4YMHA

Crystal structure of sah-bound podospora anserina methyltransferase pamth1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
239
structure length
239
Chain Sequence
LGSILPFNEETADRVSAYCEKNSHGIPDALVEHWEWTRTRFPDADKMSSRLQGSWMIFTARDRKPKRILEIGCYSGYSALAWYEGTRDTKAEIVTLEYSPKMIAASREAFKKYGVGDRVKLIEGPAENTLKTLEGEFDLIFVDANKDGYAGYVKTILDQGLLSANGIILCDNVFARGLTIGPDCAPWLNDHVRPYWNGCGQALDKFSAGLMEDPRIDVLLLPVFDGVTQIRWKDGAQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative SAM-dependent O-methyltranferase
publication title Structure and Biophysical Characterization of the S-Adenosylmethionine-dependent O-Methyltransferase PaMTH1, a Putative Enzyme Accumulating during Senescence of Podospora anserina.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Transferase
total genus 86
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ymhA00
3NDIA 2PWYA 4PYOA 3CBGA 3HCFA 1NW7A 1WG8A 5EZQA 1KPGA 2BR3A 2FK8A 2ZWVA 3EVBA 4OBXA 4ER7A 4GOLD 3NMUF 3LCUA 2XYQA 1YFJA 2NXEA 5DM1A 3VC2A 4Y30A 5LQKA 3PFGA 1EJ0A 5DTMA 3FYCA 2FHPA 3E8SA 3FPEA 3TRKA 3B5IA 2B78A 2PXXA 3FPHA 3O7WA 3EVZA 2OO3A 3CKKA 2R6ZA 3HCCA 2FK7A 2PV0A 1L3CA 1R18A 3LKZA 3DXXA 3B3JA 4QPPA 3BZBA 5K0LA 4AZTA 2BM8A 3NJRA 4E2WA 2FYTA 4RWZA 3DLIA 3FTCA 4FR0A 2BR5A 2GA9A 3CGGA 2O05A 3PS9A 4YUXA 1L3BA 1SQGA 3C3PA 3LBYA 4BP3A 3HVIA 2IDKA 5KQSA 2HV9A 4EVIA 4M36A 3UJ6A 9MHTA 1XDUA 2P8JA 4GF5A 4K6MA 1BC5A 4R8SA 3BGVA 1NW3A 4IV0A 4JXJA 4MIKA 1BKYA 1KPIA 3GU3A 3TKAA 5LQAA 3P9CA 4PCAA 5LSAA 3ER9A 5DSXA 2Z6QA 2PT6A 3SXJA 2XVAA 2QRVB 1EAMA 1PJZA 3LPMA 3BKWA 3LCCA 2GB4A 2OB2A 2JJQA 3SR4A 3UA3A 1NV9A 2G71A 4RTNA 5M5BA 1PRYA 4AZSA 2IH2A 2YXDA 3GDHA 1VBFA 1EIZA 4R05A 3THRA 4HSGA 1T43A 2C7QA 5HOQA 5EGSA 3A26A 3KQPA 5BW4A 2ZZNA 5DPMA 3QOWA 4KW7A 3I58A 5CVDA 1NW6A 5EIFA 5EKUA 4Y2HA 1JSXA 3D2LA 4E70A 1FPQA 3MTEA 3MAGA 2XVMA 4M7RA 3LKDA 2AOVA 1UFKA 4PNEA 3RODA 2ZSUA 4RV9A 5DX0A 1XJ5A 1VP3A 3AXSA 3KPJA 3MQ2A 1XDZA 2KW5A 2ADMA 4HC4A 1AV6A 3KR1A 3DTNA 5CCBA 5K0BA 1DCTA 5EMKA 4QTUB 2IP2A 2NYUA 1YUBA 3O31A 5FWAA 5EPEA 3P2KA 3RIEA 2FCAA 4CTKA 2I62A 4WXHA 5E9WA 2F8LA 3BUSA 5T64A 4CWAA 4EMSA 2IBSA 3UZUA 3ELDA 4UOEA 1D2HA 3BT7A 2BR4A 2PWPA 3HVJA 3EVCA 4GOOD 5LR6A 3GRYA 4GBED 5KQRA 3L8DA 4P7FA 3KQWA 4ER5A 3C3YA 5HFJA 4ISCA 4P7GA 3HP7A 3T0IA 3IV6A 5K0CA 4GC9A 5EHIA 1U2ZA 5CCXA 5FWDA 5LQRA 3A27A 1UWVA 4OA5A 5EMJA 5HIMA 2UYHA 2R3SA 2CMGA 2HTEA 3ME5A 1G38A 4OQEA 2OZVA 4XCXA 3AWIA 3G2QA 3PX2A 1I1NA 3T7SA 2FPOA 4YUVA 2Y1WA 1O9GA 3EVEA 3I53A 1IY9A 3KPWA 2VZ9A 1JR4A 1XXLA 3OU2A 3HCEA 4EKIA 5K0GA 4E2ZA 1L9KA 5DXAA 2ZBPA 2CMHA 2HNKA 3M4XA 1ORIA 1AQJA 2AOXA 5BW5A 3B3GA 4RTRA 3NVMB 1YZHA 4GC5A 2I9KA 3G5LA 3UJ8A 5GINE 2ZZKA 5T6BA 4OA8A 3PX3A 4ER6A 3DH0A 2PSSA 3FZGA 3FTEA 1NBIA 3B7PA 2H1RA 5DRYA 1FBNA 4C06A 4QQNA 5CVJA 3HCBA 2YVLA 5BP7A 1NV8A 1IM8A 3GRVA 3LSTA 4RTMA 3GRUA 3TOSA 3HCDA 2AR0A 5F2OA 4HGYA 5DTQA 5ICCA 3KPYA 1G55A 2O07A 3PFHA 2UYOA 2PX4A 4RTOA 4HH4A 1KIAA 3OFJA 1NT2A 2AOWA 2VDUE 4GQBA 3P9IA 3JWHA 2BZGA 3CJRA 5E9QA 3R6TA 4BLVA 2O06A 3AJDA 2UYCA 2JHAA 2ZULA 3NTVA 1SG9A 2AOUA 1MJFA 5E2BA 5DTRA 4EK9A 3K6RA 5FTWA 3MCTA 2I6GA 2P40A 1JSZA 4KIFA 2GAFA 3I5UA 5DM0A 5ICFA 2ZWAA 3KQOA 2ZCJA 1WY7A 5CVUA 3JWIA 1P91A 3FPGA 1QANA 4PYNA 4DCGA 2CKDA 2H11A 4M38A 1NE2A 2IFTA 3G7UA 3THSA 4KRGA 2HMYB 5EKXA 4CTJA 2VP3A 3M70A 2NP7A 2IDJA 3R3HA 1ZHFA 3C6KA 3X0DA 1VLMA 1ZGAA 3G2OA 5JUWA 5EMLA 2OB1A 4LECA 3SSOA 3GRZA 2AZTA 5DLYA 1EJ6A 4PCLA 4YMHA 3QOXA 1R8XA 3E7PA 3M6XA 5ERGB 3ID6C 4IWNA 5B1SA 1RI1A 2B3TA 4L7VA 5D1HA 4POOA 2ZBQA 3ER8A 4GOND 3PVCA 2P7IA 3FUVA 5HEKA 1YB2A 4R6WA 2ZVJA 3EGIA 3OU7A 4FSDA 5FA5A 4EQZA 3GCZA 1KHHA 2I7CA 3PB3A 3LECA 3UJDA 1ZGJA 4RSRA 3GNLA 1X1CA 2G8NA 2O57A 3ELUA 4V0QA 4PYMA 4E32A 4X61A 3FRIA 3A7DA 4KIGA 2WA2A 4R8RA 3OE5A 3EEYA 4RTSA 4E30A 1OR8A 4OQDA 2AOTA 5GP1A 4FT2A 4XUDA 2ERCA 3TFWA 4ER3A 4RX1A 4B17A 2YXEA 1SVUA 3OE4A 2AVDA 2Q41A 1NW8A 1AF7A 2QE6A 5IH3A 8MHTA 4FP9A 4U7TB 2XYRA 3CVOA 4C4AA 2P41A 3NVKI 4P7KA 4DKJA 3HA7A 5LQNA 5E1MA 3KU1A 4YUYA 2GPYA 5EC8A 5K0JA 4YV1A 2EX4A 3G2MA 1KYWA 2FRXA 2GH1A 4QDKA 4QDJA 1VP9A 3EPPA 4YMGA 4LG1A 5JR3A 4RTJA 5IKMA 1VL5A 4P7JA 3OU6A 3ORHA 2JHPA 4KDCA 3VYWA 3NDJA 4PGHA 2P1DA 5F2NA 1M6EX 1MHTA 4BY9E 2EFJA 1EG2A 3JWJA 4PGGA 1AQIA 2QM3A 1N7JA 3TMAA 2VDVE 3C0KA 1RJFA 3P9NA 1R74A 4FS8A 3TPZA 1RI3A 5E1BA 2Y1XA 4DZRA 5HZMA 1WS6A 5MHTA 1IXKA 1QYRA 2AVNA 4HG2A 3OZSA 1F38A 2AOUB 3M6WA 2OYRA 5DXJA 5EZSA 3MERA 5EEGA 5P8WA 4QVGA 3DULA 4BLUA 3FYDA 2ZBRA 3KQYA 3U81A 4PIMA 5LQUA 2EJTA 3EVGA 4DA4A 5C1IA 4DCMA 3FUUA 2G1PA 2OXTA 3MTIA 4G56A 1JQ3A 1KR5A 1JG4A 3FUWA 1JG2A 3G88A 3KKZA 2JHCA 5K0EA 3DUWA 4FZVA 1QZZA 3BGIA 1VQ1A 3G8AA 2YR0A 1JQEA 3Q87B 5EEHA 4AX8A 4X41A 5CVEA 2AN4A 2P35A 3KQVA 3M6VA 3LBFA 3AXTA 5HIJA 2PGXA 1Q0TA 1X1BA 1ZKDA 2QY6A 3B89A 3P71T 3SVZA 1DL5A 7MHTA 3BGDA 5K0FA 3FTFA 5FCDA 1O54A 3FRHA 3G89A 4MTLA 4X63A 4F84A 3P9KA 3JWGA 5LQCA 4RVGA 4DM3A 4IV8A 3EVAA 2H00A 5CD1A 5C0OE 2ZFUA 4E33A 5LQJA 3V8VA 5T67A 1O9HA 3LX6A 5H02A 5DM2A 2GS9A 3M6UA 5K09A 5E2AA 2ZLBA 3UJ9A 5CUQA 3G8BA 4XUEA 3UFBA 4OX9Y 4F86A 1JTFA 3FPFA 3NWEA 1VPTA 3SM3A 1D2CA 1RI2A 4HTFA 3LCVB 4M37A 1SQFA 4QVKA 2PKWA 4MQ4A 1HMYA 3DMFA 3I64A 4PYQA 10MHA 3SMQA 2G70A 2AOTB 3FUXA 1JG3A 2PBFA 3B3FA 3OFKA 2PX2A 1G60A 1XCLA 2IH4A 1EQAA 2ZIEA 3UJ7A 1YF3A 1JQDA 5EIWA 3E23A 1BOOA 4YUZA 3SGLA 3DMGA 4PINA 1B42A 3LGAA 3CJTA 2NXJA 2PJDA 3IEIA 4HGZA 4RTKA 4CKBA 4KDRA 3PTAA 3BWCA 5KYGA 3TM5A 4MHTA 3CCFA 5FA8A 2V74B 2CL5A 3RW9A 5EG5A 1RJDA 3DR5A 2JH9A 3V97A 1ZG3A 3SX0A 2Z6UA 4RVHA 1X19A 3DLCA 5E1OA 5GM2A 1HNNA 3P97A 3C6MA 1TW2A 3T7TA 2PX8A 5CVVA 3REOA 4BLWA 1H1DA 2OPBA 5DWQA 3DOUA 3HVKA 4P58A 3KQSA 3NW9A 4ZTBA 2P3QA 5FQNA 4C04A 4ER0A 2XBMA 1JG1A 3KQTA 4C07A 1RJGA 3GRRA 4H0NA 1SKMA 4E2XA 1FJXA 3GXOA 3G2PA 3A25A 2N47A 3OPNA 4AUKA 4R6XA 4CKCA 3VSEA 1G8AA 3M33A 1QAOA 2E5WA 2YX1A 3UJAA 2C7OA 3EMBA 5FUBA 4LWOA 3DXZA 2YTZA 3PT9A 2PXAA 3LDGA 3P2IA 4Z2YA 2EG5A 3HM2A 5ICEA 3EEOA 1FP1D 3DXYA 3GJYA 5HIIA 3TKYA 3KR0A 4KVZA 1WXWA 5E1DA 5FHRA 5D1NA 4OBWA 2JH8A 3SSMA 5K05A 5GIOE 2LD4A 5K03A 2OKCA 5U4XA 1TW3A 2P3LA 2C7PA 1R8YA 3IHTA 1VIDA 2YQZA 5HILA 5K8VA 1TPYA 1BHJA 1INLA 4DMGA 3QV2A 4GOMD 2NXNA 2OY0A 3O4FA 4C08A 2HR1A 2OBFA 4PIPA 3OZTA 3DMHA 3ELWA 3HVHA 5FULA 1DUSA 1XDSA 5F2KA 4ATNA 1F3LA 3KPVA 3P2EA 5CIYA 3MHTA 2VS1A 3OCJA 4GUAA 2O0LA 3SSNA 3LL7A 3FPJA 2B2CA 3ANXA 3G5TA 2IH5A 3GIWA 2C7RA 4FT4A 3FUTA 3H2BA 1WZNA 4E2YA 5HIKA 2EJUA 5GWXA 3TLJA 4YUWA 1N7IA 4PWYA 3KQQA 3GGDA 5FHQA 5FADA 3WSTA 4YV0A 4CKEA 3BKXA 1RI5A 1SUSA 3LDFA 4KWCA 3KPUA 2NP6A 3MCZA 3CC8A 1QAMA 4HTFB 4PYKA 4PYLA 4AZWA 1ZQ9A 1X1AA 5ICGA 3EVFA 4DF3A 3HA3A 4PYJA 3A4TA 1FP2A 2DULA 3KHKA 4BP1A 3FTDA 1Z3CA 3BXOA 5E8JA 2IIPA 3OZRA 3UJBA 4RTLA 1R6AA 5E8RA 2BM9A 1VE3A 4AZVA 2PXCA 3E05A 3EVDA 2DPMA 3R24A 2XYVA 1I9GA 2AN5A 3UWPA 2ZIFA 1N2XA 1XCJA 2WA1A 1WXXA 2BH2A 3UA4A 1L3IA 2QYOA 2G72A 1XTPA 5DRTA 1YFLA 1D2GA 2HWKA 4QQKA 3DP7A 1P1BA 3BWMA 5GM1A 5GOZA 1UIRA 4NECA 3P8ZA 4PONA 1G6Q1 2AN3A 2IGTA 2P3OA 3K0BA 4GEKA 5DM4A 2NXCA 1NW5A 2IBTA 1KYZA 3LDUA 3Q7EA 3TR6A 3UJCA 3UBTA 2UYQA 4X60A 3HEMA 2PX5A 4EKGA 4RTPA 3GO4A 4RYLA 3AY0A 2B9EA 1YZ3A 3HNRA 1G8SA 3R0QA 4V0RA 2A14A 2K4MA 1P1CA 2PT9A 4E31A 3BWBA 4PYIA 4YV2A 2QRVA 2ONYA 5EVJA 1Y8CA 1ORHA 1R00A 4U7PB 5EQJB 1M6YA 2UZ4A 3HCAA 2VDWA 5K01A 2ZW9A 4C03A 3EGEA 4MWZA 1KPHA 3R9XB 3EGVA 3TM4A 5DSTA 1SUIA 4A6DA 4F85A 2ESRA 4DQ0A 1Q0SA 2Z6AA 4CXMA 3PLAE 2WK1A 5CM2Z 2B25A 1NKVA 1JTEA 2PVCA 3I9FA 5EHGA 2YUIA 3KQMA 3TQSA 2P7HA 3HTXA 2IPXA 2ONZA 1I4WA 4QPNA 5KS2A 2PY6A 4LWPA 4FSXA 2ZIGA 5DX8A 1V39A 2YXLA 1L1EA 4FGZA 3EMDA 4XUCA 3MGGA 5E9JA 4QTTB 3S68A 1KXZA 5KVAA 2JG3A 1KP9A 5GIPE 2GLUA 1NBHA 5G02A 1M0EA 5BXYA 4A6EA 1RI4A 3A7EA 2CWWA 5EMMA 4X1OA 2V7EA 1QAQA 2ZTHA 3CJQA 5C9ZA 5FQOA 1XVAA 3NWBA 5K0NA 1P39A 2NNWB 4RTQA 2AS0A 5EOVA 3VC1A 4RVDA 3T7RA 4HRAA 4RVFA 5DT2A 4WVLA 2ZZMA 3ERCA 3BWYA 3KR2A 1RJEA 3HA5A 2ORED 3GWZA 3KR9A 3MB5A 5DX1A 3F4KA 4IKPA 2PLWA 1X1DA 4C05A 4O29A 3ELYA 3IYLW 3LHDA
chains in the Genus database with same CATH superfamily
1NKTA 2BHLA 4I9GA 1LJLA 1NDHA 4JBGA 5CT6A 3U3MA 2J87A 4OP2A 1NW7A 4RELA 3VMMA 3COZA 3L7DA 5EZQA 1KPGA 3C4JA 4OBXA 3HBMA 4A82A 1VIMA 3RFFA 5KKNB 1PZEA 3QKSA 4Z54A 2WV7A 1E5DA 2IOFK 5GY7A 3ZI4A 2D2XA 1FNNA 4G1BA 3QHPA 3PFGA 4XE5A 5LQSA 4CMCA 3Q2KA 4M8SA 1DCMA 4U0JA 2DWPA 4DCNA 4WESB 1HI9A 3I0ZA 5FIUA 4EAQA 3PQEA 3UMMA 2YZNA 1T6ZA 5EIXA 4IOKA 1C8KA 4G4SP 4K0KB 3NTUA 3NX4A 5K8VA 2XD4A 3OA2A 1O5TA 1K75A 3B3JA 3BZBA 3EF0A 2XWBF 4U8GA 2UVPA 3EAQA 5K6AA 4M22A 4OHYA 1PNTA 2BFEB 3N39C 5FDFA 2I3DA 4IILA 1GUFA 1B15A 1SA0A 2BZSA 1BGVA 2H52A 2VRWA 2Q28A 3IO3A 4BLPA 4CI0B 1PLLA 1ODJA 1BCSA 2RGNC 1YIDA 1QP0A 3KJEA 1ZVMA 1Z0FA 1KC3A 2MCFA 4FC6A 1ZNQO 5F77A 2FW7A 4MCHA 5B53A 4GBJA 2PT6A 2NAPA 4Q66C 1IPFA 4XRRA 3V7WA 4F9FA 2UYYA 4MS1A 3ML1A 1YTLA 4DDUA 3LCCA 5KOYA 3ZCUA 2GERA 5KOIA 1TDJA 1NF2A 4JVLA 4KE6A 1ONSA 4J6FA 1DIOB 2OP0A 5F9FA 3F74A 1W59A 3DBLB 2WJJA 3OE1A 4N03A 3JY6A 2QY9A 1EUYA 1KORA 1VE9A 3JD0A 2ODAA 3EIQA 2H5IA 4GLJA 4QAJA 4ZPJA 4NRDA 4QXPA 3WK7A 3ZK8A 1FRQA 3GWGA 4CKYA 3NANA 4EB3A 5CFOA 1IWBB 3R0IA 3PHLA 2N0SA 1THTA 3PDWA 4G5FA 4L6AA 4MA4A 3O8OB 5IXYA 4QYIB 3FTNA 4LNHA 4BCBA 2IYUA 1E1QD 2GGSA 4GI7A 5CH8A 4X3CA 3RODA 3SYLA 3BCSA 2E5FA 3R7SA 2HH9A 1QO9A 1OSNA 4PFJA 3AV3A 5EUQB 3SHOA 2QB5A 1JQLB 2BUAA 4YP7A 4FVTA 4OMCA 1WXHA 1Z5UA 3CH6A 3N07A 3E7FA 4EHNA 3T5TA 3PZRA 4YCBA 4Q7LA 2XLBA 3W2FA 1RYMA 4D6PA 2F8LA 5I48A 3ORQA 2KSQA 3QPCA 2WAYA 1QQ6A 3U7IA 3TNLA 1ESMA 5HQTA 5I5GA 1FDUA 1NDUA 4FFSA 1JKJB 2HPHA 1NYQA 3EJ6A 3FROA 4GBED 4RJIA 1CY2A 2I54A 3C3YA 5HFJA 4ISCA 3B6MA 3PJGA 4FK8A 4ZEOA 5K0CA 5LLTA 5DM70 2CHFA 3PUVA 1WSBA 2CNNA 1GKYA 2HBZA 3GLIE 1FVHA 5AJVB 4FB5A 5A62A 2R00A 3AP2A 1CUBA 4TMTA 3WY9A 5TQJA 4UBKA 3WOHA 3OPVA 3QXSA 1LWNA 4HR7A 4N4AA 3KPWA 3G1WA 8OHMA 4L78A 4UDXX 4BFXA 1NR5A 1FMLA 2XODA 2BGNA 4IY1A 4Q93A 3RLFA 1NYRA 2B1QA 4DE5A 2X8JB 3TXYA 1FTSA 2OFPA 4YJFA 5TGTA 3V4OA 2NZUG 2WG0A 4C4OA 5C52B 2CNWD 1CYEA 4M89A 2E87A 2G0NA 5EIBC 4BVHA 5CHEA 2ECFA 1DAPA 3Q9SA 5CX1B 2ODBA 3FMIA 5F64A 5AVZA 3IXQA 3OTIA 2FZVA 3IAM1 4KXFB 1JDTA 4M1SA 1AB6A 2Z1DA 3FVQA 1QH8B 4FYKA 2ZZKA 4LA4A 4ZOQI 4ER6A 1DBPA 5CDSA 1M34A 3JVUA 5C8XA 3NB0A 1IEQA 2HZBA 2PZMA 4RQUA 3RQSA 4ARZA 4Z4QA 2YOGA 1JPUA 1Z8NA 1NV8A 4RK1A 4CM4A 4RESA 1USWA 4B3CA 4RTMA 2SECE 5DCWA 5LOVA 1CQIA 4WDQA 4QTYA 3EK2A 2VUUA 1L4GA 1N2EA 4PX2A 1YVEI 2ST1A 3DB2A 2WV9A 3D6VA 4RSMA 5FWXA 5FLKA 5DLQC 3VAAA 4Z4CA 1KERA 3EZ2A 2VDLB 3PHIA 3ANLA 4L8YA 3QKUA 4N3CA 5A05A 3R74A 4FYJA 2HU5A 3JWHA 4TUYA 3SZRA 4O63O 3DKVA 3IKMB 4BLVA 3I5YA 5JH7A 5F73A 1E9BA 3ENKA 2CVQA 4G0MA 2V54A 5A9TA 4BU1A 1LLDA 3PXUA 1VYUA 1WUTA 3H9QA 4QASA 4K3VA 1W85A 5FBZA 5TLSA 4KR2A 3NIWA 2VA8A 2DFKB 3UATA 4ZYTA 4J3NA 3P7MA 4X00A 2EQBA 4YAUA 2JI6A 2J3EA 3H1AA 5FD8A 1WJGA 4JUDX 1KI7A 2PUJA 3EBOA 5KTPA 1M2NA 2ZAGA 2FWPA 3QYFA 3OF3A 2YFQA 4JGGA 5BPFA 2B36A 1T8WA 1VLMA 5EMLA 4D96A 1QFXA 2DLDA 5C37A 3C15C 4BQPA 5ALUA 1Z2NX 3M6XA 4Q05A 4ZV7A 1MZVA 1PUXA 1YMUA 3AF4A 4WKCA 4BLSA 1ZZEA 2X19A 3I2FA 3ER8A 1B74A 1NTOA 4L0QA 4TQAA 4H16A 4YIKA 1DT3A 2GHIA 4D4MA 2EGHA 4DLLA 1FTNA 1N5JA 3AGQA 4R6WA 2Q6TA 3GGSA 5DHQA 5LNK6 5FA5A 3QBJA 1OT3A 3R23A 5DO9A 5AXAA 5C5IA 1ZGJA 3R77A 2FI1A 1X1CA 2O57A 3GNLA 1FJHA 4UNNA 1H93A 4QC2A 2ON6A 2VDWB 4DPKA 3NM5A 1DIHA 1SUCA 2VBIA 1RXWA 3N7TA 2HF9A 3EUAA 3HKDA 4Q48A 4U9IS 5KJEA 3FVTA 3M9LA 4I9NA 4BJ1A 2QU8A 4M0MA 1PNOA 2Q7OE 1DXYA 4BKQA 1YE8A 1XZIA 2VA9A 5JMWA 3NJ8A 5EQTA 4CM8A 621PA 4HADA 1XSEA 5TPZD 2QENA 1LW6E 3Q40A 1T5TA 5CT9A 2JBAA 3H87A 2H63A 1ZITA 2QG4A 1U2EA 4X1YA 5J2UB 2PH5A 5EC8A 4J2TA 4YRPA 4FCCA 3TTUA 4D4KA 1SD2A 1Q0ZA 4KACA 4EVRA 2OOKA 1H65A 1YR2A 4MB6A 1I0IA 1J06A 1KKMA 4YMGA 1JDBB 1MB2A 4EJSA 5IARA 3L79A 4RTJA 1F6WA 3N8DA 4DANA 2FPGA 5MN4A 4BGEA 3NBQA 5I7WA 2QPTA 1E92A 1U80A 3M81A 2X1VA 2A88A 3NP9A 3EGXB 1PDWA 2IZZA 3VNQA 1ODCA 3OPYA 5H70A 2XKAA 4V0SA 3RYCA 1JG6A 1TRHA 4DY6A 4LOHA 3RYFA 3PNQA 4HVTA 4TT3D 3L1HA 4YHBA 1V5FA 3MAJA 2V6GA 4N0PA 8ADHA 4JLKA 4MW1A 3KJIA 3UK0A 4NOLA 4EGAA 2ZIAA 2I29A 4P31A 2HBRA 2EQ5A 4DCMA 2X0IA 4KC0A 3LC1O 2OQVA 3DZJA 2HQBA 1GGEA 1CY6A 1Z62A 1YCFA 2GZRA 1JHRA 2YR0A 3EEIA 3Q87B 1T2EA 4OLFA 2O8EA 4WOCA 1EX9A 3OZ7A 4UJ5A 2PIDA 3PFWO 1CR0A 4YJ3A 1IDOA 1NQUA 3TH5A 1U4NA 1AGXA 3EAGA 3KD3A 1XDBA 1BS1A 3DO8A 4QVIA 2HWXA 4C0KA 3VSDA 3SHWA 4IIXA 2G40A 5K0FA 3G6KA 3D4NA 1AOXA 1WPQA 2YY5A 4JIGA 4RMHA 4M0KA 3P9KA 4HH0A 4DRXA 4KQXA 1PGPA 1D2MA 3IAS1 3HO8A 4OYRA 5JY1A 1O9HA 1I7SB 1W8IA 4AQDA 2QBYA 1NXPA 3LBNA 2Y67A 5BMVA 4L5JA 3PYMA 2XA1A 3KOUA 1MN6A 2WAXA 1PLJA 3DOEA 5C7YA 4BRSA 4EKYA 1I7PA 3IDSA 4ZXPA 1VMAA 4IIYA 1VMKA 3C16C 3LCVB 2GPNA 2YHIB 4LDRA 1U2GC 1NF8A 1RMTA 2R8XA 3CUWA 4FZ5A 2PKWA 2ZUUA 3M89A 2OXEA 5IH7A 4AVYA 3RT9A 1TJPB 3RWMB 1W75A 3QE9Y 3OFKA 4X1KA 2NLOA 4URWR 3W90A 1BCRB 2AJLI 5K0ZA 1JQDA 2GWHA 2GZDA 5FAKA 2V8OA 3FCEA 3H2JA 4GVLA 3I52A 1AGNA 4FFRA 1CUJA 2VNSA 4TXMA 5DF1A 4GQIA 3OLWA 3R0ZA 4XD7A 2FKNA 1BE1A 4LF4B 1RQ2A 3N0RA 2CK3D 4QDXA 1FJGB 1BJTA 3LXRA 3K0CA 5IDVA 4ZMRA 1F0KA 1G9TA 1IOLA 2XCIA 3BWXA 3DV0B 2M98A 4PQYA 2EW1A 4DG8A 3PQDA 3N8NA 1WD5A 5AW8A 3VNSA 3E35A 1E9SA 3OCXA 1LXCA 1U1GA 3DL7A 3LK7A 5EUCA 1UMCA 2CVPA 3D8SA 3QELB 4CQLB 1A9XB 4AKSA 2B4YA 5J43A 1PWHA 3WJ1A 3M33A 3T1YB 4G36A 4HJRA 4NU8X 1GR0A 4B4UA 3W4JA 4J7CA 3HRIA 3JQ9C 2JAQA 4M9ZA 2EG5A 4P1ZA 4DUGD 3INTA 5CJJA 3R5FA 1QHYA 5IF9A 2AQ8A 1PZGA 4A6XA 4DCOA 4OJNA 3D8NA 2AX3A 2LR0A 1M7GA 3U7JA 1B2LA 1RS0A 2AC7A 3E7XA 4ZVSA 5K8IA 3EIFA 1NJ8A 5K03A 4U0KA 2UZ0A 4L9RA 3WV5A 2Q3HA 3AU8A 4PCUA 4RA9A 3I4CA 2QJTA 1INLA 2REQB 3ICCA 3NQ41 4KFRA 3SHQA 1US8B 1O94C 1SVOA 1UANA 3CPEA 4MLPA 3O4FA 4GPZA 3RK0A 3CFYA 5LPNA 4EITA 1CVLA 3U56A 1DADA 3VR6H 1AKNA 2IXDA 3AILA 2A33A 3KVRA 3RO7A 5AUNB 5KREA 2WRZA 1KS9A 5K99A 4I08A 4AECA 1N36B 2GMWA 3QBTA 3EPRA 1KGDA 3SQNA 4J1TA 4BLRA 1XU9A 2IHUA 2PAAA 2Z8ZA 3CLHA 1CUYA 3MA0A 2BMWA 4E0BA 3TLJA 3I6YA 1Y7LA 5KYWB 4F3NA 3A3NA 3H1EA 3N70A 1OVMA 3BTUA 1TADA 2HREA 5CIWA 1IK4A 1X3SA 2Y9MB 4KNWA 1STOA 3D2CA 3MCZA 2QL9A 3W5IA 4BB5A 3ICVA 3JD3A 4GBGA 4G0ZA 4WXRA 4BX9A 4O5AA 4Z9FA 3OUZA 1FDTA 4CF4A 4D46A 3N6RA 4JLAA 5AW7A 3LVFO 521PA 5F3WB 2PZGA 4B33A 1ZC4A 2GCEA 2TYSB 3ANMA 5C2JB 1PFUA 2PXCA 3QFRA 3S8MA 1C8VB 3B70A 4YNBA 4W5OA 4C4TA 1EDBA 1GTMA 1XAHA 3QVGA 4BE4A 1YH3A 3EXHA 5B1DA 5IAEA 1V3QE 4ZAZA 1FTGA 3QUBA 3NHAA 2C00A 3QU9A 3EIEA 1IMJA 2AKEA 1QPGA 4NC9A 5C8DA 3R76A 2XZOA 5LIRA 1U7ZA 1QPBA 2QLTA 4CTOA 4ZYVA 4QPPA 2JLVA 3EOBI 1E1QA 2M6SA 2QSJA 1G9XA 4G0OA 3V7UA 2ZRHA 3CYFA 5SY9A 2D7DA 3UBTA 4Y7CA 1VKHA 4AKHA 3HDGA 1T13A 1RHKA 1NWHA 4AP9A 2Y2UA 1E7WA 1PX2A 3LQKA 4N9WA 3F73A 2J30A 1ZK2A 2BZ0A 1EKXA 4ZQGA 3FWPA 3L0PA 4GZLA 4KWHA 3VBCA 3TZQA 4E31A 1KMIY 1ZY2A 2ZYGA 3DE7X 5K3SA 2FSHA 3ROKA 1GARA 3KBOA 2UZ4A 1KOGA 1TTPB 2VJKA 5H5JA 5BO5A 1L7QA 1EHIA 1YQGA 2E4ZA 1X1EA 2ZW9A 3HB0A 1ZM2A 2Y1CA 1E6CA 2JHFA 3P2MA 4R2JA 2RJOA 3PNVA 5CXXA 2XUOA 3LF1A 5FYQA 1JWLA 2NO4A 3L02A 1Q0SA 1SXIA 2YFKA 3BH6A 3UAYA 2O2YA 1B1AA 1GVNB 3DZBA 3LQRA 1JTEA 1ZIDA 4MPPA 4TV8A 1ITZA 5EHGA 3S2SA 1E64A 1MDBA 3AR2A 2IPXA 3CPHA 3BMCA 4GI1A 2CNDA 1XZCA 2JI8A 4LDAA 5JPDA 3OUUA 1RLIA 1YR9A 2CLSA 1RXSA 4H9GA 2YXLA 4RAQA 4EPRA 4DR1B 1TMKA 2EZTA 4RF3A 3MJTA 5B12A 4F6LA 1LLCA 1Z47A 3FSGD 2FVXA 3JQFC 3RTCA 1U0NA 2Q5JA 1NNI1 1U1EA 2ZAOA 3GP3A 1MAUA 4BFWA 4CL2A 5D8DA 5K09A 1CEEA 2Z56A 3PFCA 4ECEA 3T7RA 2YDXA 2CXXA 1EG7A 3FYUA 2ZJ8A 2ONJA 3ZEIA 4ZYLA 2AMYA 3ERCA 2R6JA 4KBFA 4HWSA 3P9ZA 2WWFA 3HA5A 2EFGA 2ZAIA 3EXG2 2C3MA 5ALKA 2OQIA 5FEMA 5KKCA 5DOVA 2HTFA 4OI0A 2VBGA 3FKQA 1RBZA 4PZZA 4PANA 5AVRA 1TA9A 2GN8A 2YINC 1ZWLA 3Q2OA 4II3A 1FA9A 3ZZ0A 5JLJA 5HGJA 3U1VA 4REQB 1XALA 1YVUA 3CRQA 3M82A 1H5UA 5GOTA 1GZVA 1SELA 2B8JA 2HMUA 2WLTA 2QMZA 2ZWVA 1E5XA 1YDMA 2EVWX 2WJVA 3D6AA 3JZFA 3ZDCA 2VYFA 3WNVA 2M6KA 2FEWB 2RBKA 1UODA 3U7GA 1GRVA 4MWOA 2IXBA 3ETHA 4OU5A 4OM8A 4I6JA 4L2IA 4P3PA 1NXQA 1Q1GA 2ZRFA 3OX2A 2HK7A 4FR5A 1B41A 2IEBA 3FPEA 3F6CA 4CM6A 3OPMA 4IO1A 3QSYA 4JFRA 2IHBA 3AUFA 4U4AA 4HO1X 3QVOA 1L5GB 2JI7A 4E2WA 5K4GA 4X20A 3N28A 1J56A 4GM4A 1IEXA 4LPKA 4W9NA 3PLNA 2FYTA 3TNDA 1XMQB 1XZLA 1SVNA 4JC4A 5BN1A 3LLUA 2ZQ5A 4D0RA 1EVKA 1ATZA 4U2EA 4YS6A 1WVGA 2O05A 4BLOA 3AETB 3EZ7A 1DC8A 2Z4RA 4RV4A 3ZKAA 4BP3A 2AL7A 2A0YA 1A8HA 2A1TR 2CWDA 5MF6A 1NQVA 1XEFA 3BE8A 5JZOA 1KQGA 3GW8A 1UP7A 1V7CA 3PWKA 1LPNA 4E22A 3WQSB 4NOKA 3FPLA 1H0HA 3C3WA 1ZI8A 4HB4A 4Y9DA 3M3DA 1QLHA 3V80A 4E7OA 1DB3A 1KPIA 1M1YA 4OGWA 4RANA 1WY5A 3Q15C 3UWMA 2QUHA 5E4FA 1PLKA 2AI3A 2XQJA 1CY1A 3E1SA 5A5EA 2GHTA 3GFOA 2PT5A 5K3DA 3ZLBA 2ZTVA 3G9TA 2A1UA 3ACCA 4LRYA 1KMQA 4NH4A 2ZS9A 2XTZA 1CUEA 2J07A 4J94A 5BQOA 1GNLA 2HIMA 1IB0A 1UEJA 1X2BA 3DOHA 1EIZA 3I9MA 4NBVA 4G65A 4PSUA 4V0MA 1J2UA 2D00A 3GMTA 2QX4A 2YWXA 3FGPA 1ZJJA 5L6MB 3SE0A 3HUEA 3RI3A 3VDNB 2JI4A 3CTMA 1ADJA 1V9LA 2ZZNA 2CXPA 4YT5A 3UAGA 2B2NA 5GONB 3D2LA 1PVOA 4JT9A 3VYVA 2LCQA 4GDMA 4LYFA 4ZU6X 3TVYA 5P21A 4NFHA 2PYZA 4ZCQA 4CV0A 4FIZA 1H2HA 3JAKB 5IAGA 4ENSA 2XVYA 3ZE8A 3WLFA 1BD3A 1FQWA 1O77A 2Q1UA 2PUAA 5KNCH 1DWQA 1XDZA 5BVGA 1ADFA 1Z88A 2D2EA 4PSAA 5IYZF 4FBGA 3WYCA 4ZIRA 3IQIX 5CCBA 4QGSA 4UHBA 3G68A 2FZ5A 2V4MA 2QLNA 4LOLA 3U7HB 2VL7A 2A0FA 4WXHA 4ML3A 5E9WA 5JDIA 4XX1A 5F9HA 1YZTA 2BKLA 4GOOD 3UZUA 3CR7A 1D2HA 1H1LA 4OQPA 5EPUA 2EBWA 4FGSA 3USZA 4UAJA 4LXYA 2EYUA 2GD0A 3PR2B 3DOFA 4PXAA 1AN9A 5LNK1 4YMLA 1HDXA 3L0CA 5TT0A 2I4OA 2RMKA 2OHJA 2XDAA 4BMSA 3I23A 1X80A 4C4ZA 1CUHA 2OSBA 4LDNA 1SQ0A 2H6EA 2I7TA 4HJXA 3WTBA 5AUOB 3TLAA 1IUPA 2AZMA 1P75A 2OZVA 1G4UR 3EZNA 3QIAA 2JJMA 2O2XA 4N5NA 4ZANA 5SICE 2FMTA 1XWFA 2BFNA 2OK7A 2VOJA 5DBGA 2L2QA 1AX9A 1AQYA 1PWYE 3Q6MA 3TSAA 3EXEA 4TT3A 1G42A 3IBFA 2LIPA 4I81A 4R3NA 3BJIC 3L41A 4PRZA 4RV5A 5DXAA 1TM2A 3AF0A 3ESRA 4KRYA 1B2RA 2G6BA 2QAIA 4EYQA 2QNRA 1NN1A 4XWOA 4R1QA 5EJ9A 1TYDE 2A86A 4GSLA 4LXGA 2PCLA 3NHMA 4ILKA 3WJ2A 4AO8A 5HHTA 4B3IA 4GC5A 2QYHA 3I9KA 4R9VA 4AMVA 1TUBA 2XTJA 4KUHA 1NU6A 1EBBA 4OL9A 4F6RB 3HYNA 1MG0A 2QM7A 2VRNA 3HUTA 4WBSA 3RS2A 3DGEC 5JD5A 2C2WA 3SN6A 2OVFA 3IAEA 4IDPA 1UAAA 2BLLA 5D3QA 4Q7QA 4H7EA 1TEZA 4I5DA 3CHYA 4TKLA 2XXBA 1Y8AA 3ONDA 4UD6A 2EL9A 3HR7A 3TSWA 1WA5A 3EXG1 3VVCA 4CFSA 5A9RA 3IT2A 1DWUA 1LPPA 2VF2A 2GN4A 3BXHA 4XQGA 3EQZA 4AKIA 5J4YA 4DSUA 3AESB 3E0XA 2JFUA 4U7DA 2DRIA 3RQIA 1YC5A 4G5YA 2R8EA 1PBTA 1X7GA 2HLDD 3KC2A 3HKCB 3OKFA 5KSPA 1QHHB 2ZRBA 5ALOA 1GRCA 3MIZA 2A9PA 2GRUA 1U3DA 3U7QB 3WLRA 1J6UA 1XRLA 1F5NA 4V02A 1QANA 3SQOA 4UDYX 3AUSA 2C2GA 3K3PA 3GRKA 4YONB 3SIXA 4RK6A 4INJA 3DV2A 1AXEA 4R0MA 4G86A 2VSFA 1WDMA 1HEUA 2YN0A 3LW7A 4GFDA 2NW6A 1RPTA 3SSOA 4LECA 1Q44A 2BM0A 2NGRA 1NVEA 2CK3A 5CLIA 5D5PA 3T3PB 2O0MA 4L57A 2YV2A 4N0DA 4WDRA 3TFQA 4DLPA 4HNUA 4NWIA 1MT3A 3L6BA 4WINA 1ZFNA 3TECE 5H59A 3VI4B 3EN0A 1R0LA 4I8XA 4MEBA 3DMDA 3V2GA 4TWAA 2P0YA 3PSHA 4IQ4A 2RJ3A 2ZVJA 1RP1A 2C3PA 3PDIB 3OU7A 1E4YA 2IYNA 2F64A 3GCZA 4L9WA 2I7CA 1PR9A 2Q8NA 3LECA 4I9HA 4RXMA 3JQAD 3VPBA 1Z4LA 4AZ0B 4DLTA 4UXIA 2LNDA 4MQMA 3B51X 4KIJA 4BP9A 2NZ2A 2VZ0A 4N39A 3SJAA 4F71A 3WQRA 2WA2A 1DO0A 3CLTC 5D51S 3ACDA 5TF4A 4JJFA 2BDTA 1DDGA 3TLGB 4CHTA 1CQJB 1OA0A 1OILA 4BFLA 4MA0A 5KJCA 2AXNA 5IU6A 1E60A 3D8RA 4PC3A 1KC1A 5M3BA 1WCV1 1RLMA 4IDAA 1ONNA 3QU2A 4ARAA 3BMXA 1Y7IA 2JGRA 1SOWA 4NZZA 4FP9A 1JDZA 5G4KB 2XYRA 3UHAA 4TTPA 1KJJA 4YPFA 4F8JA 4KV7A 3ZQ6A 5DI9A 1KYQA 5TMPA 2PR2A 1QRSA 1JL3A 3NYWA 5DYNA 4KWIA 5C5EA 1KI1A 3COYA 2HUNA 1YZYA 3QTBA 4Q6WA 4W5JA 3EE6A 2X76A 2QZJA 3L8CA 3NI2A 2TSYB 1UBJS 2ZETA 1Z07A 5H80A 5TGDA 2QL7A 3DTVD 4TOIA 4UBLA 5B6PA 3L7MA 2HU8A 4B32A 1DQPA 5JS2A 1M6EX 3ZGOA 4DXHA 5M04A 5ECWA 3W79A 2QM3A 2Z0MA 2DVMA 3K09A 5EHXA 2RGDA 4XJTA 3ZV5A 1KQOA 3TRJA 2WG2A 3F90A 3DE4X 2J6BA 1QGYA 1W4BA 5FUXA 2OYRA 4N5HX 4AL4A 3DW1X 4BMYA 1NFFA 3SPXA 2WNIA 1QDLB 4OI2A 3AKYA 1C9NA 1BGWA 2FSFA 2WBLC 3EQ8A 3QKRA 2B5VA 1HLDA 2H57A 3HHPA 3IJEB 2CJYA 5K6RA 1FZQA 3EHDA 3MWEB 4C76A 1H2ZA 1NX9A 1AVTA 2R6HA 5AI9A 4RD2A 3TMKA 3GLHB 1CPYA 1I51A 2Z08A 4M9XA 4N65A 3ZZNA 4AX8A 1F0YA 3LBFA 3HA2A 4TWJA 3RGGA 1ATIA 2PGXA 4KXXA 2RCNA 4D02A 4CEIA 2UVDA 4JQZA 1QK3A 1VYTA 3KKOA 1R6UA 1BU8A 1WW3A 3R40A 4JBIA 3T5CA 1PHPA 4EW1A 5C3MA 3KS9A 4IQ0A 5ANRB 3D59A 2KS6A 3Q98A 4FJ2A 4BBAA 3OQJA 4IIHA 4EQ6B 3EHEA 2AI2A 2O0JA 4EWLA 2DY1A 3T7KA 1UMKA 2MIIA 2H16A 4JU8A 1FTWA 1KI8A 1TXGA 2WU0A 5DEIA 1D1PA 1REQA 2WUEA 3ZQJA 4ZQIA 2RDMA 5K3OA 1XZAA 2I03A 3BXFA 3ITEA 2UVQA 4OQXA 2IUFA 4MV6A 4DABA 1U7WA 3NWEA 1QIDA 3OKCA 3N2KA 4XCQA 1WABA 4D4GA 3K16A 1WUJS 4WJKB 1JA1A 4YRCA 2OHOA 5A4KA 1XQVA 2LDBA 3DVSX 3NHRA 4Q12A 5BV1A 2HAEA 1QFZA 4PPYA 5DNVA 3AR7A 4FNOA 2QXUA 3P0EA 3JATA 5IRCD 1QONA 4RKQA 3TL2A 3U3XA 1XIVA 3PXDA 4IG4A 2P9JA 3ZE1B 4ZVKA 3JTMA 1XEXB 1T5OA 5H7XA 4BNTA 2EHDA 1XNHA 5DHAA 3WL5A 3WMFA 3CZAA 1U0SY 3ADDA 4B75A 1XCGB 2HMSA 3K1JA 7GPBA 3HYTA 4TZTA 2V74B 5AW9A 3W5SA 3CS3A 3AG6A 3E9MA 4P6VF 4HN2A 5EUBA 2IEGA 1JYEA 1AMNA 3H0EA 3MC1A 3ZYZA 4FGLA 4RMIA 4NKRA 2EFDB 4P58A 4TWBA 3LUFA 4ER0A 3LO5A 1B3BA 2FX2A 1N0UA 3KQTA 4QSHA 5C5DA 2DTEA 4YP0A 1DKRA 5EIHA 1MEJA 3GXOA 4DEYA 1AQUA 1PW5A 2O2ZA 3OP1A 3TW8A 2VCYA 1G8AA 1AKTA 2FVYA 5LN1A 4CG2A 1WQ1R 2A9KA 5L6LB 4L9AA 4P38A 1PD0A 5CH5A 4C7BA 1DBQA 4QUDA 3HM2A 4IS3A 4PZPA 4D7AA 1F2UA 1WULS 1C1XB 1Z5PA 3ROPA 2MSKA 3T3DA 5KHLB 1EUQA 2C0QA 2JAUA 1RLTA 3Q12A 4P08A 5A2GA 1ZH8A 4JNCA 4OBWA 1ZN8A 1BVRA 2GO7A 3FOAA 4WAUA 1RYYA 3PE4A 3IMKA 4GPEA 5U4XA 1TW3A 5F78A 1EVEA 4N6OA 4Z99A 1NVKA 3ZOKA 4K03A 4EG5A 4UZFA 1W30A 4UEJA 3F1LA 1ONOA 1V16A 1M66A 3UQYS 3UOGA 2AYZA 1ZJ6A 1G64A 4FEGA 2FEKA 3PHBE 4S1PA 5JYBA 2X9NA 4QX6A 4H35A 4JBYA 4IJVA 1UC4B 5DBFA 5I47A 2ZUWA 4MVXA 4J3FA 4U2BA 1GZUA 1R64A 2Z58A 1TF2A 2NUPA 3HEAA 4P54A 4Y6SA 1ZXXA 4WNYA 3SOZA 4CUKA 5JSZA 2HA6A 1CZHA 3H83A 3GIWA 1QQAA 1ULUA 3DSRA 1FXWA 4UHEA 4YAEA 3WLSA 4O3MA 3T52A 5DYGA 5DULA 3T4UA 1BXGB 2C8VA 3OIDA 1KZGB 2NU8B 2ID9A 3ZJYA 4YV0A 1DX6A 1RI5A 2HSWA 2ZEJA 1HV8A 4MVCA 5FWYB 3WIVA 3URKA 3TLYA 5A5GA 4NDNE 1MKYA 3PPIA 4D9JA 2YUTA 4GRDA 2ZI5A 3KOXA 3VKHA 3MNFA 3R5TA 1DKOA 3H17A 3D6NB 1T3GA 2MSLA 3IEPA 3GHYA 4Y2PA 2IELA 3IESA 4PW0A 4K46A 1E63A 2NTJA 5KYUB 4KODA 2OPHA 5JASA 4QO8A 1NVVR 1PT8A 4AZVA 1LVUA 1S2LA 1SKBA 3LBHA 3IT0A 4LNUA 3R5HA 4ZFNA 1N25A 1TGVA 2W48A 4Y2TA 2YWBA 2GFHA 1E58A 4MJLA 2BEJA 1KP2A 2FUCA 1NLUA 3LCRA 1WXDA 3H1TA 4GS5A 4IIVA 2XCTB 1I3KA 4QQKA 4ZC8A 4GQAA 2XMRA 1B0AA 4LRSB 3WWOA 4BO6A 2P3OA 1KBQA 1XMPA 5A3QA 3D43A 3PDUA 4EJMA 1DFIA 2J33A 4CI9A 2PN1A 1YGPA 1OT5A 3IKJA 4TLCA 1QGUA 2AK2A 5BRNA 2DB3A 3F8WA 3TB6A 2QLBA 1M54A 3TINA 1TAUA 4G41A 4BBJA 3PUZA 1H8HA 2FFJA 2IGBA 5AWFC 4EEXA 4EHDA 4MWEA 2PZAA 1PK8A 3GH1A 2Q07A 5AKJA 1RJWA 2D4AA 1E4EA 1OWLA 1QP7A 1XQ1A 1Y8CA 1ORHA 3IQHX 4EL0A 4S3MA 5EI5A 3V4FA 4EH1A 1L8AA 2D5AA 2DG2A 4UZEA 4BVKA 3L6OO 1RWXA 2FEOA 5KSYA 2WWYA 1YFKA 4CL3A 2QX7A 4NCXA 1NNSA 1AO0A 1N2CE 4JB0A 2GLXA 2VBCA 1M7BA 2ZG6A 1M83A 4WZAE 4ZRNA 2WF9A 3GEDA 1NKVA 3AUYA 3HYLA 1FDWA 2M1ZA 3AUJB 3IVRA 4L8FA 4Y2SA 2J0VA 4D8XA 3Q7TA 4KQHA 4EMUA 4L0CA 5L9AA 4BAZA 4JROA 4E1BA 4R9UC 1PWXA 2V97A 2Y93A 1VRWA 3QPBA 4KN9S 4YJ2A 1T5IA 4HWPA 4HGQA 1KXZA 4BC0A 3FG9A 4HGOA 4C7JA 5L4NA 5JYEA 4ZZ2A 4GMXA 4HB3A 1AKUA 3O0DA 4N48A 5K3CA 2CLFB 3CJQA 2W00A 4IJ6A 1U5AA 1QIIA 4OXRA 4BWGA 5JXGA 2DERA 2FKAA 3F9CA 3GAAA 3G82C 4QL3A 4RGYA 1YQUA 1U0HC 3WK8A 2R84A 2QJWA 2AG8A 3BAZA 1J0AA 4RVFA 4UVHA 5CM8B 2BFCB 5B58T 5DYWA 4BVFA 4B87A 3K0FA 2B37A 1JH9A 3IVAA 5B7QA 3MB5A 4KUGA 3ZDDA 2O8FB 1LBEA 2ILVA 5LUBA 4BJ6A 2BFAA 4KSCA 2QAJA 1KU6A 1HE3A 4HNRA 4L4YA 4QDUA 2QX6A 3S2UA 3THYB 2FPRA 4MYUA 4RM2A 3UB2A 5ALZA 2NIPA 2BR3A 4MUIA 2A30A 3TLMA 4C7MA 1SC6A 1U6IA 4G2NA 3OT1A 1NQ5A 3L7BA 2JLAA 4M46A 2BDUA 3COWA 4Y30A 5CLLA 1W6RA 2YMQA 3S0JA 5EZYB 1KZ6A 5AW2A 3SI7A 4RK0A 1KK3A 2DAPA 4DLNA 3B2EA 5L3SA 2AQIA 2PLNA 4GNRA 3KSUA 4OG2A 3FPHA 2WUDA 3O7WA 3U80A 2IIVA 2CVHA 4D4IA 1T3LA 2HLDA 3SNKA 2I33A 1P9NA 1LF5A 1KJ8A 3IVXA 4S04A 2FJPA 1IHYA 3PFFA 2AMFA 2CNKA 4FIDA 1OQAA 1X7ZB 4XWWA 3I3SR 5BPHA 4ZZ3A 4QHYA 4BE9A 5JNVA 2NQ2C 3LXUX 4YRMA 2VNHA 4UZSA 2YW9A 3LPDA 4INOA 5L45A 5HJEA 4GICA 4EFNA 5B55A 2W83A 4DCCA 4PPGA 3MJFA 4TPKA 2OQ2A 1XL0A 2PH3A 3C3XA 4PCAA 2VDPB 4BMXA 1GT91 4K26A 1UJ6A 1UDXA 1S8FA 3BKWA 2QORA 1DQNA 2XB4A 4MQLA 4AIIA 2PUGA 4FFPA 2VHTA 1V1RA 3RBAA 1YUNA 2YIMA 1ZD5A 1C50A 2YV4A 1E2BA 1I13A 5BNIA 2GCOB 2WD9A 2HSEA 3ZGNA 5KX5F 4AZWA 3DE1X 4R2IA 4LJ7A 4O3FA 5LMCA 3JQAA 3WKCA 5KYNA 5LFAA 5JNWA 1IVYA 2VT3A 2P9ZA 5CURA 1NW6A 2IXTA 2OV3A 3MRVA 3R3ZA 1SUFA 1PV2A 1FFXB 1XZMA 1KSGA 4E70A 4CM9D 3JWEA 4CF6A 1P7VA 4UOQA 5DOZA 2ORYA 3LKDA 5GJWC 1TJNA 5H4HA 1A4UA 3U49A 2HCTA 5CYPA 4UTPA 2B7LA 4PGFA 5DBHX 5JPCA 1E2HA 3ENVA 1VP3A 3I83A 5HCUA 2OCKA 3CR3C 1T1SA 2I71A 4HC4A 3KR1A 2HA0A 1MCZA 3C39A 1CW2B 2JZOA 3ZHOA 2XOKD 5EMKA 2DHDA 3LQFA 5JSHA 3MBIA 2FCAA 4RXTA 4F4CA 2BI8A 3TL3A 3RTDA 5CA1F 2PRSA 3JARA 1AS0A 1ULHA 2CV2A 1NVGA 2RHRA 1QKIA 3MS4A 4O4IF 2DQKA 2ODPA 2WF8A 5LR6A 3A6ZA 1HE1C 4R0VA 4XIFA 3GDWA 4UD2A 2QMEA 3QFFA 4NBKA 3UCFA 2FOLA 4LXUA 1RXVA 1LDGA 3T9FA 4KKVA 4GWGA 5FWDA 4KREA 3NH6A 3O8NA 3E8XA 3DTVA 4GMFA 3PNMA 5JD6A 2RGBA 2IOQA 4YRNA 1TO6A 1WBJB 4CLOB 4OQEA 4BZXA 3S4YA 2FCRA 1QF7A 5DBIA 4DL9A 1UXHA 4RQBA 3V4SA 2O8BA 5BN5B 1W44A 3CF4G 1UFRA 3KCNA 3OTWA 3UMVA 4DW8A 4LHSA 2B4QA 1I80A 3GDOA 1D2NA 1JHYA 1J1UA 1HE5A 2CFIA 4OGFA 4GKKB 2JGAA 1C3JA 2QJOA 4KPUA 3T9BA 3HO1A 4Q9HA 5DK4A 1PNRA 2A9FA 2V0GA 4UDOA 3Q6IA 4MYDA 5HUHA 1OIWA 1UF9A 4C9BA 2JKZA 3HCOA 1YZHA 4DARA 3DFMA 1JR6A 3IB6A 6REQA 4WCFA 2ZS7A 1JJAA 1LI4A 4I4NA 2FEMA 1J7KA 2YOHA 2ZQZA 4U39A 1JXAA 1Z5ZA 4IWXA 4WADA 5KYTA 2D62A 3ASVA 3L82B 5JZVA 5AJXA 2YVLA 4U1RA 3TI7A 5BP7A 4IX1A 4CRWB 4Z4IA 1R5OA 3M1YA 3IRUA 3S2YA 1Z2EA 2P9FA 4OKNA 3LYUA 3OY2A 4MS3A 5AVKA 2FZGA 3OFJA 1A1SA 4O2AF 2CJFA 3HJFA 1HBJA 3DAYA 3LT5A 4EUSA 1YKSA 1KR2A 2YYAA 4HDCA 1C0PA 4F2WA 4BNXA 1PYOA 5DTRA 1OI4A 2G7ZA 2QTTA 5JJLA 1UPAA 4IBOA 4MYCA 4U63A 1OJLA 3LDAA 5IDYA 3DYIA 1MJNA 3KQOA 3LAWA 4EHLA 1X14A 3R3YA 1CQPA 1TTHA 2C4NA 3LFUA 3LBAA 5AXBA 3V9PA 1VI2A 2H11A 4TLEA 2WIJA 1DEXA 3S2GA 1Y5MA 4KRGA 3WGVA 3LRTA 3KETA 5IHXA 3TIGA 4BO4A 1E62A 1T0HB 5DNDA 5HFAA 3OQIA 2G6TA 2RAPA 2C9CA 2BL4A 2GBGA 5AQEA 1QFMA 3R5JA 4WNAB 5CFZA 3RR2A 1XROA 3RD5A 1RP7A 1P5JA 2GFQA 3E9EA 1JDBC 3DZIA 3E7PA 2VSXA 3HYSA 1MMFB 5ERGB 3UF0A 1GILA 5DGHA 1JPNA 3MWDA 1V3VA 1HZZC 4NP6A 2EW8A 4DLYA 1PJ8A 4NNPA 4MWDA 5HE9A 4HUQB 4ZWNA 3UG6A 1OFVA 1OIXA 3P2JA 5AHOA 4BCDA 3IPLA 1PYDA 2VCEA 4FSDA 3OJOA 4ZREA 2JJ2D 2Q0SA 3PB3A 2ZBGA 3OEWA 2JBHA 4A10A 4TTTS 3CONA 4BQIA 1J8VA 4KH1A 2W98A 4PYMA 1P1FA 2DHEA 3IP9A 1ZUD1 3FRIA 4P32A 4PSKA 4XUGB 3WSVA 4CMHA 4ZOAA 4F9EA 3A6PC 4RHTA 2DPGA 4FT2A 4M83A 3CVWA 1Z33A 1O4WA 1QTNA 2P4QA 2GT1A 1M1UA 3DJYA 1E79A 3IPAA 2PYDA 4KN8A 4AF7A 4D3ZA 1SVUA 4YX9A 5CXUA 3U9TA 4UFPA 3T5PA 4DMLA 1XNJA 4Y6LA 4ZJZA 4Q1EA 1KYVA 4RVUA 1W52X 1AD2A 2HRQA 5CNIA 4ANFA 5IZCC 5I7VA 5B2EA 3MUNA 3HDHA 3TR5A 1SY7A 4DKJA 4MUAA 1HM5A 1KDYA 4HLUA 3N8KA 1DMRA 1PEAA 1XP5A 3OLCX 3NDBB 3HCNA 2W6JD 2XXAA 1NF3A 2YMPA 4QDJA 3PTLA 1W2WB 2XY4A 2VYCA 4EYKA 2XMSA 1MB0A 4DVGA 5DE3A 3JQ8A 3PENA 4B0OA 4BQEA 5KAPA 4LG1A 3GROA 3WVNA 4JEMA 5IKMA 5JR3A 3QMWA 1E8MA 4GZ3A 1L5SA 5HQ3B 9ABPA 2XOXA 4U7JA 3TLZA 4MV3A 3UJ9A 1JLMA 3AHIA 3C0KA 1XAIA 3N53A 4EVSA 1U8AA 3V1UA 2B5WA 2CT8A 3L1JA 2Q62A 4RDHA 1QMGA 3W5UA 5JROA 5DXJA 5EZSA 5FV4A 4IHJB 4GMHA 4UUNA 4MLCA 5FWNA 3V2HA 5BSGA 4MVYA 4PIMA 5GPBA 2X86A 1KR5A 3FPAA 4R83A 3ORYA 2HHLA 2VR1A 2ISCA 1LDMA 1P2TA 1G66A 3EFBA 3MTDA 1UOOA 1RBQA 2UUPA 3U0BA 3C98A 4J7AA 2OO5C 3DMRA 3TRFA 3VR0A 4AZ3A 4I50A 4CMKA 3T15A 4OHOA 2I8LA 3BGDA 3FLBA 4QFBA 1U7XA 1EU1A 1NMQA 2IYRA 4PRYA 2Q3MA 4FUQA 4H4DA 1I6MA 2R8PA 4X63A 3V2UA 3WIUA 5ILOA 1SA0B 2FXIA 2QTLA 4MR7B 4YASA 1Q14A 2LKDA 1FYXA 1P18A 2VXOA 4K9PA 5T67A 4EENA 1GV1A 1HWYA 2WJAA 2GS9A 2WYOA 2VHUA 1ZDMA 3B7GA 2W4IA 4QHTA 1F1BA 2XOEA 4EEZA 4QLAA 3VNVA 3CZRA 1C30B 2V6JA 3QLJA 1YOVB 1Z4OA 1N0VC 4G1MB 3CH7A 4JJAA 2YJTD 4MS1B 1G16A 1PVVA 3T12A 4QVKA 3SQXA 3H8WA 3EGDB 4HNAB 3RRXA 3ETDA 2F1OA 3I64A 4DLSA 4JP8A 4CL8A 4MIYA 4PZCA 1XMOB 1ODLA 1XCLA 5EIWA 1R1DA 1HYHA 1NHWA 5BXQC 3G8DA 5HS4A 3HDQA 3EWIA 2C99A 5CLGA 1Q1BA 1G20A 5MFPA 4X45A 3IT3A 4DC0A 3KUXA 5FF9A 4MHTA 2J3KA 4XM2A 4ZOLF 2EEZA 2AXPA 3DTYA 5FJJA 1VE7A 3SX0A 1C81A 1F9EA 2OAGA 3DLCA 2RHCA 2JCSA 3GH3A 4DOMA 3UY4A 4RTRA 4TSKA 1QJ4A 2C2MA 2QR3A 3QF7A 1V48A 2IXFA 4TRJA 1LTKA 5IBQA 5DMHA 4BNFA 4C89A 1WTCA 2ZXUA 1ZMXA 1J90A 1O2DA 1SQ5A 2BTQB 2Y6VA 5TSDA 3SE7A 3V1LA 1OX5A 1ECJA 2DE0X 3IILA 3LOQA 3ADOA 1ZSNA 3OEED 4N5IX 2XADA 3SICE 3VSEA 4P4SA 4D74A 2E5WA 4LJ4A 3LE8A 4J0HA 5E3JA 1N1GA 3EMBA 4C30A 3SEZA 1AMOA 3PT9A 1XZDA 3DDCA 5KCMA 1NUQA 2A35A 4XRGA 3WA7A 2HLNA 2C29D 3GJYA 1E0DA 4ND4A 1WWKA 2MHCA 1RHQA 4KVZA 2Q1TA 3ET4A 4CTMA 2NU9A 4LZWA 2V1XA 4M9SA 5EWLB 3ZQ4A 3G85A 2JH8A 5F7JA 3OHSX 1IEWA 1Y6ZA 4XX0B 3KE9A 3OPXA 3DFFA 2HEIA 2WYUA 3D64A 4YCMA 4BNDA 3OO0A 4BLTA 2CXRA 2I2WA 1YSCA 4UUOA 5FXMA 3TDNA 3L4JA 1IIRA 3C4VA 3EPLA 2B30A 2HFJA 2HR1A 3ZBQA 1QTRA 1K4YA 4JSTA 2VF7A 1JFTA 2QMQA 3KO8A 2G77B 1E7MA 2QZSA 4FJ1A 5DW0A 3ZHYA 1Y9ZA 3WHIA 3QGMA 3FF4A 4K9DA 4R68A 4XZ3A 1FIUA 2CLLB 2QQ5A 3K5WA 4EHJA 4KFCA 2RH5A 3LL7A 5CT4A 4OLHA 1SVIA 3PJEA 1TYEB 1JHDA 3ACBA 3QVKA 4JUCA 1L5HA 4BIMA 1G3MA 4II2A 3UTCA 1SHLA 3R20A 1UMBB 1W47A 3FGNA 5JSKA 4FJ0A 3S5JA 4YK7A 3LDFA 5KWIA 4KWCA 1XMSA 5J5VA 3IOCA 3ZHCA 4CM4B 2ZI9A 1SKYB 1LTQA 1Q3TA 4MW7A 3EVNA 2A67A 5LA6A 1EFVA 3I28A 1E61A 1LC3A 4QXRA 3EVFA 3WDSA 4EW3A 2V0CA 3NEPX 5H68A 1U1IA 1NC3A 4PN7A 2F43B 4KAXA 4KQ1A 3HRKA 4DT1A 2LKCA 4Q34A 1W73A 2V6MA 4XEUA 3T7IA 3V34A 5MGBA 4ENVA 3BXOA 1VKZA 4YACA 5KTMA 1DBVO 4OHXA 1IG3A 1Q7GA 1UKCA 1BE8A 1L4HA 2AHOA 2DPMA 4IMRA 5D85A 3ZQUA 1GPKA 2A0UA 1W85B 1VECA 3HJRA 4G97A 4LY6A 1FBTA 4IXNA 5CGQB 5D5QA 1OH6A 1X87A 2I78A 5HDBB 3PRJA 5T3UA 1KEEA 1CIVA 1D1TA 2JFPA 2Z2XA 4QUHA 4ZI7B 4R7GA 5HEKA 3U1TA 4NECA 4CM9A 3EIWA 2AN3A 1SU4A 4UBJA 2M2IA 2ZJFA 3GPLA 4N82A 3WRXC 1V3TA 4ZHQA 1RM5A 5CLJA 1KJNA 4BQRA 2FMKA 2Y77A 3QVTA 1AKMA 2ZSEA 1G8MA 1S5PA 1EFDN 3C7TA 4X60A 3RIMA 2PE5A 1T3TA 5DNUA 1QHIA 2XOKA 1MB3A 4FGKA 1W19A 4F93B 1U3WA 2A14A 3K2EA 2K4MA 4MRSA 1OXXK 4TTRA 4CVNA 1P2VA 3T3NA 3QUQA 3NEAA 3IOYA 1VDZA 3DWEX 3EASA 4IDNA 4Q24A 3PK0A 1MTOA 5EQJB 5EVJA 3T6KA 3ZI0A 1VSUA 2Q2VA 4DQXA 4LXIA 1I32A 3GT0A 2CCGA 4M1KA 4B5KA 1EUZA 1ILWA 1Z0DA 2VDKB 3HB7A 3TM4A 1BMFD 1J0DA 1UBNA 5LUAA 4DNOA 2QE7D 1QK4A 3C5HA 3GDGA 1QZTA 4FX2A 1S7CA 3KFLA 3H7AA 3MBKA 3H5IA 2BLNA 4E4RA 4OD0A 2ONZA 3ZJ4A 2IL1A 4U2CA 3HKDB 3EISA 3E70C 2Z2KA 1YTUA 2XRZA 4XUCA 3S68A 4QTTB 2JDID 5CTJA 4D3SA 2VSQA 4LZAA 1GYRA 4PLCA 1MC4A 1WP4A 5JJBA 5PNTA 1ULAA 4MO2A 4EUNA 5BN3A 5H3CA 3QF4B 4PZ9A 2DQ4A 1QNFA 4DS3A 3BFJA 3A4IA 1P6XA 2R7AA 2GEUA 4RVDA 1PG5A 1NT4A 3BDVA 4BN0A 3KKEA 1NR7A 1PZHA 1Y37A 5NULA 1NN0A 5BW6B 1V1MA 1ECFA 1CS4C 1XTVA 4EYSA 5B6JA 2VJMA 4KVFA 1SUEA 3N2IA 5JI3E 4RGVA 3UJ6A 4R8SA 4EJSB 4LJ6A 3O1IC 4D97A 4PTYA 2H9YA 2OCLA 4E21A 1I7DA 1ZOOA 1C0KA 5K0SA 1H05A 3GA7A 2ES4A 1PKXA 4E5KA 4Q3DA 3VTAA 4CV3A 4HATA 4LHWA 4KQ2A 1VHQA 4JA2A 3EPKA 4TXHA 3E58A 2H5JA 4PAGA 4E5UA 2Z2YA 1ZGBA 2WNSA 2G9RA 3HU5A 4MVJE 4DN6A 1QJCA 3A9TA 4ERNA 4IAOA 3RYFB 1SRRA 3UJNA 3U0VA 1TYAE 2WW8A 3ZXUB 2ZPUA 4KLNA 5IASA 2JLXA 1MGOA 1MRZA 2NV0A 1T6YA 3Q5DA 5EKDA 3AI1A 3G8CA 4ZAXA 2OG2A 1T5SA 3JZDA 2I6XA 3ANYB 4DAOA 1CCWA 2F3RA 3ECSA 1DUVG 2VAXA 3GRPA 2O8EB 2VH5R 1RWPA 1HNWB 4KQKA 1VOTA 4ZAGA 2BTEA 3I01A 5BSKA 1QWSA 1IFXA 4YDSA 3K4HA 4URXR 2IDKA 4QGFA 1THGA 3LCJA 2NSYA 1OLUA 3FMVA 3C8HA 4UBMA 1J5PA 2RC6A 4EAAA 1AS3A 2WQ7A 4AJIA 1SBIA 3WHKA 1R4ZA 4AS2A 3VJMA 3RT7A 4DRXB 2VH2A 1MB4A 3C97A 3PI7A 3GLFE 2RHBA 4D9HA 5AM5A 2V3WA 1D7AA 4D3FA 3LPMA 3TQOA 3ZWQA 2HI0A 2LW7A 2ICAA 4DADA 4YJGB 3F9RA 4J2OA 2OB2A 2QVXX 4INZA 4Q82A 1C7EA 1HPLA 3UA3A 2B21A 4EABA 5JFOA 4RTNA 4IIUA 2WR8A 3DF9A 1ILEA 1R5NA 3E22B 1PCXA 2VNIA 2GUGA 2YBEA 1GTZA 3JZAA 3MTJA 4HGRA 4S1WA 4A8HA 2JJ2A 3PQFA 5KSZA 5ESXA 1SIOA 1PU2A 3L6DA 3QBDA 1RSZA 3V6MA 5HJ5A 1OX6A 4NE7A 4QPJC 5L4LA 1XTBA 4FW9A 2QX9A 4KW7A 4EDFA 4M86A 3JRNA 4QATA 4WXEA 5BN4B 3O26A 5FO0A 1W5AA 2AGVA 1FPQA 3MAGA 2OCXA 5FPKA 3FFTA 3NHYA 4FQ7A 2AOVA 3DWGA 1FEZA 2LPMA 2X8WA 2IBSA 2BEVB 5DX0A 1EK1A 2D59A 3H13A 1EGVB 1KAQA 3A1EA 1UKEA 2CYCA 1BGXT 2G1JA 1H69A 3E2MA 3ZWNA 3WNQA 2B1IA 5IC4A 4E07A 4WZ6A 1DNPA 6REQB 3L8HA 1K6XA 5JXJA 3TTYA 3TFOA 3NWOA 2XB2A 2X8AA 3HL0A 3LPAA 1KAOA 2F7SA 4O2BA 5KSWB 2O2GA 2DH5A 3EW9A 2A9OA 3OLXA 1Z5WA 2W6JA 1VGQA 1NI5A 1QBGA 3DHWC 5HW0A 4WVFA 1XJQA 1WVIA 1CFZA 3A14A 5KQRA 4NU5A 3L8FA 5CVCA 2QR5A 2HSGA 1S2IA 4RA6A 1AO3A 3I5AA 5D6OA 5CCXA 4LBWA 4MDEA 1LPSA 4QJ5A 4MV7A 3TVDA 4ZK6A 2I2AA 3B6ZA 3LHIA 1P2DA 3FWHA 4OHMA 4IIJA 4NBUA 4XYBA 4I66A 2F8TA 2G06A 3CMCO 5AKEA 5F1KA 2AUNA 1RDFA 5F1YA 2XT9A 5LBUA 4C4YA 2AX4A 1XXLA 2C20A 3DDNA 3LQ2A 1T9GR 4OQQA 3ZVKA 1DC7A 1PSWA 2DBVO 4QGHA 4F2GA 2A4MA 3C70A 1OXBB 4RA9B 2Y9PB 1QF6A 1DXHA 4OYYA 1I7QB 4AG6A 4UHHA 1SEVA 4XSVA 4GP9A 1U28C 3IULA 1SUPA 2VBFA 3VR4H 1KYXA 4AWBA 2B94A 2GVNA 4CMEC 4NXNB 4IZIA 3ZH9B 3G5LA 4A8PA 1PDVA 1MJGM 3DCNA 1ST3A 3E5NA 4UEWA 2H1OA 1PR3A 1R6VA 1DHRA 4LYAA 4P92A 1WR8A 2BTOA 1Q7TA 3HCBA 1GPNA 4BQQA 4HNQA 4YGYA 4DDVA 5I5EA 3CEAA 1JA0A 1VTKA 3QSGA 4H1VA 4F56A 1E94E 1IZ0A 1V5WA 2BEWA 4ID9A 4NNOA 3ZHTA 2VUHB 1G55A 3TXAA 4EUEA 3GOQA 4MGYR 4OAOA 4TVOA 3VISA 5C80A 2FPUA 3ICWA 1E89A 4AC9A 1KGSA 1QIKA 3U39A 2UYCA 1LCIA 1Q1EA 1PSDA 5E2BA 4UPDA 2EFYA 1EWYA 4MP8A 1XCPA 3AW8A 1WPXA 4AURA 3I5MA 4MWTA 2JAOA 2UDPA 4KXQA 1CRWG 3KU4A 1BJRE 4LMRA 1FMFA 3E5RA 2VQDA 3W5HA 5B6IA 3ENQA 4QHSA 1GGVA 3CE9A 4OQLA 3QVGB 5BRAA 1H2AS 2CFSA 1CUWA 2OK8A 3GA0A 1M2VB 2GQ0A 4IEFB 1BQ4A 1EI9A 5MN6A 1CJCA 5G40A 3C6KA 4RQAA 2WHQA 5HMMA 1P62B 3A3KA 4IJMA 1JHOA 4D9FA 5JNRA 5JUWA 1G5RA 3L0YA 4IHQA 4WD3A 2CMDA 1XXHE 2G5TA 1D2EA 2QN7A 3FB1A 3GJ7A 4FMCB 2DHRA 1M5TA 3R9KA 1XL1A 4MKFA 1R6XA 3TB4A 1PJRA 1DG9A 1LS6A 4G5XA 4YAFA 2HQ1A 3GFPA 2AK3A 1KWGA 3ON5A 3MF4A 3BCUA 1H5QA 4RPJA 5ESWA 1CP3A 1R4MA 3GGOA 2ZPTX 4Q1BA 5LJLA 4DV7B 3ZE2B 5LU8A 1E0KA 3FIJA 3UJDA 5KMGA 5KYXB 3ZD8A 2EERA 4M9QA 1JIXA 4KAAA 4ALKA 4LBVA 1KJZA 5T4EA 5IW8A 1ZUNA 3OE5A 3INNA 2FW9A 2B4RO 1UBFA 2P91A 4MX8A 1LKZA 3E7DA 5FRDA 4E30A 4MO9A 4LRQA 3K6SA 3IMEA 4KE8A 4GM1A 2E89A 3FNEA 1IJBA 3P9SA 3VGJA 3K0SA 1I30A 3G2KA 1YDEA 4TTIA 5IH3A 3U3JA 3VDRA 3L0SA 4I4TA 4J0IA 5CJ2A 2P41A 4S1OA 4F2PA 1BA2A 1EWVA 2V59A 1K6IA 3M2TA 4MW0A 3D7SA 1QE0A 1QVAA 1V7QA 4LGVA 5CFQA 4YCJA 4X85A 1NIJA 2ZRAA 5CB0A 3P9XA 5IN5A 2KM1A 1TLLA 2O3TA 4LJSA 4LSMA 5CFMA 3BD7A 1AQLA 4BAUA 1DFHA 1NL3A 3SFTA 5FPQA 3ZKWB 1JSRA 1XA4A 1RHJA 4US0R 4HN9A 3GJ4A 4J03A 4YT8A 2J9YB 3NAZA 1Q95A 5IKEA 5COBA 5B3JC 1K3UB 2PZLA 1ZRSA 1ZD4A 2BF7A 4MP6A 1OYYA 1QYRA 3NIFB 2AVNA 3WNZA 2X77A 3KG2A 5J2UF 4YPVA 4IJWA 2PGLA 3AGPA 3RNLA 4LK2A 2HSJA 2WFLA 3FE2A 2XCQA 5E7JA 3DL4A 3PDCA 3U81A 2AEFA 2F9MA 1J99A 2FW8A 3COPA 4G56A 4L2IB 4FFBB 4R2MA 1FQOA 1FTYA 5FUWA 3ZW9A 4DUYB 1U7PA 3G88A 4IXTA 3MWYW 5FI3A 4GWKA 3RTEA 5CW1A 4L4RA 1T1GA 2I67A 3G8AA 3UWKA 5IJ9B 1XYYA 3MM4A 4XCVA 4BECA 3AM4A 3KQVA 1QWOA 2CMKA 1BE0A 5EXXA 3NBYC 1U81A 1HE8B 2W9XA 2CE2X 4PHFA 2GO1A 4X20B 5F23A 1MJHA 3FHTA 4WK0B 4RIGA 1OASA 3WK4A 1XZBA 5KNDH 2XKJE 1TKCA 4FHDA 1OFHA 2FUNB 3EQ7A 3C7AA 4AK9A 2ZUFA 4QPDA 1YRWA 2QMYA 3BC1A 4X1IA 2V4ZA 3ZCQA 1PV4A 2WFMA 2XT6A 5A02A 3C7DB 1BTOA 3DBHB 1YZKA 5H02A 1LLUA 1USKA 2HF8A 2ZYIA 3IIKA 3R4CA 2J7KA 4OHKA 4G0YA 4DSTA 4Z9BA 1EP2B 1ARZA 1LD3A 1M1YB 3G8BA 4BNJA 1UQUA 2IHTA 4V0KA 2XUZA 5EKTA 1QVRA 3O1JC 5I3ZA 1BQ3A 1LDBA 4J0EA 1A3CA 1JZQA 4Y6PA 1QHSA 1PL8A 1IZZA 2FWRA 3QYPA 4MAMA 3VO9A 5L3QA 1YZNA 1EDOA 1L7OA 5JWRA 1EUCA 3NONA 1RW4A 1M76A 4KH0A 5FPTA 3TZBA 5JQWA 3GGGA 3QEAZ 3L7JA 4BX3A 3KOZA 3L7AA 2P2LA 2PX2A 3EIUA 3BMNB 4M9RA 4BKRA 4ZCRA 5IXSA 3X1MA 1BMFA 4UC0A 5KOJA 1FXSA 1GKIA 1OZAA 2CB0A 2QE7A 3LA6A 5E0OA 3SGLA 4YAIA 3A2KA 1B42A 2X5NA 1PR1A 1PQUA 3TE6A 1KAHA 2OXRA 3KYCA 2WE8A 3HFGA 4BDSA 1YS9A 5AHKA 1NY5A 5FA8A 1DAOA 5BWLA 1V6CA 1KDPA 1L4LA 2JH9A 3V97A 2JDIA 3FDIA 1C3XA 1IQUA 1LJUA 2E4YA 2FX3A 3MVEA 4L5AA 5BVGB 3A2LA 4PG7A 5JJIA 2XBMA 4TRNA 2CNOA 4N7MA 5M29A 3WGHA 3HS3A 3EDYA 4O4JA 2YXBA 1P2FA 4H0NA 1SKMA 5JSYA 4E2XA 3IL2A 1WL8A 4Y0NA 3L3BA 4BZWA 3V8NA 2QA5A 1XNGA 3GC6A 3LNCA 4MV1A 4J16A 3UJAA 5I9MA 1KU0A 2QMOA 1D1SA 2GVZC 4RVNA 2O5EA 2HXGA 5FLXA 3JQGB 3FOZA 4OP3A 1YQXA 2VDRB 1RAAA 4HV4A 5BWBA 2RD2A 2A78A 2XSZA 16PKA 3P4UA 4YP9A 4HRYA 4BQOA 3KD2A 1Z83A 5D1NA 2HK8A 2XH8A 3D0OA 4L9SA 3KXIA 1KKLA 2C5SA 4NAHA 1S3GA 3ESDA 3HABA 5FPSA 1XZHA 2DKNA 2PMWB 4FCTA 2JFBA 3SM9A 2XNCA 1DS6A 3MG9A 5JWHA 3O4VA 2OY0A 3C3AA 1QGED 2J3DA 1D6NA 3IUMA 2J46A 3OZTA 1U0GA 4J91A 4XARA 3FYSA 5F2KA 4Z1OA 5IK2D 4LX8A 4D98A 1Y5RA 4LY0A 4YRBA 5JV5A 1PZFA 2GF2A 4EHFA 5BV7A 1S7GA 1RWMA 4RDCA 4GR5A 1C9MA 4WUTA 1K0UA 4OOFA 3ZHQA 3H11B 3ASUA 1Z2OX 3LF2A 5J23A 1Z5VA 1SCQA 1LZKA 3MJSA 4DMCA 3H2ZA 4UULA 2I7DA 4V03A 4CKEA 1SXPA 1MHPA 1VHJA 1E3IA 5EP2A 4TN5A 5ADWA 5LD2B 2FPIA 4ETMA 1E6LA 1Q6ZA 2ZR9A 3KHTA 5DB4A 4EA8A 2VJAA 3B13B 4O4LA 4AJPA 1Z5NA 3SZGA 1E1CA 2OFOA 2VDJA 3ZZMA 1N6KA 4R1TA 3QIVA 1IN6A 2DFNA 4MYRA 1MA3A 1YJ8A 2JJ1D 3D7LA 1QLJA 4H3KB 4HFJA 1K7EB 1OKKD 2YNMD 3H6HA 5E8RA 3V4LA 4BRWA 3FZNA 4ZO8A 3KLNA 4JZYA 2XYVA 5JLAA 1E9AA 3GVCA 1I9GA 1E3SA 2HJ9A 3Q85A 4HDKA 3UKOA 1G2QA 1R6BX 4NG4A 2I8CA 2HF7A 2XWSA 5E6UB 2WA1A 3RFUA 3SKYA 3V8PA 3C8MA 3GT4A 1JRLA 1M1XB 3HKEA 4OHWA 3A9WA 2EG9A 1BA3A 1ZQ1A 3DP7A 5IEJA 1SH7A 3P8ZA 5BT9A 3TTWA 4KB5A 4AQ7A 5EIAA 2NXCA 1V0JA 1OV6A 3OOYA 1NW5A 2J09A 1AXRA 1J23A 2PRZA 3N87A 4JB8A 4BIIA 1S96A 2ATCA 5ESRA 5BSMA 1W96A 5GVRA 1K7XB 2H1HA 5JSUA 1ZO8A 4BGVA 3GO4A 4KXVA 4XGQA 3N2YA 3W3AH 3DZKA 1GOTA 3QLTA 4ZO6A 3ENWA 4ZI5A 4BE7B 3D31A 4FLEA 2R47A 1WF6A 2OEPA 4RACA 3VAZA 2ZYVX 4YTEA 4G23A 3SR0A 1Z22A 1NOIA 4YMWA 1M6YA 4P22A 1FZTA 3R5XA 3MYRA 4JT4A 4LRTB 3U4MA 3Q8WA 3C41J 4RKFA 3ZU2A 3U3DA 2BKXA 3IEVA 1GADO 2HCFA 3R9XB 3DBVO 2H0RA 2NUAA 1W4CA 3O03A 4YAKA 1RCTE 3TZHA 5CM2Z 5JCJA 1U2TA 5JCOC 3U7FB 2RKWA 2VF4X 5GZ6A 3V55A 1Y7TA 5T7BA 1M75A 2FN8A 1J0CA 2NU6A 5GJVC 4DLUA 1ECPA 2C9DA 5FI0B 5TJHA 4M1MA 3NV7A 4KQEA 3O38A 5DX8A 3QK7A 5BNWA 3IP3A 4I1OA 1R8SA 4ZVUA 4I6GA 2O2CA 3SFVA 2QM8A 3VDMA 1W2GA 2GLUA 5K3FB 5I4IA 1PR0A 1PJ2A 1YRLA 1SU8A 4LTNA 1ND6A 4KI7A 1JEDA 1A96A 3W8EA 1U5BA 3CX3A 4GHWA 1O0BA 3QVXA 3ZV4A 5BRJA 1EUDA 3NP7A 1T29A 3OZVA 2R7LA 5EOVA 3CISA 3RVQA 2OAEA 3KXLA 3TTXA 3EA0A 3B5EA 1W87A 4UJ3A 1UAGA 2N9UA 4KR3A 2X1HA 2PUEA 1AKRA 4M60A 3NAGA 1JJ7A 3CRZA 3FNHA 3H5LA 1T15A 3KR9A 4KNVA 3VSAA 2XUDA 3RUAA 1PFKA 5DX1A 2PLWA 1X1DA 2B8WA 2R96A 1YO6A 1CR1A 2WHYA 2YWCA 5ULLA 2PWYA 5KB3A 3MS7A 1QIMA 2FPPB 2Z43A 3PVSA 1L5KA 4QTXA 1P2UA 3EVBA 2D7CA 3HJNA 5IN4A 1SWVA 1UMDA 2V7WA 2NZJA 2C2XA 1YMVA 4GOLD 1TA0A 4J07A 4K81B 1FUUA 1XRNA 2NXEA 1SG6A 1L5MA 1YASA 4MKIA 1ELOA 4DDKA 2H85A 2RH9B 1MH9A 4F4IA 2XZTA 4NV3A 5A4IS 4FFLA 1CR4A 3L9WA 2HY7A 1P0CA 3OO1A 1FSZA 3SIPA 3TNJA 1IQ0A 4DUPA 2EX0A 2OV2A 3U13A 3G8YA 2Z8YA 4ZRDA 2PV0A 3QKRB 4QPCA 1W93A 2ZKLA 1V2HE 3LKZA 1YHZA 3M6IA 1NGSA 2WT8A 4FYMA 3W05A 2NZ8A 4W7IA 5C4IA 3P2YA 5EJGA 3MRSA 1SUWA 2IPNA 3VPFA 2QD5A 4I19A 1TLFA 5LL6P 1AF4A 3MINA 3T1HB 2EDAA 2PMCA 1L7AA 3O3OB 1GEEA 4NSNA 3RKUA 5I01A 2ASVA 4Y9SA 1IXRC 2FE4A 1GV0A 4U7GA 3BK7A 2QRMA 2PJZA 4WV3A 2W2PA 3TIVA 4AF6A 4C2BA 4JB2A 1YU6A 1LUAA 4GSKA 5AM2A 2DUNA 1KOLA 3TOXA 1OBVA 4GH5A 2XUPA 4MSUA 3TQCA 2C92A 3ZIAD 3EUEA 3HXMA 1E5VA 4QXMA 5I9NA 4Q4AB 4KO8A 2JJQA 5AI4A 3HBLA 1Y80A 3RC8A 4WFKA 3ZC3A 4H3VA 1EIWA 5AMXA 3QA9A 2JFWA 1JI3A 1UBLS 4MR8B 1MOSA 3ZGXA 2R9VA 4HSGA 4DA0A 4BBPA 1Z0AA 3FHLA 2C7QA 1MC8A 1YXMA 3V2IA 3MWJA 2MYUA 2PFKA 3PXAA 2CZQA 4RY8A 2I7XA 4HAVA 3HXKA 4MV8A 1WO8A 5EA2A 4DRZA 1U2DC 4IOLA 3MTEA 1WEHA 1EAYA 2XVMA 3Q1KA 3MJ4A 1AT1A 2NYVA 2KWIA 3D6JA 4IDQA 4TXLA 1U1CA 1BHQ1 1N2ZA 3EXFA 3OMWA 2PNJA 1U3VA 1YZQA 4FNGA 3CLRD 3AFIA 3EUFA 3OZBA 2Q50A 3EFHA 3SIWA 1DCTA 1BFKA 3UPTA 4QTUB 1YS4A 2GDJA 3LZDA 2W43A 2PSFA 2Q7XA 3HRHA 3HSYA 1A95A 1AKEA 2I62A 3WLIA 2DFTA 1F3OA 2HA4A 1V9SA 1YMQA 4HAUA 4LBYA 1QHNA 1O0CA 1EHCA 4GLBA 3BT7A 1J00A 3MOGA 1KJ9A 2IEZA 3I05A 1QX3A 3PA6A 5GONF 3T0IA 1U7HA 1QZ3A 1KH2A 2VPPA 3BIWA 3F47A 2QRQA 5J59A 1UM9B 3DPSA 4CLRA 5HIMA 2YRXA 2D1YA 1HLPA 4GECA 4UHFA 1JF8A 1QBKC 2JA1A 4CLHA 1G38A 4JS0A 2CV1A 1U0TA 5AIAA 4ESVA 3BHNA 4ITVA 4LMBA 1IN8A 2RGXA 3VZSA 1UJ2A 2AYYA 2FSPA 1M2WA 2J48A 4G8CA 4IMIB 5CLFA 3HCEA 3UK6A 2FP3A 3LUDA 1QIFA 2XA2A 3BSFA 4UMVA 5FI5A 4Q39A 3P26A 4XIIA 2O20A 4HNGA 2ACVA 2PQ6A 4H3SA 1KRWA 2VOEA 2HCRA 3PT5A 1F48A 1JYFA 3ABOB 4MW6A 4NIMA 4WOPA 3BMQB 1A71A 4AB1A 5KYKA 5EPOA 4H17A 1EBFA 4ND1A 3IPCA 5LZ5A 5T6MA 8ATCA 1MRNA 4JXKA 4R5HA 1SRQA 4YP5A 3QMPA 1RQXA 3DH0A 1U8FO 2YS7A 4EF6A 2DUWA 1RWNA 4MQEA 1YHNA 3HVUA 3PJFA 2XMCA 1P5ZB 3LYAA 2QL5A 4GRIA 3TWOA 3RPEA 1JHMA 4KXLA 3WTCA 3WWCA 3ZHBA 4Y67A 4P33A 5IZ4A 3FPKA 1ULSA 4CDMA 1V11B 4OB7A 5EJFA 3REGA 5ALLA 5ICCA 4G81A 5ELMA 3STUA 2PMFA 1YA8A 2O07A 3EWSA 4AMUA 2AEEA 1OXKB 2VDQB 3ASYA 3BB4A 1J8YF 3OWHA 4KBYA 5AXCA 2DHQA 3QFCA 3HXQA 2PVPA 2ZULA 2JD2A 2AOUA 3UT5B 2HYDA 1ZMRA 3LU1A 2YFYA 3LUAA 3AFNA 1RWQA 2C4VA 1QU3A 1VJ0A 4OAPA 3PVZA 4DA8A 4KIFA 1PUIA 2WF5A 3HMKA 2FJ0A 3TTTA 3UT6A 5IJ0A 2QX8A 2Q8QA 2Q6IA 4UNQA 1Q84A 2BRUC 1ADBA 4HPJB