5AJXA

Human pfkfb3 in complex with an indole inhibitor 3
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
444
structure length
441
Chain Sequence
PLELTQSRVQKIWVPVDHRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
source organism Homo sapiens
total genus 156
structure length 441
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajxA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajxA02
3CRW1 4WOPA 2R6FA 5L3RA 3CKLA 2ZQ5A 3U44B 3VKGA 1DG1G 1KI6B 3K0EA 3BGWA 3U3RA 1MO3A 4X8OA 3VR1A 2ZJ8A 2G1JA 2W2XA 2KE5A 2DWQA 5KO2A 5DSZA 1ONBA 3EIEA 1SQ5A 4KCGA 4EO9A 3L0SA 4BZPA 3AF0A 4QOSA 3L8YA 4NTZA 1NMZA 5L3QA 5FR2A 1T5IA 2FFBA 3EZFA 4P33A 1UFQA 2QN6A 1XWIA 1VCOA 3GFTA 4QGFA 1BYUA 2OILA 3P27A 4FCWA 1DAFA 1NVWQ 1H8ED 3A36A 2FGJA 4KO8A 3TSOA 2DR3A 4KVGA 4BLOA 1X6VA 1E96A 2KJQA 4POAA 3SHWA 4KSCA 4Q4AB 4AKGA 3OIWA 1FMJA 1WCV1 2RHMA 2RGEA 1PLLA 4EPYA 3B1XA 2ENUA 3AP3A 2EQBA 4IDNA 1MO5A 2K5UA 3BH6A 1D6JA 2IWRA 2J87A 2P6UA 1CVIA 2IT1A 3DM5A 4BLPA 1WRBA 3FFAA 5KNBA 1JJVA 3CWZA 2OM2A 1OIVA 4UQOA 4GL2A 5GJCA 2ZRAA 1G21E 1A1VA 5G3YA 2OLJA 4LUCA 1GITA 2FH5B 1Z0IA 2ORIA 1N6KA 3SN6A 2BEJA 1G8HA 2WU0A 1TU3A 5FOSA 5DI3A 2FJUA 3NEJA 1Z83A 4A8JC 4URXR 4WZBE 2NO7A 1CP2A 4BFZA 4WIAA 1KK2A 1E1RD 3AP2A 3HYRA 5JFGA 2IL1A 4B3FX 2O8EB 1IHPA 2WWXA 3KB1A 2QT1A 5D3MB 5EXSA 4F38A 1XZQA 4EPVA 3THYA 3AB3A 4KV9A 2V9PA 4B2LA 2A30A 1IN8A 4DB4A 1JECA 1LF0A 3L0PA 4L5BA 4Z51A 1UKZA 1YJ5A 2GF0A 3NWJA 3LG2A 4HAVA 4PSKA 1US8B 1DO0A 3FDIA 1R7RA 5J5CA 4C2UA 1NLZA 3DPUA 3B5JA 4YMUA 1QHHA 4HLDA 1OB2A 3RVBA 3QF4B 3QBVA 3QVVA 4JIMA 1Z6AA 5EP2A 1Q1QA 4Q1DA 5F2EA 3OI7A 2OESA 3TW4A 4LBWA 1ZC3A 4NDZA 1E0SA 1MH1A 3B1ZA 3B9QA 2R6GA 3TR0A 3ZIAD 2GCPA 3P4XA 4HDCA 3NBXX 2GK7A 2WSSA 1SVWA 2GCOA 3GJ4A 1W4AA 1W4RA 2V7QA 2D4HA 1QG4A 1ZCBA 1DOAA 4LDJA 1G6HA 4WW0A 1P9RA 5FL7D 1GRNA 2KWIA 4GOXA 1Z22A 1W46A 4A2PA 2JEOA 5CM8B 4LHZA 1DBSA 3DCYA 2R9VA 1OKKA 2IW3A 3RS3A 4PZZA 3KXKA 3NVAA 1E2GA 1N6HA 3SR0A 3OAAD 2QBYA 1AQYA 2F3TA 1WXQA 4FXPA 3RC3A 1IN7A 4NKRA 3QG1A 4DCNA 3KDSE 3FKSA 3THXA 3FYHA 4DLRA 4XIGS 2XNSA 1JEDA 2B8TA 2JLVA 3QKRA 3K0FA 4CIDA 1K5GA 2WIBA 3GLGE 3LNCA 4OI2A 4GMDA 5HPYB 1YRBA 4DKXA 1UJBA 1AS0A 2EU8A 3OFND 3SC3A 1D8TA 2DFLA 3C5HA 2B7BA 3KKMA 2OSBA 1S3SA 2IHBA 1YZQA 5SZJA 3NBFA 1BOFA 3PUXA 4A8JA 2EFDB 1E9CA 4ON9A 1S1CA 1HE8B 2FPLA 2GEUA 2J46A 1SULA 2P2LA 2YC4C 3J81k 1I4DD 2ODNA 2FPMA 3ETLA 1UF9A 1Q12A 3AKDA 3BD9A 2YHSA 2FX3A 2P9YA 5BN3A 2ZVQX 4TMVA 4NZYA 3GLIA 2ODEA 1NN1A 2HT6A 4R2HA 4M4SA 3SE0A 2XB2A 2IF2A 3A4NA 2VLIA 1E79A 2XOKD 1PLKA 1S4QA 3ZZUA 2GJ8A 1VYUA 2ZSFA 3FMOB 3KFVA 2P77A 3UWOA 1VIYA 4EPWA 1GOTA 2BKEA 4HZIA 3K70B 1VYTA 4LGMA 1I2DA 3A1UA 4KHZA 3WMEA 2XTMA 4MYCA 2MSDB 3FMPB 4F4IA 4OHYA 1VCMA 4LBYA 1RIFA 2R8RA 4JLNA 1UAAA 4HLUC 4D4JA 4IVPA 2RGAA 5BW8A 3EPJA 1XPOA 1A2BA 2CJWB 4NP6A 5BYJA 5DI9A 1R10A 2IS2A 2ONKA 4PQYA 821PA 2CBZA 2QRNA 1ZNYA 2IUTA 3JZMA 1XDBA 3TUJC 5JJLA 3QPVA 3B9PA 1VG1A 1KTVA 3GJ3A 5DI3B 4JOBA 4RD6A 4Q1CA 3HP1A 1M7HA 5FTKA 1EK0A 1JR6A 1R4AA 1V37A 2ANBA 3GFOA 3TR5A 3I61A 4GFDA 1COWD 1G6OA 4PAQA 4RY2A 3W5JA 4RVCA 3DZDA 3TK1A 3WY9A 4QBHA 1OXUA 4R2IA 4UJ5A 2ZRJA 3WP0A 4QXAA 3LX5A 4Q9KA 1J2JA 3D6TB 4KFRA 4OBEA 2J5XA 1U9IC 2VF7A 3NTLA 4B3CA 2ZYVX 4Z1MA 2WJIA 2YINC 3QKSA 1QWOA 2WJJA 1GL7A 3A1TA 1N3BA 4HAWA 4OJKA 1QHHB 3IQWA 3L2OB 4QBIA 4Q03A 4TYYA 3O8RA 2ZPTX 2FSFA 2B7CA 4GSYA 2EWWA 1YR8A 3CZPA 3HPQA 4AG6A 1AM4D 3PEVA 2KB0A 2BMFA 3PITA 1GNRA 3B85A 2JLSA 3AF4A 4JLBA 4YLGA 2FWRA 1S1MA 1NBMD 3IIMA 2LCFA 3THWA 1LFDB 2JJ1D 5CM9C 1ZIOA 2GCOB 3T15A 1P6XA 4A1FA 5KSZA 1RIIA 3BORA 4EFLA 1PJRA 3X1YA 1R5OA 3VHLB 3MJHA 1RC8A 4N1AA 4B32A 3MAAC 1S9HA 2CMKA 3DL0A 3UANA 2BMJA 4BZXA 1NBME 1M6NA 3PEYA 1P9WA 4TSRA 4HB3A 3OEHA 2QM7A 4NBSA 4JLOA 2PCLA 3AEZA 2AR7A 2YWFA 1F2TA 2FSHA 1E2EA 1JPJA 1QBKC 1SVSA 2G88A 2XNDA 4RFSA 4D2IA 3QSYA 4HLUA 1CIPA 2C03A 5EP4A 1NIPA 3K0FB 4TSFA 3KUDA 3Q7QA 2HF8A 4JL6A 1XMIA 5E3HA 3T35A 1WBDA 2P5TB 2H4ZA 2IBMA 3M4YA 3L43A 4FWIB 1N6NA 4DT1A 3ZD6A 2AK3A 3DB1A 5EUMA 5FFMA 5HTKA 4UXIA 4A8JB 4ARUA 4MYTA 4V0ME 4E5UA 2V54A 4Q00A 3ZS9A 1UM8A 2Z4SA 4KVAA 3ECCA 1DPFA 1G8PA 2NO1A 5GVSA 1W2HA 4ESVA 3SYLA 4R9UC 2YVUA 3F3YA 3SEAA 421PA 3W9YA 3HU2A 3IO3A 3U7GA 1U9IA 4XWAA 1R5BA 2I1QA 5JRZA 3CR7A 2OHFA 2VHTA 3EW9A 4C7OA 3K0SA 1DVRA 1AGPA 5L3VA 5GJBA 3RNLA 1IAQA 4CW7A 4LRWA 2VP9A 2ZSBA 2OE2A 1ELOA 4URVR 1TQ2A 3BOSA 2BBTA 4R71A 1H65A 3FTQA 2E1RA 3P26A 2FDCA 4FMCF 2GILA 2YN0A 4RKFA 1YZNA 3UG6A 2ORWA 1NLFA 3VR5A 4QL3A 5JJIA 1XXHA 1OHHA 4WZAE 5JZVA 1SKAA 1Z0FA 1GUAA 4YMWA 5FI0B 4GRAA 2V1UA 1XRJA 1W4CA 2CVHA 4FMDF 1D2MA 1DAIA 2ZUDA 1MRSA 2FEMA 5E7MA 2OWDA 2Q3HA 3AUXA 1OH6A 4TYPA 4HB0A 2DFKB 3ZQ6A 1P2SA 1XJQA 2VP2A 3LQRA 4GP6A 4O25A 5AJZA 2ONJA 4XWOA 3LXRA 5C18A 4GMXA 4C0LA 3K70D 5H68A 5KPDA 1SK8A 2H7VA 3U7EB 1IXRC 3Q8XB 4MRPA 2P6OA 2ZVPX 4AKHA 1AJEA 2JLZA 2BMDA 1CTQA 1N5IA 2WM9B 3QKSB 1W5TA 2OT3B 1CRQA 3KXLA 2Q9BA 3GMTA 3LBNA 2FE4A 2WJHA 4NYJR 4I1SA 1FTNA 3B1WA 2CVFA 4LX0A 2QTFA 4GP7A 1T5LA 1CBUA 4IDPA 3VTKA 4A0RA 2FF7A 4B3BA 3EG5A 2O8BB 1RKBA 3GQBA 3ZQJA 3K9NA 1F2UB 1R0WA 4YC7A 1FZQA 4CEIB 3DZ8A 3THWB 3KZ1E 3KJHA 4DLZA 1N0VC 4F7WA 3CX7A 4NPHA 3D8HA 4X8MA 3AGPA 3ICQB 1J70A 2ODWA 1BKDR 3MFYA 1H8HA 3QXCA 3E9CA 3UPUA 4G1UC 1G291 1TUEA 2BVNA 3B1YA 4OI4A 1RRCA 2OXCA 5FPHA 1WE2A 3VAAA 3ZZ0A 3DKVA 4BGDA 1G1MA 2FPKA 2ZI5A 3ND9A 3TH5A 4HZUA 4LJ9A 1F2TB 1CLUA 1HA3A 4NMMA 1KZGB 4P4UA 3T1VA 4XVUA 3AVTA 2QQEA 2WIAA 1JI0A 1E2LA 5HCNA 2R6CA 3E70C 3CM0A 1Z0KA 4LHWA 1RZ3A 3FE2A 4JVMA 4G01B 2FFHA 2F1HA 4KBGA 4NCKA 5JSZA 5E7JA 2WSSD 5GADl 5JJKA 4CEJA 3QXSA 4OKSA 2V7QD 1KZ7B 4DT1B 3U7HB 1KY2A 2W6ID 4D6PA 1E2DA 4WXPA 4MRRA 1F6BA 1RFLA 5EE3A 1KSFX 4IDHA 4KU4A 4DUGA 4ZCMA 1OKKD 1DE0A 4NHOA 5JWRA 4F93B 4OHXA 4DDTA 1GM5A 5C4MA 3EC2A 2FNAA 4OL0A 3VX4A 2W83A 1OV4A 4DWJA 3FKSD 2BBOA 4A82A 5AJVB 3DMDA 2RH5A 4OI0A 1G41A 1HE1C 4F92B 3U4QA 2PZEA 3PGMA 4GZLA 2G1KA 3PUZA 1U8ZA 4TTQA 2QP3A 4TT3D 2PZFA 3LQQA 1CXZA 4MGIR 1M1YE 3PXGA 4NCJA 4D0NA 4LV8B 5JHHB 3VR6A 1E0AA 2VYFA 5DIFA 1N6OA 3H4MA 1RRFA 5KDLA 1XP8A 5B58C 3EOZA 1ZUIA 5TDHA 4M1MA 4DIDA 1KO7A 4LBZA 4OJQA 3K53A 4M2LA 3A1SA 1XXHB 1G8FA 4LC0A 2WTUA 2IS1A 8OHMA 4NCIA 1S96A 3O47A 1BQ3A 4LZZA 1N5LA 4HUQB 4B47A 2X2FA 2CLSA 5JI2E 1EGAA 1R8QA 1YZTA 4H1VA 1K8RA 2PLFA 1QHNA 1E79D 1BIFA 4YXWA 1XEWX 4DSNA 5EJEA 3GD7A 1BO6A 2WWIA 4RFVA 5EE5B 1XTIA 3NBZC 4D4MA 3CO5A 1SKBA 1KHTA 4A36A 2QMHA 4IDOA 1Y63A 4DCUA 4NL4H 4ZDJA 1XEWY 2VEDA 1E9BA 4M9XA 2A5DA 1W5SA 2P65A 1RJ9A 1GFIA 3JZAA 1W0JA 1A5TA 4TQ9A 3ADCA 4LSGA 4LYFA 3TSWA 1DELA 2GVDC 5K8LA 4V03A 5CIQA 1DAMA 1TF7A 2QI9C 4R7ZA 2HUPA 2P5SA 2IUUA 2IF0A 1KI3A 1Z47A 2NIPA 1FFHA 3BC1A 1RYHA 1M7GA 4NCHA 4JSTA 4M9SA 3H84A 4G5GA 1OE0A 1EFTA 4PC6A 1EG7A 4E03A 3B60A 2ODBA 1S8FA 4NCNA 2AWNA 3A4LA 2YKGA 3CR8A 5HR5A 2EYQA 3MJRA 3AVYA 1L2TA 4WAUA 4B44A 2BM0A 2OV2A 3B13B 3QIAA 4Q4JB 3X1WA 1W36C 2ZS7A 1DKNA 4FMCB 3RC8A 4MYUA 2EFEB 1X1SA 5K8UA 1CJTC 4XTCS 4ZV4A 3IT2A 2CNWA 2GBLC 1L7VC 1W0KA 3C8UA 3EPKA 1KI9A 4Z1MD 1RRPA 2EKBA 3IPXA 2JLXA 1XTKA 3L0OA 1KO5A 1Z5ZA 3FPAA 5KDDA 1CJVC 3GJ0A 3C15C 1YR7A 4PPFA 2W6JA 4HZUB 3QENA 2JJ8A 3X2SA 3ASYA 5E7IA 3LH5A 1ZBDA 4DHEA 1DKPA 2IXFA 5LPNA 3GLFA 2H4XA 2E9SA 4TTPA 3AGQA 2Q9AA 1TEXA 3PENA 3MWLA 3T34A 4CT4B 1C4OA 1MR3F 2JJ2A 2SHKA 3NKVA 4RD2A 1H2EA 4CEJB 3OIUA 3HU1A 5SZKB 2BC9A 4EQ6A 1Q0UA 1VHTA 3RSOA 4RD3A 3KKKA 4A0GA 5TB5A 3AUYA 4IFBA 5EQTA 3VR2A 2JAQA 5B64A 2QAJA 1T6NA 3OEHD 3T1OA 3BB4A 4LV5B 4HB2A 1OLOA 3K9LA 2F43A 4O2RA 1FOEB 1NSFA 1YZGA 2GESA 3VMFA 1UDWA 1II8A 1JAHA 2XNDD 5FBQB 3NHAA 4NONA 1B0UA 1CR0A 4RD0A 2PEYA 4XJXA 4JVLA 3RANA 3REGA 1GZSA 3RRNA 2GXSA 3U4QB 1T3HA 1IQPA 4TSFD 4TYNA 1G3UA 1G64A 5CB8A 2HF9A 3WYAA 1AGRA 3K9HA 1VKJA 4LYAA 4JJKA 4PXAA 2P6NA 5A4JA 3S1AA 3SNHA 2FSIA 3BH0A 1P61B 3D3QA 4TZ6A 1G5TA 2VIIA 2VPPA 5J4KA 3LX8A 2GJKA 3JVUA 1T0HB 2QL6A 1YRAA 4TWZA 2G0TA 2FEOA 4PC2A 4MA4A 5JI3E 5FBWB 2C8VA 2LWIA 2XITA 3BS4A 3HR8A 3PG5A 1WDTA 1NN5A 2GJ9A 2WJVA 4IVRA 3U7FB 3TJZA 1E94E 2GBLA 1LV7A 3CX6A 1P7CA 2V8OA 2DBYA 3KJGA 5CJPA 3R20A 4IJMA 1ESMA 5JLJA 1W44A 1FP6A 1NVVR 3ZGXA 1N0UA 3W90A 2UZIR 4DLVA 4C4PA 2CCGA 1SK9A 4BLTA 1KJWA 5FBLB 3GW8A 4N3NA 1E9EA 3NC1C 2GZDA 3X1XA 5KSYA 1GG2A 1LS6A 3R9XA 4MDEA 4PC1A 4BFUA 1G8YA 2WWFA 3IPYA 2PMKA 1RJ9B 3EZ9A 4L9SA 5JCZA 4PQFA 1AN0A 3ZVNA 2DWPA 1XNJA 2XSZA 4U7DA 1ZIPA 1G7TA 3CRRA 4HSEA 4URWR 1XJ0A 1OHHD 2QE7A 3ASZA 3BJIC 1TF5A 3ZVRA 4D26A 1VDZA 4Q1EA 1X1RA 3AF2A 4JLAA 2F9LA 3SFVA 4KITB 4QRHA 4V0NA 5J40A 2XZLA 3C4JA 3VR4A 3W6NA 3B78A 4JVNA 4PR0A 3CBQA 1XXHE 3V9PA 1D2EA 4UNQA 1XB2A 2QORA 4KAXA 1Z08A 4W5HA 5J4YA 4PAOA 1ZM4A 1GILA 4JMPA 4M1KA 4YONB 5FPYA 2ZRBA 4B6FA 4OHWA 2GK6A 4A9AA 2HPAA 1JXMA 3MCAA 3WMFA 4AKIA 4LJAA 1HEIA 4EMBA 2P79A 2RGDA 3TNFA 1FX0A 1UBCA 3GJ7A 4DVGA 2VHUA 1QHSA 2JDIA 5FUXA 2QZ4A 1Z06A 5J4HA 4Z8YA 1KSGA 3FMIA 1ZNZA 4I1OA 4ZKDA 1N25A 3JVVA 2D2EA 3TGPA 2ZREA 1HV8A 4E3WA 3AVUA 4RSGA 1OH5A 3GLFB 3F3KA 1E6CA 1XCMA 5FUWA 2GJAA 1N6PA 1M7BA 4G0NA 3LWNA 2XAUA 4Q4LA 3LLMA 4UJ3A 4DDVA 1Q1EA 4DLUA 3VNVA 5IHPA 4EQ6B 1KDPA 2J45A 2F55A 4MRVA 4ZDIA 3B82A 2CK3A 1H8HD 2C5LA 4GPTA 4PHTA 2XXAA 3WYFA 5IK2A 2ANCA 1MT0A 2C9CA 5CB6A 4DEXA 2A78A 1KDRA 4ABYA 5GJWC 2G6BA 2UZ3A 3DM9B 3T5GA 3EXAA 3F0TA 4HDQB 3MWKA 1IOZA 2IWHA 4ASUA 3MG9A 5IT5A 1EESA 2ZE8A 1II8B 2IX3A 4M9ZA 1WQ1R 2GCNA 2QT0A 3GJ6A 4A4DA 4D25A 1DG3A 4TLDA 4ACBA 1ZD8A 1V7QA 1ZNWA 4PX9A 2F6RA 3TBKA 3HYTA 2LKCA 4B75A 4BECA 1Y3AA 2EFGA 2CE7A 1ZYUA 1FL9A 1SXJC 4LJ6A 2JLUA 3NH6A 3WRYC 4QBGB 2GXAA 4DUGD 1M74A 1ZM2A 1JBKA 3CB4A 1W36B 2BIFA 3KKPA 4O2LA 4M21A 1XMVA 2CL6X 5FUYA 5DHAA 2OFOA 1YZKA 4MITA 2IEZA 1S2MA 1NRJB 3NC0C 1KI8A 5JBQA 3QY0A 5EUQB 4JLDA 3ADDA 4Q66C 1B23P 1NI3A 2ZIAA 1E2KA 5BXQC 1U99A 3CNOA 2WMNB 4IKEA 2WWGA 5CDFA 4P4SA 2PLRA 4II7A 4YMSA 4M9QA 4OK6A 2EW1A 3T1TA 1NVXQ 1K5DA 1N6IA 3CNLA 2MSEB 3CX8A 3AKCA 3NG1A 4UKDA 1UJ2A 2RB4A 1F5NA 1TU4A 1W4BA 3IUYA 3I1FA 5FUVA 5FOXA 5L3QB 2RHDA 1LNZA 2P2ZA 3THXB 4TLCA 1YFKA 3O0TA 2DCUA 2C99A 1OYYA 1JALA 2B21A 4O3MA 3IT3A 5CYPA 1X8KA 4DIEA 3EIHA 1YKSA 2VF8A 1RW4A 1GRQA 1V5WA 4JLKA 4TYQA 4YXWD 3KX2A 2UVQA 4HAYA 2GJSA 1Z8FA 2P3SA 4QGAA 3U3JA 5JS7A 1YQTA 1E9DA 4NE2A 2GHIA 3RS7A 5CIWA 4B43A 5AJXA 1KJZA 5FOUA 3UKDA 4BRUA 4MDFA 3MD0A 1GP2A 4BQSA 3MBKA 4H1UA 1VYVA 3AVQA 1Z6YA 1SKYB 3TVDA 3THOA 3BB3A 4C0JA 3RWOA 3VKWA 3CF2A 4DSUA 3TMKA 3BB1A 1G4AE 3LVRE 1U0HC 1VCNA 1FX0B 1CJMA 2R62A 3UMRA 2YC2C 5KTYA 2AFHE 3TUIC 2RMKA 2GZHA 4G3XA 2P75A 2P0EA 1P2UA 2ZJAA 2PT5A 1SXJA 1P4SA 1CEEA 1OXXK 1VCIA 3IQXA 5DYGA 4FINA 1XTQA 3CPEA 4A2QA 1ZP6A 3CPHA 3GJXC 4FI3C 4B73A 3GP5A 2CE2X 2H92A 2ZITA 4MUBA 4JLPA 4BE7B 4ZI2A 2EYUA 3FHCB 2BWJA 2A7QA 1SHZA 4GZMA 2J7KA 2CL7X 4RJLA 3RS0A 1ZM3A 2QA5A 3PUWA 3THYB 1J8YF 4A6XA 3WMGA 3QXHA 4D81A 4Z54A 1NG9A 5FTJA 2JA1A 1XTSA 3PVSA 1P73A 1IXZA 1E32A 3PUYA 2CNWD 4C3ZA 4DDUA 2XXAB 1W0KD 1XCPA 1ZINA 2W2VA 2J0QA 1DARA 5C2JB 2HIAA 3SBEA 3V4RA 1OFHA 2V55B 3C7KA 3IHLA 4B2PA 3ZLJA 4P4TA 3TQFA 1G3RA 2BOVA 1XD9A 3ZH9B 4H9GA 4HAXA 3F5FA 3LFUA 4Q19A 1JEEA 1NKSA 1TADA 4W7SA 5AR1A 2W6JD 3GJ8A 1XU4A 5AJYA 1T8PA 2DY1A 3M6AA 2HV8A 2AKAB 1TPZA 3ZYCA 4OK3A 3TAHA 3QPWA 1Z6GA 1EFRA 2J0UA 2QTHA 2WV9A 5FPKA 2YWGA 4I99A 2JIZA 2ZI3A 2ZI4A 3MUFA 4QJ5A 4BFVA 3WRXC 2REOA 4V0KA 2W0SA 3CW2A 3BWDD 4Q4HA 2HEIA 4ARZA 3GLFE 4TMTA 3TUZC 1E0KA 4TL7A 3VU9A 1R8SA 2AWOA 1E99A 2JLQA 4TMKA 2QBYB 4C0SA 2D7DA 3FHTA 3RDPA 5GVRA 2OBLA 521PA 3SDZA 1FNMA 1EWRA 1MOZA 4DLYA 4E22A 4EJSC 3QKRB 3I4LA 2BCJQ 3SI7A 3KJIA 2ZS9A 3AVVA 4DJTA 3X1ZA 2QAGC 3OEEA 3L82B 1QHGA 2BHRA 5E95A 1PZNA 2IYUA 1AK2A 1Z2CA 2MMCA 1C80A 3OHMA 5SZHB 1OB5A 4XSGA 2ZTSA 2NPFA 6Q21A 1E1QD 2B8WA 5ELXA 2V6IA 3EZ7A 3KQLA 3EASA 1W36D 1NL3A 3A6PC 3IO5A 1YJXA 2VRWA 5KDOA 3AV0B 1FPMA 3GLIB 4TL6A 2IYWA 2IYVA 4MRNA 2GF9A 4XVQA 3DMNA 1T3SA 2DFNA 4JJZA 3RYTC 1OF1A 2EWVA 1DAKA 3WHKA 3ZD7A 4GT1A 1G17A 3ZDQA 2ZJ5A 2VO1A 4MGZR 1CULC 2GAOA 1YVDA 2J0VA 3LVQE 5G41A 1KO8A 3LAWA 1FBTA 3IILA 2YWHA 2RGBA 4KODA 1JQJC 4MUAA 5JECA 2QPTA 4PPNA 2IS6A 4BASA 1YR6A 3I8XA 1XMJA 1Q1BA 3EWSA 2VP4A 4Q1AA 2XSZD 3BAFA 4K8OA 4PTLA 1XJCA 2QE7D 5H1YA 2A9JA 3LRPA 1ZM9A 2WAXA 2AD1A 4JBYA 3CRMA 2ATXA 3NIBA 2ZUBA 3OIVA 5DISB 3HJNA 2PH1A 1EX7A 2ZRFA 2EOAA 3ZVLA 1DAHA 1QG2A 4B3DA 2OFWA 4DSOA 2HHJA 1O3YA 1U90A 4IW3B 2H17A 1D5CA 4TQAA 2CHQA 2HXYA 1VTKA 3QNUA 2BM1A 1HURA 2JLRA 3I72A 4EJSA 5EZ6B 4B3GA 1IONA 1Q22A 3KKOA 2ZS8A 3M1IA 1JXOA 5TARA 3LO5A 2B92A 2IXGA 2QAGA 3AVPA 2IYRA 3DEFA 3FFBA 4GNKA 4XOIA 2ORVA 2ZR0A 1H8EA 3AVOA 4JL8A 3B6EA 2H1LA 4N0DA 1KJYA 2IYQA 1LW7A 2IYLD 2ZRLA 2JDID 5EXXA 5CX4A 1ZUHA 2A5GA 1SKYE 2F1IA 2PJZA 4B76A 1RPZA 3GEHA 1U0LA 4KFTA 1W7AA 4QHYA 2D7CA 4TLAA 1R0XA 4G5SA 1KI1A 2J59A 2TMKA 4FIDA 4FCVA 4IVQA 3I32A 3QPUA 3LXXA 2PMDA 3LL4A 4KYIB 1II0A 2J0UB 4C0HA 2C77A 3T61A 3CUEF 1J90A 2ZR9A 2GNOA 2E87A 3CLVA 2H16A 1UKEA 4D0GA 2C9OA 3W34A 1X3SA 2WBLC 1KIMA 4LJ7A 2CL0X 5JS8A 4I1VA 1JR3A 2CK3D 2F7SA 4BEJA 4ARZB 1BMFA 1X8LA 2CXXA 2G9NA 1LY1A 5IK2D 1N2CE 1EFHA 2ZI6A 2FMXA 3MLEA 4XH9B 3RSLA 5JEDA 2AXNA 1G5PA 1P5ZB 2XTNA 3V4FA 2WKRA 5DLQC 4ASUD 4TTRA 1IY0A 1G20E 5DGXA 1KI4A 2CEAA 5J4VA 2N42A 1U81A 4KBFA 2RAPA 4HB4A 4QGGA 4RFSB 5EXTA 4DLWA 1G3QA 3AF1A 3U61B 5HE8A 4LBVA 3QJYA 3EA5A 2LKDA 4BLQA 3U6BA 4JT2A 1GDDA 3C14C 2CHVA 2Q3MA 2IXEA 3AVWA 4U00A 1RE0A 3KFXA 3LLUA 1AQUA 2OFXA 1AIPA 3K0CC 3LNTA 4IXMA 2P6RA 3RS2A 5CK4A 2HT1A 1QVAA 4PPGA 4FD2A 2QMUA 1GAJA 1UKYA 2MMGA 4P0TA 2I4IA 2DB3A 1ZJ6A 2ZJOA 1HT1E 3AP1A 1EWQA 2D74A 1DKOA 1UJCA 3U3KA 3IBGA 3Q9LA 1GL6A 3CONA 4L9WA 3VFDA 2P9ZA 3U3MA 5KUTA 3E9DA 2PX0A 4CF7A 3ZIAA 4CEHA 5C1BA 1IY2A 1F3OA 2ERYA 2O8DA 1BQ4A 3H2YA 2JCSA 3Q5DA 4MKGA 2J3EA 4W5WA 3O8CA 4C7OB 1XCGB 4GBMA 3A1WA 1UKVY 3Q72A 1E2IA 5KNCA 4QM7A 2IKQA 1WF3A 1FW6A 2VHCA 3BFVA 1IHUA 4TN1A 3HPRA 2GXQA 2C78A 2ZUCA 1G7SA 3W8RA 2YN2A 3U60B 1ZM7A 3I8SA 3CF0A 3LBHA 1ND6A 4X8LA 3ICEA 2IK8A 4C9BA 1PUJA 5CDFE 1SVMA 3RRMA 5CITA 1T8TA 4HYYA 1KSJA 2V1XA 5FR1A 3B2EA 4JLJA 1YHNA 4BZQA 1E69A 1D9XA 4YQFA 1QRAA 1OT3A 1PV4A 4OYHA 1DS6A 4DB2A 1GNPA 4FDUA 1SVIA 1N6LA 3KB2A 3EA0A 2YV5A 3BE4A 1P9NA 1CKEA 1P60A 3NHBA 1OH8A 1BS1A 2D2FA 4X8HA 1T0JB 5FL3A 1NN0A 1EX6A 3GLIE 721PA 3IIJA 3C41J 2IYYA 4ZI3A 3KKQA 3QUSA 5CJ2A 5EE9A 2OWEA 2ZJBA 2AD5A 2Q21A 1X86B 5BWMA 2D62A 3MMPA 4MRSA 3QG5A 2QAGB 4PO1A 3WP1B 1JNYA 4M1YA 2MSCB 4IDQA 3KTAA 2XJ4A 4OQFA 2CLCX 1ZCAA 3K0CA 4DDWA 1GKUB 4QJ3A 5K8TA 1KYIA 2WNIA 2QSZA 4EPTA 2O8FA 2F9MA 4L15A 1NJGA 2IUSA 4LI0A 4MKFA 1I4TD 4XVRA 3KQUA 3NTUA 1OIXA 1II9A 2C9YA 1OXTA 2X1VA 4LOAA 1W2GA 2EFCB 1CR4A 2WMOB 5LD2C 4EIWA 2VP0A 2EVWX 3OE7A 2C04A 1SXJE 1ZD9A 2QGNA 3AF3A 5FOTA 4B6EA 2WKPA 1XPRA 1XPUA 3KQHA 2KBFA 1T4GA 3LBIA 1F48A 5SZIA 3N5CA 4BFTA 4WXRA 2RGCA 2EFHB 1G16A 3T5DA 2IHYA 4QJ4A 4RZXA 5KPJA 4IXNA 3PIRA 1X8JA 2H5EA 2C98A 3SHFA 1UBEA 1Z0JA 1E2MA 2GWHA 4Q4AA 2IC5A 4FMDB 4Q01A 1Z0DA 3FOZA 1G7CA 1E2JA 1M2OB 2HJVA 4HEJA 1S0UA 3CIOA 2JLWA 2ZRMA 3U3OA 2FZ4A 2FZLA 1G7RA 4E09A 4PZAA 3PCRB 1PLJA 2WNHA 3C16C 2FN4A 1SVLA 1EFRD 2X77A 5AJWA 4XWKA 5JSZB 2RFLA 1DTSA 1HUQA 2JIZD 1KMHA 2HYIC 1E9AA 1ZC4A 3RS5A 4ZKEA 3IHWA 4QGHA 2G3YA 2VP6A 2VSOA 1DO2A 4PGMA 2F1RA 5BYKA 1RRGA 4Q7MB 1Q20A 2ZSAA 3PV0A 1E9FA 3EZNA 3ZVMA 4UNPA 1R5NA 2NMVA 3L0IB 3IT1A 1AS3A 3UK6A 1E3MA 1VMAA 2A2ZA 2ZE5A 4CGZA 3AVXA 3R9WA 3VQTA 3WHLA 4FWTA 2R6AA 3DOEA 4CEHB 5HZKA 4O0MA 3VR3A 4IOJA 2PX3A 3W3AA 1N5JA 3P1JA 3UG7A 2G83A 1AA9A 1NP6A 2YOHA 2DHRA 4JLMA 5D3MA 2FA9A 3GEEA 4TMXA 5BQ5A 1WB9A 1E59A 4Q9HA 3MRSA 2ZM5A 1G3IA 1HTWA 2R2AA 2CHGA 3E2IA 3AKEA 2HYDA 4QFMA 1US8A 2L0XA 4YDHB 2YWEA 4HLCA 5FPTA 1VHLA 4D82A 2PBRA 4AYXA 1ZUNB 1VIAA 2OCBA 4FN5A 3H86A 3QF4A 4K46A 5AWFC 5E4FA 3GP8A 2ZYUX 4LJ5A 4IOMA 3TE6A 1Z0AA 4NYIQ 5G3ZA 4B35A 2R6DA 1ODFA 1CJKC 4BWYA 5B30A 5AUOB 3C7TA 4US1R 5KOYA 1TEVA 4B2IA 5AK0A 4LJ4A 2RGGA 5BN5A 4IRUB 2O0HA 3NBYC 3SZRA 5IRCD 4TMZA 1FP7A 2WWHA 1C81A 2XZOA 3SFZA 1P2VA 1TUIA 4IOLA 1Z2AA 4IEEA 3Q85A 3FDZA 4BFWA 1XD8A 5JEEA 3W6PA 4U5XA 1FMLA 2W58A 4OQLA 5DNYB 2O52A 3AKYA 4LJYA 4PO8A 4JT4A 5DHFA 1E2HA 4RCZA 1KMQA 4EPRA 3KQKA 2DFTA 1KI2A 3KTAB 4RD4A 5DN6A 2ZAMA 1OJLA 1TQ4A 1SVOA 621PA 2O8FB 1VG9B 4OK5A 4NYMQ 1KGDA 4RZ2A 2Q9CA 4OI1A 3LDAA 5HZHA 121PA 1UPTA 2IYTA 2QP9X 4ZCLA 2GEDA 2XB4A 4M1OA 2O0KA 1FUKA 1L8QA 1M34E 2OXRA 3QF7A 1S3GA 1C9KA 2RGXA 1TIPA 4OHZA 1W48A 4JS0A 4PO9A 2YJTD 3N2EA 1Z28A 1LVGA 3G82C 2HLDA 3FKQA 3NDPA 4ZIRA 4Y0VA 5TXGA 2DYKA 2Z83A 4AG5A 2ATVA 2VQSA 4JBXA 1TL7C 1MRNA 1ZMXA 1IY1A 1D9ZA 2NGRA 4L16A 4PHHA 4AWXA 3F2IA 1U8AA 1Z29A 4C30A 2REBA 3PQCA 5UKDA 2WOOA 1FTSA 4CZ2A 5DH9A 2J1LA 4JBWA 2VBCA 4PHGA 5TY0A 4L8GA 1E9RA 3B7GA 3SU8A 1UEIA 2OAQ1 5LB2A 2F90A 3E9EA 3AQ4A 4LCBA 1UDXA 4C0KA 4V02A 5FBVB 4URUR 1KMHB 2P30A 4M8NE 3P4YA 4DEYA 3KXIA 4QKQA 4AYWA 5H8WA 2A3RA 3I5YA 1TTTA 2CJWA 2W2TA 1GRRA 1JR3D 2NQ2C 5HCIA 3K4QA 3SQWA 3D6AA 1BMFD 3U5ZB 2NZJA 1G19A 4ZO4A 4A92A 1T8UA 1NMYA 3UATA 5J4LA 5C46F 4ACAA 1E4YA 4D4KA 2BDTA 2JASA 1A7JA 2PL3A 2XTZA 4XD7A 3TRFA 1GNQA 3L8ZA 4KYUA 2F43B 1AZSC 4RD1A 1J7KA 4TLEA 4PPQA 1SZPA 1JR3E 4P32A 5ANRB 4CT5A 4CRWB 5M04A 3R7WA 4A0FA 2RGNC 4ERNA 2WZQA 3I92A 2NG1A 3K0AA 1E98A 1HT2E 1H2FA 1KI7A 3TAUA 1WBBA 4QC2A 1TQDA 2NO6A 4URZR 3U2QA 2GEVA 3A8TA 1WA5A 3S1AB 5FTLA 2CDNA 1VG0B 5LDDC 2PZGA 3SJAA 4F4JA 5LD2B 2H0QA 5DYIA 5F3WB 1G9XA 1NKTA 5EXPA 3MWJA 4Q1BA 4Q7JB 4DCSA 4CDGA 3E5HA 3GP3A 3SOPA 4F91B 3E1SA 2BJVA 5FOVA 1AKEA 1OXVA 5CU7A 2ZSEA 2PCJA 1OXSC 3ZHCA 2QGZA 3RHFA 1P2TA 5IDVA 2GETA 1G18A 2A9KA 1NIJA 1Z3IX 4I4LA 4HAUA 4MGKR 3SQXA 4IJ6A 2EKZA 4Q9JA 1G8GA 2VTKA 4LYHA 4DSTA 3IKJA 1KK0A 2W6IA 2A6PA 5H70A 2GXUA 4Q1FA 3FDZB 3BERA 2FGKA 3PJRA 2PA0A 2NO0A 5A5GA 1MABA 3IDQA 1TX4B 2JGNA 2FFQA 2OLKA 3R8CA 4JYBA 4B71A 1IN4A 2FU5C 1O87A 1MO6A 1W49A 3LV8A 5FOWA 3VHXA 1S9DA 4EUNA 4M1TA 3EPHA 1NVVQ 1XZPA 4UXHA 2J0SA 4P3YA 4TT3A 1R0ZA 4XSHA 4AROA 5AUPB 3P20A 4LC1A 1YE8A 4RCYA 3CF6R 4JLVA 3NEYA 4JZKA 4LPKA 4GDFA 1KDTA 2N46A 2OCYC 4IHQA 4W5JA 2GTPA 3SYKA 4Q02A 1KSHA 5KU1A 2IA5A 1ETUA 4S2EA 2O8CA 2ZETA 1OFTA 1OH7A 2RGNA 4E07A 2J9RA 1KOFA 5G40A 2WPDA 4HI0E 4PFSA 1XEXA 1IJFA 2ZJZA 3BK7A 3WNDA 3HDTA 1W0JD 5JWHA 4HUTA 3H1TA 1C1YA 2WJGA 3BH7A 4ZIRB 2QEQA 2AHOA 2Z4RA 3K8YA 2BJWA 1KK1A 1U0JA 3QOFA 5P21A 3WNBA 2N1BA 4KLZA 2DPXA 2WHXA 4MYHA 4AD8A 5DE3A 1NMXA 3Q5EA 4US2R 5IF9A 5TMPA 3HR7A 4OQNA 4Z8XA 2XGJA 1HQCA 2J7PA 2QG6A 3EIQA 3IEUA 3W8NA 5TV2A 4B74A 1UADA 2GVZC 4W9MC 3GLHA 3OE7D 4OQXA 4GOJA 3MGCA 1JPNA 4V0OA 1Z07A 3TIFA 2YOFA 3LD9A 1OPXA 1Q3HA 2R65A 1TF2A 1MO4A 2OUKA 4Q5IA 4QNRA 5CYOA 1A4RA 1YZUA 1NY5A 4AKEA 3I5XA 1QHIA 2HDNB 4QG7A 1EFCA 5G53C 3G0HA 3I62A 1K6MA 3FB4A 1QZXA 3MSXA 3DVLA 4B33A 4C0BA 3G5UA 4IEIA 2ZRHA 1HY3A 4Y0AA 4FW9A 3R7WB 1UEJA 1CRPA 2BEKA 3K0AB 4YMTA 1XQ9A 2G77B 3FJYA 4G5RA 3FWYA 3OESA 2GA8A 1ZNXA 1V43A 4URYR 1WMSA 3RAPR 4B34A 4QM6A 2A5FA 2JJ2D 1UBGA 1Q1ZA 2QU8A 2WAYA 3D7MA 1VECA 2PJRA 3LW8A 4AY2A 4LPSA 2ASEA 2YOGA 1E2PA 3FGNA 1E58A 1WP9A 3WYGA 2ZRGA 1NT4A 2CCKA 4D0LB 1Q3TA 4OQMA 3FHOA 3EZ2A 2P6MA 1N6RA 3I3SR 1IXSB 3IIKA 2O8BA 4PHFA 1TMKA 2XZPA 4IJ5A 1F2UA 1E2FA 1MV5A 4PC3A 4BEBA 4AK9A 1ZAKA 3UWKA 4CEIA 4Q47A 4A6PA 1FNNA 3K09C 1CR1A 4NU0A 1Q21A 4M1WA 4RZ3A 5KSOA 3GPLA 4HBZA 2OZEA 1QHXA 3A1VA 3QEJA 5CDHA 2RKOA 3WBJA 2ZE6A 4P4SB 3CZQA 3R9IA 1BYIA 4EKDA 4DC9A 1J8MF 1MABB 4LJ8A 2AN9A 2ZEJA 4KI0A 4Q21A 1KAOA 2GAAA 1CU1A 4WVFA 4DLTA 4PZ9A 5B2ZA 4V0LA 2OBMA 4B3XA 4KXFB 4UXJA 1CJUC 1KK3A 2F1JA 1OYWA 3BIFA 3RS4A 2PT7A 5CK5A 3ND8A 4EFNA 3CH5A 4RZUA 2AFIE 1VG8A 4A0HA 4M0LA 3ADKA 1GKYA 2QMOA 4L4UA 2V4ZA 2WWYA 2XX3A 1E2QA 4KSBA 3KQNA 1ZRHA 4J0QA 4BFSA 2BBWA 3D4IA 3K9GA 2QUZA 2QQ0A 1LTQA 5L8VA 4JL5A 2CLDX 1NG1A 3A37A 4TL9A 2O8CB 2NOAA 4M22A 1A2KC 4LV6A 4ZCIA 3QXXA 3QVUA 1XEXB 2UKDA 1RVDA 1BH2A 4DLXA 3WXMA 2ZXUA 2VA8A 1PVOA 5HKKA 2RCNA 2BKUA 4TYWA 3BFXA 1UBFA 3QKTA 2VSFA 1GSIA 5DN6D 2GKSA 2PEZA 2WKQA 4Q9IA 5D3QA 3NFYA 1N5KA 1SKQA 3TKLA 1SXJB 2W00A 1KNXA 4TZ0A 3N2IA 1NVUQ 5C4GB 3MWYW 2GFIA 1E9SA 1XMSA 3EARA 4JYCA 1A82A 4P31A 1GTVA 1NY6A 1TQ6A 3GLHB 4ARVA 1F60A 1FQKA 4OHVA 4I81A 4Q9LA 1EXMA 1T9HA 3QI2A 4TLBA 1C7ZA 2ZROA 4GOKA 3K09A 2WSMA 5CLLA 4DCVA 2HJGA 4HAZA 4JSYA 3WBKA 3CPJB 1OFIA 2A5YB 2FOLA 3IGFA 1E2NA 1TAGA 3GJ5A 3T1QA 1KO4A 2HLDD 3H0KA 4HUQA 1HQYE 2W0MA 3QQ5A 1YU9A 2ZANA 1VPLA 3QE0A 2G0NA 2FG5A 4DXAA 5FBRB 1IN6A 1DAEA 3M0EA 2HCJB 4KFUA 1HYQA 3EC1A 2Z6VA 1DEKA 3QXJA 4FDTA 1GWNA 3PEWA 2ENWA 1KKLA 3T06B 2C96A 3GFPA 5CLQA 1DKLA 3QEOA 3DOFA 4UNSA 3HWSA 1Q57A 4N0EA 2Z5FA 4PANA 1W47A 3ZS8A 2B6HA 4ODIA 4IOKA 3R7AA 1J99A 1AS2A 1IM2A 3TLXA 4MGYR 4D4LA 4ZDWA 3EX7C 1M8PA 4FCTA 5JRJA 3HJGA 4KJZA 1EBBA 1FQJA 2QNIA 2IYSA 5FH9A 1Q44A 2YZ2A 3BXZA 5EE0A 4AYTA 3OIYA 1CF4A 1RPTA 4Q4HB 2ZRDA 5HE9A 4DCTA 3U6KA 5J47A 2D3WA 4Q18A 2OEPA 4UNNA 3CRQA 4G5OA 2JLYA 1G3MA 3TSZA 4XD7D 2AX4A 3VU9B 3IEVA 3KL4A 4XTRA 5AUNB 3DO6A 3IBYA 2QPAA 3VX3A 1P3JA 3SJBA 5K8IA 1XD2A 2HCBA 1QDEA 1DAGA 2VH5R 4C0QC 3W3ZB 4KLNA 1QHYA 4JKYA 3K4PA 4IFEA 1FZTA 1E1RA 2VHQA 4Q4JA 3SBDA 2H52A 4KFSA 4PSVA 3EZ6A 1NN3A 3VNUA 2ZJ2A 4BFYA 1NLYA 2ZI7A 3W5IA 4PAMA 2GDJA 3FVQA 2YYZA 1OSNA 4QIHA 1ZU5A 1E4VA 4HLQB 4EAQA 1KDOA 1U94A 3O8DA 1OFUX 2WJYA 3OF5A 2FFAA 4GI7A 1NJFA 2WVJA 1XFAA 3GCGA 5LB4A 1RPAA 5KHOC 2ECKA 4Q48A 2BCGY 1R6BX 1TNDA 2FSGA 4G5QA 1ZW6A 3KKNA 2CCJA 4Q7KA 5B57C 3PUVA 4WZ6A 1AKYA 1DADA 3NDBB 3FMFA 4PC7A 3P32A 1LB1B 5KSPA 1PUIA 2BV3A 3UMSA 2QRZA 2ZU6A 1MKYA 3RWMB 4S35A 5FL7A 5F98A 2NO9A 2QENA 2H8KA 2V6JA 2Q6TA 2ZJYA 1EFUA 2ZRNA 2ZR7A 4C0AC 3GLGA 3A4MA 1RYFA 1YR9A 2WOJA 3ZZTA 5LBIA 3OAAA 3ZJYA 4AC9A 2QMEA 4BUJA 3K1JA 4QNMA 2QTVB 4MH0R 3VKHA 4EFMA 1XEFA 2ZSDA 4NYIR 4BPBA 1ZVQA 2WWWA 3BFKA 1SVKA 2GZAA 2ZRIA 4HATA 1P72A 3TQCA 3MXOA 3A58B 3OFNA 1JB1A 4C2TA 5KYKA 1JAIA 1XBTA 2AL7A 3GEIA 2VP5A 3QKUA 5FTNA 2KI5A 3UIEA 5EP3A 1G4UR 1U98A 4NH0A 3BRWD 1XTRA 4YMVA 1DKQA 5FPSA 1FUUA 2QROA 2R44A 4AURA 2WICA 4PQRA 4CVNA 3IT0A 4LHYA 4PSAA 1ESNA 2WPDD 4EJSB 2X2EA 5JMTA 3X1DA 1P75A 1XTJA 1DKMA 4JOCA 3LY5A 4B48A 3AH8A 1GVNB 1N0WA 2AXPA 2P67A 2C2HA 4FMBB 4TMWA 4GPIB 2H57A 2OBNA 3RRYA 5L3SA 2DWOA 3EAQA 3UXMA 4QHSA 2I1VB 4WBSA 5TVKA 5F9FA 1NNEA 2XOKA 4F4CA 3U44A 1SXJD 4LHXA 4MKHA 4NYMR 4A2WA 1KI6A 4EDHA 2ZYWX 3SJZA 1D2NA 4PZYA 1CR2A 2BBSA 1NSTA 2J7PD 4D80A 4CYMA 1LF5A 1ZD1A 4ZPXA 4JODA 3D31A 2OCPA 3D8BA 2ZAOA 2QM8A 4BFXA 1QFXA 1CS4C 2O5VA 2QPOA 3LA6A 4YDSA 1GIAA 3W6OA 4JVSB 2ZYTX 1KKMA 4AIIA 221PA 2Z43A 5AUQA 3REFA 1KAGA 4US0R 4HDOB 2KSQA 4PZLA 4NYJQ 3C5CA 3GLHE 1NF3A 1R2QA 1L4YA 2HXSA 1QF9A 1KNQA 2OCAA 3B1VA 4ITRC 2QSYA 5FI1B 5F9HA 1E0JA 3KUCA 2X8AA 1I2MA 1XD2B 2P78A 2QY9A 3SJCA 4TL8A 1L4UA 2O0JA 2V3CC 1COWA 5JWOA 2ZE7A 2C95A 1KY3A 2IYZA 2F3RA 4BLRA 2ERXA 3LW7A 4M53A 2JATA 1SHKA 2ZI9A 4DLSA 3CH4B 4K81B 5DO9A 3V00A 1IJEA 3EWAA 3NXSA 2REXB 2YNMA 1SGWA 4BLSA 4DRZA 1QHFA 2ZRCA 1Z63A 4M1SA 4WA7A 5KNDA 1GKIA 4ARSA 2ZU0C 3PR1A 1AZTA 5JHGB 4MQBA 2XJ9A 4LHVA 2ZRPA 4QHTA 4LK2A 2VL7A 3ONWA 3UMFA 2I3BA 5BN4A 3ADBA 3R8FA 3O8BA 2Q3FA 3AM1A 2XEXA 4ZDKA 3F8TA 5EE1A 4DBLC 2O8DB 1NBMA 2NTYC 2JJ1A 4BRWA 2VSXA 1KO1A 2O8EA 1Z6TA 3WNCA 3EPLA 3RABA 2P2YA 1R0YA 3HU3A 1XF9A 3DKPA 3OEED 1P62B 2FV8A 5PGMA 4ESHA 4LYJA 2OO7A 3NH9A 4R98A 4RKEA 1OIWA 3SS8A 4DZZA 4QBFA 3GLGB 2GRJA 1JQLB 2NPIA 2AK2A 3SYNA 2H18A 4EPXA 1ND5A 2P9FA 1Z6XA 4AI6A 2NZ8A 3BBPA 1LS1A 3QBTA 4ILEA 4JKIA 5EP1A 2QP4A 4I1UA 4UNRA 5JCPA 3RRZA 1T3LA 1QVRA 1HH4A 2BMEA 3PFIA 1U2RA 4V0MA 3K70C 2OG2A 1T91A 1I4LD 1JJ7A 2IEYA 5GJVC 4Q7LA 3I73A 3PEUA 5FTMA 1IN5A 1ANKA 2IS4A 2D06A 3N70A 3T12A 3CRVA 2X19A 5A0FA 1YZLA 2ZRKA 4LWZA 3DDCA 2QNRA 2Y8EA 1E1QA 5EZ5A 3TVTA 3B8HA 1XX6A 3CWQA 3RLFA 1ZU4A 2A5JA 3DHWC 3Q7PA 4A15A 3CNNA 1G5RA 2IYXA 3KJEA 4MKIA 1W1WA 4TQUS 4GPZA 3Q3JB 2KBEA 1OW3B 2VHJA 1U8YA 3OZXA 4U02A 1GL9B 2Z0MA 4LY6A 2OAP1 5HKKD 1IBRA 5L3SB 2J41A 3TW8B 2AKYA 2Q0HA
chains in the Genus database with same CATH superfamily
3CRW1 5EMKA 3HFSA 4YFVA 2W2KB 4FOLA 5L3RA 1BGXT 2VAWA 4FDLA 1C14A 4J0EA 3KQVA 4DANA 2PGDA 2R7NA 1H4SA 1H2AS 1H5NA 4HFNA 4HQNA 4DGQA 4X8OA 2GN2A 3JD0A 3FWNA 3TPZA 3DD1A 4CQMD 1Y3FE 1N4AA 5CP8A 4FGUA 4WZAA 4H0FA 5DSZA 4ISCA 3I9KA 3FIJA 4DQXA 4K9DA 1OBCA 3N7AA 4HEQA 4KCGA 4D02A 3O84A 4BZPA 2IZ7A 3DAYA 3CVOA 3KV1A 4XFKA 1HE5A 1R3DA 1WTCA 4QOSA 3L8YA 4NTZA 4K88A 2IYPA 1T5IA 3KLOA 2FFBA 3O94A 5I9MA 1U2PA 3KXDA 2R6HA 2YXNA 1UFQA 3A32A 2QN6A 3DYVA 2CB0A 4GSLA 4UUBA 4L78A 2BTQB 3FBWA 4W63A 3GFTA 4R3NA 2OILA 3T5AA 1DAFA 3CV3A 1EQUA 1QV6A 2IU6A 4KRFA 3LVFO 5LLDA 1X6VA 3EC7A 5BUQA 4RHTA 5F3RA 1MHTA 2QRUA 3ZW8A 3G13A 5I6DA 1D5WA 4R2XA 5F4BA 1U9JA 2F9FA 3RT7A 1WDMA 2RGEA 3G7SA 4KDFA 3AP3A 3DDSA 2OQIA 3DAFA 4IDNA 3C39A 1Q0TA 4MGKR 3BH6A 1CVIA 3LK6A 1D6JA 3BF7A 2J87A 2C4HA 4TXHA 4KQ9A 1B0PA 1MW9X 4BLPA 3ETCA 3LKDA 1DQRA 4JBGA 3X2FA 2OVBA 3GV0A 4W82A 3CWZA 4AXXA 2WB2A 2DH5A 5FA8A 1O54A 2IUEA 3DMHA 4M9CA 1GGVA 5GJCA 3DE0X 4LYDA 4YV2A 1A1VA 3N5KA 2GYWA 3A9RA 4YUXA 1GITA 4YAOA 1NURA 2XQJA 4F1KA 1ACJA 2ORIA 4I6GA 3D2AA 1N6KA 2YV1A 2BEJA 2AF4C 3N8GA 4R9SA 1TU3A 5FOSA 4HVTA 2VT6A 5G1NA 2Z1NA 3N1UA 3FCUB 5AXBA 1S89A 3NEJA 4V3CA 2O2SA 2OXIA 4FK8A 2NXWA 4CTJA 2CLKB 2I2CA 3T5TA 2VAMA 4KXXA 3ZHQA 4UBLA 1PNRA 1E1RD 3AP2A 5K0NA 5JFGA 1LLFA 2WWXA 5D3MB 3FUWA 1P4RA 4YN3A 3OLWA 4B2LA 1VGQA 2AW3A 4CKCB 3T5PA 5EJ2A 1IN8A 5D01A 3WLEA 2EXXA 4PNPA 1KQGA 4L5BA 5J3JA 2GF0A 5BT8A 1TJ3A 2FPWA 2HTFA 2ON6A 4PSKA 3FDIA 1R7RA 3O8NA 2XPCA 1OWOA 1Y8CA 2I34A 3C3MA 3DOUA 4FDVA 1GTG1 3EF1A 3O1HB 3IVRA 3RVBA 1X1EA 7GPBA 2G1UA 3LUBA 3QVVA 3LVBA 1S2LA 5EP2A 4TRNA 4ZQHA 1H1LB 2BEWB 1XKLA 3DEZA 2P69A 4QAJA 3C6BA 2Q62A 5A02A 3GFSA 1VHQA 3H5TA 1E0SA 3B1ZA 1BDJA 4U7PB 2R6GA 1WIWA 3G8YA 5KQGA 2C1EA 3TZCA 1SBNE 5CD1A 1BG6A 1G55A 2GLUA 3BKXA 4R0VA 5DMXA 5BNIA 3P2MA 4ICIA 3R0QA 1W4RA 1Q50A 2B3DA 4U8GA 1QG4A 1Y5LA 1P0FA 3IHTA 4BVLA 2CDRA 4GOXA 4KIUA 1G6Q1 4RTMA 4ENVA 4EEXA 1DIHA 4E7PA 2R9VA 1OKKA 3V4SA 1TVMA 4KK4A 1E2GA 3SR0A 1OFVA 3X1KA 2F1OA 4U0JA 1CPYA 2ZWPA 3RC3A 2H2FA 4NKRA 1UBSB 4W5OA 3KDSE 3FKSA 3PDIA 4GR4A 4EM6A 3J7AC 4N7JA 2VYND 3GNQA 2B9VA 2V96A 1MIHA 2X2PA 3K0FA 1K5GA 2WIBA 4MVJE 2OHJA 4Y0NA 5HIKA 3KUUA 3ZHSA 4UDOA 5HPYB 3D64A 3WISA 4JEHA 5KTMA 5HFNA 1ZZEA 1BN7A 2AQIA 8MHTA 4UOZA 1Y7HA 2C5AA 1PI3A 5MGBA 2IU4A 4WNCA 1Z8DA 1Z3CA 3NBFA 2VJDA 3V4ZA 2EFDB 1F4VA 2HDOA 4Z4QA 4KMRA 1GQQA 5L7WA 2GEUA 3KPJA 5CVEA 3ZHBA 1SULA 2EW2A 3LWDA 1B6RA 2YC4C 2CJPA 1X70A 4X41A 5I8PA 1I4DD 2DQKA 3NIFB 3OPYI 4ZANA 1GU1A 2V8BA 1T29A 2IHJA 3L9WA 2ZVQX 1BD3A 1SELA 4R2HA 4QPDA 2BP7A 3LDUA 2WA2A 3KE9A 4FYHA 2XB2A 4K2AA 2EGHA 4EJ0A 5EHIA 3QUQA 2XOKD 4YHBA 2XUKA 1DIOB 1PLKA 1Q5PA 1VM6A 2K2QB 2ODQA 3MMNA 1DQYA 1POWA 3JS5A 4CWAA 4G0QA 1Y34E 3UWOA 1Q19A 3OZWA 7YASA 1LVHA 1RAAA 3N3AC 1Y5NA 3LUHA 4K40A 5DNDA 3K70B 4MA0A 4PYIA 4Q93A 1RXSA 1A96A 2HQOA 2VF5X 1MVNA 2MSDB 5EHNA 3FMPB 1UAAA 4LBYA 1RIFA 4LZLA 3STHA 4HLUC 4F3NA 3PUHA 2VJYA 4L5CA 2WZDA 3GAAA 1JAXA 2BUAA 1I5RA 2PKQO 2FYTA 3FVRA 3HJRA 3O8QB 3OG9A 4WUVA 5DI9A 5DTEA 4RPCA 821PA 3GDHA 1FTWA 1ML3A 4OHBA 5AYVA 2QRNA 4TT8A 5ALQA 5DTMA 2NT4A 5T3UA 2IUTA 2V5VA 5EWLA 4C87A 3MCUA 3QPVA 3B9PA 2CLMB 4QREA 2ABWA 2BZ0A 1KTVA 4CDRA 3LE8A 5DI3B 1C0KA 4R1PA 4ZTBA 3V7NA 4U2GA 4B3IA 5JYEA 4KACA 4Q1CA 3R3UA 1S6YA 2QGFA 1R4AA 1YIAA 4NFHA 1BOOA 4P7KA 1COWD 1TQHA 3VRHA 1G6OA 4RY2A 4B17A 3QGMA 4F2DA 4LWPA 1L5MA 4R2IA 2PTHA 3G59A 4UJ5A 1CD5A 4XPIA 2LGJA 5CT6A 2OGTA 3UMGA 5C51B 4K9QA 4BKUA 1J2JA 1IOVA 5F64A 4B4DA 2SNIE 3RVJA 2Q6KA 1LBQA 4OBEA 5DRTA 4BX2A 4BS9A 4K9MA 1EVEA 5F77A 2BELA 1KYWA 4P92A 3AXTA 3GD5A 3DWIA 2A4MA 4OKNA 4ZZ2A 1JTVA 2V7BA 2WJIA 1A9XB 1SWWA 3G02A 3NNDA 5COQA 4RTLA 4MW9A 3KAJA 1XZHA 5AT1A 2FMKA 3SPXA 2IV7A 5A5DA 1QHHB 1MX1A 3UK0A 4QBIA 5KNDD 3R6LA 5CDYA 2CNLA 4TYYA 4Y98A 2D7JA 1O03A 2FSFA 1T43A 1T6XA 1T9GS 1GLNA 2EWWA 2ZXEA 1YR8A 3CZPA 4GSYA 4JN6B 1XMQB 1UR5A 3V34A 1N34B 5KOIA 1JW9B 1ORHA 3GDOA 3L4BC 4CF5A 1M0TA 1YJCA 3CZ5A 2QVGA 4GRIA 3THWA 3IIMA 2LCFA 2YFKA 2QSUA 1LFDB 3KIPA 3HEAA 3F67A 1IRXA 2GCOB 4OP3A 4UOEA 2RGYA 3B6JA 2ID4A 3T0IA 4MV9A 1HYHA 1RIIA 4GC9A 1ZA1A 4DV4B 2HA4A 5D5QA 2XV1A 4GLBA 4IUCS 5SYAA 4GRDA 4EFLA 3K7EA 5IH3A 2AX3A 4UVIA 2I2DA 3GAMA 3RCBA 1IYZA 4MVYA 4B32A 5I7VA 3UANA 4RIIA 2R7LA 3PPXA 3R9KA 2MHCA 4TSRA 4S1PA 2WWRA 5GMOA 5A4AA 3A7DA 3A25A 2AR7A 3QHPA 2XLBA 1F2TA 2FSHA 2GK3A 2YWFA 3P2KA 3SIWA 3O31A 1BE0A 2V45A 1SC1A 4D4HA 4KO2S 4B3HA 4HLUA 1N92A 1ABBA 3JZIA 3LTNC 3QSYA 2P9GA 3IAS1 1XU9A 3KUDA 4MV7A 3L6EA 4Y6OA 5K8CA 1E3SA 1X94A 1ZJ5A 1JS1X 2MT9A 2Y0DA 1KBZA 2P5TB 3AJDA 2B1IA 5EVCA 4CG2A 1XUOA 1YI8A 4CKXA 3M4YA 4O4JF 3VYVA 4CMIA 1EINA 1IAVA 4FU0A 5LA6B 4DT1A 3DB1A 2QRKA 2PNJA 1RHQA 1VE9A 2DJ5A 2BGNA 1KBQA 3LO8A 4ARUA 4PGFA 2QUHA 1ZH0A 3GH3A 4Q00A 4Q15A 3U7QB 5LP6B 2H08A 2OB2A 3AFHA 3EIOA 1UXHA 1GYRA 1MPTA 1Y6JA 2NO1A 5GVSA 1W2HA 4D46A 3SYLA 2GCIA 4R9UC 1OILA 2YVUA 3L0YA 2X9GA 1JHOA 3UCEA 1N7IA 4ERXA 3NHWA 4MPTA 4A0QA 4WT7A 3HU2A 4Y6PA 3KSDO 4CLEA 3BBLA 4BVKA 2I7TA 4JY7A 3FRJA 1PRYA 2MYTA 4JJIA 4L8FA 4ZHQA 3M6MD 3K0SA 1MX5A 1AGPA 2XYVA 5JSHA 5L3VA 1JSCA 2LP4Y 4UHCA 3U62A 5GJBA 4CW7A 2QLJA 2COEA 3CH6A 3RVKA 2A14A 5K3FA 1J0BA 4PCLA 4QUBA 1U5BA 4D8WA 1UDRA 3OCYA 5ADHA 3A2LA 4OOFA 4URVR 3MMSA 5JCJA 1XNQB 2Q3JA 2HSDA 3F47A 3VOSA 4BO5A 3HUFA 3L4BA 3QUBA 2KQUA 1H65A 2FDCA 1FXWF 1ODLA 2YY6A 3TM5A 3HWRA 4EG0A 1YVPA 2ID7A 4QUGA 3UG6A 1WZUA 3SSAA 4AF7A 2ORWA 3VR5A 1A8HA 1M6EX 1USVA 2X0KA 2EJVA 3NPMA 3P9IA 3GO4A 5J5AA 2O6LA 5KEIA 5JJIA 4F0JA 2QVBA 1T1JA 2F8TA 4WZAE 5JZVA 4PLVA 1H93A 4F9GA 1D1TA 3SM3A 5D86A 1GUAA 1H2XA 2G9QA 1XTUA 1QGZA 1WXDA 4GRAA 1XRJA 4TTSA 1SHLA 2C2BA 3MCVA 3PQEA 4Y6QA 2G7ZA 5E7MA 1C7QA 2IEBA 2OWDA 2XZTA 3TRHA 3JASB 4UCQA 1KBOA 1PJLA 2H1IA 3AUXA 4Y9DA 3EOAI 5ICMA 5K4HA 2DFKB 1TPYA 3VAYA 5CVVA 3AU8A 2P9CA 3PNQA 5LYJB 1NT2A 1P1KA 3LQRA 4O25A 4ZAZA 2DH6A 3V5NA 4BFCA 5LDGA 3C45A 3MT9A 1VBMA 1CRWG 1X92A 4GMXA 3CLTD 4ZEOA 4QQKA 1Y7PA 1T36B 4HYQA 5IC6A 2LUOA 3DR5A 3OU7A 1Y6QA 1D6NA 2QVCA 1N5IA 1Z5VA 4CLRB 1ZJZA 3KXLA 1HQDA 3V1TC 3LBNA 1A50B 4I1SA 3CW8X 2CVFA 5C5CA 4NY1A 4Q6WA 1PJ2A 5CX1A 1BX3A 3FF4A 4KEAA 3QWHA 4A0RA 2KS6A 5LKRA 1OXBB 4B3BA 3BX1A 2O8BB 1JU9A 3ZQJA 1CQIB 3K9NA 2VHVA 4C1BA 1RKVA 5FNVF 1TCVA 5IWCA 4QOIA 5IABA 4CEIB 5H3LA 2C7QA 1UXJA 3WKEA 4WOCA 4LYEA 1B8OA 1FXWA 4B6PA 3CX7A 1MJFA 4ZEWA 2XCOA 1GGHA 1ABFA 2JHAA 5L40A 1KWGA 1FNBA 2DF8A 4DCPA 3ABZA 4X8MA 5JNTA 3G2QA 1J70A 1P1JA 3NTVA 3QXCA 3D4PA 3E9CA 3UPUA 4W9RA 4L5JA 1TUEA 4HGOA 4I2VA 3D7SA 2H4JA 3EY4A 4MPRA 5AK5A 3RODA 3T54A 5KJ6A 5J1TB 3RIHA 4B5KA 2YVLA 1FTQA 5JQGB 3ND9A 3N8IA 1OX4B 4KVFA 2WSLA 3BULA 4LJ9A 4P4UA 4J0GA 4NMMA 3FZEA 5HG0A 1B15A 2QQEA 3IDAA 1W76A 4AG3A 4BJ3A 3O3NB 2R6CA 2IUFA 2Z9BA 5EIXA 4K9KA 1Q92A 3E70C 1S8OA 5C5DA 1BMDA 1A9RA 1RZ3A 3ETDA 4G01B 3JR3A 4JVMA 4CNBA 4AJ9A 3B7PA 3GYBA 4BC0A 3H9QA 1J97A 1MVOA 1NV8A 1QZUA 3A4TA 3I9MA 2BGJA 4M0KA 3STTA 4YV0A 1KZ7B 2JIOA 3QU2A 3DL7A 1C7FA 5JAIA 2F67A 2C54A 3EVGA 3WKBA 1AHIA 1P19A 2WT8A 2ZULA 2JIDA 1I32A 4MUHA 2QUIA 2BUCA 1R8XA 4OX9Y 5ALGA 4KU4A 2IITA 4DLAA 4DUGA 4EFKA 1DE0A 3I2HA 2BGUA 4MWSA 1IUKA 3MINB 1ZSVA 4F93B 4OHXA 1R16A 3MC1A 1X42A 1EDEA 2HWXA 2ZDHA 3ND7A 1XROA 3PNYA 4IM7A 4BQIA 5LDHA 4ND1A 3RVOA 1QQ6A 4FYWA 1L8AA 3ML1A 1C9NA 2I66A 2V7XA 4IS3A 1GVHA 3T52A 3F49S 4ZYWA 1YB2A 1P17A 1G41A 3O1JC 1LV8A 2JLAA 1HE1C 3CZAA 3KQSA 4N4AA 4BDSA 2W90A 5FNVA 4BAUA 2JEZA 3U56A 1X7WB 1IATA 3KLNA 3URKA 4QVIA 2IOFK 4OH7A 2HDWA 2XYPA 4QPCA 1MGPA 1IHOA 4LV8B 4X66B 2VOEA 4CQMB 5HEKA 2VYFA 3BCRA 4TUYF 3VVBA 1NWHA 1RRFA 2ZT6A 3AI2A 5B58C 2Y68A 3INNA 4HNAA 1KO7A 1PTKA 3B12A 4LZWA 3IUEA 3NV9A 4J43A 3R3WA 3EYWA 5K5EA 3HVRA 4L74A 1W9MA 4J0HA 3HTXA 1MX3A 8OHMA 1CIJA 2V6GA 3ETGA 1BQ3A 4LZZA 2P9QA 4HUQB 3D1LA 4IGFA 4RC9A 1TCBA 1EGAA 3F90A 3KVOA 1YZTA 4H1VA 5HKLA 3SGLA 3OQMA 1TLLA 1P5RA 1PNOA 1BIFA 1UPXA 2E4ZA 1ZNQO 3LCVB 4DSNA 2H3HA 2P9HA 2VK2A 2EJTA 3M81A 1JGTA 4FONA 1PKXA 1SAYA 1U5CA 4WUTA 2VT2A 3ITNA 4XB6B 4BO3A 1VHDA 4IDOA 3U26A 1I36A 2X1LA 1XNRB 1SKUA 3AHCA 1XEWY 1ST2A 4ZDJA 2YV4A 1E9BA 1NKVA 1T5HX 3FIUA 3S68A 1V1MA 2A5DA 4BQPA 2P65A 1DJQA 4AWBA 1I4OA 1MN6A 3JZAA 1W0JA 5IFKA 3EXEA 4QXRA 2NM0A 5AP9A 3SXUA 2GVDC 1E7QA 1BXKA 1SCDA 2XRYA 3KYDA 3L8EA 3ASUA 1GPJA 2X3YA 1MG0A 1TF7A 4TTTS 4EJMA 4RH1A 1RHMA 3L18A 3FNFA 4ETWA 1RYHA 1YOVB 2VBGA 4MV6A 1K4KA 4NCHA 3O8OB 1TVKB 4YJFA 4FNMA 2AOXA 4JA2A 1JQ5A 4JGIA 4BLVA 4EGSA 4YT5A 3B60A 2ODBA 1S8FA 1NF8A 2HIMA 2IGTA 2R4TA 3A4IA 3ET5A 3L8FA 2EYQA 4TUYA 3SE7A 1L2TA 4M8KA 4B44A 3KOOA 3QIAA 2AUNA 5HUHA 5AI4A 1P0MA 2EFEB 3JALB 4K0KB 2PH7A 1FLDA 1ENZA 1QIFA 3HRHA 4ZV4A 3LGSA 1L7VC 2A5LA 4D8XA 2HRZA 2Z9DA 3C8UA 3CZRA 3HY6A 3WYEA 1VIDA 2YV2A 3GJZA 4FOTA 4REOA 1JA9A 4XEUA 5FUBA 3R7FA 1RRPA 3IPXA 1QPGA 1SD2A 2QK4A 4G56A 3RBVA 5AQ1A 3FI0A 1TDJA 2JLXA 1KO5A 4LZPA 3BGSA 3FPAA 1TJPB 1CJVC 2AHRA 1NI5A 2W6JA 4HZUB 3QENA 2BY4A 3PE4A 3GPCA 3UKJA 1JHYA 1N9KA 3X2SA 3V2HA 1AXEA 3CA8A 3C2QA 1QQBA 3V8MA 4C4YA 4YR9A 2CXSA 1Y4ZA 2Q7XA 1R6VA 2VDMB 3K8ZA 3AGQA 2Q9AA 1IHDA 3MWLA 4I1IA 5BOSA 4R40A 2LPMA 4CEJB 5IKXA 2YIVX 5EWJB 4B45A 5SZKB 2JFXA 2BC9A 1AO3A 2PX2A 3S4YA 1QCZA 1Q0UA 2A33A 3OY7A 4J0JA 4LE1A 3T3EA 1TZCA 1PJTA 5JD4A 2FQQA 1VIVA 5L95A 2HRDA 1QK3A 2YYSA 2QR5A 3A70A 3AUYA 5EQTA 2CBXA 3BMNA 2JAQA 4JEUA 5B64A 2E4WA 2IPMA 1T2CA 2QAJA 3W04A 4GD3Q 4UTRA 5I47A 4LV5B 4RZSA 2I71A 1OLOA 1P2GA 2F43A 2W4MA 3K9LA 5IZ4A 1IK4A 3OOYA 1JG1A 1FOEB 1NSFA 1YZGA 2IXDA 4QYSA 5FRDA 3T3PB 5C7IO 1BQEA 1YB4A 2BN4A 5CRIA 4LISA 2C42A 3G79A 3NHAA 4EHIA 4NONA 3S2IA 4RD0A 2PEYA 3PQ4A 1PV1A 3RRNA 5DLEA 3KCQA 4TSFD 1QYWA 4DLBA 4TYNA 5DNCA 1G3UA 1MAHA 1UXIA 2I03A 1V5FA 3WYAA 3K9HA 1EVQA 1VKJA 4PHCA 5FNZA 4HWKA 3FNBA 4JJKA 2G76A 3NM4A 3TS1A 1JLMA 4RMHA 4U2FA 3RPEA 3S1AA 5A4JA 2C5EA 3SNHA 1UJMA 2POQX 4HXYA 4A7PA 4DMUB 1MG5A 1M1NA 1G5TA 2I2BA 1HTBA 1CNFA 4S2UA 2PT6A 3MTAA 3V7FA 3DLAA 3JVUA 3GEBA 5JMWA 3I0NA 3V55A 4EI2A 1ESEA 3C8ZA 4UMFA 4GW3A 2HA2A 3OP4A 2O1XA 4NBWA 4EHAA 1V9CA 5JI3E 1O9GA 3PG5A 3UMYA 5A2QA 1BWQA 2GJ9A 5JC1A 3BCSA 3U7FB 3V2IA 2H9YA 2C00A 1O6GA 1P7CA 2V8OA 3GI1A 3KJGA 4UHHA 1J9ZA 4WKCA 5CJPA 4CMBA 2B69A 5BN1A 4OBWA 3QITA 2O5EA 1UBRS 3QOXA 1PR9A 3DVSX 1N0UA 1J8DA 4FEEA 4ME6A 2UZIR 3W90A 4FKZA 1KZ9A 4QWWA 4C4PA 3H42B 4K9RA 5DEIA 5EZSA 4AF6A 2XLCA 2I8AA 5E6RA 1FLVA 1E9EA 2P90A 3UJHA 5DGDA 2PGJA 1JQKA 1G8KA 1LS6A 2QZPA 3F8SA 4MROA 1WUTA 4OCZA 4PC1A 5IG2A 1KFJB 1A0OA 2XYRA 3EZ9A 5TPWB 4BATA 1W73A 1HYBA 4TRMA 4ARAA 4PQFA 1J33A 2DWPA 2BD0A 2R6ZA 3MJEA 2JI6A 1TYZA 3M6LA 4M8SA 3V97A 4ZRDA 4NE7A 4RLSA 4L7VA 3ASZA 4CLHA 1CK4A 1TF5A 4IDAA 1IZ0A 4L8VA 4Q1EA 5K01A 3IESA 4EKIA 1N2BA 3HB5X 4KE9A 4NQZA 2BFFA 5DCUA 5HF5A 2ATEA 1U1GA 4KITB 3DCJA 2XZLA 4KUGA 3C4JA 1TAQA 2HY7A 2VUTA 5AHXA 2V7EA 4QFCA 4XARA 2ODPA 3RV3A 3RUPA 5TMBA 1PD0A 3IEIA 4JWKA 3ZNNA 1LLCA 3T7CA 3CISA 3EXG2 5HDBB 1OI3A 3BRCA 5AVVA 1BXRB 3F5MA 4MW5A 3S8YA 4XQCA 2LNDA 4K05A 5FPYA 5H80A 3LX6A 4B6FA 2D0PB 4IIGA 2KW5A 5HK9A 1ISPA 2JGAA 5KX5B 3DTVD 4YO8A 2AYZA 3OZSA 3STYA 1HEIA 4RTNA 1QVWA 2CDBA 1FX0A 1TM4E 3I9OA 2VJKA 4MHOA 3ZBPA 4Z7QB 4FFBB 3FHJA 1QHSA 4HL6A 3SQNA 1F9EA 3ZGNA 3BTVA 3D3WB 4GP9A 5J4HA 1DTEA 2B4QA 1OI4A 2G06A 5KC9A 1R0KA 3AUFA 1QP7A 1MIOA 2I78A 1ZBQA 4H4DA 4BUZA 2ZREA 1ORDA 4E3WA 3FOFC 5ADVA 2HF7A 2UVPA 1OH5A 4AWAA 3AVUA 3OLYA 3PHIA 5E4JA 1AU9A 4L4RA 2C0CA 5L6LB 5AMXA 1N2CA 1IQRA 4TV8F 3D81A 1SUAA 1IOWA 2IELA 1M7BA 2PSHA 3WGNA 1H2WA 1Z7GA 2WF6A 3FFXA 3IOEA 1PIWA 4DLUA 5HUJA 3VNVA 3TOZA 8ABPA 2GVNA 4EQ6B 2F55A 1G20A 1EM8B 4M6WB 2QX7A 3B82A 3ND5A 4EY5A 1H8HD 1QANA 2UYGA 4J75A 4ZDIA 1EPUA 3I09A 2OFFA 3T1HB 3WG9A 2ANCA 5IC4A 1MT0A 3WWEA 3KVNA 2PRSA 1KMMA 5GPBA 3BGDA 3DM9B 2GM3A 3T5GA 1Z38A 4JKOA 3F0TA 2CXRA 2FFRA 5KJ1A 1H6BA 1EESA 1GXSA 3MG9A 2IX3A 4JC4A 4M9ZA 2Q6IA 4K9SA 2GCNA 3UN1A 3GJ6A 4A4DA 2TYSB 1V48A 2WQ7A 5LYYA 4ZQGA 1DG3A 3NYQA 1TT5A 5BPFA 3ENKA 4TLDA 4HZGA 1UOQA 2O6HA 1G2PA 1Q0SA 2QMYA 3HYTA 3PXBA 3G89A 4P8RA 3J80A 4LX8A 1ES9A 2CLIB 2P2SA 1Y3AA 5I7SA 1DRJA 4QUKA 4CFSA 3DC7A 3HKDA 1ZYUA 2JLUA 2HJSA 2A9PA 1GAEO 5FWYA 3RVRA 4DR2B 1GPKA 2DSNA 3E8SA 1ZM2A 2O2IA 1Y1LA 1DJNA 2AG8A 4Y1GA 3CB4A 5AKEA 1SG9A 4H7HA 2RD2A 1E1CA 1RWPA 4W8HA 2CL6X 4ONEA 4HNGA 4MITA 2IIBA 2IEZA 4X71A 5A7HA 1KI8A 3OX1A 4XDHA 3L07A 4LAFA 3R4CA 4Z9AA 1DU4A 5JR3A 3ADDA 1XT6A 6NULA 3Q1LA 1E2KA 4F8EA 5BXQC 3D4LA 1U99A 3PNBA 4H6PA 1N5OX 5IN4A 4IKEA 4H7PA 3LRXA 1QG6A 4N0MA 3GGOA 3M33A 2AG0A 4OM7A 4YK7A 3DEKA 1NBAA 1D2HA 1G63A 2A59A 2JD1A 1R12A 2Z95A 3AKCA 4UKDA 4QUDA 3EVNA 3GXBA 1YONA 1E3DA 1Z75A 2RB4A 4JGGA 5GINE 5JATA 4QQFA 3I1FA 4RVGA 5BUCA 1YFLA 1U3TA 2MTBA 4JX8A 1P5JA 2CSUA 2WHPA 5FOXA 3RJMA 3RIYA 3QVGB 1QOQB 4KQCA 3VPBA 1UINA 3ANYB 4TLCA 5EOVA 1E63A 1OYYA 1XZLA 1K6IA 2R1TB 2OFPA 3PVCA 1X8KA 4Y7CA 3AWDA 1F12A 1YKSA 2F8LA 2Q0SA 4D57A 2VF8A 1SXGA 3HACA 2M6SA 4CCYB 3L6DA 5C32A 4MRMB 2GJSA 5IM4F 2A9FA 1RTTA 2YMPA 3OFKA 4MUNA 4NE2A 1FJHA 1VE7A 5AVOA 1ZN8A 3N6VA 4HO1X 1HLFA 1YIOA 3MD0A 5FOUA 4B43A 4UPVA 4H1UA 4BRUA 4ZJUA 5L4NA 3GMSA 4KGDA 1VYVA 5TE9A 2JFZA 1SKYB 2FLKA 3THOA 3ISVA 3BB3A 4IWXA 2X8JA 3T9AA 5JTUA 1P3DA 3VKWA 3AFIA 5BRAA 1J7JA 2BM9A 2JFUA 1FS5A 2VXYA 3AI1A 3BB1A 4QGBA 5JS2A 3W7AA 4D74A 1U0HC 1C0IA 4YUYA 4LNUA 1CJMA 4MPDA 3COSA 2XVMA 1Y81A 2RMKA 3IRVA 3JVEA 4FLFA 1JHXA 3LOPA 2R7MA 5JAMA 3EMDA 4U2EA 4NULA 1OXXK 5DYGA 3OX2A 1XTQA 4XEHA 4WK2B 2OD9A 3GP5A 4FI3C 2LR0A 5CB4F 5CVJA 5CLIA 1W93A 2H92A 5EHQA 2JK1A 4JLPA 1LSUA 2GNAA 4BE7B 1TAUA 1JLLB 4AJPA 2JIPA 2C59A 1K68A 4KDCA 3ZD8A 4XRRA 4PLZA 2G17A 4JV5B 2BWJA 2PX4A 1SHZA 5JLAA 1IQ0A 2J7KA 3IQGX 1ZM3A 3TRKA 4HG2A 1J8YF 4HQRA 5F5NA 4XWYA 3QXHA 5I7FA 4FI3F 1NW5A 1IXZA 1E32A 3TLYA 2O57A 3DBHA 4DDUA 4YRIA 2C9ZA 2XXAB 2Q5FA 1W0KD 1XCPA 2PFKA 2Q1SA 1ISSA 2UYYA 2W2VA 2WMYA 2NX2A 3DOJA 2F59A 3IMEA 3PP8A 2C3MA 3MUEA 2J07A 4G5YA 1OFHA 2TRSB 3C7KA 3R77A 1P18A 4M38A 1MNQA 1J0AA 1Y9AA 3JYHA 5BV0A 5LOVF 4H9GA 3HWWA 4BN5A 3F5FA 1NKSA 4A27A 3NM5A 4WFJA 5ETJA 5AR1A 3L8HA 1B0AA 4P84A 2GRUA 5KMGB 2NP7A 5H81A 2ZDQA 4E94A 3ILYA 1O6ZA 1RJGA 3QVJA 2BPOA 2PQ6A 3GOQA 4LECA 3VDMA 5KTOA 4OK3A 5DGCA 3ZBQA 1LPMA 2HSEA 4I99A 1U3WA 2EERA 4QUJA 5HF6A 2B5WA 3Q8LA 1OPRA 4ID9A 3TJRA 2UUBB 4KFCA 1VJ0A 2CYAA 3WNVA 4K1XA 2REOA 2YX1A 5K99A 3VKFA 4EHLA 2VJBA 3IS3A 3TZBA 3V8QA 4ARZA 4BNJA 1XE3A 3SS9X 5EJFA 5E7QA 1W581 3VR2D 2E3JA 2Q1UA 2C5GA 2BEUB 3BCUA 3EVZA 3DEAA 4TKZA 3VU9A 1VI2A 2G07A 2ZXFA 2XZDA 4HN4B 5CVCA 3U1VA 1F6WA 2HU7A 4TMKA 2BTOA 4CU2A 1RAGA 3C98A 5CB4A 3RDPA 1U2ZA 2D7DA 3D5TA 3W3ZB 4LDAA 5AESA 3HKBB 4E22A 4EJSC 1VFNA 2BH2A 3I4LA 2BCJQ 3SI7A 5CTJA 3X1ZA 4CU5A 1JHMA 1Y6FA 3LYLA 5AXCA 4TXLA 3LL7A 3BTOA 1DRVA 3HUTA 1T2AA 3OEEA 3L82B 5ALJA 4AQ7A 2Q1YA 2O07A 1PZNA 3H6KA 5I8ZA 1XXLA 4JJAA 4L2IA 5FI5A 3OHMA 2UUOA 3EEIA 2IHUA 4WLNA 1KZYC 4O2BB 4CMAA 4R1QA 3B2NA 2H1RA 3EZ7A 5LOVA 1IK6A 2GZRA 2PPLA 2A88A 3L92A 3OJCA 4KQHA 4OD0A 2AMLA 3ZY2A 2O3JA 4I50B 1YJXA 3LC1O 4MXDA 1WEKA 2G4CA 3HC7A 4X61A 2OMKA 4ZQFA 5G02A 1C9EA 1FPMA 3PHJA 4NR0A 4EEKA 2YHIB 1WX1A 4BWGA 2H8GA 3BWXA 4KQ2A 4I36A 3OJWA 5THXA 2PRJA 3UJDA 2NXCA 4A6EA 3HBAA 2O05A 4F06A 4IPTA 3WHKA 2IHZA 4WLVA 4CL0A 4CTOA 2G70A 2FETA 2GUWA 3TO5A 3M70A 1LQUA 4MGZR 3KKZA 3GMIA 1GJRA 2CJYA 1ISMA 3LAWA 1A7KA 3RO7A 3H1PA 4PTZA 4G8CA 3VI4B 2RGBA 2P2GA 6CHYA 2WTEA 3DT9A 4BASA 4KTVE 1BU8A 2XW6A 4P34A 1NQVA 4XX0A 3EWSA 2VP4A 2XSZD 4FWBA 5KTNA 4PTLA 4KXWA 2WP0A 1DV1A 2A9JA 5H1YA 1YS7A 2RBGA 3H2IA 4B0PA 3HSYA 3PL5A 4S1NA 3EG9A 1DB3A 1U7TA 4HS4A 4ZU3A 3L79A 4IGEA 4CR8A 2AD1A 5K03A 4G4SO 4OXRA 3R23A 1DI0A 2ATXA 3NIBA 4W6QA 4RL6A 1EX7A 4Q16A 4WA8A 4IW3B 3JQGA 4FX2A 2AZDA 3K6SA 1WVMA 4RPLA 2CNBA 2CHQA 2ECQA 3TSCA 2BM1A 1HURA 2JLRA 3CUYA 5A5VA 4EJSA 5EZ6B 3VBEA 2DOKA 1IONA 3KKOA 3KT8A 4HJRA 3V4RA 3LO5A 2IXGA 1XL1A 3K6RA 3QFTA 4AL4A 3D3EA 5HHTA 1ZSYA 2D8AA 4AZVA 3OIFA 4JL8A 2BGRA 2AEEA 1GPNA 2IYQA 2IYLD 1LW7A 2YQ5A 1RWMA 2JDID 1PQPA 4FQ8A 1QIDA 3QWBA 4NIMA 5TQ2A 3OQNA 3U49A 4M49A 3IAS6 1TJNA 2OC4A 1NASA 4B76A 4ZC1A 1AQIA 4GS5A 3V2GA 1Z4QA 3CLUD 5CA0B 5KWEA 5J23A 4U7FA 1GZUA 1W7AA 2D7CA 3OY2A 4TLAA 4G5SA 1O9BA 3DZFA 4MVCA 1XF1A 3QIVA 4B83A 1YF3A 2P4EA 1ZRMA 5ALEA 1D4OA 4RK1A 5JRDS 4JDUA 2ZR9A 2GNOA 2QLBA 3FYTA 2H16A 3L05A 4IG4A 1M2JA 2DHQA 2YJ6A 5DCWA 1LUAA 4PIMA 5LJIA 1JR3A 2PVSA 1RRCA 2D59A 3IP1A 1D4AA 1LWNA 2NZWA 3COVA 1UH5A 3W5AA 1N2CE 2PUDA 1TKAA 1QGYA 1MTOA 3RROA 3C3KA 4RHCA 1G5PA 3E5NA 4LOKA 1WMDA 4UU7A 1G20E 3IR7A 1IEQA 5DGXA 1EH5A 5J4VA 1U81A 2RAPA 1G42A 3QYPA 5IC5A 4DLWA 2CFSA 4BMVA 3U61B 4LBVA 4RV4A 1CUAA 3FWHA 1X1TA 1FYDA 2LKDA 1XTPA 2D2VA 4G1FA 4RFLA 4HQOA 4JT2A 2YBDA 2ZCUA 2ZIXB 3DTYA 2CHVA 2Q3MA 1NVKA 5MFZA 3AUKA 2XKBA 2O1SA 3B8EA 3KFXA 3ICVA 5E0OA 3EQ9A 1RP1A 1B1CA 5FWDA 4I4CA 1AIPA 3LNTA 1HFJA 2I2FA 2CV1A 3DAOA 2HT1A 3AJRA 1MOPA 4XIFA 1LH0A 1A77A 2FRVA 2WVHA 5E2IA 1UKYA 3ILXA 5JH7F 4X6XA 2I4IA 4XD2A 4DBVO 1PKEA 1PSZA 3U3KA 2P4UA 4ES6A 4HGQA 1NV9A </