4YMHA

Crystal structure of sah-bound podospora anserina methyltransferase pamth1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
239
structure length
239
Chain Sequence
b'LGSILPFNEETADRVSAYCEKNSHGIPDALVEHWEWTRTRFPDADKMSSRLQGSWMIFTARDRKPKRILEIGCYSGYSALAWYEGTRDTKAEIVTLEYSPKMIAASREAFKKYGVGDRVKLIEGPAENTLKTLEGEFDLIFVDANKDGYAGYVKTILDQGLLSANGIILCDNVFARGLTIGPDCAPWLNDHVRPYWNGCGQALDKFSAGLMEDPRIDVLLLPVFDGVTQIRWKDGAQRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative SAM-dependent O-methyltranferase
molecule tags Transferase
source organism Podospora anserina
publication title Structure and Biophysical Characterization of the S-Adenosylmethionine-dependent O-Methyltransferase PaMTH1, a Putative Enzyme Accumulating during Senescence of Podospora anserina.
pubmed doi rcsb
total genus 86
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ymhA00
3LBFA 1XCLA 1ORIA 2YTZA 3R24A 4HGYA 1YB2A 5EGSA 3OFKA 2XBMA 3EVGA 1EQAA 1M6YA 3LKZA 4GOOD 3HNRA 3KPYA 4BLWA 2CL5A 1G8SA 4WVLA 4E32A 1D2HA 1NW3A 2OYRA 1VPTA 3Q7EA 5GINE 5EZSA 1Q0TA 1SVUA 1EJ0A 3BZBA 2JHPA 2PT9A 1IY9A 1EG2A 2JH8A 2JH9A 2O05A 3DULA 3PX3A 4PYLA 3UJAA 5CIYA 2G72A 2NXEA 2B78A 3SMQA 3K0BA 4LECA 3TMAA 4QTTB 5EMLA 5HFJA 5DLYA 4HTFA 5EKUA 1P1CA 3R3HA 3HCDA 3THSA 5GM1A 4QVGA 1SKMA 3HVIA 5LQKA 1HMYA 2QYOA 3ELYA 3B3GA 3DMHA 5HIJA 2PWPA 4ER7A 3ORHA 5FTWA 1TW3A 8MHTA 3SGLA 3UJ7A 3BWBA 5K0EA 3OFJA 5KS2A 2G1PA 2Z6UA 4PCLA 1DL5A 4M36A 5E1BA 3SSMA 4RTQA 5E2AA 3NWEA 5C1IA 1JTFA 1O54A 4YV1A 5LQAA 3JWHA 1HNNA 1NKVA 4FGZA 5CCBA 3G8BA 3UA3A 2B2CA 5M5BA 1G8AA 2UYCA 1EAMA 2PKWA 5GIPE 5P8WA 4AZVA 3M6XA 2YXLA 3EVDA 4AUKA 4POOA 5K0NA 4RTKA 1BC5A 5KVAA 5EMMA 5HILA 2P40A 2FK8A 5EPEA 2I6GA 3MCZA 2I7CA 2PXXA 2UYQA 3HP7A 2FPOA 4Y2HA 3SSNA 3DMGA 1V39A 2DULA 2BR5A 3E23A 3G89A 5K0JA 2BZGA 3KQOA 1NE2A 3MERA 5F2KA 3SXJA 1KR5A 3KHKA 2BM8A 2HMYB 3DH0A 4C4AA 3JWGA 3G2MA 4RYLA 5GOZA 5E8JA 5LR6A 5K0CA 1XJ5A 2QM3A 4AZTA 3TPZA 1X1AA 3GRZA 3AJDA 5E9JA 5DSXA 1FPQA 4P58A 2I9KA 5H02A 1KYWA 3EPPA 3BUSA 3OCJA 5HIKA 3RIEA 1RI2A 4RTLA 2PJDA 1QYRA 5HOQA 5LQNA 5EQJB 3UJ6A 1RI4A 1JG4A 3FUWA 4BLVA 4RV9A 5LQRA 3C6KA 2CWWA 3HVKA 2ZTHA 1U2ZA 3EMDA 3LPMA 3B3JA 3EVAA 3UBTA 5IKMA 1WXXA 4C05A 3KU1A 3HCCA 3HCAA 3T7TA 3TFWA 3ELUA 5KYGA 4HH4A 2GPYA 2HWKA 5F2NA 4R8SA 4YV0A 5BW4A 3P9KA 3BWCA 1L3CA 5DPMA 3R9XB 3CVOA 3EEYA 3VSEA 4BY9E 3T0IA 3P9IA 2OB2A 3L8DA 3UA4A 3QV2A 5FHRA 1KPHA 3MAGA 3NMUF 4FSDA 4AZSA 1X19A 4C06A 2ZCJA 4PINA 2VZ9A 4DF3A 5T6BA 3P2IA 4GF5A 3UJCA 2ONZA 1R00A 2AOXA 3B5IA 2VDWA 1VE3A 1KIAA 3FPJA 4OA5A 3A7EA 3OZSA 4NECA 1NV9A 2YXDA 4ER5A 4HC4A 1RJGA 5EMJA 2IH2A 1XTPA 5EIWA 4A6DA 3P2KA 1KPIA 1AQJA 4HGZA 4YUVA 3BXOA 1R8XA 1JG1A 4HRAA 4B17A 2PX4A 5FHQA 4PYOA 1KP9A 4QQKA 4PNEA 5ICCA 3HCBA 5C9ZA 3V97A 5E9QA 4IKPA 3FUUA 3SSOA 4M37A 4PYQA 4R05A 3SX0A 5DRYA 5E1OA 5GIOE 5E1DA 5DX8A 3BWYA 2ZZNA 1AF7A 2YVLA 4XUDA 2IPXA 3OZTA 2JJQA 2PY6A 5DM1A 5ICFA 2P3OA 3SVZA 2EJUA 4YV2A 2PX8A 3P97A 2OBFA 2ZBPA 2AZTA 2ZWAA 3DXYA 3EGIA 2WA2A 3FYDA 3LBYA 4KDCA 4LWPA 3SR4A 3AXTA 4QPPA 5DM4A 5E2BA 3UJ8A 4F85A 4F84A 4RWZA 5FUBA 3TKYA 3OPNA 2OKCA 2F8LA 3E8SA 2ZZKA 2ZFUA 2R3SA 2PXCA 3D2LA 5HIIA 3OU7A 5DRTA 2PV0A 4IV8A 3S68A 3HVJA 2AOUA 5U4XA 1ORHA 1XCJA 3G5LA 4X61A 3O31A 4GOMD 1YZHA 4P7GA 2B9EA 2LD4A 3FRHA 3FUVA 4GBED 2ORED 1G60A 4YMHA 7MHTA 3NW9A 3CBGA 4FS8A 3LCCA 4UOEA 5K0FA 3GU3A 4QDJA 1NW8A 1P1BA 3A26A 2IH4A 1G6Q1 3PVCA 3RODA 5BW5A 3TR6A 2Z6QA 3RW9A 3EVZA 1RI1A 3KR0A 2IH5A 4C03A 2GB4A 5KQRA 3AWIA 5HIMA 3WSTA 2O06A 2AOTA 3LECA 3I5UA 1MJFA 4AZWA 4QDKA 2FHPA 5DXJA 4RVGA 4YUXA 5K0BA 4E70A 3UZUA 4C08A 3KPVA 1VBFA 2PX2A 3BGVA 4PGGA 1BHJA 4E2ZA 1M6EX 4RTOA 1D2CA 3CJQA 3PX2A 1AV6A 3MCTA 5EVJA 2PBFA 3FTCA 4CXMA 5EEHA 3LX6A 1INLA 3FUXA 4RVDA 3M6VA 1NBHA 2JHAA 1VLMA 5LQJA 2PT6A 1P91A 2ZIGA 4YMGA 3TRKA 5C0OE 3TM4A 3M4XA 2ZSUA 4R6XA 2N47A 1SQGA 5BXYA 1X1BA 4V0RA 1PJZA 3LDUA 5ICEA 4C04A 5BP7A 5CM2Z 4DKJA 4GUAA 2HTEA 1B42A 3B7PA 3ERCA 2ZZMA 2NP6A 4PYNA 4E33A 4L7VA 4BP3A 2IIPA 4PIMA 3B3FA 2BR3A 4IV0A 3OU2A 4OBWA 3REOA 2ESRA 1Y8CA 3EEOA 2XYRA 2YX1A 2C7QA 2CMHA 5FQOA 2PSSA 2NYUA 3EVBA 4MQ4A 1TPYA 4QTUB 3BKXA 5FQNA 2VDUE 3KPJA 2BH2A 3KR2A 3ME5A 1O9HA 1OR8A 3GDHA 4ER3A 1JQEA 4KW7A 4RTRA 4LWOA 1RJEA 2PX5A 3OU6A 5CVUA 1I4WA 5T64A 4X41A 1YFLA 3FPEA 1DCTA 3EMBA 4E2XA 2FCAA 4EQZA 1UIRA 5LQCA 5FA8A 3LCUA 3FYCA 3C3PA 3DR5A 2OY0A 4E2WA 4C07A 4K6MA 3I64A 3ID6C 3OZRA 1FP2A 5EEGA 3DP7A 3FZGA 1WS6A 3HCFA 4WXHA 3VC1A 3NDJA 3DLCA 1EIZA 1IXKA 10MHA 3U81A 1G38A 5ERGB 1WZNA 1ZG3A 2NXJA 3ELWA 4MTLA 2O07A 2OPBA 3GCZA 2OXTA 3ER8A 3LGAA 1N7JA 2P8JA 5FULA 5EHIA 3JWJA 3IEIA 2AOUB 3MTEA 2ZVJA 1JTEA 3A7DA 5EHGA 5EMKA 4YUZA 4AX8A 2P3QA 2G70A 2ZIEA 2ZLBA 2EG5A 2XVMA 2PLWA 4KWCA 3X0DA 2DPMA 4DMGA 2AOTB 2AS0A 1MHTA 1QANA 4FT2A 5DTQA 4RVHA 3P71T 3KPUA 3O7WA 2NP7A 1X1DA 3EGVA 2AVDA 2PGXA 3HA3A 3KR1A 2XYQA 5DM2A 5K8VA 4FZVA 3G5TA 5EIFA 4GC9A 1SG9A 1F38A 5DSTA 5IH3A 3KR9A 2C7RA 2C7PA 4OBXA 4PONA 2QRVB 1SQFA 2A14A 3DXZA 3FPHA 3KQSA 4RTJA 2C7OA 3IYLW 3FUTA 4EK9A 1NW5A 3DMFA 3P2EA 4XCXA 3K6RA 5T67A 1L9KA 2GA9A 3EVEA 3PLAE 3MGGA 2ZW9A 1BKYA 3HEMA 5DM0A 4DQ0A 5LSAA 3I58A 2V7EA 1L3BA 3HA7A 2OO3A 5DX1A 1XDZA 2ZULA 2AOVA 5FWDA 3TQSA 4HG2A 5GWXA 4U7TB 1KPGA 2P41A 4HTFB 3T7RA 2YR0A 3GRYA 1FP1D 2AN3A 4YUYA 4DCGA 3LKDA 5K03A 5F2OA 2O0LA 3LL7A 4MIKA 1JSZA 3CCFA 2OZVA 4OQDA 4OX9Y 1QZZA 5K01A 4MWZA 4E31A 2P7HA 3Q87B 5EC8A 3UFBA 4RSRA 2IBTA 3LDFA 2JG3A 3NWBA 1ZQ9A 4FSXA 5D1NA 5DTRA 4MHTA 1VL5A 4OA8A 4GOND 4DCMA 3EVFA 2BR4A 2VDVE 2AVNA 5CUQA 1X1CA 4G56A 3UJ9A 1SUIA 3GO4A 2BM9A 3BGDA 1ZHFA 1R74A 4QPNA 4A6EA 3PFGA 4PYKA 4KRGA 1H1DA 1N2XA 5FADA 4HSGA 4PYIA 3B89A 3KQVA 1O9GA 5EZQA 2EX4A 1WY7A 2GLUA 2IDKA 5GM2A 1F3LA 3E7PA 3G2OA 2GAFA 2ZWVA 3QOXA 1EJ6A 3EVCA 3ANXA 3DXXA 3QOWA 4P7FA 5CVDA 2HV9A 5ICGA 2ERCA 2EJTA 4PYMA 3GGDA 4QVKA 2NXCA 2V74B 3MB5A 2IDJA 4X60A 3VYWA 4GQBA 5GP1A 2G8NA 4Y30A 1XDUA 1VP3A 3DUWA 3V8VA 5FWAA 1VQ1A 3A25A 4ISCA 4LG1A 1N7IA 2Y1WA 3CKKA 3OE4A 1RI5A 2PXAA 3E05A 3HM2A 4FR0A 4X63A 3M6UA 5E1MA 2CMGA 1R6AA 1L3IA 4EKGA 1NBIA 4CTJA 4DA4A 2P3LA 1T43A 3TLJA 2YQZA 2FK7A 3EGEA 4M7RA 3PFHA 5HEKA 1NW6A 2NXNA 1ZGJA 3P9CA 5DX0A 4ER0A 3BKWA 3SM3A 3C0KA 3IV6A 3BGIA 3NJRA 2ADMA 3G2QA 3GRVA 5KQSA 3GIWA 2E5WA 3GXOA 2CKDA 2FYTA 1UFKA 1YZ3A 1NV8A 2B25A 3GRUA 4H0NA 1P39A 3A27A 3AY0A 2H1RA 2P1DA 3R6TA 2QY6A 4KIFA 3CC8A 2AN5A 3KKZA 3PS9A 5D1HA 3THRA 3M33A 5K05A 3O4FA 5MHTA 4EVIA 5CD1A 3FPGA 3TOSA 3A4TA 5EG5A 5CCXA 3KPWA 5CVVA 1I9GA 2VS1A 4V0QA 3DOUA 2AN4A 3DTNA 4KVZA 5DTMA 3F4KA 1XVAA 1FJXA 4E2YA 4BLUA 1JG2A 4GOLD 4RTMA 2Q41A 4RX1A 4ER6A 1PRYA 1QAQA 4RTNA 2YUIA 4ZTBA 1BOOA 1ZKDA 2I62A 3FTDA 3ELDA 4CKCA 2UZ4A 2YXEA 5E8RA 5K09A 4X1OA 4R6WA 1KHHA 4JXJA 1M0EA 3NVMB 3G7UA 1Q0SA 1YUBA 3G8AA 3HA5A 4FP9A 5HZMA 1YFJA 1NT2A 3FPFA 2UYOA 3MHTA 1IM8A 2UYHA 3IHTA 4PCAA 3R0QA 2XVAA 2FRXA 2WK1A 1RJDA 3P9NA 3BWMA 1NW7A 2R6ZA 4GC5A 4RVFA 5DXAA 5DT2A 2IBSA 2QRVA 3KQMA 5K0LA 4PIPA 2AR0A 3UJBA 2P7IA 4P7JA 3G88A 2AOWA 1KXZA 1JR4A 2IP2A 3LDGA 1KYZA 2EFJA 2WA1A 5E9WA 4BP1A 1FBNA 3LHDA 3TKAA 4EMSA 4Z2YA 4O29A 1RJFA 2GH1A 3HVHA 4KIGA 3MTIA 2ONYA 2JHCA 1QAOA 1TW2A 3M70A 2KW5A 3FRIA 3BT7A 3HCEA 5LQUA 5FA5A 1JG3A 3NVKI 4CWAA 3KQPA 3HTXA 3GRRA 2O57A 4QQNA 3LSTA 1I1NA 5K0GA 4DM3A 2IFTA 2QE6A 3CJRA 1SUSA 4KDRA 4FT4A 4EKIA 4PGHA 4R8RA 2NNWB 5B1SA 2HNKA 1VP9A 3AXSA 1DUSA 3LCVB 3T7SA 4P7KA 4RTSA 2ZBRA 3GJYA 1JSXA 2ZBQA 1XXLA 3M6WA 2B3TA 2ZIFA 2IGTA 2K4MA 4OQEA 1YF3A 1UWVA 1VIDA 2XYVA 3MQ2A 3OE5A 2H11A 3CGGA 1XDSA 4CKEA 1L1EA 1JQ3A 3C3YA 3P8ZA 3NDIA 4XUCA 3GNLA 1G55A 3GWZA 4F86A 1WXWA 3I9FA 4YUWA 3C6MA 3PB3A 5DWQA 3UWPA 4PYJA 3DLIA 5EOVA 2Y1XA 5JR3A 5CVJA 3TM5A 3KQTA 3VC2A 5CVEA 1D2GA 4RTPA 2GS9A 5FCDA 2OB1A 3ER9A 5JUWA 1RI3A 3NTVA 4IWNA 4CKBA 4XUEA 3G2PA 2G71A 2PWYA 4M38A 4E30A 1JQDA 2HR1A 1R18A 3FTFA 4CTKA 4DZRA 3FTEA 1ZGAA 1WG8A 3KQYA 3H2BA 4GEKA 5G02A 1R8YA 3CJTA 5EKXA 3PTAA 3PT9A 3KQWA 2PVCA 2VP3A 3KQQA 4PWYA 1AQIA 3JWIA 4U7PB 1Z3CA 2Z6AA 9MHTA 4ATNA 1QAMA 2P35A 3I53A 3UJDA 2H00A
chains in the Genus database with same CATH superfamily
1TA9A 3OTGA 3KLNA 2BGWA 3DNPA 4C2TA 1LS1A 1W6RA 2F3UA 2IDMA 2QD4A 2CL5A 3BXHA 1KDZA 1FXWF 3CNNA 3KAJA 2Q8NA 3DO5A 3J7TA 2OYRA 1HMPA 1RLOA 2D0IA 2J3EA 3R5TA 4R31A 3BZBA 1AZLA 1WE2A 1YQWA 5DGXA 3P0EA 3LU1A 5FNZA 4ZCTA 1VLZA 1EM8A 4OM7A 4S2EA 5IBQA 1EVJA 3QSGA 4OO3A 1YMQA 3E0XA 4R1NA 3T9EA 3K0BA 3CUKA 4LECA 5AIBA 5JY6A 2VDWB 3EGOA 2CD7A 2G3YA 2FEAA 2FKNA 3IT3A 4MPDA 4AKEA 4DY6A 1RHRA 2AQKA 3GLUA 4C0XA 5IJ0A 1I14A 2VCYA 3FI0A 5ALMA 1LI7A 3WB1A 3WJ2A 4P93A 4L5IA 2R4QA 2XB6A 3HXPA 3PDUA 4YXWA 3W5JA 5C3MA 1DB3A 3LTEA 2C5AA 1NJ6A 3QX3A 2PD3A 2V0NA 3B82A 1GM5A 2JLVA 2PYDA 3M1YA 4NICA 4GQAA 2WAXA 5J59A 3OG9A 1ZC3A 5I9TA 2IDZA 3JQFC 5AW9A 1CYDA 2JGKA 2BN4A 1YK0A 2FZVA 2ZTUA 3NYIA 4IH4A 4ZVOA 1VPDA 2I2DA 2YXLA 4HNRA 4UFOA 4PW0A 4J7AA 4WBNA 1JFSA 3QVSA 1PWXA 5JCXA 2DUUA 2DWOA 1M2VA 5EPEA 1E3WB 5SZJA 4E4TA 4KYUA 5JQGF 2WVJA 2BHNA 4GYJA 3L7LA 1QS0A 5K0JA 5K4GA 3OCVA 3MQFA 1XMIA 2I4LA 4FDVA 5FI0B 3FPLA 3TMKA 5SYNA 3N8NA 1CPYA 1M34B 4C4AA 4E46A 3KETA 4D8VA 1CQPA 1ZRSA 3R3ZA 4K9KA 1E9CA 2B9VA 3JZFA 3TS1A 1XK7A 3TPZA 4RPIA 3MJEA 1ULUA 3N05A 3OPYI 3WQQA 4NL4H 3PF8A 4UUAA 3P0IA 1DPGA 2QTZA 5AW3A 3AFIA 2VXBA 1PWHA 3CZ5A 3Q41A 4RH3A 3VOBA 1Y3HA 4MWDA 4NYJR 5FXMA 3ZE0B 4UVEA 5FPHA 1U1EA 3KUKA 1AMUA 2P9TA 3M4YA 4J49A 4QUDA 1AB6A 3NHRA 1XRPA 4IDFA 1CEYA 3UBTA 1E98A 4K88A 2G8LA 1KFBB 3UOAB 1AGRA 1QLHA 3HCAA 3WMEA 1UJ5A 3UHOA 4CW7A 2PIAA 3C5CA 3MS2A 1T2AA 4PQRA 1G21B 3ASZA 4JL6A 3TQCA 3UAWA 4EB6B 3IBFA 1CS4C 4R8SA 1H9CA 1RXCA 2H2HA 4GZLA 2QQ0A 3GLRA 3RU9A 3MAJA 1I13A 1L3CA 3UN1A 2P6RA 1A9RA 1NNUA 1LBSA 3H4VA 3L7KA 2OLEA 4BQIA 2ZT7A 1QC5B 1DKOA 4CM7A 1GJRA 1QQ7A 2Z08A 1SQ5A 4XASA 4RZSA 3LPLA 1H2HA 1UFRA 3E2IA 3HU1A 1YRYE 5T57A 3LYLA 4YRQA 3U4DA 1QOPB 5A05A 2JFNA 2JH3A 2VDWA 3OTHA 3DFUA 4MWOA 3WWDA 4UATA 3OZSA 2OHHA 2VNIA 1CD5A 4B6QA 3GFBA 4BGDA 5GV8A 4CUJA 3Q11A 3GHHA 2ZDHA 1Z6QA 4K28A 4ZI2A 4PF1A 1ZLYA 2W70A 4B2LA 1DXQA 2L2QA 3MJSA 3ZHSA 1A98A 1RAEA 1OJLA 2XUAA 5E9QA 1EK5A 3VVCA 2VRBA 3JQAB 3VX3A 3SSOA 3CYFA 1YJ5A 4R05A 3I0ZA 1E2JA 1QONA 2WD7B 1OKKA 4XYGA 1P9RA 2I87A 5DK6A 3OPXA 1IOLA 3RPEA 3W8EA 2FSSA 3ZBQA 4BO5A 2XMPA 1MAHA 2NSHA 2E2WA 2HKIA 3JV7A 3LV8A 4LOIA 4TV8F 3UAZA 4E7PA 1G6OA 1HM5A 3DFIA 2Q7OE 3P97A 1F6DA 1YDFA 2OV1A 2V9ZA 1PGJA 3H9QA 5AI0A 1DE0A 2X2FA 4C3OB 3JAMA 2WWIA 5ULLA 4CV1A 3LXRA 4Q0MA 5TPWA 2Y1EA 3DE6X 3O75A 1JBQA 1K6XA 3R5SA 4KRYA 4IIUA 5FUBA 3SLRA 4Y7DA 5HRCA 3HJFA 4GL2A 4MRAA 1F9EA 4YRCA 3PXAA 4S24A 5CM8B 4C9BA 3LPDA 4S1PA 3F49S 4LTMA 3KEGA 4CQLA 4MW4A 2C92A 5DRTA 1U1CA 2DQSA 3KG2A 4O1HA 1DFGA 3M3DA 4I9UA 2AQ8A 4G1CA 5AVTA 2EC5A 3OHMA 4C76A 1E9BA 3FPCA 4P7GA 2RJOA 4Q3OA 3BCSA 3KHUA 3V1YA 1Q95A 3TW0A 3SBEA 3RSFA 4L02A 1RCTE 4XVUA 5KKCA 4MWTA 3SBDA 1A8QA 1E63A 1KH2A 3IESA 4B6PA 4MVJP 4H1UA 4K1LA 3MPOA 4B75A 3ZJUA 2ZJ8A 4FFWA 5E4YA 4I5GA 4F8YA 3K0CC 1CKEA 1N4DA 5IDQA 2X8LA 1CFJA 3Q3JB 5KQRA 1VZ2A 4IEFB 1IQUA 2XMGA 1WQ4A 1K88A 2D8MA 1F8UA 2UDPA 4QASA 4MH0R 4RO0A 2NUTB 3JXEA 1RYEA 4UULA 1UP4A 2HMAA 2VR1A 4U0JA 4Z9XA 2MDTA 1L5WA 1SH7A 1HKUA 1R0KA 2FQ1A 2HGSA 4QOIA 4TL7A 4UBJA 4W6ZA 3TWOA 3H7AA 4RZXA 4D9HA 2XHEA 1UC8A 3HU5A 5EXPA 1YJCA 2OT3B 3N7AA 1SK8A 1SXJC 3I2KA 1DFHA 4C7OA 2JJ1A 1WCIA 4RY8A 2POCA 2QRLA 1N5OX 1VMAA 4BATA 4XTCS 5C0OE 3RS8A 1C9MA 4JJ8A 4ZCLA 4Y9RA 1VCOA 3W9UA 5JSHA 3DVQX 3O3MB 1UDAA 3Q2KA 3DT9A 4JMLA 4RY2A 4WCDA 3VH1A 5CM2Z 1CS0B 4H4CA 3REQA 2F48A 1E20A 3K1AB 1O96A 2VSQA 3TGWA 5ENZA 3LYHA 1QCCA 5G4LA 4D6XA 3P9QA 4EAAA 5LN1A 2VP9A 3NEYA 4BWYA 1A2BA 4J4TA 3REOA 2EXXA 3FSEA 4RJTA 3QEKA 3IB3A 4N49A 2CHUA 5FQNA 2MYNA 3TDMA 3TGLA 4BXOA 4QEKA 4HDOB 2OCDA 4Q4DA 3GT3A 1KJ8A 1SCBA 4QLAA 2ACEA 3ZOZA 1VLHA 4X41A 2YQ4A 2CLKB 2IEIA 3G2IA 1OAOC 1ML4A 2DTDA 4YH1A 1Y42X 4LV8B 1VMEA 1XRLA 2A5JA 4O5AA 2EP8A 5HKLA 1HOXA 2X86A 3IR7A 4KGVA 5K3BA 3UUGA 3DLHA 4WOCA 1KFKB 4IAOA 3Q7PA 3I64A 2Y99A 3OE7A 1K9VF 4GX5A 4RLFA 1P0PA 3Q9LA 2W2XA 1E6EA 1B0UA 4QWWA 4J0IA 4DUGA 1G21A 2SBTA 3F4BA 4Q15A 1ES9A 4MW0A 2IF0A 4HP8A 3VNRA 2WP8J 4U5QA 4UHDA 3V1NA 3ZWXA 5DWDA 3TZQA 2AZXA 1IMJA 3A36A 3LGAA 3PC2A 1QYIA 4ZT4A 1N0UA 5EHIA 1K7CA 1ML3A 2AOUB 2NSYA 4NX2A 1ONPA 4RPCA 3WRVA 4EKDA 3I2FA 2P3QA 4HDRA 4R98A 1C2TA 1EHYA 4L8WB 1L7PA 1PS8A 1QNLA 2DMRA 3OM1A 2B8WA 1JKIA 2EEZA 3LQYA 2FMHA 4HTAA 4C6TB 1APBA 4MKIA 3HYRA 2IYEA 3RVMA 3P71T 1MOQA 1E1RA 1O1YA 5CNIA 3WGGA 4I99A 3RSCA 1TQHA 2JD1A 1CG6A 2TMDA 4OAOA 4H7JA 1SWVA 1M6VA 1NIJA 3C3XA 2A4KA 1A96A 3FMOB 4OXKA 2AX4A 3HDQA 4GZ6A 3WQBA 2O3UA 1L4MA 2QRVB 3EG9B 1SQFA 5HMLA 4B79A 1XMXA 5LXTA 4XA8A 4UNNA 2GJSA 1VL6A 4J9UE 4LXTA 4YROA 3KT6A 4L4XA 3OT5A 5EZ6B 3W6ZA 5FR2A 4DR1B 4GLLA 4E3WA 4RCVA 4HNVA 1YSCA 3ADOA 4LJAA 5CBPA 5JYBA 221PA 3G2LA 1XWFA 1O97C 1RRCA 2LE0A 3K2BA 4B3RB 5FV4A 4YO7A 3IXLA 1XEXB 2ZRKA 4TVBA 3U6BA 3I92A 2AGVA 2PLRA 2OYCA 5F21A 5K03A 2HWXA 2GFHA 3IR6A 1DTEA 4X20B 3IRVA 3VAAA 4MNTA 1JDJA 5JO9A 5FLEX 4X3PA 3A31A 3G59A 5AUOB 3IR5A 1NQVA 3CXRA 3NGXA 4HVCA 2YJ4A 3KHTA 2AE1A 1IN6A 3EE6A 2OUIA 3QZUA 2BGUA 1MEJA 3MJRA 3D7NA 5JLAA 1A5SB 2CFOA 1DZ3A 1U0SY 1KI1A 1HC7A 1ZITA 2WFLA 1XXHA 3QNWA 1AQYA 1GVHA 3CWCA 5GV7A 3DGFC 2NZYA 1XVUA 2I2AA 1XCBA 2M6RA 2Q3DA 3BJZA 1FY2A 1ZAKA 1GGEA 1YR8A 5ICGA 1OY1A 1VRCA 4ZOBA 4GECA 3EZGA 3RARA 2IDJA 3BILA 3EHEA 4JR0A 3MT7A 1GG2A 3GQBA 5COQA 3ZTWA 1RCUA 3SZUA 3MCAA 4H18A 4MJ7A 4Y3UA 3EA5A 3E05A 2CXNA 1T4GA 3CBQA 5IJ9A 3E9EA 4RF4A 4IDAA 3ZDRA 5KOHA 1GGNA 4FJ0A 5K4HA 2EL9A 5CA1F 3TLJA 1T0HB 4B8ZA 4M7RA 1TZBA 3U6KA 3DVLA 4CEIB 5DX0A 2J9ZB 3T5BA 4EHLA 3UJ3X 3IUSA 3ISTA 4CN9A 4M8KA 4A91A 5C8VA 4RNDB 4MR9B 1BWRA 1FSGA 2PV7A 3LUFA 1I7SB 3ISJA 3S2YA 2FYTA 1UFKA 4WKNA 2NZ8A 3D4NA 3L1VA 5JDCA 4U5XA 1XZDA 4KIFA 5JJCA 3A4IA 4AN4A 1BVUA 1CS0A 1XA0A 1TL7C 3AILA 5BR8B 4MQMA 3VSBA 3C6ZA 2C99A 1HFEL 5CVVA 2EKLA 3O38A 3LVRE 3LC2O 5FL7D 4D82A 1OYYA 3PGA1 1KF0A 1P1JA 1XXHE 4C3UA 3TI7A 1H6DA 1C14A 3H5TA 5SYMA 1JWLA 4I5EA 1QNFA 1VHLA 1S96A 2ZVDA 4ZCQA 2W6ID 3KZVA 1EZ1A 5I8WA 3PX7A 1MGOA 3MLEA 1M76A 4Q3KA 5E8RA 2XD4A 2GXSA 3KLPX 3QHAA 1S0UA 3QTTA 2OSBA 4R6WA 1G63A 4X1OA 3VHQA 4B4WA 1PEKE 4BFTA 4NYMR 2DUMA 3HGTA 3QBDA 4MVJA 1M8JA 1JHPA 1NLYA 4KQGA 1JDSA 2P4HX 4DVJA 2DPXA 4KQHA 4M54A 1DGQA 4I1SA 1PJSA 2D13A 1LWNA 1WUJS 1NXPA 2XJ9A 3C14C 3CEHA 1ENOA 4GC5A 4ED9A 3RWMB 5JNUA 2CFIA 3QWIA 2J7KA 4DLXA 1P7CA 2PTHA 3G88A 5CX1A 2IYZA 2VJNA 1JU9A 3HL0A 4B76A 1KYZA 2J08A 2ANCA 2ZIZA 1JEJA 2YWFA 3H9BA 4W1QA 3AR4A 3LLMA 4Z2YA 2YVKA 4BP1A 5IC4A 3LWZA 3QJGA 5L7TA 1YJQA 2F2TA 2VAMA 4FLMA 4E15A 4N03A 3T3NA 2P1ZA 5EXDA 2CSUA 5A4KA 2H3EA 2VQDA 2Y1OA 4Z0PA 3S4YA 4EFMA 1NAHA 3A3OA 3PEYA 4HFRA 1N1GA 1I1NA 5JRZA 3GOQA 2OZPA 3RBZA 5B4VA 5JPDA 1UDXA 2PGJA 3HG7A 3PI7A 5CURA 2ZRPA 3QXGA 1Z5PA 2A33A 2HA0A 4AIIA 4ZJYA 1P1FA 1RQPA 4FDLA 2NNWB 4YECA 4KQIA 3SNKA 3L7IA 4KMSA 1PL8A 2VJQA 1YZGA 1T4DA 3MUNA 3NIGB 1H69A 1C4KA 4YMTA 4TT3D 4MI6A 4KUHA 2H11A 3S2SA 3RVSA 4CTNA 2NQ8A 5D87A 1X7ZB 1D1QA 4RABA 3MGAA 1QMPA 3JQFA 1E3SA 1TAUA 4HFMA 1X9HA 4F86A 1JEQB 2ENWA 3S8YA 5T41A 4H60A 5EOVA 1KORA 1W25A 3AINA 1QFZA 3LYAA 2I1LA 3OLQA 3B6EA 2RGEA 4WT7A 4RTPA 2VEDA 2V7QA 4BO4A 3ZI7A 3TOXA 4XDGA 1E4EB 3R7DA 2PYZA 3PD0A 1IXSB 1V0JA 1UPAA 4MUYA 1CSEE 4O08A 2WQ6A 3HUEA 2W0MA 2A7QA 4ZAVA 2QX8A 3KQYA 3NDBB 2RHBA 3OJWA 2I1VB 5FEMA 1GLNA 3H5WA 4Y1EA 1RWVA 1XROA 2PVCA 3HZOA 3QPVA 4MV0A 1WL8A 3CG0A 2COEA 5IW8A 1X92A 2XUZA 3UIEA 1DJQA 1A8IA 3IMCA 1EVEA 1UUFA 3H16A 4X92A 4OQLA 2PTGA 4HGYA 1S7GA 4V3CA 3UC9A 2ZSIA 3MJCA 1BQ3A 4MRMA 1SHTX 3TPCA 3OETA 4WESA 3DE4X 3TE6A 3LPNA 3LSYA 3BD8A 2UUCB 3PHGA 5HIAA 2OG1A 2CW5A 2FMXA 1SIBE 1Z36A 4I9HA 3CISA 4Q9LA 2JLRA 3AP2A 1U1FA 4LJ4A 4OU4A 1NQOA 1YA4A 3VSCA 1DXYA 2D1QA 2J9YB 3W4IA 4MX8A 2ISSD 3LUDA 3O8OA 5JQWA 1ECLA 5JYDA 3UEOA 5KWJA 1ZX1A 3B1JA 2WTNA 3A05A 3QFRA 1QF9A 5HYVA 2OE2A 2I8LA 2LPMA 4EGSA 3UTCA 3ZDAA 2CDRA 2QYOA 4Z1MD 1UMDB 3ELBA 4BEWA 4F45A 2W2PA 4XYMA 1GDHA 4GHWA 4CIYA 4GMKA 2OD7A 3W2TA 3MPUA 1TA4A 1R0YA 4R16A 4N65A 2FZEA 4OQQA 4X97A 4B87A 2NZWA 3OD5A 3WFIA 3KD3A 4Q01A 2WIJA 2BJWA 2EFCB 4QEZA 3U3OA 2B0CA 2QGFA 1Y3FE 4YASA 2PUCA 2R6HA 2YIJA 2ZYUX 2AG8A 5ILQA 1YDHA 4MEJA 4F46A 4RTKA 4L8GA 5IX8A 4EPRA 1E2BA 4NE9A 1P7ZA 2MR5A 2HMUA 4KQ6A 4KUEA 3EG5A 1CY6A 2Q2VA 5TT0A 2IX3A 2PVSA 3SXUB 3F6PA 2JFYA 2BR5A 2X5KO 3OPVA 2LTAA 3ZD8A 4JVLA 1BXZA 4LNAA 4II7A 1SC4A 3JRXA 2P3SA 2ZRLA 4GM0A 5CCEA 2ZAIA 4Q34A 5EWLB 2REQB 2IEBA 4I50F 5CH3A 4Q7JB 2V5UA 5AVRA 5J1SB 4UAJA 3S70A 4DXAA 3G2MA 4JA2A 4W5OA 1SXJA 1CDZA 4LZLA 4BNTA 4F96A 1DAIA 3TZBA 5I45A 3VU0A 1ONBA 2VOEA 4D8WA 1DCFA 1V25A 3EDOA 4PTYA 4R2LA 1E5QA 4DC9A 4HPXB 1CC1S 1QZUA 4BVJA 4E21A 4WSOA 5CXSA 3UV3A 4C5AA 5IK2D 1TJYA 4KN8A 1M2JA 1FSSA 2HI0A 3LP6A 4RFLA 4EY5A 2FMKA 2JAHA 3GUYA 5JYEA 2Q4RA 4BLVA 2WZDA 3HN7A 1UXOA 1DBPA 1B0PA 3PV0A 4IVNA 1U2ZA 5EWLA 3TLMA 2H7YA 4RLSA 2AA3A 4AF7A 2XNKA 5DEIA 3NH9A 3PQEA 3KU1A 1FFXB 3CW9A 3EAGA 5BMVF 1H2XA 4ZVRA 5ELXA 3G5AA 3UGKA 4HDNB 5B1HA 3JQ7B 1KSFX 1UL1X 2ZAMA 4WLFA 3O21A 2HHJA 1FRQA 3CFYA 4NXMB 1ISMA 1QBGA 3P9KA 4TMWA 1TTPB 4EI9A 2WWYA 2C7QA 2AD5A 1G1MA 1J21A 2Q4EA 3K70B 1GHTA 3MVEA 2H5IA 4FMCF 4AICA 2PKYX 4NCJA 1VJTA 2Z58A 4MB2A 2LIPA 3A6ZA 4WZAB 5E4FA 1P9NA 2ZCJA 4P33A 4RD4A 5E2IA 2CNKA 2ONZA 3GFVA 1PHRA 3Q8XB 4PLZA 2XUDA 2Q29A 1RPNA 4AJ9A 4N5NA 4DGSA 1M34A 1MF7A 1XPUA 4L5AA 4RPGA 3DVAB 4D0LB 4C7OB 2YXDA 1UK8A 3U5ZB 2XZLA 1VYVA 1XTPA 2IYUA 1Q0PA 4KODA 1D0SA 2OFXA 4C7BA 4BU1A 2X42A 4IUDS 4EPWA 2D7JA 4MR7B 1FUKA 1E1NA 1R8XA 2CVOA 2PX4A 3L3BA 1FP7A 4HRAA 4NS4A 2J5KA 4K9QA 4GR5A 4P80A 5ICCA 4H7IA 4LJ8A 2A5DA 3SX0A 1YRBA 2C8KA 3AF1A 1CEQA 2QRPA 3J81k 1PQPA 2OCPA 4TLMB 2E4VA 4Z53A 2DLNA 2Z04A 1PGQA 4P35A 3K0FB 1YVEI 4EUNA 2ZOSA 4YV2A 4RAQA 2AG0A 3CXUA 4O33A 1LBQA 1M6NA 1E3EA 3MC1A 4I4TA 4LAFA 4NV1A 5F1OA 4F84A 3MOIA 2GZRA 5TS2A 3TKYA 3NHMA 1KQGA 1U0JA 1E4OA 1U0BB 4UPEA 3JQ8B 3N3AC 3HVRA 4IXMA 4PSUA 3O3NB 4IDQA 1DKNA 1T5TA 2GF9A 2JGLA 1Z37A 3HQ4O 4CIXA 4EM6A 4AJKA 3PYXA 1Q5PA 5KYNA 5KINB 1GPMA 4M1EA 2GN6A 1ODSA 1SHLA 3AKCA 1B26A 2ZYWX 2V03A 4OP3A 2D2IA 3RJZA 4FYXA 2ZE6A 4RACA 3C4VA 2JB9A 3U13A 4PQGA 1W36D 1FNCA 1NR5A 2CHQA 2ODWA 2AW3A 2V7PA 3RODA 2JAWA 1DOHA 1G8HA 1C4XA 3DTYA 4HZGA 2Z4RA 2LIVA 1BCSB 5IAKA 4UW9A 1ESZA 4IS3A 3UM9A 3WSTA 2BYTA 4E08A 3AVTA 1MJFA 2P6OA 1MA3A 3JQAA 4OL9A 5E0KB 4B34A 3UENA 2OESA 4K8OA 3WL8A 1N2BA 1K63A 1PJBA 3E1KA 4NYJQ 4MWEA 3QF4B 2GPNA 1XLTC 3BGVA 3I1JA 1BHJA 5JZMA 2XJ4A 1JVNA 3ZBPA 1A88A 4DIOA 3BL5A 4V0KA 4CIAA 3UCFA 1PD1A 1SAYA 1I9CA 2Y0DA 2ZJBA 3QLUA 2KM1A 3BMCB 5EYPA 5HMMA 3SQOA 4J29A 4CI0B 5TARA 3ESAA 3FVTA 2GD6A 4YRBA 3H3XA 3ICOA 1G5QA 1UMKA 3BFVA 1VGRA 5H68A 4MJXA 4OXYA 1UOEA 4W7HA 3KYBA 3T6KA 1ZIYA 2VRWA 1BJTA 2G9ZA 2BMAA 1RLTA 3B9RA 3MYRA 4I50A 4OREX 4IIGA 4G0WA 3WYNA 2C78A 2HCRA 2D3WA 2GEVA 2FF5A 2IEGA 2XXAB 3A6HA 3FCXA 1PX0A 1W5SA 3WLPA 2FWPA 4ILKA 1PTKA 4JI7B 4BP3A 1OA1A 2B1QA 3C7AA 5HTOA 2FFRA 5AJWA 3RYCA 3SHWA 2XUGA 3HP1A 1Z2EA 1M7HA 4HLUA 2CMHA 2IXDA 4TV8B 4X90A 3TSOA 3GVPA 4JJAA 2PEYA 3T3DA 5EAIA 3W1WA 3OX2A 5LA6A 3RSGA 3H9EO 3HYTA 3M1LA 1I2AA 3GEGA 2OCKA 5IUNC 4EG8A 5K6AA 2PS0A 3H4IA 3OU6A 2ZI5A 1Q15A 1I4WA 1QVWA 3T1NA 4MR8A 4ND4A 3W77A 1BCSA 3C7DB 4OKSA 2Q46A 4CCYA 4BHTA 1RVV1 2JGIA 4F7DA 1YXMA 4UEWA 2JASA 2W6CX 3OLVA 4TTQA 4LF9B 3S2UA 2IPMA 4BO7A 4HN4B 3NOQA 2GFIA 2X8AA 1TYBE 4CQMD 1EUCB 1X8JA 1ZRNA 1BZYA 2ORVA 2Z95A 3DLCA 1N6KA 3KJFA 3PIRA 1EVZA 4HDNA 4W9NA 3VXKA 1IK4A 1GUFA 10MHA 3RFCA 1CVLA 4WGFA 3IDZA 1IH8A 2NVBA 4KP7A 2DVMA 4LXUA 1OW3B 4R3WA 1ZOPA 5KJFA 2E55A 4QO8A 3QI2A 5EMKA 3EQZA 1IMOA 4EQ6B 3MMXA 4KHZA 1GWNA 1PK7A 4MDHA 2LWIA 1UM9B 3EY4A 2B61A 2REXB 3CUEF 2O2GA 1YRQA 1XDDA 4KITB 5TGZA 3U7GA 2LNDA 1IXYA 3FW1A 3ZHOA 3PVSA 4N5IX 4C7JA 2MCFA 3CNBA 3W5DA 5MF6A 1SUDA 3TG2A 5J2TA 4Y6SA 4PBSA 5JRDS 3WGKA 4MV8A 3NHLA 3OEED 4QFBA 1KZ9A 4DARA 1P61B 1A2OA 2O9JA 1QYXA 4JELA 2A14A 2DR2A 4O4LF 3COSA 5DCYA 2CSXA 3B8HA 2BUBA 2COKA 2HJGA 1SBZA 2XGGA 3ANSA 4N0QA 3RE1A 5JSFA 1S1CA 2BDTA 2GD0A 1NBEA 4ZVKA 5KO2A 2OORA 2I8AA 1F8YA 1J2EA 3ZNOA 1NXXA 5CEEA 5IVIA 1V7CA 2ONCA 3RVQA 3RYTC 1XDZA 1W34A 2GYYA 1DRKA 3N5CA 4Q9IA 2M32A 4JC8A 1FQOA 2B5VA 1NP3A 5GWXA 3RYHA 1WOMA 1U8YA 5B3KA 1HR0B 1FP1D 1A7KA 1K0FA 4M7OA 2YHSA 1OAAA 2ENUA 2ZT6A 4DABA 4WFQA 4HNTA 4KLRA 3CCFA 5KSWB 1FRNA 4M89A 3UHJA 4E31A 2OBLA 2XQFA 1T2CA 2XUHA 3FETA 1Q3HA 5MGNA 4XRGA 3OT1A 3WZ2A 3CG4A 1ZQ9A 2GKGA 4QT0A 2VH5R 4FSXA 3TG8A 1NU8A 2J09A 1P4SA 5ERXA 1VL5A 2G25A 1E6KA 1F0YA 1FUYB 4DRXB 2VDVE 5I7OA 2M9MA 2HFKA 3W2HA 4QOEA 1DDIA 1U1DA 5JH7F 4MQUA 1WCWA 4G63A 4WADA 5KPDA 4J75A 5A3VA 2YV4A 4DUGD 1LY1A 1E9SA 1GUDA 3FMVA 1L8AA 3G8CA 3ETEA 1OWLA 1ZJ4A 1JE1A 2OHJA 1SCKA 2WQZA 2GZ2A 1Y6JA 1EVQA 2YVQA 3KT0A 5DNUA 5GZ1A 1SZCA 2GKOA 2OGTA 1NJ1A 3QOXA 2DQZA 4AZ0A 1ZD3A 2GN9A 1IL0A 4YAEA 3I62A 4F4HA 2QUHA 1WPQA 4JDUA 1N32B 3E15A 3LVFO 1HYQA 4FWTA 2C84A 3BICA 5TT1A 2WSBA 5IAAA 2H2DA 4JC5A 3SX4A 4I9NA 1E6MA 2EGUA 1YH3A 2H0QA 3B1KA 1OXUA 2OC4A 4QAQA 4FLFA 3NC1C 4KYTA 4R0VA 3TSYA 4FR0A 1PQUA 4N9WA 3SC2A 3USCS 3CEMA 4IP0A 3NKVA 3SG0A 1J22A 2RK6A 2RGUA 1KYQA 4U0KA 3QHQA 3CE9A 4WI1A 5F33A 4ZVLA 4YT4A 5KQPA 5DNYB 3IQDB 1ZGBA 1B43A 1YBAA 1KFJB 3BFXA 4X00A 1RAAA 2JBHA 1LDMA 1Y4SA 1JFLA 2R1VA 1O89A 2JGAA 4I1OA 2C9YA 2R4TA 2W4QA 4R3UC 3GXOA 1RACA 4I1VA 3UH1A 2DH6A 3BS4A 4ZVPA 1NLZA 5JZVA 1ZUHA 3IUBA 3R6TA 1SQ6A 1Z83A 5K3CA 4J1QA 2O0JA 3ACBA 2D1YA 4NY1A 4RHCA 4LZWA 5ICMA 1V4BA 2GZHA 3VQTA 1EFRA 3KOYA 1X7XA 1ZOLA 2HHLA 4X6LA 4D1YA 4PIVA 4D97A 1V41E 5JNWA 3J7AC 4IHKA 4ZDJA 4ER6A 2JJMA 1V3VA 3GPDG 2I6TA 4BMCA 2YUIA 3E3NA 3L8YA 3WK7A 3ELDA 1P0QA 3KWLA 4KXYA 1SUBA 4XD7A 5CBPB 2JGDB 5J9FA 2GHRA 2WYUA 5IYZB 3DWIA 3M4ZA 3ABSB 3NVMB 2I4IA 1S7CA 2VJCA 3AF3A 4X6UA 4G1UC 2YZKA 4D2IA 4KE8A 7GPBA 3L05A 4MWSA 4YDSA 3CRW1 1QK4A 1FYWA 2KS6A 3K0KA 3HDHA 2CMKA 2QDXA 1JG7A 4IIHA 1Q7GA 5KYUA 3T9BA 1CDDA 4YC7A 1X14A 4K05A 1NW7A 2QLBA 2AYZA 4LMBA 4FYHA 1GRNA 2QRVA 3EG9A 1OLSB 3HYCA 4K6KA 4ME6A 5LXTB 3VKVA 1DS6A 4CEIA 3CF6R 4LY3A 1RBYA 4MJLA 4UUNA 3HACA 4U1RA 4MRPA 3G9TA 4ZOAA 3U61B 3O91A 4MS4A 1NZJA 1Y80A 2Y1FA 2DCMA 1HDCA 4OFXA 1J2JA 4EG3A 3KAQA 4N01A 4AW9A 4KIGA 1QAOA 3ZKWA 3OZFA 3ACCA 1WXIA 5EXSA 2ZPUA 5AM3A 1UMCB 1F0NA 5JH7B 3QXXA 1QQTA 2PRYA 4QBIA 2C88A 4JUBA 2GF2A 2JIRA 1EX7A 4DM3A 3BHMA 3CE6A 4LJSA 2EG9A 5FRDA 5L3VA 3LFTA 4PSVA 2IV3A 4R8RA 1FMLA 1MGPA 2FJ0A 3NR2A 1XLUA 3WO0A 4ZOEA 3CZPA 4XWOA 3BEDA 5GGXA 3V32A 2ZJ4A 1MD9A 5CW1A 5IARA 2L19A 1UBMS 3VI3B 3WGOA 3TN7A 5CD9A 1K4MA 3QVUA 4L76A 4AP9A 5JXIA 1XDSA 1KAMA 3B1VA 1P1IA 2EHJA 2WKRA 4QJBA 3ND7A 3ZE1B 4LGVA 1RKVA 2CXHA 3EARA 4E3ZA 2DPYA 4O25A 4WCFA 5F7JA 1H05A 3I9FA 5FOWA 4C2BA 1C7EA 2R68A 3QTBA 2WVAA 4G07A 4YAIA 1NVAA 2V8BA 3KQTA 3PUVA 4PNPA 2X9GA 3W9SA 5FNVB 4X8OA 3I61A 4JBYA 4WERA 4AN1A 5K51A 4ZOLB 1YBFA 2CLFB 1T9BA 5JUWA 2GKSA 2MT9A 4M38A 3KNZA 2H6EA 4HGPA 4HDSB 4UHHA 4JI8B 2FXVA 5BW8A 3HO1A 4I7EA 1EE9A 3HS3A 4N5LA 4V1CA 4JVSB 2R8ZA 4E2FA 3K9BA 5JFTA 3CLRD 3KO8A 1AC5A 4C21A 4D9MA 7REQA 5U4QA 4FN4A 4IQ0A 4B7UA 3KQQA 5LQDA 3IRUA 2KPOA 1M9NA 2O7RA 3JAWA 4U7PB 3HKEB 4IIJF 4V0SA 3UJDA 1NQXA 3LBNA 2YTZA 3R24A 4UVDA 4MA0A 3C1UA 3OFKA 3WIDA 1K98A 4ARVA 1WWKA 4NFYA 3OMLA 1AA9A 4LHYA 3ZIAA 1L0BA 2P0EA 2Y93A 3L7YA 4HGQA 3D0RA 3GY0A 1VPTA 3I2YX 4P4UA 1H8HA 1FLDA 1VKOA 1P62B 1Q0TA 2XOKD 1XF1A 3LXUX 3C8ZA 1GADO 3FKJA 1X15A 2FN3A 3PD7A 3TSCA 1EDOA 2JFPA 1THZA 2A0XA 3K0AB 2B78A 3X1KA 3S0JA 1OX5A 1WO8A 3G2NA 1VB3A 3MQ4A 3MT0A 4PG5A 2WM2A 2ZJ0A 1P29A 3K8YA 2BKUA 3PDCA 5DIFA 3I8XA 3TNLA 4MZDA 2IY9A 2BFFB 4U2KA 1ZOIA 3IAUA 3O5AA 4XR9A 1RHUA 1NVVQ 1XO1A 2R8EA 2XTNA 2VDLB 4NMMA 1TW3A 2XWPA 3HN6A 2YDXA 5K0EA 3HCOA 4BCCA 3Q3HA 3K32A 4FPXA 4NBRA 1I7PA 1YHYA 2D1TA 2BCEA 2IYAA 2QUAA 3BRCA 3I5MA 4LDQA 2ECOA 1BXGA 5ALFA 4DDHA 5B7GA 4YDQA 4JN6B 1K8ZB 1LDNA 5JXWA 3G8BA 4A6PA 4H7FA 2JEZA 2KBFA 4MYCA 4MUKA 1WW2A 2XB9A 4OB7A 2IEZA 4XJVA 1Q0RA 4MCJA 2Z8YM 1PVVA 2FSFA 1WNFA 1BHSA 1IHYA 2PMBA 3GQVA 2PMKA 3I9NA 3HJRA 1ZHHA 3I9OA 5AIAA 2ZR9A 1L5NA 5F7OA 6AT1A 1NVXQ 3LGSA 4US0R 4B71A 3K1YA 3HP7A 3MBIA 4C4RA 4BVKA 1ODFA 2IXBA 6YASA 4OUKX 5ABPA 3RAPR 4BGEA 1PR4A 1U6IA 5B3LA 2JCXA 4LC1A 5I51A 1ZXBA 4PZPA 1U4NA 5CB4F 2F62A 4O4HB 1DU4A 2CCJA 3EOBI 1F48A 3PA6A 2XZOA 1J2TA 5J2UB 3PHLA 4C89A 1XJ5A 2CFCA 4ZVUA 1FLVA 1H8EA 2FDRA 2QVXX 1LTKA 1B1CA 3AHGA 1M54A 3LKBA 1V35A 4URFA 5HUQA 5LMCA 1EVLA 5MN6A 2QMUA 3JQAD 3LAWA 3A2NA 2JHFA 5EJAA 2ON6A 1ZJJA 3TTVA 3OKPA 3W3ZB 1QYRA 4R4JA 5LQNA 2PL5A 3ZI4A 3TFQA 1CR2A 3D5TA 3RVBA 4WE3A 2RGBA 1K9SA 3SHFA 1TTHA 3KWFA 3LO8A 4ZIRA 4W63A 5EQTA 2E0IA 1PNTA 4J3JA 3TFWA 3UATA 4G0OA 3AM4A 2W0SA 2BMFA 2Z5VA 2QT9A 4MLDA 1GAQA 1ZU5A 4GX1A 2BMWA 1Z8DA 5A9SB 1B4DA 2BHTA 1NGSA 1RQ2A 3DEFA 3G2JA 4UBLA 3IP7A 2DLDA 2O3TA 2DBZA 3L8DA 2CLHB 5JAQA 1EFDN 5GMOA 4HQLA 4B2IA 3NMUF 1O4WA 4R8VA 3H83A 1G6KA 4PINA 1NR7A 3IIEA 5ALEA 3RS2A 1RRFA 1E2MA 1TFUA 1UKVY 1ZD9A 4UCQA 4B3BA 4X66B 1LPPA 1WSDA 3AIMA 1QUFA 3IBSA 3RVOA 2X9VA 3WX0A 2AOXA 4Q4LA 3FVVA 4Z54A 3WGMA 4YQZA 1JBKA 4N0EA 4PICA 2J0EA 5I8PA 5DO9A 4DV5B 4DCUA 3CGWA 5CA1B 4QYIA 4RH1A 5AM2A 5ADVA 4JQZA 3A4NA 2N1MA 1R4AA 3KVRA 2G7ZA 3ES9A 4PYOA 2OGUA 1J33A 1FEZA 3WYCA 1BVHA 1PW5A 4Z2AA 4IFTA 4O4IF 1G5RA 2ALJA 1PLJA 4I4TF 1GPH1 1QO7A 4ZT3A 1U0HC 4QLOA 3IEVA 3PQCA 2HADA 1YU9A 4HUTA 3KOUA 2JFHA 2XBUA 5C1PA 4YI5A 1R9GA 1Y3IA 2ZBPA 1JA1A 1DRVA 3D4BA 3JQ9A 1OZ0A 4WKCA 2OAGA 4AROA 3HLYA 5A9RA 1KRXA 1R12A 3UC5A 1PK8A 2LXNA 3RGWS 4GMHA 1PW7A 2QX4A 4MR8B 2O2CA 5INTA 3BIXA 1HDYA 4TKVB 3D2LA 4RJLA 1UMBA 4MLZA 1VSBA 4OCZA 2ACWA 4QSMA 4YFYA 1ZMOA 4GAEA 5EZYF 4FMCB 4RZQA 4IPTA 1GR1A 1UZAA 4QGAA 1QHSA 4XJTA 3FRHA 3RGGA 4ALKA 2R96A 2ORED 3IFSA 4M86A 3ZDFA 2W6NA 3GELA 4IDCA 3VU3A 4YMHA 3RADC 2O19A 5H59A 4JI6B 4KLCA 4BRWA 2GXUA 2WUFA 4J16A 2HA4A 3VO1A 1GRVA 3FA2A 4RC9A 3U3JA 3SQMA 4RL6A 2BFNA 5BW5A 3AFMA 4OTZA 4N0MA 3W8RA 1KK2A 2AZMA 3GZNA 4Q82A 1QGZA 3D6VA 4RGVA 4CUZA 1JVBA 1M73E 1Q1NA 1TE2A 2IH5A 3GA7A 1EUYA 1M2EA 3OKFA 4QXPA 3BSWA 3RHZA 4BAZA 2ADFA 3LECA 5HSGA 1NM5A 2BBTA 5KNCD 4XFJA 1DZIA 2W83A 1Z0ZA 5GGYA 1FFEA 4EEKA 5AJVB 4M8SA 1XE3A 5AVKA 4ZCRA 5L3SA 1XUOA 1QE0A 1W36C 4OQPA 1U8TA 5CMLA 1XDWA 2AG1A 2YYYA 3CLTD 1GU1A 3BA1A 1YA8A 4N6GA 3E7XA 2GZAA 3U1BA 4N48A 5AHRA 4GP9A 2FW9A 1GTJ1 1U0OC 4MUNA 1T6YA 3M6VA 1IUKA 4HGNA 4DLKA 1RLUA 5TPZD 3S1AB 4KO4S 3NBUA 3JZDA 3REQB 4MS3B 1NPTO 4BNMA 1ND6A 2HBYA 2JJ2A 3R20A 4DDUA 5KSYA 3E8MA 3UT0A 1PDVA 2N46A 1S3IA 1GY8A 3AH8A 4BFCA 4K9MA 3S40A 1QFSA 2P78A 1B16A 5EWMB 4DCCA 3NWPA 4LSGA 2GN8A 2R7MA 3IE1A 2XA9A 3N0XA 3VPBA 3ZW7A 2OILA 4HNQA 4O1MA 3WJ1A 3HDGA 3KLMX 5KQMA 5BQPA 3WGUA 1QKIA 3DBIA 3EUWA 3S8EA 1ICEA 4LHVA 1Z2PX 2PSSA 3RT9A 4H7PA 5HF9A 2WTUA 3KBOA 3K09A 5LMZA 1PR9A 3FJ1A 1UBKS 2CUKA 4G81A 2EKZA 4D92A 1SKQA 4TWRA 5A3RA 3UUFA 1DEOA 4RIGA 3VHXB 3S1SA 3DDHA 1U02A 2DQYA 4TKUB 3R0IA 4I5DA 4M2LA 3E3OA 5HF6A 4X45A 4Q21A 4RMIA 4OHOA 5KNDH 1MB0A 3AQIA 4N6NA 3OQMA 4NXNB 5F98A 1FVFA 2AT1A 1YS1X 2X4IA 3STYA 4B7XA 4D0NA 2QYSA 2OCGA 5A4IS 4H77A 4LE0A 1K8RA 4WECA 4W5RA 1EAYA 4V0MA 3U81A 1G38A 1V7ZA 2CE2X 4C4SA 4MVWA 1BKSB 1IBKB 2C5LA 3N74A 4YDHB 1Y3CE 2IKQA 1WU7A 1S9DA 2J3KA 2P8JA 2VP4A 2XH8A 3W06A 4F5EA 2PD6A 2YBDA 4YB8A 5BN3B 5J2TF 1NC1A 4KXMA 1E3TA 2VLBA 2AOTB 3FMIA 3L1UA 1Z12A 5EQFA 4A5SA 3LY9A 1MHTA 1UC5B 2ZROA 1NUPA 1ZQ1A 4NBNA 4NV3A 4ZO4A 2EAUA 1Q12A 3KPUA 1ORVA 3E2MA 4UZSA 2DX7A 4MAMA 1U7XA 2HC9A 5D5PA 8GPBA 3K8QA 3HFGA 3BXFA 3LCRA 3ZWOA 2GZSA 4X1IB 4IH1A 4PM4A 2VAPA 2XCLA 7ABPA 3PUJA 5KYKA 2XNDD 3PP8A 4QUAA 2YY5A 4D9IA 1L7EA 3KQNA 1TQ4A 1XEAA 2RGCA 3P2EA 1NX6A 4IQGA 2CBXA 2PHZA 2RGAA 3I1IA 2O3QA 3MGGA 1L7NA 4Z4EA 1F12A 1B7GO 3JWPA 4HB2A 5TMPA 2RHJA 2XHZA 4XWYA 4QU8A 3DP9A 2HL6A 1P7WA 2Q9UA 3PC6A 4NCIA 1OGIA 4RE5A 4BVFA 2IS2A 2B1GA 1J25A 1UPTA 2XB4A 3Q72A 1GFWA 3U2QA 5AM0A 4MP6A 1ZD2P 1B76A 2FPPA 2WV9A 2ZI3A 5ETJA 3PQFA 4C0KA 3QPWA 1QZZA 2F64A 2QROA 3BE6A 4FKBA 4GI7A 1NMQA 1H1LB 3IMGA 1Z6ZA 2B1RA 3TYXA 3L8HA 4WA7A 4XR4A 3W2FA 4EJ2A 3EC1A 3F9RA 1GTZA 1R9JA 1XTIA 2VP2A 4HEJA 4CM8B 4E1AA 4HAIA 4ARUA 4QGGA 3NOOA 1NSFA 1WZUA 1RZUA 2WI8A 3LUGA 4ARZA 1J7KA 3KTAB 5JZBA 3ZD6A 3TVTA 2C9OA 4EHIA 4WKGA 1X8KA 1Z7WA 2P9GA 1Y6GA 5BVHB 3T15A 1ABFA 3PENA 1PV2A 5F5NA 3H65A 2EDCA 2D3TA 2BFDB 5EYPB 1I6WA 4HZUA 3HRIA 1VCNA 4OM8A 3KSAC 3K0SA 2YWCA 3OTOB 1IEVA 2BF7A 2XMBA 1F3LA 2GT1A 2Q6LA 3G49A 1QH8B 4OF4A 3U7EB 2B6HA 3V9AA 4ALMA 1J0XO 2A0UA 2GLTA 2UVPA 3AEUA 1HURA 3D54D 3E2PA 1XDBA 3BWXA 3BWDD 3HV0A 3O1HB 1H6AA 3G02A 4NC9A 2ZRJA 4HNAB 4L2IA 1BSVA 1P2BA 3PUIA 5CT8A 4JUDX 5DW3A 1EDEA 4AG5A 2V6JA 3GA0A 4ABTA 2BSXA 1W1WA 4Q37A 2J9RA 3FI9A 5K3FA 1P0FA 3DQPA 4DQKA 2R5FA 4IQ4A 4GGMX 2Z0MA 2R60A 1R6AA 4N4AA 5IUJC 1FJGB 3ZUPA 4N41A 2W5UA 4R9UC 4TTSA 1MHPA 1Z6PA 4EDFA 1BA3A 4PV7A 2C3UA 2X5XA 4Y9TA 3TNDA 4OSPA 3BGIA 3OZAA 3AUXA 5KQSA 2QJFA 3WAJA 5TB5A 3GG9A 1AT1A 2J9XB 1EGVB 1NF8A 1PT9A 3H8VA 3KWMA 3PTZA 2FZGA 2IYPA 3T41A 3VPDA 3W8DA 5KHOC 3F78A 2YV3A 1BRMA 1CRZA 3FHLA 2WJVA 4XDZA 3L0CA 3VFDA 2WHPB 1P75A 1R5JA 2CZQA 4G5FA 3WNZA 3HLKA 3G79A 4GNKA 1YCHA 1FNDA 3A11A 2CZCA 2ZBDA 3AMVA 3ZHUA 4DL9A 5KIAA 2PL3A 1T2DA 3EJWA 4DQXA 5EWJB 2J3IA 1FJXA 2A0WA 4JENA 3UB2A 1FRFS 1BD4A 1X1TA 1ODLA 4K5QA 1WMBA 2UZ0A 1NN0A 2HDOA 3EGDB 3Q98A 4LRWA 4YJGB 4AWBA 1OX6A 5BURA 3KZNA 1L5YA 1VSQA 1ZKDA 1HRDA 4ZQIA 4RZIA 2WKSA 4YPFA 4J4BA 3SHVA 1KIFA 3PRKE 2XEXA 2RKWA 2RKBA 1Y3BE 2WIDA 1YNOA 2PXHA 1J0DA 3GJ0A 2XSZD 2UYYA 1G3IA 1A9ZA 4CL3A 4U9HS 1IBMB 3FPFA 3TTSA 3NV7A 4FZ3A 2X41A 3URMA 1NI5A 1MVOA 5IPFA 2ZBFA 2Q1WA 1L5LA 3A6DA 4JI1B 4KO1S 4LGMA 3ZGYA 4D6PA 1B1AA 2OQ2A 3U16A 1OU4A 2AR0A 3O4VA 3TBHA 2XGMA 1DBSA 2QUKA 4GBJA 5KTTA 2NPIA 2FPIA 2IP2A 2XZTA 3UK1A 1G3QA 1QGUB 3VH4A 3NUGA 4MGZR 3AQ4A 3EZFA 5CNJA 2AEMA 3HVHA 4AJIA 3TTXA 4TWZA 4Q7QA 4BRZA 3T95A 3E35A 2F3SA 3M3HA 4F11A 3DOJA 4I6GA 4O63O 2MYPA 4MHOA 4NENA 3GRRA 4TYPA 1L5FA 3SBOA 4UHJA 5J40A 1UBOS 1RPZA 2A5YB 2DC1A 4Y6OA 3NOVA 3T3EA 1BX1A 3ZDZB 3LBHA 3HK2A 5B1SA 3GEIA 1AQUA 2IS6A 3R44A 2B6NA 2DFPA 1G5PA 2BUCA 4DNFA 2HEIA 1UJBA 2IOFA 2PT5A 3LXMA 3BC1A 5FOVA 3ZWVA 3MQ2A 4BTEA 3DM9B 2GX6A 2W8BA 1RAFA 2EWMA 3NT5A 1R64A 2HJVA 3NAQA 3BXEA 4YWJA 4RHTA 3VZDA 3FNFA 1EFHA 1M2OA 4QGBA 4DCSA 3IAM1 1G55A 4ZGWA 4ZXPA 2JGEA 2EGHA 3C6MA 1U0LA 1ZJYA 4R9VA 3H2HA 5EUQB 1P7VA 1V9LA 1IUOA 3DL4A 3TEMA 1HUQA 1S01A 2Q5JA 2B4YA 1QX4A 3NTVA 1M2NA 1N5LA 3B1ZA 4RD6A 2QVCA 3BQMB 4DEXA 1PZEA 4YYZA 3H2SA 1N7GA 1JYFA 1ZGAA 4LZJA 4MW6A 5BOVA 3BMXA 1R8YA 4TLBA 4CR8A 2W2LD 2EQ5A 2F3RA 3PT9A 3ED1A 4ONEA 421PA 1E3IA 1YMVA 3JZMA 5JMOA 2DUNA 1UZLA 3U4QA 4C2AA 1X87A 1Z3CA 1T6XA 3AESA 3I23A 5K8VA 4NJMA 1Z4OA 2H00A 4EA8A 5KB3A 1ORIA 3UXHA 3NKLA 1Z06A 2Z3VA 3EVGA 5HG0A 1KJJA 1Q0HA 2DR0A 4YJGA 1P9LA 4XQCA 3D8NA 4AD8A 1G0OA 2R25B 4R41A 4M3NA 3RIMA 5DHQA 3VR4D 3RTGA 1IULA 5REQB 3E70C 1E3DA 3OIGA 2DKNA 3H2ZA 1I4OA 5GZ3A 1QR6A 3FLBA 2ISQA 1K86A 2BH9A 2WJ6A 3JQQA 3HZZA 1DIBA 1G8JA 5AR1A 3RVKA 1XGKA 1C9EA 3BMNA 1OTYA 4PQYA 4DHEA 1Y1SA 1BXRA 3L0BA 2JHGA 2VJYA 1FSFA 4QVGA 3IKMB 3ICCA 1U0RA 3OICA 2A6PA 4H3HB 1BFUA 2VC2B 4WY2A 5F7ZA 4LRSB 3DMHA 4BZZA 1IYZA 5IJWA 1V96A 4MP3A 4Q93A 2YWXA 2ZVQX 4EITA 3SGLA 1M6HA 2J3DA 4KL8S 3TW8A 2G1PA 1A2QA 3GP5A 1OX4B 5HE9A 2QGNA 3S7ZA 1EHCA 1JHMA 2Z9CA 1JTFA 1Y9EA 2OGSA 3ND5A 3INTA 3VDQA 4EBFA 1CJBA 2IZ6A 4JQYA 4F5WA 2UYCA 5KYWA 1UJ2A 3AFHA 4ZI5A 4U9IS 2GWRA 4AZVA 2P6MA 4YIHA 4HQKA 5K0NA 3QXHA 2LW7A 3ZNPA 5KYXA 5LM3A 4EHFA 1GNVA 2B7BA 2XYHA 3MCZA 5KWVA 1IJKA 2A9QA 3AEKB 4O8CA 5CB8A 1ORDA 2HEGA 4MUIA 5JS2A 5FAKA 2O8BA 1JR6A 4TPKA 1IY8A 2Q27A 3HUDA 4PR3A 4RY0A 1NE2A 2HHCA 3P1JA 2ASVA 4C4YA 1QGDA 2XNJA 4IINA 1I4LD 4J1TC 1WEKA 2ZDGA 4PLPA 4AB1A 3WGYA 4JQCA 1R5NA 1NL3A 5E8JA 2FAXA 2Q2QA 3KCQA 4IXWA 4ESOA 3BMQA 4C0BA 1EKXA 3A1SA 5DW0A 3OQIA 1I6MA 3MWFA 3QVMA 4IEIA 5IKPA 5JH7A 4OQMA 4MINA 4AC9A 4O2AF 4ZVTA 4PO8A 5CEJA 2Z9BA 4LY9A 2DPLA 3V7UA 3WTCA 1PO7A 1PGNA 3T06B 1SFRA 2DJIA 1Z28A 3AUAA 3RIYA 2O8BB 1BQ4A 2BFCA 3FSJX 3IKVA 3MIZA 1C9DB 2B34A 3MLAA 4ZHSA 1FSPA 1C9KA 4JYZA 2R1ZA 2QZ9A 3V6MA 4I5FA 4MPJA 3NHYA 1GEEA 1GFZA 3CF4G 3OZGA 1WXXA 3Q7TA 4W7IA 4ZVNA 1ZL2A 2J4FA 2PKXA 3OHSX 1JE0A 5ECYA 4EF6A 2H4ZA 1E2PA 2QR3A 3TZCA 3ORFA 5ALVA 4C6RA 5F2NA 4FKZA 1YDWA 4JOQA 1AS3A 1TYDE 2J5QA 4NKRA 4WLVA 4Y0NA 5GY7A 2CNBA 2DHEA 3R9XB 1ZESA 5BVGB 2D0PB 4O3MA 1HT1E 3T0IA 3O2JA 4NENB 4YK7A 1H3NA 4BNFA 4DWOA 1JPJA 3SEFA 5KCZA 3DT8A 4X94A 2E37A 1MH1A 1B6GA 1LLQA 3UA4A 3VR2D 2B92A 1O7JA 5G0SA 4AMZA 4AZSA 3ONEA 3A4VA 1JECA 3DHEA 1TF2A 2QN8A 5IXSA 1KEZA 5F1YA 1K92A 3NDRA 3CLUD 2HTFA 3MW8A 5FV7A 1XP5A 4LI0A 3SS8A 1SBYA 1VE3A 5DM60 1NPDA 4JEMA 2AJBA 3COJA 3WLIA 1Y6RA 3SZOA 2CBGA 1M6VB 1G20B 1I7LA 1TU4A 4QOGA 4KPFC 1U8AA 4BWVA 1R2QA 2O4UX 4ZARA 3WGHA 2PRZA 3L1IA 2FRVA 4TSFD 3D6HA 1L5HA 4X8HA 4IKPA 2NUTA 3ETNA 4HNAA 3C7CB 4DJAA 2VPXA 4QQRA 1LDBA 1RYYA 4FEGA 5HVNA 3WHLA 5D6NA 3NBMA 4FHDA 4M60A 5JEEA 1E2KA 4NV0A 5B1YA 1L8QA 3ORQA 3LUJA 4LFBB 1XNRB 1VJ1A 3FYDA 4OSOA 3ONDA 2A9JA 2QS9A 5DM4A 1RTTA 2I3BA 3NCTA 2G06A 4R84A 6REQB 3D8RA 3MWDB 4FSHA 1UK6A 2J67A 1N2OA 4B47A 1K08A 1RRKA 2JIPA 2NTYC 3D8SA 4RD2A 3SC6A 4JLAA 1XTRA 2IHJA 4DLTA 4ZICA 1GPNA 5KNDA 5HBGA 2C03A 2PBZA 4RH0A 1NKSA 1XNJA 2PXCA 4A9AA 5HIIA 3DAFA 3QLUC 4V1CI 1CUSA 1BMQA 3HVJA 4IDDA 4XOIA 1Y37A 3VI4B 3GYBA 5HF5A 4GOMD 5JMPA 3FUVA 5KNBD 1F3OA 3KXIA 3IEUA 4HF7A 3PXGA 3X1JA 4RQBA 2AZ4A 3MLBA 1VB5A 3BIJA 3CBGA 5FTMA 2V4UA 4ZV9A 4QDJA 4AN0A 3PL5A 3AHHA 1J8QA 4NBSA 2CLLB 2Q5EA 2ZWOA 3HB0A 5K6TA 1MW8X 3EZ7A 2RI0A 3EDCA 4MS3A 1ZJ5A 3D3JA 3I09A 2H07A 4Q7MB 5TQ2B 4TTVA 2I4TA 2OL4A 3AKYA 1DDOA 4AECA 5I7VA 5DXJA 1IWBB 5DNEA 1GG5A 1W6UA 4UEOA 1LI4A 5C8ZA 1TM2A 5T6MA 4PPQA 4JV5B 3LNCA 3RSQA 1UJ4A 3G9ZA 1F0KA 2ILTA 1ZK2A 3MJFA 4F6CA 3IE2A 1X3LA 5AW7A 2QNBA 5JJIA 4U7FA 3O82A 4L4SA 1ZD4A 3I9KA 3OCCA 3OJCA 4NH4A 1E1KA 3ZXYA 2WWWA 1Z18A 5TJ9A 2CDCA 4K6GA 4QPZA 4ZPXA 1RWBA 1KQOA 3PK0A 1ZS9A 1FP4B 3M5DA 4TKMA 4KXNA 5EKDA 2YKGA 1SCQA 5ED0A 1W76A 1PCXA 2AEEA 1CRQA 5DN6A 1C0PA 3KJZA 4FU0A 3R09A 1ZVQA 4KPYA 3PLNA 3QEMA 5JPIA 4YACA 3QE4A 1XZKA 1QWOA 2ODTX 3FOAA 3EGXA 4PYNA 1II9A 4RVNA 3RNOA 4E33A 1MAWA 4NEHB 1P7YA 2IIPA 4QREA 2R47A 2H1VA 2X5NA 1CVIA 1PJ3A 1XJQA 4K2HA 2NYUA 4LZOA 4WACA 1EDBA 3H4MA 5JCJA 4RIIA 1USVA 3VUEA 4CN8A 1W2HA 1URPA 5JXHA 1ESEA 3GDHA 4LWOA 3QUSA 1UKZA 1ND5A 2Y8EA 4XSGA 3ROFA 5IVPA 4UAUA 2QJTA 1YFLA 3C7KA 1NMEA 3G82C 3GMIA 4HN9A 1RHQA 3EMBA 3WYFA 4EQZA 5LQCA 1AKQA 1PGPA 4YP6A 2QK4A 4E6EA 4F3KA 5EJ9A 4PZZA 1MZVA 2D2EA 1KR2A 2OY0A 4KR7A 2QE7D 4BLPA 3Q6NA 1G5FA 1AU9A 1FP2A 2GPTA 3D7LA 3MAAC 4V0LA 3RHSA 5IABA 2AN1A 4V0NA 1DBIA 3OECA 1C1XA 1OWPA 1POWA 1X13A 3UMRA 4MKXA 1AB5A 4NJEB 3ELWA 2WSMA 1U7WA 1M7BA 3RTDA 4EG1A 5B30A 5BSFA 3QVGB 4KLNA 1YBVA 1NW4A 3IEIA 3RHTA 1JTEA 1E7QA 2DFLA 3Q1LA 5T4FA 2ZRAA 3ADCA 2CNWA 1P45A 1UP7A 2ONKA 2WU3A 3RRMA 1BU8A 1WBJB 4CLDA 3SS7X 1F2UA 4OGKA 4TX1A 2IYOA 3Q40A 3QWBA 3KM0A 1W5FA 4URUR 2RHGB 3L7AA 4LRQA 4KFUA 3ESZA 1Q22A 4JLOA 4CKZA 2NU9B 1Z5ZA 1DT3A 3E9YA 3EB9A 4NOMA 4PPYA 3VR0A 1H2AS 5AJXA 3EDRA 5DSTA 3ASUA 3CF0A 4CLRA 1KEPA 2NT3A 2FETA 1D2NA 2NO6A 4KREA 2VPIA 3IYLW 2O8DB 3U31A 2P91A 3DMFA 4Q1EA 4XCXA 3UHAA 1K89A 1T0BA 4LDAA 4B73A 4YRMA 2F55A 1LBEA 3ZK8A 1OZFA 2BFBB 3O7MA 1HNWB 4DMRA 5HM6A 1PYOA 2YIMA 3B5EA 1D6SA 2ZIWB 4A8JB 4HG2A 2KSQA 4U7TB 3G13A 5F12A 2UXDB 2YR0A 3C3WA 3KSZO 2ZBGA 4EGAA 2AEJA 2EZ4A 2IHUA 3TXYA 3IKTA 3H1FA 3IPLA 1QO0A 2O0LA 3LL7A 4JY7A 4KIWA 1HDIA 4KYVA 1TB4A 4TMXA 5CTAA 1O6FA 3WLJA 3O4HA 1QHFA 3R3WA 3UFBA 4KI7A 4I0WB 1U8ZA 4EJFA 1NJ8A 5EP1A 4CF4A 4XXHA 2O54A 4YAJA 1BO6A 4W5HA 4ND2A 2AVNA 4MGEA 4N5HX 1WXEA 1F1BA 5CUQA 3KSBC 1Q1GA 2H4XA 2PJZA 4J0HA 1CX9B 2YZGA 3BORA 3F6EX 2NVOA 5C8XA 3U44B 3GZJA 1IUNA 1WD7A 3LIIA 2Y3IA 1DIHA 4Y2VA 1CF4A 4S1WA 3RU2A 2YYZA 3GRPA 2G5TA 4RXMA 2V7WA 1VI5A 2WJHA 4FE4A 3U09A 2WNHA 3K15A 1BU5A 3CRVA 2WG2A 3UHPA 3PJDA 4HXYA 2FWMX 3JVUA 2YN4A 1IIRA 1MABB 1NY6A 3OY2A 3RQIA 3ECSA 1IHUA 4IGAA 1G3UA 1GLVA 3GGDA 4PXAA 4H1VA 5KAPA 4MGHA 4ZO6A 2G07A 4GFDA 1K6MA 1ZU4A 2H9IA 3KJGA 4Q3DA 2PGIA 1QRRA 2RHMA 3RF6A 1E58A 4HLDA 5D8DA 1N36B 4ISCA 4PTZA 3OE4A 3C3CA 5IBCA 4JL8A 1DX9A 3ZD9A 5JAZA 1U9IA 3WA7A 1YQGA 2SICE 3EEFA 1AKMA 3O1IC 5EKTA 2Q7DA 1BW9B 1EWRA 2QLTA 5IFLA 3EPHA 5HEKA 1NW6A 2NXNA 1P8JA 2JA2A 4PFKA 4XEUA 4FXPA 3TQFA 4M6WB 4MKHA 2BDUA 2VXCA 3AR7A 4MTCA 3VV2A 4F5DA 3RUHA 521PA 3R3XA 4NAVA 2PZGA 4LA4A 2XQVA 1AUVA 2B36A 4MKZA 1YJAA 4O2BF 3D0OA 5TMEA 5K05A 3IUQA 4RKEA 4L6IA 3AV0B 4UEJA 2QUBA 2G09A 3I76A 4M1SA 3FFAA 2XKBA 3ZLTA 4C78A 5MHTA 2VXYA 1JX6A 2ZT8A 4LYFA 3ZHVA 2VPZA 4CHTA 4HJRA 3SEZA 5L9AA 4JOBA 1ECCA 2JRCA 2A9KA 3F4KA 4DJFC 4DY4A 4EYSA 4LJRA 1TD9A 1I51A 3K9FC 2WYIA 3A9WA 3TLKA 3ZBUA 1W0JD 2WRZA 4TWIA 3C15C 2QTRA 3SCZA 5CFNA 2JL1A 2JC3A 4DREA 5B6PA 5JLJA 5K09A 1I2ZA 3EIOA 1SUPA 1YE3A 1M0EA 1KOGA 4UUOA 2XMDA 5GJWC 2BI4A 3IBYA 4L5CA 3WWYA 3MHTA 4M88A 1HOTA 2KI5A 1GAEO 2XVAA 5K3FB 5K9ZA 4WPGA 2J0UB 3SSAA 1DFIA 3GARA 2C4KA 4HX9A 4RK6A 4WCVA 1YS2X 2VZLA 4X1YB 3LQRA 4BO9A 5JS7A 1DPFA 3DDZX 4FOLA 3BB3A 1TIBA 3BWMA 5TQ0A 3WLSA 3GAZA 3JY6A 1CB0A 4MROA 1JQ5A 3DOFA 3RLIA 4LYYA 3UJBA 1THTA 1P0MA 1NYLA 1O08A 3I72A 2QY9A 4OHMA 4ARIA 1DO8A 3GJXC 1FFXA 1GZUA 2QORA 4XWTA 5L3QB 2RB4A 4EMSA 4P3YA 2PE5A 1V5FA 2C5GA 4RF5A 2CMFA 3K8ZA 1CZHA 3OEHD 5EE3A 1BWQA 1NDHA 1ULAA 1A97A 3NTLA 3CA8A 4DCJA 2ZKIA 4CKXA 4PFSA 1AY0A 5TEWA 1MC1A 4CWAA 5AVXA 5LJIA 4QQNA 4J1TA 4DCVA 3OLXA 4HNHA 1FNMA 1TYEB 2I91A 1N2ZA 1Y81A 4MRNA 1UH5A 2QRGA 1GCGA 4IQFA 3K0EA 1R6DA 1QB8A 3O8NA 4R01A 5FI1B 1A4UA 3C6BA 1OFHA 5HQ3B 3GJYA 2IZOA 4KU4A 3PR2B 1SCNE 4LJ7A 5HBRA 2YHBA 3G9UA 4AYWA 1W88A 2PO7A 1Z0AA 1V45E 3OE5A 1U2GC 2REQA 3TTYA 1D04A 4MQEB 4BUJA 1TOAA 1CUUA 4AG3A 1E9RA 2VA9A 1CZRA 3VR6A 2OHXA 4A2PA 5LL6P 4LF5B 4PR0A 1RMQA 3P8ZA 2DSNA 3K4PA 3O8QA 4IIDA 2DHDA 3RYFA 4DPKA 1SEPA 3H86A 5EMHA 4ZA2A 3UOWA 3DMPA 1FDOA 1JQKA 3A1CA 5DWQA 5IZCA 3DLIA 3PUWA 3VNVA 1IBSA 3DV0B 1S2NA 2BI8A 4BB9A 2I1QA 3RVPA 1FIUA 1GG9A 4EO4A 2FUEA 2GS9A 3KL2A 3NKFA 1M2WA 4DBZA 2DEUA 3DHYA 3IIKA 3R5XA 4JYPA 1G64A 1VG1A 3TAUA 2FX5A 4A0SA 4F2WA 2YZMA 1AIPA 1YQ9A 1BMFD 2J0VA 3Q5DA 5FPYA 4DZRA 4QLBA 5KVCA 5BV2P 1T3GA 3L01A 4GEKA 1S2GA 5CXXA 3CJTA 3INRA 4IMIB 4LRYA 4F6LA 4QNMA 4BO6A 3KQWA 1GSIA 3A2MA 1GQFA 1YDEA 3D1VA 4ZTUB 2BHRA 4GYWA 5FWDA 3SEAA 5A5EA 2QL7A 4O2BB 1GKIA 2ZR7A 2PZLA 4RV4A 2X0FA 4NU6A 3P9SA 4D4MA 5JCPA 4FKMA 1D2HA 3QE0A 4K8RB 2XTMA 4NZPA 2PLNA 1TO6A 1EZZA 1SVUA 1E99A 3CTMA 1LC3A 3KDAA 3NIBA 3HXOA 4BN4A 2JH8A 3F5DA 4WDRA 1L4LA 4MQFA 4EFLA 5BR7A 3TJZA 5J4VA 1V16A 1BD3A 2JBAB 4WXRA 2FUKA 1R6XA 2BEJA 2NXEA 2QZZA 3O93A 3QMWA 3SMQA 5B2FA 4DXHA 5TVGA 5C2JB 1JHAA 4UKDA 5MGBA 5DNCA 4TQGA 1JXMA 1UZNA 2NTEA 1EK0A 2QNRA 2Y27A 3ANNA 4AUEA 1QRUA 4J6FA 3TJRA 2NO5A 1A5BB 4RANA 3RYFB 3T5GA 5I6DA 1HMYA 1Z8HA 5ER6A 1N4AA 5IC6A 3SJCA 4O4LA 5HIJA 4ER7A 1Z63A 3LRTA 1UMBB 1FPMA 5I7WA 3NH6A 3UB3A 5KS2A 3IL2A 2JPDA 2GPWA 1CLEA 1SUEA 2WLSA 2P90A 1PIWA 3TLBA 2P6NA 4HYEA 3SVLA 1TJ4A 4A36A 1YR1A 1KK1A 2J6IA 3ZTTA 2IC5A 2OR3A 3JQCA 1YGPA 1K7EB 3PSAA 5BWMA 1N2CB 2I9PA 5EJIA 5HGXA 1IOVA 4O2LA 4U2BA 4F3CA 4DMFA 3A4YA 4FEEA 4B1FA 1UMDA 1VMDA 2MMGA 4CGYA 2O2DA 2C54A 2WU8A 3X44A 3U7FB 4AJOA 2FQYA 3SS9X 1S2IA 5KNLA 5F2KA 2J9FB 4FD3A 1I1OA 2C59A 3IGFA 3Q12A 3VDNB 4YCMA 2OHGA 3DDUA 3G17A 1R0ZA 4IIJA 4X3CA 3UTDA 1RRVA 1T3HA 4AZTA 1EU1A 2NIPA 4F9TA 3B78A 821PA 1D2EA 4ND6A 4CG3A 2OC9A 3AZQA 2DFVA 2E49A 4NZOA 1CQJA 4KVFA 4PSDA 3CH6A 5SZKB 5KUTA 4C1NA 4WFKA 3BXXA 3OT1B 4L15A 2QD5A 2WAOA 3HDVA 4OUDB 3RVNA 1KAEA 3T1YB 4DRXA 1H85A 5I5GA 5EPOA 3BRWA 2JGDA 4MV5A 1T29A 3HN2A 4YXFA 2JFBA 1E0SA 1FS4A 5BRJA 4KAFA 4RQTA 4EKYA 2QR2A 3FTPA 2GA8A 4ETWA 1U9CA 1M2HA 4HAUA 5IKOA 3G0DA 4QG7A 3D8BA 1MV5A 4MW5A 2ZSAA 3ESRA 2GPYA 4QTXA 4ZOCA 5JJ5A 4CG1A 2DP4E 3MGCA 3PF9A 4HEA1 2PFSA 4H3SA 2Q99A 1WMDA 3C24A 1C8KA 4DBLE 5THXA 3P2MA 2X0JA 3EXEB 3EH1A 1CP3A 3MEQA 4BV8A 4ZPJA 2ZYDA 1OV4A 1NMZA 1BN7A 1WSWA 2C7GA 2ST1A 1YRWA 4BFUA 2O8EB 4H31A 4MW2A 5DN9A 1PN3A 4YP0A 5IT9A 4GPZA 5AESA 2I6QA 1W19A 3FPJA 1Y1QA 3AR6A 4U4AA 3GN1A 1SC6A 3PGXA 4RBNA 5AQ1A 1X1RA 4TVOA 1JYEA 4X7BA 3VU1A 2ZITA 3VR4A 3ZGVA 1G0NA 2I7TA 1BTOA 3DF7A 4KIUA 3D6FA 2IHYA 2JAPA 5IDVA 3WWPA 4AMVA 4CJXA 4NBUA 4EI7A 2H2IA 4FX5A 4B80A 3OA2A 2AQIA 5I48A 2TMGA 2JJ1D 2V7TA 2WSYB 3TAHA 4J0QA 1E8DA 2A5LA 2QI9F 3SJAA 4L5YA 4FMDB 3NBXX 2W8BB 4Q3EA 4WXPA 3PE3A 4IUCS 1MB4A 1V5GA 5DM1A 4DILA 3MF4A 3CNLA 4AQ7A 1VPLA 2W11A 8LDHA 3V4ZA 5KWSA 4BV9A 3R3YA 1ZC4A 3G1TA 3DV2A 2DGDA 4M4SA 2OQRA 3DXYA 1K2WA 1KAHA 2ZWAA 3E18A 2G5GX 3REGA 5IJ9B 1CB7A 2NU7B 4UZFA 2CXQA 3VDXA 4EG6A 1P4HA 3R3JA 2FEXA 3HB5X 1MENA 3R8XA 5JHHB 2Y67A 2HSWA 1PBTA 3FFWA 1QDUA 4FE3A 4FHCA 4JP2A 5AXCA 4ENPA 3W2GA 5KQGA 1MTZA 2R3SA 3GGJA 3TCNA 1JLLB 2H3HA 3OKAA 4RA9B 5JRJA 4G0QA 4FZJA 1OXKB 4IUBS 1YVDA 3N8KA 4R2HA 5M3BA 4EF5A 1KMIY 1G2IA 4PTLA 4YQEA 1MRZA 3LY8A 3EXG1 2V5AA 3QBTA 4FXOA 4NI5A 2GEUA 4RENA 3TEJA 4TTIA 2O23A 3DO6A 4WLNA 3H5NA 1IN8A 1ESMA 5BQFA 5BUCA 3I1FA 1X7YB 4AZ3B 5KX5A 2ZBVA 2O8NA 3ITDA 3FMGA 3RSZA 1Z6TA 1TA0A 4MAFA 4ZZ0A 4ZYVA 5A1TA 1QG0A 1I80A 3TR6A 1KQNA 3WOHA 4F9FA 1W49A 4RMGA 3ZH9B 4QJ4A 1QWSA 3KR0A 4EF4A 2R8OA 4RHFA 3U4CA 1K4YA 3HSYA 3UWMA 2JVIA 1JDNA 1YB1A 3HUUA 5CNMA 1WUIS 2GEFA 3KVYA 4CMEC 3FSGD 4Q7KA 1OXBB 2N1BA 3PKIA 4QUGA 4YUXA