1GWNA

The crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
VKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Core Domain of Rhoe/Rnd3: A Constitutively Activated Small G Protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtpase
molecule keywords Rho-related GTP-binding protein RhoE
total genus 63
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gwnA00
4C3ZA 2KSQA 1GNPA 1XMVA 3SN6A 2KE5A 2ZS8A 4IVQA 4Q9HA 5B58C 1G7RA 2KB0A 4HEJA 2BKEA 2IYZA 1I4DD 1IAQA 3EZ7A 3QY0A 4IDNA 3FKSA 2EVWX 1XXHB 2IYSA 3UMRA 4Y0AA 3EZ2A 3P26A 2WKPA 1U99A 3WMEA 3EX7C 2B7BA 4MYCA 1EGAA 1SXJD 3L0OA 3UXMA 3DVLA 3F3YA 4DLTA 1YR7A 1W49A 3QPUA 4US1R 1KI9A 4XJXA 1NMZA 4XSHA 3U7FB 2I3BA 4UXJA 3OE7A 1JPNA 4OI1A 2LCFA 2GZAA 1H8HA 2Q9BA 2VHCA 1IXRC 3KUDA 4Q4LA 3CLVA 4ZDWA 2G1JA 2CMKA 3CW2A 4I99A 1M34E 2ZUBA 1KKMA 4PPNA 3DEFA 2WWFA 1U90A 4HB2A 3AP2A 5CLQA 1T0JB 3EWSA 4OJQA 4QJ4A 2VO1A 2V54A 5JI2E 4P4SB 4Q18A 4Q4HB 1R5NA 2HT6A 1Q22A 5JRJA 4NBSA 3GLHE 4Q7JB 5EP2A 2CVHA 3PJRA 1R6BX 1IQPA 4GMDA 3W8RA 4BLRA 2W6JD 1E98A 2JLXA 5TB5A 1E1QD 2ZJOA 4DSTA 2Z0MA 4QHYA 1D2EA 1P9NA 5DHFA 1K5DA 3QPWA 4M1KA 3W6PA 4DB2A 2ZRNA 5SZHB 1P62B 2O8DA 1E1RA 4P3YA 4DCUA 2V9PA 4YMVA 3AM1A 2MMCA 4XVRA 3Q7PA 4C0BA 2BHRA 3E5HA 1SVSA 4ZV4A 3TMKA 1KGDA 3WRXC 3F8TA 4DLWA 3ZZUA 2EWVA 1SVOA 2OBMA 3LXRA 3PEVA 4UNRA 3AVVA 3NBFA 4YQFA 3NVAA 3VKGA 1GNQA 5C4GB 2BBWA 2WV9A 3F5FA 3DM5A 4QNMA 5FL7D 1W1WA 3B2EA 3W6NA 1HA3A 1IN6A 2FJUA 3SYLA 2RGBA 2FSGA 1Z2AA 4JJZA 2P5SA 1NVWQ 4DRZA 2ZRDA 4BFVA 1OXSC 5CLLA 5AWFC 2GEDA 1DO2A 1F2UA 3IQXA 1XXHA 5LDDC 3RS2A 5EE5B 1F6BA 4OJKA 3EZFA 4WZAE 1E2LA 5KSOA 1U8YA 3DM9B 4FINA 5DLQC 2OO7A 2FFHA 2ODNA 1P75A 4PFSA 4PHHA 5KUTA 1EXMA 2EWWA 2AR7A 2CHQA 3GLHA 2JASA 2RB4A 1Z08A 4AKEA 1OH7A 1AN0A 1VYVA 3DKPA 5G41A 1EFTA 2CVFA 4DLUA 3TK1A 3B1VA 2FGJA 1GKYA 2OFOA 5B30A 1PV4A 3IHLA 2X2EA 1P2VA 4PC2A 1J2JA 4Q21A 1QF9A 3GLGA 1RVDA 3K70C 1LY1A 3CNOA 4Q9IA 3ZVMA 1JR3A 2D62A 1P7CA 3GEEA 4G3XA 5DNYB 4IFEA 1Z28A 4M2LA 4D0LB 4QBIA 4BZPA 2G1KA 1A7JA 3WNCA 3TSOA 4F92B 3O8RA 1KO8A 1N6KA 4Q19A 1WA5A 2AK2A 4DT1A 3M6AA 5J4HA 4ZI2A 2WWXA 2F1IA 2AX4A 4B44A 3MJRA 5SZJA 1JQJC 3Q72A 2YOFA 4HAXA 2V55B 4LJ5A 2QRZA 4TSFA 2YV5A 3B8HA 2D3WA 5L3RA 1PLJA 3KXLA 4FWIB 3SHWA 1PUJA 3VX3A 4B34A 3OFND 1FPMA 4IHQA 3CF6R 1N5KA 1O3YA 2YC4C 4W5WA 5KDLA 1OV4A 4EAQA 3UK6A 2FV8A 2NTYC 3B82A 1OB2A 1LFDB 2HXSA 4R9UC 5K8IA 4A0GA 2OLKA 5M04A 2IUTA 3RC3A 121PA 2XB2A 5HE8A 3V4FA 4W5JA 2ZRMA 2ZJ8A 1TU4A 1GWNA 3BWDD 4DJTA 5CYOA 2WIAA 1KI4A 4D6PA 1L7VC 4ZCIA 4C2UA 1BS1A 3HU1A 1W0JD 1S1CA 4E07A 2GJAA 4FXPA 5HKKA 1G5PA 2ECKA 4R71A 1MO3A 2XSZA 2YZ2A 3I61A 3A4MA 2WVJA 3U3RA 1OHHD 3EAQA 1MT0A 2QORA 3HDTA 4YMUA 4MRNA 4GZLA 3TUJC 1J70A 3PUWA 2D74A 1XF9A 2ZI4A 1HUQA 2DHRA 3ZLJA 2CE2X 3R9IA 3VU9B 4II7A 1XTQA 1KO7A 3IPYA 4O2LA 5L3SA 3KKPA 5KYKA 1XPUA 4QG7A 2OLJA 3E2IA 1G8PA 2C98A 2Z6VA 3TUZC 4NYMR 4EPWA 3T1QA 5AJYA 4Z1MD 4HDCA 4ON9A 1II0A 4ARZA 2EYQA 4M1TA 221PA 3QXSA 4RZ3A 3AKCA 5J4LA 3LQRA 3KKOA 2WWWA 4JLJA 5K8UA 4FCVA 3WMGA 4B33A 4CT4B 5CM8B 1SXJE 2IF0A 3PVSA 4TWZA 3OAAD 5DH9A 3CWZA 3RS4A 1J7KA 3A37A 1QHSA 1R0WA 1KI8A 1G6HA 2JLQA 3KTAA 1OFTA 4M21A 4YMSA 5AJWA 3REFA 4US2R 2ZM5A 4BEJA 4D4MA 3SYKA 2WZQA 2B92A 5D3MA 3CX7A 3CRRA 2ZRLA 3IILA 4QC2A 1R0YA 1KDOA 3K0SA 1WB9A 4QFMA 2AN9A 3L8YA 4MKFA 2A5DA 2GNOA 5JEEA 1KK3A 5FH9A 2QENA 1A5TA 4GP7A 4JLVA 1KSJA 3A58B 1OXVA 3QKRA 1ZP6A 1Z8FA 2W2TA 4B3GA 1I4TD 5CB8A 1CJUC 1RRFA 3RS7A 4ZKEA 2JLSA 3LH5A 2ZI7A 2VLIA 4MRSA 1GG2A 2BJWA 4FW9A 4OKSA 2A30A 2E1RA 4BZXA 5E7MA 2GJ8A 4URUR 2X8AA 2ZR0A 1U0JA 4U5XA 2N1BA 3LWNA 4C0JA 1FTSA 4JYCA 1FP7A 4RFVA 4BFYA 1E79D 1SXJC 1DAKA 2VQSA 4ITRC 4WA7A 3OEED 4G5QA 2MSDB 2O5VA 3FOZA 3CPEA 3KUCA 3LW8A 5EXTA 4R2IA 4DLZA 2QMOA 2GCOA 4NCIA 1GVNB 2ERXA 2GXQA 4KHZA 1E9FA 4TL7A 2G88A 4HLUC 1E9SA 5JS7A 1KYIA 3GCGA 4CDGA 2XTZA 2QPOA 2J87A 2QTHA 1I2MA 1UKVY 1R5BA 4IDHA 4KVAA 1CU1A 2A78A 1ZM4A 3UMSA 4AC9A 4JL6A 5J4KA 2WSSA 5FBQB 2IBMA 3KKQA 2F55A 1KO4A 2OBLA 1NN3A 2ZJZA 1N6PA 2IF2A 2CL6X 2FFBA 3K0FA 2ZU6A 2EFDB 2NGRA 5B57C 1H8EA 1XD9A 4NYIR 1XDBA 3W3ZB 2ORVA 1HV8A 2C95A 1XEFA 4BFSA 2JLYA 1FFHA 3PIRA 5FL7A 3AF2A 4TQ9A 2GWHA 3VHLB 2HXYA 3N2EA 3T1OA 2NO6A 1HE1C 3LW7A 2JCSA 2UVQA 4L4UA 3CZQA 4NYIQ 2WIBA 4L9SA 4D4KA 5FBLB 2CHGA 2XNSA 3U7GA 4M9QA 4LY6A 2C04A 3UG6A 2R6DA 4TTQA 3A1UA 4NONA 2J0SA 1RRPA 3Q5EA 3ZJYA 3H86A 2FZLA 4Q7KA 4C0AC 1D8TA 4QJ3A 3BXZA 4ZIRA 2D7CA 1OB5A 3GLIB 3H1TA 2DBYA 1RPZA 4PC7A 4BEBA 4D25A 3C15C 1CR0A 2ZANA 5LB4A 4MGZR 3NC1C 2B8TA 4B32A 4PPQA 1ZU4A 4B71A 1E2GA 5FOVA 2ZXUA 2QM8A 2G3YA 3AKDA 3WNDA 1E3MA 3SI7A 4ASUD 2VHUA 2IW3A 4MKGA 3QBVA 4ZCMA 5EZ5A 1FX0B 3U6KA 5J40A 1JPJA 3BRWD 2IS6A 5JSZA 1N25A 2OILA 3HP1A 1ZUIA 1FTNA 3FYHA 5EP4A 3RS0A 3QENA 5BQ5A 2C8VA 5J5CA 1PVOA 4R98A 5JMTA 3SNHA 1Z0DA 4JL8A 1KHTA 1D6JA 1NVXQ 4DDTA 3AKEA 4IKEA 1AA9A 2DYKA 1U81A 4DDWA 5JI3E 2HUPA 4B6EA 3A1VA 3QG1A 1BH2A 2A2ZA 3R8FA 2QT0A 3IIJA 1OYYA 4MDEA 5HE9A 2JATA 3EWAA 1WBBA 3ZD6A 2O8EA 3WYAA 4MYUA 4PSKA 4Q4JB 4TLDA 2R2AA 4TYQA 1TQ4A 4AD8A 2GXUA 2WOOA 1RFLA 1S9DA 4JLMA 3KFXA 5JZVA 4ZPXA 3MUFA 2OFWA 3EASA 3NHAA 5KNCA 2R65A 4TL6A 3UPUA 4PAOA 3X2SA 2PL3A 1GRQA 4DC9A 2VPPA 4BLPA 1DVRA 3AGPA 2X77A 3CUEF 1VKJA 4XVUA 4OHXA 3LRPA 4EUNA 3MWKA 5BW8A 3VKHA 1ELOA 1X1SA 4MA4A 4OL0A 4JS0A 1K6MA 4Q1CA 1Z2CA 4POAA 2HJGA 3VAAA 3NHBA 1EG7A 5JRZA 3DL0A 1G291 3CWQA 2ZVPX 2QMEA 3BE4A 2HV8A 5FTKA 1XWIA 1VIAA 5DN6D 4QNRA 1DG1G 3K09C 4KBFA 4OBEA 1W2GA 3NTUA 3I3SR 4M8NE 3QBTA 1XD8A 3Q3JB 4GI7A 5LBIA 3K0EA 1W46A 2FH5B 4A15A 1E99A 5C46F 2IUSA 1E2JA 2RHMA 1MABB 1YRAA 3MWYW 1NMYA 4HLUA 1LNZA 4DSOA 4Q7MB 3CH5A 1XPOA 2DFTA 2OUKA 1XTSA 4J0QA 3RC8A 2P65A 2HDNB 1FNMA 3ZVNA 1XB2A 5EE3A 4QGFA 4B73A 3ETLA 3EPJA 2DY1A 2RKOA 2W00A 4KYIB 2YWGA 3K8YA 2H1LA 2JLWA 4HLDA 3IKJA 5LPNA 3KB2A 2ASEA 2QAJA 3ONWA 1NP6A 5TARA 3GP8A 3QVVA 4H9GA 1HT2E 3RS3A 3U5ZB 3THOA 4GNKA 3EPKA 2QE7D 4OHYA 2ZI6A 1RC8A 4M53A 1SULA 5KHOC 2ATXA 1JALA 2BMDA 4PQFA 2QZ4A 1IN8A 4Q5IA 1AS0A 3QUSA 3B13B 1WXQA 4B6FA 4MGYR 4ZDIA 4WOPA 2LKDA 1VHTA 2BBSA 1VHLA 4O3MA 2ZITA 3B78A 3ICEA 3L2OB 2ZRBA 1COWA 3L8ZA 1ZNXA 4WIAA 5J4VA 1R0ZA 4D26A 1SVKA 5KDOA 1NJGA 1OKKD 1R8QA 4L16A 4OQLA 3T1VA 3NDPA 3PFIA 3NWJA 3MG9A 1Q1EA 2Q3FA 1VG1A 5E7JA 2D2FA 2ORIA 1NN1A 2QAGC 4BZQA 4ZDKA 2O8CB 2WICA 3BD9A 4MITA 4KJZA 3X1ZA 4HAUA 1NKSA 1GRRA 2GVZC 3ADKA 3ZZ0A 2FWRA 4IOLA 1OFIA 2IC5A 2VP5A 4IDOA 4S2EA 4V0OA 4A8JC 6Q21A 3A6PC 5FPHA 2GEVA 2OFXA 4TMZA 3EC2A 4CF7A 1VG8A 2ZE5A 3H2YA 4RD0A 5L3QB 2SHKA 1ANKA 4PQRA 4LBVA 3T1TA 3VNUA 5DIFA 4A8JB 5JJIA 4FI3C 4QBHA 2Q9AA 1E9CA 4KU4A 3DMNA 3KL4A 2YOGA 2ZI5A 3RABA 1X8LA 4IJMA 1OJLA 2F43A 3I4LA 1R5OA 4URVR 3AVUA 2YC2C 1KO5A 4CEJA 3A8TA 1TNDA 3PENA 4HAVA 1KZGB 2FSIA 3ADCA 2RGDA 3ADDA 4TT3D 4DSNA 3K9GA 2CLSA 3KQNA 3N70A 4N3NA 2FX3A 1Z0KA 4D81A 4EJSC 2MSEB 2IYYA 4IVPA 3NG1A 3QEJA 2EU8A 4FN5A 5FI1B 3IIKA 2WJIA 3LLMA 3VQTA 1RKBA 4M1SA 3DMDA 4EJSA 1KSFX 5FUWA 3SDZA 3ZVLA 1SVWA 2F7SA 4B2IA 4FIDA 1ZD8A 1M7HA 1TX4B 4CEHB 5K8TA 3RRZA 3LO5A 1KY3A 1FUUA 4YDSA 3I72A 3ZGXA 4TQAA 3J81k 4AI6A 1DAIA 1SVLA 2AWNA 1DAHA 4Q1BA 3U7HB 5F9HA 4B2LA 3BERA 2CK3A 3ZIAD 4L5BA 4M9XA 2CXXA 2H7VA 4A2PA 4AG6A 5JHGB 4D0GA 4JBWA 3I62A 1NNEA 4QL3A 1GKIA 2WWHA 4UNQA 4KFUA 3BH0A 4IOMA 4LV8B 2QTFA 3NEJA 1AKYA 3PEUA 1LB1B 2OAQ1 4X8LA 1YVDA 2J46A 5H1YA 3SQWA 4QRHA 1OIWA 2DPXA 3S1AB 3V00A 4C0QC 1NG1A 2CJWB 2BM1A 2P2LA 2DB3A 3TR5A 2UKDA 5BN5A 4E03A 2AFHE 1R0XA 1W0KA 4N0EA 1W5SA 2QAGA 1Y63A 4RCZA 1BMFD 2ANBA 4LHWA 4G01B 5CIWA 1ZD9A 3LVRE 1HE8B 3LLUA 1NBMD 2EFEB 1FMJA 1NRJB 2PX3A 4UJ3A 3RNLA 1RJ9B 1G8GA 1UJ2A 1D9ZA 2GCOB 2J1LA 1EX6A 4WW0A 4HUQA 1KSGA 3GFPA 2VEDA 1U9IA 4EPYA 2PH1A 4XH9B 1WMSA 2O8FB 4LX0A 2KBFA 4LYHA 1IN5A 4LJ8A 1XD2A 3K0AB 4A82A 1Q3HA 3LV8A 1NLFA 1W48A 2CLDX 1G9XA 1ZCAA 3C5CA 4HLQB 1Z22A 4IVRA 4EQ6B 3AP1A 4MGKR 1E2QA 2QT1A 3GJXC 3M4YA 2W6JA 2P3SA 2QL6A 2NPFA 3NC0C 1KNQA 3QI2A 1XNJA 1GRNA 1US8A 3FVQA 4HI0E 4CEIB 1Z3IX 4OK5A 5DI3B 4EJSB 2E9SA 5CB6A 2A3RA 1FQJA 1L2TA 4ZCLA 2IK8A 2WTUA 3B6EA 1ZUNB 4O2RA 3C5HA 2YNMA 3MRSA 3KDSE 4B43A 1R10A 1F60A 3U7EB 4KSBA 4WVFA 1XFAA 3W90A 4EPTA 2G83A 2IYUA 4ABYA 4TMXA 1N3BA 3OE7D 4UJ5A 4OHWA 3VR1A 1VCNA 5G53C 4CRWB 1E2FA 3A4LA 3IHWA 3T15A 2BMJA 1KIMA 3T5DA 1UF9A 4QXAA 3OIYA 4C30A 1F2TA 5L3VA 3EA5A 1UKZA 3I5YA 3BOSA 5BXQC 4JLDA 3T61A 2NQ2C 4Q48A 1J8YF 2QP4A 4C7OB 3IUYA 4DZZA 2EQBA 5GVSA 3P27A 5TVKA 3AVPA 3IEUA 3LBHA 1BMFA 5KDDA 3BFVA 2NO7A 4P0TA 1KI6B 2VP9A 2BCGY 1NY6A 4Q47A 4BQSA 3CNNA 2WAXA 2FSHA 4EIWA 1SGWA 3B7GA 1N2CE 2H92A 4OYHA 1G3QA 3SBEA 1JXMA 3GLGB 2OXRA 2OSBA 2QY9A 4LHYA 3B9PA 5JS8A 3FWYA 1MV5A 4BPBA 1NF3A 3I92A 3FB4A 3KJHA 4B3BA 2REOA 2ZRGA 1GL7A 1CEEA 3I32A 2XB4A 4IEEA 3K9NA 4Z54A 2CCJA 3DHWC 1GIAA 2J59A 5EUQB 3RSOA 2GRJA 4LPKA 3MD0A 1DEKA 3U60B 4B3DA 1WP9A 2YWEA 1N6NA 2JA1A 1U0HC 2HF8A 1LF0A 4PPFA 3VX4A 3SZRA 2JJ2A 4Q4AB 4RVCA 3THWB 3GEHA 4G5RA 1M74A 5C4MA 5CIQA 4B76A 2ERYA 4B3XA 4R7ZA 3TBKA 2D06A 4G5OA 3X1DA 2NZJA 3ZIAA 1QHHB 1AS3A 3SFVA 1GSIA 2VSOA 4NDZA 4JLKA 3SQXA 1ODFA 4IFBA 1GITA 2C96A 2IS4A 4DDVA 1YZUA 2B7CA 2C99A 3B9QA 4V0MA 5EQTA 5EXXA 3WMFA 1AIPA 1DE0A 4HUTA 3QF4A 3PITA 1JECA 2ZRJA 2NPIA 1QHIA 1GL6A 1NIJA 2EFCB 2G6BA 2VHJA 1DTSA 2VL7A 3AF4A 1BO6A 4LRWA 3TKLA 5LD2B 5E3HA 3HPRA 3NEYA 5TY0A 1UFQA 1FUKA 3CRQA 1C9KA 3P4YA 3PUYA 2WWYA 2WPDA 1U8AA 3MSXA 4C7OA 3DPUA 3K1JA 2ZYUX 2H8KA 1TEVA 3DZDA 4B2PA 1FX0A 3MCAA 4NYJQ 1ZC3A 4JLNA 1N6LA 3K70D 2BBTA 1MABA 2P5TB 3RYTC 3R20A 4BFZA 3UANA 1E2IA 1G1MA 4HB3A 4IEIA 4LUCA 4RD1A 4LJ6A 4RD3A 5HCIA 5C18A 2QI9C 2JIZD 1S4QA 2R62A 2FGKA 3ZQ6A 2QP9X 4K8OA 2FOLA 5IK2D 1KJYA 3RHFA 1AZTA 3WHLA 1E1QA 4TMWA 5DYGA 1TF5A 2OESA 3BIFA 4EQ6A 1COWD 2JLZA 2V7QA 4CVNA 3SOPA 3DDCA 2W2XA 1FOEB 1QZXA 3AVXA 1X6VA 2BBOA 2F1HA 4AWXA 2ZSFA 3HPQA 3ASYA 1OIXA 4ZDJA 5G3YA 1F3OA 4K46A 4W9MC 4PZLA 2AFIE 1KI1A 1UEIA 1IY1A 3FE2A 3THWA 1E2EA 4WXPA 1GTVA 1YU9A 4TLCA 2GBLA 3WBJA 2OG2A 1A2KC 3BORA 5D3MB 5GJCA 1A4RA 2QNRA 3DOEA 1OKKA 2ZAOA 3FMFA 1AJEA 4UNSA 2ORWA 2OBNA 5IDVA 1G21E 2QPTA 5BYJA 3W5IA 1FP6A 4AKHA 1UKEA 3EW9A 1E2PA 1GUAA 4LDJA 2ZR9A 1SXJA 1A1VA 1W5TA 3JVVA 2ZYTX 3EXAA 4PX9A 1ZM2A 2RH5A 2IWRA 2VP2A 1XPRA 2IHYA 4C0KA 1W4AA 4CYMA 1S1MA 2ZE8A 4LBZA 4WBSA 4F4JA 3FKSD 1AKEA 2QU8A 1U98A 1WE2A 4KLNA 5CITA 3TQFA 4OI2A 1Z07A 2GETA 1ETUA 2BKUA 1QHGA 4P33A 2ZRFA 2IL1A 3QE0A 4UKDA 4PPGA 4BLTA 4B75A 2GCPA 4EKDA 4DCVA 5L3QA 5HPYB 5HR5A 3NKVA 4GBMA 1ZYUA 3U3OA 4JYBA 2J3EA 1JEDA 1A82A 1XTJA 2IUUA 1UKYA 1E96A 1ZW6A 1G4UR 5GADl 3V4RA 3PUVA 1Q21A 1AZSC 4I1UA 721PA 4DUGA 4FMBB 4LHVA 5SZIA 1B0UA 1JB1A 4CEJB 1EFRA 1N0WA 3SBDA 4TL9A 4L9WA 3Q85A 5FOXA 2XZLA 1Z0AA 2XTNA 4A0RA 2GXAA 1V43A 2F6RA 1II8B 1U9IC 3WXMA 5IHPA 5JJLA 4A9AA 3O47A 1VPLA 3CO5A 1KI3A 4AYWA 3ASZA 4H1UA 3UKDA 2IYXA 1AGPA 3IBYA 1T3SA 2IYVA 3GQBA 3N2IA 3W3AA 4KO8A 1YZTA 4NCNA 2AHOA 4PZYA 4BUJA 3GLFB 1GDDA 2IYQA 4DBLC 2HT1A 1PZNA 1RW4A 4PHFA 2N42A 5AUNB 2ZREA 5AK0A 1PUIA 1XTKA 2GF9A 2ZJBA 1N6OA 3K70B 3SU8A 5FOUA 1E2MA 3MJHA 1RE0A 1VYUA 3AVQA 1X1RA 1TEXA 1Q12A 1DOAA 3WRYC 2J41A 2IXGA 3A1TA 3ICQB 3BGWA 1P2SA 3W9YA 1R7RA 1SHKA 2AK3A 2C9CA 1KSHA 2FDCA 1BYUA 4KXFB 3R7WA 4AK9A 2PLFA 4GOJA 2I4IA 2N46A 2RAPA 4KLZA 1CRQA 1XXHE 4A6PA 2ZJYA 2H18A 3BAFA 2ZEJA 4IDPA 2DWQA 2WJHA 1OLOA 2XZPA 3VTKA 2BJVA 2ZVQX 3FHOA 1CJVC 3QKSB 4G0NA 4I1SA 4A0FA 2QSZA 5H8WA 2BMEA 1ZIOA 5FI0B 1QG2A 1KI2A 4Q66C 2F3TA 3L43A 1ZC4A 5FBVB 4GZMA 3SEAA 3CPJB 4EDHA 4GDFA 3OZXA 3OIUA 3O8BA 1FMLA 4PO9A 1NKTA 4URXR 2IS2A 5JJKA 3GMTA 1ZCBA 4YXWA 5TMPA 4HAYA 4ASUA 4DDUA 2ZR7A 1TUEA 1TQ2A 2CDNA 2PT7A 1XD2B 3K0AA 1UDXA 4F91B 2BIFA 3AKYA 2ZRAA 1DARA 3TIFA 3K0FB 1YZKA 4LHZA 1XMJA 4LYJA 2IYWA 5GJVC 1SKQA 3WP1B 4FCWA 3PUZA 3QXCA 3ZDQA 4QM6A 1EESA 1G8YA 2ZTSA 1UEJA 4QGAA 2JDID 2XOKD 2IHBA 2W0SA 1M1YE 4QOSA 2JIZA 3RS5A 3GPLA 3BC1A 4PHGA 2OT3B 1PLKA 2HYIC 1QG4A 1M8PA 3KQLA 5IF9A 4HB4A 4B47A 4TYWA 3L0SA 4KODA 3TVTA 4XOIA 1AK2A 1GFIA 4RKEA 3SJZA 4A4DA 4A0HA 4TMKA 1F2UB 4MRRA 4CT5A 4RZXA 3RVBA 3ND8A 1OXTA 1T3HA 1A2BA 1WRBA 3U44B 2FFQA 3U4QA 3LVQE 1G8FA 2CHVA 2XTMA 3GLIA 5AJZA 3KZ1E 5JWOA 1Z0FA 4OQXA 1S9HA 3D6TB 1G8HA 3QXJA 3X1XA 2BV3A 5FPYA 4DEYA 3X1WA 3QJYA 1GAJA 1FL9A 3NIBA 4JSYA 4ERNA 1N0UA 2AL7A 5FTJA 1CR2A 1IXZA 2F9LA 3ZYCA 4D4JA 1KI6A 2Y8EA 2CBZA 1D5CA 3LNCA 4IW3B 4F7WA 2ZE7A 3OF5A 5B2ZA 4LOAA 1NG9A 2O0HA 3SS8A 3C16C 3D3QA 5BWMA 2ONJA 1UADA 4LC0A 3ZVRA 2P6UA 4HUQB 5GJBA 3FTQA 4DVGA 4WAUA 1OFHA 2X2FA 3BS4A 1XRJA 2YYZA 4FD2A 4TN1A 2GXSA 3TSWA 1II8A 5FUYA 3DOFA 4OQNA 5KOYA 3OEEA 1HYQA 4KFRA 2PBRA 4I1OA 4MUBA 1YZGA 4LYAA 3LBIA 4ARZB 3R9XA 2ZSAA 2ZRHA 4NU0A 3W34A 1CP2A 5EXSA 1YJ5A 3VR6A 1F5NA 2A9KA 2IYRA 1IXSB 5DI3A 1W36C 3AVWA 1N6HA 3KJIA 3X1YA 1E2DA 1RRGA 2QMHA 3PUXA 4FMDF 2GBLC 4MRVA 2GESA 1E0SA 3OAAA 4QGHA 4DLXA 2YHSA 2C77A 1SVIA 3HYTA 2L0XA 3KX2A 1BYIA 3FMPB 4BFUA 3VR3A 2NO1A 3HYRA 2ZU0C 2A5FA 3GJ4A 4UXHA 3T34A 3K09A 3EPLA 5EE1A 4C0LA 2B8WA 1CS4C 4M1YA 5KU1A 1QRAA 4Z1MA 1CR1A 4PTLA 2W6ID 2FZ4A 2V6IA 2OCAA 4YC7A 5BN4A 3FFAA 2QMUA 2O0KA 2ZJ5A 4W5HA 4LJ4A 3QKRB 2WMOB 1U8ZA 4V0ME 5EJEA 1F2TB 3QF4B 3R8CA 2HLDD 4P32A 2ZSBA 4B48A 1W2HA 1Z6YA 2OCPA 3IDQA 1OXXK 4A36A 1G3UA 4V03A 1UDWA 2A5GA 1HQYE 4TLAA 1KDRA 1F48A 1N6RA 4LC1A 4ZI3A 3THYA 1YE8A 4I81A 4RZUA 4MYTA 2FPKA 1Z29A 3GJ0A 4L8GA 4YONB 3TAUA 4AYTA 4DCNA 3CONA 4HDOB 2KJQA 3VNVA 1Q44A 2XSZD 3OEHD 2F1JA 3PEWA 5CM9C 5HKKD 4P4SA 3KXKA 4Q4HA 4NHOA 1KI7A 1RYHA 3RRYA 2QEQA 2CNWD 1GL9B 3V9PA 4D2IA 2X1VA 3K0CA 1RZ3A 1VCOA 2F1RA 3C14C 5KNBA 3NDBB 2HLDA 2UZ3A 1IONA 3C7KA 4PAMA 3GJ3A 4M9ZA 4V0NA 2XJ9A 3ZH9B 1XJ0A 4DSUA 2EW1A 4LSGA 3PV0A 4NPHA 1YKSA 2PJZA 2V3CC 1XMIA 4KITB 4UNNA 2JGNA 1X8JA 1OH5A 2WMNB 1W0JA 4LPSA 4DLSA 4Q00A 1QHHA 2KBEA 4TSFD 4YMTA 4DKXA 3T35A 5FL3A 4JLOA 4LJAA 3LX5A 4GP6A 4PHTA 4BASA 3CR7A 2OCYC 4TTRA 4RY2A 4E22A 4FMDB 2HYDA 5FOSA 1IJEA 3PG5A 1VCIA 4PANA 5JCPA 2FMXA 4IDQA 2WPDD 1CBUA 2F9MA 3EIEA 5LB2A 4ILEA 2O8CA 1MO5A 1OYWA 1W0KD 1SXJB 2D2EA 4RCYA 2HCBA 2V4ZA 1NVUQ 2WHXA 3TVDA 3OFNA 3FPAA 3BBPA 1DS6A 4PSAA 1JR3D 1DAMA 3B1ZA 4YMWA 3N5CA 4GL2A 3U6BA 2VHQA 5CJPA 2ZRIA 1RRCA 3PCRB 3QF7A 1S3GA 2VSXA 1MRNA 1G7TA 4BRUA 3MAAC 3LDAA 4JVMA 2F43B 2NG1A 3EA0A 5F2EA 1JR6A 1Z06A 1T8TA 4CW7A 4Q9KA 2VTKA 2GEUA 3I5XA 1ZNYA 1ZAKA 2MSCB 2O0JA 1DAFA 4V02A 3QKUA 4HZUA 1C1YA 2ZPTX 1E9RA 4EFNA 5C2JB 1AGRA 1W4BA 1EFHA 5FR1A 4DIEA 1G18A 1NLZA 5EXPA 5B64A 1IJFA 1P61B 3B1XA 5TDHA 2NIPA 1SQ5A 4O25A 4LJ9A 1OH8A 3BH6A 3LFUA 1NIPA 2VHTA 2GVDC 1DO0A 1ZD1A 2QRNA 5EUMA 1UBEA 5EZ6B 3K9LA 4UNPA 1VCMA 1XTIA 1VG9B 5ELXA 1NL3A 1Y3AA 1EWRA 1OH6A 1P73A 1G3RA 4ACBA 4KFTA 1E1RD 1P3JA 1Z6AA 2DFNA 4OK3A 2ZIAA 4NCHA 3U2QA 1W47A 3DKVA 4HZIA 4E09A 1KZ7B 4XD7D 4PC3A 1E9EA 1Q57A 1W4CA 1Z83A 1KOFA 3UWKA 4NCKA 4P31A 4URZR 5G3ZA 1CF4A 2ZRCA 4DEXA 4PO8A 2GJSA 2ZJ2A 3W6OA 3AGQA 3MFYA 2PZFA 2RHDA 4JLAA 1Z5ZA 3HR8A 5K8LA 5LD2C 4OHZA 2P67A 4YXWD 5F9FA 2DWOA 1DAEA 2BDTA 4DLRA 2Z83A 4Z8XA 1O87A 2NO0A 1H8HD 1TQDA 2PT5A 4QHTA 3AV0B 5FUXA 3KQKA 1JI0A 1MOZA 4DB4A 4CGZA 3Q8XB 4RD6A 1L8QA 2J0UB 2YOHA 5TXGA 2XXAA 3AVTA 4JBXA 4TMVA 3GD7A 3TH5A 1ZVQA 4Z51A 4LI0A 4UQOA 5H70A 1T91A 5KNDA 5SZKB 2R8RA 3B5JA 3TJZA 4BFWA 4XWAA 1FW6A 2PLRA 3A1WA 2ZETA 2O8FA 2NOAA 3MLEA 4F93B 5AR1A 1U2RA 1EWQA 2H5EA 4UXIA 2BEJA 4A1FA 1CXZA 1R4AA 1WDTA 4M22A 3GLGE 1P6XA 2DWPA 3BH7A 2W6IA 1E6CA 3CX8A 3E1SA 1E0JA 5HTKA 3QNUA 3REGA 1UAAA 4Q4JA 3GEIA 1Z6TA 1FNNA 3DZ8A 4NCJA 2PEYA 2XNDA 4HSEA 3H0KA 5UKDA 1G16A 1Q1ZA 1IN4A 4GT1A 1HEIA 4OHVA 4P4TA 2GJKA 3QSYA 1ZU5A 1XEWY 2XZOA 1E9DA 2GZHA 4URYR 1S96A 1DG3A 2FU5C 3OESA 4GSYA 1KY2A 1TUIA 2HEIA 3LQQA 1Z0IA 1JBKA 2J5XA 1SHZA 2WJJA 2FPLA 1LS1A 2WBLC 3VR2A 5FTLA 3M1IA 3B1WA 4DWJA 1T8UA 5CDFA 4LWZA 2QPAA 2ZI9A 4NMMA 3C41J 2YINC 4DLVA 1JXOA 2ZSDA 3QVUA 1PJRA 2AXNA 1M6NA 3PEYA 5DN6A 3AQ4A 3NBXX 2J7PD 2JJ1D 1E69A 4NYMQ 5FBWB 4M9SA 1OPXA 2OV2A 5FPSA 4B74A 5JWRA 1CIPA 2GZDA 3NBYC 4LJ7A 4KV9A 2CK3D 2BC9A 1VYTA 3WYGA 3BB4A 5DSZA 2B21A 1SKYE 1D2MA 2AWOA 3IO5A 2ZE6A 3RLFA 3AF3A 1DADA 4A8JA 3CX6A 3W5JA 1HQCA 4RSGA 4QBGB 4M0LA 4V0LA 1YZNA 4BLOA 2GF0A 2YKGA 3AUYA 4BGDA 1IM2A 5H68A 4M1OA 3KKMA 4H1VA 3THXB 2BM0A 1G7CA 2JEOA 1ZNWA 1BIFA 1HURA 1R2QA 1S3SA 4HB0A 2BWJA 1E4VA 2AKYA 4KCGA 2DR3A 1ESNA 4LJYA 3HR7A 4HAWA 1YR8A 2WJGA 4TT3A 2RGEA 2C78A 4LBWA 5CDFE 1XEXB 3ND9A 1P2UA 3AP3A 4MYHA 2NO9A 3AVOA 1S2MA 4AY2A 1GNRA 2WKQA 4L15A 4TZ0A 3SR0A 1XEWX 4P4UA 2JDIA 1YR9A 1WBDA 1OXUA 1X3SA 5J4YA 5GVRA 2HCJB 1NN0A 2NMVA 4O0MA 4ZKDA 2ZUCA 3LBNA 1QDEA 3HWSA 3L82B 1U0LA 1Z47A 1P60A 2GKSA 2GA8A 1UBCA 3QEOA 4R2HA 4D80A 1CR4A 3TNFA 1WCV1 5C1BA 3CRMA 4TLEA 2QA5A 4Q03A 2XGJA 1X8KA 2AKAB 1LV7A 4XD7A 4TMTA 4DXAA 3GLHB 5ANRB 2QP3A 2ZROA 2CEAA 3D7MA 4RD2A 1W4RA 4JL5A 1M7BA 3FHCB 1CKEA 3SJAA 3LD9A 3KJEA 5E95A 3A36A 521PA 1N5JA 2J0UA 3THYB 3LY5A 4BE7B 4DCTA 2PX0A 3FMIA 1ZM7A 1T6NA 2RGNC 2WM9B 3TRFA 421PA 1T3LA 1TADA 2QQ0A 2ZS9A 1NLYA 4PC6A 3NH6A 8OHMA 2FE4A 3RWOA 4S35A 3QKTA 5JWHA 1P4SA 2QN6A 4GRAA 5FOWA 2GAAA 2QE7A 3EIHA 4XSGA 1G64A 2VP0A 4IOJA 1P2TA 4PO1A 4Q1DA 4KSCA 4Q7LA 4WZBE 2WOJA 3GJ8A 2P0EA 1TF7A 3AH8A 3CR8A 1E0KA 2VA8A 2F3RA 4OI4A 3CRVA 5E4FA 4JLBA 2FG5A 1TQ6A 2W2VA 4AG5A 4V0KA 4YDHB 1OW3B 2FPMA 1CULC 1US8B 2BCJQ 3OIWA 3ZS9A 1OSNA 1XCPA 2J0QA 3SJCA 5FPKA 4Q02A 1LS6A 3D31A 2IX3A 4WXRA 4I1VA 3VMFA 2KWIA 4NE2A 1YR6A 2OXCA 3UATA 3FDIA 1YZLA 1JJVA 3GLFE 2VP6A 1N0VC 4A6XA 1E79A 1KK2A 1CJMA 1LVGA 3B85A 5KPJA 2RGAA 3U3JA 3JZAA 2Z4RA 4RKFA 1XJCA 4US0R 3BJIC 3KB1A 4HAZA 4Q01A 4LZZA 2OM2A 3QXXA 2GK6A 1NVVQ 2FN4A 2VRWA 2AXPA 3JVUA 3P20A 821PA 2ANCA 4NZYA 1KDPA 3K9HA 3RSLA 5AUQA 3VR4A 3SYNA 1E2KA 1G7SA 2QQEA 1IN7A 2FNAA 3B60A 1Q20A 3H84A 4MGIR 4HLCA 1KJZA 5FPTA 1EFCA 1E2HA 4I4LA 3BFKA 1WQ1R 1XU4A 3KQUA 3THXA 1IHUA 3ZS8A 3UWOA 4N1AA 4AIIA 1J99A 3TGPA 4JKYA 1MH1A 2VIIA 3IGFA 1XZPA 5A5GA 2CE7A 4PQYA 1Q0UA 2R9VA 1G20E 4JBYA 2VBCA 1KNXA 3M0EA 2ZQ5A 5DE3A 1E94E 1R8SA 4GOXA 4QBFA 2CL7X 3P32A 1G4AE 2O8EB 4MRPA 4CEIA 2CNWA 1NJFA 1Z6GA 2ODWA 1G19A 1KAGA 1U94A 1ZINA 1X86B 4PC1A 2QBYB 5DGXA 2V1UA 2Z5FA 4M4SA 1B23P 1Q1BA 2ZYVX 3RRMA 1MR3F 5KSPA 3BK7A 2JLUA 5KO2A 1GM5A 3CH4B 3D8BA 3ECCA 3SHFA 2IA5A 4AYXA 2JLRA 2Q3MA 3AUXA 3GJ7A 4DHEA 1M7GA 2DFLA 4PZZA 2ZYWX 3MMPA 2AD1A 5JFGA 4MUAA 4GOKA 4XIGS 5BYKA 3MGCA 2G0NA 3GFOA 1ZRHA 4M1MA 3TAHA 2I1VB 2RCNA 3WHKA 2Q0HA 2YJTD 1W36B 3A1SA 4DIDA 4Q9JA 4BLQA 2IXFA 3FMOB 4NKRA 5IK2A 1HY3A 1OHHA 2XITA 2OE2A 1ZUHA 2ZAMA 3R7WB 2O8BA 3I8XA 3ZD7A 4AKGA 4ACAA 1JNYA 2FA9A 2IYTA 1NY5A 3JZMA 1P72A 4KAXA 1E4YA 2BEKA 2A7QA 3VFDA 5GJWC 1H65A 5KTYA 3O8DA 1UM8A 4GMXA 3QKSA 3KXIA 4QKQA 1ZBDA 1XJQA 1NBMA 4IXNA 4OI0A 1G3MA 4DLYA 2XXAB 1HT1E 5L3SB 1YZQA 4JT4A 4LGMA 1N5IA 3CBQA 1H8ED 4F4IA 3TUIC 4ESVA 5EP3A 4HZUB 3U3MA 2HF9A 4TL8A 3Q9LA 5CYPA 5FFMA 2PZGA 1OF1A 2BMFA 1I2DA 2OEPA 3G5UA 4NTZA 2B6HA 1NN5A 4TLBA 2OCBA 4FWTA 4D0NA 1G5TA 4BRWA 4MKHA 4U00A 2WSMA 1G17A 1SKYB 1UBFA 5TV2A 1E32A 1GKUB 1W36D 4JVLA 3KQHA 2PCLA 5HCNA 4Q1FA 1C4OA 2YVUA 2VSFA 1TL7C 1J8MF 1JJ7A 4JVNA 3WYFA 3OHMA 1KTVA 4AKIA 3L0IB 1GILA 4B35A 2D7DA 5EE0A 621PA 1E2NA 2WJYA 3I73A 1GZSA 3H4MA 4TQUS 4EFMA 1I4LD 4QM7A 1IBRA 2JJ2D 2RGNA 4PXAA 2EFHB 1ESMA 4OQFA 3EG5A 3GFTA 1Q3TA 5J47A 1LTQA 3EARA 3U4QB 4XVQA 2IT1A 2QGNA 5E7IA 2PZEA 3OIVA 1MO6A 4Q1AA 3FGNA 2R6CA 3FKQA 3VR5A 4F38A 2PMDA 3QIAA 5G40A 1XP8A 5KSYA 2TMKA 2EYUA 4BECA 1TTTA 3IEVA 3CKLA 3FHTA 3KFVA 5DI9A 1YRBA 1JAHA 1AQYA 4NL4H 3AF1A 2O8BB 2CJWA 4A92A 4CIDA 1MRSA 3GJ6A 3CB4A 1DAGA 2RGXA 3T06B 3Q7QA 2E87A 1KDTA 1G6OA 1E9AA 3CF0A 5FBRB 1AQUA 4EPVA 1Z6XA 5AUPB 4IOKA 1MO4A 1ZM3A 2XJ4A 2G9NA 2P6RA 3I8SA 2XOKA 5KPDA 2ATVA 4JT2A 5JHHB 3G0HA 2J0VA 1IOZA 1MKYA 2VH5R 1K5GA 2GK7A 2MMGA 2PJRA 4Q1EA 1KK0A 2FEMA 3QOFA 2W83A 5JBQA 2DCUA 4YLGA 1S8FA 3SJBA 3UIEA 3CF2A 2J45A 2QROA 4DT1B 1CJKC 3BB1A 4JKIA 2Q6TA 1V5WA 2O52A 5F3WB 1XZQA 1JR3E 4RZ2A 3TLXA 2ZJAA 2VF7A 3I1FA 3OEHA 2FFAA 4NH0A 4C0HA 1AM4D 4KVGA 3E70C 1QVRA 1QHXA 1K8RA 1T9HA 5DISB 2QBYA 4LHXA 2CCKA 2QGZA 1LF5A 2QTVB 3SC3A 3EC1A 4FMCB 1QHYA 4D4LA 3C4JA 4LV5B 1XEXA 4FCTA 1NMXA 5BN3A 4TYNA 5CK4A 3UG7A 2C2HA 5FTNA 5CJ2A 3GJ5A 3TR0A 2FSFA 3ZQJA 1TF2A 2RGCA 4JLPA 3VKWA 3HU3A 2IS1A 1QBKC 2CL0X 1HH4A 2ZSEA 4RFSB 2RMKA 4EPXA 2CCGA 1KMQA 3RAPR 2GCNA 2OZEA 4EPRA 3QXHA 4ZO4A 1DPFA 2XEXA 2V1XA 2KI5A 1AS2A 4ZIRB 4Z8YA 3CPHA 5DYIA 3BFXA 4LBYA 3R9WA 1ZM9A 3PXGA 1KK1A 1NVVR 1CRPA 1YQTA 1ONBA 4NP6A 2G77B 3K53A 2H16A 4WZ6A 1G3IA 1RJ9A 3AEZA 4JVSB 1FZQA 2QG6A 1N6IA 3IIMA 1KAOA 2I1QA 4G5GA 2EFGA 3HJNA 3TW4A 2LWIA 2C9YA 4A2QA 4XWOA 3VU9A 1JEEA 3PQCA 5A0FA 3EZ6A 3AF0A 4TTPA 2BOVA 4X8HA 2ONKA 2R6AA 1CJTC 4LK2A 5P21A 2GHIA 2A5YB 2AD5A 3BB3A 5JLJA 4B3CA 5A4JA 1L4YA 5JECA 2WAYA 2V6JA 1Z0JA 4C2TA 1W44A 1Z63A 4KBGA 3ZZTA 4MDFA 1TAGA 2JLVA 2D4HA 4D82A 2Q3HA 1J90A 2GILA 2NZ8A 2W58A 3FFBA 2G0TA 2FF7A 4PAQA 3RANA 4KFSA 1EX7A 1G5RA 4TYPA 3GLFA 3WNBA 1EK0A 5IT5A 1TPZA 2GTPA 4G5SA 4HATA 4AURA 5DHAA 4X8MA 1II9A 1G41A 1GP2A 4B3FX 4LV6A 4URWR 4E5UA 5AUOB 3B1YA 5FUVA 5FTMA 2YWHA 4DCSA 2BVNA 2QUZA 3NBZC 2Q9CA 2R6FA 1TMKA 1S0UA 3W8NA 3T5GA 5JEDA 2H57A 4OK6A 2GDJA 2Z43A 1E0AA 4PSVA 1NI3A 2C03A 3MWJA 1XCGB 2P6NA 3WY9A 3U44A 4PR0A 5FR2A 2YWFA 3P4XA 4JIMA 3UMFA 1HTWA 4KYUA 1T0HB 2ZUDA 2UZIR 2W0MA 1BKDR 4MQBA 1XBTA 2R6GA 5EE9A 1ZMXA 2WWIA 1OIVA 3CZPA 2JJ8A 4C4PA 4XWKA 4OQMA 5F98A 4N0DA 4JSTA 2Z4SA 4RJLA 4X8OA 4GFDA 1DELA 4K81B 1D9XA 1T5IA 2ZRPA 5DO9A 2GJ9A 4IRUB 2A5JA 3AB3A 4QHSA 3GLIE 1XCMA 3KJGA 1CLUA 2H17A 3U3KA 4MH0R 2ODEA 3LXXA 3LA6A 3CRW1 5HZHA 1P9RA 2DFKB 1N5LA 1T5LA 2FEOA 5HZKA 4XTRA 1IY2A 2OAP1 1TU3A 2K5UA 2J9RA 4QGGA 5KSZA 3TQCA 2V7QD 1QHNA 4C9BA 3IQWA 2X19A 4IXMA 2WKRA 3HU2A 1VTKA 2VYFA 2C5LA 1NSFA 2O8DB 2IEZA 2ZRKA 4CZ2A 4BFXA 4U02A 4G1UC 4LCBA 4Q4AA 4BFTA 2REXB 3C8UA 3EZ9A 2PCJA 2XX3A 1JQLB 1P9WA 2PEZA 3CIOA 1KMHB 3MWLA 1IY0A 3KTAB 1KO1A 3NH9A 4GPTA 2WWGA 3T12A 3ADBA 1VIYA 4W7SA 1GOTA 3L0PA 3KKNA 5L8VA 3U61B 4JMPA 4M1WA 3WP0A 2XAUA 1KJWA 2ZS7A 4XTCS 3LX8A 1OFUX 1KKLA 5JCZA 4FMCF 1XTRA 4RFSA 4HYYA 1FQKA 4NYJR 1PLLA 1T4GA 3DO6A 3Q5DA 1NSTA 1P5ZB 3EIQA 1VMAA 1VG0B 2WJVA 3RRNA 4LYFA 3QG5A 5AJVB 3F0TA 2LKCA 3RDPA 5IRCD 3NXSA 3EPHA 3LAWA 3A4NA 1JAIA 4QJ5A 1VDZA 2WSSD 2JAQA 2OHFA 2R44A 4KI0A 2GAOA 2IXEA 3IO3A 3S1AA 1ZJ6A 1RIFA 1SZPA 5AJXA 1SVMA 3CM0A 4A2WA 2IYLD 1XX6A 1OT3A 3QPVA 2QAGB 1VECA 3WBKA 4HDQB 5EP1A 2IEYA 2J7KA 2Q21A 4TZ6A 1XMSA 2J7PA 1CTQA 2JJ1A 5CK5A 1M2OB 4BWYA 4Q9LA 5JSZB 4MKIA 4C0SA 1Q1QA 1RYFA 2IWHA 4Y0VA 2VF8A 1WF3A 3O8CA 2CLCX 3IPXA 2ZI3A 3QQ5A 4RD4A 3TSZA 4JJKA 1LW7A 1D2NA 1L4UA 4ESHA 3G82C 2REBA 3SFZA 1EFRD 3AVYA 3IBGA 1UBGA 4U7DA 3RWMB 1EFUA 1UPTA 2ODBA 4EFLA 2VP4A 1ZNZA 3SE0A 3CNLA 4DUGD 4F4CA 5D3QA 3VHXA 1W7AA 3P1JA 2V8OA 2HJVA 1BOFA 3PR1A 3TW8B 2QSYA 2PMKA 3TE6A 4JZKA 2C9OA 1OE0A 1YHNA 2XNDD 3K0CC 2RGGA 1KMHA 4CEHA 4TYYA 1ZIPA 1E9BA 2QM7A 1NBME 4BLSA 1DBSA 1QVAA 5FOTA
chains in the Genus database with same CATH superfamily
2P9FA 3BEOA 3USZA 4BGVA 4JVOA 2KE5A 4Q9HA 5I9IA 1GQOA 2JI6A 3ZK7A 2O59A 4HEJA 1I4DD 3A4TA 2O2XA 3FKSA 5HJ5A 1Y6GA 4J2HA 2IYSA 2QB5A 2WTXA 4TXMA 1QTRA 4Y0AA 3WDLA 4MWDA 1FF9A 3STUA 1Q92A 5M3BA 1BMQA 5AP9A 3EX7C 2B7BA 4CNQA 4MYCA 4OL9A 1HQDA 3L0OA 1RHKA 1KH2A 3COWA 2ZT5A 3QTLA 4HVLA 3KEOA 3QPUA 1DZ3A 1NQTA 1W49A 2CXOA 2VHEA 4US1R 5CW2A 5HA5A 4XEHA 3FMVA 3CZ4A 4XSHA 4AQYB 3EXHA 5E4YA 4ECEA 1O4VA 3FOCA 1O95D 1U2DC 4UXJA 4HV4A 5CFMA 1T9DA 2HW8A 5C0OE 3BFJA 4QASA 5BOSA 2GZAA 2Q9BA 1P5JA 2PRSA 3CR3C 5P8WA 1IXRC 1QUFA 3F7TA 1YVRA 1NM5C 2C3UA 3L41A 2CMKA 1YIOA 4JH0A 3VNSA 4BEWA 4I99A 1Z0SA 2ZUBA 4PPNA 3VJKA 3P2YA 3VPCA 2VOJA 4HYTA 1IZZA 2V54A 2GLTA 2VO1A 4QJ4A 4I6EA 1OXKB 1R5NA 1R9MA 3GWZA 1K1EA 4Q4HB 1Q22A 1C7EA 1YVUA 4QUBA 5AKYA 2DFDA 1ZLXA 4Q7JB 3PJRA 3KZXA 1IQPA 1U1GA 5FX2A 4IWXA 4UE6A 3S55A 3I0NA 4YP6A 4JYPA 2B3TA 1E98A 4MWZA 4R1QA 5TB5A 3WJ7A 2ZJOA 2V4UA 4DSTA 2Z0MA 5DLEA 3ZWBA 1P9NA 2ZRNA 1NDQA 5JNRA 2QLFA 2ZBFA 4C0XA 2O5EA 2YN2A 2VBFA 3P9PA 2ZUEA 1K86A 2FPXA 3HZRA 1E3QA 4YMVA 3E35A 2AJLI 2MMCA 1Q16A 3JAMA 3Q7PA 4LRYA 1Z16A 2PMFA 4QX6A 3TQRA 2C2OA 3TMKA 3NWPA 4NVRA 1T6XA 3PIDA 3AMVA 1FTYA 1QR6A 2OBMA 2QK4A 3ZZUA 4AROA 5BRAA 3AVVA 1SHLA 1HRDA 1KEUA 4YQFA 4KNYA 2QTRA 4YALA 3VKGA 2W2MA 4JFRA 2BBWA 4XYEA 3DM5A 1P33A 3QY9A 4XJSA 4BMCA 1CJBA 1J5PA 1V48A 1KETA 2YN0A 3ITDA 3LOUA 2I6QA 1HA3A 3N76A 4FYJA 5EWMB 4YUVA 1IN6A 5IWCA 1N3IA 3SYLA 1I1QB 2FSGA 2ZDQA 4FR0A 4GICA 3LCJA 2HADA 4CMEA 4N82A 2NACA 3FHLA 2ZRDA 4KKVA 1A8QA 4I9HA 3V4VB 3FJ1A 4IDFA 4L22A 3DCJA 1FDOA 1C9DB 1XCOA 1DO2A 1F2UA 3IQXA 5LDDC 3PE3A 5HG0A 3E7FA 3JTMA 2AZ4A 2GDZA 3T52A 3OT5A 1J33A 5EE5B 1F6BA 3ZV6A 3NC4A 4OJKA 1RI1A 3JX9A 3EZFA 4UOZA 2OHVA 2VDJA 3W05A 4F96A 5DLQC 2ODNA 3O31A 3QMMA 4B6RA 1P75A 5F3RA 5KUTA 3VPXA 3OLYA 2AR7A 5C52B 4RGVA 4MCIA 2AUMA 2CXQA 1AN0A 2DC1A 2HMSA 2AG1A 5BNWA 3KQMA 4XI9A 2BFCA 3FCOA 2HRCA 4C29A 1TVCA 3OZBA 4H16A 3G8AA 3UT5B 4DW8A 1UPCA 2Y1WA 4GECA 4U3JA 3IHLA 5BWLA 1P2VA 2IY9A 4GC9A 3CXRA 4EW3A 1PNOA 3AFIA 2Y9PB 2Q50A 5REQA 4DARA 2IU6A 4QTTB 3GLGA 1LY1A 2RKWA 3K70C 5LQKA 1JR3A 1LUAA 4ZEMA 1LPSA 4RNCA 3DQQA 2O3TA 2JFVA 5AXBA 4BO1A 2Q6LA 4M2LA 3RPEA 2ZYIA 3UKOA 3TSOA 4F92B 1V11B 1B0ZA 1QO0A 1N6KA 4YRPA 3U9SA 1QRSA 1OZ0A 1QFJA 5CB0A 3GJTA 5J4HA 1LBHA 1V4NA 2WWXA 4D4GA 4MS1A 1TYAE 3QA9A 1XI2A 2FVXA 3P5BA 2V97A 5SZJA 2Y3IA 2YOFA 5K45A 3W8FA 3EWIA 3HJHA 3R7AA 4TKVB 1OX4B 2HIMA 3WOHA 4DCMA 4LJ5A 4Z53A 2QRZA 4LHEA 1XA3A 4JOBA 3DEAA 3MEQA 4RWEA 3TD2A 1WY7A 2P9EA 4FWIB 1PUJA 3NTXA 3SHWA 1GTSA 2XD9A 3KZVA 4NBNA 5AW7A 3AU8A 1N5KA 2YFQA 3CKMA 1P0IA 1QZUA 4QSMA 2MINA 4FOSA 5A4AA 1LFDB 2HXSA 2K6GA 4H59A 3FNGA 4R9UC 3R76A 1UP6A 2XKJE 1QWSA 5H81A 5CCEA 2PL5A 5DNEA 3RC3A 1MB4A 4RGYA 5A5EA 2NUTB 4K6GA 2OO5A 2VZ0A 3DBHB 2F3QA 5AKIA 1J8VA 5H3CA 3W9SA 1TU4A 4QDTA 1GWNA 2HU5A 2PBZA 3O03A 3UWPA 2Z30A 2WIAA 1KI4A 3O8NA 1WL8A 3PI6A 4G5XA 7ADHA 9LDBA 3SNKA 4YRDA 3NTVA 1AN9A 4N5IX 4DV6B 1BS1A 4IHAA 1UANA 4G4SP 4U6SA 4E07A 1WLYA 3KBBA 3PIIA 3T3GA 2XCSB 2EBHX 3ME5A 3OCZA 4I5FA 1MO3A 5ENDA 3ZXSA 3I61A 3U3RA 3EVFA 3M83A 5F5NA 4BNUA 5D2CA 2F90A 1T8SA 2QORA 2XB9A 3N87A 2OVFA 4YMUA 4JX9A 1REQB 2BI4A 3AUFA 5JZMA 4ID3A 4CMKA 1IMOA 3HBNA 3LDHA 4RMGA 4UVHA 2OYRA 2WSIA 2OP1A 1HUQA 4RUKA 3D2CA 3WIEA 2ETVA 2ZUVA 4GOMD 3QVGB 1PJZA 2IP4A 1H9AA 3DTVB 1P6UA 5F7JA 5A06A 1NBEA 2XF2A 2AG6A 3DYBA 1TGYA 5DP1A 3OWHA 1JDPA 3RS8A 4IDGA 3IPYA 2HK9A 4MW7A 3ORHA 4D9FA 2LPMA 5L3SA 1AQIA 4I55A 3WLMA 5F64A 3D3NA 2AMVA 3PFCA 4QARA 3E2IA 1OBOA 2Z6VA 4FT4A 3TUZC 2YHAA 1OPRA 3I23A 4GI5A 1UPBA 2VDLB 3TLMA 4ZEOA 3VYTB 5A5DA 4EFLA 4RTOA 4BTEA 2NVBA 1EUDB 2QTTA 4ARZA 5IFKA 1VP3A 5HIAA 4M1TA 4K6OA 3S2ZA 4GKBA 2HRZA 2QM3A 4HH3C 4IR7A 2MYNA 2WVGA 4O1IA 4PEVA 3ZGLA 5J4LA 1B0AA 4O5AA 4CE6A 1ISRA 4I9GA 2YICA 3S44A 3UK2A 3VU3A 1SG0A 2DPHA 4FCVA 3JQAA 1WUYA 5CM8B 1G21B 2OAGA 4HWTA 1NBAA 4E5SA 2V65A 3A1CA 3CW9A 3CWZA 3OAAD 5CM2Z 4ALIA 4MJ3A 1LD3A 3RS4A 4FFWA 5F7XA 1IOLA 1DHTA 4K88A 3V5NA 5FUQA 3BL5A 1A8SA 1ULUA 3SYKA 4D96A 3CRRA 2QTMA 6REQA 4QFMA 4D4HA 4YMTA 1ABFA 1WV0A 1FFWA 2QZJA 3W9BA 5JEEA 3ON5A 4DDHA 3A6FA 2NXWA 5DHSA 3SF0A 1YJXA 1XE3A 1ZP6A 1WP4A 1RXIA 4KRXA 3NT4A 4WN3A 1T13A 4B3GA 3GMDA 1JE0A 4BO0A 2YXLA 4QODA 1A5ZA 2C4VA 2H4JA 3LH5A 3E15A 3WBFA 1LWOA 4PLHA 1GG2A 3OZVA 1ZJ5A 4MLCA 4OKSA 4G0OA 1IUKA 3ED5A 3NATA 3VOSA 3ZI4A 2X8AA 3QW4B 3TGLA 4G4IA 3FPEA 4GEKA 1L7MA 2JGFA 1A4XA 4GO1A 2QDXA 3IERA 2J5KA 5A7FA 2ACEA 2P27A 1E8NA 3D54D 5E0KB 4RFVA 1SXJC 4UZEA 1DAKA 1MGOA 2D8AA 2VQSA 2DOKA 4OMDA 2IZ7A 4G5QA 3ZV7A 4ENTA 4QFDA 4OM8A 4DLZA 3R6LA 1SIOA 4YDRA 2XGMA 3IPRA 2G9QA 4LZPA 3UO8B 3AXTA 3RUPA 3MCVA 2ERXA 3JYHA 3DNFA 1YV9A 3AUKA 3MLAA 1I2AA 4F45A 1VKZA 1CYEA 4F9FA 2HA0A 2JHGA 2O7NA 2OGUA 2WVAA 3F6EX 2XTZA 3GCGA 4GR9A 4IINA 4KX5A 2J87A 4KXWA 5TC4A 2ID9A 2QTHA 1UKVY 1R5BA 4LF5B 1M5RA 1CU1A 2EERA 1MQAA 3P96A 4Q9DA 1XKXA 5J4KA 2FW8A 2W2PA 4TT8A 3KKQA 4KSYA 3ZWCA 1C8VB 2EHDA 3PNBA 1JT9A 3ENVA 3E61A 1QAMA 1L5VA 2CL6X 2GNAA 3FOFC 1IVNA 2NGRA 3INGA 3KHKA 2H2GA 1G1AA 2VG8A 2XWBF 4NYIR 1H4QA 3W3ZB 4YP5A 2C82A 2RHWA 2C95A 2Y67A 1XEFA 3EODA 1I9CA 4AZVA 2TMYA 3PIRA 4BDTA 3VSEA 3I30X 3IAM6 3EFOB 2FW1A 3OTHA 4ZYLA 1G2PA 1KVUA 2D2VA 2HXYA 2PSHA 3TEFA 1F2DA 1HE1C 2PH7A 3ONEA 3KALA 5BSKA 4REQA 2M6RA 1EX1A 3PGVA 3USES 2VJLA 4F2HA 2XNSA 3UHPA 1NXSA 2ES4A 1RAAA 4LY6A 1TIBA 2JGEA 2DWUA 2P77A 3UG6A 5JVDA 3K1ZA 2J0SA 3DYVA 3WK4A 1ZJZA 3ETHA 3RBVA 5J43A 1RRPA 1G5IA 1J2EA 4C0AC 3H86A 4O4IA 5LQMA 4HX9A 5JLAA 3BXZA 1MTOA 1FJGB 1E1CA 5EHGA 1KRWA 1IBSA 4NBKA 4GWGA 1T0PA 4P2BA 4L78A 1ESEA 1YUBA 2GYYA 1LNQA 3ESXA 4FBLA 4PC7A 2IE8A 2DTDA 2Z1NA 4BDSA 4WOJA 3FYUC 5DNAA 4DV2B 1ZU4A 4B71A 1E2GA 4B7UA 4HYQA 3S28A 4YRAA 3OZTA 2ZXUA 1YS7A 4DG8A 2DF8A 5EIXA 1L5SA 2CJXA 3U40A 4J0FA 4RTMA 2YY5A 2VHUA 1CNMA 2PUBA 1FX0B 5I4BA 5BWOA 3U6KA 3RCBA 1JPJA 2IS6A 4UARA 1PJSA 1WU7A 1NWHA 2ZB8A 4HQFA 4EHAA 1FTNA 5EQFA 2BONA 4XM0A 5BQ5A 4LY9A 3PYLA 1PJ3A 4HWGA 4C87A 3SZ3A 5CA1A 1C9MA 3DUWA 1XZ8A 2R7AA 1OVMA 4JL8A 1KHTA 1KFCB 4ZQBA 4D0SA 4RETA 1NVXQ 2OQ2A 1ORWA 3AKEA 4YV7A 2K7ZA 4Q3OA 2PV7A 4KQ9A 5CFRA 2WFLA 2HUPA 5EG5A 4B6EA 1X70A 1L5WA 5LXTA 3QG1A 2JIMA 3KUUA 1BH2A 4BWGA 2HMAA 1RXEA 1SIUA 3N74A 1KKUA 1IZ0A 2JAXA 2QT0A 3CLRD 1OUMA 4CM4A 1OYYA 5LOVB 1JAYA 2WINI 4PNHA 5HE9A 3EWAA 4AD8A 4MYUA 1P0CA 2FFJA 4N5LA 2A6PA 4Q4JB 4RVNA 3A05A 2WOOA 1JSLA 5JQGF 3M70A 5DWDA 4JLMA 4E2YA 1RHUA 1RS0A 3ECSA 4GGMX 3ZTYA 1PEYA 1I51A 1KFBB 4XVHA 3EASA 4LDPA 3NHAA 1GPJA 3Q3VA 2R65A 4ZZIA 3UPUA 3P4UA 1JHYA 1TZ2A 2X2OA 3AHDA 3MILA 3UJAA 5AYVA 4L02A 5K01A 1ZR4A 2GN2A 4AKSA 2R86A 1DVRA 3AGPA 4M0PA 1LK0A 1PWXA 3FBWA 4HGQA 5JNLA 3Q9NA 4KZKA 1QG0A 1WM1A 3P9NA 4Y9RA 4EUNA 2CC2A 1X1SA 4OL0A 4UTVA 4JS0A 1K6MA 4KZPA 5FH9A 1EG7A 4WK4B 2R7MA 2OQRA 4EFKA 4KC0A 1SOWA 2YQ5A 2ZBDA 4UCFA 3ZDRA 3U09A 4LDQA 4O8CA 5DN6D 1O6ZA 5KOHB 5JPIA 3OQNA 4KBFA 1W2GA 4DCPA 1S6YA 1DRJA 2FEPA 1QH1B 3H11A 5ADVA 5C8YB 3D6UA 1J20A 1NJ6A 1SA0B 1ZJJA 4NZ9A 1WD7A 3HN6A 3VNQA 1MW9X 4MYDA 1ACMA 1YRAA 2RK4A 3I04A 4D44A 1NMYA 5H9VA 4AP6A 3IAEA 1LNZA 3FFXA 2OUKA 4Z2AA 3A26A 2IKQA 3GVCA 5EZYA 1FNMA 2VWGA 1QF7A 5EE3A 4RPHA 3N6XA 1RHJA 3OBIA 3M4XA 4B1FA 3LJKA 4K1LA 5EJ8A 1HBJA 1JIVA 5HKAA 2H1LA 3CVXA 5DCYA 4HLDA 2JLWA 1SCDA 5ER6A 2JI7A 5LPNA 2ASEA 4ITUA 3V4OA 3ESQA 3KETA 3QVJA 4TYMA 1EIZA 3ONWA 3EVBA 4EG7A 3KV3O 1J5EB 1MA3A 3GP8A 3RS3A 1UIRA 1B4DA 1TO6A 2QNIA 1YNSA 1TVKB 1D1PA 4GKAA 4AF6A 4C05A 3EPKA 2JCXA 2NO4A 4REOA 4CI9A 4QZVA 1U0NA 2ZI6A 4ZJYA 4OIFA 1WXWA 5TSDA 3S8MA 3V1TC 5IC4A 1JUDA 5AXCA 2HHJA 3CVOA 3M6LA 2WLTA 3COPA 5U4QA 5A9SB 5KVVA 4PQFA 2OBBA 1IN8A 1RLIA 2Q3CA 1AS0A 1FU4A 2W7TA 4YT4A 2LKDA 5KNDD 1VHTA 2C3OA 3QUBA 5A4DA 3I04M 3TFWA 2JAOA 5JAZA 4K87A 5DF1A 1COWA 1U2ZA 4G2NA 4WLOA 5BRNA 1TA9A 2ZCJA 3Q87B 3EVTA 1JPVA 3ZNOA 1OKKD 1OLXA 1OA0A 3DTTA 2K2WA 3UOWA 3WWYA 3PFIA 3NWJA 5AW8A 3W2EA 1VG1A 3Q12A 3ND7A 4X62B 1X39A 1OVGA 2O8CB 4UM7A 4O5OA 1IU9A 4QUAA 2ACVA 2H54A 5AJHA 1C0LA 2R48A 1C3VA 3DFMA 3T7RA 4C7XA 1I7LA 3SLGA 4PZ0A 1GRRA 1XFDA 1VBFA 3HKEB 1P5HA 1X14A 5E2IA 4FKMA 1Y0BA 2DH5A 3LQ2A 1KC1A 1T8WA 3ZE9A 3X0DA 3GH3A 6Q21A 3ROMA 4A8JC 5FPHA 5CNMA 3GRAA 3D5EA 2EL9A 1FNBA 2IDMA 3O94A 3COSA 2SHKA 3F46A 3ANLA 1V1RA 4LBVA 3VNUA 1TZKA 1YU6A 3R6TA 8GPBA 2P5UA 1E5TA 2NUPA 3DMFA 3QWFA 2PUVA 3JD4A 3KL4A 3NTLA 1ID1A 3D3WB 13PKA 1J23A 1OJLA 1KOJA 1P4RA 3HKBA 4JJEA 4PBSA 3TEJA 2VK1A 1BU8A 1M8KA 2YC2C 4CEJA 3UVEA 1EI9A 3VUEA 2BFDA 4HDMA 1OFUA 2WD7A 4IJQA 4TT3D 2ZWAA 4LF7B 3T41A 3MTIA 3FETA 3K9GA 3S68A 3ZHRA 1LPAB 3M9LA 1U5CA 4WRRA 5L40A 3AF6A 4IX1A 2FX3A 1Z0KA 1MRZA 4KMRA 4RBNA 4AMUA 4D81A 5I51A 4DFDA 1FSFA 1TOAA 2XIJA 3KR0A 5CVUA 3N5KA 3QEJA 5G1OA 2R7LA 3IIKA 1B76A 2WKSA 4G0VA 1RKBA 3O2QB 5CH3A 4ZANA 2CUZA 1CY0A 2AF4C 4N54A 3VHXB 1N8TA 1UKAA 2GKOA 1QGZA 4CCYA 1FDUA 2O23A 3HLKA 1QPBA 3U0VA 2AFRA 1ZD8A 1WJGA 4CEHB 1Y9DA 1N57A 1MLDA 3RV3A 3ZZ1A 5K8TA 5B7NA 3E9EA 3PX7A 1W9HA 4B7XA 2EC5A 1FUUA 4YDSA 3I72A 3LI2A 3QP9A 4KO2S 5HZGA 1O77A 4ARIA 4TQAA 4ROTA 3JRXA 1DAIA 2Q5CA 2AWNA 4G4SO 4K9OA 1HL3A 4WVLA 4EECA 4R84A 3S70A 1RC1A 3TXAA 1R8YA 3DFFA 3N3BC 4WUVA 2BFWA 4B8WA 2NXJA 3R24A 3V6MA 4C7KA 3O75A 3GUHA 3KXDA 4K1XA 2KS6A 1BEUB 3AR9A 3LK7A 1CP3A 4QFCA 4FJ0A 3LOQA 1ZOOA 1A5BB 4Y6RA 3TZCA 1AKYA 2OAQ1 2VJNA 5K4HA 2Y68A 4RANA 4I19A 1HKHA 3CB2A 4X8LA 2PUTA 2PS0A 4DNPA 2H0QA 1HL7A 5DGHA 1OIWA 3AFHA 4NMWA 4C0QC 2IEBA 3F4LA 2CJWB 2IIPA 3HYNA 2IZ5A 4P7KA 1VL1A 4R3UC 4RS4A 5FCDA 5KKCA 1WW2A 2AFHE 1LX6A 3AR4A 1W0KA 1WUTA 4P5PA 2QAGA 4KR2A 3I9V1 1R16A 1OX5A 4RCZA 5D3KA 2ANBA 3OZIA 3Q0TA 4O4JA 5SYAA 3B1JA 1ZD9A 3QJGA 1T4CA 3QLUC 3LLUA 2J3KA 3NWBA 1FMJA 4YS6A 2J31A 4ZMSA 3GFGA 1MPXA 2NUPB 4FYPA 2BKXA 1KQPA 3P9RA 2EATA 1QKIA 1UJ2A 4L51A 5LLSA 1KJ9A 1JZTA 1GCGA 2W4MA 3JQPA 4P38A 4DJJA 1NW8A 1KSGA 4EG5A 1RJWA 4EYSA 1A3CA 1U9IA 2H0RA 5CFZA 2PM8A 2RH8A 4XH9B 2BTQA 5CT8A 3KXPA 4L8VA 4LYHA 1IN5A 1E3IA 4GH5A 4O4LA 4TUYA 1Q3HA 2MSKA 1NLFA 4M55A 1RXCA 5C8XA 1NXXA 3GVHA 1G9XA 1ZCAA 4HLQB 1ZNQO 1Z22A 1U6KA 2QE6A 4ZQHA 1JPUA 2FVYA 1E2QA 3OEYA 4MHOA 4H3VA 1G63A 1SUDA 1T2CA 2QRJA 1X1TA 3JQ8A 4MVCA 4NFSA 3OQMA 1KNQA 2P2GA 4HI0E 4EY6A 3AIMA 1Z3IX 2FEWB 1OGIA 2E9SA 3EVZA 5M7EA 3I1JA 1YRHA 1Z6QA 4L8LA 3QLVC 5HUHA 2HSJA 1EPUA 1PR1A 3BRQA 5I4CA 2RHGB 4EYOA 4B87A 5G0SA 3UGJA 4MKZA 3B6EA 5IKOA 5BW5A 1ZUNB 1TT7A 2OENG 4O2RA 2HU8A 1T24A 2HQSA 1R10A 2FX5A 1O5IA 3AM5A 4L5IA 3RGWS 4BMZA 5JC1A 2R79A 1S2GA 1U7PA 2HRBA 3REOA 1QIDA 3DE3X 1YJAA 3MRXA 4MW1A 3W90A 3WJAA 5IBPA 3FF1A 3KJQA 2GKGA 3RC2A 4Z4CA 4M9CA 3T9DA 5G53C 4N7RA 4S0ZA 1MFPA 3EVNA 4YCNA 2P5YA 4HH4A 1MH9A 1ZK2A 4RAQA 4D8WA 1KIMA 1YMVA 3T5DA 4QXAA 2IKSA 1FBNA 3BA6A 5LQNA 3ESRA 5PGMA 4Y8VA 3SF8B 3GQVA 3EA5A 4TS3A 4TTTS 4R83A 5IKEA 2X7HA 5BXQC 1GYRA 1ZL2A 4JLDA 4EGCB 2NQ2C 4PZEA 1J8YF 4Q48A 4RACA 3AJRA 2EQBA 3F4KA 4ZAZA 5GVSA 3P27A 1CV2A 2PWBA 4H6PA 2C88A 5ILQA 3L7IA 2K87A 3PL5A 1QHEA 3B52X 4ER5A 2NO7A 4RHTA 3G8DA 5DCLA 4C22A 3A14A 1KI6B 1A2OA 2DLDA 4IIHA 3ZHCA 1TA0A 3HJTA 4EIWA 4NXNB 3B7GA 4O4JB 4FX5A 4TM7A 3WGHA 1B8PA 3L4KA 3UM9A 4C04A 3RUDA 4KE7A 4BMSA 1EBBA 1DKMA 3H8JA 1ZWLA 1MV5A 1XO1A 4XKJA 5HWSA 3I92A 5GY7A 3C8DA 3PLAE 3RU9A 2WG2A 2GPSA 1SQ6A 3I32A 4YJKA 2C2GA 3E2PA 3Q41A 4IEEA 1UDAA 4V0QA 2EJBA 5BUZA 5JXGA 4UD6A 1JDUA 1XCLA 3E8XA 3PHIA 5L4LA 1ECJA 3P52A 1GIAA 5EIOA 4ZXFA 1PL7A 3UWDA 1KY4A 3ENQA 3EXHC 3H75A 4ZT6A 2WYWA 3JQBA 3TECE 3RFFA 3DFUA 3QU4A 2RHCA 4B3DA 4CMIB 4RL4A 4WFQA 4V0RA 4ZAWA 1AB6A 1U0HC 2ECQA 2HF8A 3G8YA 4PPFA 3VX4A 1BQ4A 4Q4AB 1FTWA 4RVCA 4TV8B 3GEHA 5A6SA 5KYYA 3LQ4A 4PS1A 4IILA 5DULA 1M74A 3IVXA 5J1SB 4A03A 2I2WA 3Q8MA 1PHRA 3JQ6A 4AMZA 1VJ5A 3OG9A 1EQUA 1UMBB 3CUTA 3ZWDA 4W9RA 3EHEA 1FNSA 1C8KA 2RHRA 1QHHB 3E05A 1ADYA 3RF7A 2B0JA 4JLKA 4MHSA 3U4IA 3IP7A 1GITA 1AUPA 1ZD4A 3K30A 3OPXA 4EG1A 4FHDA 1YZUA 5I8WA 1IRIA 1IH8A 1JXAA 2B0CA 2C99A 1UFOA 4X44A 1Z75A 2JF0A 4OQ4A 3SQDA 4URHA 5CYGA 2NPIA 2NLOA 2O5CA 3A06A 2EFCB 3AF4A 3C8ZA 4WW0A 3TKLA 5IKXA 4NK4A 1BO6A 2G28A 1JDJA 3NEYA 1QB7A 1EJ2A 2WWYA 1W1UA 2PE5A 2UUAB 1U8AA 4P8RA 3EXEA 2YVLA 4E31A 2VQFB 1RMQA 3K1JA 2ODAA 2H8KA 1TEVA 1IHOA 4B2PA 3EGCA 4K6HA 1WR8A 4NYJQ 2B20A 3EYWA 3GBSA 2LNDA 1N6LA 4LOHA 1ST3A 1MABA 3KPJA 3AOEA 1E2IA 1OLUB 3UUWA 2W6MA 4QYTA 3C0KA 1ISFA 4WXMA 4AP9A 2FMTA 3LUDA 1ATIA 3HB4X 4LJ6A 4WCDA 5K51A 4MR8A 5LQDA 2ZSKA 3VSDA 4Y6PA 3JYOA 2VDOB 3KQYA 1WPGA 4JU9A 3ZY2A 1GFWA 4WLNA 4QDJA 4FFSA 4GUAA 2FOLA 5E6RA 5BUQA 5K0EA 2IBSA 3Q0IA 3RHFA 1AZTA 1BC5A 2OQIA 4DL9A 2OWEA 2PYZA 3BIFA 4L2IB 1DFGA 4ZTUB 3IOYA 2RE8A 4M9RA 4YNBA 1ULSA 1Y1PA 2ZSFA 3QFRA 4KDEA 5ALKA 4CMIA 1OIXA 4ZDJA 1TD1A 2VK8A 4IJ6A 1F3OA 3KNZA 4W9MC 3DE6X 3CG4A 4V38A 1YJBA 4TV8A 4W1SA 3TW6A 1U0BB 2KLHA 3VZQA 4TLCA 4JP3A 1QYWA 2OG2A 2PJUA 1RZRA 1IOWA 3AKZA 3BORA 5D3MB 2QNRA 1AJEA 1OKKA 1RWOA 4NZZA 5DP2A 4XEUA 3GP5A 3DBHA 3NHMA 2VXOA 3NOOA 3QZUA 5IDVA 4WMLA 3F6SA 4CIXA 2A1IA 1Z2EA 5BYJA 5JNSA 3RFXA 5IZCA 4I46A 2IOFK 2SBTA 4TQGA 4CKEB 1GUAA 3K20A 1B0PA 3H2HA 1K8YB 4TWBA 1W5TA 4EGFA 2GZ3A 1Q17A 3D5QA 4KQXA 4D9HA 2IWRA 1MU0A 2RH5A 3FTFA 2VP2A 3LYAA 4QQNA 3RU3A 1GA6A 3DGEC 3S8EA 3ICWA 1NI4A 5KC8A 4B3MB 2ZE8A 4WBSA 4KR9A 1KZ6A 1UC4B 2G40A 1AKEA 3TXXA 3TQFA 4OI2A 5CB4B 1YDWA 2I7CA 2GETA 4S1PA 1ETUA 2BKUA 4GVPA 1JP7A 1YDHA 2NUBA 3KLBA 4WLUA 3ZBQA 1DJNA 4BLTA 2IV7A 3EXEB 1DXQA 3I9V6 4GYKA 4EKDA 2L2QA 3G2HA 3QLVA 4WK0B 5HXAA 1CC1S 3UAGA 4H1WA 5JAIA 2KQUA 1OWLA 2BFEA 3SBOA 1A82A 1XTJA 2Q4DA 1UKYA 4P83A 2VJMB 4RK0A 5K0JA 4V3CA 3EOZA 3RG2A 4ZAFA 3K2BA 3OJXA 1AZSC 3WGIA 5AKZA 1GG8A 5DYWA 3UN1A 721PA 1WHSB 2F8SA 1B0UA 5DLYA 4NI5A 2DLCX 1FS6A 1EFRA 1VL8A 1N0WA 2P2DA 3LCCA 3OP1A 3SBDA 3R5FA 5IH7A 1EUDA 4R8LA 4DLAA 3F2VA 2XTNA 3ZBPA 3GGGA 1ND5A 1II8B 2F6RA 1NR1A 2QGFA 3K8QA 3OPYB 4JC5A 1U9IC 2PPLA 4WD3A 4D9GA 2ONCA 5AVRA 4KJXA 4H6XA 4UZFA 4WBXC 3RTGA 4YGYA 2GS9A 4L2IA 1KI3A 3WWCA 4JYZA 3E9MA 3ASZA 1N2XA 3K32A 2R68A 5L6LB 2VBIA 2ZDHA 3B9RA 3V8BA 8ADHA 4O2AB 1ZCZA 1WX1A 1VM6A 1Y6JA 4ND1A 1JZQA 1SK9A 4PYRA 3UJ7A 2FW9A 3GQBA 4C14A 4NCNA 1YZTA 3GLFB 3IP1A 2IYNA 4AZ0A 3I28A 3LPNA 1AKWA 2MCFA 1Q14A 4DBLC 4AUEA 2YRXA 4JIGA 1YIDA 3FTCA 1UODA 1UC9A 3PP8A 4PHFA 4E14A 5CA0A 1P1JA 3E7XA 4B82A 5JCXA 1TVEA 1M2FA 1U3UA 1CEQA 1XTKA 2GF9A 2GERA 5DEOA 1N6OA 3HKDB 4PFQA 3DF9A 3SU8A 1E2MA 1X1CA 2WSYB 2FSSA 3MJHA 3VO1A 2SICE 3SYTA 1K7XB 4D9NA 1OJ7A 5IVPA 5DOZA 3AVQA 1L5QA 3DP9A 3V8VA 4B80A 4IJKA 1SCBA 1FMTA 2IQ5A 2I55A 3CLKA 5JBNA 3F71A 3QFTA 4YT5A 2HI0A 3H5OA 3QHAA 3SZMA 2G9UA 2Q2NA 1JLMA 1H6CA 2OECA 1Z4LA 4G1CA 4D5EA 4PNPA 1PQUA 1L7BA 5AW4A 1M33A 1W35A 3W9YA 3H0EA 1PJ8A 4RHYA 2AK3A 3A6LA 1UMDB 3V7FA 3Q9SA 5K3DA 2YDYA 3VZDA 5ALEA 8AT1A 5IZ4A 2I4IA 3OTGA 4XRRA 5T3UA 3UA4A 2VPYA 2HREA 4DN6A 2RAPA 2Z4TA 4BO2A 1XXHE 3KLNA 3L6RA 1J0EA 3OECA 2XRZA 5IAEA 3UT5A 4B2YA 2RBKA 2ZEJA 1K0UA 2WJHA 1V8PA 2Q1TA 1IG0A 3HJCA 3ZWAA 1C7RA 1KJJA 2PKWA 2ZVQX 3FHOA 4HDRA 4EYEA 4A0FA 2QSZA 1VHDA 1Y6FA 1XRMA 4PWYA 3I1IA 5FBVB 1PG0A 2N1MA 4LRTB 3WK6A 2Q3LA 4LOLA 4ARVA 4IMRA 4EDHA 1V39A 2ZOSA 2R1VB 1EGHA 1M1YB 3JPWA 3KFLA 5LZ2A 1M3SA 3T7DA 1RVV1 2HV9A 5BMVA 4IJVA 5C1PA 2ST1A 4FB4A 5C81A 2O0MA 4YT2A 3GMTA 2FW0A 1OILA 4HAYA 4DDUA 2XF8A 3NKLA 1E7SA 2VHWA 2CDNA 3TPZA 4WCFA 1XD2B 4F91B 3CVUA 1HORA 5IBCA 5TLSA 5J59A 4TSKA 4KK3A 3NMUF 1DARA 3TIFA 3H2KA 4N47A 3BX1A 1M67A 1TLTA 1YZKA 2G5GX 2HBZA 3IPCA 3N2KA 4LHZA 4LYJA 4Q7EA 3UFBA 4RPIA 5JADA 5GJVC 1L5NA 1OC2A 3QXCA 1EESA 3LZDA 4PE5B 4M8IA 2ZSIA 1HFWA 4QGAA 1BN7A 3SVLA 3IKMB 3CO0S 2W0SA 4ADSG 3LT2A 1RQGA 2HMTA 2MINB 1PLKA 2EG5A 2FFRA 4M49A 5E9JA 4ZT2A 4F72A 4K9PA 1IWBB 1QG4A 2ZIZA 1M8PA 1USWA 1EE9A 1D2GA 2JFQA 3M1YA 4GQIA 4HB4A 4HCJA 4RHFA 4C0WA 4RULA 2C7PA 1AK2A 1GFIA 1TFRA 4RKEA 2G4VA 3ASUA 2I8AA 4MUHA 1DFIA 1NRXA 4KQMA 4P7FA 4RZXA 4QDUA 5FTWA 3M4JA 3DF7A 1C3OA 1TM3E 2FWBA 2Q5HA 3FUXA 1A2BA 1OWNA 4R51A 3IP3A 3ERCA 3VA7A 1ODSA 5B6PA 2H29A 3DH0A 2NZ2A 2CHVA 2XTMA 1X74A 1JEQB 1NP7A 3KZ1E 4G07A 1M0SA 5AJZA 3TTWA 1DXHA 1YBFA 4MQFB 4OQXA 2OXFA 1RQNA 4OQYA 3WL6A 4HMPA 3DT9A 3TZEA 1FTGA 4UUAA 2MYUA 1JEYA 4DILA 3X1WA 4DWOA 1GAJA 4HGNA 5A62A 2XY4A 3GNQA 2X5OA 2VJOA 4GZ3A 3M6XA 4N0PA 2Y0DA 4S1VA 3OJEA 3TTYA 1IXZA 2F9LA 2C3MA 4F7WA 1PF7E 4FFVA 3LNCA 1YC5A 2A4KA 1GGEA 3DMYA 1WVIA 2O0HA 4JEIA 4O4HF 5K6AC 3OZSA 1BXRB 3WL8A 4K9SA 4OYYA 3MN1A 4P0QB 4LC0A 4KV7A 1TCVA 2P6UA 2WD9A 1U7XA 2PYIA 4RK6A 4YECA 1WXEA 1OFHA 2HNKA 3LT5A 1SOMA 3FCCA 1AV7A 1TKAA 3UK7A 5KHLB 4J6EA 3C6ZA 4TN1A 2NNLD 3SHTA 1W5EA 3PNPA 3CJRA 1N1GA 1HYQA 2JKVA 3C4QA 1AZLA 1NMSA 4Y1GA 3AW9A 4YJHB 2PBRA 4I1OA 4ZGBA 5BMVB 4G97A 4FZJA 4LC9A 3KG2A 4ARZB 2WT8A 2ZRHA 3EXIB 1NVEA 1VE9A 3NR2A 1OAAA 4NCAA 4LW8A 2C9BA 2OK8A 3R4CA 3E84A 4Y6SA 2AG0A 4JC4A 4JLUA 4OJNA 3AVWA 1SPBS 3OC0A 4NU5A 1RRGA 3X1YA 2QMHA 3PUXA 3L07A 1ZK0A 3FRHA 1IBKB 1EWTA 3BZBA 2PNFA 3IUNA 5FLXA 1OAOA 2ZBUA 3BRCA 5B12A 3A9TA 2PBFA 4QGHA 3STYA 5ERXA 3LUCA 3S2EA 2L0XA 3FLMA 1MEEA 1VBKA 1LEHA 2NO1A 3TOZA 2VTDA 2ZU0C 2VYVA 3RIMA 4BP1A 5C1IA 3WFIA 2A0WA 1BFDA 1A71A 3KD2A 4C0LA 2AR9A 1CS4C 3TQIA 3HCCA 1SRQA 4Z1MA 4PTLA 3LY8A 4UVGA 5LZ5A 3A7EA 3KQPA 4HYEA 2OCAA 4OP3A 4BVEA 3FFAA 2A0UA 4V0ME 2WMOB 5EJEA 1F2TB 2C9ZA 3G2OA 4Q05A 3O4HA 1I6LA 3R8CA 4RDCA 2IHTA 3ZTTA 2HLDD 2Y0EA 3F4BA 1DPGA 2IZ6A 2AJ8A 3ZWQA 5A5VA 2RGUA 3B12A 4LMPA 4HT3B 3N05A 3M5WA 1R4ZA 4A36A 4UHFA 2A5GA 4TLAA 3NPMA 4AJ4A 1F48A 3FIJA 3PJEA 2YIMA 1ZJWA 4LC1A 4ZI3A 1Z33A 3THYA 5JQWA 4DQXA 4O8ZA 3V3KA 4RZUA 4QWMA 4JI7B 1F0KA 1RYBA 4MYTA 1U63A 1S8OA 3HK2A 4H4CA 3GJ0A 2X42A 3TAUA 2I76A 2KJQA 3MS4A 1Q44A 3QU9A 2ZYDA 2QTGA 3PEWA 5CM9C 5M29A 2R00C 3C1UA 1A5AB 4KN5A 4B6SA 2ENWA 4EKNB 3F97A 3HJRA 5ISMA 3SXUB 4K6CA 3S0JA 4HH0A 3QRWA 4QPPA 3UC5A 3BE5A 3WIVA 4UULA 3WNQA 5LYJA 3WWZA 2DKNA 4CGYA 2H59A 3HCDA 4KQ2A 2F1RA 2RHHA 3C14C 3NDBB 4RA9B 4ENPA 5EJ9A 1ILWA 1D09A 2CLIB 4PAMA 5TPZD 4N7BA 4J43A 3IELA 1XJ0A 2JBAA 2PGIA 4PXYA 4I1PA 2RHOA 2B4AA 2Q3DA 1JTVA 2WT9A 3PV0A 4NPHA