3NV7A

Crystal structure of h.pylori phosphopantetheine adenylyltransferase mutant i4v/n76y
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
KVGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMIQLATKSFKNVECVAFEGLLAYLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPLISKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of H.pylori phosphopantetheine adenylyltransferase mutant I4V/N76Y
rcsb
source organism Helicobacter pylori
total genus 41
structure length 155
sequence length 155
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nv7A00
1H3NA 2CYCA 3CLRC 3GMIA 1KH2A 1IFXA 1VBKA 4MW0A 5DB4A 4MVCA 4DDKA 1OWMA 4EG6A 1TEZA 5BNZA 1GZUA 1QU3A 1NSYA 2CFOA 3ISJA 2B7LA 2PXHA 3FWKA 2ZUFA 4EFKA 3IOEA 1NI5A 1R6TA 1TQ8A 1U3CA 3TZLA 1ZH6A 4HK4A 1IQ0A 1N75A 4ZCPA 4I6EA 3ZJUA 3INNA 3HZRA 3P0HA 3P0JA 3FDXA 1N3LA 2DPLA 2A84A 1PFWA 4MQ6A 1N2BA 2DEUA 1OWNA 3SDBA 5DEOA 1EFVB 1JIKA 4YMIA 4Q93A 4L2IA 3TZEA 2BYTA 4U63A 1O94C 1EFPB 3ZXIA 3ELBA 1K4KA 3IMGA 3LOQA 3CVWA 1MOPA 1O97D 3CLUD 3N2YA 4MUJA 3QTTA 2CYAA 5LFAA 3RHSA 1GAXA 1Q77A 3ND7A 4DDHA 4MUHA 3P52A 4KPUA 1XNJA 3G59A 3SYTA 3CLSC 1TYCA 1XNHA 4G5YA 4E1AA 4EG7A 1GTRA 4HJXA 2VTBB 1FYDA 2DR2A 5TGTA 1X6VA 4QBTA 2D13A 2J07A 2YWBA 4OUDA 1I2DA 1G8FA 1NUQA 3GUZA 2HZ7A 1JHDA 4TS1A 4S1OA 5HUJA 3ZIUA 4HJRA 2BTEA 2C5SA 3RK1A 3CA8A 1OBCA 4MW2A 3A4IA 5IJXA 1H1TA 3PNYA 1O0BA 3D6UA 3NV7A 3PXUA 3X1JA 5KCMA 1N78A 4MW7A 4ZT5A 1PFYA 4HPWA 1T9GR 3C8ZA 4MUEA 5J59A 4CDMA 3UMVA 2PZAA 1N1DA 5JBNA 3UOWA 4I6GA 4YP6A 1N2HA 5H16A 4MW1A 4Q16A 3L92A 3HL4A 2X1MA 1M8GA 1KKUA 1OWLA 1TYBE 3FNRA 2HGZA 1GTSA 2QTRA 1M8PA 1V47A 2NZ2A 2Z09A 4RPIA 4K0RA 1IQRA 5DASA 4XFJA 2OQ2A 1G8HA 1G59A 2QUHA 1D2RA 3LCJA 2A1UB 4MVWA 2CV2A 5F23A 3ZUGA 4ZCSA 1J20A 3CR8A 1NZJA 2Z3VA 4F3RA 1ZH0A 2PZ8A 3HV0A 2X1LA 1WQ4A 3AG5A 1JMVA 1R6UA 4J75A 3H9CA 5K0TA 3SP1A 1YI8A 2DXIA 1J1UA 1O95C 3FH0A 4RUKA 3E27A 3D6VA 1N2IA 1MAUA 3IUBA 2Z08A 2A86A 3TQIA 3IMEA 1GPMA 4A91A 4MVYA 2WSIA 1EFVA 3MLAA 4ARCA 3L93A 4AQ7A 1NUSA 1EFPA 1J1ZA 2D5BA 1WOYA 1NYLA 3G6KA 4JXZA 5K0SA 1XNGA 1IVSA 2D54A 1JILA 4CQNA 2G36A 1MRZA 2O8VA 3Q12A 3TQOA 2A88A 1T6ZA 2NSYA 3QTBA 4EG8A 1PG0A 4PBRA 1M1ZA 1OBHA 2HMAA 2YY5A 3KT3A 2RE8A 2WQ7A 1VLHA 1WQ3A 2PIDA 3LE8A 1NUTA 1I6KA 3PNVA 1KQPA 1M8JA 1WY5A 4MUFA 3FHJA 4QRDA 2JAXA 1Q19A 4DDMA 2PZBA 3DLAA 3NBKA 3FETA 1MJHA 1G8GA 1H3FA 3DV2A 1IQUA 1YUNA 4MWEA 1TYDE 3AFHA 3A05A 3U1VA 4ARIA 1NUPA 4ZT2A 4GRIA 1KH3A 3VGJA 1QRUA 1NURA 3ILVA 1EUQA 1F7UA 2H29A 3DPIA 5H7XA 1KQNA 2DETA 3X1MA 1O96B 2YWCA 2CT8A 1WXIA 1YUMA 3FG9A 3UK2A 4QREA 1WXGA 3KT6A 1QRSA 4MVXA 3N8HA 2A1UA 1ZUNA 3CLTD 3HGMA 4UZFA 4MUKA 3CVVA 1F4LA 4ZT6A 1U3DA 1KP3A 4ZCRA 1MB2A 2A1TR 1K97A 1PFUA 1X8XA 5FO0A 2CSXA 1F9AA 3N9IA 1YIAA 1EE1A 1ILEA 1T6YA 4EG5A 2EJCA 3ZXSA 4ND7A 2WQ6A 1QNFA 2H2AA 3AL0C 3S3TA 1QQTA 4X0EA 1LI7A 1VBNA 3F3MA 4FZJA 5TEWA 1KH1A 3CVYA 2ZUEA 3MLBA 4ZT3A 4AS1A 1H3EA 1N2GA 1JZSA 1YULA 1GN8A 5IHXA 3TNJA 1N2EA 2J5BA 1S4MA 3IMCA 1KQOA 1KR2A 2XRYA 1NP7A 5FO1A 3ND5A 2DERA 4MUNA 4KKVA 1T9GS 4MLPA 2JANA 1KAQA 1YIDA 3TS1A 4MW6A 4U8HA 1B6TA 3I05A 3AKZA 3SEQA 4MULA 4CT0A 3DO8A 4PBSA 4OJMX 5J58A 1FFYA 4K03A 4YP7A 1OD6A 1N2JA 2QUIA 4MUIA 1O97C 3CLUC 1HYBA 3H99A 1A8HA 1EJ2A 3NBAA 1EUYA 1WXEA 1VL2A 1XJQA 3FY4A 1WXHA 1U7XA 1QU2A 4OUDB 3MMXA 5KHAA 3COVA 2CUZA 2J08A 1Y42X 4MW9A 1O0CA 2DUMA 3COWA 1EXDA 2E0IA 1WXFA 4UZEA 3CLSD 1U7DA 4R0NA 4MWDA 3N05A 5HG0A 2E21A 2V0GA 3Q4GA 3SZ3A 4KR6A 3ZGZA 3UC5A 2CV0A 4P2BA 2IJGX 1WKBA 1J70A 2VTBA 1MB9A 2AZXA 2WB2A 1SURA 4NDAA 2O5RA 4R2MA 3BL5A 3VU8A 4JZYA 1N77A 1MBZA 3KT8A 2R5WA 3KFLA 4CDNA 1J09A 2XRZA 3H05A 1T6XA 1O5TA 2CYBA 4WNYA 5KWVA 1IH8A 1J21A 3AG6A 4PBTA 4DNXA 4MW4A 3IDFA 2RD2A 1PG2A 1N2OA 4MUGA 3IODA 1QJCA 5TS2A 2OV4A 5AHWA 2GOYA 3FI0A 3HFJA 4EG3A 1TYAE 4G5FA 3A04A 2ZP1A 3Q10A 3IOBA 3A2KA 1BS2A 3OTWA 4KR9A 1JECA 1WJGA 1JEDA 4NZPA 3CVUA 2QJTA 1QTQA 1OWPA 1P7PA 3RBAA 2IELA 3IVCA 4JFAA 3X1KA 1MAWA 4JYZA 3ZJTA 3VRHA 2VXOA 3COYA 3KT0A 2E89A 2J4DA 1DNPA 4R2LA 1GLNA 1I6MA 1MC1A 4DE5A 4U7JA 5TEVA 4JXXA 1IHOA 1O95D 1KP2A 1IRXA 3IVGA 4ZT7A 3MXTA 4H3SA 5LLTA 5EKDA 4EGAA 1M8FA 2QUKA 1Q15A 3MUEA 1COZA 3ZJVA 1KORA 4ZT4A 4NX2A 2PG3A 1JEEA 4MAFA 1I6LA 4ND6A 1K4MA 1ULHA 2JA2A 3CLRD 3K32A 3QE4A 4NAUA 4XSVA 4BWVA 1PFVA 1V8FA 3COZA 2E18A 3IVXA 3SZGA 4EF6A 2A1TS 2V0CA 3PRHA 4F4HA 4YP5A 3RFFA 2EL7A 4J76A 2QTMA 3JXEA 1QRTA 2QJOA 2YXNA 5FNZA 1ZJWA 3IH5A 4L2IB 2A4MA 2X3FA 2A7XA 4MW5A 3G5AA 3AIIA 4G6ZA 4XFDA 4YBRA 3P0IA 1K92A 4NATA 3RJZA 1Q11A 4MWCA 4PY2A 4DJAA 4EG1A 4KPUB 1LW7A 3FOCA 4I6JA 2AG6A 3UY4A 1VBMA 3M5WA 1R6XA 5LM3A 1O94D 5HUHA 1JGTA 3GLVA 1LI5A 2IP1A 4WSOA 4GU5A 3FIUA 3H9BA 4MWBA 5J5AA 1JIIA 3PNBA 2PFSA 1M8KA 1WZ2A 1JIJA 4ZCTA 1TFUA 1F7VA 3CLTC 2TS1A 4DLPA 4NAHA 2X0KA 2I1LA 3OP1A 4KR7A 1O6BA 2DLCX 1CT9A 1RQGA 2AKEA 3IUEA 3H97A 2QUJA 1O96A 2QTNA 3RK0A 1M83A 1JZQA 1NUUA 3IOCA 1UFVA 2GKSA 5DK4A 3SEZA 1KAMA 2GM3A 4ZCQA 3CVXA 1U0BB 2J09A 2CV1A 1OWOA 3HMQA 2QJFA 3K9WA 4EG4A 3ND6A
chains in the Genus database with same CATH superfamily
2CYCA 2WFLA 3L8FA 2EDAA 2FJ0A 4F4UA 2IUEA 2PS3A 4FFSA 1DUVG 4BZPA 4YXFA 3CZPA 1KVSA 3KUKA 4FGSA 5EQFA 2VJYA 5LBUA 4KAAA 4AZVA 4CL3A 1ZIOA 2Y6UA 4IILA 3B52X 3CWQA 5GMOA 1KI6B 2OBMA 4DMMA 3H11B 2FK8A 1D1PA 4GSLA 1NGSA 3PDWA 1V26A 2ZBFA 2V4UA 3M8KA 2XGOA 2ZRAA 8ATCA 3AOGA 2N46A 2BFCB 4PQEA 3ESYA 4IMRA 4WACA 3QNMA 1KZ1A 4I6EA 4LKRA 3RIEA 1ZOSA 2ST1A 1WBDA 1JHZA 2WM8A 3RU7A 5CFOA 1XI2A 3VOAA 3PXAA 1AN0A 2DRIA 1D2AA 4C7VA 2FWMX 1HGXA 3KRTA 3L18A 5SZHB 4ZO9A 4ZZ2A 4F9EA 4AN4A 4CEIB 4V1CA 5JG7A 4CM8B 4DXAA 2QMOA 4C6SA 3GHYA 3VC2A 4RY0A 2C2ZA 4KNVA 4YRAA 1IUOA 4G1BA 4M36A 2UZAA 3DDOA 3R3YA 3DVSX 2WUEA 3I6QA 1XEWY 1N25A 2CD9A 2PS0A 3C1UA 3VPXA 4GKBA 2Y92A 4H7JA 4OI4A 1HDYA 1K2WA 2Q0HA 4G2TA 5FBWB 3ELBA 4GBED 3R8CA 1DJLA 3DLBA 1UPXA 5TGZA 4XIIA 2YFYA 2RGEA 2CYAA 4MRAA 3ED5A 2QL5A 3IT0A 2W83A 4R8VA 2R6HA 4CXMA 3OOYA 3UUFA 4DA4A 4IS3A 4F85A 3DFZA 1E89A 2YXDA 4KK4A 2WJGA 3WKDA 1XNHA 1SPXA 4A8HA 3C14C 5BV2P 3L41A 2VDLB 1UT8A 3PFIA 2WJVA 1C3XA 3QLEA 1ICIA 2HA7A 5AUQA 1C1YA 2H1FA 4KUHA 1J06A 2AC7A 3DV9A 1LUAA 2PS1A 3QP9A 2RHCA 3VJMA 3TX6A 4DB4A 1RZRA 3FW1A 5KNCH 4RTSA 1KBZA 2QU7A 4B48A 2PMBA 4EF5A 2EATA 2B25A 3HKDA 5AKZA 2QY9A 4A26A 1NLFA 5F3RA 1DX6A 2QI9C 1GNQA 2WD9A 3F96A 3FBTA 4GPTA 1HFWA 4JOBA 1WZEA 4XUCA 4PZCA 3NS7A 1JG1A 3U39A 3CCCA 1TT5A 2PZLA 3NV7A 3OMXA 3AJAA 3GRVA 3OIUA 4Q9JA 5CB4B 3KSDO 3K0AB 4L51A 5HZMA 1YNSA 5IJWA 5L3SB 4QQRA 3EAQA 5JMPA 1TC1A 4MW7A 3VTKA 4YCSA 2GASA 1X42A 3D6FA 4DNQA 2AZ4A 4CU2A 3IT1A 3U9TA 3MT9A 5JBNA 4PX2A 4YP6A 1PT8A 2JCXA 5CVJA 3HL4A 2DWOA 4I5EA 5KSOA 1M8GA 4BV9A 3RVQA 2YC2C 4Q6WA 3CPJB 3FIJA 3FNRA 4NL4H 3LYUA 5F51A 3N8IA 3R9KA 3O38A 3V2IA 2PMCA 3QE9Y 4MS4B 1W9HA 5E4JA 4KRXA 1CB7A 3U13A 5JPDA 3QMPA 2IS4A 2A9KA 1YCGA 3MLEA 4QDOA 4PGHA 5KHOC 1G59A 3T0IA 1ECFA 2NXNA 3KUUA 1UC9A 4I7EA 1FP4B 2MDTA 1CEXA 1ZIPA 2ZJ3A 4R1NA 5EZQA 1BFKA 4Z8YA 1G5PA 6CHYA 4MCAA 1M6NA 1NRIA 3S2YA 4DWVA 1ESNA 4QGFA 3N1UA 1CDZA 3WDSA 2ZYRA 3JZFA 3TO5A 4D26A 4F4DA 4PRZA 3G2OA 1J90A 2J9XB 3PNOA 3DXXA 2Z98A 1PYOA 1Y9DA 4FS3A 2ZANA 4LK2A 1G19A 2I6XA 2AOWA 2QNIA 2BFBA 1BAPA 4A8JB 4BVJA 4DC0A 3RS7A 2YWRA 1E2DA 2XF8A 1CULC 5EFZA 1YJAA 5KAMA 2HN9A 3RYHA 3UMRA 1YDHA 2H1RA 3IUBA 3VPCA 3V8VA 4LDNA 5LQRA 1XNRB 3GDWA 1ZRSA 1A0OA 5LA6A 2QL9A 3C0KA 4RE5A 3LWDA 3VUFA 3KSBC 5JYCA 4GAEA 4JQSA 3R23A 1J1ZA 3WYEA 2QTCA 3BL6A 3G6KA 1RJDA 4E1VA 1WMEA 2XI4A 3K1TA 2C4NA 4PC3A 1RPTA 1NN3A 4BS9A 3OTOB 3PE6A 3W8NA 3WOVA 4E2YA 4EHAA 3GLKA 2FLVA 2SBTA 2W9XA 3E3AA 4KO1S 4XYBA 1GDHA 4WFIA 3GJYA 5D3KA 5CD9A 1XYGA 4XQ9A 4H60A 4PSDA 2C9ZA 2PRSA 4K86A 5ADWA 2SKDA 2APJA 4JR0A 3TYXA 1ZA1A 3WIOA 1M1ZA 2WNIA 3WZMA 5AM2A 4KITB 1K9SA 1LWOA 2X77A 1J0EA 4UD6A 5LYJF 4UBLA 3TRHA 1Z6QA 4OSOA 5AW2A 5BUCA 3C41J 2GLTA 2VHYA 2ZCJA 1VSTA 3FN4A 4P31A 3RLFA 3KEFA 3REGA 1E6CA 2HRDA 1J33A 3DB1A 3IEIA 4LE1A 4Q6BA 3VOTA 1XPJA 3WA6A 3RYCB 3FHJA 2JGIA 1P2SA 4M89A 1X8JA 1WDTA 3GRPA 4YRRA 1Y9ZA 1G2IA 2R62A 4ZKEA 3ZDQA 3EGDB 1KQGA 4IDEA 3P9RA 4J0GA 5CHEA 1HSZA 3HDQA 4TWRA 1A50B 1V8ZA 3C87A 4G0QA 5C46F 5AYVA 3ML1A 3I1JA 4OYLA 1G6KA 1Z2PX 1BDBA 4CM1A 1NASA 5G02A 3VZCA 4A92A 3NWPA 4FYJA 3FNHA 3H2YA 4KWIA 3VX4A 3KS9A 3G17A 3TAHA 3IR7A 3O92A 4WY8A 2O50A 3EXFA 4R1LA 5I9SA 3A3PA 4BO5A 4BWGA 5AVJA 3SR0A 3X1MA 2FE1A 4QUHA 1IZ7A 4IF4A 2BEJA 4U8GA 5EQDA 1N34B 3LQKA 5CH3A 3I04A 4ZGWA 3DKKA 4K6GA 5SYMA 3SYNA 1AK2A 1AF4A 1SVNA 3SR3A 4RKYA 1T8SA 2JIRA 1H4VB 1YZQA 2ONCA 1QIKA 4MI6A 1HI9A 5ILOA 4O4IF 2RGRA 5HIAA 2FPMA 1DL5A 1QANA 1ZINA 1GLVA 1O8CA 2PVPA 1HNZB 4JJ6A 2FW8A 3AGQA 1FOEB 2FMFA 3C98A 1T2DA 3BHJA 1F60A 3DGEC 2Q45A 1J5PA 3FPSA 4BO1A 1SBTA 1UKCA 1XU7A 1ZI9A 3CSDA 4KIJA 4L0DA 1RJFA 1GRRA 4MGYR 1TEVA 1PJ2A 1F9AA 2O9JA 3AV3A 1I1OA 1I94B 1E5LA 3WRXC 1U5BA 1QIHA 4KIUA 3SIRA 4RH1A 2QBYB 2JFPA 2TSYB 1KZHA 3RSHA 1CUHA 2ES4A 4UVIA 1T8WA 5EJMA 1I7QB 1LBSA 1U7UA 2B4RO 3KL2A 3TEFA 4I5FA 1EWTA 1PKEA 2HAEA 1EM8B 4RDIA 1N36B 3N8DA 4FFBB 1EUCA 1YNOA 4OQYA 2CNOA 5FYDA 2BEWA 1T15A 3LY9A 1HO3A 2P77A 3DQPA 3NH6A 3F49S 3OOSA 3UCXA 3NTUA 4TTRA 1DBQA 2XCTB 4D9GA 4DAOA 3NWEA 3AI1A 4L6CA 4B2YA 3G3EA 1NVGA 3PNLA 2FE4A 1C9DB 1P2GA 1YZUA 3ER8A 2PT7A 1TECE 3RS9A 1V1MA 3PUIA 3RS3A 3A8TA 1KR2A 1ECGA 2AN1A 2FPXA 2VR1A 4WRRA 5JWRA 1C1XA 1QO0A 1ZAKA 3LI2A 2ZRBA 4L76A 3KKEA 3OEED 5DBEX 2BTQB 2PFKA 2QSUA 2RJOA 4ZYYA 1AQJA 2FDRA 3R3ZA 3TVTA 4BO2A 1FLAA 4EWLA 2QRJA 1CFJA 4AWAA 3LTEA 1BN6A 2PPLA 4WZZA 5DTJA 3DBRB 2LBPA 2FU5C 1KYZA 1KZGB 3PQ4A 1IUPA 3PFKA 2O5VA 1P9WA 4GVPA 1Z8FA 4MKGA 4YP7A 1EFAA 1ZD1A 2DB3A 1Z37A 2QM8A 3DDUA 2Q6IA 2QGFA 3DOCA 3NBAA 4JA2A 4EW3A 2F90A 4EFDA 4GGOA 2VRCA 3RNLA 1M72A 5EFOA 4C03A 2OE2A 3HO6A 4MHTA 4FCWA 1U7XA 1XZHA 4R8KA 2QPAA 3RV4A 1K3TA 5HIIA 3L6RA 1Z4JA 2P9BA 1ZMRA 2GWHA 2IGTA 1IUKA 1RLUA 1SEPA 3S2GA 4ZEVA 1ZITA 2B7CA 3S6JA 1ZJ4A 3G2KA 1YB7A 1EXDA 2R4UA 3H18A 1ENZA 3DZGA 2G9RA 5DNEA 4BFYA 4J0EA 4MRMA 4DSTA 4D8VA 1KJWA 3HYTA 2CL6X 1OX4A 4POAA 5HG0A 4TZKA 2RC5A 4UDYX 1TQ2A 3WV5A 2E21A 1RBQA 4UW9A 2A5DA 2R48A 4J3FA 3NVDA 2VYND 3ZGZA 5H3HA 3TNLA 1UBSB 2ZIXA 1UXKA 4HMQA 3OQMA 1AKVA 2YJTD 4OMFG 2LIVA 2VTBA 4KREA 1U1EA 3STYA 1ZG3A 2NN3C 4HLDA 4B35A 3RREA 2IHTA 1OXTA 1CV2A 4MRNA 5B57C 3OLYA 1NX9A 1Q50A 1DFGA 1Z3CA 1L1EA 4BV2A 2J0UA 3ABSB 1D09A 2O2XA 3EOZA 3P20A 1GCOA 4W5NA 4WECA 3TSOA 5DP2A 2Y99A 2VP0A 1O54A 2OFPA 2FGKA 4LV5B 3VR6A 5E3HA 5A02A 1AD2A 4MUGA 1QJCA 1V41E 4KOEC 1KAHA 5DX1A 5GZ6A 1K5GA 2RCYA 4JU9A 3HGTA 1QYRA 1UQTA 2C8KA 2OV4A 4JI7B 2ZRQA 3EEFA 1BS9A 4E03A 5L7WA 1UMDA 2GZRA 5CXUA 2NXCA 4WN3A 4CMHA 2QRZA 1V5IA 2ZQYA 3B1JA 4MKRA 1RRGA 3GUYA 4RH0A 4OU4A 4K6CA 3TRKA 1JHVA 1GQYA 1PWEA 2RONA 1SB8A 3HDYA 3N87A 1NVTA 5IANA 4LJKA 2Q1XA 5TQ2B 3PHBE 1QTQA 1J6UA 1KXZA 1GQ2A 2JW5A 1Z0JA 2J45A 4GLBA 5HZHA 3OPXA 4H1TA 4JFAA 1ZI6A 3O90A 4K6OA 4QFMA 4CGYA 2OCBA 1O6CA 3U3ZA 1LSSA 1O57A 5F5XA 3O7MA 4DEXA 5IC4A 1IULA 4PNZA 4WNCA 3KTDA 4FHEA 1CUGA 4HQFA 2R6ZA 1V96A 4EQZA 5C81A 3QXHA 4DSOA 5E6RA 2HLHA 1ML4A 1U9IC 1LK7A 1NVFA 1RJ9A 1IRXA 1XZCA 2BF4A 2C03A 4HGQA 4ISBA 2D4HA 1GG2A 4ZIRA 3AR2A 5THQA 1WSDA 2I4IA 2N3ZA 3JYNA 3VGPA 2I2DA 3SHQA 3X1XA 3PUJA 4AUEA 3AUTA 1WDMA 5U4QA 3VFDA 2JJ1D 4WESB 2QUKA 4F21A 1TM1E 3OKAA 3ZY2A 4B4OA 1TXGA 1QM5A 3PDCA 1BOOA 1FDVA 2F9MA 2BEUB 1ES9A 3MD9A 3SLGA 3K8YA 3BMXA 2E4UA 2HU7A 2CLOB 3CW9A 2CUNA 2V8OA 4I66A 4CLOA 4XDZA 1OX5A 3SF8B 4OLJA 2Z4SA 2UUOA 3ZG6A 4CG1A 2H7CA 2VF2A 2D3WA 1PJ3A 5ALDA 1V7QA 2WJ6A 3JQFA 1BGXT 3DBLB 3PF9A 4PPGA 1UJ6A 5G0VA 4BO3A 5C1DA 3L4JA 1RPNA 1TIKA 2IBSA 5JZVA 4DY6A 4I2NA 1BJKA 2F3SA 2XT9A 2O8CA 1DP4A 4HX2A 3K15A 4PC2A 1QGOA 1B00A 3W8EA 2K5UA 4G4SP 3EGEA 5CFZA 4D43A 5AVRA 5GP1A 1NWHA 3SQMA 2X3FA 3IKLA 1GTMA 2GN1A 4RSHA 1K66A 2P3LA 2Q3FA 2V6BA 2WSSD 3WJ2A 1O95A 3L0YA 4C2TA 4LCBA 2QRKA 1SXJA 5T4BA 4AECA 3WWCA 5AFSA 2IFTA 1ISPA 4L5JA 1W5EA 4LBYA 2H07A 1DXHA 1NI4A 2A57A 4FI3C 2PE5A 2ZSDA 3QWBA 2PY6A 1V9CA 5FHRA 4CT5A 3AXSA 3GEPA 3OE4A 3QE2A 3TGPA 2ABWA 1RBMA 2EKBA 1GZ6A 3VHQA 2EZ8A 1A9ZA 2R8PA 4AMBA 2LR0A 3BRWA 1ATIA 3LX8A 5AI6A 1M6HA 1INLA 1TKAA 3X2SA 4TZ0A 3PS9A 1O94D 4Z0HO 2NU7B 1ZRMA 3SD7A 1S3IA 5L53A 3PPWA 2QTBA 3GLVA 3QF7A 1T8PA 3CTMA 3T4XA 1ETHA 1E2GA 2FUCA 3S1SA 5FEMA 4U7FA 1MOQA 1QIJA 3P5BA 3QELB 4LEIA 3CEJA 3E9DA 2R7KA 3Q9NA 3ROZA 4EUSA 5L3VA 5MF6A 1Q6ZA 5TMEA 3VSAA 2WTUA 1KQ3A 1PD1A 2HI0A 5JQGF 1JFFB 1O87A 3CS3A 4LOJA 2Q8QA 3IP5A 1U11A 2PSJA 4WLFA 2DLCX 4JLVA 3WX0A 4ASUD 2X42A 1AKNA 4O4JB 2DY0A 4QUEA 1HETA 3D8SA 4GR9A 3I73A 1H0KA 1QKJA 5DRYA 4PZEA 5EMKA 4B82A 5A9TA 3SU8A 1UFVA 3I9FA 3IV6A 4LSMA 5DM70 1EWKA 3FI9A 1Y3IA 4I4TF 4RXMA 3H9GA 3B2NA 5EKXA 3FVQA 2XQFA 1FBTA 1T36A 3Q9LA 2QAGC 1M7HA 4GFDA 3ZK8A 4CL2A 1PDOA 3DYBA 2ZBGA 2BFFA 3ANLA 3IIMA 5E0KB 3V1UA 1UBGA 4AQYB 2JCBA 5A0VA 1TD9A 3UT0A 3D6HA 1DBVO 5A3VA 2GZHA 2XB9A 2XT6A 4FB4A 2D5LA 3KZVA 1EQ2A 2Q46A 5JXGA 4IHJF 5BNZA 3LL4A 3AM3A 1L9XA 2Q5CA 3NJRA 3TCKA 1ZUIA 1P2DA 2GDJA 2QG9A 3W5HA 2W8BA 3NGXA 3DC7A 3R74A 4YAJA 1GXSB 1F17A 3CB4A 2OKGA 4XLLA 4EFLA 1Z7BA 3AUFA 2WWWA 3GEHA 3OA2A 3PQEA 4LVNA 1AIPA 4YRZA 1Z6XA 2OA0A 1MHTA 1LBTA 3G5UA 4WGGA 1TZMA 1N75A 4QARA 2FZLA 2JHCA 4U2BA 2BE9A 3FPBA 1Q5PA 4DZZA 1XLVA 1E1CB 5ALHA 1AUOA 3PP8A 1W9MA 5LP6C 3FDXA 1NF3A 2C2WA 4R4JA 1M6YA 1PL7A 2O4CA 4QFDA 4KAJA 2Y4OA 3RKSA 1ADFA 2IPXA 1PFWA 1ZOOA 2C04A 2P75A 3JTMA 4UEWA 1ZWLA 2B98A 4BMPB 2HBZA 4YJHB 3T5PA 3EZLA 2QJRA 4KFRA 4H6VA 3P19A 4Y7DA 1P1CA 5CMLA 1QGYA 4JWTA 3FVTA 1SOVA 3HYLA 3TZEA 5JXHA 1EFPB 5H80A 4DZRA 4J6FA 1L7DA 1TEHA 4TS3A 4D9NA 1Y89A 2NSHA 5E9JA 3RC9A 4E0BA 4ERXA 4MUJA 3QTTA 4XQ0A 3IXQA 5K8JB 2HUNA 3I4LA 1ENPA 5G3YA 2Q1WA 1R0ZA 2YL2A 5JVDB 4D56A 3I12A 3JQGA 3GJ7A 5ERXA 4XGKA 3OE7D 2JI4A 1P5FA 2X5NA 3QEJA 1A5SB 5ITSA 4OHXA 1M0TA 1P1KA 3VSCA 1WEHA 2ZSHA 2X76A 1XMPA 4PXSA 2FN7A 1V5EA 4DHEA 3GLIE 5JJCA 3KVRA 2HNBA 4YAEA 5KNCD 2YWBA 1I2DA 1FFBA 2QU8A 3I9MA 2VUHB 1JHDA 1QHHB 3SS8A 1VECA 4Q01A 4C7MA 5HUJA 1JZTA 1DKRA 3O5AA 1G6OA 2R1TB 2AR9A 3NBUA 4HEHA 4PPYA 4BZQA 1VG1A 5AH0A 4ZCIA 2B36A 1XF1A 1T9DA 2P4EA 3KP1A 1WF6A 3PXXA 3VV3A 4MHSA 3TM5A 3DE3X 5B7QA 5EKSA 1VMKA 4FCCA 1AKWA 3GGOA 4LDZA 3D2BA 2CF6A 2OXTA 4CCWA 4UUAA 1ISJA 4MV5A 3KYJB 3TTTA 3QEKA 1KDZA 3PE4A 3M3HA 4DLUA 1MCZA 4FR2A 4TSFA 3T7KA 2IEDA 3ADOA 2K2WA 4P4TA 1ESMA 1FXUA 4YPOA 3R6LA 3AHIA 3IIJA 2JAUA 3RC8A 3BXGA 4WXHA 1QONA 1RWXA 1M74A 1QK4A 3GT7A 3OSUA 3FRJA 3JWJA 4KQ1A 5CBPB 4F5DA 1PVVA 1JL3A 1Y3AA 4FGZA 5EWMA 5SZJA 2AJ8A 3U1BA 4EABA 4DCMA 2GS9A 4NFLA 3ZV3A 4C6TA 2AXQA 1WEKA 3GLHA 1JQEA 2WABA 4HAYA 4IM7A 2P62A 4TWBA 2N47A 1PJLA 2QUHA 3LCJA 2B1GA 4RF3A 2PVCA 1KI6A 3E81A 3H11A 1JTFA 2WJJA 5HZKA 1WZIA 2VBGA 5JSQA 1P8JA 2HL6A 1SUSA 3NWBA 2P6PA 3E2PA 2P27A 3CT4A 1UC4B 5A05A 2OCLA 4B0PA 3D1LA 3CNQS 4LNHA 3TVDA 3BA6A 4AY5A 2NXWA 1Q1ZA 1MEEA 3DTYA 3I92A 4J75A 3L6OO 4KE9A 3VH1A 5BWNA 1UODA 4UPVA 5DXJA 1F0YA 2F9FA 2O2JA 5K6AC 4EUEA 2IDKA 2P65A 3GARA 2A9VA 1RWQA 3NTRA 4CQJA 4DLWA 2QV7A 4CEIA 1TM3E 2CJYA 3PUYA 1MAUA 1VE9A 1NUAA 5MN5A 1BMTA 1T2UA 5G4KB 3QQPA 4BQSA 1GPLA 1TK9A 2AJTA 1PV4A 4J7XA 3KKNA 1U8CB 2HQRA 3U7JA 3RDPA 3DDZX 1O6FA 2VRWA 1OFIA 1XD2B 3ZPXA 1IVNA 2FQWA 3P9KA 1UBTS 2YYYA 4HTAA 5G0WA 1NBME 3HBFA 2XXJA 3BUSA 3V4PB 1YQUA 2AI1A 4KU4A 3ZLVA 4WL0A 3GRZA 3GNSA 2VDJA 2KLHA 1TA9A 2QL6A 3JWIA 5D5HA 4DWJA 3N2EA 2ZG6A 1ZEMA 3N7UA 5LKRA 3PEUA 4LHVA 5D2CA 1P2VA 3K0CA 4KPYA 1SFRA 4X7RA 4DA7A 5COQA 4XB2A 3M9LA 4IWNA 3QPAA 1BG6A 1XKXA 3C8UA 3IAS6 5FR2A 4H6PA 2FN3A 2KQUA 1PV1A 1V16B 4A1OA 4B0OA 5IXYA 2RI1A 5JJ5A 3CF4A 3ONFA 1X19A 1T0IA 2ACEA 2OTCA 4KZKA 4JC4A 2BE7A 5I45A 5ICSA 4P7FA 2QW0X 5C7LO 3R76A 1I1HA 3QLTA 3THYB 3KXIA 3ABOB 3FTQA 3TZ6A 3WGGA 4YIKA 5IARA 2R68A 1VHTA 2HF9A 4DRZA 3TW8B 1RWNA 3PT5A 2NU8A 2DFDA 3NAGA 3T3EA 2UXCB 4IW3B 5CB4A 3K0AA 4H2DA 1FEZA 1KAOA 2O2EA 4U02A 1JKJB 3NRBA 4D9FA 2PO7A 1NW5A 3A05A 3EMBA 4B8YA 4ENPA 1EEHA 5ABPA 3HJBA 1CS0B 3RG2A 4DLTA 1N7HA 1NJFA 2E3JA 5HJ5A 2JLBA 4BKOA 1MGPA 3DPIA 2BFEB 1YQXA 1EFRD 1UK7A 2EXXA 2QM7A 3MWYW 1SZCA 3R3HA 4B85A 3K1JA 3D4NA 1W2GA 2HQSA 3KOOA 1VHQA 4RY9A 2Z6AA 4I1IA 2ZZNA 3R5XA 4BMYA 2QR2A 3CKMA 1Y82A 4XYMA 3AOEC 3IP3A 4UEQA 1ABEA 2DF8A 3EW9A 1C0LA 1Z6YA 3R7NA 4IQGA 1TCUA 1O3YA 4N12A 4J16A 1CVLA 1FP4A 2IXAA 1VJGA 3LF2A 3RWMB 2ATCA 2CXSA 2YYZA 2Q3EA 3B1ZA 5EOVA 3SAJA 1J24A 2H4YA 1NC3A 3H2IA 3C3JA 4G84A 5ENDA 1LX6A 2F1IA 2NU6B 4GI7A 5FPYA 1Q44A 3BFXA 4IRMA 2FEMA 1FXWF 4PGMA 5AM0A 5KEIA 2A78A 4BFTA 5KYWB 2XCRB 4JJIA 3CT6A 1XWFA 5DULA 2ZE7A 3T8YA 1YFKA 1J2YA 2I1WA 5DSTA 3VTAA 1EJ0A 3D8HA 3I64A 9ABPA 3E3NA 3I9NA 1WSBA 2DJ5A 3L7OA 1QNFA 5FKJA 4DT1B 1QQTA 4YS6A 4Y9TA 1XVTA 3QOXA 5KNLA 2OZPA 4HFJA 1J9ZA 1EJ6A 3OEHA 3K5IA 2CW5A 4BKPA 4Z99A 3M6AA 1S1CA 1DTWB 1ZN2A 4KJXA 1N2XA 4IJUA 1E7QA 4TV8B 2FZVA 4KLNA 2DCUA 2PQMA 4GYKA 1N6RA 4P5EA 2G1AA 3RIGA 1L3BA 1V4BA 4NKRA 4CTJA 2QX8A 5BVHB 3W9BA 1Z4LA 2CBGA 4ETIA 1NONA 4GHWA 4KODA 3OVMA 4YJ3F 4R1MA 4FPXA 5AESA 4AI6A 3WK8A 1Y3BE 1KEZA 1H0RA 2CXQA 4FQ5A 4XUEA 2ZTVA 3DHVA 1CRPA 4R3WA 5FBRB 5C8XA 3JQAD 1I24A 2GVDC 2O2CA 3GCZA 3SEQA 5HK8A 4XCVA 2AOTB 1D0VA 2EKZA 4ACBA 2ZIVB 3ILSA 2V3WA 3LW8A 2FN8A 3ZE9A 2VBFA 5J58A 2C7RA 1RCTE 4MV8A 1MQAA 4ALLA 2H1VA 1FFYA 2EJWA 2H63A 2ODEA 2QUIA 3DXFA 3FOWA 4FFRA 3RIXA 5HR5A 3RYCA 4DJFC 3Q98A 1DWOA 3FSJX 2R8ZA 2CKMA 4NVRA 3FFXA 1X80B 2ZUTA 3WLPA 4HS9A 1CUJA 1LLUA 4KMOA 2WTMA 1XJ5A 1QHYA 3G8AA 4EQ6B 1MQ9A 4JD5A 4C1NA 2O1WA 4XZ3A 1NP3A 4P6VF 4TRMA 5B7NA 2QRVB 5I3ZA 1E6LA 3GLFE 2C4KA 4A2QA 1M33A 1XEXB 1JLRA 2FH5B 4FFMA 4A82A 2BJHA 4FGKA 2NZWA 3AX6A 3PGMA 3OG9A 1GRNA 5FWYA 3CUEF 1CXZA 4Q05A 2LPMA 2QD5A 4IKEA 6ADHA 4MWDA 3A4VA 2JCGA 4JX9A 2EZUA 3R2JA 2DTDA 2RGUA 4RDCA 1A96A 4ZVNA 5G2OA 1L4UA 3NFRA 4PC7A 2P9YA 2IEZA 4GEKA 5ICFA 1HC7A 4BO4A 1BU8A 3FCCA 3C7DB 4FKZA 2H08A 4MOWA 1PRYA 4MRVA 3PD1A 2FMXA 4OVKA 3L49A 4CIXA 1A2BA 1GWNA 3HVKA 3KIPA 4UMFA 5LC1A 4DQUA 5IUJC 1PQ4A 1IN4A 1O1YA 3H1PA 2YYSA 1J4AA 3PSAA 1I32A 1KJZA 1MBZA 4TTQA 4WLOA 1DB3A 2AUNA 5FOVA 3T9BA 1OZGA 1S6YA 3NEJA 3JQ6A 3R9WA 4DGSA 1CYEA 1DRJA 4A15A 1A1SA 1QQ5A 3KPWA 4II3A 3QLJA 4LWOA 4M83A 1JLHA 5JZOA 4TWZA 5LZ2A 4DNXA 5CCBA 2VPQA 2WR8A 4PZ0A 4HN9A 2Q2WA 1B1AA 2AZTA 2ID4A 3W9SA 3P0EA 4E5VA 1DHTA 2QBYA 1ZGGA 4F38A 1KK0A 2ZTHA 3LT2A 4IHAA 3KD3A 4ARZB 3E3LA 3K2QA 4CW7A 1TJYA 4GUDA 1AH2A 5EVJA 3OSZA 4JB3A 5JXWA 3FNQA 4A5SA 4ZTZB 3RFTA 3TINA 4JIMA 4JMLA 4M0PA 3A3NA 1OX6A 2WM9B 4C0QC 4EPWA 4BLTA 1NBMD 1UIRA 2DPYA 4HB4A 2ETVA 1WJGA 2OCIA 3GD5A 1B7GO 3L07A 4N5MA 3ZU3A 1WETA 2ONKA 2XNDA 2LKDA 5JNWA 1O7JA 4OLFA 4QWMA 2CDBA 2CKDA 2NO9A 1S2IA 1M1XB 2QG6A 1MAWA 4GO1A 4G1VA 5EIFA 2OCDA 3LG2A 1GCAA 1CY1A 4KH1A 3ZKAA 2I1QA 4N0EA 2OMKA 4RJKA 3COYA 2E89A 2G7ZA 3RADC 4NBKA 4RH3A 4EATA 2BTQA 4RA6B 4BFXA 3FVRA 4DE5A 2DUJA 4NPHA 3T1TA 3TOSA 3WYDA 5JDIA 1RAFA 4P35A 1U0RA 1TK3A 2QZ4A 3DZDA 2JKVA 1Q1BA 2BJVA 2MCFA 3W5UA 1AX9A 3WL3A 2DC1A 2BBWA 1UKYA 2WDZA 5HRAA 2I6SA 2QZSA 3DBRA 3A7DA 5JS8A 1Z8NA 3H87A 3JQCA 3N6VA 5KQGA 2FN4A 4TM7A 3HVHA 3I9V1 4CMKA 9LDTA 1L4HA 3EHEA 3O2NA 2C42A 5KMGA 1YJQA 1K0UA 2CXOA 4H7DA 3MMPA 2E5WA 4BNVA 1WL8A 2AUMA 3PTAA 2QF7A 1XQ1A 1HQDA 3I1YA 4CM9A 1P33A 1ZOLA 5EUMA 4D74A 1SCQA 3E58A 5HS4A 2NAFA 3U60B 2IC5A 2CHQA 2NWQA 3GGGA 3HBLA 4RLSA 4Z4HA 2HO4A 1UBCA 1ACJA 3P94A 1NIPA 2JRLA 1F8YA 1B26A 2BFAA 3JR3A 4I9FA 2VHUA 3TD2A 3ER9A 5JCJA 1MAAA 1XZMA 2JGEA 3H8WA 2QJOA 2YN4A 1GPNA 3IH5A 3L3BA 1LB1B 3AO0B 1SKYE 3OF5A 4LQCA 1M2NA 3Q15C 2XYQA 2WF7A 1JIXA 4GM4A 4F1WA 3NONA 1GPAA 3FRHA 3TOVA 3M9WA 1S8NA 1A9PA 1U6KA 2VYFA 5K0EA 3IIIA 5EQTA 1NJ6A 1K92A 1OPXA 3HEBA 3JZDA 1XL0A 1XXHA 1KDOA 4MQEA 2A9RA 3V3TA 3AU8A 1PJRA 2JAHA 2WSLA 4OAPA 4WFQA 2XUGA 1XMQB 2AE2A 4AX8A 3ZIAA 4G0UA 5C0OE 3UY4A 3K9BA 5FTLA 3C7AA 4GL2A 2WU3A 1R0BA 1M2GA 3OESA 3P2YA 4MKFA 1JGTA 5GTDA 2IP1A 4ITUA 1OFUA 5HMMA 5BNTA 1C7QA 3AM1A 1QIMA 1Q57A 5ANRB 5M5BA 3VOBA 5F9HA 2PFSA 4Q9DA 1KK1A 4TSRA 1KP9A 1M8KA 1NBEA 2UXDB 1FPMA 4EJSC 2PM8A 5K3EA 3PHHA 1IY8A 3TQHA 1D7OA 3PDUA 4BJ1A 2ZM6B 2DPXA 4Y2UA 3EEYA 1VJCA 3H84A 2GAIA 3ZTWA 1CY2A 1RQNA 3H42B 1VKJA 5IULC 4GMXA 4DUPA 5IAGA 2VP3A 2HUPA 4O4LF 4RZ2A 3C16C 3U9LA 3VMMA 2Y1FA 3BICA 1W0KA 2DUUA 3M6VA 4UATA 5AOAA 2GM3A 4OL9A 3IFSA 4IOMA 3EPJA 2FX2A 4CKWB 3DEAA 3LUCA 4DTCA 1OWOA 2Q2OA 1IM8A 1Y8CA 3LBFA 4PEVA 4R40A 1LTQA 4Q1BA 5A4JA 2VP4A 3LXUX 1WHTA 2X5KO 2ZJYA 1V2GA 3CLRC 4EHNA 3KU4A 1LK0A 1G7TA 2EZTA 1MA3A 4R68A 2NQ8A 4QYWA 1VLVA 2VATA 4AAYA 4X85A 2QG4A 3D7NA 2O3QA 2YQZA 4E5KA 3AKCA 2X19A 1SCIA 4KVGA 1UJ5A 2CLLB 1X94A 4EFMA 5A7FA 2I2WA 5JH7B 2ZXUA 2ZUFA 4C05A 2ATEA 3AFGA 2BEUA 3E8MA 1UBNA 3AKYA 4H17A 5KU7A 3KWLA 1FU4A 4E94A 3L1VA 1XLTA 4HK4A 3WMFA 4X6XA 1L8LA 3K9FC 2AFVA 2CMDA 4KFTA 4KUEA 4EI8A 1E2PA 2HSEA 3INNA 4GWGA 4NH4A 3SQNA 2XUIA 3QU7A 3Q7QA 1D6MA 1NE7A 4V0QA 3ENNA 5EN4A 3DBLA 3NBQA 1EGMB 5JW6A 5CG1A 3PL1A 5E95A 1RKVA 2HCRA 2VZLA 4ENUA 4IQ8A 2DEUA 5DBGA 3IP9A 5DF1A 1ZVVA 2F7SA 3ORSA 3SWWA 1RRCA 1EFVB 2DXIA 4AF8A 2R6AA 4Y6SA 2PLRA 4ZQHA 1L6IA 1R8XA 3KYDB 3UAYA 4E1AA 4ZXPA 2COEA 3NBMA 1U3FA 1AO0A 5FFNA 2IHKA 3CURA 4I55F 4IUBS 4Y6RA 1P4SA 4LECA 1TJ5A 2D3TA 4MINA 3AH8A 4J1SA 4QATA 4YH1A 3DA8A 2GTPA 1CDDA 1BGWA 1PDVA 3C3PA 3HABA 4FE4A 4HAXA 4OI1A 3KPUA 1CJBA 1WVGA 5KYGA 1L8AA 1E1DA 1U3UA 1N8SA 2P4QA 4G2NA 3WHKA 1WF3A 3B6IA 3VUEA 4EPYA 4QXMA 3DONA 1N5LA 4UVHA 4NK4A 2GCEA 2YTZA 5IASA 3I8OA 1GTRA 4L72A 5JARA 3FJOA 3WKEA 1WP4A 2NU7A 3OTIA 4DA8A 3IUYA 1PZHA 3OCXA 3O83A 3QJYA 2YY7A 4FEAA 2CNWD 2R65A 4OK3A 3PHGA 4OUDA 1QYCA 4XWTA 1K6MA 2FF7A 3QELA 4E2FA 1OILA 4G5XA 3TPFA 1N2CE 5TS3A 4BP1A 4MRRA 3EUWA 4BNFA 3KJEA 5A9SA 3W4KA 1SAYA 2ODQA 3WGZA 4W5HA 2VRNA 1GVNB 4YA6A 5F7ZA 3TVYA 4GE3A 1NN1A 3QUTA 1US8B 2PUVA 1ZSNA 2XE8A 4HVAA 3T1OA 3U6KA 1AOXA 1QP4A 4O4JA 5DLQC 3ZS8A 2OO5A 5JS6A 4HAWA 4M1EA 1EBUA 3ZNPA 3DTNA 4Z4QA 1X74A 4DC9A 2WKQA 3K6RA 3HU1A 1BKYA 3LPCA 2NUTB 4JUFA 5SY6A 4NTZA 1BCSB 3KKZA 1QHSA 3HA5A 4R5HA 3HWSA 4IAOA 5BYAA 4LK3A 4Q4AA 1Y81A 3FGZA 3K31A 4JLNA 4LPSA 2FQ1A 2WP8J 1N9GB 5E0OA 3SJUA 1NTOA 4Y18A 3EPLA 2IPNA 5HFJA 4EW6A 2XQKA 1M8PA 1U8FO 4NCAA 2ZIUB 5FUMA 1I3KA 2J3HA 5KB3A 4FDMA 1CR6A 5CDYA 3W7AA 3KZCA 4OHBA 4L8VA 1SQSA 1LEHA 3K71B 2HK6A 3H1GA 3ED1A 2J6IA 1CP3A 4Z5XA 4TTIA 2BOVA 4XWWA 2A1UB 1I1QB 2MMGA 1GXSA 3I2KA 3NCHA 4HX5A 5FPHA 2V7QA 4L3VA 3KVVA 4EJ2A 5HKKA 5EMJA 2JJ2D 2P6MA 4EHIA 4PSCA 3MRTA 3SEAA 3WAGA 1JMVA 2CEAA 1SUFA 4PHCA 2GN8A 1AXGA 2WPDA 1E1CA 2PX2A 4GKKB 2EHDA 3T7AA 4G5OA 4KPGA 5CLIA 2OV2A 5KPDA 1DQZA 1N2IA 2CHGA 1SBHA 5ER6A 1CZNA 1Z36A 3D8NA 4GBMA 4O8CA 4YDRA 3U0VA 1N5MA 1N6PA 5E6SB 5I7RA 3O8CA 3GP3A 1SBNE 4PM4A 4AB1A 2QM0A 4MTCA 1BEUB 2MYTA 2W71A 4C04A 4YJGB 2IDJA 4US0R 4BNHA 2NVWA 3GHHA 1JR3A 3RFCA 1YQTA 1EFPA 1NPTO 5AXBA 1NYLA 4PX3A 3CUUA 2O0JA 3QE3A 2OUIA 5K3AA 4MVJA 4CQNA 3CE6A 3FNFA 1P9OA 5J43A 1ESEA 1OCEA 5JVDA 1RACA 2PDAA 2OVFA 1C1DA 3ZWXA 2R1VB 2ZI3A 4P4SB 3TDKA 5JZSA 1JQLB 4YRKA 4K9KA 2AC4A 4WXPA 4EG8A 1U31A 2YWEA 2HSWA 5AW8A 4ENQA 1S5PA 3AXTA 1G16A 1FFEA 5CYGA 5LU9A 3UTDA 1V4VA 1V2HE 2Y0CA 2YY5A 3GJ6A 4M9XA 4BXOA 3HJFA 1ACLA 1VZ2A 4FWIB 2HT6A 2AI2A 2QSYA 4ISCA 5DHRA 2D5CA 2L18A 1XEFA 2FUKA 1JKIA 3JVUA 1AK9A 1ZJYA 2WHEA 3L05A 4V0RA 5DMHA 2PUDA 1FMFA 2ZJ6A 5BV0A 1HNWB 2XT0A 1OASA 2MTBA 2NT4A 1IWPB 1J07A 3FSRA 3KM0A 1U2GA 3FCUB 3N0TA 2B1IA 3AFNA 3FMVA 3KKKA 3NB0A 4BRZA 4OI0A 2QPOA 5D3QA 2ZB8A 3VNAA 4OLHA 4L8WB 1XPUA 1VXOA 3FETA 3KKOA 2AYYA 4JU8A 2PT9A 5KTYA 1YUNA 3LHSA 3DAGA 3AFHA 3G5TA 4QUAA 5EWLB 1DEAA 4GRIA 2OHOA 2Q8NA 4UMEA 1KS2A 4UBKA 4HRVA 2X5OA 4L8LA 4LSWA 2XB4A 3L1IA 1DIHA 2PIAA 2QVLA 2HRQA 1D6NA 1LRJA 3BMOA 4RNDB 1HF3A 2AOXA 1C81A 2AXNA 2WSBA 4MCJA 4X5OA 2FUEA 1ZH4A 1YUMA 1YMVA 4EYOA 5BWMA 1PGNA 4BV3A 5IHPA 4EJFA 4QREA 2HSDA 3KT6A 4WADA 1KSFX 3NVMB 3ZCVA 1W4ZA 1YUBA 3IKMB 4GVXA 3U17A 1H2FA 1BHJA 1IY0A 2P41A 3BYZA 4IRUB 3TQRA 2WZCA 4OXQA 1F4LA 3U2QA 3E82A 2F64A 4NYJQ 1U98A 2C29D 3ROMA 2AKEA 4BBZA 3ZBUA 3OMWA 3TQCA 4MS1B 2CDAA 4GR5A 3OAAA 3URMA 4EEKA 3GROA 1BD4A 1AB5A 1W8DA 2CNKA 3P9CA 4C3VA 4B73A 4HYYA 2REBA 1PFUA 3WIDA 1BD3A 1P60A 1BW9A 2WKRA 3WNZA 4J7UA 5DYYA 4FM9A 5BNFA 2GD2A 3I5AA 1T5OA 5JCOA 1CUWA 2EJCA 2O05A 3DP9A 1A5ZA 2WU0A 2YICA 2X14A 3JQDA 4OHYA 2QT1A 3NR2A 4JX8A 4MIKA 4WH0A 3ZNOA 1J56A 3G9XA 3E4DA 3RRYA 1IN6A 3A1UA 2JIZD 3EXEA 3I9JA 1PEYA 2AG0A 1DMRA 2BSAA 2DBZA 3PJFA 4DXHA 1FW6A 2QW1A 2FWNA 3PU6A 5TEWA 3DF7A 3IILA 2ZUEA 3FNGA 1RYYA 1E9DA 5AVSA 3M33A 4QVKA 3EUAA 5LOVB 4V0OA 3ZHYA 2J6BA 4YECA 5AKHA 3E7DA 5DH9A 2TMGA 2J9GA 2ZRJA 3NHBA 1NBOA 4TRNA 4CTKA 2FQYA 4CFYA 2VDRB 1R64A 2YV3A 2KJQA 3U49A 4C76A 3PQ7A 1DRKA 1PLKA 3A2NA 2XUQA 5K2MA 5JHGB 4F5YA 4K0KB 1OA0A 2B2NA 4CDGA 1XX6A 3OIDA 4B34A 3ND5A 3BH0A 3EBLA 4D8XA 1C7ZA 3K2EA 2HH9A 3BWEA 5IN5A 5CURA 4D6XA 4LDJA 5IUKC 2PRKA 5LSAA 1ZBDA 4YJ2A 3VR2A 5IVDA 3EPKA 2ZBQA 2QIPA 4RLFA 3GWZA 1TO6A 2AOUA 5FTNA 2GNPA 1V16A 4MA0A 5FOSA 4ZKDA 3HXQA 2JF0A 4K2AA 4A6XA 1ZLXA 4E2WA 2G8LA 4XEUA 4NG5A 4RY2A 1PX0A 2BKEA 4PU0A 2ZRFA 2I55A 3JQ7A 4LF4B 3THYA 1IVYA 2IZ6A 5TF4A 4ME6A 3FUVA 3KJIA 4AKIA 3T1NA 5GM1A 2YHIB 4AJ1A 3ELWA 2AEEA 3UAZA 3K0BA 4R6WA 3RSQA 2Y1XA 3TW8A 1GL3A 1XE3A 5DSZA 1EDZA 4WV3A 4H0CA 2NUPB 3MMXA 3NVAA 1DO0A 3OLQA 4JJGA 3VNQA 2IYXA 2GB4A 1HQCA 2DPMA 4QUDA 2J08A 2OD9A 4X1IA 2GAAA 2XX3A 1OF1A 2G9UA 2IW3A 3CCFA 1CRQA 3ECSA 4HUQA 3UQYS 1CS0A 2EZ9A 4D99A 1R9MA 1S2OA 4YRQA 3RIMA 4HZUA 4HYTA 1KDTA 1EFLA 1GVHA 1VE5A 2GBPA 3EOAI 3L8HA 2BFEA 3T4UA 3EPPA 4PFKA 3FCOA 5AW6A 5AW3A 3JVEA 4EPVA 5EJ9A 3U4DA 5HDQA 3K09A 3OJWA 3U7EB 1GQRA 1Q1QA 5CYOA 4C01A 3DLCA 4HGRA 5KQRA 2Z43A 2O5EA 3PRKE 3B7PA 3F8TA 3TWOA 4PYQA 1WW2A 1NJ5A 3QEOA 5ALNA 3R5TA 4HDNB 4O25A 4OKNA 4BP8A 1MNQA 2B4QA 1NQAO 1PJTA 1XTBA 2YV1A 3P4YA 4GPAA 1DQSA 1EVYA 4XI9A 3JQPA 5AJHA 2HKIA 3Q0TA 1C80A 4CEJB 1L5ZA 1J09A 3QI2A 3OTQA 4FE3A 2X58A 1T9BA 3H05A 3LXXA 1XL1A 3EXHA 3K20A 3NCTA 1B4DA 2YJ3A 4M88A 3WKAA 4AS2A 1NQXA 1F8FA 1S01A 2KX7A 2NU6A 1EDOA 3PC8C 4NNJA 3CBGA 3ETCA 3SJCA 1NF8A 4J1TA 2VAWA 4DABA 3IUNA 5G53C 3GJTA 2GCPA 3PVSA 4Q37A 3IDFA 3RF7A 2QI9F 1Q0RA 1P0MA 5AHOA 1N2OA 4FYVA 2O54A 3DAYA 4PX5A 3F6PA 3I2HA 1GU1A 1M2EA 3GLGA 2OBFA 4MCHA 3HV2A 2B1JA 2X0JA 4TN5A 2E49A 3AFIA 1RKQA 4INOA 4W99A 2ZOSA 3KJFA 4JI3B 2Q7XA 2Q9BA 4FJ1A 4ID3A 3TAUA 1Y7HA 2Y9PB 4HWSA 4J4BA 4OIFA 5C1IA 1SUPA 4KO2S 1GCUA 4P5DA 1CJVC 2RGWA 5L3QA 3CVUA 2QJTA 1NZFA 1NV8A 1Y98A 3SKVA 3DEJA 2PXAA 3KQPA 1QAOA 1SJ9A 3TLGA 5BVHA 1ENOA 3ESCA 1MJGA 2PLAA 3RVMA 3BKXA 3UGKA 3PI7A 2W43A 1KEWA 4UHEA 2XB2A 3KOUA 3OETA 2J9FB 2V58A 1JS1X 2E6KA 3C85A 3PHJA 3G02A 3SNHA 2VPTA 3HLKA 3W8DA 4D3ZA 3LPDA 2P5SA 4G1FA 5DLDA 4FMDF 5JROA 1EYZA 5BW6B 3G89A 1BVYF 1YQWA 2CWDA 3GO4A 3JR7A 4KV9A 4EG0A 4ZI7F 3C3CA 4J3JA 4L07A 3TAXA 1UFRA 5J3JA 1CG6A 1COWD 2J4CA 2V1XA 3D1VA 4O02B 5F21A 3WOHA 2DFVA 3U31A 4DR3B 2J3IA 2LDBA 1S0UA 5CH8A 5T57A 1ANKA 1HLFA 1X80A 3B1WA 2A5JA 2F3UA 3H5LA 2W6IA 13PKA 3AERA 3MC1A 3F4BA 4GSYA 4JVMA 2C5EA 5GONB 5CDHA 2JA2A 3GIDA 2V98A 2D4AA 2B3DA 4HADA 4TVSA 4WEOA 3IP8A 1SOAA 4I1YA 4YLGA 3GT3A 2QRVA 2VTKA 1SELA 4ZU1X 1EA7A 4D0SA 4C07A 2H8KA 5EKUA 1XEXA 4R5MA 5G0TA 4V2IA 3ASUA 2YVAA 3DMGA 1TKCA 3K9HA 2VJQA 2HRRA 2WWIA 3CXRA 4JLUA 3KR2A 1C14A 3JWEA 1DWUA 1K8QA 4OFBA 4E5PA 1MZPA 1X7WB 1QVWA 1KDYA 1DAKA 1OGJA 1HMYA 5HNKA 5BSFA 4NABA 2C57A 4OJNA 3ORRA 4FZVA 1WNTA 3DE7X 5K8UA 5CUQA 4DUGD 3CZAA 2VAVA 3GJZA 3EBPA 2JFZA 2BGIA 2GYUA 4BQOA 1IDN1 1R2QA 2HA2A 3NW9A 3HKBB 4RPKA 4MV0A 3GEDA 2MYPA 4U2GA 3PC3A 5BSRA 2C2BA 4E7OA 3GEMA 4RTRA 1K08A 3GXOA 4GNKA 5FL7D 4ZV9A 4C0KA 1WZNA 1XXLA 3OKPA 4BEVA 3AVPA 4EB6B 2VHQA 3BK1A 4HGZA 4ZAGA 3FKSD 3GBVA 1R6XA 3ZWYA 2GCIA 4QUBA 4DCJA 4O5AA 2L42A 2ZI6A 2ZJ2A 3T9AA 5KNBA 1PFKA 1VE3A 1KEEB 2ALJA 2C5LA 3I39X 3QXJA 2PK3A 3FCAA 3NLLA 5AI9A 1EWYA 3GLUA 1RQ2A 3Q6MA 3U37A 4YMUA 1B0UA 3O4GA 3AB8A 5CM8B 1E1QD 2N75A 1XMIA 4BKMA 1S2DA 1JIJA 2Q8PA 3FYTA 5B1DA 4ARZA 4DBZA 3S8EA 3OM8A 1BMDA 1IL0A 3NAZA 2QVGA 1JQBA 2BMAA 4KFUA 1ESCA 3SYMA 5KNDA 4DV0B 2OM2A 4G37A 2C9OA 5KWEA 4TRJA 3BB3A 2O59A 2C4HA 2WJWA 1O96A 2HK7A 3T5AA 2GFIA 5T3UA 4JA0A 3ECCA 3UYKA 3H75A 1M83A 1WMDA 5EAIA 2UAGA 1NFRA 2HCTA 1R5NA 1X7GA 3L40A 3T54A 3BXOA 2CV1A 4P93A 1W4RA 3K9WA 2OZKA 3CINA 1QE5A 4BVGA 4RA6A 5CW1A 3SHVA 5FNVB 4IDPA 3V7WA 1AHHA 2Q5OA 3MZ0A 2XMCA 3E9NA 3ZD8A 4ZI7B 4N8SA 4REOA 4TYPA 3R6DA 1X7HA 2CFCA 3JY6A 1TK2A 3BIJA 3L8MA 2R2AA 2Y0BA 1VI2A 1U2DA 2PRYA 3LAWA 5KOIA 5DLEA 2PSEA 1II8B 2BKXA 2IUTA 2RJNA 3LF1A 3U7IA 4ON9A 5I3CA 2QA5A 3CN9A 4S1WA 4Q82A 5I9MA 2M2IA 2ZBVA 5SZIA 2QRQA 3M4NA 3KQOA 3KZNA 4UOQA 5DOVA 3IOMA 4LV8B 1IQ0A 5JMTA 1QBGA 3KTFA 3PEEA 3MILA 3Q9UA 4P34A 5FULA 1JQ3A 3HCWA 2GQ0A 2ILVA 4INZA 4ZYLA 1P72A 1UT6A 1XN4A 4Y3UA 5E7JA 1BDJA 4ND2A 2XIJA 5SYNA 2B8JA 2PBRA 3DFIA 3HCFA 2BDUA 1D1SA 3TLBA 4URWR 4U00A 4C22A 4ZZIA 1Y34E 1Z0UA 5DEOA 1ZXBA 2REXB 3SE0A 3BDAA 3ZWKA 1MW9X 1QTNA 1XDWA 2HDNB 4PLHA 4GLJA 4RTPA 3K16A 3KALA 1MRSA 1N2SA 1KGSA 2Q2NA 3H86A 4UUQA 4K8RB 5DI3B 4BE7B 1CJUC 1O97D 3IV7A 1PJ8A 1R9GA 4M1SA 3BFJA 3CISA 3TI7A 1ZGHA 1W4LA 4X8OA 5LFAA 1KO1A 3A37A 4G5GA 4RMNA 3U0BA 2BFDB 1WD7A 3FNBA 4PRYA 3O2QB 4PZAA 5CJ2A 2DULA 3GZ4A 3KYIB 1YZVA 3OJLA 4MAMA 2PX5A 2XEDA 1P9NA 4UVGA 3IHTA 2MWMA 1GGNA 2PV0A 2X1VA 2WWRA 4HVCA 3TTUA 2PKXA 2J07A 4PWYA 4BLSA 4LSGA 3DZFA 1SOUA 2PWPA 3H5RA 3GUZA 4X71A 5ALMA 2C31A 2X9NA 4QHSA 2CLHB 4AMYA 4B3DA 4B3FX 1W36D 5BV1A 1EM6A 3A2LA 4LXXA 3LHKA 1ZHFA 3ZQJA 5JAIA 5B1YA 4B83A 4CCSA 3RWOA 2PH7A 3UK1A 2QX4A 3N74A 3EGXB 4AZ0B 1IC6A 2IF0A 2IXTA 2NV2B 1NYRA 1ZJ5A 3EFBA 3T7DA 4EJSB 1P45A 3O8OB 1A4IA 2WQZA 2A0WA 4H3VA 1ONOA 5C7YA 3F5DA 3JWHA 3IBTA 4X54A 1EUDB 1NU8A 4L57A 1UZUA 3H2JA 1CY4A 3RK4A 2ZYDA 3E8SA 1LWNA 3NH9A 1NG1A 1ZD8A 2H7YA 3OU7A 4GX2A 1XQ9A 4YMTA 2FX3A 1X1SA 4B3JA 1UKEA 1GQFA 4ONEA 4V0ME 1N1DA 3TXYA 3IMKA 1NX6A 1SA0A 3A58B 3G2JA 5A5FA 2J3JA 1D8AA 2RDMA 1KR5A 1AMOA 1TYBE 2WUDA 4RACA 1QBKC 3S4YA 3JU3A 4BJHB 1FYXA 2V7EA 2XUDA 2I7VA 3GCXA 1RQ7A 4K81B 3MT7A 4XOUA 4AS3A 3OD5A 4GMKA 1P44A 3GD7A 4I3GA 2NP6A 4DIBA 1Z5VA 4G81A 2XNJA 1Z45A 3EQ6A 1G8HA 1HT2E 4UUBA 1D2RA 4V38A 2QRMA 2F3TA 2QP3A 2GLXA 1VQ1A 4I0WB 5JH7A 4Q4JA 1E79A 3CR8A 4RCVA 4WXRA 2IV3A 4J7CA 3TR5A 4EYSA 1GEGA 1HT0A 2X2OA 3I3SR 2PZ8A 1QH0A 1T9KA 4KXLA 1WQ4A 2OVBA 4RORA 1T13A 1E2MA 2B5WA 2WHRA 4RO0A 5ALXA 4LF7B 5JAMA 2BM1A 1KO8A 3OE1A 1MC8A 3SF0A 4BV8A 3JYHA 3B3AA 1I13A 2XECA 2Z3ZA 1L4NA 3E7XA 4HWPA 5DWQA 5ALZA 4TKMA 1E1KA 2FKNA 1PCXA 1J1UA 3ODGA 1H6DA 3VDMA 1KS9A 3GVCA 1UBUS 2GH1A 1FK8A 2POQX 3VNBA 2V9ZA 3I32A 4IV8A 4ODIA 4OKSA 4B7XA 4JNKA 5IT4A 1X7DA 3GUVA 3IMEA 4ZFNA 2D6FA 1HE1C 1EFVA 3ONWA 4BLUA 2ZAMA 3OWXA 4W4TA 421PA 3W5DA 1AQUA 5HX7A 1G21B 3FUWA 4LVCA 4E09A 3KYDA 4KBGA 3THWB 4Z0PA 1QP8A 2CL0X 1DG1G 1RWVA 1TO1E 1YA4A 2JA1A 2QD2A 3T7JA 3EDQA 1P7WA 4MITA 5TT0A 3HZHA 1SUCA 3HR4A 3EF1A 1G7CA 4M3NA 4URXR 4E11A 1NQ5A 3HJCA 3ZEAA 3G9UA 1QO9A 2D2IA 3L0CA 1R0SA 4FNOA 4RM3A 2FWBA 5FCDA 1OH5A 1P0FA 2H5JA 4YAOA 4ZZ1A 5KOHB 4RMJA 4BNGA 3LSYA 4ZQBA 4IIXA 4JLOA 4PSKA 4S2UA 2B8TA 1EVEA 1GARA 1J8FA 2BIFA 2NYUA 1G4HA 1HZZA 2A6PA 4N5DA 1OBHA 3TRFA 3IBGA 4BFUA 4CUJA 3CX6A 1Y6FA 4BCBA 3QPCA 4Z8XA 2QW8A 3ZHZA 3A2MA 1ZESA 4BECA 5CLFA 5GIPE 1F5SA 3HN7A 3PE3A 4S05A 5FTMA 5ALRA 3VVLA 2R60A 3U44B 1D1TA 3CLHA 1SC4A 2JL1A 3H1BA 4KGXA 5DTIA 5CFMA 2B6NA 3RVDA 3KVOA 1T2FA 1WZCA 4AKSA 2IT1A 1GAEO 4X8HA 3AY3A 1WUJS 2JJ8A 1ORIA 3EBOA 4UXIA 1ZMXA 2GYWA 2ZWMA 1IQUA 4RTQA 4EVSA 1UXJA 1THZA 2GZMA 3WIBA 4AJIA 1N5IA 2SKCA 4FINA 3ZE8A 2JBAB 2IW1A 1KA9H 3HB7A 3PLRA 2WG2A 3IO3A 1TTQB 3IEUA 5CLGA 3WWDA 2Z1NA 1EUQA 4OU5A 2H29A 5BURA 4Y30A 4NENB 4IIBA 4ARUA 4EHLA 2RFLA 4HXFB 1PZXA 1XRPA 3UV7A 2W2PA 4FI3F 4YJGA 4LKOA 2I7CA 2RI6A 4MA4A 2FDCA 3QX3A 3VKHA 1CQIB 4TVBA 4EM6A 2YFHA 2ZI4A 3E9EA 4X41A 3GG9A 1Q0UA 3WFIA 1QRSA 2W2KA 3GFVA 2UYHA 4IMIB 4RFLA 5T6BA 4B7ZA 1R37A 3GR6A 2A1UA 4F1KA 5KYTA 1GGFA 1GGMA 1Q7EA 1CCWA 2WW8A 3KEMA 5D00A 3NP9A 3NHLA 3ZKWB 1A5BB 2EFCB 4FBGA 4B4DA 3WBJA 2SCUA 4HEQA 4U39A 3G88A 4ZCRA 3FXAA 3LS2A 4LHSA 4GQBA 3C6XA 2P5TB 2WA2A 4GR4A 3U81A 4GZ5A 4W63A 5KDOA 1GT6A 1F8XA 3IKTA 4DLKA 5A6VA 3ZWWA 5KVVA 2QN7A 2W6QA 4JBHA 3T06B 4KE6A 1AKTA 2O0HA 1XNQB 2HEGA 2BKVA 2JFNA 3QVJA 3PR2B 4G1MB 1O9GA 2FZGA 3A6LA 1UJ4A 3AY6A 3L84A 4QULA 4TS9A 5E6SA 3FUUA 5EINA 4CV1A 1BXGB 3PGJA 5MN4A 1OZHA 1GSOA 4QXAA 4WZBB 1DDOA 1IIRA 2CB9A 2VOJA 1VMIA 3D0QA 3PYLA 1IEXA 4R8RA 5AJWA 5K3DA 1JXOA 4DM3A 5FJJA 1RQXA 1JDVA 4ZOAA 3IPXA 3IPCA 3CBQA 2XPCA 2I3DA 3BHMA 4OHUA 4OJQA 3LW7A 4R8LA 1RNLA 2AEFA 4TXJA 5D01A 3KYBA 3VC7A 4YHBA 4QELA 5TR9A 2FNAA 2SKEA 5ELLA 1W4BA 1NP7A 1XKQA 3BD8A 3ETNA 4MJ3A 1LQTA 2R1VA 4P4SA 4XD7D 3TJZA 3PWZA 5BN1A 4DRYA 3A9WA 3FWPA 2OENG 4A1FA 1YIDA 5JFTA 3T15A 1E59A 3R7WB 5DYGA 1X2EA 2P3QA 4WKCA 4N0PA 4BGIA 8ADHA 3H2HA 3IULA 3V8BA 4IR7A 1NVVR 1XZDA 4CCAA 3IRUA 1JA0A 3K2BA 2ZT7A 4TTSA 2UVPB 2M6LA 5BQXA 2XNSA 2C4TA 3C3YA 3FAZA 4KVAA 4QICA 1T1SA 2ECOA 1LSOA 2NYRA 3H1FA 4IJ6A 2FR8C 4RX1A 4S0XA 2CVQA 5HUQA 4H3HB 1SXJC 1W30A 2B35A 5LP6F 3L8GA 1ORRA 1WB5A 4YCAA 5KQMA 1TIBA 1U5AA 1QFJA 2QRPA 1WXXA 4I9GA 1A98A 2JBHA 4RZXA 4IX9A 3I8SA 3I04M 3HUFA 5JAUA 3LLVA 3MAGA 2UUAB 2ZTSA 3WNDA 3G2HA 2OWDA 3X43A 4BAUA 5EWLA 1ISIA 1YCDA 3WICA 4OMUA 1AS2A 1XZGA 2E0IA 3Q7PA 3VZSA 1NJGA 2BHLA 3DMDA 1JRLA 1KY5A 4Y1EA 1BVHA 1QTRA 3TQTA 1R4NA 2MINA 2Y1WA 3U4AA 3JQQA 4JLMA 2EX0A 4X7MA 3D4OA 5JZBA 2V0GA 4QTYA 1FW8A 1N9ZA 1Q0SA 2CV0A 5BPFA 2PYIA 2DLDA 1J70A 4DWOA 3TCXB 1PVDA 4CIAA 2ODNA 3BXXA 3D3QA 4JEUA 1XK7A 3KE9A 4X9XA 4ZI5A 3RC2A 4QM7A 2JLUA 1N77A 3BMQB 3KT8A 4K9MA 3KFLA 2PBZA 2J31A 3KG2A 4OJYA 1X7YB 3LCRA 4K9SA 4MV6A 1XTUA 3UK0A 4C08A 4LXUA 1AM4D 2DE0X 2IXGA 2NSDA 4TQAA 1PT7A 3V1NA 3LCCA 3GQVA 1ADBA 2G4LA 4B9AA 2UUBB 1SB9A 2FPKA 5IXJA 1G8YA 2BR5A 2QAJA 1A7JA 2VPWA 3QEBZ 4XQEA 1OI2A 2GRAA 1PTJA 3CGWA 1AVTA 1WY7A 2M9MA 3E6AA 1ECJA 3LRTA 3K8QA 3QJGA 4NPAA 2AWOA 2OHXA 4PINA 1QIDA 3M6IA 1XRRA 3Q10A 4M1QA 4HKTA 3MJTA 5HQTA 3WL5A 2P9TA 2XUHA 4G0XA 1VJ1A 2YS6A 3BQ9A 4JCOA 1AURA 1RXCA 2F1JA 3TZQA 1XT6A 3RBAA 2CFSA 4UHJA 4URUR 3UGJA 3W5AA 4JYZA 3ZJTA 4JQOA 3G5MA 2ASVA 3B89A 3G2MA 3G6WA 4HAUA 4CNQA 2G83A 2R66A 5LZ8A 2PMKA 3KLMX 2J4DA 1VLQA 4NS4A 3WB0A 5JNVA 4JJFA 4IY1A 1DGQA 3GOQA 4JL8A 4P54A 4R2HA 5CCDA 1E2JA 2LTAA 2P91A 2CXRA 2K87A 4WKNA 16PKA 1SIBE 2QV0A 4RL6A 4D8WA 4B71A 5LLTA 3HQ4O 3QKWA 4YUWA 1Y3DE 3LOPA 1MD9A 5CYPA 3U7GA 2JCYA 2WYIA 3GA0A 5EXXA 3WGLA 2ZIEA 3PWSA 1Q92A 3AHDA 3MERA 4FMCF 1Z4KA 2Q3CA 3A9SA 2ZJOA 3C6BA 5D85A 2YHIA 4ZT4A 4BNDB 2REQB 4U9HS 2PG3A 3S1LA 1DFHA 1I6LA 1ZUWA 5IMSA 1ULHA 3QE4A 2NUPA 3BCRA 3S81A 3EA5A 3K9NA 4B2PA 3TXXA 5AKGA 1SZPA 1L6RA 1X87A 1OFVA 3HR8A 1L5KA 2IYWA 1C7IA 2IEIA 1T4CB 4HDMA 3VHXA 2QTHA 2FRVA 1FDIA 3EY4A 5C4MA 2XCSB 1L5RA 3JXEA 1QRTA 3MWEB 1MUUA 2XUFA 3A6JA 5FNZA 4N5IX 3WR5A 1C9MA 1YO6A 2RHBA 3CRNA 2HA3A 2W2TA 3KLOA 5AXCA 3N0XA 1JALA 4O0MA 4DIMA 5AVVA 2WIKA 4Q1DA 4LDQA 2FG7C 4NLLA 3G5AA 3SSOA 1OXBB 4FEYA 5F2EA 3DO6A 2ZE8A 1I7DA 2HBQA 4P7KA 1HK7A 2P40A 3OURA 3T3DA 4F3CA 4CEJA 2FZ5A 1P19A 3TUZC 4QLOA 2JJ1A 2QDKA 2YXLA 3MFQA 3QVVA 3FOCA 3C5VA 4ZOLB 1CBUA 4DC1A 2AZDA 1SVSA 1WDWB 5B7GA 3NNNA 1JKFA 3ENQA 4I81A 3RAEC 2ZAGA 1C0IA 4BVKA 3KDAA 4J0DA 2N9UA 4G25A 3U3JA 1NQUA 3GYGA 3DM9B 2VHXA 2AK2A 5JV5A 3FR8A 3DWGA 1P0CA 3FIUA 5AVWA 2F59A 3INGA 4ZDWA 1OV4A 4TUYB 2ID8A 3WYGA 4DSZA 4UEOA 4FFVA 3GLFB 3V4LA 3IUSA 5ELMA 2WD7A 4O59O 3CH5A 2O20A 1DQYA 3AB3A 1VI5A 1CK4A 4QQKA 5A71A 1BA3A 1WB6A 1NOJA 2V7TA 3MWJA 5KSWB 1TUIA 1YWGO 3OQHA 2ZYHA 2LE0A 2C9YA 2AZMA 2OYSA 1CJMA 1P1FA 3CG0A 4WT7A 1XAHA 4OA8A 4WJZA 4DFDA 4H7HA 5E8JA 3W6NA 4EYEA 2VJAA 4KYIB 4NHOA 2H2DA 1MIHA 4CODB 2Q7OE 1QJ4A 1QH1B 5DK4A 1E1LA 2WF9A 3ZDEA 3WQHA 1U0BB 1QS0B 2E4VA 2QD3A 3MXOA 3TCNA 1AGNA 3FD8A 3UJHA 1N8NA 5A9RA 1D07A 2H51A 1EVJA 3GW8A 4MLCA 2H31A 2QJFA 2HJGA 2C5HA 2W00A 4F2DA 1P2TA 4TKZA 1M10A 2I03A 4WY5A 5JEDA 4WASA 2C54A 3ASYA 2KYRA 3GMIA 4KYTA 3LYHA 3OPYB 1E5DA 3ZWOA 4BVFA 1L1FA 3JYQA 1EWQA 1WABA 3IPRA 2C84A 4YUZA 5JEEA 1OXKB 3QPUA 1VP3A 5BMOA 1DMSA 4ZAVA 2W37A 3GV0A 4CMGA 2OC4A 2MIIA 4UULA 2ZT5A 2VEDA 4OYRA 2ZRGA 4AQDA 4DLBA 1RXEA 3I9KA 4EY8A 7ABPA 1MB0A 3TZLA 5F35A 2D2FA 3QV2A 4FCVA 1C3EA 1T5IA 2QZJA 2YYAA 2JLYA 1XA0A 5J2UB 5CT8A 4KRYA 1RJEA 2AD1A 3W90A 1WOMA 3BFPA 4P32A 1E58A 1NF2A 4R16A 1ISGA 4ASUA 3THOA 5IFKA 3T94A 1N1GA 5K0GA 2QR3A 1JMYA 1YONA 2HBYA 1IZ9A 2DPLA 3GAFA 3GJXC 3HYSA 3KPJA 4HEJA 4S1PA 3GC6A 1X7WA 2BBSA 4YROA 3ZHTA 4E1BA 1OWNA 3SDBA 4GVLA 1NM5C 3CEAA 3IDSA 3TJRA 2X5XA 4Q93A 3C4VA 4PXAA 1II0A 5KYXB 4L02A 2GWRA 4A8TA 2QNRA 2BYTA 4FYWA 1O94C 2RGCA 1GNRA 1X13A 2CNDA 3MJCA 4OJTA 1F51E 4KZPA 2AIRA 3MUOA 5TQVA 1GCGA 1GKKA 1DINA 1Z07A 4JMPA 2HYDA 3HHEA 4JENA 4PAGA 3BVPA 3HKBA 4E5SA 1SOWA 1EK1A 4E21A 4Q7EA 5K0JA 4JSRA 3GZTB 1U9ZA 1NW7A 2DFLA 2GFHA 4HY3A 4EB6A 1UBHS 2WAMA 4LQLA 5GOTA 4LOKA 4P5PA 2XRMA 4V0SA 5JS1A 3DZCA 5IYZF 3TLEA 1PEAA 3C6ZA 4PG4A 3S40A 3ZX5A 1KEEA 2YH2A 3QY9A 5EE9A 1JQ5A 1NUQA 2OT3B 4I9UA 1J49A 4YY3B 4G23A 5C1OA 2WJIA 5CM9C 2D00A 4NMMA 1JQDA 5LQCA 1NT4A 3CA8A 4RZUA 4TLLB 1DKUA 1XTIA 1YBAA 5LQMA 3MTEA 3UPTA 1PW7A 2ZK7A 2X0EA 3ET5A 1E64A 2LXNA 5FPQA 1OFUX 3M49A 4J16C 4HT3B 1DCKA 3HEMA 1XB2A 2ZS7A 5KYUA 5EERA 1NAHA 2OD7A 4L73A 1LSJA 2G0NA 5FFFA 3FHTA 3GJRA 5KCMA 3LY5A 2FGJA 2Q6TA 2TMYA 2C92A 2GLUA 1SKYB 2YIMA 3FDZB 4DDWA 4UHBA 2IHUA 1CETA 4MUEA 2PO5A 1SBCA 2AKAB 2NVUB 2F6RA 1T0JB 4A8JC 4C4TA 4D0GA 4YO8A 1ZCJA 4IJMA 1N2HA 2IU3A 1G17A 2UYQA 2EBWA 2VAMA 3L92A 1G18A 2LCFA 2X1MA 1IN5A 4KL8S 4RK7A 5SZKB 3ZWCA 1FU7A 2LGJA 3OE7A 4HEA1 5FNVA 4DYVA 3IB3A 4ZGBA 2QTAA 3NHZA 1K7XB 4I3HA 3WYNA 1VKZA 4D1YA 1FYEA 1ORVA 1V47A 1W88B 1GKLA 1ZZEA 3NIWA 4JASB 3S7TA 1SCNE 1TUGA 1K8RA 5HJ2A 3K4PA 4P08A 4XFJA 5CFNA 2H6EA 2RHGB 2V6FA 5KNCA 2BR4A 4EMSA 1II8A 4NAVA 2OCKA 1A5TA 3TTSA 1X92A 3K0KA 4H7IA 5B37A 1JLLA 2WG1A 3O3MB 4O33A 1B0AA 2CE7A 3NJ8A 3ROXA 3BSWA 5CVUA 3R3VA 4C7JA 2C61A 4IIFA 2ZGVA 5JD6A 2NV0A 2JFXA 1DC6A 4GUAA 1N7IA 2AFHE 1VSQA 1PUIA 1CS4C 2B83A 2DFPA 2C99A 1T2AA 2GK3A 4IQFA 2CFTA 4U1RA 4AJPA 4BE9A 1LDEA 2BFNA 4GWLA 3G1TA 4LXGA 1K6EA 2GMWA 4IG9A 2H3HA 5H59A 5B55A 3AP3A 4ZV7A 4A91A 1B1CA 3T3PB 2EFGA 1A8UA 1W44A 2J5XA 1A8IA 4KBYA 4L9RA 3DWFA 4Y67A 1SH7A 3EUEA 2YJZA 5DI3A 4AJEA 1KYQA 3FLMA 1LW6E 2IH5A 1X3LA 4I1PA 1U0NA 2PRJA 3K0FA 2GAJA 4US1R 1THGA 1JX6A 1N3BA 3AL2A 1G60A 3L0SA 4YQEA 1MV5A 2BUCA 3LQQA 5J4LA 2BFDA 3TLCA 5I7HA 2HBRA 4OMCA 4ZMSA 1TU3A 1Z73A 2HGSA 2JIDA 4XKJA 5AM1A 3CX4A 1P62B 3UWKA 1KDPA 4PWZA 1QZZA 2OSBA 1PG0A 4I1RA 3PNPA 4YRTA 2YC4C 5AUOB 4CPDA 5EIEA 3UJ8A 2I4NA 1IHXA 3L4EA 5F33A 1B2LA 1ZNQO 1KE1A 1MGOA 4CMBA 5BRAA 2HU8A 2PCLA 2YDXA 4DIDA 5CA0F 4GYYA 4MRSA 2WT4A 1HFEL 3VHLB 4R01A 4YX9A 3LC2O 2G76A 5L40A 2YWGA 1AUXA 1I6KA 3FSGD 2Q4RA 3IAM1 5E4TA 2JHAA 4ER7A 5CD1A 2IODA 2QN2A 4J0KA 1LFAA 1NHWA 2A59A 2COKA 3LHDA 3ADPA 3P2KA 4IIJB 4Q21A 4WCDA 3VX3A 3PQ2A 3QPWA 2NP7A 2IZOA 5BR1A 3NHMA 5JXIA 1Q0HA 3ZE0B 4AXBA 4HC4A 1P1BA 3Q7RA 3LECA 1CQZA 2HSGA 2PZBA 4IOLA 4M1OA 3L06A 4DJJA 2Q1UA 1XEWX 2DBQA 2GEJA 1RRMA 2PGIA 3OEWA 2H57A 3H7AA 1CZOA 2FETA 5EIBC 1D7AA 3GZJA 4M7PA 4M1MA 3VGJA 5CA1F 5IAEA 1NVVQ 3ILVA 4F6RA 5LYJA 4F71A 2CJPA 3NTVA 2M1XA 3L01A 2PPVA 1F6BA 3H5NA 5E7MA 4ZVKA 3HDHA 5H7XA 1FS6A 3F7MA 3H13A 4ICIA 4BB9A 1B14A 2HHAA 2PJUA 3LJKA 5CIYA 3PWTA 1VG8A 4BZXA 2FR1A 3UK2A 1IE3A 1XQYA 1DT3A 1GRCA 3LLSA 1DVRA 1LKZA 4LMBA 4ESEA 4CI0B 3D3KA 1W59A 4JGBA 2BPOA 2EQAA 3M70A 3OT1B 1OC2A 4IVRA 1EFHA 3ZGXA 3GJ3A 3KEQA 3MGCA 3P2IA 1LPOA 2G1JA 5E1DA 2C0QA 3L4BA 4XLZA 5U9CA 4DW8A 1OXXK 3UJCA 4LZLA 3X2FA 2A1TR 2OZVA 4MV7A 3D7RA 1KY4A 2P67A 2I6UA 4QO7A 4UNQA 3PIRA 3VI4B 4B3MB 1KEKA 2EBHX 1XTQA 5AW5A 4EZIA 3VU9B 3A25A 5JDIC 3GYBA 3AF1A 4HX9A 3UWOA 4EG5A 5KTPA 4LDAA 4KNYA 4QG7A 4BB6A 2OMEA 3KPYA 3VJRA 4GOXA 4KQFA 5D8DA 2JC3A 3CRZA 2O5CA 1N8KA 2X3UA 4X7PA 3RFVA 3DL7A 5GGXA 2I3AA 3WHLA 3EFEA 3WLLA 5K5EA 4JR1A 1YQDA 1OYWA 1J42A 2BEVB 3CVYA 1EFRA 4HDKB 2CZQA 4TT8A 3DWIA 2FXVA 2YUIA 1PR1A 2OFWA 2WHQA 4ZT3A 1R16A 1NMZA 2WILA 4I5DA 1K06A 1VG0B 2FEKA 4RV4A 4D4GA 1NN5A 1WPXA 4CETA 3B3FA 1JT2A 1FLVA 1SULA 1V0JA 2IUFA 2LUOA 3BXHA 4PZDA 5L8VA 1ZGJA 2WWFA 4Q3BA 4N5LA 1VL5A 4NOKA 3WWZA 5KOHA 4LJRA 1IB0A 1ZQ1A 3OLVA 4DCOA 3W1VA 1JFTA 1T9GS 3HNRA 2XCQA 1B76A 1UINA 4R2JA 1E3MA 4YTEA 5YASA 1KZ9A 2AFRA 1N2ZA 4J43A 3VV2A 1HBJA 3U4QA 1YGPA 2ZQZA 3R0QA 1BU5A 4ZOCA 3DO8A 4IP0A 3FOAA 3UJDA 2I87A 3HBNA 5BQFA 1GU7A 2PTGA 5AVZA 4RTOA 1BX1A 2O8FB 5K8IA 4HDCA 1Z88A 3G9TA 3Q8XB 3UJAA 5LD2B 2LCIA 4EGCB 4PO1A 4BGDA 1Q7RA 3FPAA 1AHNA 4R1SA 3AZQA 1XJQA 3KL4A 1LX7A 1VCOA 4E14A 3CWZA 3GN2A 2HA6A 2XGGA 2P5UA 4QTZA 3HCBA 2Q99A 1K75A 4GDFA 2JBAA 1Z75A 3C43A 2DUMA 5SY9A 1VHLA 5DISB 3E4CA 2QZZA 1QU2A 1D8TA 4UZEA 3N2GB 4XGQA 3F0TA 4OD0A 3IQZA 5IXSA 3R5JA 4NENA 4ZO4A 1YBVA 3B13B 1K88A 3C6MA 4MZDA 2O7VA 1KK3A 3NALA 1U2QA 4GYJA 4HHEA 1W5FA 2A0XA 2BRUA 3ASVA 4MQBA 1DBSA 3K1YA 3WL7A 3NASA 4HVTA 5D6NA 1KMMA 3ZXYA 4NBNA 4Z54A 1VDZA 4QXRA 1FNMA 1SXPA 1AY0A 1X7XB 5JOQA 1ECCA 2WB2A 4CEHB 2J30A 5CJJA 3EK2A 3GLIA 2IYQA 1W1WA 3LZ6A 4PRKA 2BKLA 2LCQA 1OKKD 4JP1A 5LU8A 1DAEA 3ZKWA 3F8WA 2CXXA 1ZNYA 2Q21A 2ODWA 4GX0A