5AJXA

Human pfkfb3 in complex with an indole inhibitor 3
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
444
structure length
441
Chain Sequence
PLELTQSRVQKIWVPVDHRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 156
structure length 441
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajxA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajxA02
1E2EA 1YR7A 4JLAA 3NEYA 4TN1A 2AD5A 4ZKEA 3W34A 5CB8A 2W83A 3IT1A 1N0VC 1ZNXA 2IS2A 1YFKA 2FFHA 2HCJB 4KCGA 1YR9A 1AS3A 4AY2A 3DB1A 5KSYA 3IO3A 1WCV1 1RJ9B 3Q5DA 1WF3A 4QNRA 4XD7A 4EKDA 4LBWA 3B1ZA 2V4ZA 4P4UA 1JECA 4FCTA 2HHJA 4DVGA 5TMPA 1FZTA 3FPAA 2F3TA 2RGEA 2ZYVX 2OCYC 4Q4AB 1LFDB 2IS4A 3FMIA 3OI7A 2CMKA 1NMXA 3TE6A 4DBLC 3EW9A 2QBYB 3OZXA 3LBHA 4LRWA 1OB2A 4FWTA 4N1AA 5DISB 2WOJA 3SBEA 5TARA 3CX8A 1CKEA 1E9BA 4EFNA 1WA5A 2PA0A 4KBGA 1IHUA 4OL0A 3NH6A 4PZYA 1U98A 2FX3A 2RGCA 1Z0FA 4PHHA 3IIJA 1KI4A 1D2NA 2RAPA 3N5CA 4CIDA 4CVNA 2IW3A 4LCBA 3I73A 4DLWA 5EP1A 3BFVA 3GP5A 2YWEA 1VG9B 2WIBA 3GLHB 2H57A 4G0NA 2CLSA 2BBWA 3UWOA 1FP7A 1DAHA 1DBSA 4LI0A 5E7MA 2QGNA 4MKGA 1IQPA 2WJVA 3UKDA 3W3AA 2FE4A 4F7WA 1TQ4A 3GJ4A 3R9IA 2J45A 5KSZA 4LJ4A 2EFGA 4X8OA 1Z07A 2PZEA 3VR5A 4DCSA 3QKSB 3K09A 2ZU0C 1Z6XA 2NTYC 1SKYE 2AXPA 3K0AB 3PEYA 2XGJA 5HE8A 3SFVA 5LPNA 4XSGA 3SEAA 2BJVA 4LUCA 2OBNA 3T34A 2ZSDA 1GNRA 4M9SA 5AR1A 1DPFA 1II8B 1N6NA 4AK9A 1S3GA 3MAAC 5LB4A 2YN0A 3SHFA 1ZUHA 4HLDA 2ZQ5A 2OWDA 4H1UA 2XTZA 2GTPA 2ZRLA 4F4IA 3K70B 4Z8YA 2QROA 3A1WA 2N46A 4RFSA 4BFUA 1QVAA 2D3WA 2WJJA 3WXMA 5FFMA 4BFYA 3DDCA 1T5LA 4PC3A 5CYPA 1UJCA 2R65A 2OAQ1 3GJ5A 1BIFA 2ZE7A 4MGKR 4N3NA 1E0AA 4Q9IA 2GEDA 4Q1EA 1T4GA 1C80A 1TQDA 1T0HB 3SHWA 2ZI3A 1E9SA 5CIQA 2H52A 2ATVA 3QKRA 5K8TA 4KFRA 2GHIA 5DE3A 5LBIA 1CIPA 1OHHD 4G5QA 5KNDA 4H1VA 1E59A 3L8ZA 1JNYA 2VEDA 2OO7A 2WSMA 1CRQA 4HB0A 1GTVA 4M1MA 2Q6TA 4MUAA 4BASA 4GNKA 1TIPA 2UZ3A 4MYHA 1ELOA 2ZJZA 1XTSA 1G7CA 1XF9A 2H18A 4DSTA 3KTAB 1IN6A 4M2LA 1MKYA 1X3SA 2KSQA 2ZE8A 4PQYA 1E6CA 1OH7A 1IXRC 3WHKA 2A5GA 5B58C 1KI1A 2GETA 2ZJ8A 4NYMR 3I5YA 4HLQB 3B5JA 4KYUA 2J5XA 2IUTA 1EGAA 2AKAB 4QJ4A 2CJWB 1E2GA 2P6UA 2WAXA 1Q22A 2ANCA 3BH6A 4JYCA 4LBYA 3SE0A 2IK8A 4BFWA 1CR1A 2FSIA 4EQ6A 3KJIA 1DKMA 1SZPA 4L5BA 3QG1A 4E22A 4PC7A 4JLBA 4B47A 1MH1A 4FXPA 1E9RA 4HAWA 4TL8A 1ZBDA 4FMBB 3RSOA 5FOWA 3VKGA 4M9XA 2JLYA 3HYTA 4B33A 2QSZA 3LFUA 4LHXA 2NZJA 3QXJA 4HLUA 3U6BA 1SVSA 5EP3A 5IDVA 5JEEA 2HEIA 4B2LA 4R9UC 3OIYA 1IN5A 4AYXA 5CDHA 2RMKA 3ZVMA 2A3RA 1VIYA 4BLOA 2ZRNA 2VP2A 2H0QA 1EFCA 4LY6A 4MGIR 3L82B 2OILA 2JJ8A 5ELXA 5C2JB 1AS0A 1OFHA 3U7EB 1KHTA 4NL4H 2GAOA 2HDNB 5DI3A 3TGPA 2GXAA 4OK3A 2WSSD 1GL6A 1N5IA 5EE0A 1OLOA 1GG2A 1HT1E 4DKXA 1R0XA 4UXHA 4C0QC 2V7QD 4TL7A 3TVDA 4B3GA 4O25A 4AWXA 1E9FA 1GIAA 4URUR 4Q21A 4DDTA 1OHHA 3ICQB 4RY2A 1W0JA 3W8RA 4G5SA 2X19A 1RYFA 4ARZA 2ZM5A 2PT7A 6Q21A 3E70C 4C7OA 1YRAA 4A92A 4D81A 1PLLA 1F6BA 2ODWA 1I2DA 2AL7A 1SKYB 2MSCB 4MH0R 1MABB 1WB9A 4L9WA 4WAUA 3T1QA 2ZTSA 2IYQA 4KODA 5TXGA 1F48A 1XD8A 1G4AE 2ZROA 1FOEB 2AHOA 5L3QB 1DKLA 3THWB 4CEIA 4TSFA 4GDFA 1QZXA 4ZIRB 1NMZA 3JVVA 1ZP6A 2J0QA 1PJRA 1E2IA 3TLXA 1SHZA 3Q72A 4UJ5A 3OAAA 2DCUA 1WDTA 2C5LA 3TUJC 5D3MB 1ZNYA 4XTCS 2AD1A 4EPWA 3RSLA 3TQCA 1AS2A 1LTQA 3OIWA 4LJ9A 1IXZA 3NIBA 3OF5A 3J81k 3PEWA 1S1MA 1OF1A 1S0UA 4F92B 2IYVA 2EOAA 2X2FA 5KNCA 1HE8B 1KAGA 2QORA 4EIWA 1EX6A 3V4RA 3F3KA 1R8QA 3GLIE 5CIWA 1KI6A 3I72A 2Q3HA 3HR8A 1DO0A 2F1HA 2IT1A 1PZNA 2A9KA 3EA5A 4JLKA 2Z0MA 1GKYA 5C4MA 5CX4A 2WSSA 2YC2C 3OESA 4GL2A 2F55A 2HJVA 2CE2X 1LVGA 3Q7PA 5J47A 2DBYA 2VLIA 4FN5A 4FDTA 2B8WA 2ZRDA 1BOFA 3K9GA 3O0TA 1R6BX 4D4JA 2XB4A 5E4FA 3ZDQA 3HPRA 4A1FA 2D2EA 3QF4A 3GLGB 2P9ZA 1E0KA 1ODFA 2BMEA 3LWNA 1A82A 2ORIA 3DO6A 2FPMA 4PFSA 1P5ZB 1TEXA 4P4SB 1NG9A 4EJSA 1SULA 1KI9A 3SQWA 4OHWA 121PA 5KTYA 3AVWA 3NWJA 2J3EA 3WBJA 4DSUA 2YWGA 3KFVA 3W90A 2C03A 5JRZA 1E9EA 2G0NA 4BLRA 3IHLA 1ESNA 2PJRA 2ZAOA 2WWYA 1XZPA 3I8SA 1ZAKA 4RZUA 2OXCA 2O0JA 2WHXA 1DTSA 4NCHA 4DT1B 2FSFA 1R5NA 1N0WA 1SXJC 1XXHA 1CR4A 3NBFA 2W00A 1GKUB 2ORWA 3GD7A 4U00A 2IYXA 1T5IA 3TJZA 2C96A 2F43A 4MRRA 3B1WA 1P2SA 4ARUA 2H4XA 2ZRMA 5G3YA 1SKAA 1E9CA 4HLCA 4PR0A 2B92A 3KKNA 1G9XA 4DB2A 3BWDD 2RGNA 4IDPA 2ZE5A 2VPPA 1QBKC 2J0VA 3FFBA 1NVVR 1E98A 3K4PA 1P7CA 2ZRJA 3RABA 3R7WA 4TMTA 2VP5A 4WVFA 4HUTA 4HUQA 4XWAA 2ENUA 5B57C 3RVBA 2JGNA 4XTRA 1A2BA 3MUFA 3UMFA 1S2MA 1JR3D 4PTLA 4XVQA 5H1YA 2XTNA 1E0JA 1S8FA 2F9LA 1P2TA 3I4LA 2GVZC 3B1VA 5J5CA 1Q44A 2LWIA 4EDHA 3AB3A 1VTKA 3UG7A 1FP6A 1NBME 1NRJB 1MO3A 2XSZD 4GRAA 4IOLA 5TY0A 3FJYA 3PG5A 2K5UA 4TLCA 3FVQA 5FOUA 2ECKA 2VA8A 1BYIA 3PEVA 3ZQ6A 1NI3A 3REFA 3NC0C 4HAUA 1UJBA 4DZZA 1A4RA 1WP9A 4AI6A 2ZS8A 1RC8A 2PMDA 4GZLA 4MYCA 2DB3A 4ASUD 4C4PA 5FOTA 1E94E 4U5XA 4BZQA 1M6NA 3OE7D 4LSGA 3AVXA 1SVIA 1E2HA 1OFTA 3K9LA 1DAGA 3Q3JB 1R4AA 1YZNA 3SS8A 4HBZA 4Q9KA 1E1RD 2BBSA 1Z29A 3CRRA 2NGRA 1JEEA 4B6FA 1G5TA 5JSZA 1WMSA 2AK2A 2V9PA 3GLIB 4PAOA 1E4YA 1GWNA 1ZU5A 4PQFA 3FTQA 1BMFD 3W6OA 4MITA 1Q12A 1P75A 2MSDB 3A1UA 4JT2A 2RB4A 2G9NA 3CNLA 4KLZA 3THXB 3AGQA 1N6IA 2VSFA 2XNSA 1OFIA 2XTMA 4XIGS 2OESA 3A58B 1AIPA 3O8DA 4ITRC 4B75A 2DFLA 2GKSA 1NN5A 3L8YA 3UK6A 5DH9A 3BD9A 821PA 1UKEA 1KO1A 2RHDA 1H8ED 1YVDA 1Z6GA 3CH5A 4PQRA 4Q00A 3ADCA 2YOFA 4PSVA 4NYJR 2GXSA 4GOKA 3ADDA 1NSTA 1BYUA 4DDVA 1E2JA 1XWIA 2FFAA 1YJ5A 3BFXA 4A9AA 3SI7A 4DCTA 1VCNA 1DVRA 2REOA 1VMAA 3L2OB 4XVUA 2CK3D 5SZHB 2WAYA 2GEUA 2R6DA 3A4MA 2AFIE 1XQ9A 2GZHA 4TZ0A 3WY9A 2F1JA 4PXAA 2P0EA 1SHKA 4GP6A 2XSZA 1IBRA 4FMCB 2O8EB 3JVUA 1IOZA 1OH5A 1G6HA 4C0KA 1YU9A 5BWMA 3ZVLA 2BEJA 1QG4A 1CS4C 1O87A 1JAIA 1G8PA 4DLYA 2DFNA 4LBVA 3T61A 1IJFA 1GILA 2BBOA 4E3WA 1NY5A 4DUGA 4OHVA 3GJ8A 3L0IB 2VL7A 3VKHA 2Z6VA 1Z6TA 4PSKA 1GRRA 1S9DA 3OE7A 4TMWA 4QC2A 1NKTA 3REGA 2BWJA 1KDTA 3HJNA 4OQNA 4OJQA 1E1RA 3EPKA 2Z83A 4L16A 3ZGXA 3PENA 1ZNWA 1KSFX 1XD2B 3MSXA 4M0LA 3LW7A 4O2LA 3EZ7A 2W6ID 3THYA 4W5WA 1BMFA 4B34A 2J7KA 3RWMB 1W5SA 1JXMA 3NBYC 3AEZA 4IFBA 2V55B 1OT3A 2VBCA 4DCNA 2GZAA 4Q19A 5JEDA 3D4IA 2YOGA 3KKMA 4OQFA 3PV0A 3R9WA 2YOHA 5DI9A 5EJEA 1HY3A 1XMVA 3QXSA 4NCIA 3CWQA 1TAGA 1G3QA 2QAGA 1H8EA 4RCZA 5FI0B 3NDBB 3LH5A 1KKLA 2BMFA 4QBIA 1HYQA 2ZR9A 1MOZA 3QBTA 3FMPB 4B73A 1P9RA 2QTFA 2JDID 1P73A 2HYIC 3KJGA 4U02A 1Q1BA 4B2PA 1ND5A 1OXVA 2EFHB 3K53A 2CK3A 2Q3MA 1CJMA 2C95A 3CX6A 3EZ9A 4QJ3A 1KJYA 5FTKA 3NTUA 2J7PA 3U44A 3K0FB 2P77A 2WKRA 4K8OA 1J8MF 1N6KA 1Z08A 1D9ZA 4B3DA 3RS5A 2R6FA 4AKGA 4KHZA 1ONBA 2PL3A 1S9HA 1FX0A 3CF6R 4B3CA 2EKBA 1QHFA 5CM9C 1GNQA 1XB2A 5JI2E 3T1OA 4G3XA 2D7DA 4HSEA 2OFWA 5L3SA 1ZNZA 3LD9A 3A6PC 3CLVA 5IRCD 3B82A 1G20E 5JBQA 4DLSA 4B76A 2OCAA 1DG3A 2ZRHA 5H8WA 5GJBA 5H68A 1FTNA 1NLYA 3ASZA 5DN6D 1C9KA 2KBFA 3EA0A 3HDTA 5FPYA 4US1R 3A37A 3CZQA 1T3SA 4B3FX 3QF4B 2GFIA 2Z43A 3GFTA 4FCVA 4L4UA 2WWHA 2R8RA 2A5JA 2W6IA 4G1UC 4QHSA 4OI0A 5GJVC 4URVR 3T15A 3BS4A 3AF2A 4URXR 3K0SA 3TUIC 3LAWA 1OIWA 4IEIA 4D25A 1SKQA 4KAXA 1GDDA 3ECCA 4F4JA 4CEHB 4JLOA 4C30A 5HPYB 4JT4A 2IYLD 2ERYA 1OE0A 2EKZA 1UBCA 4MKHA 3CH4B 4FIDA 3GW8A 4LZZA 5E3HA 3UMSA 3H4MA 2JDIA 3AV0B 1S3SA 1E2NA 2BKEA 1ZCBA 2H8KA 1XEXA 3UMRA 5AUOB 1LF5A 3T1VA 3GLHE 2EQBA 3CIOA 1DELA 3I8XA 4Q4JA 5DHFA 4GOJA 4HLUC 4W9MC 2VHQA 2JLWA 2X8AA 4OQMA 4CGZA 2H17A 4A0HA 1Z3IX 4ABYA 4Q9HA 2C99A 3TMKA 1PUJA 3AGPA 2UZIR 2BV3A 4CRWB 1RPAA 4B71A 2WMOB 2IX3A 1KI7A 1IY2A 3R7WB 5D3QA 3MBKA 1U2RA 2W0SA 1GAJA 4JBWA 2GXUA 4UQOA 3SYLA 5EP2A 1ZM4A 3WNCA 4P33A 1K5DA 3RDPA 2KB0A 2IYZA 1ZMXA 2W58A 1E3MA 2IYYA 2QRZA 4DLTA 4YC7A 1N5LA 2RH5A 3RWOA 5GVSA 3IQXA 4YMWA 5FUYA 4LPSA 1XD9A 3GCGA 3FFAA 4JZKA 1E2QA 3PFIA 4TMXA 5DN6A 3CNOA 3KKPA 3QOFA 4LDJA 2O0KA 2XX3A 4IW3B 5FBRB 2OV2A 5FUVA 1E58A 1KO4A 1G41A 1GVNB 5JWHA 3D6TB 4GP7A 1V7QA 2FOLA 3B8HA 5PGMA 2VRWA 2ZR0A 1ZYUA 3K0CA 1II0A 1KI8A 2PEZA 3TAHA 4KU4A 3O8RA 4HZIA 4Q7LA 1DAEA 2FEMA 2GESA 2JEOA 2HF9A 4PPQA 4LX0A 2BEKA 3K8YA 3KZ1E 4P31A 2B7BA 1P60A 1Z6YA 1W2GA 1AA9A 1ZM3A 1KSGA 3TUZC 3CKLA 2V1XA 1U94A 1ZUIA 1NIPA 5HKKA 2ZRCA 1ZINA 1W44A 2EWVA 4FINA 5TV2A 3BE4A 4JL6A 1KYIA 1E9AA 3SC3A 5C1BA 4PZZA 3WP0A 5J4HA 4LJ5A 1JPNA 1TQ6A 3TVTA 3KKQA 4BFVA 4GPIB 1EG7A 3U4QB 1GM5A 2P9YA 2FN4A 3CUEF 2QL6A 1E32A 1OW3B 3Q5EA 1TF2A 3PUZA 2FPKA 2E9SA 2IYRA 1SXJE 1VHTA 1YKSA 5CITA 1UPTA 3A4NA 3DCYA 5B30A 5KPJA 3LA6A 1PLKA 3BAFA 1N25A 3EC1A 2R62A 1NNEA 2CLCX 4OK5A 4BZPA 1ND6A 1Q20A 4MYUA 4LHYA 4TMVA 3W3ZB 2D2FA 3C5HA 3OIUA 2VHUA 4F38A 4Q1CA 1GKIA 3ZYCA 4WOPA 1NL3A 3RS4A 4IXNA 1L4UA 2QT1A 4CF7A 1P4SA 1D6JA 2WKPA 3T1TA 1Z6AA 2LCFA 2WOOA 4LC0A 4C0HA 4PAQA 1KDPA 5BN3A 3C5CA 2FG5A 2PT5A 3GJ3A 1ZM9A 2E1RA 3ZS8A 4AC9A 2P2ZA 4NYIR 1M8PA 3HR7A 2OFXA 2VHJA 4EPXA 1SK9A 4V0LA 3ZVRA 3LNTA 2GRJA 3A36A 3ZQJA 1CP2A 1Y3AA 3IUYA 1OIXA 3U3OA 1HEIA 1C81A 3EOZA 2OWEA 1AZTA 2REBA 1X6VA 1VYTA 4ZCIA 1W48A 4C2TA 1P9NA 2O8BA 4PHGA 2IXGA 2P3SA 3JZAA 3KUCA 1KMQA 1L2TA 1CR2A 4GPTA 2ODNA 1F2TB 4M9ZA 3OEED 2A2ZA 3THYB 4M1KA 2RGNC 3AVPA 3RRMA 3DEFA 5CB6A 4NONA 3DM5A 2PX3A 4I1SA 1UKZA 2WMNB 2ZIAA 1KAOA 1NN1A 1XMIA 1XPUA 1KTVA 4Q4LA 2YINC 4QBHA 1VDZA 3JZMA 4BPBA 3IGFA 5LDDC 5HCIA 1RE0A 4RD6A 2EFCB 4CZ2A 2V8OA 3P32A 3W5IA 2DWOA 3BRWD 4DWJA 3X2SA 2C04A 4ZDIA 2HIAA 2JLRA 1T8TA 1RRPA 2XNDD 2AXNA 3X1ZA 1NLFA 3VHXA 4OQLA 3KQUA 3MMPA 2Q0HA 4OHYA 4BFSA 2D7CA 1FQJA 1Q0UA 1TADA 3NHBA 1GNPA 5FTMA 4V0ME 3W8NA 1AGPA 3FHCB 3A4LA 5HKKD 2VHCA 4LJ6A 1Z28A 1LS1A 3DZDA 3TW8B 4IFEA 2ASEA 4KBFA 1W0JD 4XVRA 1SVMA 4Q4HA 1K8RA 2Q21A 3FE2A 5EE9A 4ZDKA 1QDEA 2FPLA 4J0QA 5JLJA 3G0HA 3H86A 1X8LA 2GF9A 4UXJA 1HT2E 4QOSA 3U44B 5G3ZA 4Z51A 1TTTA 2O8FA 3TNFA 3UIEA 2J9RA 1Z0DA 1KSJA 3QSYA 2VTKA 1Z0IA 4FMCF 1ETUA 2XZPA 3IBYA 2C8VA 2QAJA 1FFHA 3EIQA 3GFOA 3LRPA 4AG6A 4HZUA 4ARSA 1NMYA 2FA9A 1UKVY 2GILA 4O2RA 4D82A 1M1YE 1I4TD 2QA5A 4TSFD 4B43A 3BIFA 4JJKA 1I4DD 4GT1A 1IN4A 2BM1A 3OAAD 4O0MA 4TLBA 1LS6A 4POAA 4RZXA 4IDOA 1SXJB 2ZITA 1MRNA 3QVVA 3OEEA 3RLFA 1R10A 1PUIA 4WZ6A 2BCGY 1DADA 1E99A 1R2QA 2C2HA 1QHGA 2R44A 1OV4A 3AP3A 3U5ZB 1H2EA 1JEDA 1YJXA 3H2YA 5A0FA 4WZBE 4NE2A 1XCPA 1JI0A 2W2VA 3KJEA 3LW8A 2R6AA 1U8AA 1HQYE 2A7QA 2D62A 4KO8A 3HJGA 4B74A 3S1AA 1KJZA 4GSYA 1CJVC 3E1SA 4LYAA 4B3XA 1DOAA 3D6AA 3HU3A 3QJYA 4G5GA 2XNDA 3IO5A 4G01B 4TQUS 2ATXA 2OCBA 2YN2A 3GLFA 5FOVA 2QZ4A 1GFIA 1Z8FA 1WXQA 3DVLA 5ANRB 4PPFA 4DXAA 4HYYA 4D2IA 4X8LA 1DAMA 2CVHA 3MD0A 2N42A 3P1JA 4RD1A 5AUPB 1VCIA 5FPKA 3R20A 2LKDA 3BB3A 3MJRA 4MRVA 1AM4D 4UNSA 4L9SA 2CE7A 2IKQA 4AIIA 4MKIA 2VP4A 5A4JA 2G1JA 4IHQA 2QPAA 1ZM2A 4YLGA 1R0ZA 2GF0A 4EPYA 4HAXA 4TTRA 3KQKA 1DO2A 2G1KA 1QVRA 2VHTA 1W0KA 3BBPA 2IHYA 5BN5A 3BH7A 4M1OA 4IVPA 3LVRE 5FUXA 4A6XA 1DG1G 4YMVA 1UJ2A 2GBLC 3QXHA 4Q48A 1EK0A 1BS1A 3F5FA 3KKOA 2ZI9A 1N5JA 3EZFA 1AGRA 2KI5A 2C98A 4U7DA 3AP2A 4ZV4A 4MA4A 1LY1A 2ZSFA 3IKJA 1XRJA 3P26A 1FL9A 2YHSA 2O8CB 3RS3A 3QXXA 1NBMA 4KFSA 1XZQA 5EZ6B 4PO9A 4AYTA 2RGAA 3D8BA 1NJFA 2O52A 1G4UR 2PMKA 2FSHA 4JLDA 4MRPA 1RIFA 2QUZA 2Z4RA 1ZIPA 4G5RA 1AQYA 2GCNA 4KSCA 3H1TA 2MMCA 3E2IA 1I2MA 3EPHA 1L8QA 3AKYA 1IHPA 4ACAA 1YR6A 2AKYA 3F8TA 4QFMA 1WQ1R 5L3VA 2ZS7A 4GI7A 2FU5C 2UKDA 4C0AC 3DKVA 1KDRA 1IY1A 1CTQA 1CXZA 1XU4A 4US2R 4V0OA 3D8HA 1NVXQ 3SU8A 2RGBA 2ZYWX 1EWRA 3AVQA 3CBQA 3IHWA 1G3IA 4OKSA 1A1VA 2ZETA 4AROA 1U8YA 3TSOA 4JS0A 4JLPA 2OAP1 3VX3A 3X1WA 2ODBA 5F9HA 5F9FA 3KUDA 4LJYA 2Q9BA 1T6NA 4R7ZA 2GNOA 4I4LA 2KBEA 2AWNA 3V00A 4QGFA 1YZTA 1AN0A 3QVUA 4HATA 1OFUX 4NZYA 3VU9A 4CEJA 1TNDA 2GAAA 4Q9JA 4LV5B 1Q21A 2DYKA 3CWZA 5FOXA 4D4MA 4PO8A 5DIFA 1UDXA 3FKQA 4S2EA 5CJ2A 3TK1A 4BLSA 1KNQA 3FMOB 4D80A 4YXWD 3TR5A 2QMOA 2ZRAA 2QPOA 1U9IA 3AKEA 3L0PA 2I3BA 2VP6A 3IBGA 1VHLA 3EPLA 3BXZA 4JVMA 4QGAA 1D9XA 2O5VA 4TLDA 2V3CC 1N5KA 2GJ8A 2PEYA 4EPTA 3VQTA 3IIKA 2OEPA 5CK5A 2BMJA 1F3OA 3H0KA 4TZ6A 1P2VA 3NEJA 5AUQA 1XTQA 2ZRKA 1Z83A 1G3UA 3ZVNA 1KMHA 1M34E 5K8LA 3LQQA 2VSXA 4PZAA 1HUQA 4TWZA 4TL6A 2ZYUX 2RFLA 3C7KA 1EX7A 1W4BA 4JOBA 4XH9B 1FMJA 1KI3A 2OLJA 2IUSA 4PO1A 1JXOA 2GZDA 3B7GA 1ZD9A 1OXSC 3PUYA 4HDOB 3CONA 3WMGA 3A8TA 3NTLA 2BVNA 4HDQB 1QF9A 1OYWA 4KV9A 2O8DA 3HPQA 3DPUA 2H92A 3VAAA 2XITA 2OCPA 4MUBA 4OJKA 1YR8A 2Z5FA 2ZRIA 3KXIA 2IYSA 1R7RA 1SVKA 2BDTA 2VP0A 4M1WA 4FD2A 2A78A 5CU7A 5EXTA 1QHHA 2ONJA 1T91A 3ZHCA 4QGHA 1T3HA 4NU0A 3WBKA 1NVUQ 3LO5A 4ZCMA 4RFSB 1AJEA 1W46A 5FR1A 1TQ2A 2IWHA 1XNJA 1J2JA 1OJLA 2BJWA 2CCKA 1SGWA 4TL9A 4DUGD 3GFPA 5FTJA 5EP4A 4ZDWA 2C9CA 3ONWA 4PHFA 3T5DA 3TSZA 1HA3A 2B21A 2XJ9A 4KI0A 1Y63A 4B32A 2BHRA 1LV7A 1CU1A 4YXWA 4AKIA 4NMMA 4OK6A 3QKRB 1BQ4A 3M6AA 4BZXA 3ZH9B 1UM8A 2ZUBA 1XEWY 5B2ZA 4H9GA 2QTVB 4JBYA 1CULC 4LV6A 2ZI6A 5AWFC 1XCMA 5J4VA 4Y0AA 1V37A 3K4QA 1OKKD 1J70A 3B60A 4QM6A 3VNVA 3WYFA 3CF0A 2ZSAA 3ZZ0A 4B44A 1Z2CA 1T8PA 1OXTA 4A2QA 2GCOA 4X8MA 4RVCA 5LB2A 5DGXA 5BYJA 5TB5A 4AURA 5JS7A 3PJRA 1UFQA 2ODEA 1JB1A 5E95A 5KSPA 2ZVQX 1G7TA 3B85A 4HZUB 5KDOA 1FZQA 3QE0A 1MT0A 3PUXA 3U7HB 2OSBA 4KVGA 2RKOA 3WRXC 4QM7A 1R5BA 3AUXA 3T5GA 4C0BA 4EQ6B 3QKUA 3FYHA 4LYHA 4P32A 1NVWQ 3SDZA 2GVDC 3RAPR 4QNMA 3SJAA 4L8GA 3QG5A 3CW2A 3K70D 2NQ2C 2VQSA 2CL6X 2C78A 3L0SA 1XEFA 1RJ9A 5JI3E 2D06A 4BFTA 4QL3A 5TVKA 2NO6A 2F1RA 3Q7QA 5FPHA 2J7PD 4NP6A 4JYBA 4AG5A 1RRFA 3U3KA 4DLVA 1WBDA 4NTZA 4DLXA 1C1YA 1YHNA 4TTQA 1J8YF 3AVTA 3LG2A 1P62B 1UF9A 4LC1A 4UXIA 1XXHE 4Q4AA 1I4LD 3BERA 4DDWA 2DY1A 2QY9A 4RCYA 5DI3B 3ZZTA 2MMGA 2QBYA 2QSYA 1US8A 2ZI4A 2OM2A 4JBXA 3LL4A 1GP2A 4W7SA 2A5YB 2JLSA 3AF4A 3GLFB 1W5TA 2HT1A 3EIEA 2PX0A 4IEEA 4OQXA 4ODIA 1IAQA 4MKFA 1R0YA 2IC5A 2WJYA 2IF2A 4Q1BA 4ZCLA 5SZKB 3EPJA 2BIFA 3GLHA 2ZR7A 5J4KA 2JLXA 4ARZB 4XJXA 2YYZA 4Q66C 2JASA 4Q01A 5HE9A 1Z0KA 3K9HA 4C7OB 1XPOA 1Z63A 1UEIA 1OKKA 3QEJA 3LXRA 3N70A 1TX4B 2QM7A 3KKKA 2WPDD 1P61B 2WNHA 4IXMA 3QKSA 3X1DA 3K9NA 2JATA 3F3YA 3K0AA 3M4YA 3LX8A 3HP1A 3U3MA 2WVJA 3DL0A 2QI9C 4S35A 4PANA 4E03A 2HXYA 3K09C 2QP3A 5AJYA 2WWXA 3GPLA 1G21E 2BKUA 1QHXA 2ZJOA 4ZI2A 5KYKA 3DHWC 2A5DA 4V02A 1RZ3A 5FUWA 5BN4A 3AVUA 5JFGA 4K81B 2W6JD 1W4RA 1E2LA 2VYFA 4MDFA 1FUUA 4OBEA 5CDFE 3ADBA 5CLQA 2F1IA 2YVUA 2ZSBA 2JJ1A 3ND8A 3WP1B 4B6EA 2ZRBA 3O8CA 1P72A 2QU8A 1NG1A 4M9QA 4Q7JB 4BWYA 1EESA 1KI6B 1VG8A 1M7GA 3FHOA 3KXKA 1F5NA 2IYWA 5GJWC 1H65A 5HR5A 5EUMA 3BFKA 2A9JA 3QXCA 4TYPA 1CJKC 5EXPA 1SVOA 5KUTA 1KZGB 5FL7D 1MO4A 3KDSE 4JKYA 4Q1AA 2FZ4A 2ONKA 3ETLA 4DB4A 1VG1A 2AFHE 4LHZA 3C16C 3KTAA 2OG2A 4OYHA 3IT3A 4HAZA 4AKHA 2ZXUA 4QKQA 2IHBA 1NVVQ 3OIVA 3PUWA 4Q1DA 4C0SA 3AF3A 1JR3E 4EUNA 5IHPA 2NOAA 1A7JA 2XOKD 3QNUA 1X1SA 4PC2A 2CJWA 5EE3A 5FBLB 4EJSB 3P4YA 2ERXA 1UKYA 3I5XA 2L0XA 1LW7A 2R2AA 1X86B 5BYKA 2ENWA 2WPDA 3SNHA 4CEJB 4WA7A 2QMUA 1CRPA 4TMKA 1JBKA 2XXAA 1DKPA 4IKEA 4F4CA 3MRSA 4YDSA 3PQCA 4URYR 1E4VA 4DRZA 2JIZD 1J90A 4TLAA 2XJ4A 5AUNB 1KIMA 2BC9A 5FH9A 2O0HA 3AVVA 2CCJA 1Q3TA 5JRJA 3P27A 4KXFB 3X1YA 1XXHB 3I62A 1RYHA 3LXXA 1E2PA 2P6OA 2F43B 3AVOA 5FTNA 4IJ6A 3HYRA 3N2IA 2W6JA 1Q57A 4A6PA 1G3MA 2AR7A 1G291 3RRZA 4A0FA 3QY0A 4NPHA 3KQHA 1TU3A 4BLQA 3BORA 3KFXA 2WWIA 1XJCA 1GL9B 2EU8A 2IA5A 1JJ7A 2HF8A 5P21A 3VHLB 2IEYA 3CR8A 3LNCA 1E2FA 3O8BA 4A0RA 3FGNA 3FWYA 4HUQB 1UEJA 3EG5A 5BQ5A 5JZVA 4HEJA 2GDJA 1W36D 3T35A 2G83A 1E69A 4FMDB 2WWWA 2TMKA 4V0NA 2KJQA 3NG1A 621PA 3I1FA 3QENA 2Q9AA 1N6LA 1B23P 5FL7A 1VYUA 3QPVA 3B9PA 3SYKA 3CRQA 5DHAA 3GLGE 2KWIA 2W0MA 5AJVB 2NG1A 1CF4A 1VG0B 1MABA 3NXSA 3GMTA 2C9OA 1DEKA 5LD2C 3PXGA 4DIEA 5L3QA 1S96A 3E9DA 3F2IA 2P9FA 2OHFA 3BH0A 4WXRA 2XOKA 5BW8A 1VYVA 3THWA 4NCNA 1KY3A 1QHSA 3ZZUA 4ZIRA 3VKWA 1W4CA 4PPNA 3EC2A 1XTJA 3AVYA 4RKEA 5IF9A 4TYYA 4JIMA 2ZRPA 3TIFA 3R8FA 3CO5A 2DFTA 4A15A 3E9CA 2WNIA 5JHHB 5D3MA 4TSRA 1EBBA 4GMDA 1SVLA 1MV5A 2JIZA 2EW1A 2IXEA 3NVAA 2NPIA 1Z06A 2FEOA 4PGMA 4P0TA 2JLZA 5JSZB 3WNDA 3SR0A 3EZ2A 3FB4A 1IN8A 1VCOA 2CHVA 1QHYA 2J46A 3CPJB 4K46A 3Q8XB 1QG2A 2J41A 4OHZA 1W1WA 2ZANA 3IEVA 4LJ7A 3LVQE 2P5SA 2ZI7A 2JLUA 1PV4A 3MXOA 2GCOB 4WXPA 2NIPA 3ZIAD 4FDUA 4KLNA 4NHOA 3PITA 4ARVA 3NHAA 3T12A 3ZJYA 5EQTA 3M0EA 2ZPTX 2HCBA 3EASA 2OZEA 5TDHA 1F2UA 4DC9A 4JMPA 2WWFA 4OI1A 3GLGA 1Z0JA 4GFDA 3U2QA 1MRSA 1AK2A 3EZ6A 3SZRA 3SOPA 2WICA 4ON9A 1SK8A 1ZD1A 1RRGA 2CL7X 1YZLA 1G19A 1G8HA 5FOSA 2QG6A 4P4SA 3SYNA 4A36A 1M7BA 2J87A 2HYDA 2EYUA 3GP8A 3LDAA 1TUEA 4M1YA 1KY2A 3NH9A 4NDZA 2HT6A 3FDIA 1IXSB 4EJSC 1JPJA 3N2EA 1KK1A 2HLDA 4LYFA 2CEAA 2GEVA 4KYIB 5GVRA 4BECA 2IEZA 5JCZA 2V54A 5FTLA 2FV8A 4KSBA 1JQJC 4DT1A 2GWHA 1X8JA 4BQSA 2ZREA 3ZS9A 1YZGA 4E09A 1FBTA 4FI3C 1US8B 4HDCA 3RC3A 4Q7MB 4R2HA 2YZ2A 1XPRA 3LX5A 1U9IC 3LV8A 1Z5ZA 4KITB 4PAMA 4YMSA 4R71A 2G6BA 2BBTA 4ZDJA 2P6NA 1P2UA 5AJXA 2VO1A 1OYYA 3Q85A 3KX2A 1LB1B 2YKGA 3QPWA 2CCGA 4TMZA 3E5HA 1G7RA 1FQKA 3UANA 5EE5B 3MFYA 3VFDA 1G18A 3WRYC 4BFZA 1E79A 4II7A 1P6XA 4D4LA 3PR1A 5C4GB 4BRWA 3P4XA 3IPXA 3TW4A 1R0WA 3ZIAA 2YJTD 4GBMA 1IJEA 4LJ8A 2QAGB 4Q18A 1NN3A 3UPUA 1R5OA 3W9YA 3O47A 3DM9B 1XMSA 1L7VC 3KL4A 4RZ3A 2WWGA 5FL3A 3B78A 4R2IA 1JALA 2ZE6A 2ORVA 4N0DA 1C7ZA 4A2WA 2R6GA 2NO1A 2ZU6A 1KKMA 2FFBA 3CF2A 3IQWA 3TAUA 4JJZA 5GADl 3ICEA 4M53A 3X1XA 4A8JA 3FDZA 1EFHA 4IDHA 3RS2A 2Q3FA 3IILA 3AM1A 4NCJA 2RGDA 4HB3A 2EYQA 2P75A 3EARA 1Q1ZA 3MWKA 3TKLA 2FNAA 1FX0B 3A1TA 2CL0X 3BK7A 5J40A 3WYGA 3I61A 1W0KD 4RD4A 2R6CA 4UNQA 3MWYW 3U3JA 3SQXA 4JSYA 4B48A 4MRSA 5L3SB 5KO2A 2ZJYA 3GLIA 4IVRA 1JQLB 4OI2A 2X2EA 2P5TB 2PH1A 5K8IA 3THXA 2SHKA 2FMXA 2QE7D 3ADKA 3RANA 1ZC3A 1KZ7B 4P4TA 2XZOA 1NLZA 4M1SA 1M2OB 2CLDX 3V4FA 3GEEA 5JECA 2G3YA 1GUAA 2D4HA 3EIHA 4URWR 3RS0A 1XBTA 1XEWX 1OXUA 4DSOA 1NBMD 3R7AA 4KFUA 4LPKA 3I3SR 2P78A 1IY0A 4URZR 1W2HA 3OEHD 5FI1B 2A6PA 1IN7A 3IIMA 1G8YA 1TMKA 5IK2D 1FPMA 1GRQA 1P3JA 2GJKA 4N0EA 5SZIA 4E5UA 1XTRA 2JAQA 1BH2A 2WV9A 1IM2A 2XXAB 5FPSA 1T8UA 4TQ9A 1U90A 4YMUA 4PX9A 4RD0A 1MO6A 2QMEA 2J0UA 1NN0A 4IOMA 2FSGA 3G5UA 4XSHA 5M04A 2ANBA 1FNMA 1XEXB 1G5PA 4Q9LA 5C18A 2O8EA 4Q4JB 2H4ZA 1ZVQA 1FMLA 8OHMA 4FCWA 4A4DA 4DDUA 1OH8A 4OHXA 3C4JA 3GJXC 2OBMA 3LY5A 4PPGA 1YZQA 1D2EA 3CRVA 2R9VA 4YONB 4DEXA 2F3RA 3KJHA 2C77A 3VMFA 2ZUDA 3U6KA 1TUIA 2DPXA 1NKSA 2Q9CA 2YC4C 1KO8A 2H16A 4IVQA 2RGGA 2D74A 4ZO4A 5HZKA 1DKNA 4JLJA 3TBKA 2PCLA 3RHFA 4P3YA 4CDGA 3MWLA 2VP9A 3OHMA 1M7HA 1H8HD 2H7VA 3ZLJA 3EXAA 4F93B 4MQBA 1XD2A 3C14C 2WKQA 1U81A 2G0TA 1EFTA 3GQBA 3R9XA 3BC1A 1ESMA 3DKPA 1LNZA 4JOCA 4XOIA 4V0KA 5KDLA 3DZ8A 5JJLA 3VTKA 2QE7A 4TYQA 2GJAA 3D7MA 4DCUA 4JVLA 4C0LA 1CEEA 4DEYA 3QIAA 4QGGA 4DHEA 2DR3A 3FHTA 1T3LA 2WBLC 1RKBA 1TPZA 1AKYA 1OH6A 1H2FA 2QM8A 3OEHA 1KJWA 1U8ZA 1II9A 3C15C 1M74A 4QBFA 4UJ3A 2QAGC 1G8FA 3EX7C 2BCJQ 1QWOA 2BM0A 5IK2A 2I1QA 2QENA 2WTUA 2H5EA 5HTKA 1VPLA 4XWKA 4I1UA 2ZUCA 1XDBA 1NSFA 1FNNA 2FGKA 2NZ8A 1F60A 2VSOA 5FBVB 1G7SA 3NDPA 1QHNA 1YZKA 3TR0A 3IT2A 2IF0A 4Q03A 1X8KA 4W5HA 3K70C 4I1OA 2X77A 4NCKA 1ZCAA 3K0FA 1CBUA 1MO5A 2QQ0A 2PLFA 1U0JA 2ZJBA 5GJCA 5B64A 4Q02A 1A2KC 2ZJAA 4DLUA 1ZJ6A 1RRCA 4RD3A 3QF7A 3M1IA 5F3WB 3GJ0A 5JWRA 2AN9A 3B2EA 4LV8B 4C2UA 4NYIQ 2RHMA 4WIAA 4BE7B 1XX6A 2ZS9A 4QG7A 3LBNA 2HXSA 2QPTA 5JJIA 521PA 3K1JA 2FDCA 3BB4A 1G17A 1U0HC 1J99A 4Z54A 1S1CA 3PIRA 2XAUA 4TT3D 2V7QA 4YQFA 1E9DA 1DAIA 1UAAA 2ZRFA 1W36B 2EFEB 1H8HA 2OFOA 4GZMA 5E7JA 5F2EA 5KPDA 1F2UB 3KB2A 4JLMA 3F0TA 2QNRA 2IBMA 1EFUA 1Z0AA 3A1VA 5HZHA 2XZLA 4EPVA 3I32A 3L43A 1FW6A 4FMDF 1XTKA 5J4YA 1BKDR 4BUJA 2J59A 2I4IA 2ZJ2A 1GL7A 3WMFA 1HH4A 2ZSEA 4DJTA 1GOTA 3UG6A 1DARA 3NBXX 1CJTC 2IWRA 5E7IA 221PA 5FBQB 4CEHA 3OFND 3C7TA 1N6PA 4Z8XA 2FFQA 1JAHA 2B8TA 3GLFE 4EMBA 4RFVA 2CVFA 2CNWD 2GK6A 5JWOA 3B9QA 1BO6A 1Q1EA 2YWHA 1KDOA 1RVDA 1W47A 4OI4A 3QEOA 5KNBA 4HB4A 4BRUA 2QNIA 1KK0A 5KDDA 2NO9A 3ND9A 3DMNA 4I99A 4Q1FA 1YE8A 4DCVA 4C0JA 2IYUA 5K8UA 4B3BA 2MSEB 2Z4SA 2JLQA 2QRNA 4LWZA 3U61B 1OB5A 4C3ZA 2O8BB 4EFLA 1GSIA 4JL5A 3LLMA 5FR2A 3SFZA 3AKDA 1N2CE 4NKRA 3CM0A 4PHTA 1KI2A 1PLJA 4US0R 5G41A 3LBIA 1N0UA 3PCRB 3U7GA 3QQ5A 1SVWA 1N6OA 3GJ7A 3CZPA 4IOKA 2VH5R 1ANKA 2BMDA 2I1VB 4PC6A 3VNUA 3AUYA 1IONA 1XTIA 3VR6A 1PVOA 1WE2A 4JLNA 1TU4A 1P9WA 3EAQA 4V03A 5FBWB 2B6HA 3H84A 1YZUA 5EXSA 1HQCA 2J0SA 1DKOA 2VF8A 2YWFA 2QP9X 1E2KA 4NYMQ 4IRUB 2P67A 4IOJA 4DLZA 4TT3A 1RIIA 3RC8A 1D8TA 3THOA 1VIAA 2V6JA 3SBDA 3PEUA 4B35A 4LJAA 4CYMA 4DSNA 3MGCA 4UKDA 5JCPA 3CPEA 2EFDB 3SJBA 3PGMA 3SN6A 4LGMA 3NKVA 4Q4HB 3TQFA 4KVAA 1NP6A 2UVQA 4B2IA 2EVWX 1WRBA 4MYTA 3L0OA 4HAYA 4A8JB 1KK2A 3KXLA 4ZI3A 3FDZB 4LBZA 3KQNA 3K0CC 2IL1A 3DMDA 4CT4B 2O8FB 3RS7A 3AKCA 4TYNA 3CR7A 3OFNA 4KFTA 4RD2A 4M1TA 5CDFA 1E2MA 3AF0A 3CRMA 3DOFA 2DWPA 4JSTA 2H1LA 3W6PA 1KO7A 2CNWA 2OUKA 3G82C 3GJ6A 3HU1A 4W5JA 2P6RA 2HPAA 4PZLA 4ILEA 5CYOA 1XP8A 2OE2A 1DKQA 5HCNA 1UADA 1Z2AA 2CHQA 4UNRA 3FKSD 4LYJA 4R98A 2IS6A 2QGZA 4DIDA 5L3RA 3B1YA 3BOSA 4RKFA 4UNPA 4EFMA 2LKCA 1AKEA 4QIHA 4EO9A 1E1QD 2J1LA 1KOFA 4RSGA 1QHIA 4G5OA 2CDNA 2ZRGA 4PC1A 2YNMA 2IYTA 4F91B 3U4QA 4ERNA 4CW7A 1KK3A 4IJMA 1K5GA 1NIJA 3PVSA 1TL7C 2OXRA 2JJ1D 4D6PA 3IEUA 2W2XA 5DYIA 4EAQA 1D2MA 1UBEA 2REXB 4NBSA 5DSZA 3RNLA 1V5WA 3BB1A 3WNBA 2FH5B 3MWJA 5IT5A 1SQ5A 2CHGA 3LLUA 4D26A 4MDEA 1JR3A 2IS1A 3S1AB 1HURA 4Y0VA 4D0LB 2OBLA 2OT3B 4A2PA 2JCSA 2QQEA 1G64A 5L8VA 1W36C 721PA 4DLRA 3GEIA 1KO5A 4MGYR 1DAFA 1B0UA 1VKJA 2PZGA 2DFKB 3TRFA 1TF7A 2J0UB 4C9BA 2HUPA 4D0NA 1NT4A 3ASYA 3WHLA 3W5JA 2NO0A 1JR6A 3U60B 3CB4A 4L15A 5F98A 2GA8A 2PCJA 4CEIB 4QRHA 2XB2A 1C4OA 1HV8A 1RFLA 1BQ3A 4RZ2A 2P65A 4M22A 1G1MA 1EFRD 2ZEJA 4QXAA 1SKBA 4AYWA 1OXXK 3B1XA 4JKIA 5JS8A 1W49A 2G77B 1KGDA 3VR2A 4ASUA 3MJHA 2PZFA 1U99A 3TSWA 3UXMA 3B13B 5A5GA 1E2DA 2OLKA 5LD2B 4IJ5A 1NJGA 3I92A 4FWIB 2JLVA 2WJIA 1XJQA 5FPTA 5KHOC 1DS6A 5DLQC 1A5TA 4JVSB 4Z1MD 4TLEA 4PZ9A 3GP3A 2NO7A 3WYAA 1LF0A 2GBLA 1SXJD 1X1RA 4HI0E 4JODA 4NH0A 3FKSA 1F2TA 4PSAA 3W6NA 1HE1C 2XEXA 4AKEA 4BLTA 1K6MA 3CPHA 4GOXA 4RJLA 5G40A 1II8A 2NPFA 2JJ2D 4ESVA 1E1QA 4JLVA 5EXXA 2VIIA 4LHWA 4X8HA 2AWOA 1DE0A 1UBFA 3AH8A 2QP4A 2ZAMA 4QJ5A 3R8CA 5KSOA 3LQRA 2PJZA 1NF3A 4IDNA 2F90A 1DAKA 1FTSA 1Q3HA 2N1BA 1WBBA 3FMFA 3V9PA 5AJZA 3BGWA 2Y8EA 4WW0A 4LHVA 3NC1C 2KE5A 2ZJ5A 1MR3F 5CK4A 4WBSA 1ZC4A 3VR3A 3C8UA 4IDQA 1ZIOA 1ZW6A 1GZSA 4ZPXA 4WZAE 3MG9A 4M8NE 5SZJA 1ZU4A 1ZUNB 2EWWA 4YMTA 2V1UA 1W7AA 2P2LA 1G5RA 4O3MA 2P79A 1N6HA 3Q9LA 1CR0A 2F6RA 2AX4A 2WZQA 3IT0A 4A8JC 4ACBA 4M21A 2FZLA 5AJWA 1QRAA 2GJSA 1N3BA 1EFRA 4BGDA 1AZSC 1EWQA 1G8GA 3BJIC 1EXMA 1OPXA 4MGZR 4I1VA 3MLEA 1RPTA 5DYGA 1YQTA 3CRW1 2P2YA 1T0JB 3D31A 1OSNA 2PLRA 2ZVPX 3VU9B 4Z1MA 4A82A 4LOAA 3CX7A 1AQUA 2A30A 2P6MA 1V43A 3E9EA 3D3QA 3EZNA 1SXJA 5C46F 4ESHA 3UWKA 4BLPA 3T06B 4HB2A 3K0EA 2G88A 2ZYTX 3DOEA 1JJVA 2VF7A 3IDQA 4MRNA 4TTPA 3SJZA 5KOYA 3KQLA 4A0GA 1S4QA 2DHRA 4QHTA 4M4SA 2JJ2A 4E07A 2WIAA 2V6IA 1CVIA 5JJKA 3B6EA 5JHGB 1J7KA 2F7SA 1COWD 1VECA 4Q7KA 1T9HA 4KJZA 3FOZA 2X1VA 2QMHA 2BOVA 4XWOA 1G16A 5DNYB 1CJUC 3AQ4A 5H70A 1KMHB 3QUSA 2HJGA 1Z47A 2F9MA 4JL8A 5UKDA 1KSHA 5EE1A 4BEJA 3A1SA 3UATA 1CLUA 1XFAA 2RCNA 2IUUA 1TEVA 5AK0A 4BEBA 2WU0A 4GMXA 2FGJA 2FWRA 3EWAA 5EZ5A 3NFYA 1XCGB 1GRNA 2GXQA 1OIVA 2B7CA 2RGXA 5KU1A 2O8DB 3HU2A 3VR4A 3VX4A 3C41J 1YRBA 4Q5IA 3GEHA 1L4YA 4CT5A 1KNXA 4XD7D 4HAVA 2E87A 1QHHB 4D4KA 4YDHB 3HWSA 1QFXA 3QKTA 1ZM7A 5CJPA 1UDWA 2NMVA 2FF7A 2HLDD 3CNNA 2AK3A 3NBZC 3RYTC 2QEQA 3IPYA 2C9YA 2GJ9A 2IXFA 2A5FA 1Q1QA 2QN6A 1N6RA 4JVNA 1W4AA 2WJGA 3MCAA 4D0GA 4EPRA 3U3RA 3ZD7A 4TYWA 3P20A 5G53C 1XMJA 4NYJQ 1D5CA 1ZD8A 3RRNA 5J4LA 2CXXA 1TF5A 3TH5A 3ZD6A 1E96A 5DO9A 3EWSA 4BFXA 5JMTA 1ZRHA 2WJHA 2QTHA 2QT0A 2W2TA 4UNNA 1UBGA 1Z22A 1G3RA 4ZKDA 5CM8B 2O8CA 1RPZA 3QI2A 1U0LA 2ZI5A 3AF1A 4AD8A 4I81A 4Q47A 4V0MA 421PA 1VCMA 1NY6A 2DWQA 3PUVA 4GPZA 2YV5A 4QHYA 1G6OA 3VR1A 5CLLA 1FUKA 3KB1A 1E79D 1XJ0A 1COWA 3WMEA 2P30A 1R8SA 3SJCA 4FW9A 1RW4A 3QBVA 1GITA 4TQAA 3QPUA 2WM9B 3RRYA 2HV8A 5BXQC 3U7FB 2CBZA 2JA1A 1E0SA 1O3YA 3AP1A 2FJUA 1HTWA 2GCPA 2GK7A 2PBRA 4QBGB 5EUQB 4LK2A
chains in the Genus database with same CATH superfamily
3DFUA 3QVGB 1Q1NA 3NEYA 1W88B 1A5ZA 3MWDB 5IEJA 1OBCA 2OSVA 2W83A 4NQRA 5CA0A 1N0VC 1PO7A 5KB3A 2UXBB 4MX8A 2C0PA 3ZDYB 1AUOA 4YCDA 1OX4A 1YR9A 4B31A 1C4XA 1ZCFA 2FYTA 3TLEA 4ZV9A 3IO3A 2WB4A 1FU4A 3Q5DA 2RG1A 4LBWA 2AYZA 3STTA 5IJ0B 2WYVA 4P4UA 4RV9A 4HTAA 1BNCA 4FCTA 1UMCB 2HHJA 4CCWA 2WWRA 3QU2A 1PEDA 5TMPA 2RGEA 1DJMA 4XZ3A 2ZYVX 2OCYC 3D3WA 5ILQA 3DLPX 1LFDB 1XE3A 2XR1A 3TE6A 4DBLC 1FYEA 3DUFB 4GECA 5JRDS 3EW9A 3F7NA 4FHGA 4BB5A 3E1GA 1YIAA 3LBHA 1MAVA 2AHRA 4XE5A 5KNDD 3SX4A 4V2IA 2I6FA 3F3MA 3AF6A 5FUMA 3LYHA 4ADSG 3ND5A 1E9BA 4FYJA 1WA5A 1IHUA 3B6ZA 4OL0A 5EVJA 4GBGA 4QAJA 2IUEA 1JAXA 4EJ2A 4NLLA 1MPXA 3ZHRA 5CFRA 1D2NA 3ZW8A 1LU9A 3D2AA 3CZ5A 4M6WB 5F3DA 5K8CA 4CVNA 3I73A 4EH1A 1JR2A 3B7PA 5L51A 3BFVA 2H57A 5K8VA 5DNAA 2C7GA 2O2GA 1N4DA 4BCDA 1H9BA 5E7MA 1BA2A 1EXNA 4ZCPA 2EX0A 3OJEA 5BXYA 5E2AA 3QNWA 3W3AA 3DMHA 5JIBA 1T9GS 1ZO8A 3RAEC 1J07A 3NALA 3OCUA 4CL2A 2EFGA 4X8OA 2PZEA 1L7XA 2PBLA 3LXUX 3UT5B 1NI4A 3ZU6A 5ICMA 3EDOA 2NTYC 4ENRA 1SKYE 3OJXA 5CLJA 3PEYA 5IKEA 1U2QA 4JUCA 5HMLA 2BTQB 2O54A 3AUUA 4DMHA 4BJHB 4CKCA 4E2WA 2OKGA 3AMVA 4FYXA 4G9GA 3U6KA 2X76A 1FFGA 2OBNA 3T34A 4JDUA 1FRNA 3TLYA 1GJRA 1GNRA 4M9SA 1NYRA 2FRVA 3PT9A 5AR1A 1EE9A 5LB4A 3VZSA 1THTA 2IIBA 4ICIA 2B25A 4L9AA 1EJ2A 1NAHA 2ZQ5A 4FPXA 4D9BA 2ZRLA 4D9MA 4L2IB 4OATA 1DTEA 1B3BA 4XLZA 3RSHA 1KJQA 3TNDA 2D3WA 2WJJA 4B83A 2GKGA 1WD5A 1T5LA 2HF2A 1XCJA 1DLIA 2JK0A 5CYPA 3KOMA 5KIAA 1QRDA 2OAQ1 1A0OA 2H5LA 2R65A 1Q1AA 3BD8A 3EB9A 2HIGA 4IRMA 1SBHA 4N3NA 2HSJA 4Q9IA 3OLZA 1B0PA 3PPIA 2QRMA 4P53A 3I9NA 1V8FA 4QTXA 1NC1A 1IOVA 1OZGA 3UZUA 2EJVA 1E9SA 2ZI3A 2BDUA 3OFVA 4QUAA 4CPDA 3IE1A 2Z1DA 4KFRA 1JYFA 3ROXA 1DWUA 2XWPA 3II6X 4CDNA 3ZDXB 1PG0A 2HA2A 5DE3A 4NFLA 3FPBA 4EB0A 1CUYA 1ULZA 2QTGA 4G5QA 2J6BA 3UYKA 3V4SA 1JNYA 1ULAA 1ZJZA 2VEDA 1M72A 3DW1X 1M2VA 2OO7A 1DOZA 2WSMA 3KD3A 5EJ5A 1ZD3A 3NATA 3PI7A 4MUAA 1LWNA 4M1MA 4U5QA 4BASA 4DIMA 3N2YA 1ELOA 5KTNA 4KXYA 3VSDA 4TZTA 4DM3A 1G7CA 4DSTA 1NXTA 2CSUA 2P9EA 3BYZA 1WVMA 1MKYA 2X1MA 3HEMA 3M6MD 1ICIA 4PQYA 3TQRA 3VU3A 3VR6H 2DFVA 2A5GA 3AHHA 3BMCA 2AUMA 2P8JA 1Z16A 2HZBA 4C06A 1PS0A 4MQFA 4B6GA 3DLBA 3ZY6A 3ZCSA 4IMPA 4FD3A 3I5YA 1HZJA 3F7MA 2AKAB 1XVUA 3AERB 2CJWB 4NHEA 1I33A 2WUGA 4EMTA 2ANCA 4LBYA 5BRAA 4X45A 1UIMA 3KSMA 2FSIA 3OLYA 2ESRA 4BFWA 4XYEA 4BP3A 4EQ6A 5L7TA 5JO0A 3ZHTA 4BMVA 3RIXA 2FDXA 4GR4A 2Y0BA 4MVJP 1MH1A 1E9RA 5CBPB 2UUPA 4M9XA 3HYTA 3A32A 1T10A 3IDOA 4CMHA 3LFUA 4LHXA 1LRLA 2XMDA 1Q0QA 3QXJA 2XMBA 3K9BA 3DTTA 1KYXA 2I7TA 1C1XB 1OA1A 4XDGA 4XIIA 3QLJA 5DXFA 2YJ3A 4W9NA 4CM3A 4DQVA 3AIKA 5JEEA 2YV3A 3WLFA 4AJEA 4X41A 1IN5A 1M0SA 5CDHA 2B99A 4Z4CA 2QOEA 1QP0A 1QTIA 1VJ0A 5C37A 4CETA 4JJ8A 3KETA 1JGTA 1XNGA 4LY6A 1JG7A 4YVFA 3FBWA 1PR1A 5K3SA 3TTYA 3LCMA 3EIWA 5ELXA 1Q83A 1AS0A 5C2JB 1I5OA 3U7EB 2EJTA 1U11A 2GAOA 2X2PA 3NJ8A 1BHO1 1GTMA 3TGPA 5EKTA 1L6IA 2LNDA 4GGMX 5BSRA 2WSSD 1NUAA 2LDXA 2CUZA 1HT1E 1GAQA 3EZXA 1V4VA 3NVMB 3OPQA 4U2KA 1P4AA 3E4DA 4QE3A 5FYDA 2JIMA 3D6FA 5T6MA 3TVDA 4CMBA 5LXTB 1GU0A 4B3GA 3HCAA 2YHAA 2CDBA 1H6DA 4AWXA 5K03A 1KIAA 5GGYA 1HI9A 2QD1A 1T2NA 1YUNA 4RY2A 3THSA 4DS3A 1KGSA 2X19A 2P1RA 1KH3A 4IIFA 3FOEC 1HQDA 3LVFO 5K4AA 1QGUA 1YRAA 4C7OA 4A92A 3ESQA 1F6BA 2ODWA 3CPSA 4G09A 5K2OA 1QNFA 4MH0R 1MABB 2HWKA 4ZOCA 3MJEA 4WAUA 2A35A 2X4LA 4MUGA 1ILWA 2IDMA 4JI1B 1G4AE 5L3QB 4EGSA 5I8ZA 1DKLA 4UU8A 5ECGC 4OVKA 2J3JA 4JI7B 1DAOA 1P7VA 1QV9A 2NZXA 1VJTA 4J6FA 1F5SA 4DG5A 3AOEA 2CN1A 4C4AA 3KT3A 2J0QA 3E5MA 4G0YA 2FY8A 2W2OA 4B4DA 4ENTA 2OORA 1XU7A 3OAAA 2DCUA 3STVA 4J0IA 2DBRA 1WDTA 3CLRC 2M2IA 2OUIA 1FP1D 1CQIA 4FNMA 3L01A 2AD1A 1ZIDA 3RSLA 1FFCA 1WCIA 1HFEL 1YULA 1Z74A 3TQCA 2GM9A 4BE9A 3OIWA 2Q3LA 3PUKA 4HHEA 3P2IA 2PKQP 4HNGA 4IWNA 3PXXA 1QIEA 5GOTA 4ZOQI 1JHDA 3MFQA 1S0UA 4F92B 4JYZA 1MB0A 1UZNA 2ARKA 3LX6A 4MW2A 5KNCA 1B76A 2WM2A 4EIWA 3U9TA 2HU7A 3PNKA 5HIAA 3V4RA 1G9TA 1T9BA 5CIWA 1KI6A 1X7XB 3F49S 4Z7OB 2ZIEA 4NULA 1ZAYA 3ER6A 2GN6A 1GKYA 2OHHA 2Z0MA 3IQGX 3JYPA 1UMDA 5C4MA 4KTVE 3AESA 5DM4A 5KTOA 4E5MA 4ZQEA 4GL2A 3OZGA 6ADHA 4BWVA 5J47A 1RJFA 4D44A 3CV3A 4K1LA 1R00A 3HUEA 2J3IA 3DR5A 3PFCA 1R88A 4U6NA 3EQ7A 3VVMA 3AQIA 3RB8A 5EKXA 3CO0S 3FYUB 2XB4A 4OBBA 2CKMA 2HU5A 3QF4A 2P9ZA 4K6HA 1E0KA 1L7QA 2PQ2A 4P7FA 4NQZA 3KWJA 4LZNA 2D54A 3WMWA 3W2FA 3LWNA 3R7DA 4QLBA 3OG9A 2FKNA 5ARCA 5LU9A 1IUNA 1TEXA 2V59A 1GNSA 4NVRA 2VRBA 4C7BA 4OHWA 4YT2A 5AHOA 5A62A 4RF2A 4OQDA 2J3EA 3WBJA 3KFVA 4QYXA 3TDMA 1SZJG 2XYRA 4NEQA 1AF7A 4HNAB 1V96A 1G66A 1PVVA 2IDKA 3IHLA 4CLHA 2JCXA 3Q3IA 1ZAKA 4RZUA 2O0JA 3PHJA 3D3WB 4G9BA 2C0QA 1U2DC 4IIHA 4NCHA 3VC7A 3WWDA 1EDOA 4ZZ0A 2FSFA 3MC1A 3GXOA 1AXRA 4YAFA 4B9EA 1DUSA 1MMFB 1R5NA 2ZSUA 1N0WA 3B1JA 1EXDA 1SXJC 2ECOA 4BE4A 5FDFA 5GONB 2IYXA 1AKVA 5JD4A 3H9JA 3TJMA 2I76A 1B6SA 3TQTA 5INTA 2WU8A 4HS4A 4H6XA 5G3YA 4BUZA 1GQYA 5JAOA 4HLCA 1MC8A 1PF7E 4D8XA 4ZJYA 1KBOA 3RTAA 1LBIA 3MCVA 1HMPA 3FVVA 3SR3A 4D8WA 1YQEA 2ZE5A 1FFEA 1QBKC 2J0VA 1L5MA 4R1OA 2ZRJA 3SQDA 3PJFA 4NG5A 1T0IA 4TMTA 3WQSB 1DRWA 1YIDA 4R41A 3H4IA 2ENUA 2ZWAA 1Y3HA 3A6KA 3HWRA 5HKLA 1PG5A 1RHMA 1AGXA 4XTRA 4REQB 2NUBA 3C5VA 4DARA 3HWWA 5KOIA 2H08A 2CV1A 1R9NA 5H1YA 4BNDB 5HOQA 1EA7A 4LCEA 4ZVKA 5CGZA 1CFJA 1QS0B 3MCTA 5B55A 3F46A 2AJBA 2JCYA 3B1VA 4CKCB 4G1MB 2GPYA 1VTKA 4QU9A 4Z9YA 1FS4A 2NUAB 3JQ9A 4QYMA 3NM5A 4YRMA 1QONA 3CLTD 4IOLA 3RFXA 3ZI4A 2WR8A 2HBRA 4TLCA 1AUVA 5FOUA 4MV3A 5P8WA 1XZ8A 2VA8A 4QBKA 2IHTA 1XAJA 4BTVA 5AICA 4QOEA 4F3YA 4HAUA 5CH5A 4X6UA 1IUPA 5M7EA 1N2IA 2X0NA 2I87A 3SWWA 1L4NA 3E27A 2DB3A 5IKXA 2ACEA 1NVBA 3Q7SA 2H2WA 1E94E 3A3OA 4LSGA 6YASA 3AVXA 1SVIA 3Q3JB 1UZAA 2GZ3A 4JR0A 1Y5IA 4EWLA 3UJPA 1RZUA 3FSGA 1QIIA 1FYVA 1Z29A 2H2HA 1OAOA 3QVLA 2FP4A 3ZDRA 4I14A 2VZLA 1SR8A 4J9UE 4UE3S 5JSZA 1WMSA 2AK2A 3O94A 1C3XA 2IOQA 1BJTA 4GYKA 4I4IA 4QD3A 3W6OA 4TT8A 1R6UA 1Q12A 2PWPA 4JT2A 4P3PA 3PI6A 3CNLA 1N0IA 3R5HA 1N6IA 2VSFA 3BDVA 4BNJA 2B8JA 2XNSA 5AHKA 3ST7A 4XIGS 7REQB 3WRVA 1PDVA 2OESA 1DFHA 4B75A 1TZKA 2QD2A 1NN5A 3SBOA 1BMTA 1XELA 4F97A 5I7VA 2LUOA 4DBLE 3BMOB 3E8MA 2V0CA 4MQEA 1FP4A 1H8ED 1Z6GA 3RIGA 1SQ0A 3ZZNA 5GMOA 4Q00A 5F3WB 3VPBA 4PSVA 5C8XA 1BHQ1 1JFFA 1W85B 2GXSA 3INNA 4NYJR 4QTUB 4F3RA 1NSTA 1BYUA 1WS6A 1I1NA 1XEAA 3JQDA 3ITEA 3QFHA 4R2JA 2PA3A 1XVTA 1TM1E 4WLNA 1PW5A 5ALQA 4K86A 4DCTA 3F8WA 1EUCA 1DVRA 5GM2A 2R86A 4PY2A 4ZU3A 1L4KA 4XVUA 5SZHB 1WXGA 5G1PA 4DNPA 1VBNA 3A4MA 4IHJB 3WY9A 1Z9BA 5AVXA 1SHKA 3PNOA 4BNLA 2XSZA 1VHDA 2DOKA 4RF3A 4JIGA 3KYDA 2W6CX 3TXAA 4E5PA 1IBLB 3I9JA 3QNMA 3K9QO 5E8RA 5BWMA 3VO8A 4QOGA 1CS4C 3S7TA 3QI7A 1OX6A 3NPAA 3LKDA 3O93A 1G8PA 2B3DA 1Z5UA 4FEAA 1BXRB 2EC5A 2MJLA 2E89A 4DUGA 4BQEA 1SCNE 4OHVA 3UV7A 2LV8A 1Z6TA 1VL8A 3DGEC 4RXTA 3HHEA 2WG1A 3OE7A 5EZYB 1Z17A 3WLPA 2O8DB 5LYJF 4ZOBA 3S7ZA 1OTYA 2BHNA 5A1JA 1TZBA 3EPKA 1O6CA 4XR4A 4L16A 2C7QA 2Q1TA 2DR2A 1ZNWA 3FVWA 5EHZA 4M0LA 2IBTA 5B6IA 1CERA 4UUNA 3DLAA 3GQBB 3VHQA 1QYWA 4O2LA 3O8OB 4WA8A 3GFQA 2NVBA 2W6ID 5JS6A 3R9XB 1NQOA 1BMFA 2CF6A 2NYRA 3AXSA 2VF5X 2QL5A 4B34A 3EG9A 4YPVA 1U7UA 3AEZA 2V55B 3CW8X 1WSBA 5CP8A 2ZIVB 4Q19A 3KKMA 3WLTA 5KYXA 3PV0A 4FGLA 3H7IA 4OU5A 3NHSA 1HY3A 3TQSA 1TTPB 3ZWWA 4B6JA 5LP1A 3BJRA 3CWQA 4OP3A 3L1JA 1G3QA 5FI0B 1KKLA 2A59A 3HV2A 5H16A 1MOZA 2P4HX 2ZRQA 3S99A 2QTFA 3AG5A 4RO0A 2PGIA 3VI4B 3C98A 2HYIC 4U02A 4OIMA 4X1KB 1P7YA 4ETNA 1ND5A 4B2PA 2Q4EA 3H0EA 4ZVPA 1E8NA 5SY6A 2G71A 2NP6A 4N65A 2PUTA 3SDBA 4MLDA 1C1DB 3CZAA 4R05A 2F17A 4CM8A 5LQDA 1ORRA 5FT9A 1CJMA 3GB9A 2FLKA 1DSSG 3LUDA 3I12A 4RE6A 4ZMRA 4PG5A 4HQFA 1KJYA 3AEQB 2O3SA 3S8EA 2PX2A 3BL5A 1ZH2A 3NTUA 4KUHA 4UAGA 4CCSA 3K0FB 3U44A 2P77A 2XCIA 1K1EA 2WKRA 3I6IA 2Q50A 3PNVA 1Y7HA 3UJCA 1Z08A 1RJDA 4EHFA 2CEKA 2V5UA 1GFWA 4UUMA 1JYSA 3K1YA 4UHBA 3TIIA 1U1DA 1QZTA 3EDYA 4U7HA 1K8YB 1T4DA 3D8TA 1LK0A 1W87A 1R66A 5CM9C 1SVNA 2JI9A 3RC1A 3U3XA 5JI2E 3T1OA 1PHPA 3K73O 3PE4A 2Y67A 4O3FA 3P0EA 4XXHA 5EIXA 1F38A 4HX2A 2A9QA 4V3BA 3A6PC 3B82A 4LF7B 2XY4A 2G70A 2MINB 5JBQA 1DG3A 4W9RA 4UTZA 1FTNA 5H68A 5LUAA 1NQ5A 1FW8A 3H6HA 3KUUA 3W05A 5K0JA 2G4CA 2W93A 4HGNA 4MWSA 2AXQA 2AMVA 3DNMA 2WFMA 3M4XA 3QF4B 4BAGA 4B3FX 4K28A 3VPFA 3IL2A 7AT1A 1EJ6A 1U9ZA 3ORRA 4G1UC 3ZXYA 4OI0A 1PNRA 2IEGA 3MQFA 2C9ZA 2Y1KA 1DT5A 1YO6A 3MTJA 4JA2A 4KGDA 3W5BA 3AF2A 5WRFA 3IAS6 1B8PA 1OIWA 2KM1A 1D0SA 3MAGA 4D25A 3LF1A 1SKQA 3LT4A 5TNXA 4WCFB 1GDDA 3C3YA 3D4LA 2V0NA 3IOEA 4CEHB 1PYOA 2IYLD 2ERYA 3S68A 1I4WA 1OE0A 3JALA 1UBCA 1TMOA 2AE1A 1FLAA 1UBOS 2PXHA 4LZZA 3AM5A 5E3HA 4E7OA 3IA7A 4IDEA 2P35A 3GG9A 5JZ9A 1VZ3A 4CU5A 5KNDH 5AUOB 1UJ4A 1AT1A 3RC2A 3GLHE 3I8XA 3JD4A 1IN1A 4Q4JA 4W82A 1OBFO 4GOJA 4HLUC 2JLWA 3TLBA 2GEJA 1FDTA 4CGZA 4TXMA 3VO9A 4EO4A 4MUHA 2YCBA 1I7PA 4QOFA 5CD1A 3A3PA 4DUPA 1QSGA 1PUJA 1I13A 1RPAA 4EX7A 5EXEA 2I2DA 1TM5E 1FU7A 2Y77A 4MTCA 4F8EA 1F8YA 1NVDA 3MBKA 5ENZA 1GAJA 4IDAA 3U0BA 4F06A 3SYLA 3HB1A 1T2VA 5ALOA 3NAMA 1GGHA 4QREA 3WNCA 4OB8A 1K5DA 1QIHA 1SRRA 4RLFA 2AN5A 1C30B 2KB0A 3RDPA 1KEZA 3F73A 1TRHA 1RWPA 3FN4A 1T24A 2VLBA 1N5LA 2PJRA 4RKRA 5H02A 5KWJA 3RWOA 3AKZA 2WIDA 1R0LA 2XUFA 3G2HA 3U4GA 2AQIA 5HCUA 2AF3C 5K6AC 3GCGA 3SMVA 4OH1A 4MEAA 5LOVB 5KTTA 4MKXA 2BR3A 2AG8A 3CNOA 3RVJA 4O2AF 1ZICA 3QOFA 3ORSA 2DUJA 5IJZA 1QQAA 2GN8A 2XX3A 1QK4A 3MS7A 5FBRB 2BHSA 2OV2A 2V45A 1YI1A 3IUNA 3GEBA 1GHTA 3KHSA 3QQPA 5FUVA 4DIOA 1NW3A 4ZZ3A 1ID1A 5B1EA 2CXNA 1KQGA 1G21B 5ISMA 1L5LA 2ZR0A 1GSAA 3IALA 4ZVNA 3ETGA 1SU6A 1I2CA 1W19A 1QORA 3QE2A 4HZIA 2X4DA 3EFOA 3AL3A 1F8GA 1W4ZA 1C1HA 3L5OA 3V7NA 4UU1A 3K8YA 5CVCA 3OX4A 1DMSA 1VE3A 4JC8A 5AKHA 2D0OB 4BNNA 4ZHQB 4KREA 1ATIA 3LUFA 2HJ9A 1GZ7A 2J8ZA 3FYSA 3IPLA 4H2DA 5TMEA 5ES4B 4HNVA 3IH5A 3O4JA 4PGFA 2GJ4A 4LJLA 1KSGA 1LQUA 4I4TB 4JENA 3UQZA 4MCIA 2V1XA 3CZRA 1ZUIA 2P9GA 3R44A 1JU4A 3HP4A 3T38A 5AVSA 2A86A 2Y3IA 1H2ZA 5ALZA 1NVKA 3CCCA 1W44A 4G56A 3OT1B 5E2IA 2OAGA 4JL6A 1KYIA 1SXHA 1E9AA 3VH2A 1JDBB 3N0WA 2ZUFA 1VA4A 4JGIA 4KYTA 4IJWA 5J4HA 4BV3A 1GA4A 4D9IA 4ONEA 2B5WA 3R4VA 1YQQA 1T36A 2AUNA 2FN4A 4H6VA 4Q3EA 3JRXA 1UT6A 1E3IA 1SQFA 2QK4A 3IP5A 4YRJA 1Q7EA 4DMRA 5KOJB 1KMMA 1SXJE 1IJKA 1VHTA 1JFFB 5EQDA 3SPXA 3U48A 5CITA 3OWOA 5KPJA 4KLCA 1JHZA 1PLKA 1XZEA 3WWOA 1N25A 4G1VA 4CN9A 2ZB7A 3HZHA 3P96A 4FHCA 5IAKA 4DRYA 4E14A 3EVCA 2I2AA 4XAQA 4BZPA 1UC4B 3ONDA 1O7JA 1T6ZA 4GGPA 1LX6A 4LHYA 4R3NA 4XFKA 1M6HA 5L6MB 3ZV3A 1KOJA 4D9JA 4EGAA 1MOSA 1OT5A 4F38A 3HI4A 4YRDA 3CLKA 2A0UA 4RY9A 4U4AA 4BX2A 1FY2A 1GZHB 3KAKA 4FYWA 3KYDB 1D6JA 2WKPA 2LBPA 4WY5A 3T1TA 3H97A 4LC0A 3FWHA 2B1GA 4L22A 1GPAA 3T7AA 4DN6A 4E70A 2PT5A 1WKCA 3C7DB 4AC9A 4AY5A 5AFSA 3HR7A 2ZDHA 2VEOA 4EPXA 4Z9FA 1QFYA 1KS9A 4UOEA 4Z3OA 1PGOA 3ZVRA 3HK2A 4B80A 3A36A 3SZUA 5IKOA 5MHTA 1YC2A 2NNWB 2CFRA 3IUYA 1BGWA 3UVEA 4DR1B 1C81A 4AW9A 4Z53A 1X6VA 4IH1A 1E8MA 3HYSA 1UIRA 1BEEA 1AQLA 2OYSA 1ZK0A 1XDZA 1Z13A 3H2KA 4C2TA 4LF8B 1QPBA 3ENQA 1P9NA 3FUCA 3O73A 4YK7A 2P2DA 5D86A 3N9IA 2IXGA 2P3SA 3E2MA 3NOXA 4N6OA 1I8TA 1NXSA 2IDZA 3OX1A 1WUHS 3CNBA 2A2ZA 3CXRA 4IDCA 3NUGA 1GPH1 3GOQA 1ZOPA 3RRMA 4L8YA 5THQA 3W79A 1VC2A 5C8ZA 1QC5B 2A14A 4DR4B 2WMNB 1D4AA 2ZIAA 3QX7A 3DDWA 4FP9A 1KAOA 1NN1A 4J49A 4QXMA 4D1YA 4Z6KA 3IP9A 1SD5A 2CWWA 3QV2A 4ZYZA 1VDZA 3EEFA 3IGFA 1NXQA 2CMDA 5E7QA 4BKRA 4RPLA 2PUAA 2CFIA 4EGJA 4DWJA 3Q0EA 2C04A 2JLRA 1GUBA 2WHYA 4LNUA 1GO2A 1LPOA 1NLFA 2AJCA 2XAAA 2D8MA 2JI7A 4LX8A 4EKNB 1OZFA 3HADA 1B2LA 1P4JA 5HUQA 5JJBA 1PW7A 3DVSX 1M75A 4AZWA 4MW5A 5DW3A 2VHCA 3WSVA 2C8JA 2R8ZA 3DZDA 1TIBA 2EFYA 3OX3A 4P7BA 5EMJA 4IFEA 4KBFA 5BY2A 1W0JD 4R6WA 4XCVA 1SVMA 1IIBA 2PU7A 2O1SA 3SEQA 1NOJA 4ZDKA 1QDEA 5E3JA 2EF0A 5JLJA 3G0HA 1JQAA 1X8LA 2Q6LA 3MS2A 1SEPA 2X9LA 4QOSA 3TB4A 3U44B 4P3NA 3L8GA 5KVVA 1H22A 4AJIA 4X7MA 3TNFA 3OPNA 1QZUA 5ITSA 3WAGA 1T5DX 4G0PA 4GOMD 2XZPA 3IBYA 4D9FA 5JJ5A 2FWAA 3GFOA 2YIVX 4F9FA 3OLQA 2YHUA 3RARA 4XW2A 2XCOA 3NM6B 2GILA 4O2RA 1K5PA 2MU1A 2QA5A 3BIFA 4WKNA 2DZDA 2GYUA 1NM5A 4OA5A 1STOA 4JJKA 1DAPA 4FTWA 4NE9A 2FMTA 1N8TA 4O0MA 4NOMA 4POAA 3V2IA 4UC0A 2I3GA 2Z98A 4N41A 5IN5A 3EN0A 2FR1A 4DRXA 1JQKA 1N2XA 5A2QA 4WZ6A 3CCFA 1DADA 1NLMA 3G9UA 3QLVC 1QHGA 1INLA 1OV4A 2QTRA 1ES9A 1JHXA 1JEDA 1YJXA 3H2YA 5AI6A 3DH0A 3M49A 4WZBE 5A0FA 4YYZA 5IT9A 4OYYA 5AXDA 1U8AA 1JWLA 3DEKA 3L0BA 2Q2OA 3E9MA 3ENNA 2EIXA 1KJZA 2NV2B 2HQOA 3DDZX 3OQJA 5GIOE 2JFWA 2ZTHA 1QH1A 4LYAA 1B16A 1DOAA 2NU9A 1XA3A 4O5AA 4RVHA 4DABA 3BJMA 2GN9A 4BNTA 4FYIA 3BSFA 5ESRA 1NKVA 1K3FA 1RYZA 4HXGA 4PX2A 4QICA 2YN2A 1LBTA 5FIUA 5FOVA 3GLFA 16PKA 4ZI7F 1GFIA 2HMUA 1DX6A 5ANRB 4PPFA 1TT5B 4HYYA 4G23A 2HBQA 4L0CA 4RD1A 2N42A 2EJCA 1XNHA 3P1JA 4LRXA 1VCIA 1ZK1A 4HRVA 5KREA 3R20A 5IZCA 3CLTC 1QV6A 3MJRA 5JBNA 1DKRA 4EYEA 5LWHA 2GWRA 3IMCA 1E5XA 2IKQA 2BD0A 1U3UA 2IXDA 1RADA 1DJQA 1NBEA 4RDCA 2G1JA 1YDMA 3RIMA 1CLEA 4MPJA 1UINA 1FYFA 4YLGA 2C00A 2NT4A 3TM5A 1OX5A 1J06A 3DT8A 3WO0A 5K3CA 1MX9A 3NBUA 4HAXA 4TTRA 1N2CA 2QV7A 1DO2A 3FKJA 2VDUE 3CVUA 3PQ5A 1W0KA 2VQDA 1U1CA 2I2BA 3BBPA 3LVRE 5FUXA 2R48A 1BWPA 1PFYA 4QVGA 4R2MA 1KAHA 2I2WA 2Q2QA 3RKRA 1JU9A 3IOBA 1B6GA 4MO2A 5A6SA 3C8DA 3HM2A 1AV6A 1U31A 5EMHA 4OL9A 2ZDQA 2FEAA 1EXVA 1RLUA 5CLHA 4B7ZA 1JQ3A 1VGQA 2MR6A 4MA4A 1FJGB 4DJJA 4U8GA 4L57A 2RAUA 3CUWA 2GS9A 3OU6A 1RAAA 4OHKA 1CS0B 2A9PA 3T54A 1J5EB 4PO9A 4AYTA 3LKVA 2HRZA 3C7AA 2PWYA 1NJFA 2HA7A 4AUEA 1G4UR 2TSYB 2PMKA 5C8DA 1RIFA 1V5FA 2Z4RA 4G5RA 5HZGA 4CKWB 2Z4TA 3GNQA 4YALA 4AO7A 5GINE 3VPAA 1F3LA 3ZWAA 4IH9A 5JC1A 5EEGA 2Q6VA 1YK0A 1IHPA 5I3CA 3LDUA 3IUJA 1TM7E 3P9QA 1D3AA 4J0FA 3FF4A 3F8TA 4R2KA 3WWEA 1HL3A 1G42A 3PGLA 4EFDA 1UL1X 4YJDA 3V2HA 2WTNA 1CXZA 2AJTA 1WNTA 4RWEA 1WB5A 2D0PB 3L3BA 1KYWA 4RXUA 2O0LA 1ISJA 1PSZA 2CXTA 2RIRA 3BXOA 4UCXA 4DY4A 1W76A 1GZ3A 1EWRA 2G5TA 2YXLA 4YUZA 2BR4A 3NTVA 3UOGA 1Q0RA 4QUBA 1U8YA 4Q1VA 3TSOA 1MJHA 3UGQA 2V7TA 3GJQA 4J0KA 1K8QA 2ODBA 3RBXA 4R1UA 1IQRA 2O23A 2P27A 1JILA 2Q9BA 3KUDA 2EQAA 4JGGA 4R7ZA 4DILA 4F1JA 5LVAA 4GM1A 2X9GA 2GAJA 3E8SA 1A72A 2AWNA 4I4LA 3WKCA 3OFKA 4HDRB 3P94A 1SUFA 4YRFA 5CAEA 4HATA 3THWA 1H1LB 1SUWA 4CEJA 3QA3E 2GDZA 4YRAA 5HWSA 1FLNA 2Q62A 4FDVA 5A3SA 3NBQA 1SC4A 3C8ZA 3QXGA 4YACA 5FOXA 2IE0A 1RM5A 4BO7A 4DDMA 3TK1A 1V3VA 4C78A 1VCHA 3WK8A 4PX5A 1P0IA 5F33A 2W2MA 4LWOA 3ZH2A 1AG9A 3L0PA 4F6CA 3KPYA 3NJ4A 4FR5A 3FYCA 4EB6A 1CUGA 1H5QA 4C22A 3EPLA 4L75A 4TLDA 1XI2A 3IAM1 2V3CC 4R31A 2Y05A 1QO7A 3FUTA 1PI3A 4GD3Q 4INAA 4EPTA 5F4ZA 1XA0A 2OEPA 3LO8A 4AX4A 1M2NA 4IZHA 4TZ6A 1ULBA 3FXAA 5I01A 5LN1A 5AUQA 1WIWA 1XTQA 2FRXA 2J30A 2ZYDA 3BAZA 3MXTA 4G4IA 4TX1A 4CLXA 3WLSA 1SOUA 1M34E 5K8LA 2R6HA 1HUQA 3QBJA 1UPCA 1VFNA 3NGXA 2RFLA 3C7KA 1EX7A 1W4BA 4MK4A 2JEYA 1Y6QA 4M98A 2GZ2A 5I9MA 4KXXA 3H5AA 2IUSA 4WN9B 4P4GA 1RLIA 4NMHA 1JXOA 2XWBF 3NCTA 5JCXA 5KKNB 3I28A 2GUGA 1ESDA 2XYPA 5I7EA 3WAJA 2WV7A 3LCVB 3NTLA 2AJLI 1GGVA 3ANTA 2BVNA 4EBFA 4Q3DA 3RG2A 5BSWA 3HPQA 3QELB 3DPUA 2H92A 2PU5A 4QASA 2ONCA 1GG5A 1P81A 2V7UA 1CRZA 4L0DA 2ZRIA 3KXIA 2PUFA 2IYSA 1OU0A 2BDTA 1R7RA 1RWVA 1SVKA 2JI4A 2Q2NA 1Y81A 3AR4A 4INZA 4WDQA 1HQKA 2DETA 4FD2A 5CU7A 1JDJA 2VJDA 4D3FA 1T91A 3GRPA 2PQ6A 4MJ7A 4KMSA 2VAPA 4TVOA 3WBKA 4DQXA 2FXVA 3H9QA 3WGIA 3IIEA 1CZOA 2VPWA 3DNFA 4H7FA 2ECQA 3R3JA 2I99A 4HQ6A 2IWHA 3ZI7A 2FK7A 1YOVB 2BJWA 3EXFA 4AKTA 1SCUA 3HYCA 2R8EA 3JAKB 3T5AA 5L9AA 4PAWA 2B1QA 4BV8A 4HDKB 1NRXA 2C9CA 4IUBS 5EP4A 4PHFA 3SS9X 4B3HA 2EX1A 1ECLA 3UMBA 1HA3A 3HCPA 5MGBA 3ETJA 3LOPA 2QZPA 2BHRA 4LDZA 2ETXA 3L04A 4M8SA 3RPEA 4CTJA 1LV7A 1CU1A 5KVSA 4YXWA 4ZEVA 1X7WB 4AKIA 2EL7A 5A0TA 4NMMA 4OK6A 2I7DA 2X58A 5KYVA 1G0NA 5I7RA 3R9WA 3ABIA 4BZXA 1UM8A 3VZDA 3ZE6A 2MOKA 2I6GA 2CVQA 4R81A 4MS3A 3MN1A 5ADUS 2ZTVA 1CULC 3HBFA 2BYTA 2HSEA 2UZ0A 1XCMA 2WIKA 2H6EA 3K8OE 3P2KA 4FT4A 1OKKD 5REQA 4KQMA 3KHUA 3NUQA 1F0YA 1Q7BA 3UF0A 2ID4A 2ZSAA 2J48A 2OO5A 2UVDA 3ISVA 4FZJA 3MGKA 1OXTA 2A7XA 1E7SA 1HG1A 4OA8A 1FTWA 1O1YA 4X8MA 3QVKA 5LB2A 4MVJM 5DGXA 5TB5A 4AURA 4YCCA 4WDRA 3PJRA 2ZJ3A 2ODEA 1CZHA 3D6HA 3EEBA 3GJRA 3GY0A 1G7TA 2IEBA 5E95A 1XQXA 1FZQA 3QE0A 4JA0A 2OSBA 3RUAA 1QO9A 3UJ7A 2RKOA 4EZIA 1QGED 4WCDA 4QM7A 1QBGA 3BIXA 1NXPA 1U4NA 3AUXA 3DTNA 4P7JA 1DCFA 4QJBA 3UAXA 1I1OA 3R3YA 5C3MA 1G6Q1 1QMPA 3CSUA 3DVQX 1RHQA 3PHGA 4CR8A 1PFQA 4OREX 1PT5A 3VDNB 3DTVA 1T1IA 4OQZA 4ZOEA 2BRUC 4QL3A 1ZL2A 1Q7TA 3Q7QA 3LSTA 5FPHA 2J7PD 5KS2A 1AKTA 3WV5A 3E7DA 4LF5B 3RC7A 5JATA 1XOIA 4NTZA 1SA0A 1Z2OX 4U9UA 4CM5A 4XARA 5HP4A 4EJ6A 1P62B 4NE7A 1WZIA 1P18A 4UXIA 4AMZA 3JY6A 3STHA 1Y5MA 1VRWA 4HH3C 3BERA 1PFKA 3RVLA 4DFDA 4DDWA 1IM8A 2QY9A 1L7DA 3KEMA 2R4TA 3KEFA 3ZZTA 2QBYA 3HLKA 4GEGA 5DB4A 5DEIA 2WFAA 4INOA 3WNQA 3F6SA 1I1QB 3E7FA 2E48A 3LXMA 3MTGA 1PJZA 3LL4A 1KPHA 1SBZA 1GEEA 1V11A 3T3MB 4U7WA 4QZVA 4W7SA 5JARA 3AF4A 3DLCA 3GLFB 1W5TA 3LT1A 3T7EA 4F5ZA 2XMGA 3WICA 3LHKA 1C0IA 2CFTA 2QRHA 4B7AA 4Z2AA 5C80A 5FA5A 2R2GA 4ZA2A 2BF4A 5H80A 4G84A 5ALVA 3Q1KA 3GLHA 5J4KA 2JLXA</