5AJXA

Human pfkfb3 in complex with an indole inhibitor 3
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
444
structure length
441
Chain Sequence
PLELTQSRVQKIWVPVDHRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
total genus 156
structure length 441
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajxA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajxA02
4LHYA 1E4YA 1OYWA 2GKSA 5EP4A 3GD7A 1PLJA 5L3SB 5F2EA 4O2RA 2KBFA 2QM7A 5L3VA 2QENA 5FBQB 1T3HA 4RZUA 2XTNA 2BMFA 2ZJYA 1SKBA 4B2IA 4N0EA 1JECA 4DSNA 1ZVQA 3K09C 4ZI3A 1JEEA 3S1AA 1LTQA 2OUKA 2CJWA 4ON9A 1L4UA 2MMGA 4P4SA 4CEHB 2BIFA 2O8FA 1YR9A 4YMTA 2WWHA 1Z0AA 2ZRDA 5HCNA 4TMVA 3R8FA 4HZUA 1ODFA 1E2KA 2QAJA 3EW9A 4DLWA 4H1UA 1TQ2A 2PBRA 5H70A 5FUXA 1NI3A 2ZYVX 1JR3E 1G41A 2FEOA 2VL7A 3LY5A 3KJIA 5CJ2A 3WBKA 4PHGA 5HCIA 3O8CA 4NCHA 1ZC3A 4Q1CA 4C3ZA 3WNDA 2WOJA 5TB5A 1A7JA 3AVOA 4CYMA 1HE8B 1SXJD 2RGNA 4TL8A 2RFLA 2AL7A 3PUWA 1X86B 3HJGA 5AJVB 1G17A 1ZMXA 4URWR 5D3MA 1KO4A 2W58A 3GLFE 3QEJA 1WBBA 3BB4A 4Q5IA 4B76A 4O2LA 3VNUA 2GA8A 3CRQA 2XXAA 5FTJA 1YFKA 5JI3E 1BMFA 4FMDB 3IIKA 5DGXA 1M74A 1ETUA 2QP9X 3CH5A 2QORA 4V0KA 5UKDA 3UATA 1E1RD 4KFRA 4PC1A 4GZLA 5EXSA 2F1JA 3ZJYA 3NXSA 1YZNA 1QHHB 1G3IA 1RZ3A 3QY0A 1DPFA 2Z43A 1XTSA 1COWA 4OJKA 4UNNA 4PZLA 3MG9A 4EQ6B 3DB1A 1I4DD 1W4BA 2FU5C 5L3QB 1P7CA 2HLDD 2ZRBA 3VKHA 2WWIA 1US8A 4ARVA 4WOPA 2YN2A 3QUSA 2QTHA 5GVRA 3K4QA 1G6OA 2CCGA 3GJ0A 4JYBA 3BAFA 3SFZA 3U3JA 2EOAA 3OE7A 1FUUA 4DEXA 5E4FA 1A1VA 5CDHA 1P4SA 3QF4B 2NO1A 1OB5A 4BLSA 1IQPA 2C96A 5JMTA 1DOAA 2WKQA 4AKEA 4D4JA 1Z8FA 4QKQA 1WB9A 3ZDQA 1UJCA 1UBFA 3QG5A 4KLZA 1WE2A 1X8KA 2HJGA 4B2PA 3FB4A 1LY1A 1C81A 3WP1B 4W5HA 3CF2A 4ZDJA 5HZKA 1R0WA 4UKDA 2O8CB 4LYJA 1AGPA 1G3UA 1SXJA 4ABYA 1GKYA 2H8KA 2AKYA 2ZSEA 5EZ6B 5KSPA 4V0LA 1XQ9A 4W9MC 2ZYWX 3RAPR 2LKDA 4MYHA 1I2MA 4O25A 4IJ6A 1QHGA 2J5XA 3WNCA 1TF2A 3WMGA 1D9XA 1E2NA 4ZCLA 4RJLA 2W0SA 5F3WB 3NWJA 1BQ4A 2CJWB 3TIFA 4OK6A 4ESVA 3ZS8A 4BFVA 3AEZA 3J81k 3EC2A 4M1MA 1F48A 2GFIA 4HDQB 2IHBA 4JSYA 4BRWA 4C0AC 2PA0A 1ZUIA 1CS4C 4HZUB 4N3NA 4R2IA 4DDTA 4L5BA 1YZGA 3VR3A 3OI7A 2YJTD 2RGDA 3GLFB 4BWYA 1W36D 3LBNA 3SNHA 1GRRA 2HJVA 1QHSA 3EG5A 3K09A 5K8UA 2RGNC 3RVBA 1Z0JA 3TJZA 3QBVA 3LVQE 1ZU4A 2D4HA 4W7SA 2GEVA 2WVJA 3SQXA 4WBSA 1VDZA 3D6TB 2HLDA 2EKZA 3KXKA 4RFVA 1Z6GA 4PC6A 4IDNA 3FVQA 2ANBA 1KMQA 1IBRA 5DHFA 3DVLA 1IN5A 3MWKA 1OXSC 5E7IA 1VCOA 4Q1AA 5FBVB 1PV4A 3QPUA 3QPVA 4TT3D 4P4SB 4CEHA 1U8AA 3K0CA 2HIAA 4IXMA 3OFND 3DMDA 4DLUA 3TSZA 3PVSA 1LB1B 2ZTSA 2CVHA 2IUTA 4IDPA 1II9A 2HT1A 1II0A 2DYKA 2WSSD 3CBQA 4PQYA 2GXQA 3NH6A 3QKSA 5DO9A 5KOYA 3BH0A 3QI2A 3PEUA 2P77A 3L43A 4RFSB 3QXJA 3AKDA 4BASA 1RJ9A 4AYTA 4F4JA 3AVUA 3W6PA 1KKMA 1E2HA 1N6RA 2Z0MA 2CL7X 4MH0R 1E0KA 1KTVA 1TUEA 3ND8A 3CRRA 4RD6A 2JJ2D 1KZ7B 3PEVA 1AJEA 4MKIA 1S9HA 1P2VA 1E96A 1OYYA 5CYPA 4I1OA 4U7DA 2BCGY 2FZ4A 2ZS7A 1ZM2A 3B9PA 4DDUA 1Z07A 2BJVA 4BZXA 5LD2C 1NMZA 2NO7A 5L3QA 1DELA 4X8LA 3UMSA 3A6PC 1W5TA 5JHGB 4DCNA 2ZXUA 1VG0B 2P78A 4NYMR 3REFA 3AKEA 3VQTA 2QT1A 5IK2A 3AH8A 3KKNA 3LG2A 4TZ0A 1E9CA 3CR7A 3CKLA 2F1HA 2OBNA 3K70D 2VF8A 4EIWA 4PC2A 1W4RA 3DOFA 3W9YA 4DLXA 3QPWA 5JRJA 5CYOA 5JEDA 4YMVA 1J90A 4OK3A 1KMHB 3K0AB 2LCFA 2ONJA 2QY9A 4GOJA 2ZR9A 3KKQA 1G19A 1IXZA 3ZIAA 4LJ8A 2C03A 2GDJA 1N5KA 1E9DA 4IHQA 2CEAA 2BC9A 5K8LA 1T91A 2JLRA 2OBMA 1EX6A 4U02A 4B3GA 2DY1A 1V37A 5BN5A 2IW3A 2ZU6A 4C0JA 2GZDA 4Q4HA 4B6EA 2DB3A 4PFSA 3IO5A 5JCPA 4JJKA 2ZI6A 2GAOA 1U0LA 2GVDC 4NYMQ 2ZETA 3AVPA 3I5YA 5M04A 1NN0A 1NIPA 1ZCAA 2CE2X 2Q9CA 1LW7A 4WVFA 4WXRA 3A58B 2JCSA 2J41A 2KE5A 4I1UA 1YR7A 1E94E 5J4KA 3RS2A 4IOJA 3F2IA 4Q18A 2QBYA 1RYFA 4P4TA 2AD5A 3EASA 3T15A 4JLKA 2NIPA 3EA5A 2V7QA 3OF5A 1G3QA 1OKKA 3WMFA 2YOFA 4Q1FA 3HWSA 1EFRD 3K70C 4FI3C 1XCMA 3DM9B 4QG7A 4TSRA 4DLZA 2DFKB 4H1VA 2HCBA 2WTUA 2GJAA 2FOLA 2QSZA 1XPRA 2JASA 4JSTA 5EUQB 2ECKA 2OSBA 3RSOA 5KNBA 3I73A 2H7VA 2ODWA 3SDZA 2JLYA 4Q03A 1CR2A 2AKAB 4TL6A 3GJ7A 5EUMA 3C15C 1JPJA 3MD0A 3LNTA 2ZYUX 4Q9LA 5JBQA 3PFIA 3TMKA 2WAYA 1MO5A 2JDIA 2WJGA 3G82C 3MUFA 4Q02A 1LF5A 1R5NA 1SVIA 2QT0A 3KTAA 3IEUA 5BYKA 4TYPA 2XB2A 2P6OA 2H4XA 1KYIA 1SULA 3ZIAD 2FDCA 2ZVPX 3IHLA 4X8OA 1GFIA 2FFQA 3FWYA 1Z2CA 1TQ6A 5HE9A 3GLFA 1MRNA 1Q44A 3R20A 2K5UA 3BOSA 4MRPA 2XNSA 1SVWA 4MRSA 1RYHA 3PUXA 5FL7A 4HEJA 1RKBA 3ASZA 2VP0A 1R10A 1U0JA 1WCV1 1PVOA 1F2UA 4LOAA 2ZE6A 3LQRA 5DH9A 3QEOA 3VR4A 5TY0A 1YZTA 1U8YA 1JXOA 2BDTA 2VPPA 3ZYCA 3TR5A 2X77A 1UEJA 1N6OA 4MKGA 3R9IA 2ZVQX 3PUZA 3EZ9A 5EXTA 1W44A 2GCNA 3T61A 4B6FA 1YRAA 1EX7A 2QPOA 4KBGA 3GW8A 3LNCA 4BLRA 1C7ZA 5FPYA 1GRNA 3RHFA 4ZI2A 4KYUA 4DSOA 1KK3A 1NKSA 2CVFA 3D31A 2YVUA 4JLAA 2IUUA 2R62A 4XJXA 1NNEA 2V7QD 1OKKD 2AHOA 1SKYB 2WKRA 3GJ4A 2CMKA 4KVGA 2IYTA 2WWXA 5KUTA 4NCKA 4GPIB 1D2MA 3BGWA 4G01B 4QJ4A 2PEYA 1E2MA 4LJ9A 4G5SA 4TYQA 3DEFA 4Q1DA 2CNWA 2H57A 4A8JA 3T06B 2CL0X 3WHLA 4IDOA 1KHTA 4B48A 3NIBA 1T5LA 1OH7A 3CO5A 1KI6B 1G21E 1VG1A 2GXSA 3O8DA 3U6BA 2QTVB 4QBFA 4AYXA 3W8RA 1NL3A 3IPYA 4Q4HB 1KO7A 4JBWA 4TYNA 2MSDB 4US2R 4NDZA 3TUJC 3I32A 2OCAA 4BECA 2YYZA 2MSCB 4JYCA 1DG1G 4TLDA 3FE2A 2BMEA 5G3ZA 3JVUA 2QL6A 1WBDA 1ONBA 2Q9BA 1IHUA 2PMKA 1G3MA 4NONA 5A5GA 2HT6A 2BKEA 4EO9A 1N6PA 2CK3A 2PL3A 3MXOA 2IL1A 3QKRB 1KNQA 2ZEJA 3TSOA 3TUIC 1Q20A 1TU3A 2J7PA 1FX0B 1VIYA 3WYAA 2BVNA 5FPSA 1SXJC 3PGMA 1EESA 4Q9KA 3U7GA 2VP9A 4P3YA 5HKKD 4A0GA 2C04A 1S4QA 1NY6A 1TX4B 3LLUA 2VHUA 4EFLA 2W0MA 3QXCA 3B13B 1UFQA 2NZ8A 4B3FX 4F93B 1CF4A 4EDHA 221PA 4RZXA 5EQTA 1ND5A 4B47A 2OFWA 3HU1A 2WIAA 2PT5A 4MYCA 2ZE7A 2NOAA 5BN3A 4IKEA 2OWEA 1VHLA 2B6HA 2E9SA 1K8RA 1GP2A 1T8PA 2FGKA 3WNBA 1XBTA 5B30A 5KO2A 3TAUA 3BJIC 4WZBE 4JLDA 1GDDA 4TLBA 1E2DA 1ESNA 2DBYA 1Z63A 3EZNA 2X2FA 4MRNA 3SJAA 5AR1A 4IOMA 5EE1A 3EAQA 4TTQA 2FE4A 2V55B 1W0KD 4Q00A 4R7ZA 1R0XA 1FBTA 2HF9A 2IBMA 4JLOA 2GCOA 4LRWA 1TMKA 3QBTA 5HR5A 4FD2A 3B7GA 3OIUA 4TQ9A 4QGGA 4PX9A 3TQFA 1F6BA 5C18A 4FINA 2GZAA 5EZ5A 3VKGA 2DCUA 1G4AE 1NBMA 4WA7A 4C0BA 5JJKA 1OV4A 1DAIA 1W48A 3DO6A 4DLRA 3K9NA 4LYAA 5FBWB 1GG2A 2AN9A 1TUIA 2A5YB 1QZXA 5KU1A 4D25A 3KTAB 2G83A 1ZYUA 1E2EA 2WMNB 2BM1A 4TMTA 4ZIRB 2YC4C 3NBFA 2C5LA 4XTRA 2FMXA 4UNSA 1VG8A 4MDFA 4GBMA 3VHXA 4BQSA 3E70C 1W0JD 3B9QA 3FHCB 5FOXA 2BHRA 4URXR 2ENUA 3THOA 2DFNA 4UXHA 2F1RA 4JLJA 4ZDKA 1CJMA 2C95A 3OESA 1FMLA 5JLJA 2ZJAA 1VTKA 1GNRA 1GITA 2A78A 2VQSA 2A3RA 4EPVA 4A8JB 2BBSA 2IWHA 3D3QA 2P5TB 4EKDA 1FL9A 2HDNB 3IQXA 5L3RA 3AF0A 1E2GA 2ZSDA 3TVTA 2ZJOA 2ZI7A 2ZRNA 2ZS8A 4Y0AA 3QOFA 3QG1A 1XEWY 4JVSB 1O87A 3C8UA 3PUVA 3P32A 4BLQA 4EPRA 1MABB 2FSIA 3A1UA 4MYUA 2CE7A 3OAAD 3VR6A 3KFXA 1F2TA 1G7SA 1KDOA 4YMSA 2RH5A 4RZ3A 1OH8A 1QFXA 3BFXA 5KDLA 1EGAA 3ZQJA 5CLQA 4Z8YA 3D4IA 4DSTA 3WRYC 3H0KA 2ENWA 5AUOB 1HUQA 2QMOA 4G0NA 4KYIB 4IVRA 3B8HA 4E03A 1D9ZA 2OAQ1 3OIVA 4OJQA 3EWAA 4UXIA 5TMPA 3EPHA 1ZUHA 2J9RA 1P2UA 2IYWA 1FUKA 5EE9A 1IN4A 3ZH9B 1OXUA 2WHXA 4B71A 2OCBA 1R8SA 1SVOA 3IKJA 4AIIA 2WPDD 2YKGA 2C9CA 4V0MA 1HH4A 2HPAA 4DB2A 4GPZA 1RJ9B 5HTKA 4PHFA 3RANA 1G8YA 1XPOA 1WMSA 1KDRA 1QHXA 1DKMA 2O8DB 1ZINA 2EQBA 3IIMA 5EP3A 4EJSB 2AX4A 2VBCA 1XFAA 3NBYC 4FCVA 3FKSD 3TW8B 1W0JA 3ASYA 1ZNXA 1Z83A 1G4UR 1GILA 3W34A 4DBLC 4Q47A 3RWMB 1Q1BA 4AD8A 2A5FA 4HUQA 4NYIQ 2WWWA 4FCWA 1HT2E 2P65A 1JQLB 3QF7A 1BQ3A 1R7RA 2R2AA 1GWNA 1ELOA 3HYRA 1IJFA 4DCVA 3FDZB 4KV9A 1GRQA 1CBUA 2BMDA 1GIAA 4IDQA 2JJ8A 1E69A 5B2ZA 3HYTA 1ZW6A 4EJSC 3FHTA 3TGPA 1XNJA 2PZGA 3SOPA 1CJTC 3AGQA 3WXMA 3HJNA 4PSKA 1OIXA 1OIWA 2D3WA 5FBRB 3LQQA 4PXAA 1FP7A 2BBTA 2W2VA 1BS1A 4M1OA 1XJCA 2P30A 1EFTA 2FG5A 1QRAA 1E98A 1OFTA 2UVQA 1VIAA 5J4LA 3X1XA 3TW4A 4MITA 3TAHA 2JLZA 1Z47A 4LK2A 1JNYA 5ELXA 4JVNA 1P2SA 2WKPA 2ZRPA 2YWHA 2EVWX 4M9SA 1CJKC 3DHWC 4ODIA 4C2TA 4FMDF 1UDWA 5B57C 4JVMA 3GP5A 5IF9A 4F4IA 4ZPXA 3BC1A 1IONA 1U8ZA 1J8MF 2IXGA 3P4YA 5AJZA 4A92A 4CEIB 2P9FA 3K9LA 5FPKA 1LS1A 3KKPA 2X2EA 3DOEA 3IT3A 1G18A 3CRMA 1KY2A 3LBIA 2R8RA 2WPDA 4OYHA 5LB2A 5JJLA 3KJEA 2UZIR 2EFCB 1GM5A 3ONWA 1N0VC 3EZ7A 1C4OA 2QMUA 2D2EA 5E7JA 4JLVA 5CITA 2WU0A 3CZPA 4URYR 2GXAA 1HEIA 2WJVA 3KJHA 4NKRA 2ZUDA 1G64A 2CHQA 4JMPA 1NN5A 2DWPA 1XX6A 3QKUA 4ZIRA 3OEED 4XSHA 4BPBA 5E3HA 3P4XA 5K8IA 1CIPA 1YKSA 3DM5A 1P6XA 2GK6A 2OCPA 3EOZA 4D2IA 3CWQA 4LPKA 3EIQA 4OHVA 4DUGA 4UJ5A 3I8SA 1G7TA 3NG1A 3QXSA 4TWZA 3THWB 2CDNA 2FF7A 3LBHA 2WJJA 3VU9B 1KOFA 1M8PA 2YWEA 2ZRHA 2B8TA 3LW8A 1Q21A 3M1IA 2PZFA 4YXWA 1XJ0A 4LYHA 1G8HA 5AK0A 3V4FA 2FH5B 4CIDA 4TLCA 2FV8A 3CRW1 3BD9A 1FNNA 3FOZA 4G5QA 4M1TA 2IX3A 3DCYA 5JJIA 1UKZA 1WP9A 3QSYA 1HQYE 4R71A 1LFDB 3GEHA 1R2QA 2IS1A 2DFTA 1JJVA 2EFGA 3NHAA 3VR1A 1U81A 2ZRIA 3AUYA 2FFBA 2VHJA 2GJKA 1E32A 5KPJA 2EFHB 2GBLA 3K8YA 2CLDX 2FPKA 5L3SA 2Z6VA 2GVZC 1E59A 2R6AA 2NPFA 4A2WA 4ACAA 4RY2A 3GLIA 5FTNA 1TEVA 3A36A 3RRZA 2P9ZA 1Z0DA 1DKQA 2GWHA 2O5VA 3CWZA 2P67A 3BORA 1IY0A 1NJGA 1WA5A 3BH6A 3IBYA 1CXZA 4A1FA 4A2QA 4DEYA 2MMCA 4HYYA 3U5ZB 2ZI3A 4C0LA 5BW8A 1I4LD 1VYUA 2YV5A 3L8ZA 4V0OA 4A82A 5CDFE 4G5GA 2G88A 1HT1E 4Z8XA 4LJ4A 1X8LA 1IN8A 1JQJC 1P75A 2IYXA 2OT3B 4GOXA 4F38A 1E0AA 1VMAA 4QGHA 4IOKA 5JSZA 1W1WA 1IY2A 1B23P 2WV9A 3OEEA 4F92B 3NEYA 2BEJA 5E7MA 2XB4A 4PHTA 1PJRA 4OI4A 3SS8A 3QXXA 3T1OA 2J1LA 3D6AA 3R9XA 3Q7PA 1FZQA 2RAPA 2XEXA 3IIJA 4PC7A 2ZPTX 1MKYA 1GKIA 2IYQA 2A5GA 4LJ5A 4YMWA 4TTPA 3L0OA 3AP2A 4ZCMA 1G8PA 4ZO4A 1UKEA 4L15A 2ZJBA 3AKYA 4LBWA 4OI1A 3W3ZB 1JB1A 2XJ9A 2QE7D 4BZQA 3NBZC 4Y0VA 2QNRA 3U3OA 4BFTA 4NYJQ 1NVUQ 3PENA 5LBIA 1OB2A 1U2RA 1COWD 3AV0B 2ODEA 4IXNA 2WBLC 2CHVA 3UKDA 4QGAA 2X1VA 4MGIR 4EUNA 5J4VA 3FDIA 3QNUA 4N1AA 4WW0A 1E79A 2F7SA 1SHZA 4D82A 2BWJA 4LX0A 3K9GA 1FQJA 1XCGB 2KSQA 1H8HA 2ODBA 4HAUA 1FNMA 3T1VA 3ICEA 2DHRA 2NMVA 1S1MA 2FJUA 3E5HA 1KJWA 1AM4D 3QVUA 5CLLA 3QE0A 5DI9A 4ESHA 1RPAA 3U4QA 1YHNA 2IS2A 5F9HA 2JAQA 1OW3B 1KY3A 5C46F 4D0GA 2OXCA 3LX8A 2DFLA 1RFLA 3U60B 3EX7C 2FEMA 4OKSA 2O8BA 4LBYA 3AVQA 1AQYA 3GLGB 3EA0A 5B58C 5CB6A 3BE4A 2ZSFA 1SVKA 2H4ZA 1TPZA 1F2UB 2ZE5A 1LS6A 3CF6R 1XRJA 3EWSA 2AXPA 3UMFA 2ONKA 1SVMA 3B85A 1NVVR 3PQCA 5IHPA 5DHAA 2OAP1 1NVVQ 1U0HC 4KSBA 2QN6A 2R9VA 2P6RA 2V4ZA 3E9EA 3QXHA 1EWQA 4Q1BA 3TE6A 5FH9A 4PZ9A 1NN1A 2IEZA 2YNMA 1IJEA 3RSLA 1BO6A 1CRQA 2B7BA 4KFSA 4WAUA 4JZKA 4CT4B 1Z3IX 4A0RA 3AKCA 1VHTA 4B33A 4C0HA 1NG1A 1ZBDA 2GCOB 4Q1EA 1S8FA 5FPHA 4G3XA 3GLHE 4DJTA 1Q1EA 1Z08A 2R6GA 4LV6A 3A1VA 4C7OB 4Q48A 4HDCA 4DLYA 1SXJE 4D0NA 4URZR 4TL9A 1OFHA 1JAHA 4KJZA 5J47A 3AF3A 2JLQA 4JL5A 3CX7A 5JWOA 2GEUA 5HPYB 5KSOA 1OH6A 3SE0A 4RD4A 1K5DA 3GCGA 2PLRA 2ZJ2A 2J0VA 3IBGA 4PAQA 4F91B 1VYTA 1E79D 2R6DA 3T34A 4B3BA 5JZVA 4MKFA 2BEKA 1PUJA 3HPQA 4WZAE 2PH1A 3P27A 1H8HD 2CLSA 2N1BA 2GILA 2FZLA 1SKAA 2GF0A 3FFBA 3H86A 3RDPA 1UDXA 5SZJA 3Q3JB 2O8EB 1LNZA 4E5UA 1XU4A 4BFXA 1QHIA 2PLFA 4XSGA 4A15A 3K53A 1S3GA 1YZQA 2WSSA 1BKDR 3A1TA 3QF4A 1XD2B 1N5IA 2V9PA 1CR1A 4XIGS 4UJ3A 2AK3A 4IEEA 3Q5DA 1M7BA 2ZIAA 3MJHA 4Q4AA 5KDOA 1FW6A 5H68A 2B92A 2CBZA 5C2JB 1KZGB 4XH9B 2KI5A 3IPXA 3NEJA 3Q5EA 2GESA 1P3JA 3KX2A 1EBBA 1FX0A 2OLJA 2JJ2A 1NT4A 2P0EA 2QMEA 5DYIA 3BS4A 4MKHA 4IJ5A 3CR8A 1G20E 4RD0A 1JPNA 1DADA 2RB4A 4BE7B 1FOEB 1NSTA 1T4GA 3MCAA 4DIDA 1F3OA 1H2FA 1WDTA 5JECA 4BZPA 2B21A 2G6BA 3TVDA 5IK2D 4IVPA 3B78A 5FOSA 2RGBA 2J3EA 3GJ6A 1JEDA 4D4LA 3FFAA 2D62A 4PQRA 1H65A 3RWOA 4OHXA 2HEIA 2ZR7A 1YJ5A 621PA 1MO6A 3WBJA 2O0KA 3BWDD 3U4QB 2QAGB 4LDJA 4P32A 3U7FB 1E2PA 5KTYA 5CM9C 3Q72A 4CEJB 4LWZA 4PZAA 4TQAA 5JCZA 5SZKB 3L0SA 2XZOA 3U7HB 2IA5A 3R7AA 3PJRA 1XEWX 3C5HA 2DR3A 3JZMA 2VIIA 1M2OB 2ZRJA 5CIQA 3VX3A 4E09A 2Z4SA 4BGDA 1YU9A 3W5IA 1XDBA 5KDDA 3ZVMA 1KDPA 3I4LA 3VR5A 1ZRHA 1G1MA 3GEIA 3VX4A 2MSEB 3IEVA 3AVXA 1IOZA 1AZTA 3AVTA 4LUCA 2XSZA 2H92A 2YWFA 4D4KA 2G1KA 4L4UA 1CVIA 1YZKA 3MJRA 4Z1MD 4KAXA 1II8B 4DLVA 2HXSA 4KI0A 1X1SA 2NQ2C 3Q8XB 1NN3A 3AF2A 2QUZA 4K46A 4KHZA 3JVVA 1A82A 4M22A 2FPMA 5IT5A 2E1RA 4B2LA 3HR7A 3LLMA 2HF8A 4MGYR 2B8WA 3LWNA 1Q0UA 1W4AA 3SI7A 4OI0A 3P26A 1EFRA 4GMXA 4DC9A 2EU8A 2WAXA 2ZRKA 4RCYA 1H2EA 3OIWA 2GTPA 2IYVA 5GJCA 2Q6TA 2V8OA 4A0FA 1U90A 4HB0A 1N6NA 2G0NA 5CU7A 2A30A 2NTYC 4TYYA 3NHBA 1WQ1R 3F5FA 4JT4A 2A6PA 2JIZD 1D8TA 1KK1A 4F7WA 2BBOA 5FL3A 2ZI5A 4QHSA 3I5XA 1YJXA 2QG6A 4DCSA 4KO8A 2HYIC 5FOTA 2VLIA 2WJHA 2D74A 3X1WA 1W36C 3WP0A 2F9LA 4QFMA 1ZD1A 1KSJA 4NL4H 4B32A 1ZJ6A 1XD2A 3RRNA 4TYWA 2P3SA 2Z83A 2EFEB 3B82A 3K0AA 4NCNA 2GNOA 4PPGA 4Q4AB 5DIFA 1GUAA 2F43A 2PX0A 3Q7QA 4BFZA 4DCUA 4EPTA 2X8AA 3GEEA 2QA5A 2ODNA 3H4MA 3FMIA 4HAWA 3ADDA 4FXPA 2C78A 3EPKA 4AKIA 2ZU0C 2ORWA 5FTLA 3AF4A 821PA 5JFGA 4BEBA 4HLQB 1E2JA 3I8XA 1Q22A 4RKEA 4EFNA 1OHHA 3R9WA 1FPMA 1ZM9A 3GFOA 4HB4A 4GFDA 1XP8A 2EWWA 4Z1MA 2FSHA 1V43A 1YE8A 1KI8A 3KXIA 4IFEA 4L9WA 3ZVLA 2V3CC 3SR0A 2BV3A 4TLEA 1UEIA 1AQUA 2H18A 2ORVA 4CZ2A 3P1JA 3LH5A 3SYNA 4GSYA 1Z28A 5GJWC 3BXZA 2QTFA 1SVLA 2RGXA 3PIRA 4KSCA 3R8CA 1KI6A 4L16A 1SK8A 2OILA 4OL0A 2KB0A 2CL6X 4N0DA 3RS5A 2NO0A 2A5JA 2G0TA 3GJ5A 2W6JA 3CONA 3K0SA 4AG5A 1US8B 3D7MA 1P60A 3GJ8A 4XVQA 2UZ3A 3L0PA 5JWHA 1P2TA 1Q3HA 3N70A 2WOOA 1Z6YA 2QGZA 4NMMA 4BUJA 3UWKA 3ZS9A 2JIZA 2D06A 3U7EB 1TF5A 2JEOA 5DISB 2XXAB 4E3WA 1SQ5A 4JBYA 3PITA 2BCJQ 2ZSAA 2ZAOA 2OZEA 3HU3A 4HAVA 1GTVA 2WWGA 1GNQA 3V00A 1J7KA 1XMJA 1ND6A 3NDBB 1E9FA 1K6MA 3QKTA 1W36B 3L8YA 4WZ6A 4ARZA 1S2MA 2ERXA 2R65A 5FFMA 4B44A 1II8A 4AK9A 3OEHD 2BOVA 2QNIA 1G7CA 5BQ5A 2IHYA 5EJEA 3K4PA 4HDOB 1R4AA 2CK3D 1ZNYA 2VA8A 1XXHA 4GRAA 4Q19A 1IY1A 3UXMA 3SYLA 2J7PD 521PA 4DLSA 2REBA 1WXQA 2HCJB 4NH0A 1ZP6A 5DE3A 4AI6A 1M7GA 1U9IA 1QG2A 5E95A 1OHHD 2OESA 4JKYA 3SJBA 5HKKA 1YZLA 4LI0A 3FTQA 4ZKDA 4TZ6A 2IWRA 4MUBA 2OE2A 1QG4A 4JIMA 1GVNB 3BBPA 2P2ZA 4I4LA 1N6HA 2ZRGA 3EZFA 2WM9B 1KJZA 1W46A 2IYLD 1W4CA 3T1QA 1GZSA 3VTKA 1ZNZA 1TAGA 2O8CA 2R6CA 3O47A 2RCNA 4OQNA 3V9PA 2ZSBA 1OE0A 3W8NA 5PGMA 1HV8A 5FTMA 4DSUA 2VRWA 1CR0A 2W6JD 1OFIA 2FX3A 2SHKA 3MSXA 2WIBA 4W5WA 5TXGA 3GFPA 1H8ED 2W6ID 4PSVA 1SVSA 4M2LA 2P2YA 3EIEA 5G40A 2BMJA 3K0FA 1ZU5A 4L8GA 1KSGA 4E07A 3M0EA 1S1CA 4BEJA 4IOLA 4KLNA 1G5TA 1NF3A 4M4SA 4DT1A 4NPHA 4R9UC 1GAJA 3NC1C 4HLUA 3TNFA 1KK0A 1NMYA 2QRZA 3FPAA 3VFDA 3AP1A 4M1KA 3RC8A 5CK5A 1XTJA 3GJXC 4GZMA 4TMXA 4DXAA 4OQFA 4LJYA 1NRJB 3U2QA 3ZVNA 3I3SR 2AWNA 1MRSA 2GAAA 5CB8A 1G16A 2QP3A 4B35A 2HUPA 2V1UA 3IHWA 1M7HA 1TEXA 4S35A 4BRUA 4C0KA 2XNDD 4XWOA 1IXSB 3KB1A 1AK2A 1E2FA 1LV7A 2JJ1D 4G5RA 3IT2A 3WMEA 1KJYA 1W5SA 4M0LA 2GJ8A 2ZANA 4BLPA 1RC8A 3LX5A 1Z6TA 3T1TA 1BIFA 4QNMA 1N6LA 1KK2A 2Q9AA 1P9NA 2VSOA 2ZJ8A 3PCRB 2V54A 3L0IB 3TK1A 1T0JB 3GLHB 1AIPA 5LDDC 1VCMA 3L82B 3BB3A 4LHZA 2ZJ5A 1XTIA 4OHWA 2IYSA 3W6OA 1EK0A 3ICQB 2YN0A 1P61B 5FUWA 3FMFA 2XAUA 2ZRLA 5FTKA 1N0WA 4DRZA 4US0R 1V5WA 3A1WA 4QIHA 1W2GA 3CIOA 4G5OA 3SBDA 1OFUX 1KGDA 5GADl 4FDUA 2OEPA 1QVRA 1Q57A 3OAAA 2IEYA 5GJBA 1IXRC 4YLGA 4QM6A 3IO3A 2NPIA 1KI4A 2OO7A 4HAZA 4TMWA 1H8EA 5DNYB 2H5EA 2GCPA 1EFUA 1U9IC 2W6IA 4DIEA 4RSGA 1RVDA 3B5JA 1OLOA 4A36A 721PA 4TLAA 1E2IA 2ZITA 2C9OA 3B1XA 2D7DA 3AUXA 3FMPB 3MRSA 3T5GA 4JOBA 3MWYW 4V02A 5AJYA 1MABA 1P5ZB 5TARA 1WRBA 3B60A 1UJBA 1ESMA 4AKHA 4EJSA 3PV0A 4BFWA 2QM8A 1XZQA 2P5SA 4TL7A 2OHFA 2OLKA 421PA 2GRJA 1N25A 4C30A 5DN6D 3UG7A 1AS2A 4B3DA 2RGAA 2J59A 1DAGA 1XWIA 2QEQA 4OQLA 3WYGA 2PJZA 2NZJA 3O8BA 5A0FA 2OV2A 2QROA 1CTQA 2AR7A 1RE0A 1SKYE 2PX3A 1FTSA 5KSZA 5F98A 1DKNA 4R98A 2NO9A 1DAFA 2XNDA 5D3QA 1KI3A 1YR8A 2JJ1A 2Q3FA 2XJ4A 1RIFA 1DE0A 1JI0A 4OHZA 2WICA 4CRWB 2PCLA 1E9EA 3UK6A 2QI9C 1E0JA 4HAYA 4UXJA 3THXB 5H1YA 5TDHA 3U3KA 2ZJZA 1PUIA 4UNRA 3H84A 4XD7A 4D0LB 5JWRA 3MLEA 4B74A 3B1ZA 3K0CC 1MOZA 3SHWA 2JLXA 4JLPA 3MGCA 1SZPA 3IILA 4Q4LA 1TTTA 121PA 3GLGA 2IYRA 3VKWA 2G1JA 3K0FB 4M1SA 1MV5A 4FMBB 1OIVA 3RLFA 4LGMA 4FWTA 1C80A 2OM2A 3RYTC 2PJRA 1G5RA 1NP6A 3TQCA 4HUQB 2P79A 4UNQA 1CKEA 5FUYA 2ZAMA 1CU1A 1S0UA 1XF9A 5EE0A 2GK7A 3X2SA 2L0XA 3LW7A 4CEIA 2ZRFA 3FDZA 4JKIA 4OQXA 1G8GA 3BFVA 1KI2A 1E4VA 4DB4A 1UAAA 2IK8A 3TSWA 1L7VC 2AFHE 4CW7A 4R2HA 5JS7A 1L4YA 2FFHA 1JBKA 4KVAA 5DSZA 5KYKA 3X1DA 4GL2A 4A8JC 4G1UC 3HR8A 1HE1C 1KI7A 4LJ7A 2D7CA 2YHSA 3KDSE 4C9BA 1RRGA 3KKOA 1R6BX 2WNHA 1LVGA 5DI3A 1KNXA 2EKBA 4RKFA 1D5CA 1ZC4A 3BK7A 1N5LA 2ANCA 2PT7A 2H52A 1V7QA 4PO1A 5DN6A 1Z0FA 3AF1A 4C4PA 4YC7A 1QWOA 2KJQA 1XMVA 3BFKA 4NBSA 4OQMA 1CRPA 1PZNA 5J5CA 3IDQA 1TNDA 4X8HA 4A2PA 4DKXA 3EARA 2GXUA 3ZZTA 2HV8A 1JALA 3AVYA 1JAIA 4A6XA 4PQFA 4XVUA 1BYUA 1HQCA 3U44B 2Z4RA 3CW2A 1T8UA 2H1LA 1DO0A 1ZM3A 4ERNA 2J0SA 4Q66C 1T0HB 3X1YA 1NY5A 4EFMA 3UMRA 1VYVA 4LYFA 1RRCA 4NTZA 1UM8A 3CRVA 5FBLB 1E1QD 1Z0KA 4LJ6A 2XTZA 2C77A 2ZE8A 1HTWA 3ZHCA 2ZI4A 1M34E 3EZ2A 2CCKA 3VNVA 3W90A 4TN1A 2RGCA 1CEEA 3ZVRA 2WJIA 3KUCA 1E1RA 1P73A 1ZM4A 5D3MB 1KO8A 2JA1A 1J70A 1TU4A 2IXEA 3C14C 1XEXB 3LO5A 5SZIA 5TVKA 3SQWA 1CP2A 1M6NA 2ZR0A 1D2EA 4TMZA 4DHEA 1YQTA 1XXHE 1E58A 2VP5A 3H1TA 1N6IA 4RD2A 5F9FA 4XWAA 1B0UA 4DDVA 1YZUA 3HDTA 3KB2A 3QQ5A 3C7TA 1P72A 1Q12A 1NVWQ 4ARUA 4AURA 1W49A 4JL8A 1ZD9A 3LV8A 2VTKA 2REOA 3NBXX 2NG1A 4AC9A 4AWXA 2EWVA 2H0QA 3RS0A 4WXPA 4D26A 2WMOB 1QHHA 3T35A 4PTLA 3OE7D 1X8JA 2I3BA 3VMFA 3ND9A 2ATVA 4JLNA 4UQOA 3SYKA 3MBKA 3QKSB 2PEZA 1GL9B 2CLCX 4ILEA 1SXJB 2FGJA 4PPNA 4MGZR 2ERYA 3AGPA 3FJYA 1KO5A 2QAGA 4EPWA 3CM0A 3E1SA 2GEDA 3NKVA 3B1WA 4Q4JB 4JL6A 1ANKA 5JSZB 4KBFA 1KAGA 4EPYA 2Z5FA 1NG9A 3FGNA 2A5DA 3QJYA 4P31A 1TL7C 3I1FA 3ADBA 1X3SA 2IS4A 1NSFA 4GNKA 4LC1A 3R7WB 1XJQA 1SHKA 4I1VA 3WHKA 1W7AA 1SK9A 1GNPA 1E2LA 3QKRA 5FI1B 2QSYA 3I92A 3IGFA 3UWOA 1J8YF 2IXFA 4PAMA 5J4YA 1TADA 4YONB 1XTRA 4PANA 3KUDA 4HAXA 4IEIA 4JBXA 1E1QA 1XZPA 4DWJA 1OPXA 4II7A 4XTCS 3KL4A 1MO4A 2A7QA 1N6KA 2JLSA 5FOVA 4FMCB 4ZDWA 3DZDA 2AFIE 1VG9B 4Z51A 2FFAA 5KSYA 1XB2A 1DBSA 1GOTA 3G0HA 3BERA 4LCBA 1KSHA 2C2HA 5AJWA 2H17A 2VSFA 1N0UA 4OK5A 3V4RA 1NJFA 5CDFA 3UANA 1R0YA 2QE7A 1OXTA 2O0HA 2ZI9A 4LZZA 2GF9A 3QIAA 4BLOA 2QMHA 3DZ8A 3CNNA 1KSFX 3QENA 4PZYA 3H2YA 3ZQ6A 2ZREA 5J4HA 4LC0A 1NIJA 3VU9A 5AUNB 4NYJR 2ASEA 8OHMA 3F3KA 4M1YA 1DAEA 3EPJA 1DKOA 4L9SA 4FWIB 5G3YA 3W3AA 1GL7A 3KQUA 1AS3A 4CGZA 2VHCA 2F6RA 1T6NA 1MH1A 4ARSA 4B73A 2FA9A 2O8BB 5CX4A 2XOKD 2NO6A 3PG5A 1TQ4A 3U44A 1Y3AA 4QOSA 2GJ9A 4UNPA 1R5OA 1HURA 3REGA 2HHJA 2QBYB 1DAHA 3X1ZA 4TT3A 2PZEA 4FN5A 3E9DA 3DL0A 3OFNA 4NZYA 5EXPA 3PEYA 1J99A 3LA6A 4LHVA 2J0UA 2ZRAA 4JT2A 1X1RA 1DVRA 1FTNA 1UBCA 2JATA 2LWIA 4GP6A 4TSFA 5DI3B 1RRFA 2WSMA 1TQDA 2JLVA 5IRCD 4QRHA 2F43B 2CHGA 4JODA 1XTQA 2A2ZA 2I1QA 5LB4A 2XITA 3RABA 3CLVA 2W2TA 4RCZA 1N3BA 1OT3A 4LV8B 1N2CE 3RS3A 3EPLA 1DKLA 2J7KA 2V6IA 2ZYTX 4MUAA 1KMHA 3B6EA 1OF1A 3M6AA 4K8OA 4D80A 2QAGC 3I61A 1SKQA 3KJGA 3HP1A 1SGWA 1UBEA 2EYQA 4D6PA 4FW9A 5KHOC 1FMJA 4XVRA 3CPHA 1QVAA 3SJZA 1RPTA 3DPUA 3TKLA 4LBVA 1E0SA 4KFTA 4EMBA 2P2LA 5CJPA 2W2XA 4I81A 1VKJA 1A2KC 2QPAA 4GMDA 4C2UA 6Q21A 2IC5A 5P21A 2QZ4A 2AXNA 1OH5A 2V6JA 2P6NA 5EE3A 4GT1A 3UG6A 1EFHA 3ZD6A 1XEXA 2IT1A 2KWIA 2YINC 3TLXA 2Q0HA 2OBLA 3A4NA 1RRPA 3SHFA 1R8QA 5AJXA 4EPXA 4QJ3A 4NU0A 3ZLJA 2R6FA 4P0TA 4E22A 5C4GB 2F55A 2QGNA 2REXB 1E9SA 2XOKA 2YWGA 3C7KA 5JRZA 3GLGE 3FKQA 4RD3A 2Q21A 1TIPA 3GLHA 3NH9A 4F4CA 1JJ7A 2IYUA 3G5UA 4IJMA 3MWJA 1DARA 3FYHA 5IDVA 1JR6A 1XTKA 4ARZB 3UPUA 1IN6A 3LVRE 1I4TD 4PPFA 4QXAA 5G41A 1Z6AA 3SJCA 2ZRMA 4MRVA 4TSFD 4HB3A 4XWKA 4Q7JB 5JI2E 4Q7LA 1RPZA 2IF0A 2HXYA 4DLTA 1DKPA 4AKGA 4Q4JA 4RD1A 1GKUB 4KITB 3NTLA 1ZM7A 4NCJA 1PLKA 1QHFA 4HI0E 3A37A 2GETA 3B1YA 4QBHA 3ZZUA 4A0HA 3K70B 3AM1A 4V0NA 3OHMA 3R7WA 2QRNA 3O0TA 2QU8A 2W83A 4PC3A 3TH5A 4YDHB 1S3SA 4QC2A 1VCIA 4IFBA 1U99A 4ZKEA 2A9JA 1NLYA 4XOIA 1EWRA 3C41J 3JZAA 1G9XA 4HLDA 4LHWA 4OI2A 5AUPB 4FDTA 3MWLA 1ZUNB 2JDID 2AK2A 5KNDA 2C8VA 4JOCA 2ZQ5A 4PPQA 1UBGA 2FSGA 2ATXA 3F0TA 2G9NA 5K8TA 4LY6A 1F60A 3KQKA 4Q01A 3D8BA 4PAOA 4US1R 1UADA 3VHLB 2J0UB 4LBZA 3IQWA 3PR1A 1N5JA 3C4JA 3DKVA 4LV5B 3EIHA 2FNAA 3U61B 3Q85A 3TUZC 3KFVA 5EE5B 1RIIA 2OWDA 3PXGA 3THYA 1DAMA 4OHYA 4Q7MB 5FL7D 4QHTA 4URVR 4GOKA 3W6NA 1Z06A 2P6UA 1G3RA 3IT1A 1BH2A 3LDAA 3VR2A 4URUR 1CR4A 2BM0A 2ZUCA 4M9ZA 2YOGA 4HZIA 2XSZD 3VAAA 1TF7A 3RRMA 2ZM5A 4NHOA 1IM2A 2OG2A 4A4DA 3KQNA 3B2EA 4MDEA 3GP3A 2AWOA 5B64A 4ASUA 1I2DA 2VHTA 4YQFA 2O8EA 3UIEA 1E3MA 1BOFA 2QP4A 4M9XA 2ZRCA 4MQBA 4P33A 2QQ0A 2XZLA 3EC1A 4A6PA 4HBZA 3ETLA 2QPTA 1G7RA 1JR3D 4C0QC 1Z0IA 4ZDIA 2PCJA 2R44A 4GDFA 1DO2A 4HUTA 4ZCIA 2RHMA 4KU4A 4PGMA 3FMOB 2ORIA 1E9BA 2TMKA 3EZ6A 3SEAA 5TV2A 1VCNA 3F3YA 2CNWD 2GHIA 1CJVC 4PO8A 1MR3F 1XCPA 1CLUA 2DPXA 1L8QA 3B1VA 2IKQA 1T8TA 4GP7A 3CPJB 3CPEA 1XD9A 1KAOA 3RS7A 1Y63A 4O0MA 1ZIOA 2VP4A 4KFUA 4M9QA 1QDEA 4B3XA 5JS8A 4YMUA 3MAAC 4JJZA 4PZZA 5CK4A 5GVSA 4TQUS 3ADCA 3KXLA 1AKEA 4IRUB 4B75A 2F3TA 3GMTA 3K9HA 2VP6A 1UKYA 1KKLA 1W47A 5C4MA 4AY2A 3GP8A 5CIWA 5GJVC 2I4IA 1NVXQ 2N42A 3KKMA 3PEWA 1ZAKA 3F8TA 3P20A 4MYTA 4RFSA 4HSEA 1IHPA 4DVGA 3K1JA 1NLFA 4EAQA 3ZZ0A 1ZD8A 4H9GA 3Q9LA 5H8WA 1UF9A 2JLWA 3M4YA 3D8HA 4CDGA 1RW4A 1GSIA 2J45A 4IDHA 4B43A 4AYWA 1E99A 2GJSA 1AS0A 4PR0A 2BBWA 2YOHA 4A9AA 4QGFA 4QM7A 5LD2B 3CX8A 5AUQA 3RC3A 1Z22A 4BFSA 1MT0A 3W5JA 1P62B 4ASUD 3AVWA 1IN7A 4AROA 1D6JA 1C9KA 4M1WA 4BLTA 4RVCA 5ANRB 2J0QA 2F1IA 3CH4B 4FMCF 2PMDA 4B34A 4LSGA 1Z29A 4TMKA 4PHHA 5FOWA 1F2TB 1GL6A 2RMKA 1FZTA 3ZGXA 1HA3A 4W5JA 5BN4A 5BYJA 1NLZA 1JR3A 3BIFA 4I1SA 1NBME 1P9RA 4LJAA 4WIAA 3LXRA 4DZZA 3AB3A 1T9HA 1AGRA 4NCIA 3RS4A 3EXAA 4JLBA 4QBGB 4DCTA 3U6KA 1D2NA 2C99A 4Q9HA 3OIYA 3KQLA 4U5XA 4LHXA 1AA9A 2WWYA 4FCTA 1KIMA 3A4MA 3HPRA 3TRFA 5HE8A 2XGJA 4HLUC 4J0QA 1E6CA 3BRWD 5BWMA 2FN4A 1W0KA 4O3MA 3CNOA 3WY9A 2P6MA 4PO9A 4JLMA 3SC3A 4CT5A 3IUYA 1XXHB 2OCYC 3FHOA 2KBEA 2J87A 4QBIA 4QNRA 2HYDA 1A4RA 2Y8EA 5HZHA 1CJUC 5SZHB 2O8DA 1X6VA 1NBMD 3MFYA 5KPDA 2WWFA 1CULC 1FQKA 1EFCA 1G291 3C16C 2FPLA 4KCGA 3OEHA 1KI9A 3CX6A 4HB2A 2GZHA 3NVAA 3PUYA 4ITRC 1K5GA 4JS0A 3SZRA 1MO3A 1OXXK 2H16A 3GJ3A 4I99A 3TBKA 2RGEA 3MMPA 5FOUA 4OBEA 2IYZA 4BFYA 1G8FA 2OXRA 2E87A 4X8MA 1Z5ZA 5FR1A 1YR6A 1IAQA 3GPLA 3CB4A 3THYB 2G3YA 2XTMA 1O3YA 2VYFA 2CCJA 2P75A 4P4UA 3L2OB 3NFYA 3AVVA 2CXXA 2W00A 4C0SA 3ADKA 1DAKA 2NGRA 4RZ2A 2VHQA 1HY3A 4M21A 2IUSA 4C7OA 4ZV4A 5J40A 4B3CA 4IVQA 2XX3A 4CVNA 5KNCA 2VSXA 1Q1ZA 3N2EA 1ZNWA 4V0ME 1U94A 2C98A 1NKTA 1QHNA 1T3LA 2OFXA 5A4JA 2O8FB 1VECA 3T5DA 1T5IA 1Q1QA 2VF7A 1R0ZA 2G77B 2VH5R 3LFUA 1DEKA 3NDPA 4YDSA 3BH7A 3T12A 3GFTA 1EG7A 4ACBA 3O8RA 5FR2A 3KKKA 1PLLA 1QBKC 2A9KA 4Q7KA 4CF7A 1QHYA 1KO1A 4M53A 4M8NE 1VPLA 3RRYA 4AG6A 4DDWA 2RKOA 4TTRA 1Z6XA 3CF0A 5CM8B 2AD1A 5JEEA 1FFHA 2VP2A 3I72A 3E9CA 1W2HA 4JVLA 2O0JA 3SN6A 3S1AB 2DWOA 1LF0A 2LKCA 1G5PA 4GPTA 1QF9A 3GQBA 4DT1B 1XMIA 4IW3B 3NTUA 2V1XA 3NC0C 4MGKR 1EXMA 2N46A 1P9WA 1T3SA 3FKSA 1L2TA 1XD8A 2VO1A 2WJYA 3KZ1E 2P9YA 3N5CA 4MRRA 1Q3TA 3A4LA 3LL4A 5AWFC 1HYQA 2IYYA 3HU2A 3THWA 4FIDA 2BKUA 1DG3A 1E2QA 3C5CA 1AN0A 3IT0A 2RHDA 4MA4A 1J2JA 4NYIR 2JGNA 2DWQA 3QVVA 2EW1A 3AQ4A 4K81B 1AKYA 4HATA 5DYGA 1YRBA 5DLQC 1YVDA 5EXXA 1AZSC 4QJ5A 1E9AA 4U00A 3DKPA 1FP6A 3A8TA 5LPNA 3AP3A 3LAWA 1DTSA 3CZQA 1OSNA 1S96A 1KI1A 2B7CA 1U98A 3LRPA 2JLUA 1UKVY 2F3RA 1JXMA 1XEFA 3GLIB 4POAA 4KXFB 5L8VA 3K0EA 3DMNA 3LD9A 3WRXC 1E9RA 2YC2C 2F9MA 3CUEF 5JHHB 1G6HA 1F5NA 1S9DA 2Q3HA 3DDCA 4Q9IA 5C1BA 5BXQC 2UKDA 4LPSA 4PSAA 4KODA 1DS6A 2X19A 2WZQA 2Q3MA 3SBEA 1XPUA 1XMSA 2XZPA 3E2IA 2EYUA 4BFUA 5FI0B 2FSFA 3U3RA 2RGGA 4EQ6A 4Q9JA 2F90A 1KDTA 2GBLC 1C1YA 1A2BA 4NP6A 3I62A 2IS6A 2IF2A 2I1VB 4CEJA 2ZUBA 1ZCBA 1WF3A 2FWRA 2YZ2A 1M1YE 4S2EA 4V03A 3ZD7A 4Z54A 2ZS9A 5FPTA 3RNLA 1A5TA 4NE2A 4Q21A 4HLCA 5G53C 5EP2A 4GI7A 3TR0A 3U3MA 1OJLA 3A1SA 5EP1A 1NMXA 1R5BA 2BJWA 2ZROA 4XD7D 4D81A 2OFOA 3BB1A 3KQHA 3N2IA 2VEDA 3SU8A 1Z2AA 2C9YA 3ECCA 3OZXA 2J46A 2EFDB 2O52A 3LXXA 4D4MA 5FUVA 3CNLA 1UJ2A 1UPTA 1BYIA 4DUGD 1OXVA 2QQEA 2WNIA 1BMFD 4QHYA 1ZIPA 3SFVA 2D2FA 3GLIE 3THXA 3WYFA 4QL3A 4YXWD
chains in the Genus database with same CATH superfamily
1ZS9A 1GAXA 4JITA 4RTOA 2GKSA 2W9XA 5K45A 2PX2A 4PGAA 5L3SB 3ASUA 3R77A 1YB7A 4O2RA 3KT8A 4Y6PA 1J1ZA 5L3VA 1GN8A 2QENA 4I4TB 3AV3A 1XAJA 2EHJA 2XTNA 4IDFA 3KSAC 2ZJYA 1N7IA 3DT8A 4JVOA 1OWLA 4N0EA 1GGEA 1N2OA 2IELA 3KUUA 5EIWA 4JT9A 4ZI3A 4TROA 5F35A 1LTQA 2E0IA 3FDJA 1LDGA 3EVEA 3TQOA 5ALDA 1HDZA 5LDGA 3C3PA 1N8TA 1UBKS 3IAHA 2WWHA 4EEZA 4UQPA 5HCNA 4B79A 1LX6A 3TOVA 1E2KA 1MZVA 2QUAA 2VZEA 1RQLA 3EW9A 3LECA 1ZA2A 3MWFA 2EFYA 3UT5A 2C9DA 1L7BA 3SZ3A 1JPUA 1TQ2A 2PBRA 2UUBB 1WZIA 4K9DA 5H70A 4EY7A 2XYRA 2RHJA 5DGDA 2EJWA 4CHTA 1NJ1A 1G41A 1ORVA 1ZJ4A 5ALRA 4CF3A 4C21A 1KAHA 1H2ZA 4H59A 5DBIA 3EZXA 3NV7A 5M29A 3WBKA 4PHGA 5CFMA 1I33A 3JQGA 4X92A 5HCIA 3ANXA 4HGQA 4JASB 5BVHB 1SUDA 1FLDA 1YDGA 2OGZA 3G88A 3TTSA 1ST2A 4TKLA 4XLLA 4P4NA 1PHRA 3WNDA 5BNTA 1HE8B 4YV2A 2Y0DA 1ZO8A 3RIGA 1LRJA 4K0RA 2XV1A 1TJNA 3TNYA 1G17A 2GN1A 2PGXA 3QU7A 4LGYA 4WDQA 1KO4A 4ZO8A 4D9HA 4F8EA 2V0GA 2HBZA 4NICA 1U4OA 2V6BA 4N7JA 4ND6A 4DY4A 1G6KA 3Q6NA 4E12A 4ZYZA 1VXRA 1PGQA 4FOOA 4RHYA 3N58A 4N0PA 4Q5IA 3ZJUA 3I5UA 4R3NA 3C8DA 3BGDA 3HYCA 5ULLA 3CRQA 4ZHQB 2AUMA 5KVQA 1O97C 5DGXA 4DNXA 3CH5A 1J2RA 1V16A 2QW0X 4FSHA 4GGOA 3UATA 4CM6A 3N28A 4I5DA 5DHPA 4DCMA 1M6HA 5EXSA 5A62A 3LQYA 1I24A 1MJGM 4W63A 2I6TA 4KIJA 4N8SA 2F1JA 1C14A 3ZJYA 5LP6B 1QHHB 1DC3A 3KLMX 4AB1A 3GEDA 1YA6A 1VCHA 1VIMA 2SKDA 1JB9A 3D4LA 3MG9A 4JN6B 1GVHA 4HNSA 4JP3A 4C4RA 1I4DD 1W4BA 5L3QB 2XVXA 4AWAA 1Y1LA 3NR2A 4WOPA 2A8YA 3QUSA 2AJCA 3IMGA 3KCQA 4WK0B 4CDRA 2QL5A 3SFZA 1TYAE 3OE7A 1DFGA 3AHCA 5E4FA 3QF4B 1T2EA 4GMHA 4N5LA 2NO1A 1LRKA 2I3GA 1VKRA 4AKEA 1D04A 1UWKA 3UH0A 3M1YA 4A1OA 1UJCA 4C20A 2RHCA 3CH7A 1DWOA 4L7VA 1U7TA 2PKWA 3GYGA 1X8KA 3PHJA 4HX2A 6ABPA 2HJGA 4RELA 4JP2A 2G9QA 2J30A 3ZU4A 5DNAA 3LC2O 3WJ2A 2AYYA 1U9JA 4W5HA 5HGXA 5HZKA 1RZVA 5KWIA 2FPIB 5AK4A 1ZCFA 2R97A 3CUYA 3IPCA 1AGPA 4RH0A 4TVOA 3MRTA 4ABYA 4BVKA 4E5KA 1GKYA 4I2VA 2AKYA 5HW0A 5EZ6B 4HJRA 4V0LA 1XQ9A 4W9MC 4AS1A 4NC9A 1J8FA 1R4MB 1Y6GA 3JRWA 3RAPR 5BWBA 2LKDA 4N6GA 1ZN7A 3OFJA 2NZVG 4IQ8A 4E6PA 1VSQA 4BX2A 4WY5A 3Q3VA 3W8DA 1TF2A 3PC4A 1D9XA 2HF7A 3WMGA 1IEQA 3T7RA 4LJSA 3CTMA 4KIGA 3FN4A 4DQLA 1UAGA 1L5GB 5KYVA 5GY7A 2CJWB 3TIFA 1QIHA 2W6NA 1PJCA 3AONB 2ECPA 3J81k 3IA7A 2BE7A 4M1MA 1QQ7A 4HQ6A 3AETA 4HDQB 3C4VA 1CS4C 3L4BC 4HZUB 4LHSA 4IH4A 1UK7A 3LIPA 4G2TA 5B58T 4BWYA 3AR7A 3LBNA 3OZ7A 1GRRA 4PF1A 1PD1A 1PQUA 2FFJA 1QHSA 2HJVA 2H59A 3K09A 3BTVA 4BMSA 4ND3A 2P2SA 1JVBA 1NXPA 3KT3A 4Z4HA 2D4HA 2GEVA 1Y82A 2NQTA 2WVJA 5EVCA 3WB0A 3EFEA 3SQXA 1DDIA 3BXXA 2EKZA 3HCPA 2IEDA 2XHZA 1TECE 1JUDA 1B3BA 1MDFA 3W5VA 4D57A 4PC6A 1E1DA 3TBHA 5ALVA 3GFSA 2RD2A 2DBQA 2PS1A 3KZNA 1IBRA 3A11A 4XX1A 2VPZA 4W5TA 3PL5A 3BMNA 4E5PA 4IQGA 4OGFA 3ABRB 1SCDA 4UVIA 1ACLA 1P1FA 1JEOA 1VCOA 4ZV7A 5T4HA 4QXQA 2F8LA 3IBSA 3GUZA 1PV4A 4QYXA 2R8PA 4JEMA 1FSPA 4CEHA 3T3MB 2FR0A 4IXMA 3BG5A 1O95C 3DMDA 2YHUA 4ZT3A 1CUAA 3EEQA 5I47A 4FKMA 4IDPA 1II0A 1PJ2A 2DYKA 2WSSD 3R7SA 1K8QA 2A88A 1YONA 1XO1A 2C1ZA 1L5HA 2CJYA 1Q2XA 4C6TA 1UXOA 4HBGA 4QREA 4RFSB 4XIIA 3IQHX 3AJAA 4I3HA 3ENQA 4AYTA 5ARCA 1J09A 2BW0A 1HFEL 3HGTA 4RAQA 1N6RA 4NI5A 1UODA 3W6PA 2Z0MA 2CL7X 3B1FA 3DBIA 1KTVA 2PJDA 3BHNA 4IMRA 2Q5QA 4MH0R 3WWCA 4IILA 2JJ2D 5EKXA 2I34A 3SQLA 2FSUA 3KSRA 1AJEA 5BSMA 1S9HA 2AIRA 1VFNA 1P2VA 3AEKB 4Q3KA 1OYYA 3V8MA 2XIJA 4I1OA 4IIJA 3BGOS 4J0HA 3WB1A 2IYPA 2NO7A 3AZOA 5T4FA 2FB9A 2WB4A 1DELA 1VJTA 3D6VA 2P78A 1E0DA 4X1IA 1VG0B 2NN3C 2VYCA 4DCNA 5MGNA 3HRKA 1OCEA 4UOQA 5G0UA 4QYIA 3CKLA 4RPLA 2R7KA 5DLYA 4KPUA 2GMWA 1JHAA 3K2IA 2NUPB 1EDZA 1I30A 2JGLA 4UCWA 2ZT6A 3U1VA 3DWEX 3VR3D 4CM7A 1DV2A 1N2XA 4JYZA 1EGHA 4D9MA 1JAXA 3DF7A 1KMHB 3H6GA 2IIBA 2ONJA 1P18A 2ZR9A 9ABPA 1DG9A 1IXZA 2CZQA 3GQBB 3UZUA 3V2IA 1KQFA 3ZHBA 2GDJA 3D3KA 2Y6VA 3LC0A 4MKZA 4OFWA 3CZMA 3E03A 5JY1A 3LP6A 2VK8A 4IHQA 4QXRA 2CEAA 2BC9A 2KX7A 1T91A 4G8CA 4HDNB 2AW3A 1T9DA 2OBMA 4IIJF 2J9FB 4MVJE 4U02A 3TCNA 1TM3E 1Z82A 3CCCA 4MDHA 3W6ZA 5BN5A 1E1KA 4GUAA 3RT7A 1VL1A 1JWAB 2GZDA 4QAJA 1Q15A 4Q4HA 4PFSA 1C1HA 3LGAA 7REQB 4KYVA 2ZCUA 3OBIA 4JJKA 4R51A 4KLCA 2D2IA 4ZJPA 3UTDA 2JK0A 2N75A 3E3MA 1IG0A 2AG5A 5TRTA 4D8YA 4ATNA 1QRTA 5M04A 1NN0A 1YZVA 2IPMA 2CE2X 2FDXA 2YRWA 3P2OA 4HCJA 4P84A 4WXRA 1F4LA 2BI7A 1WCYA 2G76A 5LZ4A 4ENSA 1YR7A 3HDYA 4F2WA 2AC2A 1EUCB 2P2NA 1WMFA 4LVUA 4B1FA 1GNVA 3F2IA 1Q1AA 5BMVA 3QLTA 4Z3KA 5JD5A 1G66A 2NIPA 2V7QA 1E3TA 1G3QA 1OKKA 4CMEA 4NJOA 1GGHA 1JLSA 3WGVA 3K70C 2W8BB 4CMJA 4TSRA 4E33A 2IEGA 4G6ZA 1HLFA 1ZK2A 1PYDA 1VSUA 2ECKA 4MROA 1PG5A 4WI1A 1KY5A 1ENPA 1VZ2A 1IQRA 2AB0A 1T0PA 3MPOA 2O2CA 4Q03A 3SY8A 4DTIA 1ZW1A 5AW1A 1JE0A 4FOTA 4MVJM 3VR6H 3R24A 3B51X 3WL7A 4ZK2A 4W9RA 2IW1A 4P3OA 5HS6A 3ROPA 2YYSA 4MQ4A 4IJWA 4Q9LA 4YAKA 1O94C 3KR2A 5JBQA 5LZ9A 4A7PA 1EXVA 1U0TA 1Y7TA 1R4ZA 3OX2A 5KNDD 5DHSA 5AM5A 4AJEA 3AFMA 2SICE 5JCJD 1AVTA 1WBJB 1XNHA 1XTVA 3IEUA 3SG0A 3FNRA 3M70A 1K7YA 3O1HB 5B2FA 2P6OA 1KYIA 2CN1A 2FFQA 3GLFA 3JQRA 3AI3A 5ALNA 4KQ9A 1MRNA 5GIPE 2ZBVA 4FI3F 3R20A 2OAEA 4DIMA 5GONA 5K6TA 1YZHA 4MRSA 2XQIA 4MHTA 2CMDA 4MVJF 3VOSA 2QE6A 2VP3A 1L3BA 4O8CA 1R10A 2WV7A 3JD1A 4OAQA 1WMDA 1GZVA 4B9EA 1PVOA 4LOAA 5DH9A 3QEOA 3QFCA 1FVFA 2ZIVB 3VR4A 4CLDA 2BDTA 1U8YA 3ZYCA 3OSZA 4P5DA 2V7PA 2ARKA 2XTJA 3MJCA 4MV9A 1BD3A 3LMKA 1N6OA 5IBRA 3R9IA 3GL9A 3ZHYA 1YQXA 2ZVQX 4V0SA 3ZDDA 3PUZA 3EZ9A 3IODA 3VO8A 3MVEA 2BJHA 2WFZA 4O5AA 4ZOCA 3SBOA 1YRAA 1QTNA 2X41A 3WOVA 5CFLA 2QPOA 5AW2A 4WDRA 3CUWA 2GM3A 4FHCA 5C32A 4X66B 5ALPA 1P2FA 4EUEA 1EK5A 1TVCA 4WLFA 4AX4A 5LNK6 4QXMA 4DSOA 4JYMA 1NNEA 1NKSA 2ACWA 2CVFA 3I09A 3D5QA 2IUUA 3W77A 3WQHA 4EVRA 5DTJA 1A5ZA 4A91A 1OKKD 3NGXA 2QRHA 1UBLS 3JQ9C 1DQSA 3E15A 4NENA 2HHHB 1USIA 1IN1A 4ZVVA 1Y3HA 3F98A 5LP6F 5HZGA 2PYDA 2WWXA 2Q1WA 3ETEA 1I5EA 3G0BA 2R8EA 4J3FA 1D2MA 2ZR8A 4P3NA 1Z4PX 4LJ9A 5JQGA 4G5SA 4TYQA 3R7DA 1ZN2A 1P44A 5EJ9A 3T06B 1KHTA 3VNRA 5A71A 1FIUA 2I7DA 3KOMA 2OPBA 6REQA 1M1XB 3HCOA 1FVHA 2V7WA 3G9QA 4IAOA 1GYPA 2V03A 1G21E 2IY7A 4DM4A 3C85A 4QUDA 2ODTX 5L6LB 3TB4A 3WLLA 1BRMA 3A9WA 4Y6QA 1KO7A 4QNNA 4TYNA 5HZMA 1MXFA 2MSDB 4US2R 4FR5A 2DTDA 1F2DA 3JASA 3S8MA 4YRGA 3JW8A 4D92A 2O14A 1Z2OX 2MSCB 3GT3A 2FPRA 1DG1G 4JYCA 5CVVA 3P0EA 3NHLA 2YWXA 1M73E 1HE2A 3JPYA 1B6GA 4FUTA 2CNNA 3JVUA 4WOBA 4KMRA 1LK5A 3RREA 4NONA 1TT5B 1NURA 2Q6IA 4JJ4A 3QHAA 4K7JA 5I8WA 5FNVF 5KJCA 3EQ7A 4J2OA 2AFHB 3P9QA 1UK9A 2IL1A 4IXDA 1GPH1 1KNQA 2ZEJA 4CL0A 3NP7A 1H0HA 1TU3A 4M1QA 2IYNA 3UGJA 4DMHA 5ES4B 2BVNA 5I01A 2VJYA 1SXJC 2DPLA 5JIBA 4LE1A 3KV3O 3DMTA 4ZGWA 1J0AA 2XT9A 4EVIA 3U7GA 1O03A 4MULA 4Z4GA 4ZI7A 3JATA 1R6UA 2C04A 3ZBQA 4A0GA 3UH1A 4WACA 2W0MA 4EFLA 1F4PA 1RWXA 3B13B 4J3NA 3SOZA 4AU1A 4F93B 1V16B 1L7PA 4PYMA 1BCSB 4TT8A 3T0GA 4B47A 4E2WA 3RQIA 3NT2A 3OX4A 2OFWA 3FF1A 1T5SA 3OWHA 3V8PA 4ZGBA 3N6RA 2RI0A 5CXUA 2GPTA 2GTIA 4L6IA 3B70A 2Y2UA 2ZE7A 2NOAA 2R4UA 3BFPA 3NM6B 3QU9A 3IUQA 4K6KA 4Z4CA 1NUPA 1VHLA 2B4TO 1H69A 2B6HA 1GP2A 2E9SA 3WNBA 5KO2A 3HEAA 2C29D 4MJ7A 3GRUA 2P1DA 2BM9A 4K3VA 2AJBA 4WZBE 1GDDA 3TPFA 4I50A 3PHBE 3R6TA 4M49A 3RARA 4BO4A 3MLBA 5F1OA 3E48A 4WRRA 2K7ZA 1QGZA 3IP1A 5EE1A 1A9XA 2IE0A 4WBNF 3ODPA 3TINA 1S8OA 4GECA 4CNQA 4FFBA 1L5SA 1U4NA 1A76A 4H7IA 3BWXA 4Q00A 4CG1A 1KWKA 3DXZA 2E4YA 2GASA 2IBMA 2XYQA 3HB4X 4ZREA 3UJ6A 1BWSA 4JLOA 4DV6B 2GCOA 5ALTA 1JHQA 5HR5A 2R8OA 2A7XA 1P4HA 1WO8A 1F6BA 2C88A 2OORA 1PL8A 2DCMA 1RBMA 3IOYA 2ZSUA 1XN4A 2JK1A 5E0KB 5FYQA 1HKUA 1DAIA 4DUPA 4EI8A 4DLRA 1CVLA 1HZZC 3PTLA 5DRTA 1TUIA 1QZXA 5KU1A 4RMIA 1R15A 1JTFA 1A9SA 3KTAB 5JXIA 2A1UA 4D25A 5MF6A 2WMNB 3VPFA 3W79A 1RZRA 3H42B 2WU3A 4YPFA 5E4JA 4UNSA 2VWGA 1Q6ZA 1ILEA 1VG8A 3U7QA 4FBLA 4DMKA 4IH1A 1RBZA 3E70C 3HXKA 1WM1A 3B9QA 2R25B 4HL6A 3THOA 1Z5UA 3MRXA 3PNOA 5BRNA 3OUUA 4IJQA 1WVIA 3V1UA 3N0TA 1E63A 3W2GA 5K0BA 5LQCA 1UBHS 3OESA 1XYGA 1YMVA 1GNRA 2ZJAA 4UBKA 4JBGA 4EPVA 2PO5A 1U9YA 3ELBA 3D3QA 2P5TB 5D84A 2P27A 2HDNB 3HV0A 3AF0A 5ESRA 1E2GA 3ON5A 3PYXA 5CYFA 1DBRA 2ILTA 3TVTA 3GJTA 7ABPA 4MI6A 1TZMA 1TM2A 4NXMB 4FYJA 4OG2A 3REQB 3ZPXA 4F7DA 3H11B 5JMPA 1QV9A 3DV9A 4KVFA 2FP4B 3EXHC 4CIWA 1ES9A 3N1UA 5HJ2A 3ZV6A 3AFIA 2XUOA 2CE7A 4MYUA 3TE7A 3CVVA 3KFXA 4I14A 3V42A 1P19A 3CVXA 4YMSA 1R18A 2WZCA 3OOSA 3N2NA 3BFXA 5KDLA 1EGAA 4PYRA 3FUVA 1DEAA 3M83A 2DH6A 3ELYA 3ABSB 4IO0A 4YPVA 4XWWA 1YVEI 4H1HA 1J0CA 2Q41A 3D4IA 3UXHA 3MMNA 4DSTA 2Q2QA 3U7RA 2JLAA 3GMIA 4P5PA 4DA7A 2UU9B 3H75A 1HUQA 4A0SA 1R5JA 1BHJA 3B8HA 1NAHA 3D7LA 2OAQ1 3L0CA 4IIGA 2YQZA 5TMPA 3C97A 4QT4A 1EDEA 4CI9A 1GL3A 1U7HA 2IYWA 4N03A 1B4DA 3TNLA 4ENPA 1OXUA 2WHXA 4R81A 4ZC8A 1PK7A 3IKJA 1XRQA 4TV9B 1CNEA 1XALA 2C9CA 3GVCA 3NHZA 1LUAA 1BFUA 5FAKA 2IH2A 4K3UA 4DB2A 3KD2A 3TTVA 3D6FA 2QUHA 1O08A 2ACKA 4M9RA 5JCXA 4GBGA 1G8YA 4NDNE 3QBEA 3ROFA 1F8UA 4R5MA 1UEXC 3AXTA 4R2JA 2PGAA 3VU1A 1MAHA 4A73A 1Z34A 3QNMA 1ZINA 4XM1A 2C7OA 1YVPA 2AX4A 2VBCA 3VZPA 4BNDA 1DDOA 4O4LB 3ZXSA 4DRYA 4WKGA 2PAFA 3FBGA 4LDQA 3VVBA 1O0BA 1G4UR 4NH4A 3OQNA 2FUCA 2PWBA 2XE4A 4JEIA 4LRTB 4EHBA 3I52A 3ZGVA 1VBKA 4CLRA 5JD3A 2FWPA 1URPA 3W2FA 2BAGA 4E30A 4HUQA 4IIEA 1BQ3A 1JQLB 2XAAA 3QF7A 3FYSA 3MJEA 5HWSA 1ELOA 4JD5A 1IJFA 2PMEA 5ENDA 4TTVA 5TIIA 1GRQA 1OZGA 3AEUA 2PFGA 1E7RA 1M1NA 3MWDB 2C0QA 4EJSC 3FZQA 1W0CA 3HDHA 2O1EA 1BS2A 1GGFA 2JLBA 1RHKA 4YN3A 3KHUA 1O97D 4NWIA 4DYDA 1UBOS 1IOWA 3HJNA 2HDHA 4M8LA 5J2UF 2XWJI 3AZQA 1FP7A 3MUNA 4KN5A 3VYUB 3CXRA 1MV8A 1NV8A 1XJCA 3N2YA 1QRAA 1E3WA 1OFTA 3KB8A 2C5SA 3X1XA 5J4LA 5KKCA 1XDDA 3IUJA 4W1RA 3TAHA 5HKBA 2Y67A 3W06A 1FUIA 5AW7A 5KNBH 1J0XO 3HL0A 1P2SA 2ZRPA 5G1NA 2XUKA 3CE9A 1NTOA 4G0WA 5EHXA 3SWWA 2FG7C 3EEIA 4FMDF 1UDWA 2QUIA 3NEAA 5B57C 4DABA 2GPNA 4YBZA 3SQOA 4F4IA 4F21A 5IF9A 4XRRA 4XVHA 2F4VB 2ZIUB 2TSYB 2VXYA 1THGA 1QZZA 2D7JA 4WLEA 3SVTA 5AJZA 4CEIB 1PVDA 2P9FA 3K9LA 1LS1A 1PTJA 2X2EA 4R0NA 3ROZA 2WJ3A 4DV5B 1EUCA 4V3CA 2UZIR 2EFCB 2XMDA 1N1EA 3ONWA 3EFOB 4M1ZA 1C4OA 4QRDA 4YLEA 5E3JA 3HNRA 4OHUA 4QU8A 5DF1A 1KERA 4H7PA 5E7JA 5HVNA 5DXFA 3IL2A 1WKBA 1RWMA 2JC3A 2NXWA 3LHIA 4JLVA 3VO9A 2DVMA 2Y93A 3ZNNA 1KEKA 2WJVA 2JBAA 4LC9A 3DOOA 2ZUDA 3FDXA 1G64A 3GWZA 3GRPA 3OOJA 4K6GA 4Q24A 4WHMA 5IKPA 3AJDA 3W7BA 4TS3A 5IBPA 2WLSA 2V9ZA 5KHAA 4D97A 3LLCA 2WSLA 1WEKA 3NDJA 1E7WA 4HQ0A 4YUVA 2HWYA 1YKSA 3K5WA 4QUGA 3C1OA 1P6XA 4MVJD 5BV7A 2GK6A 3L49A 4D2IA 3VHXB 2F4NA 3U7IA 1QH1A 1BFDA 1PBTA 1Y48E 1CY4A 2ALJA 3GQVA 3K72B 1L7XA 1CF9A 4P36A 2IV2X 2NAFA 3BM5A 4DUGA 1G7TA 1GU7A 1N33B 4U8GA 4NZMA 1I01A 2CDNA 2BGIA 2FF7A 1BXZA 2B8TA 3M1IA 1ZJJA 1LVUA 5I3CA 1IM8A 3MS4A 1G8HA 2JAWA 3LUBA 5FCDA 4CIDA 2FV8A 2Z5LA 3BD9A 1FNNA 4EY6A 1H1DA 3EGXB 4G5QA 3DCYA 1VBFA 1UKZA 2HK7A 4QO7A 5A9SB 3X1JA 1WP9A 1HQYE 1DC7A 5GONB 2IHJA 3H8VA 2DFTA 2E6UX 3EE6A 3EQZA 5KAMA 2J4DA 4YV1A 2JKZA 2ACEA 1S3FA 4TVBA 2C92A 1OVMA 3MWEB 3OD1A 1XZLA 1JDBB 3AUYA 4ZCQA 1B0ZA 2GJKA 2Y1DA 2EFHB 5FUMA 3MN1A 2FPKA 5L3SA 3ZOZA 1DCTA 2FEPA 2VHWA 4U7GA 1ESZA 3KQWA 2ZZMA 5F2OA 2HX1A 2Q5FA 3IX7A 3EGCA 3ZCQA 1K6JA 2Z3VA 3EDQA 5FUBA 4DZRA 1N3IA 1WXHA 5BMOA 3KWMA 5IZCC 4V1CB 2CZGA 4X20B 5GZ6A 4ZVQA 3GDHA 4ZXPA 3WL5A 1WA5A 3TEFA 2I2WA 3K9WA 2AOXA 3ZW9A 2OOSA 1EX9A 4CWAA 2ZI3A 4BYGA 2YJ4A 4OJYA 5CDFE 2HDOA 2G88A 1DQPA 4YJ3B 2AOTB 1QGDA 1L7QA 1X8LA 1E0AA 3CZ4A 2ONYA 2OT3B 4GOXA 3UKJA 1QG6A 4DIOA 2MCFA 4QGHA 3A6HA 1C5KA 2YIDA 1V0JA 2WV9A 1BE8A 2VNAA 3PXDA 2VWQA 4BU0A 1TK3A 3F73A 5SYAA 3PWSA 2BEJA 1DEHA 3RRFA 5C80A 2HQBA 3T1OA 5A3JA 1XZJA 4PGGA 3R9XA 1DAPA 3V33A 1XLUA 2BGGA 5EINA 5AYVA 5IVHA 4MDYA 3HMQA 2RHLA 2BGNA 1KFKB 3AP2A 3GWGA 4BN0A 1ATZA 1A50B 2VPIA 1UKEA 3W3ZB 3COJA 4UU8A 1JYSA 1JB1A 2ATCA 4BZQA 3LX4A 2AN1A 1L5FA 2B2NA 4Y0VA 5KYXA 1ZJ5A 2ZBDA 1N5MA 3HBFA 1SIWA 2I3ZA 4TUYA 5LBIA 3TTWA 3N3AC 4IXNA 2H4JA 1TT5A 3L7JA 3AHEA 5AJUA 1H6DA 4QGAA 3NJ4A 5LWHA 4EYSA 5GOTA 2Z6QA 3S55A 4KQGA 4B3HA 5J4VA 5JQGF 1MHPA 1CC1S 1UIRA 2C5HA 4EB8A 4FD3A 2WF8A 2YVQA 2O2YA 2VJQA 5CFZA 1P4AA 3RKSA 4DZTA 3L4BA 1YI0A 1C7QA 2C2KA 2HSEA 3K9GA 2GH1A 3N7AA 4PLGA 1FNMA 3T1VA 4L02A 2Z6AA 3QJGA 4WA8A 3IJ5A 4HNTA 4MSUA 1N77A 5C81A 5CLLA 1Z38A 1AM4D 1HEUA 2HJHA 3MAGA 2V7XA 3QE0A 5DI9A 2QQGA 2DUWA 3OF2A 4MR9B 2LCQA 1JT9A 2IS2A 4HS4A 1CUGA 1OD6A 3HYLA 5K1ZA 4PYJA 2JGIA 3LUDA 1OW3B 3NX4A 1KY3A 1WVGA 5COBA 2VQFB 5AVXA 3P96A 1G42A 1K6XA 1NVTA 3B6JA 2DFLA 3DKRA 3V2GA 2FEMA 1W8IA 1YK1A 1MGPA 1D2GA 2O8BA 2UVPA 4WXMA 2O54A 1O96B 1UMCB 3CKMA 3BE4A 3UOAB 2ZSFA 5C7IO 2FWJA 3M34A 4AJNA 5CB6A 2C00A 2MYTA 2WJPA 4MIYA 4QX6A 4CTKA 2HIMA 2IY9A 4B45A 3WDMA 1TPZA 1F2UB 4K6HA 1LS6A 4TGLA 3JQGB 4WXYB 1ESEA 4B46A 4C5BA 5K0JA 1JHYA 2EBWA 5IHPA 1M8JA 2CXQA 1SG0A 3QFTA 5DHAA 2XZDA 3FZGA 5C7LO 3R5TA 1H4VB 2EJVA 3QXHA 2ODQA 4MQ6A 4X7BA 2BFNA 4EUFA 2P3QA 1IJEA 4ENQA 3T94A 1R9JA 4C04A 4KFSA 4OHOA 4UAUA 5IN4A 4OGKA 4JZKA 2JL1A 3ML1A 4HGOA 1CY6A 2Q8NA 2HA0A 2PKEA 4B33A 3CT6A 1QCDA 4R31A 5DCYA 2GCOB 4PX2A 1IB6A 2XQVA 4IF4A 2X2PA 2NZYA 4QRIA 4HH1A 3EQ9A 4BDTA 3M8KA 5JNSA 2XKJE 1DJPA 1T3ZA 3D4PA 1WVMA 4HRAA 1OFHA 4KJZA 4TL9A 1ZY2A 1T8WA 1EEHA 1VGQA 4Z7NB 4MK4A 1J25A 5JVDB 4JL5A 4ZANA 2QJOA 3EPRA 5T6BA 4L9AA 1QBGA 3SE0A 4RY9A 4WFQA 3GCGA 2PLRA 3KJXA 4OMDA 2X8JB 1XVUA 1VYTA 1ZN9A 2NZXA 2J3QA 2R6DA 2J3IA 2Z3ZA 4G9EA 3CLSD 4I55B 4Y7DA 3THSA 4B3BA 1NUUA 5K0ZA 4IM7A 4GGMX 3TX2A 1PUJA 2VEOA 3GA5A 2PH1A 4JUDX 1PZMA 1YUMA 2ISQA 2FZLA 2GF0A 5BSFA 1NNI1 1T8SA 1ZH0A 2IUYA 2XY4A 1PJ3A 1UDXA 1W6UA 3ORYA 3UV7A 2A0UA 2BFEB 3BZUA 4Y67A 4E5UA 4H6PA 3W2EA 4EZBA 3ULKA 4BFXA 1QHIA 4YJ2B 3WLAA 2IITA 1GCGA 3EF3A 2X22A 3L3BA 4HPXB 4JOQA 1V41E 4XSGA 1F9EA 1FFBA 3QF4A 4UU1A 4A15A 3HTXA 1N5IA 3SR3A 4UJ3A 3Q5DA 1M7BA 3GPCA 3MJHA 4MP8A 3QE3A 4BKRA 5KDOA 3BDVA 1KJ9A 2B94A 4ZARA 4WK4B 4KUGA 4ED9A 4GG1A 1KZGB 2W6CX 5ICEA 3U26A 1LPOA 4M7WA 1FSGA 1HE4A 2FWAA 2NVUB 4KSYA 3LQ4A 1NT4A 1O54A 4OU4A 3WWPA 1TM5E 3COZA 1G8AA 4P86A 4DJFC 4DR7B 3CR8A 1G20E 2PRYA 1JPNA 1SRQA 5KNDH 1RP7A 2YNMD 4W8HA 1S7CA 4XQ9A 2CLEB 1OTXA 1DZIA 1I1NA 1H2FA 1WDTA 2GD0A 4PFKA 4QQNA 1ZCJA 3UK1A 1QF6A 3WNZA 4YUAA 4KXUA 5IK2D 3LHSA 3TDKA 4IV8A 1JEDA 2PGIA 4PQRA 2NP7A 2Q5IA 1I3CA 4OHXA 1KMMA 3FLEA 4RPGA 2NVOA 2ZR7A 4OSEA 1TT7A 4ZMSA 3WBJA 2O0KA 3BWDD 4N18A 4D6YA 4P32A 1R8YA 2O2GA 3DJYA 2B98A 2LTAA 3Q72A 4LVNA 3TVYA 3RM3A 4PZAA 4TQAA 5JCZA 4CG2A 2Z5VA 1H1TA 3L0SA 4RWEA 2ZM6B 3U7HB 3G2QA 3SBXA 3TSAA 2ZGVA 3UW3A 1XEWX 2G28A 1Q0SA 3JZMA 1BDHA 2VIIA 2P9EA 1XI2A 3GA7A 4UAJA 3HCCA 1A8UA 3LHKA 5HFAA 2QD3A 3BMOA 3OY7A 5CDSA 1YU9A 1EHYA 5FQOA 3EY9A 1KDPA 1BRTA 1M2GA 3RSGA 1IBCA 2Q3CA 3CLTC 3KQYA 3W5SA 3WYCA 4KQEA 4ZD6A 2ZJ7A 1DRJA 1IOZA 1I3MA 3GNSA 1P77A 1PJAA 1VHJA 5AVZA 3I58A 3I45A 4D4KA 1XJWA 5L95A 2EATA 3FOWA 2CYBA 3MJRA 4WCDA 4KAXA 1II8B 1I8TA 1ZUWA 2PMWB 3WA6A 1GZ6A 2NQ2C 2V7BA 3D8RA 1MNQA 4EQ6A 6ADHA 3AF2A 1SCAA 3E9YA 4LFBB 4ZZ0A 3M5CA 4ETIA 1ZJWA 3O73A 3IALA 3B3QA 3ZOKA 1O0CA 2HF8A 4MGYR 2B8WA 1KZ6A 4GZ5A 5JANA 1EFRA 4OBBA 4J4TA 3S44A 2ZRKA 2BUAA 1H2EA 3OIWA 5E7QA 2GTPA 2LNDA 5IN5A 1J0EA 1HMPA 5GJCA 3KCNA 4ZYYA 2CHFA 4O4IA 5EAIA 2V8OA 2XGMA 5EIHA 1U90A 3SX0A 4I1IA 3JQAB 2NTYC 4EB3A 3JSXA 4TYYA 1ARZA 3GUHA 2D1TA 3NHBA 3PHGA 3DFIA 2XDYA 1WQ1R 1ZD2P 3MGAA 1P31A 4N5NA 1V45E 2PH5A 2OK7A 2B5WA 1L5NA 5I7WA 1V5IA 2SCUA 4QBKA 2C8LA 5TQVA 1M6YA 5FI3A 2CFRA 1JGTA 1TZCA 3ASVA 3CEPB 3S4YA 2BBOA 4B82A 3WAGA 1X7WA 3DVSX 1CD5A 3I5XA 3VU3A 1BX0A 5ED0A 2QG6A 2PNJA 5M34A 4KO8A 2GD2A 5B4TA 3RUFA 3S8EA 2WE8A 1MGOA 2O0LA 4ZEXA 3LT0A 1PUXA 2ON6A 5E1DA 1W36C 2OBBA 4QYWA 2F9LA 4YRBA 2A9FA 4YCMA 5AVWA 1ZJ6A 1NUAA 3HMKA 1J2TA 4TYWA 3F8WA 3U62A 1L5KA 2JANA 3H7AA 4NCNA 1JE1A 3QX9A 4PPGA 4Q4AB 5DIFA 4A8TA 5LJIA 4G1MB 3Q7QA 4CLXA 4EEKA 3GEEA 1YMQA 2PUTA 4DADA 2XT6A 1JTEA 1Y37A 3FMIA 5I9NA 1SBHA 2QQFA 5I7EA 2KHZA 3C6MA 2CJFA 2ORWA 2OC9A 5FTLA 3AF4A 821PA 2J9FA 2Q0SA 1Z0UA 3BE6A 2BRUC 2OV6A 1KEVA 5H81A 1JH8A 4A6DA 3E3OA 4UOEA 4HB4A 1FRVA 1L5QA 3L1KA 1U7UA 3R3YA 4GFDA 1V43A 3EUEA 3H2JA 3U7JA 2FN7A 4PV7A 2HF2A 2Q5OA 4B81A 1G1AA 4WKCA 5IMBA 2V3CC 3FOBA 4U2EA 1XKTA 3PF8A 1M2NA 4MKXA 3BK1A 4RV9A 4OLBA 3O7WA 1FCJA 4G0OA 4PFJA 1Z28A 3SLGA 5AW6A 3LQKA 4RKRA 3OT4A 1X1CA 3PIRA 1WUYA 2ZYAA 3FCAA 3KEFA 2PWYA 1DIOB 2BELA 1AKTA 1JEYB 2A5JA 3QYPA 2W6JA 3KJQA 1X7YA 4FONA 2NW6A 4DQDA 3JWHA 1TUGA 3D7MA 2IOFA 1P60A 4G5FA 1AKQA 5LQRA 4CU5A 4QPDA 4CL2A 2RHRA 3N6XA 1NJ5A 1TJYA 1GJRA 4PTYA 1Z6YA 2QGZA 1PG2A 2DULA 3PNBA 4BCDA 3M3PA 3S2FA 4EW6A 4PZCA 5BUSA 4CMIA 2GAFA 4RH3A 1SQ5A 1W2WB 4JBYA 1PDWA 5K0FA 1E3SA 4XJSA 2ZSAA 3T1HB 4BO3A 3TXAA 1FU4A 3HXMA 1E9FA 3WLEA 1L4NA 2PX4A 1W36B 4ZK6A 4EHAA 3IDAA 4XYMA 4D8UA 3OMWA 2FYTA 4ARZA 2Z2YA 2H00A 3QITA 5FFMA 3ZV3A 1DX4A 2Q4EA 1HLGA 4BS9A 1G7CA 4NU5A 2RHTA 3UVEA 4HDOB 1SXIA 3QE2A 3DTYA 1R4AA 2ZJ1A 3O6VA 1H1LB 2I1LA 4BC0A 1WJGA 5TGZA 1H5UA 4OUKX 2UZ1A 4DKJA 3DVAB 1FXSA 1YCDA 521PA 4YRPA 2PNFA 4DLSA 4RIHA 3MCZA 3TX6A 5EXDA 1T5DX 1M7GA 1U9IA 2A86A 4KE6A 1DB3A 3C3AA 3SJBA 3T5TA 5BSRA 5HKKA 2R60A 2VJNA 1KMCA 1ZEMA 2XKBA 1WMEA 4B3SB 1N1GA