1GWNA

The crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
VKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoE
publication title Crystal Structure of the Core Domain of Rhoe/Rnd3: A Constitutively Activated Small G Protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtpase
total genus 63
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gwnA00
1KI6A 3SBDA 2HXSA 5EP2A 4AG6A 4W9MC 1W0KD 1OF1A 1VG8A 2CCJA 1NMXA 1GNPA 1IOZA 3I61A 3TH5A 4ZKDA 4Q9IA 2A5FA 4WXPA 2C2HA 1MT0A 1GM5A 4M0LA 3K8YA 4DSUA 1FOEB 3AGPA 5TVKA 3NHBA 1R0ZA 4HAVA 3HJNA 3DEFA 3W8RA 4B48A 2WICA 4ZCMA 3BOSA 2D3WA 4LJ6A 4B34A 2IXEA 1F2TB 4M1YA 1SGWA 4JKYA 1Q1BA 4Q4JB 3LX5A 1ZCAA 2IYVA 3EASA 3LLMA 4FMCF 2B7BA 2NMVA 3A37A 5K8TA 4V0LA 2R65A 2F43B 2CJWA 1KK2A 5BW8A 1IQPA 4NHOA 2RKOA 2OV2A 4MKGA 1Z0FA 4PQRA 1OIVA 2BWJA 2IHYA 4A36A 2C5LA 4QJ5A 3IEUA 5KTYA 3QPWA 1P72A 1SXJA 4NCKA 4X8LA 1G1MA 4B76A 2D2EA 1U0JA 4DDWA 1ZM3A 4C0LA 4MYTA 4TL6A 3AVWA 2J0UA 2ORIA 2RGNA 2IYLD 4LHVA 1TF2A 1P4SA 3EIQA 2V7QA 4M9ZA 2WPDA 4ZIRA 2WSMA 2H8KA 1FTNA 1VECA 2CBZA 3V00A 3D3QA 2J7PA 2ZPTX 2JLXA 2Z0MA 4M1MA 4GP6A 3GEIA 1UDXA 3KFXA 4N3NA 1CRQA 5J4YA 4YMWA 4PSVA 5DIFA 4BUJA 1CF4A 2BMFA 2DB3A 1OHHA 1BMFD 3SFZA 2HLDD 3NWJA 2JIZA 2ZSAA 4JLJA 1W0JA 4URUR 1U9IA 2BKUA 4EPWA 3HWSA 4E03A 1OIXA 3THXB 3KZ1E 5JFGA 5K8UA 4RD3A 1SXJE 2GILA 2FF7A 2GXQA 3SYNA 2FSFA 1ZMXA 3DOFA 2UZIR 4PC1A 3FB4A 5L8VA 5GJBA 1DPFA 2ZI6A 4NCJA 2GJAA 1XEFA 1TQ4A 2JJ2A 2Q3MA 1VPLA 3V4RA 5CDFA 1XTJA 2OCBA 421PA 2XSZA 4IDQA 5HR5A 2GETA 3PEYA 2I3BA 3B1XA 2GESA 2GK7A 4KBGA 4E22A 2I4IA 1SKYB 4YDSA 2C78A 3DVLA 3PENA 3TR5A 4LJ8A 3LQQA 4B74A 2JAQA 2ZJ2A 3OFNA 3RWOA 4HEJA 5GJCA 2YNMA 4DZZA 2IT1A 1A2KC 1CU1A 2ODEA 2ZAMA 2O8DB 4DLXA 5JSZA 1F2UB 1E2KA 5EE5B 4A8JA 5CDFE 3R7WB 4OQLA 3G5UA 1OYYA 1XB2A 4MKFA 1SULA 4KI0A 2REOA 4TN1A 1CP2A 4HDCA 5FBWB 4TMXA 5DI3B 5JBQA 1Q3TA 5FUXA 1RFLA 4PO1A 5KNBA 1W44A 1D9XA 2FZLA 1Q3HA 3SJZA 4NP6A 4EFMA 1EWRA 4RCYA 821PA 2KBEA 3TUJC 1DBSA 3OEHD 4LY6A 5FBVB 1F2TA 4OI0A 4PQYA 5A0FA 2EFGA 4QNMA 2F1IA 5FOWA 2PEZA 2YZ2A 2BJVA 1SHKA 2ZRJA 4KSBA 2LKDA 3W8NA 1OLOA 1LB1B 1GKYA 1BYUA 1E2EA 2F9LA 3CH5A 1HYQA 5FTMA 3L82B 4FD2A 2QGZA 5HZHA 1QHSA 2QPAA 4S35A 1ZCBA 4PO9A 3VR6A 2JLQA 5CM9C 1GAJA 3B60A 1TU4A 1Q22A 5DHAA 3EPHA 4XWAA 1Q1EA 2IXGA 1E9AA 1XEWY 1EESA 2HV8A 1NMZA 3FMPB 5FR2A 1YVDA 1UKVY 2ZR7A 4LV5B 5JWHA 5KPJA 4LYHA 2F3RA 1XCMA 2B92A 1ZVQA 4GMXA 3TSOA 4IVPA 5EXXA 1E1RD 1G7SA 3OF5A 4ZCLA 4GOKA 1WBBA 2YC4C 4NCHA 3UWKA 5J47A 5CJPA 1GG2A 1OXVA 5AUNB 4Q4HB 3U60B 3H4MA 3HU3A 4LV6A 5EXTA 4ZDJA 1K8RA 3GD7A 4D4JA 1XZQA 2ASEA 1KJYA 2WIBA 4JJZA 1WB9A 1JPNA 1KI1A 3AGQA 1Z47A 1LNZA 1V43A 3TGPA 1U8YA 3FVQA 3B6EA 1G291 4DC9A 1KDTA 1FMLA 3GEHA 1CKEA 2ONJA 1AZSC 3VAAA 3AP3A 5EJEA 3R9XA 3WNBA 4B75A 3U7FB 3DPUA 4URVR 4Q66C 4URYR 1K5GA 1W4BA 3U2QA 1OFIA 4RJLA 2NPIA 1J99A 1TMKA 3LW8A 1ANKA 2G1JA 1P9WA 4DLZA 1E9FA 1U94A 4Q00A 4IXMA 4QGGA 4WIAA 4X8HA 3S1AA 4Q1FA 3A6PC 1UBCA 4BEJA 4A15A 3FOZA 1TF5A 1J2JA 5EQTA 3CR7A 1E1QD 2HCJB 3U44B 3P1JA 5E7IA 3EIHA 1BYIA 1KAOA 3PQCA 1EFTA 1AIPA 1M34E 4C2TA 4QRHA 3AF3A 2RB4A 5GADl 3FKSA 1N5IA 1VIAA 2QRNA 3QXHA 3MGCA 1N0VC 3TRFA 4AKGA 2ANBA 1RZ3A 2G0TA 4NKRA 3THOA 4LYJA 2CLSA 1V5WA 3KTAB 3LXXA 5G3ZA 3W6NA 1KI2A 1FQKA 2OUKA 2W6IA 2PH1A 4U00A 2IYYA 3R7WA 4GOXA 2PLFA 1OSNA 3LNCA 1RIFA 5F98A 1NP6A 2XZPA 1FNNA 1KDPA 1KIMA 4ZO4A 4C4PA 2VQSA 3OAAD 2XXAB 4RD6A 2MSDB 1SKYE 4KVAA 3Q7QA 5SZIA 4A9AA 1T0JB 2GVZC 1LF0A 4BLRA 4B44A 4EJSB 4LHXA 5L3RA 2VF8A 3SJCA 1X1SA 2H92A 2NO7A 2VL7A 1G8GA 3NH9A 3KQKA 5GJWC 1KHTA 2H16A 1E2JA 2H7VA 3T5DA 4Z51A 1XXHB 3IPYA 4M1KA 1BMFA 5FL3A 4D4KA 4RD0A 2UZ3A 2CCGA 3CX6A 1VCIA 3C7KA 5IK2A 4FXPA 2GA8A 2FFHA 2R6GA 2QQ0A 1NY6A 3DHWC 3U7HB 2ZUBA 4Q1CA 3MD0A 3GJ7A 4JT2A 4EPTA 1FX0A 4Q4AA 1N0WA 3RNLA 1R8QA 3K9NA 4UNSA 5AJXA 1UEIA 1XTKA 4F92B 4OK3A 3VR4A 4CW7A 4LWZA 1RJ9B 1QF9A 1FUKA 1HE8B 4N0DA 3NDBB 3FPAA 2N46A 4KFSA 5EP1A 3IILA 3P27A 5CK5A 1C1YA 1T3SA 2JDID 3KKNA 4QJ4A 2KBFA 1TEXA 4LJAA 2V1UA 5L3QB 1KO5A 2VP0A 2RHDA 4XVRA 2N42A 1E9SA 2XEXA 3AKCA 2WOJA 3QKTA 3VR3A 5K8LA 3AVXA 3CPHA 2XX3A 1JALA 2WMNB 3HPRA 5LD2C 4LHZA 1SKQA 1EX7A 2WZQA 1EGAA 1JJ7A 3GLIB 1GIAA 1CRPA 2JJ1A 3O47A 1NG9A 4JIMA 4F4JA 2BDTA 3RS5A 2YV5A 3E1SA 4OK6A 1J8YF 4B6EA 1BKDR 1NN3A 2GXSA 5K8IA 4I1OA 2JLUA 2CL7X 3AVQA 1P2SA 3LBHA 5C18A 5L3SB 5F2EA 2Z5FA 4LUCA 3QKUA 2V55B 1E4VA 2CNWD 2FWRA 2PLRA 5DN6D 4XJXA 1TEVA 4IRUB 1DG1G 1D6JA 4LBVA 3HU2A 4PANA 1N6PA 2GF9A 4LCBA 4ZKEA 3MWJA 1N6NA 3QG1A 3AQ4A 4IOLA 3U44A 3OEHA 3EXAA 1XX6A 2ZJBA 4DEYA 4WOPA 3D8BA 4NYJR 4Q5IA 3K0AB 4K81B 4IFEA 2IF0A 3T61A 2GXAA 2VF7A 4XH9B 5E95A 3PEUA 4DBLC 3QPVA 4JLOA 1Q1QA 4Q02A 1NLZA 1NN5A 1AZTA 2F6RA 3U3KA 1YZLA 2QMEA 2ZE5A 1JXMA 4PZYA 521PA 4G0NA 3TR0A 1N5KA 3LAWA 2C96A 2FZ4A 2WMOB 3CZPA 4UNQA 2O8FA 3KQLA 3ZD7A 1E0KA 1TL7C 3B2EA 4QXAA 2OG2A 4NTZA 2A9KA 4AI6A 3GJ6A 4BRUA 2VH5R 1ZNWA 4A2QA 1N6LA 1E3MA 1XPUA 2ZYTX 4V0OA 4GSYA 3G82C 1FPMA 3ADBA 4WA7A 1KNXA 1SVOA 1TPZA 3L0OA 4NDZA 2YVUA 2YC2C 2ZRPA 4BFZA 4Z54A 2JLRA 1W46A 3GLFB 2MMCA 2QPOA 3QNUA 1CJUC 1WQ1R 2QORA 5KOYA 1S1MA 1QRAA 4TWZA 4NH0A 3EA5A 2J5XA 3RS0A 4QJ3A 1XXHA 4DIDA 1OXXK 2QE7A 1Z29A 4OHYA 3PJRA 3EZ7A 4V02A 1RYHA 2GKSA 3CWQA 5C46F 1WCV1 3AVUA 1NN1A 4XOIA 2VP2A 2C8VA 1E2HA 1KNQA 2IYQA 4QBHA 2OAP1 2D7DA 1ZW6A 3CX7A 1ZU5A 4Q9HA 3HP1A 1VCNA 3EW9A 4OHZA 1YRBA 2ZI5A 4A92A 1VG1A 2PT7A 4HLUA 4JMPA 5FTJA 2WWYA 1RJ9A 3QQ5A 4RFSB 4QHSA 2F1RA 4AYXA 2G3YA 1ZRHA 1R0XA 2ZRLA 2QT1A 2IYUA 4EFNA 1DTSA 1SXJD 4Q47A 1Z6XA 3PFIA 4BLTA 2R8RA 2ZI3A 4HZUB 1P73A 5FOVA 2QM8A 1GWNA 1S9HA 1Z2CA 3PUZA 5L3QA 2QSZA 4IEEA 2QAGA 1XXHE 2ATXA 1H8ED 2FU5C 2WPDD 1A7JA 3PITA 2IWRA 2VEDA 1J8MF 1SVSA 1ZNZA 4L15A 5FUVA 3J81k 2BM0A 2EVWX 4US0R 4CEHA 2D7CA 5BYJA 4B33A 3AF4A 4QBIA 3GLIA 4LHYA 4JLKA 2IS6A 4HB2A 1FFHA 1N6OA 2YWEA 5H1YA 3DDCA 1XP8A 1OHHD 3VNVA 4TLEA 4FMDB 1G8YA 3RHFA 4BZPA 1W36B 2JIZD 1CR1A 3BH0A 1W0JD 5KSPA 3DZDA 1U81A 2N1BA 2WHXA 2FGJA 2ZXUA 4B3CA 4R98A 1GRNA 2A7QA 1ZIPA 2IYSA 4LYFA 1VYVA 4CRWB 3QXJA 1RYFA 3OAAA 3WMEA 4FMBB 3RS2A 2ZJYA 2O0HA 1SVKA 2R2AA 5IF9A 1XJCA 1YR7A 3U5ZB 1E2MA 3HYTA 2J45A 5ANRB 2QBYB 3I8SA 2JJ2D 3QF7A 2VP4A 3W90A 5FOXA 1N5LA 1XMSA 5DYIA 3MCAA 3REGA 2EYUA 1SXJC 2BKEA 3GLIE 2XSZD 3U3MA 1UBGA 2ZQ5A 5TDHA 4PO8A 2Q21A 5EP3A 2RGNC 1JECA 2FEMA 4EPXA 2O8BB 2ZTSA 3MSXA 4C0SA 1OXSC 2V1XA 3I72A 4HLCA 1CIPA 1DADA 4KJZA 1N25A 4OHVA 1OH7A 1G18A 2ZR0A 3DZ8A 3CO5A 3UANA 4OJKA 4LPKA 4BRWA 4BEBA 2AHOA 1G6HA 1OFHA 3KKQA 1ZC3A 2QP3A 3TAHA 4M1WA 4HAWA 2GAOA 3OFND 4KV9A 1G20E 4FW9A 4DLVA 1D2MA 1CR0A 5F9HA 4TMZA 3DL0A 1ZC4A 4FI3C 3DKVA 2Q9AA 3I73A 4GOJA 1LVGA 1L7VC 3QJYA 5EP4A 2P3SA 2OLKA 1JAIA 4AWXA 3B5JA 2FN4A 1II8B 3CWZA 4KFRA 4DKXA 3U7EB 5JWOA 4TYYA 2J0VA 1FMJA 4ZDKA 3CB4A 1JAHA 1OXUA 4ON9A 4QC2A 1GSIA 2JASA 4R71A 2CE7A 1IN6A 2IF2A 2JGNA 3BD9A 3M4YA 1H8HA 3LXRA 4HSEA 4ZI3A 2WJYA 5AJYA 4NYMQ 1WP9A 5IHPA 1OH5A 4BPBA 2OCPA 2VSOA 2G6BA 4UJ5A 1HH4A 4XIGS 4ZCIA 3P26A 4PHTA 3SYKA 1NBME 3PUWA 1W5TA 2FNAA 1KSGA 3GJ8A 3ZGXA 2ZUCA 1IY0A 3NXSA 4DT1A 2IW3A 2Q9CA 1EWQA 5FOSA 3T1VA 1B23P 3HR7A 4DVGA 3D31A 2X1VA 2AD1A 2QNRA 4F38A 1RVDA 4YC7A 1L8QA 5KSOA 2Q3FA 5KUTA 2ZSEA 4QBGB 3PUXA 2IYXA 2ZM5A 3KX2A 1YZQA 4HZUA 1AKYA 3IBGA 4PXAA 3AKYA 3RRMA 3ZVMA 2PT5A 2J1LA 4NPHA 5CYPA 4A8JC 1LF5A 4GFDA 3MRSA 2NO6A 2DBYA 3KXKA 1XCPA 3JZMA 3GJ4A 1GDDA 2A78A 3L8ZA 1G4AE 3KUCA 1M1YE 2IEYA 4CT4B 3T1OA 5EZ5A 2VBCA 2RCNA 3AEZA 1ZM9A 2ZREA 1XD8A 3ZZTA 2ZU0C 3FFAA 2NOAA 2IYZA 4R7ZA 1CJTC 1IN4A 1HA3A 4IXNA 3WY9A 5KSYA 3MFYA 3SR0A 3LH5A 2ZU6A 3C14C 2NZ8A 3E70C 2AXPA 5CM8B 3TUIC 1G7CA 2O0KA 2XTNA 2WWGA 3AV0B 1M6NA 4FMCB 1Z0JA 2BMEA 3W5IA 4PTLA 4UNRA 1TNDA 3R20A 2CHQA 2IYRA 2GZAA 5AUQA 3SBEA 1NVWQ 1HQCA 1VG9B 1KI4A 2IS2A 1LV7A 3A1UA 3CNOA 1EFHA 2A5JA 3RRYA 2ZRMA 2ZETA 1GOTA 1U8AA 4GMDA 4B2PA 4JJKA 3GLGB 2D06A 2ZRKA 2CVHA 1T8UA 2YINC 1BOFA 1KY2A 4S2EA 1QHHB 1UAAA 4AY2A 1MR3F 2R62A 1Z8FA 3IKJA 4OJQA 1TQ2A 1VHTA 4KSCA 3Q7PA 1Z2AA 3HU1A 3R8CA 4YQFA 3L8YA 2X77A 1XTSA 5G3YA 2RHMA 2H1LA 3FKSD 5CYOA 4FINA 2P6NA 4BFYA 2EFEB 3B85A 4C9BA 1UJ2A 1X1RA 2W6ID 3GFPA 3JVVA 3WHKA 2X2FA 4F93B 4B3BA 1NJGA 4TQUS 2NO9A 1MRSA 4A0GA 4HZIA 3T5GA 4EAQA 1KJWA 3DO6A 2VIIA 4PZZA 5ELXA 3ADCA 1G5PA 1US8B 4NE2A 1H8EA 3ZVLA 3FDIA 4MA4A 3CF0A 3ZIAA 2WJVA 4PHGA 3SJAA 4CEJA 2W6JA 3BK7A 3QEOA 1J7KA 4YXWA 1JEEA 1JI0A 3I92A 3W5JA 3VR1A 4NCNA 4P0TA 3LX8A 3C16C 2VLIA 2AD5A 2PZFA 2JLYA 2P5SA 2QPTA 1YU9A 4QL3A 1G3MA 4TMWA 1Y63A 3ZH9B 3C5HA 1MABB 4Q1AA 5FPSA 3ZYCA 2IS1A 3VKGA 5IK2D 1U8ZA 1T91A 1U2RA 3HYRA 5FTNA 1Q1ZA 2P0EA 1D8TA 5EUMA 3IEVA 4LC0A 3LDAA 1DG3A 1JPJA 1D5CA 1OW3B 1HURA 4MGIR 4JBXA 4PC6A 2ZROA 4ZI2A 4AK9A 3CONA 5FFMA 2AKAB 2OEPA 4KHZA 5H8WA 5CB6A 1YR8A 3IO5A 3PEWA 5AJZA 1T6NA 1S3GA 2J3EA 2O8CB 2J46A 1KI3A 4JLVA 3SQWA 2VPPA 4KYUA 1J90A 3UXMA 5JS7A 3IUYA 3LLUA 1XU4A 4MYHA 1ETUA 1D2EA 2HCBA 3CBQA 4MGZR 2AK3A 3I8XA 4DLWA 2ZRAA 3IIKA 5TMPA 4Z8YA 4EUNA 2C98A 2DWPA 1PUIA 3P4XA 4WAUA 3KJEA 1NF3A 2V3CC 3RC8A 1DAIA 3AVYA 3N70A 3TLXA 1G3UA 1G8FA 3Q85A 3LQRA 5JJKA 3RC3A 5C1BA 2R6AA 1AM4D 1SQ5A 1E79A 2PZGA 4RD2A 1KDRA 1G3IA 4D82A 2O8EB 1ZINA 4IOKA 3SDZA 4O3MA 2JJ1D 2ZYUX 3Q5EA 5B2ZA 4EKDA 4FCVA 2ZS8A 3BJIC 3BXZA 5TARA 4QG7A 3K9LA 4L8GA 3AF0A 1QBKC 2W83A 1G19A 4Q9KA 3GFTA 2R6CA 4BWYA 3K0EA 2RGBA 3GCGA 1XMIA 2GXUA 4PC2A 4V0KA 4F4CA 1AS3A 1AGPA 4Q7LA 3M1IA 3MG9A 2WTUA 3PIRA 2EWWA 3ZZ0A 1OFTA 4NYIR 2FV8A 1P7CA 2IBMA 2DYKA 2ZR9A 3EZFA 2PJRA 4Q19A 1G5TA 3K70D 1IN7A 1W47A 4II7A 1A1VA 1VYTA 1QHHA 2C9OA 2GF0A 2JLWA 3UK6A 1YZUA 3CX8A 4L16A 3A4LA 2B6HA 4W7SA 1MV5A 5GVRA 1XEWX 4AG5A 3PEVA 1NLYA 1ZUIA 4P3YA 5FTLA 4LBZA 4Q4JA 5FR1A 1G6OA 1R10A 1FUUA 1ZUNB 2F43A 1SVWA 2P65A 2P6RA 1S4QA 1COWA 2ZYWX 4JYCA 3U61B 5JI2E 1A2BA 3BC1A 1Y3AA 2BC9A 3VMFA 1G4UR 1U0LA 1M74A 4PPNA 1N5JA 5DISB 1G7RA 2VP9A 1M7HA 1T9HA 2ZE7A 3OESA 3WBJA 1OH6A 2W00A 2A5YB 2XZOA 1E2QA 1GZSA 4OL0A 1AJEA 4Q18A 1WRBA 2NGRA 2OBNA 1KO8A 2D74A 2DWOA 4URXR 4LZZA 1T5IA 3VFDA 3P20A 1YZGA 1PJRA 5CIWA 2ZYVX 4IDOA 2H57A 3KXIA 4BLOA 2QL6A 1I2MA 5LB2A 1Z6YA 2VSFA 4HUTA 2Q0HA 4BFVA 5D3QA 4M22A 4OBEA 4BQSA 3N2EA 4TL7A 1MO4A 4DHEA 2ERXA 2BEKA 3NVAA 3GJ5A 1GRRA 3K70C 4B3DA 3TKLA 2QE7D 1NRJB 2ZAOA 4I99A 1GL9B 4NYMR 3KFVA 3THXA 4C0QC 1YQTA 4GT1A 3W34A 3IIMA 4TSFD 1ESNA 2GHIA 2EYQA 1Z08A 2B21A 3AVOA 5BQ5A 3ND8A 2VYFA 1H65A 3RWMB 3SS8A 4AYWA 1QDEA 2BHRA 2XTZA 4GPTA 4A2PA 4U5XA 2ATVA 4UJ3A 1I4DD 4KYIB 1ZBDA 4HLQB 3SU8A 4AKEA 4JBYA 3TIFA 4JVNA 1JBKA 3TW4A 3TSZA 1UF9A 4IEIA 5HE9A 1YZNA 5JLJA 4UXIA 4GNKA 4TZ6A 1C4OA 3AVPA 2RGAA 3KDSE 3UKDA 1GL7A 3WYGA 3ND9A 1XCGB 3SJBA 2OBLA 4BLQA 1W4RA 4MYUA 2ZJ5A 3IDQA 1KOFA 3TW8B 3TSWA 1Z6AA 4E07A 1BS1A 1Z0AA 4P31A 4DLSA 2F1JA 2WKPA 4JSYA 3KJGA 5C4GB 2ZRNA 4EJSC 4PAQA 2CCKA 5CJ2A 2H18A 1KKMA 4D80A 1ZM4A 2LKCA 1KZGB 5FH9A 1U90A 1WDTA 2O8EA 5J5CA 1LS6A 3ZDQA 2WOOA 4DSTA 1PZNA 3K9HA 3U3JA 1E96A 4DSOA 2O8DA 4LYAA 3QG5A 4LDJA 4X8OA 1F2UA 3FWYA 4TYWA 2W0MA 1DAGA 5H68A 3OHMA 1DAEA 3KXLA 4IKEA 2QTHA 1N2CE 3SE0A 1ZD1A 4MRVA 1WF3A 4G01B 3CRQA 1ZNYA 2QP9X 5J4KA 2QTFA 2I1QA 2K5UA 5DI3A 2CXXA 4JSTA 4RZUA 5EE3A 2GNOA 2GRJA 2ZUDA 4NONA 1UKZA 4HLUC 4LRWA 2ZRIA 4D0NA 3SN6A 621PA 4RZ2A 4LJYA 1LW7A 1KI8A 5G53C 1KDOA 3EG5A 5DO9A 3A58B 4LGMA 1II9A 4JVLA 3IQXA 4HUQB 4A4DA 1IY1A 3HR8A 4KCGA 1VTKA 4ABYA 4QBFA 1KSHA 2QAGC 3P32A 4BZQA 2F55A 2JCSA 4QFMA 1UKYA 3K1JA 1XJQA 3ZQJA 4O25A 1SHZA 1X8LA 1BIFA 4G5GA 1P9NA 4ZPXA 4DSNA 1FW6A 2ZRBA 3CF6R 4G5SA 3QSYA 4MH0R 2UKDA 3F3YA 3B78A 2REXB 2QMUA 1PUJA 4Z1MA 3QKRB 1F6BA 1NBMD 1P3JA 3VR5A 1CULC 2YWFA 3KUDA 3GEEA 1N6RA 3T35A 1WA5A 4B73A 5JRJA 4ARZB 1M2OB 3GJXC 1L4UA 2AR7A 3A1VA 3CW2A 3SOPA 4C7OB 5KPDA 4TYQA 4DWJA 1Z22A 4K8OA 1RRCA 1E0AA 1IY2A 2R9VA 2GEUA 2WM9B 3U3OA 3QBVA 3X1ZA 4CT5A 2C9CA 3FGNA 4EFLA 1QVRA 3MLEA 2IX3A 4WXRA 4LX0A 4Q4HA 3FHOA 4XVUA 3LVRE 5JECA 4DLUA 2A5GA 1E4YA 3Q3JB 1OYWA 2ZI4A 3WRYC 3T1TA 1H8HD 4KFTA 4Q1EA 3SI7A 1GTVA 5JHGB 2RAPA 1K6MA 4PAMA 4PQFA 2C9YA 1XEXB 3UMRA 4BGDA 1NVVQ 1VG0B 2OO7A 2QUZA 1E0SA 1P60A 1XMJA 1E98A 4EPYA 4LJ5A 3OIYA 2HXYA 4YLGA 4G5OA 1PV4A 3EWAA 2XNDA 2Q3HA 4P4TA 1OB2A 2NO0A 1OKKD 1KK0A 3LBNA 4NZYA 1GKUB 4BFTA 3EAQA 4DEXA 1ZYUA 4JLDA 3GPLA 3ZVNA 1II0A 2ZE8A 3D6TB 2PMDA 3AF2A 3SHWA 4TTQA 3U7GA 4ZDWA 5DGXA 2F7SA 1GUAA 2GEVA 5EZ6B 1KY3A 2GBLA 1P5ZB 3T15A 4CDGA 3ASYA 1QHXA 2OHFA 4JLAA 2GJSA 4NBSA 4EQ6B 4L9WA 2FSHA 3UATA 2QM7A 4KITB 4AKIA 3KTAA 2H17A 4M2LA 4B3GA 4KXFB 4A6PA 2YYZA 3H2YA 1W36D 3BFXA 2RH5A 4I1UA 4JYBA 2WSSA 4I1SA 2XB4A 1YJ5A 2CHVA 4WZBE 2D4HA 2VRWA 5E7MA 4B6FA 5DSZA 2DFKB 2XXAA 5BWMA 3W3AA 2DFLA 2HJVA 1DAFA 4KFUA 4JT4A 2DFTA 4M9XA 3KQNA 2EFHB 3A1SA 1UPTA 4EJSA 4KU4A 4D0LB 4LJ9A 3U4QB 4PPFA 5P21A 1TF7A 2B8TA 1ZJ6A 1Z06A 1G64A 1DEKA 2ZJZA 3SHFA 2ZSFA 2ZVQX 4LHWA 5DLQC 3OZXA 3CIOA 3TAUA 4F4IA 2EU8A 4LSGA 2IS4A 2W2TA 4XSHA 1WXQA 1K5DA 2VHJA 3TNFA 2Z83A 5AUPB 4PHHA 4TSFA 2OBMA 4Q48A 1MOZA 3LWNA 4OYHA 4AIIA 5F3WB 1RC8A 4CEIB 3LD9A 2BCJQ 5KNDA 3WNDA 2P6UA 2H5EA 5DNYB 1E2LA 4MKIA 3U6BA 1XF9A 1SVIA 1HV8A 4RVCA 3AUYA 3CPEA 3ZD6A 2EFDB 4UXHA 3QKRA 4M1TA 1X86B 1W36C 1DAMA 3THWB 2VA8A 5AJWA 4DCVA 4BFXA 3AP1A 1CXZA 3CNNA 5FPHA 3BBPA 1F48A 3W6PA 1W48A 1Z28A 2J7KA 5HPYB 2W0SA 2GCNA 2HF9A 3KL4A 1IXRC 3NG1A 1NSFA 3ZIAD 1Z0DA 4GI7A 1KKLA 2W6JD 1UBFA 1BH2A 4U02A 1DAHA 3B1VA 3AH8A 4YXWD 3K9GA 3QENA 2E1RA 5JWRA 3W3ZB 4JKIA 2X2EA 3EZ9A 2JLVA 4IDNA 5HCIA 2KJQA 2YOFA 1UDWA 5E4FA 4PX9A 2LWIA 1ZD8A 5KDDA 1G41A 1X8KA 5LDDC 1Q57A 3SFVA 3AP2A 3LBIA 3NKVA 2P2LA 5L3SA 4PSAA 2PCJA 1CS4C 1NJFA 1KTVA 5L3VA 2C03A 3Q8XB 1A82A 2QT0A 3KB1A 5FBRB 4XD7A 3VX3A 4HB4A 4F7WA 2BMJA 3NH6A 3V9PA 2FSGA 4V03A 2ZITA 4GZMA 3K0AA 2ORWA 2AXNA 1GL6A 4TQAA 3X1DA 4XWOA 5SZJA 4RFVA 1KSFX 3K0FB 5JJIA 2W2XA 2RGDA 1KO4A 4D4MA 5DHFA 5AUOB 4OI4A 3PXGA 3ZJYA 4CVNA 3NBXX 2IHBA 2KB0A 3TQCA 5J4HA 1IN5A 3OEEA 4RCZA 2QAJA 1CEEA 1E79D 1LFDB 1D2NA 1MO3A 4JL6A 2JLSA 4YMUA 1NBMA 3B1YA 2WAYA 3GJ3A 3R8FA 3IHLA 4EDHA 3GMTA 1QHYA 4BFWA 1XZPA 1GNQA 2AFHE 1S1CA 5KSZA 1KK1A 2FFAA 4US2R 3GLFA 1O87A 4W5HA 3NBZC 2MMGA 2BJWA 4LI0A 3F5FA 3T1QA 1GFIA 3LA6A 1G5RA 1J70A 1R0YA 1VDZA 5FL7A 3DM9B 2ZEJA 2CJWB 2EQBA 1JQJC 4TZ0A 4Q4LA 3VHXA 4LJ4A 3ZQ6A 1KO7A 2RGXA 3QXSA 1IJEA 1RRFA 2V6JA 3LW7A 2CLCX 2V8OA 3H1TA 4O0MA 3O8RA 2OE2A 3C4JA 3RRZA 3TJZA 5M04A 2E87A 2EWVA 2HDNB 4TL9A 2IK8A 4D81A 3RSLA 3KB2A 5IRCD 3I1FA 4XSGA 2QU8A 2UVQA 1COWD 2C04A 1T0HB 3MJRA 3O8DA 4MYCA 5FOTA 5A5GA 4HLDA 3WNCA 2F9MA 3K53A 1OKKA 4RFSA 4TLDA 2OAQ1 5BN3A 1U0HC 3PR1A 4FCWA 3GLFE 2GVDC 2ZSBA 3B9PA 4ESHA 5CLQA 3UMFA 4DDVA 3D7MA 2WKQA 1NNEA 3UIEA 4JL5A 1W4CA 4HB3A 2OLJA 2ZJOA 1XTQA 1KI7A 3TE6A 1NIPA 721PA 3VQTA 3B1ZA 2MSCB 3KJIA 3NC0C 4IOMA 3PVSA 3K0CA 1W2HA 4IHQA 3QPUA 1DO0A 3B13B 5JJLA 1YZTA 2QP4A 4ZV4A 221PA 4MRSA 5FPTA 4U7DA 1GILA 2RGCA 3GLHB 3UG7A 2KE5A 4TT3A 2A2ZA 4LV8B 1DO2A 3ICEA 4B32A 5JCZA 3W9YA 4QGFA 5G41A 1E9CA 4A1FA 4L4UA 3CM0A 3LV8A 1JJVA 1Z5ZA 1ZM7A 4CF7A 3X1YA 4HDOB 4MRNA 5E3HA 3H86A 5JI3E 2JLZA 1G3RA 1R0WA 2V4ZA 5HCNA 1XPRA 4OQXA 4KVGA 4YMVA 1AS0A 2QBYA 1EFUA 2KI5A 2IYWA 2G77B 1TX4B 4JLPA 3ZS9A 3DKPA 4BFUA 3KQUA 1Q44A 4MQBA 2Q9BA 3BB4A 4HB0A 4D2IA 4DLTA 3WMGA 2PCLA 4QGAA 3L0SA 1A4RA 1WBDA 1EFCA 3B8HA 3BS4A 1VCOA 3I4LA 3K09A 1NN0A 4JZKA 3L43A 1JEDA 3X2SA 2WKRA 2G83A 2O8BA 1Z0KA 1EFRA 4UXJA 4A2WA 2QENA 2FFBA 4HAZA 1IXSB 5JSZB 4FCTA 5EE0A 2LCFA 4A8JB 4MGYR 4HYYA 4OHWA 4PSKA 1ZAKA 5HKKD 2DPXA 1ESMA 2VHQA 2DWQA 3BH6A 4HAXA 4FIDA 2FX3A 2ZIAA 2DR3A 4Q7JB 4XWKA 1IN8A 2A5DA 2ZJAA 1VCMA 3OIVA 4OI1A 4A0HA 1ZD9A 3AKDA 3L0IB 4JLBA 5DH9A 4NL4H 3LY5A 3MMPA 1JQLB 1FP7A 1W5SA 3ADKA 5JS8A 1E9EA 1OIWA 3F8TA 4MUAA 2QI9C 3R9WA 3RABA 1VYUA 1E2IA 1R2QA 5EXPA 3ZS8A 5B30A 3DM5A 4I1VA 1X6VA 1YE8A 2GAAA 1II8A 1FZQA 2GDJA 1NKTA 1ZUHA 2WAXA 3QF4B 4OKSA 1LY1A 5DE3A 4DUGA 2BBSA 3GFOA 4IW3B 1S96A 3MWYW 3UPUA 1R5OA 4AD8A 1E2FA 1G21E 4OK5A 4A82A 3SEAA 2VO1A 1YR6A 4UKDA 1E9RA 4K46A 2GZHA 4RZ3A 2IYTA 4Q03A 2AK2A 1MO5A 1QG4A 1XJ0A 1E9BA 5EXSA 3WXMA 4IJMA 3T06B 4M9QA 1HY3A 1W1WA 5H70A 2GEDA 3NEYA 1OH8A 4B47A 3AVVA 5J4LA 4BFSA 4I81A 5TY0A 1G16A 4TLAA 3UMSA 5DI9A 2WWFA 2PL3A 1OV4A 3TK1A 4AC9A 5B58C 4M21A 4JBWA 3M0EA 4LBYA 4Z1MD 1Q0UA 2W58A 4HI0E 4Q7KA 3VNUA 1GRQA 4QNRA 2ODNA 4R2IA 2NQ2C 3CH4B 1HUQA 1A5TA 2PZEA 4KBFA 5BYKA 1AS2A 3EC1A 4RKEA 5KU1A 4C0HA 1W7AA 4C2UA 4OHXA 1UM8A 4X8MA 3WHLA 3JVUA 2CHGA 4KO8A 4Z8XA 4LK2A 2BMDA 3SNHA 1CLUA 3VR2A 3C8UA 3QBTA 3KQHA 3OE7A 2FE4A 3FFBA 3GLHA 1MH1A 3AF1A 3ZZUA 1UFQA 2Y8EA 5G40A 3WBKA 1CTQA 1Z07A 1TTTA 2ZRFA 3QKSB 4PHFA 3REFA 4I4LA 2BEJA 2CK3A 4IDHA 4TLCA 1E32A 4ACBA 3WP0A 3WRXC 5FI1B 5EE1A 2ZVPX 4KODA 4HATA 2F1HA 2REBA 3A36A 1TQDA 2J41A 2IL1A 2TMKA 3CNLA 3GQBA 3NEJA 3AKEA 4B43A 1AN0A 4NYJQ 4KAXA 3S1AB 2B7CA 2R6FA 1NG1A 2PEYA 2OCYC 3IO3A 4PC3A 5B57C 2XNDD 2KWIA 1NKSA 1VIYA 2ZS9A 1G17A 5F9FA 5C4MA 2OFOA 1ELOA 1E0JA 2AWOA 4TLBA 3BERA 1NL3A 2WBLC 5J40A 3GLGA 1IBRA 3FMOB 3GLHE 5DYGA 2PX3A 3UG6A 2KSQA 3I62A 1RPZA 4RD4A 1Q21A 4H1VA 1CR4A 3A4NA 4OQMA 3FHCB 3QUSA 3B82A 3X1XA 4DB2A 2FA9A 4WW0A 2XTMA 2I1VB 3UWOA 4C0AC 1ODFA 4JL8A 1CBUA 3K0SA 2FSIA 3U3RA 4OQFA 1IONA 4WZAE 4DLYA 4URZR 4ASUA 1E94E 3EA0A 5JRZA 5AJVB 4C0BA 1TAGA 2X8AA 1KYIA 2W2VA 3CUEF 1GITA 3MAAC 2F3TA 4R2HA 1XFAA 4XTRA 5FBQB 2XB2A 3CKLA 2WSSD 1IM2A 1JR3A 2J87A 3A8TA 3GLGE 5JZVA 1US8A 1DELA 1DARA 1DE0A 2YWHA 4JVSB 3RRNA 4CGZA 3QF4A 2DY1A 2XITA 1E2NA 1ZP6A 1TQ6A 1ZM2A 3IPXA 4KLNA 4QHTA 5FI0B 4C30A 2DCUA 3QE0A 1YKSA 5KDOA 1R6BX 3BFVA 3G0HA 1FX0B 4Q4AB 1NVXQ 2GTPA 4FN5A 3FYHA 4NMMA 2FPMA 5LPNA 1IXZA 2YKGA 4RSGA 1XBTA 4QOSA 3PG5A 1MABA 2G88A 2OFXA 1SZPA 2GK6A 3QI2A 4RD1A 3BORA 1FQJA 1KI9A 1JB1A 2YOGA 2PMKA 4ERNA 2OM2A 2GBLC 1TUEA 3E2IA 1NLFA 2ZE6A 5EUQB 1JR3E 3B7GA 2WV9A 1P62B 1XD2B 3VKWA 5JEDA 1QHNA 2VTKA 4WVFA 2XOKA 1KMQA 4V0NA 1RRPA 4TTPA 3EPKA 2GCOB 1G3QA 3FMFA 1Z63A 1U99A 5AK0A 1D9ZA 4MITA 2O8CA 2GJ9A 1UADA 2WVJA 4LPSA 1KMHB 3KKPA 3QOFA 1X3SA 2DFNA 5B64A 1N0UA 1ZNXA 2QMHA 3DMNA 2ODBA 1E2GA 2G1KA 1T3HA 1OE0A 1N6IA 5FOUA 1NI3A 2ZANA 2ECKA 2IWHA 5KYKA 4BE7B 1S0UA 2MSEB 4DRZA 4TMTA 2FPLA 2R6DA 5KNCA 3CRW1 3MUFA 2QN6A 3C41J 3QKSA 2Z6VA 3RLFA 3X1WA 3SQXA 1W0KA 4W5WA 4JLNA 3I32A 1XRJA 3BIFA 4WZ6A 3EZ2A 5HKKA 3L2OB 3QEJA 1XWIA 2G9NA 4YDHB 3WMFA 1I4LD 2QGNA 4D0GA 2GZDA 2OFWA 3RYTC 3NIBA 5LBIA 3K70B 1P2UA 2IA5A 4QM7A 2FFQA 1UKEA 2AKYA 1S9DA 3A1WA 2XAUA 3CRMA 2VHUA 3QY0A 4QKQA 5HE8A 4J0QA 3CLVA 1MO6A 2AWNA 1LS1A 2WJJA 4D6PA 3LFUA 2IC5A 2JA1A 4LBWA 4R9UC 2FPKA 2WWHA 4B2LA 1U98A 4XD7D 3GJ0A 4IVQA 1KAGA 2O8FB 1QG2A 4QM6A 1LTQA 1QHIA 1W4AA 5EE9A 4CZ2A 2ANCA 2NG1A 4L5BA 4PR0A 4Y0AA 2CDNA 4JLMA 1P2VA 4TL8A 1F3OA 2XJ9A 4G5QA 2PJZA 3FMIA 3OEED 2QMOA 1TUIA 1G8HA 2NIPA 1S2MA 4V0MA 3VU9B 1CJKC 1E6CA 2V54A 3B1WA 3CR8A 1HEIA 4MUBA 4AYTA 5GVSA 4GBMA 1OT3A 2HLDA 3MWLA 3EIEA 4M53A 5FPKA 4D26A 1GP2A 1GVNB 3GP8A 1E99A 3LRPA 4TYPA 2GCPA 2CL0X 3F0TA 5TV2A 1XNJA 3SYLA 2QEQA 2D2FA 2PBRA 3QXCA 5E7JA 2XZLA 5FL7D 1HTWA 1BO6A 4XVQA 1S3SA 2QA5A 1I4TD 1X8JA 1Z83A 1RRGA 4WBSA 1JNYA 3PUYA 1M8PA 1FL9A 2J9RA 4P4UA 4YMTA 1Q12A 5JEEA 3T34A 3E5HA 4UQOA 1T8TA 4V0ME 2WJIA 1XD2A 3NBYC 1MRNA 2BM1A 4EPVA 5D3MB 3CF2A 3KKOA 1EXMA 1N6HA 1NIJA 3PV0A 4LJ7A 4N1AA 4EIWA 2GCOA 2QAGB 4MGKR 1XMVA 3BRWD 4RZXA 5AR1A 3TBKA 3HDTA 3C5CA 1RE0A 2WWIA 2P5TB 1YZKA 5UKDA 4CEHB 1KMHA 1WMSA 2FOLA 3H0KA 1P61B 2OXRA 4QHYA 3EPLA 3I5YA 1JXOA 1VHLA 2AX4A 3Q5DA 3VX4A 4GP7A 3BGWA 3O8BA 2IEZA 1FTSA 1GKIA 4Q01A 4D4LA 4GRAA 4CIDA 4DLRA 2IXFA 2O0JA 2Z4RA 3NHAA 2DHRA 2GJ8A 2C95A 4B2IA 2AL7A 4PAOA 2J0SA 2B8WA 1L2TA 2SHKA 3WYAA 4US1R 2FMXA 3Q72A 4B71A 4AURA 3FE2A 2EW1A 3BWDD 4O2RA 1AQYA 5C2JB 3TQFA 2XJ4A 1OJLA 5FTKA 4KLZA 1E2PA 4TT3D 3AB3A 2AN9A 3HPQA 3ZLJA 3T12A 3DOEA 2XGJA 2E9SA 1T4GA 5AWFC 4YMSA 5LD2B 4M8NE 3TVTA 4IFBA 2P67A 1UBEA 2OT3B 2VP5A 1R5BA 4GZLA 3RS7A 4TYNA 5IT5A 5TXGA 5BN5A 5SZKB 1MKYA 5TB5A 1B0UA 1N6KA 2OILA 1NSTA 2QTVB 3VTKA 4LC1A 2BV3A 4Q9JA 4TMVA 2WJGA 3BE4A 1AKEA 3LVQE 2VSXA 1ZU4A 1F5NA 2OXCA 3NC1C 6Q21A 2V6IA 5KDLA 1M7BA 1W2GA 1AQUA 4G5RA 3U6KA 2QROA 4POAA 2YOHA 4ILEA 1YHNA 3I3SR 5CITA 4HUQA 2WIAA 4DCTA 3EPJA 4BECA 2HF8A 2C99A 1Z0IA 1EFRD 1G8PA 2ZJ8A 1RW4A 3EC2A 4AKHA 4B3FX 1DAKA 2GJKA 4BLPA 3THYB 1QHGA 2HEIA 3K0CC 3MWKA 4GDFA 2WJHA 3DMDA 2OZEA 2A30A 3CPJB 1UEJA 2CEAA 2JEOA 1E1RA 4HDQB 4IDPA 4G1UC 2J59A 3P4YA 3VU9A 5JCPA 2ZRGA 5FUYA 4DDUA 1G7TA 1IAQA 4M1SA 3RAPR 1Z6TA 3WP1B 3ZVRA 4ARZA 4XTCS 5FUWA 4PZLA 4ITRC 4TMKA 4C7OA 4Q1BA 3EZ6A 3EARA 5J4VA 4M9SA 4Q9LA 4JS0A 1IJFA 1Z6GA 2HJGA 2D62A 3RDPA 2IUUA 4A6XA 5BN4A 4C0JA 4PPGA 3RVBA 2FEOA 1P6XA 2G0NA 3QIAA 4H9GA 4DUGD 1FNMA 4Q7MB 3SC3A 3KKMA 2YWGA 4UNNA 3EWSA 1XD9A 1XTIA 2FJUA 1R5NA 4DT1B 4P4SB 5HTKA 5A4JA 4H1UA 3RSOA 2ORVA 1N3BA 3ADDA 4FWIB 4BLSA 1YRAA 3VKHA 3K09C 3R9IA 1AK2A 1E2DA 1ZIOA 1XEXA 5D3MA 2ZI9A 4F91B 1QZXA 3TMKA 1XPOA 3ETLA 2CMKA 3H84A 1KO1A 2V7QD 4NCIA 1P9RA 2ODWA 1FP6A 3RANA 4MDFA 1E1QA 4PFSA 1PLJA 4BZXA 3A4MA 3B9QA 3IQWA 4UNPA 2RGGA 3IBYA 4ESVA 4URWR 1CJMA 1C9KA 2J7PD 2BCGY 3N5CA 3JZAA 2QQEA 3FKQA 4IVRA 5FPYA 4G3XA 4JVMA 2C77A 5CLLA 4TQ9A 1NY5A 1Z3IX 1QVAA 3O8CA 1OFUX 3CRRA 3IIJA 3L0PA 8OHMA 4PPQA 3CZQA 3M6AA 2CL6X 2ZS7A 2OESA 4A0FA 4HAUA 2QRZA 2BBTA 4IOJA 4M1OA 3RS3A 3TVDA 4EQ6A 4LOAA 1HQYE 1JR6A 3OE7D 1KZ7B 2OCAA 2WWXA 1R4AA 4HAYA 4DXAA 1KI6B 1TADA 2FG5A 3IGFA 4D25A 4NYIQ 2FH5B 2CK3D 3ASZA 1P2TA 5JHHB 2GWHA 4QGHA 3BB1A 1VKJA 2O52A 4E09A 2QSYA 3FHTA 4EPRA 2NZJA 2PX0A 3ECCA 1G9XA 3NTUA 2IUTA 2X19A 2YJTD 4FMDF 2HT6A 1PLLA 2O5VA 3BFKA 2Q6TA 3KJHA 4B35A 2HYDA 2ONKA 3MJHA 2HUPA 4PC7A 2FGKA 1DS6A 3PUVA 3U4QA 4N0EA 5JMTA 1SVMA 3Q9LA 3FTQA 2J0QA 1AGRA 5HZKA 2QG6A 4DCUA 5IDVA 2HYIC 2YHSA 2EFCB 4OQNA 5FBLB 2ZRDA 1PLKA 1E69A 3ONWA 4YONB 3ICQB 2QY9A 1W49A 4FWTA 2FDCA 1DVRA 3THYA 3NBFA 3C15C 4CYMA 4DCSA 1U9IC 3OIUA 1CJVC 1KGDA 1SXJB 4MRRA 4CEIA 2JDIA 1RKBA 2ERYA 3RS4A 1CR2A 3BAFA 1EX6A 1E9DA 2BBOA 1NMYA 2J0UB 1Q20A 4RY2A 5CB8A 4ASUD 5LB4A 1XDBA 4ZIRB 3BH7A 2NTYC 2QZ4A 4DB4A 2V9PA 4CEJB 1GNRA 3THWA 1T3LA 1HE1C 3N2IA 2JATA 2JJ8A 4P32A 4ZDIA 1F60A 2CE2X 4MRPA 1I2DA 1EK0A 1JR3D 1OPXA 5CIQA 2NPFA 1HT2E 2A3RA 121PA 3W6OA 1YR9A 1VMAA 2XNSA 2ZSDA 2VHTA 3NDPA 5BXQC 2Z4SA 4DIEA 2BBWA 2OSBA 4Q21A 2R44A 4GL2A 3SZRA 1OXTA 1R7RA 4P4SA 1OB5A 2ZRCA 4RKFA 2WWWA 1TU3A 2BOVA 4DDTA 1KK3A 4C3ZA 2ZRHA 2L0XA 2CNWA 4TTRA 5DN6A 5KHOC 4BASA 1P75A 1WE2A 1XTRA 5GJVC 2BIFA 3VHLB 1M7GA 1R8SA 1SVLA 1KJZA 3AVTA 2CLDX 1L4YA 3QVVA 4NU0A 4MKHA 3IHWA 4B3XA 4O2LA 1EG7A 4ACAA 3A1TA 1AA9A 1NVVR 4E5UA 4MDEA 3QVUA 3PCRB 2HT1A 5KO2A 1S8FA 3TUZC 1PVOA 2CVFA 2XOKD 4OI2A 5SZHB 1KSJA 2ZI7A 3CRVA 4DCNA 1IHUA 4W5JA 2NO1A 3I5XA 3V4FA 3AUXA 4Q1DA 4A0RA 1O3YA 4P33A 4DJTA 4Y0VA 3EX7C 2RGEA 4M4SA 3AM1A 3QXXA 4C0KA 4L9SA 1NVUQ 2Z43A 2BVNA 2IUSA 1ONBA 3BB3A 1HT1E 2AFIE 2VP6A 2RMKA 3K0FA 3OIWA 3WYFA 3LO5A 2VHCA 1T5LA 1DOAA 5CK4A
chains in the Genus database with same CATH superfamily
3ETHA 3SBDA 2IH2A 4R41A 5EKUA 1O54A 4BNJA 3RYIB 1GRCA 5T4FA 3M82A 3N2NA 2G09A 3I61A 3TH5A 2AR9A 1E7YA 4OUDB 2XB8A 3PTAA 1APBA 3PPWA 2GPNA 3WIVA 3QOXA 1IZ0A 2NADA 1MT0A 2V58A 1VGVA 2QM3A 3DE4X 3NETA 4M0LA 2RG1A 4AJIA 1FOEB 2V9ZA 1SCIA 3H5WA 3NHBA 1N2SA 4KMRA 3HJNA 4I6JA 2RAVA 4BO6A 1HZZC 1PGPA 4EEKA 2R751 5KI6A 5I48A 1KORA 1I4WA 1YS7A 3AUKA 3BOSA 4PSCA 1IHXA 1IK4A 2XDQB 2QZJA 3G79A 3O2QB 3TLGB 3V80A 2IYVA 3PDWA 4B4WA 2B7BA 1OGYA 1T9ZA 4FSHA 2UUOA 3LPNA 4ZZ1A 1WD5A 1C1XA 3U7QA 3HBMA 4V0LA 5IYZA 2F43B 2DQ4A 3GLTA 2I6UA 2Y05A 2Y71A 1RRMA 2VH1A 1N3IA 3DOIA 4DJFC 2YHIA 4MKGA 4R9SA 4OB7A 4CJXA 4PQRA 3BXFA 4OYRA 4QJ5A 1C1DA 4ALNA 1W4LA 1J0BA 4ENUA 2D2EA 1U0JA 3DL4A 3E8XA 3WNQA 3D4LA 3Q8KA 2P90A 2HF2A 3HYNA 3NCTA 4TN5A 4CFZA 1FUEA 1P4SA 4R4JA 4M9ZA 3ZCRA 3UWPA 3QWAA 3R7BA 4EL5A 4WWHA 1PSZA 3VAYA 2Z4TA 1PWEA 4ND6A 3V00A 3MLBA 2ADMA 4AJNA 4ZGBA 3DPSA 2J7PA 2JLXA 3C5WP 4M1MA 1XRSB 4GP6A 4N3NA 3N86A 1DDOA 2HU7A 2HNBA 5DIFA 1UUFA 1ZL2A 3OTGA 2DB3A 2GN8A 4DRYA 4NBRA 4BAZA 3NWJA 3R7LA 5LFAA 1ENZA 4K1XA 2AMLA 1RJEA 1U9IA 3EY4A 4CLOB 3BXEA 4E03A 1Z7WA 1WLYA 2J3JA 3EQ2A 3HKCB 4L50A 5JFGA 3KT8A 3S8YA 2FF7A 2GXQA 4WBXC 4N48A 3FPFA 3SYNA 3BTUA 2FSFA 1F8GA 5A06A 2VZEA 1I1NA 1L1RA 3F1LA 2FSUA 2HWYA 4H7IA 4FNGA 5ABPA 1EKXA 3VC3A 1A8UA 1RXSA 3C3EA 4J16A 2QD5A 4A6DA 4G84A 2YFYA 5CDTA 4BLVA 2I3GA 3IFSA 3HDJA 3I9MA 3T9EA 2BGKA 4LDPA 2OCBA 1AGYA 1X1BA 3ILYA 3Q3CA 2XSZA 2X1MA 3Q11A 1HI9A 1K68A 1NI4B 2OB2A 3ILVA 4WKNA 1E9VA 4Z9FA 4YRCA 2I91A 3JAKB 4II2A 3VSEA 5ELMA 3SICE 4M7WA 4ESEA 5JQGF 4MKXA 4QPJC 2RKBA 4LKRA 5KREA 3EGDB 4MO2A 4ARAA 4DS3A 2GM5A 4GYYA 2PAFA 1OLSA 3ZLTA 4ZMSA 3BFPA 3OFNA 4P35A 1OYVA 3LKZA 4WLVA 1BRMA 5GJCA 4HTAA 2QN7A 2C61A 2ODEA 1WW8A 3PX7A 3IP8A 1OBFO 4PNPA 3JARB 5JSZA 2GN2A 4P82A 2WM8A 4MEBA 1MBZA 2ILTA 1KP3A 4WOKA 2P2YA 1NDHA 4FFBA 5EWMA 3R7WB 1TIBA 4YRQA 3G5UA 3Q8LA 3MTEA 5MHTA 3RRFA 1XB2A 2Y1EA 3WB1A 2V9CA 3H65A 2NVWA 1Z2EA 2FK7A 3PJDA 4TN1A 5K99A 4BX8A 1FNSA 4LNAA 4G9BA 3WYBA 5L95A 3M4NA 1RFLA 3L8DA 4H18A 5IVHA 1W44A 1DIOB 4A0QA 3V34A 4IIYA 5LJLA 4KNYA 3CJQA 4NP6A 3VKFA 4MVCA 3LI2A 4PW0A 2B5VA 2F4VB 2OV3A 5FBVB 2BGTA 5AM4A 4HNAA 3QFSA 1GA4A 4QNMA 5FOWA 2IJGX 2PEZA 3MHTA 1JFRA 2B2NA 2PXHA 1Q7EA 1JAZA 4HS4A 4MQEA 1N8SA 2XYPA 3TGWA 1E5DA 3NANA 2WB2A 3ITEA 3N2LA 3CSDA 3L7BA 5FNZA 2E82A 1Z34A 3ZLBA 4CODB 2D6FA 3BWCA 5KTNA 4XB1A 3RG2A 1GSOA 2CFOA 4NOLA 2QPAA 3WGJA 3DFFA 2V03A 4S35A 2B69A 4GRDA 5CB4F 1QUFA 1ZCBA 3AESA 2CYAA 4XIJA 5CM9C 1RZVA 1SCUA 1FMTA 2IXGA 4ISCA 1E9AA 1P4AA 3A05A 2HTEA 2HV8A 2IXAA 4QYIB 5FR2A 2YXEA 4BBZA 5E9QA 1ZONA 2QR5A 3OX2A 2XMQA 3EVNA 1NOJA 3JVEA 2R0QC 3HJUA 3ZWXA 3MINA 3PNPA 3URMA 5KPJA 2F3RA 2B92A 4OHOA 5KX5F 4FE7A 1G7SA 2PX8A 3OF5A 4TTVA 3ETCA 4BQQA 4B6OA 3ENWA 3X1JA 2XMSA 4DAOA 4ZXPA 3CRNA 3GEMA 1GG2A 3HDQA 3AHIA 3L4EA 4PRLA 2EKPA 3H5NA 3U60B 4G1VA 5J2UF 3H6KA 3GD7A 9GPBA 1XZQA 2ASEA 2WIBA 3EBLA 5KC8A 4TKLA 1V16A 1JPNA 5I3CA 1KI1A 1MQ8B 1VPWA 1BU5A 4F7DA 2B1QA 4JP2A 2QRMA 1M34A 1XA0A 2WD9A 2XNKA 3BA1A 3AY7A 1FFSA 3NQ41 3E2PA 3NC4A 5HIIA 2L2QA 5C52B 1I6KA 1NR5A 2Q5EA 1G291 2NUAB 1KDTA 1HETA 4FDAA 2ONJA 1EVJA 1Q1NA 3AP3A 2X8JA 4CCYA 4YP0A 1BCRB 1OR8A 3I9FA 5K0SA 4H17A 5BXYA 3VPFA 3LPDA 1DZ3A 4Q66C 4A0SA 1BEEA 1K5GA 2Q3BA 2D1TA 3UAYA 2Q0XA 3ABZA 2I65A 3QW4B 1PJ2A 4LF7B 3AETB 1E9FA 2A9RA 1HK7A 2D2XA 2FXVA 3JAWA 1U94A 3IJ5A 4L76A 5GV8A 4L6AA 4QGGA 1OX4A 5A4MS 1ES9A 2V97A 3HCFA 4R3NA 4Q1FA 3GNTA 1O5OA 1UBCA 4DILA 4CF6A 3A6PC 1YRQA 4OGWA 3WIDA 3H04A 4KQMA 4NARA 3PVCA 1FFCA 1UFRA 5FYQA 1TJYA 2O7QA 2FUNB 2I1WA 1BYIA 3N87A 4WCVA 5H4GA 4MUEA 4E2FA 1WXIA 3TZEA 2BM9A 2CKMA 3SZOA 4RNDB 1N9GA 5AW1A 3BMCA 2Q5QA 1WX1A 3K9BA 4C1NA 7GPBA 3ZEIA 2P9HA 1N0VC 3COYA 1WS6A 1E3TA 2N47A 3F7TA 3FLMA 2G0TA 4E14A 4FHZA 4AKGA 5NULA 3THOA 3A2NA 1RM4A 3AEYA 5G3ZA 5BVGA 2BFCB 3ZHYA 1BKSB 2RBGA 4WE3A 1P4GA 4N5HX 5BNFA 1KYTA 2IYYA 3ZE1B 4DCOA 2C0CA 1CDOA 2V6GA 1I32A 3AT1A 3DSRA 3LNCA 5EIHA 4FDTA 3ZXIA 2BKVA 5F98A 4OSPA 4J6FA 5G4KA 3UXYA 3A9RA 4UE2A 2JFXA 1DI0A 1FJ2A 2VQSA 1QGOA 1K6XA 4DA7A 4KVAA 3LS2A 3Q7QA 4A9AA 3HBNA 3ZDYB 4N41A 1TB4A 4PYRA 4BLRA 4FGUA 4B44A 4ZODA 1NBIA 3IERA 3N58A 4EG4A 3O03A 1X1SA 1YV9A 2VL7A 1G8GA 3NH9A 3JWHA 4LNUB 1RBYA 2BDUA 4XR9A 2CV1A 1VIDA 3QTTA 4Y2PA 4L74A 1KVRA 1E2JA 3MTDA 3T5DA 3P2MA 1IBMB 3IPYA 4G0YA 1PGOA 4M1KA 1YMQA 5FL3A 2QYTA 5SV2A 1NZFA 4L4RA 2QK4A 5DMXA 1VJ1A 2HA3A 4W1RA 5IK2A 1BVRA 4FXPA 1GSAA 2GA8A 3NM5A 2WHYA 3UT0A 3TMYA 3ZLUA 1NY6A 1WR8A 1HO3A 1PP4A 3DHWC 1DEOA 4JP3A 4CCAA 3U7HB 3C8DA 3U7JA 1T9DA 3VXKA 4JT2A 1TZ2A 4Q4AA 1N0WA 2VAPA 4UNSA 5AJXA 1A2QA 3OJ0A 1XTKA 3ZW8A 3RT9A 1KEUA 4GMKA 4OK3A 4HAIA 4LWZA 4RV4A 1RJ9B 1QF9A 2JKZA 3NDBB 5IVIA 3VV3A 2N46A 3QZUA 2B2XA 3UJAA 1TKBA 4GL4A 3OQ6A 4AW9A 4EW3A 3P27A 5CK5A 5I5GA 4X5OA 3DEYX 2PBFA 2PL9A 1KPIA 2DLDA 4BFLA 1EZ4A 5EHXA 4YXFA 3T7AA 5L3QB 4YQYA 3L7CA 2VP0A 4AMGA 1IN1A 3I2YX 2AJ8A 4R3UC 2NTNA 4OL9A 4IRMA 4V38A 1DWQA 1LNSA 3GIWA 3DAOA 1G2QA 1MW8X 1PFYA 1JALA 3RKUA 5LD2C 3IAM1 1Y81A 4LHZA 5IFKA 3OY7A 1SKQA 5HF9A 3JPYA 3WGUA 4KX5A 4U8GA 3PGMA 3N53A 1UKCA 1T3TA 4GM4A 1QZUA 2ZJ7A 1CRPA 1NG9A 1DHRA 4H6XA 2BRUC 4JIMA 2BDTA 3RS5A 4F4JA 3OOEA 1LPSA 2AN4A 5K8VA 1DOHA 3G0IA 1BKDR 4MQLA 4EP1A 2V7TA 2ZT5A 4BRSA 4I1OA 5KYTA 1CZLA 2ZWPA 5HGJA 1DO8A 1RS0A 5B53A 5C18A 1FSZA 2HWXA 4AMYA 4LDZA 3V7WA 2A4MA 2EJUA 4KE7A 4LUCA 3M6WA 4CMJA 4UM5A 4KP7A 1JJAA 3W05A 2FWNA 2PLRA 3RW9A 1AHNA 1EUDB 1Q7GA 2V74B 1DJQA 3SIPA 4YMVA 2FRVA 1PHRA 3FCEA 5ENZA 3HU2A 1OILA 5THKA 3C3KA 2BGGA 4BGVA 4IOLA 2DBQA 3JYOA 2CDAA 4JELA 3U44A 5H02A 3V46A 4EW6A 4M46A 2D0PB 4Q5IA 3K0AB 2AMFA 1YL6A 3DOHA 5D5PA 5DRYA 2IF0A 4QDXA 1N7HA 1J24A 5BMVF 3STYA 4XH9B 5E95A 1TO6A 3PEUA 4DBLC 4JLOA 4MXDA 3N7UA 4Q02A 1NLZA 3U7IA 2AW3A 4OY3A 2D5IA 5AOVA 1GCGA 1EFVA 5ADWA 1H6CA 3ZDAA 2YXDA 3FTEA 4CKZA 4PZYA 2QLLA 3MT7A 3JRWA 2VSYA 3CZPA 2QXTA 1J07A 6AT1A 5ESXA 4UDXX 1E0KA 3NGLA 4F4HA 3ZD7A 5BR7A 4NTZA 4AI6A 3IUBA 3E8MA 4E7PA 2WT8A 1UFVA 5K1ZA 1ZNWA 3DZHA 5BT8A 5CVTA 5KNDH 4PLCA 1E3MA 1XPUA 5DBIA 4V0OA 4GSYA 3G82C 1I13A 4DRXA 3EXHA 3OJLA 1KNXA 1GG8A 4OJMX 2YC2C 2GO1A 2ZRPA 4PLYA 4RSRA 1Y82A 4JI7B 2PQ0A 3HM9A 3TR6A 3OT1B 2QPOA 1K7SN 1ND5A 3H2KA 3QEKA 1DKPA 2B3TA 3UFXA 5K03A 1RKQA 1WQ1R 4MLZA 1U2DA 4FOOA 4EHHA 1EH5A 3HSYA 4MUYA 4NH0A 1Y3DE 2ZYHA 3I6BA 3RS0A 1OXXK 1MPTA 4GZ3A 3H4IA 2GKSA 1O95D 4EHLA 1SOMA 1B76A 2VSQA 3L0BA 1U0GA 3O8NA 2FHSA 2PD6A 2ZPAA 4FYWA 4XOIA 3V4PB 4ARIA 1NJ8A 4I8DA 5EIBD 5A3SA 5DM60 2IYQA 2B99A 4JB8A 2BW0A 4JQZA 5BSGA 5BR4A 3SG0A 3QVJA 1ABEA 3GQVA 4O63O 4BPRA 1YRBA 2Q6OA 5DM4A 1UDBA 2ZI5A 3WYEA 3VYSB 1F9AA 2P68A 3KCNA 4MR9A 4F8JA 4CIBA 3II6X 4ZAZA 1QAMA 3SYTA 4MWOA 4O5AA 4AYXA 3G17A 3I05A 3S7TA 5HFAA 4EFNA 2IYUA 1X7ZA 1XDWA 4B8WA 1TD9A 1ODIA 1FU4A 1QFJA 2CSUA 3OKFA 1YNSA 4NX2A 5LQSA 4BLTA 1P73A 3HGTA 4PBRA 4YRDA 1GWNA 4KE8A 4LGVA 4LSWA 1TYDE 2XADA 4IEEA 1H3EA 1XXHE 2FPRA 4GWLA 2A0FA 3MCTA 5EQJB 5DNDA 3PITA 1J8MF 4TUYF 1ZNZA 3A9CA 2FJPA 2KX7A 2WJAA 3Q6IA 3ANNA 4US0R 1EM8A 5IJ0A 2D7CA 1VP3A 2W5UA 3DBHA 1MRZA 4KXWA 1PFQA 4Y0NA 4QBIA 4K03A 1TCAA 4KLRA 4LHYA 1K6JA 4H7JA 1ZSVA 1D07A 3D0KA 3KUKA 1QYIA 3PEFA 4YUXA 5IG2A 1BMQA 2IVFA 2IBTA 4BOYA 3FTFA 4KL8S 2E4AA 4W5OA 1M1UA 2RDMA 5H1YA 4ZHSA 1X0VA 4EFKA 1ABBA 5J2TF 5TMBA 1N8TA 1KBQA 1YBHA 5HZMA 4P4NA 4FMDB 3USCS 4MS1B 2OV4A 4BZPA 1W36B 4HPXB 1CR1A 3UMMA 1UIMA 4AMUA 1ODTC 3JW8A 4ESOA 3MJCA 3AUFA 3RVPA 3FWKA 4XRGA 1XCOA 5B55A 3AG5A 4GXRA 1R8JA 3WQQA 2CUKA 4DA0A 1RYFA 3OAAA 4UMDA 4KPUB 3RS2A 5JMWA 2ZJYA 4WLFA 2IDMA 3T3NA 3HYTA 3MCVA 1CUUA 2DQYA 2K87A 2QUKA 4FBMA 4N40A 5ANRB 3RGGA 3W90A 4GX2A 4RDHA 3HR4A 1V1MB 1Z4PX 4X1OA 5FOXA 1N5LA 3WZLA 4HEHA 4TSRA 3SVZA 4MULA 5H0IA 1CFZA 2OBBA 4GX0A 4RJKA 1A5SB 5FO0A 2PQ6A 2XSZD 1LBEA 3TTWA 2QTVA 4EATA 4RJ2A 3DH0A 4AP5A 4F6LA 5HNKA 3PDJA 2Q21A 3R4CA 3LQKA 3B2QA 4Y6PA 1JECA 1V35A 5EP3A 4MLCA 3BXPA 4IMPA 4O4IB 2O8BB 2SCUA 1POWA 4JBIA 1VPEA 4OHVA 3GPDG 4HLCA 5EPOA 3AUJB 1FDUA 2ZR0A 3NAGA 3AR9A 3LCUA 4LPKA 4PS1A 4UVEA 4BEBA 3WAGA 3CN7A 1MB4A 1ABFA 2RONA 3E18A 5CXXA 4IGFA 3OFND 3MZ0A 4KV9A 4FW9A 3VZDA 2FN7A 3SAJA 1GVHA 2XF2A 5LMZA 1D2MA 3I6ZA 4EO7A 1H4TA 2NQTA 5BSHA 1ZZGA 4MI9A 4TMZA 1Q91A 4FI3C 4HBGA 4BNNA 4JI0B 4JXJA 1D1QA 2XKKA 4Q3EA 2QVCA 4GOJA 4L95C 2YVAA 4KXXA 1PEAA 3WIEA 2P3SA 1YNOA 4HAOA 4Y2XA 4Q3AA 5D3KA 4IV0A 1LWNA 4MVJE 2G82A 3B5JA 4YA6A 3ZHSA 1LPPA 3U7EB 5JWOA 2J0VA 4J16C 4HP8A 4UPVA 3QOYA 1XLTA 3CB4A 4AWBA 2G71A 1OXUA 1NXWA 3CBGA 4QC2A 1J22A 2B4RO 1M9NA 1W6UA 5HFJA 4R71A 2DR0A 4K86A 2IF2A 3QU5A 4UD2A 1SG9A 4ZI3A 3IVRA 4JUAA 5BURA 3BSFA 4NYMQ 3T41A 5IHPA 4BPBA 2QD4A 3E7DA 2WHEA 3BXXA 1H66A 5REQB 1U9CA 3KT6A 3P26A 4IJUA 4PHTA 4BTVA 1W5TA 4MWCA 3GJ8A 2LW7A 3K5PA 4KOEC 4OSEA 1QB8A 5THXA 1OA1A 2ZUCA 4K0KB 1MOSA 3E05A 2OCIA 3QH4A 4GE0A 1EWQA 1NQTA 5FOSA 2XUKA 4KQ2A 3HR7A 4DVGA 3H2SA 1DEXA 4S1WA 4MP8A 1DCFA 2BGNA 2O57A 2QNRA 1RVDA 4YC7A 5H82A 5ALSA 1L7QA 1Q1AA 2RI6A 4OJTA 5KSOA 1DWPA 2E49A 4J8PA 3SZGA 3Q2KA 1AKYA 1PJQA 1X80B 2Y67A 3RRMA 4A10A 4DV7B 3MJEA 4ND7A 1PR5A 2PT5A 3S0JA 4D0SA 3ZVMA 4MEJA 3KNZA 4FXOA 3EIOA 3LUJA 1FNDA 3IIEA 1RZUA 4L0CA 1G4AE 3PPIA 4PX3A 3ULKA 1PL7A 2P35A 3I45A 3GGGA 3HEBA 2C2WA 3T1OA 3WLOA 4IUYA 2WFLB 4I4IA 5ITSA 5ALQA 2DF8A 2XDWA 3ZZTA 4CM4B 5DHTA 2BMWA 3FFAA 2NOAA 4UMVA 2OLEA 1CJTC 1IN4A 1B14A 1HA3A 2CLHB 4IXNA 4B4OA 2P75A 1IQRA 1D0VA 2DX7A 4DQKA 3BIOA 5KSYA 1V9SA 2C4UA 2NZ8A 4K9MA 4UREA 1L1FA 3TUIC 2IPOA 3WDLA 3WFIA 3A32A 3LP6A 1V8ZA 2R8XA 3KPYA 4A26A 2QJOA 2WWGA 4B85A 4M87A 3RUEA 3BE6A 1R0LA 4AX8A 3CLTD 1BE0A 1OA0A 2OECA 1JDNA 3SX0A 4DDMA 5KBYA 1W581 3DP7A 2WYHA 1GPLA 2PA3A 3G1WA 3IIIA 5AXDA 3ADPA 2P7HA 1RC0A 4B4DA 1LV7A 3DLAA 3ORFA 2HCRA 3VNQA 2ZETA 5BNTA 1IJKA 3M7IA 1N7GA 4IJVA 4GMDA 5T6BA 2D06A 3OU6A 4UPEA 2ZRKA 2CVHA 1TCVA 1L7NA 5F3DA 2YRFA 1UAAA 1L4BA 2Y1KA 3PZRA 3F6PA 1FLVA 4KQCA 4UFPA 2JJMA 2R62A 4HBZA 1GZDA 3IKJA 4PSDA 1VHTA 4O1MA 1KYQA 4KSCA 3OZ7A 3Q7PA 1HDGO 2I54A 2O14A 3NHLA 3UOAB 1CE8A 2C5FA 3VC7A 1JSCA 3WL7A 2X7HA 1EJ2A 5BSEA 5C8VA 2GZ1A 4GLOA 4QASA 4S04A 2RHMA 1ATZA 4HQ0A 1UJ5A 2PUAA 1H1TA 4FINA 4B8YA 4PBSA 5IC5A 2P6NA 2WLTA 4BFYA 1QSGA 3IRUA 3E58A 3NZEA 3VR0A 3GRKA 3KB6A 2O2CA 3JVVA 5H3CA 4H7FA 1BJKA 5JH7B 3AHHA 2DHDA 5DULA 2HR1A 1P33A 3BL5A 1NJGA 4I6EA 1UPCA 1OZ0A 1P3DA 2YMPA 2JGLA 1GUDA 4MI6A 1ZN9A 3PDIA 3EVAA 3T5GA 1KJWA 1J25A 4N7RA 1NV9A 1G5PA 3ZCXA 1QQTA 1DFGA 3ABIA 3IUEA 3O74A 4HXGA 4RHFA 3E81A 1QYWA 3CLTC 3RF6A 1L3BA 3EGXA 4RK1A 3UV7A 4PHGA 2CBXA 2B8EA 4YPFA 2W6JA 3BK7A 3QJ5A 1H1LB 4II3A 4DUZB 3OSZA 4HVTA 1J7KA 3P94A 1JI0A 3PNYA 4ZQIA 2YWJA 3W5JA 3WQHA 5IM4A 4CL0A 1RQGA 2AN1A 4P0TA 3C16C 2BEWA 1GCAA 2VHEA 3EH1A 4QL3A 3TLBA 4YMLA 1J5XA 5A3RA 1OASA 1SPXA 4O0LA 4TMWA 3R24A 1GCUA 3ZH9B 4YIHA 5C53B 2HBQA 4C6TB 1UK7A 3ETDA 2PFGA 2GPAA 3STXA 5D51S 2BZ0A 5ALTA 5IK2D 1U8ZA 1XHLA 2PMFA 2QL9A 2IOYA 2VNJA 5AVSA 3CEAA 1ZH6A 3WWEA 2RG7A 2A9JA 3LDAA 4PLFA 3RYCA 1HURA 1ZX1A 3QLTA 2G67A 3BL8A 3DKRA 4ND4A 1HX7A 1GYPA 2Y3IA 5ECYA 3DWFA 3CONA 5G1PA 5FFMA 2AKAB 2OEPA 3Q9NA 2DUJA 5H8WA 1S2OA 3IO5A 2ID7A 1X92A 4KR3A 4LQDA 3BMQA 4L3OA 1C4WA 3A25A 4LXXA 4I14A 4KR9A 3BSYA 1CDDA 1N2CB 3QOWA 4C4XA 4KWIA 4DIOA 3UXMA 1QMPA 3MWFA 3IUYA 1F5SA 3UHAA 1ETUA 1UXOA 5JZOA 1D2EA 3B9RA 1JZQA 1JWAB 3CBQA 1TYZA 4MGZR 2Z6UA 3GP3A 2ZRAA 5KTKA 4Z8YA 4EUNA 1D2AA 3DFZA 1S01A 3ELBA 3JZDA 2C98A 3N5KA 3PGJA 2X13A 4N7JA 3FUXA 4X0EA 5I51A 1X70A 4PY2A 1G3UA 4PLTA 3C85A 5C1BA 4EKGA 1SQ5A 2PZGA 3O7MA 3EVZA 4C88A 4BAUA 2WFZA 4OUKX 4ITUA 3UZUA 3Q5EA 5B2ZA 4MV9A 1QX4A 5CFOA 1GKKA 4TKMA 3BXZA 3UAVA 1TLLA 3KD2A 5ADHA 1LPBB 1ZRMA 2AHRA 2I99A 3ON5A 4L8GA 3QXGA 3BBLA 4K6CA 3KZOA 2RJOA 2RGBA 3GCGA 4Z9AA 3RFVA 4PC2A 3C6MA 4OUDA 1AGPA 3OKCA 1VRCA 2ENWA 5EWJB 4AMBA 3KKZA 3M1IA 3HFJA 4J6EA 4YCJA 2WTUA 3I04A 4BJ5A 4NYIR 3WYNA 2E4VA 3HCAA 5HBGA 3EZFA 1E1CB 2PJRA 3K70D 1G5TA 2GRAA 2DSNA 1W47A 4II7A 5C32A 1F6WA 3DULA 4RIGA 3BIXA 1FZTA 4L16A 5LM3A 3CE9A 1MV5A 2YN4A 2ZUVA 2CEKA 1GZ5A 1NBEA 2H4HA 1NLYA 2JAWA 3PEVA 4UTVA 3VYVA 2AN5A 4U7TB 3U1VA 5KX5B 4EY6A 2X8BA 4DSZA 1QE5A 4AS3A 4TTAA 3PRYA 2VTBB 2F43A 2AW5A 3U61B 2BR3A 4UD6A 2F2TA 1P19A 1Y3AA 3PNMA 3QY9A 4RE6A 4RENA 3JD1A 1G4UR 4WESB 4O4HF 3VDRA 1M74A 4ZYWA 1N5JA 1G7RA 2IYFA 2VP9A 3RQIA 4AN0A 1VYHA 5J2UB 5EI5A 3L8FA 3MFQA 3WLEA 3IMFA 1UDRA 2A5YB 1ZUD1 2XZOA 3DVQX 4XGKA 4IICA 4ZZ2A 1GZSA 4DGSA 4OL0A 1Q5PA 1WO8A 4Q15A 4R8RA 1JG7A 4Q18A 2BFOA 2NGRA 2OBNA 3BUSA 3MPUA 2ZDHA 2D74A 4KH0A 4M0FA 4UHDA 1O4VA 4LZZA 1MA0A 1O58A 1XYGA 3SC6A 4Y30A 3WGHA 4E5YA 5CX4A 1RLOA 1PJRA 1OROA 2QTZA 5CIWA 2PKCA 3LUKA 4RPGA 3N3AC 3SIWA 1BHSA 4JJ8A 2JLZA 5CT4A 2VYND 2VSFA 4HUTA 2CVZA 2LDXA 3ROEA 3NYWA 1SHJA 5D3QA 4D45A 4MDHA 4OBEA 4ECAA 3OURA 3HXQA 2GWRA 1GRRA 1RSZA 3DMRA 2D3TA 3ZU5A 4CQJA 1WZCA 1K6IA 2PZMA 3HVJA 3RTCA 3HEAA 3D2CA 3N0WA 2ZAOA 3WSVA 1UXGA 5JYDA 2FLVA 1X87A 2WVHA 2YH2A 3FBGA 1KY5A 3H2JA 1WMEA 4ZQEA 2XTAA 3HKCA 3N0VA 3R3SA 5A02A 4IVNA 3IIMA 4TSFD 1T9CA 1GU0A 3F46A 1Q19A 4MWTA 2ZSJA 3W34A 3PF8A 1Z08A 2VDVE 3L5OA 3UK1A 2DEUA 2VYFA 3ZI7A 1O2DA 4CV0A 4JD5A 1Z7YA 3RWMB 4H7HA 1OXKB 5LZ7A 1D2CA 8ADHA 2OB1A 2GA9A 3G68A 2WNHA 1VHDA 5E1MA 1VSUA 2C3UA 1LPNA 3BPSA 5DCYA 4A2PA 2ATVA 4UJ3A 1P9LA 4KYIB 2REQB 5BQ3A 5I01A 1MDFA 1DHTA 1WQ4A 2O2ZA 3DZIA 4JBYA 5H3LA 1L8XA 4JVNA 3QX8A 4WZBB 3TW4A 4C7JA 3RU7A 3L7IA 3GDFA 1BWSA 2AOXA 4UXIA 3FYUB 1XVIA 1C4OA 3AVPA 1N36B 4TZ6A 3OE5A 4U5QA 1NI4A 1SKBA 1XCGB 4FDMA 1Y6GA 1OFVA 3ZHXA 3IDQA 3WYDA 1ZHFA 2FPWA 2WF7A 1EDZA 4E07A 4P81A 4P31A 3AYXB 2F1JA 3EXHC 3FUVA 2AC4A 3GOQA 3KJGA 5IAEA 4LRQA 4NAVA 4EYGA 2O8VA 5CJ2A 2CCKA 6ABPA 3E9RA 3OBIA 4D3ZA 1C5KA 2LP4Y 1A1VA 4GMHA 5BVHB 3ZKWA 3PBKA 1WDTA 2BKXA 1Y6QA 2B5OA 2Q3LA 5I45A 1U2DC 3JVDA 5IMSA 2PU5A 1Z15A 5H9WA 3K9HA 3C98A 1E96A 4LZNA 3JARA 4X8OA 3ZG6A 1IWPB 4IMRA 4TYWA 2W0MA 5H68A 4BMSA 1QP7A 4V0QA 4IKEA 3PDUA 4D9IA 4BBAA 4R1NA 1SCAA 5CTAA 3T6KA 3TLYA 4L0QA 2B98A 3KM0A 1WF3A 4G01B 1TDJA 3CTPA 2XVMA 3CRQA 2QRQA 4DQVA 2QTFA 1Q95A 2K5UA 4FU0A 3KD3A 2OYSA 4JSTA 1LQUA 1TZBA 2C97A 2XUFA 4N54A 5BQFA 1UKZA 4LRWA 4D0NA 4NMWA 2C42A 3FF4A 4R8KA 3C8HA 3ROXA 5DX1A 1DX9A 2CB9A 1RABA 4KWTA 1GGJA 2C31A 4ZMRA 5DO9A 1Q0LA 1HYBA 1LPOA 3A58B 4IRXA 1II9A 4UTOA 1ADFA 2H65A 3IQXA 1R0SA 3M6XA 3F2VA 2WF6A 3QITA 3WRXA 3TFQA 3KJXA 4A4DA 4WJLA 2N1MA 3HR8A 4QBFA 2ZSKA 1F8XA 2FUEA 4RF3A 5KYUA 4HF7A 2JCSA 3DD1A 1JLRA 3G0BA 1XJQA 2IODA 4Q6WA 5I8PA 1QGAA 4ZTZB 1L8LA 1CNFA 2WTMA 1BIFA 4G5GA 1RYZA 5GIPE 1XK7A 3KLBA 1MG0A 1FW6A 2ZRBA 1M76A 4XM0A 3FXAA 4G26A 1XT6A 3IAXA 5GM1A 3WTCA 2WINI 4QOEA 3T99A 3VO8A 1VB5A 1QIFA 3PJGA 3PPYA 1J20A 3QKRB 5AK4A 4N01A 4QYIA 1KAQA 3IS3A 1JT2A 1IPFA 2YWFA 3EULA 4KE6A 1N6RA 1U80A 2Y76A 3HB5X 4NFLA 4B73A 1A2OA 5D87A 1M2OB 1L4UA 2AR7A 3CW2A 4IHKA 2PJDA 4C7OB 4BE4A 5KPDA 1RWVA 4RVHA 4TYQA 5BSTA 3RSSA 1CS0A 3W5UA 1E0AA 1P8AA 2WG2A 4OD0A 2R9VA 2WM9B 3U3OA 3KVOA 4ILKA 3F67A 2IUYA 3FG9A 4KQFA 3FGNA 1QKJA 4AS1A 3VZSA 3MLEA 4LX0A 4C03A 3I6IA 3ICCA 3LOQA 1C7IA 2AUTA 4N0PA 5DTRA 4YP9A 3SP1A 3L4JA 4XVUA 1E3WB 4W6ZA 1VMEA 1NXVA 2A5GA 3Q3JB 1GZ6A 1OYWA 2ZI4A 3ZE0B 3RRXA 5C37A 3T5BA 3SI7A 4YH1A 2AE2A 1LVUA 1EGHA 1PWHA 2CMFA 2EJVA 2VAWA 3GNLA 1ZD3A 2C9YA 4E5SA 4BGDA 2QUZA 1UIRA 1XMJA 2NUAA 3L6RA 3DYBA 2ID8A 2CXSA 2OK8A 3OIYA 4LJ5A 4YLGA 4B4KA 4G5OA 1BCRA 1SVUA 1J2YA 4MDYA 4RV9A 1OKKD 3HO6A 3OP1A 2ZQZA 2NVBA 4HGOA 4LA4A 4F11A 4BFTA 2VP3A 1AGXA 3DQZA 1A0OA 4RLQA 1BMTA 3KCQA 2HZBA 3FLAA 3PC4A 3BXHA 3IBFA 4JLDA 4N3BA 4UAUA 3AETA 2BSXA 3H5LA 4Q7EA 1II0A 1WMDA 2IHVA 2ZE8A 4NAUA 4C4AA 1F1BA 1RADA 5KTPA 5INTA 2DPLA 2OM6A 3U1BA 3U7GA 2W6ZA 2NLOA 3EIFA 5AKHA 3RVQA 3TAXA 4L9RA 5D3ZA 2F7SA 4FFPA 4ABTA 3NW9A 3KR2A 3KT0A 1JTEA 4OAQA 4I66A 3AUAA 3T15A 3J7AC 1GGNA 2R7AA 3ASYA 4CDGA 2OHFA 4EG1A 1MQSA 2AQ8A 2JK0A 5FNVA 4P5PA 1DGQA 4MI3A 4ZU3A 3K1YA 4D6XA 2W2NA 1G1AA 2GBGA 2ATIA 2H17A 4B3GA 2Q1WA 3M6FA 4A6PA 1U2SA 1M66A 1WDKA 4E1AA 4MMZB 1LDYA 4YV2A 1CRZA 2JKYA 2P62A 4EENA 1E3LA 4BNKA 2B36A 1YJ5A 3N3BC 3WLIA 4WFJA 2VDQB 4ZXFA 5BSFA 2EC5A 2Q1XA 2YL2A 4G0ZA 3FOWA 3GNSA 2DFKB 4JOCA 3D6HA 3W3AA 3IURA 4GE3A 4DIUA 1MXHA 4HAUA 2HJVA 1JI3A 1QS0B 4LHSA 5BYBA 2DFTA 1UPTA 1PS9A 1XTVA 4X95A 2EJWA 4MQFA 4ZAFA 4LNUA 3L3BA 1QQ5A 4FUTA 2JFNA 3DJYA 3U4QB 4CTJA 1CR6A 3CVJA 4IHJA 4ZVRA 2JNWA 2Q4OA 5EJIA 5TMEA 2ZJZA 1XALA 4C3UA 5FWAA 3OQPA 3TRIA 2CNNA 4HFMA 1NULA 3W04A 2ZVQX 4JUIA 2Z9DA 1YIDA 2H0RA 2QUJA 3FZYA 1RTKA 4LSGA 4W1PA 4E1BA 2NXCA 5K01A 3DWGA 2PS9A 3KTDA 2JIQA 1K5DA 4TUYB 1HG0A 3AIKA 1S5PA 4PGGA 1SUWA 2J4CA 3GDGA 4R1SA 1V0JA 3PLAE 1MOZA 1TC1A 1FFBA 2H9YA 2ZUUA 4AIIA 1B0ZA 4N3CA 4FEYA 3WNDA 4G37A 4LE2A 5DNYB 3RSGA 5TS3A 4L4SA 4MKIA 5JAOA 1T8WA 2V98A 1DCMA 1HV8A 3AUYA 4REMA 2EFDB 1CNMA 1Q0HA 2ZQYA 1UOPA 1X39A 2NXNA 2XRYA 4M1TA 4DBZA 5J2TB 4G24A 4KK4A 2VA8A 5AJWA 1FIUA 2VF5X 1CXZA 3AP1A 1DKQA 3LCMA 1EXWA 4MGEA 1NP3A 1FDRA 1F48A 4Y6GB 5FLKA 3VU1A 4O6VA 2FPIA 1DLIA 2I4TA 4CUJA 3I6MA 4EJFA 2YW2A 2FDRA 3H4TA 4NICA 1QRTA 5K8CA 5LUAA 4MARA 1MN6A 1RWPA 1E61A 3B89A 1Z0DA 2FOIA 3WGTA 2YYAA 2OD2A 3HSSA 5HF5A 2QRVA 2W6JD 4Q4CA 4QTXA 2FZVA 1OXMA 2J85A 1L6RA 3LOPA 3K9GA 3GH1A 2JAUA 1OD6A 3HUUA 3A6ZA 3I9V1 5GONA 2X2EA 4KGVA 4F1JA 4GLFA 3UM9A 2AOUA 2IYEA 2KJQA 4BLWA 4Z49A 4ZRDA 3T3EA 4BNGA 5E4FA 1IXKA 3GAAA 4G4JA 2ODAA 2W48A 3A1CA 4MV8A 3SIRA 3OTOB 1K5HA 4IX1A 3C4QA 1LC0A 3DTVA 3NKVA 3AFMA 2PCJA 1U0FA 1DQRA 5DTMA 1CS4C 5JANA 4OQZA 4Z5XA 3ZCPA 2FSPA 5BSKA 1EUDA 1DINA 2RHRA 4UUMA 5FA5A 1ZGHA 3GLRA 2FW1A 3QSGA 3EHDA 2PMCA 1AXRA 5D1HA 2QX9A 1NQAO 3M6LA 4I4TF 4ER0A 2B9EA 1NVTA 3KZXA 1IULA 4HB4A 4ROSA 2G70A 4FDLA 1F14A 2PUWA 2FSGA 1OVGA 3K0AA 4WH0A 2AXNA 4C08A 2AKEA 1YKFA 5LWQA 1A9XB 2E48A 3DMFA 2O06A 3K0FB 4FIZA 4QOFA 5CW1A 1FW8A 2W2XA 4KQHA 3HA5A 2P9GA 1WMFA 1P7VA 1YS4A 2RGDA 2VJAA 4D4MA 2F90A 5AUOB 4OI4A 3WDSA 1Y4DE 4ENRA 4G0PA 1HNNA 2I8LA 4KIGA 2RHJA 5J4HA 1IN5A 4XUGB 4WI1A 4O02B 1SIUA 4GNRA 4EJ6A 4IY1A 1E1DA 4RQBA