3NV7A

Crystal structure of h.pylori phosphopantetheine adenylyltransferase mutant i4v/n76y
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
KVGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMIQLATKSFKNVECVAFEGLLAYLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPLISKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of H.pylori phosphopantetheine adenylyltransferase mutant I4V/N76Y
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 41
structure length 155
sequence length 155
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nv7A00
1NUUA 2AKEA 1N2GA 3I05A 4H3SA 1MB2A 5J58A 1LW7A 3CVWA 4YMIA 1OWOA 4F4HA 1T6XA 3IOCA 1K4MA 3IODA 2IJGX 2E21A 4XSVA 4HK4A 4ND7A 1TFUA 5LFAA 4ZCQA 1GZUA 2WQ6A 3H05A 3G6KA 1NUQA 1KH3A 5KCMA 2G36A 5FNZA 1WXHA 2YY5A 1IHOA 1I6LA 3ND7A 5FO0A 3AG6A 1N2OA 2X3FA 3INNA 3IUBA 1J1UA 1K97A 3M5WA 3NBAA 1F9AA 1NP7A 1H1TA 3S3TA 5JBNA 2Z08A 3FWKA 2CYBA 1H3EA 4X0EA 2DETA 4DNXA 1Q19A 2CUZA 4MWBA 5IHXA 3QE4A 3TQOA 5HG0A 1T6YA 2E89A 1O94D 3DV2A 1Q77A 2YWCA 2QTMA 4MUIA 4DDKA 2RD2A 1WXEA 3CVYA 2DLCX 1JMVA 1QNFA 4MW2A 1U0BB 4UZEA 4TS1A 4NAUA 5TEVA 1LI7A 2PIDA 3CVXA 1YUMA 2J4DA 2QUJA 1M1ZA 1DNPA 2J09A 3FETA 1QJCA 4ZCPA 4EFKA 3LE8A 1ZH6A 4U7JA 3CLUD 4CDMA 3ND5A 1EFVB 1EUQA 2AZXA 1KQPA 3HV0A 1PFWA 3FY4A 4MQ6A 1ILEA 4KKVA 2JANA 1QRSA 1NSYA 2DXIA 3TNJA 1IVSA 1EFPB 1JILA 4ZT7A 2BYTA 4RUKA 2RE8A 2CV1A 2PZAA 1F4LA 1ULHA 1J20A 4S1OA 1V47A 3IMGA 3AL0C 4PY2A 4ZT2A 1OWLA 2PZ8A 2WSIA 4MLPA 4MW5A 4AQ7A 3GLVA 3ZXSA 4YBRA 3RHSA 2V0CA 5BNZA 1MRZA 1ZUNA 2O8VA 3A04A 4MW6A 1R6XA 3FH0A 5F23A 3Q10A 4OUDA 4P2BA 4MUHA 1IQRA 2GKSA 2YXNA 4ZCRA 3FIUA 1KH2A 3CLRC 1EJ2A 3CLSD 1JEDA 3CVVA 3IUEA 3AIIA 2CV0A 2VTBA 4EG1A 1U7XA 3GUZA 4MULA 4E1AA 2WB2A 3L93A 4J76A 2HGZA 4CDNA 1GAXA 1U7DA 4MW4A 1P7PA 3HL4A 4OJMX 3X1KA 1JGTA 2H29A 3PXUA 2CYCA 2X0KA 4R2LA 1TYCA 1VBMA 1KH1A 3NV7A 4G6ZA 1MB9A 1NI5A 1WQ4A 1J70A 3LCJA 3SEZA 4MUNA 1QRUA 1J21A 2D54A 3GMIA 4MWCA 5K0TA 3H97A 4QBTA 5H7XA 3L92A 1NYLA 1R6TA 3KT3A 4MUGA 1N1DA 3RFFA 1LI5A 1BS2A 3VGJA 1O0BA 1OBHA 3DLAA 1Y42X 1M8KA 2CYAA 3P0IA 1PFVA 4NATA 1WY5A 1OBCA 2ZP1A 3DO8A 1N77A 3ZJTA 2Z09A 2E0IA 5DB4A 4K03A 1M8PA 3UMVA 2DPLA 1U3CA 4F3RA 5K0SA 1XNHA 4NX2A 3N05A 3TQIA 4GRIA 4KR6A 1GPMA 4L2IB 1MBZA 3P52A 4CT0A 3K9WA 1VBKA 2CT8A 4JXZA 3OTWA 2CV2A 2HZ7A 5TEWA 2BTEA 3TZEA 1KAMA 1S4MA 4KR9A 3MXTA 2QJOA 2HMAA 2QTRA 4JXXA 3SYTA 3COZA 3ZGZA 3VRHA 3ZIUA 1NUTA 1F7VA 1N78A 4G5YA 2DERA 1O5TA 4MUKA 3IMEA 4I6GA 3N2YA 2QUIA 1JECA 1UFVA 1VBNA 2JAXA 1O96A 3IOBA 1HYBA 3PNVA 4HJRA 1JHDA 4EG6A 3ZUGA 1VL2A 1O95C 2A1TR 3RJZA 5H16A 3COVA 2A1UA 3UK2A 2NSYA 1TYBE 4CQNA 1H3NA 5HUJA 1F7UA 4K0RA 1COZA 1N2HA 1KKUA 2OV4A 1MC1A 2X1LA 1NUPA 4HJXA 1KQNA 1G59A 1EXDA 3KFLA 1SURA 2A88A 1WJGA 3IVCA 2YWBA 4MWDA 2CFOA 4MUFA 1FYDA 3N8HA 1NURA 3Q12A 4KPUB 2GOYA 4MW9A 2D13A 4R0NA 4DJAA 2NZ2A 3FHJA 4NAHA 1OWPA 2OQ2A 1JIIA 1N75A 4PBSA 4EF6A 4ARCA 4EGAA 1XNJA 1KR2A 3AKZA 2R5WA 3MUEA 4XFDA 4ARIA 3BL5A 1IH8A 3COYA 4MW7A 3UC5A 3D6VA 1G8GA 2DEUA 1M83A 4YP7A 4MAFA 4QREA 3HGMA 4YP5A 3X1MA 2CSXA 1H3FA 1XNGA 3CA8A 3U1VA 4WSOA 3F3MA 3IVXA 1TQ8A 4EG3A 1CT9A 4MUEA 1ZH0A 1I6KA 3E27A 1R6UA 1JZSA 1IRXA 2B7LA 3CLTC 3LOQA 5HUHA 1KP3A 1N2BA 3AFHA 1WXFA 1KP2A 2IELA 3MLBA 3QTTA 4MVWA 2A1TS 3IDFA 4U63A 3H9BA 1N2EA 5KHAA 1T6ZA 1N2IA 1JZQA 1I6MA 2PG3A 3X1JA 2QUHA 3G5AA 1NZJA 1JEEA 3PNYA 2ZUEA 2PXHA 3ZJVA 1JIJA 3C8ZA 3A2KA 3CLRD 3IVGA 1T9GR 4FZJA 4ZT3A 2QTNA 1WOYA 1MAUA 2J5BA 5DK4A 3HFJA 1K4KA 4I6JA 3ILVA 1KQOA 3IOEA 3CLTD 2J08A 4WNYA 4RPIA 4ZCSA 1B6TA 1O0CA 3MMXA 4XFJA 4ZT6A 4OUDB 3COWA 3TS1A 2V0GA 1PFUA 2PZBA 3N9IA 4MVCA 4A91A 2QUKA 1QRTA 3ZXIA 3VU8A 5AHWA 2VTBB 1NUSA 4EG7A 3IMCA 3ND6A 1O6BA 2A4MA 4JFAA 2GM3A 1J09A 3PRHA 1EE1A 1EFVA 1EUYA 1Q11A 1GLNA 3SZ3A 1X8XA 4NZPA 1O94C 1G8HA 4J75A 2A84A 1D2RA 1U3DA 3IH5A 1IFXA 3P0HA 2H2AA 1GTRA 1PFYA 2A86A 3D6UA 4NDAA 1IQ0A 3RK0A 3SZGA 3ZJUA 1EFPA 4PBTA 1WXGA 4EG5A 3FDXA 3AG5A 1MOPA 3A05A 2WQ7A 4KR7A 1JIKA 1MJHA 3CLUC 4KPUA 4MVXA 2X1MA 3CVUA 2QJTA 1OWNA 4DDMA 4HPWA 1X6VA 4MW0A 4I6EA 3H99A 4MVYA 2AG6A 5KWVA 3Q4GA 1QU3A 1GN8A 4UZFA 2O5RA 4YP6A 5DASA 1T9GS 2PFSA 1GTSA 4ZCTA 1PG2A 3RBAA 3OP1A 4PBRA 3FG9A 3G59A 4GU5A 3KT6A 3RK1A 5J59A 1A8HA 4Q93A 3SDBA 3SEQA 3HMQA 2EJCA 3ISJA 1OD6A 3ELBA 4ND6A 3UOWA 1RQGA 1WXIA 5TGTA 3DPIA 3HZRA 5DEOA 2E18A 2DUMA 2J07A 2D5BA 1O95D 3SP1A 1ZJWA 2XRZA 2ZUFA 4DLPA 1WQ3A 2EL7A 4R2MA 1QQTA 3CLSC 4DE5A 1KORA 1WKBA 3K32A 3FNRA 1PG0A 4MW1A 3FI0A 3CR8A 4JZYA 1TYDE 5EKDA 1O96B 1KAQA 1XJQA 1WZ2A 2XRYA 2C5SA 3UY4A 1QU2A 2Z3VA 1Q15A 4U8HA 4JYZA 1O97C 2A1UB 2VXOA 3PNBA 1N2JA 3H9CA 4G5FA 3JXEA 1TEZA 3P0JA 1YIDA 4QRDA 1M8JA 4Q16A 4AS1A 4ZT5A 4DDHA 1YI8A 5IJXA 4MUJA 1J1ZA 4L2IA 4BWVA 2QJFA 2DR2A 3KT8A 2A7XA 3KT0A 1QTQA 1OWMA 3FOCA 1MAWA 5LM3A 3A4IA 4ZT4A 1TYAE 1I2DA 2I1LA 4EG4A 1FFYA 1YIAA 1K92A 1YUNA 5LLTA 1G8FA 1O97D 3NBKA 1VLHA 1IQUA 2IP1A 1YULA 3TZLA 2TS1A 3MLAA 1M8FA 1M8GA 5FO1A 1N3LA 5J5AA 1V8FA 2JA2A 5TS2A 4EG8A 3QTBA 4MWEA
chains in the Genus database with same CATH superfamily
3QOWA 4HMQA 5KTOA 5D3MA 3WYEA 3BRCA 2JK1A 4JEIA 1CFZA 2GN2A 3GGGA 1L4MA 3MJEA 4FSXA 5AVJA 5EPOA 1R4NB 1UFQA 4URUR 4UHEA 3AUKA 2Y9MB 2VCHA 2GPJA 1P39A 2CLKB 2PZFA 1T6XA 3BG5A 1KFKB 2WKSA 1QPGA 4QBFA 3VSDA 3BD6A 1D1SA 1RYFA 2QOEA 1KDYA 3IP6A 5J2TF 3P32A 2ERYA 3CRVA 5BRAA 2FMHA 3GNTA 5C4GB 1X7YA 3ZWQA 3IAEA 2E21A 2Z30A 3WC4A 4BVJA 2ZITA 3GEGA 2QDKA 3WKDA 4FGWA 2BFAA 4CQMA 2XODA 4M1SA 4F9EA 1XDBA 4Q1FA 3RKUA 3O1JC 1P3DA 1N34B 3K9QO 3E03A 4X7PA 4E5YA 4G01B 2EGHA 4ZJYA 2NN3C 2JJ8A 4AY4A 3E58A 1OXUA 1TO6A 4IVNA 1I1NA 3Q6MA 2YY5A 5TQ2A 2DPYA 2F6RA 1S3IA 2NT3A 2VRCA 3D6NB 2R6FA 3JZMA 9ATCA 2I8LA 2WWGA 4RMHA 4DV4B 3LFUA 1DKPA 2X6QA 3SMQA 3LGXA 1C0EA 4PRZA 1KS9A 4MQEB 1YRHA 2I4MA 5BN4B 1P6QA 1DX4A 1VYUA 2H16A 1V0JA 5AICA 1WV0A 3IKVA 4FSHA 2G6TA 1ABEA 1A9SA 1FZQA 5EOVA 4YUVA 3X2EA 4BMSA 5A6SA 2H1VA 4NYJQ 2CBGA 5CDFE 3KB8A 4DLVA 1TEVA 2PLWA 2DLNA 5G4LA 4IKPA 4LOKA 3DV2A 3FSGD 3DLTA 4PQFA 4MRRA 2Z0MA 3HJBA 1LS1A 4D81A 3C3JA 1Z2OX 2C0QA 1ZCAA 2DULA 4BMVA 1U0BB 2OZEA 5ITSA 1GJRA 1KJJA 4KH1A 4GE3A 4V03A 4XX0B 1LI7A 1RYEA 1ZCBA 4QODA 3U80A 1HT0A 2J4DA 5T4BA 2WWYA 1WSDA 2PUCA 4OXKA 3DE3X 3FSEA 3II6X 1X7HA 4FB4A 2C3OA 4A0RA 4DZZA 1MAHA 2FHPA 2R44A 2VK1A 2IP4A 2OM2A 3AV3A 1NQWA 1SELA 2OILA 3FLAA 3LHKA 4OU5A 1W96A 2B8WA 3D3JA 1PJTA 1VB3A 2HA7A 1YVPA 3MHPA 1MJNA 1HOTA 1FLDA 4KKVA 3VQTA 4MARA 2PO5A 2FSVA 5JE8A 4IYJA 5JLJA 4L3WA 5DOZA 1UIMA 3B1ZA 3BSFA 1F20A 4JI6B 3T9BA 1PTJA 2ZWMA 3ZIDA 3JWPA 5KC8A 4XFKA 1NNI1 4OXIA 3V1UA 2VSQA 1G5FA 1YQUA 3HPQA 1P7CA 1U99A 1XTJA 5LXTA 4L8LA 4KNWA 3S2UA 5H5JA 4UQOA 5K51A 1FIUA 3ZWOA 1G3IA 1B00A 2WSIA 4O4HB 2Y1GA 3IHKA 2H5LA 3FUTA 4MLPA 4OP1A 5I3CA 4KJZA 2FZEA 1X9IA 1BU5A 2LNDA 3VPHA 4JODA 3WWYA 5AR1A 4A10A 3AR9A 4FYIA 4CNQA 4HDMB 5IT0A 4FJ2A 2O8FA 4FN4A 3Q8MA 3H2YA 3WMGA 4R83A 4P4TA 2FR8C 3I23A 1QORA 1CNFA 2VI5A 1RXYA 4XVUA 3G9XA 3IKJA 3FCOA 2QD1A 3O73A 1Z7EA 3LHSA 3E9DA 1E3DA 3DBHB 3CRRA 3M5DA 4RJIA 5AHOA 1EJ2A 3UMSA 4OFBA 3CVVA 3USCS 1G8YA 4LRQA 5FL7A 4TZ6A 3RRMA 1SXQA 2V0NA 1J0EA 4MHSA 2BGJA 1GGFA 1V11A 2SKCA 1VSVA 3I12A 3OIFA 5FPYA 3S2IA 1DKUA 4HAVA 1G7SA 3HUEA 1QR2A 1IZ7A 2QXUA 5CRIA 4Z9BA 4RANA 3WLAA 2DUJA 4W9NA 2GUWA 2O5VA 3VHXB 4WWHA 4QU5A 4DL9A 2CK3D 2PN1A 3WV5A 4DA8A 1USGA 4NDZA 1S2GA 1SB9A 1VPVA 3CTMA 4LHZA 4PVCA 4TL7A 4X93A 3FTNA 1UR5A 4AO7A 2ZPTX 1E8DA 3PPXA 4KLZA 1K7XB 1MGPA 3I2KA 3CONA 1NI5A 3HGQA 2EYUA 3PWSA 4OI0A 1VPEA 5FRDA 5BPFA 1ZL0A 4RXMA 3FCSB 1I36A 4I5DA 3WK6A 4FYVA 1V8ZA 4TKMA 4NTZA 4HAOA 3TOZA 2WSYB 3WJ2A 1H0RA 1ZJ6A 4MV9A 1QYVA 1O08A 2D54A 2Q1WA 2ZYRA 3IQXA 4Y0VA 4MB2A 3OJEA 3DJYA 2D1FA 3GQVA 3HCWA 4JLUA 3TOCA 1J8YF 2HJVA 3FDZB 2YC4C 1R6TA 3BGVA 3KAJA 4OFWA 4P22A 1HE3A 2A67A 3EGIA 1SCUA 4ZFNA 3TKLA 4EHIA 1TZCA 4BGUA 1BOOA 3R20A 3RLIA 4C05A 2B1IA 5FOQA 3OTHA 3PT9A 1V43A 5B37A 4Q1CA 2V7GA 3G0IA 5TT0A 3FROA 4I4LA 1PR6A 4LTNA 1JVNA 1SKYB 3EFOA 3AJRA 3CH6A 5ALMA 4MV0A 5DEIA 5IBCA 3NTOA 3G8CA 2P0AA 3K7EA 1H1LA 2F7SA 4TRMA 1JLLA 1N4DA 3MPOA 3WXMA 5DK6A 3VKHA 2BMVA 3N87A 1WPXA 1V16B 2GETA 4DLZA 4CPDA 3RVBA 3CRQA 1ETHA 2GZDA 1YZUA 5F7ZA 3D3WA 3F9IA 4NMWA 5LNK6 2LBPA 4QA9A 1WMDA 2XMPA 4JQSA 1WU7A 1IN7A 1XKLA 2V9ZA 3Q7TA 4QBKA 3VC7A 4NC9A 3I2IA 3AEKA 5EE1A 4DV6B 2HMAA 2IYOA 2VH2A 4CV0A 4C4RA 3B70A 3I5YA 2PA0A 3GPIA 5CG2A 4M0FA 3Q9SA 1UMDB 3HA3A 1PDOA 2OXRA 3I01M 2NUPB 2P62A 1O5TA 1C4KA 3HXLA 5CX1A 3FUCA 3PHIA 2DFDA 4YQYA 1J90A 1GQ2A 1SOVA 2DWCA 2FQXA 2HJGA 2WU3A 1DTWA 1S3SA 1ZJZA 1FSGA 1RQNA 2JAXA 4DW8A 1S2IA 2FFRA 1LX6A 2AD5A 3IUPA 1V9CA 5JISA 4UCQA 2C0CA 3HN2A 5FPQA 3V9PA 1W5BA 4F96A 1QWOA 3ZUGA 3WYFA 2B5VA 4IFEA 4KC0A 2FRVA 3EBPA 4N8DA 3BJEA 1K5GA 3O2NA 3UT6A 1NXSA 2HK8A 3W1EA 3ZHBA 4F5YA 4IDFA 4ILEA 1FB5A 4TQUS 4K0RA 1SCIA 3PQ2A 2ESRA 2HWKA 2RH4A 2ZATA 5J4KA 3U7JA 4AP5A 1I1OA 1A98A 4M8SA 3OM1A 5BMVA 2O14A 4J49A 4XUEA 4RMIA 1TADA 2QJWA 4US0R 3SI7A 1BYUA 1JDPA 4B73A 4DSUA 4E6EA 4RULA 3ZV4A 1BQ4A 3R7DA 1IG3A 3DF7A 2LDBA 3E70C 1EXVA 3FZNA 1X7GA 4ND1A 5I51A 3KQMA 3NIFB 3L7KA 4F56A 1N4AA 3UB3A 3SOPA 4C4ZA 2XD4A 1PGPA 4Q3AA 4CKCA 1LI4A 5IF9A 3U9TA 4EFDA 3M1YA 2EZ4A 2MOKA 1A76A 4IJVA 1OU0A 2J6IA 2WJ3A 1UPCA 3F8WA 4WXYB 2A2ZA 5E3JA 4L5CA 4NZOA 3J7AC 4I3FA 5EHIA 1KEEB 1PZGA 4LHSA 4O59O 4D0NA 4OXXA 3M3DA 3DZDA 3RI3A 1YQGA 1QO0D 5ICMA 1BXRA 2GJ9A 1KMMA 2R6AA 4MW7A 1JVSA 4J90A 1IB6A 3OLCX 16PKA 5EZ5A 4DSOA 2YVLA 1TIPA 2ZJYA 3E9QA 4TL6A 3KHTA 4KGZA 4YQZA 3I1YA 2PVCA 2BDUA 2QAGA 2CSXA 4PO3X 3U7GA 1AU9A 4M0KA 4LY6A 4KH0A 1QGUA 2RFLA 3N3BC 3P45A 4TTRA 2ATVA 1R4NA 2Q2WA 3GAMA 1OAAA 2O0JA 2A9JA 3GT3A 3R3UA 4LOHA 4QNNA 4XEUA 3TLEA 3ZYCA 2H4XA 4B4UA 4A8JC 2VEOA 2IBSA 2HM7A 4MQBA 1J33A 3HJGA 2YXBA 4HYQA 3WWEA 1HTWA 1D5CA 2KWIA 3L6EA 3PTLA 4CIVA 1G2OA 3EFHA 2ORYA 4E4RA 1EA5A 1KP2A 2Z8XA 5IKOA 5J43A 1JEYA 4PAOA 4C20A 3AV0B 3H9BA 3I83A 4OF4A 5FD8A 1GARA 2HLDA 1BROA 2A33A 2O3SA 1OROA 3PEEA 1EGAA 2GCGA 3GBSA 3GCGA 1ZXLA 2BFPA 1V6AA 3ELDA 1UWKA 3N70A 4AJ4A 2P6UA 3LAWA 5JZVA 2RDMA 4YQEA 5K3BA 4E30A 1AA9A 3NUQA 4EM6A 3VNQA 3O75A 4ZOCA 4B6JA 1U63A 3SJZA 1E2NA 2NTYC 3P0RA 4MQEA 2CXSA 5BN4A 3M4ZA 4RDXA 3VKFA 4N9WA 2PUJA 1AH2A 4BGDA 1JMKC 1CNEA 3W7AA 3WGOA 4BJ3A 2AGVA 4BX9A 1ISIA 2P2CA 2GERA 3AILA 4FKMA 4RCVA 2WYHA 3W9BA 1EVKA 3X43A 5IK2D 4HMOA 1H2ZA 1U9ZA 2QW0X 3U2QA 2WTUA 4BNLA 1Q74A 3DHYA 4UHHA 4N6GA 4Z7JA 1FU7A 3LLUA 2FDXA 4O02B 2JJ2D 4HAYA 4BZXA 2QKYA 4ZV9A 2GPAA 3UQYS 3ZXUB 3BD8A 1CW2B 4XX0A 1HORA 2OGTA 4C2BA 1IOVA 3JQBC 4EFLA 1Z33A 1N2CB 4I9UA 4REQA 4YUZA 2GM3A 1C1DB 1XTKA 2HFJA 2IK8A 2WWWA 3SKVA 3ONEA 4RLQA 2NYUA 4ENUA 4LXHA 1AV6A 1NUHA 4TMWA 3ZDFA 2VS1A 4Y7CA 1W4LA 1X8XA 4MR8B 1WKCA 1UC8A 3KWJA 1ESNA 4YPVA 1MFZA 4YT5A 1RRMA 3ISVA 5K0BA 4AYWA 3BKWA 4D9GA 3PHLA 3TZCA 5ALLA 4YEDA 3KLPX 5DM4A 2IU3A 1ZR2A 1Z6AA 1DJPA 2WK1A 3F2VA 3GJZA 3CGGA 5K7SA 5TJHA 3FN4A 5JECA 3K0BA 3AEUB 4DJ5X 1NMQA 3CLUC 3K9HA 3GJ4A 4KPUA 4PGMA 3QVJA 5AKXA 4DDMA 3ANNA 1ZH2A 4MGZR 4HFJA 4O4HA 1X6VA 1UJBA 5EHXA 2VH1A 3MJCA 5CXXA 4I4TB 4HWPA 2Q2QA 3C8HA 4HDMA 3VYRB 4BP9A 2C4UA 3I04M 4EHHA 1U2EA 2P2SA 1Y3HA 1G66A 3JD2A 4UTRA 1HTTA 5DHAA 5DNWA 2DPHA 1VHDA 4BQPA 3DTVB 3WSWA 3ROTA 5BQ3A 2Z8YA 1U8EA 1DXQA 1C9JA 3MOIA 3QA3E 3V4OA 13PKA 1SC9A 1RFGE 4B0PA 2BPOA 3QPWA 2QLFA 2GQ0A 3WQBA 2XNCA 3AVPA 3DBHA 1C3OB 3NKVA 5K0LA 2X42A 4TTIA 4EELA 1KY4A 5L9AA 1WZCA 5J4YA 3AR6A 4LGCA 4AK9A 3D7SA 4IQ4A 4D7AA 4KK4A 1R50A 1PKEA 4IUYA 3HCEA 1TLTA 2GT1A 3ABIA 3E5HA 3H5IA 2AYYA 5TNXA 3TTUA 3UHOA 2X41A 1YC2A 1YNOA 3PCRB 4QG3A 1YR1A 1EA7A 3R9WA 5ADVA 5IM4A 3VHXA 3AI1A 4QGHA 4IOKA 4S0XA 2IQ5A 1RLOA 1WB4A 4G67A 3QBJA 5EP2A 5IHPA 4RIHA 4P53A 1PV4A 4Z8XA 3SP1A 3TLKA 1CVLA 3VU3A 2GD6A 3OICA 4QM6A 4UBJA 2E49A 3LHDA 4IJUA 2EFCB 4A1FA 3G2HA 3ZHTA 2WT9A 4D44A 2QVZX 3H1EA 4WXHA 1B7GO 2FSFA 5J23A 3ZE7A 2PKEA 1RAEA 3AR3A 1AO0A 1JF8A 4Y2YA 4Q1EA 5G2OA 2ISQA 2TMKA 2RI6A 3JZIA 4OY3A 2ACKA 2XEDA 3LWDA 5CVEA 5FJIA 2C2BA 4B3HA 3RVKA 5EJ5A 5F2NA 4UPDA 2DQSA 1DZ3A 3FDZA 4K2AA 3MB8A 1DRUA 4ZEWA 2Z2IA 5CUQA 2IUYA 5A3VA 4LF6B 1VKNA 4B7UA 1DWQA 3VHLB 2VJQA 1RU3A 3HADA 3VNRA 4H0CA 4IXTA 4NK5A 1GDDA 1U65A 4YRRA 2JIDA 3JYHA 4KITB 3TNYA 2FWRA 1FTQA 1NXXA 2O3UA 4G5FA 4IIFA 4KO8A 5HK8A 4Z7NB 3G2IA 2VAXA 1I3MA 4KP7A 4URZR 1FY2A 2HA0A 5KX5B 1XU4A 3HEBA 4OLJA 3E48A 4U7DA 4H08A 3DZIA 3PKZA 1UBGA 5DCLA 1ECCA 3O4HA 3DCYA 3PUYA 3SPXA 2YHUA 1V16A 3ROKA 2FF7A 3F1KA 4GO1A 1CZLA 4DLTA 1Q0PA 1RTKA 1VYTA 5CBPB 1TF7A 4RHXA 1W47A 1MEJA 1NP3A 3LVRE 3FDIA 1PTJC 4UMDA 3SS7X 1XAGA 2NAFA 5E8RA 1ZRMA 3B48A 2DFVA 5H83A 3MK31 3NEJA 5JU6A 1KARA 3GGSA 2Z56A 1P19A 1UEXC 1OMOA 3WSTA 4KPFC 3THWB 3NUZA 4B6RA 2BOVA 1IDN1 1VG8A 3OZWA 1UMDA 3RSGA 4JIMA 2NUPA 2ORED 5L51A 1JHMA 2XCIA 3HDJA 4AUEA 3G0DA 3OT4A 5J5AA 5KU7A 1HR0B 3OP4A 3L7YA 4LWQA 1ZEMA 2N1BA 5TVGA 4DJDC 2AWOA 1RI2A 4QJ4A 4XGQA 1S8AA 2YW9A 1DC4A 4GXRA 3I05A 1JR2A 1F06A 2W11A 4H3SA 5B6JA 4A6XA 5B7QA 3J81k 4WERA 2PT5A 4DGQA 2B8EA 4ETIA 4AS2A 3R6WA 3KXKA 1M1UA 2ROQA 2QTAA 3P0FA 4FI3F 3QYFA 3EXIB 4L57A 4OH1A 3UMJA 3H0EA 3V2IA 4EYGA 1M6HA 2O3TA 2C4NA 4LQ4A 1PX0A 3S5UA 1PZNA 1NQAO 1SKBA 3PPWA 4O6VA 1ZGGA 2PX2A 3G89A 4ND7A 1JU9A 3AUSA 1EAMA 1TECE 2IP2A 4M1QA 1RM0A 3CRZA 1TVKB 4MR9A 4NIMA 5FOWA 5LFAA 1VPWA 1RRVA 4Q18A 4WACA 4YALA 5BV8A 5I7RA 4E5VA 1T15A 3KVYA 3PFWO 4LISA 2IOYA 4GX0A 1GPJA 3DGFC 4F9GA 4HY3A 3ND7A 5LIPA 3NI2A 4N3GA 1H8ED 4EI2A 1D6MA 4LZWA 1CUUA 2E4WA 4PSUA 1VPLA 3K1YA 3VBCA 3QVWA 4YYEA 2EJWA 3FTDA 2HQSA 5ALGA 3TQFA 1QR6A 1GPH1 2C9BA 3RTEA 4B2LA 2BI4A 5ENDA 5EJ8A 1KEEA 2QY6A 1ZC3A 2JJ1D 4P4NA 2BGGA 5L7WA 1C2TA 2NYAA 4WBNF 3GJ3A 4L5YA 4M9XA 5AUNB 3ACBA 4FBLA 2N1MA 1P2VA 3BE4A 3ZWWA 2ZE7A 2CJFA 3C97A 6CHYA 5KKCA 1YL6A 4PAWA 3CVYA 1OB5A 4TL8A 4AO8A 1QNFA 3FJ1A 1GITA 4RTLA 4ZAVA 2AR7A 4H15A 1TT7A 4IHQA 2PUTA 4G1BA 4X92A 4JKIA 2VP4A 3Q87B 1BVRA 3E3NA 5NLLA 1W34A 2GK6A 4WNCA 2YUTA 4YIHA 1OJLA 3BTSA 2NO7A 3FKSD 1GQYA 5BSTA 1NU6A 1X39A 1PW7A 4MP3A 3AEQA 3B85A 5T67A 4HRVA 4JZKA 5LQMA 5E7IA 1B6GA 2ZQZA 3RCBA 4BNGA 1PFWA 2BONA 1E1NA 2NSLA 2Q3DA 2ZAIA 4G9BA 1PI3A 4I7EA 1QV7A 1V5WA 4RPCA 1SG0A 4Q82A 1AKUA 3PQCA 4QOFA 3V9AA 2G77B 2EF1A 3CX6A 2WD7B 4DBLC 1BEZA 4CL3A 3PGXA 5EEGA 2BEKA 3FOBA 4JLBA 3PNSA 3PJDA 4BV2A 5EIHA 3OJCA 3DT9A 3MN1A 1ULHA 2EVWX 3DMTC 3TVDA 2Y0EA 8MHTA 4TRNA 1Z5GA 4HVTA 4ZT2A 3R7WB 2P6MA 3RUFA 1Z0SA 2ECFA 4NQRA 4EATA 1T9ZA 1RXUA 2V0CA 2BSAA 4JASB 2A3NA 3I09A 5CFZA 1XDWA 1DKRA 4G4IA 5AVKA 3S70A 4KXNA 1D6SA 4JAVC 2FK7A 4QUJA 5FLKA 1NBAA 2FN8A 5CAEB 3WK8A 5J5CA 3DG9A 1F0KA 2BBTA 4GIBA 4HWRA 1E63A 1TZBA 1Z18A 4F8EA 4FE4A 3CZAA 1XJCA 1YB2A 4LPSA 4W1PA 3ZY4A 4TTVA 3ZX4A 2BHSA 2G0AA 2BGLA 4B6PA 5GWXA 1RSZA 2ZB4A 1C7RA 1KJZA 5K3SA 2CV0A 1VI5A 1N2CA 1Y6ZA 2A9VA 2GBGA 3OWHA 2B61A 1C1DA 4ESVA 3TIVA 3GLRA 2YYAA 3M1AA 4O2AB 4X54A 1ZHOA 2VPPA 1FFBA 1N1EA 1T1GA 2P7IA 5KWVA 4AZVA 2RGNA 5K3AA 4MR8A 3VTAA 2VPZA 3RYCB 1L4GA 1XQ1A 2YN4A 3K70D 4PSCA 4BFSA 5JFGA 4QVIA 5TMEA 1RC0A 3WTBA 2CLFB 1AD2A 1VECA 1HG0A 1FUKA 1USVA 4UD6A 3GMSA 5H02A 3VSEA 1RT9A 3FRHA 1EX6A 3K6KA 2C2HA 2YHIB 4LECA 1SXGA 4QTTB 1WLYA 2X40A 1UZLA 3CO5A 4ICIA 2VDUE 2ONKA 4UBIA 2LIPA 3MQFA 1EFTA 1MQ8B 3AEUA 4DQUA 5KHAA 5KJFA 1P7YA 5FFNA 2G9ZA 3D3QA 4HEJA 1Z37A 5EMKA 5K99A 1CUJA 3H97A 4PG4A 1HDIA 3BIOA 3BPSA 3K5HA 4TMFA 4BKMA 3TLGB 1MTOA 2BDTA 3SR4A 3P2MA 1LI5A 2QAGC 2WM9B 2QX9A 4I4TA 4DIOA 3CEPB 1ZVQA 4XRRA 2XOEA 3VV2A 3CR3C 1OBHA 5CD1A 3WDMA 1J8VA 1Y42X 2IVZA 4DABA 3KG2A 1M8KA 2FUG6 2H6EA 5AIAA 3WRYA 3DTVA 3L7BA 2II6A 3MGKA 2X9NA 3LX5A 3R1IA 3VR5H 1N8TA 5AKLA 1OF1A 2J7PA 3LWBA 4K1LA 4INJA 1GAJA 3TN7A 4N01A 1C3OA 4OX9Y 3W2IA 3LBNA 3SJCA 1HMYA 3DNFA 3TKAA 4JBIA 4YR7A 4KQCA 1W4RA 3V7UA 4CKXA 4XR9A 4NBKA 4ZZ1A 2IQIA 4M7WA 1G9TA 4QJ3A 4NBUA 4TYWA 2WNIA 5DMHA 1E3SA 4PQRA 4A26A 2X13A 5FOSA 4XB6B 2B5WA 2MSKA 3CX4A 1KPGA 1L7VC 4U2KA 1L4EA 4QELA 4WX2B 3K9WA 3DOFA 3A1FA 1YGYA 1LEHA 2HZ7A 5JXIA 3MJDA 4L4XA 4KR9A 2H54A 2P77A 3BXPA 1FXWF 1NQUA 4FFBB 3ZOKA 1QOPB 1EVZA 1EVIA 2C4MA 3EDRA 1E1RA 3D7RA 3ZIUA 4DDVA 5DCWA 1QWSA 5I7OA 1ZISA 3FJOA 1LFAA 3HM2A 4LRWA 4NYJR 1DRWA 4BKUA 3OSUA 1Z63A 2FW7A 2OCKA 1C8BA 3ZTYA 2QT9A 3KJFA 1Q91A 3IQGX 3NTXA 5F1YA 3X1WA 1KJYA 1AZWA 1U2GA 1UBRS 5EIAA 3SX4A 2AV6A 1QBKC 1HYBA 1YJQA 3MS7A 4RABA 5T8KC 2GSDA 3RH0A 5E1DA 4BBZA 1NBEA 5IT4A 1OVMA 4ZOAA 5JCZA 4U6QA 2OKGA 3H9GA 4D9JA 4TVSA 4IIJF 4P54A 2PIAA 1E6KA 1RDFA 3BXZA 2V54A 4LZPA 1KI1A 1SD5A 3EIEA 4HL6A 4NE9A 3KCQA 6Q21A 3NBUA 4TV8B 2E48A 2RHWA 3BS4A 3NVAA 3OM9A 3PNPA 3NIBA 4XW2A 2OMKA 3K8QA 2W8ZA 2WF9A 2Q5QA 2XUDA 4P98A 3NASA 5KX5A 3I5UA 4BLRA 4GI7A 3QXGA 2BI8A 3FI9A 4F4DA 1YR2A 3CIFA 3GFVA 4K6GA 2H11A 3LCRA 5EGNA 2OHJA 4NE2A 4U7WA 4JVLA 5FWNA 4JSYA 1D2GA 2PLFA 1CF4A 3ZWYA 2O5CA 4HVCA 4DBZA 1DG3A 2XR1A 1AQUA 2AL7A 2H4ZA 1BG6A 3A4LA 1CDEA 1ZBQA 4JMPA 1WG8A 1L5HB 1SIBE 1AO3A 4ER3A 4DJAA 3PX7A 3ILSA 2V6JA 3DXZA 4OM7A 4EYEA 4BNWA 5G1NA 2GPBA 3ZDEA 4EB6B 3QJ5A 5AM0A 3HU5A 3OA2A 2H00A 4HYYA 5T5QA 3THWA 1I4DD 1ACLA 4G0PA 3KR9A 5E4TA 1KZYC 2M6KA 3U3XA 4CF6A 4AQDA 5KNDH 4LMAA 1S4QA 4MPDA 2BFBB 2JAPA 1OLSA 3JSAA 3X44A 5K8UA 2IHTA 1VJCA 2SHKA 4Z4IA 3KPYA 1L4FA 2TECE 3BE8A 3CA8A 4OJTA 4B7AA 4A2CA 2VNIA 1AX9A 4I1SA 1GPBA 1THZA 2EKLA 3GRKA 3IMFA 3O95A 4QE3A 1NN5A 1WNFA 3CURA 4TS9A 1SUDA 1ZGBA 3PBKA 3Q7EA 1OI2A 3TDNA 4DSTA 1Y8ZA 4G9GA 1CF2O 1XEWY 1JZSA 3HCFA 3G0GA 3EXIA 4F60A 3OT1B 3MRVA 2FNAA 3SM9A 1U3UA 3MPUA 4O29A 1AKMA 4UXHA 2JLQA 5ICCA 2XA2A 3BUSA 2VRBA 2OBYA 4Z0HO 1ZIYA 4KPGA 1KI7A 3IDFA 2QL5A 5DTIA 4LFAB 4H1HA 3NB0A 3U60B 1U0RA 4RXTA 1TVKA 2JFZA 3F9RA 2OLJA 3TSWA 1QRRA 4BU0A 1C9MA 2IZOA 2JGKA 3G5AA 3GC6A 4KUGA 4UAJA 4D42A 1MZVA 4BLWA 1V3VA 2CN1A 3BILA 3NPMA 2W4QA 1KEPA 2X5NA 3DKRA 3A70A 2R1UA 2XE6A 2VC2B 4NBVA 3EPJA 1TQHA 4DQ0A 3VH4A 4IICA 2WTNA 3RIHA 4JJ8A 2FDCA 2E7ZA 1P6UA 1H0HA 3QBEA 4BE4A 3KLMX 4J2TA 1U0EA 5CLJA 4J7AA 1RJDA 3N39C 4FYHA 4G24A 4X1OA 3PLRA 5FUYA 5T4HA 1PQYA 3SBOA 5JNTA 2BUAA 3USZA 2JD1A 4L0CA 3COWA 3HNOA 5IKPA 4IM7A 4UDYX 2C54A 3RAPR 1XVVA 2O7NA 2X7XA 4L8YA 2F55A 2GZ1A 2RH8A 2X7HA 1PFUA 2V5UA 1TX4B 1WUYA 2IEYA 3DEYX 4QUKA 4CV3A 2VK8A 3BDVA 5C18A 3BFKA 4QSHA 3UC9A 2IC5A 1TIBA 1OA0A 1QDLB 4K6OA 2A4MA 1W6RA 1LLDA 1PEYA 1XELA 2AE2A 4I9FA 4QVKA 3I4LA 1S2MA 5F7OA 4TSKA 2A9FA 3EVGA 3WL3A 3GLIA 3PYMA 2FWBA 2PMDA 3GNLA 1J2JA 1FLVA 4HXFB 4NMMA 4FOPA 4M86A 4Z99A 4CODB 3WKEA 4GBED 4WXPA 3ZOZA 1ZNQO 5EWJB 1YVDA 1WPQA 5I7AA 4GKJB 2CHGA 2DY1A 5AXAA 3N07A 2WD7A 3T5AA 3GLSA 3D6UA 4UVDA 2ORIA 1S2LA 4ID3A 1F4VA 2JNWA 4KO1S 5T4FA 2I99A 4YWJA 4C9BA 2AHOA 3I9KA 4AKEA 2GBCA 5LZ2A 4WLUA 4NCAA 2QE7D 1HT2E 3IDAA 4RVCA 3EVCA 3R7WA 1I3NA 4IIUA 1BN7A 1XYYA 4J0JA 4LBZA 4R1MA 3ZD9A 3ZQ4A 4E12A 1QIKA 2X14A 3MTJA 2FPWA 4B7CA 1FZTA 2JH3A 3B78A 1PQUA 5CPBA 3G2KA 1DWUA 2EFHB 3JX9A 1ZK4A 4RSRA 2VHWA 4YUAA 2DWPA 4A0GA 4R9SA 1H05A 2OSVA 3B20A 5C5DA 3DVRX 1ZMOA 2PKWA 1Y1RA 3EVTA 5EKXA 3ZI7A 4KLCA 1E7YA 1JI0A 1N9GB 2JCXA 3IBFA 5CAEA 4K8OA 1DFGA 4PBRA 2YJ3A 3O8LA 4NBSA 4PLFA 4X85A 5AM4A 5FBQB 2OQVA 3I1JA 1E2IA 3OC6A 3ADCA 1G16A 3N2KB 3UH0A 4OXYA 5LOVB 5B2FA 1P0QA 1KOGA 3FPLA 2OP0A 4DYVA 1WLSA 3A7DA 4YK7A 2RKBA 4WN9B 4O2AA 2VPIA 3FFBA 4LWPA 4E88A 3HWWA 1OFVA 1BHO1 2VXBA 1VIAA 1WRBA 4OQFA 2ZEJA 3D1VA 4G3XA 4RC9A 4UATA 3RYCA 2H3HA 3ZNQA 4BOYA 2O1EA 2E18A 3MCAA 4NI5A 1FX0B 2VPWA 4K88A 3UT0A 4A2WA 4DLPA 1S8NA 2C59A 3DZFA 4HUQB 3PGA1 4Q7KA 5EA2A 5TPZA 1LXCA 1QGAA 1D04A 4G0UA 1GILA 4MV3A 1KHHA 3K0CA 4H31A 1XROA 2YHIA 4OQZA 3UAYA 1U8AA 2W6JD 2C2YA 1SO8A 3K0AB 1E9VA 1XFDA 3ZY2A 3LBYA 1Z82A 2E6UX 4O4JB 3PV0A 5AKYA 1U3WA 3Q9UA 4RTOA 3LNTA 4AG6A 5B30A 1J23A 1RHUA 4IVQA 5BN3B 1YQXA 3JALB 2D5CA 3TLGA 3WMFA 2B98A 2H85A 2QT1A 2J59A 2V7QA 5G0VA 2ADFA 1A8UA 5AJYA 3BYZA 3KQYA 4OMDA 2IIQA 2A1UB 3V46A 1FXUA 3QLVA 3ZN2A 1B8UA 2RAFA 3H9CA 3QMVA 3OZSA 1CDOA 1XVTA 3L9WA 4G5RA 3ZHCA 5ADUS 3NGXA 1DC7A 4Z1MA 3ONDA 3QIAA 2MJLA 3QFTA 1UT6A 2HK7A 3ZWXA 5IARA 1G55A 3QWIA 1JQDA 1XTRA 1RC1A 2G3YA 1U02A 2HHLA 4UXJA 4LRXA 4EA9A 5JI2E 2OFFA 5LLDA 1Z5OA 5CLFA 4DDHA 1UXOA 2JLRA 2Q0QA 1U5BB 3K9BA 2OO7A 4UDXX 2B4QA 2ORVA 2EW2A 4B6SA 3ZI0A 4NG4A 4MGEA 1NSTA 3SKYA 4CIBA 3MA0A 4K26A 3CCCA 4XYMA 4FZVA 3JD4A 3WAKA 1A9PA 3WJ1A 3A1DA 2Q0SA 1O9GA 4DWVA 2YRFA 2CLIB 2OQRA 4UBOA 4EX7A 1N9ZA 2IP1A 3FCXA 3RS0A 1GCAA 1GKUB 1C1XB 1YQEA 4IY1A 4ZU1X 4EMSA 3T7JA 2BH2A 4C0XA 1DAOA 1XVIA 4P7JA 1BFKA 2XIJA 4LV5B 1TK3A 3I52A 2YFQA 3TB6A 3EXG1 3HKDA 2QIPA 3U3JA 5AOCA 2WKWA 3G68A 3MWKA 4P5DA 3E5MA 3BH6A 4OHVA 1Z5ZA 2PX6A 3RVSA 3L06A 2ID9A 4EF5A 1F4PA 5EXEA 1NVWQ 3G0HA 2M32A 1IPEA 1H6AA 1OWOA 2IHBA 3ASVA 1MZPA 3IEKA 4HO1X 4WLFA 5IJ9B 4BNFA 2HDOA 1F0NA 1QG4A 2P9BA 5IJWA 3PGMA 2IDKA 3F96A 2QG6A 2ZBEA 2VAPA 4TV8A 1E1CB 2O2IA 3A27A 3WHLA 4EY8A 1D4ZA 4DY6A 3ZWPA 3HDYA 4WI1A 1BWSA 3NOOA 3V4FA 3ONVA 1ZD4A 1QNLA 2BBOA 2NGRA 4RLHA 1JPNA 3WLKX 1EM6A 3D8TA 4PM4A 1G4HA 2VQSA 4BYMA 3T1VA 1DT5A 4CI0B 2DOKA 4REOA 3OE5A 1KSJA 3U4DA 3G0CA 1GSAA 4MVJM 1OZFA 3EW9A 3G8AA 5LNK1 3HBMA 3LBIA 5FA8A 2X3FA 3TRHA 5CDTA 2HSGA 2WHQA 1L5HA 3TGWA 3IL2A 2B2NA 3QMWA 3RVPA 3D8HA 2IYYA 2VHEA 4DJTA 1FUEA 4YV2A 2HBYA 4EB6A 5LZ8A 5D84A 3TZKA 1ZA1A 4JNCA 4X9XA 2PAFA 1SAYA 3GLGE 1JKIA 2H0QA 3OQJA 4I5FA 4J4HA 2G0NA 4MWBA 4XQ9A 1TE2A 1Z5WA 5F76A 5JNVA 3W5AA 4PXSA 1Q21A 3TQOA 1W0JA 3OE7D 2WPDD 1LSSA 1XPOA 1K3UB 3NAGA 1X8KA 2BFBA 1QX3A 4DMHA 4HQRA 3AF4A 2ZYGA 3GVHA 4B3MB 1L4UA 1H5NA 1NQVA 3W2TA 4RVUA 4BCBA 2QHXA 5AXDA 1QHSA 4DR6B 4K46A 5DMXA 2EEZA 3V4VB 4NAUA 3N2LA 3FOFC 1DRJA 2QUJA 3CNEA 1QP7A 1MIOB 2VSYA 3A1TA 1J9GA 4BVKA 3NTUA 4CCYB 4CVNA 2ZBVA 4LYEA 1JYSA 3OT1A 1NX9A 4P36A 5JSYA 4U1RA 1NFQA 4IYRA 3I0MA 2RHBA 1QMGA 3KJIA 5J4VA 5C46F 1JLKA 2H52A 1YQQA 1Z25A 3V8MA 1CV2A 4M1ZA 3S8EA 3K2IA 2XCSB 1OC4A 4QBHA 3FY4A 1W76A 3IUQA 4FR5A 3T1TA 3KB1A 2GEUA 4KDCA 2AT1A 2OY0A 4Y8VA 5DN6D 3ZNNA 1BSVA 2P0YA 4PLCA 1M34A 4MWZA 3BIWA 1H6BA 2KI5A 3KL4A 5CM2Z 5JI3E 4RHEA 1JILA 2NPIA 1J00A 2CUKA 1OIWA 2CLSA 2WJIA 3CBGA 3BB3A 3IV9A 5C31A 1DBVO 5K0ZA 2BYTA 4X20B 3NHLA 2Z6UA 4AYXA 2H31A 1Z4NA 2HNBA 4KN8A 1IY2A 1KAGA 3GUHA 2GO7A 3AL0C 2GJSA 4CFZA 3WDLA 3KAQA 2PZ8A 1HL3A 3NJRA 3F7MA 1WKVA 4KQXA 3IPCA 4O1MA 3ZXSA 1U2GC 3T3IA 4RTSA 3EWAA 1GPWB 3BAFA 3NP9A 4Z51A 3A04A 3DMGA 2OPBA 5CH3A 1R0ZA 1ZMTA 2Q4TA 3LLCA 4KXWA 5AI8A 4Z3KA 4FXPA 4FWTA 4Q37A 1PUXA 2OBMA 2Q9AA 4QO7A 3ZD8A 4LF5B 3DHWC 3MHTA 2AUTA 3A9UA 3LKZA 1MIHA 4OUKX 3VR4H 2PL9A 3T52A 5K8JB 3R5SA 1DARA 3EASA 4JU8A 4B2IA 1KH2A 3CLRC 3OU7A 1NE2A 2GESA 3AF5A 3IUEA 1D7OA 2CF5A 4BGEA 4PYOA 5K0SA 2H4YA 3ILYA 3RB8A 4GBGA 2IL1A 4WOCA 4KUEA 2TMYA 4M7RA 4UBNA 3QSYA 2JFVA 4MKGA 4HHEA 4OHMA 3TPCA 4R9NA 4BDSA 1O9BA 2O2EA 3I6QA 4AX8A 3C3AA 1H8HD 1N5OX 3ZZMA 1J0XO 4OJMX 1OFGA 4CM8B 1JEYB 2JHPA 4HB2A 3ILXA 5EWJA 1BU8A 5FBVB 4JCOA 1KEKA 1AKRA 1X1DA 1Z06A 2B4AA 2R1TB 2V4ZA 4PZZA 4X1YB 3SYNA 3TCNA 3NYWA 4E31A 4L8GA 3CJTA 2IHYA 2ZUCA 4PO9A 1WQ4A 3QFCA 1J70A 2X8WA 1JWAB 4A2QA 4AZTA 1XD2B 2JATA 4KQEA 5JCXA 4PHCA 4BUCA 4HS9A 3LPNA 1J21A 1EFCA 3GCXA 3SDZA 4P7FA 5C4MA 1F48A 2V98A 5AKGA 1RWMA 3AIKA 2PUGA 3ZCXA 3MM4A 4EPYA 1T1IA 1SU7A 4RSGA 2IH4A 3EC1A 1FS6A 2A5YB 2XDWA 2GS9A 3VGJA 1UP4A 3SYLA 3WMXA 4DCCA 1O0BA 1MJ5A 5T3UA 2WYVA 5DH9A 3SC4A 5HP4A 1LX7A 3ASZA 3W05A 5ILGA 2A59A 2H1HA 3TL2A 4RIGA 2RCNA 1N9GA 2XBUA 3FKQA 3A6ZA 3M6XA 1NZDA 1ATZA 3PUHA 3S0JA 1JRLA 4RBNA 3AONB 2CWDA 1XCMA 2B5OA 4JLAA 5B3JA 5SYNA 3N7TA 4K03A 1HM5A 4TXLA 5LP1A 3N2KA 4XLTA 3BXXA 5LOVA 2B82A 2ADOA 4BO1A 1Y6JA 1OSNA 1U3CA 4N3NA 1SXPA 4Z1OA 1KYWA 4HB3A 3DDUA 3HY4A 4N5NA 2CVZA 2P2ZA 3PZBA 1CUDA 4PIVA 1RYDA 5G3YA 4Q02A 1YS1X 3ORSA 2BHRA 1IL0A 3H19A 4DF3A 3DVQX 4UAVA 4E5NA 4KSYA 1QAOA 3EQ8A 3R0VA 2YJ6A 1RWOA 1FX0A 2BM8A 1MEEA 3LY8A 4IIBA 3WK7A 5HQ3B 3EEFA 2WICA 1FRFS 5F7JA 2F3RA 4HUQA 5GADl 2RIRA 2HDWA 2PH1A 2X8BA 1ITZA 3QTLA 2V7UA 1N78A 3M81A 3OZVA 1YVRA 4H6PA 3K0AA 5LP6C 2YC2C 5JR3A 1GKIA 4O4JA 1UFVA 2WW8A 1FQJA 3DA8A 3IX7A 4UULA 3DZJA 1BE8A 1OT3A 3V1KA 2J9XB 4F3NA 2YMLA 4HBZA 2OGSA 3HNRA 3HU2A 2O3QA 3JALA 4HJRA 5BN3A 1ID8A 4AKGA 1ISFA 1WSWA 4C3OB 2KYRA 4MIOA 3W6NA 4ZHQB 5JDIC 2A1TR 4Y1RB 3HCBA 3L18A 4MPPA 2JAOA 1AE1A 2A1UA 2HA6A 3HB7A 3OZUA 4IMIB 2AK2A 3DE4X 4IS2A 4XJSA 5GJWC 8LDHA 2ZE8A 4Y3UA 1CZUA 4ACAA 1CC1S 1CDDA 3OPNA 4HGZA 1M2EA 1COZA 1N2HA 4HBGA 1WPRA 4IIEA 2HWUA 4UTNA 3UJNA 1JFSA 1ZSVA 4BDTA 5BUSA 4QQFA 4YDQA 4IXNA 2CB0A 5G53C 5KSPA 5COAA 1VL6A 1FUUA 4M1WA 4EL5A 1RYBA 1E3QA 1SOAA 4P93A 1KK1A 4M9UA 3UMRA 3PDHA 2ZB7A 2IX3A 4Q4CA 4UFOA 1SBZA 1SKAA 3O90A 5HXAA 1RE0A 4YMLA 4URFA 1U5BA 2FTKE 3K8OE 1PFGA 2COKA 1Y5IA 1NXPA 3ABOB 1SR8A 2E55A 3GRPA 2Q4BA 4Y98A 4F04A 2G5PA 4D3YA 2G7MC 4RZ3A 3V8NA 1K6IA 1D7AA 4LJRA 1YE5A 3A6KA 3GA0A 5FLYA 3E61A 2R1VB 4EAQA 4OIMA 1UDRA 2RHMA 1A97A 1C1XA 1YMQA 3GVPA 4PG5A 3ZZUA 4E11A 3IAUA 3SQNA 4Q48A 2PNFA 4YP7A 2J48A 1YASA 2J3DA 1B41A 5DHTA 4LV8B 4RD3A 5JJLA 1Q84A 2W6CX 4D98A 3LFHA 2GXQA 3E9EA 1PNTA 2F1IA 2Q21A 2FLWA 1JQKA 1MVOA 4WSOA 4QGGA 3VPBA 3ILHA 3EEYA 5EL0A 3UHFA 1XHEA 5FR2A 4S12A 4FNMA 4P58A 5E95A 3ISTA 5FTMA 4QM7A 3THYB 5IJ9A 4XWWA 1KEWA 3GRAA 2B9VA 3PC7A 3PFIA 1QFJA 4NV0A 2ZM6B 3I5XA 2P27A 4EUEA 4MVJA 1KFEB 2J67A 4GE0A 1CP3A 1E1CA 4OFXA 3VZCA 2GD0A 4IIXA 1Y6FA 1J9EA 2QSUA 1T3TA 2ZJOA 4RS3A 2GAFA 1LDGA 3LKDA 1WUHS 2Y1KA 2XPCA 3U7IA 5GZ3A 5ULLA 1ULUA 4DEYA 3M9XA 1V6CA 2YXLA 3A26A 5MN4A 4PPNA 3U4QB 4RD6A 3OH8A 3HFGA 4D74A 3HR7A 3ZHRA 1XA0A 2VQ3A 2X8AA 3DZCA 3QFSA 5ECGC 3PD0A 3QPBA 2VUHB 2AQIA 2PXHA 1PX2A 1YZ3A 2VDRB 3K0CC 3QF4A 1RIIA 5EY5B 3B9RA 3IVGA 2XMGA 2D1RA 3M6FA 5CFQA 2ORWA 2V58A 1SBCA 3UMYA 1T13A 2JFFA 3QELB 4RADA 1MAUA 4DAOA 3DXYA 2BCGY 3U56A 4O8ZA 4N47A 2W48A 4B2PA 3GZ4A 2I65A 3O7WA 3FZGA 5K8TA 1XU7A 3C45A 3ZG6A 2GK4A 3MMNA 1E59A 1SQ5A 3D0RA 1PD0A 2P8SA 3GLHA 1QO7A 2IOQA 2B8TA 2R68A 2RI1A 1QANA 1X15A 2X4IA 2GLXA 1W1WA 3G6WA 3NATA 3IPRA 4NU8X 2QUKA 3UV3A 4ME6A 3R0XA 1QB7A 2X0DA 4E5PA 1RAIA 5LQUA 1MIOA 4CCYA 2QRLA 4B3RB 5KSZA 2C97A 2J1LA 2QSYA 3SIPA 1XWWA 2J6BA 3OPYI 1EJBA 2BTOA 3QHQA 2DR3A 1GQSA 1K6EA 4YRNA 2FF5A 2ZS8A 3C8UA 3UWMA 5K0EA 3VAZA 1GR0A 1G64A 1PWZA 1YRQA 3IPXA 2ODBA 4FM9A 3CPJB 2QLMA 2QPLA 3B9QA 3GUCA 5IASA 3LL7A 5FR1A 4UE2A 5CB0A 2C2MA 5HK9A 4C22A 1CF9A 4DCUA 1JWLA 5FA6A 1YA8A 3I64A 3CW9A 1T4GA 2W00A 1LV7A 3ETJA 3SLRA 3P4XA 3SZOA 1URPA 1N7IA 4X20A 5A03A 3OZDA 4E0BA 2JA1A 4GP7A 3F6CA 3SSNA 9LDBA 1MXFA 3CUYA 3SF8B 4UEJA 1KY5A 3WR5A 4OREX 1YZYA 4P0TA 2XWSA 2G6BA 1E5VA 1HPLA 2NADA 4Q03A 3WLTA 2W42A 2OO3A 3G8DA 1W48A 4RF3A 4DLKA 5JMOA 4WJZA 3DJFA 3VYWA 2VXYA 1Z4QA 1XK7A 3MC1A 1BO6A 1FE8A 2E1RA 3GUVA 2VAMA 2HLPA 3V1LA 2HXGA 3K31A 3DB2A 5SICE 3I2FA 2X9GA 3UF0A 7MHTA 1GCGA 1SVNA 3PIRA 2C2GA 3FG9A 1AK2A 3KT6A 1H1DA 4XIJA 3I73A 2HQOA 1IY0A 2JCGA 3K73O 3QXJA 5LXTF 4BX3A 3OFNA 3FPBA 3IJPA 3PFHA 5B1YA 2M6SA 4JI3B 3B7WA 4HB0A 3UN1A 5ESWA 3UOWA 3ZXXA 4AJ1A 2Y1CA 3A3OA 5DCYA 2P9FA 3EGEA 1DQPA 2PRZA 1E99A 3BA6A 3MERA 4YRJA 5TGTA 1Q1QA 4CM8A 2JGDB 2XMSA 3DMDA 4OPMA 1U80A 1SCNE 3IQDB 3U3DA 3IBCA 4X1YA 2TYSB 4EBBA 1KNQA 5JADA 3LT0A 1Z4OA 3PICA 4CN9A 3G17A 3P96A 1JA0A 2NX2A 4COOA 5IVHA 5CNIA 1BX1A 2HTEA 3R40A 4IV0A 2BUCA 1X2EA 1PG0A 4JS0A 1XD2A 4CDRA 2Y71A 5BR7A 5BNWA 5IYZA 3P94A 4G5GA 1OBFO 1O96B 1ZITA 1P1IA 5D7BA 3QYJA 1OBOA 4CKEB 1QQ7A 4CQMD 1XLUA 2JCBA 1L5KA 2DECA 1YKGA 1XZEA 1ONOA 3NJ4A 2QUBA 4Q9IA 4JLKA 1J0DA 2HU7A 4G0ZA 5HBGA 4GR5A 4F0JA 3A2LA 4GMKA 5HWSA 1G8MA 4TLAA 4FT2A 1RIFA 4POAA 2VRCD 4NXMB 4MLCA 4MUBA 4D8XA 3K53A 4MPRA 1D6NA 1SUEA 2YHSA 2Q1SA 4YBZA 3RREA 3IBYA 2UZIR 5FUMA 1OGJA 1LGYA 3QRWA 2PBRA 4TV9B 5JSHA 1SUFA 1CJUC 4H1TA 3V6MA 5FI3A 5LYYA 1CRWG 1E9SA 4UTPA 2FN3A 1BW9B 4Z9XA 2D2EA 3JWHA 3Q0EA 3QG1A 3T9FA 4DNQA 3QE9Y 1XL0A 2P6RA 3SHFA 2C9OA 4OM8A 2JL1A 1SCDA 1X2BA 2WHPB 1BTOA 1KZ1A 4NR0A 1KI3A 4U7TB 2CNDA 2GN8A 3WKBA 5HQ3A 1ZAKA 3BJIC 2PS9A 3KO8A 3N0TA 1D07A 4YCCA 1AN0A 3IXMA 2AJ8A 1G9SA 1ZU5A 4HN2A 1J97A 1VCNA 1WCXA 3ENQA 2OCAA 1W73A 3ROFA 4DQKA 4UU8A 2XWJI 4K9MA 1PEDA 2AMFA 4A6EA 4C0HA 5GTDA 1AURA 1O95A 4MWEA 5BN1A 3E23A 1KO7A 4R01A 3LPAA 3E3MA 3PFBA 3PQ7A 5HRCA 2IU6A 5LMNB 4NNOA 1ULBA 1IVYA 1RKQA 3ENVA 4Y1RA 3ITEA 4F4HA 2FUG1 2M6RA 3WOVA 3LDUA 3OU6A 3GG2A 2IS4A 1TCUA 4OGWA 5D6NA 3WHIA 1F5SA 4NHEA 1VMAA 4Q3KA 1CJMA 2C5GA 1XAHA 4A16A 2EARA 3GZTB 2CFSA 5IMBA 4MPTA 1R2QA 2J3LA 4D25A 4R1LA 3MJHA 4GPIB 4UDNA 2EGUA 3VI4B 4ALMA 4DQXA 3NMUF 5EWMB 5ICEA 1E3IA 1YRWA 5FNZA 3AERB 3C3DA 4GS5A 3HDQA 5FO0A 4JB3A 4UM5A 3IUBA 3AINA 4CGZA 2QN8A 1PR9A 2VK2A 4DMUB 2I4LA 4KLAA 1L7PA 3NTVA 3G9UA 4MWOA 3RNOA 4DUZB 3GN2A 1J2RA 1GGMA 3L6UA 3QA9A 2C7VA 3L8HA 4JQOA 2P3QA 2DETA 1RPAA 4OJQA 2RG7A 1E3MA 2IY8A 2R1VA 3HZOA 2Y0BA 5FL7D 5HG0A 4E7PA 3RANA 1WTCA 3FKJA 4JC4A 5BMVF 1T5TA 2AUMA 4RFVA 4XXHA 1T4MA 2ZULA 3OESA 4GFDA 1AZLA 2RD2A 1U2RA 4LXUA 4CTNA 3DF9A 1KEZA 3I37X 4B40A 1Z8NA 2DJ5A 4D2IA 1PJSA 2FXVA 4J1TA 3CVXA 9ABPA 1E2BA 1QX4A 5GGXA 1IAQA 2GVDC 2NWQA 3S68A 2WWIA 4EFKA 4FDLA 1WULS 4H7PA 4O4LB 2WAAA 4YH1A 3ZYZA 5BWOA 3BWXA 4O8CA 4UM9B 1FYFA 2I2WA 5E0OA 3G9TA 1FW8A 4FYYA 3PQ4A 4JN6B 4PVDA 4WW0A 2C3UA 2QG9A 3B7GA 3U16A 3UPTA 1XDUA 2DHDA 4EPRA 1NSYA 1M2JA 4N39A 3L0IB 1L0BA 3U4QA 2I2BA 3HNPA 4F45A 2QPOA 3A1WA 3L5OA 2OFOA 3P19A 4QYSA 4JENA 5PGMA 4WPGA 1DBSA 4TTQA 1YTUA 2RE8A 2V7TA 1KQ3A 1UC4B 1TB4A 4S1OA 1MCZA 5KVCA 4HNGA 1FRVA 4ND5A 3VYSB 4AQ7A 3QELA 2CBZA 3I6IA 4JFRA 5BURA 1P2GA 2RGBA 3FWNA 1YFJA 2R8EA 3KVRA 1XLVA 2RMKA 4MCJA 3JQ8B 3RK4A 4BFCA 5B1DA 3C6YA 2GB4A 3CXUA 3NYQA 1U0FA 5CYGA 1THGA 3OOSA 1NDHA 3KOYA 1BE6A 2GN0A 1R8YA 5JAPA 1OTXA 1F6BA 1NASA 1VTKA 4L02A 2HPZA 2R7NA 2QVYX 2DFKB 3W2EA 5KZMB 4PYQA 4FK8A 2Q3LA 1NDQA 4RK1A 1A5TA 2XNHA 3ZK7A 3GJRA 4WL0A 4BGVA 2XZDA 2XKKA 4OCZA 1VP3A 4LHEA 1U7XA 4B4WA 1E9DA 3LP8A 1PT7A 3O0TA 4XH9B 3USES 5A9RA 5CA1B 1LUAA 1RWQA 3ZKAA 4PINA 2JLBA 4J76A 3TSYA 3F3SA 3F74A 2ZBQA 5FFFA 3T3PB 4XJVA 2FI1A 2OK7A 5HILA 4JV5B 3OSZA 2C61A 3HEMA 4DWOA 2F8SA 1A71A 4UE3S 4XB1A 1JG3A 3TTYA 4C1BA 4LY9A 3SAJA 1CHDA 5AWFC 1E8MA 1T2FA 4J0KA 4F2PA 1C4XA 1ODCA 3VPGA 1KQGA 1SB8A 4C0AC 1G3UA 3JVDA 5KYVA 4BVGA 5B6IA 3UV7A 4B79A 4QFCA 4KNYA 1UP6A 1UBSB 1RMTA 2P9HA 1N2SA 1UBCA 1YH3A 1AHHA 2W93A 2WPNA 3I39X 4ENVA 2ZRJA 3FWZA 2HPAA 2H7VA 3AQIA 3OIWA 3SF8A 3RIYA 5IANA 4KNVA 1C81A 5IXYA 1PJZA 3UJDA 4Z0TA 1UZAA 1BS1A 4DFDA 1GFSA 1FTYA 4R3WA 1KMQA 2JPDA 1BS2A 1VL0A 2G28A 1WB9A 3OT5A 2ZYTX 1TRKA 2EF0A 4ZOEA 1YB5A 4CT5A 1KBQA 1R74A 1NN1A 3MS4A 3HB4X 2WNSA 3HG7A 2HU2A 3BF8A 5GZ6A 3WLEA 5GIOE 2GM9A 1E2JA 4DLXA 1HX7A 2XADA 1IWOA 4HWKA 4XEHA 3ZBUA 3ZJTA 1RXVA 3SEFA 2E0IA 1J39A 1PJ4A 3EGCA 3V5NA 2HIGA 1P2FA 5CBKA 1G1MA 3ROPA 5HZKA 4WKNA 5LWQA 1TEHA 1RWWA 2DPLA 1RJEA 3QW4B 1A96A 1K8XB 3LRPA 3EF3A 4J0FA 3GLKA 1BXGB 2P4UA 1YWGO 4U8GA 1VBKA 1HF3A 3AM4A 4O4HF 5GVRA 2CV2A 5TEWA 1TL7C 1X1TA 1Q5PA 2VDJA 2XE4A 2EZUA 1RYNA 2JGDA 4XYEA 1Q1GA 2HHJA 2ONYA 2JZNA 2ZS9A 3FFTA 3SEAA 3W5UA 3IALA 4JXXA 4V0QA 2VSXA 3ZGZA 3GW8A 2HA3A 3WA6A 4GRDA 2OXTA 4V39A 1UWLA 4O5OA 3DL2A 3LPMA 1ZSNA 4RQBA 5IC6A 3E5RA 2PWAA 3QY0A 1ZD3A 2QSJA 2ZIWB 3ZH9B 2DQ4A 4ACBA 2YN0A 1FP6A 2VYQA 1YKFA 3A9VA 4IGFA 1LQUA 1O96A 5EHNA 1PBTA 4H3VA 4E07A 3AVWA 2JFGA 2NZXA 3M1LA 2OB1A 2UKDA 3PNVA 5KYWB 3C5HA 3N53A 1KS2A 1DAMA 3WYCA 4CKEA 2ID4A 1AS0A 4MR7B 2NSDA 4UM7A 2HLDD 5BQOA 2ZJ8A 3U61B 1IUNA 2XRMA 2O07A 3RJZA 5LKRA 3TLCA 2IUTA 3UK2A 4BVLA 3JQEA 2C31A 3O3MB 2BGIA 5IM4F 3RC3A 1W2HA 2A5JA 4X95A 1ZDMA 1KKUA 3M4XA 2B83A 3BEOA 3Q3HA 4JT9A 1LTQA 4PEVA 2V7EA 3EZ6A 2ZFUA 5JPDA 3KE8A 1SQSA 3RT1A 1VHLA 1FVFA 3FYTA 1IY1A 1WMBA 4RMNA 3VTFA 1W7AA 2W37A 4I4CA 4TV9A 4ISBA 3NHJA 4WY8A 5DNUA 1E0DA 3EYWA 4YHBA 1JT2A 1XYVA 3NM6B 1EUZA 1AGRA 3U9LA 2QZPA 2WFZA 1UOEA 2GNAA 2QP9X 2N46A 2VL7A 1BW9A 3KOMA 2GX6A 4L50A 1OFHA 1G4AE 1ADBA 1YDGA 2R6GA 1C7IA 3CUVA 4H1UA 2WHPA 1V3UA 2POCA 3A10A 3RVOA 2QMOA 2FDRA 3DDZX 1J0BA 1P62B 5ILQA 4TS4A 4Q9NA 2O2HA 1QZTA 4WCFB 2CGEA 4RA9A 2ZJAA 4YP0A 3R4CA 1QYXA 4QEDA 4CG3A 4O1IA 1DIAA 3MUEA 1KKLA 5IX8A 1NMYA 3ZE9A 4XRGA 1E2FA 1MAAA 3O93A 4EGQA 1T2NA 2WTAA 3DQZA 3GGPA 5HPYB 1POXA 1GG9A 3FRJA 3MGCA 1M83A 4OQNA 4G86A 1F2DA 4Y2TA 4I3GA 3RVJA 4AF6A 1PWEA 4H60A 3P2OA 4YP5A 4AB1A 4GKVA 1KZ7B 4YI3A 2YOHA 4UBKA 5JTTA 1QP4A 4JI0B 1TA0A 2CSUA 3BFXA 3F3MA 4KE8A 2XBMA 5JJCA 3IUNA 1TUBB 4IDDA 1XRQA 5BSGA 1ADJA 5THXA 2O50A 1QGED 1J0AA 1FTSA 1QB8A 1ZOLA 3CHYA 3IB3A 4KTVE 4YIKA 3BXHA 1DXYA 3TVYA 3I6BA 2VHCA 5DWQA 3UW1A 1NG9A 5ECDA 2WJ4A 5AHXA 1PNRA 2IYNA 2NIPA 1FFSA 1I10A 3TW4A 4QQKA 2CNKA 3MJTA 1TAGA 1H2XA 2C9MA 5HX7A 4UCFA 1ISRA 2JGIA 4B3FX 3UGQA 2GM5A 5EWMA 4EO4A 4OYLA 2EKPA 1UBTS 3EJ6A 1MB4A 2QTCA 3AERA 5AVRA 2QMUA 1N5JA 4L08A 2PRIA 2ZPAA 1ZD2P 3O8QB 1JU4A 5I45A 2NXCA 4P8RA 2X23A 1PNOA 1ENZA 3VOTA 4DB4A 3DLBA 2GO1A 1E2UA 2VP5A 5IJZA 3RC9A 4N7RA 3AUTA 4BNMA 4TYPA 3OOJA 3TF5A 1JW9B 2R4TA 3HFJA 1M10A 7YASA 1EAYA 5CHEA 1LKZA 3GP5A 4RJKA 3PUJA 4EGJA 2WJWA 9LDTA 4ZCSA 3UOAB 1B6TA 1S9HA 2Q8QA 3W90A 4LZNA 1TVCA 2WZBA 3TKYA 2W83A 3MINB 3CJQA 2BFWA 2JS7A 4R2JA 2XNJA 1PK9A 5T41A 2EDAA 3ZKWB 4D8TA 1CUEA 1H2FA 1E9AA 1LA2A 1LPSA 5HIMA 5AW9A 2J0QA 1P33A 2WP8J 4DG8A 1FXSA 2AN1A 4CQJA 4PG7A 2PFKA 4O4LA 3E8SA 2P35A 3PC6A 2ZRFA 5FUXA 5KDOA 2X9LA 3F6YA 3KZVA 3CG4A 1DVRA 4R5HA 5B57C 1POWA 3QOFA 4ILKA 3VNAA 1H65A 2BFCB 2V55B 2IDJA 1BS9A 1T8PA 2K2WA 3IR5A 2VUIB 2Q3CA 3MXOA 1XU9A 3N59A 3N74A 1UC9A 3M5CA 3NRBA 3AZPA 4G0NA 2J0UB 2PO7A 4NDAA 4QOJA 1W94A 5HJ2A 3RU2A 1L5LA 3L41A 2XD9A 5DLYA 1UCFA 1R9GA 1S02A 2YOGA 1GPUA 2BZSA 1QYDA 1W6UA 2H63A 3AG5A 4KQGA 4DWWA 4UJ5A 3H0CA 4JBWA 1OAKA 3OOHA 4ZV4A 4PTZA 4IJQA 3JZFA 3KKNA 3GEEA 3BHNA 2DVMA 1KVTA 4ABYA 3RRXA 4MJ7A 4P6VF 4I6EA 3SBXA 5HKAA 4BVBA 3AGPA 1S2DA 4TLBA 2GRJA 4GT1A 3ZE8A 1RLUA 1Y48E 4NYMQ 4LY3A 2VPQA 3C3XA 4PICA 4C04A 3JQ8A 5JS8A 2W6ZA 2LCQA 4EHKA 1P0IA 2J3EA 1KZ6A 4FPXA 1TT5B 2QN3A 6REQB 4PF1A 5C5EA 3FPGA 2BMDA 2DT5A 3IOYA 1MX1A 2P40A 5IH3A 4HXEB 1PG2A 2UVPB 1IY8A 2BH9A 1DWOA 4MYRA 5G3ZA 2G1UA 3PEWA 5AI5A 2I1VB 2JD2A 3T3MB 1KAHA 2AN9A 3NZEA 3R0QA 4MIYA 4KWIA 2G04A 3ZHZA 5TQJA 2ZBPA 3PVZA 2W6OA 2D0OB 2KBFA 2Y1LA 5JZ9A 1JN0A 4MQMA 1NVXQ 5CA1A 1MNAA 1Q1BA 4BFVA 1JR6A 2N75A 1X8LA 3BL8A 3PXBA 2V9CA 4A23A 4ZA2A 3L1VA 3E53A 2OZKA 1MB3A 1W44A 5E38A 1R1DA 4KV9A 5H82A 3L1IA 4HEA6 5IG2A 1HNNA 1UJNA 4B43A 1QRAA 2OAP1 3WADA 3L8ZA 3HJRA 3FMIA 1Z0JA 1VLZA 6GPBA 2M2IA 1M54A 5DNEA 1OLOA 2QWXA 4Y30A 3RSCA 4ZYTA 1Z22A 3OQHA 2EW8A 3SN6A 4ER6A 4Q1DA 3LHFA 2R8PA 3HVUA 4ECEA 1L1RA 5ESRA 1Z28A 4ATNA 4TLMB 1XMPA 3BKXA 4PZDA 3RF7A 3SF0A 2XQGA 1KXZA 3OLZA 3WIDA 3W5HA 4ZK2A 1E79D 4GX5A 1I9GA 2DSTA 1EBFA 3NWJA 3OMLA 4TLCA 4NV3A 5U9CA 1WZ2A 2F67A 1PJCA 1Z7YA 3WJ7A 2CZCA 4R8RA 2Z3VA 2YJZA 2OO5A 5IEJA 5KJ1A 2OP1A 5BV7A 3EH2A 5TC4A 3UHAA 1JHXA 3I8SA 1T4CA 3T3GA 5L4LA 1KU0A 1WXXA 2H48A 4WLNA 3X1XA 2CLDX 3E35A 1OLUB 4CFYA 3TQTA 2V3VA 1VJ0A 1YOBA 3JQGB 2C2XA 1TEZA 2FSGA 5IAJA 2IH2A 1U31A 2W6IA 3O3NB 4QRDA 3MAAC 2CFRA 2JGFA 4QDUA 1AG9A 3B1FA 2J0EA 1NW5A 2FG7C 2W0SA 4G85A 2JHAA 4LDRA 2HL6A 1F0PA 4BXOA 3AHFA 4BWVA 2CLOB 3CR7A 2AX4A 2QJFA 2DR2A 1FNSA 2A7XA 3P26A 1QTQA 2ZJ0A 2H1OA 1TK2A 2C9DA 1I24A 3TINA 5LM3A 1DSSG 1V5FA 1ZA2A 2BM0A 2OCBA 1VHQA 1Y3AA 2R62A 4I4TF 3WWCA 1N0UA 2QP4A 4BBAA 3UH1A 1I1HA 4W7SA 4V38A 3LUAA 1CYDA 2Q6IA 4W7HA 1UJ2A 4UVGA 4R8KA 1EU1A 1VLHA 2NSHA 3AY3A 4FC6A 2AXNA 3KK0A 1P9LA 1ISPA 2ODPA 3Q7RA 4TGLA 3GJXC 5C8VA 1Q1NA 2VBGA 1ENPA 3B36A 1CLEA 1GYQA 5A9SB 4GBJA 1G19A 2Q2NA 2FWAA 2AKAB 1CB7A 1TLFA 3DC7A 4LN1A 1V4NA 2X1HA 1RKUA 4F6LA 2CXPA 3KU4A 1V25A 3BSSA 4G9EA 3REGA 2VDOB 1MB2A 3V34A 3ZR4B 4D79A 5KYWA 3CVWA 5ELXA 1T3HA 3CWZA 3FNFA 1A3CA 3HLYA 3DT6A 4MR7A 4RACA 3ZPXA 3K35A 3K3PA 2QRVB 1RC8A 4F4CA 3BE6A 1LWOA 2PDAA 1IZZA 2H1FA 4Q4AB 4DIDA 1G8AA 1AY0A 3HPRA 1ODJA 1ZM7A 4K6KA 5DNDA 4G8CA 4QD3A 4NFHA 3T4XA 2IJGX 2J3QA 5C4IA 3ECSA 1IMOA 3OCCA 2XKBA 4OXQA 4HK4A 4Y0AA 4K9RA 4N9QA 1AS3A 3R74A 1MC8A 1G0NA 1XI2A 4GNKA 1YU9A 4F38A 1HA3A 3DFZA 1XUOA 3O8CA 1NW4A 3ZLJA 4NBTA 4MQ4A 4B5KA 2G36A 4BN5A 2ZJFA 1QVAA 3IV6A 1IHOA 3LVBA 4KL8S 2H4FA 4OEHA 3DHNA 3GAFA 3DBRB 4OA8A 1JYFA 4G84A 5JZOA 2WJJA 4NHOA 2QW8A 1AB6A 3M6AA 3CNQS 4Q3OA 4ZO7A 5J2TA 1XEFA 1U7PA 1Z16A 4WCFA 2GN6A 3QHAA 3RTGA 4G41A 1G5TA 1S89A 2VDNB 5JT1A 1K7FB 2R48A 2OQIA 3K96A 1THTA 4G25A 4C0SA 3TJZA 1LF5A 1N8SA 3ELYA 1P31A 3GDOA 4HI0E 5EMLA 4DV7B 1DC6A 3ADPA 4HZUB 4DNFA 1RTTA 1Q77A 2AZTA 4M0CA 5KX5F 1MQ9A 2XQFA 2NAPA 3E9RA 4JBNA 2ZJ7A 2H7XA 2PKQP 2IDZA 2EGGA 2BISA 5KSWB 3U39A 1HG1A 1USIA 2J6CA 1TUBA 2DWOA 1DBIA 1PFKA 4LK3A 4FQ8A 4ALKA 3RC1A 4K7JA 4LYJA 1R0BA 3B3AA 4Y2HA 1E98A 2O8NA 5AFSA 1ZH6A 1NQTA 1UXKA 2DRIA 1XMIA 4JP1A 3A1VA 4AJOA 1DFIA 1LZLA 2WAOA 5K0FA 1Z74A 2RK6A 1OB2A 1WEKA 5A5EA 4UNPA 3LCUA 2QD5A 4ZP1A 3ZZNA 5EINA 2LCFA 1DBRA 1ZOPA 3H2KA 2PCLA 3PCXA 4CMGA 3X3HA 5K3EA 1ONSA 1K75A 4G5XA 3D5EA 1FDVA 4GR4A 3UAWA 1I4TD 2IXFA 2H4JA 3BIJA 3O8QA 3OA0A 1EK0A 2FEAA 2YUIA 3JPYA 4ZT7A 3LS2A 4XOUA 5G1PA 2PH3A 3STTA 3I45A 3OCJA 1A4XA 1WXWA 3DTVD 3HY3A 2I87A 2P9GA 4OYRA 4PY2A 3T38A 3T7IA 3K6SB 4ZQCB 1KRWA 2J7PD 4O63O 3ESAA 5IKMA 1AS2A 2VLBA 3AY0A 4G81A 1ODSA 4YBRA 4BLVA 2V65A 1Z39A 1Q2XA 2D1TA 2Z2ZA 2ZI6A 1B43A 1I0ZA 3ABRB 3B38A 4PPGA 2WYWA 3PB3A 1W0CA 2PKRA 3TXXA 3BCHA 3L8EA 4V0MA 2C7BA 3NFRA 3JTMA 3O21A 1RAFA 3MINA 4AWAA 2F1KA 2AFRA 2ODTX 3C3BA 1ZSYA 2P75A 2VJCA 3M6LA 4XWTA 1EFUA 5BSKA 5IAAA 4HSEA 3T7AA 2J9RA 3ETDA 5AW7A 4RLFA 3ZKWA 2ZRQA 3A6DA 1U8ZA 3R6GA 3AIIA 2XJ4A 1NW6A 4XVRA 2GXAA 2I54A 3GXBA 1IJBA 4LSMA 2H4WA 2CFIA 5CA0B 1BXKA 1X1SA 3EDMA 1P6XA 5JCJA 3KALA 3A25A 1E1RD 2IFTA 2WFLB 1UM9B 4LDPA 3NKFA 1F2TB 4AZSA 5L4NA 3O2QB 1O58A 3ENKA 1GADO 2GNOA 2EWWA 3PC4A 4FHFA 4M89A 4N0QA 4D5EA 1ADGA 3HL4A 2Z9DA 3ZD6A 1GAQA 2BFNA 2CCJA 5ILOA 2H29A 2NVBA 2BFCA 2R8RA 2ECKA 1PZMA 1MEOA 2NOAA 3C7TA 4KN9S 1ZNZA 2YXPX 3WE7A 2WHRA 1OPXA 4A27A 2J0UA 1TKAA 1A4IA 3HCPA 4HH1A 4HKTA 4M1OA 3ZBTA 4JLPA 1Q7EA 2WAXA 3NWOA 4JB0A 4W5RA 3OCZA 1XZFA 2P3SA 4E14A 3H5LA 5FPKA 5B7PA 2FMKA 5HQJA 1R6VA 2DAPA 1XP8A 1MX9A 2P78A 2AWNA 3PUZA 5F73A 4A0FA 2NMVA 4FONA 3H17A 4JP2A 4MWSA 1RAGA 5ER9A 4U5QA 4N03A 4DUPA 3HRKA 1RZ3A 1JFRA 1WVIA 3OAAA 2WP0A 3GJTA 1WBBA 2FVXA 4D6PA 2ID8A 2FWJA 2JEZA 2IEIA 2ODAA 4YJKA 2V3CC 1PVVA 1XMJA 2CB9A 1KJ9A 3EC2A 5K4GA 3LQ2A 1TT5A 6REQA 3VC2A 1EEHA 3SQLA 4ITUA 1JAHA 3SSMA 3I8XA 3PVCA 2TRSB 1WQ1R 4JT4A 3T41A 4EEXA 4GZ3A 3TW0A 4NE7A 3MS2A 2UVPA 1FFHA 4JK3A 2IIVA 2Z09A 1LH0A 5JD3A 2VQDA 2P5UA 2XMCA 4IIHA 3MTBA 2FOIA 1C1HA 2ATXA 1L4LA 2Q6OA 2HQRA 2I91A 1QYWA 3AB8A 2IHJA 1ZINA 3RS8A 2RJOA 5IFKA 1TFRA 4MAAA 5TV2A 5AO9A 4DLBA 4DREA 2VYCA 1CTQA 3A4YA 3ORRA 5IBPA 1M1XB 2BELA 2CHEA 4BRUA 4IDOA 1X0VA 2HAEA 3HXQA 1F8XA 1Y3CE 1QZXA 1NGSA 1GNTA 1IHPA 3I2YX 3KNZA 2QZ4A 4XSGA 5FA5A 1PWXA 2IKSA 2BKAA 2VJYA 3C41J 3GDGA 3MTAA 5BWMA 2QTWB 1OLXB 2L19A 4HTFB 3F1LA 4RD4A 3S7ZA 4JP3A 5ALFA 2O54A 4HAXA 1XR3A 4PTYA 2HTFA 1OU4A 1NUTA 5KVVA 4H7HA 1EUDB 2C2KA 2EX4A 4P2GA 3QEAZ 3LY9A 3AK4A 4XD7A 1JQLB 5CVDA 1DO0A 2FZ5A 1L4YA 3FPHA 4YMVA 3IMEA 5LQJA 3BMQB 4DGSA 1N6RA 4PYLA 5AVYA 2JGNA 2QUIA 1CERA 5CVUA 1DKLA 5E9WA 2BE9A 4QWWA 4RTRA 1TVMA 2GAIA 2BFEA 3ICEA 5D51S 4LBWA 4K5QA 2ZB2A 4RU1A 5IVIA 1D1TA 4MKZA 4O2AF 2K7FA 4M1KA 4B48A 2QLJA 4I55B 7AT1A 3EZYA 2WV7A 1TYBE 4IDGA 1V71A 2ERXA 4F5WA 4RK0A 5LQNA 3ZDDA 3K4QA 4LDJA 2YHAA 3IERA 1EVLA 4LWZA 1P0FA 5CB6A 3LUFA 4MV7A 4R54A 5M3BA 3M6UA 2VDWB 1V9LA 5DDIP 1TJ4A 2A88A 2HCFA 2VWHA 1PF7E 2XMDA 1XZKA 5EFOA 4FFSA 1U8UA 4IH1A 1V26A 4LXQA 3EZLA 4GLLA 4MUFA 4B3DA 5IKXA 3IHWA 1JXAA 5AK0A 5FIUA 4DJFC 2COEA 1HBJA 4NS4A 4ZQEA 2H2GA 3P9YA 1J25A 4M53A 1IE3A 4CM1A 3LDGA 1GEEA 4FGZA 3FUVA 4KQWA 2NZ2A 4R0NA 5FJJA 4D4MA 4JSTA 3RS4A 3QVSA 4AICA 1FNMA 3QEJA 4X62B 3UT5B 2HSWA 4UAUA 4NBWA 3GMDA 1XNJA 1SWWA 3BHJA 1H69A 1ZNYA 4XDYA 1G7CA 1GU7A 1LPAB 3FNHA 3RQSA 3DE7X 2D62A 2K7ZA 1XCLA 3ANYB 3UC5A 2NTJA 4GGMX 1CEEA 2RB5A 3DL7A 2X7JA 1HEYA 1VG9B 2EJUA 2Y6VA 5A9SA 1DQSA 2YYSA 4FOSA 5EE0A 5ESXA 2PPLA 4KSCA 3ROEA 1XNGA 5C53B 5F3RA 3K5PA 2F59A 1RVDA 3GWGA 3VM6A 2FMUA 1OZAA 4GC5A 4J16A 4BE7B 1TLLA 3KFVA 4LOIA 1BOFA 1VXOA 2QRVA 4C6RA 1DC8A 1JKXA 1GUAA 4Q4AA 2P6PA 3FPJA 1V35A 5JNLA 4UEQA 1IBRA 3PYXA 1YB7A 3FE2A 3QE3A 1GHTA 3NT2A 1L5NA 4B5LA 2QTGA 4BMNA 1QC5B 2VKQA 5EJ2A 1CDZA 3ZU5A 3LT4A 1TUGA 2OHOA 3MCWA 2RAVA 3HXKA 3RRYA 1HQKA 1Z4PX 4Q9KA 3I0ZA 2AOUB 3IE1A 5LSAA 1ZJWA 3U26A 5FH9A 2PXAA 3THOA 4F21A 1ECGA 2J4FA 4O2RA 1NVFA 1X7WB 4ETMA 4RTQA 3DNPA 4ND8B 3HVIA 5F3WB 2ILVA 3DBRA 3OKCA 4WGFA 4FDMA 3K0FB 3ZJVA 4WZBE 3U4AA 2NU6B 2BZ0A 2GYVA 3AHDA 1U2PA 1JEQA 4IG4A 3SC6A 3HJTA 1GRQA 3DXXA 1BQEA 3O82A 3PENA 4XGKA 1U0OC 2HQBA 3PJEA 1XO1A 2N47A 4NDNE 2RHCA 4ZD6A 4QHSA 1DELA 1SUAA 3HVHA 4TV8F 4CV2A 4D8YA 3MSCA 3F3KA 4PNPA 4S1PA 5MGNA 3C16C 2KHZA 3LC2O 4HZUA 2OO5C 3CSDA 5EMNA 4G0OA 3EQZA 4F2GA 1PZXA 1R5JA 3CN7A 3RASA 4Z4GA 2EWVA 3QUCA 3B1YA 5CT9A 4A91A 4BFWA 3JD0A 2LIVA 4EVQA 2P4SA 1L5ZA 5JAZA 4YAIA 2CJWB 4DHWA 2PPVA 5TPZD 2ZG6A 2DTDA 2CJYA 1VYHA 3D4OA 1E58A 4R41A 2CLLB 5FTKA 1MQAA 3EIQA 3HYNA 3SZ3A 3VHRA 3BK2A 2PL3A 4NRDA 1NPYA 2AC4A 3JQFA 4HCJA 2A84A 3UWSA 4NCXA 4HDQB 1NVDA 3NG1A 2VTKA 1LDEA 3L1HA 5HF8A 4IS3A 4D9NA 3FBWA 1E1MA 4BBPA 1N6HA 3HZHA 4OL9A 1HE2A 4URHA 4CM4B 1J8MF