EASA 1XTKA 3W5IA 4NHOA 4M9ZA 3I72A 1XMJA 3GJ0A 3T5GA 1ETUA 4L9SA 3HPQA 1R8QA 1KMQA 1P2UA 1XNJA 4DIEA 2NO9A 4HZUB 2JLSA 4TYPA 3CX8A 5FL7D 1WXQA 3AF2A 5IK2D 1P75A 4C0LA 3ZVRA 1SXJD 3NBXX 1Q20A 2BJWA 1E79D 3LXRA 1SVKA 4B47A 4AURA 3R8FA 4NE2A 4CGZA 4PAMA 1N0VC 3MSXA 1IN4A 3UG7A 3RS0A 2Z5FA 2QTVB 4UXHA 5KPDA 2CHQA 2QT1A 2IF2A 1Z06A 3IGFA 4GOJA 4IEEA 3RAPR 2WVJA 3ZIAA 5M04A 3A36A 2ZPTX 3ZZTA 1UADA 2XZOA 1EFHA 3CUEF 5DHAA 3AVUA 4GP7A 1YZUA 4QG7A 5JCZA 3ASZA 1ZUNB 2B7BA 2D2EA 2WHXA 3B8HA 4BRUA 2Q3HA 1P73A 5GJBA 1IXSB 2JJ2D 4LHYA 4MYCA 3SEAA 5G41A 4IEIA 2OLJA 4FMCB 1Q1ZA 4HUQB 4Q1DA 4TQUS 2KE5A 2RB4A 5HE9A 1W4RA 2YOGA 5H1YA 4A8JC 3RVBA 4QGFA 1GL7A 3IPYA 3RRZA 3CBQA 3A8TA 1KI6A 1MR3F 4W5WA 2D06A 1W4CA 3SFVA 3GLFB 4PTLA 2OAP1 4TN1A 2HUPA 5EXSA 5DSZA 4QNRA 2C9YA 1UKEA 3H0KA 4FINA 1G6HA 4M22A 3AGQA 1N2CE 2AKYA 3QQ5A 4C7OA 1W47A 2WKQA 2XNSA 4LDJA 2BBTA 1VG0B 2BKUA 5G53C 1W4BA 2MSCB 1R8SA 1SZPA 2N46A 5H70A 5BYJA 4XVUA 2AFIE 3NKVA 3WYGA 2QGNA 4BFXA 5DN6A 3ICEA 4P4UA 3THYB 2OZEA 4POAA 3R9WA 5JHGB 2GEVA 3CX6A 4N0DA 3BC1A 1RJ9B 5TXGA 5KPJA 3S1AA 4XD7D 2R6GA 4AWXA 1HT1E 1P5ZB 3BFXA 1GRQA 2MMCA 1J70A 5FPSA 3TSWA 1GRNA 4RFVA 1G4UR 4BUJA 3QXHA 3VHXA 4PPFA 1KTVA 3ZD6A 5JJKA 3P27A 1IY0A 3TE6A 1CF4A 5FUXA 2FFBA 2DWOA 1IQPA 1E9AA 1BIFA 3RSLA 4E09A 1EFCA 3UIEA 1MABB 1SKYE 2OCBA 2ZYVX 3CPHA 1Y63A 3CRRA 3HYTA 3NBZC 1KI7A 4JLBA 4BQSA 2FF7A 4IVRA 1DS6A 2FE4A 1TQDA 1XCGB 5C46F 4DZZA 2ZSBA 1AA9A 3CR7A 4M9QA 3RSOA 3WRXC 4L15A 2W6ID 3U7GA 2J0SA 2VQSA 1ZRHA 4FIDA 4AKHA 4IOLA 3Q5EA 2AXPA 2R62A 1M34E 2HF9A 4QHTA 1KMHB 1GL9B 1ELOA 2PCLA 4PAOA 4MRVA 3K0CA 2IEYA 2XJ4A 2Y8EA 4Z8YA 3CRQA 2WBLC 4BLOA 1TEVA 1FNMA 3BJIC 3Q85A 2VA8A 1MKYA 2B7CA 1XJCA 2OM2A 1QG4A 2ZRMA 3LLUA 4S2EA 4UNNA 2C98A 1I4DD 1ZUIA 3LV8A 4MKHA 2P65A 3SC3A 2QL6A 3EPKA 1E2FA 4GMXA 4RD0A 1EWRA 1T0HB 3TVDA 2PCJA 2NO1A 4QJ5A 3VKWA 4HAXA 2FZ4A 4DCNA 2P67A 2ZS8A 1N6KA 5LPNA 1Z6GA 1N6IA 3CB4A 4JLAA 4QJ3A 3D8BA 4UNQA 4C3ZA 5A5GA 4C0QC 3DOEA 5FOUA 1CR2A 3IO5A 4JL5A 1TF7A 1E9CA 3EWAA 5AUQA 5CM9C 2R6AA 2CLDX 1D2MA 4FCTA 1OXSC 2ZI6A 4DVGA 3BK7A 4W5HA 4BFSA 3BRWD 5KO2A 4EDHA 1NSTA 1Q12A 2EYQA 2YVUA 3W8RA 4UKDA 5C1BA 4JLKA 2GXQA 3AGPA 3WRYC 2GXAA 1JNYA 2GEUA 2PH1A 4LJ8A 3GLIB 3OEHD 4LRWA 2WKPA 2QUZA 4LCBA 1ZW6A 1N0WA 1OB5A 3EX7C 1R0XA 2ATVA 1E1QA 1MO5A 1MV5A 1ZNZA 4MQBA 1A7JA 5B30A 2A78A 3EZ7A 1U2RA 2BM0A 4NYJR 3KQKA 1DE0A 1AS2A 2XTNA 1DAIA 1FQKA 2C9CA 2XOKD 1G7TA 5JZVA 2YYZA 3Q9LA 4M21A 4A6XA 4H9GA 4C0BA 2JLQA 3AVXA 4KFRA 3J81k 2VSFA 1UFQA 2AD5A 2ANCA 1XMSA 3KL4A 4D0LB 1IXZA 1TL7C 4C2UA 4QHYA 3U61B 2GCOB 3AQ4A 4TLDA 4Q1BA 1KAOA 2H57A 5JMTA 2WWYA 4MRRA 4BFUA 5KSOA 2V4ZA 5J5CA 4DJTA 3OIWA 3R9IA 1YQTA 3KJGA 3NEJA 4F91B 3QF7A 4BLRA 1IJFA 4CF7A 3SI7A 4PR0A 5AUOB 3GLIA 4GL2A 2FA9A 3P26A 1XEXB 3DZDA 4LJ4A 2J1LA 2GCPA 2XNDD 3TAUA 1KKLA 2MSEB 3QENA 1RE0A 1ESNA 1VDZA 1BMFD 1VHTA 1CP2A 4M9SA 4PC6A 1E99A 1A2KC 1FX0B 1ZU5A 4UNSA 2QPTA 4O3MA 2ONJA 4QGGA 3VR2A 2YWEA 4ZKDA 1JALA 2C78A 3GCGA 1DAEA 1KDPA 3LVQE 4A0FA 2FSFA 2A5FA 1J2JA 1OJLA 1VMAA 2WICA 1G6OA 3GLFA 1AQYA 1XD9A 1D2EA 3KFXA 4GMDA 5CJPA 1Z8FA 4L4UA 3NC0C 5HE8A 1G4AE 4CEJB 1CIPA 1DELA 3T5DA 3TSOA 3GJ6A 5A4JA 221PA 1Q1BA 2YWFA 4OI1A 2GXUA 2XSZA 5E95A 2RMKA 4FWIB 3GEHA 1JR3D 2H8KA 2ZE5A 2J0VA 5KDDA 3OIUA 3KKMA 4LWZA 3RWMB 1M2OB 5FOSA 1JECA 2OUKA 4TYYA 5JBQA 2JIZA 2AK3A 3EZ2A 1RYFA 2VLIA 3ETLA 4BFVA 4DSUA 3L0PA 4BZPA 8OHMA 2CDNA 4JT4A 3Q7QA 5SZIA 3RC8A 1JXMA 2OBLA 2Z83A 4Q9KA 5CIQA 1OIXA 2X2EA 3CZPA 3X1ZA 1XZQA 2PT5A 2FPLA 3ZJYA 4CDGA 5FL3A 1PLKA 1KK1A 4Z1MA 1NI3A 3FFAA 1AZTA 5SZKB 2VYFA 2JCSA 4S35A 1ZUHA 3VR3A 4EPXA 1E69A 3KTAA 1U0JA 4MRSA 4G5OA 1QHIA 3IHLA 3B6EA 2F1RA 2C96A 3I32A 2CMKA 3DMNA 2NPFA 3TRFA 3C5HA 2IK8A 3TIFA 4DLZA 5HPYB 4KLNA 2HLDD 4OK6A 4U02A 3QBTA 1ZJ6A 1IY1A 2EW1A 3H1TA 3GPLA 1DADA 1L4YA 1Q1QA 2W83A 4ZI2A 2ZYUX 4TMZA 3SU8A 3C15C 5EZ6B 2BM1A 1KMHA 4LOAA 1NIJA 4XVRA 1XTSA 2LWIA 3C5CA 4Q9JA 4HB3A 5AJYA 2ZJ5A 1EFUA 2GJKA 2QY9A 2C03A 1DAFA 5DI3B 1SXJE 2QAJA 4ASUD 4DSNA 5CDFE 2NO0A 4P4SA 3WHKA 5JWOA 5FPHA 4II7A 4M8NE 2GF0A 2N42A 5EP4A 5DE3A 2WKRA 1J7KA 1E9SA 3D7MA 5BQ5A 1E0SA 1GKYA 1KK3A 4EJSB 3FYHA 4FMDF 1G7RA 3N70A 4TMVA 2IWHA 3TW8B 4LY6A 2F43A 3PQCA 3CF0A 2C9OA 3OESA 4TTPA 1US8B 2CL7X 2BCGY 1G8FA 3GJ3A 3F5FA 1W36B 1NMZA 1A82A 5LB2A 2A5GA 3U3KA 4WVFA 1TF2A 2ANBA 3KZ1E 4JVLA 2ZREA 5LDDC 2ZTSA 3C7KA 5EE9A 3QKRB 1ZNWA 2CXXA 4YXWD 1RC8A 1JBKA 4E22A 2R6CA 4ZIRB 1JJVA 2JA1A 3RC3A 4DRZA 1N6NA 3VHLB 2PJZA 4TT3D 1OFUX 2W6IA 4L16A 4Q1CA 3GLGB 3H84A 2GK6A 3IIJA 3CZQA 5E7JA 5KDLA 1HV8A 1X86B 2GTPA 3TR5A 1HE8B 4B71A 1TMKA 2J59A 2DBYA 3CPJB 3DKPA 1XX6A 3A4LA 1VECA 2VIIA 1U8ZA 2ZI7A 3MGCA 3NG1A 4RFSB 5DLQC 4YMWA 2O52A 1GITA 1RYHA 4LSGA 2QT0A 5KOYA 5DI3A 1OF1A 3MWLA 2ZRAA 1T4GA 1JXOA 3U2QA 1TEXA 4KYUA 3FPAA 3E70C 1W7AA 3VAAA 1KYIA 2ZUDA 2Z4SA 1XPOA 4NYMR 2A5JA 4PX9A 1KK2A 2AWOA 3GFOA 4CRWB 1E9RA 2FU5C 4Q4JB 1G8GA 2JJ1A 1Z0FA 1GDDA 3VTKA 2IF0A 3B9QA 4W7SA 4AYWA 4B3FX 4DLVA 1E9FA 1ZM9A 2ZU6A 4GOKA 3LH5A 1WB9A 4JJKA 2WV9A 2AX4A 3EPJA 1RKBA 4JYBA 3X2SA 2CNWA 2F7SA 2ODBA 4DCTA 3CWQA 1V5WA 3QNUA 4AKIA 2QQ0A 1NVWQ 4OHVA 5IDVA 2GHIA 1YZKA 2J7KA 4OI4A 3U44B 2QM7A 3SBEA 5EXPA 3O8BA 3CW2A 2W58A 4TYNA 2O8CB 2UKDA 5EE5B 4NH0A 1PJRA 4ZDJA 3IIKA 4DXAA 1CRQA 1IY2A 1CR0A 1LV7A 1KIMA 1SVSA 3B1XA 3CRVA 3AF1A 4DWJA 3PXGA 1JB1A 1FFHA 2DWQA 2RH5A 1OB2A 2WSMA 4QNMA 2QE7A 4PSAA 2ODNA 4PQRA 4R98A 3QUSA 4HB0A 3FMPB 5FR1A 1NF3A 4EIWA 1KY2A 5L3QA 2EYUA 5BN5A 2XTMA 3W8NA 1E94E 2J87A 3FKSD 5JWRA 4OBEA 4KFUA 3N2EA 1OPXA 3REFA 5FPYA 3GJ7A 1NVXQ 1OIVA 2W2TA 4JSYA 1U99A 1LW7A 3TUIC 4EFMA 1ZU4A 1AJEA 3B13B 1XF9A 3TQFA 5TMPA 4D4MA 1QVAA 1X1SA 3DPUA 2EQBA 2I1QA 1DOAA 1E2DA 3BH0A 4IDQA 4X8HA 3SYKA 4B44A 1FQJA 4QC2A 5B64A 4D81A 4IRUB 3DM9B 4HDCA 4KFSA 1KAGA 1R0WA 2RGBA 2B6HA 2JLRA 3KJIA 3L8ZA 4IOJA 4JLNA 4M53A 2O8BA 4CT4B 4ZIRA 1E4VA 2FPKA 3HR8A 1NKTA 2QEQA 2GVZC 4A0HA 1KO4A 3ZVLA 4B75A 2GZHA 3QVVA 3I73A 1VCMA 1M1YE 4RZ3A 5JWHA 3ND8A 2Q9BA 2ZROA 1T9HA 1YE8A 4GOXA 3SZRA 3SNHA 1M6NA 5DI9A 2YWHA 4RFSA 4TSFA 3V4RA 4URUR 4Z1MD 2JLVA 4ITRC 1F2UA 1U8YA 3QPUA 2IYYA 5JJLA 2WWGA 3LQRA 4M1OA 4NYIQ 4IDHA 4EFNA 1LFDB 4LYFA 2RAPA 4FMDB 5EP2A 2XTZA 1EGAA 2F1JA 5GJCA 3SHFA 2IYTA 3FMFA 3T06B 1N0UA 1G19A 2PT7A 1SXJA 2H5EA 2F3RA 3AKYA 4Q1AA 4TYWA 3QG1A 2FEMA 3I92A 1RPZA 2IS1A 4BZXA 1E2QA 3PVSA 4Q1EA 1XEWY 1T8TA 4ZDWA 2GNOA 1H8HD 2ZE8A 4LYHA 4NYJQ 5IF9A 4D80A 3EIQA 1FW6A 4B73A 2NTYC 5EZ5A 2G0TA 2QROA 4A8JB 5DGXA 2FGJA 3ZS8A 3QPWA 3T35A 2OFXA 5L3SB 2WJGA 1W44A 3CNOA 3RS3A 3U7HB 2LCFA 3GQBA 2ZR7A 3TLXA 1HEIA 1G20E 1NNEA 2NZ8A 3EW9A 4JS0A 5FOWA 1US8A 3NHAA 1L2TA 2Z4RA 4C0AC 4NYIR 5TDHA 3NH9A 2O0HA 1FOEB 2R6FA 4E5UA 2BMJA 3LA6A 1M8PA 2SHKA 3B82A 4C7OB 3B5JA 2HYDA 4NPHA 3X1DA 4PC3A 3ONWA 5EE3A 2WM9B 1T5LA 1D9ZA 3NIBA 3PUVA 3GLHA 2Q9CA 4MGKR 4D4JA 2OCYC 4DC9A 4W5JA 2P6UA 1E32A 1D5CA 2ZRBA 1SHZA 2CK3D 4HAZA 2N1BA 4CIDA 1N6LA 1WF3A 2G9NA 4BEBA 5KNDA 2C8VA 4H1UA 2R2AA 2KB0A 3KX2A 2HEIA 2JLYA 4EPVA 1YRBA 3SQXA 4ARZA 1QRAA 4DCSA 4BASA 1NY6A 1ZNYA 4JLOA 2ODWA 1N6RA 2GCNA 2OHFA 2CCGA 1PUJA 1C1YA 2F43B 3RS7A 5KSZA 1W46A 1Z08A 3ZQJA 3SE0A 5F9FA 2JEOA 3DZ8A 5J4VA 1E98A 3TNFA 3GLIE 4K8OA 1CJTC 1UBCA 2DFNA 1S0UA 4B3DA 3K0AB 1FUKA 2J9RA 2V9PA 3EC2A 1FMJA 5TB5A 1W4AA 3ZVNA 1XD8A 3K70B 2XX3A 1E2GA 2YC2C 4TYQA 2X77A 1Z5ZA 2QENA 4TLEA 3K53A 4D82A 4ZCMA 5FTMA 4C0SA 1Q0UA 3K09A 1NLYA 2ZU0C 1M7HA 4OI0A 3G0HA 4V03A 1ZC4A 2ERXA 3ZQ6A 4GPTA 3MWJA 2AWNA 2G83A 2GWHA 3QKTA 1GNRA 1NN5A 1LVGA 3WYAA 4A0RA 3GLFE 1TNDA 2FOLA 1E2KA 2ZRCA 5AR1A 1GNQA 3KQLA 3W3AA 4TLCA 5ANRB 3IBYA 1E96A 4QFMA 3PIRA 4JL6A 4BFYA 4IW3B 2OXCA 2HJVA 1VYUA 2IYZA 3JZMA 2QBYA 4BE7B 3AVQA 3D31A 1S1CA 4URZR 2VBCA 2IUTA 3I8SA 2CJWB 1EFRD 2DFKB 2R65A 2VP9A 2ZRFA 3PEVA 4NTZA 1DO0A 1SGWA 4NCKA 1E2MA 4DSOA 4P3YA 4Q9IA 4AYXA 2ZE7A 2A3RA 2V6IA 3TK1A 5BXQC 2BV3A 1P61B 6Q21A 4A1FA 2FDCA 5F3WB 3ADBA 4V0OA 1JI0A 5LBIA 1P3JA 2OT3B 3IDQA 4Q4AA 1Y3AA 3I62A 5FTLA 3A1SA 1T3LA 5CJ2A 4ZI3A 3UK6A 3VU9B 4PHGA 3PEYA 4QBFA 3IIMA 1RFLA 4LYJA 1Z22A 1XDBA 1XD2A 1M74A 4RSGA 1OH6A 2CE2X 2AHOA 2P2LA 4ZKEA 1XXHB 3LY5A 1X8JA 4B2PA 3KKNA 2J41A 2G6BA 3QI2A 2W0SA 3EXAA 3RABA 2O8EA 3T12A 1KSGA 4OQMA 4B34A 4V0LA 1A5TA 2RGDA 4WA7A 2WWFA 1W5SA 3KJHA 1KDTA 4PO8A 3W6PA 4JLVA 4QM6A 3AUXA 3CM0A 4XTCS 4LK2A 1MO4A 3W3ZB 1AS3A 3B7GA 1XPRA 4Q66C 4DDWA 3MG9A 2ZRPA 3CRW1 3SN6A 1DEKA 2GCOA 2E9SA 2QM8A 2V8OA 3C41J 3EWSA 2QMEA 4G01B 4LX0A 4PXAA 3THXB 3RNLA 1WE2A 4BWYA 3T1QA 5GVSA 4U7DA 2O8DB 3M4YA 1G16A 2F1IA 2WWXA 4MRNA 4KITB 3NBYC 4QM7A 3K0EA 3UMFA 4B3XA 2V1UA 3B78A 2DR3A 3FMOB 2BC9A 1E2NA 2NG1A 1N5KA 1ZINA 2WJVA 3SJAA 2ZS7A 3CO5A 3CX7A 3U60B 4LBWA 1XJQA 1XB2A 2R8RA 1VPLA 1MOZA 2ZUCA 3AVPA 3PUZA 4OQNA 4LBVA 2CNWD 4UNPA 3JZAA 3W90A 4D4KA 1QHNA 3IKJA 4NCNA 1L4UA 1BS1A 3WYFA 1COWD 3LQQA 2ZJYA 1PUIA 2GRJA 2LKDA 2BOVA 4YMTA 2IYSA 1AKYA 1F2TA 4A9AA 2G3YA 4G5QA 3QJYA 4TSFD 4I1UA 3H4MA 1ZYUA 4LC0A 3LBNA 2ZANA 2RGGA 3E5HA 1HT2E 4OQFA 1S96A 2HT6A 2IUSA 2VF8A 2Z0MA 2PZGA 1LS1A 5FPKA 2ZRKA 1AS0A 4HB4A 3TH5A 4D4LA 2ZJZA 4Q1FA 3O47A 1R0YA 3DL0A 4RJLA 4G5SA 5C4GB 1W0JA 1LY1A 2NOAA 3C16C 2FSIA 2HDNB 3A37A 4HAUA 3MCAA 5B2ZA 1GAJA 2ZIAA 4Q47A 1CTQA 3P4YA 1LTQA 4PQFA 1DBSA 4CYMA 2CK3A 4LV6A 4L5BA 3ZGXA 2O8FA 2OBNA 2I1VB 1PVOA 3HP1A 1SXJC 4UJ3A 1FZQA 2XSZD 1JR3A 1I4LD 1IAQA 4M4SA 4TTQA 4BECA 1KJWA 2ZRJA 3NDBB 3HR7A 1LS6A 1ZIPA 1OFTA 3ZDQA 4LJ7A 4NYMQ 4GBMA 4EPYA 4KVGA 2GVDC 3EZFA 5JS7A 1MRSA 2ZM5A 3A6PC 4Q9LA 5L3QB 1D8TA 1NG1A 4DB2A 1V43A 2WPDD 3FHCB 4B48A 2RKOA 2OLKA 3LX5A 3DOFA 1RJ9A 1TF5A 3OEEA 4FCWA 4KLZA 1P9NA 1FMLA 2YOHA 4DCVA 5BW8A 2D7DA 4AC9A 1CULC 2WWHA 2ZE6A 2ZSFA 2XZLA 3OZXA 1KK0A 1NLFA 4O25A 4A15A 2OAQ1 1DPFA 4Q02A 1XU4A 5EQTA 3P32A 4Q19A 1Z0AA 1B23P 3D3QA 1ZVQA 1FP6A 3VKGA 2BEKA 4RD6A 2EFDB 3BGWA 4MA4A 1K5DA 2CL6X 3AF0A 1SVLA 3HJNA 3QIAA 4ZO4A 1TU4A 3FFBA 3KXLA 621PA 1YR8A 4IDOA 5CYOA 1OH5A 1MABA 2ORWA 3THXA 1VG8A 4DLRA 3RHFA 5CK5A 2OSBA 4TWZA 3WBKA 3ZZ0A 5AJVB 1Q3TA 4XWAA 1HUQA 2F9LA 1G3IA 3WY9A 1TUEA 2NPIA 4WZAE 3WBJA 2X2FA 3RRYA 3L0IB 2BVNA 4DB4A 121PA 3U4QB 1QHSA 2H16A 4JZKA 2WJIA 3F8TA 3N2IA 1CS4C 1GG2A 3FE2A 4LJAA 3IQWA 4P32A 3SQWA 4YLGA 1P7CA 2R6DA 3EIEA 1Z6YA 3EZ6A 4OHYA 1ONBA 4FWTA 2IA5A 4OQXA 3LDAA 5BYKA 2X1VA 4G3XA 3BBPA 1QHYA 1RRGA 1P9RA 3A4MA 2ZAMA 1VG9B 2E1RA 4DLUA 4PAQA 3RWOA 1SHKA 3QG5A 4HI0E 3PENA 1IM2A 3QKSB 3QXSA 4DCUA 2BJVA 5FTKA 4NDZA 4CEHA 4HZUA 2OCAA 2UZ3A 1U9IC 2YKGA 1VYVA 2V54A 4US0R 2ZI4A 4HDOB 2BMFA 4B35A 2O0JA 3UPUA 1GTVA 2ZYTX 4TL6A 3QXXA 2ZJBA 2ZUBA 4KU4A 4HLCA 4KO8A 3K8YA 3A58B 2WJYA 3AP1A 1YKSA 1RRFA 4XSHA 4TLAA 4ON9A 1L7VC 1CJUC 1W48A 2X19A 3E1SA 1Q3HA 4HAYA 1O87A 5CDFA 1A4RA 3WXMA 1VTKA 2QA5A 2ZJOA 3WMEA 4OJKA 2ZJ8A 2KSQA 2BMEA 4JBYA 1CJKC 1X8KA 2VH5R 3LW8A 2PL3A 2GETA 3IEVA 1KI9A 4MYUA 5FBRB 4LPKA 1BOFA 1VIAA 4IOMA 4CW7A 2JLZA 3K70D 1KKMA 4FI3C 2GA8A 1W2GA 2W6JA 1N6HA 1ZM7A 2O5VA 1EXMA 1QHGA 4Q18A 3I4LA 5E7IA 3CR8A 5KSYA 1HYQA 4HDQB 5FR2A 4CZ2A 4ZDKA 5HR5A 2ZSAA 4Z54A 1RW4A 1QHHA 2W6JD 4LJ6A 1YR6A 1LF0A 1IONA 1NBMD 1OH8A 1EG7A 3C14C 4M9XA 4TQ9A 5JCPA 1KO8A 3K0SA 1TQ6A 1G5TA 2BKEA 1RZ3A 4GI7A 4IOKA 1Z6XA 2OBMA 4TMWA 4US1R 1CKEA 3D6TB 5D3QA 4TZ0A 2OESA 3OAAD 3K9HA 4FD2A 4C2TA 2VSOA 2HXSA 2Q3MA 4JJZA 4X8LA 3ADCA 2WWIA 2GJ8A 3LBHA 3BS4A 5P21A 5FBVB 1FUUA 1KI2A 1U8AA 1E0KA 3LLMA 3LNCA 5EP1A 4XTRA 4YC7A 5G40A 5C18A 2C77A 4LBZA 3Q72A 3PEUA 1U0HC 2QRZA 2QTFA 3TBKA 2IS4A 2PLFA 2PMDA 1IXRC 2VP2A 3R7WB 4KJZA 4DDVA 3RS4A 4DBLC 2R44A 1XTIA 2IYQA 3H2YA 4RCYA 1QZXA 4XVQA 2VP6A 4A6PA 5JHHB 3NVAA 3TKLA 1XXHE 2AFHE 2ZRNA 4PC1A 4CEIA 4MH0R 4XH9B 5IRCD 3AP3A 3WNBA 4BZQA 4OKSA 3BFVA 2QGZA 4Y0AA 4DIDA 5FFMA 3SJZA 2D4HA 2ZRHA 1E0AA 3KFVA 1OE0A 4L9WA 4B6EA 4KXFB 5UKDA 4A0GA 3NXSA 4DDUA 1R4AA 3V4FA 1M7BA 3KB2A 5E3HA 1XCMA 4RZ2A 3GJ5A 1ZM4A 3MFYA 4HEJA 4HLQB 2AKAB 4X8MA 521PA 2OEPA 4N1AA 1SVMA 1ZIOA 2WMNB 3THWB 2ZR9A 4RKFA 1OXXK 1BO6A 3W6NA 1U0LA 1TU3A 1JPNA 3ZD7A 1PLLA 4BLTA 3CH5A 4UXIA 4HLUC 2HXYA 4F92B 1G5RA 3FOZA 3U3OA 2QZ4A 2ZQ5A 5EUMA 2WOOA 4PPGA 2P6NA 4R2IA 1G7CA 1FPMA 3CWZA 3T1OA 3X1YA 1CLUA 2GK7A 5GADl 1P2TA 2OFWA 4JSTA 4HZIA 3TUJC 2FGKA 4AYTA 1IN7A 2ZETA 1NN1A 3KUDA 4C0JA 3NWJA 3IBGA 1XTQA 3FDIA 4CEIB 3AKCA 3VR6A 4HYYA 3GFPA 1IN6A 1AK2A 1G8HA 2VHUA 2WAXA 3UKDA 1ZD9A 2B92A 4EQ6A 1WBDA 5KU1A 2OG2A 4M1SA 4M1TA 2WWWA 1YZQA 1P72A 2ZJAA 1Z63A 1G3QA 4V0MA 4TT3A 5K8IA 1E1RD 3K9NA 1IJEA 4QRHA 1OFIA 3AP2A 1COWA 2QAGB 1U9IA 1NBMA 5KSPA 3VX3A 4OQLA 4F4JA 1RVDA 4Q4LA 2FWRA 1VCOA 2DCUA 1MO6A 1ZMXA 2VEDA 2ZAOA 4RZUA 4GSYA 1MT0A 4NMMA 2FJUA 4TMXA 1T3SA 2ONKA 3K0FB 1YR9A 5GJWC 2VSXA 4EFLA 5B57C 3O8DA 2HCBA 3BB4A 1GRRA 3FWYA 2F6RA 1N5IA 1KO5A 3DO6A 4D25A 1VIYA 3LVRE 1YR7A 4A4DA 1AZSC 5LD2B 5EJEA 1NVUQ 1U81A 4UQOA 4V0KA 3B60A 1UAAA 2CEAA 1CBUA 1ZBDA 3KKPA 4JKIA 3QEJA 5CLLA 5HCIA 5IK2A 1R5OA 3VQTA 1KI3A 3K70C 2B8WA 3A1UA 1SXJB 5DYIA 2AK2A 2ZVPX 5HKKD 1R0ZA 2O8CA 1X6VA 1Q22A 4HAVA 2Q9AA 1P2SA 5EUQB 2GBLC 4B32A 5CK4A 1C9KA 4LJYA 2UVQA 2ZI3A 2J5XA 5CLQA 3RYTC 1T5IA 5KNCA 3HWSA 4HB2A 4JLJA 3DM5A 4Q5IA 1G3MA 4WBSA 4TMTA 5TARA 4YONB 2H92A 2VL7A 4NCIA 4Z51A 1PV4A 2PX3A 2W2XA 4TL7A 2JGNA 1FX0A 5FOTA 4JLPA 2QORA 3CNNA 3VMFA 3EPHA 4M1WA 2RGEA 3BH7A 4OYHA 3SDZA 3NH6A 1XRJA 1KI4A 2QAGC 3VKHA 4F4IA 1YZGA 3OEED 4B3BA 5CM8B 2B8TA 2ZRIA 1BMFA 4QOSA 2OILA 1TQ4A 1DAKA 2YJTD 1T3HA 3QY0A 1N6OA 1QHHB 2REOA 4B74A 2EFHB 4LV5B 4PANA 1ZAKA 2JDIA 2QP9X 3M6AA 4WXRA 3CH4B 4EPRA 1SULA 2WJHA 3B9PA 2FG5A 3BIFA 2IS2A 1NKSA 3MMPA 5K8UA 2D3WA 2A7QA 4WIAA 3NEYA 2HYIC 2YNMA 2IEZA 2I3BA 1KSHA 4F38A 3TMKA 1M7GA 5J4YA 2XAUA 1WCV1 1NG9A 2YZ2A 1GM5A 1E9DA 2HV8A 4IJMA 1XP8A 5DISB 3V00A 2WIBA 4JMPA 1UEJA 1MH1A 1II9A 1K6MA 1WP9A 5EE0A 3FGNA 4PZLA 3PV0A 4AG6A 2QMUA 3P1JA 4XD7A 2WJJA 4B6FA 1F3OA 3BFKA 3T1TA 1H8EA 2GZDA 2R9VA 1JQJC 4LI0A 3G82C 1FP7A 4B3CA 3HU1A 2QMOA 5L8VA 1RIFA 2WIAA 1F6BA 1GVNB 4A2QA 4XWOA 4FMBB 1OFHA 3CKLA 2WPDA 2L0XA 2QTHA 4FN5A 4JVNA 3DEFA 2ASEA 3M0EA 3PITA 1GFIA 1NN0A 1DO2A 1BYIA 4EPWA 4ACAA 1GOTA 5FH9A 2FFQA 1J8MF 3AEZA 1GKUB 3T15A 4D6PA 1E2PA 1SVIA 2CJWA 1P60A 4I4LA 1S1MA 2F3TA 3QVUA 1F60A 5JJIA 2VP4A 5AUNB 3HU3A 5TV2A 3CPEA 1KI6B 2AR7A 2QPOA 2VO1A 5E4FA 4LJ5A 1OHHD 2PBRA 2J3EA 2GAOA 3AUYA 3QPVA 1YU9A 2ORVA 3JVVA 5EE1A 2CLSA 3CONA 2IYUA 2D7CA 4PZZA 3EAQA 5C4MA 4D0GA 1TUIA 4IXMA 3AVYA 1MRNA 1ZD1A 4HATA 4B33A 5JLJA 1UBGA 4UJ5A 3T1VA 2NZJA 3ZYCA 3GLGA 2VHTA 2FPMA 3CRMA 1AGRA 1OV4A 1EX7A 2WMOB 3MWKA 4GZMA 4IVQA 4BEJA 1ODFA 1KI1A 2G77B 2QP4A 3IO3A 3PUYA 4YMSA 4ARZB 1R6BX 5DO9A 1Q57A 1J90A 2ZI5A 1U94A 1WRBA 1CXZA 5HZKA 1OIWA 1G7SA 2P0EA 5JI2E 1CR4A 1G21E 1GZSA 4XIGS 5H8WA 2CHGA 1NIPA 1CU1A 2Q21A 3ASYA 2J46A 3CIOA 4B43A 2IYLD 1F48A 2IX3A 1NBME 1E3MA 3S1AB 4A82A 5JRZA 4US2R 2CHVA 5EXTA 2DWPA 4N0EA 4DUGA 1ZP6A 3N5CA 2ODEA 3I3SR 3LAWA 2Q0HA 4XWKA 2O8BB 1VHLA 1JAIA 3AF4A 3KKQA 2H1LA 3DKVA 4G5RA 4FXPA 1R2QA 4AI6A 1VKJA 1KDOA 3W9YA 1OXVA 3CNLA 3UANA 5HZHA 3BB3A 4YDHB 3MRSA 2VHQA 2H18A 4KYIB 3KDSE 3KJEA 4XJXA 3K0CC 4B76A 1U98A 1TPZA 2RCNA 3AV0B 4GNKA 2GZAA 2A5YB 2NO7A 2YINC 4PC2A 1E79A 4RCZA 3KXKA 3AM1A 2PEYA 3U3JA 3EIHA 2CBZA 1G9XA 2KI5A 1LF5A 4DKXA 1J99A 1ZM3A 4MGYR 1XTJA 1L8QA 1GIAA 5AK0A 5B58C 5J47A 3GLHE 4K46A 2V55B
chains in the Genus database with same CATH superfamily
1OXKB 1S3IA 2MMGA 1L5HB 1RLIA 2FEOA 2RDMA 3ORQA 2IL1A 2PZMA 3EVNA 4TXNA 5FA5A 1HA3A 2GNPA 3NI2A 3FMIA 2X22A 3KOYA 5F4ZA 1W0JD 2OZLA 3FHOA 1JKMA 2WVHA 3LF1A 5I9IA 3K0AA 3OC6A 2JLWA 4H4CA 1R4MA 3PEWA 1QB7A 2D13A 3W77A 2XOEA 3EYAA 3TFQA 1XYVA 3V7WA 1KC1A 3V9PA 2SBTA 4WVLA 1K8RA 3MUFA 1GGJA 1OXTA 4G09A 4BNDA 2PG3A 3PBKA 1XD2B 2REQB 4P3KA 3ZQUA 3DMFA 2GN6A 5FI0B 5ES4B 4IKEA 1QKJA 4P84A 1Y34E 1CEQA 4HNVA 1R64A 4J3NA 1DG1G 1H1TA 4MICA 3BWDD 4NJMA 4EJSC 5A3SA 1ADYA 3DD5A 5JS2A 3MT7A 2FEWB 4C2TA 3WLSA 3AB3A 5A3QA 4CTJA 1EAMA 2ISCA 4LJLA 4QSHA 1S89A 1FTSA 2GKSA 5TIIA 1VGVA 3E9NA 4O0MA 1GKLA 2H31A 2OZKA 4NONA 4RSHA 5U1PA 3NTUA 3ZE6A 2P9CA 3SM3A 4UQLA 4H6VA 4JENA 1GRVA 2Q07A 5IKMA 4X7PA 4X61A 5C2JB 5LXTB 1M8FA 3W05A 2DFDA 4ZCTA 3GRYA 5DHUA 1CB0A 3TUZC 2FF5A 3NTLA 3QE0A 4JUFA 2X42A 1PGPA 3LY9A 4WK4B 4WXEA 3S5UA 4KN8A 4A73A 3E3MA 1LDMA 3TMYA 3WSWA 2WUWE 2NZUG 4EGSA 3LOQA 3IAS1 2AXNA 3TD2A 4ETWA 2XDYA 3AR4A 1SCIA 5CT4A 4AX8A 1HK7A 1G55A 4Y9RA 1OTHA 4BFWA 3VFDA 3DLIA 4WOBA 1EDZA 1WQ1R 3BULA 1AVTA 4EHJA 2A0YA 2GN2A 3LX8A 4L5IA 3RBVA 4LRTB 3DMYA 2GESA 4Y2VA 4MYTA 1Y8CA 2JDID 1ORHA 2HZBA 3PIDA 1L4HA 2FG6C 3FVVA 3LGAA 2VS1A 3DO5A 4MQFB 2BGKA 3P9KA 4WK6A 5TSDA 2IQ5A 1A96A 1YFKA 3UJ6A 4WESA 4BRWA 4DPLA 3W1VA 3IYLW 4K6GA 2QRQA 4AKEA 3QVTA 5BMOA 4UZEA 4KPGA 2CLLB 2KM1A 3JYNA 1Z4LA 5CDHA 3CF4G 2ET6A 2P9QA 4QPCA 4L6AA 2RJ3A 5ERXA 1I80A 2BCJQ 2PWAA 3K09C 4GXQA 3PI7A 1UBHS 4JUCA 4C87A 4CE6A 5JFGA 1XRNA 5ERYA 1VGQA 4O59O 3FDJA 3HU5A 3TB4A 4BN4A 4E2ZA 3GLGE 4OM7A 5DTEA 1KNXA 2D2FA 3C5WP 4M1MA 4O2LA 4QXAA 2ISQA 3ND6A 1I32A 1LQUA 3IOBA 3B85A 5J59A 3IR7A 4RKEA 2AOUB 1ZMRA 3O7WA 4P4SB 5SV2A 4ABYA 1NYTA 1D6JA 4BGVA 5GZ3A 7ADHA 3QOWA 2W6ZA 4ZRNA 3H2GA 4FHDA 1L1FA 4BNHA 2Z2YA 1CUZA 2RGNA 1U8EA 2M98A 2X9GA 1A7UA 1XL0A 3GVPA 4I5IA 2BFDA 4M0DA 2E6KA 1SN7A 4KGZA 2IVFA 1JQKA 4TKMA 5D6OA 3TM4A 4HUQA 4MGZR 4LHVA 4KSBA 1W85B 1ZNXA 4C0HA 4EATA 1BXGB 2EHJA 3R8CA 1YQ9A 1Z0IA 5CA0B 1Z0DA 4LIPD 3RRMA 1YR2A 1CR1A 2B99A 2YL2A 3FOCA 5KAPA 3NHFA 4KVAA 5BYBA 2K5UA 5T4EA 3R7FA 3SZMA 4QJ4A 1IZ0A 3PJRA 2OXEA 5D8DA 2A30A 2ZTVA 4HPXB 3B1VA 5EIAA 5FAXA 4BN0A 4RKRA 2ZR8A 3IPRA 5ED4A 2QNRA 3UCXA 5IKEA 1AM4D 4K3VA 3NDPA 1DP4A 3AHIA 1QC5B 1XZ8A 4K87A 4RL6A 1M1UA 1A2BA 3G1WA 1IPHA 1NJ6A 2PX0A 4RKQA 2IYXA 5LMCA 3E15A 2JLCA 4JEUA 3EBPA 1YJAA 3W5UA 4Z3DA 1P2GA 1ZO8A 3HB0A 4I50B 4PLFA 4DUGD 3UVEA 3M9XA 1IH8A 3RSFA 3KM0A 3QNWA 1H3NA 2W2OA 1YI1A 1T4BA 2JASA 3RRJA 3JVIA 4JXJA 4L28A 2P69A 3H7IA 3VDMA 2ODQA 3PRJA 2HF2A 1C9EA 3QBVA 2F1HA 4C4TA 2VEOA 3IAXA 5KQSA 1NPTO 1C4OA 4BGEA 4FM9A 3JR3A 3OX4A 1VCIA 3GMIA 5KUTA 4FIZA 1E2LA 1UP4A 3MJVA 3FTNA 4Q7EA 1M8KA 1EK5A 2RKBA 1NFFA 1MA0A 3O0TA 1KP2A 4EGCB 3PEEA 1V9SA 3IEUA 4TYMA 4OBXA 3EJWA 4WXHA 3ZH9B 4EJ6A 4YY3B 5BPHA 3TSYA 1W52X 3KO8A 4AQ7A 2DCMA 1KO1A 1UINA 1DBPA 4K9MA 5AJXA 4Z8XA 5EZYB 4E6EA 1NU8A 2PSHA 3BE4A 3KAJA 4EVIA 2DVMA 1USKA 1EHYA 2PMKA 1Z34A 3AL3A 3VJKA 1XDZA 4OJQA 1AC5A 1LPOA 4R41A 3T7SA 3RT7A 4I36A 3S2ZA 3ZCXA 1DV1A 2Z09A 4FDVA 1QVWA 1XNGA 1LTKA 1GUAA 1GEGA 1NUPA 3FWHA 1HQKA 3KDPA 2Q8PA 2OQVA 1RR6A 2FMXA 2QTMA 3SS8A 5FPTA 3OFNA 2IEGA 2ZB8A 5BURA 4NOJA 1DKPA 5ALUA 5LR6A 2IGBA 1N7JA 3MGAA 3N75A 1O9HA 2I8CA 2JD2A 1KPIA 1UKCA 1W4ZA 5FTNA 3EGOA 1R9NA 2KJQA 4MLCA 3OE1A 5E9AA 5EMHA 1C9DB 1BQ4A 3LDGA 2BBSA 4KH0A 4YMUA 1Y1QA 1IOZA 1M76A 3QVGB 3JQ7A 3NPAA 5JSZA 1Q14A 1XO1A 2IRWA 5A06A 1XJ0A 4P7JA 4F60A 3TJZA 1PJBA 2ZP1A 1EBUA 4GI1A 2L17A 4Q01A 3VNQA 1BD4A 2QP3A 4GBED 3BWYA 3I09A 4AECA 1NVVQ 1JPUA 3FSEA 5A0FA 1EFKA 3B3GA 3UBMA 1IQUA 1ISPA 3ETHA 3OJFA 1AMNA 2FNAA 1NW6A 2VPPA 3EJ6A 4FZ5A 4GI3A 3EARA 3DE1X 1P62B 5WRFA 4BNJA 4EFDA 2YHAA 2BGWA 5JEDA 5IXSA 2EG5A 3SSNA 3RYFA 2YY6A 2YFYA 1VLQA 2FRVA 4NNPA 4QPZA 5K8VA 1X42A 2IYRA 1JQEA 3UW1A 2PZEA 2BR4A 3FKQA 1UPCA 1ZOLA 2CLKB 4TMKA 5L3SA 1SZCA 1IN8A 2W4QA 4QU8A 2XXAA 2VZEA 3RG2A 3IP5A 2IBMA 4MYRA 4QIHA 4AJNA 4DLTA 4DLSA 2BMDA 3RFUA 5HWSA 4IQ4A 1XRPA 5IN4A 3ZGNA 4M1KA 1IBSA 3MJRA 1DG3A 4O1IA 3RPEA 4NBLA 3AF3A 4BNWA 1GPNA 1LUAA 2Y92A 4JITA 4KQEA 2ZG6A 2YHUA 3M49A 2B1JA 5TS2A 5I01A 4CEHB 3AETA 3PFKA 1NMYA 2IE0A 1MX3A 1XZLA 4NJEB 1Z2PX 3P7MA 3B2QA 4I1YA 2EWVA 4AY5A 5IPFA 4DKJA 1J24A 3T3IA 2AG1A 3E0QA 4ZYVA 2RFLA 1LNZA 2X0KA 3BB1A 3C6XA 3G88A 4HR7A 4L8VA 1U5BB 1U90A 1MVLA 2H2HA 1WD5A 2YN2A 1Q7GA 4EM6A 2V6JA 5MFPA 2JJ1D 3I2HA 3LXUX 1CUDA 2DQ4A 4E08A 3GZJA 3G79A 3N0RA 5K01A 2ZRDA 4C4AA 1X1TA 4H3KB 3NEAA 4O5OA 5JI3E 3TZLA 5TR9A 2RIPA 3QTBA 4U6QA 4Y18A 2P68A 4TLLB 3L6EA 4B2YA 2Z6VA 1M2JA 4KQCA 3U49A 1CJMA 1KERA 1D2NA 1WF6A 4FXOA 3SHWA 5T3UA 1AOXA 3AFOA 1EJ0A 4HN9A 4RHTA 4C6TB 2J0QA 1B76A 2QOEA 1E4YA 1XVLA 2J3QA 1G64A 4V1CB 1F2TB 3ZV5A 3U4MA 3RFFA 1CUHA 4RGYA 1P4SA 1R9MA 2QAGA 3U4DA 3S2UA 3QV2A 4CMEC 3O75A 4GKJB 3L01A 3RDPA 2C7PA 3OHMA 3OIVA 5D3KA 4PAWA 5K3SA 5CB6A 1C7EA 1EQUA 5SY6A 4N7RA 4RNCA 2JJYA 1A9TA 1QO9A 4MMYB 3QLVA 4DLYA 1B4DA 1P29A 2VQFB 1Z18A 2PH3A 1CZRA 5FUYA 2A4KA 3GT4A 4YCAA 3WSTA 3ZS9A 5IT9A 3FW1A 2AOTB 4AAYA 3DAYA 3ZXIA 1E89A 3CJQA 1YH3A 2GHRA 1QK4A 2A2ZA 3IMCA 3VOAA 4B4WA 4YR9A 2BLLA 1X7YA 1N2IA 4KX3A 3ABSB 5B37A 3WIVA 3VZDA 4LDPA 3AVTA 2ILTA 3T6KA 4I1VA 4MWDA 2DHRA 4E46A 4ZDIA 5K8TA 2FP4A 5ESXA 1P17A 3N5KA 1AA6A 2ZUTA 5F64A 4LY0A 3OKFA 2RHMA 2OPBA 2ZSEA 1V11A 4W4TA 1R0LA 4IG9A 3U44A 3EXEB 2R751 2RI0A 3RARA 2BAGA 1FS5A 5JJCA 2VN8A 2ZUFA 1LK0A 2F8TA 2H9YA 5AIAA 2VPZA 1T13A 4DS3A 5K45A 4WX2B 3KSZO 1AZWA 2DULA 2JL1A 3O6VA 3PYMA 4LZZA 3SR0A 4ANFA 4F86A 3PA8A 1SD1A 3BXFA 3PJFA 1K5GA 4FR2A 4XIIA 2XEXA 1Y9EA 2ACEA 3MEQA 3OO0A 4IY1A 4NJOA 4I55B 3U81A 4EG3A 1MQ8B 3ED1A 5IC4A 5FQNA 1EQAA 4MVJM 1IHDA 1KEPA 2GN0A 4IKOA 2E87A 4ZTBA 5F2KA 3TPFA 5IJ9B 3H1BA 4UU1A 3P97A 3EPRA 3WNVA 1OLOA 2K6GA 4KTVE 1T15A 2FETA 2XGMA 5AJWA 2VP5A 4DR1B 1L6RA 4JXZA 2ZJ0A 5B1HA 2DAPA 2E7ZA 4BV3A 1E5TA 2GT1A 1OGIA 3RRBA 3WDKA 1XZFA 3TW4A 4F3YA 3Q8XB 4I6EA 2MYUA 1O94C 3UG6A 4I46A 5C1IA 4IG4A 1K6IA 2ZRLA 4Z2AA 3A4IA 3RGGA 3I05A 3UMSA 4MYDA 3PFFA 4YDSA 2RGNC 4HEA1 1ZNQO 2JI8A 2GJSA 3Q2IA 1DU4A 4TVBA 4K7JA 1M1XB 3LX4A 2VDJA 3I4FA 2I78A 1Z8HA 4PYLA 4C4ZA 1OAKA 5CX4A 1TO6A 3S3TA 3WX0A 3BDVA 1N6PA 2FYTA 2C3PA 3W6OA 3X1WA 1MA3A 3F2IA 5FLKA 2F17A 3QBJA 4Z7JA 1XFDA 4FGUA 1PJTA 4WAUA 2CXTA 2W93A 5G4KA 4C9BA 1Z25A 2W71A 2XUIA 4QICA 5E4TA 2YWXA 1DUSA 1ORVA 4N5LA 3TZBA 4EB6A 2CL0X 3KOWA 1RHUA 4MA5A 4ZEOA 5C5EA 3PWZA 1W75A 5LYJB 2XA2A 5LFAA 3SWWA 1M2KA 1GILA 3STHA 1AY0A 3BZWA 2C4VA 3IEMA 4BTEA 1Q1EA 2LE0A 4GLOA 1FFXB 5C81A 5AWFC 4ONEA 4WY8A 3W4IA 1CK4A 1U2QA 3A9RA 5LD2C 2B21A 3SIPA 3MYRA 1KQPA 3QFFA 5CX1A 2C20A 1XZDA 1DJOA 5ARDA 4MQ4A 4QHSA 3M89A 4I9HA 4QL3A 8AT1A 1E64A 3HVRA 3P4XA 3U6BA 1TJ5A 1SUFA 3CO0S 3P20A 3PC3A 1UBOS 4G84A 1Z2AA 5I8WA 1W88B 2R84A 3NO4A 5DHFA 5TQ0B 3LFUA 2OXRA 1PHPA 4D8WA 1T3GA 1YJ5A 1IM8A 2W8BB 2A5DA 1HYBA 4GC5A 4TQAA 2QRGA 3COJA 4YMIA 2OL4A 1NL3A 5HXAA 5B36A 1QVRA 4NWIA 1KP3A 2C5AA 3HB4X 1G20A 3ILHA 3KXIA 1I3NA 2CLCX 2Q9UA 2RCYA 1UBMS 2ZIWB 3ZLTA 4X1YA 4F84A 3SDBA 1S01A 3A3YA 3UN1A 3W04A 4RVCA 3Q3JB 4N9WA 3HSYA 4COOA 4BHTA 3NT4A 5KWSA 3E7XA 3NXKA 1FLDA 3GQBB 4O2AF 1PFGA 2DZDA 3MJHA 3K9LA 4K2HA 2GDJA 5TT0A 3WGZA 4Z9FA 3ULKA 3MTQA 1DTWB 5E4YA 1BW9B 3Q0TA 3ONFA 2JBAA 3CN7A 4L9AA 3WGJA 5C7YA 4G4JA 5JQWA 1XEFA 2C9BA 4P83A 4RD4A 1RRKA 3ZGVA 1M83A 4MQ6A 2LKCA 5H68A 1O3YA 5HMLA 4OUDB 1KDVA 1IN5A 1Z26A 2F64A 3LBAA 5HGXA 4O4LA 5I5EA 3K32A 2XJ9A 4EMSA 3HV2A 1ENYA 2HZ7A 3RLIA 4MGIR 1QH8A 1VZ2A 4P22A 2XZPA 2QPAA 5HFNA 4R01A 3T4PA 1ZJ5A 2AJDA 3TINA 2VRCA 2V96A 4RD3A 3VU0A 3VR5A 1CR6A 3A04A 1P6UA 1UJBA 5JXGA 2QNBA 1FXSA 4N41A 4C4PA 5L3VA 3WV4A 1XTRA 2VUIB 1Q7RA 2IELA 3WOHA 1JIXA 4F1WA 4EI9A 3ZDBA 4NL4H 4V3BA 4L08A 2CJFA 3ITDA 4XEHA 4MDHA 2KX7A 3RK4A 4DPKA 5JZ9A 2M6RA 2EKLA 5DM70 4C78A 4D0NA 1DOZA 2EC5A 2FPSA 3DEIA 3FF1A 1SBQA 2YVLA 3A4NA 1G18A 4H18A 4OHZA 4YV0A 3UHOA 1HDGO 1UMBB 1VE3A 2H4XA 3TLAA 4U5XA 1A9RA 3GCWA 4GPEA 1PSZA 3SOPA 2LIVA 1NN3A 2RGCA 3I76A 5J4HA 1C8BA 1T91A 4BY9E 3TNDA 2GN1A 3G2KA 1SVOA 3QEKA 5CM2Z 3WP1B 4GDMA 3ZKWA 3TW6A 3UICA 4N40A 4F8EA 2I76A 4WNCA 1P5RA 2W00A 2X9NA 3QOXA 1KSJA 5G3YA 1E6CA 3INRA 1F5NA 3LBIA 3GJYA 2E0IA 2P3SA 1A97A 2WUDA 1MOPA 1VKHA 2FOXA 3EY4A 2AUMA 1MW9X 4WFJA 2PKCA 1JR6A 2GEFA 4BB5A 1IJKA 16PKA 2X0JA 1ZOIA 2E82A 2PKXA 3DV0A 3GJ4A 4JB3A 4O2AB 4X8OA 3A9UA 5TJ9A 5JPCA 3JPYA 1ZD8A 1UANA 5FNVB 1F8YA 1S3GA 2QTRA 2VKQA 3HJCA 4R2HA 1LDBA 4ZCQA 4V1CA 2YJ3A 1BX1A 2H3EA 3AZOA 3R5HA 4WZAA 4PBSA 5EMNA 4REQB 1WUYA 4IJWA 3KKEA 2V3CC 3CVYA 2QBYB 1G1AA 1KO7A 3MBIA 3T3MB 1OKKD 1JEAA 1LLQA 3DT6A 3Q8LA 1REQB 3VKGA 3HDJA 3HRHA 4ZV7A 3V1LA 3WJAA 4A6EA 4WEQA 2HT1A 4L5AA 3U7QA 4IDPA 1NNLA 2IP1A 1J1UA 3HYRA 4UC0A 2D1SA 4RMNA 5THQA 4KZKA 4A2CA 4A92A 2O9JA 2FMFA 2XYHA 3SLRA 1K63A 1L1QA 3BERA 3DDUA 3I9JA 4LJ6A 4RD1A 5MF6A 1X7XB 1E2JA 2O2YA 2NO6A 1L7RA 2QE7D 3I9FA 3VJMA 1AKEA 3OPYB 1QQAA 1WW8A 4HMPA 3TJRA 4DCJA 1MXFA 4YRSA 1HX7A 2W98A 2NYAA 2NXEA 2OVBA 3QYAA 1RLJA 3QLUA 4JL8A 3Q1KA 4UXJA 3V7NA 2J45A 1TTTA 4KQ1A 5HA5A 4U9HS 2PU7A 1Z83A 1MNQA 4FMCF 5EOVA 4F7WA 4WKPA 2O20A 4LHSA 5LNK1 3QF4A 3H2BA 3GZ4A 3JYHA 4NI5A 3LHIA 3O8CA 4C04A 2FPPA 1XZCA 1UKVY 1V11B 2V9CA 3LSTA 4WERA 1G3UA 1OSNA 1OZGA 1Z7BA 2WLTA 4PO3X 1L4BA 3LO5A 3HJGA 1T9DA 2BDTA 2WHRA 3RQIA 3Q0IA 1JR3E 1JMVA 1Z47A 5DBFA 5AVWA 1ZX1A 2GN4A 3BXGA 3AR3A 4FQ8A 3TAHA 1XXHA 3DXYA 1RRPA 5CLHA 1K88A 1H2RS 2DHDA 4JDPA 3JQQA 3ZHSA 3KEGA 4GRDA 1ZRNA 1NR7A 5AW1A 4JK3A 1KSFX 1GKIA 1Z7GA 2CE7A 4LC1A 4OEHA 3ESZA 5LP6A 3EPLA 3H2HA 4PIVA 2ZEJA 1R5BA 3RRNA 2HMTA 4ZV4A 5ADWA 3K1ZA 3IA7A 3M82A 3ZWCA 1YCDA 1FYFA 3JARA 4FYKA 1Y37A 2HNKA 4P58A 4D2IA 4ZYZA 1TMOA 2CXQA 4RH0A 2EV9A 3UW3A 2BEJA 1M72A 1WA5A 3DAPA 3I5YA 4JKYA 1NJFA 4BIMA 1QE3A 1E2HA 1SK8A 2PTHA 4RESA 3EHDA 4UVHA 1W87A 2IUUA 2GCGA 2ZJ2A 5FWXB 4JB8A 3DEYX 4HPJB 4N47A 3VSBA 3GFTA 2OHJA 1DB3A 2L19A 4AZVA 1F12A 4DIUA 3F71A 1C1DA 4L7QA 2O8FB 4BO1A 1HF3A 4I4TB 1E9EA 4HNSA 3QOFA 1PGOA 1SUAA 1TYZA 2IKSA 2W6NA 3CJTA 1XTKA 3W5IA 2CT8A 1ETUA 4K9RA 1WSWA 2H07A 4L9SA 2IV7A 4O4IF 3RTCA 4OGGA 2QAIA 5KTMA 1YSCA 1EEXB 3IDZA 2H5IA 5JASA 1KMQA 1M2WA 1P2UA 1I7NA 1Q1AA 1XNJA 2BELA 2HOQA 2JI4A 2XWSA 2ZVDA 2BPOA 2C00A 1PJ8A 1FNCA 3CX8A 3HABA 2WT9A 3I0ZA 4PRLA 1ONPA 2O07A 4PV7A 5TPWB 1SXJD 1Q20A 2BJWA 5IM4A 5F1YA 2MSNA 5CLIA 1OLSA 1JDSA 10MHA 4MIKA 4FTWA 4E3WA 4CU2A 4EUEA 1IN4A 5JZOA 5LIPA 4FYWA 1QP4A 2DWCA 5KOHA 4Z9YA 1IXKA 5AD1A 2Z5FA 3K35A 4ALKA 4UXHA 1XVIA 4EI8A 3WQHA 3RAPR 4RIEA 5IYZB 4BWGA 2WVJA 3PDCA 5M04A 2J4FA 1RADA 2ZPTX 4GXNA 2N3ZA 2ECQA 1UADA 3OU6A 2ZW9A 2FZGA 3W4JA 3HI4A 2VUHB 5E6SA 1F51E 2QTAA 3AIIA 1ORDA 1RKUA 2B7BA 2D2EA 3IQEA 4J4HA 3RF7A 3KKZA 4L4XA 2UDPA 1OJ7A 7YASA 5I8ZA 2XCQA 1TC2A 3R3WA 4P08A 4R2MA 3L0ZA 4YAFA 3SEAA 2WF7A 5GJBA 1CUJA 2QVXX 2R00C 2ZCVA 4HUQB 4Z53A 4YB8A 1FFSA 3K9QO 4CFYA 2KE5A 4DIFA 2I6GA 2GZSA 2RB4A 3PRKE 4M6WB 1QIKA 2YOGA 5H1YA 1ITZA 1EMDA 3BIOA 3W5SA 3IPYA 1QZUA 4Q3AA 1KI6A 1MR3F 1PFQA 2X3UA 3UOGA 4BWVA 3GLFB 5DW0A 5L95A 2P41A 5AK4A 3IFSA 4YI5A 5CBPB 1SBIA 2VAWA 3DW1X 4FINA 4L4ZA 2GSDA 1N2CE 3H8JA 1T1IA 3AUJB 3LC1O 3REOA 1UXJA 4LDJA 4DAOA 5H70A 3E22A 4YIKA 3NKVA 5I9MA 4MAFA 1XKXA 5KQMA 1U7DA 4B7UA 1BH6A 3U7RA 4CKWA 3U1VA 3ICEA 3THYB 1GV0A 3BF8A 4FILA 5EGSA 3T5PA 1RJEA 4KACA 3T7TA 1EKXA 5DX1A 2R6HA 1E1NA 1EX1A 3L1UA 4I9GA 2GA9A 3P4UA 5FO0A 1N2CA 3CX6A 5ADUS 5HKOA 2C5BA 3NKFA 4U6SA 5TXGA 5K6RA 2N47A 3S1AA 2R6GA 1Y4AE 1U1IA 1E5LA 4UBJA 4BNYA 1SVUA 4X71A 3ZHCA 4LXYA 3MGBA 1C8VB 4FEEA 2QW8A 2JGEA 4NMWA 1GRNA 3O84A 4QUJA 1HSZA 1CNFA 4RFVA 1QRSA 2CBGA 3HWRA 4M0PA 3HUEA 4PPFA 3VHXA 9ATCA 1PR6A 1Y5NA 5A4MS 1IY0A 2ZIXB 5ARCA 2PRSA 4YACA 5BRAA 1UBNA 1IQPA 4G9GA 3F49S 4G8JA 3UIEA 2XF2A 1S8NA 1SKYE 1YOVB 3RNOA 1KI7A 4JLBA 3B6MA 4IVRA 3BQNB 1J0XO 4OU5A 1U3VA 4J90A 3RSOA 2OBFA 1O6FA 1Z36A 2WA1A 2H1FA 2QRVA 3OFJA 2GKOA 3U7GA 1LPSA 2J0SA 2VQSA 5HJ7A 1ST3A 4FIDA 4MVYA 4B9EA 3ZY6A 3JRXA 4YX9A 1ND5A 1Z2DA 2R62A 1MC1A 1EFPA 3OZEA 3RTBA 2GCEA 3D64A 3NFYA 1C4KA 3IDFA 4KXMA 4Z0HO 1Q2UA 3BA1A 5GONB 3ZY2A 1E5XA 3CF4A 1MQSA 1XN1A 3EXFB 4QDJA 3LUJA 3HB9A 4CIYA 2I9KA 4LOHA 5AOVA 5HM6A 4R8KA 3ZYZA 2WBLC 3PCXA 1FNMA 4GYYA 1N9GA 2Q2VA 2ZRMA 2OM2A 1XJCA 2FUG1 3PDUA 4HRXA 4KDCA 4UNNA 3HO6A 4LF6B 2C98A 1ZUIA 3LV8A 4MKHA 4QYWA 5EWJB 4Z2YA 2QL6A 2YR0A 3F9CA 4CF3A 4GMXA 2K7FA 1VKZA 2PCJA 2NO1A 2R8PA 4YRQA 3VKWA 4M7PA 2YQZA 1DKNA 1NQAO 2P67A 4PLVA 1PDWA 4GVXA 4R3WA 4RY8A 3GT3A 1N6KA 4X5OA 2XKAA 1N6IA 1LDGA 5E0OA 2XLCA 3D8BA 3KQOA 1NVKA 1YQEA 3RUCA 4CKCA 3IV9A 1PS0A 3DJFA 3PCTA 4C3ZA 1T6XA 5KHLB 4MDYA 5FOUA 5AUQA 4HGQA 4XQEA 2WD8A 1T9BA 4K5QA 1CQPA 4HQNA 1NC3A 1T9KA 4KK4A 4RA6B 1NQ5A 4U3JB 1OXSC 2ZI6A 4BXOA 1Z5VA 3BK7A 1QP7A 3BRWD 3SC2A 4PFQA 5JSHA 1OWNA 4BLVA 4TROA 2Z5VA 2XPCA 4L0MA 4R8LA 1XTBA 4KUGA 2B1IA 1MC4A 3BMOA 3WRYC 1JNYA 1CQWA 3C3YA 5LCXA 4ZA2A 4Z7QB 1WOYA 2WSIA 1BD3A 4GKKB 3KEOA 2AYZA 1UK7A 3L1HA 1N0WA 3WLPA 1OB5A 1GN9A 1R0XA 5EPUA 3LHDA 3HJHA 2WTEA 1A9QA 4MQBA 3W7BA 5GGXA 2DQZA 5B30A 3ZLBA 1OV6A 3KQKA 1DE0A 1YR1A 4JWTA 1AS2A 4HDAA 3SHQA 4JYPA 4WT7A 4ENQA 2XTNA 1JP7A 4Z49A 5CVTA 3COZA 4JJ4A 1E6EA 1MENA 4NK5A 4YP7A 6ADHA 4HFMA 5B3JC 3LY7A 3V7YA 2Q1TA 3Q9LA 4QXPA 2OWDA 4DMMA 1RJWA 3D6MA 1IBMB 3MMSA 3OT1A 2VDNB 2G76A 3GGJA 4TKUB 3AVXA 3IV6A 1I9CA 3HS3A 4YJFA 3J81k 2QX7A 2VSFA 3GFGA 3QE4A 4J91A 4N54A 4DREA 1SUSA 3IUQA 4RLHA 3KL4A 4NZZA 1IXZA 3F8WA 1HRDA 3ST7A 2CZCA 5EIFA 1XELA 3UMVA 2O2HA 1IDN1 5CD9A 2WYUA 3AQ4A 2JH8A 4M1ZA 4TLDA 1WW3A 4LWOA 3QMVA 4BFUA 2WNHA 5IJAA 4M9CA 1ZLXA 2TS1A 3OH8A 5J9FA 4DJTA 2QMQA 1MJFA 1RKXA 4CR8A 4AQYB 4Z1OA 1NAHA 2FUKA 3X2FA 4F91B 1P4AA 3HI6A 4DMGA 4BLRA 2W70A 3QU2A 4GQIA 4WGGA 3ISTA 1XEXB 1Z5NA 4IFIA 2XNDD 2HLHA 2HAEA 1KKLA 1L5QA 2YHBA 4QNNA 1VPTA 4YJ3A 1AUQA 2NTJA 1YVRA 1VGRA 1OGJA 3W0LB 4HO1X 4M9SA 1X38A 2ZYRA 3TEJA 1A2KC 5CVJA 1FX0B 2FMKA 2AMYA 4JMLA 2QPTA 5ALDA 4PYKA 2FZCA 4QRIA 4LNAA 2O7NA 2VDUE 3GAFA 4J49A 3S40A 1O57A 1QIDA 3ECAA 1Y3FE 4IP0A 4MVJA 2J6IA 4B6GA 4ZI7A 4ZKDA 4GXRA 4PLGA 2IPAB 3EFEA 2XNJA 3GRVA 4GPAA 1KFCB 4N9QA 4WHMA 4ZAWA 4D9EA 1N7HA 1WU7A 2RHCA 3D0RA 4CF4A 5JC1A 4UULA 4L4SA 4OUDA 5L40A 2WICA 5U4XA 4MV1A 1XD9A 1D2EA 1TIKA 2G9ZA 2IKQA 2WWRA 3E4CA 3KZMA 4L4UA 1NM5A 4XFKA 1O6ZA 3CUWA 4FT4A 5CJPA 4EW6A 5JFTA 4RTRA 5ALHA 2JZOA 3BMQB 3MWEA 1CQIB 4G0XA 1MXHA 1RS0A 1PSDA 3C87A 1Q1BA 3LPDA 5KSWB 2PJDA 4OI1A 1JU9A 2Z5LA 5E95A 3UT5B 2VHYA 2H8KA 1SPXA 5JZSA 2D8AA 5IYZF 4QJBA 1M2OB 2R7NA 1L5RA 4WJZA 5THKA 2EX0A 4UUBA 5JBQA 1VRVA 2G8NA 3HGTA 5C5CA 1VMIA 3U16A 2VLIA 3BMNB 2JZNA 1NW3A 3L0PA 3URKA 3WGGA 1R6DA 2CDNA 3HR4A 2JIBA 4JT4A 5HDQA 3TRKA 3UF0A 1NJ8A 4BB0A 6CHYA 2OBLA 3RC8A 3RAFC 4EB8A 3PX2A 1YBMA 4JR2A 1IRXA 1FYVA 3CZPA 4DSAA 4QBKA 4XA8A 1E7MA 1WQ4A 3FYCA 5EJAA 3ZJYA 4ENWA 4FFNA 5L4SA 1KK1A 2JFVA 3EUEA 1J56A 2R4UA 4GGOA 1HNZB 4DRYA 4B0OA 3RC1A 3LCRA 4KXYA 2JCSA 2PXXA 4XGQA 3NR2A 1ZAYA 2Z9BA 2CDRA 4G5OA 2I2CA 2N75A 2QRJA 3IQHX 2CNBA 1L4MA 1C0PA 3TYXA 2H1WA 5IXYA 1NBEA 5EERA 1T9AA 3UZUA 1RBMA 2D5CA 4HSGA 4HX9A 4RETA 5AIBA 1CUVA 5LJIA 3QX3A 2DOKA 3RVJA 1RI2A 4DLZA 5HPYB 5FD8A 3ROQA 3PVCA 3BCRA 5AP9A 1BN6A 4U02A 3QBTA 1RXYA 3WGOA 5ECGC 1I1OA 4MVJP 3JQRA 4PZEA 3K6JA 2W83A 3E7FA 4WLEA 4YAJA 4BKRA 5JS6A 2I7CA 4ITUA 5K3EA 4NESA 4EVRA 4DOMA 2NNWB 3PNSA 3VNBA 5D84A 3MTBA 5AJYA 2VA9A 5JLAA 1SOMA 2ZJ5A 3HA2A 3Q10A 4FFRA 3TMAA 5CDFE 1DAFA 5DI3B 4ATNA 2ZIZA 2AOUA 2NO0A 2WYIA 3AT1A 2D2VA 4P4SA 1DCMA 1TRKA 4FNMA 2H65A 1XQWA 1QIEA 2AFIB 1H69A 2G9VA 5KQRA 3CVJA 4II7A 2N42A 3V1YA 1OMOA 1W30A 2CWWA 4QX6A 1FQOA 4ZPJA 5DE3A 3WSVA 3ZU6A 5JJ5A 3KQTA 5BQ5A 1E0SA 1KK3A 1JHPA 4XPZA 3II6X 1KYWA 3NDRA 1U7UA 1DRJA 3CA8A 2EEZA 2I6FA 1G7RA 2Q5HA 5A3JA 2PZLA 4LY6A 1MBZA 2NXNA 1ADJA 4R2WA 1EXVA 1NM5C 3L7BA 3THSA 4YAKA 3FVWA 2CL7X 3KPJA 5IBPA 2BCGY 2AEFA 3GJ3A 4D79A 5K6AA 3PNYA 1C3XA 1A82A 2VH2A 3AOEA 3HCOA 4V2UA 2F3SA 1TMYA 1U28A 3LT2A 2WTXA 3RR2A 4JVLA 3ELUA 4YHHB 2ZTSA 1P2FA 2GSWA 3QKRB 5EE9A 1KH2A 3UB2A 4J8PA 3SEQA 3KZNA 4E22A 1JHUA 4ZIRB 4ZQCB 1SCAA 2OMKA 4D97A 4KE9A 4DRZA 2P2CA 3K7EA 2WIGA 3W1WA 2GZMA 2W6IA 3CLKA 3GLGB 1P9OA 2GM3A 2PHZA 1YQGA 4HNGA 3HJAA 3KVYA 4RVGA 5D86A 2VHXA 4G07A 4BKPA 1JA9A 1MQ9A 4LN1A 1DUIA 2DBYA 5EJGA 1XX6A 2WU1A 4K9OA 1VE1A 4RF2A 2VIIA 4O4HA 4KW7A 2D4AA 5JDIC 3E9EA 4NBKA 5DLQC 3GFFA 1FDRA 3U0BA 1YASA 4EY8A 1OWLA 3DCNA 5JAOA 1ZWKA 2O52A 3CLRC 1UZLA 3DO8A 3GH3A 4P3OA 4LSGA 3S29A 3WYBA 4BGUA 1OF1A 1RI4A 2ZRAA 1T4GA 3AEXA 3RIMA 4LDQA 1GQRA 1JXOA 1QJ4A 2UUBB 2EDAA 2PIDA 3VAAA 1ISHA 1KYIA 3BSSA 3QWBA 4HX5A 4F72A 2Z4SA 1Z7EA 4PCLA 4KFCA 1RIIA 3IJEB 5KIAA 2CLHB 2JGJA 5HIKA 3M83A 4PX9A 1JTFA 1PG5A 4MO2A 4D44A 3RTEA 1SU6A 3GFOA 4IH4A 1PEYA 5HQ3A 4OXQA 5LLTA 2ZDGA 1Z0FA 2OECA 4B82A 2HO4A 3VTKA 2A92A 4PG8A 2F59A 3THRA 1RKQA 5LLSA 4X95A 3NWBA 2ECFA 3QLUC 4K9DA 2ZUWA 1E9FA 3NHLA 2GVNA 3DAOA 1PT9A 1H5UA 1WB9A 2AX4A 2I7XA 5DVZA 3L7OA 2HWUA 3HCFA 5IEBA 1SZJG 4ER3A 1JFLA 1MX1A 2E4VA 3VR4D 3X2SA 1QGDA 3O4RA 4DCTA 1QG0A 4AKIA 1NVWQ 2GHIA 5K0NA 3PUKA 4YRDA 3U44B 2QM7A 3G89A 1QS0A 1YFJA 1Q7BA 1TCBA 3O8BA 5K8JB 4Y2HA 2EBUA 5LYJA 2W2PA 2IH2A 5K51A 4OLBA 1M3SA 2B4QA 3MTGA 1QVVA 1TO2E 1MJ5A 4DSZA 2O8CB 4BRZA 4ZDJA 4DXAA 3FWNA 4CETA 2RGYA 4NC9A 1KIMA 1K92A 3B1XA 5D1HA 2VWHA 3DLPX 4LF4B 1UODA 3BTVA 2QZ9A 4TXLA 2DWQA 5BSEA 5JDCC 3CG0A 4JQYA 2QE7A 3L0CA 4HLNA 4HB0A 5FR1A 2ZIEA 4AL4A 1NF3A 2YV1A 4EIWA 2X6QA 5BN5A 2GFQA 1KEUA 1E94E 2XMQA 1Z5OA 2XVYA 3E5RA 2HSDA 3A7DA 3D2AA 3LZ6A 5TJHA 3N2EA 2Q2NA 3Q5GA 5COAA 1NW7A 2QLMA 1RYMA 3PRYA 4OM8A 1EBBA 5KU7A 1E92A 4ALJA 1QANA 3Q2KA 1CW2B 2Z4TA 1NVXQ 1EB9A 1OIVA 2OAEA 3EH1A 4EWLA 1QGUB 1LW7A 1DEXA 4Y67A 5LQKA 3F6CA 4PTZA 5F3DA 1E0DA 2YVAA 3B13B 1GZ6A 1L9XA 1XF9A 1ZSYA 3FTCA 5DPMA 2NVBA 4DG9A 4D4MA 1N2ZA 1QVAA 1X1SA 1XRLA 4CMKA 3MJCA 2RONA 4N3BA 5IM5A 1NTRA 4X8HA 4IIBA 1SUDA 3SYKA 4AUKA 2Y2UA 4IIUA 4B44A 1FQJA 5BMVA 2QM0A 4JSRA 3RWBA 3WL4A 3DM9B 2CJPA