1HEIA

Structure of the hepatitis c virus rna helicase domain
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
443
structure length
443
Chain Sequence
NSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Helicase
molecule keywords HCV HELICASE
publication title Structure of the hepatitis C virus RNA helicase domain.
pubmed doi rcsb
source organism Hepatitis c virus (isolate 1)
total genus 138
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 1heiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1heiA01
3OE7A 1I4DD 2CNWA 4QBIA 2NO6A 1GRRA 3I1FA 2NQ2C 1IONA 3OEHD 3ZDQA 1UJ2A 5CDFE 1AGPA 5DGXA 4KITB 3SC3A 1IN4A 2REBA 2ASEA 3OF5A 2OT3B 3NWJA 4TMXA 4EKDA 5EUQB 4BUJA 3U5ZB 3VR6A 2QZ4A 4XWAA 1R5OA 2FSHA 4A0GA 5BW8A 2RGAA 3RSOA 1OV4A 1ANKA 5B58C 4GP7A 4OQNA 4KSCA 2FGJA 1YVDA 3TE6A 4FMBB 3EC1A 3B7GA 5D3MA 3ZVRA 4Q7KA 5FOWA 1KO7A 3CO5A 1IXSB 2FF7A 3G82C 3E1SA 5JEEA 3ZH9B 2IS6A 2C8VA 1AN0A 5J40A 2TMKA 3BOSA 1GM5A 1G1MA 3J81k 3QXXA 3P1JA 3K09A 1NKTA 2BDTA 1CS4C 1LS1A 4KFSA 3GLIE 1YQTA 1E9BA 3QE0A 1G16A 3GLIB 4HLCA 3ZIAD 4R2HA 5F3WB 4TMKA 1UDWA 1QHHB 2GCOA 2ZJ5A 4R9UC 1HUQA 3WY9A 5JLJA 1YZTA 2BCGY 1P9WA 4AURA 3W34A 3U7HB 3EARA 5DHAA 3QF7A 2QP4A 4TTPA 4HDCA 5GVRA 1D5CA 3WXMA 1GKIA 1DVRA 2H7VA 3RC3A 1OHHD 1SXJA 3FHTA 5HE9A 5B30A 3EX7C 3RHFA 3MGCA 4IDQA 1E32A 2KB0A 4JT4A 1M7GA 3EG5A 4NYJR 1MO4A 2ZJYA 4LCBA 1BKDR 4Q9KA 4OK5A 1XTQA 5CYOA 3KUCA 4M9XA 4A15A 1C9KA 1CJTC 1MT0A 4FMCF 1XU4A 3KTAB 4OI1A 1TEVA 4OI0A 3FKQA 3IPYA 1KO5A 1RRGA 2ZRIA 1B0UA 4LHVA 2E87A 1E6CA 2QE7D 5FTMA 1OKKA 4PC2A 4B32A 1W44A 1E9RA 1KDOA 2GXQA 3AKYA 2X77A 2WV9A 1JXMA 3RANA 4G5QA 3OFND 5FUVA 1XCGB 3CIOA 4G1UC 1Z0IA 4RD4A 5FL3A 2GF9A 1W48A 3SFZA 4G01B 3T34A 1DARA 4DT1A 2ODEA 4V0ME 3WP0A 4JVLA 4OI2A 2W2TA 2SHKA 5TVKA 4TL8A 1R0YA 4D4JA 4QG7A 5GADl 2CEAA 1D2MA 4GZMA 1Q12A 1XXHA 1PLKA 2ZYWX 2V3CC 2LKDA 1CR0A 1UKYA 3LQRA 4DUGD 4N0DA 4CEHA 1F3OA 1YZLA 2EVWX 2PL3A 4R71A 2FWRA 1PZNA 1X8JA 2YOHA 1EX6A 2JASA 1VIAA 1KAOA 2IK8A 3IEVA 2C96A 2VP9A 4TYNA 1A1VA 2J7KA 1I2DA 2RHDA 4ARZA 3FGNA 5EXXA 3W3AA 2OXCA 1AA9A 1G4UR 4LJ4A 4Q48A 4OJQA 3DOEA 2ZI9A 3QPVA 3AVPA 3MWJA 2QAGB 3WBJA 4K8OA 1P7CA 1A2KC 3T12A 2MMCA 1UEIA 3QKSA 2JJ2D 3QENA 4UNRA 4KI0A 1WA5A 5HZHA 3Q85A 1OFUX 2R44A 1W36B 2CVHA 3SBEA 3IQXA 1M74A 3QBVA 3VX4A 4CZ2A 3AGQA 1OXXK 3B60A 221PA 2GVDC 2GXSA 5DN6D 1NL3A 3RRYA 4TMWA 1YRAA 4A36A 3THOA 3O8DA 4PX9A 2ZRKA 4FCWA 2OBLA 1XWIA 3VQTA 1E94E 2GJSA 2YJTD 3TR5A 4M9ZA 3VU9B 3NBFA 2ZITA 1OT3A 1N25A 3QXCA 2FA9A 2BWJA 1E0SA 4LUCA 1OH5A 3BJIC 1HEIA 3AQ4A 2HF9A 5EP2A 5CB6A 2J59A 4JLOA 1P61B 3MSXA 5F9HA 4KSBA 4C3ZA 4F4IA 4DLUA 3FFBA 1EFHA 4WZAE 2ZRLA 2HEIA 2V4ZA 4CT5A 3B9PA 4D82A 5KDDA 4ZIRB 3THXA 4GDFA 2C9OA 5BYJA 2VRWA 3RC8A 2H5EA 4BZQA 2R2AA 3A1VA 4HLUC 3B13B 1FNNA 3LXRA 1NMZA 2ZRNA 1UAAA 3MWLA 3U4QB 4Q19A 4PC7A 1J99A 3GJ0A 3RWMB 1G6OA 4M2LA 1XMVA 3WNDA 2QPAA 1OPXA 1W4RA 4DC9A 2NO0A 4B35A 3VTKA 5FTKA 4DLTA 2HV8A 1SKQA 1PV4A 3UIEA 4Q4LA 2REOA 5JS7A 2CLDX 3RWOA 3UXMA 1JEDA 1T0JB 1XJCA 1WP9A 4LHYA 2DPXA 5FFMA 3TUJC 3ZGXA 2GWHA 4AK9A 2WSSD 5GJCA 1L4UA 1QHNA 4DWJA 1S3GA 2N42A 2J41A 1KOFA 2ZI5A 1WQ1R 1S9HA 3GJ4A 2NZJA 4ILEA 4KYUA 1Z0DA 2VF7A 5HR5A 2HJVA 2JGNA 4Q01A 2ZXUA 4B76A 3KXIA 1EFTA 1ZCAA 2J7PD 3A58B 4B6FA 3SS8A 5FPHA 4Q7LA 4UNSA 3CUEF 1QG4A 3KZ1E 3R20A 2CXXA 1JBKA 2W6JD 1SGWA 3LXXA 5H70A 1MABB 5H68A 3U2QA 2D7CA 1KI9A 1CJKC 1S8FA 3SYNA 4UNPA 4NCJA 2CHGA 1IXRC 3S1AA 1KHTA 2GJKA 1DELA 2CHQA 3B78A 5EXPA 1CKEA 1Z6AA 5CDFA 4FCVA 3QKRB 2OZEA 2J0VA 1H8HD 1OF1A 3MJHA 2R65A 5FUXA 4NPHA 2BMJA 3IIJA 3KQUA 2PJRA 1IJEA 2QMHA 3EIQA 4Z51A 3OEED 1R8SA 2Z4RA 4LJYA 4ZCIA 2KBEA 2EFEB 3K70B 2PCLA 5J4VA 1CR4A 3GQBA 1O3YA 3RSLA 3EXAA 1N0WA 2WM9B 1SVWA 1G17A 1HT1E 3GD7A 4QM6A 2V7QA 3PCRB 4HSEA 1W7AA 4RD6A 2GESA 3I8SA 3A1UA 1ZNWA 2ERXA 2C95A 4MGZR 2AD1A 2NIPA 2W2VA 2E1RA 1AQUA 5DSZA 4DLXA 1RRFA 2ZSAA 4QBGB 4YC7A 5C4GB 4EFNA 3CRQA 1CEEA 4AYTA 3EA5A 5JSZA 3FMOB 2A5DA 4FIDA 2ERYA 2QBYA 3K9LA 2F6RA 4JKIA 1E9EA 2FJUA 3THWA 1Z0AA 2QTFA 3ADCA 2VL7A 1VG9B 3NXSA 1H8ED 2OFOA 4QHSA 4D80A 5FTLA 4TT3D 3T1OA 2GVZC 5CITA 4P32A 3N2EA 1AKEA 3FKSD 3GLGE 1JI0A 2QGZA 1ZM9A 4BGDA 3GLGB 4IJMA 3KKNA 2QT0A 3TMKA 1D9XA 4GNKA 4YDSA 1NLFA 2G3YA 2OBMA 2ZREA 4DLWA 4GL2A 2IYLD 3AVQA 4M1YA 1XP8A 2GRJA 2QAJA 3Q8XB 4OL0A 2WWWA 5KDLA 2W6ID 1WCV1 3EWSA 2RKOA 4PZLA 1KAGA 5EE3A 3W5JA 4IRUB 5BWMA 2WWIA 1CBUA 1GIAA 2O8FB 1Z6GA 4A2PA 4JLPA 4Q1FA 2VHJA 2WJJA 2N46A 4MYUA 1E1RD 3IDQA 4ABYA 2F1HA 3CRW1 4GMXA 3GP8A 3ICQB 4NONA 3X1DA 3RS2A 4R98A 5G53C 1JPJA 4C0BA 1NY6A 3BORA 3DL0A 4QHTA 5FR2A 2X2FA 2HYDA 3RABA 1A5TA 1AK2A 1XEXB 3RDPA 5EE0A 5FOUA 2XTMA 4O2LA 4OHWA 1XCPA 3P26A 3LBHA 2V6IA 1JR3D 2ZI3A 3EZ6A 2EQBA 3NC1C 4OBEA 4CRWB 4RFSA 2Z6VA 2ZJ8A 4ZDKA 5AUPB 4IDHA 1G5TA 4Q4HA 1SULA 1NSFA 1GFIA 1Z6YA 3JVVA 4V0MA 1DG1G 2BKEA 4LPKA 3MRSA 3U3RA 2R6CA 4C9BA 3IHWA 1XJQA 1TPZA 4FD2A 4D0NA 1IY0A 1KK0A 1P9NA 2QU8A 2Y8EA 4TLCA 4PFSA 4MRSA 2G83A 1J8MF 3LLUA 5L3SA 2AWOA 4W5WA 4DCUA 1BIFA 1D2EA 3LBNA 2ORIA 1FL9A 1G5PA 1HV8A 2Q3HA 2WOJA 2HCBA 3JVUA 3OEHA 4RZXA 3TSWA 4F38A 1ZM3A 3WMGA 5D3QA 3R9IA 1P4SA 2AR7A 2ZE7A 2WPDD 4B3BA 3EPHA 1QHXA 2NTYC 2YINC 3D8BA 4ZCLA 4G5RA 2BOVA 1VTKA 1N5IA 1VCOA 1ESNA 2ZYVX 3BS4A 4LYAA 4PC3A 3IPXA 2DB3A 3IUYA 5JCZA 1AGRA 2AD5A 2WKPA 3DZ8A 4JVNA 4M1MA 4PQFA 4TMTA 4B48A 5EE1A 3KKMA 1GAJA 3QPUA 4QFMA 2XB4A 3SNHA 3L8ZA 4PXAA 3PQCA 2ZYUX 4S2EA 2GJ8A 4MITA 4BPBA 1T8UA 4LRWA 1VYVA 1P2TA 5E3HA 2IYZA 2IW3A 1K5DA 3OHMA 1M2OB 2ZAMA 3BH7A 1YR6A 4GSYA 3P4XA 3CW2A 4LJAA 3K0EA 5DIFA 4RSGA 2AK3A 1JPNA 4HB2A 4GMDA 4MH0R 1XJ0A 3FE2A 4KAXA 5D3MB 3RYTC 1G3QA 4ACBA 3KQNA 3GLFE 5HE8A 3QVVA 3TLXA 2FSFA 1NBMD 2J3EA 2PX0A 3O8BA 2B21A 3AB3A 5JI3E 2FEOA 2D2FA 4PZYA 3QY0A 3WHLA 2VSFA 2EW1A 3CONA 4C2UA 2ZE8A 3T5GA 2JATA 1ZNZA 2PBRA 4B34A 5E7JA 5JJIA 4C7OA 1QZXA 1N6RA 1OHHA 3PUVA 3V4FA 2H92A 3K0SA 2C04A 1XBTA 2R6GA 2QA5A 3AGPA 4A0FA 4KU4A 1GRNA 2HYIC 2GCOB 3CWQA 4Z8XA 2EYUA 2GKSA 5KPDA 4DEXA 5F9FA 1LF0A 1R0XA 2QG6A 3V9PA 3UG6A 3ADDA 1P60A 4HDQB 1XX6A 3BB1A 1KJYA 2WMNB 1AJEA 1G18A 1N6NA 4OYHA 3R7WA 1L7VC 2Q3FA 1F60A 2QE7A 4AG6A 1SXJB 4LBWA 2X19A 1U94A 1M1YE 2GZAA 4QHYA 2A7QA 2LWIA 1JR3E 521PA 2PT7A 3K8YA 1W2GA 3OFNA 1QHGA 3VR4A 4I4LA 2VH5R 5DYGA 3EA0A 3E5HA 4BE7B 4Z8YA 4CDGA 1ZUIA 1Z0FA 3BFVA 3JZMA 4Z1MD 2Z83A 3V00A 2ZUDA 1BH2A 5IRCD 4O2RA 2FPMA 1ZU4A 3U7EB 3LV8A 1G8YA 1R2QA 4DUGA 4TYWA 2X2EA 1GNPA 1MRNA 5CYPA 2J0UA 2PCJA 2QORA 4HATA 5J4YA 3TUZC 4JSTA 4QBFA 1Z3IX 4RVCA 2HT1A 2WJHA 4DIEA 3HWSA 2ODWA 3BFXA 1HURA 3LA6A 4PO8A 4DT1B 3MAAC 3LNCA 4PC1A 2P65A 2ZRCA 5EUMA 1UFQA 1H65A 1ZM2A 1JAIA 1XXHB 3GMTA 1L8QA 4Y0VA 1CJVC 4I81A 1BYIA 4BEJA 5J4KA 1ZNYA 2N1BA 2JJ2A 2P6UA 2QTVB 3FDIA 1E2NA 1LS6A 1II9A 4BFYA 2F1IA 3B5JA 4IFBA 1GUAA 1GZSA 1QRAA 4ARZB 3CLVA 3UKDA 3DOFA 2ZEJA 4X8HA 1KY2A 1P62B 5DN6A 3LRPA 4TWZA 3KQHA 1N6LA 3PEWA 4C30A 4KBGA 1R5NA 2AXPA 4M53A 4K46A 2QP9X 3F3YA 3QXJA 3AUXA 1E2GA 3QKSB 2P0EA 1M7HA 4DDTA 1NJGA 2VYFA 2FG5A 3N5CA 2GHIA 2ZRBA 4LSGA 4IXNA 5FBVB 4V02A 1FW6A 4GOKA 1WF3A 3T5DA 3BBPA 1T5IA 3RLFA 4BLQA 5IK2D 4A92A 3WRXC 1TNDA 3LVQE 4PHGA 2A2ZA 1NBME 2PMDA 1AM4D 3EAQA 2IXGA 3K9HA 4H1VA 4XD7D 5ANRB 4TLDA 3PXGA 1DAHA 5JJLA 4WA7A 2LCFA 5CM8B 4ZDIA 1E9DA 3IBGA 3IHLA 4Q9JA 4LV6A 5A0FA 2IYTA 2IS4A 5JMTA 5K8UA 4PANA 4LHWA 1W0JD 4ERNA 3EZ2A 5G3YA 4ZV4A 2DWPA 4A4DA 3ZZUA 4H1UA 4MYHA 1LB1B 2O0KA 3SJCA 3EPJA 3THXB 4LHZA 5TXGA 2GZHA 2QQ0A 5EZ5A 3FTQA 1UPTA 1OSNA 2WSSA 4KV9A 2FFAA 3UMFA 4B75A 4X8LA 2RGGA 1NIJA 4OQFA 3K53A 2BMDA 2CE7A 4JL8A 1HE1C 3EW9A 2ZS9A 5J4LA 4DVGA 4B6EA 1FOEB 1VECA 2KBFA 2J7PA 4LYHA 4AYWA 1OB5A 2WHXA 4AD8A 2Q21A 2G0TA 1UF9A 1LTQA 4JVMA 4MUAA 4XTCS 3ZS8A 1VCIA 3QKUA 2F1RA 2W6JA 3L0OA 4V03A 5TDHA 4ESHA 2J0QA 2H16A 3L0PA 3QI2A 4A2WA 4MA4A 5EJEA 2F9LA 1CIPA 1C4OA 1WXQA 1ZVQA 2GETA 1Z63A 5SZKB 4P4UA 4TQAA 4YMTA 2QPTA 1XMIA 2JLXA 1LY1A 2DFLA 2ZI7A 2BJVA 5J4HA 2CLCX 3H2YA 3NKVA 4II7A 1QVAA 3AF0A 1DE0A 1RYFA 4LBZA 1F2TA 3CNOA 1BOFA 3UG7A 3OEEA 4DEYA 3EZ7A 2ZS7A 4Q4JA 3DHWC 1NKSA 4LX0A 3CKLA 2GJ9A 3S1AB 4BLSA 2GTPA 1VYUA 2GXUA 2W83A 2WBLC 2P67A 5CIQA 4XWKA 1XEWX 3QG5A 3IO5A 1UBCA 3VAAA 4NCIA 1IJFA 4B3GA 2B7CA 4FW9A 3QIAA 3TBKA 1KNQA 1JEEA 2WJGA 3LBIA 1XTRA 3B8HA 4AG5A 3CWZA 1IM2A 1CF4A 2P5TB 1XDBA 2W0SA 1MR3F 1ZP6A 2D74A 4JL5A 4ASUD 4QBHA 3PITA 4HUQA 3B1WA 4MKFA 4WOPA 1U9IC 1IXZA 2EFGA 3MLEA 1H8EA 2KE5A 3BAFA 4XH9B 2BBOA 3TW8B 1K5GA 4IVQA 4WXRA 5F2EA 1FP7A 5FR1A 3GLFA 1I2MA 4URWR 1ZM7A 2ZE6A 1KJZA 1N0VC 3ETLA 4OHZA 3W8RA 4ZI3A 2WOOA 5FL7D 5JSZB 1KNXA 5CIWA 4CYMA 2QBYB 2VP5A 3W6OA 3Q72A 1XD9A 2IYWA 3LVRE 1CLUA 1GVNB 3THWB 1JAHA 1X8LA 2JLSA 4KFTA 1N2CE 2DY1A 2JA1A 2QPOA 2W6IA 4FWTA 3CX6A 2Q9BA 1XTJA 1UBGA 4ZDWA 1Y3AA 3MMPA 1KI3A 3AF1A 3GFPA 4BZXA 1SQ5A 4DRZA 1WMSA 4QGHA 1Z2CA 1NLZA 2G88A 2XZPA 4NDZA 1E1RA 5BN5A 2B6HA 2O5VA 1QG2A 2QMUA 4OI4A 4A1FA 1EGAA 5FH9A 3SFVA 5HPYB 2Z0MA 4D4MA 5KSPA 1XD8A 2QMEA 5JFGA 3OAAD 1BS1A 3ONWA 5G3ZA 1KMHA 1ZC4A 1VG1A 2OAP1 1ZCBA 4ZO4A 1BMFD 3AP2A 1ZD1A 2VBCA 3BC1A 4UXIA 5FBQB 1UDXA 2OE2A 4E07A 5C1BA 4PHHA 1JR3A 4N0EA 4C0HA 3T35A 2YV5A 1D2NA 2IHYA 5L8VA 1S3SA 2ZVQX 5L3VA 3PJRA 4FINA 4V0OA 2QM7A 1U99A 3I62A 2OG2A 4EQ6B 5HCNA 3X2SA 5TY0A 3NHAA 8OHMA 5CM9C 1E2LA 2D06A 1GP2A 2O0JA 3ZS9A 4DZZA 4YXWD 1Z6TA 2PMKA 3VX3A 1XRJA 3I92A 2WJVA 1A7JA 2F3TA 1U8AA 1KDPA 3KB2A 2JAQA 2LKCA 1KI1A 5E7IA 5FUWA 1S2MA 2RGDA 4UXHA 5FOTA 1T5LA 4RFSB 1E2MA 4PZZA 4Q4HB 3C8UA 2D2EA 1P3JA 4A0HA 1Z28A 4NHOA 4LBVA 2W0MA 3V4RA 4N1AA 4Q1DA 3AVUA 1OYYA 1GRQA 5L3SB 2J5XA 5H1YA 3EZ9A 2IYSA 5M04A 4M1SA 3RRZA 1EK0A 1TMKA 4C0LA 4Q47A 2ANCA 3T1QA 1NN3A 2QT1A 5K8IA 3CPHA 1L2TA 2J87A 1ESMA 3RNLA 3T15A 2HT6A 1N5JA 3ZLJA 4HB4A 3HYTA 5E95A 1TTTA 4MKIA 1EFCA 1VCNA 2GCPA 1U2RA 2DCUA 2PZGA 1RFLA 1GL9B 1TF7A 2J45A 2FFBA 2ZRFA 2FSGA 2QEQA 3X1ZA 1E2DA 2A5FA 4Q9HA 4IFEA 1JALA 1NF3A 3I61A 4F91B 1XZPA 3OIUA 1ZM4A 1XPUA 5DI9A 1QF9A 4DBLC 3SBDA 3TAHA 4UJ5A 1NBMA 2C78A 3UPUA 4DB4A 2I4IA 4A8JA 1GKYA 2F7SA 4Q1EA 4HLQB 2OV2A 3HYRA 4LC1A 3C5HA 1NVXQ 4A0RA 5AUQA 4CT4B 4RKEA 5JWOA 4JLDA 3TNFA 1K8RA 3RS4A 4EFLA 1NRJB 2IYVA 3H4MA 1T0HB 1NVVQ 2JLZA 1FPMA 3ADBA 1HQYE 1G4AE 3OIYA 2CJWA 3UWOA 4G3XA 4EPYA 1G7SA 4B44A 1SVMA 5FBLB 4TZ6A 2GA8A 2V9PA 3O8RA 2YOGA 2ZANA 2JIZD 3HPQA 2O8DA 4I1VA 2OCPA 2F1JA 1TL7C 1M6NA 3KXKA 4M4SA 3ASYA 1DEKA 1OXSC 3E70C 2JLYA 1YZQA 2GEVA 3CF0A 4C7OB 3Q7QA 2RGNC 4BASA 3TJZA 3NHBA 1RVDA 1FFHA 2UZ3A 1W4BA 4JLNA 1KKMA 5FTJA 1QVRA 4HZUA 1FX0B 4L4UA 4JLJA 2QMOA 2DFNA 3IQWA 2HXSA 4Z1MA 4GRAA 3SJBA 1S4QA 4OQXA 1ZC3A 2AXNA 2PEZA 4PPQA 4G5GA 3R7WB 4EFMA 3Q5EA 1I4LD 1VG0B 2EWWA 4QOSA 5LD2C 2GAAA 2JEOA 3TQFA 4MRRA 1W4AA 1RKBA 1SVSA 3CX7A 4Q1BA 4RY2A 5SZJA 421PA 2RGBA 2JLUA 4CVNA 2ORVA 3FYHA 1TU3A 4JSYA 4NZYA 5JBQA 2XX3A 1TQ6A 4TLAA 4DXAA 2IUSA 3UMRA 3FHOA 3GPLA 1XZQA 5DI3A 4Q9LA 1U8ZA 3T1TA 4D26A 4DLZA 3KKOA 3IEUA 1U98A 4X8OA 1NVWQ 4RD1A 3U3KA 5DE3A 1C1YA 1ZUNB 1P6XA 2VP6A 2J0UB 4KFRA 1GNRA 4EUNA 2PZEA 4TQUS 5FOVA 3EC2A 4EPWA 5KYKA 3FOZA 5EZ6B 4QJ5A 2NO9A 2NO1A 3X1YA 1FQKA 3PFIA 1KI8A 1ZRHA 3GJ3A 5AJVB 3I5XA 4XVRA 2CDNA 3N2IA 1FQJA 2IS2A 1VHLA 3VR2A 4PAOA 3TVTA 2PH1A 1E99A 1OIXA 4LWZA 4RCZA 1FMLA 3U6KA 1TQ2A 1G291 3SJZA 3EIEA 2ZUCA 4R7ZA 2HXYA 2VQSA 4LBYA 5KDOA 3BD9A 2C5LA 1DAIA 4HUTA 4HDOB 5C46F 4IOKA 5EQTA 5JEDA 1AS2A 1W1WA 2YKGA 3CH4B 1R5BA 1DTSA 4WW0A 2F43A 1KY3A 3EPKA 2ZRJA 2MSCB 4YDHB 5IK2A 5P21A 4IDNA 2JCSA 1VYTA 3M4YA 2AK2A 1G64A 4XD7A 4BRWA 3LW8A 3R8FA 4KBFA 1OH6A 4KLZA 3VFDA 1DS6A 2WKQA 4TL6A 4PSAA 1G7RA 1V43A 2MMGA 2O8EA 3MUFA 2IEZA 1LW7A 3KJIA 5TMPA 1KI6A 1E2FA 2OXRA 4HB0A 2IUUA 1Z2AA 4KFUA 1W0JA 3NBXX 3R9XA 2FPLA 3SJAA 1CJMA 2IA5A 3AVXA 5GJBA 2REXB 4MDFA 2R62A 2R9VA 2VHUA 1OXTA 2ZRDA 3AUYA 1GKUB 4MUBA 4A9AA 2NMVA 2YWEA 2D3WA 1ONBA 3UANA 4YMSA 4EJSA 2BM0A 2PEYA 3NIBA 3B1XA 2D4HA 4C0QC 5JWRA 1P9RA 4LV8B 3GFTA 5JRZA 2E9SA 3KJEA 4LJ9A 3TQCA 4EQ6A 1R6BX 3BE4A 2VTKA 4XSGA 3I8XA 4ZPXA 1ELOA 2NO7A 4B74A 2XSZD 3VKGA 2DFTA 4PHTA 1XNJA 4HAZA 1F2UB 1QHSA 1E1QD 4KO8A 3Q5DA 2NGRA 4P4TA 2VLIA 2ODNA 3B9QA 4PAQA 2XITA 4M1TA 4Q7JB 4JMPA 3GJ7A 2FDCA 2OILA 2Q9AA 2FSIA 5AWFC 5BQ5A 4D4KA 3TH5A 1EXMA 4URYR 1IY1A 2AFIE 1R8QA 1ZYUA 1E4YA 4BWYA 4YMUA 1D6JA 4LYJA 1NN0A 4RZ3A 2ONJA 1FTNA 5BYKA 4L9WA 2FOLA 3TRFA 1B23P 4M1KA 5L3RA 2DBYA 4A8JC 3PR1A 3LW7A 3T1VA 3L43A 1JR6A 3KXLA 4WVFA 4BECA 3TW4A 1P2VA 2OCYC 2GXAA 3C4JA 4K81B 4MRNA 2CK3D 2OESA 4NYJQ 4RZUA 2ZPTX 5HZKA 4P0TA 1VHTA 1SVKA 1HH4A 2OUKA 2XXAA 1ZMXA 1DPFA 4DCNA 3TR0A 1F2TB 2C2HA 1YHNA 1OKKD 4V0NA 2WMOB 4DHEA 1PJRA 4TL7A 4ZKEA 4P4SA 4GOJA 3SN6A 2XOKD 4NKRA 2H18A 4TSFD 2WICA 4Q4JB 2A30A 4QNRA 4I99A 4JS0A 3FWYA 2G0NA 1G41A 2NZ8A 3HR8A 2Z5FA 3G5UA 3VMFA 3I4LA 3A4LA 4B33A 4LI0A 4DSOA 3D7MA 5DO9A 3QVUA 3QPWA 1DAFA 5KNBA 3EPLA 2RGCA 2FGKA 4HAYA 4FMDB 3GEIA 3QKTA 2BEKA 1JNYA 2OLKA 5LD2B 4AKIA 4CGZA 2BVNA 3BERA 1EFRD 1YJ5A 1NY5A 2GJAA 1N5KA 2I1VB 3CH5A 2VHCA 4IOMA 5FL7A 4DSTA 4B3XA 2MSDB 2ORWA 4MYCA 2FNAA 2KJQA 4HUQB 3AKEA 4D25A 2AFHE 4Q1AA 2BM1A 3ZIAA 5B2ZA 4JBYA 1Z29A 3BIFA 1SZPA 3GLFB 1N3BA 3SEAA 2YC4C 4UNQA 3WNCA 3WYFA 2ZROA 4B3DA 1Q3TA 2VP0A 3DPUA 3HU2A 3LDAA 1U0JA 4Q4AB 4QKQA 3ASZA 2QL6A 1NMXA 3OAAA 1UM8A 1TF2A 1NJFA 5DH9A 2NG1A 3P20A 1KDRA 4XSHA 4ESVA 3FHCB 1BMFA 1DG3A 2IL1A 4AKEA 2V54A 3LY5A 1D9ZA 1FX0A 4XVUA 3C41J 4DSUA 3DMNA 4W7SA 1Q44A 3KQLA 1KIMA 2WIAA 4V0LA 3Q3JB 5JECA 3A1WA 3ZD6A 2EFHB 1E0JA 3CRMA 3REGA 3KDSE 1U9IA 3AF2A 3L0IB 5TV2A 2GZDA 2B7BA 3OESA 3H86A 4YONB 4YXWA 3H84A 2ZJAA 1KMHB 1Q1BA 4KHZA 2ZJ2A 4BFVA 3BFKA 4M1WA 3EIHA 4M22A 4B3FX 3GLHA 2DFKB 4JJKA 3KB1A 5AJZA 4V0KA 4F93B 2WJYA 3FMFA 1ZD9A 1AKYA 3ZVMA 2EU8A 2ZIAA 1MH1A 2ATVA 3F8TA 1XTSA 5DLQC 4ON9A 3NBZC 2BHRA 1X6VA 2A78A 2VPPA 2W2XA 1YZNA 4C0AC 1JQLB 4MKGA 4C0KA 5B57C 4YMWA 1N6KA 4HZIA 1CULC 3BK7A 3SQWA 3A36A 1S96A 4URZR 2W58A 3HP1A 3TUIC 1G20E 4OJKA 1JXOA 3PVSA 1T4GA 4NCHA 2BBTA 4JT2A 1E9FA 3L0SA 1T8TA 1TQDA 1NLYA 2ECKA 4IXMA 3U44A 2V8OA 2GBLC 5C4MA 1KO8A 3X1XA 5FPTA 2WVJA 1ZNXA 4OK6A 1W5SA 4QXAA 5BN3A 4HAVA 3AP3A 4YLGA 1T3LA 1E9SA 2UVQA 3AV0B 1J2JA 2AN9A 4C4PA 5LDDC 5AJXA 2CL0X 1LFDB 1G21E 5C18A 2YWGA 3QBTA 2GK6A 3QF4A 3WRYC 1KGDA 3SR0A 4EJSC 5DNYB 1E2JA 2IYUA 621PA 3VNVA 3PIRA 2RCNA 2CL6X 1OYWA 2VHTA 3W90A 3PENA 4MGKR 1NG1A 2V1XA 2B92A 1COWD 2QNRA 4OKSA 1E9CA 2F9MA 3B1ZA 4YMVA 2ZR9A 4JJZA 2HCJB 2CHVA 1NVVR 3NH9A 3RAPR 3CB4A 3VR1A 1CU1A 4M8NE 3A8TA 1W49A 4NYIQ 2K5UA 1E79D 2IXFA 2YWFA 5KO2A 1NSTA 3K0CA 5GJWC 2BCJQ 5AJWA 4MRVA 2B8WA 4KVAA 4JLBA 2YC2C 4A8JB 1II0A 3TAUA 2IC5A 2ZR0A 1G5RA 5JWHA 2OEPA 2V7QD 5FI0B 2VHQA 4B2PA 3U3JA 1NNEA 1IN7A 1SHKA 3B85A 3K0AA 721PA 3RS3A 1PVOA 2CCJA 1Q1QA 1NP6A 1G8GA 1VMAA 1N6IA 1TUEA 1XPOA 3BH0A 1CXZA 4Q21A 2QN6A 2CJWB 3AVYA 2QQEA 2A5GA 5JHHB 1RJ9A 1KSJA 1KI4A 4G5OA 1F2UA 1E2IA 4WBSA 3LH5A 3TVDA 3SHWA 1GG2A 2DYKA 4B3CA 2O8DB 3T61A 1W46A 3DM9B 2FZ4A 2G9NA 2BV3A 4IEEA 4JBWA 2QSZA 2NOAA 4FN5A 2W00A 3QQ5A 4MDEA 3Q9LA 1G3UA 4DSNA 2ZE5A 4NYMQ 5H8WA 4MGIR 4PTLA 1TAGA 4D4LA 5SZHB 2YHSA 2R6AA 1AS0A 4HZUB 4GFDA 3VKHA 1G3IA 3CX8A 4DLVA 3H0KA 1YR9A 1FUKA 4LK2A 3PV0A 2QGNA 2I1QA 2V6JA 1G8HA 4FCTA 4E5UA 5J47A 1N5LA 4KXFB 5GVSA 1XEWY 3I3SR 3NEYA 1CR2A 4RD0A 2JDID 3UMSA 1Z8FA 1P75A 2C03A 4IKEA 1X1SA 4OK3A 1T91A 3KKQA 2J0SA 2BJWA 2ZSDA 4TYQA 1MKYA 1MOZA 1W4CA 2IXEA 4HI0E 2ZAOA 1WB9A 4JL6A 1OFIA 1H8HA 4L9SA 2Q0HA 3A4NA 2D7DA 4O0MA 1HQCA 1GOTA 4J0QA 4DCSA 3NTUA 3OIWA 4W5HA 1XCMA 2OLJA 3G0HA 1Z5ZA 2RGNA 4G5SA 1DAKA 4OHVA 1QHIA 2FMXA 5DI3B 1Q22A 4RJLA 2XZLA 3F5FA 1JJ7A 3C7KA 2ZTSA 3W6PA 3HJNA 2G6BA 2O8BA 1W2HA 2I3BA 3LX8A 1OH7A 1WE2A 3ZD7A 1Q0UA 5FPKA 2ZUBA 1G3RA 1N6OA 3SU8A 3OZXA 2ZRMA 1IN6A 1SVOA 1SVIA 3ND9A 4JVSB 4I1OA 3WYAA 1RPZA 3SYKA 2DHRA 4QM7A 1KSHA 4MRPA 1P73A 4PC6A 3RRMA 1KZGB 1FNMA 3SYLA 1ZIPA 2VP4A 1CRQA 5A4JA 4N3NA 1VIYA 2GILA 3U3OA 3DVLA 1YZKA 1PUJA 3UATA 1UADA 1E2EA 4TT3A 3SOPA 1RRCA 4DCVA 2RAPA 2H1LA 3FKSA 2ZJZA 3QG1A 5EE9A 2XTNA 2F43B 2FEMA 4I1UA 4S35A 2GF0A 2OO7A 3K1JA 2IEYA 3U7FB 4Q4AA 4AYXA 3CM0A 4P31A 3CNNA 3SI7A 4LHXA 1W36D 4UJ3A 3WBKA 3GJ6A 3VKWA 4PO1A 3LAWA 3RVBA 5DYIA 2JLQA 3NDPA 1OIVA 1F6BA 1G3MA 2O8EB 5G41A 2ZVPX 2FN4A 1KI6B 2EFCB 1K6MA 3ND8A 2HUPA 4IDPA 3GCGA 4IEIA 3L8YA 4BLPA 2KI5A 2KWIA 2OHFA 4E09A 4ZDJA 5KU1A 2VO1A 5G40A 4UXJA 2RGEA 3R8CA 4P33A 4TTRA 2XSZA 3B1VA 1Q57A 1KO4A 2XTZA 2FZLA 1U0LA 3VR3A 5JZVA 2O8CA 1S1MA 4EJSB 1E1QA 3W9YA 3WP1B 4QC2A 3PUXA 3TIFA 1AQYA 2G1JA 1EG7A 1SHZA 3DKVA 1CJUC 2RMKA 4F4CA 2AL7A 1G8FA 2HF8A 1RC8A 821PA 4H9GA 2P3SA 4ZCMA 4QGFA 4FMDF 1KZ7B 2FFHA 2RH5A 3A37A 1VCMA 1ZBDA 3KKPA 3Q7PA 2AWNA 2CE2X 2Z43A 4GZLA 3ZZTA 3K70C 5GJVC 2GNOA 4AWXA 3IILA 2IBMA 3KFXA 4HLDA 2FFQA 1I4TD 3SHFA 4B2LA 1LF5A 1T9HA 2UZIR 2XNDD 2BEJA 1OW3B 4RD3A 4CW7A 5AUOB 2CK3A 3K0FA 5IHPA 1DADA 1P2SA 2OFWA 5L3QA 2CVFA 1HYQA 4WZ6A 3NBYC 2WAXA 2WPDA 1YR7A 1EWRA 1IHUA 1UBFA 2WZQA 1XEFA 1S1CA 4UNNA 5FTNA 1P2UA 3K0CC 4M9QA 3T06B 4BZPA 1Q1EA 2ZRPA 3P32A 2YZ2A 2XOKA 2P5SA 1SVLA 1V5WA 1Z0KA 4TSFA 1GSIA 1RE0A 1GDDA 4B43A 4EDHA 3PEUA 3RS7A 4CEIB 3FMPB 4OHXA 5IF9A 1P5ZB 5KNDA 1G7TA 5LB2A 4ACAA 3LLMA 4Q18A 2XXAB 4L16A 4JBXA 4EPXA 1A4RA 2IHBA 3SE0A 121PA 2XB2A 4FI3C 4MGYR 1EFRA 4P4SB 1RRPA 1F48A 1DO0A 2WWXA 3CZPA 5FPSA 1G9XA 2OAQ1 1AZSC 2YVUA 3KJGA 4O25A 4U5XA 2X8AA 4RD2A 4UQOA 3WYGA 5KTYA 1DAGA 2VP2A 3AF3A 4LOAA 3K70D 1M34E 4C0JA 2CCGA 4TMVA 4BFUA 4GPTA 4HB3A 3NG1A 1E2HA 2IYXA 4EPRA 4PPGA 2FU5C 4HEJA 2QSYA 3EWAA 1UKEA 1N6PA 2CMKA 1R10A 2Q3MA 4CEJA 1W0KD 3EASA 4QRHA 2A5YB 3AKDA 5EP3A 2IS1A 2HJGA 5HKKD 1DOAA 5ELXA 3AVWA 2WIBA 5FBWB 1NI3A 1UEJA 4EIWA 1II8A 2Z4SA 1RZ3A 2IYYA 2WWHA 3GJXC 2IX3A 4A6XA 2ZU6A 1E2PA 1N6HA 4Q7MB 1OLOA 1G6HA 2J46A 4UKDA 1TQ4A 3FPAA 4YQFA 3U6BA 1AZTA 2B8TA 2HLDD 5JJKA 4A6PA 2WWFA 5IT5A 2PLFA 2CL7X 4XWOA 1Z22A 3CR8A 5BXQC 1NG9A 1VPLA 1A2BA 1N0UA 1MV5A 4LDJA 4JLAA 2ZR7A 2C99A 3D3QA 4KVGA 1YU9A 1KKLA 4KYIB 4U02A 3K9NA 5KSYA 4IVPA 2OCAA 3CF6R 4P3YA 2D62A 3MWYW 5JCPA 3DO6A 2QUZA 1IBRA 1CTQA 4IOLA 3A4MA 4O3MA 1GWNA 5TB5A 3W3ZB 3A6PC 2QRZA 1J7KA 2ZSEA 4LJ5A 2KSQA 5J5CA 2ZI4A 4D6PA 2JJ8A 3LFUA 2JJ1D 3GLHE 2AKYA 4NBSA 3GLHB 4GT1A 4XIGS 1XD2A 3QOFA 3DEFA 5KHOC 1TX4B 2XAUA 1DO2A 1OH8A 3DZDA 4TQ9A 2F55A 1KI7A 4QJ4A 3E2IA 2ZS8A 1NMYA 4MYTA 4DLYA 1KO1A 5K8TA 1ZU5A 2EWVA 2NPFA 2C98A 2AX4A 3CRVA 4LYFA 2IWRA 3THYA 1ZUHA 2ZU0C 3W8NA 5KSOA 3FFAA 4LC0A 3TKLA 4M0LA 3VHLB 5EXSA 2YOFA 2J9RA 1WDTA 4KODA 4EPVA 3I73A 4D81A 2FV8A 3HPRA 4JZKA 4G0NA 1GTVA 5LPNA 4FWIB 1E0AA 3VHXA 1EFUA 4IDOA 5JHGB 1E3MA 3NEJA 1OIWA 4A82A 4W9MC 3I32A 2WAYA 4MQBA 1HTWA 2BIFA 4C2TA 2O52A 3U44B 1KSGA 3BGWA 1VG8A 3NC0C 4Q5IA 1UKVY 3KQKA 4W5JA 2V55B 4Z54A 1M8PA 1COWA 1QDEA 4BFSA 2G1KA 5FOSA 1E69A 3REFA 3DDCA 3K09C 4QJ3A 4NYIR 1VKJA 4AKHA 3QF4B 3BB3A 4DDWA 4HAXA 1KSFX 4ITRC 4POAA 1G8PA 2FPKA 2RHMA 4NTZA 1NN1A 4TYYA 1E79A 4DLSA 4PSKA 4CF7A 1S0UA 4PQYA 2RB4A 4DDUA 2QP3A 1ZJ6A 4US2R 3OE7D 4OHYA 2CNWD 2FH5B 2ZYTX 2EFDB 1EX7A 1WBDA 5AR1A 3IBYA 2PZFA 3C14C 3CR7A 3KJHA 2ZRHA 4JIMA 5SZIA 1FZQA 1U0HC 3HR7A 3ZZ0A 1SXJC 4PO9A 2GBLA 1ZD8A 4R2IA 1AIPA 4B73A 1W47A 3U7GA 2OM2A 2AHOA 3ZVLA 3AEZA 4D0GA 4DCTA 4IOJA 4TMZA 3D6TB 4DDVA 3CPEA 4URUR 2VEDA 4JLMA 3NDBB 4AC9A 1RW4A 3KX2A 4LJ7A 3ZYCA 2J1LA 3GLIA 1T6NA 1MO5A 4X8MA 3AKCA 4DB2A 4BQSA 2JLWA 1QHHA 1KTVA 3LWNA 2RGXA 4NYMR 4PHFA 2H17A 3K0AB 1XB2A 2G77B 4JLVA 1J90A 1X1RA 1R0ZA 2XNSA 5FBRB 1OXVA 4Q02A 5E4FA 3SQXA 4Q00A 5CLLA 3R9WA 4URVR 5FUYA 1HA3A 3HU3A 4PAMA 5C2JB 1SKYE 3EZFA 1FTSA 1JECA 1E98A 1XFAA 1Y63A 4L15A 4F7WA 1SKYB 2ONKA 4HAUA 4GBMA 1X8KA 1RJ9B 2IUTA 3PUYA 1KI2A 3I5YA 3LD9A 2O0HA 4Q03A 1G7CA 1Z06A 2GCNA 2IYQA 2JDIA 3AP1A 5E7MA 2UKDA 5FOXA 2WWYA 2IT1A 4IHQA 3CRRA 5CJPA 4B2IA 1QHYA 3PEYA 4DLRA 1WRBA 3KTAA 3JZAA 3CPJB 3CZQA 1O87A 2DWQA 1DAMA 4GP6A 5KUTA 3W6NA 3GFOA 2IYRA 3A1SA 3IO3A 2OBNA 1SXJD 3IIKA 4WZBE 4QGGA 2WWGA 4L5BA 1R4AA 1GL6A 2PLRA 1E9AA 4PR0A 1KMQA 4RFVA 4B47A 2XJ9A 5JI2E 1Z0JA 4CEIA 4US0R 2YWHA 1LVGA 4M9SA 3BWDD 2L0XA 1CP2A 1DAEA 3B82A 4Y0AA 3DKPA 4JKYA 1TUIA 2GEDA 1DBSA 2GDJA 3PG5A 1RIFA 4TN1A 3AVVA 2JLRA 5EP4A 2H57A 4NE2A 4AI6A 4ASUA 2O8BB 3DM5A 4RCYA 2P2LA 2VSXA 5UKDA 2VSOA 2F3RA 3TSZA 2QAGA 2BKUA 4Q9IA 2R6DA 4M21A 1VDZA 4KJZA 3K9GA 3B1YA 4L8GA 1ZAKA 2YNMA 1MO3A 1R7RA 2VIIA 2ZJBA 2EYQA 3C5CA 3WNBA 4GOXA 1Z47A 3VNUA 1UBEA 4KCGA 2FE4A 4I1SA 4LPSA 2QENA 1US8B 1ODFA 2ZSBA 3PEVA 3FMIA 3ZQJA 5JS8A 4F92B 1CRPA 2ZQ5A 4QL3A 3C15C 3NH6A 2VF8A 1E96A 2WJIA 1KK2A 1Q21A 2AKAB 1YZUA 3RS0A 1Q1ZA 2V1UA 4FMCB 2GK7A 4WIAA 1IY2A 3VU9A 4BEBA 1EESA 3D31A 4PPNA 3PUWA 1R0WA 1X3SA 4AKGA 1YKSA 1OJLA 3I72A 4BFXA 5CK5A 3GJ8A 3QUSA 5HTKA 2OSBA 4D2IA 1YR8A 1U81A 1PLJA 2OFXA 4LGMA 2ZM5A 4AY2A 3KUDA 4ZIRA 5KOYA 3AVTA 3MWKA 1TF5A 4US1R 4BFTA 3WMEA 5AUNB 2C9CA 2IWHA 3ZQ6A 2GEUA 3GJ5A 3O47A 1OXUA 2H8KA 4PSVA 3U4QA 3ECCA 4DJTA 1W5TA 1Q20A 1XMJA 1LNZA 1Z83A 4LJ6A 3M6AA 4HYYA 4URXR 3IGFA 2WTUA 1D8TA 3L82B 3RRNA 4KLNA 3U3MA 3QEJA 2O8CB 3MD0A 4WXPA 2A9KA 3ICEA 1A82A 1XTKA 3KL4A 5KNCA 2ZSFA 2XNDA 4NCNA 5CB8A 1Z07A 5CLQA 2BBWA 5FPYA 1OE0A 2CBZA 4TLBA 1OB2A 4Q1CA 3A1TA 5LB4A 3AH8A 4E22A 3MG9A 2BC9A 1SXJE 4BRUA 1XF9A 1GILA 1BYUA 3MCAA 4OQMA 4QNMA 3TSOA 2ZI6A 4D0LB 3PUZA 5B64A 3BB4A 3OIVA 4JYCA 4WAUA 3BH6A 1NIPA 3P27A 5HCIA 4E03A 4GI7A 3ADKA 1PLLA 2WSMA 2A3RA 1JQJC 2A5JA 3ZVNA 3FVQA 5AJYA 1BO6A 1MABA 1MRSA 3K0FB 4PPFA 5L3QB 1ETUA 4BLRA 2WKRA 3QEOA 1P72A 1GITA 1T3SA 4IW3B 2CLSA 1IN8A 1PUIA 2R8RA 4EAQA 1U90A 5KSZA 1ZINA 2JLVA 1KYIA 2YYZA 4A2QA 1IN5A 2CCKA 1TADA 2Q9CA 1X86B 3QKRA 4IVRA 4XVQA 1U8YA 1CR1A 4TLEA 3UK6A 3M1IA 1L4YA 3VR5A 1MO6A 3L2OB 3KFVA 5CK4A 3ZJYA 1J70A 4TTQA 3SZRA 4BFWA 1FMJA 1TEXA 2GAOA 3FB4A 4LZZA 3IKJA 1XXHE 4NH0A 1GL7A 5DISB 3O8CA 1WBBA 4CEHB 4RZ2A 2R6FA 3TGPA 6Q21A 3WMFA 3AM1A 2DR3A 1KK3A 1W0KA 5JRJA 5HKKA 2C77A 1HY3A 4LV5B 2XJ4A 3QXSA 1E2KA 2ANBA 1HE8B 3BXZA 4JYBA 4U7DA 2ZJOA 1YRBA 1G19A 1OFTA 1GNQA 2OCBA 4QGAA 3GEEA 2XEXA 2ZRAA 1ZIOA 3DMDA 3TK1A 1J8YF 1EWQA 4HAWA 1YZGA 2JIZA 1UKZA 1M7BA 3C16C 2HLDA 3AF4A 3B2EA 4LY6A 2QM8A 1OFHA 4CEJB 1QBKC 1KK1A 4TYPA 4M1OA 3X1WA 2QRNA 3QNUA 2Q6TA 1YE8A 4EPTA 4JLKA 2VA8A 3MJRA 4XOIA 1NN5A 3GLGA 4F4JA 3RS5A 1S9DA 3U61B 1II8B 4B71A 1JJVA 2IF0A 4ZI2A 1E4VA 4TZ0A 2QTHA 1AS3A 3HDTA 5IDVA 2MSEB 1IQPA 4MKHA 4DIDA 4U00A 4AIIA 2XZOA 2ZRGA 1XPRA 2O8FA 1E2QA 3QXHA 2NPIA 5LBIA 1KDTA 2JJ1A 4NU0A 2BMEA 4PQRA 4BLTA 1TU4A 3GEHA 3N70A 5EXTA 1XMSA 1FUUA 4Q66C 3W5IA 1KJWA 2PJZA 3HU1A 5FI1B 3AVOA 1XEXA 2IF2A 3CF2A 5EE5B 3UWKA 4XJXA 2HDNB 3CNLA 2QAGC 2QI9C 2ZETA 4NMMA 3IIMA 5F98A 1IOZA 1IAQA 1NVUQ 1FP6A 3U60B 4XTRA 1HT2E 3B6EA 1XTIA 1LV7A 1W36C 3M0EA 4BFZA 2PT5A 2XGJA 2BBSA 2X1VA 1F5NA 2DWOA 3CBQA 1XD2B 3QJYA 3P4YA 4ZKDA 1Z08A 5EP1A 4NCKA 1ZW6A 1Z6XA 3WHKA 5K8LA 4RKFA 4C0SA 3LQQA 3LO5A 2ODBA 4LJ8A 3LX5A 4NL4H 3THYB 4NP6A 5CJ2A 4FXPA 2QROA 1T3HA 2BMFA 4BLOA 2C9YA 1RYHA 5A5GA 4HLUA 2FX3A 3QSYA 1JB1A 2ATXA 5AK0A 2P6RA 3F0TA 4DKXA 3BRWD 5BN4A 5TARA 1E0KA 2QY9A 3MFYA 5KPJA 4OQLA 4TL9A 5DHFA 1US8A 2P6NA 1Q3HA 3NVAA 3H1TA 2PX3A 3SDZA 4CIDA
chains in the Genus database with same CATH superfamily
1I4DD 3OKCA 1O6GA 4CL3A 1JIVA 2FWPA 2NQ2C 3OEHD 4H7EA 2YY5A 2GH1A 1E1DA 3MQFA 5DLEA 3T52A 3V8BA 1L5SA 3LO8A 4KITB 1IN4A 3ZQ4A 1OBCA 1TA0A 3L0DA 2ASEA 4X24A 3OF5A 4BVLA 3BIJA 4WLNA 1R0KA 5D6OA 4HDKB 1RZVA 5IUNC 2ID8A 3UFBA 4TMXA 3EGDA 3JQFA 1P1IA 4X41A 4BUJA 3N2GA 4EG6A 4D9NA 2FZCA 1V2HE 3C8DA 2FSHA 3G8YA 2R3SA 3NM5A 4LE0A 1OV4A 1ZRMA 2FWJA 1L4NA 2ZBUA 3DP9A 3R3SA 5AHXA 3R7LA 4FVTA 3PHLA 4K40A 1WABA 4P3OA 1ID8A 3B3GA 3EQ2A 3EC1A 4RHTA 2Z9DA 3WYEA 2H4FA 4FYIA 3TLMA 4JI7B 4I6EA 2Q5IA 5COQA 1IXSB 1SR8A 3G82C 1LLFA 4KIFA 5JEEA 4PZ9A 4GYWA 2IS6A 2JIPA 1KGSA 2JVJA 2QTWB 3R0QA 3EGEA 2C8VA 1L3IA 1XRSB 5J40A 1UFOA 3J81A 1QC5A 4KLCA 1BA3A 1GARA 3QV2A 5DWQA 4M0PA 3PC7A 3ESDA 3AFMA 4GXRA 3QHAA 5LOVA 1E9BA 3QE0A 3SF8B 4P6VF 1EWYA 1Z38A 1UWKA 1Z4IA 4TTTS 3WY9A 1QE5A 3UA4A 2AE2A 1X0XA 2DLNA 2BRUC 3DA8A 1X7XB 1F8UA 1A50B 5JU6A 1BW9B 2O2DA 3W34A 3QF7A 3DB2A 1ZHHA 3CEMA 3IT1A 4NG5A 3ZZMA 4ZGWA 1JSRA 1XRMA 5BV1A 1DQNA 4L07A 1OWNA 1E3LA 1GKIA 1IAVA 3GR6A 5JVDB 2BFWA 2YQ4A 3KDAA 1OHHD 1PU2A 4PZPA 1SXJA 1JU4A 5TEVA 1N3IA 3BN3A 4BN4A 1Y89A 3WLSA 1ZJ4A 2CXOA 5HE9A 4BKRA 1TZCA 5B30A 5KCZA 5AK6A 2O8NA 3HY3A 4GVXA 5K6AC 1XI2A 2I80A 3EG5A 2ZJYA 4K9MA 4FLFA 1C5KA 1V3TA 4QO7A 4A15A 3PDIA 3LHSA 1C9KA 2H1WA 2DUJA 3I04M 1F5SA 1MT0A 1XU4A 3TMAA 4OBBA 2XDYA 4FU0A 4OV6B 4RH1A 3UMBA 5ADWA 1ZN8A 1KO5A 2ZTVA 1RRGA 3O9VA 4GPD1 4Z4QA 3PGVA 1EK6A 2QIPA 5D6NA 2ZBPA 1E6CA 3PKIA 1OKKA 3AWDA 2OL4A 1W59A 3HCFA 1W44A 4EB8A 5LP6A 1KDOA 2V74B 4YO8A 2I4TA 2QVXX 3FW1A 3AKYA 3ZBQA 1NHWA 2X77A 2OHJA 3RANA 2I5PO 3QYFA 3NHMA 1RLOA 1XCGB 1XVUA 2QD5A 3KZMA 3MUOA 3PLRA 5FL3A 5K1ZA 5ELLA 5A04A 4P08A 1Z68A 2F2TA 2PZJA 4G01B 4NMLA 1OFUA 4V0ME 1TTHA 2SHKA 3ELBA 4H0FA 3C39A 1E7SA 3RSHA 4GZMA 1ZEJA 2PRSA 3ZGOA 2I4LA 2V3CC 4JP2A 4OHKA 5JXWA 4QXPA 1YOBA 2FLWA 2HWXA 2PVCA 3DE0X 4LMAA 4MYDA 4CEHA 3KZOA 5B12A 1F3OA 4FFOA 2PL3A 2QTVA 5LQJA 4R71A 3HZOA 3ONFA 1NHGA 1QO0D 1KFBB 1THMA 3CLRC 2VP9A 5ALFA 3IEVA 3L7AA 1QX4A 1AA9A 1G4UR 1FCJA 5B4TA 4YEDA 2ZVJA 2ZI9A 5EIFA 1Q7GA 3MWJA 4KQEA 3WBJA 4AF8A 3FSRA 4HQRA 3LFTA 3T12A 2MMCA 5T57A 1UEIA 1YS4A 2JJ2D 2XB9A 4AN1A 1RLTA 1R6UA 1WG8A 3DBLA 1YH3A 1HE5A 4RELA 5DNCA 3P9XA 5KYXB 3AXTA 4KMRA 4Q3AA 3SBEA 1J8DA 1NPDA 4PIVA 3QBVA 4EI2A 1Q0SA 1OXXK 3ACBA 2BMAA 1JB9A 2DAPA 221PA 2GVDC 5IN5A 5DN6D 3SDSA 1R6AA 2OCLA 3O8DA 3N2YA 3THOA 1WVGA 3H4TA 1S4MA 4D9JA 4GPEA 2ZRKA 2XQVA 4K6GA 5KJEA 1C2TA 2P0YA 2YJTD 2Q3JA 4O08A 2HJ9A 5ECWA 3ZWCA 1OGYA 4N7MA 2ZITA 3UUEA 2GN8A 3QLUC 2CLMB 3C5EA 3I01A 4KYTA 3SKVA 4KE8A 3RE1A 1WW3A 1X7GA 2BGIA 1FFBA 3LF1A 5CB6A 4U8HA 3C1TA 2J59A 4JLOA 1UJ5A 3GOQA 3ZGYA 1N57A 4HEHA 4KSBA 3UWSA 2GZ1A 4YYEA 1EFHA 4CT5A 2AFVA 1BCRB 4S3MA 4DV5B 1RRMA 2LP4Y 1E6KA 2WABA 4OFBA 5K4HA 1HPLA 3VPCA 4UVGA 3RC8A 2H5EA 2ZGVA 5IAOA 3A2KA 5D7BA 5CEFA 5KB3A 3A1VA 3QOXA 2IIQA 1FNNA 3HABA 5AKHA 1GZHB 2SKDA 5EMKA 5F64A 1O94C 4Q19A 2ZTUA 1VJCA 3SZOA 2OV3A 4C20A 1D7OA 4FC7A 1XMVA 5DHUA 3EOAI 2QPAA 1W4RA 1X1AA 5F3DA 3SF0A 5ICMA 4L51A 3SX0A 1T2DA 3AK4A 5HOQA 1UOEA 1PV4A 4Q4LA 1VZ3A 3E61A 4EH1A 3UXMA 2O1SA 2P9EA 4JSRA 2HMUA 4YP0A 3RRFA 3WLTA 2DPXA 2VHZA 2UVPB 3ZGLA 2WSSD 3L4BC 4Y2UA 5GJCA 4AK9A 4C88A 2ODPA 2C5SA 2PFSA 4CF5A 1EB9A 4RIFA 3ODPA 4FYJA 2QF7A 5CMLA 1S3FA 4CKBB 1XOIA 4CGYA 3MWDB 5LIRA 1V9CA 4N76A 1UIRA 2VF7A 2EXXA 2JAXA 4QYXA 1XALA 2HJVA 2JGNA 1GSAA 4B76A 3FPHA 3A58B 2FK7A 4C3VA 5HMLA 5KNLA 5FPHA 3M9WA 1FYEA 2DPGA 4UNSA 3R20A 3FCAA 1P3DA 4KHPB 3LXXA 4MULA 3VJKA 3JAWB 3L7MA 5H70A 2HNBA 5DSXA 3K31A 2BEVB 3E53A 5DCLA 4F3CA 4PS1A 1KVQA 1QS0A 1S8FA 4UNPA 3SYNA 4M0DA 1A2OA 3T41A 4QPCA 3G1WA 2R84A 3H5RA 4QBTA 2IVZA 3DTTA 4EVQA 1IXRC 1IZ7A 1KHTA 1V3VA 4UHKA 5EXPA 4N01A 3UOWA 3GP5A 4JODA 3EIXA 3MZ0A 3QKRB 3CNQS 4YGYA 2YWJA 1B00A 1LW6E 5KQPA 1TB4A 2BMJA 1N3LA 2IRWA 4AQYB 3ZWDA 1JT9A 2M6SA 3ABOB 4MICA 2ZTLA 4CNQA 2CN1A 3SYTA 5FNVA 3SXPA 3WI7A 4RTOA 4DPKA 5JMWA 4N5IX 3K70B 1GUYA 5J4VA 2X0IA 4I55B 5JADA 3RSLA 3JQ7B 3EXAA 4WX2B 1G17A 3DUWA 5C80A 3GD7A 3M5PA 3PCRB 4O4JF 4QM6A 1TZJA 1XZFA 1MF7A 3D6NB 4G2TA 4OFWA 3FPGA 3A1UA 5JTUA 3OPVA 4YAKA 1HYGA 1V48A 2VPXA 3PLNA 2FE1A 4YRFA 5CH5A 3TLBA 2C95A 4MGZR 4P7GA 1VC2A 1WPXA 4BHTA 4GX5A 1V35A 5DSZA 4DLXA 1HT3A 1RRFA 3DDWA 4L6AA 1EMDA 3L7IA 3CRQA 5ED4A 3EA5A 1V5EA 5JSZA 1A5SB 3H42B 4BAGA 1FP2A 3A4TA 1L6IA 2ERYA 3NC4A 4HNRA 4BC0A 3FPSA 4JKIA 5M5BA 2HU2A 1E9EA 3VI3B 4LQ4A 4OPMA 5IZCA 5M7EA 2B1JA 2QTFA 3JARB 5FJJA 5C1DA 3V4PB 5LZ7A 2JD1A 1RPJA 3REOA 4GQBA 5CB4A 1BNCA 1MNQA 4EYSA 4HDQB 3GLGE 1C1HA 3QM1A 5JNRA 3EVZA 1N1GA 3KKNA 3OMXA 4B9EA 4HWGA 2Q5QA 4DR6B 1XAHA 1JHVA 1MX3A 1X7DA 4G0MA 1JIJA 4P84A 4RVGA 1WCIB 3F46A 5DHRA 3WOHA 2OBMA 4G67A 3QVGA 2ZREA 4M8IA 2IYLD 4RABA 5A06A 3KDPA 1G8SA 3PDJA 1PJBA 2WWWA 3ZJTA 2NU6B 1WCV1 3EWSA 3W79A 4C05A 1Y8QA 1HDIA 1BJRE 3WLAA 4HXGA 1KAGA 1CDZA 5EE3A 1XJ5A 3LTNC 1GIAA 4QOGA 3I37X 4A2PA 4QUHA 4R7GA 2VHJA 2WJJA 2N46A 1WB6A 1E1RD 2OCDA 1KZ9A 3D7NA 3K1TA 4MMXB 4MYUA 4CMJA 1PS0A 4GMXA 4L6CA 4XD2A 3ZHOA 4KDFA 2HZ7A 3X1DA 4R98A 4D9GA 1JPJA 3GH1A 4EZIA 3G88A 4NQRA 4MNTA 2CGEA 5FR2A 2O1EA 2BEUA 1XEXB 2PKRA 2GK3A 1ZISA 5LP1A 1ZLXA 2RK6A 2XTMA 4WH0A 3RUEA 2F67A 5HA5A 5AW4A 1XCPA 3W8EA 5HKBA 3CE6A 2IZ1A 2ZI3A 4F8EA 3IAEA 4AAYA 3NC1C 2V58A 1DU4A 2Z6VA 4AF7A 16PKA 2AC2A 2H3EA 1XLTA 2VA9A 3AB7A 4Y2RA 4Q4HA 2YZNA 1NSFA 1VJTA 1WDKA 1GFIA 1I2ZA 1LCIA 1Z6YA 2YL2A 3LUAA 4A03A 4P58A 2BKEA 1NRXA 5CB0A 3I2JA 1IBLB 1XJQA 4FD2A 5KYWA 4WASA 1P9NA 1V3UA 4KREA 3ZXYA 4QU9A 4PFSA 3IBTA 4MRSA 4ZO7A 5FNZA 1X1EA 5FX2A 1KZ6A 2DJ5A 2DWUA 3BTUA 3UOAB 1XZGA 2PA0A 4GPIB 4RK5A 1IY8A 1GZ6A 1NXVA 3PNBA 1FP4B 1QGUA 1U2PA 3PA8A 3ZQKA 1D4OA 1BIFA 5DM1A 1THGA 4JENA 1FL9A 3TRIA 4Q24A 2WOJA 2HCBA 2MT9A 3OEHA 3O2NA 5HKAA 2VFAA 1YJXA 3E05A 3IP1A 2C8KA 1ZM3A 1YKGA 3R9IA 1P4SA 2ZE7A 1LQTA 4GLOA 3TIVA 2GX6A 4LF5B 2WPDD 4R3NA 3FXAA 3EPHA 5D3KA 3D8BA 3RBZA 5COAA 2BOVA 4MWGA 4I6JA 1SC3A 2W43A 4DMHA 3GPBA 3A9RA 3BS4A 5EQDA 3G7UA 1TO2E 4LYAA 1U1GA 4PC3A 3SC4A 3X0DA 1T3TA 3IUYA 2YX1A 1AGRA 4B48A 4CMIB 4CF3A 4PQFA 4ME6A 4PLTA 1GAJA 1F0KA 2O06A 2FQXA 5HFJA 4CR7A 3WFIA 3ZNQA 1RQGA 3SNHA 5AIAA 1G6Q1 3CXUA 2BR3A 1SU7A 2N3ZA 2HRRA 4PXAA 3ZK8A 4D9IA 4EJFA 1VLQA 2ZTHA 4MITA 2WF7A 4YJ2F 2OYRA 1P2TA 2IYZA 3EQ8A 5F1YA 2ZSKA 1Y48E 3BXEA 1RBMA 3EGDB 3FUWA 3OHMA 5CURA 5ITVA 2EZ8A 2ZAMA 3BH7A 1EIWA 3WE7A 4LJAA 4EB0A 3MOSA 1U8XX 2AR9A 5CA1A 3GLKA 5DIFA 1NUTA 3BIWA 4YTEA 3RTAA 2RC5A 4G9BA 3WAGA 3L1IA 3ZWVA 4Y6OA 4TXMA 1G3QA 2NV6A 5CT5A 3T7KA 1SWWA 4ACBA 3HADA 2CNBA 2FSFA 5J1TB 4CTJA 3WZ2A 3O8BA 3EDQA 1IWPB 2FEOA 4ZALA 1C80A 2B1IA 3M6VA 3WHLA 2WIJA 4WNAA 1K5HA 4CGZA 2X9GA 5JASA 4C2UA 1UBNA 2GFIA 2GHTA 1IRXA 1BMQA 3EVNA 1M2EA 1T9AA 1VSUA 2JATA 4HDSA 1F14A 4TGLA 1U2GA 5DTJA 4Z3KA 3K05A 1QC5B 4DKJA 3PSAA 5E2AA 3F78A 4WJZA 1QZXA 1OHHA 4JH0A 2WE7A 3TIXB 4LAFA 5LOVB 5M04A 1XBTA 2VBGA 5KTRA 4J94A 2PDAA 4QVGA 4A0FA 1W93A 4KU4A 1TEZA 1NVFA 1KMIY 3TSYA 4FZ3A 3LX4A 4XQ0A 4PG7A 3PI7A 1P77A 4ZRNA 4GOLD 1IMJA 5KPDA 2HNKA 1A4UA 2QG6A 3IPCA 1NW4A 1QUFA 1A9QA 1P60A 1ZOOA 5KOJA 1SEVA 3ESYA 1KJYA 2FZEA 3IP3A 3TNLA 1AJEA 3R7WA 3CZAA 3BDIA 1NVTA 4LXYA 5CCBA 3A04A 2PBLA 3LMKA 3TZCA 1J8FA 1I01A 1PJ8A 1SXJB 4LBWA 4MXDA 3K4PA 1U94A 4E1AA 1J5EB 2QX9A 3JQ9A 1XYVA 3IQFA 2OC9A 2LWIA 1JR3E 4MLPA 4WOJA 4TXHA 3O82A 1B6SA 1AY0A 1GN8A 3AR7A 1L8OA 2JFPA 5DYGA 3ID6C 4C6RA 3PDIB 4BE7B 1JHAA 1R64A 5EUCA 4CDGA 1IVSA 3BXPA 1Z0FA 3JZMA 1NV8A 1QNFA 1IEQA 3H5AA 4MPDA 1CNMA 5ALDA 4BGUA 1MC4A 1L7PA 1BH2A 2HIHA 2PZBA 5IRCD 3RO7A 2FPMA 3GEGA 1U8EA 4Z9YA 2OHXA 3LV8A 1NP7A 1ZK1A 2R96A 4TYWA 3WL8A 1FXSA 5H3HA 4ZT5A 4CHGA 2LIVA 1UAGA 5AI9A 1QFZA 1JKXA 1SUBA 2NZXA 3I9LA 4OBWA 5LP6B 3RS9A 4KQGA 4ENSA 5C4IA 1L5MA 1ML4A 3DVAA 2Q8QA 2HMAA 4JSTA 4OJNA 2IEAA 2OV6A 1F6DA 3N7AA 1DCFA 1QO0A 1KDYA 3ICVA 4RVCA 3WGMA 3QVTA 4DIEA 1CQPA 1SBIA 3FWZA 4MZXA 4XQGA 4RO0A 3FGZA 3AR5A 4PO8A 3MAAC 3UA3A 3GP3A 1VB5A 1AU9A 2P65A 2Q62A 3HRKA 2GZ3A 3L1UA 4FOPA 5KTKA 1WMDA 2KMLA 4TRJA 1L8QA 4FFRA 2P1DA 1CJVC 3B3QA 3GPCA 3BA6A 2GCIA 3H9QA 2JJ2A 1Z18A 3D5TA 4UHEA 2QTVB 3DR5A 4MVWA 3PBKA 1C9DB 5BR7A 1LS6A 2NNWB 3KVOA 5LNK1 1TD1A 1M6EX 1QRAA 2DQYA 5ALIA 5LYJA 4BO7A 2V59A 4TVOA 3DOFA 1L9KA 1P62B 4FX5A 1UZNA 2PK3A 3MGKA 3MWFA 3LRPA 5DGHA 3KQHA 1N6LA 5DN6A 3ZCPA 2HQ1A 1XQXA 1ORTA 5BT8A 3PEWA 4QUJA 2VCYA 3RKUA 3IOBA 1JKIA 1R5NA 2AXPA 4LNAA 1I2CA 4JJ4A 4M53A 4ND1A 3QXJA 5ALTA 5B1YA 1K0FA 1BX3A 1ISFA 3GDWA 3DXYA 4RZSA 5U4QA 4MUFA 5KQMA 5I7VA 4QARA 3FAKA 1CUHA 4A27A 1HSOA 2ZRBA 1GD1O 3DBLB 4IXNA 3D6AA 5HP4A 3WL4A 1FW6A 3CVXA 1CUJA 4HH3C 1NF8A 3SLRA 1JA0A 4DV3B 3KQQA 2MR6A 2WSYB 3F9RA 3P71T 3DZCA 3EYAA 4TKLA 4D1YA 2C42A 4L5IA 2CNOA 4H1VA 4XD7D 4NQZA 4DIKA 5AVZA 5JJLA 1TGVA 3G9QA 2GEJA 1C50A 3K73O 3M5DA 3H05A 1Z6QA 4GRIA 1A5AB 3BMXA 4ES6A 2PD4A 3BXXA 1C7IA 4ZDIA 2DUMA 3CQ9A 4XRGA 1F0PA 5DOZA 4ND8A 4Q9JA 4UBIA 3T3OA 2X2OA 1E6EA 1ULHA 2IYTA 2XMBA 4PTYA 4ZQEA 1AUOA 1QP0A 1UXIA 2J9ZB 3GJTA 4DMFA 1JQKA 1W0JD 3HSKA 5H80A 4E88A 2BFCA 1SOMA 4A4DA 3BCRA 3E22A 3ZZUA 1LB1B 2O0KA 2HI0A 2CLFB 2J3KA 4RC9A 3H1EA 1KEZA 4V2IA 1KJ9A 5TXGA 1NQWA 4AZ3A 1YGYA 1C3VA 2WSSA 1OSNA 2FG6C 5FV7A 1CY0A 4BTVA 1H9AA 1EBBA 5I6DA 4Y2HA 4LRUA 4MAFA 2PUDA 1CEQA 5KVSA 1BQ4A 4JL8A 3DC2A 2EX1A 2OORA 4HY3A 2YV4A 1K4KA 3CZ4A 5B1DA 4M7OA 3TLAA 1I2BA 2ZOSA 2O19A 1BRMA 3H5VA 1FOEB 1Z2NX 1MB0A 2O2XA 4AYWA 1GZ7A 1DXQA 2AFIA 1RAHA 4F5DA 1X39A 2C58A 2X0FA 2IEDA 2G0TA 3SJUA 4AD8A 1YCDA 1LTQA 4FYPA 1KBZA 1U8FO 1J0CA 5IP5A 4XTCS 3ZS8A 4V03A 4ESHA 5EMHA 5A4KA 3L7KA 3EZNA 1ZHOA 2A0KA 4LS3A 1JT2A 3SC2A 4A2WA 2FSSA 2A92A 1WXQA 1BWRA 1E63A 2HSGA 4YMTA 2OAGA 3AYXB 4XOUA 4LOHA 4WUTA 4E70A 5THXA 2DC1A 2UZ4A 4RMHA 4CLHA 2ZI7A 1SB8A 2BJVA 2VKQA 2X7JA 3DDSA 5T3YA 2XA2A 1L7AA 2Y1OA 1DE0A 3B38A 4KKXB 1RYFA 4BDTA 4LBZA 3RODA 1GPLA 2JAOA 1U3UA 3CNOA 2XTJA 3L0YA 4G81A 3SPXA 4JI1B 3KRTA 2PXHA 4CG1A 2YQZA 3EY4A 3WLLA 2H00A 3KEGA 2RHTA 2X76A 4IKOA 3DCJA 5AVXA 1QS0B 1TLLA 1E89A 1ZA1A 2CXUA 2HO4A 3V7FA 3QUBA 3RVQA 2B4QA 5K9ZA 4H27A 4AN0A 3DV2A 2GTPA 3H3FA 2WBLC 4MVJH 4TV8F 2P67A 4F0JA 1Q95A 2E4WA 3IAM6 5ILQA 4O29A 3GC6A 1UC8A 3F9CA 1T35A 3IO5A 5EXEA 4ZMBA 4NCIA 4D9HA 2ZKIA 4B3GA 1PJLA 3W9SA 2PMFA 1FPQA 3G8BA 4J7CA 3SCZA 4ZC1A 2J3HA 1D4FA 3M8KA 2WJGA 3RASA 1M83A 1HMPA 1IVYA 2FPXA 4JI5B 4GX0A 4HMPA 3CWZA 1IM2A 2P5TB 1GR1A 3E35A 1O03A 3CCBA 2IYEA 2W0SA 1ZP6A 1P3Y1 3EBPA 3ML1A 3WR5A 4FT4A 3PITA 4HUQA 1Z0SA 3B1WA 1UOOA 4HWTA 5CP8A 3GLSA 2EFGA 3IQHX 4QYIA 5EMNA 4O6VA 5E3JA 4LYEA 2CYAA 5CG2A 4KQ9A 4IVQA 1DNPA 2QJTA 1FP7A 1Q7TA 3UXHA 4FP9A 4X9XA 5KNBD 4FFNA 3C85A 4YT2A 4I1RA 1I4WA 4OHZA 2X7XA 3II6X 1WXWA 4QUKA 4DLLA 2JFBA 4UDOA 2OWDA 2H2WA 1E1KA 5TC4A 3O4RA 4NFYA 1KQOA 1W88A 4YP5A 1KNXA 3QUQA 5CIWA 1KP2A 5ICFA 2VZLA 1X7HA 3MPUA 4EKNB 2YRXA 1CLUA 3C7CB 1N2CE 2DHQA 4FWTA 2IHUA 3QBDA 3CX6A 4PAWA 3DFUA 5EPUA 1UBGA 2JJMA 4OYYA 1O9GA 3MMPA 3AF1A 4BZXA 4DRZA 4HTAA 5KZMB 1WMSA 1IQ0A 1ISHA 1Z2CA 4J03A 3AQIA 2XZPA 4NDZA 5DYTA 1GTL1 1E1RA 4QEDA 8GPBA 4O1MA 1FYDA 1YJAA 5IJ9A 2WUEA 1EGAA 4CCYB 4GBED 4ARVA 3LKBA 1RYZA 3SFVA 3W9BA 5HPYB 4D4MA 3R77A 2CZCA 3ISJA 3QVGB 3ONWA 4PYJA 2H65A 4Y2JA 1F8XA 1VG1A 2OAP1 3GO4A 4YCJA 5DPMA 5ENZA 3ROTA 4W5NA 3NUQA 4ZO4A 2B4YA 3FCSB 1UAYA 3FNGA 3AP2A 1Y8QB 1ZD1A 2R87A 1I1HA 2XCIA 3BC1A 4I8XA 1UJNA 1FRNA 3BJRA 2B8EA 4N0EA 1D2NA 1U8UA 1YQDA 5L8VA 1S3SA 3ZDXB 4R0MA 3FWPA 1V39A 3OZ7A 4FINA 4M7WA 5EVCA 3FDZA 3WQRA 1OBFO 1C8VB 3NCHA 5LQSA 1N7JA 3I62A 4EQ6B 3MM4A 5HCNA 2IU6A 8OHMA 3NHAA 2O0JA 3ZS9A 4ZU6X 1QR6A 2AVNA 2NV2B 4BQIA 4DZZA 2W37A 2BEUB 2WKWA 1XRJA 4WY2A 3KALA 1YNSA 1QK3A 4C4ZA 1UQRA 1YRWA 2GHRA 2V0GA 1KDPA 2ZYIA 5DTIA 2LKCA 3I45A 1KI1A 1NDUA 2J6IA 5E4YA 1ENZA 3HVKA 4BIIA 3OZTA 2YCLA 1Z36A 1BE1A 3GL9A 4U7FA 2EJUA 2C1ZA 1ZI8A 4ZXPA 2VWHA 5I9TA 4Q4HB 1MC5A 4J0CA 1P3JA 2ZBVA 2LXNA 5EGNA 4FYHA 4NHOA 4XLTA 5KYWB 1MEJA 5EWJA 3INGA 1OYYA 3N87A 1GRQA 1FFYA 2BTQA 1ZAYA 1NLMA 3EZ9A 2BFNA 2IYSA 1B0ZA 2II6A 4M1SA 1QGUB 4D9CA 4RTLA 1U28C 1V8ZA 1ARZA 1JMKC 1KBOA 1TMKA 3RRZA 1DPGA 4QEZA 3C3YA 3ZBTA 1NN3A 1D09A 4FS3A 5LU8A 2ZJ4A 1MOPA 4ZT6A 4R51A 2VYQA 2EDAA 4LYDA 4BNJA 3HYTA 4QOHA 3B53X 2C82A 4GPBA 5F1OA 3LPCA 2GCPA 2VZEA 4PVDA 1UXJA 4F3NA 1GG9A 4IO1A 1EE1A 4GP9A 1EJ6A 1YB7A 2J45A 4QYWA 1Q14A 1TRHA 2B61A 2FFBA 2JLBA 1JQAA 4IZIA 4U2KA 1E2DA 4IGIA 1DGQA 4IFEA 4GZ3A 1E9VA 2HJWA 3I61A 4IL5A 1NZFA 2YFKA 4Y2QA 5IC4A 1T8WA 3TF5A 3H04A 5DI9A 4DRYA 5FAKA 1DX6A 1KR2A 1RXCA 4I36A 2C5AA 1BFUA 2YJNA 1NRIA 3BICA 3L1KA 4WCFC 4DB4A 2I4IA 1GKYA 4WBXC 1A76A 2F7SA 2QK4A 3E81A 4HLQB 3HYRA 4FFSA 4Q1EA 4RVNA 1NVXQ 2GBFA 3B1KA 4A0RA 1SAYA 3ONEA 4ZPJA 2PNJA 2C4VA 4N9WA 3U39A 5CA1B 1TW3A 5I4IA 4QYMA 2B1RA 3F71A 4GNRA 4HEA1 5CFZA 1H0HA 1X7YA 2NU8A 3UT6A 4F12A 1T0HB 2JLZA 3AKZA 3ADBA 3MS7A 1TLTA 1GCAA 3AR2A 3R3JA 2Z5LA 2OXIA 2CJWA 5JD4A 2GVNA 3D59A 5ERXA 3I6ZA 1U4NA 4G3XA 3VH2A 4EPYA 3EFHA 3TZQA 1SVMA 3I5MA 4EDFA 4I3HA 3QE3A 4TZ6A 2R6ZA 2YOGA 3GGCA 3HPQA 1Y3FE 2P3LA 4HQFA 4HDSB 1QLJA 3PJEA 2HEGA 2ATIA 2E85A 3ENQA 3RF7A 4A5SA 1OXSC 3E70C 4C5BA 1J0XO 3M3PA 2GEVA 1X15A 1MFZA 4OCZA 4D3YA 2RGNC 4EWLA 5A3RA 4DV2B 1MG0A 3GJQA 1YQUA 4IYRA 2C54A 3NHBA 1FRFS 1RVDA 3DLHA 1NQVA 1M2VA 2BDUA 1QVRA 5BNFA 1V1JA 4L2IA 3AUTA 3GRUA 2DFNA 3N8NA 4ZT3A 1NV9A 4QUEA 3ZDYB 3HUUA 2DH6A 4FYWA 2HMVA 3K96A 5KOJB 1TAUA 3R4VA 1IZ0A 4KXXA 1ZC3A 2PEZA 4ZTBA 1HL3A 4G5GA 3R7WB 2P40A 5F7OA 3FNIA 4EITA 5L4LA 3OKAA 2JEOA 2DKFA 2XR1A 1T6YA 4MRRA 3CX7A 4RY2A 1OROA 421PA 3BILA 3EZLA 1XF1A 4ARCA 2M32A 4E5NA 2P69A 2JLUA 2NXEA 3WV5A 4WECA 2XBMA 3PDWA 2FWBA 1KYZA 1G5QA 2GUWA 5JBQA 3ZDEA 1K2VN 3I0MA 4LQLA 4TLAA 4ZAVA 4QU0A 3S6JA 4DXAA 1GPUA 1EZ4A 1E1NA 4G8JA 3U1BA 2JGLA 2AEMA 3V7UA 1QIKA 4JEMA 2IFTA 1K7YA 3GNLA 4WE3A 4D26A 2B9EA 4DLZA 1F8FA 3LGAA 3TLZA 4FHDA 1U98A 1SC9A 2HK9A 2VUHB 3GVIA 3M49A 1LRLA 3AHFA 2XMRA 2AQ8A 2YW9A 1ID1A 3DVAB 4QPPA 3VNSA 3V4ZA 3LE8A 2NO1A 2HQRA 2P77A 3COWA 3PFIA 4LGYA 1Y4UA 3GJ3A 4UFNA 4DS3A 1PTJA 4XVRA 3E18A 3FWNA 5G02A 1V6CA 3OZCA 3U37A 2CDNA 4D02A 1FQJA 1R3DA 4EY3A 1LJLA 3K8QA 4PAOA 3VR2A 2RH9B 3ESCA 4RCZA 3GDFA 1TQ2A 3GGGA 4MV0A 5BUZA 5K2OA 4CUKA 4D9KA 5L9AA 2WR8A 1R6XA 3PL1A 1S01A 1TMOA 2OP0A 2VQSA 1YZ3A 3NRJA 5K5EA 3BD9A 1K9SA 2C5LA 4Q82A 3QA9A 1OI7A 3RYHA 1RIIA 3MMZA 1W1WA 2YKGA 3CH4B 3KSUA 3B2QA 1C30A 4WW0A 1Z12A 4KQMA 1KY3A 1E3SA 4HNHA 4J9VA 3ROPA 5LYJB 2PU7A 1EYZA 1MD9A 2X0NA 3TI7A 4BKUA 4DF3A 2AK2A 3LXUX 3DH0A 1PK7A 3B1JA 2H5JA 4XD7A 5E1DA 3LW8A 3SEQA 4KBFA 4BMYA 1Q1AA 4EW2A 1AA6A 4KLZA 1K3UB 3CUYA 3EZXA 3H2JA 1DS6A 3L7YA 1NOIA 4JX8A 1V43A 4CM8A 2EEPA 2A67A 3RAGA 1QVWA 3UV6A 3MINA 3VR6A 2GFHA 3R3WA 4BP9A 1KI6A 5TMDA 1JDZA 1H4SA 1C7QA 1QONA 3ABZA 4X97A 5ELMA 1U5AA 1Z2AA 3KKLA 4KFUA 2AJTA 2XDQB 2CD7A 5CRIA 5IT9A 1W0JA 2D1QA 2F8MA 3FA2A 3KP1A 3Q8WA 1KZHA 5IJAA 2IV7A 4NBNA 3EDCA 1Z5GA 3NBXX 3FZGA 4M7PA 2LZ0A 5IC5A 4ALKA 5B2FA 1EDEA 1BC5A 1EFVA 1PF7E 2HLHA 3GMDA 3V4LA 3EEYA 2FQ1A 4NFLA 4UARA 1YI1A 2AXEA 1U0FA 2W6PA 2YJ3A 4G0ZA 2YV3A 4MJXA 4JUFA 4PO3X 4YMSA 5C1PA 2W5UA 2BM0A 4ND8B 2NO5A 4U3JA 3OM0A 5JSKA 5IWCA 4JQYA 5GZ6A 3R7NA 5KKCA 4MV8A 1EQAA 4RAOA 4NG4A 3LHDA 2ZUVA 5L6MB 1P9RA 3WGYA 2BFCB 2VCEA 1ICIA 1R6TA 3GFTA 3WYDA 3E22B 4JOQA 3BE4A 3EHDA 3STWA 4MR7A 2J8ZA 2NO7A 4MWCA 4B74A 1W94A 2XMPA 2YBDA 3GIDA 3W2HA 4AZ3B 2VHWA 3T6KA 3Q12A 4MW2A 5JSUA 3KOXA 1YR1A 1ZH2A 5FLKA 3MF4A 1LPAB 2O5RA 2VCHA 2NGRA 1E59A 2Z2IA 3WRXA 4DBLE 1YQEA 1NFFA 3B9QA 4IMJB 1F51E 1VLMA 2XITA 4Q7JB 1HKHA 3RVJA 4D9FA 1VE1A 1G9SA 2V6FA 3H13A 5AWFC 5BQ5A 4D4KA 1CZLA 2KPOA 3HXQA 3W2EA 1J1ZA 2HDHA 1IY1A 2WHPA 3VZSA 3KLBA 1DEAA 3I5AA 5I45A 1B1AA 4OQ4A 1K1EA 2AFIB 1E4YA 3M6WA 5CPBA 1Z6PA 5ILOA 5EHGA 5BYKA 8MHTA 3ZH2A 1LBHA 4L9WA 3TRFA 2NUAA 4M1KA 5L3RA 1SZJG 2W9XA 5REQA 4F1WA 2B5WA 3DLIA 4MCJA 4CLDA 1Z88A 2QTAA 3LW7A 3L43A 4MUYA 1H93A 3KXLA 3NI2A 3ZJ5A 4BECA 5JD5A 1J00A 1E2BA 1P2VA 3E7WA 4YALA 5IBRA 3EVCA 2F59A 3VOAA 4DG5A 1WZ2A 2OESA 1CDDA 1XDWA 2ZPTX 1O6ZA 3EC7A 1SVKA 2XXAA 3T5TA 2ZB7A 1XYYA 2C2HA 1A9XA 1YHNA 4V0NA 1GQQA 2WMOB 3GELA 4ALIA 4TL7A 4ZKEA 4YRMA 3FGPA 1WHTA 3D5QA 2HKIA 4JA2A 3FUCA 3Q11A 4TSFD 1QYCA 2RG7A 2ZSHA 2PXAA 2JHGA 3CMCO 7REQB 1JWAB 4JS0A 2JGMA 2F8TA 1ZESA 4DCJA 1G41A 4CHTA 2NZ8A 3FTCA 3HR8A 1GGVA 2MR5A 5ALKA 4D8TA 3G5UA 3KSZO 4U4AA 2QR2A 2VXOA 3I4LA 2O1WA 4B33A 4YRSA 5KNDD 3LY8A 2Q07A 3AT1A 2B69A 2WMYA 5JALA 1TIPA 1A2QA 5KNBA 1MRZA 1AV7A 3H2HA 4FMDB 1GR0A 3GEIA 4LYGA 1V11A 1A96A 3I1IA 4M8LA 1RXSA 1JNYA 2CLEB 2E49A 2OTCA 3E3MA 2HC9A 1EVLA 3E9RA 1QGED 1YJ5A 2PY6A 3F5DA 3A28A 1K5PA 2GJAA 2I1VB 3T7EA 2YV1A 2VHCA 4E2WA 4GMFA 9LDBA 4Q6WA 5IXJA 4B3XA 1Q7RA 3PLAE 4I1PA 4HUQB 1F2VA 2AFHE 3R5HA 3WLPA 4PSCA 3ZIAA 4UOEA 5B2ZA 2IYOA 5BVGB 1PZEA 3ETEA 5DLYA 2YC4C 3IMEA 3T4EA 3WNCA 2ZROA 3WYFA 4B3DA 1GYPA 4F85A 3DPUA 4JGBA 3LDAA 3N74A 3TDMA 3H5NA 4F3RA 1DBQA 2C84A 5HUJA 1RYNA 5DOVA 5MFZA 4AKTA 4WNYA 1E3JA 1NBWB 4Q4AB 4KR2A 1JFFA 1TJ3A 3UTDA 1B7GO 1NURA 3DMFA 1NMXA 1HNNA 1UM8A 2XF8A 3O38A 2P11A 1NJFA 3P0JA 5DH9A 1LBQA 5LDGA 3FHCB 3KEOA 2G7ZA 3BXFA 4KIUA 4LHEA 4IHAA 1RAFA 5I9SA 4Y9SA 4BMVA 4C78A 3C41J 5JPIA 1JEYB 4EHFA 1TM2A 1Q44A 1PFQA 1IM5A 5JECA 3VSEA 3AEKA 1Y6QA 4K1XA 3TN7A 1UBTS 3KDSE 4WKGA 1GSHA 5IJ9B 2Q4DA 1C7ZA 1QX3A 1V8BA 1ZSNA 3CLTC 3L0IB 4RAQA 4AIRA 2B7BA 3S81A 1Q15A 3QEAZ 3PQ4A 2FWIA 4D5GA 3NHWA 3IFSA 4KHZA 1Y3CE 4BFVA 4YMIA 3EIHA 1IB0A 4L8FA 1TC2A 2X5NA 4RK6A 5KBYA 1J6UA 3KB1A 5AJZA 4V0KA 3FMFA 2QW0X 3KKKA 5C7OO 2Z5GA 5DX0A 1MH1A 5DLQC 4GLLA 2JFVA 3LT2A 1KEEA 3RYIA 4XM0A 2PWPA 1K0UA 3B2NA 5IJWA 1USIA 3BWEA 3FDZB 2BHRA 3UW1A 3KSBC 1WKBA 4DMKA 3MCZA 5EINA 1K6XA 5T5QA 3SP1A 4MKGA 2XD9A 4LRXA 3QOYA 3FX2A 3KZNA 1CQXA 3LKZA 4EYEA 1Q0LA 2PBZA 1EFPA 4HZIA 1BA2A 1CULC 1NVGA 2VF4X 3DEHA 2BUAA 4IYJA 2C5FA 3KT8A 4UVIA 3SQWA 1T5OA 2W58A 3FVRA 2AR0A 2RC6A 1CY8A 3FPLA 2G0AA 3SZLA 5IS2A 3C24A 4NULA 4XPZA 1PAUA 3QU7A 3I2GA 4DHWA 1T8TA 3MXOA 2AVDA 4FQ8A