4YMHA

Crystal structure of sah-bound podospora anserina methyltransferase pamth1
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
239
structure length
239
Chain Sequence
LGSILPFNEETADRVSAYCEKNSHGIPDALVEHWEWTRTRFPDADKMSSRLQGSWMIFTARDRKPKRILEIGCYSGYSALAWYEGTRDTKAEIVTLEYSPKMIAASREAFKKYGVGDRVKLIEGPAENTLKTLEGEFDLIFVDANKDGYAGYVKTILDQGLLSANGIILCDNVFARGLTIGPDCAPWLNDHVRPYWNGCGQALDKFSAGLMEDPRIDVLLLPVFDGVTQIRWKDGAQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Biophysical Characterization of the S-Adenosylmethionine-dependent O-Methyltransferase PaMTH1, a Putative Enzyme Accumulating during Senescence of Podospora anserina.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Transferase
molecule keywords Putative SAM-dependent O-methyltranferase
total genus 86
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ymhA00
4ER3A 3OU2A 4X1OA 3PVCA 3SSNA 4V0QA 3ELUA 3BGDA 3GU3A 4FSDA 4Y2HA 3EGIA 3IHTA 3HCFA 5CCBA 2AVDA 2ONYA 1KIAA 3LDFA 3FUWA 2PWYA 5DT2A 3EGVA 4HH4A 4HTFB 2VDWA 5MHTA 3DUWA 4YV1A 1ZKDA 4PGHA 3NMUF 1N2XA 2ERCA 3NWEA 1BOOA 2PX5A 3UZUA 2IH2A 3LX6A 5K0NA 4CTKA 2HWKA 3BGIA 2B2CA 2VS1A 2Z6UA 5K0JA 1IM8A 1QANA 3P2KA 4C05A 1T43A 5IH3A 3BWBA 2IH4A 1BHJA 1RI2A 5K05A 4MWZA 5KQRA 2NNWB 2AN5A 3HNRA 2R6ZA 5EEGA 4EMSA 5FCDA 4RTSA 4XUCA 4AZSA 1DCTA 1X1DA 3B3JA 2C7RA 4PINA 4DM3A 5E9QA 2GS9A 3P2IA 5HIMA 3WSTA 5DX0A 2ZBRA 3B89A 3KQPA 2OBFA 4YV0A 1F3LA 3Q87B 4P7FA 4PYJA 1JQDA 1NV8A 1Y8CA 2NXCA 2NYUA 2YR0A 5EPEA 3DR5A 3KQMA 5BXYA 2BH2A 2QY6A 4QVGA 3P71T 4LECA 4R8SA 4OBXA 4FS8A 3RODA 3HEMA 4QPPA 4QDKA 2JH8A 1KYZA 4RVHA 4FSXA 5DRYA 1G60A 2IPXA 2KW5A 3P9KA 5E1MA 5KQSA 4HC4A 3A7DA 3HCBA 3ANXA 3G89A 5EQJB 2JHCA 2AOTA 3FUTA 3DTNA 3HCEA 3HA5A 1O54A 3OE4A 3E8SA 1IXKA 3T7RA 5M5BA 3OZRA 1ZGAA 3FRIA 4F84A 3E05A 1VP9A 3LCUA 5GIPE 2ADMA 5E1DA 2OKCA 2HTEA 1VBFA 2AN4A 2V7EA 1KXZA 3ELYA 3E23A 3FUVA 3I9FA 3P2EA 1SQFA 5E2BA 5K03A 2C7QA 1M0EA 4V0RA 3HVHA 1XDUA 3DULA 1UFKA 2EJUA 4P7GA 2IBSA 5CCXA 3C3PA 5HIIA 3VYWA 3KQQA 3LSTA 1YFJA 4P58A 3F4KA 5JR3A 1ZGJA 4RVGA 3HCAA 3IEIA 3MTIA 1P91A 4MIKA 1FP2A 5CVEA 4HGZA 3K0BA 2ZSUA 3EVEA 2PXXA 2ZWAA 2C7OA 4PYOA 5D1HA 3FRHA 2VZ9A 3I64A 3X0DA 5EMLA 3SVZA 2EFJA 3AXTA 1NT2A 3EVDA 4OQEA 1Q0TA 4YUZA 4DCMA 3M33A 4AZTA 2G71A 3EVGA 1RJEA 4B17A 3B3FA 4DCGA 1L3BA 3R24A 3SX0A 1NV9A 1DL5A 3A26A 3DXZA 3UBTA 4RTMA 4OQDA 4YUXA 4G56A 3KPVA 1I4WA 1TW2A 4FT4A 5ICGA 3P97A 2AOVA 5T6BA 5DPMA 3GO4A 1AF7A 1Z3CA 5E8JA 2PJDA 3C0KA 1XCJA 3OZSA 4PIPA 1QYRA 4M36A 3Q7EA 3R6TA 4RTRA 4U7TB 4R6WA 3SR4A 2CWWA 3UJAA 2ZBPA 2P3QA 3LCCA 3FTDA 5G02A 5EHGA 3BWMA 2R3SA 4HGYA 5T67A 3SSMA 3UJCA 3LDUA 2ZLBA 5E9JA 3SGLA 2O07A 2IDKA 2QYOA 1D2CA 4E33A 3E7PA 3MQ2A 5LR6A 2OB1A 3FTFA 4IKPA 1SUSA 2ZIGA 4OA8A 4EQZA 3TFWA 3BWYA 2OXTA 4LG1A 3EVZA 1I1NA 4LWPA 1JG2A 2GH1A 3ELWA 3UA4A 1RI5A 2DPMA 4GOMD 3SMQA 3VC1A 5DTQA 5FA5A 3IYLW 4AZWA 5HOQA 3GRYA 3KKZA 3QOXA 4KDRA 3QOWA 3GWZA 3THRA 2AN3A 4YUYA 1BKYA 3BUSA 3HA3A 3MCTA 4GUAA 3UWPA 5DX1A 2HNKA 4ER0A 3C6MA 3OCJA 1NKVA 5K01A 3KR2A 4YUWA 2P3LA 1Q0SA 1YF3A 3R3HA 4M38A 4R8RA 2CMGA 3OPNA 2JH9A 3SSOA 3G2QA 5LQCA 3DXYA 5CVUA 4RTPA 3FPGA 3P9CA 9MHTA 4GQBA 4CXMA 3EVFA 5EMJA 5FWDA 4ER5A 4GOND 1SUIA 2ONZA 5EMMA 4RTKA 3HTXA 1XDZA 2QRVA 2B25A 5KYGA 2JG3A 2H1RA 3HCDA 3OFKA 1AQIA 3AXSA 2NP7A 1BC5A 3UJ6A 5K0EA 4GEKA 4RYLA 4RWZA 3TRKA 1L9KA 4DQ0A 5C9ZA 5LQNA 1KPIA 2AOUB 2CL5A 3UJ8A 3M6XA 3TKAA 4NECA 1JQ3A 2GAFA 2IP2A 3G5TA 3MTEA 2ZULA 4E70A 1X1BA 1G6Q1 3LPMA 4FR0A 5CIYA 1QAQA 3P8ZA 2UYHA 5EMKA 3B3GA 3KR9A 4GF5A 1P1BA 3HA7A 3PX2A 3NVKI 5B1SA 4Z2YA 5FA8A 3GIWA 3FTEA 1KPHA 2YXDA 4C03A 2UZ4A 5K0LA 1EAMA 2P40A 5DXJA 3NW9A 3TQSA 4E2WA 5DLYA 3DLIA 5LQAA 5E1BA 8MHTA 2QE6A 2P41A 3A25A 2ZBQA 3BKWA 1KPGA 5HIKA 3VSEA 1L3CA 2O0LA 1PRYA 3TOSA 2AOTB 4IWNA 5EG5A 4POOA 5LQKA 5LQUA 1N7IA 3PLAE 3CVOA 4JXJA 5EKUA 5BP7A 3NJRA 4EKGA 1D2HA 3RW9A 1FJXA 5DSTA 3TM5A 2VDVE 2C7PA 2JHPA 2AVNA 2NXNA 4E32A 1AQJA 3MB5A 1SVUA 5FWAA 3G8AA 3KQTA 3LCVB 2A14A 5K09A 2OB2A 4QQNA 4RTQA 1WS6A 2P35A 1G8SA 5FHQA 1ORIA 4H0NA 3LBYA 4QVKA 5EHIA 4IV8A 2AR0A 2VP3A 3KR0A 3C3YA 5ICFA 4E30A 3SM3A 1YB2A 1SKMA 5H02A 2YTZA 2HMYB 3GRVA 3LBFA 2O57A 1R8XA 2GLUA 1EQAA 2O05A 2PX2A 2YVLA 3FPJA 3G8BA 5E2AA 4M37A 4PWYA 3GRZA 3GCZA 4KIFA 1RJDA 3LKZA 5K0BA 2ZIEA 4CKEA 4PNEA 4FP9A 4L7VA 1KHHA 4PYNA 4WVLA 1ZG3A 3LL7A 2QRVB 1N7JA 4XCXA 2PXAA 1X1AA 3O7WA 2DULA 5FHRA 3DMGA 4AZVA 3O31A 4R05A 3UJBA 1EJ6A 1NW3A 3EVCA 2OYRA 1ZQ9A 1R6AA 2NXEA 4X63A 3GJYA 3JWHA 2PV0A 2FYTA 4OA5A 4HG2A 4IV0A 2FK7A 2AOUA 3KQWA 2ZCJA 2PY6A 1EG2A 5GM1A 3THSA 2ZZMA 4PONA 5F2OA 2H00A 4BY9E 4WXHA 3CBGA 4LWOA 3G2PA 5GINE 1XDSA 2FHPA 3L8DA 1D2GA 4A6DA 2UYOA 1JG4A 2WA2A 4MHTA 1NBHA 3I58A 3S68A 4A6EA 1RJGA 4X41A 3G7UA 5DM0A 7MHTA 3G5LA 1KYWA 2EJTA 3A27A 3NWBA 5DRTA 2BZGA 4YUVA 3ELDA 5F2NA 4HRAA 4PCAA 3HP7A 1XCLA 3HVIA 3UJDA 2Z6AA 3TM4A 2HV9A 3GDHA 1M6EX 4HTFA 4QQKA 4QTUB 5C1IA 2Y1WA 3NDIA 2PX4A 1JSXA 4EKIA 2ESRA 4PYKA 5LSAA 10MHA 4ER7A 4KW7A 1F38A 1R74A 1L1EA 4EVIA 5JUWA 4DKJA 3KQVA 1NW7A 2N47A 1U2ZA 1V39A 3KPWA 3ORHA 3IV6A 1VP3A 4U7PB 1QAMA 1PJZA 1VQ1A 1WZNA 1P39A 3FYDA 2OY0A 3GXOA 2EX4A 2I6GA 3V97A 2FPOA 2F8LA 4RTJA 2FCAA 3FPHA 1VIDA 2BM9A 1HNNA 2I7CA 2P7HA 2ZFUA 3D2LA 2YUIA 5F2KA 4ATNA 2XVMA 4MTLA 4R6XA 4KIGA 3JWGA 1NW8A 2AS0A 4C06A 2XBMA 1P1CA 4AX8A 3BWCA 3VC2A 4X61A 3SXJA 2BM8A 4CTJA 3HVJA 3PT9A 1O9HA 2XYVA 2UYQA 3DXXA 2G8NA 4YV2A 2ZVJA 5EEHA 2BR5A 3DP7A 5FQOA 5EKXA 2B3TA 5K0CA 1O9GA 4MQ4A 4CKBA 3ER8A 3UJ7A 3FYCA 3OE5A 3DMHA 5GIOE 2GPYA 3MERA 4YMGA 4OBWA 4HSGA 1SQGA 1FP1D 2UYCA 5FQNA 1RJFA 5LQJA 4DF3A 1WY7A 4BLWA 4C08A 2ZZKA 1G8AA 2P3OA 3AY0A 5EGSA 5ICCA 2V74B 2G1PA 3DOUA 2IFTA 1L3IA 1R18A 3CKKA 2E5WA 3FUUA 5GM2A 2JJQA 4CWAA 3KU1A 4RVDA 4FZVA 5ERGB 4E2YA 2Q41A 5K8VA 1JG3A 2AOWA 3MHTA 3CJTA 2WK1A 3MAGA 5FULA 3BXOA 3DLCA 2WA1A 3KQYA 3BKXA 3G88A 3K6RA 3KPYA 3KR1A 1NW6A 1OR8A 4C04A 2GB4A 3M70A 5C0OE 3G2MA 2XVAA 1G38A 1VL5A 2PVCA 3H2BA 3OFJA 3PX3A 4GOOD 5HILA 4CKCA 2PXCA 3U81A 2H11A 5DM2A 2I9KA 3A4TA 1KP9A 4F86A 1R8YA 3FTCA 3M6WA 4FGZA 3LKDA 4C07A 1NE2A 2BR4A 4DMGA 2P8JA 5FUBA 1MJFA 3KHKA 3G2OA 5U4XA 4DZRA 3GNLA 4RTLA 2ORED 2PKWA 5EZQA 2B78A 5EIFA 1QZZA 4QPNA 3EGEA 4X60A 3NVMB 1UWVA 2ZTHA 1YZHA 1VPTA 2PX8A 4UOEA 3TPZA 2OO3A 4FT2A 4RV9A 3HVKA 2PSSA 3CCFA 4KDCA 3A7EA 5EOVA 2FRXA 4YMHA 2O06A 5HFJA 3FPFA 5KS2A 4ISCA 2K4MA 3BT7A 2GA9A 1AV6A 1X1CA 2P7IA 2YQZA 3P9NA 4F85A 3LGAA 2FK8A 4RTOA 2HR1A 5DM1A 4PYQA 3OU7A 2PT6A 2AZTA 3ER9A 5D1NA 4BP1A 2LD4A 4AUKA 2YX1A 5IKMA 3EMDA 1FBNA 1XJ5A 5GOZA 3PFHA 3CC8A 1RI3A 5HEKA 3TKYA 1JTFA 3T0IA 4PYLA 1HMYA 5EVJA 2XYQA 4BP3A 5ICEA 2OZVA 4RSRA 2CMHA 2P1DA 1YZ3A 3AJDA 5CVVA 3PB3A 2JHAA 3I53A 5EC8A 4E31A 3LHDA 3BGVA 3RIEA 3M4XA 3KQOA 2Y1XA 4GC9A 1B42A 5FADA 1DUSA 1H1DA 3BZBA 1WG8A 3B7PA 1I9GA 3KPJA 4KRGA 1EJ0A 3FZGA 3ME5A 3UJ9A 3PTAA 3C6KA 4O29A 1NW5A 4ER6A 2XYRA 3MGGA 2ZZNA 1X19A 3HM2A 4RVFA 3DH0A 1VE3A 5BW4A 3I5UA 1QAOA 5DWQA 5DM4A 1XTPA 4ZTBA 2PWPA 1JSZA 2IBTA 2G72A 2QM3A 3MCZA 3EEOA 3DMFA 5FTWA 3JWJA 2I62A 3REOA 3AWIA 3HCCA 4BLVA 3GGDA 3NDJA 3ERCA 1UIRA 5CD1A 5CVDA 1IY9A 5DTMA 4C4AA 3LECA 3GRUA 3OZTA 5GWXA 4DA4A 2PGXA 1M6YA 4PIMA 4BLUA 2YXLA 5E8RA 5LQRA 4RTNA 5EIWA 5DXAA 2NP6A 3R0QA 3LDGA 3OU6A 3P9IA 1SG9A 3FPEA 2IGTA 3KQSA 5E9WA 3EEYA 1JTEA 4P7JA 3B5IA 5HZMA 2PBFA 4Y30A 2VDUE 1TW3A 4K6MA 4KWCA 1XVAA 3M6UA 3EMBA 2IH5A 3EPPA 4P7KA 2BR3A 2ZW9A 2G70A 1TPYA 3QV2A 4E2ZA 2CKDA 1EIZA 2NXJA 3O4FA 3FUXA 2OPBA 5CM2Z 3TR6A 3T7TA 2IDJA 2B9EA 2PT9A 2EG5A 4PYIA 4PYMA 3NTVA 4RX1A 5DSXA 3EVBA 4EK9A 4XUEA 3JWIA 3PS9A 3V8VA 4OX9Y 4GOLD 4GC5A 5HIJA 1WXWA 1YUBA 3CJRA 3CJQA 5DX8A 5K0FA 2AOXA 1ORHA 4XUDA 5CUQA 3T7SA 1FPQA 4KVZA 1NBIA 5T64A 3TLJA 3UFBA 1JG1A 5P8WA 1RI1A 3PFGA 3UA3A 5DTRA 1JQEA 3CGGA 5K0GA 5KVAA 2Z6QA 1ZHFA 3TMAA 2ZIFA 1JR4A 4QTTB 4PGGA 1RI4A 2PLWA 4GBED 1R00A 5E1OA 1MHTA 2ZWVA 2YXEA 3KPUA 3M6VA 5EZSA 3R9XB 5BW5A 1KR5A 3GRRA 4M7RA 4QDJA 1YFLA 1INLA 1XXLA 1G55A 1WXXA 3ID6C 4E2XA 3EVAA 5GP1A 5CVJA 4PCLA 1VLMA 2IIPA
chains in the Genus database with same CATH superfamily
4KR9A 4F8EA 4CW7A 1E99A 3TBHA 3ADBA 2DX7A 2DT8A 4NBWA 2DHCA 1ZD3A 3NJ8A 2DLCX 1YZVA 2VP5A 1KDPA 3MGBA 3IIIA 4JI7B 2HF7A 4P08A 2GKSA 1AN0A 4BMXA 3BGSA 2AFRA 3BFVA 1TNDA 2BAGA 2IUEA 1PD1A 1ZKDA 7REQB 3NMUF 2CLLB 1TD9A 3KUKA 4Y9TA 1BOOA 1Y6RA 2QUJA 4KQIA 1M0WA 4X7RA 5T4FA 1VMIA 2QE7A 2HWKA 3AZOA 5C52B 3I8OA 3C3BA 1AXGA 1JECA 4COOA 3UMJA 3VPAA 2J0UB 2ZIZA 4N5HX 4RQBA 1BEUB 5CLQA 2OUIA 3CZ5A 3EIWA 1WZUA 2EW1A 5BQOA 2R6ZA 5EMNA 4UCXA 3UUEA 1X1DA 1XYGA 2JW5A 3UNXA 1HDYA 1L4GA 4BE9A 2OCXA 4NH4A 1H2AS 4ZMRA 3KQPA 2APJA 3PTAA 1E79A 2IP4A 2NTVA 3FWYA 2HY7A 2ZI4A 3KQMA 1EHIA 5BOSB 2OECA 5E7MA 4US2R 2PS1A 2MYPA 5KYYA 4B6JA 4JR2A 5M7EA 3HJFA 4O8CA 1G5RA 5IANA 1TEXA 1VDZA 4G89A 1PEDA 4QXAA 1WKVA 1VCOA 1NLFA 1VPWA 1IHYA 4ID9A 5KQSA 4KR3A 1WQ4A 3A7DA 5IPFA 3RAFC 2RGBA 2JDIA 1LNSA 3PR1A 4QOEA 3Q8XB 2BFEB 5H0IA 2D1SA 3T1NA 3PFBA 3TECE 3CEJA 2ZRAA 3FUTA 1ZZGA 3SJZA 1QVRA 1O54A 5HPYB 3E8SA 3E4DA 5G3ZA 1RPZA 3SG0A 1HWYA 2WINI 3L43A 3IJRA 4BXOB 4DWJA 2GHTA 4F84A 4PBSA 1F0KA 2A67A 1WP4A 3F7NA 5CFNA 3EUWA 3JSAA 1QRDA 1WF6A 3CFYA 1WM1A 2I6TA 3I9FA 4K2AA 3QY9A 4GIBA 5ERXA 4C5AA 4KTVE 2C7QA 1N25A 1AMOA 1MGPA 3SCZA 3MWDB 3ZIAD 3QYFA 1GG2A 5IW8A 3DULA 2BM0A 4JYMA 1P60A 4RV4A 4RPLA 4WZAA 2PMEA 4ID3A 4BV2A 4DS3A 2VXYA 4Y0VA 5EE9A 4RA6B 4D9JA 5DT9A 2OESA 3HCAA 4KGDA 1YQUA 1D09A 2XT9A 5EE3A 4REMA 4ITVA 1WA5A 1H3NA 2PUVA 4TT3A 1IK6A 2XNDD 4JLAA 2GVZC 2R8XA 4MUIA 1PV2A 3HB5X 4QXRA 3FBGA 2PUEA 2P6RA 1H4TA 3AXTA 1NT2A 3HFRA 4MCIA 1N0HA 2QZZA 1P44A 1GARA 5HQ3A 2PH1A 1AUVA 1B6RA 1H2EA 2QTLA 3BWXA 3H2IA 4LA4A 1NAHA 3E0XA 5K2OA 4UZSA 4XYBA 4ZI7A 4IKEA 1NF3A 3C3EA 4I9FA 4JLNA 3O83A 4LE1A 3DBHB 4UHCA 4XAQA 4HD8A 1X87A 4X0EA 4WASA 1FDRA 2I6UA 2IHKA 1C9MA 1TW2A 4HZIA 3Q7IA 4EJSB 1QF7A 4FUTA 4BN5A 2ZJ6A 4DLZA 1JKFA 1I2ZA 1JXMA 3HKBB 1Q57A 1FLNA 3H9CA 3HLKA 1TZKA 2ORWA 4LWZA 1QQAA 4UM9D 2Y76A 2P5SA 4Q37A 5DNAA 4JI2B 3RRYA 3GPCA 3PPVA 2NU7A 4CM8B 1QIGA 4W5RA 4H6WA 3RSSA 2ZBUA 3BWMA 1E5XA 2XMCA 4PZYA 5AK6A 4AN4A 3OQVA 4D02A 3HWSA 5E9JA 3PITA 4JBIA 4P84A 3QXJA 2ZB8A 1E6KA 2OHFA 3TAXA 1EYZA 1D4AA 3R5FA 4YXWA 4HNGA 5HW0A 5JZOA 3B85A 2XZLA 4IKPA 3R0JA 2YZMA 2Y1EA 4MV9A 3JVDA 4Y6LA 2WP0A 4MWDA 4W5HA 5H80A 2E0IA 5C5DA 1ZVKA 5C4MA 2VDPB 3SWWA 4L8YA 2DPMA 4P4TA 1PJQA 2X3YA 1SIWA 2Z4SA 4JKYA 3OUUA 4HT3B 4C7OA 4J3FA 4OFBA 1KMNA 1X1QA 1DG3A 5LOVF 4OD0A 5SZHB 5GZ3A 1ES9A 4H35A 2D2IA 3E15A 3Q3CA 4LK2A 5ITZA 4ZV7A 4R2JA 3L01A 4QFCA 1A9RA 2UZ1B 3N0XA 5CVUA 1Z5WA 3U7EB 9MHTA 1SC3A 3SX4A 1NYTA 2HPZA 5B58T 3MMPA 3ROPA 1U31A 5JJLA 4P36A 2IOQA 4NE9A 1FU4A 1UZMA 3A4YA 3D8UA 3F67A 3LVBA 4NARA 4PM4A 4KFUA 3MCUA 4AO8A 1ODKA 1TKRA 1V25A 5IBQA 5I5GA 5KYGA 4DV7B 1WTCA 2L82A 1I36A 1AQIA 2ECFA 3FHOA 3EB9A 3I2FA 3KALA 4TTIA 1YTUA 1TJ3A 3EH1A 3UJ6A 3MWKA 5F51A 2QL6A 3PXBA 5HFAA 4U7HA 3R23A 4O2AF 3K2BA 4XM2A 4Z53A 2EX0A 1W85B 1Q74A 3U7JA 5ALEA 1LXCA 4OOEA 5IU6A 3JQAD 2ZULA 3HTXA 2BCEA 1FMFA 5TPWA 3A1NA 3OQ6A 1OLOA 1QAQA 4PSDA 4Q9IA 3ABSB 5HE9A 3R6DA 3PKIA 3GYGA 2OP0A 3A9WA 3DONA 4JS0A 3VGJA 4F21A 5BSEA 1QH1B 3NONA 1A7JA 5FOQA 1EZ4A 3SDBA 3P52A 3O8QB 3W2FA 2A9FA 1K0UA 1YI1A 1CUUA 5DCWA 3BKWA 3ITEA 1BEZA 4B7CA 3KL2A 4GYJA 3PC8C 4OM7A 3SIRA 3VSEA 3WGHA 2JCBA 5CGQB 3QI7A 4JI0B 3LNTA 4FN4A 4IBOA 5LQUA 1C1XA 1JA1A 5G4KB 3UT0A 1UJ5A 1QRRA 1SA0B 4ARVA 2IYYA 2JCXA 5IARA 5ALRA 2EHJA 5CXSA 1D2NA 1G59A 4RANA 1HZZA 3FY4A 2W6JA 4GKVA 3O1HB 3GT7A 5FHQA 2YN2A 1B8VA 2EX1A 5E2IA 2JHGA 5K3FA 5T4HA 5L45A 2GEDA 4W5JA 2F8TA 3KXDA 3A3NA 4RW0A 1BHQ1 1YR9A 1DELA 5ICFA 5J2TA 1SC1A 3JPYA 3E9RA 3LBAA 2VPWA 1FLDA 3O2SB 5KJ1A 3ADCA 1KMIY 4PO8A 1F48A 5C5CA 4K28A 3ROKA 4O4LF 3MXTA 3RC2A 1U4NA 4HXYA 1RYHA 3X1XA 4O3FA 2GLUA 1A9OA 2CUKA 4LS3A 4EOGA 1OPXA 4OHFA 1RJDA 3C3JA 4PZAA 4TMTA 2FF7A 1JPVA 2FQWA 3Q6NA 4QUKA 5ERYA 3OCZA 1WDLA 2Q1XA 2VZEA 1W94A 4BIMA 2XUIA 1R1DA 2C7BA 4IZOA 4E5SA 4L85A 2VTBB 3O8NA 4HGRA 2VHTA 3IQXA 2VPYA 4IW3B 3ZHUA 4BEVA 4W8GA 2GR9A 1CHDA 5DH9A 4CU5A 2I4MA 3G6WA 1WABA 2E3JA 3OBIA 4J94A 4GSKA 1BRTA 4OA5A 4DDTA 2B8EA 2FK7A 3ADDA 3BQNB 1QS0A 2FPPA 3A1CA 4S0ZA 3EXG2 3TL3A 4IYRA 3W9UA 1IRXA 1G9SA 1LLQA 2Q9CA 2Y0CA 3G8YA 2WAXA 1L5RA 1W49A 1GRQA 3H2SA 3DEJA 1XCBA 3JQFA 3P9SA 4ZYXA 5LD2C 2WA2A 2VWGA 1W47A 3MT7A 4KG7A 3GROA 1BG6A 3H2YA 3ZH9B 4DR3B 3IB3A 4LJSA 1Z4QA 2J46A 1RLJA 4FHFA 3SDSA 3O84A 4CIYA 5AQ1A 3AU9A 4TRMA 5LOVB 1OH5A 3CUEF 3IQHX 5CGZA 1VL0A 4HBZA 1G4AE 1C7IA 1X8JA 2XUQA 4I9GA 1ZH6A 5E3HA 1QYVA 2BLLA 2IOFA 4GNKA 4M1MA 4N47A 2EQ5A 3KPWA 3GZJA 3IV6A 1VP3A 3O3CA 4MYRA 2QK4A 5A4AA 4JT2A 4K0RA 4O4HA 4QECA 4B40A 5M34A 4RTJA 3DYBA 2I6GA 4DTIA 3D1LA 2GUWA 1EE2A 1C3OA 3FPHA 3D2LA 1L5OA 4I6EA 1RTKA 3HG7A 5JY1A 4DV0B 1RXUA 3O26A 5J2UF 2QLMA 3AERA 2O3SA 4EATA 5FBRB 4CJXA 4X61A 4L95C 5A03A 1K7CA 2BM8A 3HCPA 3B3AA 4BBJA 2YCBA 2A92A 1XROA 4KBGA 4Y2SA 5L7TA 2PAFA 1ZEJA 2OSBA 3IQFA 2OHOA 4FS3A 4QARA 4KOEC 1F12A 2X86A 2YNMA 4WN9B 5KZMB 1NASA 4GMFA 3CRQA 3C3WA 4IHAA 4KK3A 3C1AA 5GONB 4TRJA 4N0DA 3IDOA 3S7ZA 1PKEA 4YBZA 1SKBA 5CFOA 1TZJA 4DA6A 3G9TA 4P6VF 1PS8A 4C7MA 2PJRA 3WLQA 3U7IA 1JIUA 2REQA 1ONPA 4XKJA 1SKQA 2PHZA 1FRNA 1T1SA 1RQ7A 3C14C 5FPYA 3H9GA 3CT4A 1UFQA 2JIPA 5I7WA 3RYTC 2CHGA 1KNXA 1YL7A 1COWD 1NU8A 3ZW9A 4BKOA 2REBA 4UBOA 1DJOA 2YHBA 5A9TA 3BFKA 2CZCA 2XA1A 3PZBA 3M3PA 4LN1A 4MUKA 1K97A 3WBKA 4WZBE 1JXAA 2O8VA 3HY3A 3IRUA 4MWEA 2IKQA 4CR7A 5CA1B 2GB4A 3WGGA 2HJWA 2HPAA 2QG6A 4EL0A 2PUBA 2FX3A 2IOFK 3TZEA 3U81A 4CKCA 5KI6A 1MU0A 1MT0A 4RQTA 3TOXA 2IIVA 2ZI9A 3A4TA 4FYYA 4FBMA 4KSYA 1XRPA 2QORA 3HLTA 4HNQA 5BRNA 5AMXA 4CF3A 3OIUA 3GT3A 4GMGA 5DHFA 3OQ1A 1OWLA 4F4UA 4HPWA 2DR3A 2ORED 2B1RA 2I55A 1ARZA 1DAMA 1SCBA 4UBKA 1H2HA 3D8HA 4XW2A 3DT9A 2WIKA 3UWMA 3EFOB 1U9YA 1W2HA 4ADSG 3A7EA 1QCCA 1YXMA 3KLBA 3LC1O 3R0XA 1SXJA 2DSNA 2ZB3A 4UHHA 2GZ1A 2GAJA 3J80A 1RLUA 1GAXA 1OI4A 4Y7CA 1PLKA 5KHAA 3HKDB 4X1YA 4Y67A 4KIUA 3I0MA 3LD9A 4RTOA 4KQKA 3VDQA 3WQHA 2V6FA 2AXNA 1J23A 3SOZA 2YX1A 3O91A 1W19A 1JAIA 2RJ3A 3EMDA 1XJ5A 4YQZA 3GMTA 5ALOA 3ZTYA 4S05A 1P7CA 2ISSD 2QN7A 4X20A 4LVOA 5JAPA 1TT7A 5K7SA 2Y1DA 3EXHB 3NHBA 2XYQA 4PYLA 3HDTA 4ZCIA 5F4BA 2J5BA 1P7WA 4RSRA 3E70C 4M7WA 1FXWF 5DCLA 1CLUA 5G3YA 3LG2A 3CSUA 4U3JB 3OF3A 3VFDA 5CVVA 4KZKA 3PB3A 1QHNA 1K3TA 4YCBA 2P3SA 1W4AA 2WUGA 3OWXA 1G17A 2V5VA 4DG9A 3EZLA 4HDAA 2M1XA 4C0SA 1DUSA 1R8SA 4C4XA 3UC9A 1E3JA 2BW0A 4GRDA 3BRSA 3QI2A 4S35A 4BNXA 2YYAA 2Y1FA 4ZKDA 1Z7GA 2VZ8A 1HRKA 1IBSA 2BY4A 5FV7A 5DTJA 1QFSA 1KWKA 2UKDA 3D7MA 3DKPA 4MR7B 3EISA 3DVRX 5AJHA 4NR0A 4UEJA 1OKKD 3L6UA 2RH8A 2QUBA 4B4OA 4P3KA 3IXLA 3UMCA 2ONKA 3SS8A 5FLXA 1IY9A 3N6RA 4MV8A 2QMZA 3KYJB 4S1NA 2TS1A 5DTMA 2ORVA 1BFUA 1XNJA 3RU9A 4L07A 1E5VA 3PI7A 3OZTA 4Y2UA 4E15A 4EDHA 1THGA 3W3AA 1L5QA 1BRMA 5LQRA 1EA7A 4G4GA 3IDZA 4EI8A 2NU9B 3IAFA 5AI6A 1W0KD 3B7GA 3KL4A 2DY0A 3AP1A 1WXFA 3FPEA 4MPTA 3UXYA 3U4QA 3KJNA 1OAKA 5C32A 4ZJYA 2NZ8A 1N1DA 2F9MA 2O52A 2PU5A 4BX0A 4UEWA 5H4GA 2AMLA 3ND7A 3ZZMA 5CT4A 4CM4A 2I78A 3KB6A 2FR0A 5AW7A 3UAXA 3OTIA 2GTHA 1S01A 2K2QB 5HUHA 1BOFA 2I1LA 3GI1A 3PWSA 1ZY2A 5KX5A 4WOBA 4FCCA 5A5GA 3ISJA 5B2EA 1T0UA 3MW8A 3RSLA 5LNK6 1KRHA 4PYIA 4BJ1A 4MQLA 4EVQA 3I9LA 4UFOA 4KREA 4R16A 4EK9A 3U6KA 3EVNA 3PS9A 2ZRBA 3ITDA 3M6FA 3QPAA 3AI7A 3M9LA 4MV1A 5CYOA 7REQA 2ZB4A 3CJQA 2XQGA 3RVQA 4CIDA 3U39A 1AUPA 1G7TA 3LVQE 2ZTMA 3JZMA 5AW2A 4FZJA 3WB9A 1NNI1 3HMQA 4M0LA 1RI1A 1EFVA 4AG6A 1H1LB 3CGGA 3NQ41 4M1ZA 1Y5RA 5K0GA 2VJCA 3UK2A 2OK7A 4K81B 3W5CA 3MB8A 3EZGA 1CRWG 4PGGA 2XUHA 1WVMA 1YRBA 2J3EA 3ASUA 3SF8B 1OT5A 5LBUA 2ZWVA 2YXEA 2VJBA 4ARBA 3NM5A 1AZSC 3W1EA 3DEIA 3GRRA 1X92A 2ACVA 3QF4A 1B93A 2Y9MB 3RDPA 4FOPA 4Z4EA 2INGX 4Z9YA 2V8BA 2ATIA 3MMXA 1MEJA 2GPNA 3VQTA 1AQNA 4IIYA 3REGA 4G5OA 4QOSA 2AR7A 2BFBB 3DYIA 4MW6A 2VYCA 4GP6A 4ED9A 5K8LA 3QE2A 3ZD9A 2AQ8A 2LWIA 2WQZA 3N8IA 3UW1A 2IS2A 4O4IF 2IYRA 4P33A 2DQZA 4C4SA 2W6OA 2VR1A 2VT2A 2VP0A 2Q07A 5EJ4A 2PX5A 2QLLA 3OQBA 2NIPA 4Z3KA 4R1QA 4TGLA 1K7FB 2FDRA 4ECAA 1EGMB 1M2NA 2A84A 4GE3A 3RVPA 1R88A 1ZNYA 5BR8B 1GUFA 4H3VA 4Q82A 3GMDA 3PUHA 1LDYA 1DI0A 2GASA 3FW1A 3HY4A 1I1HA 3ONDA 1U0FA 1ULUA 2DJIA 2DLDA 4AZSA 3UHJA 3V1NA 1E1DA 3KTOA 3EG5A 5ESWA 5KVVA 5TDHA 2XUJA 1AK1A 1TK9A 3FJYA 4GPTA 2QAGC 1IHPA 3VYVA 3LDAA 1FJ2A 1FFDA 2ET6A 3C6YA 5JQGB 1MW8X 2OGZA 1IVYA 4TWRA 5G1OA 4KCGA 3UGTA 4EX6A 1RPJA 1JILA 2XIQA 1QIDA 4B8YA 4R9RA 1KYZA 2FE4A 4BX9A 2XDYA 1EHCA 3VNQA 3VM6A 2C5BA 2AXEA 1USUA 4IRXA 4A73A 4PRKA 4IDPA 4M88A 1ECJA 2XMDA 3RUHA 1JEEA 1W4CA 1P4JA 1D2AA 2XB2A 5HP4A 1XRMA 1V4NA 4L4SA 5EYPA 3RHTA 3SXUB 3WDKA 4QVIA 3OZXA 3IP9A 1GZ3A 2OKCA 1AQYA 4FYKA 1V8PA 1YQTA 1OV6A 1ITZA 1GITA 3P9RA 4CCYB 3PUXA 3ZW8A 3THXB 2ZJ3A 2AJDA 5G1PA 1VCIA 2ILVA 1QF6A 2MSEB 1ZOIA 1TADA 3ADKA 4WEQA 1QPBA 2DLNA 2HLHA 3UMRA 1QOZA 5DHQA 5IWCA 1J5PA 4U5XA 5CTAA 2H85A 4QJ3A 1P91A 3OFND 5THKA 3NYWA 3PHJA 2XKAA 2OBYA 3JAMA 4N41A 1R4MB 1N2OA 1NBMA 4R69A 3M2PA 2EYQA 5CM8B 2ODNA 4OUDB 1UPUA 4C0WA 4W1SA 2JLWA 2FR8C 4LC1A 1HETA 5C2JB 3KLOA 3DWIA 3DJFA 3EZNA 3WGYA 2IPMA 4KBFA 4HJRA 3M33A 4XJTA 4I1IA 5ILGA 5DNDA 1HQKA 1KY3A 2R47A 1UBUS 2YBEA 3E3OA 3FPSA 3IVAA 3OEWA 4MCJA 4ZP1A 4ZT6A 3VUFA 1CEQA 4F3NA 2QI9F 5B5SA 5JISA 1DC8A 3EEQA 1W6UA 2Q6OA 2VHUA 2QUAA 4LYHA 5AHKA 4EGCB 5ICGA 4L9SA 4MS4B 1NBMD 4LV8B 3ZKWB 3UH1A 1WAMA 3RYCA 2AJLI 1TA9A 5COBA 4TQAA 1DQSA 5JAIA 4M36A 2YICA 3FYUC 4RPGA 3OZFA 1I7DA 1Y1QA 1FQOA 3LF2A 3R3UA 1XN1A 5A6SA 4GZLA 4H16A 3F8TA 2Z58A 3LDUA 3WWDA 5H8WA 2X0DA 1ETUA 2GKOA 1Z07A 1W36B 3JTMA 1U7UA 1RAIA 1K0FA 3KJHA 3TVTA 3HKCB 1SCDA 2B21A 1E7YA 4QQ8A 3GLHB 2PZMA 4URFA 3WGLA 1RAEA 3LP5A 2HWUA 4BMZA 3VMMA 3DCNA 3WQBA 4H0FA 3CEMA 4CEJA 2Z4TA 3LK7A 1XL0A 3PA6A 3F98A 5JSQA 2IZ1A 3GRYA 2IX9A 5AUOB 4R31A 3S0JA 1IWOA 1E2GA 3NAZA 3TTVA 1FRQA 4GXRA 3VU9B 2WU4A 3MS2A 3ZCQA 3U44B 2P9ZA 3CIFA 1HEUA 2ABWA 4NV3A 2C5AA 1YT5A 2D7CA 5IF3A 3B13B 1NVWQ 4BB5A 4D96A 4M38A 3E9YA 3CZ4A 3E9MA 2D2VA 3OLXA 3VV2A 3NBAA 1X3SA 1U8TA 2AYZA 4IUYA 4PNZA 4FXPA 4QASA 5JMPA 3AONB 3PC3A 3DE6X 1U3FA 3UW3A 4DPKA 4YCNA 5L8VA 2B34A 2E82A 5IDWA 1J9ZA 1NQUA 2R7LA 1WMSA 3AUJB 3DT8A 4OQ4A 4YA6A 4OATA 5DNUA 4EVRA 1FU7A 1LBHA 4HZUB 5A9SB 2FR1A 3COWA 3KBOA 3NEAA 1K27A 4GVXA 3DZIA 3UTDA 5LPNA 1ISIA 3ZJUA 4OQQA 2Q1YA 2VDLB 4C7XA 4N9QA 3PI6A 4KV7A 3RFTA 3KZNA 3PEFA 3H97A 4R71A 5C7LO 2Q7XA 1NX9A 3KTFA 2P1ZA 2Q3DA 4RIIA 5ALMA 3U7QA 2E21A 3QNWA 4G5RA 3KQHA 1IE3A 4RF5A 4ZO8A 4IWYA 2C2OA 3HWRA 1PFWA 3IO5A 1DGQA 2I33A 2YRWA 1O6FA 1IJBA 4OKSA 4RJJA 3DCIA 5FA8A 3GIWA 2AYYA 2HX1A 3ANMA 1MEEA 2CLEB 3TS1A 1PTJC 2VI5A 1Z4IA 4JFAA 1QTRA 3P0JA 1MOQA 4FZ3A 4A2WA 2AXPA 1TU3A 2H2AA 1IN4A 4FWIB 4Q1DA 1A96A 4KQ1A 4RL4A 2XYHA 2CHUA 3JYPA 1GCAA 1VLZA 1I5EA 2HIAA 2V6GA 3MGAA 2ODTX 4CNQA 5IEJA 2PSHA 4TV9B 3CF4G 2QDKA 3FD8A 1RWOA 4IWNA 4IICA 4II2A 5AM1A 4AJ9A 2D2EA 1CS4C 1QGAA 2GSWA 2FRDC 2NTEA 1NSFA 2P8SA 2O8BA 4QTZA 3D6UA 3U09A 2AW3A 1WQ3A 1DXHA 3NYIA 4C4RA 3IR6A 3OO0A 1OX6A 3UJPA 4C4YA 2QP4A 4UZFA 2XZDA 3E9EA 4TLLB 2GEFA 5BYBA 1PZMA 2NTJA 4EPXA 2GXAA 3TNFA 4BMOB 1QH1A 3MILA 2XTJA 5MDHA 2IZZA 4ZQBA 3T34A 4LAFA 3TLXA 3AOEC 5FPPA 5D8DA 3D3JA 2QVYX 2R1VA 1C9DB 3PHIA 2KB0A 2JCYA 2HMYB 3WMWA 3O38A 4ZT5A 3GRVA 4DIFA 5CBKA 4LJYA 1W8IA 5E2AA 2GPJA 3VO1A 3TRIA 5IXJA 2BKXA 1C41A 2C99A 2F90A 3KE9A 2PGIA 3OOWA 4TRRA 4CQMD 2XQFA 1PWXA 3ECCA 1RLTA 4ZYTA 5F98A 4MLZA 3GEHA 1Q50A 4ZO9A 1E2PA 1WE2A 5EQFA 3C1UA 3QFFA 1H2FA 3PNYA 2WOJA 4KFRA 5FOTA 1BD3A 2Z5LA 2JK1A 2ZSBA 4QUJA 3TSWA 3HYSA 4HLQB 1E7RA 3OAAD 4QBFA 5A02A 4CLRB 4NAHA 1ZRSA 4DWVA 5JBIA 2JH3A 3CISA 3OZIA 4O4HB 2OV3A 3EY9A 1TF5A 2XUAA 3OESA 3PUZA 1ULBA 2D59A 4QAJA 4WAUA 2RHOA 1O6CA 3TW8A 2XRZA 4CT4B 3NRJA 1DIHA 2JAUA 1Y42X 4QGHA 1F4LA 3THWA 1KH3A 4HHEA 3A1EA 1XZPA 3U1VA 4C3OB 2ZCJA 1E4OA 1H9AA 4IVPA 4YP5A 4BNNA 2PMDA 2PWBA 4H7DA 2W48A 4KWTA 1XDSA 4DSNA 2FHPA 3ZDDA 1LA2A 4HLDA 1ZVVA 1KIMA 4MW5A 4QOIA 3S3TA 4D8WA 2EERA 5LUAA 2J5RA 3T4UA 4WBNF 1GUZA 3G7UA 1VMAA 3PQ8A 4QC2A 1J9GA 3A27A 3NBZC 1JR6A 4R0NA 4XARA 1V1JA 4FKBA 2M6KA 1L4MA 1NM5A 2HEIA 2JLZA 4EHFA 3IP1A 2G88A 1V5WA 4GBMA 4RZUA 3GVPA 4AD8A 5IVPA 1XDBA 2QVGA 5C1IA 3BE4A 3HACA 3R7DA 1HLPA 5U9CA 1I8TA 1HE5A 3H6GA 4UOQA 4BOYA 1O03A 1WTAA 3AFNA 3G2HA 3UK7A 4NZNA 2WUDA 3QHQA 4I6GA 1UFVA 1M34B 3ORHA 1O58A 3NT4A 4LY6A 4Y2YA 1L4FA 3ESCA 3GXOA 4HFRA 4CMGA 2WU8A 1Z29A 5E6RB 3GNTA 3HC7A 2RBKA 5DNVA 3SNHA 4CF5A 5TB5A 3RSHA 2PL5A 1IG0A 1H5NA 1HYBA 1M2OA 1IJEA 4MTLA 5EJ5A 2H1FA 3TZKA 3GA5A 4AUEA 3SVLA 3F0TA 1S2NA 3EZFA 3FCCA 3FJ1A 4Q48A 2CL7X 1AMNA 3AR6A 1MJGA 1Y8ZA 1FDUA 1FNBA 1O9HA 2WYOA 2CWDA 3ANTA 4JKIA 4LOJA 2H1WA 1XJWA 3FVRA 5BV2P 4HH1A 1WCIB 1RWVA 1I6MA 2G9UA 3L0DA 3QVXA 4NENA 3B1ZA 4MGEA 3I5YA 3EWAA 3VKGA 1UBCA 3PK0A 4RY8A 4IXWA 1ZBDA 1EE9A 1QNFA 4D45A 3NAQA 5AD1A 1NP6A 1SHUX 4ZGGA 3DNPA 1JEYB 3BMOA 4CM9D 5AKYA 1MCZA 3R3VA 4Z0PA 1ONNA 3T1OA 3ORYA 4RNCA 3QEKA 5ALQA 4DF3A 4MRNA 4LC0A 1TT5A 3ZCVA 4JJEA 4HMQA 5THXA 2VJQA 4M0CA 4NRDA 2ZRNA 4DC1A 4H3SA 1ZA1A 3TXYA 1L3IA 1ZUNA 1WKBA 3CKKA 4GBJA 1P31A 1VJRA 3F49S 5GJBA 1BH2A 2B4AA 4OAQA 5C81A 4WQMA 3RK1A 1ZEMA 4WFKA 1EFPA 1S7GA 3MHTA 3CJTA 4LNHA 2C88A 4CU2A 4B87A 1F9AA 5KTYA 2QGFA 2IU6A 3T7DA 3ZWDA 2X4IA 2W6IA 4KR2A 4W5OA 2WTXA 1O8BA 2CFOA 4D4MA 4EPTA 2VQ3A 3A9CA 4K6CA 1EZZA 1SCUB 3NWPA 5EI5A 4TTQA 3RTDA 3OKPA 3V8RA 1AKQA 4XVQA 1R2QA 1QQ7A 3FXAA 1UMBB 3IUEA 5KTRA 3FTCA 3M5WA 4YJHA 3CUVA 1SBNE 3FOFC 3RRNA 2NT4A 1UXGA 4N82A 2FMKA 2B35A 1IDN1 4RZ3A 2WT9A 4HDRA 3T9DA 4DZRA 5JXJA 4OQPA 3GHHA 3RUCA 4PZDA 2BHSA 4WV3A 1AS3A 2FZCA 2A86A 2OXRA 2DAPA 1BJTA 2V45A 3NVMB 4X60A 4MDEA 1TQ4A 1UP4A 1QLWA 4RK6A 1J5XA 3GGGA 2WEKA 1JR2A 5DM70 2J3HA 3ZNQA 2RJOA 1U7WA 1ZM3A 1RD4A 1KI8A 1X7WB 2NZJA 4LRYA 1CS0A 1DPGA 1MJ5A 5FT9A 2WY2D 1VHLA 4Y8VA 3JRXA 3D1VA 4UEQA 3S1AA 5IUJC 2JJ1D 1FCJA 2RFLA 2FSVC 2GT1A 3B6EA 3AUFA 3Q5DA 4NDAA 5FDFA 2EBHX 3ER9A 1NQ5A 4BP1A 2LD4A 4ZT3A 3Q3GE 1P6QA 4H7JA 2EZ9A 4PAMA 2VL7A 4UFNA 4FGKA 1GXSB 2PA0A 4TL9A 1GFIA 1PZGA 3VHLB 5MFZA 3M0EA 4BP3A 5EVJA 5L9AA 5H81A 2Y0DA 5JAHA 2ARKA 2OD7A 4CKXA 1OXSC 2UVPB 3AF2A 4W5QA 2QIPA 1DP4A 2R79A 4G5SA 4G85A 1N5JA 5EP2A 1AA6A 2YZ7A 1U8UA 1TI7A 3I92A 3FTQA 1GAEO 2OGSA 1R7RA 2PYDA 4NOLA 4JJIA 1LK0A 2A5FA 2R7AA 2A5LA 4R84A 2H1OA 4HATA 1QR6A 1FUIA 1QYWA 4RH3A 5THQA 8LDHA 3E9CA 2VQFB 2DFKB 4ES6A 2A3NA 2OK8A 3VKHA 3NBXX 2GDZA 2FI1A 4DPMA 1H94A 4I5EA 3MGGA 2ZZNA 1KQOA 1SU4A 1W8DA 1JUDA 3DH0A 3S27A 4ZTBA 5BW4A 3L7JA 1GDHA 3B20A 3TUJC 3EEOA 4FGWA 1CB0A 2HFKA 1J2TA 3JTEA 4JZYA 2GBFA 2P6PA 3VRHA 2A0FA 2CDCA 3JAWA 1S3SA 3AI1A 1XEXA 3OIGA 1S7CA 2V96A 4PX2A 2XZOA 4JB2A 4QGFA 4KWIA 4YAIA 2BOVA 2QAIA 2QLFA 1R0WA 2XWPA 4I5IA 5I6DA 4FFDA 2EBUA 4YRFA 4MROA 5JCPA 4ZN6A 4FOLA 4WE3A 4BJ3A 5JNRA 3GJ8A 3FGOA 3OU6A 3C4VA 1NN0A 2XTAA 1GJRA 1T36B 2XEDA 3ENVA 3TZHA 2WJ3A 4OFXA 4O5OA 5BUZA 1FU8A 1SUDA 2R25B 4XR9A 4G0PA 3JQRA 4NK4A 3RT9A 4KPFC 1XZMA 4BCBA 4FDTA 3S6JA 3DZKA 3DVQX 3ROXA 1UQTA 3PE6A 1ZH2A 4XTCS 2E4WA 4EEZA 1U0BB 4IIEA 1KIFA 1E9SA 3PXAA 2DCMA 3NRBA 5JNUA 1TJNA 2H4HA 3V55A 4R7ZA 4RJTA 3TUZC 1E66A 3NTVA 1P8AA 3D8TA 1F2TB 2CZGA 1BQ4A 3ADPA 3KC2A 2HKIA 3SBXA 2O50A 2BEKA 2VQDA 1HSOA 4YMIA 3W5IA 3TNYA 3REQB 4F8JA 2BM1A 4KVZA 3WE7A 3DE3X 1JG1A 5HF9A 4OMUA 2I67A 3A28A 3GRCA 5F7XA 5IAGA 2JA2A 4AJ1A 1P33A 3M89A 2B83A 4WZBA 2HQ1A 3MYRA 4Y1FA 1NJ1A 1EQUA 2FQQA 3KEQA 4RE6A 2BBSA 2DBVO 1H6AA 1WMDA 1JR4A 2C84A 2ZIFA 3TMAA 5KKCA 3PNOA 4IFEA 3UYKA 3L92A 4RMHA 1W5AA 1DAPA 3NKFA 1PL0A 2YH2A 4Z4GA 4OGFA 2QM0A 3H1PA 4Q24A 3DB2A 1C7FA 2JBHA 3ID6C 1LX7A 4GMHA 3SC6A 1CU1A 2V6BA 4ZOBA 3OU2A 1GPLA 2WSIA 3CRMA 4V3CA 3H2KA 3QE9Y 3R3JA 1Y3DE 2ZRGA 1EH5A 1N7GA 3IHTA 4HUQB 3ESRA 4JL6A 4HWGA 4F7DA 2DUUA 1YDGA 2JEOA 4NAUA 2XT6A 1A7AA 4DUZB 1EKXA 4L4ZA 4KUEA 2VTBA 5CEFA 3NWEA 1RXSA 4G97A 4DAOA 5DOVA 2QGZA 3HV0A 5B3JC 3JZIA 3U3OA 1A2QA 4QUEA 3CKYA 2NU8B 4BUJA 1Z6AA 4I9HA 5F52A 3SJBA 4RXMA 4JOQA 4ZAVA 2IH4A 3RO7A 3VPDA 2DBQA 4WFIA 4FVTA 2WJ4A 4HBGA 1TKAA 2XV1A 1GM5A 2MIIA 5F12A 4A3SA 3EDRA 4N48A 3GR6A 1CDZA 2HBQA 2LDBA 2QMOA 4FEEA 3VGPA 2R8PA 3WWPA 1P0FA 2Q5OA 4RADA 3AP2A 1AK2A 1FFEA 3B60A 3LUCA 5KSWB 1EP1B 1XVLA 1O96B 3HKEA 4BVHA 5L4NA 1M67A 4BU1A 3OP4A 4LECA 2QP3A 1AUQA 2J6HA 2H1HA 3QJ5A 4BIIA 3FRJA 5FWXB 4PG4A 1ECPA 1RM3A 1KEWA 3RGWS 3MLAA 2EP5A 1MABB 3ANXA 1K88A 1OZAA 3K30A 3AI3A 1CG6A 3BTUA 4LSMA 2OCDA 1XZNA 3GGCA 1LPOA 3ETNA 4AG5A 5IX8A 2OWDA 3QVGB 2CBGA 2A9RA 4JJZA 3ZHQA 1XMJA 4KQ6A 1YDWA 3QU9A 1T26A 1BE6A 3GBVA 4NZPA 4WESA 3AZQA 3RK0A 1SHLA 2PXHA 3I73A 1Y9ZA 1ZIYA 3P2EA 5B6PA 3RFFA 4BZQA 1UAYA 3WLTA 3RV3A 3QM1A 3SE7A 1EDZA 5AKZA 3V4VB 3QLVA 2IBSA 2FP4B 4GQAA 1IPFA 1FYEA 2XLBA 1Z7WA 3LSTA 3ZNPA 2ZYDA 5DBFA 1Q1QA 3BIOA 3BERA 1G8KA 2R66A 3ZE2B 2O8FB 1ESMA 3DVAB 1QIJA 1AKVA 4X1KA 2ZB7A 3SFTA 4TYNA 4JQCA 1BDIA 1C7ZA 2ZWAA 1VXRA 4UVEA 4MR9A 4PPQA 4TKMA 4CCSA 4D42A 1XCOA 3FWNA 4IJMA 3WHPA 4F12A 3ANLA 1K86A 2AI3A 1EEXB 4U39A 1VMKA 5J40A 4WGFA 2QYSA 1SVNA 4PR0A 4G41A 3UGQA 3R76A 5LP1A 1V5FA 3AG6A 4BFYA 4DCGA 4CMIB 2XAUA 4YRCA 3F9RA 2KM1A 4EGJA 3E18A 3N8HA 4G09A 3UBTA 4OX9B 4J0HA 2XWSA 4OQDA 2C8VA 3N3AC 2ODPA 4A2CA 3WWOA 3DAOA 1KNQA 2NSJA 3GMIA 2NW6A 3GEPA 3L6RA 3C5WP 4DZZA 2DECA 3KB1A 4A0FA 3H7AA 2PCLA 3O8DA 4CDRA 4H4EA 2J5QA 4GLBA 3UJAA 1MUUA 2ZBPA 2YMLA 4TRNA 2Z1MA 3B2EA 4LGMA 3ZIAA 3PDUA 3GT4A 4BO8A 2WJPA 3SGLA 1M54A 3GJ7A 2WPDA 3IBCA 1CQZA 2PBRA 5JFTA 1ZFNA 3M6IA 4KXQA 1ADFA 4W7IA 4EFDA 4Z3DA 3RREA 3THYB 2GZMA 3T5BA 3NC1C 1LBSA 1L7BA 3EVZA 4MKRA 4YR7A 4RD0A 1JR3E 4TSKA 2PS3A 3T95A 1L5WA 4TKUB 3M6MD 1QV9A 3E9DA 2F1KA 2HJHA 2XKJE 4TXMA 3THRA 4AN0A 4G2NA 4KK4A 1GR0A 3LBHA 2R6JA 2B4RO 1TC1A 1ST2A 2KSQA 3JVIA 5K45A 4LYGA 4LRWA 4EQ6B 5JNVA 1B0ZA 5EWLA 1QONA 4WBNB 2YNMD 3PGKA 3WS7A 2GN8A 4A0QA 3HXLA 3K8YA 3L7DA 2BCJQ 1LLUA 1EP3B 3HKCA 1AMUA 3HJBA 4DR2B 1LBTA 1ADYA 1OGIA 1T4BA 1E0KA 3O8OB 1WXQA 4W4TA 1GQYA 2BKUA 2FDCA 2SKCA 3TRDA 1ZXLA 2NZ2A 3C45A 2OAP1 3DL2A 2IU3A 4RYLA 4RWZA 2VBGA 4HWOA 1AG9A 5FL7A 2ZSKA 5IABA 3IVXA 1KPIA 2XAAA 4WMLA 5BWBA 5CB4B 3PIIA 3A2KA 2O1EA 3I9JA 4WUVA 1KC3A 1LB1B 1BS2A 1CQWA 1Z38A 4EEXA 3DO6A 3GW8A 2FEKA 2WC1A 1PL6A 3C7CB 3QU4A 5JWHA 1N5IA 2YWEA 3KOMA 3RRXA 4UFPA 2VK2A 4D3ZA 4IH4A 3QF4B 4EB3A 3SZOA 4NTZA 9ATCA 4E2WA 3K70C 2VDNB 4FR5A 3PBKA 3DGEC 2OM2A 1D6MA 1Q17A 1OFUX 1ZM4A 1Y1RA 1GTZA 5I7UA 5EJAA 1EFRA 1KPGA 2EATA 1UBGA 4KPUB 1DVRA 1R6VA 1T3GA 1N7IA 2FVXA 2SBTA 4EJ2A 1WR8A 2EJVA 1QE3A 1Z82A 1K4MA 2BHNA 4ZCMA 3DTVA 3IBSA 3VOBA 4JLBA 5FUYA 2BFAA 2R6DA 3CMMA 1N2IA 4M76B 1SVUA 3KYBA 2QD2A 3GRKA 2B0JA 4M0PA 5AIBA 3JYHA 4ZOQI 1N8NA 3ABZA 3QITA 4AQDA 5EHIA 2QGNA 1H8HD 1GZ7A 2WNIA 1SBZA 1JKJB 3GGOA 4EA8A 1JPNA 1GG5A 3GA0A 4J9UE 4JHXA 1YB2A 1C9KA 4UMEA 1PR6A 1KI9A 2BMJA 1NT4A 1WXHA 3FDZB 4Y2PA 3USZA 3ZHOA 1UT5A 1C8BA 2ZIWB 1P9WA 5T8KC 2GXQA 1UBKS 1UXOA 4JJ7A 2PU7A 4OI2A 5FWNA 1T4DA 5KQLA 3FSJX 4K6KA 5CLLA 2KYRA 1BE1A 5KU7A 4M89A 4CKBB 1ODSA 1Y5NA 2VJDA 1A8SA 1SB9A 1X7ZA 2DFDA 2W2KA 2WWRA 4R1NA 1KYIA 2QVXX 5G53C 1H85A 3LKZA 5CEJA 2GPBA 3KJQA 2C83A 3PDWA 2W98A 1G8HA 1ZIPA 2XE6A 4PG6A 1K1EA 3TR0A 1M1UA 3A3KA 4QGGA 4EJ6A 3MSCA 1NVGA 2WF6A 2YWFA 3T35A 3S55A 3LA8A 1NW3A 2BGNA 2XI4A 3PQEA 5E6RA 1ZQ9A 1UDWA 2NQ8A 4UJ5A 2OV4A 1L7PA 4JQYA 5GJWC 4IV0A 4HWPA 4A5OA 2QY9A 13PKA 1U2PA 5F2OA 1G3UA 3S99A 1NXSA 1MB2A 3LHKA 3QIAA 1GYPA 2WHRA 5IDXA 4L0QA 4I3HA 2PUFA 3R3XA 3E7WA 3L8DA 5K0ZA 1UMKA 1ZK3A 2PEZA 3OECA 3WJ1A 2NVUA 5LP6A 3WGKA 1F7VA 4FDAA 2FN7A 4A6EA 3UAWA 3G17A 5JQWA 1SCJA 5T4EA 5JFOA 4YUVA 1DQZA 3OD5A 2Q3FA 2IYFA 3TTUA 4CN8A 4B0PA 1O7JA 2FLVA 3ENWA 2Q5HA 2VTKA 4RFVA 4J4BA 2B1GA 1B1AA 3HR8A 4FTWA 4LOHA 3MLBA 3M7IA 5IT9A 2ZATA 4MHOA 3SYMA 3U3ZA 1XAIA 2C59A 1Z5ZA 4G4SO 4NI5A 2H29A 4D9MA 2A78A 4YRAA 5K6AA 3PEYA 2E37A 1HL3A 4OYYA 2QTRA 3MUNA 4LRTB 3IAM1 4PHCA 4JASB 5AKLA 1WNTA 4U7PB 3JQAA 4PE5B 3ZV7A 1JHYA 2BTOA 1PJZA 1M6VA 3FYDA 4M7OA 3MMZA 4P35A 1N3BA 4QBTA 4BGEA 4XWTA 1X86B 3A4NA 2X8LA 1CIPA 3DAPA 1NXWA 5KEIA 4OQYA 2QRJA 4R6XA 3ZCPA 2JZOA 3M4YA 4OO3A 3HO1A 5HA5A 1OFIA 4OI0A 4HDKA 1UXKA 1H8EA 3RHSA 1O94C 4CUKA 2V9PA 3LXMA 2F1OA 4CMBA 3VNAA 4V1CB 3C7KA 5ECYA 1X2EA 4X8OA 2IRWA 3L1KA 4FB5A 1I3CA 5AM2A 2VJPA 4RHEA 1L5NA 1VXOA 3OE5A 3X3HA 1ZK2A 4ENSA 3WMXA 1H23A 1VE5A 2PA3A 4OG2A 4PBRA 3U3KA 2YJGA 2I2DA 2WT4A 5BNWA 1GLNA 1G8YA 2ERYA 3MM4A 3URKA 3DE5X 3FCEA 3RF6A 3R20A 3AVUA 1B00A 3PHBE 1CCWA 2B94A 5HDBB 3G1TA 3EFBA 3M6LA 1WY7A 4HX9A 3SI7A 4DADA 3SVTA 4CETA 1EXDA 1C3VA 2ZZKA 1LDGA 5C7YA 2IYAA 5B53A 1II0A 3WJ2A 4LBYA 3Q6IA 3IVCA 4LDNA 2PKRA 3R40A 3OOJA 1QDLB 1HT1E 1WXIA 4TPKA 4KFCA 5KWVA 2FPLA 1QO0D 3OJ0A 4FZVA 1X80B 4LHSA 2VDKB 3AT1A 1KTIA 3IALA 1N5OX 5AXAA 3U61B 4EP1A 2HA2A 4QWMA 1VIMA 4R40A 1L5SA 1TCUA 2C3OA 3EX7C 3PDIA 2YJZA 1E9VA 3DLCA 4RIHA 1UFOA 3CX8A 3KPYA 3U5ZB 3VNVA 3T06B 3UICA 2NO1A 4DCTA 3NC0C 2YJ3A 1GQSA 3OFJA 2WWTA 1MO4A 3FOCA 2IPAB 1X7XB 1PYOA 4YJFB 2O8EB 1DEOA 3HPQA 3M6WA 3TE7A 5JDCA 1B2LA 1CQJA 1OWPA 2XF2A 2ZU0C 3HB4X 4JI1B 3V46A 4HZUA 4DMGA 5JNLA 3DUFA 1W5EA 3I1YA 3AKYA 3MWYW 1YS1X 2MR5A 2JAXA 3H84A 2BHRA 2DBZA 1YZHA 3STHA 4CIVA 3RKUA 1M1YE 2GEVA 3A2NA 2IP1A 3F6CA 1EGVB 3L1VA 1RLIA 1QO9A 2C03A 4NMWA 1R6UA 2HSDA 3AUTA 2ZE6A 2P5YA 3CU5A 4N8EA 5IJXA 5JRZA 2HSEA 1RBYA 1YZTA 3LQRA 3FLBA 4CR8A 2ZIAA 3ILSA 5AVZA 2LTAA 5I9BA 1Y6GA 1YHNA 4IIGA 3VJLA 2EG9A 1IM5A 3FNGA 3HU1A 3N8DA 5IC4A 2IYVA 2WYVA 1MXHA 4QQFA 2LKDA 2Y4NA 4R1OA 4UKDA 5LLDA 1I0LA 5BWMA 4EW2A 1EK5A 5A6SB 1NPTO 2BFWA 3R2JA 4M22A 1TYDE 4IEFB 1RWWA 4G37A 3PFHA 4FMCB 4I4TF 4JBXA 5BPHA 1D4FA 4L73A 4YT2A 4PC2A 1CY8A 2QVZX 1KFEB 1IBKB 1DUVG 2VJMA 2CLOB 2Q4RA 4MW9A 3VI4B 1U6JA 5JSZA 4XFKA 5JECA 1VL1A 4EG5A 1KQPA 4W5WA 5KJCA 2XR1A 4O2LA 5KHLB 4ZI5A 1DDIA 1KDRA 1SO8A 4MGIR 4RVUA 1IQUA 3BXZA 1KJIA 3U3MA 3G0BA 1LNZA 4XQEA 1N5DA 3JD0A 2Y1XA 3V2HA 3SF0A 5A5EA 5HF6A 4YUAA 3ECSA 3WFIA 4OBBA 2XOEA 3TZQA 4KRGA 2C3PA 2VYVA 3UJ9A 1E2HA 1JLMA 1XR3A 3AFHA 1M10A 4BNTA 1I2AA 2IVFA 3FUCA 3IVGA 2BE9A 2YV2A 4PBTA 4LF4B 1OWNA 2P9FA 1S2GA 4UPEA 3UB4A 1B26A 1NZJA 5DHUA 3R9IA 1YRHA 3TWOA 2WWFA 3L82B 2X1LA 3COJA 4MEJA 4F93B 3NKVA 2BJWA 1NVAA 2HH9A 1TXGA 4R8KA 4XDZA 3WIDA 5BQXA 2Z04A 1TM5E 4W8OA 3HWWA 1BXRB 3W6ZA 1T3ZA 3QYPA 3W7BA 3WG9A 4DCUA 2DM6A 1M6YA 3E7DA 2G1UA 4NONA 5E8RA 1SFRA 1Q3HA 2O0KA 2GN0A 3DOCA 4G5QA 5DXAA 5L4LA 3B2NA 4RTNA 4CHGA 1JAZA 1BEEA 1VYUA 1TU0A 4BJ5A 4CDGA 3LUPA 1TRKA 2IGTA 2XCOA 1JQ5A 3AQIA 5EXDA 3JS5A 1KEKA 4JXXA 3NPMA 5I3CA 1D0VA 4Y30A 2IZ7A 3H0EA 3UK6A 2CCJA 4LHWA 2R48A 5HX7A 1FQJA 1MG0A 2BDUA 2AFIE 2FMUA 3ZJ5A 3EIHA 2VFAA 4D46A 3SJUA 1IEVA 1GL7A 2OOSA 3N7AA 1I4OA 4CT5A 4AWAA 3N2NA 4RK5A 2PGLA 1EIZA 1D8AA 3PEVA 5JRJA 3HK2A 1OJLA 2IDJA 2B9EA 4TVSA 1BGXT 1YU6A 4Q1BA 4YROA 4HWSA 3ZLTA 5IT0A 1Z0JA 1H5QA 3ASYA 1JP7A 3KKQA 1R0SA 3TX2A 3DLBA 2EW8A 1GFZA 4D99A 2CE2X 4HB2A 2IUTA 5CUQA 5EUQB 1I7LA 1DDOA 1H3FA 2WKSA 2ZJ2A 2G36A 4OU5A 3VH4A 1LZKA 1SGWA 1XZLA 3ZE1B 2ZR9A 3GFFA 5KVAA 2CLMB 1J22A 1P1JA 4PS0A 5BUQA 1SG0A 3BHIA 5JS7A 1B8OA 4UTOA 1U5CA 1BSVA 1EG7A 3H5WA 4P2GA 2LIPA 1ZD4A 4QJ5A 2LVBA 4TMFA 4OU4A 4P5DA 5D00A 2GOYA 3W34A 2W8BA 1BJRE 3HN7A 4G5FA 1LPSA 3UB2A 5ALFA 2HO4A 1FSFA 4GI7A 4GLLA 4TWIA 2HA4A 3QX9A 3WQQA 1N8TA 3BGOS 2OE2A 2Q49A 1KMQA 2EHDA 2LPMA 3EVAA 1EK6A 1B3RA 1N75A 2ZM5A 2NUAB 4MI3A 2IIPA 1FFXA 3S2IA 4BYGA 2GN4A 3F5FA 1JJAA 4R3WA 3FN4A 4BFUA 2JLRA 1Y1KE 3V3TA 4I4NA 1YVDA 4G4IA 1ETHA 4KX3A 4E94A 3DDNA 1Z17A 2VDWA 2YHSA 2YIVX 2HMWA 3MK31 4S1TA 4YV1A 4Q02A 2FPIA 2PANA 2NN3C 4I55A 2P9EA 1EK2A 3KSDO 2A33A 2DWOA 2WKPA 3COZA 3PGA1 4YLGA 4HDMB 4HLUC 4J6FA 1YC2A 4QL3A 3RVLA 1D2MA 4AP5A 4RFSA 3EA5A 4CGYA 5ES4B 5JJIA 4DYDA 1U0TA 2ANBA 2Y05A 2H3EA 3N0VA 5FCDA 2ANCA 4WCFC 2Q7OE 1W87A 4TMVA 3ZDXB 1MG5A 3G0DA 3LZ6A 3B3JA 1PAUA 3E84A 3M83A 5FH9A 5LU9A 4RM2A 4E03A 4Y7DA 3NIFB 4BZXA 2VUTA 3I4LA 2E55A 1P19A 1SVWA 3RM3A 4RAQA 3Q87B 3VR4A 3VVLA 4MA4A 1EE1A 2JJ2A 4UVDA 2YR0A 4YREA 4C3UA 3KP1A 3C8HA 3W5BA 2VQEB 1C9YA 5KYKA 2H54A 3QKSA 4O33A 4M87A 3K70B 1RZVA 5LA6B 4Q47A 1HFKA 3ACBA 4RETA 5AI4A 1J8DA 1FTNA 1P17A 3K20A 3C8DA 1LSOA 5KVSA 1D4ZA 2BGRA 2ZAGA 1UZAA 1KTVA 1VRCA 1X77A 1DOAA 4L8FA 3GG2A 4JLDA 4AWXA 4QOHA 1ZMTA 3HCEA 2F3SA 2ICAA 1L5GB 2I3ZA 1MDBA 1WSBA 3TFQA 4IMJB 3WICA 1BCRB 4W99A 1S2MA 4MB2A 1F0PA 3WL7A 5HXAA 2HK7A 1T2UA 2O7QA 5ALUA 1SKAA 1FUYB 1WOMA 2I1VB 2RC6A 2RHJA 2WVJA 3I52A 2WQ6A 3IOYA 1RU3A 1Y9JA 2DHRA 1WHSA 2MYUA 3IBGA 4V0RA 4CM7A 1SWWA 2GF2A 4J7CA 1J0EA 1WCIA 3UY4A 4CV2A 4A9AA 5JSHA 4XWWA 2JBAB 2K7FA 4JHLA 3S29A 1DNPA 3RBXA 5CBPB 5JAMA 1LNQA 4PGFA 2KI5A 3BYZA 1XP8A 4BO0A 2QW0X 1VRWA 4ESOA 4Q3KA 1OZHA 3DE7X 2ZJ4A 3MTBA 2G9QA 4J1TC 3GEGA 4OMDA 1WY5A 3N70A 5TC4A 3RUEA 2CSUA 5M3BA 1IZ0A 4BFTA 2G71A 2OEPA 2A4KA 1ZW1A 1F3OA 1OREA 3I83A 3HDGA 2FWBA 1JHOA 3PE3A 1U7XA 2A0KA 1PVOA 3RS4A 4RGVA 1LV7A 3DXZA 2FQ1A 1EX7A 4EBBA 2Y66A 3KPVA 4BJ6A 4EFKA 1NW4A 3KNZA 5DPMA 3TVDA 2VJAA 2WR8A 1Z62A 2NZUG 3C0KA 3EN0A 1JI0A 5E6SA 2Z4RA 4LF9B 3RU7A 3I09A 3VSBA 4F2GA 1AE1A 1TAHA 3DVAA 1JXQA 4MZDA 4X1KB 4BVLA 1K5HA 1MIOB 3M82A 3NT5A 3PENA 3R5XA 4JVLA 4P92A 1HDCA 1UIMA 4RF2A 2OQVA 5CMLA 2OA0A 3UJCA 1T6ZA 5C8ZA 3VPBA 4B3SB 1Q7EA 4UVIA 1FFHA 4YPFA 2BL4A 4B48A 2D1RA 2A35A 3VSAA 1SOAA 1NUSA 4MQEB 1W29A 1XEWY 2ZIGA 3T6KA 1O97D 5IXYA 4JLSA 2OXTA 4KIWA 2HFJA 3L8YA 4YPVA 4UNRA 4QGAA 3WYCA 4JU8A 2G4CA 3OVMA 4MQFB 2X9NA 2R6FA 1DJNA 3GJQA 3GX1A 3LWZA 3OO1A 4MJ7A 5TGTA 3OCJA 4J2TA 2HU2A 3NATA 2EKQA 2HUPA 4RKQA 4D7AA 2I4NA 1RTTA 4YASA 1NATA 1Z2NX 1DCMA 1E2JA 3A70A 5KC8A 2Z1DA 4G3XA 1AGRA 3VH3A 4QU0A 4FFMA 3RYHA 1NMYA 3D7KA 1ZD2P 5FWDA 3NFRA 2DH6A 1L5LA 2BEWB 1DAGA 1LK7A 3OTGA 3ZDRA 1D7OA 1FE8A 2QL5A 4G1EB 4M3NA 4HEA6 3OT1B 4OXNA 2H16A 1Y9AA 4RDHA 4BLPA 4HN4B 3RADC 3DGFC 3UV6A 2WIJA 4DQ0A 4Q4HB 1Z2PX 4NMMA 3ZCTA 1FNSA 1VIAA 2FPRA 4FBLA 4I5GA 4BDSA 3CNQS 1QIIA 1Q1BA 1P0MA 5FFFA 2HF2A 4XWAA 3ZGYA 1YA6A 5IVHA 3B82A 4RV5A 1G6Q1 1MIHA 2OFOA 3LPMA 3W2TA 4RA9A 3FFWA 4HEA1 4O2BB 4F06A 1DBIA 3EDYA 3WV5A 4Y18A 4DA0A 3RABA 4NPHA 1SVLA 1KJNA 2FQYA 5L3SB 3FTEA 3ZE7A 3PU6A 4ZPXA 2H18A 1MB9A 3KQKA 1A9XB 5A7HA 2X6QA 3S2UA 2WG0A 3OX1A 3Q3HA 2O2ZA 1JE1A 5JVDF 3LY5A 2ZAMA 3LDHA 3AYXB 5CNIA 1EUCA 3W7AA 1K75A 1FMLA 1T29A 3FPLA 4Q21A 3A0UA 4F1KA 3CV3A 4KGVA 4F6CA 5DSTA 1MORA 2G7MC 2VCEA 3ZY4A 4BBZA 2H2GA 1IY2A 3AGQA 5FWAA 5K99A 3CURA 3PUKA 4FOOA 4IZHA 4NU0A 2NU8A 5ED4A 2ZKIA 3ET4A 4QVKA 5KYWB 3FVTA 1CR1A 2WU0A 3KSZO 4MUMA 4O6VA 2O19A 3TIFA 1NOKA 3W5UA 4LI0A 2WJVA 4HRVA 2GHIA 4W63A 2X5JO 4F4CA 5EAIA 4JIMA 2PQ2A 3JQFC 2VZLA 4IFIA 4ZQIA 3RS9A 2OORC 4GT1A 3DWGA 2HRCA 3IXMA 2JJ8A 3ZJTA 2PRZA 2HHLA 1DBQA 4M6WA 4NNPA 3FPJA 3M9WA 4G1MB 3FKSA 2HK9A 1G98A 4F6LA 4GE0A 4HQKA 3KTAB 4X54A 4HMOA 3WFZA 3QVSA 4D4GA 1M74A 4GPEA 4MUBA 4DDUA 2I1WA 1UK9A 3LL7A 2DPGA 1B8UA 3HDJA 4B3GA 1MJNA 1VE6A 5E95A 3RU3A 3WISA 1M6VB 1H69A 3KOXA 4DPLA 4I81A 5BV1A 5EJ6A 2QOEA 3DMNA 3BXEA 4WFJA 3P20A 4L4UA 5AKHA 3WBJA 2RGNC 3FGPA 4FMCF 5GQSA 3GP8A 3ZWBA 1N0VC 3NTQA 1AKEA 4QM6A 4E5NA 1G5FA 2VP4A 4X9XA 4B76A 4FMDF 1V1MB 5HR5A 5B1DA 1UOQA 4FJ2A 3B36A 2QPTA 4H1WA 4MHTA 1MHPA 4IJKA 2YINC 2VNIA 1FDOA 1PR1A 2AI1A 1RJGA 1U5AA 3KX2A 1NF9A 5KKAA 2JFQA 3DEKA 3BE5A 3LUBA 2IEIA 3F8SA 4H1UA 1LJ8A 3NBMA 2AFHA 1OI3A 1KRXA 1W2WB 3MWDA 4H3HB 4OMFG 4MLPA 1A76A 1M6EX 1SN7A 4OY3A 2WTEA 3IL2A 1NP3A 3SN6A 1TLLA 3LZDA 1KY2A 4V24A 3UMMA 1QTQA 2VSOA 1QGOA 4TN1A 1SKYB 4DKJA 5EKDA 3IT3A 5A71A 1I7QB 4GL2A 1G8JA 2QP9X 3TQRA 4CMJA 2O8CB 1TM2A 1VSUA 3AF3A 4HS4A 2EX4A 2Q4DA 5F5LA 3BFJA 4XYGA 3RS7A 2Q4TA 3RTEA 5TLSA 2ISQA 2PMFA 5CXQA 4OHVA 5JXIA 2I4IA 1T15A 1XZJA 4KIGA 1V37A 4RIEA 1WF3A 5BWLA 4B6PA 3ZDBA 2CFCA 4J91A 1U02A 3STVA 2FUEA 4BKRA 4BB9A 3RC8A 3H9BA 2B92A 1T8YA 5IULC 1ZR4A 1TGYA 2ADOA 4G8DA 1HKUA 4KQFA 4U7FA 5SY6A 2IEDA 5GJVC 5IAAA 1AHNA 3EFHA 2Q5LA 5DIZA 3T3GA 3C7DB 3IUBA 4ZVQA 1PEKE 1TZCA 3BEDA 4L78A 4NE7A 3WZ2A 1LLFA 4I55F 1NQTA 4ZJUA 2WSMA 1NUUA 1C9JA 1ECGA 4IDBA 2R1ZA 3UTCA 3OSZA 1T1GA 2QUZA 4C7JA 1HH4A 4FUQA 1E3MA 1W4BA 1AA9A 4BFCA 2XRMA 2HU5A 2CFRA 3O9MA 2WB4A 3FR7A 1G8GA 4O2BF 3AKZA 2V74B 2YJ4A 4G07A 5F4ZA 4M1OA 3UJNA 3EBLA 3Q3JB 4LEIA 4BYMA 4RZHA 1A2BA 1KVQA 1PGNA 1DQYA 3HUFA 4U9UA 5BQPA 4D8XA 3EXHC 2OHGA 4CLDA 1Q77A 1TEZA 3QBTA 4C3VA 2AOWA 3RLIA 5C8YA 3D3EA 2QXUA 3G2JA 1F2UB 3R5TA 1MOSA 3VNUA 1FSPA 2B1JA 4OGLA 1KK1A 1G2IA 1ECLA 3ED5A 1Z9BA 1CZKA 4H31A 3G1UA 3V32A 1NW6A 1U8YA 3CUTA 3A4VA 1RZRD 1JH9A 5BSGA 3C15C 2Q62A 4C20A 3SHVA 1FFWA 2Q2QA 4UHJA 4I5FA 3OLCX 4PC1A 2VHZA 4L9WA 2F1JA 3DL7A 4HO1X 2NO7A 3A1WA 4BO2A 4BQIA 4Q01A 2UUCB 5TMBA 1MJFA 3AP3A 4OMCA 2PRIA 1IN6A 4GYYA 4MRMA 3NB0A 2C9DA 3C3KA 4AQ7A 2XGOA 1UWVA 5FD8A 1C7RA 3DZFA 3B12A 1N2CE 3L05A 2PX8A 4F4JA 1WDMA 3QFRA 2ETXA 5KCZA 4KO3S 2VDMB 4GMXA 4QJIA 4EHLA 2Q6LA 3SP1A 5J4KA 5BYJA 4MJXA 5D01A 1KU0A 2YWBA 4NCXA 4OHRA 3ZW7A 2P7IA 4JP3A 1LC3A 2QTBA 1EDEA 2PYIA 3DZHA 3ZWCA 2R8YA 3BILA 1T0JB 1HSZA 1WSDA 2ZKLA 3DF7A 3DTTA 3IQIX 3KJFA 3PV0A 4A8JB 2AZTA 3ZCXA 4PLTA 4YRGA 4A0SA 2QMHA 3I2JA 5D1NA 4BV9A 4IGEA 2IKSA 2XTZA 5BVGA 1NPYA 4QSMA 2IL1A 3DW1X 3CC8A 4ASUA 4Z9AA 2WJWA 3BRWD 4EYQA 2WVGA 2DP4E 1A9SA 3AY6A 4Q1CA 4AX4A 4N7RA 4M0DA 5ADUS 4U2FA 4PLPA 1UODA 1V35A 4X00A 1ZJ4A 1X2BA 2PKCA 4MH0R 4C14A 3H87A 3HUUA 4HF7A 4OHWA 1Z4MA 1FUKA 3B9PA 4MIYA 3JWPA 1FNDA 1PFQA 3ETEA 2XNCA 3W6UA 1OYYA 2Z08A 1YDFA 2RHBA 4KFSA 1MNQA 3O3MB 3KKLA 1OTHA 1C0IA 2XD4A 3BHNA 3KPJA 2QW8A 2JNWA 3MJRA 2J3KA 1E1QD 3GHYA 3DHNA 4ZDJA 2W58A 4IINA 4F3CA 2ZUVA 3SX2A 1E2NA 1JKIA 1JKXA 2HIGA 2HTFA 2PT7A 4CVNA 2CXUA 5CA0B 3EXIA 1NGSA 1QV6A 4MUAA 2WWVD 3AJAA 2O8DB 3KG2A 4D0GA 5EP1A 3VPGA 1QMGA 3O3OB 3DEHA 1Z75A 3NDJA 4MDHA 5JYDA 1EGAA 3N53A 2X2FA 4ALKA 3GK3A 4WNAA 1WDTA 3KDPA 1NXTA 1SQ5A 4HFMA 2BFOA 2IF0A 5J2TF 3RARA 2YXLA 3MVEA 4O1HA 4MB6A 4YCCA 2JLQA 5CNJA 5CB4A 1YR6A 2DUJA 2EGUA 2ECKA 3AIMA 2GQ0A 5HM8A 2N9UA 2RGYA 4Q4JA 4PWZA 1I3KA 3L6EA 4LKRA 1Z35A 1CJBA 2JD2A 4DV3B 3OTWA 5C8DA 1BN7A 2C7VA 1QO7A 1GTJ1 1WLYA 2LE0A 1EXWA 2HO5A 1ZZEA 2BGJA 3AM4A 3H5OA 3HU3A 5EE1A 2FN9A 3DKIA 1IG3A 4OSEA 3VKVA 3OZWA 1KS2A 2ZW9A 4GP7A 2YHIB 5BR4A 4GLOA 1FNCA 1G4UR 1Z0UA 2OV6A 1IIBA 2ZT7A 5FR2A 1Y6FA 3VKFA 4MWCA 1WPRA 2H2IA 3U5TA 3AJ8A 3PJDA 3O4FA 5CM2Z 4Y6GB 5BSVA 5JV5A 3AEQB 2QTFA 2BFBA 5IKOA 1LTHR 1M2VA 2Z2YA 3U4GA 4OX9Y 1A1SA 4GOLD 4GC5A 1Y7PA 2DQ4A 3MIZA 2AE1A 4OAPA 4YAEA 5H4HA 2E9SA 1U7ZA 1A9TA 3QHAA 3DTVB 4JBLA 3ZGNA 1YRQA 5DNCA 1XDDA 2A7QA 3GLIA 2AQKA 1F14A 1W96A 3JZFA 1E89A 4L6CA 5T5QA 3MCWA 4AJHA 3PDCA 3WIBA 4V0NA 3NHKA 1I4DD 4K9MA 2FEPA 1A4RA 3CXUA 3ZDYB 3CZPA 1BIFA 4QTTB 5ADVA 1VSTA 3ZH2A 1XFDA 2A9KA 1WETA 2LBPA 1Y8RB 5EZSA 3QKIA 4AJIA 1HDEA 2HLPA 1HOXA 4EBFA 1C4KA 4EF5A 3PA8A 3GC6A 1C14A 1G55A 3TK1A 2X6RA 2GJ9A 1OQAA 1QQ6A 3ROMA 2XPCA 1JDNA 4YIHA 3KOUA 5DKFA 1IQRA 2WTNA 3ELUA 2BYTA 3OA2A 1QOQB 1X1RA 2NM0A 4E5VA 1JZTA 2P11A 5BUCA 1N33B 2DZDA 3DO5A 3QV1A 4HOYA 2MSLA 2B5WA 2V7TA 3L6OO 3SPXA 5EJ7A 1QFJA 5EJ8A 1NVMB 4LGVA 4PGHA 4M86A 1Q7GA 4HB3A 4PC7A 1QS0B 2FPPB 2WV7A 3ED1A 3KHUA 3LM8A 1NRJB 1V9CA 4DMLA 2D3WA 4LOIA 3OHMA 2WRZA 4MUXA 1AUXA 2GEBA 1QJCA 1GGFA 1I4EB 2TMYA 5J5VA 2YUTA 3RIHA 1HUQA 2AZMA 1U0NA 4OKIA 2QWXA 3I04M 4JBWA 2XGSA 4TQ9A 3ZOZA 3CKMA 3N86A 2Z56A 2DSTA 1I5OA 1MV5A 3A32A 5I9NA 1ZJJA 3IKVA 2C7RA 1PZHA 4LE0A 3H2JA 3HWX1 3LMKA 2P68A 4KVGA 2PUJA 4YRTA 5TARA 1TD1A 3DL4A 3OHPA 4GKBA 4PLZA 4MDFA 2C5LA 3AF0A 5CJPA 1RYFA 5EPEA 2XMSA 4O0LA 3FF1A 1CTQA 2RGCA 1KO4A 1PJ3A 4H59A 2AMJA 2HK6A 2PH5A 3V8NA 5K8CA 1SUEA 2B9VA 4QDKA 2JH8A 4II7A 4CFSA 1JW9B 4CMAA 3K0KA 2EKBA 3ZG6A 4Z4FA 2JFVA 3AVPA 1V96A 3EWIA 5B7NA 3GLGA 2ZP1A 4IR7A 4G9EA 4NDZA 4YFVA 5EQJB 4HNTA 3ZI0A 1AHIA 1G5HA 4TS4A 5A0VA 2D13A 3V4FA 5JZ9A 1FX1A 2XX3A 1UJMA 3B2QA 2OZKA 1XWWA 1ZGAA 5A1JA 1L6RA 3RTAA 2GERA 1C7JA 1Y5IA 5K4GA 4GWLA 3KZVA 3DOIA 4Z4HA 3G49A 4D74A 1PFVA 2GLTA 3L9XA 4Q9JA 1KXZA 1YD7A 2X7JA 3MJEA 3OZUA 4ZCSA 3I6BA 3TZLA 3DD1A 1IXYA 3N8GA 4H6PA 1CUCA 5G0VA 4ABTA 1MIOA 2FSFA 1U0RA 1J09A 1L4KA 2Q2NA 1MAAA 3O03A 1T5IA 1YL6A 4JH0A 5CCXA 4EPVA 1UQUA 2O4UX 3L4EA 3CTMA 2JJ1A 5AW1A 2ZAOA 1F51E 3H3JA 4QULA 4IDAA 1EU1A 2C2XA 8ADHA 2AEFA 2BGKA 2EFJA 4JEUA 3KHTA 1SH7A 4WA7A 2RHMA 1E2KA 1XUOA 4YUZA 1JQKA 4ZCLA 2HREA 4RD3A 3ZD6A 1W85A 3JV7A 1JU3A 4GVPA 5LWHA 2PYZA 4W9MC 2QJWA 1X3LA 3WK9A 3COPA 4ND3A 3SX0A 5EINA 5DE3A 5IM5A 3U4IA 4FHDA 1W59A 1RJWA 2FG6C 4KO8A 3IDAA 3BZUA 5JW6A 4MLDA 1W73A 4WIAA 3VC3A 1VLJA 1SB8A 4ZRNA 3K0AB 4ZARA 1P1KA 1ZRHA 1BTOA 2SCUB 4GHWA 4BO5A 1Y8QA 2WZQA 3NOOA 1WZCA 1EA5A 1X13A 4NEHB 4D44A 3EA0A 5DWVA 1E9CA 3SSMA 1RABA 1RHMA 3PP8A 3GLFE 1K9SA 2O07A 2FEMA 3KB8A 2ZJ0A 3VU8A 1J1IA 2PL3A 4JU9A 4LDQA 1V2HE 4Z4CA 2AKAB 4C87A 5B36A 2OG1A 5EGNA 3AL3A 4MWOA 1E62A 4FSHA 4QO8A 3UA4A 4MDYA 3WY9A 3K72B 1JDUA 1YB1A 5FA5A 1X9HA 1NXQA 5JS8A 1CT9A 1S9DA 4NFSA 4GUAA 2ZTSA 1JAXA 2GVNA 2HNKA 3NWJA 3WK7A 5JH7A 4TN5A 2FFJA 1CR2A 4DQKA 5AVQA 2NYAA 4J3JA 1L8OA 1VCMA 2W2NA 1JZQA 3G2QA 4D9FA 1KZ7B 1U28A 4NCJA 3OJFA 4GOND 2AJTA 4QOJA 2H1SA 4PFQA 3WO1A 1E9DA 3NTXA 3L06A 4D0SA 2EV9A 1ISRA 1UL1X 1D2RA 2EP8A 3ESZA 4LRXA 1JN0A 3AIOA 1V48A 2FZGA 4IOLA 3P9ZA 2GM4A 3D2AA 3R7BA 4LXTA 3OPYB 1M7BA 2ZBFA 4IIJA 2JVJA 4X44A 3WK8A 1TA4A 3NOVA 3V2GA 5GAJA 2AK2A 4UUOA 4E21A 2CL5A 3HRIA 4GI3A 1JQ3A 3AFIA 3SQDA 3D7SA 1NI5A 1V8ZA 2QR5A 1OH8A 1HLGA 1RQNA 1NULA 4DIDA 1WUYA 3KKNA 4G0QA 5LMNB 1DX4A 3WL8A 1ZKMA 3KR9A 2PO5A 3WRYA 4M1SA 2RIPA