1GWNA

The crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
VKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoE
publication title Crystal Structure of the Core Domain of Rhoe/Rnd3: A Constitutively Activated Small G Protein
pubmed doi rcsb
source organism Mus musculus
molecule tags Gtpase
total genus 63
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gwnA00
4NMMA 1NJGA 4RKFA 1OXVA 2GNOA 2V54A 4Q03A 3TNFA 5HKKA 4GP7A 4TN1A 4JJKA 5A4JA 1R0XA 1DO2A 4M0LA 2BBOA 4V0LA 3N5CA 2R9VA 2VHJA 3BH7A 3OIYA 4IHQA 5FI0B 1ESNA 2ODEA 1RIFA 1BKDR 3DOEA 3HPRA 5D3MA 2HT1A 3A1TA 2EYQA 3GLGE 3FE2A 4QBFA 4JS0A 4N0DA 3ZLJA 1Q1EA 3WNCA 2JCSA 2DY1A 4K81B 1B0UA 3TK1A 1F6BA 2XTNA 3PEVA 2HT6A 1Q57A 4J0QA 4OHXA 1CJTC 2EYUA 3C4JA 3LA6A 3U2QA 4ERNA 3HR8A 2JGNA 4C0JA 1IY0A 1W0JA 3U3JA 1XXHE 2G3YA 4QBGB 4AKHA 1GRNA 1DOAA 3IO5A 2W6JD 2W0SA 2V55B 3ND9A 4KV9A 2Q9CA 4LY6A 2IWHA 1FNMA 4PHHA 5SZJA 1Z07A 3TBKA 3AF3A 5HE8A 3VQTA 5IK2A 1E9RA 4HYYA 5K8LA 4DKXA 4HLQB 2C8VA 4LSGA 2BM0A 1MRNA 3SQXA 1YZTA 1KJWA 2XTZA 3FMOB 2RGCA 2VSXA 1JR3E 1F60A 1QHYA 1DG1G 2GJSA 5LD2B 1G7SA 2Z4RA 5JJIA 1EFTA 5FUVA 3KQHA 2YOGA 3NH9A 1Z0FA 1VG9B 1G5RA 4BLRA 4CZ2A 5EE5B 2OAQ1 2WOJA 3ZZ0A 1IN6A 3TE6A 2JLSA 5ELXA 3ZVNA 2G1KA 3PEUA 3QKSB 1YZGA 3W6PA 4NZYA 1JALA 5EXPA 2IYYA 2FN4A 4OHWA 3VNUA 4GZMA 1QHIA 1RRFA 1YZUA 5FOXA 4C2UA 3CPJB 3DMNA 1HY3A 1YRBA 2WZQA 1E6CA 2FSHA 1W36C 5CJ2A 4KFUA 1CF4A 2HYDA 2HXYA 1AGRA 2CL6X 3LBNA 2GILA 4B34A 2FFAA 4WXPA 1KO7A 1QVAA 2Q0HA 1XXHA 3KKNA 3U6BA 1Q1QA 2REBA 4DIDA 1W36B 4C0HA 3GJ4A 2VSOA 1SVLA 2WM9B 3K0CA 4GSYA 3SYNA 2IYUA 2GESA 3KB1A 4HDCA 4BPBA 3U4QB 3WNBA 3EZ6A 3RHFA 5BYKA 1QBKC 3MJRA 2IXFA 1GZSA 4P0TA 3D31A 4QHSA 1LNZA 4YMTA 1RRGA 1W4AA 2OCYC 3DHWC 1JAHA 4WXRA 1NY6A 2W0MA 5TXGA 1HV8A 4S2EA 4QM7A 1YE8A 4LV6A 4O2LA 3R9XA 2P5SA 2VRWA 5A0FA 3I8XA 4E22A 4PR0A 4BZPA 3FKSA 4B2PA 1Q3TA 4D82A 1OT3A 2A5GA 3IO3A 1MABA 3MSXA 2W6IA 3MUFA 4XVRA 4Q1BA 1S1CA 3IHWA 1VKJA 4NDZA 4LOAA 3WBKA 2R44A 1OE0A 1PZNA 4M9QA 3SDZA 3VR1A 3W34A 3PUXA 1QG4A 1XJCA 4TMVA 2VP6A 4BECA 4QG7A 4WZAE 2ODNA 5D3MB 2ZVPX 4Z8XA 4TQAA 3BD9A 4MITA 1EGAA 1ZUHA 2IUSA 2VF7A 2DYKA 1BIFA 2V9PA 4E09A 1Z6XA 4KXFB 2FEMA 1KOFA 3GEIA 1FUKA 2ZE6A 1IN4A 2WOOA 3AVQA 5F98A 1L4YA 4YQFA 3W3ZB 3B5JA 3PEYA 2KBEA 1QRAA 3CRMA 2ZRIA 4HAZA 3TKLA 4C2TA 2VHQA 2R65A 2ZU0C 3BJIC 5KDLA 2DWPA 1VIAA 3AQ4A 3MAAC 2WWFA 1SGWA 5F9FA 2GEUA 1KNQA 4POAA 1ANKA 4ZPXA 5KNBA 4Q9KA 4Q4AB 1JQJC 1ODFA 1OHHA 1ZM7A 2G88A 4DJTA 3T34A 2ZRPA 2GJ8A 5B2ZA 4MRNA 5B64A 2C99A 5FR2A 4AKEA 5K8IA 3PUWA 3SBEA 3DKVA 1NMYA 3BH0A 3BK7A 2IYZA 1NLYA 1FL9A 1E2FA 1E2LA 3PG5A 3OFNA 2ZRNA 1T8TA 1ZNYA 2QY9A 3FB4A 1WP9A 2WAXA 2DFLA 4ZDJA 5JHGB 2RGAA 1GKUB 2WSSA 1N6NA 4M21A 3ZIAA 2MMCA 3BB3A 4KSBA 2ZI5A 3QXSA 3SC3A 1R8SA 1Z06A 3IKJA 4WZ6A 3C5CA 2CHQA 5FBVB 1DPFA 3KTAA 3I8SA 3GLGB 1XBTA 5CLQA 2Q9AA 2QMHA 2GK6A 4HSEA 1DAMA 3CH4B 1XEFA 4DEXA 1N5IA 2WJIA 2WKPA 4DVGA 4JT2A 5DH9A 2QENA 3EZ9A 1XXHB 1G64A 1DARA 1IJEA 1FX0A 1KGDA 1S3GA 2VIIA 2AWOA 4MA4A 4MGKR 2ZSDA 1II0A 2FE4A 3TVDA 1D5CA 2VSFA 3K9NA 3QPUA 2J5XA 4HLUA 1GTVA 4NCKA 1U8YA 4OJKA 2BC9A 2W2TA 2ZRBA 1OV4A 3EZFA 2ZJ2A 3WHKA 4F93B 2F6RA 3VHLB 3Q72A 5KTYA 2ZREA 3CLVA 1E9AA 3NVAA 4DLXA 2OFXA 2D7DA 1YU9A 2QMEA 3TGPA 5CB8A 3NC1C 1P2UA 2J1LA 3A4NA 1WB9A 2ZVQX 4AK9A 4PPNA 4OKSA 3F0TA 3QSYA 2QP4A 3UATA 3KJHA 4TLCA 3NEJA 5J4LA 4H1UA 2Z43A 1IBRA 1FTSA 3LAWA 3LX5A 1TX4B 3KZ1E 4FMDB 4KU4A 4RZUA 1OB5A 4Q7KA 3GJ3A 2ZI3A 3A1UA 4UNSA 3RS0A 5G3ZA 4KCGA 2PCJA 1KIMA 3KJIA 2VP9A 2JLXA 3OIUA 2ZEJA 4Q5IA 2LCFA 1XU4A 3B2EA 4QXAA 4N1AA 1JQLB 2IYWA 2Z0MA 4EPXA 3NC0C 4JLJA 1N3BA 1ZNZA 2ZRLA 4YXWA 5AWFC 2A5YB 1P5ZB 3Q9LA 1MO4A 3CR7A 1R0YA 2R6DA 2GJ9A 1WRBA 3WMFA 3K0AB 4PHTA 1VPLA 4IDNA 4QBHA 4TL8A 1X6VA 2NMVA 3CBQA 2HCJB 1CP2A 4TWZA 4Q48A 1GL9B 4LWZA 4DUGD 3HR7A 1E79A 2PLFA 1QG2A 5KOYA 3F3YA 2CLSA 2XNDD 2R6GA 1TF7A 2CE2X 2AHOA 2OCBA 4TTQA 2BVNA 4MGYR 3AF2A 4RD0A 5IHPA 2QP3A 2XZOA 4CEHA 3KKMA 1NJFA 1XWIA 4Q9JA 5SZKB 2WPDD 1RFLA 3QF7A 4TT3A 2AN9A 4GI7A 5JJLA 1HYQA 1QVRA 4LHYA 4Q47A 1PLLA 3B60A 4ABYA 4URXR 4RJLA 2XSZA 5KHOC 3ADKA 3TQCA 2JIZA 5JCZA 1FQKA 2FPKA 4PQFA 1QHXA 2BBSA 3OEHA 4FCVA 2GF9A 3TUJC 3V4FA 1R6BX 4ZDKA 1US8A 2FGKA 3CX8A 1XCMA 1RRCA 4HUQA 4E07A 1ZM9A 4KVAA 4JVNA 1XTRA 5DISB 5H70A 3UIEA 3N2IA 4AD8A 4ZI3A 1OB2A 4F4CA 1UJ2A 2FH5B 2GRJA 5FOSA 3EPHA 4KFSA 4X8HA 1YR6A 2XOKA 2V6IA 1TUIA 4UNRA 5B58C 3P20A 2QGZA 1OYWA 1Q22A 2ZAOA 2FG5A 4IVQA 1BMFD 2LWIA 4QNRA 2BDTA 4H1VA 2H5EA 3FHCB 2IX3A 1Z6YA 2FV8A 3MWYW 1XJ0A 3JZAA 2V7QD 1RVDA 4HI0E 5JZVA 4JLDA 4P4SA 1Z6GA 2RGNA 2ZU6A 2ZI6A 1NRJB 1KK2A 2X77A 4GOKA 3I3SR 1J2JA 3LXRA 4CYMA 1SZPA 2PEZA 4MKFA 4LYAA 1EFCA 5L8VA 1J99A 5FR1A 1K5GA 5H68A 3LV8A 4Q9HA 5E95A 1EFHA 3LO5A 2JLUA 3C5HA 1X8JA 3ONWA 4PAMA 2V4ZA 1KDOA 4JIMA 2B92A 2CJWB 4OI4A 4BLTA 1WXQA 4IRUB 1O3YA 2VYFA 3PQCA 2JJ8A 3AVYA 2QN6A 5TARA 2VP5A 5CM9C 4BQSA 2QPAA 4D4MA 4MGZR 1XP8A 4L16A 1N6RA 4TZ6A 1FOEB 3FGNA 2EVWX 1TQ2A 2W6JA 2GVZC 2ZE7A 4V0OA 3A4MA 1MO3A 1N6HA 2ZIAA 1RYFA 1VCOA 3A36A 4EKDA 1NY5A 1TMKA 1G3MA 3ASYA 3PIRA 3ADDA 4L4UA 3KUDA 4M4SA 2FFHA 1SVSA 1XEXA 3IHLA 3RVBA 2I4IA 4RZ3A 2P67A 2PT7A 3QXJA 2W58A 2Q3HA 3HP1A 1U0LA 1XMSA 1ZRHA 1ZD9A 2ZTSA 2FPLA 2TMKA 3RS4A 2DFTA 5EQTA 1BS1A 4QRHA 4PZYA 4B3CA 2IXEA 3GLHE 4QNMA 3HU2A 2A7QA 4Q4LA 4FIDA 1QHGA 2ZI4A 3SJCA 2WWWA 1Q0UA 3A4LA 3SZRA 1MRSA 3RNLA 1G4UR 1XPRA 1M74A 4IFBA 1NBMD 1IAQA 1J7KA 3SYKA 2GBLA 2O0HA 5CDFE 4WVFA 1D9ZA 4B33A 1IQPA 3W6NA 4LC0A 4B3XA 1Q3HA 2QTVB 4C0KA 3CRQA 3P4YA 4JL8A 2QM7A 4EJSC 2IS2A 2NZJA 1SHKA 3OAAD 4MRSA 4DWJA 3BFVA 2OFOA 1U81A 2AR7A 3PEWA 4F92B 2QNRA 5GJBA 1P62B 1NLZA 1F2UB 3GEEA 1JEDA 1DADA 3DMDA 1ZUIA 4DB4A 1RPZA 3B85A 2QL6A 3LLUA 4EJSB 1BYUA 1GP2A 4XWOA 1Z2AA 4TMXA 4CEHB 1E1QD 4PC1A 2E9SA 2ONJA 1P7CA 3U3KA 4DSUA 4O25A 4DDWA 1W44A 4I99A 1T9HA 3WP0A 3CPEA 2EFCB 2ZXUA 1F5NA 2UZIR 3MG9A 1E96A 1AGPA 2JLVA 2ZR7A 3SR0A 2BEKA 4HAVA 3AUYA 3UWKA 1Z0IA 5GJCA 3K0EA 4EFLA 3SFVA 3V00A 3D3QA 3QNUA 2OFWA 2ZAMA 3GLHA 1KAOA 2P2LA 4KI0A 4HAUA 2AFIE 4JKIA 4ARZB 3H1TA 1FZQA 2HF8A 1GAJA 4DSOA 3NBYC 3ZDQA 5JBQA 3DEFA 3K0FB 1VIYA 4CDGA 1QHNA 1PJRA 3KKQA 5CDFA 4TYYA 1T6NA 2F43A 4LJYA 1TU3A 2O8FA 2XEXA 2JJ2A 5FL3A 2R62A 2C04A 3JVVA 2ZUBA 4NL4H 3PFIA 4NYIQ 1MO6A 5EXSA 5KDDA 4AYTA 2W2XA 1N0UA 3CH5A 5HPYB 1KYIA 3RC3A 2CHVA 4OI0A 1SXJE 3RRMA 3SQWA 1P75A 4LK2A 5FOTA 4MGIR 1U9IC 2J0VA 3U3RA 3PXGA 1DTSA 2YWEA 3EXAA 5J4YA 4JLOA 2WTUA 5DN6D 5FOVA 1AM4D 2ZR0A 3AH8A 121PA 3EA5A 3QPVA 3LNCA 4PSKA 2EQBA 1I4LD 2DWOA 2PX0A 4TTRA 1A4RA 2OILA 2PZEA 4CF7A 4MRVA 5FTKA 2FFBA 2QSZA 2IS6A 4IOMA 4NCIA 2QAJA 4W5HA 1HUQA 4UQOA 2O52A 4M1SA 3I73A 4X8MA 521PA 1W46A 2REXB 1EX7A 1VCNA 2YZ2A 3CX6A 2IS4A 2CVFA 1T0HB 4NCNA 2PZGA 4AKGA 1T5IA 3AB3A 3CW2A 2P65A 4LCBA 3M1IA 2ORIA 4A1FA 3OIWA 4OHZA 1JJ7A 4D26A 3P27A 1NVXQ 3O8CA 2G6BA 3DKPA 3AKDA 3LQQA 4KVGA 2GF0A 4A2QA 1NSTA 2H8KA 3ND8A 3KJGA 3HDTA 1ZW6A 1S9DA 1T3LA 4AYXA 1P9WA 1UFQA 1H8ED 2BCJQ 2ZJBA 5UKDA 3TH5A 5BW8A 4ZCIA 1VTKA 1M7HA 5AJVB 4OI1A 4XVUA 3RS7A 3S1AB 3TR0A 1S3SA 1KO8A 2G9NA 1M2OB 1QHHB 1UEJA 4ZDWA 1G6OA 1AS3A 3KQNA 1Q20A 1Y3AA 5BN4A 2ZSAA 1P6XA 2ASEA 4S35A 2BBWA 3BFXA 4G5RA 4PO9A 3IGFA 3RYTC 4US1R 3QIAA 1BOFA 1DAKA 1NVVQ 1U8AA 3KXIA 4FCTA 4IDOA 1XPUA 4R9UC 4P3YA 4HAYA 2AL7A 3UMRA 2GCOA 2YHSA 3VU9B 2EU8A 3R7WA 3GFTA 2GZHA 1XMVA 2CBZA 4EIWA 2V3CC 3RWMB 5FPTA 3QJYA 4EFMA 4ESVA 5AJXA 3HU3A 2CLDX 3VHXA 4A0HA 2QMOA 3O8RA 5TB5A 2ZRFA 5LPNA 5EE9A 3R9WA 3C41J 4B2IA 3QUSA 3WYGA 2PBRA 4V0NA 4NCJA 3ZQ6A 2QAGA 4BASA 2H16A 2G83A 3EAQA 3DZDA 3MLEA 4KJZA 2CDNA 3V4RA 4LHWA 4A4DA 1XEWX 2IL1A 2REOA 2HJGA 3GEHA 1JNYA 5DGXA 3SBDA 1VG8A 4Q4HA 1AQUA 1SKQA 2F7SA 3CRW1 3QKRA 1KAGA 4BEBA 1KTVA 1NI3A 2DBYA 3C15C 2ZQ5A 1JXMA 2P3SA 2VO1A 2ZI7A 2RGGA 4V02A 5BXQC 3CRRA 5EZ5A 3NTUA 1UM8A 3L0IB 1P61B 4RD6A 2O8FB 2GVDC 3NBXX 4UKDA 4FN5A 2BMDA 1W5TA 4TL6A 4KYIB 3W6OA 4L9WA 1Z08A 2XITA 3TJZA 3VNVA 1AS0A 4D0NA 5DYGA 2VP2A 1P2VA 1IY1A 4DXAA 1G16A 4YONB 3K9LA 4DT1A 1SVMA 1W1WA 3X1WA 2WKRA 4NYIR 1EFRD 2KWIA 1RRPA 1G8FA 2D7CA 3GD7A 4BZXA 1KMHB 1DAIA 3TW4A 4AY2A 4F91B 3W90A 3ZZTA 3BFKA 1KI6B 3D7MA 4B35A 3LW8A 5JJKA 3ZZUA 1EESA 1OH5A 1E1RD 4DUGA 1P2TA 1VMAA 1NIPA 3ZVLA 1QF9A 2D2FA 4ITRC 5E3HA 1II8B 1UF9A 1ZMXA 3ICEA 2XNDA 4GBMA 1GIAA 4EUNA 3IEVA 3THXA 5JI2E 4IKEA 3OEED 2WPDA 3SFZA 2HXSA 5LD2C 4RFSA 2KBFA 4NHOA 2J0UA 5DE3A 5FPHA 3M4YA 3EASA 1KDPA 3EG5A 1KI4A 3LQRA 4HB0A 1WQ1R 2CLCX 1E9EA 1SXJC 3FTQA 3H2YA 1O87A 1KJYA 2ZRCA 4ACAA 4O0MA 5IT5A 2PL3A 4LHVA 4OL0A 3VAAA 1KSFX 1SULA 3A1SA 4ASUD 1N6OA 1R5BA 1SXJB 1TU4A 5GADl 1XPOA 1G3UA 3QVVA 1KNXA 5BYJA 1KI2A 1GVNB 3I4LA 4LJ8A 4TZ0A 4OQLA 2GKSA 3GQBA 4LGMA 1M34E 1T3HA 5JHHB 3VR5A 1DELA 1ZCAA 4CGZA 3CF6R 1BMFA 2IYSA 5JWRA 4MDFA 4WZBE 3K0SA 4A8JA 4TSFD 4EPWA 1ZP6A 4IJMA 2JLZA 2ZRJA 4M9ZA 4JBWA 3KXKA 2GCOB 3W5IA 621PA 2V7QA 2C03A 1NN3A 4FMCF 4IFEA 2BWJA 4L9SA 4P4UA 1UDXA 4F7WA 1YQTA 4JVSB 4M9XA 1NVVR 4W7SA 3I92A 1CKEA 4PAOA 5FPKA 1II9A 2A5JA 1FP7A 3EWSA 4ZI2A 1ZD1A 4JLNA 3THWA 3QOFA 3PUZA 1HA3A 3FHTA 1A2BA 1DO0A 5M04A 3U44A 1I2DA 2FNAA 4YLGA 1J70A 3C8UA 3P4XA 4US0R 1N6LA 4A0FA 4B2LA 4A82A 2OM2A 3VR2A 4HUTA 2O0KA 2O8CB 1AZSC 1YKSA 2H7VA 2YWFA 4KODA 2F1JA 2XJ4A 1AK2A 2ANBA 2KB0A 4URWR 3TAHA 2CK3D 4QL3A 3EIQA 3QEJA 3K70C 2AKYA 5JI3E 1LF5A 3PCRB 5F3WB 2MSCB 4PX9A 2CCGA 3A37A 3QG5A 3WY9A 3AKYA 4JLVA 3ZGXA 4KBGA 3VX4A 3K70B 1NBMA 3CONA 3DOFA 2XZLA 1IOZA 3T1QA 3VR3A 5FFMA 1OW3B 3CPHA 4TLBA 1XRJA 4H9GA 4IDPA 5BN3A 3FFBA 4HAXA 1PUJA 3ZJYA 1FQJA 1KKMA 2XXAA 3OAAA 1N5JA 3NDPA 1UPTA 2ZS7A 4IOLA 2WKQA 5TVKA 1UADA 2VQSA 4FXPA 4JLAA 3IPYA 2D62A 3VR6A 5EP4A 4GOJA 4F4JA 1P3JA 2A5DA 1M8PA 3BERA 5AUPB 3WBJA 4G3XA 1CJVC 2IUTA 3RANA 4NH0A 3THXB 2ZSEA 4UNPA 4LBWA 4F4IA 1ZVQA 1E1QA 1J90A 1E98A 3EARA 4HEJA 4XD7D 1RYHA 3UANA 5JS8A 3ZS8A 5J47A 3PITA 2J0UB 1E2HA 4ZKEA 2H18A 3KB2A 4OHYA 3L8YA 1R0ZA 4TL9A 1ZYUA 3N2EA 1TTTA 1WBBA 1DAGA 2Q3FA 1JECA 2GDJA 1S9HA 4A6XA 3P32A 2W00A 2N46A 2BMEA 4JZKA 4XTRA 2OBLA 2FZLA 2UZ3A 4ILEA 1XMIA 1W0KA 3JZMA 4RKEA 2MMGA 2XGJA 3SJAA 1E2GA 1LS6A 4RSGA 4TQUS 4LHZA 4HZIA 3QKTA 3I5XA 5DI9A 2ZI9A 1KDTA 2P0EA 3RS2A 1HT1E 5HR5A 3K0CC 1I4TD 2ERXA 2YINC 4M1TA 4NU0A 2JASA 2FSIA 1M7BA 2PMDA 5CK4A 4M1KA 2QORA 1AKEA 3BWDD 4CVNA 1YZLA 1AQYA 3LFUA 3CZQA 3RWOA 3KXLA 3Q5DA 5DN6A 1WA5A 1XF9A 2A5FA 4LBZA 4W9MC 2QTFA 2ZYVX 4BFVA 5EE3A 1JAIA 1D2EA 1W2HA 1KI3A 1ZINA 2PH1A 2ZR9A 4MYHA 3MCAA 5CK5A 3U44B 1NF3A 1XDBA 1ZJ6A 1Z3IX 2BKUA 2C9CA 4UXIA 5DI3A 5FBWB 4Y0VA 2B21A 2JATA 2WICA 2QT1A 5FH9A 5IF9A 2ZRHA 1W36D 2DFNA 3QBTA 1XFAA 1ZC4A 3DL0A 3M0EA 2ZROA 4N3NA 3F8TA 3QF4A 3K8YA 1A82A 3UWOA 4GDFA 5G41A 1MABB 1P9RA 1IN5A 1E2KA 3B9PA 2FDCA 1LVGA 4G5GA 4LYFA 2Z83A 4XTCS 4Q7JB 1S96A 5L3RA 2JEOA 3C16C 2CVHA 5FTNA 2YYZA 3LDAA 1X3SA 2OUKA 3I61A 1T4GA 2YNMA 1DAEA 5H1YA 1OFUX 2WJVA 1CRPA 2KJQA 4PHFA 4OK6A 3R8CA 5CITA 1E9SA 1CR1A 4EPVA 8OHMA 2FJUA 1W5SA 5L3QA 1T5LA 1YR9A 1U0HC 2WHXA 1WMSA 1H8EA 1NKSA 2Q3MA 4Z8YA 2GCPA 2J0SA 4DCUA 5TMPA 1Z6AA 4JLMA 2A30A 3ZVMA 1X1RA 1E2QA 4E03A 5LBIA 2QBYA 4HAWA 1RZ3A 3ZH9B 2O8BA 1R2QA 5FUXA 2NQ2C 1H8HD 3W5JA 3KL4A 4PSAA 2ZPTX 4DLZA 4JVLA 1GFIA 3PUYA 1JPJA 5TY0A 3MGCA 4NTZA 3E5HA 4IDHA 4MYCA 5G40A 2Q9BA 3GFPA 3I5YA 2FOLA 1Y63A 4AWXA 2K5UA 1E2PA 2W83A 2AX4A 4YMWA 2RHDA 4IXMA 1RJ9A 4M2LA 1K8RA 1Z0AA 1OJLA 3UK6A 1ZM3A 1N6IA 1UAAA 4B48A 1G5TA 4QOSA 4PFSA 1OLOA 4KYUA 5H8WA 4DHEA 3BGWA 3D8BA 4LJ7A 4MRRA 1XCPA 4X8LA 4WIAA 3PENA 4BLPA 5EXTA 1NN1A 2X2FA 4URVR 2YC2C 4PO8A 3GP8A 2VLIA 3NG1A 1KI9A 1XTIA 4BFYA 1G8HA 4GNKA 2XJ9A 2G77B 5DYIA 1VG0B 1JEEA 2QMUA 2SHKA 1KK1A 1R4AA 3UXMA 4DCVA 1D2NA 3AEZA 1FP6A 3EA0A 4UJ5A 2X8AA 4OQMA 1Z63A 1YVDA 2NO7A 2BCGY 2W2VA 2WMNB 3LH5A 4QKQA 3NHBA 4DCTA 4Q1DA 3HWSA 3GJ7A 3HYRA 4QHTA 2J7PD 1IY2A 3KTAB 4LDJA 4AKIA 1M7GA 5FL7D 1U90A 4PPFA 1S0UA 2IT1A 3RS3A 4HLUC 3IQWA 3NKVA 3MD0A 1JXOA 1KY2A 4WW0A 1W4BA 1X86B 4LI0A 5BQ5A 5KNCA 2IF2A 4FWTA 2RKOA 3DDCA 1ZD8A 3C14C 3HJNA 1XCGB 2H1LA 1OH7A 3PVSA 2B7BA 1FX0B 2WBLC 5DLQC 2O8EA 2GEVA 1IN8A 5J4VA 4U00A 1GNRA 3K09A 3RRZA 1DVRA 1VECA 2X19A 2AK3A 3T06B 1R8QA 2J87A 2BJWA 5FTMA 2VBCA 4AG5A 2QPOA 4Q18A 1EFRA 2PJZA 2PJRA 2XB2A 3FYHA 4O2RA 2YWGA 2CHGA 2ORWA 4GPTA 2GA8A 2IYRA 3L8ZA 3WRYC 2BHRA 1GNPA 1OFHA 1BH2A 4TLAA 5JWHA 4BE7B 5CIWA 1E1RA 1Z6TA 4C0SA 4D80A 1G3IA 3PR1A 3SJZA 3E2IA 3X1YA 1Q1ZA 1DG3A 1Q44A 1U8ZA 4GP6A 4D4LA 3QF4B 3CM0A 2ZE8A 1B23P 1VHTA 4PO1A 4OI2A 2ZYTX 3HYTA 3LW7A 3OEEA 4DCNA 2I1QA 2NTYC 4C4PA 3VKWA 1L8QA 3BH6A 4GRAA 3M6AA 3X1ZA 1L4UA 4NKRA 3U7HB 1LW7A 2LKDA 3GLIE 3SI7A 1UKEA 2EWVA 1OKKD 1ETUA 1TADA 4BEJA 1CU1A 2ERYA 4KBFA 1E3MA 1AA9A 3Q5EA 4BUJA 1JR3D 1IJFA 2D3WA 2QUZA 5CM8B 3RDPA 5K8TA 5L3QB 5AK0A 4URUR 4EQ6A 3IIKA 1CR2A 3W3AA 2X2EA 3T1VA 2O5VA 4WA7A 1CULC 3ADCA 2GZAA 4Q1CA 4DLSA 4ASUA 1TAGA 5CB6A 5LB4A 2GAAA 3QPWA 4B47A 4A36A 2GJAA 6Q21A 4RCYA 2C78A 2QE7D 3UG6A 4BFZA 2QA5A 1UBGA 2BOVA 2DPXA 1M1YE 4TSFA 2VHUA 4XH9B 3TR5A 2IS1A 4LUCA 1YJ5A 2J0QA 1W49A 4Q66C 2ZRMA 4YDHB 1RC8A 3REGA 1F2TA 1T8UA 1UKZA 1Z28A 2H57A 3Q7QA 4ZDIA 1AZTA 5JRJA 2R2AA 2FZ4A 3MJHA 3TSOA 821PA 4P33A 3N70A 3TUZC 2VTKA 4B76A 4B3FX 2R8RA 4Q4JA 2Z5FA 4GL2A 1NSFA 1P73A 1P2SA 4WOPA 4V0MA 3AF4A 3U5ZB 2H17A 2WWHA 4W5WA 4A2WA 1US8B 1GRQA 1Z2CA 3GLIA 2QRZA 2DFKB 4HUQB 1IN7A 2V8OA 4QGFA 2J7KA 1ZM2A 2HJVA 5IDVA 4A9AA 4CEIA 1ZU5A 1R7RA 2NO1A 3BE4A 1HT2E 2UKDA 2OLJA 4C30A 3ZQJA 2FEOA 4IDQA 1TF2A 3T5DA 3BORA 1XJQA 3O8BA 5K8UA 2RGNC 3T61A 2QT0A 1COWD 3KUCA 1TEXA 1ZUNB 2NO9A 5KO2A 4XIGS 3TW8B 2CK3A 5SZHB 1G3QA 2VEDA 4BLOA 4MYUA 5EP2A 5DSZA 4CIDA 1GILA 1Z0JA 1SQ5A 1AKYA 4JLPA 4P4SB 1T91A 4TL7A 4PXAA 4RD3A 1OXXK 2B7CA 2QROA 2RGEA 2Y8EA 4KLZA 1TQ6A 1VDZA 5KPJA 2FFQA 2WV9A 4KLNA 2B6HA 1EG7A 3WHLA 3W8RA 3TUIC 2VHTA 2HDNB 3GPLA 2WJGA 1VCIA 4RD4A 4XSGA 1ZAKA 2ZRGA 4D4JA 2GZDA 2E87A 2ZS8A 4TLDA 1XD8A 3T12A 1G17A 1MOZA 2HUPA 2NPIA 1JB1A 4XWAA 4YMUA 1U98A 2YV5A 1G4AE 1G8PA 1KO5A 3FWYA 4JL6A 1KI8A 3B1XA 3GLFE 3VFDA 2GK7A 2BV3A 1IHUA 4MH0R 4B73A 2BMFA 3EZ7A 4KFRA 2ZS9A 1DBSA 1XEXB 3RRNA 1KO1A 3DZ8A 1NMZA 2G0NA 4XD7A 421PA 1W7AA 4GFDA 2ZYUX 3A58B 3LVQE 3MFYA 2NIPA 1E0JA 3I62A 5TV2A 1YZQA 2GBLC 2PCLA 4M53A 4D4KA 4CW7A 4BZQA 3QENA 2IYVA 2VP4A 5FPSA 4AYWA 1YHNA 4MKIA 3WYFA 4BFXA 1GKIA 4Q7MB 4A0RA 2EFGA 3VTKA 4BFUA 1CEEA 4EQ6B 2JLWA 4AC9A 4D2IA 3UKDA 1FPMA 1XEWY 4A92A 3U6KA 2BIFA 4HB4A 2AKAB 3QKUA 2GXAA 4WBSA 1G1MA 4HLDA 3MWLA 2AD5A 2MSEB 1C9KA 3B8HA 1NG9A 2FGJA 1W2GA 5F2EA 1KY3A 1NN5A 1E2EA 1G19A 3VX3A 1K6MA 3OESA 4DEYA 1HE1C 3TSWA 2DWQA 3U7GA 3QQ5A 1X1SA 1XB2A 4QJ3A 1FW6A 2ZSBA 1KDRA 2D4HA 2JLRA 1FMLA 4Q01A 1ZM4A 4V03A 4K8OA 5AJZA 1NNEA 4QFMA 4XWKA 1E32A 1WE2A 4GMXA 3QKSA 1E2MA 4OJQA 3DVLA 3DO6A 4QC2A 4LPSA 3GLFA 3FFAA 2JAQA 1YZKA 1HURA 2GJKA 5HE9A 1CLUA 2F3TA 4JSTA 4KSCA 2CNWD 1E69A 4M1YA 1G5PA 1U0JA 4JVMA 4A2PA 3T35A 3R20A 1UBFA 3BB1A 5JWOA 4EPRA 2WWGA 3LX8A 4L5BA 4A6PA 1P4SA 2N42A 3A1WA 3GLIB 3ECCA 3GLHB 2V1UA 2FA9A 2J46A 3BAFA 2WWIA 2DHRA 4C0BA 3K9GA 1CJMA 4M1MA 2JJ1D 2ZJOA 2ODWA 1R5OA 2GCNA 4DBLC 2VA8A 1GG2A 1QZXA 1W48A 2F43B 4JBYA 4RY2A 5KPDA 3AVWA 4NYMQ 4P31A 1P9NA 2OO7A 4U7DA 3KKOA 1TQ4A 5CJPA 1KO4A 3EIHA 3FMPB 4FMCB 2IXGA 3GJ8A 2A3RA 3F5FA 2PEYA 3G5UA 2ZITA 4GOXA 2C9OA 4LBYA 3ZVRA 5A5GA 1EWRA 4OQNA 1ZU4A 4XOIA 3AKCA 3O47A 3THOA 5C4MA 3KQKA 4CEJA 1TNDA 3L0OA 2IEZA 1L2TA 3TQFA 3CX7A 1DAFA 5IRCD 2QU8A 4PPGA 3VKHA 2IK8A 3NH6A 1A2KC 1LS1A 3H0KA 3J81k 2I3BA 2ZYWX 1LFDB 1G20E 2X1VA 3AVPA 1UBEA 1H8HA 1N6KA 2JA1A 3ZYCA 5FUWA 1TEVA 2WJYA 5J5CA 2ECKA 4QJ5A 2IWRA 5L3SA 3GJ0A 5EP1A 4Q1AA 5P21A 4LYJA 4II7A 3L0SA 1GM5A 1ZIOA 1CJKC 3Q85A 3W9YA 1KK0A 1N6PA 2OLKA 4ZO4A 5EP3A 2ZRKA 3FVQA 3LY5A 3GFOA 3WP1B 4U5XA 5LB2A 3IPXA 3VR4A 3AV0B 3IDQA 4JMPA 5CYOA 4M9SA 1E0SA 2YVUA 1E4VA 5EE0A 3BBPA 1VHLA 3QXXA 2HLDD 4LPKA 1D6JA 3H4MA 1HQCA 4HZUA 4QBIA 3X1XA 2QI9C 4G01B 1WDTA 2VP0A 2AXPA 4EAQA 3AP1A 3UMFA 2BKEA 1E9CA 2OXCA 4MKHA 1ONBA 221PA 5GJWC 3SEAA 4Q4AA 4US2R 4LC1A 1G8GA 2AD1A 1UKYA 3LWNA 4MUBA 4QGGA 1V43A 1NL3A 1Z29A 5FI1B 3THYA 4YDSA 2OG2A 4AG6A 4FD2A 3EX7C 1W4RA 2WWYA 2J7PA 2OBMA 1GL7A 1R10A 3KJEA 1DEKA 2O0JA 4GMDA 5C2JB 5LDDC 4TMKA 5FL7A 2HEIA 2EFEB 3CF0A 1NBME 4IXNA 4LHXA 4MUAA 3I72A 3OE7D 4B3BA 4LJAA 2G1JA 3LBIA 3R7WB 1OFIA 4IEEA 4B32A 1G291 3NBZC 4BFWA 2CCKA 2ONKA 3SHWA 2FX3A 3VMFA 1WBDA 2QAGC 3GLFB 4KITB 5E7IA 4NCHA 3B1VA 5TDHA 2YOFA 4UXJA 3AUXA 1JR6A 5HCNA 3GLGA 1PV4A 4IOJA 2QAGB 4ZKDA 2G0TA 1KSJA 2VL7A 2VH5R 2FWRA 4Q1EA 2PZFA 1KSGA 5KDOA 3QBVA 1X8LA 3FPAA 4JSYA 2RCNA 3DM9B 3WYAA 3Q3JB 5EE1A 4Q4HB 2GXSA 2NOAA 3L82B 3QKRB 2A9KA 1R5NA 3B13B 4JLKA 5KU1A 4M1OA 4ESHA 4F38A 2JLYA 4B44A 4C0AC 1LF0A 4Q9IA 3U60B 4Y0AA 5E4FA 1E4YA 2QZ4A 1OKKA 2BM1A 4OQFA 1KSHA 2ORVA 5E7MA 3T1OA 1JR3A 2P6UA 2QM8A 4XSHA 5E7JA 2CMKA 2XX3A 5AJYA 2GHIA 3RLFA 4B75A 5AUNB 3G82C 4HDOB 4KO8A 5JLJA 4DT1B 4Z1MD 4NYMR 4QHYA 3HU1A 2DB3A 1LB1B 1E2JA 1Z22A 2FSGA 2ZANA 5EUQB 3RS5A 4CEJB 1KJZA 2IEYA 4TQ9A 3KFXA 2B8TA 4DLUA 2JJ2D 3CRVA 1XZPA 1VYUA 5B30A 1E94E 2IUUA 4DRZA 2EFHB 2J9RA 2GTPA 2CCJA 1G7TA 3SNHA 2NZ8A 2WMOB 3K53A 2QE7A 3E70C 3O8DA 3CF2A 5AJWA 5CIQA 5L3SB 1SVOA 1XD2A 3DPUA 4DDTA 1HE8B 4R2HA 3ZS9A 5DIFA 4LV5B 2IYQA 4RCZA 3AF0A 4JT4A 5JS7A 2ZJZA 2QRNA 3UPUA 4DLRA 2BBTA 1NVUQ 3CZPA 4UNNA 4BWYA 2XZPA 1UDWA 3BRWD 4OYHA 4LJ5A 3K0AA 1G8YA 1GKYA 4RFSB 2DCUA 4TYQA 2FPMA 2F9LA 1XD9A 3ETLA 2ZUDA 4RFVA 2C2HA 2QGNA 3RSLA 5DO9A 4DCSA 4MRPA 1OIVA 4HZUB 3CO5A 3LD9A 2OZEA 2RHMA 5B57C 4G5SA 2ZM5A 2J3EA 2NGRA 3EPLA 3U61B 3ZD6A 1S1MA 5FBLB 4RZ2A 2GXQA 5JEEA 4O3MA 4AURA 4C7OA 4A8JC 2ZRDA 1OPXA 2AFHE 2JDID 4DDUA 1CRQA 3NXSA 1NP6A 4FI3C 3L43A 1AJEA 4L8GA 3THYB 3NDBB 3CR8A 3G0HA 4G5OA 4CT4B 4PZZA 1XTKA 2A2ZA 5FPYA 1COWA 2V6JA 4A8JB 1S4QA 3BXZA 4KHZA 3IEUA 4Q21A 2D74A 3AGQA 2KI5A 1SVWA 1XTJA 1G6HA 2ZUCA 3LXXA 4IEIA 3TSZA 4AIIA 4FW9A 2XTMA 1SXJD 1YR7A 1Z8FA 4YMVA 4ZCMA 2IHBA 4TMWA 1SVKA 3NWJA 2AK2A 3RRYA 4OHVA 3B78A 2DR3A 4PC3A 1OH8A 3D6TB 1OFTA 3TRFA 1I4DD 1RKBA 3PJRA 3THWB 4OQXA 2J41A 3B7GA 1GDDA 1L7VC 1FNNA 4Z54A 3X1DA 3T1TA 3EC2A 3GCGA 1TQDA 3DM5A 1KI7A 5DNYB 4B6FA 5HZKA 3RC8A 2Q6TA 1F48A 1NVWQ 2YC4C 4BFTA 1D9XA 3U3OA 5EZ6B 3B1WA 4IVRA 3RSOA 4B3GA 4Q00A 4P32A 4PQRA 2OHFA 4V0KA 4PTLA 1XX6A 2N1BA 1C4OA 2CJWA 3X2SA 1OXSC 4DC9A 2OCAA 3B82A 1Z47A 2C9YA 1E2IA 2WJJA 5CLLA 2PT5A 2L0XA 2JLQA 2OEPA 4TYWA 2ZJ8A 1RW4A 3EIEA 1ZNXA 4QM6A 4NBSA 2ZETA 3L2OB 3E1SA 4I1VA 2EFDB 4RZXA 4PANA 2IA5A 4BRUA 3W8NA 3FMIA 4HB3A 2MSDB 2ZE5A 3OF5A 2QSYA 4FMBB 1FFHA 1GOTA 3LRPA 4LBVA 2FF7A 2ZJAA 3IIMA 3KQLA 4FCWA 4B71A 1H65A 3OIVA 3CUEF 4XJXA 2VF8A 2XXAB 1IM2A 5HKKD 3B6EA 4ZCLA 3AVVA 2QQEA 1HEIA 4Q1FA 4Q9LA 3EZ2A 3AGPA 1A5TA 3AP3A 3KKPA 2ANCA 2WAYA 4KAXA 3I32A 1EK0A 1XD2B 1HH4A 2YKGA 1JBKA 5BN5A 2BEJA 4PQYA 2XAUA 1W4CA 3K70D 3TVTA 2IF0A 1TF5A 4EDHA 4DSNA 2HF9A 4BFSA 1YRAA 3CWZA 3V9PA 3BIFA 3GJ5A 3NBFA 3MWJA 3SJBA 3SN6A 3VKGA 1CXZA 3SE0A 2GAOA 5C4GB 1JI0A 5JFGA 2FMXA 2IYTA 4CT5A 1MT0A 4B74A 4Z51A 4D6PA 4G0NA 4DLVA 1G18A 4C3ZA 1CR0A 4IW3B 1XMJA 4LZZA 4BLQA 4DB2A 3EC1A 1W0JD 2C5LA 3WXMA 1F2UA 5JEDA 2CNWA 4TMTA 2IYLD 4EJSA 2O8DA 4I1SA 1CJUC 2C95A 1NIJA 3TAUA 5GVRA 1U2RA 5BWMA 1N5KA 1TPZA 2KSQA 3EW9A 3OZXA 1K5DA 2CL7X 2WVJA 2LKCA 3P26A 5IK2D 4C7OB 1GL6A 2ZSFA 4YC7A 2YWHA 2JJ1A 3NEYA 1ZC3A 1JJVA 2QQ0A 2RMKA 5ANRB 3FKQA 1U99A 1ZCBA 1MR3F 4FWIB 1M6NA 1LV7A 3AVTA 3B1ZA 1EXMA 2OXRA 2OBNA 4JJZA 4PC7A 1GITA 1WCV1 1LTQA 1Z83A 1NG1A 1MV5A 4DDVA 3R8FA 1QDEA 3CKLA 5HTKA 1NN0A 3EPJA 1HTWA 4ARZA 5AR1A 2OE2A 2YOHA 1DS6A 1BYIA 1SKYE 2VHCA 4LJ4A 4RD2A 3K0FA 3UG7A 1OSNA 4M8NE 1ZNWA 4C0QC 2IYXA 3K1JA 5KSPA 4I4LA 4E5UA 5FBRB 1E2DA 1D8TA 3CNOA 2C98A 1OXUA 3LVRE 4W5JA 3TIFA 1GSIA 3BOSA 4ZIRA 3I1FA 4URZR 4FMDF 4LRWA 3U7FB 5DI3B 2RGXA 2KE5A 1G7RA 4I1UA 2BMJA 2NG1A 4HLCA 2D2EA 3PV0A 3QVUA 5FBQB 5KSOA 4TLEA 4BGDA 2ZRAA 2RGBA 2QTHA 2R6AA 5FUYA 3SS8A 3Q8XB 5DHFA 1OF1A 4V0ME 3EPKA 2F55A 2QP9X 1U9IA 2ZJYA 1Z0DA 4JL5A 2Z4SA 1PLKA 3NHAA 1Z5ZA 1RE0A 5SZIA 4QGAA 2PMKA 3AM1A 1CBUA 3R9IA 2CL0X 2WJHA 3QXHA 1G7CA 2P6RA 3LBHA 4R2IA 2HLDA 4LX0A 4HATA 3FKSD 5G53C 1AIPA 2QG6A 4UJ3A 1BO6A 2HCBA 4X8OA 4ACBA 5AUOB 2W6ID 5DHAA 4L15A 5D3QA 1KK3A 2WWXA 4M1WA 2P6NA 1JPNA 3P1JA 4JYCA 5JSZA 2FU5C 2QBYB 2E1RA 3PUVA 2O8BB 3K9HA 1E0AA 721PA 1GWNA 3MMPA 2YJTD 1D2MA 1CIPA 4A0GA 4D25A 5F9HA 3FOZA 5EJEA 1DE0A 2IHYA 1E0KA 3GMTA 2GETA 4PPQA 5FTLA 3MRSA 1I2MA 3QEOA 2XB4A 1RJ9B 3T5GA 2VPPA 5J4HA 3AF1A 3OE7A 3QI2A 4NYJQ 4Q19A 5GJVC 3S1AA 3WMGA 4PAQA 5HZHA 1GRRA 2ODBA 3SYLA 4LV8B 4MDEA 1QHHA 4JLBA 1GNQA 4LJ9A 4QJ4A 4TMZA 3KQUA 4AI6A 3A6PC 2EW1A 1N0VC 2GWHA 3IUYA 4MQBA 5KYKA 2C96A 5C1BA 3IBGA 2R6CA 3SHFA 1SVIA 1ESMA 1E9FA 4DLTA 2O8DB 1GUAA 4RVCA 2B8WA 4NP6A 1XNJA 1HQYE 2F1RA 3BS4A 4YMSA 3VU9A 1MO5A 2J45A 3WNDA 1VYTA 2AWNA 1OHHD 4Q7LA 3IBYA 1NKTA 1Q21A 2Z6VA 4TYNA 2QPTA 4ON9A 2RAPA 2H92A 4PSVA 2IW3A 4PHGA 3A8TA 4R98A 2A78A 5KSYA 1DAHA 2CE7A 1CR4A 2OAP1 2ATXA 1IONA 1UKVY 2CEAA 2BJVA 3QG1A 3OFND 4OK3A 4C9BA 3K09C 1G9XA 1XTQA 5FOUA 4M22A 1E9BA 1J8MF 1IXZA 4MYTA 1W0KD 1TUEA 2WSSD 3QY0A 4DIEA 5KSZA 4IOKA 3ZIAD 1OIWA 4FINA 2O8EB 2FSFA 1NMXA 2NPFA 4EFNA 1AN0A 1CTQA 2OV2A 2V1XA 2PX3A 4JKYA 5EUMA 4Z1MA 3ADBA 4D0LB 4QGHA 1S2MA 4B43A 2XNSA 3CWQA 4DLYA 2P5TB 2CXXA 1LY1A 1WF3A 3KX2A 3U3MA 1EFUA 2ATVA 4ZIRB 2D06A 5FTJA 1EX6A 3WRXC 1KHTA 1ZBDA 5AUQA 4A15A 1FUUA 3WMEA 2EWWA 2J59A 1PVOA 3FDIA 1E99A 3QXCA 1TL7C 1T3SA 1Z0KA 2C77A 3LLMA 1E9DA 4OK5A 4P4TA 4R71A 1E2NA 2NO0A 2WIBA 5JECA 3RABA 1A7JA 3CNNA 1NLFA 3B9QA 1PLJA 1IXSB 3U7EB 2Q21A 1KMHA 1VCMA 4DSTA 1MH1A 3L0PA 4LJ6A 3RAPR 1SHZA 2I1VB 3ASZA 1KI6A 1OYYA 1N25A 3IQXA 4BLSA 4EPYA 4IVPA 3ICQB 3KFVA 4NPHA 1OXTA 1UEIA 3MWKA 4EPTA 1II8A 5JMTA 1ZIPA 3B1YA 3FHOA 4D0GA 4LYHA 1FMJA 4PC2A 1F3OA 3REFA 2F1IA 3GJXC 1PUIA 1XTSA 5J40A 1P60A 1C1YA 4DZZA 2PLRA 4MKGA 4NONA 4C0LA 3Q7PA 2OCPA 4B6EA 5JSZB 1SKYB 2JDIA 2R6FA 1VYVA 3CB4A 4NE2A 4K46A 3AP2A 4BRWA 4I1OA 3TMKA 3SOPA 3AVUA 5J4KA 1S8FA 2WIAA 3BB4A 2ZJ5A 1AS2A 1YR8A 3GJ6A 3IIJA 4HB2A 3BC1A 2IC5A 5EXXA 1G3RA 3CNLA 4G5QA 1YZNA 2AXNA 2OT3B 3AKEA 3JVUA 4PC6A 4UXHA 3C7KA 4Q02A 4R7ZA 4RD1A 4YXWD 4GZLA 3QE0A 1X8KA 5G3YA 1Q1BA 5JCPA 1N5LA 1SXJA 4I81A 1F2TB 4KFTA 1VG1A 4N0EA 4ZV4A 2QEQA 4DLWA 3FMFA 3A1VA 1J8YF 1G41A 1KI1A 3H86A 1E79D 4Q4JB 5GVSA 2RB4A 4WAUA 1N2CE 1A1VA 1QHSA 5HCIA 4NYJR 4TTPA 1UBCA 5KUTA 3CIOA 2UVQA 2WSMA 3T15A 2F9MA 1ELOA 4TT3D 2RH5A 4CEIB 2GXUA 3KDSE 4OBEA 1R0WA 2IBMA 1G21E 4GT1A 2HV8A 1KMQA 1FTNA 2F1HA 2XSZD 5C18A 1KZGB 1KZ7B 4HDQB 2JIZD 1W47A 3U4QA 5L3VA 1T0JB 3OEHD 5JRZA 2HYIC 2OSBA 3ZD7A 1OH6A 1U94A 4B3DA 5KNDA 3UMSA 3AVOA 4TYPA 4URYR 1CS4C 1XZQA 3NIBA 4G1UC 4JBXA 4CRWB 2RGDA 1KKLA 1Q12A 2XOKD 1P72A 2OESA 3HPQA 1N0WA 4PZLA 1V5WA 3OHMA 4JYBA 1MKYA 5CYPA 4D81A 5C46F 2O8CA 2GEDA 3H84A 3TLXA 1EWQA 4XVQA 5FOWA 4U02A 2F3RA 2NO6A 3IILA 1IXRC 3SU8A 4UNQA 3EWAA 3AVXA 1OIXA
chains in the Genus database with same CATH superfamily
4RKFA 3K2IA 1O6CA 1O94D 2E2WA 2NZVG 3R4VA 2IZ6A 4I9GA 4Z86A 1GV1A 1TM2A 4KQMA 4MW5A 5HKKA 4TN1A 1GUYA 2DHCA 3TTUA 2Q28A 1R0XA 1A1SA 1XRQA 2XF2A 3FYUC 3SZOA 5BVHB 3NAQA 2K2WA 3ER9A 5BUZA 4QEDA 3SSMA 2FG7C 2R9VA 4CMEC 2WJ6A 3OIYA 2FWNA 4GMGA 2ODEA 4HCJA 4U2CA 5DBHX 3VNBA 1XNQB 4HPJB 2VT7A 4EITA 1R6VA 5KYTA 4XIJA 2EF1A 3G3EA 1KPGA 2JHCA 3LCJA 2EYQA 4ZT3A 4JI6B 4OJYA 3ZXSA 3RRXA 3H6KA 4PG5A 1Q1EA 3LKDA 4V39A 3ROKA 1TM3E 2WVHA 3NLLA 1B0UA 4H3HB 4WT7A 2H9IA 3EVNA 3HSYA 5LSAA 1Q57A 2FEAA 2QLTA 5EMLA 3DE6X 3DZKA 3HR8A 3NKFA 4ALMA 4BV9A 3R3XA 2PJUA 5JSHA 2JGNA 4KXLA 3J80A 1IY0A 4ISCA 4H18A 5COAA 4AKHA 2DFDA 2EL9A 1GRNA 2UXCB 3IO5A 4P35A 3NT4A 2HNAA 4HC4A 4YAOA 2V55B 5FBZA 4ZICA 3ZV7A 1Y4AE 4AZSA 3NVDA 4RTNA 1NYLA 1XDGA 2IWHA 4CKZA 4PHHA 4AP5A 3IUSA 4B3HA 4K2HA 2PPVA 2Q8PA 1JG2A 4ZVRA 1U6IA 1W6RA 4R1QA 3AF3A 3RYFA 3J7AC 2I1LA 3LHFA 2AJDA 3O4FA 2FDXA 5IDWA 1HYBA 4O63O 3IIIA 1GZVA 1X42A 4AULA 3V1LA 2C8VA 4O29A 4KIFA 5BSHA 2UUAB 5GM2A 3BXPA 2RAFA 2JGIA 3FMOB 3PC7A 3R5TA 4NLLA 1EA7A 3L7LA 1T0BA 1NI4B 2RGRA 1JR3E 1UBNA 1JFSA 1G5FA 1SKUA 2Q2OA 1G7SA 1L5FA 2YN2A 4M0KA 3CG4A 3WBFA 1FRVA 3D8RA 1G5RA 1PNTA 1TCBA 1XL0A 1PX2A 1YAJA 1NBAA 1NMSA 2C92A 3O75A 4DV0B 1IN6A 3DP7A 2JLSA 1JT9A 4K2AA 4DG5A 5A2QA 3PEUA 6REQA 3NHUA 2CMHA 1IZ8A 3NDJA 3W5DA 1WO8A 3DEKA 1TJ5A 3FZQA 3PC6A 5FO1A 3VNUA 1NM5C 1YZUA 3GDGA 4D8UA 4RJTA 3AU8A 2DC1A 1Y4UA 5FOXA 3E22A 3ROZA 4A27A 4C2UA 4W4TA 3IR7A 2WZQA 4CHGA 1CF4A 1ZJ4A 2G9RA 1T1SA 1JIXA 1MLDA 4L0CA 1X7ZB 1Y1RA 7REQB 1M6YA 1TZKA 1WMDA 2JPDA 2VUTA 2ZUUA 3BMCA 2FFAA 1YULA 1HE3A 1KO7A 2AQIA 3CTPA 4N76A 2Q0HA 3N86A 2HPAA 1N2IA 1ADCA 2REBA 4LECA 5B12A 3PXCX 5HYVA 1OPRA 1GZ5A 1RM5A 1NLUA 3DKRA 1H66A 1SVLA 1T13A 2G17A 3NQ41 4R1OA 4CM7A 4E7OA 5FEUA 5KCZA 1ULZA 2EHJA 3DEIA 4OAPA 3LT0A 3BE8A 4PN3A 3BE5A 1O5TA 4FILA 4BPBA 3L7IA 3U4QB 1DFIA 2VYQA 1M2EA 1QBKC 4EGFA 5FUBA 4ZOLA 4B2YA 4F9GA 3N8KA 3QLTA 1Z5GA 4FYKA 1PUXA 2ID8A 3Q9UA 1QQ5A 1L7XA 4QHSA 3FCAA 2FJPA 1ARZA 1Z8NA 2A14A 2IP1A 1H1DA 2OCYC 3W6ZA 2W0MA 3L7NA 2R6HA 4D9FA 4IXTA 1TKBA 2FCAA 3ZR4B 1A7AA 3N6RA 2BGTA 2RIPA 3A04A 3HTXA 3RVMA 2VQDA 1JDTA 4PR0A 4HEA6 4BZPA 1GAWA 4KNWA 5E7QA 5LMCA 4B2PA 4YECA 4D82A 3IO3A 4IICA 5T3UA 4H16A 2CLOB 4JI7B 1JEJA 3T9CA 2ACVA 5KOIA 1R4ZA 4MR7B 2J0EA 4N48A 1OOEA 1USVA 4J1TA 4NDZA 5K5EA 1OILA 2FDRA 4UBOA 5I7FA 4ZVPA 4CI0B 2MYPA 1OE0A 5DOVA 3SDZA 5KU7A 1M34A 1L9XA 2L42A 1GV0A 3FYTA 4GKJB 4EI2A 3CVXA 2EKQA 1PBTA 1N2CB 1T8YA 3DL2A 3HCDA 4NK4A 1QG4A 4YDRA 4KR6A 1YRLA 2ZP1A 3E8XA 3JAKB 4TMVA 4INAA 4R8MA 2CLIB 1P7ZA 3HFJA 4XAQA 5EJ4A 1KRHA 4RTRA 1YQEA 4B5LA 2J3IA 2D1TA 2ZVPX 3HRHA 4HGQA 4LSZA 3BD9A 3T4PA 4PYIA 2VATA 4MITA 2GD1O 3BDIA 2MU1A 1JS1X 2J5RA 1DJLA 4XYBA 2B94A 2VZ0A 4KXFB 5GMOA 1N2HA 5T8KC 3UCFA 2FHPA 4R9RA 4ERXA 4EG1A 2Q5JA 1NFRA 2WOOA 2ZE6A 2XUGA 1K9VF 3AVQA 4TXNA 5F98A 4C6TA 3U17A 3QVSA 4JB8A 1SUBA 3B5JA 5DWVA 1EXWA 4IIFA 1QRAA 1KC3A 3DAPA 4YWJA 1CUZA 4DMFA 3WLHA 1QHEA 5HM8A 2XUKA 2H48A 5KDLA 3UKJA 1YQGA 1X70A 2GZMA 3KVNA 4MYDA 1CZLA 3LYHA 1KNQA 4ZHSA 3GFSA 4ZPXA 1J49A 3V7YA 1ACLA 1VPEA 4Q4AB 5L51A 1CRWG 1J0CA 1ZM7A 2HHLA 4RZHA 4HL6A 4B6GA 5DHUA 2ZSHA 5DGIA 5CB4F 1VA4A 4QTZA 3WGHA 3ORHA 3AETB 2C99A 3PRYA 5FR2A 5K8IA 1EHCA 3SBEA 2CXQA 3DLCA 3DKVA 4MV9A 2H0QA 1NMYA 2CNDA 1WMAA 1CJCA 3BH0A 2PNFA 4DQLA 4FIZA 1I94B 1TCCA 3F3KA 1GLVA 2HWXA 4PLZA 3OM8A 2VRCA 4O5OA 3SC2A 2YY5A 4HYTA 1ZICA 4HX2A 3VKVA 3W5UA 1DRKA 1Q74A 1QUFA 2ZRNA 3LT5A 3LVFO 1ZNYA 3I2JA 3PLNA 4Y1RA 3ZIDA 1ID1A 1P3Y1 3NATA 2VOEA 5LQUA 1MD9A 4UVIA 4YO7A 2C5AA 1CC1S 3SXUA 4BMZA 4LCEA 3CO0S 4M21A 3UUEA 1JU9A 3E53A 4KSBA 1Q2UA 4LY3A 2ZI5A 3NORA 4WLEA 3WK4A 1M0EA 4ENPA 3BMQA 5A3VA 1ISHA 3IKJA 4WZ6A 1SEVA 1HMPA 3TQIA 1TD1A 3C5CA 3QE4A 4JP8A 4PBRA 4ZD6A 3KTAA 3I8SA 1VQ1A 2XD4A 3GAAA 2E82A 4HQ6A 1YZFA 3PU6A 4G4GA 2Q5CA 1F4PA 5LLTA 1GDHA 2GK6A 2V7EA 2XYPA 2WB2A 1XEFA 4MAAA 1K7FB 5ISMA 3HB0A 3R44A 1W35A 2QVGA 2R8XA 2WIJA 4PX2A 4D8XA 4W8OA 4J2HA 4CM5A 2PM8A 1VKRA 4HFRA 4ACAA 1IJEA 4E3WA 1RLMA 2BR4A 1TW3A 1MBZA 2VIIA 2XA9A 4CCSA 2ZSDA 4D3ZA 4OHCA 3RODA 3UUFA 5IAJA 3WB9A 4ER3A 4F11A 2BZ0A 2J5XA 2NVWA 3BXGA 3Q8KA 2BC9A 2WSBA 5I8PA 1DG9A 2W2TA 3LYLA 3WDKA 2ZJ2A 3G13A 1DWPA 2F6RA 3EFOB 3FNEA 1KE2A 1W1IA 1TTQB 2OCLA 4HNVA 4UEJA 4ZWNA 3V7NA 4X61A 3CLVA 3PNPA 4ZREA 4DLXA 2FN3A 4NMLA 4D3SA 1PR5A 5HA5A 2BH9A 2P91A 4M46A 4U7TB 4D02A 2XCQA 1Y3IA 4EHIA 5JJKA 4N12A 5DTMA 4EO7A 1JDSA 3CNEA 1KJIA 3JD0A 3M5PA 3BVPA 5KTTA 4O4JF 3X1MA 3KJHA 4TLCA 3NEJA 3MGAA 4H1UA 3ZQKA 2VEOA 3QLEA 1D7AA 1ISRA 1VMDA 5KKAA 1FMFA 1IBRA 1H6AA 2BEVB 3KZ1E 3UQYS 4L7VA 4R1LA 1X74A 1PJQA 2GBFA 5G0UA 4ZVOA 5A5FA 4DC0A 1Z56C 3KT6A 4LJRA 3NHSA 3RS0A 1ULBA 2A57A 2X40A 1OGJA 1ZXLA 2P62A 2PCJA 4G56A 5PNTA 4DXHA 3UQZA 2JLXA 1TDJA 2ZEJA 4Q5IA 1SUAA 1IZZA 1FVHA 1TCVA 2QKYA 2PUAA 5GOTA 5KIAA 2Y9MB 3C3KA 3R0XA 1MZVA 2IYWA 1ODKA 1GPNA 1NXPA 3KAPA 5ECDA 4EPXA 1AKQA 2O50A 5A3QA 4JLJA 4CXMA 2X2OA 2Q5IA 1B73A 2A5YB 1JI3A 2Y1WA 3CT4A 3CR7A 1R0YA 4B8ZA 2GJ9A 1ODCA 1TVEA 2IUEA 1Y5NA 2HIGA 2PBLA 3K0AB 3ZDYB 2B3TA 3T99A 4TL8A 2BGGA 3OU6A 1X6VA 2NMVA 1Z5OA 3HWX1 4TWZA 2GA9A 2VWQA 1GL9B 4FBGA 2H1OA 3SZMA 4L9RA 1DXQA 3U16A 1IDN1 4F6CA 3A2KA 1LD3A 1QG2A 1R88A 1M75A 1Y8QA 4MAMA 3N87A 1ONOA 2CE2X 5C8XA 1T2UA 2G9ZA 3TTSA 2H51A 2OCBA 2W11A 4A1OA 5IHPA 1QZZA 3G7NA 4E5VA 2VTVA 3KKMA 3RVKA 1CUEA 1TOAA 1UC4B 5SZKB 3IHTA 4BNUA 3QF7A 4Z53A 2AN9A 4GW3A 2AG8A 1QVRA 4W5OA 1GZ6A 3VAZA 4QUKA 4CMAA 4O5AA 2UVPA 2F4NA 4URXR 3D5EA 3ZDFA 4DA9A 2H00A 3HY3A 1JEQA 3IFSA 1VE6A 3IA2A 1BFKA 3OEHA 4M0CA 4MLZA 4FCVA 2Q2WA 4O6VA 3ROPA 1R6BX 1NFFA 1US8A 4NZPA 2FGKA 4PNPA 4TMYA 1SXHA 3DFFA 3OEYA 4ZOAA 1XCMA 1U7HA 1RRCA 2PKCA 3IV9A 4O2AF 1O89A 2A88A 1V96A 1RQGA 4AD8A 4N0PA 1XN1A 2PQ6A 4BKUA 5FOSA 2V7VA 4PLPA 4JXZA 4HQKA 2EP5A 2J5KA 3VI3B 3LBFA 2V6IA 1TUIA 3DTVD 3P20A 5AW4A 1NPYA 1Q22A 4ZYYA 2ZAOA 1AKUA 3C6BA 4X91A 4ALKA 2LWIA 4H1VA 2O54A 3VV3A 1K8ZB 1OR8A 5HF8A 3AUAA 4AUEA 2BJHA 4MW1A 1BHJA 4KDFA 1EJ2A 2X5JO 4E1VA 4MUXA 2V7QD 1RVDA 4HI0E 2ATIA 3RUFA 1Z6GA 2RGNA 2X77A 4BUCA 5JCJA 5C4IA 2D0IA 5D5QA 1SZPA 4LYAA 5DX1A 4JT8A 2B1RA 2VDNB 2YVQA 1CNMA 3ZBUA 3E8MA 5E95A 5TSDA 1GPKA 1ISIA 1EFHA 3LO5A 4FOSA 5FIUA 1EE9A 4MULA 2MSWA 3C5HA 2PNJA 1MENA 3ONWA 2V4ZA 4PLWA 1VJGA 1PR0A 1Z2EA 1E1MA 3VPHA 1WTCA 2X3YA 3AVYA 2BDEA 2QN6A 2PKXA 4IIVA 1UBLS 5BOSA 4F4DA 1DIBA 1QCZA 4JEHA 4BQSA 1W5BA 3E4CA 3QJ5A 4AZ3B 4F3NA 4G1VA 5FYQA 1JSLA 1MB4A 1XK7A 2BMWA 2EJUA 2PWYA 4V0OA 4E14A 4EZEA 3V48A 1C0PA 2G82A 5JD4A 4I4TB 1NY5A 1TMKA 1G3MA 1BVRA 1AF4A 1E7MA 2EG9A 1LQ2A 4L4UA 2FFHA 3CSSA 1QYCA 1XEXA 3IHLA 4NX2A 4AL4A 3HP1A 1U0LA 1PFWA 5AOVA 1L0BA 5IUJC 2ZTSA 3IJRA 1VJ0A 3VUEA 4AW9A 2QZZA 4MNTA 3DV0A 1PR1A 1UMKA 3PHCA 1K75A 1SCUB 3HUUA 4QNMA 3W7VA 3UBMA 2A7QA 3FBWA 4FIDA 5EJIA 2WABA 3ES9A 5FO0A 2ZI4A 3UYLA 4CLRA 5K3OA 1TJYA 2QMYA 3SJCA 5JD5A 5F2KA 1JHMA 4IIHA 1UAYA 3SNKA 1YBVA 4MUNA 3SZRA 5C8YF 1MRSA 3RNLA 1G4UR 5J1TB 4BIIA 1XPRA 4CR6A 1RCFA 4RXTA 5GQSA 4B87A 4L6AA 1IAQA 1J7KA 1U3VA 4IL5A 3H6HA 1SM4A 3VR3D 3RVNA 1IQPA 1SA0A 3W6NA 3ZN2A 4EHLA 2QVBA 3W5VA 1Z6QA 2B69A 2VDWA 3CRQA 2OA0A 4B3XA 5F1PA 2GHRA 2Q3EA 1SCBA 5EMNA 1U0GA 3KTDA 4BO8A 4EJSC 1WDWB 3OAAD 3BCSA 4GI3A 4R16A 2ZAIA 5TPZD 5A1TA 3PEWA 3QE2A 1G9TA 3D1JA 4FN4A 2YZ7A 1D03A 1CQJA 2Y4OA 4EJFA 4TS4A 1O97D 2QR3A 3TX2A 1F2UB 1GNVA 1JEDA 1KOLA 2HU5A 4H4CA 4DB4A 4JI0B 1CIJA 3H4IA 3R0VA 2UVDA 4X6UA 3B85A 2XUQA 3HEBA 3ZBQA 1GP2A 2X0EA 4NHEA 3LUBA 2CNOA 5ESWA 2P3OA 3DZIA 4E13A 1PYDA 3CLUC 5TGZA 1WVIA 4M6WB 3V7FA 3U3KA 1QR6A 4O25A 2HPHA 1W44A 3KS9A 3DTTA 2B2NA 2RI6A 3CPEA 1PT8A 2EFCB 3LM8A 3RF6A 5LZ2A 4MUJA 1F5NA 4S1WA 2XDQA 4GRIA 4RM3A 4ZCQA 1PKXA 2BGMA 2QVYX 3OE1A 1IH8A 1IHDA 3MG9A 1WLYA 4BVKA 2B7LA 4L6IA 2PRIA 3AUYA 4WADA 3UWKA 1BSVA 4E11A 1X9IA 4BMSA 4EFLA 3MCZA 3MA0A 4KQ1A 1JQKA 2M98A 1Y1KE 3GLHA 4HTAA 5AT1A 3OCXA 4GU5A 4ARZB 2IYAA 4DSOA 4BJ6A 5EN4A 3ZDQA 5BVGA 5JBQA 3DEFA 4ZK6A 1LPOA 1QGOA 3C3DA 2QDXA 4BBJA 4XDHA 1CE8A 2B2CA 4YY3B 3QKIA 4BKMA 2EG5A 5CDFA 4F4UA 1T6NA 4R5MA 3U4HA 5KQSA 4RXMA 2BE7A 4BNKA 2AMLA 2CEKA 4FR5A 4RA9A 3DPSA 4BBAA 2JJ2A 2O8FA 2JGRA 3M70A 2C04A 2ZB7A 3OZDA 3VHRA 1A98A 1DWQA 2QLLA 1Q0SA 1UIRA 4JNKA 1MO6A 2XVZA 3M89A 4M3NA 4NYIQ 3NMUF 1EP2B 2LE0A 4FT4A 1N0UA 3SKVA 5HPYB 1TIPA 3HK2A 2OB2A 1KYIA 2P4HX 3WOVA 2XXBA 1H2EA 2FUG1 3RRMA 5AK3A 1ZD5A 5HKBA 1E1CA 3T9FA 1T5DX 2GH1A 1GGMA 3H1BA 3CVUA 4K9OA 3OMXA 3JASA 4MJLA 3TTYA 3EOBI 3H9EO 3ED5A 1R37A 3JQ6A 1JHPA 3LNCA 3EDRA 5JPDA 2DQZA 1TK2A 5JDCC 1KQOA 4BQRA 1BMDA 1A9TA 4TTRA 3NM6B 1QOPB 4YALA 1ZJYA 3R40A 4DIBA 2BEUB 2DECA 4CF7A 4UZEA 3S44A 1X77A 4RVGA 2QRMA 3X1JA 2DEUA 3K4PA 3EEFA 3FPCA 3NXKA 4NCIA 3L1UA 4L4XA 3E1KA 4Q9DA 2QAJA 3C3BA 3TZBA 4MV1A 2FW9A 4XDZA 4W5HA 4CQMD 2BM8A 4UQOA 2XYQA 4M1SA 2ZZMA 2H06A 3I73A 3K3PA 2GS9A 3Q41A 2BFBB 4XGRA 3AI1A 3QE3A 1VCNA 2O5CA 1PT9A 2FQXA 3WKDA 3ZK9A 1L5HA 1T0HB 1WPRA 1KS9A 2O7RA 2YRXA 5H02A 4FGSA 4I14A 2HEGA 3MJ4A 3SR3A 5LLDA 4AKGA 1PK9A 3EIUA 4E5KA 3N0RA 1LRLA 3M1IA 1E5XA 3QLVC 2YNMD 1Z18A 2EQAA 3HI4A 3OIWA 4MLDA 4RH1A 1JJ7A 4D26A 3ZCVA 1NVXQ 3RVOA 4KVGA 4N0QA 3HFGA 2QIOA 2GPSA 2GF0A 2HJRA 1NSTA 4IIBA 4ALJA 2VYVD 2BFPA 1CUAA 2Q2NA 3HDTA 1VBKA 3I9V1 3ZW8A 3CS3A 4AYXA 5A9RA 1QP7A 2ZB2A 1H8ED 2BCJQ 3B5IA 4HTFB 4YUWA 1TMOA 3CXUA 4OI1A 2KHZA 4S1VA 3TR0A 2G9NA 2WYVA 3TQOA 3AW8A 3DH0A 4G63A 3FD8A 4ZDWA 1PW7A 3NTOA 2DR0A 1Q20A 4RDXA 1Y3AA 4D9MA 1KBOA 1C3LA 1KETA 3FKJA 1T6BY 1MVNA 3U3DA 3EGEA 4NY1A 5C5DA 5AYVA 4YRAA 3BAZA 1J21A 1ISGA 1XAGA 3IL2A 4R1PA 2JAXA 3RYTC 4H7JA 1DAKA 1NVVQ 1RAAA 1Z4QA 3MBIA 2PK3A 4IDOA 3BRQA 3OOEA 1N1DA 1RZRD 5CB4A 2GCOA 2JH8A 4XFJA 5KYVA 1HDEA 4GL4A 1L5GB 3R7WA 5EGNA 1D1PA 3WGKA 3O92A 3VPGA 3AOEC 5IWCA 2OYCA 1OC2A 3QJYA 3ZEAA 3HN6A 1QBGA 2DTEA 2CLDX 3CRZA 3QVWA 4NJEA 3J7TA 3R3ZA 2FR8C 3ANYB 3O8RA 5TF0A 1KP2A 2IHNA 2XIJA 1QO9A 3FF4A 3LPCA 3DWFA 3QUSA 5ILGA 5D7BA 1RMQA 3LKBA 1DUVG 3JW8A 4M87A 4NCJA 4ZPJA 2G40A 2YY7A 4EL5A 2QAGA 2WF8A 4Y9UA 1KR2A 2EZUA 2Z2KA 1AF7A 2RAUA 4KJZA 5FWAA 1ZEJA 2CDNA 2PT6A 3K5PA 2I65A 3RIEA 4ZRDA 3BSFA 2Q6LA 3TW6A 4A4DA 1EXNA 2REOA 2HDWA 3ANXA 3GEHA 3NFYA 1HDOA 1M5TA 3UF0A 4XKJA 3SBDA 1CDOA 1VG8A 2BEWA 1IUNA 5BVGB 3CNQS 2F7SA 1UJBA 3FNRA 1KAGA 4FFLA 1KZHA 3QJGA 1C50A 1CE8B 1RDFA 4LZAA 3GVIA 2VO1A 2QN1A 1M72A 4UBMA 3LA8A 4AVYA 3CRRA 4LOJA 5EZ5A 1NF2A 3TZLA 4DLPA 4IF6A 3R5JA 4J49A 4RD6A 2O8FB 3NBXX 3USES 4FN5A 1YH3A 2EW8A 2P69A 2XQGA 4GX1A 4AJOA 1P2DA 4OMFG 1TM5E 2PANA 1OV6A 2OMEA 3PVCA 4L9WA 5EWMB 3L6DA 3CX3A 3G5MA 3W6OA 5CDHA 3P9IA 5E2BA 2ECOA 5HK9A 1E1CB 1P2VA 3JVIA 1QAOA 3QVTA 1G16A 4DXAA 1E92A 1XLWA 2Z8YA 4YONB 2HBYA 4R0VA 2FOXA 1SVMA 4CLDA 4ZVVA 4EUHA 1LSOA 2X0RA 3KR9A 4HS9A 1KJ8A 3ANMA 2WKRA 2HWWA 4KK3A 1HDIA 2HLHA 3DPIA 2ZAGA 2CFCA 4QOJA 3U1TA 2ZB4A 1SBHA 2BFDA 2XT6A 3GD7A 1T2CA 1U5AA 1MGOA 1YCDA 3M6WA 1H2YA 1KMHB 3DFZA 3Q1LA 3TW4A 3UT5B 1FFXB 2PUHA 3W90A 3H75A 3ZZTA 1KI6B 3UA4A 3NONA 3GNSA 1N7IA 3IMFA 3QTLA 2BGWA 1QDLB 3ZZUA 4UM5A 2DF8A 3W04A 4DUGA 3BGSA 1VMAA 1NIPA 2WPNA 4O4JA 2GPBA 4WV3A 4EA7A 1II8B 1VPDA 1UF9A 4X66B 3ICEA 2XNDA 4ZXPA 2P1ZA 4EUNA 1W88A 2JFNA 2C4VA 3MOSA 2ENWA 1KYQA 4ZVMA 3IH5A 3Q88A 3KQWA 5DU2A 4P8RA 3I0NA 3OEED 4BQFA 1MQ8B 1N1EA 2CUTA 1L9KA 4OGKA 1KVUA 1HDYA 2XMSA 1SIWA 2J0UA 3AUTA 4K6HA 5FPHA 2JHAA 3IDSA 3T5TA 4C01A 4PZUA 2HQ1A 2D1QA 4E88A 1GEEA 2C3PA 2Y0DA 2C2GA 4LOHA 3GEMA 3H6GA 2YDXA 4JBLA 1MIHA 3IPLA 3H2YA 1E3LA 2VI5A 1KJYA 1CVRA 2H29A 3BUSA 4JA0A 4BP3A 2RKBA 3AEUB 1CZRA 2PL3A 2H2WA 2UYQA 3W3AD 2GN9A 1VL1A 3GN1A 2RI0A 3GELA 4GEKA 4JLWA 3A1SA 3VAAA 2JAHA 3D4NA 4ZTBA 3T9DA 1K88A 3TSCA 3B89A 5DT9A 1Y5IA 4ASUD 5FTWA 4Q1VA 1TU4A 1G3UA 3QVVA 3RTGA 1BS2A 2RH4A 5HM6A 1IUOA 1H0SA 2FW0A 1GVNB 3B70A 4IJ5A 1E8DA 4WESA 3FUCA 3GQBA 2GO1A 1M34E 2FN9A 3JQAD 3VR5A 3O31A 1DELA 1ZCAA 1OWNA 3HXTA 4OTZA 2AE2A 2X42A 3ME5A 1RRMA 2I3AA 2N9UA 1RM4A 2BFCB 5K3CA 3WNVA 4A8JA 4QVIA 4QTYA 5JNLA 3G2NA 2X8LA 1JYEA 2X9LA 3OX2A 3KXKA 1H93A 2GCOB 3W5IA 2HJWA 3IQHX 3S0JA 2C03A 2EDAA 1O9HA 4FMCF 4R9SA 4L9SA 2H59A 4FHCA 3JYOA 3DKKA 2X15A 2XR1A 1L8LA 1QMGA 1S8NA 3IQFA 1GQRA 3HKBA 4U6NA 3UUGA 5LXTB 3I92A 4RHYA 1II9A 3JVEA 2P78A 4UMEA 1YDHA 3EXHB 2C5GA 4O2AA 4WBNF 2ESRA 3LIIA 4BZZA 4ZI2A 4N4AA 4CG0A 1JJAA 1ZH0A 3GP5A 4GPZA 4MQMA 5B36A 4DHWA 2NXWA 3FLMA 4IDEA 1CEYA 3FPFA 5M04A 2R7NA 1Z4IA 4ZOBA 4ECAA 1REQB 3GOHA 4P7FA 3LQ2A 4NMHA 3UJBA 3GHYA 4G4IA 3P4XA 4NR0A 4KQ9A 3FVRA 3GLRA 1TM1E 4A82A 2HMVA 3IAXA 5CB0A 1PK7A 1ZXBA 3C6KA 1V95A 2O8CB 3TL6A 4FBLA 1AZSC 2QY6A 5H82A 3EAGA 5CXXA 1QQTA 3HBLA 2GO7A 2XJ4A 3QI7A 2J07A 4B45A 2WYIA 1BCSB 2XEDA 1YUBA 5GGXA 2GUWA 4FDTA 3N0XA 3EVBA 4U7FA 1M1NB 1Y7TA 3OZCA 3EVDA 3O3OB 2XE6A 3PDHA 1ISJA 2NYRA 2RC5A 2RBKA 3IBTA 3K70C 1O8CA 5CAEA 5AXBA 2LIVA 3ZEIA 3JD4A 3AR3A 1YDMA 1XC7A 3A28A 4MS3B 2CCGA 3QG5A 2Q4DA 3EEIA 1JMVA 2IDKA 5CLJA 5B7GA 2QVCA 2WE8A 5ULLA 1WU8A 2PR7A 3AKYA 3K6KA 1TVMA 4JLVA 2HF2A 2AFVA 4KBGA 4URHA 2X0FA 3EEBA 1KBQA 3VX4A 4GVPA 1U63A 1V6AA 3D2LA 2IOQA 3DOFA 3GNQA 3T1QA 4KYTA 1BJKA 2VWPA 4LXGA 5KYYA 5IF3A 2IV3A 1OW3B 1BE6A 2BFDB 1ZL0A 1V8ZA 4F12A 4C05A 1L4FA 5BN3A 2NZXA 3D7RA 2QTGA 3EIXA 4OUDA 4MQ4A 1PUJA 3QFTA 4JEIA 1TJ4A 3BEOA 4EG5A 5CDYA 8ATCA 5JU6A 2XXAA 3GRVA 1FEZA 3II6X 2ZS7A 4PHCA 1WM1A 5CVUA 3A6ZA 1SB8A 2WKQA 2VQSA 4JLAA 4D4GA 1CY4A 2D62A 4GEGA 5EP4A 3MWEA 4KAJA 3AMVA 1M8PA 2FZ5A 1Q11A 4G3XA 4WLFA 4YRCA 2W6OA 3WBJA 2QGFA 4DA7A 2IUTA 4NH0A 1FFDA 3FLAA 4GLLA 3HFSA 5B4TA 1P0MA 1T0UA 2ODAA 3OU2A 1ZVQA 4LBWA 3FF1A 1E1QA 5HIJA 4F4IA 4NBTA 4WEQA 5CW1A 1DKPA 5C5EA 4W5QA 4C1BA 3AB7A 4XD7D 1RYHA 3O7WA 4CKCA 3D4BA 3N8DA 3PITA 2J0UB 1U0BB 1E2HA 5C8YA 2XUAA 3FJYA 4ZKEA 3AY7A 4EF5A 2R87A 2J6HA 3GPCA 3O8NA 1T4BA 3S2EA 1LPPA 4IS3A 3VO9A 1WBBA 1IQUA 1EEXB 1Q7GA 3BRCA 3N76A 4R01A 1JAYA 3MT7A 4BJHB 5HBRA 1S9HA 2ARKA 1UC8A 3F6EX 1MQSA 3DMRA 3L18A 2N46A 2ES4A 5EKXA 5U9CA 2BMEA 3VSEA 4E2YA 3B3JA 3HNOA 4ER6A 2UZ3A 4GI1A 4RVOA 1DKRA 1YMVA 3TPCA 3JZMA 3PYXA 5FLXA 2XGJA 4DUZB 1E2GA 1MXFA 2PH5A 2PL9A 2QF7A 4TQUS 4GBJA 4WESB 3GY0A 3T7CA 3MTJA 4IH9A 4B17A 4W7IA 1W73A 3WO1A 2PWAA 5E3IA 4UCQA 5DI9A 5ALEA 3CQ9A 3WRVA 2P2YA 5IM5A 5AESA 4BZWA 2I2AA 1NFQA 4YA6A 1HT1E 1JHXA 1RYEA 3I12A 3HBAA 3ISJA 5LQAA 2C29D 3H05A 2F8SA 2OPBA 4A5OA 3QELB 2CUZA 5DGCA 1Z6PA 3PI6A 3ZCUA 1C1XB 4H1HA 2QW0X 3LCVB 2QORA 1DWUA 1AKEA 2V5UA 5CMLA 1CB7A 4EMBA 3SXPA 1D1TA 1YZLA 3O8OB 1H9BA 2ISCA 3EGIA 3RWOA 3VI4B 1V8OA 1QRRA 2VK8A 1JG4A 4EI7A 1MZPA 2H85A 1ORRA 4WHMA 3R7FA 1WZNA 1WA5A 4MI6A 4UEQA 5F1KA 3JPYA 5EE3A 2HXGA 1JAIA 4O2AB 2CZQA 2JAWA 3UAWA 3KJNA 1D2EA 5ALKA 2I33A 1DUSA 1Z12A 2PXHA 2ZR9A 2ZTLA 3I4FA 4IGAA 5F7JA 4S24A 4C4RA 5KX5B 3C8ZA 4JA2A 1GZUA 2OHHA 1LK0A 2C2YA 2C9CA 4UXIA 5FBWB 4Q37A 4WDRA 2B21A 1FLNA 1KEVA 3B52X 1EGHA 4DA6A 3WL4A 4ALIA 2BONA 3MRVA 4J1TC 1B41A 4P7BA 4E32A 2ZROA 5B1YA 1EZZA 2HMYB 1JDZA 4AMUA 2XWSA 3K8YA 1A82A 3GFRA 4IHJB 3RLIA 3ZY2A 2VJLA 1SG0A 3CMCO 1RM3A 1MABB 1GGEA 2O6LA 1ZLXA 4XTCS 3QWAA 5F4BA 1ZR2A 3GIWA 4RULA 2PRSA 2JEOA 3F97A 5FTNA 2AFHA 2R7AA 2RB5A 1E6WA 1IDOA 3I61A 3AG6A 3IJPA 5H1YA 2WJVA 3NIDB 1CRPA 4PHFA 1N2OA 2RHCA 4I8DA 1E9SA 8OHMA 2DLNA 3BD6A 3CKMA 4BX3A 2FJUA 3ETNA 4EVIA 1W5SA 5L3QA 4ZZIA 1CF2O 3T3MB 3ZE6A 1SWWA 3GFBA 3MXTA 1EX9A 3OTHA 3P0FA 4PVCA 1NKSA 4JP3A 1EFVA 4IGIA 4Z8YA 3ZI7A 4Q4CA 1UBUS 2POQX 3FGZA 4DCUA 5J23A 1SRQA 2A30A 3ZVMA 1VZ2A 4Y9DA 1X1RA 4RC9A 3ZKWA 1PV2A 5BN3B 3ZH9B 2HWKA 4FEEA 1FLAA 1S8AA 2WWTA 5FUXA 1M5RA 4J7AA 2O2EA 3HY4A 3GUHA 3QX7A 1V45E 3SF8B 8AT1A 1GFIA 3PUYA 3VH4A 4YAUA 4JJ4A 1RJFA 4IDHA 3DVRX 3FTCA 3GFPA 4MKXA 4X7RA 1QRTA 3VJLA 2K5UA 3W5CA 1XYYA 1E2PA 1U8XX 2AMJA 2ZWPA 2VUSA 2MJLA 3DBRA 1EP9A 1O6ZA 2FSUA 5G0WA 2YFKA 1OJLA 3PNMA 2QX9A 4I9FA 5EIFA 3PDIA 3T7KA 3SWWA 3CZ4A 3A6HA 5JVDF 4QOSA 4YRLA 1OLOA 1C4KA 2YWJA 2VHWA 4KYUA 4OGFA 3BWCA 1J56A 3D8BA 3PWSA 4LJ7A 4MRRA 2FSPA 1FE8A 1D3AA 2V97A 4PYJA 1Y1TA 1EVLA 2EJCA 3JVDA 1SXGA 1K4MA 3KVYA 4JGBA 3OT5A 4K6OA 4N3CA 4NV1A 3WZ2A 4AY4A 1TZMA 2YC2C 4PO8A 5T6BA 2VLIA 4JQCA 5KJ6A 1CVIA 4UAJA 1Y7IA 2Q5QA 5FV7A 4FC7A 3RAGA 1LWOA 1VG0B 2OHXA 3CZ9A 2QM0A 2LRHA 2H54A 3FCEA 1CJSA 4MWTA 2NU9B 3A4YA 3R3YA 3X44A 1R4AA 2KPOA 4NNOA 3U49A 4QQ8A 5IKOA 3AL3A 4G6ZA 4RVUA 5WRFA 3EA0A 1B15A 4RS3A 2P9QA 2Z58A 3EMBA 4TPKA 4OQMA 4UJ5A 1YVDA 1VKHA 1GGVA 2NO7A 2QRPA 5KC8A 4QKQA 3CGGA 4IMPA 3P9XA 3EXFB 1USUA 4RHTA 4Q1DA 5EWLB 1QWSA 5BSUA 3Q8MA 2GSDA 4QHTA 5CIYA 1XU7A 4LDJA 4YQYA 3SZGA 1ZUNA 2H5IA 2CZCA 4ZAFA 5FA6A 1U90A 4ZCPA 2WF9A 3RUPA 2DUNA 5FWYA 1Z6ZA 2Q4BA 3IQWA 3F8SA 5KNCA 5CEEA 4OXKA 2ZZNA 1X86B 5AW0A 3KTFA 1O6GA 2RKOA 3HY6A 1ZA1A 1ZD8A 4MVJH 2Q6OA 5LQMA 2Y99A 5DLQC 2FPPA 2OCDA 1WY5A 2XYRA 4YPVA 5I7HA 4YRSA 2C1EA 2M9MA 1NXVA 1DVRA 4DKJA 1SU7A 3T06B 1FZTA 2J87A 4M0PA 3DMTA 1Y6GA 4FDMA 1QO0D 2WILA 1Z39A 4AG5A 4FE4A 3E9YA 3N75A 2PJRA 5K4HA 2XB2A 4G0UA 3LY7A 1Q0LA 4L7QA 1RHUA 4ZP1A 4HDRA 3KSUA 2D59A 2IYRA 3KFLA 3L8ZA 4HWKA 5JWHA 1OFHA 2D2IA 4BNFA 3M34A 1HM5A 3D8TA 5ELLA 5JNTA 3FYSA 5AI5A 2O3UA 5CJJA 1ECLA 4D80A 1UBRS 1LQTA 1H2BA 4IKOA 1Q1ZA 2XMQA 4U7GA 3CUWA 1Q44A 1U8ZA 2O2CA 2PSFA 3EVEA 5SY6A 1RIIA 2DY0A 4TWRA 2ZLBA 3OTWA 4PO1A 3MELA 5EZYB 1NQWA 2ZYTX 3ZUPA 2DT8A 1J00A 4BVBA 1SKMA 2I1QA 2OV4A 1Y89A 2GPTA 2CXPA 1L8QA 1XCOA 3E7WA 4PXSA 4PGHA 4NKRA 3NU1A 4PCVA 3WGUA 4IMJB 4M37A 2LKDA 4OQYA 3W77A 5LU8A 1IXKA 1PK8A 1XKLA 3GLIE 1UKEA 3IA7A 1OKKD 1T4CB 1UXGA 1ETUA 2PWZA 2X9NA 4LXQA 2VT3A 4DR6B 1CU1A 1PFVA 2O2SA 2FWJA 1Q19A 2JBWA 2QN8A 2X4GA 1RLIA 3KPVA 1AA9A 3Q5EA 4JQOA 4MUFA 3SSOA 3I45A 2GZRA 4BUJA 5ICMA 4KN6A 2R4QA 5JSUA 4AQ7A 5K8TA 4K9KA 5FX2A 2YMPA 4URUR 5AK0A 3U3XA 4EQ6A 5L3QB 4E70A 5HWSA 2PSEA 5BSTA 2O3SA 4DZTA 3F1KA 3T1VA 4M7PA 2O5VA 4GUAA 3ADCA 4FYXA 3WFIA 2FMIA 4EWLA 3PIDA 3A1DA 4RE6A 2VJQA 3A0UA 2AX3A 3FSGA 1X87A 1NPDA 4B4DA 2L18A 3OY7A 1LVUA 4RCYA 2C78A 1P74A 2QE7D 5AW7A 4CF3A 3KOZA 1JHQA 2FX5A 1UBGA 1CPYA 4QYXA 3K71B 4EJ0A 4ZMBA 1KU0A 2R1UA 4XCXA 1EUYA 1AQ6A