5AJXA

Human pfkfb3 in complex with an indole inhibitor 3
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
444
structure length
441
Chain Sequence
b'PLELTQSRVQKIWVPVDHRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
molecule tags Transferase
source organism Homo sapiens
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
total genus 156
structure length 441
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajxA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajxA02
4BZPA 1Q22A 1US8B 2QE7A 4XVRA 4A1FA 3K9GA 4UXIA 1E2QA 4LYHA 4IOKA 4NMMA 3X1ZA 4ESHA 2F3RA 2JEOA 4LBYA 3K0AA 2EFDB 4XVQA 4JKIA 1U8YA 5F3WB 2WM9B 1P2UA 2R9VA 3GFTA 3AF1A 2ZR0A 4NYIR 3V4RA 3S1AA 2RH5A 1L7VC 3KJHA 2GETA 1TEVA 3HP1A 4B76A 1Z47A 2FG5A 3P4XA 3AVPA 1Z0AA 1KOFA 2CMKA 5FI1B 2JLWA 2AK2A 2ZRLA 2LCFA 4LJYA 1KAOA 3KFXA 3K0SA 1U2RA 4P4TA 5IK2D 3NC0C 4BRWA 3LWNA 2P2YA 1P9WA 1UJBA 3C7TA 4BASA 2V9PA 1X3SA 3THXA 3IT3A 4TYYA 3GFPA 4DUGA 2H52A 3SJZA 3ZVNA 2FMXA 2OXRA 3MD0A 1G19A 4Q01A 4IW3B 4PX9A 1FX0B 1XD2A 3FHCB 1U0HC 4PPNA 4YDHB 1M1YE 2FFBA 1N6NA 2IT1A 4W5WA 1ZIOA 4U02A 4HAVA 5AUNB 4A8JC 4AWXA 2OCBA 1W0JA 1HQYE 1E69A 2FEOA 2JIZA 1E79D 4KVGA 4IDOA 5SZKB 3AP3A 3L2OB 1SVWA 4QGFA 4O0MA 5DYGA 5DHAA 3VU9B 4ON9A 1L4YA 1W5SA 4OHYA 1UBEA 3JVVA 4LHWA 5FR2A 1XEXB 1P73A 1D6JA 1U9IC 3VHXA 5IF9A 4JBWA 4QL3A 3IBGA 1LF0A 2ZRIA 1G7CA 1KNXA 4JKYA 2QEQA 4QG7A 3UXMA 2AK3A 2VHUA 5FOTA 2O8EB 2REBA 3EC2A 3N2EA 1U81A 2OBLA 4RD4A 1T3LA 2GEVA 4Q1EA 2C9YA 1JR6A 3Q72A 4LHXA 4B2PA 5GJVC 5FPSA 4AK9A 1TADA 2XOKA 2ENWA 1G1MA 1Q1ZA 1XXHA 4NP6A 3EPJA 4Z51A 1WCV1 1ZW6A 4E09A 2X77A 3ZQJA 2XSZA 4QBIA 1OHHA 5FPTA 2IYZA 2BMEA 2OE2A 4FW9A 4A8JB 4EPWA 3SU8A 2GXQA 1UKVY 4FINA 1E9DA 1ZAKA 4XH9B 4Q4JB 3U44B 3M4YA 3U7GA 2WIAA 3X1YA 1AM4D 1SXJB 2QAGB 2NO6A 2W6JD 3FOZA 1S96A 4HEJA 2FGKA 1N6HA 4GL2A 4BLQA 1E0SA 1OW3B 1UJCA 3TW8B 4GSYA 2OAQ1 3LV8A 4V0KA 3R8CA 4ZV4A 2ZXUA 2Z6VA 1J99A 2WWYA 2VO1A 2FDCA 2B8WA 4OQFA 2QL6A 5GADl 2UZIR 4NCHA 2DPXA 2RGBA 3R7AA 2ZSDA 4DSOA 3TIFA 2QMOA 1NL3A 4M1YA 4TZ6A 5GVRA 1QRAA 4EAQA 1N0UA 2ZJ2A 3CPHA 3D6TB 4WW0A 2YNMA 3ZDQA 1S8FA 4G0NA 1DAGA 1E58A 1QG2A 1SVKA 3K1JA 1Z0IA 4PO8A 2ZJOA 3PG5A 1EFTA 5DIFA 1Z6AA 5IDVA 2H18A 4YMUA 2P0EA 1RZ3A 1AKEA 3U61B 4OQNA 2JASA 4LJAA 4PQFA 3LG2A 5JSZA 4XTRA 1CULC 1TUIA 2WJHA 3K9NA 1IN6A 2EYUA 4KFUA 1VIYA 4JLOA 4KAXA 1E59A 3FMFA 2JJ1A 2JDIA 2XZPA 3P20A 5CB8A 1R10A 4EPXA 3R9IA 2H8KA 4HUTA 2Y8EA 5FL3A 3OFND 1Q57A 1HQCA 3B5JA 1S1CA 3UMSA 4URVR 3OFNA 3SR0A 1AZTA 4L9WA 4QBFA 2XITA 4US2R 2WOOA 4JLJA 1OB5A 3J81k 3CM0A 2DY1A 1M8PA 3FTQA 2CBZA 5CX4A 2W83A 3I73A 4FMDF 3CRW1 3PUWA 4PSAA 5JWOA 3B9PA 1Z8FA 4Q47A 1K5GA 4B3GA 1DVRA 3E9CA 2V7QD 1VYVA 2OHFA 2A78A 6Q21A 1Z5ZA 3AGQA 2QROA 4NYJQ 3AKDA 1FUKA 4IVPA 1IJEA 5FOWA 1E1QA 3T06B 2R62A 2HUPA 1WRBA 3AV0B 1XMJA 2O8DA 4V03A 4Z1MD 2ZI4A 3U3JA 3RS3A 4Q4JA 1OIVA 3RLFA 2VEDA 4I1SA 3SHWA 3IKJA 4UXHA 3UKDA 4NDZA 2PEYA 5H68A 1FNMA 1PUJA 2BJVA 2O0KA 1XZQA 5JHGB 221PA 2FFHA 2C98A 3NVAA 2BBTA 4F38A 4URXR 4OJKA 1BH2A 2W2TA 2DR3A 3UG6A 5KHOC 1KI2A 4HYYA 2BKUA 2G6BA 4IOMA 3RHFA 5JLJA 1AIPA 2GRJA 4D4KA 2CK3D 2I4IA 2OFOA 2P67A 2C78A 4EPYA 821PA 2EU8A 2GEUA 3QOFA 2P5SA 1K6MA 2XTMA 2W2VA 4PR0A 1OB2A 1YZLA 2NO1A 1L4UA 2EFEB 4PANA 3CKLA 3CNLA 3W6NA 3LFUA 4PGMA 4II7A 4QBGB 2NO7A 1VG1A 3AKCA 3R7WA 4FWIB 5G53C 4AD8A 3L0OA 2YKGA 2EWWA 2GZAA 2ZSBA 4QXAA 121PA 2CVHA 2BCGY 1AJEA 4LV6A 1FZQA 1MO6A 3NEYA 4Q9LA 5UKDA 1V37A 1HT2E 1KO5A 4DB4A 1ZNWA 4NBSA 3OESA 1VECA 4Q4HB 1RYHA 1F2UB 1XU4A 2V4ZA 4B43A 5FOVA 1ZINA 5G3ZA 2O8BB 4DDTA 1DS6A 3PFIA 2DWQA 4BLRA 4D0NA 2IA5A 1E9RA 2QP9X 3QEOA 3SDZA 2D7CA 4YMSA 1TU4A 1XEXA 3PENA 3ADKA 1MV5A 1G3QA 4ZO4A 1CRQA 3LDAA 4ARUA 2AKYA 4HDQB 3QPUA 4JYCA 3ZD7A 1KO4A 2GK6A 5H1YA 5DGXA 3T1QA 2OFWA 3W9YA 3A37A 4OQMA 3FHOA 2ZRHA 4Z8YA 4EMBA 1G5RA 1P4SA 1OPXA 1N5JA 2ZU0C 4O2LA 5AJXA 5FL7A 5EE1A 4TSRA 3RS4A 5HKKA 2UKDA 5CM9C 3ZVMA 2EQBA 2N1BA 3OHMA 3T15A 5FUYA 2JLYA 2ZS8A 1SK9A 4GP6A 2V1UA 1NG9A 4MDFA 4MDEA 1C9KA 4FDUA 4GOJA 2ZYVX 4OI1A 3V9PA 3EZ7A 4BLTA 4D4JA 2PX0A 5AK0A 1OXVA 2B7CA 3E2IA 1E2NA 2VSFA 2X2EA 3LW7A 5FTKA 1Z29A 4AKGA 4OKSA 3C8UA 4S35A 5J5CA 3S1AB 1UDWA 1VMAA 2JLVA 1TX4B 2RGXA 3AVQA 1U0LA 1P3JA 1RRPA 1DAHA 1YRAA 5KTYA 2YN2A 4TLDA 1NRJB 2HT6A 3Q5EA 5KO2A 2V7QA 1D2NA 1YJ5A 2OT3B 1E99A 1OYWA 2OCPA 4K81B 4MGKR 4UNQA 1AK2A 4JJZA 4XSHA 5CLQA 2ZPTX 3EARA 1XPRA 1UF9A 1T4GA 1CIPA 2Q9CA 3RS5A 1I4LD 5J4HA 4G1UC 4PQYA 2VPPA 2C99A 4K8OA 4PZZA 2BM0A 1G5TA 3SC3A 3H84A 4KSBA 1SK8A 4JOCA 1A2BA 4CEHA 4L5BA 1U94A 1HTWA 1G21E 2QMUA 3GD7A 3GJ4A 4JVSB 1QHHB 4BLSA 2IXEA 2GHIA 3CPJB 3QF4B 1IXRC 3VR1A 1W5TA 4TLEA 5TY0A 2XZOA 4BPBA 1XQ9A 5L3SB 1DAKA 1E1RA 621PA 1ZM2A 2O0JA 3DPUA 1BMFD 1C80A 2ZROA 4CF7A 3CF2A 4OI0A 1D8TA 3EZFA 2FE4A 3CO5A 3ICEA 4HAZA 4MYTA 1FFHA 4GNKA 4QJ5A 5B64A 3DM9B 1NBMD 2VHTA 2BMDA 3GLGA 3KB2A 1N6IA 1JEDA 2GCOB 1L2TA 3KTAA 4DHEA 2ZJ5A 1E9SA 2GWHA 1WE2A 2WWFA 4LV5B 3TLXA 4B3XA 4DSNA 1SXJA 2QAGA 3PXGA 3SQXA 2VP9A 4GRAA 4C3ZA 4XVUA 1SXJC 2QAGC 4NL4H 2JGNA 5J4VA 2A5JA 1KSFX 2XSZD 1ZUNB 1G16A 3RAPR 4CVNA 4FIDA 3SJCA 3BIFA 4Q7MB 1GRRA 3TUJC 1AKYA 1NY5A 4Q9JA 2PBRA 3HJNA 5LBIA 3WMFA 1YZKA 3WHLA 2ZYUX 4QHTA 3IUYA 3TQFA 1GM5A 3B6EA 3THYA 3PCRB 2F1HA 3K0CA 3KJEA 1E4VA 5EP3A 1OT3A 2F7SA 2ONJA 1E9CA 1XWIA 3K0FB 1D5CA 2B8TA 2O8BA 1YZQA 1EX7A 1YU9A 3RC3A 1IY2A 2QI9C 1G4UR 5E95A 3TK1A 2IS4A 2P79A 1TEXA 3FVQA 3ND8A 1A7JA 2IK8A 2WJIA 4YC7A 1SKYB 3B82A 2J41A 4OHVA 4ZDWA 1E9AA 4KBFA 1G5PA 3LX8A 5DNYB 4ODIA 3BB1A 1IN4A 4MH0R 1UEIA 2DWOA 3BOSA 3CH4B 5EP1A 5IRCD 4NKRA 2ZSFA 2ZYWX 4AI6A 1CR1A 3TAUA 1ANKA 1XXHE 3KB1A 1K5DA 4EJSA 1KGDA 4KODA 3V00A 5K8IA 5JI3E 2P77A 3K70C 2OCAA 2L0XA 3CX6A 1ZM4A 4B71A 3AB3A 4R71A 1KI4A 3U3MA 2CCGA 4ZDIA 1ESMA 2WAYA 2BMJA 5DSZA 2ZJ8A 4NCKA 3KL4A 4C0JA 4A6PA 3ZHCA 4HAYA 1LY1A 1OXTA 1NN3A 4HATA 4DLZA 2C9OA 2KJQA 3TGPA 3K8YA 1XTKA 1E9FA 4UXJA 3QXJA 4DT1A 1G3RA 3KQUA 3WRXC 1P75A 2Q9BA 1R5OA 4UKDA 1XMVA 3SI7A 2CVFA 2GCOA 4E5UA 3OE7A 2WBLC 2FEMA 3VFDA 2CK3A 5BYJA 4C0HA 1FBTA 1A2KC 3EIQA 5C18A 2HV8A 1D2MA 1HA3A 1TAGA 1FP6A 4B6FA 3BK7A 1K8RA 5DHFA 3W34A 3ICQB 2HT1A 4Q21A 4DCVA 3PGMA 1GFIA 5BN3A 1SULA 1DAEA 1QHFA 3KKMA 4Q48A 4PXAA 1IONA 1GILA 3Q7QA 1JEEA 3ZYCA 5EUQB 2NZ8A 2YWEA 4AYTA 4Q4AB 1I2MA 1UBCA 2RFLA 4F93B 1JJVA 3ZQ6A 5EUMA 4BRUA 2CL0X 2QTHA 5EE5B 3LAWA 2R6FA 4WIAA 2FN4A 4Z1MA 1KK3A 2F9LA 4DLRA 3NDBB 2W6ID 2B92A 1Y63A 3ECCA 3ETLA 3U3KA 2P30A 4TSFD 4RSGA 3U2QA 1G6HA 1OXXK 4MGIR 5CYOA 3G0HA 2QNRA 3CUEF 5DH9A 4D0GA 1VYTA 2NG1A 3ADDA 4MUBA 3THWB 2H0QA 1KYIA 3G82C 1WA5A 4G5RA 4WBSA 4JVLA 3D4IA 2J0UA 4BFWA 1TF5A 4YONB 4A6XA 3QXSA 5FPHA 2D06A 3QBVA 2GAOA 4Y0AA 1KKMA 4LJ6A 5FH9A 5BXQC 1FTNA 3RS0A 4EJSB 2I1VB 2G0TA 3U3RA 4POAA 3GLFE 4OK6A 4BEBA 2VIIA 2IEZA 1LFDB 2QQEA 2GF0A 1E2MA 5G41A 4G5GA 3LXXA 3KXIA 1XDBA 3AH8A 4TYPA 2IYRA 2IEYA 5G40A 1T91A 3BGWA 1P6XA 1QG4A 4I99A 4IXMA 2J0VA 1E2PA 2ORIA 1R6BX 3SN6A 1G3MA 1R0WA 3LY5A 5JCZA 3EIEA 3R7WB 1JPNA 1QVAA 4IKEA 2O0HA 4ABYA 1G3UA 1OH6A 3A1WA 4HB2A 4V0OA 3V4FA 1KSGA 4MRNA 1JALA 3DCYA 1QBKC 4AC9A 2ZEJA 1N6LA 1J90A 1E98A 4TTPA 2OM2A 4TMKA 3VNVA 1E94E 1XD2B 2J0QA 5FTNA 4DLTA 1G7RA 2BKEA 2MMGA 1G20E 4B2IA 3VTKA 2ERXA 1Q1QA 4KYIB 1NMZA 3RS2A 3KFVA 4OI4A 2BVNA 1UADA 4OJQA 4PZAA 1EESA 2YZ2A 3GLIE 2BM1A 3HU3A 5K8LA 2VHCA 5BQ5A 3TUZC 2WSSD 4CEIA 3DL0A 1AZSC 1W4BA 2PMKA 1GRNA 4MGZR 3RSOA 2R6AA 1ZCBA 3KTAB 3RC8A 2ZRBA 1KDOA 1A1VA 1T5IA 1GOTA 3EXAA 3HDTA 1G8YA 4X8LA 3AEZA 2PA0A 3MMPA 4QHSA 5L3SA 5LD2C 1QHGA 1G41A 4B6EA 3OIYA 1EFRA 1WXQA 2RAPA 3R8FA 2JLSA 3UWOA 3WNCA 3FDZA 1KMHB 3PEYA 2AFHE 2XX3A 2ZUBA 2B6HA 4F4IA 1GL9B 1H8HA 4Q03A 5DI3B 4LY6A 2QBYB 3D6AA 2H4XA 2NPIA 4LC1A 3AQ4A 3OF5A 4H1UA 4B3CA 5KPJA 4KFTA 3LNTA 1TQ2A 4DCUA 2ODNA 4DCTA 4PZLA 1XTQA 4Y0VA 3SEAA 5KSYA 1N6KA 1LVGA 4MKGA 4PO9A 4PSVA 5KYKA 1FX0A 2PLRA 4R2HA 2J9RA 3KDSE 2WMNB 3DM5A 5FI0B 2QPAA 3IHWA 4BFYA 4JMPA 4B32A 5G3YA 3DEFA 4GDFA 3THWA 4FCWA 4X8OA 1VCIA 1NI3A 1KDRA 4ITRC 2XXAA 3F2IA 2ODEA 2QUZA 1CJMA 4LC0A 2EKBA 2RGNA 2OESA 3GCGA 1ZD9A 1E2EA 5JI2E 4QGHA 2JIZD 1MH1A 2O8DB 4RZ3A 3O47A 2OV2A 2ZI6A 2JCSA 3R9WA 4Q4AA 2CEAA 2OCYC 1YZGA 2A5YB 4A4DA 2IW3A 4TQAA 2WWIA 3LH5A 1EFCA 3VAAA 3I32A 3U7FB 4BFZA 1WBBA 1E2FA 2C04A 5KDOA 1GDDA 1FTSA 4ZDKA 2RKOA 1R5BA 4G5SA 1MO3A 4LCBA 2FSHA 4DSUA 3QJYA 3ZS8A 5F9FA 4FCVA 1W48A 3MWLA 5HE9A 4GMDA 4RCYA 1ZNXA 1DPFA 3GLIB 2IHYA 1MO5A 1OLOA 1ZUIA 3FFBA 4M53A 3U44A 2P6RA 2QSZA 2HEIA 2HYIC 3FMPB 2WKPA 3Q3JB 2XTNA 3AGPA 3H2YA 3GJ6A 4QGGA 4N0DA 3LVRE 3LX5A 3B60A 1L8QA 4QKQA 2VF7A 3DVLA 4W5JA 1KK0A 4PTLA 4ERNA 1JBKA 1NKTA 2P2LA 3QE0A 5FUWA 4MKFA 4Q9IA 3RRZA 4ZIRA 2YVUA 4D25A 2H17A 3GLGE 5HR5A 5CU7A 1DO0A 4JVNA 5JHHB 2JLUA 1PJRA 2QG6A 3FYHA 1SXJD 2CDNA 5GJCA 3Q7PA 5JSZB 4AURA 4LBWA 1E1QD 1CP2A 5GVSA 1H65A 1VCOA 5C4GB 4P32A 4YQFA 1Q3HA 1P5ZB 3DKVA 3AF0A 1GNPA 4C0KA 3LQQA 4ZDJA 5KNDA 1XTJA 1IY1A 4LI0A 3WYAA 4M1SA 1NVWQ 1XCGB 4HDCA 3PEWA 5CLLA 3IGFA 1XRJA 4X8MA 1E2GA 1EWRA 3P32A 3QPVA 2WSSA 5ANRB 5EP4A 3TW4A 2WHXA 4I4LA 3X1XA 3PUZA 3E5HA 4ACAA 4TL9A 1ODFA 1G8PA 1ZM7A 3R9XA 1E2HA 4LJ5A 4OL0A 1DADA 2BC9A 1UDXA 1DKMA 3AF2A 5AR1A 2F43B 2HLDA 3O8DA 2YOFA 4RJLA 2KSQA 2KBFA 3EW9A 4QBHA 1UKZA 4EFLA 3GLIA 2WIBA 2PLFA 3PQCA 1A82A 3C5HA 1W7AA 3RSLA 1GSIA 2FJUA 3B1YA 4WXRA 3TH5A 5BW8A 1KJWA 2ZUDA 3KJIA 3OEED 2HLDD 3TVDA 3EX7C 4Q1DA 4P0TA 5CDHA 2DFLA 3VMFA 2ZE8A 5TARA 1RRCA 3K4PA 4DIDA 4B47A 3U4QB 1MOZA 4TLAA 1E32A 2J45A 2K5UA 2HIAA 1S9HA 3THOA 2XJ4A 2YOGA 4HZUB 1PLJA 4M9SA 1IXZA 4L15A 2JLXA 2ZRKA 2PJRA 5PGMA 5SZIA 4HB3A 3UIEA 2AXNA 1WQ1R 3IIMA 4E07A 1X8KA 4IOJA 1AS2A 3BAFA 2D4HA 3T12A 1CKEA 4F4CA 4PFSA 3A8TA 2X8AA 3SYKA 3U6KA 2GK7A 2PZGA 3SE0A 4EKDA 3VKGA 4DDWA 1EX6A 2C95A 2ASEA 5GJBA 1OH5A 3HR8A 4H1VA 4M1WA 4TL7A 1XTSA 2CNWA 2D2EA 3BXZA 1YJXA 2HXYA 4GZLA 1QHHA 1JNYA 3KQKA 4BFUA 2RHMA 5SZJA 1G7SA 3CBQA 2AR7A 3JZAA 4YMVA 3TBKA 2W6JA 4DJTA 3EZ6A 4FWTA 4JT4A 3F3KA 1Z28A 2FPLA 3DO6A 1CJKC 4YXWD 1II8B 4D2IA 3QEJA 5KDDA 4IHQA 3NDPA 5TVKA 3LRPA 1NLZA 2FZ4A 3KKPA 1NLYA 4B2LA 1WBDA 4D0LB 3ZLJA 4ZI2A 2G1KA 3FMIA 4G3XA 2IYUA 1IHUA 2Z83A 3QBTA 1TL7C 2JATA 2G88A 2QGZA 2RGCA 1G291 1ZUHA 2FPKA 3BB4A 3MGCA 4WZBE 4DLYA 3IPYA 4LV8B 1OIXA 3BFVA 1E96A 2ZJBA 2ZU6A 3FKSA 2CHQA 2V3CC 2EYQA 1JR3A 2RGNC 1OIWA 3NIBA 1OH7A 1HE1C 2PZFA 2OBMA 1WF3A 3SJBA 1UAAA 1B23P 1N2CE 3W90A 4PPFA 4DKXA 1VIAA 4NYJR 4CW7A 1AQUA 1QHYA 2ZI9A 1YHNA 1ZD8A 4DLSA 2F90A 3PUXA 5KSPA 5JFGA 1Q12A 5J40A 1RIFA 2IYVA 3AP2A 3BH0A 4MITA 3RRYA 3U3OA 2A30A 2VBCA 3GLHB 4RD3A 3QXCA 2GFIA 1OFTA 1OXSC 1BYIA 1F2TB 1BOFA 2XB2A 1Z6XA 2QTFA 1T8UA 2BBSA 3FGNA 4RKEA 1JQJC 2YWHA 1XZPA 2FX3A 4Q9HA 5DISB 4ZCLA 4CRWB 5C2JB 1N3BA 3AUXA 4OI2A 4P4SA 2GXUA 1BIFA 1KK2A 2IUTA 3DOEA 1RPTA 4PZYA 1G3IA 1QVRA 4ZPXA 3VX4A 4IVRA 2PZEA 4L8GA 4AY2A 3GW8A 2HF8A 3D3QA 4RZ2A 2GZHA 3T61A 3X1DA 5KUTA 8OHMA 4DLUA 1YR7A 1COWA 3I5XA 3OIWA 2CCJA 3X1WA 5L3QB 2QM8A 2WVJA 2XTZA 4O25A 2IS1A 4KFRA 4JLVA 1RPZA 3IILA 1M2OB 3W3AA 2N42A 1PV4A 3QQ5A 2WWHA 1ND6A 1LV7A 3I61A 3K09C 2QNIA 1KI6A 1EXMA 1T3SA 1Z83A 2RGAA 1XXHB 3ASYA 2HCBA 2JA1A 3A36A 4MRSA 3CNNA 2GF9A 1FP7A 2R2AA 3E70C 1YR8A 4KHZA 5DO9A 1SKBA 1UBFA 2A9JA 2P6OA 1B0UA 3QI2A 3NH6A 2F1IA 2ZUCA 1F2UA 3QUSA 1F3OA 3NG1A 4GT1A 4KU4A 4MYUA 4MRRA 4G5OA 1U8AA 3B7GA 5KPDA 1X8JA 5E7IA 2PH1A 1YKSA 2JJ2D 3BC1A 1AN0A 4C2TA 2WSMA 5LPNA 1W0KA 1TNDA 3ADBA 4HLUA 4UNNA 4HDOB 4AG6A 3GMTA 2XNSA 3CB4A 3W3ZB 4URYR 1J8YF 3TUIC 3IQWA 1ZNZA 2QSYA 3QY0A 3N2IA 3REFA 3IIJA 2AN9A 4IDQA 3OI7A 3E1SA 2Q3HA 5AUPB 4X8HA 4U7DA 1XP8A 3P4YA 4DVGA 3NBFA 1Z6YA 4JJKA 3BERA 2J0SA 3LBIA 5DLQC 3C41J 1OFUX 3WBKA 4DWJA 4A0FA 5JEEA 2ZR9A 1G6OA 4D80A 3H86A 1HE8B 2RHDA 4Q1BA 2A3RA 3W8RA 5AWFC 3VHLB 1NSFA 2WNHA 4QFMA 4LPSA 1OKKD 4BLPA 2JLRA 1NJGA 1NLFA 4OQXA 3SNHA 1G8GA 1CU1A 3ZZTA 4WAUA 3P27A 1CXZA 1F2TA 4RCZA 4DLVA 1J8MF 5EZ6B 2CJWA 4ACBA 1HY3A 1P2VA 3MWYW 1U90A 3KUCA 1EG7A 4TT3D 5E7MA 5B58C 2ZAMA 3X2SA 1GNQA 4UNPA 1Z07A 5BWMA 3EWSA 1KK1A 4MUAA 3SOPA 4ZI3A 5HZKA 2YHSA 4Q66C 4TZ0A 4FI3C 3EOZA 1JXMA 1MT0A 1P2SA 3NTLA 1XNJA 3D31A 1SHZA 2CCKA 3LD9A 4FCTA 1PLLA 4HUQA 2H16A 3L82B 4TYNA 3QIAA 4RFVA 3CZQA 4FN5A 5HCIA 3QSYA 2VSXA 1Q44A 2HJGA 2OILA 1QHSA 2AWOA 2MSEB 1GTVA 1Z0FA 4XD7A 5K8UA 2IS2A 2C96A 5D3MA 1W0KD 2NTYC 5F9HA 1ZC4A 2R8RA 1VG8A 5KDLA 3VX3A 1YR6A 3FE2A 3FDIA 4KI0A 5FPYA 4EPRA 3VKHA 5FL7D 5DN6D 1ETUA 1XD9A 1Z0KA 4TSFA 1JJ7A 4LSGA 4Q4LA 3B13B 1H2EA 1E2JA 1VDZA 4KCGA 2MSDB 4RFSB 1T9HA 4DCNA 2AKAB 2VTKA 1S3SA 1C7ZA 4S2EA 3LNCA 4HLCA 4DLXA 5CK5A 3KXKA 1RVDA 2BCJQ 3CPEA 1F5NA 4IOLA 1KMHA 3AP1A 1C81A 2PX3A 1IN8A 3W5JA 4F7WA 1Q1BA 1HEIA 5TXGA 4ZCIA 3CR8A 5A4JA 5JEDA 3MJRA 2QMHA 5KNBA 2LKCA 2OO7A 3C7KA 4G5QA 2F1JA 2CHGA 1IOZA 5FBRB 1W47A 1G18A 2GBLA 2DBYA 3F8TA 3F0TA 4XWKA 1SVIA 2FV8A 2H4ZA 1LF5A 3ONWA 3SFVA 1ZBDA 1OXUA 1BO6A 1Q1EA 2IS6A 1AS3A 1UPTA 4PAQA 5LB2A 2MSCB 5JRJA 3PV0A 4IDNA 4TMZA 5J4LA 3WYFA 2I3BA 2PL3A 4M9QA 2QP3A 4MRPA 4JVMA 2ZRNA 1RE0A 2XAUA 5K8TA 5L3QA 2O8CB 1U98A 3HYTA 2IYXA 2NQ2C 4W9MC 4Z54A 2Z4RA 2PCJA 4AKHA 1NJFA 1XBTA 3T34A 3D8BA 5LD2B 1IXSB 5FBVB 1DKOA 3K70B 4A9AA 1MRNA 1W4RA 1G17A 4M1KA 1CR2A 4G01B 3CWZA 1IHPA 2ECKA 2XB4A 2GJSA 1LTQA 2IHBA 1SZPA 3FKSD 3CZPA 5E4FA 3C16C 1GZSA 1SVSA 1VYUA 2E87A 4A8JA 1JAHA 1NVXQ 2QAJA 2XZLA 1G64A 2VF8A 3FKQA 2HF9A 2OBNA 2ZRFA 3BD9A 4QOSA 2D3WA 4Z8XA 2ZS7A 2KWIA 4FDTA 2ZE6A 2ZQ5A 2P9FA 1TQ6A 1JECA 2J59A 3SYNA 1EFHA 2J1LA 1GKYA 1E79A 2KB0A 4P31A 4EFMA 1RRFA 2VP6A 3BB3A 5DN6A 4IJ6A 3MCAA 4A0GA 3LBHA 2OLJA 4XJXA 4LRWA 3MAAC 1E2IA 1T0HB 2PJZA 4LJ9A 1TMKA 1ZCAA 1DKPA 4KSCA 3OIVA 1AGRA 1N25A 4IRUB 2IYSA 1KI6B 3WHKA 2BBOA 2ATXA 2PCLA 5B30A 4DUGD 2WZQA 4NYIQ 3LVQE 3NBZC 4ILEA 4LYJA 1R8QA 4AROA 1RC8A 4V0LA 4K46A 5EXPA 1KO7A 4PAOA 4DDVA 1EBBA 1NT4A 2YJTD 1YVDA 1OF1A 3EZ2A 3IO3A 1TQDA 2A5FA 1MABB 1IBRA 4QC2A 1ZC3A 5CK4A 2IC5A 2WJGA 4HAXA 2J5XA 4KV9A 4NCNA 2WJVA 4TT3A 4ARVA 2KBEA 1QHNA 1DEKA 4D4LA 3THXB 2ZJZA 2ZRJA 2HPAA 4BEJA 4EJSC 1IN7A 4IDHA 4TL6A 5KU1A 3HPRA 4HUQB 3TMKA 4GPZA 2GJ8A 2OWEA 4M22A 4GFDA 4CGZA 1NSTA 4Q18A 4QGAA 1DELA 3GJ3A 1Z2CA 4M21A 3QNUA 4MA4A 1DKLA 4E3WA 4OYHA 3FWYA 2CL6X 5JJKA 3TVTA 2PMDA 1IQPA 2AL7A 1ELOA 2GJ9A 2FA9A 5C1BA 5FOXA 3I8XA 3K0EA 4J0QA 5EP2A 1TU3A 3CF6R 3QKTA 1BS1A 1VCMA 4TLCA 3NBYC 4PAMA 4FMCF 2R65A 1LS6A 3K9HA 3DMNA 1KJZA 2ANBA 4I1UA 4EDHA 1US8A 2PT5A 4HLDA 1BKDR 2ZTSA 1NVVQ 1F6BA 4LHYA 5KOYA 4BGDA 1X6VA 2EFGA 2WPDA 2JJ8A 5HPYB 3K53A 3OIUA 2ORWA 2C5LA 2QT1A 1XEFA 4KYUA 1E0JA 1ZVQA 2W6IA 4KVAA 4ESVA 1GNRA 4P33A 4UNRA 3L0SA 3FFAA 1W2HA 5J4KA 4DEYA 2QBYA 1G8HA 2NGRA 1XMSA 2BJWA 1DARA 4M9ZA 1KDPA 2P5TB 1SXJE 3CX8A 1Z0DA 2OG2A 3DZ8A 3TNFA 2OWDA 4GP7A 1YQTA 4R98A 5BN4A 3LXRA 3RRNA 2H57A 3AVTA 1BYUA 1UBGA 2BMFA 3KZ1E 4EPVA 2Q0HA 1VHLA 1XFAA 1TTTA 2FSGA 4Q9KA 3SS8A 5HKKD 3F5FA 2IF2A 3QKRA 4RD1A 1R5NA 4CDGA 3BORA 3CR7A 2RB4A 3C4JA 3MWJA 5FTLA 2IWRA 3RNLA 4A82A 2X1VA 2ZJAA 5FUXA 3VKWA 2HXSA 2WKRA 5EE3A 4AKEA 2ATVA 1NVUQ 2CLCX 3KKNA 2LWIA 5TDHA 1DAIA 1VPLA 2C03A 2YWGA 2J0UB 4C0AC 3U4QA 4QNMA 3B1WA 1Z6GA 2BEJA 4HSEA 3VR2A 3EPLA 1HH4A 1OHHD 2HDNB 4LJ7A 2VP5A 4V0ME 3SBEA 1BQ3A 1W36B 4DC9A 2CE7A 3NXSA 3QVVA 5F2EA 4C0LA 5JECA 2WWXA 1X86B 4NE2A 4XTCS 1VHTA 3FMOB 5KNCA 3TSZA 3W5IA 4LWZA 1T0JB 4B48A 2J46A 2PEZA 1E0AA 1GG2A 4IJMA 1SKAA 2EWVA 2ANCA 1UEJA 2QN6A 4RZXA 1W44A 521PA 3L43A 3ND9A 1Y3AA 4M1OA 2VHJA 3TR0A 3QKRB 2EFHB 3ZVLA 4LGMA 1OE0A 3C5CA 3GP8A 4MQBA 3EWAA 4OQLA 4LYAA 3BH7A 1LNZA 2FOLA 1NMXA 1KO1A 2NO9A 4I1OA 3BFXA 4NCJA 2X2FA 1GVNB 4OBEA 5H70A 2GJKA 4IXNA 1N0WA 1Z6TA 4LOAA 1G7TA 4DZZA 1N6PA 3Q8XB 3ZGXA 4D26A 3RWOA 2ENUA 4BZQA 1OFHA 2KI5A 4V0MA 3K9LA 3AVYA 3D7MA 3GEIA 2FWRA 1SKYE 3GPLA 5AJVB 3HWSA 2E1RA 4C7OA 3CRVA 3JVUA 3B78A 4TYQA 1X1SA 1XPUA 2J87A 2P78A 1W46A 3A1TA 2CNWD 2BWJA 3AVUA 3ZZ0A 3Q5DA 1CJTC 3DZDA 2QE7D 1R0ZA 2YN0A 1XJQA 4TMTA 2FSIA 3RDPA 3O8BA 3CWQA 4TMWA 1KJYA 5TB5A 3IBYA 2R6CA 2ZI3A 3PEUA 4TTRA 3AUYA 1ZMXA 5EZ5A 1DOAA 2OAP1 1GUAA 4CYMA 3O8CA 2RGGA 4NONA 1TF2A 3EC1A 4PHHA 2XGJA 5ELXA 3GJ7A 2FFAA 1JI0A 4B73A 1S9DA 3CIOA 3A1UA 3GEEA 3WYGA 1QWOA 1IJFA 3LL4A 3I3SR 1R0XA 3JZMA 4O3MA 2JDID 2JJ1D 4LBZA 4XIGS 1XPOA 5JJIA 1J2JA 2AXPA 4NH0A 3H1TA 5FOSA 3L0PA 4YMTA 1GITA 1DG3A 4QNRA 4GOXA 3GFOA 1OKKA 1E1RD 1OH8A 3SJAA 2ONKA 3HU1A 3N5CA 4B74A 4IVQA 4PO1A 3T5GA 2DCUA 4MKIA 5FOUA 5C4MA 3T1VA 3A58B 2IWHA 4HBZA 2XJ9A 3CRMA 1NMYA 4LUCA 4TTQA 3AVVA 4LYFA 2ZANA 4GZMA 1NIJA 1ZJ6A 5E7JA 5FTMA 4C4PA 3TAHA 1E3MA 1J7KA 2E9SA 5L3RA 4CEIB 4RY2A 5D3QA 2ZRAA 3A1VA 4BE7B 4A2WA 2CJWB 1KI9A 4YDSA 1E2DA 1KZ7B 1LW7A 5L8VA 1GL6A 1NBME 2XNDA 2REXB 2QQ0A 4PC1A 1M6NA 4IEIA 2Z43A 1AGPA 3AVXA 5FPKA 3I92A 2B21A 1Z3IX 2WOJA 4Q1AA 1KIMA 2ORVA 1XJ0A 4TL8A 3OEEA 1QFXA 2F3TA 2QRZA 3GJ5A 4HLQB 2YOHA 3CRRA 2XEXA 1DKNA 1YE8A 4D6PA 3A4LA 4FMBB 1C1YA 4Q1FA 5JJLA 3SQWA 2VA8A 4KO8A 4OHXA 5TV2A 4JBYA 3UPUA 4D4MA 4ZKDA 4AYXA 2GNOA 1R7RA 2H1LA 2XOKD 5KSOA 3HR7A 1E0KA 1M7GA 4B34A 2FF7A 1TPZA 2MMCA 5A0FA 4B35A 1G8FA 3ZIAA 3VR4A 5DYIA 1P9NA 1P7CA 1I4TD 3W6OA 4NHOA 4QM6A 4HZIA 3IPXA 3K4QA 4C2UA 3HU2A 5JZVA 4P4UA 2W0SA 1DE0A 2V1XA 4PHFA 4XWAA 2H7VA 4AKIA 1HV8A 4BUJA 4TMVA 4PC3A 4BFTA 1UKYA 1XB2A 4L9SA 1CS4C 2QZ4A 4HI0E 5AJYA 4A0HA 2VLIA 4F92B 5J4YA 3EZ9A 2W58A 3CRQA 3TKLA 2ZSEA 1A4RA 1CTQA 2OXCA 3BWDD 1TF7A 4JSYA 2C8VA 1NN5A 3OAAD 4JSTA 4RVCA 3OE7D 1WDTA 1XD8A 2V54A 3U7EB 3UANA 4Q00A 2R6DA 4C30A 3RANA 1COWD 1M74A 1QZXA 4A15A 1DBSA 3ASZA 4BFXA 3PITA 4P4SB 1KI3A 2ZIAA 3H0KA 3DKPA 1KY2A 1IM2A 2Q9AA 2UZ3A 3QF7A 2OSBA 1P60A 1TUEA 2FZLA 3ZVRA 5EXTA 3PVSA 1DO2A 2WTUA 1LB1B 1QDEA 4LBVA 4US0R 5EE0A 3RABA 4N0EA 3I4LA 3GQBA 2GCNA 4WZ6A 4NPHA 4DIEA 3TRFA 2I1QA 5LDDC 3B1VA 1Z08A 4KJZA 4DDUA 5LB4A 1RKBA 4B44A 2NMVA 2VRWA 2YINC 4DSTA 2P2ZA 1VTKA 2BDTA 3ZZUA 3I5YA 1S3GA 1KNQA 3EPKA 1T3HA 4TLBA 1FNNA 1II8A 2ZRMA 1S4QA 3LW8A 4JL8A 2IBMA 4MKHA 1N5LA 4EIWA 1GKUB 2IXFA 3WNBA 3U5ZB 3FPAA 2OLKA 4M1MA 3C15C 4Q7JB 1WB9A 2V55B 5AJWA 3CW2A 1HUQA 4M2LA 2AFIE 4B3FX 4QHYA 3MSXA 1Q20A 4XD7D 2ERYA 5H8WA 3QPWA 4URUR 1R4AA 2Z0MA 4WA7A 2GBLC 2VP4A 3B9QA 3CNOA 4WVFA 1R2QA 4PSKA 5BYKA 5HCNA 2J3EA 4NZYA 3H4MA 2H92A 1ONBA 2BHRA 3L8YA 3NEJA 2D62A 3QENA 2DFTA 5FTJA 4N1AA 1E2LA 4AYWA 4NYMQ 4C7OB 3MUFA 3L0IB 4M4SA 3TE6A 4IFBA 1NKSA 2F55A 4R2IA 2NPFA 3B8HA 2ZM5A 4Q7KA 1GL7A 2CXXA 3IT1A 4I1VA 3OEHA 3I1FA 3RYTC 5JBQA 1GP2A 5AUOB 4XWOA 2ZREA 1WP9A 5HTKA 1FQJA 3AKEA 4MYHA 2IYWA 4BWYA 1FMJA 1KKLA 3REGA 3T5DA 2KE5A 2IYLD 3EAQA 3CF0A 1O87A 4GMXA 3W8NA 4CEHB 1CEEA 4A2QA 2GTPA 4WXPA 2FFQA 4Q5IA 4XOIA 3SYLA 3K70D 1KI8A 3U7HB 4TWZA 1T5LA 1VG0B 5EE9A 2UVQA 1J70A 1XJCA 3N70A 1NBMA 1XEWX 3DHWC 4NTZA 1CF4A 3B2EA 4A92A 4CZ2A 3THYB 4JYBA 4V02A 1KY3A 1Z22A 4PPGA 2BV3A 1CLUA 3GJ8A 5JWRA 2AD5A 4IDPA 4US1R 2A6PA 2ZAOA 1HURA 2DYKA 2SHKA 4JODA 1EGAA 2QU8A 4UJ3A 4R9UC 4QIHA 3MWKA 1FL9A 5EXXA 4QJ3A 3UATA 2NO0A 4QJ4A 4A2PA 5KSZA 4JLDA 1W36D 3MRSA 2JJ2A 3HJGA 4GI7A 2J7PD 3UG7A 2Q3FA 1Z06A 2ZSAA 1EWQA 4C9BA 1JQLB 4ZKEA 2CLSA 4HB0A 2QM7A 2G77B 3SBDA 2A7QA 4CT5A 4DXAA 4E03A 5E3HA 3IIKA 4Q4HA 2CLDX 2EFCB 1H2FA 2YC2C 3AVWA 2WJJA 4LHZA 5FR1A 5DE3A 2QP4A 2Z5FA 3WMEA 1FPMA 2VYFA 2P9YA 1ESNA 1IN5A 2C9CA 3L8ZA 3TSOA 2WWWA 4KLNA 4URZR 5FBLB 5C46F 1SGWA 2B7BA 2GJAA 4CEJB 2RMKA 4ASUD 3EA5A 2DHRA 3M0EA 4AG5A 2P9ZA 3CONA 3SZRA 4PZ9A 1Q3TA 2R44A 1M7HA 1MRSA 2HYDA 3DMDA 4OK5A 4RFSA 3ZS9A 3BE4A 3E9DA 3IT2A 4B3BA 4KITB 2OFXA 5M04A 1H8EA 3PEVA 3KX2A 2G3YA 1ZP6A 1TQ4A 4OHWA 4QRHA 3KQNA 3QG5A 1U99A 2WNIA 2D2FA 3LA6A 3IHLA 4UQOA 1ZD1A 2R6GA 1G9XA 4TQ9A 3MLEA 1FUUA 1F48A 1GIAA 1SVMA 1IY0A 1CBUA 5FFMA 4BFSA 2A5GA 4NYMR 2O8CA 2ZETA 2GA8A 1BQ4A 2QY9A 2YV5A 2GAAA 3EZNA 3GEHA 2IYTA 4JLPA 1KAGA 1OV4A 1A5TA 1NN1A 4KFSA 3AM1A 2ZRGA 2H5EA 2ODWA 4LHVA 4IFEA 3AF3A 3BS4A 1JR3D 4AIIA 3AVOA 2WU0A 2QORA 2QGNA 2IF0A 3B1XA 3AF4A 4EQ6A 3E9EA 1JAIA 3DOFA 2JLZA 3PUYA 3I72A 2NZJA 1NG1A 3GLFB 3QXXA 721PA 4M1TA 1YFKA 1QF9A 1RW4A 1WMSA 1OFIA 3NC1C 2ZJYA 4Q7LA 3EPHA 1Z2AA 2QPOA 2GESA 2ZI7A 3NH9A 4Q1CA 1N5IA 2Z4SA 3BJIC 2EVWX 3KQLA 3NHAA 3QF4A 4JZKA 3NHBA 2QTVB 2GCPA 3PR1A 3IO5A 3VR6A 1SVOA 3KXLA 3GLHE 5B2ZA 5FUVA 4DT1B 2NIPA 1C4OA 2OZEA 1KZGB 2DFKB 2ZS9A 5P21A 1W0JD 1RFLA 2BBWA 2VH5R 4CT4B 1XF9A 1V43A 4DRZA 3U60B 2C77A 3C14C 4GOKA 1H8HD 2ZRPA 2O8FB 3OAAA 3P1JA 2TMKA 4RD0A 1JPJA 2XXAB 3GJ0A 2GEDA 3MJHA 4WZAE 1P2TA 1EFRD 5J47A 3GP5A 5A5GA 1I4DD 1Z0JA 3ZJYA 1DAFA 1E4YA 1V5WA 3A6PC 3FDZB 5D3MB 4JBXA 2AD1A 3EASA 3RVBA 1EFUA 5IK2A 3PIRA 3R20A 1RJ9B 4PC6A 4DB2A 421PA 2G1JA 5SZHB 5CJ2A 2FH5B 4HLUC 4MRVA 3ZIAD 3ADCA 4YXWA 3A1SA 3IDQA 3G5UA 1X1RA 2N46A 2O8EA 5CIWA 1W36C 1ZYUA 4FMDB 2QA5A 4F4JA 1AS0A 2GDJA 5CJPA 4KBGA 2REOA 3A4MA 3AKYA 3WP0A 5CB6A 1XEWY 1O3YA 1YR9A 4URWR 3GJXC 4UJ5A 3TSWA 1NN0A 1YRBA 2F9MA 1VCNA 2NOAA 5JCPA 4YLGA 4ARSA 4TN1A 1LS1A 2A2ZA 1NNEA 3K0FA 2VQSA 1T8PA 4JT2A 1KDTA 4BQSA 4DLWA 2F1RA 2IYYA 1YZUA 2ZYTX 3QVUA 3UMRA 2WPDD 2P65A 1N0VC 4XSGA 1MABA 3NBXX 3T35A 3MBKA 3RRMA 1EK0A 2F43A 3ZD6A 3T1OA 3MXOA 4N3NA 3CLVA 1CVIA 1W49A 1QHXA 1NF3A 5AJZA 3GLHA 1RYFA 1SQ5A 4RD6A 1N6OA 2HHJA 4NCIA 3LLMA 2QRNA 1NIPA 5FBWB 3NKVA 4PQRA 2OEPA 1ZM9A 3NWJA 4KLZA 4EFNA 2YYZA 1GWNA 1Q21A 2PT7A 2YC4C 2WJYA 4JS0A 1OSNA 4OHZA 2CHVA 1UM8A 3K0AB 3QG1A 3MG9A 4IJ5A 4IEEA 4B75A 1CJVC 2J7PA 4O2RA 4M0LA 1BMFA 2RGEA 2GVZC 5HZHA 4ZCMA 2ZVQX 2O5VA 2ZITA 3KKOA 4LZZA 5TMPA 3KQHA 1XX6A 1U0JA 4B3DA 1RRGA 1MO4A 1I2DA 1ND5A 3LQRA 2BIFA 5BN5A 1HYQA 4PC2A 2VSOA 3VU9A 4D81A 2GXSA 2WICA 1FW6A 4JLMA 3WNDA 1P62B 1ZM3A 3BH6A 3Q85A 1KI1A 2CE2X 3SFZA 3RWMB 4C0QC 4D82A 4YMWA 1U9IA 3KJGA 4LJ8A 3QKUA 5JWHA 3P26A 5HE8A 3KKKA 3IEUA 4RKFA 2IUSA 1G4AE 3UK6A 1YZTA 2V8OA 4PPQA 4GBMA 3M6AA 2ZI5A 2W00A 2P3SA 4JIMA 4TMXA 3RS7A 5EJEA 2EW1A 4I81A 2ZE5A 4PC7A 1ZRHA 1OJLA 3I8SA 5JS7A 3FHTA 2HCJB 5EQTA 2DWPA 1AQYA 1QHIA 5GJWC 2WAXA 4C0BA 2LKDA 1RPAA 3BBPA 3D8HA 4H9GA 3GLFA 1AA9A 3MFYA 2Q3MA 3EA0A 1GRQA 2IX3A 1KMQA 1SVLA 2VP0A 5CIQA 3TJZA 4EQ6B 2IXGA 2BEKA 2FNAA 3OEHD 4L4UA 2D74A 2ZRDA 3SHFA 2G0NA 3F3YA 4E22A 2P6NA 4HZUA 4BECA 4Q02A 1W1WA 1CJUC 1KTVA 1IAQA 2AHOA 3LBNA 3VQTA 2ZRCA 5IHPA 3KKQA 2QPTA 4MGYR 4PHTA 3QKSA 4ARZB 5CM8B 4W7SA 3VNUA 1KSJA 1XCPA 4JLBA 1XCMA 2Q21A 4QM7A 2V6IA 1SHKA 1TIPA 1W4CA 5AUQA 3WBJA 1GAJA 1XMIA 1S1MA 4JOBA 1CR0A 4EO9A 1NVVR 2HJVA 3GP3A 1R0YA 2ZVPX 1KI7A 4FMCB 1U8ZA 4LX0A 2GVDC 4BFVA 2P6MA 2JLQA 2YWFA 4P3YA 1JB1A 2OUKA 1ZU5A 1KHTA 1II0A 3O8RA 5DI9A 3BRWD 1D9XA 3WMGA 1FOEB 1DTSA 5DI3A 4Q19A 1VKJA 1DAMA 1FMLA 2IYQA 3K0CC 4CEJA 5CYPA 1UFQA 4HB4A 4FXPA 1PUIA 2AWNA 2RCNA 4OK3A 1JR3E 1PVOA 2IKQA 3OZXA 1VG9B 3DDCA 2FU5C 3PUVA 3FJYA 1JXOA 3UMFA 4JL5A 2QENA 4V0NA 3IQXA 1CRPA 4LPKA 1M7BA 3HPQA 1T6NA 1D9ZA 3EIHA 4FD2A 2X19A 1X8LA 4ASUA 4R7ZA 1SKQA 1XTRA 3T1TA 4BZXA 4ZIRB 2GXAA 4W5HA 4TYWA 4B33A 2JAQA 1DKQA 4UNSA 3IT0A 1DG1G 3B85A 2WKQA 1ZIPA 4U5XA 2QT0A 2G9NA 3UWKA 1FZTA 3TQCA 2ZE7A 4MYCA 5L3VA 2DB3A 2IUUA 3PJRA 5B57C 1S0UA 3WRYC 4CIDA 4LJ4A 2GZDA 3I62A 5JS8A 1ZU4A 2W2XA 2GKSA 2FSFA 2QMEA 1PZNA 1II9A 2C2HA 3W6PA 3GLGB 1H8ED 2V6JA 2FPMA 3WP1B 3B1ZA 2P75A 2RGDA 1N6RA 3FB4A 1R8SA 1KSHA 2WWGA 1T8TA 1P72A 2A5DA 3NFYA 4PHGA 3VR5A 3QKSB 4ARZA 1CR4A 5JRZA 3O0TA 1UJ2A 4JLAA 4JL6A 4C0SA 4GPTA 5CDFE 5JMTA 3CH5A 1HT1E 3LLUA 1GKIA 4DEXA 2WV9A 4LK2A 3CX7A 4LDJA 2P6UA 4U00A 4EPTA 3HYRA 4NU0A 3Q9LA 1XTIA 4HAWA 2O52A 1D2EA 4JLNA 1F60A 2W0MA 4EUNA 2VHQA 3A4NA 2J7KA 4DBLC 3WXMA 2VL7A 1S2MA 5FBQB 3EG5A 1UKEA 2D7DA 3KUDA 1MKYA 1RJ9A 4M9XA 1RIIA 2ODBA 4M8NE 4KXFB 2F6RA 1E9BA 4BLOA 4GPIB 2VP2A 4A36A 1KO8A 5IT5A 1ZNYA 1NY6A 1YZNA 2ZR7A 3U6BA 4HAUA 1PLKA 4DCSA 1M34E 1Q0UA 2IL1A 2XNDD 3WY9A 2CL7X 1P9RA 3NTUA 3QXHA 1Z63A 3BFKA 3K09A 1MR3F 5CDFA 3TR5A 2EKZA 2WMOB 3M1IA 2O8FA 2G83A 4WOPA 2AX4A 1FQKA 4RD2A 1NP6A 2GILA 5EXSA 1E6CA 2FGJA 4L16A 4RZUA 2BOVA 2EOAA 1N5KA 3DB1A 1OYYA 4F91B 3ZH9B 4JLKA 2A9KA 1E2KA 1W2GA 2Q6TA 2DFNA 1V7QA 3IEVA 3VR3A 1E9EA 1P61B 1W4AA 5CITA 3LO5A 4A0RA 5F98A 4TQUS
chains in the Genus database with same CATH superfamily
4BZPA 3JVIA 4XVRA 3DDUA 3K9GA 1K89A 2XE7A 2IPXA 2LCIA 1NBAA 3FJ1A 1LX6A 5ALQA 2WQ7A 4IOKA 2QTMA 3AONB 4NMMA 3AX6A 3K0AA 2EFDB 4JKIA 2C4TA 4PFQA 4QUDA 1ZMTA 2HHAA 4Y0NA 1BJKA 3AF1A 2A0XA 3GGCA 5CRIA 3S1AA 4B6QA 3LBYA 1L7VC 1YBVA 4RMHA 1VJ0A 1H2BA 4KDEA 4BBPA 1TEVA 3HP1A 3QFRA 1XDDA 3P4XA 3AVPA 1MIOA 3QLVA 4LRSB 2Y67A 1U6KA 3ZHRA 5THKA 3P2YA 2HSWA 1ID1A 4S1TA 4LJYA 4FDVA 4U9IS 4A73A 3GFBA 3MILA 1U8FO 1SXPA 1FEZA 3NOXA 1E62A 5FPQA 4GS5A 5FWDA 5A7HA 1WR8A 5GV8A 1X3SA 2DQKA 1IH8A 4TYYA 5AI8A 2OHGA 4C4YA 3GFPA 4GXNA 3QU5A 4JJ4A 3SJZA 5C1PA 3CB2A 5THQA 2DQZA 4FHEA 3MD0A 3ZOKA 3GRAA 3F90A 4IW3B 3G88A 4KSYA 4ZVKA 4IZOA 2HK8A 2B30A 4YDHB 1YQGA 3S2IA 1CY0A 2HU8A 2GAIA 3K72B 2FFBA 1N6NA 3KVVA 2X3FA 4IQGA 1ZIOA 2R7KA 4MQ4A 3EE6A 4W5WA 4W1SA 5IMBA 3OQ1A 4FFMA 4QWWA 4UHFA 3L46A 4A8JC 3TOVA 1E69A 1U0FA 2FEOA 2PZ8A 2O59A 3PCXA 3AP3A 2BFOA 2WZDA 5DYGA 1I3CA 4MKZA 3BILA 2QZPA 3HCOA 3UK2A 1T25A 1A77A 2ZIFA 2JVJA 3PP8A 4X84A 2IUEA 3AHFA 4LE2A 2HWXA 2Y1FA 5K01A 2IRWA 1LRJA 1DTWB 1U9IC 3L1JA 4TXNA 4DQDA 1VJDA 2C8KA 3A26A 3KYDB 4QL3A 4CCSA 1KNXA 4JELA 1BVHA 5KMGA 5K3AA 3LUPA 2VHUA 2ZCVA 5IBQA 3W06A 2O8EB 2GCEA 3AKZA 3G8DA 3IOCA 1U81A 1GUZA 2I8LA 2Q1XA 2WFAA 3O7MA 3IMEA 4Q1EA 4R01A 3HA3A 5CDGA 4KLCA 3X1KA 4BNYA 4AW9A 1F06A 5DT9A 5K0EA 3BL6A 4B2PA 6ABPA 4JXXA 1JR6A 2BFNA 4HPXB 1TM2A 4YP7A 2ENWA 3V1KA 1JAYA 2COUA 4L3VA 1JF8A 5LJLA 3QX9A 4NP6A 2KYRA 5KX5B 1CX9B 2F8MA 4FFWA 4MW2A 1N4DA 4DLYA 1Q6ZA 3WAGA 4E09A 4XKJA 4CM4A 1XLTC 3ZQJA 2OCLA 5FPTA 3GX1A 1T2CA 2CD9A 2GZ3A 4M0MA 3RIMA 1XZDA 4EPWA 3I9JA 3JQRA 1UKVY 4HPWA 3H2JA 3KQYA 3OO1A 2I7CA 4Q4JB 3U44B 3M4YA 4LOJA 1EGHA 2PLNA 1VP3A 1NM5A 3KSMA 2VDOB 2B4QA 1YA4A 3GGPA 3X1YA 3ZXIA 2PQ2A 1ZH2A 2XA9A 3MS2A 4GLLA 1KYXA 4X6XA 4DV3B 1IB6A 1TVCA 4ESEA 5AD1A 4E08A 4YCAA 4DYDA 4GL2A 1GAEO 2JI4A 4FQ5A 5FLKA 1QAMA 3UMCA 1OW3B 4BLQA 4D46A 3GY0A 5HF5A 3GB9A 2OAQ1 4PIVA 3RT9A 4A2CA 4UFPA 4ZV4A 7MDHA 3TFOA 2GR9A 4U7JA 1J99A 3RYIA 1CNMA 4L78A 2XH8A 1Y4ZA 5EUCA 2XAAA 4K0KB 3KOZA 5GADl 4NCHA 4C14A 2RGBA 2PWZA 3R7AA 2BDUA 4DAEA 3Q3IA 4P2BA 4DSOA 2QOEA 3TKYA 1NL3A 2YFKA 1PR1A 5CVDA 1I2ZA 3D3EA 6YASA 2PWYA 1GPBA 3CPHA 2ZJ2A 4HNAB 3D6TB 4INPA 1JDJA 2PH5A 2YNMA 4KQHA 4YT4A 1DAGA 1X7ZA 1QG2A 3K1JA 4PO8A 3VU0A 1GZUA 2ZJOA 4GLOA 4JHXA 1XJWA 2ETXA 1QIEA 4NIMA 1H4TA 1Z6AA 4D45A 2P0EA 2JASA 1U63A 3JWPA 3N74A 5BOVA 5JSZA 1O5TA 2O2EA 4N12A 5CDTA 2NNWB 3MUEA 1FDRA 4L8FA 5EIHA 1PN3A 4YRFA 1IN6A 2IPAB 2IU4A 2AZMA 2HNKA 1Y1QA 3RWBA 1HNZB 1F51E 4QLOA 1JLHA 1L7PA 2I6TA 4EM6A 4HNUA 5LQKA 3QUQA 2CKMA 5I5EA 3UM9A 2I0FA 4M83A 3THSA 1Z5UA 2EKQA 5HIAA 4YJ3B 2I7TA 1KXZA 3GU3A 2QK4A 2AQ8A 2Y8EA 3ZV5A 1VE6A 1Q57A 5LA6A 2A3NA 2W2NA 2WTNA 4IP0A 3OZAA 1VLMA 3ZH2A 3HJBA 1HQDA 4QBFA 2VQEB 4LNUB 1FDIA 1JDSA 2VJPA 4HMOA 5AW9A 1QO9A 1Y7TA 2M32A 5B6PA 4CIBA 2QTVA 1E1CA 4BVJA 3J81k 5LNK1 2XCUA 1ARZA 4CUJA 5E1OA 1JG3A 4GF5A 4TLLB 1KE1A 4EFKA 3LKBA 2NAPA 4ZV7A 3CRW1 3FDJA 2A14A 1CEQA 2VTDA 1T1SA 4LW8A 4RK7A 2BGUA 3RVQA 1M2EA 1XI2A 4LF9B 3G5AA 2L19A 2XMBA 3CCFA 3MWEA 3E3LA 5CVUA 1B74A 1E6KA 3RYIB 1V2GA 5FXMA 1VYVA 2OHFA 3W5VA 2WYUA 4HT3B 1Z5ZA 2FXVA 5LQUA 1GARA 1WXHA 1IM5A 4IGKA 3BSFA 1EP9A 1Z4MA 4RA6A 1IJEA 1H05A 1T35A 3CN9A 3KOUA 2R62A 4RDHA 3EQZA 3FCYA 3PS9A 5ES3A 4B6OA 1FUIA 2CUKA 2PZKA 3EAGA 4CU2A 2QRVB 4WY5A 2O8DA 1OYOA 4V03A 5EQFA 3U3JA 2NO5A 1PZMA 4Q4JA 1OIVA 3RLFA 3V8PA 3ED5A 1M10A 3N76A 4YT8A 3SHWA 3VSBA 3IKJA 3KU4A 3F6BX 3QVTA 4YUVA 2PEYA 4K8RB 2FWBA 2XZOA 2ZUUA 4IY1A 1KPIA 1Q1AA 4N7RA 4UDYX 4ZAFA 5JHGB 2FFHA 4URXR 2BBTA 1G6KA 3A3YA 4NR0A 1BH2A 5CDYA 1UDBA 2ZOSA 4J6FA 2W90A 5CLIA 4BVGA 2Z5GA 4P5PA 4D4KA 3WK6A 2BCEA 2CK3D 4ZU6X 2OFOA 5L4SA 3WWCA 2C78A 1MB9A 1VSVA 3C3BA 2XEDA 3W5UA 821PA 3HVUA 3W2HA 1T9KA 2HRBA 2O2CA 3QOFA 4PR0A 1OUMA 1K6MA 2P5SA 4WEQA 4BO1A 5JYDA 1FVOA 1L4UA 1VRCA 5EJ9A 3I4FA 1XHLA 5KVVA 1G21A 4I3GA 1PX2A 3WVNA 1H93A 4KZKA 1K0FA 1U7UA 2JH9A 4FWIB 3QPBA 4P3XA 3HDJA 4FLMA 2G6TA 5CEFA 1ZCJA 1U1CA 2PGOA 1HZZC 3K73O 2CVHA 3BCRA 3LDUA 4N0QA 1FZQA 4F72A 5GTDA 3PX7A 4FOTA 1V37A 3K0HA 1T26A 1T1RA 4XI9A 1V6CA 2CSXA 4MA5A 1QF6A 2PSSA 3PWTA 5K3DA 2APJA 2VH2A 2W2KA 2V4ZA 3UAXA 4D44A 5FOVA 1E7SA 4ITVA 1M0WA 3BXEA 2O8BB 4DDTA 3ZW7A 2ZUEA 3PFIA 4Q34A 2AQIA 1E9RA 4R2MA 4ZPJA 3SDZA 3BULA 4YMSA 3EXEA 3MS7A 1EG2A 1Z17A 2V74B 3AIMA 1A4UA 1MV5A 4DR4B 1XLVA 4FD3A 4FEEA 3WLSA 4OJTA 1M1NB 5FA5A 1EHIA 1JLMA 5IVIA 3RT7A 2GF2A 2QVXX 3ELYA 3SJ7A 3NHYA 2FRDA 4ARUA 2AKYA 2BR4A 3FKJA 2RE8A 3E22A 1X80A 3NVMB 4M38A 5JQGB 3H2BA 4HWSA 4OYLA 5LYYA 3D3WA 4EL0A 1YAHA 2XMDA 5H0IA 5MGNA 3GJSA 4LXYA 1OPXA 2ZU0C 1Z9BA 1VHDA 3GF4A 5EE1A 3V8NA 2Q49A 2EZUA 3KLMX 1SD2A 1YDEA 4RETA 3KG2A 2H5IA 1PQYA 5CM9C 3EDQA 4NJEB 4P83A 4BYGA 4D99A 5FUYA 1N2HA 2ZS8A 4OXKA 2V1UA 2YQ4A 3G17A 3K6JA 3PNBA 3BGSA 1VDMA 1E1NA 3VXKA 1Q7GA 1HDRA 1MU0A 2RK6A 3LKZA 4YRCA 1O03A 3ER8A 3SGLA 1AK1A 4D4JA 1FFYA 1ACJA 2WIGA 4Q4DA 1BW9B 3PKJA 1MJGM 2OMEA 2B7CA 3E2IA 4P22A 1XQVA 1O0SA 3LW7A 5FTKA 1Y98A 3DMPA 3QBJA 5JYEA 3GA0A 4DQXA 4ZVRA 2QZJA 1N2EA 4S35A 1ISPA 4MQEA 5E0OA 5J5CA 3ZE1B 5A2QA 3W77A 1UDWA 1UODA 2CXQA 2P2GA 4NBRA 2JLVA 3AVQA 2XKAA 4L9RA 1LRKA 4QQNA 4XJTA 4RHFA 5AOBA 3SWWA 5H81A 4KAAA 1RRPA 3SE7A 1GTSA 4LZAA 3ZWAA 1QIMA 3Q5EA 2G71A 2OYSA 3JQAB 4QTTB 4ZAWA 2J9YB 3OPYA 4E11A 4NULA 2OT3B 1E99A 1YQXA 2ZPTX 3NR2A 3EARA 4QDTA 3WGZA 1E1MA 5CVCA 3OTOB 2C61A 2IZZA 2GVNA 2QM3A 1CIPA 3OKPA 4WK6A 2B78A 4PQYA 2VPPA 4PNEA 4BEWA 4UMFA 2BM0A 2HSEA 3N0WA 5LZ2A 4FONA 3WWOA 4QLBA 2Q5JA 2XQJA 5JMWA 4IIHA 4MTCA 2B98A 4KSBA 5ALOA 5HBRA 3TCNA 1S6YA 3H2KA 5AM2A 4KQJA 4RCVA 4RTJA 4W5OA 1FSGA 5IVKA 2GZ1A 4QUKA 3VNBA 1RVV1 3K0BA 1QHHB 4JDUA 3UAOA 3QF4B 5AVQA 1R16A 1W5BA 5J2TB 3R24A 2PU7A 4WLFA 2IW1A 1I3MA 2QVLA 6AT1A 5L3SB 5G2OA 1EVLA 2O0JA 2JFOA 3D3NA 1V41E 4CF7A 2Q50A 2BGIA 4MULA 3V4PB 2FE4A 1JIIA 3CO5A 2X0RA 4NH4A 2DM6A 3WK4A 1GPJA 2X9NA 3WB9A 1V16B 1V5EA 1FFHA 3WLMA 1SURA 2VHTA 2ZULA 3O2SB 5BWCA 2VJKA 1B42A 1C7IA 4HNHA 1UJ6A 1L7NA 1YS9A 3KB2A 5LNK6 1L2TA 4NRDA 4WBNF 3TLXA 2FDXA 3T1NA 4B3XA 4DSNA 2QAGA 4GRAA 1MJ5A 1CLEA 2QAGC 4DADA 3CMMA 5HQJA 2QLBA 3I34X 4AJ9A 5JAZA 2AEJA 2GWRA 2JGNA 4BO9A 2XSZD 1ZUNB 2D59A 1OXBB 1OVMA 4HMQA 5EOVA 4UTPA 3D7RA 1LVUA 3HACA 4FIDA 5EJ4A 1M1ZA 5IWCA 3FMVA 3TUJC 4GEKA 3JATB 3M4JA 2VNAA 2Y1EA 3HJNA 1NM5C 5LBIA 1R3DA 1WMFA 2F59A 2XYGA 3DOUA 3IUYA 3NRCA 5BYBA 1Y34E 3QXGA 1TMOA 3PCRB 1JP7A 1E4VA 3B52X 3EFOA 3CKKA 2PE5A 1ICIA 1XWIA 4KDFA 1YBHA 2K7ZA 3S28A 4IBOA 4GECA 4Y1FA 3RC3A 1DIAA 1IY2A 1G4UR 2CLKB 1L5QA 2HQRA 1Q0HA 1TKAA 3TK1A 4CM1A 2FPGB 1WB4A 3FVQA 2WJIA 3T3DA 3WAKA 4ATNA 1PK7A 4FJ2A 3R4VA 4D3XA 1AMNA 4KQ6A 1HORA 3B82A 4C78A 5AW1A 4OHVA 1UC4B 2NXWA 2P4EA 3HP7A 1JLKA 1H2YA 3ZWWA 1GQSA 1J97A 3Q8WA 3FNIA 2HRQA 5DHUA 1IN4A 4MH0R 2VBFA 5A4KA 5A3RA 2DWOA 5K6AA 4PY2A 3ST7A 1EBUA 5EP1A 1DT5A 1L7XA 5KAPA 8GPBA 1USGA 3ADPA 1CR1A 1BXZA 1QFZA 1DTEA 2D13A 3AY3A 3D4BA 1CUVA 4D98A 4G4SO 1C9JA 3UJDA 1U1IA 3W05A 1XNQB 2LRHA 4JQOA 1KGDA 4HQRA 4KODA 3GXOA 1AURA 1T8RA 5KQGA 1X2BA 2OCAA 1VBKA 4I1PA 3AB3A 1M6WA 3K15A 4PCAA 2PY6A 3EEBA 3VV3A 1Y3BE 2ODPA 1KI4A 1ZNQO 3KPWA 3DPSA 3RUEA 3U3MA 4HQKA 1N1EA 2PH3A 4ISCA 3E5RA 3JQAA 4NJOA 2OORA 3F7TA 4PPYA 2RHJA 2OXFA 4WERA 3GLRA 1EMDA 4M3NA 3A7DA 3BJEA 4A6PA 3ZDCA 4HAYA 2O7QA 3FR7A 2C9OA 4DLZA 2KJQA 1ZHOA 4EGJA 1BU5A 2W6QA 1T9DA 3GEGA 4FKZA 4R1UA 4BQRA 4BQOA 2C5FA 4DT1A 1KEPA 2VHZA 3DEYX 1G3RA 4K28A 2OHHA 3EGXA 5EA2A 1P75A 2Q9BA 4NEQA 2BEVB 1XMVA 4RIFA 4GXRA 3C7CB 4Y6QA 1KOLA 4B1FA 4C0HA 4DW8A 4E5UA 2DXIA 4OLAA 1FBTA 4G2NA 5ERXA 2HV8A 4OA5A 4H7PA 4X3OA 4W5NA 4B6FA 2BKAA 3AI3A 3H8SA 3W34A 3IL2A 1DWPA 1Q17A 3DXXA 3JX9A 1AB5A 2X1LA 2HIGA 5B3KA 3ESXA 4Q21A 3CZ4A 5BN3A 4HEHA 4KN9S 4BGEA 1DAEA 2EHDA 4WH0A 4QDKA 4DM3A 5B4UA 4A8PA 1W19A 3KKMA 1RYEA 2AUTA 2YYSA 3OPMA 3NHZA 3Q9UA 3R0VA 4G4JA 1WXGA 3IERA 4Q48A 5DOZA 2ZBVA 3R9KA 1Q0ZA 1USWA 4BWVA 1RWXA 4F93B 4WOCA 2C5EA 4WWHA 2QTHA 1CUIA 2AF3C 2CY0A 2R6FA 2F9LA 2FJ0A 2OO5A 4JVOA 3NDBB 4X1YB 2H9AA 2XDYA 4DPMA 1YHYA 4TSFD 4MZDA 2PX4A 1TPYA 3JQBA 5DP2A 3LHIA 4O2BA 2LZ0A 2FMFA 3G9QA 5CP8A 5CYOA 4OXRA 3G0HA 5INTA 1SU6A 1SQSA 2H0QA 3H2IA 5AIBA 1KYIA 3THWB 3ZR4B 2C3OA 3PGLA 4G5RA 1QYDA 2DHEA 3D4IA 3H5IA 3I2GA 4CMKA 3CJQA 4JB8A 4YCLA 5FPHA 3QBVA 2BMWA 4C21A 1GZ4A 4LMPA 1RKXA 4Y0AA 1KKMA 4LJ6A 4GM4A 4EO4A 3HYSA 3IOYA 4S1NA 5DFAA 4CCYA 2CJYA 3U3RA 1ZWLA 4POAA 1P91A 4OK6A 3GLFE 1JHXA 3OG9A 3TYXA 1E2MA 3V3TA 5B1YA 5CFOA 2WQZA 3UPDA 3LXXA 4BJ6A 2XUZA 2H2WA 3AM3A 4U2GA 3VPCA 4TYPA 1A9SA 4CN9A 5ITVA 4HH3C 1PNVA 4I99A 3TEJA 4IXMA 4E3ZA 2A0YA 1DEOA 1A9QA 1R0WA 4G86A 4L4XA 4TV9B 2DBZA 3G2JA 3AFGA 3P9QA 4H6WA 1QVAA 4YRSA 3OU6A 4IH9A 1P4JA 3KSUA 3WK8A 2BP7B 1WZIA 1Z5WA 2WJAA 5F1YA 1YGPA 3ZUPA 4BMNA 5ADVA 3MIZA 3HCNA 3AW8A 3FZYA 3LWDA 3G7UA 3M5PA 4N7JA 4V0OA 3V4FA 4GMFA 2QXUA 1EU1A 1IJBA 1KFBB 4LCEA 4AY6A 4TTPA 3BHNA 3BMQA 1PNRA 1L5GB 2QUKA 2YRWA 4DLTA 1C7QA 4PYKA 4R1NA 4CKBB 1RYNA 1TTQB 4B2IA 3VTKA 3TEMA 2ERXA 3II6X 3WKDA 1JQDA 1R8JA 3BA1A 1PJCA 1W29A 3AETA 5SY9A 3WLFA 4A0QA 1NMZA 1RU3A 5E4JA 1BS9A 5IARA 4C20A 3SCZA 3KFVA 3TOZA 4OI4A 1Z26A 2BVNA 3QJ5A 4OJQA 4RACA 1XZLA 3K2IA 3WIVA 2HUNA 1M9NA 1S8OA 1OV6A 3KR0A 2VDPB 3NONA 2VHCA 5L51A 2QTBA 3KZOA 1NUSA 1WHTB 4K9QA 4YROA 1AZSC 3USCS 1EQUA 2I2CA 3NRBA 4H27A 2VDQB 3H7AA 3KTAB 3DMTC 3I52A 4JCOA 4RABA 5AKHA 2VAVA 3NM5A 4TS4A 1U7HA 1KDOA 1GXSB 1PVVA 3ZD8A 3ZY4A 4EW2A 1Y3FE 1UXOA 1T5IA 1GOTA 1KRHA 4ZTBA 2HMSA 3BTSA 4KGVA 1ABBA 1NVMB 3EXAA 1Q0LA 1XN4A 2W6OA 1JG2A 5DRTA 1G8YA 4ER3A 2Q6VA 1L5SA 2J9GA 3AEZA 3K96A 3VU1A 3FPSA 1HEYA 3B6IA 3OMLA 1ZMBA 1WL8A 2B34A 2B8JA 3OIYA 4JXJA 1BNCA 2RAPA 1P5FA 3WFJA 1G98A 3V2HA 2IQ5A 1KMHB 3PEYA 1KYVA 2BTQB 1DC7A 1M6HA 2XX3A 2ZUBA 4G89A 1PO7A 1GL9B 1B1AA 5HUHA 2CFRA 4LY6A 5CD9A 1CV2A 3VR6H 2ZG6A 1RJEA 1GT91 4LC1A 1YHZA 1QGDA 3IA2A 1NUPA 3AQ4A 3ZTTA 5KNLA 4H1UA 1F1JA 2NTJA 4WZBA 4MB6A 2UVPA 2VXYA 4PZLA 1EM8A 3F6RA 3SEAA 4X41A 3OICA 4JB3A 3ZLVA 3FR8A 1LVGA 4TTJA 2NXJA 1TZCA 1WEKA 2PPVA 2PLRA 2BRUC 2FEPA 5D2CA 3DNFA 3RYFB 2X5XA 4HFNA 2B4AA 2VRNA 5M34A 4G0WA 2R4TA 3IHWA 3RRJA 4N4AA 4WXEA 1ZR2A 3JALA 3PU6A 3LECA 3AESA 3MTBA 3PSHA 3Q98A 5G3YA 1OC4A 5IH3A 4GDFA 4JGBA 1QV9A 3OZTA 1XAGA 1Y3CE 4FCWA 1JHOA 1LJLA 3PDIB 4I36A 2VYVD 4X8OA 2QUZA 2XXAA 1CJMA 2EKBA 2C3UA 4FZRA 4BWFB 4EG4A 3L0ZA 5FJIA 3S3TA 3OQNA 4UBJA 5F1KA 4MO2A 4DDMA 2JIZD 1T8SA 2VPWA 3KM0A 2PT9A 3OOWA 4UD2A 1GZHB 1JFSA 1FIUA 1J0DA 4O29A 3I1IA 3R9WA 2WHPA 4ER0A 4BNUA 2ZIUB 4CQMB 1L8AA 2A5YB 1FW8A 1TJ4A 2IOFK 2IW3A 3O9VA 4ZYZA 2RHOA 3PK0A 4LG1A 2NUPA 2WWIA 2Z9DA 3LH5A 1EFCA 4MEJA 1V7ZA 3TD9A 3VAAA 2VYVA 3I32A 2X6QA 3U7FB 1HDZA 2WB4A 2RH9B 1EHCA 4B0OA 4HDNB 1NX6A 5JNSA 1JHDA 1DU4A 4LXXA 2NU9B 1LC0A 4RX1A 3KJFA 3B1JA 3UOGA 1TMGE 5SYAA 3S7TA 3RVPA 5F9FA 1GPYA 1OZGA 1ZNXA 2GYUA 1PQ4A 4L4RA 1JIJA 2F64A 3OLQA 4GZ6A 1MO5A 3V97A 2WF6A 1QMGA 3U44A 2P6RA 1TJ3A 1ZD5A 3GWGA 1QR2A 3N2KB 1NV8A 3OPQA 2XF8A 2HYIC 3CLRC 5JMPA 2O7NA 1G42A 3Q3JB 2QD4A 3GJ6A 2JEYA 5ICGA 3LVRE 2PGNA 2G28A 3HS3A 3L5KA 3PLRA 4E70A 4X7BA 5A71A 3G8CA 3ZCUA 1Z7YA 2P2LA 3M83A 1FRZA 1HRDA 1CS0B 3PD7A 4XGQA 2W2QA 5FI3A 2HMAA 4WKCA 4FOPA 2OPHA 3DFMA 3GLGE 3K0KA 1DO0A 4R81A 1RC1A 1ORHA 1ZISA 1SXJD 3OBIA 4PTYA 2X9GA 2JRCA 1GKKA 5GGXA 4FJ1A 4ZJYA 4QUJA 4O4HA 1NBHA 1FX1A 4JEIA 4ZOLA 4E2WA 1JJIA 1A8IA 3EGVA 3K1YA 1EVQA 1RLTA 1QK4A 4UHHA 3A06A 4EW6A 1GNPA 3KUXA 3IV6A 2RJNA 3BE5A 3LQQA 3NP7A 3UJBA 4C0KA 2EKPA 4GXTA 2QRHA 3CPSA 4BE9A 4HH1A 3S2SA 2WDPA 1U0NA 2NN3C 3KT8A 1H69A 1Z37A 3GK3A 1H5NA 2GRUA 3HG7A 2AF4C 4X8MA 1E2GA 1CUWA 1EWRA 1GV0A 2JFZA 2WSSA 2YCBA 3P32A 4M7PA 2CLIB 4MS1A 2ZJ1A 5EP4A 3RVJA 3TW4A 3F5DA 4BO5A 3PUZA 5EJ6A 3E5HA 2RK4A 1BX0A 1ZM7A 5BUCA 1DIOB 4OY3A 2UXBB 4KE6A 2BC9A 1UDXA 3O1JC 3SIXA 1KAQA 3O8DA 1NJ5A 4GE0A 4MWCA 2SBTA 5I5GA 4Q4CA 2KBFA 4HRYA 3UHOA 3EW9A 4JMLA 4QBHA 4D4HA 3I9FA 4EFLA 1ADYA 2J3IA 3PQCA 4BCCA 3GA7A 1A82A 1T9GS 2B4RO 4UUNA 2FJUA 5C4IA 2ZBUA 1LQTA 1UOQA 2ZUDA 5KBYA 2HLDD 1C1XA 5JSFA 1TM5E 4BJHB 4OBXA 2A7XA 2JH3A 2BELA 4P0TA 4NOLA 4L27A 3MOSA 3EDOA 4AN4A 4AZ0A 4AWAA 1TMYA 4FW8A 2Q5IA 4DHWA 2HA4A 2A9RA 5KTOA 2Z57A 2J45A 3HUFA 2K5UA 1ZCFA 3IMGA 3M6WA 3MJ4A 2AQHA 5HS6A 2BAGA 5G4KA 2YOGA 2QRLA 3THOA 3GFVA 2D4AA 3BN3A 4L15A 2ZRKA 3RVNA 2GD2A 3N7TA 3IIMA 4E07A 2I71A 1X8KA 4LMAA 4DILA 3BAFA 5LJIA 1AKVA 3T12A 3SQNA 1CUSA 1FUYB 4EKIA 4PFSA 1EQAA 2HMYB 1W87A 2IGBA 2X8AA 1XAJA 4N3GA 3S5JA 2GK7A 1BJTA 2FQQA 4DC1A 1LC3A 5HSGA 4ZC8A 3P9RA 4EKDA 4DDWA 1XRPA 4H0NA 1PRYA 2ASEA 4LFAB 3GPDG 5GJBA 3HR8A 4H1VA 4G0MA 1MX9A 1EWVA 2P8SA 3JU3A 1AUOA 4M1WA 1VJ5A 4TL7A 2HXYA 1AK9A 4ALMA 3VYVA 3KQKA 3AL2A 1ZK3A 3EY9A 3MTJA 3ZOZA 2HQOA 2RHMA 3UJCA 5EMNA 1PJ4A 2AR7A 3JZAA 1D6SA 3AFNA 2O0MA 3OC6A 2IZ5A 2W6JA 3JTMA 3KLOA 4FWTA 4G4IA 1Z28A 2FPLA 5HIKA 1AGYA 5HIJA 1C2TA 3LHFA 1FQWA 3BDVA 4N82A 2ONYA 2PV0A 3HLKA 2XGOA 4FGLA 4D2IA 1LQ2A 3PX3A 3BL8A 4UDOA 2FZ4A 4CLRB 4EMTA 2Z1NA 5JNUA 3DG9A 1MAWA 1I13A 1UKCA 3ZLJA 1C3LA 3ME5A 3N0TA 4YRGA 4G3XA 1Z6PA 2IYUA 1TK3A 1TL7C 2JATA 3DUFA 2G88A 2RGCA 3BB4A 1G291 1ZUHA 2A9FA 3HZHA 1UXGA 2VXOA 3KOOA 5BSRA 1KEKA 4EZIA 3JQQA 3SC2A 3W1VA 3FKSA 2CHQA 2PD3A 4TPKA 2MSWA 1NXOA 3S70A 4ZYLA 2RGNC 1JR3A 3NT2A 1KZ6A 1OIWA 2TMYA 3HA7A 1D5WA 1EPUA 3I45A 3P0RA 1WF3A 1LSUA 3R4CA 3NUZA 4P7JA 4XCVA 5ED0A 3CEJA 4BO3A 4NF2A 4NK4A 2F90A 1AQUA 1QRDA 4R54A 1YHNA 2WTAA 1EGQA 4KNVA 4GPAA 3PUXA 1L7AA 2W42A 4I5EA 5E8JA 1TKBA 2IYVA 3AP2A 3I30X 4MITA 1SC1A 1CUHA 1B15A 3D2AA 3VR2D 1Q84A 2VBCA 2D00A 2ISSD 3GLHB 3QXCA 4RD3A 1OXSC 3DZKA 1CB7A 1F2TB 3H65A 1TYCA 2EJCA 2IZOA 3I12A 2PUJA 4AMBA 4AS2A 5KPDA 4A6EA 4ZCLA 4TMFA 5B3AA 2I6QA 2GDZA 3OE4A 4ZAZA 4XE5A 2DP4E 1Q1GA 2R7NA 3C3DA 4FR2A 1SB8A 1BIFA 1KK2A 3JQFA 3O8QB 4YPFA 3DOEA 2IH2A 3P45A 4KH1A 4B4OA 1QVRA 4QAQA 3H11B 3WLOA 1YDMA 4ARCA 4L8GA 5GP1A 3HEMA 3EA4A 1DCKA 3I5UA 1JH9A 3BMQB 1UUFA 3X1DA 2JD0A 4FFBB 4KXQA 4P7KA 3WNQA 2AMYA 4DLUA 5B64A 3IXLA 1YR7A 4DG9A 2QM8A 4O25A 1H0KA 1PFUA 1PS8A 1ULUA 4LY0A 4B2YA 4HH0A 3L4KA 1T1EA 1YCDA 3DTYA 1Q7BA 3W3AA 5JASA 3QQ5A 1D03A 1ND6A 1LV7A 1VJGA 4KWEA 3ASYA 1T3SA 4CDNA 4EUEA 4JC0A 3PC8C 4Y2QA 2JEZA 5DW3A 1TIBA 2JA1A 3FRJA 3GP3A 3R6GA 2GF9A 1FP7A 2R2AA 1GGHA 2XGMA 1L3IA 4NQRA 4PS1A 5ALPA 4K3UA 2IH4A 4R7TA 3DR3A 1GADO 4K9LA 4DV6B 3A0UA 5CLGA 5LCXA 1P1FA 1JWAB 4GT1A 3L9WA 4YAJA 4KU4A 1UDRA 3FSRA 3DBRB 1Z73A 4OHKA 1V4NA 2BFMA 2CN1A 4HYEA 4RAQA 2WSMA 1YB2A 4QEDA 4CJXA 4JV5B 3FGPA 3JD0A 4HLUA 1NI5A 3M5WA 4UNNA 5E4YA 4AG6A 2ODAA 4K9PA 1L5YA 5F9MA 4RGBA 3W3ZB 4O4IB 2FPIA 2OOKA 1T9AA 3H18A 1HLGA 2QSYA 4HGZA 1X92A 2JD2A 1GYRA 3IOMA 1E5XA 3UCXA 5AUPB 1CVLA 2OBXA 4I5GA 3R8XA 1MPTA 2KM1A 5AKLA 1Z6YA 2GX6A 4I5DA 4PHCA 3PD0A 4X1YA 2J0SA 4CM8A 1UK9A 1XMOB 3DQPA 5I7AA 3ZDAA 1RHKA 1G6OA 1JSZA 1W85B 2PVCA 1X1EA 2RHDA 3EFBA 4I4NA 3TDKA 3I64A 3PHJA 4Q1BA 2A3RA 3WC4A 2AOUB 4LKRA 5FIUA 5ETJA 1NSFA 2JFQA 3BD7A 3ZWOA 3QYJA 5J1SB 4PG5A 1NJGA 1NLFA 4OQXA 4BNLA 4Q24A 3HB4X 2Q99A 3SNHA 1VFPA 1B00A 1BH6A 1VL5A 4X0EA 5DF1A 5DRYA 1TVEA 5BWBA 4RCZA 1TOAA 2BH9A 2Q45A 2CJWA 4N7BA 2R00C 1HE3A 1EG7A 4FGSA 3MRVA 5EIBC 1GAQA 2BUBA 2VJOA 4F96A 2VS1A 2UZ1B 4RQAA 5JISA 1YXMA 4YDQA 5HUJA 3HL0A 1V35A 2HPZA 5ED4A 5IEBA 1B8UA 1KK1A 2UAGA 3SOPA 4ZI3A 2ZXEA 4TZ0A 4Q66C 2PM8A 3AT1A 2I9KA 4XLTA 1X1BA 4A16A 3H4VA 5B4VA 2B83A 4XWYA 4IM7A 3IQZA 3Q12A 3F6PA 4FCTA 4FN5A 2HI0A 2N1MA 3WIDA 4H4DA 1UBOS 5EIEA 4GU5A 5K8UA 1LX7A 5K8JB 1W0KD 4PNZA 3VPBA 2ZDHA 4U3JA 1M2NA 1T5OA 5KDLA 5ULLA 3VX3A 3NHKA 1NQ5A 4KI0A 4EPRA 3HNOA 5FL7D 5CNIA 3WKBA 3DMGA 4HX5A 1UAGA 1ZN8A 1TLLA 1N33B 4XX0B 1U3VA 1A9RA 1CQPA 2PRKA 2FWJA 4RZSA 1I5EA 2HCFA 2JBAA 4AWXA 4GRIA 2VJNA 5F2KA 1T0UA 5AIAA 4BNMA 5DNDA 5EHNA 2MSDB 1H0HA 3KAQA 1JRLA 4RFSB 4YN3A 3PHHA 5JADA 3ZEAA 3R9XB 4OB8A 1H1LA 2A33A 4PO3X 4HLCA 1PL8A 5CVJA 3ONNA 1WKBA 3I2HA 4BHTA 1Q15A 5FYDA 4DLXA 4E31A 1GGVA 3NNDA 1YACA 4DG5A 1WKVA 4YQFA 5IYZB 3NORA 3UAYA 4YCSA 4PRYA 2RG1A 4MCAA 3W5JA 2QX6A 2B5WA 1N7IA 1QZ3A 4V2UA 3IJ5A 2YVAA 3MJRA 4NMWA 3ZCVA 5BWOA 1Z4KA 2LKCA 4BNGA 3PGKA 3DTVD 3EB9A 4B6SA 4L0CA 5IC6A 1N5DA 2F1JA 5JOQA 2GERA 1ZH6A 1NMQA 2QTLA 3QA3E 4OHOA 4MWDA 4UAJA 4QPJC 5AVOA 5ITZA 2XDQA 5K3SA 1NSYA 1ORIA 2DWCA 2R85A 3BHJA 3DT8A 2NXEA 4MS4B 5E1BA 4CV2A 1IYZA 1ENYA 3JQ8B 3LHKA 1UPTA 2VA9A 1T13A 4PAQA 1T1IA 4HUJA 3ODGA 5AKGA 3QHQA 3VDXA 4FYPA 2QGFA 2ZJ6A 4IDNA 1ZJZA 4G84A 4M7RA 3FTEA 5J4LA 2I3BA 1JKMA 4KUGA 5HJ5A 1U11A 1W59A 1RP7A 2AT1A 2H1IA 2I55A 2QP3A 4MRPA 1WV0A 1IIBA 2HPHA 4PYIA 2O8CB 2C8LA 1RWBA 1UZMA 4ZT7A 2WG1A 2AJBA 3G9TA 4TWBA 1KJQA 2NO4A 4XGNA 2X3YA 4LMRA 3T34A 5BNWA 2GHQA 1I94B 1A69A 5C8VA 1DKOA 1NW4A 1IEWA 3GNQA 3H11A 4MW4A 4AX8A 1MRNA 1W4RA 4RUKA 1WHSB 2R66A 1IHPA 3IDAA 3CVXA 4YUAA 5F4BA 2IHBA 3DFZA 3WK7A 4YRIA 4E2FA 1E7MA 3FIJA 2O3TA 1GZSA 4N8EA 2CYCA 1CUEA 1YRYE 2QSJA 3NWOA 2JRLA 1M2KA 4BN0A 5FWYB 5FUMA 3VR5H 2XZLA 2ISQA 3FKQA 2ZRFA 4DNOA 3A3PA 3BD9A 5CXQA 3L6RA 2WA1A 4Z8XA 1I5OA 5JDIA 1IVSA 4K87A 2QL