1GWNA

The crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
b'VKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoE
publication title Crystal Structure of the Core Domain of Rhoe/Rnd3: A Constitutively Activated Small G Protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtpase
total genus 63
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gwnA00
2ZYWX 2O0JA 1RPZA 2OSBA 2IXGA 4DLVA 3GLGE 4HYYA 4MA4A 5BXQC 3W3ZB 4MYTA 3N5CA 1G6OA 5F9FA 5KPDA 1M34E 4BEJA 1FOEB 3BH0A 4C7OA 4B2PA 4BZXA 1OKKD 1U94A 1GRRA 1ZUIA 4Q21A 1E99A 4LHWA 1NLYA 4X8OA 3A1TA 1UJ2A 4UJ3A 1OXTA 2ZROA 1XMIA 2J1LA 2QMHA 5JJKA 2EFEB 1EWQA 5K8IA 4JT4A 3B82A 4R98A 4ZKDA 2QTVB 4JVMA 1FP7A 3TVTA 4DLYA 1Q0UA 1P2UA 3JZMA 1Q12A 2AFHE 2QT1A 3DMNA 2YC2C 3SJAA 3SJBA 2G6BA 3C14C 2ZRGA 3KB2A 1TEVA 2HYDA 3VQTA 1TAGA 4FWIB 1EESA 4DUGA 3AVOA 4JS0A 3TK1A 3WP1B 1HUQA 1Z0JA 2ZVPX 1KI6A 4HLCA 4LUCA 2YC4C 4X8HA 1G3RA 1E0KA 3SJZA 5JMTA 2BIFA 3ASZA 1D2EA 1KI1A 3CO5A 3PUZA 3C4JA 4E22A 2NPIA 1ZIPA 3EZFA 2PZGA 1KK3A 1MRNA 2OCYC 1HURA 1Z0AA 2PZEA 3WXMA 4ZCLA 4A9AA 1JPJA 1NBMA 1PZNA 4TMZA 3SN6A 4QBGB 3CR7A 2WSMA 1OXXK 3LD9A 4TMVA 5JHHB 1N6HA 3EZ9A 4D80A 3N2IA 1NY6A 1G8YA 2WOJA 4PZYA 4X8LA 2WJIA 1N5KA 5BYJA 1YKSA 4HZUA 3T1OA 2G1KA 4LRWA 1ZUNB 4AC9A 1SVSA 2CXXA 3N70A 3NIBA 4C0SA 1QVAA 4AWXA 1F6BA 1G5TA 4G5OA 2C9OA 5FPKA 4B76A 5FPYA 2PCJA 1G3MA 5KSPA 4BZQA 2OHFA 4M1MA 1TMKA 3QBTA 2A5FA 1JALA 3E2IA 2QMEA 3TW8B 1M74A 3UMFA 1GL6A 4D4MA 5HE9A 4OHVA 1N2CE 4YMSA 3P4XA 8OHMA 2XXAA 3OIVA 1YU9A 2VP2A 1H8HA 4I1SA 4LY6A 3IHLA 2D7CA 4NH0A 4GNKA 3OAAA 1M8PA 4K81B 5DI9A 1G5PA 1TU3A 2B92A 2IYXA 2VBCA 3BXZA 4Q4HA 2CE2X 3AEZA 1CTQA 1XD9A 4B3GA 3RAPR 2Q3HA 3VR4A 4A92A 1CP2A 2N1BA 4FMCF 4QHTA 2GJ9A 3KKMA 2W6ID 2EFGA 1ZU4A 5KNCA 4QBFA 1YVDA 5JEDA 3ZVMA 2F3RA 2GK6A 4P4SB 1W7AA 2IBMA 5L3RA 4FMCB 4QNMA 1E2PA 2ATVA 2KBEA 3QKUA 4TLCA 1E9DA 3BRWD 4AURA 2NO1A 1KDPA 4DRZA 5JI3E 1T0HB 1Z07A 3PEUA 1W4CA 1QG2A 3WMFA 1NJGA 3A1VA 4Q02A 3TKLA 1KO7A 1ZYUA 2ZE7A 2K5UA 4CZ2A 5FBVB 2ZR9A 1CIPA 1XCMA 3BIFA 3GD7A 3LA6A 1UDWA 4Q5IA 3FMOB 1W0KD 4B75A 3K0CC 3SEAA 4E07A 1CJTC 2JEOA 2W6JA 3X1ZA 3RS5A 1J7KA 3NKVA 1JJ7A 1E2LA 1NN1A 5EP4A 2ODBA 3K0CA 4EQ6A 2GEUA 1JNYA 4OQXA 1G7SA 1DG1G 5G40A 3ZZ0A 5CB6A 1A5TA 1YZLA 2RHMA 4NBSA 3ADBA 3B7GA 2UZ3A 5L8VA 1N6RA 3UANA 1FUUA 1E9BA 4QNRA 1Z0KA 4TYNA 3EC1A 1KDOA 3WY9A 1CEEA 3SI7A 3VR2A 2O8FA 2G0TA 2QM7A 1VG8A 1TF2A 4YXWD 3FTQA 2FE4A 2IEZA 2IYLD 4MKFA 4OJKA 4L16A 2GEVA 2RMKA 3VR3A 3L0OA 3SU8A 1A2BA 2QENA 3OHMA 4TQ9A 4KJZA 4BFXA 1AJEA 1B23P 4C0BA 1NN3A 1PLKA 2PZFA 3RC3A 4PC6A 1TUEA 3T15A 2ZVQX 4IDQA 3TSZA 3K0FB 4M53A 2P3SA 2E87A 1KAGA 1TQ2A 4V0NA 2X2EA 4LPKA 4R2IA 1MOZA 2QQEA 4TZ0A 4PHGA 1G8FA 1XJQA 2J7PD 4NPHA 3A58B 3RSLA 1E2GA 4ITRC 2Q9CA 2PX0A 4WVFA 4QKQA 4J0QA 221PA 5KNDA 1FNNA 5F3WB 3SE0A 1UBFA 2RGAA 3LVQE 4MDFA 3GJ8A 5FFMA 1J8YF 2FFHA 4M9SA 5DNYB 1ZM9A 4RD3A 4KV9A 4G1UC 4A2WA 2ZJOA 3L82B 2PJZA 1XEXB 5AJZA 3GLHE 1GDDA 1YZUA 4R9UC 1CLUA 4II7A 2EFCB 3U3JA 4BZPA 1IXRC 5J47A 4DIDA 1NN0A 3PVSA 1IN4A 4ARZA 4O0MA 4B32A 3K9HA 4I99A 3GJ4A 4M22A 5AWFC 2Z4RA 4I1OA 4KVAA 3NHBA 1J8MF 1U9IC 4PC3A 1DPFA 2D3WA 1KO8A 4FMBB 4L9WA 3Q8XB 3BJIC 3QJYA 4JVSB 3DMDA 2F7SA 2JLRA 2OM2A 4GBMA 4LC1A 1U9IA 3BD9A 5JJIA 4MGYR 4Q4JA 4O25A 3C41J 1Z5ZA 2JJ1A 3SJCA 3MJRA 4PHTA 2E1RA 3BBPA 1AIPA 1GZSA 2JIZD 3PG5A 4W5HA 2B8WA 2J41A 1W0JD 1YHNA 1KYIA 3KFVA 3UKDA 4D6PA 2V1UA 5DYIA 4RCZA 3T1QA 1Z29A 2Q9BA 2ZI5A 2G0NA 1G3UA 5IRCD 1E9RA 1ZD8A 2IYRA 2Z4SA 1A82A 4PSVA 1G19A 5TARA 2R6DA 3DKPA 2MMGA 3CX6A 2HCJB 1YRBA 4QJ4A 1JAHA 1HYQA 2CJWB 2UKDA 3CRRA 3W5IA 2JLXA 3EW9A 2RGNC 1N5LA 4MRPA 1KO4A 2PMDA 2JLVA 3RS3A 4URXR 1DELA 1S1CA 1TF5A 2QY9A 4RD6A 2IS2A 4AKGA 1T3HA 1EFRD 2OUKA 2VF8A 3QPWA 2GAOA 5J4LA 5KPJA 2WJYA 3QXHA 3ADDA 1Q1QA 1L4UA 4DSOA 3KZ1E 1COWD 2GCPA 4LSGA 1FMJA 3AUYA 3W9YA 2WWGA 4YONB 4MRRA 1IONA 2FU5C 4EPTA 2WIBA 2F1RA 3T1TA 4JL5A 5JCPA 2BM0A 5C46F 3KTAB 2V3CC 5FOUA 5BN5A 4ACBA 5DHFA 3EWAA 3CPEA 4V0ME 5GVRA 3OE7A 4Q9LA 3KXKA 3JVUA 1ZNZA 1OJLA 5FPHA 3RANA 2C98A 3L0IB 3M1IA 1TPZA 2ZRDA 4LGMA 1JPNA 3LX8A 1KIMA 4JJZA 4Q19A 4DEYA 5KSOA 2PT7A 2GZHA 4U00A 2WJGA 1NSTA 3QXCA 4NU0A 3TR0A 4U7DA 3Q7QA 3AVVA 1ETUA 3LO5A 4Z54A 1U98A 2ZRCA 2LWIA 4QM7A 1E3MA 1OXUA 3CONA 4URUR 4A82A 1HQCA 2IYYA 2XTNA 4R71A 4HI0E 2VHUA 4MITA 5DE3A 1EFCA 4XSHA 2GBLA 3SFZA 5B2ZA 2ZITA 3TVDA 4GP7A 5TB5A 3AF2A 1OH5A 1KI6B 2BOVA 4WXPA 5JJLA 2ZJYA 1W48A 3TSWA 1FX0A 3I92A 1TX4B 1JJVA 3GEHA 1VYUA 2QE7D 1TF7A 2ZIAA 2ZYUX 3B13B 3ND8A 4FMDF 1S96A 5JI2E 2NZ8A 3DM9B 3K0EA 3U2QA 5KU1A 2QBYB 5GJVC 4D4JA 5JRJA 1SVIA 3EPJA 4OI2A 5KNBA 4OQNA 3KTAA 4P3YA 4Y0AA 1JQJC 1NLFA 1KNXA 4U5XA 2ONJA 1GITA 5CLLA 1GNRA 3PUVA 1GTVA 1SXJC 5SZIA 1G8PA 1N25A 3LBIA 5SZKB 5K8TA 4HAYA 4MDEA 4XD7D 3VNVA 1E0AA 4QHSA 4QJ3A 1CBUA 4DCSA 4XWOA 3DDCA 4PSAA 1SXJA 4UKDA 4TYWA 3GCGA 4TMWA 4POAA 4V03A 1UBCA 2OFWA 3AKEA 5FBQB 1UADA 2ZU6A 3C8UA 3U3OA 3KDSE 3GFOA 1G1MA 1HEIA 2JASA 1J99A 3AKCA 4KO8A 1II9A 4A6XA 1AK2A 2GK7A 4WW0A 2D4HA 4HLUA 3CRVA 4UNSA 2JLZA 2JLYA 2HEIA 3FVQA 3EASA 3R9IA 4Q1CA 1Q57A 2RGEA 4D81A 3NDPA 5K8LA 3GLIB 1KMQA 3LVRE 3D6TB 1B0UA 4DSUA 1R7RA 1Z2AA 5HKKA 1TUIA 5L3VA 3AF3A 1S2MA 2QBYA 3KKPA 1KSGA 1DAHA 1JI0A 5J40A 4DCNA 2DB3A 1UKZA 4IOMA 1ZP6A 4W5JA 5FTJA 4M21A 1K5GA 2IWHA 3HPRA 1W4BA 4AYXA 3AH8A 4LJYA 2ZRBA 4URYR 3LAWA 3TBKA 3THYB 1ZM3A 5HCNA 5P21A 2AK3A 5AR1A 4QC2A 2H1LA 4ZO4A 1SKQA 4MYHA 4CEIB 2WIAA 2DR3A 4KHZA 2B8TA 1G64A 4IFEA 3T5DA 2ZRJA 1Z6GA 5D3QA 3U61B 3KFXA 4A8JB 5BWMA 3ICEA 3H4MA 2CK3A 2OAP1 3IPYA 4BLQA 2ODNA 5JLJA 2GF0A 1OT3A 1XRJA 2V6JA 5FL3A 3CNLA 3U5ZB 3B85A 2VP0A 1G6HA 2W00A 1YZQA 3VX4A 2IS1A 3VU9A 4TQAA 5EXXA 3IDQA 2J3EA 4C30A 4TTQA 3KJGA 4QBIA 4Z1MD 3NHAA 2CDNA 4YQFA 1G18A 3H1TA 4PAOA 1TU4A 3HJNA 4BRUA 2PBRA 1PUIA 5FTKA 4LJ6A 5FOXA 2O8EA 1ZCAA 4ZCMA 2DHRA 3CZPA 3BORA 2WPDA 1Q1EA 2VF7A 2G83A 4A2QA 3THYA 3U3KA 3WYFA 4AD8A 1XPOA 4KSCA 2VP6A 4AYTA 1XXHA 1OKKA 4PQRA 2XTMA 4MKIA 1TL7C 3SBDA 5LPNA 3JZAA 4CEIA 1DO0A 2C8VA 2OBMA 5CK4A 1QBKC 2OFOA 4KLNA 4JVNA 4Y0VA 2X1VA 2YJTD 3MG9A 4ZDKA 2W58A 3RS0A 1KI4A 2V54A 1E2DA 5FI1B 4Q03A 4IVPA 3T1VA 1CJUC 3I62A 3PUXA 4HB2A 4JYBA 1QHHA 3ZZTA 3QF4B 1P60A 2WZQA 3A1UA 1KOFA 4D0LB 4JBYA 821PA 2AN9A 4B74A 4BFSA 3SQXA 5AUPB 3EX7C 3FHOA 2H92A 3F3YA 3RC8A 3RRNA 1W5TA 2HDNB 4GRAA 1Q3HA 2ATXA 1PUJA 2CE7A 2KJQA 1WA5A 2OESA 2XX3A 3C5HA 1MH1A 1MO6A 1XEWY 3UPUA 4O2RA 3PJRA 1OH8A 2QAGC 1U90A 4LBZA 2WKQA 2ZE5A 3JVVA 1KI2A 4NP6A 3TAUA 3B2EA 4ZCIA 5C4MA 4BRWA 4DDWA 2VP9A 1GFIA 4YMVA 1E69A 3PUYA 4TYPA 4XTCS 4M1KA 2ZQ5A 3A1WA 3U6KA 4RZXA 2EYQA 5TY0A 3KUDA 2F9LA 4B48A 1W5SA 2IXFA 2FFQA 2QP9X 2ZRMA 5E7IA 1V5WA 5FUVA 4DVGA 5DYGA 3AVYA 4E09A 4BFTA 2REOA 1G3QA 3LQQA 2IA5A 1T8UA 3LQRA 1MO3A 1IAQA 1NIJA 3HU3A 4JLNA 5JFGA 2YOFA 1AS3A 3U44A 3X1WA 3THWB 2F55A 2G9NA 4BE7B 5TV2A 1EK0A 3K53A 4EPRA 2QGNA 4AG5A 5G3ZA 2KSQA 1T8TA 2FGJA 4Q4AB 1OYWA 3MUFA 3ZD6A 1M1YE 4KYIB 1MO4A 1RJ9B 421PA 3GLFB 2GXSA 1DAGA 1FFHA 2BBOA 4OL0A 2AXPA 4EPXA 2QRNA 3E70C 2WJJA 2EVWX 4MUAA 5SZHB 4URWR 4JVLA 1MR3F 1AQYA 4ZPXA 1ZAKA 1N5JA 4GMDA 2XNSA 4DZZA 1YR7A 4D82A 1AGPA 1O3YA 2D62A 4KFRA 3TH5A 4OI1A 4CYMA 5JSZB 2ZRNA 1D9XA 1GL9B 3QI2A 4JL8A 5ANRB 1LS1A 4C7OB 1KMHB 3U6BA 1NBME 1C9KA 2QN6A 3A4NA 3AVWA 2DYKA 2OBNA 5E3HA 2Z43A 4PZZA 4EUNA 4XH9B 3OESA 2W6IA 4EJSC 2WWXA 5KSZA 1OH7A 3IEUA 5DISB 5C4GB 3AQ4A 1CJMA 1N6IA 1ZNWA 2FF7A 2Z83A 3BFXA 2QRZA 1K8RA 3P32A 4IDHA 3CPJB 3VKWA 4C0AC 1SHZA 3QNUA 2LCFA 2AKYA 3BB4A 1E79D 2HLDD 4L15A 1ZRHA 1ZM2A 4UXIA 4V02A 4QXAA 5LD2C 2A5YB 2AR7A 4LHZA 1LB1B 2RH5A 4DSTA 4IDOA 2RKOA 3EWSA 2XZLA 4RD4A 2ZXUA 2A30A 2ERXA 2P0EA 1W0KA 4CEHA 2ZU0C 3GJ7A 4EPVA 4B35A 2GJAA 2WPDD 4DDTA 3U7FB 3TAHA 1ZC3A 2REBA 5JSZA 3EIEA 5DI3A 3W6PA 4QJ5A 1ZVQA 1KMHA 1DAFA 4DSNA 4PO8A 1IJFA 1PVOA 1MKYA 1H65A 3DKVA 2OLKA 3E5HA 3LNCA 4M2LA 2XZOA 1VCIA 1IY1A 2BMFA 2ZRKA 2WOOA 4CGZA 1CRQA 3I72A 2C5LA 2CNWD 5ELXA 4HZUB 2ZM5A 1RE0A 1Q44A 2KWIA 1FTNA 2FJUA 5FTLA 2OT3B 3AM1A 5EE9A 2X8AA 4YXWA 5SZJA 1UBEA 2JAQA 2ODWA 3CX8A 3ZYCA 3C16C 2IYSA 3EZ6A 3UIEA 4EKDA 1KY2A 1QHXA 3GFTA 2ONKA 1RFLA 1Y63A 1I2MA 3PEVA 3B1ZA 3VKGA 3Q5DA 3CPHA 1D2NA 1P9WA 3C7KA 1W36C 3LH5A 2QMOA 2NO6A 4PX9A 2GXUA 1G17A 3VX3A 1IM2A 3DPUA 1PJRA 4JKIA 2H18A 4KODA 5C2JB 2XXAB 4Q7MB 2VRWA 1CJKC 1Z0IA 4JLDA 1QDEA 2J7PA 1MO5A 3EAQA 3RS2A 1QHGA 4EFMA 1DTSA 2HF8A 4KLZA 3P1JA 2HV8A 1E2NA 4A0HA 1OE0A 4ZDJA 3K70D 1G7CA 3E1SA 1DAKA 4BFUA 2GWHA 4JZKA 4ESVA 4YDSA 2WTUA 4Q4HB 4LDJA 1XTJA 2ZJ8A 3KKQA 4HDCA 3Q85A 1VG1A 4Z8YA 2C04A 3HP1A 2FPLA 5JWOA 4G5SA 5AK0A 4HLQB 4PC1A 5J5CA 4D25A 3KQHA 3LW7A 2FN4A 1QRAA 5FPSA 1OXVA 2VSXA 3FB4A 5TVKA 3HYTA 3NBXX 3U4QA 3OEHD 2CEAA 4PXAA 4B43A 4FXPA 4HUQB 2J9RA 1MT0A 3QKSA 1NKSA 3FGNA 2ODEA 1UF9A 3NC1C 3I4LA 1T4GA 4UNNA 2CCJA 1XTRA 1ZU5A 3UMSA 1U8AA 3L2OB 1NVWQ 1US8A 4JLVA 2A5JA 3KXLA 1DEKA 1RZ3A 1F5NA 3ZVLA 4DDVA 4TQUS 1BMFD 4N3NA 3C15C 1FQKA 2ANCA 4DLUA 2BBWA 1G7RA 3SNHA 1CJVC 3CBQA 4MQBA 5FBLB 2W83A 3UK6A 3A4LA 3AKYA 6Q21A 2JIZA 4TT3D 3THXB 3B1VA 1BH2A 3KKNA 1RW4A 3OZXA 4B6FA 4EQ6B 1W0JA 3UG7A 5UKDA 4CVNA 4BGDA 1R0WA 2IF0A 2GZAA 2BEJA 4M1TA 3QSYA 1XU4A 3QIAA 3DEFA 1SVMA 3MD0A 1D5CA 4NE2A 2XB4A 3IBGA 1WBDA 1E9AA 4HUTA 3TSOA 2RHDA 2EWVA 4CRWB 3ZH9B 3RABA 2PJRA 1C4OA 1VDZA 4Q7LA 2ZUDA 3B60A 1NP6A 4W7SA 1T0JB 2O8FB 5HCIA 1SVKA 2EWWA 5AUNB 2NZJA 4HUQA 2D7DA 2Q9AA 2ZSEA 2V6IA 1XMJA 4PC7A 2QGZA 1EFRA 3OFND 3WP0A 1EG7A 4IRUB 4OQFA 1P2VA 2DWQA 1VIAA 1COWA 1CS4C 5LB2A 3WRYC 2FDCA 5CJPA 4URZR 5A5GA 1UEIA 4JLKA 3THOA 1HT1E 1LF0A 1WMSA 1H8ED 3TQFA 3AB3A 1UFQA 3I3SR 5JRZA 3A4MA 1E4VA 1KO5A 4HB0A 4IDPA 1TQ4A 1ZIOA 1W49A 1LFDB 3AV0B 4TTRA 2YV5A 4RVCA 4US0R 3NH6A 3W5JA 3THXA 3H84A 3SYKA 4HAXA 1W44A 2FV8A 2QZ4A 3OIWA 3BERA 2FFBA 3EA0A 2ZR0A 3UXMA 4Q1AA 1QZXA 3RS4A 3HR8A 1RRCA 2GHIA 4KFSA 5BN3A 2YOGA 5KDOA 1N6LA 4XVQA 2J46A 1SKYB 3QE0A 5DHAA 1X86B 4I81A 1XX6A 2QTHA 3QF7A 3L43A 2GVDC 3IKJA 1DO2A 3MRSA 3FMPB 1G4UR 3QVVA 1DAMA 4LPSA 2VHQA 1E2EA 4Z8XA 2C95A 1OPXA 2DFTA 4DLXA 3VMFA 3X1DA 4B3FX 4DT1A 2GCNA 2QE7A 4ARZB 1DAEA 2DWPA 4OHWA 4OHXA 4TMXA 2XOKD 2OXCA 1P75A 3ZLJA 4C0QC 1ESMA 1AZSC 2YWEA 4YC7A 1U0HC 3LY5A 4C9BA 3IO5A 2BBSA 2ZI4A 3AVXA 1JQLB 2BCGY 4UXHA 1W36D 3VKHA 3FWYA 1MRSA 3PEWA 4NCHA 3IQWA 4Q48A 2CLSA 2CVFA 4RFVA 4PAMA 4XD7A 4P31A 4Q4JB 2FSGA 4GPTA 1KNQA 4B33A 3BH6A 2J87A 3EZ2A 4F91B 4MRVA 4CW7A 2ZYVX 4GZMA 1S3SA 2IYQA 5B30A 4A0GA 1BYIA 3VTKA 4DIEA 1LNZA 2P5SA 4BFYA 1KZGB 2OAQ1 2KB0A 2ZRHA 3NTUA 2ZSAA 4RZ2A 1OV4A 2YVUA 1CR1A 1GP2A 3R7WB 3BOSA 2WJHA 2IW3A 3NBZC 2V9PA 2BV3A 3EIQA 2NTYC 1W47A 4OYHA 4LJ9A 3S1AA 2A78A 3V4RA 1ZW6A 1T5IA 5L3QA 1N6PA 3IIJA 4LWZA 3VHXA 1A7JA 1YZKA 2V4ZA 4LZZA 4NONA 3CKLA 4JLOA 4ZV4A 5AUOB 5G53C 5AJXA 4QHYA 1J2JA 3NVAA 5DLQC 3I8XA 3AVPA 2BCJQ 3P20A 5TDHA 2R44A 3L0SA 5GJCA 2C96A 4A6PA 1A1VA 1E4YA 3RDPA 3U7EB 1TQDA 3RS7A 5C18A 1P73A 3IIKA 4WIAA 3RLFA 1XCGB 1LTQA 3BH7A 3A1SA 1Z0FA 3I5YA 3FFBA 2N42A 1R0YA 5KSYA 1WE2A 3LBHA 1YZNA 2FMXA 4GOKA 5J4HA 2AXNA 3P26A 3WNCA 2RGBA 1ZCBA 3QENA 4D0NA 2C99A 2ZUCA 4WZAE 1N6KA 4PPGA 2W2VA 2GA8A 3R7WA 4AG6A 4CT5A 1IOZA 1KKLA 4RD2A 3SHWA 1NG1A 1XNJA 4S2EA 2WSSD 4LV6A 1RRFA 4Z1MA 2W2TA 4Q01A 1IN8A 2RGNA 4DLRA 1FX0B 3FKSD 1K5DA 3C5CA 4LJ7A 4TLBA 3IUYA 3RYTC 4DWJA 3K9LA 4YMTA 2WKRA 2V8OA 2B6HA 5B64A 1HH4A 5H68A 3TR5A 3WBJA 4BFZA 2VIIA 1JXMA 2HUPA 5FOSA 3ZIAD 2A2ZA 121PA 5JHGB 1GKYA 4A36A 4G01B 2IF2A 1XZQA 3VFDA 2FFAA 1Z6TA 2CL7X 3DOEA 3QBVA 3KQLA 2D2EA 1AM4D 1UDXA 1F60A 5DO9A 721PA 4EDHA 1SXJB 3FPAA 3HWSA 4RSGA 4EIWA 2RGXA 1XZPA 3GJ5A 3Q3JB 4EFNA 5K8UA 4MGZR 4GDFA 3X1XA 4TL9A 4IKEA 2FZLA 4LBYA 1E9FA 2RGGA 3W90A 5IT5A 4QM6A 4E03A 2R65A 4Q18A 2A9KA 5EE3A 3GLIE 2DCUA 2IYUA 4P32A 4BLSA 1IXZA 2OEPA 2PL3A 5HE8A 1EFHA 2IHYA 5FBWB 4CEJA 1FMLA 3FMIA 4B2IA 4HZIA 2JLUA 1L8QA 3W6NA 4D4LA 4LYHA 2C78A 2VHCA 2EQBA 2IX3A 1GOTA 2JDID 5JCZA 2LKCA 2L0XA 1CULC 3GLHA 3K0SA 3DHWC 2Z5FA 1JBKA 4DDUA 2I1QA 2HJVA 5HZHA 1XP8A 4FMDB 4OQLA 4RCYA 4UQOA 5DGXA 1CXZA 3CNNA 2CVHA 1LVGA 1GRNA 4LCBA 2H17A 5EE5B 5LB4A 4MUBA 3EZ7A 4XOIA 4DEXA 1E1RD 2BMJA 2ZI7A 1VG9B 1EFUA 3QKRA 1RVDA 2E9SA 2OV2A 1G3IA 3GJ3A 4AIIA 4C4PA 5BN4A 5FL7D 2PX3A 1YRAA 3QXSA 3A8TA 2NGRA 3GEIA 1SVLA 4D26A 5HTKA 2W0SA 4PAQA 4LV8B 2GESA 4N1AA 1TEXA 3WBKA 3KXIA 1P5ZB 1VMAA 4KSBA 4QGGA 1JR3E 2CHVA 2WHXA 3QG5A 3AF4A 1WB9A 3TGPA 2W0MA 2Z0MA 4JSTA 4FD2A 5E95A 1CR4A 4H9GA 2P6UA 3VU9B 2H5EA 1NNEA 1OHHD 2VYFA 1XMSA 2R9VA 2ZSDA 3EA5A 3HPQA 2XJ9A 1E2JA 3QPUA 3CWZA 4FINA 3O8BA 2OFXA 3ECCA 5E4FA 1T3LA 2WICA 2O8EB 2ZTSA 5EP3A 3V9PA 2YHSA 4ZIRA 2R6GA 3BGWA 4M1OA 2H57A 4NCIA 1U8YA 5AUQA 1NL3A 1XF9A 1S9HA 4NZYA 2J0UB 2R6AA 2F1JA 1AS0A 5E7JA 1TADA 2QSYA 4NL4H 4M1YA 1DVRA 1XXHB 4YMUA 4IEEA 1II8B 3I8SA 4C2TA 1S9DA 1R5BA 2PH1A 1UEJA 3PCRB 4HATA 3CUEF 4WXRA 3TQCA 5KO2A 4LJAA 1ZM4A 2JJ8A 3MLEA 2XSZD 4AYWA 1XFAA 2O8DA 4NKRA 3EARA 1U2RA 3CH5A 4B44A 3KB1A 4HSEA 1R2QA 5GJWC 3I1FA 5JS8A 1IN6A 1QHHB 2R8RA 2ZI3A 2ZS9A 3CX7A 4IFBA 4V0MA 5F2EA 4L8GA 5KDLA 4D2IA 4AKHA 2V55B 4LHXA 1E79A 1SZPA 2GRJA 2HLDA 4Q00A 5EUQB 1P6XA 3SDZA 2GKSA 1IXSB 3QEJA 3HU1A 4TLDA 2WWIA 3EPLA 3RHFA 3D7MA 1N0UA 1N6OA 2ZANA 2O8CB 5CYPA 4C2UA 3IO3A 3I32A 4BQSA 1N0VC 4RKEA 1XEWX 2ZUBA 4GL2A 2ZAOA 1OXSC 1KSFX 2HT6A 4GFDA 3WYAA 4OBEA 2GXAA 1Z28A 1JR6A 3IPXA 2ZJ5A 2Q21A 1YR9A 2J0UA 4GOXA 2VHJA 2F1HA 1OIVA 2QAGB 2HXYA 2LKDA 1II8A 4Z51A 4A1FA 1R8SA 2CMKA 1X6VA 2I3BA 2ZRFA 3FMFA 3AP1A 1FTSA 1IN5A 2XAUA 4KVGA 1P9RA 2GNOA 4FCTA 2BC9A 2C77A 3RRYA 5FH9A 3NXSA 2CNWA 3CR8A 2NOAA 2BMDA 2OILA 3NBYC 4UJ5A 5EQTA 2OZEA 4F7WA 5IHPA 5KOYA 1X8LA 2OE2A 3Q7PA 3FHCB 1T91A 4NMMA 2D74A 1OW3B 2DBYA 3RSOA 3U44B 4IDNA 4O3MA 2JJ2D 4M9ZA 2HXSA 1S3GA 1A2KC 5CYOA 3LX5A 2YNMA 3PXGA 2ZETA 4MRNA 1YZGA 3SYLA 3TLXA 3WHLA 2XZPA 1WRBA 2O8CA 1VKJA 1P2TA 4LC0A 4RY2A 3ZGXA 3GLFE 3EPKA 1LV7A 5CDFE 2BVNA 4GOJA 4QL3A 1W2HA 1GKIA 2UVQA 4PZLA 3CH4B 3RWMB 3X1YA 4N0DA 3K70C 4F93B 4PPFA 3T34A 4B2LA 1HQYE 4AY2A 1JECA 1X1RA 1KSJA 3GEEA 3I73A 4Q9JA 4URVR 3MSXA 2QAGA 1G7TA 1ONBA 5AJWA 4JBWA 2IHBA 3M4YA 4BLRA 4WAUA 4PQFA 1RC8A 2A5GA 1E2IA 3LXRA 4M0LA 1KDRA 3HDTA 2AL7A 3BK7A 4C0JA 1CR0A 4BWYA 4FW9A 3FYHA 3J81k 2HYIC 1WF3A 1E1QD 1DOAA 4LI0A 4NYIQ 2XJ4A 2VH5R 3H86A 1OF1A 2GEDA 4JKYA 1RYFA 4BECA 3I5XA 3CNOA 3U7GA 3SFVA 1G9XA 2VPPA 5A4JA 4Q1BA 2FNAA 4GMXA 4O2LA 3OEHA 4IXMA 2XITA 1HTWA 2WAXA 3OEED 3CW2A 4MKGA 1HV8A 2QROA 2ZR7A 3ZDQA 1KJWA 1G4AE 2H8KA 2NG1A 4M1WA 1KI3A 3KL4A 4Q1DA 1DARA 4XWKA 2G1JA 2J7KA 4IOKA 3UATA 3CM0A 4B47A 1XPUA 3UG6A 4JJKA 3TJZA 1GKUB 4TWZA 2JGNA 3AUXA 1NRJB 1L4YA 5LD2B 1BMFA 1MABA 4KBFA 4XVUA 1WDTA 4C0HA 4CEHB 5GADl 1P62B 3AGPA 1F3OA 3VR1A 3KKOA 4TLAA 1F48A 2BKEA 3DL0A 4TT3A 5DI3B 2I4IA 2AKAB 2B7CA 5KDDA 1FUKA 2BJWA 1OH6A 3BB1A 2YOHA 3FHTA 2N46A 4UXJA 4A0RA 1RIFA 2NO9A 5GJBA 2QTFA 1E2KA 2O52A 1G291 1QVRA 2QORA 3B8HA 3T06B 4MGKR 1W2GA 2GILA 4QGHA 2IEYA 3ICQB 1KI7A 4PFSA 1R10A 4EJSA 3WHKA 3SZRA 4LBVA 2R6CA 2KBFA 1QHYA 4HDOB 3QPVA 2VP4A 1AA9A 4YLGA 2GDJA 3OFNA 4JLMA 2YYZA 2QUZA 3GPLA 2ZE8A 2ZSFA 3B9QA 2VSFA 1ANKA 1RYHA 1CKEA 2DY1A 4BPBA 2RGCA 1N6NA 3CF2A 4I1VA 3PITA 3B6EA 3NEYA 4CIDA 4NYIR 4A4DA 2X77A 1H8EA 3HR7A 4BEBA 3CB4A 5EXTA 1G20E 3GFPA 1R6BX 3L0PA 1W36B 1R0XA 2IYZA 1VIYA 2JCSA 2YWHA 5KTYA 3R9WA 1G8HA 2WWYA 1D9ZA 2WBLC 1CU1A 1IY0A 2RB4A 4WA7A 3K0AB 4JLAA 1KJZA 3TRFA 3W6OA 4JBXA 3TUZC 1T5LA 4M8NE 5FR2A 5FTNA 2R2AA 1T3SA 3IEVA 1QHSA 1X8KA 3GQBA 1UBGA 2FOLA 3EC2A 3GP8A 1VHLA 4NCKA 4LJ4A 4B34A 2HF9A 2R6FA 5JECA 1PV4A 4A0FA 1YR6A 5AJYA 3EPHA 1I2DA 1L2TA 2C03A 4M1SA 3SOPA 1F2UA 4XWAA 2ZJAA 2WWHA 2EYUA 4OI4A 3B1YA 4GZLA 2GJSA 3PV0A 2IUUA 1E2QA 1E6CA 3PIRA 1NI3A 4IJMA 2ZS7A 2O8BA 3U4QB 1WQ1R 5AJVB 2WV9A 3KJEA 5FOWA 1Z6AA 3QKSB 2XOKA 1YQTA 1C1YA 5FOVA 2F43A 1NSFA 1T9HA 1NJFA 2O5VA 1XMVA 1US8B 2GAAA 3NEJA 1EX7A 1HA3A 2XNDD 4C0LA 1JR3D 4DLSA 1AQUA 2XTZA 3TW4A 4BLOA 4F38A 2O0KA 5EE0A 1CF4A 4NYMQ 4PQYA 4Q1FA 3U60B 1E2FA 2AK2A 2YINC 2IS6A 3UMRA 2ZRIA 3DZDA 3EG5A 2G88A 5F9HA 3K0AA 4B73A 1ELOA 2HJGA 2BDTA 4U02A 2ZRPA 4KFTA 1TNDA 3H2YA 1I4LD 3LRPA 1GM5A 2GCOB 2QPAA 4YMWA 4FIDA 2GJ8A 1NF3A 2ZJBA 3P27A 4RD0A 4WOPA 4YDHB 3GLGB 3R8FA 1NY5A 3SQWA 5HPYB 1QHNA 4I4LA 4V0OA 2Z6VA 1AGRA 1QHIA 1S8FA 1VECA 2BKUA 4ZDWA 4MYUA 3RVBA 1AS2A 3UWKA 4IOJA 1W4RA 2IUSA 3MJHA 3B1XA 2P6RA 4A2PA 2IC5A 1OSNA 4V0LA 4G5QA 1Q3TA 5CM9C 2QP3A 3T61A 1GAJA 4P4UA 1R8QA 4MYCA 4ON9A 4C3ZA 1EFTA 2P67A 1K6MA 4B3DA 4EPWA 1Y3AA 2ERYA 3AVUA 1E94E 1KK0A 1WXQA 2FEOA 4G3XA 4C0KA 1E0JA 3BB3A 4M9QA 1Z06A 3O8RA 3DO6A 3VR5A 4D4KA 1HE1C 1S0UA 2JLQA 5IK2D 1ZC4A 4IEIA 2MSEB 4TMTA 2QMUA 2YWGA 3REGA 3CRW1 3QEOA 1DG3A 2QT0A 2ZPTX 1GRQA 2FA9A 5JWRA 4N0EA 2GCOA 5G3YA 4LK2A 4ZDIA 2CHGA 5B57C 1BIFA 1E96A 3GLGA 2PT5A 4LYJA 4TSFD 4S35A 4NHOA 3TE6A 2VLIA 1SKYE 1TTTA 4WBSA 3B5JA 4PO9A 1PLJA 1E2MA 1D8TA 1FZQA 2QI9C 1AKEA 1OFIA 4PR0A 4NYMR 4GT1A 1XCPA 2WSSA 3KX2A 5CJ2A 5DN6D 4A15A 3LLMA 3D8BA 1SULA 4KI0A 4Q66C 3MWJA 3FOZA 3AF0A 1DADA 3FKSA 4ASUA 2OCBA 1MV5A 4UNRA 2FH5B 4DT1B 3G0HA 4NCNA 5H8WA 4LJ8A 2QU8A 3GJ6A 3AP3A 4ZI3A 5EE1A 1VCMA 1XTKA 1EXMA 1JXOA 1F2TB 2ZRAA 4HDQB 2BWJA 2IWRA 4B71A 3ZIAA 5CLQA 5B58C 1G41A 1KJYA 2IYTA 3T12A 3IQXA 4BUJA 1FL9A 2F9MA 5EP2A 5C1BA 3HYRA 1DAIA 1GUAA 3L8ZA 4UNPA 2ZAMA 4TL8A 2G3YA 1XDBA 1P3JA 2JLWA 3ZVRA 2QL6A 1N5IA 5L3SB 3A6PC 4PO1A 4F4IA 1Z08A 4JLJA 5DIFA 4EPYA 3REFA 3NDBB 2C9CA 1BS1A 4JL6A 3WNBA 1GVNB 3KJIA 2FEMA 2REXB 4TTPA 4DLZA 4K8OA 4TL6A 1UKEA 5EJEA 2RAPA 3ND9A 4P4TA 1FW6A 5BQ5A 4IW3B 3K1JA 2WVJA 5EXPA 4W5WA 3Q5EA 3PENA 4JMPA 2D06A 4PC2A 5CK5A 4Q1EA 2KI5A 2RCNA 4F4JA 3S1AB 1IJEA 5L3QB 2VQSA 1N3BA 2VSOA 4JLBA 5J4VA 4W9MC 1JAIA 2JDIA 3BE4A 2TMKA 1F2TA 1ZM7A 1VPLA 2RGDA 2Y8EA 3T35A 4P4SA 3EIHA 4DLTA 1LY1A 2QNRA 2J0SA 3O8DA 3D31A 1IQPA 5E7MA 3AVTA 3KQNA 1E1RA 3V4FA 2EFHB 2YWFA 4AKIA 5L3SA 2X19A 4TL7A 4PANA 2DWOA 4HAUA 3CZQA 2B21A 5FL7A 4DUGD 4HAZA 2DPXA 5BW8A 4XIGS 1KKMA 4RD1A 5FOTA 2V7QA 4ACAA 3LFUA 2BEKA 2EW1A 3NC0C 4L9SA 1NG9A 1XJCA 4LHVA 2VHTA 4KCGA 1UKYA 2W2XA 2ZYTX 2UZIR 5EXSA 1BO6A 3TUJC 4HAWA 3AF1A 1X1SA 4MRSA 1KK2A 5CB8A 3AVQA 2IXEA 4PHFA 3VAAA 5FPTA 1E9EA 3QXXA 1HE8B 1NBMD 1R0ZA 3MAAC 1OHHA 3B1WA 2SHKA 5KHOC 1OFHA 1A4RA 2C9YA 4NCJA 2QAJA 4G5RA 2ZRLA 4M4SA 5F98A 2FZ4A 2XGJA 4NYJQ 3PR1A 1SHKA 1U0LA 4B3BA 2QPOA 1NVVQ 3K9NA 3NG1A 3EXAA 2AWOA 1S1MA 3ONWA 2VP5A 4PHHA 4P33A 4OK6A 2P2LA 2KE5A 2OLJA 1PLLA 1X3SA 4LV5B 3R9XA 3BC1A 2F6RA 3T5GA 2H16A 2CHQA 2Q6TA 1BYUA 1E0SA 1OIWA 2ZSBA 4HAVA 2Q3FA 1VG0B 1XWIA 2OCAA 2XSZA 2YZ2A 3SHFA 1O87A 1SXJE 1VYVA 3K0FA 1GILA 1OB5A 1P61B 3ADKA 5M04A 4IVRA 4M9XA 2VO1A 3CF0A 4QOSA 2NQ2C 1WCV1 1XD2B 4JLPA 4KBGA 3W34A 1OB2A 2X2FA 1H8HD 4G5GA 1LF5A 2Q3MA 3PEYA 2O0HA 3AGQA 2P5TB 2GTPA 3OAAD 1QF9A 2QPTA 2ORIA 1VYTA 2OG2A 3RWOA 3SC3A 4XVRA 1NVUQ 1XJ0A 3IIMA 4BFWA 2ZS8A 2I1VB 5JEEA 2VA8A 2PLRA 3BFVA 1UM8A 4H1VA 4ASUD 2NIPA 4B3XA 4CEJB 4LOAA 4QFMA 4DCUA 5LDDC 4TYQA 3O8CA 1E98A 1GIAA 4KYUA 1L7VC 4LHYA 4R2HA 1XEXA 1Q22A 3R8CA 3GLHB 4F4CA 1UAAA 4KAXA 1EWRA 1IY2A 2HT1A 4DC9A 4PSKA 3QY0A 4TYYA 3MWLA 1ZNXA 5FBRB 3WRXC 1N0WA 4OHYA 1GL7A 4FCVA 1G5RA 1KO1A 4AI6A 4OI0A 3QKRB 2EFDB 2BJVA 4Q7KA 1U8ZA 1M7BA 4R7ZA 4NYJR 1NMZA 2WJVA 2YKGA 4NTZA 5H70A 1W46A 1M7GA 2ZI9A 1KDTA 5FUYA 2BM1A 3FE2A 3ASYA 1XD2A 1NKTA 3DOFA 4X8MA 4RFSB 2GETA 4XSGA 3SR0A 4KITB 3U3MA 1NVVR 3KQKA 2IS4A 1SVWA 2GVZC 2JJ2A 3KJHA 1Z47A 2W6JD 3DZ8A 3ZS8A 4Q9HA 1AKYA 3TMKA 1KSHA 2DFNA 3OIYA 4F92B 1EX6A 1IN7A 3GMTA 1RRGA 2QSZA 5JZVA 1Z83A 521PA 3SS8A 2GZDA 3W8NA 3L8YA 2EU8A 1BKDR 3O47A 4JT2A 2GBLC 3F0TA 4I1UA 2JATA 1E9CA 2ZE6A 5HR5A 1LS6A 2CJWA 4QBHA 1SGWA 3F5FA 3G82C 4ZI2A 4ZIRB 1XB2A 1X8JA 3LLUA 1OLOA 1VTKA 1ZMXA 2JA1A 2AX4A 1JEDA 5CIQA 4DCTA 4TN1A 5LBIA 1KI9A 4DB4A 4BFVA 2CCGA 2NO7A 1XXHE 3OIUA 3IGFA 3P4YA 2R62A 4NDZA 1E1QA 1M7HA 4BLPA 1GNPA 1V43A 4LJ5A 2ZEJA 2CLDX 3W8RA 4D0GA 5JBQA 4HEJA 1JB1A 2V7QD 2FGKA 1KY3A 2O8DB 4RZUA 4P0TA 4Q7JB 4RFSA 1ZJ6A 3ZD7A 1NIPA 4PPNA 4ILEA 1FPMA 3OEEA 1OIXA 5DH9A 621PA 3ZVNA 2CLCX 1P9NA 2WAYA 1RRPA 2PMKA 2FPMA 3IHWA 4JIMA 3U7HB 4B3CA 3ZJYA 3VNUA 3QUSA 4TMKA 2ZJZA 5FR1A 4HB3A 4HLUC 5G41A 2FSFA 4B6EA 1ZUHA 3K8YA 2IUTA 2DFKB 3MCAA 1Q21A 4OQMA 2ASEA 1DE0A 1W1WA 2ZI6A 2VL7A 3QXJA 3CLVA 3K9GA 4WZ6A 2NPFA 3VR6A 3Q9LA 1ESNA 1G16A 2PEZA 4FWTA 2ORVA 5FUXA 4CF7A 5EUMA 1KI8A 4V0KA 4QRHA 1I4TD 2PEYA 4Q4LA 4CT4B 1XBTA 2B7BA 3WNDA 2OCPA 2WMNB 1XD8A 3OF5A 1U81A 3GJ0A 3QQ5A 1VCNA 2AFIE 2VEDA 3Q72A 4US1R 1R5NA 2J59A 4DXAA 3PFIA 3CRMA 3NH9A 5JWHA 4XJXA 3CWQA 5EP1A 2JLSA 4H1UA 5A0FA 1G21E 3B9PA 2AD1A 4OHZA 2JJ1D 2AD5A 4AKEA 4FI3C 1UKVY 1AZTA 1AN0A 3WYGA 3M6AA 5IF9A 4GSYA 3FFAA 4OK3A 5D3MB 1NVXQ 1XTIA 3KQUA 1KTVA 3LV8A 1J70A 1NN5A 2AWNA 2BBTA 4GI7A 4RKFA 2GXQA 3RRMA 1ZBDA 5EZ5A 3BAFA 3MMPA 3IBYA 4L4UA 5FUWA 2A7QA 4LYAA 4LX0A 4QG7A 5GVSA 1NMXA 4LBWA 4G0NA 5CM8B 3PUWA 3GLIA 3SBEA 5HZKA 4MH0R 4OK5A 1QG4A 3CIOA 4FN5A 1M6NA 5FI0B 5J4KA 1E9SA 4L5BA 4Q9KA 3R20A 4KFUA 5DSZA 4DBLC 3K70B 4JYCA 2A5DA 2CCKA 3W3AA 2GF9A 3G5UA 4HLDA 5FTMA 4DCVA 1UPTA 1OYYA 4ABYA 4DKXA 4UNQA 1GG2A 1GWNA 1LW7A 5H1YA 3BWDD 2FSIA 3X2SA 3A36A 2F1IA 1ZINA 3LXXA 1NLZA 5KUTA 3ZS9A 2XB2A 4RJLA 2QA5A 2IYVA 1I4DD 1P72A 1VHTA 3OE7D 2ECKA 3QVUA 2CL6X 3TNFA 4RZ3A 4A8JC 1Z22A 2AHOA 1P4SA 5D3MA 4QGAA 1CRPA 1U0JA 4OJQA 1KGDA 1M2OB 2J45A 1P7CA 2H7VA 2CL0X 3ADCA 1W4AA 1DBSA 4IHQA 2F3TA 3FKQA 5JS7A 3LWNA 4A8JA 1ODFA 4AK9A 3AKDA 3BS4A 2XNDA 4DLWA 1JR3A 4BASA 1GSIA 1MABB 2IT1A 4FCWA 1ZD9A 1YR8A 2ZJ2A 3LDAA 2WM9B 3BFKA 1SQ5A 2P65A 4GP6A 4PTLA 4TZ6A 2QM8A 4Q47A 3GJXC 2QG6A 5CITA 1XEFA 2OBLA 2OXRA 1Q20A 3HU2A 5TMPA 1HY3A 1G8GA 1YJ5A 1RKBA 4BLTA 3TIFA 3IILA 1Z3IX 4TLEA 1Z6YA 1R4AA 1NMYA 2D2FA 1II0A 1ZNYA 2VTKA 1D6JA 1Q1BA 1JEEA 2J5XA 4EJSB 1EGAA 3KUCA 3SYNA 2Q0HA 3QG1A 4EAQA 2G77B 3PQCA 3TUIC 4XTRA 2BMEA 3QKTA 1GNQA 2ORWA 4OKSA 4HB4A 2FWRA 3VHLB 1SXJD 1R5OA 3K09C 4KXFB 2J0VA 2PLFA 4EFLA 5EZ6B 1KAOA 1BOFA 3WMEA 4DHEA 3QF4A 3N2EA 3K09A 2QP4A 3ZZUA 4CDGA 1XTSA 1ZD1A 5IK2A 3FDIA 3LBNA 3D3QA 2FX3A 3MWKA 1S4QA 3H0KA 2MSDB 3M0EA 3MWYW 2MMCA 1KK1A 2FG5A 2FSHA 3ETLA 3A37A 4JSYA 5J4YA 3DM5A 4DJTA 1TQ6A 1D2MA 1WBBA 1KZ7B 2WWFA 3CRQA 5HKKD 5TXGA 2BHRA 2NO0A 2FPKA 2QQ0A 4MGIR 4IXNA 4TSFA 4US2R 3RNLA 4QGFA 2WMOB 4LYFA 5BYKA 3U3RA 3UWOA 3CF6R 2GJKA 1Q1ZA 1KHTA 1FNMA 2XEXA 1E32A 1P2SA 1Z8FA 2HCBA 5KYKA 1F2UB 3NBFA 5DN6A 1FQJA 1OFTA 1Z6XA 2OO7A 2C2HA 1Z0DA 4IVQA 1J90A 4ZKEA 2O8BB 4IOLA 1YE8A 2V1XA 1FP6A 2ANBA 2MSCB 5CIWA 2A3RA 3V00A 4K46A 1DS6A 1E2HA 1WP9A 1Z2CA 2DFLA 3AP2A 3ZQJA 3LW8A 2WWWA 1IHUA 1Z63A 2NMVA 2QEQA 4WZBE 1VCOA 4ESHA 2F43B 2J0QA 1SVOA 4MKHA 4DB2A 1HT2E 3I61A 3THWA 2IYWA 1T6NA 1OFUX 2P6NA 1IBRA 3NWJA 3QOFA 5IDVA 1XPRA 2CK3D 1XTQA 2PCLA 3ZQ6A 3MFYA 1YZTA 3RRZA 4Q4AA 4KU4A 4E5UA 4PPQA 2ZREA 4ERNA 1RJ9A 2IL1A 3F8TA 3GLFA 2WKPA 3DVLA 3WMGA 2IK8A 1CR2A 3B78A 5CDFA 4Q9IA 2CBZA 1U99A 3MGCA
chains in the Genus database with same CATH superfamily
5KEIA 2ZYWX 3IQFA 4U7PB 1CY6A 1NF9A 2JRCA 2VJLA 2OSBA 4HMOA 2B94A 1LZLA 4HYYA 3F96A 1WY5A 4BMYA 3ZWQA 5L6MB 1VI5A 1OBHA 2BR3A 3BMXA 4OIMA 2RHJA 1DFHA 3EVBA 1Y8QA 5KPDA 4OBWA 3CPSA 4KQWA 3K1AA 4PCUA 1QDLB 1GRRA 4N0PA 4Q3CA 4ZO7A 4BE4A 3BJMA 1VGVA 3GAZA 3NIWA 3GVPA 3KSMA 4LHWA 3CEMA 4ADSG 2N9UA 4C5AA 2GNPA 1NUAA 1JVBA 2CWWA 2QMHA 3OPMA 3H1AA 1L5HA 3SD7A 1UDAA 5HRAA 1ILWA 2BPOA 4KXQA 2FKAA 1T2EA 1R6AA 2I78A 2F17A 1U7ZA 4TYMA 4R98A 4F6LA 1FBNA 1L3BA 2NXEA 4PX3A 2BHTA 1FP7A 2FZWA 1VZ3A 2VAWA 2YW2A 4TKVB 4DLYA 1VL8A 1WZIA 3K73O 4L5YA 4OXXA 2QT1A 3RE1A 1SEVA 3RAEC 1LPMA 3DMNA 2OVFA 3MM4A 4X85A 3SJBA 2DBQA 3CUTA 3E5NA 3WNVA 4BJ3A 1KVQA 4PS1A 3L77A 4KWTA 2HYDA 3KLOA 3SKXA 7REQB 5T4BA 2I4NA 3IB6A 1H85A 4LHSA 3TK1A 1RWMA 2C2XA 4EJFA 1Z0JA 2Y0EA 1KI6A 4HLCA 3M6XA 4X62B 2RBEA 2IEAA 3HNPA 4ETNA 1SPBS 2HRDA 2HSGA 1OTYA 4WCFA 1AQJA 3PUZA 1UC9A 1Q15A 3C4JA 3MT8A 3JQ6A 4E5PA 2A7XA 1HYBA 4ZOLF 3REQB 2P2YA 2PZGA 3TIVA 4E32A 2GLXA 4RHTA 1DEOA 2G72A 2PZEA 4R41A 4D02A 3U5TA 3UO8B 2C0PA 2FEWB 1JG6A 3HVKA 1PZNA 2P7IA 1G8KA 3EISA 4HNGA 1G55A 3SBOA 4GZ3A 1DKOA 3SN6A 4QBGB 4YBZA 1OXXK 1C0LA 1INLA 1X7WB 2BUAA 4D80A 3N2IA 1NY6A 3EBPA 1PFKA 1REQA 1Z62A 2A59A 2JFHA 2NYRA 3T1OA 1J0EA 5FNVB 4LRWA 1ZUNB 4NE9A 2EQAA 3PHIA 3QA3E 4B9EA 1QFMA 1QH9A 5LMNB 1QVAA 3QGMA 2I6UA 1MHTA 1F6BA 3AJEA 1QZZA 1Z88A 2C9OA 2G76A 2XNKA 3JYPA 4B76A 5JVDF 5FPYA 2PGXA 2EBWA 2PCJA 3NRBA 4RJKA 4YRPA 1LGYA 2OYCA 1OI3A 4KE6A 5K9ZA 3RUCA 3MTGA 2DM6A 3K9BA 4QUHA 1OBOA 2A5FA 1JALA 1UXIA 4AKSA 1C3OA 2B37A 2C2GA 2PUDA 3JRXA 4XUCA 5DNCA 2W6PA 4OHVA 5M29A 4WK2B 1JFVA 3AR5A 4IQ0A 3R7LA 4NV3A 1D2RA 1BN6A 1YU9A 1BKYA 3LZ6A 2VP2A 2WSBA 4MS1B 2R751 2YZMA 1H8HA 3LUCA 3PRYA 3IHLA 4N9QA 1LDBA 4NH0A 4ALKA 4CL8A 4ZCSA 5ALSA 4K81B 4ISBA 1TZCA 1FRZA 1WUJS 3B70A 2ZTVA 4HXFB 2J6HA 4ZRNA 2B92A 5IUKC 5ALRA 3ZQ4A 3G2LA 4MQEA 4IIHA 4UUBA 4Q4HA 5JNTA 3DA8A 2BGRA 1CTQA 1MVLA 4KWEA 3WQSB 3JV7A 4IO1A 2ATIA 4IVNA 4UBNA 1OZ0A 3EBLA 1RRVA 2VT2A 2BUCA 2E89A 2QTTA 3KKMA 3KSDO 5HNKA 4FJ1A 1CUWA 5FA6A 2VC2B 4WXYB 3C3YA 3WO0A 4BN5A 4C29A 1DP4A 2O8CB 5DNEA 2FMTA 1IZYA 3GUVA 2WR8A 6PFKA 4LF9B 4CF6A 2UYOA 1OXKB 4JODA 3PHBE 1JLMA 5THKA 3RADC 3F90A 4QNMA 2WJ4A 4UHJA 1VB3A 2ATVA 2KBEA 3M6LA 1UODA 1E9DA 1VKOA 4GOOD 3ZWBA 4DRZA 1H1LA 3JSXA 2X42A 3PEUA 3U26A 1BMQA 3OC6A 3ILXA 1Z16A 5AM1A 3RVOA 3WMFA 2FQWA 1HYHA 3TW8A 1XXLA 3RG2A 4ZTBA 1CYDA 2XB6A 5IMBA 3T95A 1BX0A 4CZ2A 5LA6B 3GG2A 3GD7A 2HPAA 3LA6A 4DDKA 3KQMA 3G9XA 1WEHA 4WSOA 5D6OA 4ECAA 2HNKA 1W0KD 3FMOB 3G0GA 3K0CC 3U7IA 5KU7A 4LDRA 4D46A 3ZDCA 2JEOA 2DKOA 2W6JA 1KFKB 2IYEA 4UHEA 3X1ZA 4BRSA 1J7KA 4WDQA 2JD1A 2XIQA 2OZPA 1NN1A 4KSYA 1MPTA 1J24A 2AMFA 3G5LA 3K0CA 4HRVA 2ADOA 2W2NA 1FY2A 1G7SA 4DV7B 5JPCA 5CB6A 1SUEA 1YZLA 2DTXA 2VDLB 1PK8A 4NBSA 2MYPA 4UCFA 1N6RA 1XTPA 3A9CA 4TYNA 1I33A 1X2BA 3QFFA 1M2GA 1H6AA 1HWYA 3PI7A 1ZHHA 1KDOA 3WY9A 1FNBA 3CJTA 5IXYA 3TQHA 2O8FA 3WV5A 2ZJ3A 1VG8A 1TF2A 4CMJA 4S1TA 4YXWD 4NJOA 2IYLD 4ETMA 1J33A 4MKFA 1J0BA 2EG5A 2GEVA 4LI3X 2RMKA 3TOSA 1XGKA 3G5TA 3VR3A 4CFSA 1A2BA 1IEWA 2J3QA 5F5XA 5ALIA 4EY7A 2QL5A 3I05A 4IIFA 4RLSA 4M0MA 5TPWB 3AG5A 1Y1KE 2WAAA 4YRBA 1I6LA 3S81A 1DMRA 4RVDA 1DXHA 2A3NA 3AM5A 1PF7E 1RDFA 1TUEA 4REQA 1AKUA 3K0FB 3SP1A 4M53A 2XXBA 1XVLA 3PA8A 1KAGA 1VB5A 2OK7A 4V0NA 1Q6YA 2JZNA 5FRDA 3JALA 4R2IA 1F06A 3EZGA 5JH7F 2VT6A 1JNXX 1YK0A 3DDOA 1M67A 1SHUX 1G8FA 2J7PD 1TVKA 5H7XA 1PZFA 4JQZA 3GZNA 5AJUA 4J03A 1J0XO 5AW5A 1Y0BA 4ITRC 1UDBA 4ZQGA 1XMOB 2PUVA 1I4WA 4IIBA 3RREA 1DHRA 5TQ2A 5KNDA 2HO4A 3HDYA 4IDBA 3T5AA 1RTTA 3IUNA 4F71A 4JASB 4Q3DA 4MDFA 3PUKA 3TTWA 4I9HA 5E6SA 5DNYB 2XUHA 1Y34E 4MJXA 1TW3A 4ZVNA 5A5DA 2DJ5A 5SICE 1UK7A 4PYKA 2APJA 4WX2B 3OCVA 4B7ZA 2WW8A 1J07A 1YZUA 1XL1A 2ZIXA 5T7BA 4QEZA 3F5DA 4FUTA 1CLUA 4R9UC 5KVAA 4II7A 3BCUA 3CZ4A 3GFFA 1VSBA 2NNLD 3W5BA 3S4YA 1N9GA 1OLXB 3DB2A 1O9HA 1IN4A 1JLLB 1SBTA 1Z7BA 2WJ3A 4FD3A 3TL2A 1WNTA 4GO1A 3TIXB 1Z0SA 4M22A 2R4QA 5AWFC 2G8NA 2JB9A 4I1OA 4R68A 4WFIA 5BVHA 1DPFA 1DOZA 2R7NA 3H8JA 4DA8A 4FMBB 4NBVA 4L9WA 2OHHA 3BJIC 3OSZA 4TVSA 4XAQA 3PXAA 1AKQA 2JLRA 2OM2A 1NI5A 3GA5A 3BD9A 4ZEOA 4IQGA 3ZBUA 4X0EA 5I3CA 3AILA 2WU3A 2FUEA 4HWGA 3W5AA 5BN5B 1Z5ZA 2IPXA 2VT3A 4KW7A 2YRFA 4N8SA 4OFWA 3AUJB 1OGJA 4PHTA 1N1DA 2E1RA 3G23A 1AIPA 4GMFA 3Q7RA 1M2KA 2PGOA 5KNCD 1NXSA 16PKA 2C2ZA 2OLEA 1MAHA 2QTWB 3FFTA 2J41A 4L72A 1W0JD 1YHNA 4D6PA 4HNUA 1A9XA 3T1QA 4MW9A 1PVVA 3RARA 4AJLA 4BX0A 4WKGA 3F6BX 2G0NA 3GJRA 1G3UA 5F4ZA 4YY3B 4K05A 1S3FA 1UINA 2IGBA 4GPAA 3ETDA 1QWSA 1G19A 4OJYA 4ZOQI 1U1IA 3DKPA 1X0XA 5IM4A 1HYQA 1ECJA 3QU7A 3VUFA 3O90A 4V24A 4CL3A 1XDDA 3KPWA 3NTLA 4R1TA 5AJTA 2WB4A 1Y5IA 1R8JA 1QSGA 1TF5A 2I6FA 2QY9A 2NTEA 2IS2A 1EQ2A 4WXEA 5CDHA 2D1FA 3QPWA 2GAOA 5E3IA 1YBMA 4EG5A 1HLGA 5LYJF 5D51S 1XALA 3L5KA 4CMEC 3P5SA 5GMOA 1EGVB 1I1OA 2ZB7A 3NM6B 5I5GA 3RFXA 4A0QA 4DIBA 1DJQA 4FR5A 4LDQA 5ILQA 4IS3A 3V1YA 3KTDA 4G65A 1GHTA 3KTAB 3QK7A 1CY2A 1VP9A 1Y3DE 3L4BA 5FOUA 4RV5A 1JFSA 1P19A 3PQEA 4ACBA 4INOA 1PBNA 2E55A 1GGFA 1UJNA 1Y7HA 2MINB 2PWPA 4HGQA 4IWNA 1X7DA 1U7HA 5FPHA 1Y6JA 3SSOA 4LGMA 2G1UA 2EIXA 1TPZA 3M1IA 3LPCA 4BN4A 4HJRA 1XPJA 3NORA 5KSOA 3OZCA 1P44A 3KBOA 4K86A 4TXMA 1L7NA 2C2OA 3UY4A 1CYEA 4ZHSA 1VE6A 1U98A 3INGA 2DTEA 2LWIA 5EMLA 4Y2UA 4BUZA 1SB8A 4WV3A 1BROA 2DERA 1N5DA 3Q8KA 2FWJA 4WZAB 3CE6A 3N0VA 2QUKA 5KYYB 1YBVA 2RJ3A 2VHUA 3NYRA 5HRUA 3NBMA 4GKKB 1EFCA 4KH1A 1RM4A 5A9SA 1I1NA 3KYCA 3VJKA 2ZITA 3TVDA 4MTCA 3MILA 3NWEA 1G2PA 2IZ0A 2PUFA 1MORA 1CSEE 1KZYC 2BOVA 1G60A 5JJLA 1JDBC 3ENVA 2PU7A 2JBHA 1EJ2A 2HLNA 4CE6A 4O4HF 2RD2A 4V3BA 5LU9A 2JK1A 5BSTA 1X39A 2YFQA 1H0RA 2ZIAA 5ENZA 1BNCA 3WAKA 2ZYUX 3B13B 1MOQA 3ND8A 4LDAA 3ICPA 3RK4A 4AO7A 2XUIA 3SQNA 5KU1A 5L4NA 2QBYB 5JRJA 1U31A 3BXEA 1KDZA 3TZQA 4C05A 4PNPA 5A3JA 3SSMA 1OUMA 4CM8B 9ATCA 1WXIA 1NLFA 1KNXA 4BB9A 2AI2A 1S7CA 1T9DA 2A9JA 4DPKA 1GNRA 1IULA 3PUVA 1NPTO 3RUEA 3PNSA 4P8RA 5SZKB 4C4SA 3LBIA 4FYXA 1HFKA 4IX1A 4BVLA 2VWGA 4MDEA 2AX3A 4BP8A 2R11A 5LZ8A 4QHSA 3VPXA 1SOWA 1CBUA 4RC9A 1N3LA 3I0ZA 3MCVA 3WDMA 1XMXA 4BMDA 3DDCA 4PSAA 3EXIA 5AW3A 1XZDA 1YC2A 2OFWA 4X1IB 4K6FA 1UADA 3TFQA 1QNLA 1XLTA 2INGX 3BE6A 1BWQA 2P2ZA 3C8UA 1A4UA 3NJ4A 4TTVA 1HEIA 2JASA 1J99A 2JI4A 4OXKA 4ZAVA 2F8SA 1F8YA 1ZHOA 1MC5A 4DLPA 4KWIA 2JLZA 2HEIA 3CHYA 3EASA 5JY1A 3NOOA 3BMCA 3G0OA 3LVRE 3SYMA 3A1NA 4I9NA 4PLZA 3M3HA 5BNTA 2ZT6A 1IDN1 5AW0A 2NUAB 2X1LA 1A9YA 1PL8A 1U1DA 3EH1A 2XGMA 2Z2XA 2JVJA 3JD0A 3NONA 4MLZA 4OB7A 5TJ9A 3W9SA 5ERGB 1JI0A 5J40A 1P7VA 2R79A 4DUZB 2XW6A 4R0NA 1E62A 1RAIA 3PNLA 4IOMA 4KO3S 5HSGA 5ALYA 1C3JA 1K5GA 1XRRA 1TFUA 2GEFA 1H2AS 3EOBI 3KD2A 3SC2A 4X64B 3H9UA 3AH8A 4UAJA 4LJYA 2ZRBA 3IP3A 3BMQA 3TBKA 3THYB 5P21A 3FCEA 2GHRA 1XNHA 3MK31 1OZFA 1PG5A 4DR5B 4HNAB 3KXPA 2O3QA 3OE1A 4ZK6A 1Z8HA 3W7AA 3IQDB 5J59A 4IJ5A 1G64A 3RU9A 3ONVA 1Z6GA 3NWBA 2UYHA 2E48A 4CQMB 1LLCA 4BKUA 5JDIC 1L4MA 5JR3A 4CG0A 4LNUB 3GA0A 4D9CA 4H16A 4H4DA 2ODNA 1NLUA 1WG8A 3LUGA 1XRJA 3ENZA 3W0LB 5HOQA 4NBUA 1W9HA 4IIJF 2M6RA 1ABBA 1LWNA 1TM3E 2PA0A 3AEUA 2W6QA 3WLEA 5DEOA 1YB2A 2IS1A 3E3LA 1MB4A 1KQPA 4I4IA 2CSXA 4TTQA 4U2KA 5G4KB 2GERA 5B1DA 3NHAA 2CDNA 3D8TA 4YQFA 5JBQA 4ZODA 1GAXA 4PAOA 1TU4A 3HJNA 3W2EA 3ZLVA 3LPMA 5FTKA 4JI0B 2O8EA 3ZNOA 1ZCAA 4EH1A 2QTCA 3W2IA 3CZPA 2XRYA 1QGZA 2BM8A 2WPDA 3BORA 2BFDB 4G0XA 2P91A 4IDAA 3EG9A 4YAJA 2LIVA 4D9BA 1SHLA 2A4KA 3K8OE 1SU6A 4DV1B 4V0SA 5EZYF 2QTAA 2BH9A 1VZ2A 1NGSA 1K8ZB 2ZYHA 3RSGA 3UGKA 3ZCXA 4ZAYA 3GUUA 4AYTA 5CEFA 2WWRA 5JCOC 4QYTA 3HA2A 1SUDA 1WPQA 4MI9A 4ARSA 3IKLA 1E5LA 2ECOA 3L1UA 3SBDA 5LPNA 2PUEA 4GUDA 2C8VA 2OBMA 3WLAA 3KSBC 4CXMA 4DJ5X 2JGMA 4KLNA 5DM4A 3DFZA 1TO2E 4ZCRA 2FWPA 1NFQA 3QOXA 1QH8B 1QZTA 4P22A 4GR4A 2OD9A 1E2DA 5FI1B 5H0IA 4N8EA 4Q03A 4ZT5A 3KIPA 3H9BA 3SZMA 4C7KA 4BNNA 1N1MA 2ID7A 2C3UA 4HB2A 3OQNA 3OP4A 3W1WA 3BXHA 3A1UA 1FQWA 1KH2A 2BISA 2GNAA 4LW8A 1KOFA 4W5NA 2NUTB 1PQYA 4JBYA 821PA 4YV1A 4NSNA 4B74A 3EX7C 4LXUA 2H92A 5AXCA 3F3YA 1B8OA 1H2BA 2D0IA 1W5TA 1SH7A 3AR4A 1MRZA 2CE7A 2PR2A 1WA5A 1JAXA 1V11A 4N5LA 3UK7A 4P4LA 2XX3A 3ZBQA 1MH1A 4WCVA 3RVPA 1U0GA 5B2EA 3FM9A 1XEWY 2R8EA 2JLCA 4BNHA 3UPUA 3NDRA 3PJRA 4GICA 1TRKA 2IHTA 2ZE5A 4JC0A 1YUMA 5DYWA 4AMUA 3GBVA 2XNCA 4EJ6A 2HQSA 4OQYA 4DDWA 5IMSA 3QX7A 1SC1A 1ATIA 3NGXA 4YMVA 5IAJA 3FNIA 5A4MS 5KVVA 4XYLA 3F4LA 4TYPA 3OPXA 4RDHA 5TEVA 4ETIA 3A1WA 4FSDA 4RZXA 3EVEA 1U2QA 1L5ZA 3FUTA 2VHZA 2CY0A 3ZNNA 5H9VA 1W5SA 5E7IA 2O1WA 4UHFA 1EHYA 3C8ZA 1JS1X 2VRCD 1G4HA 4BFTA 1FW8A 4BZZA 1NW9B 3LQQA 4AZ3B 4BLUA 1T8UA 4U2GA 1IAQA 3HU3A 4JLNA 4J0IA 3VZCA 1HFEL 4DTIA 1G21A 4HVTA 1FFBA 1HE2A 1ODCA 5EJ8A 4BE7B 3RRBA 1EK0A 2BEWA 4EPRA 5AFSA 2R5WA 3OJFA 5G3ZA 3ZD6A 1ML3A 4B09A 1M1YE 2PK3A 4CCYA 1WXFA 4Q9DA 3ZKAA 3M70A 1V8ZA 4RGYA 3UQYS 2VHEA 3LCJA 1JZSA 1ZHFA 2AXPA 1E92A 2QQ5A 1WB4A 3O8NA 4GM1A 1PT8A 1NRIA 4RESA 2HA2A 5EAIA 4D5EA 3H4TA 3LLCA 4JVLA 1AQYA 5CB4B 5JPDA 1P2BA 1ZAKA 5FORA 4F4UA 1K5PA 3A4TA 3TLCA 4X41A 3FRHA 1AGPA 2P30A 5D7NA 3TH5A 2EBFX 4OI1A 4E5YA 4G0WA 3OU2A 5MN6A 1EPUA 1U0TA 2HTEA 3TI7A 4CYMA 2J0EA 1Y8QB 4JI8B 1GL9B 1A8SA 3A1FA 3K1AB 3DBVO 4EYQA 1U2TA 1C9KA 2VWPA 4LVCA 4MDYA 3F3SA 2QN6A 4U8HA 1OREA 4LHEA 4EUNA 1RBYA 4QXRA 1NA5A 1G38A 1L7EA 1ZOLA 2CFRA 5KSZA 2A9FA 3WSTA 3A70A 1Z6ZA 1OH7A 1L5HB 5EJ6A 1MQ8B 4YP0A 3GZTB 4Y30A 3CKMA 3U80A 4DY4A 2GCGA 3KT6A 4X6LA 1RM3A 5B6PA 1UDCA 3OQOA 2DH6A 1N6IA 4RQTA 4HV4A 3RWBA 4WACA 2YS7A 2RIRA 3NJ8A 4U7JA 4IDHA 3CPJB 2EF0A 3VKWA 4BUCA 3HZOA 5BWLA 4NI5A 2JHAA 8ATCA 1JBEA 3AHJA 3NXKA 3IPCA 4L6IA 4P58A 3UUEA 5CFRA 4EVRA 1DBPA 5DX1A 1ZRHA 1ZM2A 3CEAA 4R6XA 5ALMA 4EAAA 4UMVA 4QXAA 1LBQA 4FK8A 2MHCA 3H1EA 1U6JA 3L0CA 3UHOA 1IVYA 2G25A 1ZRNA 2RHHA 1GZDA 3D0QA 3QXGA 2ERXA 1W0KA 3L0YA 4BO0A 4BQQA 3BD6A 4EMTA 2YV4A 1C8KA 3I0NA 5KINB 1EXNA 3PWSA 3V4ZA 4Q15A 4L3OA 4GQIA 2CLFB 1R64A 1ZEJA 3T7TA 3ORQA 4DV6B 2HQOA 2O2ZA 3P97A 2HA5A 2NZYA 2RHOA 2IUFA 1JMYA 1YSCA 1NVFA 1KJQA 1JZQA 3QWAA 4U7TB 3FF4A 3O1IC 3NOQA 1IJFA 1G8JA 1NVTA 1PVOA 1HDYA 3GRPA 1Y9EA 2XMDA 4M2LA 3U4GA 2ZRKA 5C34B 1YL5A 2Q3LA 4M7WA 3L46A 5FJJA 1JIKA 5I7RA 4PTZA 4CTJA 2HAEA 1RE0A 2Q7OE 4FZJA 1KDVA 1QVWA 4CL0A 4YCLA 1NNI1 1Z4MA 3WWPA 4YXWA 4E15A 3D3JA 4XIFA 1Z0ZA 1UBEA 4IMPA 3SX0A 2JAQA 5MN5A 3IXMA 3VR0A 1PT6A 1HOXA 1E7YA 4FNOA 3MT9A 4ENUA 1PEYA 3G9TA 4MQ4A 3C3JA 1NVBA 3PEVA 3RRXA 3Q5DA 1BRTA 3T52A 3WWCA 1W36C 5ADUS 2J9YB 3ETHA 2QMOA 2R25B 4WY5A 3S2YA 1C3OB 1DMSA 1LI5A 1XZMA 1F8UA 1LSOA 1T35A 2A0YA 1V7ZA 2H18A 4FHZA 4KODA 3SWWA 5DNVA 3ND5A 4XB1A 1P7PA 3R40A 1QDEA 2J7PA 4FN4A 1IOVA 3RS2A 4B6OA 1T0PA 3O03A 4ROTA 2XYVA 5TR9A 1DTSA 5LP6A 3P4UA 3EUFA 5JLAA 4A0HA 1RLJA 4ZDJA 4I7EA 3P0FA 4KKVA 2FUKA 3E1SA 4BFUA 1N7IA 4MQEB 2GWHA 2W2OA 4YDSA 1BX1A 2VZLA 2LZ0A 2XE7A 1GAQA 3CJQA 4Q4HB 4YT8A 2O50A 3AZOA 2R8XA 2VZ8A 2ZJ8A 1LDYA 5KX5B 2OCDA 3FVWA 2HU8A 2C04A 1CQIA 1NQ5A 1W94A 2DPYA 2FPLA 3FETA 1GG8A 1VBNA 3P9NA 4HLQB 5AK0A 2H7XA 3LL4A 4FGZA 2P9BA 3ZDRA 5FWAA 4D25A 4E12A 5JQGB 1DJMA 4WN9B 5KWIA 1D04A 2FN4A 1QRAA 5FPSA 1OXVA 2Z57A 4GECA 1MC8A 3FB4A 4MP3A 2V0GA 2B0CA 3HYTA 2C42A 3NBXX 1JB9A 3O1LA 2XUPA 4EEKA 1MAVA 1ZG3A 2CEAA 2QMZA 3G9UA 3LHSA 4HNRA 4NZZA 1D07A 4B43A 2D5AA 1H1LB 2J9RA 2O2YA 2ZAGA 1JIVA 4EG6A 3FGNA 4WFQA 3NC1C 2ZZNA 4MHOA 2ZIEA 3I4LA 1JYFA 4KB5A 4R5HA 1U8AA 3L2OB 4DMRA 1B43A 2LNDA 2WVGA 4KIUA 1QTIA 2XT0A 4P5EA 3ZVLA 5BV8A 4TQUS 4F6CA 1BMFD 1LK0A 4N3NA 4LF4B 4FZ3A 5TQVA 3W05A 2ANCA 1EE2A 1DZIA 1GGNA 1YA6A 5AXDA 2BBWA 2WVHA 3SNHA 3WQBA 4ALIA 3OX2A 1J8DA 2W83A 1V1JA 4MAMA 5IH7A 5TRTA 3AKYA 3PLNA 2UVDA 3E9ZA 3THXB 3B1VA 1VIDA 2X2OA 3A06A 3JQFA 4X20A 1W0JA 4AUEA 3BFPA 4BGDA 2ZIUB 4V3CA 1R0WA 5BT8A 1NHGA 1R9NA 2AYXA 3HB5X 4FT4A 4Q4CA 4MAFA 5L7TA 1XU4A 2QTZA 3DYIA 3H7AA 3MD0A 1BHQ1 1D5CA 4LMBA 3ZE6A 1TO1E 3IBGA 5L4SA 2H2IA 4K28A 5AW9A 3WLMA 2RHDA 3ZH9B 2ZUDA 3OZWA 1EVZA 2ONYA 3AERA 3IP6A 1T0JB 3G1WA 2O8FB 3O21A 5C1OA 4DL9A 1KTIA 3PC4A 3G17A 3O2JA 4HUQA 2NSHA 3D8UA 3X1KA 2AYZA 4J0DA 1I8TA 1F14A 5CVEA 3WP0A 3WWOA 3F2IA 4RQBA 10MHA 4WNCA 1NDUA 1DDOA 1X9GA 3PXUA 5DULA 4B4OA 5J2UF 5MHTA 4UHCA 5K2MA 1MPXA 1WMSA 3NLLA 3TQFA 4REQB 3VPGA 5E6UB 3AB3A 4JJGA 5JRZA 4RPJA 3VZPA 1H6BA 4JOBA 5FNZA 3UH0A 4D3ZA 2Q0SA 2VP3A 1E4VA 1D09A 1G6Q1 3JALB 4IDPA 1DBIA 1TQ4A 1ZIOA 1EP3B 2EHDA 2IXTA 2HWUA 3AV0B 3OTWA 1VCHA 5FHQA 1TVKB 1Y8AA 3U16A 3T7IA 3WGMA 1QU3A 1E64A 3U9LA 3GZNB 4F8JA 3B3JA 3OM9A 4HAXA 3VTZA 1XZJA 4ZYYA 3CVUA 4Z4FA 2FV8A 3AY6A 2FFBA 3BERA 4XEHA 1VPEA 4GDMA 5TQ2B 2GD0A 5L9AA 3IVXA 5CT5A 3RS4A 1R5JA 4FT2A 1DRKA 3HA7A 3U09A 3WV4A 4QREA 2NVBA 5K3AA 4RAOA 4RF5A 1N6LA 3HDVA 3MWDA 5E6SB 4NQRA 1X86B 2P75A 3QF7A 2QTHA 1PDWA 3KVYA 3R4CA 1Y80A 4I81A 3L9XA 3U48A 2GVDC 3RLIA 4I5EA 1NXWA 1GSHA 2VAVA 1W8DA 5HIKA 3F6CA 3NJRA 2ID4A 3R0JA 2PMFA 4LPSA 1O54A 3DVRX 4UHDA 1CUEA 2C95A 2DFTA 1LBHA 1N9GB 2HHJA 3FTDA 4H27A 1L5LA 3OBBA 4CJXA 4DT1A 4FMPA 2I3GA 2HQ1A 3FPEA 3AHDA 4RZSA 3RVMA 3EZLA 2HRZA 2OXCA 1H2RS 2XOKD 5K0JA 5BVHB 4AQYB 1C50A 1A8HA 1V41E 4C0QC 1ESMA 5C53B 2VQ6A 3JRWA 5FPPA 3IO5A 2VNHA 2R8YA 2BBSA 1N75A 2BI7A 1JQLB 2NTVA 4KXNA 3GJQA 2XQFA 4NCHA 2PGDA 2CVFA 3OFSA 1CY0A 3TLGA 2XRZA 1B6SA 2IH2A 4RMIA 4RJJA 1WP4A 1DAOA 2A35A 3NANA 2SNIE 3KYDA 4WLUA 3GD5A 2ZYVX 3FLEA 1WOMA 4GZMA 5LQMA 2IYQA 2AMLA 1N2CA 1A9XB 1BYIA 1IWOA 1KQFA 3NWOA 2OD2A 2P5SA 2RIPA 3A6ZA 4WNIA 3N2KA 2BZ1A 3V6MA 1QF6A 3KQWA 4R1UA 2IU6A 1BZYA 4QGSA 2NVUA 3RIGA 1YIAA 1T9CA 2WF6A 2ZSAA 1L9XA 2VYCA 1SBHA 1RAFA 2G36A 2NU7A 3ORRA 1CR1A 3W2FA 1JXAA 1GZUA 4YP5A 4LRTB 3R7WB 1M6YA 2V9PA 4AJ9A 1MDBA 2BGIA 2BV3A 1GPUA 2HFKA 2P8SA 2WTXA 3TX2A 1W47A 1T9KA 1P77A 1UQRA 1P9LA 5LQNA 3K4PA 1RWOA 1U4SA 3S1AA 2A78A 3V4RA 4RDXA 1CNFA 2XZDA 4GLJA 1N6PA 2TSYB 3IIJA 3O84A 4Y2JA 1PQ4A 4S05A 4CDMA 4LVUA 4N5DA 1U02A 1A7JA 1FX1A 3N0TA 4EKIA 3V33A 2XBMA 2X15A 3WFIA 1EAMA 3IAAA 1O58A 1NQOA 1TK2A 2JAWA 5DKFA 3NUQA 1EMDA 4Q3KA 4XZ3A 2WUVA 3P9YA 2PH5A 4ND2A 1ICIA 2VZ9A 2QM3A 3AVPA 3P20A 4X7MA 2JAUA 1ORDA 2R3SA 3BHIA 1PWZA 5C1PA 2XRMA 3RDPA 3D0OA 4X95A 5C18A 4WIAA 3IIKA 1QRUA 1ZKDA 1TM4E 1XCGB 1ZSYA 2G70A 3FPSA 4MROA 3BDAA 4PGMA 3WYBA 1NV8A 3V7NA 2UAGA 3FFBA 1HG0A 5A5FA 4O8ZA 1NZFA 5KSYA 1H0KA 1N2JA 4GOKA 3FNBA 3DVAA 3P26A 2E2WA 1QONA 3WNCA 1Z7EA 3U37A 5AOBA 3F47A 4U39A 1QIEA 4MUFA 1YFKA 2J08A 3ZKWB 4FC7A 2TYSB 4JBIA 3QEMB 1PIWA 2LCIA 3A9WA 4LA4A 4PFKA 4OGGA 4WZAE 5DHPA 5EPUA 3U3ZA 3AIKA 1A3CA 3UV7A 3M49A 2ACKA 3Q3IA 3CUVA 5A9SB 3KYCB 3E4CA 4B7AA 4FOLA 4CI0B 4DADA 1C1XB 1H4QA 1JUDA 1XVIA 1C2TA 2W6CX 2BY4A 2W2TA 3JQCA 2J3JA 2DUUA 2YIVX 4OXNA 4Q93A 1VRWA 4PHCA 4LRSB 2V8BA 5BSKA 1N2SA 3B5IA 3C5CA 4LJ7A 5HF5A 2MR6A 5CA0A 3LSYA 4YMTA 1J2TA 3WMRA 4AB1A 1JDBB 2WKRA 3DHNA 3WZ2A 3EB9A 4ALJA 1ZS9A 2XQKA 5EHQA 2UZ1A 1DAPA 1M2HA 4MHSA 3DBOB 3LUHA 1M0WA 4D9FA 2A2ZA 4KLRA 1T5OA 1GKYA 5BYBA 3DJYA 5ICSA 1I14A 1DLJA 1E77A 5KS2A 4AN0A 5C35A 2OZLB 3DOEA 4R2JA 1YZYA 3SIXA 3QBVA 1O9GA 1ODIA 4MMZB 2D2EA 4ARUA 5CXSA 5ICFA 1FXUA 3HUUA 1UDXA 4MIKA 1F60A 4TTTS 3RHZA 3LFHA 3NS7A 4RSGA 3HWSA 2RARA 5AVSA 1SXHA 2GVNA 3FYDA 4Q24A 5KJ6A 1BQEA 4F5DA 1U5CA 3VO2A 4K9NA 4TV8B 3PFHA 4M46A 5F23A 3GMIA 2FZLA 4F85A 5IT5A 5J5AA 1J8FA 2ZUUA 3ISTA 3CTMA 3ACDA 3E9RA 4JU8A 4L5AA 3TPFA 4Q9AA 1LQTA 5K3EA 5YASA 1ONOA 3L07A 3FUWA 1V16A 5I5EA 2A0WA 2IYUA 3BMCB 1VE7A 1WAMA 4KDRA 4P32A 5LBTA 4BLSA 4KNVA 3TR6A 1G5IA 1I24A 2A9PA 3KHKA 4GC5A 2PL3A 5HE8A 1O6GA 2VFAA 3H2GA 1FMLA 3FMIA 3WK9A 4BGEA 4BU0A 3KSAC 4GEGA 3A28A 3TTVA 4D98A 4D4LA 5GY7A 2D5LA 3QPDA 5CEEA 2JDID 4HRYA 2L0XA 2CXNA 4DBLE 2IKQA 1X42A 1VJ5A 5EJ9A 2Z5FA 1JBKA 1RYDA 3R3UA 5DNDA 3BL8A 4YACA 4A5SA 4QFBA 2P6MA 1EBFA 2PBZA 2VNSA 4G24A 5DF1A 2J67A 2GUGA 2ZJ4A 4OQLA 4RCYA 4ALLA 3HO1A 3CNNA 2CVHA 2HWXA 4NABA 3C85A 2H1IA 4IJVA 4PZPA 3MERA 3GCZA 3EZ7A 4XOIA 1G98A 3G2KA 3M4ZA 3UW1A 1VG9B 3LKVA 3C7TA 1Z17A 2E9SA 5EWJB 4C4PA 1A88A 2PX3A 3BBLA 5FL7D 2VRCA 3AR8A 1TFRA 3Q0EA 2NGRA 4X1KA 2BGJA 4BVJA 1ZAYA 1TCBA 5HTKA 4PAQA 1WF6A 2GESA 3PGJA 1TEXA 3QLJA 3WGKA 2RHWA 3PGLA 1SHTX 1H93A 3GAAA 4G4IA 1ULHA 3ANXA 3ZWWA 3QG5A 1WB9A 3W77A 3MT0A 4G36A 3IAHA 3QLEA 4RIGA 3BULA 4PINA 1E7MA 4HXYA 4YK7A 4D6XA 5AQ1A 1D03A 4AS1A 1CR4A 3B9BA 3ER6A 1AX9A 3I83A 2H5EA 4RIEA 3W4JA 1EBUA 1OHHD 1SPXA 4EB3A 2DMRA 2BTQB 4Y6GB 1VGRA 4FOTA 1SUAA 2I2XB 3CWZA 4QJBA 2VPZA 3AI7A 4PG8A 2VS1A 2IQ5A 5BMVB 3OJWA 3PNKA 3VKGA 4Q3BA 2WICA 2C8LA 3AB8A 3RJTA 4OVKA 2O8EB 5EP3A 2YHSA 2BZGA 1L5MA 2AC2A 3G89A 1RI2A 2H57A 4HDMB 2J4CA 3RVNA 2F4VB 1B6TA 3IDFA 4R3NA 4KQEA 3FDZA 3TBFA 3RROA 3QTTA 3MEQA 4A0SA 5IC5A 2QZJA 4WPGA 1AS0A 1HYEA 4YIKA 2QSYA 3HA3A 1D6MA 3P9IA 1DDIA 5A62A 2I7XA 5ESRA 4YMUA 4FEGA 3AEKA 1R5BA 3TQCA 3CUEF 4HWKA 4WL0A 4ZXFA 2C2BA 1OAOC 4LJAA 4TXHA 5F1PA 1LSSA 2G5GX 4RH1A 3MLEA 4K6OA 3BTOA 2ROQA 4F6RA 1ZA2A 2O8DA 1RKVA 2AFRA 3EARA 5CVTA 4DR7B 1B15A 1U2RA 1EVYA 2CXQA 3I2IA 3HA5A 3KB1A 3MS2A 1OAOA 4E2YA 1BEUB 2PAAA 4XX0A 5GJWC 1L7QA 1HRDA 2FW1A 3PIDA 4BGIA 1IN6A 2H4WA 1GPLA 2ZS9A 3CX7A 3PC2A 4Q82A 3TJRA 4ZYTA 2WU8A 3TNYA 2OCIA 4D2IA 2POCA 2EXXA 2Z1NA 3GGSA 2Y6VA 2HU7A 3ZGOA 4BO1A 4RVOA 1T8WA 3URMA 1JG1A 3HU1A 1X92A 2WWIA 3QV1A 3RGWS 3FJ1A 4LZJA 3D7MA 4X63A 3LPAA 2EP5A 1VL1A 2NT4A 2QX9A 5CYPA 4G6ZA 1YCDA 2HK9A 1XEWX 1SBYA 2QTGA 3EFOA 3O9ZA 4O4IF 4YJ3A 4BMPB 5TF4A 4YO8A 1OXSC 1KSFX 2H2WA 5BQPA 3WYAA 5BOSA 4OBEA 5KYNA 2GXAA 2HMTA 2R87A 5ESDA 1UC5B 4A10A 1IC6A 1R0SA 3SYTA 3V34A 3JAMA 2ZJ5A 4H7EA 2FZVA 2JJYA 2J0UA 4KLCA 3T9CA 4TN5A 3KLBA 4GXRA 2F1HA 4NZ9A 1P4AA 2PKWA 3NYQA 4EY3A 4IIYA 2HIMA 3T54A 4A1FA 2CMKA 2V0NA 2I3BA 3DKIA 3ROGA 2XHZA 3ZJTA 2AUMA 3OA0A 4PY2A 4DE5A 1FTSA 3WB0A 3DNPA 1T36B 2G63A 1IN5A 4NRDA 4NMLA 2GNOA 3ZTTA 4EW1A 3HWRA 5FH9A 5LQJA 2CD9A 3NBYC 1MJGM 2OILA 2Q6IA 3C97A 5IHPA 5SY6A 1XCBA 2KPOA 5CDSA 5FWXB 5JARA 1X8LA 3GI1A 3DMTA 3ZCQA 1EJ6A 2PUAA 4B3MB 1T91A 1J9EA 4ZVPA 4YGYA 4C1BA 2FZGA 3PQ2A 1O0BA 2P5YA 3IAS6 3L40A 4MOWA 3F71A 1ZWLA 1G21B 3OQJA 1S3GA <