4OGLA

X-ray structure uridine phosphorylase from vibrio cholerae in complex with thymine at 1.25 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
247
Chain Sequence
b'KTVFHLGVTEADLNGATLAIIPGDPARVQKIAELMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVPDFDVATAMKAAAQESGATVHMGVTASSDTFYPGQERYDTFTGRVVRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRTQKEIPLKETEARSIKVVVEAARKMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure uridine phosphorylase from Vibrio cholerae in complex with thymine at 1.25 A resolution
doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 93
structure length 247
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oglA00
2QDKA 1A9SA 3FWPA 1JP7A 3OOEA 1Z35A 2A0XA 1RYZA 1K27A 3UAXA 1JDTA 4WKCA 1TD1A 4OEHA 1B8OA 3U40A 3DP9A 1K3FA 3NM5A 5FAKA 4D98A 1TCVA 3D1VA 1TGVA 4D9HA 1RT9A 4YNBA 3IOMA 3PNSA 4NSNA 3KUKA 4WKBA 4JWTA 4X24A 1ZL2A 2P4SA 4F3KA 4DA0A 4MCHA 1V48A 2IQ5A 1YBFA 4KN5A 4MARA 4E1VA 2XRFA 1RXSA 4TYMA 1U1DA 1LX7A 4YMLA 1FXUA 1SD1A 3EMVA 4TS3A 3ONVA 3KVRA 4TS9A 1ODLA 1VHJA 4FFSA 1CG6A 1JDUA 2I4TA 4R2WA 4QARA 1PBNA 1ULBA 5CCEA 2H8GA 1Z34A 5CYGA 4L5AA 1PF7E 1T0UA 4TTIA 3UAYA 1V3QE 4QASA 1PK7A 3FNQA 4M7WA 3E9ZA 5CCDA 5B7NA 1T8SA 1JYSA 1ODKA 3P0FA 4OY3A 1SJ9A 4I2VA 5CYFA 1Z39A 2A8YA 3PNPA 4LKRA 4DANA 3GB9A 5F7XA 1C3XA 3BSFA 2PGAA 3OZBA 4RJ2A 3NBQA 2BSXA 1V41E 1NC3A 1PK9A 3GGSA 3KVYA 1OTYA 3F8WA 3FOWA 4YO8A 4DAEA 1PR0A 3K8QA 4TTJA 3DF9A 1JDSA 4TXLA 4DABA 3SCZA 1U1CA 4JP5A 4OGLA 3BL6A 2RJ3A 3EUFA 3E9RA 4JOSA 4NS1A 4L5CA 4MCIA 3K8OE 1Z36A 3OZDA 1JDZA 4L0MA 1JE0A 4LDNA 3UAZA 3ODGA 5B7GA 1QE5A 4GLJA 1PR5A 1SD2A 4F2PA 5EPUA 1JPVA 3PHCA 1U1FA 4DA6A 4LNHA 4BMYA 2AC7A 3DJFA 3E0QA 4DA8A 2HN9A 2A0WA 1YR3A 4QATA 1TCUA 5B7QA 1Y1TA 1V45E 4H1TA 1ODJA 3OF3A 3KHSA 3LBAA 4WKOA 3T94A 1U1GA 3EUEA 1OV6A 5F77A 4BMZA 2OECA 1PW7A 4UC0A 4P54A 2QPLA 4TXHA 3KU4A 5F73A 5F7JA 1VFNA 3EEIA 1LVUA 1Y6QA 1T8WA 1Y1QA 4R31A 1NC1A 1PKEA 4WKPA 1RCTE 4M3NA 5IU6A 1PR2A 4G89A 1ODIA 2AI1A 3INYA 1A9PA 4G41A 1A9OA 3P0EA 1Z38A 1T8YA 2QTTA 1ZOSA 1OTXA 1NW4A 1OVGA 5JPCA 1Z5PA 3IEXA 4LNAA 4DARA 4K6OA 1OU4A 1RSZA 3OPVA 1A9QA 1JE1A 1I80A 2B94A 2AI3A 3OCCA 1A9RA 4QEZA 2GUWA 1Z33A 1CB0A 1Z5OA 4D8XA 4YJKA 5CXQA 3FB1A 5F7OA 1RXCA 3UAVA 3DPSA 1PR6A 1A69A 4OF4A 1T8RA 4EB8A 3UAWA 1RXYA 2QSUA 5IFKA 1VMKA 3OOHA 1JDVA 3MB8A 1PR1A 4TTAA 4ECEA 1RFGE 1N3IA 2AI2A 3BJEA 3QPBA 4BN0A 1OUMA 3NM6B 1B8NA 2OC4A 2I8AA 5K1ZA 5C80A 4LZWA 3UT6A 1YQQA 1V2HE 1A9TA 5CXSA 4PNPA 4GMHA 3LGSA 5EFOA 1M73E 1ULAA 2HSWA 4GLFA 4R2XA 1Y1SA 1WTAA 4L5YA 1U1EA 2OXFA 2HWUA 3OZCA 4TXMA 5DK6A 4EARA 4OGKA 2A0YA 2OC9A 4M1EA 4BMXA 1Y1RA 3LA8A 4G8JA 1PR4A 4NY1A 3NM4A 3KVVA 1TGYA 3O4VA 5KB3A 2ON6A 4L6IA 4F3CA 1LV8A 1ECPA 4OJTA 5F78A 5B7PA 3FUCA 5F7ZA 3O6VA 4F2WA 4D8VA 1RXUA 1YRYE 3DDOA 3MMSA 1PWYE 2HRDA 1VHWA 1V4NA 4IP0A 1K9SA 4QAQA 1SQ6A 3ENZA 5F76A 4PR3A 5I3CA 4U2KA 4TXJA 3TL6A 3PHBE 1Q1GA 2Q7OE 3FAZA 2QTGA 1YQUA 4DA7A 4D8YA 1RR6A 1G2OA 1Y6RA 3C74A 3OZEA 1Z5NA 4WKNA 4DAOA 5EUBA 4F1WA 1Z37A 3BGSA 4GKAA 5ETJA 2ISCA 4TXNA 4QFBA 1XE3A
chains in the Genus database with same CATH superfamily
5FXMA 2YL2A 1YOVA 2AC4A 1RAIA 5I7EA 1TQ6A 3V2GA 4L78A 1IRXA 1BMFD 2F9MA 3F9CA 3BK7A 5AJZA 3EVAA 5J5CA 4AN4A 3B3JA 4YASA 4DCOA 1YV9A 2R5WA 3CUKA 1AG9A 4J90A 4N9WA 3H1GA 1J1ZA 3FUTA 4H4EA 4QSMA 3LU1A 1DKRA 2OHJA 4GAEA 2QTCA 3NHRA 4M87A 4MVYA 1RAEA 3PJEA 3KPJA 5ESRA 3UAXA 2XGMA 4M1TA 3U48A 3DLHA 4E4RA 5H1YA 1J25A 2F43A 4W99A 1NVXQ 4BB9A 7REQA 3V33A 4EG8A 1UWVA 5B55A 5DM60 1SXJB 3K9CA 3L7MA 5LOVF 1AC5A 1E1MA 2NOAA 2X6QA 1Z06A 5I8ZA 4DDKA 1NDUA 2Z58A 4ILEA 1VJ5A 1XZIA 1FX1A 3GAFA 4OM8A 4C4TA 3FRHA 4EPWA 3IJPA 1BXRA 2BHTA 2HREA 1KKUA 2O7SA 3GZNA 4PFJA 5TF0A 2VYCA 3ZJ5A 1BEUB 4HAUA 2XAUA 1FVHA 1F17A 2BM8A 3F4KA 3L7DA 4IDDA 3T34A 3CNNA 4GP6A 4EG0A 1N0HA 1OHHD 5AH0A 1ZP6A 4MCJA 1TF5A 13PKA 4INPA 1UF9A 3CRMA 4HAIA 4M1QA 3UWMA 4ZTUB 2QRLA 3PVSA 1CD5A 3G89A 1G6Q1 4IRXA 5LYJA 3SE7A 4WKGA 3NUZA 4JGIA 2CBZA 3ZS8A 2RK3A 4CKEA 4EEKA 4KFRA 2OXRA 3U4HA 5IDYA 1O95C 2FWBA 1J9GA 2ZU0C 4OBBA 2FZLA 1WRBA 5K8UA 4MHTA 4Y7CA 2NYUA 4FI3C 3QW2A 1Z2EA 4RDIA 2F00A 2PRIA 1UFVA 1JEAA 1NT2A 4GLLA 1Z0IA 3T1YB 2HLDA 1MV5A 1E2UA 2OFPA 5DHFA 2CXTA 5DLQC 1R6AA 2OXIA 1VKNA 2NQTA 1XPRA 3PRHA 1LX7A 3MAGA 1FXUA 4OMDA 4Y2QA 1BOOA 3EEBA 3RSCA 3S28A 4BP8A 3JQFA 1YB1A 1X7XA 2H1SA 4TYPA 2B8TA 2PX2A 1QH9A 3GT3A 5EA2A 1PEDA 3OPYB 3I9JA 3FLAA 3VC7A 1WU8A 3CH7A 3D0RA 1CVIA 1KMHB 5KYWA 1VKJA 3AFMA 2H8GA 1GRNA 4G0YA 4GT1A 1SUFA 3Q7QA 4CMCA 3VOTA 3KWMA 3ZI0A 4AY6A 5JSUA 1DCMA 1CF2O 5AWFC 2Q41A 4OQPA 2QG6A 3F1KA 3K4QA 4YJDA 1C3VA 1SZJG 1PK7A 4LSZA 1F4VA 3GY0A 4D74A 3EBLA 1ILEA 3MOSA 2VJMA 1MOQA 3M3DA 3LX5A 2HB6A 2CZGA 2X5NA 4G4JA 3ZV5A 4E2XA 2WB2A 1Q0QA 3G0IA 3CVWA 3DTTA 5ES3A 4UD2A 5BSVA 4YHHB 3OPYI 1RIIA 5LN1A 2R7LA 1S3IA 1Q3TA 3M6XA 3KTAB 4Y6OA 1DAHA 1C1HA 4KKVA 4UUNA 2BH9A 5CYFA 1Z39A 1G9SA 2V7WA 4OLFA 2QQEA 5EYPB 3HO1A 1BX3A 2EGUA 3KOWA 4N01A 3MPOA 4L76A 4Z3OA 2IKSA 1GL3A 3HBFA 3IRUA 3ZN2A 1TO2E 1XCMA 2F4VB 1H0RA 6NULA 4YAIA 4MVJF 3GCWA 3IAEA 1E77A 4BNDB 4O1IA 3NCHA 3AHDA 2ZJOA 4ZYVA 5CAEA 5AVKA 5CFLA 1TMGE 4WERA 2XKJE 2P62A 3UH0A 6LDHA 2RIPA 3WLRA 4WBNA 1HDYA 5LMNB 1NLYA 4D4KA 1H2WA 1XTBA 1VL1A 3GH1A 5BW8A 1WCXA 1TO6A 3S2SA 4X64B 4DUPA 3EIOA 4R1LA 4X1IA 2EJWA 3TCNA 2ZUUA 4YO8A 3A4NA 5DE3A 2ZU6A 4EO4A 3UK1A 1DBVO 2X8LA 1XCBA 2J0UB 5DF1A 4R1NA 4HDNA 2OXTA 4AC9A 1K7EB 1UMCB 2O54A 2CVPA 1CRPA 2G8NA 1I5RA 4EK9A 5I7RA 2A5GA 4IHKA 4PCUA 3AUYA 1T0HB 1TYAE 3IDZA 4K9QA 1U1CA 3SQDA 4Q4JA 5DOZA 3CT4A 3AY3A 4I55F 4JNCA 3ESYA 2RGXA 4ISCA 3X44A 5AMXA 1CUBA 2OL4A 2W70A 2EGGA 1OIVA 3IBFA 1V1RB 3NJ8A 2P0AA 1WPQA 1I33A 3P9PA 3T3DA 5KSWB 4GKVA 3L1HA 3B5EA 4JAVC 4PLHA 5CT4A 1LKZA 1U8TA 4DVJA 4CMBA 3NYQA 4ZQGA 3IQZA 1ZHHA 4Z6KA 1IN4A 3BRCA 1WPXA 5ER9A 2VZ0A 2UUBB 1RTTA 3C5CA 3N2GB 2XOEA 2UZ1A 3MQ4A 4HNRA 4CM8B 4JSYA 1CC1S 1L1EA 1E18A 3L04A 2ZRAA 3HA3A 3FF4A 3UAOA 1PT9A 5ALRA 3V9AA 3BIXA 2NU9B 1BQ3A 2YHSA 3PUHA 1XRRA 2VJDA 3BJRA 3QWAA 3SMVA 1YDHA 4F45A 2H6EA 1CFJA 1FXWF 2NU6B 2XF2A 3WK7A 5FTLA 5LP6F 1JPVA 1E79A 2GXUA 4HO1X 4QE3A 1VMDA 2F3SA 3HUFA 3MJ4A 4DWVA 1MB2A 4B3RB 3S0JA 4BFCA 5DYIA 1CRWG 1AUPA 3EFBA 3QQ5A 5EIOA 4EPXA 3LT5A 1NVVQ 4B4UA 3GJ8A 4JB2A 5KQGA 2YFQA 1JG2A 2PX4A 2NPIA 2D59A 3NUQA 3JVUA 2VLIA 4TV9F 1BVHA 1QRDA 3DQPA 1KMQA 3FMOB 4N5MA 3E4CA 4MWBA 3A3YA 4UATA 4DT1A 2JFUA 2ZWOA 4MS3B 3PGJA 2G0NA 2OQIA 4B6FA 3NNDA 3PXBA 4C6TA 3C48A 4D41A 1RBMA 4MX8A 3NOVA 4NONA 1B0PA 3OY7A 2HMYB 3M8KA 2F8MA 3NEAA 3FY4A 3USES 1B15A 4RTNA 1SU7A 4BL5A 3OF5A 3ZJVA 3TDNA 2QPAA 1U1GA 3SLKA 3MBOA 4AUKA 4MTCA 2X4IA 4TTTS 2I33A 4V38A 1ZI6A 1XK7A 3SGLA 1UPTA 2NYAA 4LZPA 5F77A 1R2QA 1GGKA 4A15A 1GUFA 1YTUA 2ZIEA 2BEUB 1GPJA 1C3LA 1OKKD 1SN7A 4IH9A 4MRVA 2YX1A 2OORA 2ZBFA 3D7LA 1Q5PA 5CLHA 3HDTA 5KQMA 2FPKA 1OI4A 2AXNA 2GJ8A 4YRBA 2RMKA 4G0OA 1V7CA 5T64A 1QHHB 4PC3A 4G8CA 4ZVRA 5FEUA 1B93A 4WXHA 3EWNA 1JZSA 1VL5A 4FU0A 5AXDA 1U65A 3T1QA 4S04A 1ZNXA 3ANLA 1CR2A 4RE5A 1QF6A 2A9RA 2W2OA 2OSVA 1DFGA 3D2AA 1KA9H 4A5OA 3IUEA 3BQMB 1FW6A 4BN5A 3S5UA 4HN4B 1VHDA 5C35A 1O96B 1YO6A 1GAXA 3OI7A 2C5FA 1CJMA 1EP3B 2NX2A 4X94A 4RTJA 1G8AA 3NXSA 1J2RA 3LHSA 5FPSA 5GM1A 4RF2A 2V03A 2GCIA 1JKXA 5IC5A 3TTUA 1XEWX 2EX4A 3UJ8A 2WTMA 5FUWA 2JH3A 1E0DA 1F3LA 1KJ8A 1E61A 2EW8A 3EH1A 5EOVA 5HFAA 2VFAA 1SULA 3AUFA 3KOUA 2W4MA 4FFBB 4K6MA 4R2MA 3RHFA 1GITA 3ZIUA 3M81A 1EGAA 4FWBA 4G41A 4KDFA 3ZWQA 3L41A 5ILOA 1A9OA 2WWXA 3K0AA 5BSKA 4HFRA 2OESA 4TROA 2WIBA 3E5MA 1QKJA 4YO7A 4D57A 3HMQA 4M9CA 1X1CA 2V65A 5HUHA 1CK4A 2W2NA 4GX5A 3JQGB 4M0KA 1DTSA 4DV3B 3OBBA 3LDHA 4FLEA 2D3WA 2FSIA 2FPOA 4N5HX 4Z1OA 1E4EA 5FIUA 3RIMA 3S5JA 1OU4A 3P97A 4PCAA 3BC1A 4PSAA 3ESZA 4UNSA 2FPUA 3G6KA 5D01A 1I3KA 2XNJA 4S3MA 1LNSA 4IOJA 3X2EA 4IMPA 5E95A 1SUCA 3RFVA 2Y1CA 3ROEA 1I80A 2C9CA 1J4AA 3TB6A 1FSPA 1JR6A 4X20B 5C1PA 4JASB 5D86A 2IYAA 4RTKA 4F4JA 4MV8A 3F3YA 4WFKA 4W9MC 3UJPA 1ORHA 1Z33A 1N1EA 2HCFA 3E70C 3T7EA 2Q8NA 4M8KA 1QYWA 3ZVLA 4BGDA 4HEJA 2G67A 2Z56A 3LUHA 4GICA 5THQA 3RF6A 2OILA 3MCUA 1MVOA 4MKGA 4B0PA 3D7RA 3KZMA 2XGOA 1NBAA 2DYKA 5EKUA 4D25A 2XNCA 4PZZA 3TOSA 3UMVA 1S4QA 3SVZA 4D4GA 5LQAA 3U60B 1GU7A 2WFLB 1UMDB 3V4OA 3JQDA 4DMKA 3S2IA 1T6YA 2FZGA 3U37A 1T8RA 3ASUA 4UBLA 4Z1MA 3AEKA 3SNHA 5EP1A 3QG1A 1N36B 2M6SA 5FWDA 5J1TB 2BZ0A 2MT9A 4OYLA 1AA9A 1SBYA 5FWYB 3N2KB 3PFIA 4D6PA 5IASA 3KAKA 4XLZA 4ZAZA 2EBWA 4DIEA 3JZDA 1L4GA 4NIMA 3WGZA 3P45A 2I4RA 1QP7A 1JDVA 1KY5A 5CEFA 5DN6D 2XRZA 3C4QA 1WSBA 4RM3A 1Q84A 2BHSA 1BFDA 2GEBA 1KQOA 1IDOA 1PHRA 2MYTA 2R1VB 3DBHB 1F8XA 3EIHA 2CE2X 4H9GA 4IJVA 4KQ9A 4MP6A 1PU2A 4AIRA 1QIHA 5ELLA 4N6NA 1E3TA 1UOOA 1A72A 3H11B 1UBGA 5ALNA 2DZDA 3SJ7A 1WBBA 2VRNA 8MHTA 3IP5A 3USCS 5A7HA 4P4UA 3T12A 4ODIA 1WB9A 1KP2A 2MSCB 1RKXA 4MWCA 5DTJA 2QBYA 4D0RA 4D4MA 2G04A 1SCQA 4NQRA 4RHEA 1MQAA 1QNFA 1V8ZA 4O4IF 1JGTA 2YDYA 1FNCA 3FBTA 3SD7A 1NIPA 1PI3A 3CCFA 1RC0A 2CZQA 3ONFA 1GLNA 2YJ4A 3C1OA 3HBAA 4KE9A 3TEJA 3MRXA 2HPZA 4C3UA 3QU5A 3DMTA 1V5GA 4W8GA 3P5SA 3PI7A 2QT1A 2IHZA 3UTDA 2Q1UA 3WLHA 2MYUA 1L5QA 5J4LA 1VGQA 1OIXA 2XQGA 1HOXA 4IDHA 2PKEA 3FDXA 2XMCA 2VDMB 1NXWA 5HEKA 5JBNA 4EELA 1RXVA 1Y6ZA 3FPCA 3SIPA 3RVPA 4UFNA 4WZBB 2MHCA 4A2CA 1BTOA 2P67A 1VSUA 2GFHA 1E2MA 3H75A 3IAUA 4KJZA 4RFVA 3S7TA 4D97A 5LYYA 1JG3A 1DS6A 1XKTA 3G3EA 3QOXA 4DIUA 3FJ1A 1YHNA 3U3RA 4BGIA 1GILA 1LSOA 1XPOA 4F8EA 3ABRB 1LBIA 4G8DA 2CHUA 2I6TA 2VNHA 3CUWA 2X7JA 1G21A 2W58A 1UXHA 2V9CA 2JFZA 1SHJA 4NJEA 3ZI7A 3SBOA 1NMEA 1XZHA 2F2TA 2OHOA 5DBOA 2OP0A 3UY4A 2PSFA 2QIPA 2ZI3A 1G5RA 4FBLA 4QU8A 3WMRA 3GAAA 4BVBA 3HLTA 3ENKA 4CJXA 4RV5A 3N8IA 2PD4A 1LJ8A 2J7PA 2ZYRA 3CKYA 1P2BA 4KLCA 4MR8A 3EXFB 2GM9A 3PQDA 3PFFA 3AFGA 1ZL0A 3Q7IA 2COKA 2RH8A 3EGXB 2RBEA 2VUSA 3H5LA 5E1MA 1V8OA 4Q47A 4D42A 3KR0A 4ESEA 1NULA 3BHJA 3LVBA 2FUG6 2Y4OA 2O0HA 1OFTA 1X94A 3E7PA 3ED1A 4DNFA 4UHHA 4EEZA 1Z6GA 4AY2A 3G8YA 1OX4B 5DSZA 2H11A 3FDIA 3L06A 3QUAA 4MAMA 1GV0A 1A7JA 3GAMA 2PZEA 4EKEA 4BMCA 2JIZD 3BREA 3H4TA 3O0TA 3L7NA 2XOKD 3DUFB 4IS2A 3LI2A 1QIMA 4ZALA 2GVNA 1OMOA 1Z6YA 4U02A 1W76A 3UB3A 3O4FA 4G0NA 4IY1A 4C0XA 5KYYA 4W5TA 2WPDA 3TM4A 2KX7A 5J63A 1W0KA 5C5DA 2VJQA 3PNLA 3TPZA 3RU9A 2PZJA 3ZE2B 4HDMB 2QJTA 4P32A 2ZYVX 4FBMA 4KPUA 4ND8B 5KOHB 4UVEA 3OT1B 1B0ZA 1ZZEA 1QGUA 4QGFA 5BRAA 4K3UA 1R3DA 2JJ1A 4DBLC 4M8NE 5KYUA 3STUA 5BV8A 4PHHA 2LW7A 1GGFA 2VG8A 1ZAKA 2VT2A 3G2PA 1U3FA 3OEEA 3U3DA 1OAOC 2NTYC 2YHAA 2I4OA 1SCBA 2FF7A 3HCFA 2ANCA 3IEUA 4B87A 4DJEC 4RA6B 1ZUNB 4LYDA 3TI7A 4Z7OB 1XDWA 2W11A 1LSJA 4WEQA 1XWWA 2ID9A 5JNLA 2ECPA 1ZOIA 2GHIA 1KK3A 3MXTA 3U4DA 3L8DA 3AIIA 3R77A 2J6IA 3SX0A 3HR4A 4CV0A 5IVHA 3C1UA 2XBMA 1EXMA 2G09A 2XZPA 4J3JA 4NTZA 3TRIA 2FK7A 4JU9A 3UMMA 1GKKA 2JIQA 2OGUA 3M6MD 3PDCA 3GW8A 1YR6A 2Z8ZA 3F3MA 4TN5A 4IIFA 1NBME 4E32A 1IK6A 2XNSA 4I9FA 4DA7A 3D8NA 4M9SA 4OXRA 3TOVA 1E96A 1ADCA 2C5LA 2Y05A 1E2EA 1SU4A 1UKBA 3K9WA 4WK6A 3R5FA 4Z86A 1B6GA 5EUBA 1YFJA 4PPQA 4KOEC 2M1ZA 1ECBA 2ISCA 3WWDA 3KUUA 5KX5F 2HKIA 2GM5A 5SZJA 3PSHA 1GDTA 4EFKA 4O0LA 1PHPA 4QBGB 4AJKA 1GNQA 2Q9CA 2VF2A 3L4EA 4YRMA 1KVUA 4EPRA 3OMWA 2O3JA 3EAFA 1U31A 1E20A 2ZYTX 5A5GA 1MZPA 4UUAA 5TT0A 2RD2A 4ARCA 2Q1WA 3EQZA 1T0JB 4BX8A 1I36A 5EJ8A 2BEJA 3IJEB 2CNNA 2QNBA 1Y7PA 1AVTA 1I01A 4NH0A 5HM8A 5JZOA 4C0LA 1MIHA 3MT0A 5DNVA 1N0VC 2GKSA 2Q1XA 2F6RA 3C6QA 4FYWA 4MVJE 1PLLA 3UT5A 1RWMA 2V0CA 3DCIA 1YZ3A 2ZB8A 4CL2A 5A0TA 3DP9A 3NO4A 1XROA 2ZJYA 4QHSA 5F33A 4FNGA 3BDVA 4J29A 1JYFA 5IZCA 3KSRA 5ALWA 2YV4A 1TCVA 4JJGA 3C6MA 4RD6A 1EK5A 3KETA 1OI7A 5GGYA 5CT5A 1LU9A 1OA1A 4M9UA 4CMJA 4XPZA 3M5DA 16PKA 4H1HA 1O5OA 3GU3A 3FYUA 4A3SA 1R6TA 5A5DA 1JR3A 4ETMA 3M3HA 5EP3A 5IJAA 3ISTA 3EVBA 4K40A 3FW1A 5JCJD 4IQGA 3Q5DA 2Z98A 2F67A 4RMGA 4BNLA 5JY6A 2OFOA 3WX0A 1TCAA 2H1RA 4JKYA 4Q9KA 2BF4A 2ZRPA 3E7DA 3NYIA 1U0EA 3CNBA 4XIYA 4XJSA 3D4OA 4Q1FA 3G13A 2VXCA 2F1HA 1PEKE 2XUIA 4M9XA 3VU0A 2PX0A 4DN6A 4GR4A 4JSRA 1FB5A 3I2YX 5DOVA 2X14A 2PBZA 3OOJA 5IK2A 2P1DA 1XZGA 3FUWA 1XL0A 1U5BA 4JA2A 4LZNA 4ETWA 4MRAA 4TLEA 4HFMA 4RJKA 4PGGA 2WD7A 4B3MB 4Q1CA 3U9SA 4N41A 3F5QA 5K01A 3K32A 5CYGA 1ZAYA 5A5EA 3LFTA 4Z54A 1QBKC 2VRCD 1II0A 2B3DA 1AS3A 5BWMA 1KOJA 2AT1A 3PXUA 3R3UA 4GO1A 4NE2A 4BFWA 1E5XA 1PJ4A 1P2UA 3MRVA 1F5NA 3ESXA 5CFZA 3R3YA 4K26A 5L7YA 4C0WA 3CVOA 3GGJA 1HR0B 4E5SA 2HO4A 1T1JA 3JQAA 4UBMA 4DNPA 5E6SB 4IKEA 4DJDC 5JAQA 1CUDA 2JLQA 5AVOA 1T3TA 4KACA 3VSAA 4YUZA 2EQAA 2JVJA 3BD8A 3IAAA 1G1AA 1SQ5A 2PGIA 1QQAA 2QVZX 3WTBA 2BH2A 3T9BA 2PJDA 2ZB7A 2PS1A 3I1IA 1E3JA 1E4YA 2PGXA 1O58A 1L5YA 1GA1A 2AE1A 2JCBA 5IZ4A 2MMGA 4JJ8A 4KXNA 3GLIB 1UDAA 2ZWPA 3REQA 2C5BA 2RGDA 1E2NA 3VPGA 4F5EA 1KVRA 2J0SA 4EY8A 1TEZA 3L46A 4RQTA 3PE6A 2OCIA 2QJFA 3TLMA 2XF8A 2Y1FA 4G1VA 4R81A 5TS3A 2O57A 5DBGA 4G9BA 4DMGA 3M89A 5IJWA 1SXPA 2AQHA 2AR0A 2Z8YA 2FW0A 3C39A 3L0BA 3C43A 2VBGA 1KYXA 5CDUA 3QXCA 4L8FA 2QRVA 2REQB 3T5MA 5IKPA 5JD6A 3AR8A 4C4AA 1N92A 1WCIA 3VJMA 3SQWA 2CMHA 3A7DA 3B3FA 4KAJA 4KO1S 1ZM3A 2VPZA 1TIKA 3PPWA 2XB9A 1YAJA 2EG9A 3BIJA 4FYJA 3LGAA 5L9AA 5IS2A 1KI3A 5B6PA 2B2XA 1AH2A 1HDCA 4TUYF 3VTAA 2H4HA 3AF1A 3ENWA 4E4YA 4M53A 3Q7SA 4Z2AA 1HKHA 4PBRA 1SOVA 4YRZA 4REQB 2V9ZA 1QFSA 3AKCA 2WQ6A 3HPRA 3LX8A 4PN7A 4G0VA 1YZKA 1JX6A 4ID3A 5JC8A 4LOIA 3ZE6A 4Y2YA 1ORTA 4MS1A 4XWOA 1K7YA 5JXIA 2NUTB 3Q15C 4RYLA 1I0IA 1VP9A 2YICA 4MHOA 1W35A 2VAMA 1VA4A 4IF6A 4LHVA 4YV7A 2J0VA 2Q5JA 2IEDA 4G5YA 2XQIA 2V6FA 4IICA 4NS1A 5KNDD 1YS9A 1GAQA 4WLEA 2CV1A 3HJTA 1K86A 3DFUA 4RGYA 1V37A 2B30A 1U2GA 3LXXA 1VKZA 5A6VA 3HZRA 2IF2A 3MQ2A 1G3QA 5KS2A 1R5BA 1W4BA 1ZEMA 2D7CA 3SJCA 4NBNA 1Q22A 3PDIA 4FGWA 4DFDA 4NBTA 3L1VA 2BL4A 2DX7A 4FILA 4REOA 3VKVA 3ODGA 4F06A 1RLOA 1GIAA 4A91A 5K3DA 3DTVD 5KJCA 2C5HA 1VTKA 3A26A 1JS1X 3OQIA 4MNTA 4RORA 2OG2A 4F2PA 5BURA 5CYPA 3JPWA 3MT8A 1B73A 4GPD1 3PWZA 4PAMA 5JBQA 3AXTA 1OBHA 5EPUA 3ZGZA 1IRIA 4F4UA 1T4CB 2CVZA 2WUEA 4QJ4A 4XX0B 3GRCA 3SIWA 4UCQA 4TZ0A 1EEHA 2V5VA 4OYHA 1KS2A 1POWA 4QDKA 1ZOLA 1IBCA 1QE3A 3EY4A 1YCGA 3SMQA 2I7DA 4RMNA 4ZOLB 4IM7A 1IQUA 2J3JA 4JLKA 5KDLA 3RYIB 1DAIA 2SCUA 7ABPA 1AZLA 1OT5A 2JJYA 3NHUA 5EAIA 5JMPA 5FUBA 2IBSA 3LFHA 4A0HA 1Y1TA 1Z75A 2Y68A 1G7SA 1RE0A 1Z26A 2Y1WA 5CHEA 3F5FA 4HX2A 3X1MA 5CLLA 1J2EA 2FUG1 3X0DA 4EA9A 4MKIA 1GNTA 3C3PA 3QXHA 4BCDA 1ZIPA 1AKYA 1ETHA 2H4XA 2WUVA 1U0LA 3IDQA 3PF8A 4E21A 1E5QA 2OHGA 3G2OA 5BPFA 5MN5A 4LJ5A 1DO8A 3B6EA 2V3VA 4LQCA 3R5SA 2PPLA 4UEJA 2B61A 4LOAA 2P2NA 3TX6A 2FQYA 4BB0A 1LBQA 3TMAA 3VH4A 3BEDA 3PEEA 2Q6VA 5JD4A 3QFFA 2A4KA 5KI6A 1MJGA 3NWJA 4Q4DA 4D3SA 3QY0A 4EI8A 5BSEA 1PGPA 1WETA 2B9VA 2WUWE 2CUNA 3G0OA 3A6EA 2B8WA 5DYWA 3RARA 4DLWA 4XYBA 4KXFB 4BNHA 3VJLA 2ZYGA 2HSJA 3KWFA 4FLFA 4QO8A 4J2HA 2XKKA 2QYSA 5F2OA 1J2JA 3WOVA 1RDFA 1KVSA 2A2ZA 1BXZA 4U2EA 3HGTA 4KWTA 1AKEA 2GR9A 2CDBA 1B7GO 3H5VA 1QB8A 1ISRA 3FFBA 5JR3A 3ZVMA 5ALQA 2QMEA 2PKYX 4C4OA 1RI2A 1NYQA 2W5UA 3D3QA 1PJBA 2AOWA 1PS0A 1QSGA 2HEGA 3GELA 3W2EA 1JH9A 1C8LA 1OXBB 4L0CA 4O8CA 1QZUA 4PLWA 1OJ7A 2Q7XA 5G41A 2ZTUA 5DI3A 2HXYA 2F3TA 4IFBA 1L5LA 2W6NA 2FQXA 1SUAA 2Y27A 3SXUB 2GK6A 3TRDA 3VBEA 1A8UA 4E2YA 4OSPA 2IYNA 4UNQA 3ZX5A 3VH1A 4H7KA 5JXWA 3TFOA 2YIDA 1Z2OX 4KU4A 1KIMA 3F7MA 2QJWA 5EUQB 1YTLA 5GPBA 2ZSIA 1P7PA 2HF8A 4MA4A 3S3TA 1G2QA 5LKRA 4N40A 4ZN6A 1LTHR 1YGYA 1X0VA 3CG0A 2IBTA 1I4OA 3EZNA 3ZY3A 3KHUA 1VLHA 1M2VB 1NKTA 2D2FA 2QTHA 4P4GA 2WM2A 3N0WA 4WXRA 3VR4H 3QNUA 4J0HA 1KVTA 2A92A 4MW5A 2B94A 3W8DA 2AJDA 5BVGA 1OWNA 4FSXA 4ZU6X 5ER6A 1L9XA 4P7JA 1Z13A 5IJ9B 4C2BA 1ZIYA 2NQ2C 5EUCA 5K0LA 5TC4A 1LPOA 3GIDA 2AD5A 4WMLA 2HNAA 2C2MA 3FDFA 4HYEA 1F14A 2QZJA 2AEMA 3IE0A 3WGKA 4YBRA 5KTTA 4LUCA 4XA8A 4JUFA 1CLEA 1Y1LA 3IAS6 1OW3B 2ZUWA 4KC0A 3MAAC 3STTA 2C8VA 3WGQA 4ZDWA 2FRDA 1TPZA 2I7XA 1CIJA 2VNJA 4RNCA 4DPKA 2EL9A 1WHSA 4DC1A 4XYLA 4WI1A 2QRKA 2R2GA 1O8CA 2H57A 4LWPA 2ACWA 5CDYA 4IJMA 1KI8A 1K98A 1LLFA 3LF2A 2RGRA 1DUSA 5JZSA 1THZA 2OD2A 1TQ2A 1UXIA 1F06A 1QJ4A 1I8TA 2QM7A 2E21A 3COJA 3SICE 1KNXA 1IBSA 1TT7A 4FHZA 1JV2B 5AW2A 2J5KA 4LISA 3WGNA 2YJZA 1Z8NA 4YQZA 3HXQA 2BFDB 5ICFA 5J3JA 4Q15A 4BZQA 3GGOA 3NTLA 4REMA 2BEKA 4DQXA 4CIYA 3KD2A 4AQYB 1FJHA 1C7EA 8ABPA 1FRZA 2COUA 1TIPA 1XNRB 4XKJA 2FJUA 3ZWKA 3AERB 3BUSA 3H8SA 5L95A 4AWXA 4AZTA 2XTJA 4KO3S 3AP2A 1S8OA 2O4UX 4WIAA 3U3JA 2GAJA 1MFPA 1P7ZA 3AUUA 3L1JA 3MYRA 4UHEA 5FUYA 2AW5A 3WLKX 1NKSA 3NM6B 3BTSA 4NBLA 4M6WB 4BLRA 3O90A 2GPWA 2W98A 2ZTHA 3WVNA 4L28A 4RJJA 2PEYA 4B7XA 1UWCA 3LKBA 3WL7A 2VHCA 1ACLA 5BV0A 2GEJA 1Q7TA 1Z8DA 2X0EA 2E6KA 2J30A 1M6HA 4RH1A 1S9HA 2YIVX 2UYOA 2XSZD 4FHFA 3TTVA 1QUFA 1RW4A 2G1KA 1P7CA 1BH6A 3G5MA 4HXYA 4K8RB 4UXIA 4YCDA 2HA0A 4P9NA 1G8PA 3QELB 4TT3A 5IJ0B 4GM1A 4PSDA 3V1TC 2JAOA 1GZ5A 4FOOA 3RYFB 1AUOA 2E37A 2X9LA 3KS9A 4PZCA 4EYQA 2Z9CA 1M8JA 1FTSA 4BBJA 1Q15A 2FMIA 4IIUA 5CEJA 4DLPA 3N5KA 4N82A 3Q0IA 5F2EA 2EF1A 3R3VA 3CNEA 5TDHA 5CCEA 2W90A 2QK4A 1XZLA 5IARA 4H15A 1FYVA 3LY5A 1VCHA 1M34B 4MVJG 4F46A 3WDSA 1YFKA 4LE0A 5KNCH 1DG9A 3UQZA 1ZN9A 2CSUA 1C7JA 2E1PA 2VH2A 1L4HA 3QKRA 2R9VA 2Y9MB 3HN6A 4HF7A 5T41A 3RTCA 3FJYA 3S1AA 2Q3DA 4J9UE 1Z0KA 3EVNA 3WRYA 4BMNA 2RGGA 4HOYA 4LPSA 1FFGA 1FMLA 2DH5A 2Q3BA 3CNHA 4G9GA 4BFTA 5BYJA 3HGMA 1JB1A 3VR2D 4BC1A 1RI4A 2EBUA 1E3WA 1GRQA 1Q0HA 2Q49A 3A8TA 5AOVA 5PNTA 3O83A 1HBJA 3KEQA 3GJ7A 4ID9A 1UWKA 2O3SA 4JIMA 5JBIA 1OY1A 2EV9A 3H19A 1BE6A 3DEJA 3QH4A 1OWPA 3BK2A 3ZDBA 5TRTA 4P53A 4ZMRA 1V1MA 2B9EA 5CA1B 1PWHA 2QNIA 3VPAA 1N5IA 2FEKA 3FUCA 2DTDA 5F4BA 3WLSA 4JOBA 2J3EA 4Q3OA 1CT9A 1I51A 2ZIAA 2ZWMA 3HVHA 3VHXA 4I1OA 3RUAA 3FZNA 4A1FA 3PJRA 2QLLA 2ZSBA 4HG2A 1QCCA 2H51A 1JI3A 2E4VA 5D3KA 4BTVA 3K0SA 4ZO4A 2OV3A 2ECQA 3H18A 1RLUA 2AR7A 1MB0A 2ZG6A 4OQFA 4L1KA 4YDRA 1PFGA 1N5LA 2ZRJA 3UXMA 1U3WA 2JKZA 3AOGA 1QC5A 3QEOA 2AZTA 4EMBA 3MB5A 2WHPB 4ZV4A 4NU6A 4J6EA 2CFOA 2CB9A 1H0KA 2NO1A 4H2DA 2WJIA 2ODEA 1BU5A 2AJBA 3EGDA 3D7NA 3NTUA 3QVSA 2C0PA 1E9AA 1FS4A 5D5PA 3TIGA 2Y4NA 3OZXA 4EFLA 4MQLA 3NG1A 3DMFA 3GWGA 4IZIA 2QRZA 1JIUA 3LQQA 1TXGA 2RC5A 4FDVA 3QVGA 3FYDA 1JT2A 1VPDA 1N2GA 1NUQA 3BH6A 4DYDA 5J2TB 2AFIA 4N39A 2JK0A 4PC1A 3LYLA 3L8ZA 4D7AA 1XP8A 1ADGA 1Q1GA 3AY7A 3NUGA 3ESCA 1UODA 3BMOA 4RKFA 4Y1RB 4DNQA 2O8DA 4F3YA 5A0VA 1I7DA 1LVHA 2FA9A 3O2JA 4KQWA 4C76A 3G5AA 3K8ZA 2JHGA 2VS1A 3B8HA 4Q7EA 4BVGA 1NOIA 5CX1A 2OBFA 3MFQA 4M8IA 1D1SA 1FBNA 2FR1A 2JK1A 3I8XA 3OKFA 2RK4A 4EABA 3KO8A 5LNK6 3HCWA 3L6RA 4IOKA 5KKCA 3GLQA 2CXUA 1XWFA 2GN2A 2ZJAA 4DRZA 4P84A 2EP8A 3V00A 4BQSA 2AIRA 4QPNA 1WSWA 4Y9DA 4F1WA 1YR8A 1W7AA 1S1CA 2GWHA 4PGHA 1L7EA 4O2AF 4BLTA 3I2FA 3IP8A 2EIXA 5DGTA 1C4OA 3KQTA 1G20E 3RVRA 5LWQA 2HDOA 2WEKA 1T2UA 4I0WB 3ER8A 2I2DA 4ZDIA 1DQSA 3ZYZA 1DBPA 4Q05A 4RNDB 4NS4A 1BFUA 4BDTA 1OYOA 1XMXA 1SOUA 3EQ2A 4OB8A 2VUHB 3VVBA 5C5EA 2SICE 3VTZA 3SM3A 1JEQB 2A0XA 4GS5A 2GAIA 5F9MA 3IDSA 3T4XA 1A9XB 4KRXA 3IO5A 2ETXA 3WNDA 2A1TR 2IYFA 4JBIA 4AN1A 3R40A 1V1JA 1AZTA 1C81A 4X7BA 1D4AA 3T7KA 2P79A 1VE1A 2QUHA 1AB5A 3NVKI 1QS0A 4JROA 3C3XA 1R4MB 1SCJA 2Q27A 3BMCB 2ICAA 2Y9PB 1ZD1A 2GCPA 2ZYAA 1XLTC 3AB7A 3LVRE 2BKEA 3PR3A 1G3MA 4EYKA 4KWEA 5CTJA 1Y3HA 1O95A 3EVDA 1OROA 3CLKA 3MWFA 3C1AA 1MGOA 4G0WA 3LDUA 3LDAA 4G5RA 5GZ3A 3S70A 1NMZA 2QG4A 2WV9A 3WL6A 1G6KA 1OXUA 2IT1A 2IYUA 2QY9A 3HWWA 4BO1A 3CNQS 3HJHA 2GYUA 2GCNA 3DE7X 1RYYA 3DKRA 1HSOA 1YFZA 2W2VA 5AJTA 4DSUA 2I6SA 4MWGA 3R44A 1USWA 4H0CA 1SVKA 1QO0D 3FKJA 2EIHA 4MQBA 1SBIA 4US1R 5JROA 4PLPA 5AXAA 1P73A 4GQBA 1IJEA 4URYR 1V3UA 5C18A 1JIVA 3WQHA 5CD9A 1P19A 5EN4A 3VAYA 1UBMS 2IBMA 3IAXA 2BBSA 3U7HB 2XUAA 4FFMA 1I13A 4WLOA 4E46A 1Z4JA 4YMLA 3RHSA 4EECA 1E2FA 3VO9A 4XASA 1QDLB 3TZCA 3TLZA 2L0XA 3SC2B 4C30A 2YWRA 1THTA 4L8VA 2I4TA 4GHWA 4URWR 1ZITA 3SKYA 5AM4A 2WBLC 4R2WA 3UJ3X 1Z62A 2UZ0A 1H65A 1H1TA 1YS2X 3KD3A 1TUGA 2N46A 3M0EA 5A3JA 1R50A 1L8XA 5F9HA 2I6FA 2WSSA 2DC1A 4M8LA 4ARIA 2CHGA 2JGEA 4X3CA 2EFCB 4N47A 3URKA 4AJIA 3ZV7A 2YYAA 4QQNA 1IQPA 1C9JA 1KI1A 1V5FA 1VL6A 3NH9A 3O3CA 1FS6A 3WNQA 1DCTA 4NZPA 4FGJA 3A3PA 3BRQA 3QHQA 3VC1A 3LNCA 3IAM1 4OB6A 1XD2A 3BSYA 3WZ2A 2WM8A 2ZSKA 2HMUA 1A2KC 3O4JA 1N9GB 5JC1A 1I7PA 5I7FA 1NM5C 3KB1A 3UG7A 2ZJ6A 4DB2A 1GZHB 3ZVRA 4ISBA 3TO5A 3QLEA 4N7BA 3AL0C 1QAMA 1RFLA 4E09A 2IYSA 5HQTA 1F12A 2XT9A 1GT91 4BQPA 3HEBA 1ODKA 3PC2A 4L8YA 2ZI9A 1BDBA 1C9DB 3UGKA 1P5FA 3F4BA 4OHWA 4PM4A 3IBYA 2OPHA 2WUGA 5D84A 1M33A 3UK2A 2FR8C 3SJBA 4MVJH 2YQ4A 3CN9A 3V5NA 2OYSA 5H68A 1H2BA 1XDGA 1X0XA 3FCOA 4EMTA 2HFKA 3GB9A 2GDJA 1Y63A 2OYCA 3BX1A 4RSRA 5DMHA 3PT5A 2Z43A 5AVUA 3EWIA 4DLVA 1RZ3A 4B6EA 1E1QA 1TAHA 2C2OA 3Q3VA 4P38A 5JH7F 1CJUC 2D5LA 4TMVA 3KJFA 5AJXA 1WSAA 2VK2A 3WLJA 4B7CA 5E3HA 4DR5B 4LF7B 3K0BA 3RQIA 2EQBA 3WKCA 2VOJA 3OVMA 2XXAB 1XEFA 5KMGB 3CO5A 3DA8A 1AKWA 1V3VA 1WNFA 2FSUA 3AWIA 1YOVB 1QFZA 2VDWB 3DVSX 3M5CA 3O4IA 4HDQB 1GFSA 2AOUB 3MG9A 3RROA 3RADC 1YZQA 3BMQA 1LD3A 3OU6A 2IX9A 1NVAA 1J0EA 4RVSA 3HZHA 2A6PA 3HADA 5HKOA 1GTSA 1EQUA 1MX1A 1P9RA 2C61A 2H65A 1QOPB 3EZLA 1JQAA 3FCYA 4KGDA 2C1XA 1JNXX 2QLTA 4W5JA 5ANRB 4DQVA 4POAA 2ZTSA 2WVJA 2N1MA 4F1JA 4KR3A 3OJFA 3V6LA 3WISA 1KRHA 2F43B 4CMAA 2O7NA 7REQB 4YP9A 5BPHA 1ZNWA 5BN4A 1EK2A 1AOXA 3EUFA 2R6R1 2DQKA 3ONEA 3W1WA 3DAPA 3RNLA 2VUIB 2YUTA 3A37A 2ZDHA 3ZQUA 2GPTA 2FH5B 3KJIA 4LYHA 1JUDA 4O33A 1BXRB 5BQOA 3GZNB 1BCRA 4QUHA 4E30A 2ZRCA 5DSTA 3QMPA 1DZ3A 3HZZA 4BFUA 3EW7A 1ZY2A 2FRVA 3I2HA 3T7SA 2Z4RA 1UBCA 4IIHA 5LLSA 4TKVB 5B2FA 4H31A 5AUPB 1DU4A 2Q4OA 3QFTA 4XVRA 4NCIA 4ALIA 1RWQA 1Z08A 2DVMA 5LYJB 2BTQA 3QX7A 2WABA 4WEOA 4CKEB 5JYCA 2QTAA 4P86A 5MHTA 1QV6A 4MUBA 4DW8A 3CURA 2J33A 4WQMA 3SU8A 4DWWA 2QE6A 4ND2A 1KZHA 1N2CE 4UOEA 2D2VA 4G1EB 2V55B 1EWKA 1DLIA 1G4HA 1NW9B 4GI2A 3I9LA 3A0UA 2IEIA 3O38A 1RC8A 1QYIA 3C97A 1TVEA 3EIQA 1P0PA 1QYRA 1YRBA 1TIBA 4HATA 4B3FX 1IUPA 1Z8FA 2IEZA 4A2WA 1X7XB 3L6EA 3ZU6A 2X15A 2HPAA 1C1DA 2EJUA 4C7JA 4EGJA 1XMIA 3DLTA 3PC8A 2HHJA 2JD1A 4K7JA 3TEMA 2X2OA 4RMIA 3CISA 5HKBA 1PLKA 5L8VA 3H5RA 3RYCA 5EVCA 5EZ5A 3HVKA 1N78A 4IPTA 1Y8RA 1E69A 1PX0A 2DPHA 1YU6A 1RI1A 1FFBA 2B1GA 2I3ZA 1SC1A 5KTYA 5HIIA 3ZYCA 2DPXA 2XYVA 2BMVA 3EQ7A 4BXOA 4M0PA 1MFZA 2AJTA 3G1WA 1SY7A 5AK3A 3THSA 4EBBA 1QX4A 3OZTA 4C29A 2F7SA 3WAGA 3BG5A 4JLNA 4DCGA 1ZJYA 5HOEA 2WZCA 3CZ5A 3ECAA 1HLPA 1PCXA 2C20A 4YDQA 4JL8A 5K8IA 4C4ZA 3IP3A 2BGGA 2L42A 2Z04A 1EFPB 2VAVA 3OKPA 5HYVA 4MVJM 3QQPA 4GZ3A 2VQFB 1P8AA 3IEIA 4P7BA 3HDQA 3CZCA 4J49A 1BWSA 2I2AA 3O92A 4MMZB 4B2PA 3C1TA 1GSHA 4Y3UA 2R4TA 1R8QA 1SM4A 5K2MA 2UYQA 3RAEC 2IXTA 1JLSA 2KMLA 1ZH8A 1GPNA 3N86A 3OM1A 4GVLA 4MQUA 3RJZA 3AKZA 4Z53A 3WLLA 3CX4A 5KU7A 4LK3A 1TEXA 3QUSA 1JKFA 3EPRA 1XGKA 1QHXA 3GEHA 3VKHA 1J8DA 1V2GA 3F3KA 2PSEA 1NOJA 1GUZA 1EBBA 2NYVA 2DOKA 2VQ3A 1JAHA 1ODIA 2ZYIA 4G89A 1QKIA 1B43A 4PQEA 4WBNB 3GDGA 3C24A 1I7SB 2WIDA 1SCAA 3IDOA 5FNVF 5DP1A 5BSRA 3ONDA 4IKPA 2QTTA 3OWXA 3KKQA 2ZE5A 2DJ5A 1G5HA 5ECYA 5KYKA 4MIKA 2O3TA 3ASVA 2WE7A 1D6SA 4G36A 4RQAA 2V7UA 5HCNA 4RULA 3EFOA 3QTTA 5EMLA 3UGTA 1U3CA 1RI5A 2P4UA 4HDNB 4UVDA 4YT2A 3RU7A 4Q7MB 1NNUA 4YFYA 1RRKA 5T3UA 2XMPA 2VJPA 3WDLA 5E1BA 4FYYA 1IHOA 4M1MA 3ZDDA 4CI0B 2GPSA 1PT6A 3IE2A 4HLNA 4Q4JB 3L0OA 3H9GA 3IUPA 4NLLA 1NHWA 1JE1A 3F2VA 3X2SA 4R9UC 2GZRA 2C57A 3DDWA 3FTNA 1A4UA 5FBQB 2PUCA 1P60A 3ZWMA 3QK7A 3MLBA 1F1BA 5DU2A 2E5FA 1QOQB 3M2TA 2IGBA 1NVWQ 4QEZA 4MUAA 4CG1A 4IEFB 1U0FA 2JFGA 2A0UA 4D96A 4GDMA 4NU0A 3FB1A 2J3DA 3QA3E 2UZ1B 4IDNA 2DKOA 3SEZA 5KDDA 4PHTA 5JJLA 2IZ0A 4PG5A 1CZUA 1TJ5A 3B2NA 3O9ZA 5GJWC 3SZ3A 3HDHA 4FC7A 3LK7A 1GVNB 1AHIA 1KZ7B 1DXHA 1XRMA 1PGOA 1AT1A 3A1SA 2NG1A 4G0ZA 3IE1A 4ZI7A 1MAVA 3DLIA 2F64A 4FN4A 1WMBA 4PO1A 1L7BA 2YASA 1T1SA 1U3UA 2I65A 1SXGA 4IKOA 3ZHBA 1PQUA 1DEOA 4MQ6A 4ZVUA 1EE1A 1T1IA 3AC0A 4KK4A 4O2RA 4EHBA 3F9IA 3C3MA 1JHYA 1NZDA 1VI2A 2F59A 1VYVA 3I0ZA 4KQGA 4P7KA 3CUTA 5GVRA 3MB8A 4DTIA 1CPYA 3AUKA 2HWWA 3AY6A 3FLEA 2XQFA 3THOA 3R7BA 1GCAA 2G83A 1C7FA 4FYVA 3RH0A 3TQIA 2XYQA 4TKUA 3INRA 3UXYA 2VRBA 2C00A 1KO8A 3KAQA 3LXRA 3C16C 1CW2B 3M4YA 3OFVA 4KW7A 2TMYA 3DL4A 1GKIA 4K9DA 3KYDB 4PIMA 5DVZA 3BJEA 2VCYA 4DE5A 1OYWA 1Z73A 3O03A 1RWOA 5F1OA 3RT9A 4HZUB 2DBVO 1QV7A 4UKDA 1Z07A 3UB4A 3CC8A 1MENA 1PJZA 1LDGA 3UT6A 2PVCA 1CZRA 4M0EA 2V7EA 5JUWA 4BS9A 4A16A 3P4XA 5H4GA 1G5QA 1HEIA 4Q9HA 2KBEA 4BJ3A 1QGAA 3LH5A 2P77A 4RV9A 2C2HA 4GMHA 3VC2A 2EXXA 4R5HA 3OH8A 4NMHA 1UXGA 2WQ7A 2ODWA 4JLUA 4ON9A 2OAQ1 2FN3A 4PPNA 4PZ0A 4GLFA 4Q6WA 1CE8A 3HA5A 5CVVA 3Q88A 3JW8A 2JGMA 2A5FA 3JASA 1KKMA 3IDFA 3UW1A 1IHPA 2D62A 3HRIA 3K70D 2XA2A 3QX9A 3WIUA 5JAPA 2CMFA 3AHIA 3QNWA 3U7IA 3G2NA 1UBNA 4D9MA 5JISA 5EWMA 3V4LA 4EARA 4KSBA 1JKJA 3ICPA 2Z08A 5IDVA 2WYWA 3DLBA 2IEBA 4XEUA 3A4MA 4PV7A 1XAIA 1P39A 1YMUA 2PX6A 2ZRNA 4FMPA 1RWVA 1C1YA 3QUCA 3NNSA 4NHEA 4YJ2A 1NMQA 5K45A 4R01A 5D1HA 1LQ2A 1H42A 5HZGA 3KQHA 1PD0A 1YU9A 1DARA 2IXDA 4DXDA 4YRRA 3K0AB 5DTMA 1EXWA 4H1UA 4FMCF 3T0FA 5LBTA 4HQRA 3HXOA 4MWTA 1JAIA 4HPJB 2VI5A 1MAUA 1GD1O 3TSOA 4FEGA 4ZPXA 1DQRA 4KAAA 4HAYA 1L4KA 4B71A 3GN1A 2DQZA 5K3OA 5KOYA 3LOUA 2D1RA 1A88A 2H2AA 1R15A 2R4QA 4G26A 1E9RA 5ECGC 3IL2A 4ZK2A 1FQKA 5LSAA 3U5TA 3NC0C 4XWAA 2RHHA 5AR1A 4EL0A 2Q2OA 3G1UA 3AM5A 3UENA 4NV3A 5B7PA 3R6TA 1X7DA 5CM2Z 4GSKA 3OQHA 4OVKA 5CB4A 3SXJA 5JJKA 1IZYA 2CV2A 3PD1A 4CEIA 2QV0A 4O4LA 2ZAIA 4AKSA 5M2QA 1L2TA 5C1IA 4B9EA 4DMUB 4XVUA 1OAOA 4WSOA 5EHZA 1UQRA 4HQFA 1LJUA 4MP8A 4EG7A 4XVCA 1XTZA 2FZCA 5IBRA 1TW3A 3X1WA 4Q37A 3ZHOA 5IN5A 1KH1A 5A04A 4HQ6A 2IA5A 2SBTA 3A6FA 4TMWA 4ZPJA 3U7FB 2FU5C 3AR2A 1NN5A 3H4VA 3OT5A 1R0XA 5F76A 2Q0SA 4BE7B 3R09A 4J1SA 4OP3A 5EERA 3UIEA 4MK4A 5JADA 3O91A 1TKRA 2R11A 2I2WA 3KL4A 2GCOA 5DGCA 1T9AA 5I3CA 1A97A 2NSJA 1QGZA 1PK8A 1XVUA 5BWBA 3GC6A 2NP6A 1TUBA 3QVOA 5DW0A 3IALA 3I04A 3PHBE 5TV2A 3DZKA 2NZJA 2X41A 3ECSA 2XVMA 4IVQA 1NUAA 3E5NA 3HABA 3EXEA 1H1DA 3OEHD 4ND1A 4QSHA 521PA 5A4KA 1N2ZA 4MPPA 1Y5IA 1T3HA 2JI7A 1F8UA 1M2WA 2Z2JA 1GFWA 4H4DA 1RWWA 1MJHA 4WK0B 1KAQA 3VPSA 4KNVA 3GQBB 4WE3A 1K7CA 1O57A 2OFFA 1L4UA 4OFWA 4EOGA 5ELXA 3DD5A 4FDUA 3TMYA 3ZHYA 5DSXA 2JH8A 1E2GA 1H22A 1T5IA 2IPLA 2VPYA 2ZVDA 3V2HA 4B44A 1B16A 5AHXA 3LWZA 5TPZA 2O3RA 1PNQA 3V7UA 1YACA 1A9YA 1ZO8A 1CNMA 3LJKA 3AKYA 4B0OA 2QVBA 4YAGA 2QBYB 1Y34E 2IGTA 3EJ6A 1XRSB 2PNFA 3KXDA 4MPDA 4MRSA 3NIFB 2PS9A 4R7GA 1V96A 3AILA 1RJDA 3DKKA 3G9UA 3WC4A 2IUUA 4LA4A 4OIMA 4ARUA 3ADKA 2RB4A 5C3UA 3WLAA 3I9V6 4P7FA 4QJIA 4UTRA 4Z49A 3OOEA 5FLEX 3LQ2A 3RB8A 3WADA 2YN0A 2ZRIA 1GHTA 5JXGA 1KO7A 4CUZA 3PYXA 4E5YA 2X76A 2JGJA 1VL0A 3B2EA 3SJUA 4K03A 4ER0A 1D6NA 4CLOB 5D3MA 3KWJA 4BIIA 2JFPA 1YZYA 2VP0A 1M1YA 3S27A 3WIVA 1ECGA 1JSXA 3L0DA 3IJ5A 4B6QA 3KR1A 1ZCAA 1TVCA 4M0UA 5C0OE 2XB6A 1W49A 1OXVA 3H84A 1KY2A 3FDZA 4KRGA 4NFLA 3SF0A 4DRXA 2ZS7A 2BFMA 5AM3A 5K2OA 1QGOA 1P18A 1IZ9A 3PTAA 4EAAA 4O5AA 1N8SA 4EUNA 1OF1A 5CLGA 2J48A 4L6CA 5GONF 4GX1A 5B3KA 4JLVA 2Y93A 2FFBA 4FKBA 1BC5A 2IX3A 3NDJA 3O8QB 2P0YA 2XCLA 1WF6A 2P4SA 1SGWA 2HWKA 3PUYA 4MR8B 3EUWA 2IQ5A 4UXHA 2HJVA 2GK7A 4YT5A 5E3JA 1UT6A 1DO2A 3JAKA 3LLSA 3KFVA 1M6YA 3GYGA 3P4UA 3BE8A 1KDVA 3OZRA 2NV0A 4DUGD 3GLFE 2YWGA 1GAEO 4ZEMA 1ZIDA 3IFSA 4L0QA 4NP6A 2XMSA 4XXHA 3A04A 4XYMA 2V54A 4GUAA 4TKMA 3RUIA 2P2DA 1BCSA 3RYTC 3QPAA 3TBKA 4CHTA 3DG9A 3CLTD 3GDHA 4GL4A 4LN1A 2CCJA 1Y5MA 3L8CA 4RADA 1Z2CA 4RUKA 2C99A 1RRGA 4UMVA 3V8EA 4OI1A 3NVMB 1MC4A 3GLTA 3G5UA 2IUYA 2AZXA 1XZEA 3OZWA 4Y2JA 5ELMA 4TTIA 2JFXA 4KBGA 3WIOA 1OE0A 4AS3A 1OZHA 4ZOEA 3GJTA 5KTRA 5K3CA 1Z6PA 3OOSA 5KYUB 2FPGA 1GPDG 3AR4A 2VNAA 3IQXA 4COKA 1MAWA 2E4UA 4PY2A 1DC4A 4M7WA 1C3JA 1JTEA 2FAXA 1AQUA 1JG7A 5FOVA 4OHFA 2MU1A 1G21E 1OC2A 1JBQA 1E7RA 2G08A 1KDOA 3F96A 4GW3A 5FTKA 2AEEA 2BFFA 1LB1B 1R5NA 1TZKA 2J07A 4GUDA 4LG1A 4OJMX 2O8CA 2CK3A 2YVUA 4LC9A 3ZWVA 3JQPA 2FPLA 1L9KA 4N54A 1SJ9A 1T4BA 1A1SA 5CA0A 4ZVOA 2A8YA 1ATZA 3A31A 4OUDA 3WLEA 5FOUA 3TKLA 4N5IX 4MOWA 2J1LA 5KYNA 1FLNA 3BD9A 2XGJA 3R5TA 1ZK2A 2ZQ5A 1J09A 1XQ6A 1GN9A 1YB4A 1IZ7A 1G8JA 2ZT8A 4S0ZA 1AKRA 1ZD3A 2H4YA 1F2TB 1U9IC 4K9SA 1VG9B 1VSTA 2D7JA 1RAAA 2O48X 2R47A 4RW0A 2HCRA 2ZYDA 4WN9A 5IP5A 4DQDA 4R3NA 3JU3A 2I2XB 1SHTX 4YUAA 4ZJZA 1WUIS 1IEWA 3FZYA 1WL8A 4CN8A 5KTSA 2O8FA 3RKSA 4LRTB 1LK0A 3BE6A 2WTUA 2WD9A 2DUNA 5AVRA 3E1SA 1RABA 1S3FA 1JTFA 4QM6A 4BVJA 1J23A 1YRQA 4NV1A 1NBIA 2QLFA 3O21A 1EWVA 3MJCA 2ZITA 5FP0A 4AKEA 3LY7A 2OM6A 3MUEA 4RPJA 4UHDA 2OOKA 2DCUA 2QRQA 2ZBEA 3W4JA 4F91B 2C7PA 4C4YA 4UPVA 3FXAA 5EIBC 1RRCA 2Z3WA 1B0UA 3R76A 5LMUB 4OX9B 4AJNA 3KUCA 3OFNA 1EFVB 3TIXB 5KZMB 5L7WA 2R97A 2IZ1A 4TPKA 5TVKA 1KK0A 3EN0A 3UT5B 2F8TA 1RHRA 2IYZA 4LJLA 2QD5A 4XQCA 2V7QD 4DXAA 1KR2A 3N2ZB 1ZRSA 1M1UA 4NMXB 4F6RA 3EPHA 1ZBDA 1I1QB 2IPMA 3IUMA 5DN9A 5ITZA 1VLLA 3JX9A 4Q1DA 5F51A 3WO1A 4ZHQB 1EK6A 4BQRA 3T5AA 1W73A 5JPIA 2HFJA 3DLAA 1ZMXA 4QLAA 4Y2HA 2FEAA 3DC2A 1K4MA 4LRWA 2M6LA 5B1EA 1DJNA 1CEYA 1QYDA 1VLMA 3E3AA 3TZ6A 2WU8A 3ZU5A 5CVTA 2ZBGA 1L5MA 4HYQA 3PYLA 3I5UA 2IDJA 4MUHA 5DJ5A 3FYUB 2P9HA 4B34A 3VDXA 4JELA 3QYAA 3HVUA 4X45A 1W5FA 3MQFA 4AYXA 2HLHA 2OG1A 2V98A 3N5CA 3UM9A 3AI2A 2OLEA 2FFRA 3O3NB 5FFFA 4PHGA 3A9RA 4L3WA 1EESA 2IIVA 1VECA 4DA8A 1LJLA 4BRSA 1SCDA 1C4XA 2A3NA 5BSFA 1NKVA 2XYHA 1ZH2A 1LY1A 1PJ8A 1H2YA 2GETA 2P9FA 1R66A 2WYUA 1KQNA 5B12A 4U8GA 4D2IA 3C3DA 3F90A 4M2LA 5EIBD 3CXUA 3WFIA 5CB6A 4UASA 5ALIA 2WVGA 1YFLA 5IWCA 1GM5A 4ZK6A 1U5BB 3T3PB 3LBAA 5K3EA 1MD9A 4AJLA 1WKBA 3K9HA 2JGDA 2X19A 1NDHA 3ZW9A 3IEPA 2HCJB 3SJZA 1DBRA 2GMWA 3CEHA 3USZA 1U2TA 2FSGA 4Z9BA 3PGA1 5CNIA 2QGNA 3TUIC 3G9TA 2RKBA 3ZHTA 1J21A 1KI4A 2BUCA 2R7NA 4BZXA 3TDMA 3OZGA 5LBUA 1H6AA 1JFVA 5B6JA 1KFEB 1YD7A 1D09A 1WXIA 1YRAA 3WG9A 5CBPA 3SDSA 3JQAB 1JA0A 4C0KA 3TGLA 3IP6A 1UWLA 2FPMA 1EP2B 2GCEA 3ET4A 1IZZA 3PICA 5KTKA 1IVSA 1DTEA 3DHVA 4OGGA 2ORED 3BGWA 4GRAA 1T0IA 4L4RA 2C7VA 1GL9B 2YOFA 3A14A 2ERCA 4WZAA 2ERXA 1V5IA 4TS4A 4D0SA 1NRXA 4UUBA 5LZ5A 1V7PC 1ZYUA 5A9SA 3W04A 5CK4A 1TKAA 1JR3E 2B4YA 5LP6C 1J8QA 3REQB 3G8BA 4D9NA 2COEA 3R41A 2ILTA 1B8UA 3DNPA 1T8WA 4Q7KA 3TXYA 1SR8A 2BW0A 3K0CC 1L8OA 2VH1A 2P2GA 5J5AA 1Y48E 1SCKA 3PZBA 3U81A 4KLNA 4EPVA 2G9UA 3KSZO 2D8AA 5UKDA 3HXMA 2WG0A 3P94A 3AR6A 3IKMB 3E61A 3QPCA 5A7FA 1GU0A 1EIWA 1XBTA 2QRVB 3D7MA 3GJ4A 3KOMA 3LP8A 5I7VA 3RASA 5DW3A 1MZVA 5F64A 3QU2A 1U3DA 3X2FA 2B2NA 1AN0A 3TVYA 2V7XA 2WSIA 4FMBB 3QKSA 2SKEA 2CFIA 3E15A 2IS1A 4YA6A 5EPEA 1VB3A 5J40A 4JV5B 2JASA 3WRWA 1HE8B 1P74A 2RHWA 3CZ4A 4QWMA 4ALKA 2UYCA 3Q8KA 2OWDA 1F4PA 1FFEA 4GG1A 4AMBA 2X4DA 5C3MA 1R8YA 1YR1A 1V6SA 2HPVA 3IUYA 1DFHA 3UUWA 3NBXX 3OZUA 4K6OA 3FSEA 3UVEA 5KVCA 5HKKD 4TLMB 4F6LA 2NVOA 5F5XA 3E1GA 4O59O 3J7TA 5TXGA 2C59A 1X8JA 2EVWX 3JALA 5HW0A 1Z8HA 1DC3A 2ZBPA 4L9WA 4HS4A 121PA 2WE8A 3I30X 2EFDB 2AI3A 3LSTA 2WQZA 3ZY4A 4WNCA 4CV2A 3EVCA 1A8HA 2J0EA 3JZIA 2AG0A 3GPLA 3MUNA 4M1OA 4RXTA 4QXPA 3JWGA 3RS3A 2UZAA 1EDZA 1OXMA 3IOBA 4M88A 2XJ9A 1L5GB 1XVVA 1XZNA 2JD2A 3IUNA 1EFRD 4IGFA 4UEWA 2BT4A 4MUNA 3T5GA 4FCCA 1ESZA 1JXQA 4OREX 2V7GA 1QK5A 1FMJA 3CB2A 4NU8X 4Y2PA 3ZV4A 3OQIB 2FGKA 2X0IA 4M1WA 4PONA 2Q1SA 4WXPA 4WESA 2C9ZA 3A1VA 4U2DA 3RPEA 1M5RA 2IHNA 2YJNA 3QEBZ 4WUTA 4YHBA 5IAGA 3W8RA 2JZCA 1GZ6A 2GILA 2FOLA 1NUPA 1WG8A 2P4HX 3VI3B 5KWJA 2BJHA 5AHKA 2BOVA 2XR1A 3Q5EA 4GR5A 3BS4A 3RFFA 1PVOA 1TQHA 2H1VA 5A62A 1ENYA 4R2IA 2QEQA 4F9EA 1T1EA 4IZHA 1Q1AA 4ILKA 1TZCA 5L4SA 2N0SA 4KX3A 2IOYA 1LPBB 3GRAA 4ZAYA 1GG5A 4L9SA 3QKWA 3EPJA 2FY8A 1BHO1 3C6XA 3GGGA 3LPDA 4JBLA 4UAVA 1XN1A 1J8YF 2PFKA 2W83A 1EP1B 5G0VA 1H0SA 1M5TA 1SH7A 2BJVA 3OAAD 4KQ6A 4ME6A 3CPEA 4DLSA 1G38A 3QUBA 1EINA 4IYJA 2IYEA 4RGQA 1O8BA 2IDKA 4D9EA 1TPYA 4AK9A 1CVRA 3FPGA 4XFKA 3R7LA 4P0QB 2V4MA 2WWFA 4HWRA 5MGNA 2FVXA 1JSLA 3PDWA 4UBIA 3EGIA 4G63A 4BVKA 3QI7A 1E9DA 3G2IA 2CC2A 3OICA 5FI0B 2UXCB 1H8EA 5FWXA 2B4RO 2JLBA 3KZKA 2HJRA 3IVXA 5DO9A 621PA 4TOIA 3W1EA 2JI4A 5A3QA 4PLZA 4M7PA 1I4LD 2ERYA 1NAIA 3R3HA 4UZSA 3WB9A 3G0BA 3OPQA 3GA7A 1LPMA 3RS4A 4JK3A 2AQKA 2D5CA 5A02A 5A2GA 1U9YA 1PJLA 1WZIA 1TECE 3AJRA 3OLYA 3VR3A 2DWQA 3KKEA 5HVNA 4TV8F 1NIJA 1DHTA 1SKUA 2VNKA 5GJCA 5C1OA 1KFKB 1ADFA 5HZMA 3O9MA 2R6JA 1GA4A 2VSNA 2CWWA 4LDPA 4M1KA 4BWFB 4M1EA 1QG2A 3GCZA 1I3NA 1H2HA 1ICIA 4PCVA 3I0MA 3KFXA 3KDPA 4YAOA 4RTOA 3NTOA 3J80A 1THMA 3RE1A 4BLVA 3IQDB 1G17A 1PR4A 1Z63A 5HSGA 1BJTA 4FW8A 5HFJA 3W2TA 5DI3B 2AQ8A 1GA6A 2YZMA 2NWQA 3M4XA 3NWOA 2IPAB 5K20A 3B89A 3EIWA 1X87A 1NRWA 2RKOA 1Q7BA 2O6HA 4AG5A 3R20A 2OK7A 1T2DA 2PL1A 3D4LA 3N3BC 5JNRA 4EGCB 3AHGA 1Z0FA 4K9PA 4AUMA 1GSIA 4E15A 4J03A 4GX0A 2F55A 1EE9A 1OLUA 2Q4RA 3BXGA 4LBVA 1PTJC 2DF8A 3LUDA 4OJTA 5JOQA 1U0NA 1W96A 3K4PA 4O25A 5ALYA 5GY7A 1MB9A 1RCUA 3HY6A 1EXVA 1VIDA 3CF2A 1NFQA 5U9CA 3O6VA 4DNXA 5BVGB 3BFPA 1CY8A 2HMWA 2GT1A 1BMQA 2BMDA 2J41A 1JQ3A 1EHIA 1CUZA 4J0KA 3DDOA 4OOEA 2YWBA 4UEOA 4WRRA 5EXEA 3TAXA 1M7HA 2X8AA 2GD1O 1U02A 5E1OA 3MIZA 1S3SA 2PY6A 4LJAA 4GPIB 1FZQA 3F2IA 5BR7A 2IODA 1KYWA 3AH8A 2Z4TA 4HDRA 3RAPR 4RY0A 5AOAA 3GMTA 1WXWA 3CRQA 2WYVA 1G8YA 1N5DA 2Q7DA 1L4NA 5C46F 3NEJA 1WHSB 1ZNQO 3KQPA 4ZT2A 3BCSA 3HLYA 3FMFA 2WDZA 3CKKA 1CHNA 3IUSA 2EJCA 5EXDA 4J1QA 5TT1A 2YHIA 3AR5A 3C5WP 4MKRA 4H7FA 2XE8A 3U0BA 4ZT4A 1XYYA 1U7XA 3MWDB 5DHUA 5BOSA 3HCOA 2DFDA 4GFDA 3L01A 1BGVA 4DLAA 4B48A 5LZ9A 1YS1X 5A3SA 5A4JA 3MHPA 2HQ1A 2JIPA 2W2QA 2V7TA 3HYSA 2GZ2A 1WULS 3NEYA 3D8BA 2I7TA 3RGGA 2PXCA 1N0UA 1CJSA 2I7VA 5ESWA 3BPSA 4ZXPA 4ZCTA 4XUCA 1L5VA 2DFLA 1AV6A 3FSGA 4RJTA 2JKYA 4B45A 1IK4A 2X23A 5B36A 1JRLA 2JLRA 3TLYA 1E1LA 3HVJA 1CQZA 1G64A 3ELDA 4NYMR 3F74A 1UK8A 4A27A 5F1KA 3RWMB 3RG2A 3WKEA 1EZ1A 1U80A 1TRKA 4R7ZA 1AKVA 3WK8A 1RKVA 1NVGA 2IXBA 4JITA 2XPCA 1E9BA 2ZJ8A 2B83A 1G8SA 4CKCA 2YNMC 1A9SA 3SQXA 1FSSA 4KFSA 3ETHA 1IM8A 3GCGA 2ZTMA 2ZRFA 4O3MA 1W1UA 4CCWA 4QOEA 1NF9A 3IXLA 3S4YA 4Q3NA 2FZVA 3EPPA 1Z2DA 2RBGA 3F3SA 3ZY2A 1DBSA 1T2EA 5IKEA 3W5JA 4JYAB 3HWSA 1HQKA 4R8SA 4L8WB 1CNEA 1IN5A 5EWJA 2EW1A 1RYZA 1XLTA 4OFXA 3EQ9A 1M3SA 4HKTA 1KTVA 1KYQA 3C15C 2HL6A 2VT6A 5E8RA 4ER7A 2JIBA 1GXSA 1U8ZA 4MLCA 4KVFA 4XWTA 4OATA 3CTMA 1F1JA 3QPVA 2C77A 4BJ5A 5KVQA 2VYNA 2DWOA 3DH0A 3HS3A 2DETA 5HM6A 2RG1A 4XX1A 1M2HA 1NRIA 1EAYA 1A2QA 4NFHA 4RWZA 3Q0TA 1U7PA 5K8VA 3ITEA 4RACA 1OA0A 3S1AB 3KCNA 3TCXB 3K30A 2GM4A 2CV0A 3B9RA 1V6AA 2FQ1A 4IIXA 4Q3EA 1RJFA 1J7KA 3C14C 3QLUC 3ETGA 4UM8B 1J99A 4IGAA 3QRWA 1RHUA 5FTWA 1IXSB 2AZ4A 4D9IA 2VAPA 5LQSA 1E3WB 1LSSA 2GD0A 4NG5A 5C51B 4MDEA 5LMZA 3T5PA 2JS7A 3PG5A 4LCBA 4OA5A 3LBIA 1XZKA 3O3OB 5A05A 3SXPA 4ZCQA 2VP4A 5ALTA 2Y3IA 4J0JA 1C4KA 2PO5A 1V71A 1SUPA 1US8A 2DCMA 2H3HA 3GMSA 3IBTA 3MWGA 2JAHA 4WOKA 3UWPA 1MAAA 2J5XA 3QU4A 3ZGLA 4MQEA 3K5IA 3P2KA 5DM70 1V1MB 3EMVA 1ZJZA 4UHJA 1FYFA 2XVAA 3AP1A 4TS9A 3VKGA 4P98A 3VHXB 1ZHOA 2QW8A 2RGCA 4DDMA 4ZFNA 5AW4A 1LDYA 4X65B 5DLYA 4UU1A 3H0EA 4MW6A 4P36A 2JEZA 4R2LA 4A8TA 2H3EA 3QEKA 2L19A 5CPBA 5KVVA 6Q21A 1H69A 2C4WA 1DNPA 3OURA 4LJRA 4DZZA 4L5JA 4LF4B 2A1IA 1NM5A 4XSHA 1NUHA 2ANBA 2BRUC 3RGWS 3LCJA 2IPXA 4LZZA 1OZFA 2XZTA 1T6XA 2CHVA 1H9AA 3RIXA 1ODSA 2X2FA 3EGDB 5JQGA 3A6HA 1DIOB 4HXEB 4M54A 4QASA 4WOPA 3TOZA 4EUEA 4F86A 2XHEA 2XCQA 4L95C 1NPYA 2WJYA 4C14A 3ACBA 3IIJA 2Q5FA 2FR8A 3CPJB 4N5DA 4V0LA 4B85A 4U7DA 4LYJA 3QVGB 4C05A 1FVXA 3LHDA 5CP8A 3FJOA 4DB4A 1IMJA 4M83A 3HJUA 1TTQB 2HCBA 4GMKA 3V7NA 1R5OA 3FYHA 4W1SA 3TJZA 1F60A 4V03A 1G7RA 2OWEA 1BE1A 2W2XA 3RR2A 4AJEA 3BMOB 3PVZA 1S89A 3G0CA 4K88A 4NYJQ 4Z4HA 4GP9A 4JU8A 3G5LA 1Y9AA 4UBKA 2AXPA 4MRNA 5IUKC 5AM0A 1Z0AA 4CM5A 5CX1B 3THXA 3GEIA 3SBXA 3PFNA 4R1QA 4UM9D 3UOGA 3C3CA 3WLNA 3PXCX 2ZRDA 1JIJA 2Y71A 2NP7A 4LOHA 5HQJA 3W2IA 4N0QA 2QUAA 3JQ8A 1H94A 1CJTC 3RSLA 3U9LA 1QG0A 3HZOA 5B7GA 1Z0JA 5I7HA 2ZUEA 1XZQA 2E82A 2VSQA 2I4NA 3OA0A 3HU3A 3JVDA 1XC7A 3ENQA 2H4WA 4DMMA 5J4KA 2Z6UA 5KSYA 5TGZA 4K9RA 1S8AA 3RSSA 4FKMA 3GP5A 2HRRA 2EG5A 1KO1A 1HT2E 3FOWA 3EHDA 1NURA 2IZOA 4C01A 4MUYA 3ZHZA 1URPA 1XHEA 3FVTA 4JC8A 2ZCUA 3VV2A 3WJ2A 4CMEA 3N2LA 1TZBA 2X2EA 1AKTA 5LB4A 2P7HA 1L6RA 1CUVA 3IERA 3DBRA 4RY8A 3W5CA 3DLPX 3I6YA 3ZJ4A 2OZPA 3DZJA 1L8QA 3UJHA 3QYPA 2LGJA 1WOMA 3REOA 3WHPA 1P1JA 2P6UA 4D9BA 2VR1A 1Z2NX 2WZBA 1QS0B 4DCNA 4CTNA 2AFIE 1WXHA 2FYTA 1J2UA 1EP9A 1CDDA 2ZJ3A 3BWMA 4GZLA 3V8NA 3ZCXA 2O2GA 7MDHA 2YVAA 3RRNA 2HC9A 4C04A 4HSEA 5I4IA 1LC3A 2AZMA 1T5BA 2O1SA 2VDKB 1N7IA 3RJ9A 2NU8B 1EB8A 3IELA 1Y4ZA 1XEWY 1DDOA 2VUTA 4YVFA 2IOFA 4K9LA 4YAWA 5K3FA 4B7UA 2PX8A 3UBMA 1GO2A 2H1HA 4YRTA 1RM3A 1XTJA 2OHFA 2DR0A 1V26A 3CWQA 1SK8A 4G09A 4JC5A 2NXEA 3DFKA 4RK6A 3I6IA 5TQVA 3EOBI 2WAMA 2YCLA 1FU8A 3OCXA 3R3XA 4EKIA 3H6HA 2HN9A 2WG2A 3DZHA 3E22A 1U6JA 3LQRA 4HADA 4YP5A 4LQDA 5BNWA 2A5LA 2BZSA 1GG9A 3ZH2A 2AOXA 3ZPXA 1UC9A 3DXYA 3UH1A 4AKGA 1TCUA 3GVPA 4Q24A 4ZJUA 4HEHA 2PCLA 1ZM4A 2G5PA 1N0WA 2QL9A 3DT6A 4OGWA 5DCUA 5BQ3A 3DDUA 3LT1A 3D4PA 3OZ7A 4IHAA 3KHSA 5SYMA 3VOAA 2FWPA 2JJMA 4JI6B 4QX6A 2J9YB 2UKDA 3T94A 3YASA 1WLYA 1O6CA 4EHHA 5LQCA 2C1EA 4KPYA 1QIDA 1E62A 2BLLA 3SYTA 4XYGA 4CU2A 4JS0A 4C2TA 2VHQA 2GFQA 4BJ6A 5JH7A 4HUTA 1N5RA 2GBIA 2GYYA 1YDWA 5K5EA 4O5OA 2NZUG 2HK9A 4IHJF 4PPGA 5E4JA 4F3RA 5I9TA 3Q8LA 1KP9A 4LV8B 4G1BA 1Z5UA 1SD5A 1XAHA 2GRAA 3FLMA 4J0EA 5EY5B 4HDSA 4EI2A 5JMWA 1Q6ZA 4BNZA 4YCAA 1QZZA 1C2TA 2XDWA 2NXJA 4JEUA 4CDRA 4MIOA 3K5PA 1CUJA 9ATCA 3SZMA 1SBCA 3OJEA 1XMVA 2AJ8A 3QXJA 5AJUA 2WKRA 4CQMD 3ZHSA 3SQOA 3A6DA 4ABTA 3WJ1A 1IG0A 2G6BA 1Z28A 3G9XA 3KSMA 4PC6A 3WWYA 4DCPA 2KE5A 4J0DA 3L8MA 4HQ0A 1EUDB 1U0OC 1SUWA 2G0TA 2JJ2A 4PZDA 5FADA 3DAFA 4A2PA 4ZYUA 5K6RA 4J4BA 1VBKA 4XIFA 4AWBA 3NHZA 4EKNB 5AW8A 2EEPA 1J8FA 1Z16A 4CFZA 3CF4G 5LQUA 2AHOA 2ATIA 1ZOOA 4ZZ2A 2P75A 3ID6C 3ES9A 4MJ3A 1PR2A 5CR9A 4UOQA 1XF9A 2WILA 1GYQA 2D3TA 4LCEA 3V1YA 2BR5A 4P3XA 3RD5A 3P71T 2GTHA 2DWUA 5G1NA 3B3GA 5JHHB 1ZOSA 1VLZA 1JIXA 1K3UB 3A4LA 4ARZA 1K5GA 2EP5A 1CULC 1P2SA 1U4NA 3UQYS 2DG2A 3ZWCA 1OTXA 4R1TA 1TK3A 2AWOA 4XCXA 4LX8A 3CPSA 4L8LA 4R6WA 3VSEA 2O2DA 3W4IA 4BHTA 1CIPA 2G1AA 2C03A 2CMKA 1GQRA 3IHWA 2VJNA 2QAGB 4UPEA 2CUTA 4Q9IA 3JWEA 3QE0A 3ZWYA 1UBSB 5BN4B 4WBSA 5J9FA 1B26A 2IHJA 2GOYA 3GR6A 3L05A 1A9RA 1LBSA 3FA2A 2DWPA 3HDGA 3L1IA 4N7JA 3V7FA 1QLJA 3Q6IA 1DEKA 3VX4A 4F0JA 4R9NA 5A1JA 4R2HA 5ITVA 5HBRA 2I5PO 4F84A 1GG2A 3QXXA 3LCMA 4XM0A 4XI9A 4HT3B 1IHDA 5KO2A 1BOFA 4WCDA 2J3QA 3QMMA 1E7QA 3E82A 1D1TA 3EOAI 5H16A 1HRDA 2X9GA 2ZAYA 1RMTA 3ZDQA 1NJ5A 5B6IA 4F12A 8ATCA 2X8WA 3AESA 2BTQB 4UU8A 1YBMA 4I19A 1QLHA 3HK2A 2EOAA 2M2IA 4MKZA 4LS3A 1N9ZA 2PANA 2ACEA 4B74A 1B1AA 1F6WA 5I9BA 5I9NA 3W8NA 1UINA 3CS3A 1WUHS 3T4EA 1WEKA 4CMIA 3W6PA 5CD1A 4GDFA 4CTMA 5B3LA 2NLOA 3ZD8A 2E55A 4AF8A 2RG7A 2CHEA 4JLSA 1QWOA 4RZ3A 1ZM9A 2Q2WA 3UK6A 4TTAA 1SG0A 4AT1A 1P1FA 1RFGE 5JS6A 4X6UA 5JAHA 4FCWA 4QRHA 3VR4A 1WDWB 1A50B 3E3LA 3LZCA 4RX1A 3SP1A 3H05A 2IWRA 3F6SA 3N3AC 3D6UA 1ZUD1 3T95A 4I4NA 3THWA 3MIIA 3NV9A 3PUJA 5D8DA 1XU7A 5HDBB 2D4HA 3TZEA 3BXFA 2I4LA 2PX5A 1NP3A 2BI8A 1QVRA 1B8NA 1G4UR 2PIAA 4RWEA 4U2FA 2HMSA 1N8NA 1X3LA 3GLHE 4TQ9A 4D3ZA 4DPMA 4ZGBA 1JR2A 1KEKA 4BXOB 5FBWB 1E58A 2Q5EA 5BR8B 1TVKB 1TMKA 4QODA 4MQ4A 5FX2A 3EE6A 4X44A 4EMSA 1V25A 4IDGA 4Q3CA 3RBAA 3TG8A 3FAKA 4IXMA 3D6NB 3TWOA 3ZDXB 1I2CA 4N5LA 5A9TA 3MBKA 5T8KC 2GF0A 3BJZA 1R4NA 3G2HA 3K05A 3VAAA 4YUYA 4OXNA 3FFTA 4CIAA 1NV9A 3DT8A 3KELA 3FTEA 2J9FA 2MSNA 3D43A 1MO3A 2B99A 3JCZA 4PLYA 4YFVA 2BMWA 1RJEA 4UCWA 4W63A 1G42A 2P2YA 2PR7A 3GI1A 4N0PA 1SHLA 5JRJA 1N2XA 1FMFA 5DBHX 2IUEA 4B3SB 5FUXA 4TXMA 1WS6A 3ZW7A 1DSSG 2BJWA 2VLBA 2CXNA 2QSYA 3BBLA 2ZQZA 4W7SA 5BSMA 5C31A 4OX9Y 2HW8A 4TTVA 1MRNA 3VPDA 5J47A 2GCGA 1LZLA 2GO1A 2VTKA 1WO8A 4Y2RA 2CFCA 2EZUA 5IF3A 2HIHA 1CP2A 1Q12A 1F5SA 3PC4A 4PNZA 2AGVA 1PT5A 2L2QA 5EMNA 4P3YA 3ROMA 2EWWA 2YWEA 3LQFA 4A8HA 2OGZA 1KZ4A 3N1UA 5AVTA 5GADl 3NM4A 2E3JA 1K6MA 2YDXA 2XTAA 3P2JA 4BAGA 3OE7D 1JBKA 2OM2A 2AN4A 2DFTA 5AJHA 1VE5A 1H5UA 4L08A 1G9TA 4YB8A 4LSWA 3WHIA 4EYSA 1UQTA 1VCNA 3OP4A 1DOHA 5L45A 1DC7A 5EIAA 3Q4GA 5LCXA 3E1KA 2GN0A 3X1DA 2Z2YA 4FE3A 2P68A 2EFJA 1QE0A 2H0RA 1TJ4A 4WJZA 3RO7A 5LZ4A 1JHZA 4EHIA 5EINA 3FNBA 1JXOA 1SHUX 1ZICA 3ZDFA 3HG7A 2PZGA 4UMFA 2HBZA 3DCYA 5K99A 3H9UA 1M6NA 2I1LA 3DVRX 4JA0A 5TEVA 3TTXA 5JSFA 4GWKA 1NR5A 4C06A 5I7SA 3EXHC 3EY9A 3INGA 4I81A 4F7DA 5KNCA 4CQJA 2VK1A 3DLCA 5I5GA 3CN7A 2UYHA 3T7IA 4OPMA 4BWGA 3TXXA 1O5TA 1H3NA 3KPUA 2RCYA 1EVEA 2C0QA 1ZU4A 4IIGA 1E9VA 2XNKA 1R0KA 4F56A 5CDHA 1QZTA 3IT2A 4M99A 2QN8A 4JYCA 3DMRA 4RK0A 2JZNA 2IS6A 4YJ3A 4RTPA 1CLUA 4CEJA 4Q4AA 1Y4DE 1NQWA 2C84A 3O75A 2IYOA 4C4XA 5C53B 1VI6A 1PWXA 4B6PA 6ADHA 1YZNA 4U9UA 3EZGA 4GLOA 1FCJA 3NNNA 1W59A 3D2BA 4O29A 3I72A 3F47A 3FAZA 5TSDA 4QA9A 1NVFA 1NYLA 2FW6A 4IJQA 4NZMA 4TWBA 3QM1A 3PTZA 2HIMA 4MYUA 4XCVA 2YIJA 2PS0A 1PWEA 5I7AA 3R7DA 4KPGA 4C4PA 4HXGA 4TKUB 2D6FA 1M6VA 3H1EA 1YRHA 2VIIA 3P96A 5EL0A 3ADPA 4YMIA 4QTTB 1FP1D 2G4CA 2PKCA 3C74A 3PFGA 3RV4A 1PJ2A 4W9RA 1EVLA 5LU8A 3TVDA 1ZGHA 1BWRA 2FFAA 2GKGA 1W0JD 5DHPA 4OHYA 3EW9A 4ENWA 2HGZA 3PTLA 3ZWXA 2UXBB 1ZEJA 4MUFA 4X1KB 4BMSA 3R3WA 4CN9A 5K4HA 4FYIA 2WRZA 4QOFA 2VN8A 2W48A 1P0FA 5K0CA 2C5SA 2C98A 1KQPA 4OJQA 4PBSA 5EHXA 4BMDA 2R5FA 1TNDA 1XJCA 2XVZA 4WZZA 3TFWA 4S12A 3T5TA 4GGPA 1T29A 1MMFB 5TX7A 1VGRA