4OGLA

X-ray structure uridine phosphorylase from vibrio cholerae in complex with thymine at 1.25 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
247
Chain Sequence
b'KTVFHLGVTEADLNGATLAIIPGDPARVQKIAELMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVPDFDVATAMKAAAQESGATVHMGVTASSDTFYPGQERYDTFTGRVVRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRTQKEIPLKETEARSIKVVVEAARKMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure uridine phosphorylase from Vibrio cholerae in complex with thymine at 1.25 A resolution
doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 93
structure length 247
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oglA00
1Z5PA 1PK7A 4X24A 1U1DA 4R2WA 3PNSA 4M7WA 4JOSA 1PR6A 4R31A 4TXHA 4BMZA 3D1VA 1Y6RA 2Q7OE 2HSWA 4LNAA 4DARA 3LA8A 4TXNA 1Y1QA 3LBAA 3OOEA 1Y1TA 4WKBA 1RSZA 3BJEA 3EUFA 3PNPA 1V48A 4RJ2A 3FUCA 4JWTA 1NC1A 3UAVA 1Z36A 3LGSA 1T8WA 3ODGA 3E9ZA 3FWPA 1ODIA 1V45E 1ULBA 1V41E 3IEXA 4EARA 1PR4A 2HN9A 4FFSA 1TD1A 4DA7A 3P0FA 3E9RA 3MMSA 1PW7A 5C80A 3UAWA 4DAEA 1OV6A 5F76A 2QDKA 5F77A 4BMYA 4DAOA 3DP9A 4GKAA 3E0QA 1VFNA 2OC9A 1M73E 1JDTA 1OTXA 4QARA 3O6VA 4OF4A 4DA8A 4NS1A 3DF9A 1Y6QA 5F7XA 4P54A 2AI3A 1PBNA 1LVUA 4L5AA 4TS3A 1RYZA 3BL6A 3KU4A 4DA0A 3OPVA 2AI1A 1RXUA 5F7OA 1JDZA 3ENZA 4EB8A 1TGYA 5I3CA 4M1EA 1Z33A 1SD2A 3C74A 5F73A 1PWYE 1VHWA 3K8OE 1ZL2A 4M3NA 1YQQA 3IOMA 4TXMA 3ONVA 3SCZA 1VMKA 1ECPA 1ULAA 5B7GA 1K9SA 2HWUA 5IU6A 4LZWA 5K1ZA 1NC3A 4JP5A 4PNPA 1CG6A 3FNQA 4K6OA 1B8OA 4F3CA 5CXSA 4U2KA 4G89A 4TTJA 4LDNA 1Z5NA 1Y1RA 3OZDA 1T0UA 3KUKA 2A8YA 4L6IA 1RXCA 5KB3A 1OTYA 1CB0A 3T94A 4L5CA 4UC0A 1JP7A 2P4SA 2HRDA 4OGLA 1SQ6A 4YMLA 3NM4A 3BSFA 4PR3A 1SJ9A 1PF7E 4DANA 1Z39A 4GLFA 1TCUA 3UAXA 1OUMA 4YO8A 4DA6A 4F2PA 3OCCA 1YBFA 1Z34A 3KVYA 5F78A 1TCVA 3KVVA 1NW4A 1ZOSA 4F1WA 2ON6A 4WKCA 1ODLA 5CYFA 1TGVA 5CCEA 4D8XA 4R2XA 1JPVA 1SD1A 5DK6A 1A9RA 5CYGA 5B7PA 2GUWA 1RXYA 2I8AA 3U40A 3KVRA 3QPBA 2QPLA 1VHJA 4F2WA 1I80A 3FB1A 1N3IA 4MCHA 4BMXA 4ECEA 4QAQA 2RJ3A 4YNBA 2QTTA 1FXUA 1V4NA 3OF3A 1YQUA 3NBQA 4D8VA 1PR0A 3OOHA 4QFBA 1RCTE 4OGKA 1U1GA 5ETJA 3GB9A 2OC4A 1YR3A 1K3FA 3EMVA 2IQ5A 3PHBE 4DABA 5FAKA 3GGSA 5CCDA 3NM6B 1OU4A 3INYA 1A9SA 2A0XA 4TTIA 1JE0A 4GLJA 4QATA 1Z37A 4L5YA 4OY3A 3K8QA 2B94A 4I2VA 2PGAA 3F8WA 4L0MA 5IFKA 1G2OA 4IP0A 2I4TA 1PK9A 3KHSA 2A0YA 1T8SA 3UAYA 1T8RA 1ODKA 4WKPA 1LV8A 4G41A 4D8YA 1OVGA 3MB8A 1PR5A 1QE5A 5JPCA 1YRYE 1K27A 1U1CA 4LKRA 4G8JA 2AC7A 1A69A 1ODJA 2QTGA 1T8YA 4TXJA 1A9TA 1V3QE 2BSXA 3FAZA 1C3XA 2A0WA 4TTAA 4MCIA 4H1TA 5F7ZA 3UT6A 5B7QA 3DDOA 4MARA 3TL6A 1A9QA 4QEZA 1Z5OA 4TXLA 1JDVA 4GMHA 2ISCA 2OXFA 1RT9A 3UAZA 4F3KA 3BGSA 4OJTA 2OECA 5EFOA 5F7JA 2QSUA 1RXSA 3OZCA 5EPUA 4BN0A 4E1VA 1PKEA 1B8NA 1U1EA 4WKNA 1JDSA 4TYMA 4QASA 4KN5A 2H8GA 4YJKA 1U1FA 1PR1A 4NY1A 1RFGE 1LX7A 2AI2A 2XRFA 4WKOA 1RR6A 1XE3A 4NSNA 1V2HE 3EEIA 1Q1GA 4TS9A 1JYSA 5B7NA 3P0EA 3NM5A 1PR2A 1Y1SA 1A9OA 3PHCA 4LNHA 3EUEA 3DPSA 1JDUA 1WTAA 5CXQA 1A9PA 3O4VA 1Z38A 1Z35A 4D98A 4OEHA 3DJFA 1JE1A 5EUBA 3FOWA 3OZEA 4D9HA 3OZBA
chains in the Genus database with same CATH superfamily
5FB3A 4GOLD 5L4LA 4P22A 4CXMA 1YQTA 2WPDA 3EARA 1USUA 5AVYA 3P26A 1CIVA 1WV0A 1JX6A 3HCFA 1N25A 5E95A 3CZCA 5TEWA 4B5LA 3HUDA 3QLTA 4GLBA 1TLLA 1C4KA 1FX0B 2IY9A 4S04A 3GJXC 1R6XA 2H9IA 4L51A 1OLSA 4DN6A 5MN4A 4BU0A 2PS1A 1Z63A 2ZBVA 4C7KA 2P9BA 4CEIA 2Q4DA 3K9QO 1YA6A 1CY0A 1E7MA 2PX6A 2IHTA 4EB0A 5LP6B 1KU0A 3SM9A 1ZH4A 3OLCX 4LJ7A 5AI8A 3HPQA 4BO9A 4YX9A 1V16A 2WM2A 3AR4A 3CLTD 3FUWA 5A2QA 1LW6E 3BJEA 2QAGC 1SGWA 4B3FX 3PICA 4HO1X 4RJ2A 1H2EA 1OAAA 5IAKA 4YJHB 2F59A 2IYYA 4E6EA 2UZ0A 2HCTA 3ZJ4A 3VJLA 4TTRA 3ZX4A 4CMJA 1CK4A 4CQNA 4AKTA 4GEGA 3ZS9A 4E5VA 1BXGB 3Q1KA 5GWXA 3WKEA 3A1NA 3JQ7B 5FTKA 1GRQA 2FSPA 4DC9A 4ZDIA 1BS9A 1QNFA 2XUZA 1DDIA 1P7ZA 3PWZA 3K0CC 1FFSA 1FRZA 4TV8B 5I7WA 2R6CA 1YQGA 4I5GA 1OZFA 1AZTA 1GDHA 2FZCA 2VAPA 3PLAE 3BB1A 4DJTA 1RKVA 3Q3CA 4DUPA 5K9ZA 3SKYA 1ZM2A 3BPSA 3W05A 3K9NA 3HVKA 4Q6BA 5CDFA 1WEHA 1G6Q1 4GQAA 1ZD1A 1B6GA 1WKVA 3Q41A 5H3HA 4WH0A 2PU7A 3GLFA 2W8BA 4YRNA 2WJAA 2JFXA 3JQBC 3LUKA 4CNBA 1T1GA 4ZI2A 3NBMA 2CDNA 4YFYA 4DAOA 3DP9A 1UBLS 1LDYA 2IE0A 1N9GB 1RHJA 2HCRA 4CHGA 5BQ3A 2VKTA 2Z9BA 2BR3A 5C7LO 3E0QA 2Y1XA 5IT4A 4MRRA 2UZ4A 1HNWB 2PQ0A 4ZQBA 3ZIAA 4HHEA 4HKTA 5G0TA 3R3HA 2DPHA 4CMEC 2VA9A 3P0RA 2OO7A 2Y1DA 4KE9A 5CK5A 3ZCPA 4E5NA 5IT5A 3CW9A 3G1WA 4R2IA 1YI8A 4NK5A 3FSRA 3PT9A 4CV1A 2J3LA 5KTRA 2FLWA 3NH9A 3B6KA 4YUAA 1MBZA 3ETHA 4P54A 5HS6A 4YJFB 5A6SB 5FCDA 1ZL0A 1H9BA 5TQ0B 3C85A 4ROTA 1KY2A 5CU7A 5BV8A 2O05A 1D2NA 1R18A 1OXBB 3HSKA 5ALJA 4AMVA 3VR4A 3G0DA 4ZC1A 5BN5A 1E1KA 5CJPA 3KB2A 1PWZA 3DL0A 3WLKX 4RYLA 2BR4A 2WD9A 1KP2A 4P6VF 5I4BA 5KWIA 5EKSA 3VMMA 1J2UA 4J94A 2IYUA 3LK7A 4FFDA 2E3JA 4PQGA 2V74B 5KU7A 2DCUA 4G8DA 2RIPA 5DW0A 1VKOA 4JLMA 4V2UA 3ICOA 3FKQA 3BDAA 4EP1A 5LUAA 3NNDA 1HO3A 2X2FA 3FNGA 3N6RA 1BYUA 3SC2A 4IZOA 5JT1A 4KPUB 5DW3A 3V9AA 1G3UA 2COEA 3C5EA 1JIQA 1KBZA 4EB8A 2FSVA 2C4KA 2W6NA 1G8YA 5AM0A 1U90A 4ZAFA 2OTCA 4Z3DA 1DOZA 2VJOA 1VSBA 5HOEA 4EGAA 5K7SA 2EBFX 1T0BA 1GA4A 3M7IA 1GARA 1JH8A 2B5OA 3BJMA 1GPJA 4B4OA 3MWJA 1XQ1A 3CSUA 2NTVA 4M55A 4CV2A 4EIWA 2ETXA 4M83A 4JNKA 1ZA2A 2E5WA 4JEHA 4X7PA 1U80A 4DLZA 1USWA 3MLBA 5IN4A 4B84A 2JLZA 2V5AA 1YS1X 2HSJA 2NO1A 5JFOA 2GPJA 4WKGA 3OO0A 4HAIA 3QIVA 4DLNA 4WCDA 5HFAA 2E7ZA 1JFRA 1UP7A 4YEDA 1EVLA 2BYTA 1JH9A 1MXHA 3EH1A 4AQDA 3IA7A 2AYXA 2WUEA 3M83A 5J63A 4C89A 2O9JA 4NZYA 5DKFA 1PHPA 3CWCA 3EYAA 3JQGA 4D4KA 1IPFA 1NBIA 2E1RA 1KKLA 2PS0A 1U2SA 2Q99A 3HR7A 4WA7A 4W7HA 4ECAA 5TT1A 4TV9A 4AY5A 1CUFA 2HSGA 3JZDA 3S70A 5K0EA 1WNFA 2WU3A 1AK1A 1X9HA 2OHVA 3O94A 2R751 2FN7A 4PNPA 3SPXA 2ZM6B 2BM0A 5F12A 1ECGA 4HFMA 2AVDA 1II8A 3OM9A 3T7AA 1N5OX 1RC0A 3UEOA 3DDCA 4MPRA 4FNAA 2BMVA 1HTBA 2Y6VA 1PZGA 1PUJA 5C9ZA 1LVGA 1WE2A 5KJFA 2A14A 2IWHA 1EXNA 3B2QA 2I4LA 3OKAA 4FE3A 3M5CA 4HNSA 1QU3A 2WFZA 4IOMA 3F47A 1J2TA 3V8BA 4YP0A 1QLJA 1JLHA 5BYKA 4GW3A 1V3VA 2NTEA 2ZBFA 1BX0A 3DMPA 3AFMA 4HDNA 4G89A 4XJXA 5FF9A 3UHJA 1RWWA 1Z5NA 4EOGA 4RWZA 4DLTA 1GLVA 1Y1RA 1I1NA 1ZUWA 4J0QA 4ALIA 4BFYA 2B30A 4F11A 3EG9B 4EITA 1XTVA 2AYZA 1G17A 2IE8A 4QT0A 5IDQA 3LDUA 1MX5A 1VA4A 1AVTA 4I7EA 4ZVRA 1EB9A 1J5EB 2P2LA 3OIFA 5DZSA 2XVYA 3MINA 4MIEA 1H2XA 3CLSD 1I33A 1BQEA 1MA3A 1UKVY 1DUSA 4ETNA 3MQ2A 3WMWA 3SKVA 2G7MC 3LO5A 3W8DA 2D2VA 4FW8A 5EOVA 3UO8B 4ITRC 3W3AD 3WVNA 3HB4X 1XPJA 3PIIA 4Y1GA 1A7AA 3NO4A 5K4HA 2O4CA 4XD2A 3ZPXA 3ML1A 1GAQA 3CLRD 2AHOA 4JJEA 4CM4A 2HAEA 3ET5A 2GBLA 2YJNA 4UM9B 1EBUA 5GJVC 2HXSA 2I3BA 5IJ9B 4KMSA 4R98A 3WLTA 2R8ZA 3FDXA 3T06B 5LWHA 2FHPA 2AFHE 4UREA 4MQLA 1V95A 4ZVUA 5LZ9A 4TKLA 5A71A 1ZG3A 1GV1A 1WRBA 2A35A 2P75A 1HOXA 2XH8A 1I4OA 4FGJA 4GLFA 5D2CA 3V46A 1YZVA 4DA6A 3M4XA 1ZH0A 2H1OA 5IDWA 3OQPA 5D6OA 3SHTA 1Y9ZA 4PM4A 3C8ZA 5LOVB 5I9NA 4I55A 2PGLA 3GPLA 3OWHA 3WL6A 1GL7A 1FNSA 4ENVA 2M6SA 1G8PA 1NIPA 1D2HA 4ALKA 3TTXA 3SYKA 4XFDA 3SJBA 1TMKA 2AL7A 2UZ1A 1E32A 2PDAA 3NIWA 3F97A 3GD5A 4M37A 1SC6A 4KXXA 2DR3A 2GXUA 2XWQA 1G20A 2R62A 5ADHA 3WP0A 3AEKB 1VCHA 2N42A 1RYBA 3GY0A 2OLEA 3KZCA 2F00A 3FCUB 4JXKA 3R7WB 4DDKA 5HM6A 2RFLA 4LJKA 2PKQO 1P9NA 3VKVA 1XVVA 3VPDA 5CVCA 4B7UA 1LB1B 2H0AA 3ZHQA 3PPXA 3NGXA 3T12A 1GUDA 4PZ0A 1UBNA 4F2HA 1RXVA 1UBHS 2OENG 1BNCA 3EZGA 7AT1A 5DN9A 3NT4A 3JYQA 1XRQA 3EHDA 4B9EA 4CIWA 3IDQA 5A0TA 1R5NA 4KFTA 3E1KA 3WLNA 1Q7EA 2WYWA 2ZPUA 4IIBA 1UIMA 3TSWA 3T1HB 2R7LA 5SY4A 4G0YA 1YVRA 2BTQB 4RJKA 3N2KB 1T9GR 3WKBA 1RLJA 2RJ3A 4ZC8A 1P7WA 5IEBA 1GXSB 3OFKA 1QGAA 1OZ0A 4I5EA 4W5HA 1GSOA 2BHLA 1DLJA 3NBQA 1Y34E 1RKBA 2BEWA 1Y7TA 2WIFA 2C92A 2FPGA 4YXFA 4MWDA 3BD6A 3WQSB 1Y3HA 1BU5A 1EK6A 3E23A 4UD6A 1N4DA 1XJ0A 3WR5A 5B5SA 1B14A 3K5HA 4AK9A 1YSCA 2PYZA 3EVTA 1EX1A 3ZOKA 3OFSA 3NYRA 1L5NA 1RJWA 4BNIA 1IZZA 1MC4A 5CT6A 4GHWA 2DGDA 3VVBA 3B3JA 3BTUA 1M6HA 1LW7A 3S2IA 5K6TA 2WFAA 3ZDRA 1PQPA 1E3WB 3AK4A 4P82A 2TMYA 5E7MA 3WA7A 2XI4A 4F0JA 1XHEA 2WJZB 3E53A 3VJRA 1WF6A 3GP8A 2A5GA 4HDKA 4IQFA 3RC7A 5IXYA 3E3AA 4M6WA 3HXTA 4YHBA 5AQEA 3DLIA 4EGFA 2P8JA 2ZETA 5BRJA 2BZSA 2Q2OA 2GZ1A 3TIGA 5KC8A 1AKUA 3V48A 3O91A 5E7QA 1P19A 1BEEA 4EA7A 4E3WA 3P45A 1QV7A 1FXSA 2C7RA 3B9PA 4G6ZA 4ZYUA 4IO1A 5FADA 1Z37A 4OY3A 2A6PA 4GRDA 1T1IA 3KUDA 3HYCA 4QSMA 2ZI4A 5B30A 1P3Y1 4I2VA 4K0RA 2DFPA 4B6SA 2FQQA 4NNJA 3USES 1G2OA 2GXQA 3BH7A 3OEHA 5HQ3B 3P8ZA 3BXFA 2VJBA 1K68A 1SZDA 3QFCA 4N3GA 1BX3A 2QRUA 4RK1A 4DTIA 4MYTA 1T8SA 2Y1WA 3C6QA 1J8YF 1CZNA 4YBZA 2QJOA 5KQGA 5FOSA 1AXRA 3AZOA 3V7WA 2XNSA 4EL0A 1W36C 4HVCA 4Q1CA 4NR0A 1B26A 3RIYA 1E0DA 4CTKA 1Z6ZA 3M6LA 1JNXX 3E9MA 4K81B 4ARZA 3ZY4A 1R0CA 1XD8A 4MUKA 5TC4A 3TMAA 4IFTA 1QDEA 1QE5A 5AKHA 3CV3A 1W9MA 2ST1A 3EEYA 4RJTA 3WY9A 4BVGA 4WJLA 5JJKA 2R00C 2NN3C 2JIZD 2AYYA 3U3KA 1B1CA 1ECFA 3A7DA 4K7JA 4PQRA 4YHHB 1YOBA 2FRXA 9MHTA 5IYZB 3K0KA 2CLDX 1FU7A 3UQZA 4ZD6A 1G9XA 3AUTA 2WUDA 2BN4A 4TUYB 1YZKA 3P9ZA 5BMVF 1PT8A 1T8YA 1HSZA 4RV9A 1L9KA 4YT8A 1A9TA 3PRJA 4KOAA 2M1XA 5BNIA 2ZANA 3IHTA 3AUFA 3WGVA 2G9VA 5HCIA 1FFEA 5E7IA 4XDHA 1FFGA 2NVUB 3RC1A 1JHAA 1XF9A 2BV3A 4HNGA 1NVBA 1REQA 5DULA 3AUYA 3Q8LA 3MSXA 4MHTA 3AERA 2GK4A 2EZ9A 1SVMA 3FW1A 2AOWA 3PCRB 3ZUPA 4PLTA 1P3JA 1Z5OA 2FYTA 2NZWA 4ZOLF 2QTHA 1S96A 5TPWB 2A1TS 3LM8A 1HYEA 1U0RA 4G0PA 3RKUA 4DT1B 1ODFA 1GCAA 4HDSB 3V33A 2K2QB 1QUFA 3ZI0A 1MEEA 2PKQP 4Y98A 1T36B 4AW9A 1EE2A 2O0JA 4LE0A 1WVGA 4AYXA 2GTPA 1XDDA 3BYZA 3PUIA 2Q9AA 2NTYC 4NPAA 3WE7A 1YIOA 5REQB 4PHGA 1C9MA 3NGMA 1OZGA 1UMDB 2Q2VA 3HKCB 3NW9A 5EPEA 3TUJC 1B8NA 3DNPA 3N7UA 3VSEA 4FYPA 2GZHA 3FCSB 2PKYX 2VSOA 5AXBA 1D0SA 3QVTA 2BGWA 1XVLA 1ZH2A 1LPAB 1GG8A 3LPLA 3H11B 4HRXA 4Y6OA 3RPEA 1K1EA 1QE0A 3T7KA 2C20A 2GVZC 4CN8A 4MLDA 5HRAA 3O2NA 3FPAA 3GRCA 1GQRA 4JBHA 1S9DA 4JI4B 4N3AA 3ZDCA 2V65A 3K4HA 4JT9A 1U1FA 2V45A 1Y3BE 1F2DA 3T9BA 3UPUA 4F91B 1JFFA 3PEVA 2EFJA 5FOUA 3KWMA 1M6WA 1EMDA 4IZ6A 1ZN2A 4ER7A 2O2CA 4YXWA 5ALIA 2ZWVA 3EBLA 1GPWB 3GLUA 3SS9X 2UZIR 4J7UA 3IXQA 4HGQA 4OCZA 1X2BA 1I2AA 1ZR2A 2ETVA 4HFRA 1GA6A 4EG7A 1W30A 3BCRA 2IH5A 3HGTA 2GPSA 4P33A 4GMXA 2E18A 4I50F 4QYIB 3CRRA 1JDPA 2B61A 3EEIA 4Z3OA 1Q1GA 3T3MB 4RPHA 3LL7A 1JZQA 1OGJA 1AQLA 3CYFA 1YB7A 2X15A 4JLKA 2YJ5A 3WLHA 3GJSA 2OM2A 2F48A 3ASVA 4GBGA 1RHRA 3UV3A 2O7VA 3MWEB 5CLLA 3VHXA 3C3WA 2IYRA 4LVCA 4YUVA 1TD9A 5EJEA 3UGTA 2QN1A 5LYJF 2F3UA 2XZLA 1CZUA 2OBXA 1NOKA 1YC5A 3LCCA 3O8OA 3U9LA 4EHFA 4BO0A 1COZA 3B6EA 5JS6A 4NMLA 4CW7A 2QJFA 1Z38A 4IKEA 2P3QA 1M3SA 2QEQA 1CLEA 1S89A 3OMWA 2ZDGA 3P9RA 2BDUA 4GKVA 1CRQA 2D2XA 1E1YA 2AFHA 2WJJA 4F04A 4FDMA 1KZYC 1JE1A 3ZHTA 3Q8KA 1ECBA 4YS6A 1CULC 1D2AA 2EKPA 2GAJA 5EZ6B 2XJ4A 3W5IA 4RY0A 3EXEB 2O5EA 2BBTA 2D4HA 5A05A 3KT6A 4BVLA 4OXQA 5A04A 5T7BA 5LQCA 4RD6A 2F4NA 4MPJA 3AZQA 3QBTA 2C4WA 3T9DA 1SHTX 3TPFA 2AG1A 5H7XA 2JFUA 3Q8MA 4RMHA 1W88A 4Z1MA 2R4UA 3THWA 1BRTA 2F1JA 4BMDA 1O96B 1IM5A 1G7TA 2RGDA 3N3BC 2XUQA 4Q4AA 2I99A 3RHZA 2IU6A 4WVLA 4P5EA 1PE0A 3R0VA 5AKLA 1XRSB 2HC9A 2V7BA 1PR6A 3BWCA 4IXTA 3ITKA 1O5TA 4R8MA 1OWMA 4KWEA 3ZHYA 4QYMA 5JH7F 3B7PA 1WW8A 4UMVA 4F4IA 4FQ8A 4ZEXA 4B3SB 2GR9A 4KAJA 2ZJFA 3DFMA 3DE4X 2W2NA 5LBIA 3ZV3A 4B40A 4CCYA 5HJ7A 3GZJA 2XKBA 4AM8A 1RI4A 1TC2A 4XPIB 4M9QA 3H16A 2O06A 2Y1FA 3D59A 2VNIA 3UFXA 4DLKA 4LWPA 1GTZA 2XIJA 4E5DA 3KQHA 3U7GA 1CQJA 1N2HA 3GK3A 3N2GA 4C7VA 5CVDA 5LQJA 3O03A 3RFCA 4BLRA 4WK6A 1OXKB 4D6PA 3GP3A 3PK0A 4GGMX 4MS4B 4E51A 2PZAA 4QHTA 4F84A 2DUUA 3B2NA 4FEYA 4ZO7A 3ZE2B 3GRAA 5KOYA 2F17A 3OC6A 4PIMA 3WGYA 3AJ9A 3LXMA 5TIIA 3GLHB 3PUZA 2GCPA 3Q0TA 3OPYI 3U7EB 3HE3A 4E15A 2HNAA 4KXMA 1O95A 3FHLA 3I64A 4Q9DA 1PR4A 1PKXA 4RF4A 3LSYA 1TD1A 3RH0A 3I2FA 5U4QA 3WRXA 3VPGA 4AT1A 5IS2A 1MC5A 3FJYA 4ZVOA 1BIFA 2C4UA 5JAHA 1O5OA 2PH5A 1QH1B 5KYUA 3ZLVA 2X0NA 1ZJYA 4D44A 4EEXA 1MTOA 1OX5A 1W6UA 2AXEA 1U3CA 3AR7A 3KEMA 1B2RA 4F4UA 4OHMA 4IJMA 2JNWA 2QR3A 2DH5A 2JAQA 2XTMA 1QYXA 4Q7LA 4IZIA 1P2VA 3IQZA 4Q1BA 4U63A 1CCWA 5FHQA 3ZHZA 1YQ9A 3FTDA 5JAQA 2Z5VA 3H7IA 2C1XA 3QEMB 4RK4A 5HF9A 1GPNA 3I30X 4BV8A 2CYBA 3W6UA 5AQ1A 2ANCA 4XCQA 3C1UA 2PEZA 3F8SA 3R3YA 4KDEA 4KIFA 2R85A 1DNPA 3AUXA 3T61A 4DIEA 3FMPB 1UBKS 2VRNA 3W1EA 4MR7A 2ZIAA 2AXPA 4AP5A 3AWDA 3DNMA 4WCFA 4EUSA 2HFKA 2P5TB 2P9YA 5AD1A 3MGCA 3MJEA 4ZYTA 3GU3A 2H1VA 3CPHA 4JZKA 1JV2B 1ZU4A 4MK4A 4TX1A 1GG2A 3ZV7A 1Q7RA 3EVNA 1C30B 1OWNA 3FYSA 4FGWA 2OP1A 4O5AA 3L1HA 3TRKA 4BO3A 4C0AC 2CGEA 1O3YA 3R3XA 1WZIA 2X2OA 4HEJA 4Y6SA 5JYCA 3G0BA 3IEKA 1R00A 5A0VA 4AJ1A 3TJZA 1E2PA 1J2EA 1P5FA 1VCOA 2ZKIA 2EFGA 1G8KA 3LOQA 4KACA 4U9IS 5AVJA 3R7BA 4DCVA 4B3GA 4J4TA 3NXSA 4TYQA 2B7LA 4U00A 4QDUA 4BV2A 4TMWA 3HHPA 1ZJ6A 2EWMA 1DO8A 3W7AA 4JIMA 1Z17A 1PWHA 2Z2ZA 2Z2XA 4D3SA 3V2UA 2D8AA 1EA5A 2C3UA 3EW7A 4NPCA 2WYIA 1RP7A 3K0FB 4ZT5A 4DWWA 5BOSB 2GZ2A 3AF2A 3CJTA 4JEMA 5DYYA 4IF4A 3BZUA 4C20A 4J0IA 2VNAA 3WL5A 4OMCA 3A14A 3EIFA 3NBZC 6LDHA 3QBVA 1THMA 1CR0A 5KQLA 4ALNA 1D9ZA 3ZWNA 3MJ4A 3TLBA 1QP4A 1YR1A 1Q1EA 1KVSA 1RWOA 2JCYA 2V7UA 2IH4A 2J5KA 3E3MA 2BI7A 2AKEA 1PTJC 2NOAA 2DLNA 1IZ0A 3SDZA 2Z04A 5C8VA 4RV5A 1IZ8A 3P96A 4HBGA 1ZI9A 2I1QA 4MAFA 3DEKA 4G26A 1DQPA 1VTKA 3G9QA 5C4GB 2YHIB 4L6CA 1CRLA 1XQWA 1VJDA 1C0KA 2H3HA 3GRFA 2O3JA 1C81A 3H6HA 3ONVA 1QM5A 2Q6VA 5ALKA 3SCZA 3TZBA 4BYMA 4JQSA 1ECPA 1Z2DA 2WMDA 3IC5A 2CV1A 3ZDBA 1SKYB 2HWXA 1ULAA 421PA 3KRTA 4EHIA 4LS3A 2H08A 3ZVKA 3CVYA 1F0YA 3ZHRA 1R0XA 3LLSA 4MIOA 2ZQ5A 3MPUA 4AY3A 5IU6A 5LQNA 3DOUA 2CJWA 2JGLA 1UJ4A 2QENA 4TWIA 1GTG1 3PGVA 9GPBA 2BTOA 1CG6A 2V6IA 1FMLA 4DCJA 5EESA 3WADA 2WKQA 4EGJA 3Q12A 4OP2A 3VKFA 5K6AA 1LZLA 1R9MA 2HMAA 3WICA 4BNDA 1W2GA 4R6XA 2CV0A 5CXSA 5FYQA 1A1SA 1GDDA 1XZFA 2JGKA 2QTNA 3FDIA 4GC9A 3T9EA 5J2UA 1YS6A 4DKJA 1N78A 1BGWA 1S7GA 3EVGA 1DTSA 1NN5A 2NTJA 1STOA 4Y7DA 2Q0HA 2PZGA 3ES9A 2H0QA 3JSAA 3KEGA 3QJGA 5FQOA 3GRKA 4HP8A 3TNYA 1OGIA 3B1FA 3GLQA 1HFJA 5ALYA 3QNMA 1A50B 4UULA 4CTNA 4CMGA 4Q3KA 3NTOA 2CEKA 2CCKA 1KJWA 1RRMA 1NNLA 4MLCA 1R0WA 4D8UA 5JJIA 2Y9PB 3I39X 3DVSX 3OI7A 4OX9Y 2PMDA 1OTYA 2ACVA 3NQ41 3WSWA 1EK5A 3A3YA 5KAPA 3GLSA 1T9DA 1NBOA 2Z30A 6ADHA 2CBGA 1XN1A 3I5AA 1VLVA 5I8PA 4DNQA 5KTSA 1M0SA 2CJFA 1YQDA 3PXUA 3T3OA 2XUJA 1P2TA 4N01A 3DZBA 5BN3A 1KYWA 3UGJA 1PWEA 1BDHA 1GGEA 1ZR4A 3ER6A 3DFUA 4AZTA 2Q9UA 4YBRA 2IZ1A 5ICGA 4RADA 3OE7A 4J0CA 1F12A 5B36A 3V8EA 5CLGA 2B98A 1T4DA 2G25A 3MA0A 3G0CA 2VPXA 1XWIA 3GVIA 4IQGA 4JB3A 4PLGA 4DA9A 3DOIA 1DIAA 2EJUA 1XA3A 1Z18A 3ZLTA 3RJMA 2AKAB 3KJFA 3M8KA 3F3MA 1TCVA 4ISCA 2R44A 3LP8A 3CCCA 4FNGA 4LY9A 1EK1A 5CVJA 4CM8B 2R60A 3DT6A 2ZRCA 4MQEB 4P8RA 4O0LA 3EVBA 3GROA 1P0QA 2JGEA 1T6NA 2Y05A 4G65A 4TM7A 1QBGA 1FP4B 4IXWA 3PNQA 1WQ1R 4BMNA 2KHZA 3L79A 3ECSA 2I4RA 1JKJB 1VYUA 3CE6A 5GTDA 1XTTA 2PX5A 4GLOA 3GDOA 2Z98A 3HEMA 4HUJA 4PLPA 2NP7A 3FYCA 4B0PA 3GFGA 2EKLA 3BL5A 4HAVA 3TNDA 2QVLA 2CFRA 2PU5A 2C57A 2FSIA 3DBIA 4B47A 3NYWA 5KSWB 3RVKA 2X7HA 2XF2A 3EF1A 1ZGBA 2W00A 3HC7A 3LP6A 3PGKA 3DS8A 4MVJM 4MVJG 4NVRA 3KM0A 2WU1A 1XEWY 3E5MA 3HWSA 1DEHA 3FYUC 5DWVA 4CEJB 1GPKA 3KQQA 4PTLA 1WU8A 4E21A 2F43A 1AKMA 1ML4A 1E60A 4PAQA 2Y2VA 5EEGA 4DLSA 2EARA 1E2LA 1RVDA 2SHKA 2W0MA 2I5PO 3I83A 3NYQA 2HI0A 4GI2A 4N3BA 3RREA 3VYWA 4BBAA 5TMDA 5DBGA 2YNMA 3QA9A 1O97C 1Y8RA 3GCDA 3JARB 4N8EA 4LSMA 3T5PA 2AW3A 1L8LA 4JXZA 2NAFA 1P1IA 3K70B 3BMQA 2H65A 2OCLA 3HK2A 1Q17A 3F5QA 5GZ1A 1GGHA 3INRA 3G13A 4X91A 4UUBA 3MPOA 3FPFA 1G41A 3OZFA 1U2DA 1Y42X 2ZYHA 2OCDA 1BWQA 3CLHA 2PFGA 3AZPA 3P2JA 4HR7A 4KUHA 5L3VA 1K92A 1SBCA 3FF4A 3ZGNA 1C3OB 4J0JA 3VRHA 2ZPAA 3G2JA 1RJDA 4JAVC 4PPNA 3HGQA 4B6EA 5LVAA 1J09A 3WMRA 1SXJC 1K3FA 3CEHA 1QRSA 4LF6B 1KK2A 3I9JA 4MV0A 3IUEA 4ID9A 1GG9A 5LFAA 1GFZA 1VCNA 2VXCA 4FNMA 3TL2A 4BO7A 4RS3A 3W04A 2IX3A 1HPLA 3DEYX 5ALSA 1IK4A 1FX0A 2IYOA 2MYTA 2VH2A 3QVWA 4OLJA 4R1UA 4DABA 3TB4A 5JASA 3I42A 5DTRA 4H7IA 1OXXK 2GYUA 3SX4A 2NLOA 1OC4A 1HEUA 3DAOA 2OVBA 1H69A 4IKPA 2I29A 3AW8A 3HZHA 3AVVA 3V1YA 1QMPA 3J80A 1ESNA 1H3EA 2E89A 1N2SA 1ODSA 1XTUA 3BK1A 3JPWA 5LP6A 1YKFA 3FSEA 3EFBA 4HGNA 721PA 1RWQA 2OCIA 3T0FA 4R7ZA 3RJTA 3R3UA 5HUQA 2AN9A 1WZUA 2P65A 3C8HA 3SGLA 1U0HC 4M54A 1EFRA 1BXRB 1R4NB 3ACBA 3UUFA 5FEUA 1N34B 3I2KA 1LSUA 1MQ8B 3COZA 1XZLA 4KJZA 1D0IA 4JI3B 3UNXA 1X0VA 1HDEA 1WOMA 4LJ9A 1EWVA 1KZ6A 3VI3B 5KYXA 3F78A 2BGUA 2AJLI 1N0VC 4M2LA 4XUEA 3GT7A 1KZ1A 1VL5A 3QFTA 1E89A 2X5JO 5CA0B 3SJAA 3PPIA 1I30A 3ITEA 4CM1A 3FNIA 3JQ7A 5ALEA 5LBUA 3RQIA 5JOQA 4DCPA 2YJGA 1TO1E 1ODKA 1ZZGA 1ZUNA 4LDZA 1PZMA 2XODA 5D84A 2CNLA 3F74A 3KOWA 3OUZA 4BJHB 1JHXA 2QLTA 2ZRMA 4ZHQA 1LF5A 1ZZEA 4AF6A 1NM5A 4G41A 4LZAA 2ERCA 3COSA 1OVGA 3KD2A 1NJSA 1THZA 3K6KA 4ND7A 1DXYA 2C03A 5IC5A 1PG2A 1N2CB 4LCJA 1R5BA 1HURA 1W0CA 2J3QA 5CFMA 2I67A 2JJ8A 1RLIA 5K20A 1IBKB 1N9GA 3NNNA 5LL6P 1YRYE 5BRNA 3AI7A 3ONDA 5CAEB 5HVNA 4TYNA 5EQDA 3B48A 5E38A 4CDGA 5AKGA 1M8KA 1FNDA 4HL6A 4WY8A 4DLVA 2F4VB 3IB6A 4EYGA 1P0PA 3H65A 2XBMA 3II6X 4D81A 4AJJA 4TXJA 3WWEA 1KC1A 4OBEA 5FI1B 3FIJA 1WPGA 5K4GA 3CG0A 3VR2A 4AUKA 2HU8A 4EUKA 3X1KA 4OL0A 4R7GA 5TQ0A 4D43A 4PYJA 3QMVA 1LS1A 2J1LA 4L0DA 1I3MA 2MMCA 4ZO9A 3WNZA 1JAIA 1JHDA 4DJFC 4K3VA 4F72A 8LDHA 1JEDA 3G0OA 4MARA 5B7QA 2P2GA 4R8KA 3TL6A 3ZDQA 3CF4A 2G70A 4O2LA 2PD6A 5DJ5A 5IP5A 3KELA 3IV9A 1OILA 2P4QA 2B99A 2ZAOA 4IWYA 3HU5A 5KYYB 3JZIA 4RD4A 1RMQA 1I7LA 1UT5A 2QRQA 3DMTA 4P84A 4RDHA 4CBVA 3EDCA 5CB8A 1DMSA 2J0QA 3BWYA 3KVNA 3HEAA 3QE2A 1K7YA 2OCPA 2CBXA 3UGQA 2G09A 5JC8A 3HN6A 1DRVA 1KEZA 3IUMA 4HTAA 4XSHA 3L7DA 4O4JB 1S2IA 2VOJA 3NIFB 2VA8A 5F7JA 4WW0A 1QFJA 3D8SA 3T5GA 1XEFA 3V8PA 4XOUA 1U6JA 3LLMA 2NO4A 3NVDA 2QTAA 2AA3A 1DDGA 2WAXA 3KKKA 2C2GA 4KPUA 4F6RB 4EHNA 4ZV9A 5BWLA 2PKWA 4EY3A 4F7DA 3RUDA 2I4IA 2IH2A 3PITA 3EPHA 2HB6A 2JCSA 4EPWA 1FVFA 1U3TA 1P7PA 4BBPA 1U8YA 5CLIA 1JJVA 2GEDA 3EA4A 3FRIA 4MROA 4C0LA 5KZMB 3TOCA 3AONB 3EEBA 3PQDA 1RM3A 4D0RA 2WFMA 1E9BA 1P7VA 4FEEA 1AHNA 4KFCA 4D9NA 1YOVB 5AOBA 3WS7A 4Q4CA 4I1UA 3RSZA 1VIMA 3DPIA 2YZGA 1PDWA 3HCCA 5ALMA 1QFXA 2Q1WA 4D26A 2A9KA 3FPGA 3BE5A 3GFPA 5JQGB 2JD1A 1XDBA 2ZRFA 4ZAYA 5GVRA 4KLRA 5P8WA 1T5LA 4XDZA 1LF0A 3PDUA 3L0SA 3WDLA 5M5BA 2GILA 1H9AA 2IZOA 2O7SA 3A25A 3EGXB 5CXXA 4BOYA 2ZQZA 1Z6TA 1V9LA 4H7FA 4OYRA 5CEEA 1T5OA 4QOEA 3MHPA 5EA2A 4LBVA 1M7BA 2AD1A 1ZM3A 3SDSA 4ZFNA 2WI8A 2BRUA 4AL4A 3G8CA 3H42B 4H7HA 5HKAA 4KN9S 3QYFA 4B45A 3LOUA 2F3TA 2XOEA 3I34X 5KNDH 3D3JA 4L28A 1G98A 4IVPA 2H3EA 1OFUA 1YI0A 2LDXA 2REOA 3LP5A 4LGYA 1IVNA 3ZCTA 1CV2A 2P78A 4D0NA 4NCNA 3U4QB 2XIQA 3SF0A 5TQVA 1ECJA 1I7NA 3B6MA 4I5FA 4IL5A 4O4IB 2FZKA 1I1HA 1M8JA 3A4MA 4DS3A 5CB4F 2R0QC 3GBPA 1OX4A 4QA9A 1AOXA 1UXGA 2G0NA 2H06A 3OLZA 4ZAVA 3EXG2 5T6BA 5BR4A 4LG1A 2BEVB 1YULA 1BDMA 2LD4A 2R8YA 2XE4A 3M4ZA 3S55A 9ATCA 1ZW1A 3W5SA 1KAQA 1KP3A 1YRAA 1U2ZA 3FN4A 1BWSA 1MC8A 3OZEA 3Q85A 1YFJA 3M3DA 4MUIA 5AW0A 4DIUA 3ZXSA 2DFLA 1YCHA 4Q9JA 2CYAA 2AQHA 2FPOA 1IYZA 2WT9A 2I6SA 3AOGA 4LDAA 3ULKA 2O3QA 2DULA 3M6VA 4JHLA 4CETA 3AUUA 2J6BA 4GSKA 5K09A 4EBBA 3E61A 3QWFA 4ND8B 1QXSA 4BCCA 1VZ3A 3PUJA 4S1PA 1H4VB 2DLDA 2QM0A 4D9MA 3AKCA 1CUSA 3FIUA 1SOAA 4NJMB 5IJ9A 2B4YA 5AUNB 3KALA 4DV0B 3VYSB 2O0LA 4NFYA 3VYTB 2LR0A 2XECA 4XQEA 1YA4A 3B3FA 3BIJA 2C5HA 3FFAA 3NT5A 4MB0A 5G4KB 2Q7OE 3U3OA 5IT9A 1E1QD 2JHAA 3M3PA 4ZMBA 3L9WA 1SIWA 1Z8NA 4KR3A 1E0SA 1UMCA 2GVDC 1R15A 2WVGA 4IDCA 1JG4A 4PFSA 4POAA 3G88A 3H87A 3SU8A 5EHQA 4P4TA 5BNZA 5BR7A 1D8AA 1W8DA 3KBBA 3M6FA 3PQ3A 2VTBB 3MRTA 4PCAA 1NC1A 1X7XA 1GV0A 4JIGA 3I72A 1CW2B 3ETNA 3JR3A 4LHEA 1KS9A 3CHYA 2C5FA 3KOYA 4O29A 3Q7SA 5BSMA 2G8LA 4XB6B 3V4ZA 5BPFA 1NAHA 1KC3A 1BVYF 2OD7A 4TV8F 2IEIA 2WTUA 3OESA 4TSKA 4P7GA 3EGOA 4HJRA 2LVBA 4WLEA 3UOWA 1XPOA 4KMOA 2QL5A 1B43A 4JGGA 4K5QA 3SJUA 4BGUA 1ZAYA 5JCXA 1CJMA 1PK8A 1PW7A 4XJSA 1MJGM 3GHYA 1QH9A 1AGRA 1HE4A 2HJSA 3S0JA 1F20A 1QWSA 2HMVA 3FHJA 3DFKA 2NT3A 1XVIA 2W2XA 3H9QA 1UK7A 1PR9A 2X77A 1RD4A 2P41A 4PC6A 4XM1A 3FPSA 1ACMA 2YWCA 3IAFA 4MMXB 2A92A 1W0JD 2A57A 2Y27A 1EWKA 3HL0A 3F98A 3HJNA 1WCXA 3P4YA 4J0KA 2C8JA 1ID1A 1MB0A 1KJZA 1TYAE 1ZMOA 1ZMXA 2BTQA 1HDZA 3GA0A 4M53A 3DDSA 3LHFA 1PJLA 2JL1A 2H4FA 3IHWA 3N2KA 1J9EA 2G77B 4RBNA 3PYLA 1GTL1 2HDWA 1UAAA 1VFNA 3AVUA 2XXAB 3CNHA 3LX5A 1SURA 4YRCA 4EF4A 4BQRA 3I0ZA 1Z4PX 1J06A 1MO2A 3QEAZ 4NOLA 3GV0A 3ZHSA 5JSFA 1KMIY 4HN4B 3UH0A 1HI9A 2JH3A 3BJZA 2AI3A 1B0AA 4TOIA 4IG9A 5HZMA 2FPPB 1D0VA 1Q83A 2ZT8A 3A1VA 4UM5A 5EXDA 5K45A 1PI3A 4IIXA 3VC1A 4NJEB 1SHJA 2RIRA 3Q7EA 4GI7A 4TL6A 5EJ8A 2WWWA 5I7FA 2C7PA 3TBFA 4YDQA 1R0BA 4DJAA 4TMVA 1ABEA 1PL0A 4X1YB 1NG9A 3BGWA 1ACJA 1QHHB 4Q03A 4IY1A 1WA5A 2B8NA 3SR3A 1NXWA 3LRPA 4G81A 3O26A 4N12A 4NV0A 2KBEA 3NT2A 3QITA 4TYPA 2GPWA 1QP0A 3QTLA 4A0RA 4GI1A 3NEPX 3ENZA 4U0JA 5YASA 3V00A 3A3PA 2DETA 4PGMA 3AKEA 4JP3A 3OETA 2AF4C 1E2FA 1GUAA 3DSRA 4DNOA 1SD2A 4Q48A 4X64B 1H8HA 3STVA 5IXSA 5JTUA 4AZ0A 2ANBA 1QYRA 4ZJYA 1FTGA 3E7WA 2Z9DA 5C34B 1B4DA 3B38A 2IHKA 1D2GA 2Y93A 4HAYA 2IU3A 4X62B 5KOJB 5HQ3A 1PD0A 2C59A 2PX0A 4RSGA 1WMAA 1YZ3A 1E58A 3OFVA 1IXSB 5IVKA 2R96A 3PXXA 4GP7A 2DPMA 3K94A 2FE4A 2XNKA 3O1JC 1VMKA 3U5ZB 4NLLA 4PLHA 3G8AA 4XWGA 4DMFA 3WRYA 3D8TA 5HKKA 3BHNA 3IRUA 5LB2A 4RO0A 1CR6A 1T6ZA 4D99A 3HJHA 2GS9A 3MD9A 3ZBQA 3TQHA 1FFWA 3EC2A 2DG2A 4DMRA 2E5LB 4UXIA 3PFCA 4R84A 1H2BA 1G5QA 1RWPA 2DT5A 1EFLA 4NYMR 4KOEC 3ZD9A 1B8OA 2NU7A 1XX6A 4KAFA 4YASA 3RVNA 2VRBA 1J2RA 1CHDA 1R0SA 4X85A 4H6WA 1BHO1 2QX7A 4IGEA 3ELUA 4OYYA 1XKQA 4UEOA 2IU0A 1UOPA 3OM8A 4NULA 3R8FA 3TW4A 4DV2B 4TUYA 3IAXA 4C0JA 1FFXB 4PS0A 4RZ2A 3ADBA 2VK2A 4PVCA 4RMGA 2NVOA 5ALHA 1ZKMA 3TVYA 4ZEVA 1YRQA 1KY5A 3P32A 1M2EA 3UXMA 1I7SB 4E2FA 5IBRA 3QF7A 3DL2A 1K2WA 1JVNA 3L7LA 3LFUA 5THKA 4WTOA 3BRCA 1EI9A 5FL7A 1OH7A 3HTXA 4KYTA 1XAJA 3JAWB 2AFVA 2Z1NA 4FTWA 4IIVA 4A0HA 2NVUA 5AVXA 2RHLA 2GK3A 3MMZA 5CNMA 5DI3B 3PR2B 2PKCA 4CE6A 4D3YA 3HBMA 2P2ZA 3I92A 4Q82A 2P0AA 5C1OA 4FBLA 2NYVA 1KVQA 1ZSYA 4U6SA 4UU0A 3ZBTA 5C37A 3HADA 5TPWA 2FWPA 2V4ZA 2NV6A 4UDOA 4DT1A 5A7GA 3B9BA 4HDSA 2Q1UA 2FH5B 4GGOA 5TB5A 2XV1A 2AVNA 2Z5GA 3U1TA 3ZBUA 2QY6A 5C5CA 5P21A 1CEEA 2QE7D 1T36A 1HM5A 2IBMA 4LHVA 2G17A 3OG9A 1PF7E 3NTXA 2CDRA 2P5SA 5REQA 1EXMA 3H04A 4Z4HA 1UMDA 4LX8A 4QULA 2VAXA 5AM5A 1O9HA 4IH9A 3GN1A 3S8MA 4IIJF 4OJMX 2IV2X 2DFVA 4HLCA 4R1OA 5T8KC 4YO8A 1VHDA 3LAWA 2E6UX 3SNHA 4REMA 3UMJA 4F2PA 3H11A 3NOVA 3FBTA 4NCKA 3BH0A 3QEKA 4NYIR 1KVRA 3PYMA 2X13A 4I3HA 3KZKA 2PL3A 5DBOA 1OFUX 4MEBA 5JWRA 5AH0A 2JI7A 2VZLA 3Q2OA 3OPXA 2VQEB 2YWJA 1SH7A 2OY0A 3IIJA 1ODLA 4NAUA 1FPMA 1IIBA 5F5XA 5L40A 3ZDDA 1QJ4A 1SUCA 3ASUA 1ESMA 3L82B 1XZCA 2Q4RA 3E27A 3WGZA 1JPVA 2VSQA 1NUQA 3HA3A 5BSUA 2PS9A 4WXRA 5B3JC 1AO3A 2QYTA 5C8ZA 4JI5B 4EJSB 3MCWA 3CS3A 5BV1A 1OH6A 1Z4QA 3EGVA 3A9RA 1LWOA 3WB1A 2B37A 4QYIA 1N92A 4B3HA 4IIFA 3FM9A 3QPBA 1NVGA 4LC0A 5KC9A 3HRIA 1PFKA 4H4CA 1LPNA 1M2HA 4E46A 3FMFA 2UUCB 2ZJAA 3R6DA 5EZYA 1U3GA 2C58A 5DWQA 3ZW8A 1DQZA 3UY4A 4BQOA 4DMCA 2D00A 3MWEA 2I54A 3JRWA 2ABWA 2J3KA 4LV8B 4ACBA 3WIUA 3LUHA 2LGJA 5HP4A 4NAVA 5IHXA 4BVKA 4RQUA 3O75A 4OSOA 2R8EA 1JQJC 2RMKA 4XVHA 3BXXA 1G2IA 2GEJA 1XYYA 1Z6XA 2P77A 2RKOA 1IM2A 3IOCA 3P9YA 4FIDA 3VBCA 1XNRB 1XU4A 4YACA 4X44A 5A5GA 3CM0A 4MGZR 1LRKA 1SU4A 2C3PA 3ANSA 2O2HA 3W3ZB 5E3HA 4D8VA 3IR7A 2YZNA 4G2NA 3EZNA 4G1EB 4OGKA 2XNDA 1NF3A 4P35A 2A86A 4NMHA 5IKXA 3EXEA 3QOWA 3GRRA 1L5VA 1LPOA 1URPA 4X6LA 4Y2JA 2YY6A 1KIFA 1PDVA 3LUPA 4ZTBA 5FOQA 5JNTA 5FOTA 1A96A 1L5FA 2RHTA 2MIIA 1O08A 3PFKA 2OOKA 1R10A 2OVFA 4KU4A 1D4ZA 3VO2A 1WLYA 1XU7A 4YDRA 1GZUA 2ORVA 1LBIA 2JFHA 3KHTA 4DHWA 2BUCA 3BDVA 3D54D 3ICWA 1L6RA 4U9HS 5C8DA 2O59A 1KFBB 1ZY2A 1QRAA 3IDFA 5DMXA 3AGQA 1HOTA 3MIZA 4KUEA 2J9RA 3ABOB 3ESDA 2PUJA 2HEIA 4N7BA 3G8BA 3QTTA 4UBNA 3TE6A 2PJZA 4ZCTA 5JCJD 2ZJ3A 4QYXA 4JX9A 5F3RA 2Y1LA 2COUA 1G5IA 2ZR7A 4BO5A 3PGLA 3R2JA 1B1AA 4MUGA 2OKCA 3CU5A 2TMGA 3CNLA 5DN6A 3ZWVA 1A9SA 3QEBZ 1I36A 1N6LA 1Z45A 2D2FA 3QA3E 4O8ZA 4YAFA 1Y37A 2X2EA 3H0EA 5FBHA 4XUDA 3WBJA 4D92A 1E2BA 1JIJA 2D1QA 2QPAA 3ROZA 1DBSA 4I99A 1R74A 1QQTA 4E30A 4H6PA 3CLUD 3CISA 4JH0A 3JQ9C 2E48A 2AJ8A 5IFKA 1FVHA 3KO8A 1EAMA 3ANTA 2PS3A 2YRWA 3OJFA 1PK9A 2EP8A 2HT6A 1ES9A 1O89A 5IUJC 4U39A 4V0ME 2Z57A 3DE0X 5AW2A 2PX4A 1H3FA 1KOLA 1L7QA 4R9SA 2KLBA 3GRVA 4A0SA 5U1PA 4BQIA 2BFCA 1XEXB 1ZNXA 1QV6A 3DH0A 3I2IA 1JLLB 1PTKA 1XRMA 1QH1A 1VE3A 3KZOA 2CCGA 4TWBA 2YN0A 4I19A 2QTWB 3I6BA 5NULA 4CMIB 4PNEA 5HRCA 1F2TB 1P77A 4IIYA 3GUZA 1KDZA 2J07A 5JADA 1B6TA 1R66A 3MGKA 1BE6A 3IESA 1RM4A 2BZ1A 2PY6A 4N0MA 5EMHA 2VRCD 1Z0AA 3ZU4A 4BP8A 5AW8A 4KE7A 3EQZA 2Q62A 3QEMA 4B8WA 3HO1A 3TMYA 3T8YA 2YVUA 3WGMA 4DMUB 1E6WA 4LNUA 2GWRA 1T26A 2GKSA 2IEYA 2R48A 3K30A 1TK2A 5DOVA 1FLNA 4M7PA 2C7OA 1P33A 4WFJA 5KI6A 2FN8A 1YR9A 2ZI6A 2DBQA 1P6UA 1XFAA 5FLKA 6AT1A 4A92A 3CX3A 5BSHA 1BZYA 1RRPA 5J4KA 4WWHA 2I7VA 4WNCA 4E5UA 2FDCA 1RYMA 3MWFA 1SPXA 3SQMA 4K2AA 1GSHA 1N2JA 4PZAA 2O48X 1V3QE 2BSXA 4QBIA 2BF7A 2BFBA 3ROPA 4RETA 4DC1A 3FAZA 1BN6A 2X86A 1FTWA 4M49A 2ZUFA 4N18A 3T7CA 1N2CE 2C4TA 1DU4A 1T9BA 3OM0A 4OM7A 2ZSIA 1XA0A 3A9VA 5LYYA 5HUJA 4WBNF 1GYQA 3JQ6A 3FH0A 1J90A 2E85A 2W2LA 4UBMA 4MYSA 4AYWA 1E3DA 2KJQA 4QC2A 3D6FA 1B8UA 4RF5A 1I5RA 2H85A 4RPKA 4Q9AA 1ZHOA 1JHQA 3TOZA 5DPMA 3CH4B 2JA1A 4KCGA 4MV1A 3H5RA 1U9IA 2OQRA 3H8JA 1SNYA 2IBTA 3K0FA 2I33A 1JI0A 3F5FA 1JPNA 4KG7A 4DIDA 4J07A 4COKA 5H70A 3AHHA 3MF4A 3J81k 2DSTA 5EPOA 1MN6A 1JKIA 1OASA 4KQHA 4PZEA 4O1IA 4F9FA 1UEJA 1JDSA 1L7XA 3BMNB 3HVJA 4Z2YA 2VHCA 1YF3A 3TIFA 1YIDA 1RPJA 1GQQA 1ZJJA 3I6QA 5TXGA 1ACLA 4BFUA 5DBIA 5H9VA 5ALDA 4YJKA 3RRJA 4BJ3A 1ZGZA 3TCXB 4JKYA 3WDMA 4CKXA 4X7MA 3W2GA 4NC9A 4UBOA 2XLCA 1BGVA 4WHMA 2PSSA 1JZSA 3OAAD 2YHIA 2Q5HA 3RANA 1UMKA 1HLDA 2JLAA 2QVZX 1N57A 4ZPJA 2ZJ0A 3M33A 4CDRA 1PFQA 1RVV1 1U2GA 1VSVA 4PXYA 5A6VA 1L1RA 1BA3A 3I05A 5JD3A 2WAOA 2AMLA 2POCA 3THYB 4UEWA 3RC9A 2Q9CA 3SFZA 1LK7A 1U28A 4M9SA 3RS5A 1DRWA 1CX9B 3WL3A 2J6CA 4UTVA 1PVVA 2FMXA 1QZXA 2Y4NA 1TL7C 2DQZA 3BCHA 4LXXA 4QEDA 3U0VA 4XYEA 5ALZA 1U65A 2A33A 2Q50A 3RD5A 3V7FA 3U3ZA 3UAOA 4AAYA 5JWOA 1KF0A 4YUWA 3RVPA 3PI7A 4D0LB 2QMOA 2O07A 4BP1A 3PHGA 4AP6A 2CHQA 5LXTB 3CUYA 2MOKA 3C7AA 4KGXA 1EFPA 1Y7HA 3IS3A 2VT6A 4TVOA 3WWDA 2F8SA 4NYJQ 4G1MB 1JHOA 3V4PB 4ZRDA 5L8VA 2HK9A 2RGNA 4L9SA 1VPLA 3MAAC 2I4MA 2A88A 2GN4A 1QMGA 4MDHA 2ZI5A 1IHUA 1LQTA 3AV3A 3QLJA 4C7MA 1V1RB 1EVQA 3PC4A 1M6VB 3ZJ5A 3CW8X 1U0EA 4IUCS 2OZLB 4B48A 5I7AA 4F85A 1AQNA 5CNIA 2QGFA 1BFKA 3BBLA 5SZKB 1SUPA 2AB0A 1LDEA 4D9HA 4DCUA 1KQ3A 2X4GA 3R0QA 1AA9A 3KFXA 4L5JA 4CKCB 5LDDC 3U19A 3ESYA 4KUGA 1XDZA 2XGJA 1R6VA 1MU0A 2OV8A 1U1DA 1M1ZA 3EDMA 3L04A 4ZOAA 3AF3A 3AUAA 4J4BA 1V8FA 4TT3A 5BMVA 2QTRA 3ETCA 3PFWO 3DQQA 5BURA 1OI3A 3T7DA 4KWHA 5J4HA 3AJ8A 1U7TA 3LUFA 2I3AA 4M0DA 1OLXA 4PC3A 5CM8B 3ITDA 2BBWA 3NNSA 4FGKA 3ZKWA 3T95A 1VMAA 2CLKB 5LJLA 4A1OA 2RH8A 3PCXA 4H08A 3T35A 2OCXA 4HXGA 4KMRA 2YXBA 2X76A 2ZR8A 3M1LA 3IJRA 4PXSA 1F06A 2XCUA 4RHUA 1L5ZA 2Q8NA 4KR2A 2FP4A 3AP1A 3QVVA 2EVWX 2OQIA 1Z47A 2WG0A 4CRWB 2EJCA 3DEHA 3SR4A 1F7UA 2G71A 4RABA 1II0A 2Z56A 3AHFA 4CUJA 1L6IA 1GPAA 4OQYA 3PNPA 4CM8A 2VUUA 4NHOA 5CJ2A 4Z5XA 4MQEA 4E4RA 2R6ZA 3UAVA 1DCTA 4I0WB 2XWBF 2QM8A 3V4LA 1ICEA 4TTVA 3E9ZA 4FZRA 1FP4A 2EYUA 4A10A 5L6LB 1JSLA 1L0BA 4L1KA 4MJXA 3RADC 5BN1A 4D1YA 1NXSA 1NOJA 1JKJA 2WSSA 4NOJA 5JD5A 2IPMA 3K2IA 4UARA 1G5FA 1NVWQ 1FW8A 3R5KA 3DONA 3NVKI 2FR1A 3A6JA 5DTMA 2SBTA 2K87A 4MDEA 1XQ6A 1JQEA 3F0TA 3LXRA 1CR1A 1OX6A 2IHBA 2YOGA 3OEED 4KZKA 5EWMA 1AKNA 1OU0A 4RE5A 2QUHA 3W2IA 3G2KA 2QG9A 3OP1A 5ED0A 2WDZA 5AESA 4DJ5X 3FBWA 2ID7A 1ZUD1 2F90A 3KP1A 4US2R 4RZHA 2I87A 2BGTA 4OK3A 5B1IA 3V7YA 1WD5A 1Q1BA 1BFDA 1JJAA 4KTVE 8ADHA 2F3QA 3H5OA 4KXFB 5JG7A 4F45A 2O1SA 3PKJA 3U9TA 5CEJA 4DUGD 2WU4A 1GGFA 2PVSA 1XZGA 4M87A 4PY2A 4QBKA 3JARA 3PFGA 3CXRA 1EJ0A 1SB9A 2W6CX 2XNHA 2Z1DA 4XOIA 4I50A 2VHQA 3QIAA 4OIFA 5JSQA 5LZ2A 4HPJB 4RKWA 4L3WA 5CDSA 4MWSA 1HT1E 2EGHA 1MENA 4OXYA 3RFXA 4DREA 3Q40A 1RPNA 4N7JA 1EGMB 1UC5B 4KWCA 1ZMTA 6Q21A 3UB3A 4ZA2A 2V7PA 3NANA 2C2XA 3A9CA 1JIXA 3S6JA 3FTNA 3WYAA 4G4SO 3MELA 5C7YA 5JI3E 1KVTA 1UP4A 3DKIA 121PA 1DAEA 4FJ2A 2WYHA 4YR7A 5B4UA 3FOAA 3KU4A 5IM5A 2QAIA 2Q7DA 3Q4GA 4HXYA 3SQNA 1TF2A 3OPVA 4FT4A 2IZ6A 4FEAA 1WPXA 2A84A 1N75A 3AUJB 2AD5A 4EFKA 5KYGA 5G3ZA 3CJRA 2I6TA 4JYCA 5ESRA 1NG1A 4WGFA 1M2VB 3QUCA 1E79D 2I3ZA 3IMKA 4WESA 5TS3A 2N47A 2VQSA 1I6KA 4PIPA 1HQYE 5E6UB 3HYTA 3R9XB 1BXRA 2F1HA 5L53A 2B1QA 1R12A 2QR5A 5ALPA 3TB6A 3W6NA 3UKOA 1NN1A 2QLFA 4GVXA 5TX7A 2W6OA 4N5LA 2WJYA 4CG1A 1M9NA 3OIWA 4FFWA 4CKEA 4CLXA 1ZL2A 5SY6A 4E22A 1EUDA 4HNQA 1QCDA 1T4BA 2R66A 4KX5A 1GTSA 4C7OA 1Q16A 4GRIA 1YQQA 3KJGA 4RACA 4J1SA 2Q3FA 1EHCA 3L0BA 5HGJA 3LDAA 1XPUA 3WYNA 3TD9A 4Q9HA 1S4MA 1IC6A 1N2ZA 1VL1A 2VOEA 3DTVD 3N7AA 4B85A 5K3EA 3U56A 1CUWA 2FFAA 4HT3B 2ODBA 3ZWAA 2XB4A 5GJBA 3VU1A 4CF7A 1MR3F 3S1AB 1R6DA 1IEWA 1ZHHA 2CDBA 1LLUA 3A10A 3D2LA 2ZBEA 2NZYA 3KNZA 4ZODA 4C7JA 3HYSA 3PZBA 1PT5A 3G3EA 4MLPA 4ZK6A 4EYEA 1H05A 3OEYA 2Z58A 1N2CA 4A82A 3HU3A 4HQ0A 4IJUA 4OOEA 3MCUA 1I01A 3JVDA 4EEKA 3A6LA 5HDBB 3DUFA 3DWEX 3UTDA 4CFYA 2CMKA 3WRVA 5H4GA 5FWXA 1SG0A 3HKBB 4CV0A 2ZTHA 3LF1A 4UE6A 1M83A 5CAEA 2ZIGA 5CXQA 2WMOB 2WWIA 1T13A 1CNMA 1RTKA 3HWRA 3Q6MA 3Q1LA 5FTWA 4O1MA 1OMOA 2KPOA 1BHJA 1X7ZB 1W35A 4WZAE 3RVRA 5HUHA 4EA8A 5EL0A 1T3TA 2HMSA 4N7RA 2WAMA 1ZIYA 1MIHA 3L4BC 3VVMA 2OGWA 4AJHA 5I3ZA 3CCBA 3RYIB 4B8ZA 3W2FA 4CFSA 4NCBA 4LGMA 4L6IA 1K9VF 3P0HA 3LQ2A 3QFFA 4BLOA 4C43A 1RQXA 3RAPR 1YB5A 4JDUA 2WTBA 3IVMA 1SC4A 3LNCA 2GYYA 3I01M 1JDBB 3O74A 1DCKA 4MR9A 3PG5A 1FP7A 4NECA 2PK3A 2R1TB 5IVDA 4JNCA 3EJ6A 2Y76A 3IT1A 4ZAWA 5IZCC 5C81A 1PX2A 4LRSB 3H5LA 4A6PA 1YACA 1NLFA 2HF8A 4JJGA 2C4VA 5EHNA 5EN4A 3PR3A 4YMLA 1KI8A 1SVLA 3BS4A 4PCUA 3BSFA 3ZWDA 1JLSA 1V5GA 2IJGX 2VDNB 4IPTA 2RI0A 4L4ZA 3PV0A 3U4CA 3V3TA 5DYIA 1KJ9A 1B2LA 1MO3A 3D7NA 4K9QA 4P81A 3H3FA 4H18A 3V2IA 4ERNA 4RTQA 4F6RA 2X14A 3OQIA 4LRUA 2Q0SA 1WZNA 3EXAA 1MV8A 5BW4A 2CNWA 4Q1EA 5C32A 3NUGA 4Q21A 2ILVA 4IBOA 1E3LA 2CW5A 3JQAB 3J7TA 4YP9A 3H84A 1V7PC 4L5IA 4IMPA 4F96A 2FXVA 3H83A 5H81A 4U4AA 4DLRA 1QHXA 1KMNA 4QBGB 3WLLA 1M0EA 5AJUA 3Q3JB 1DO2A 1NW4A 2O19A 2P2YA 1TLTA 4WKCA 5TF4A 3R7DA 2ONYA 3ZWOA 3EMBA 3OJWA 2ES4A 1GQYA 3JPYA 4RANA 1J99A 3DFZA 3UT5B 3DVAB 1M5RA 2IEAA 4JITA 4E5KA 1W87A 5EGSA 2WWGA 2F3RA 4KKXB 5MFPA 1UBRS 1L7AA 2ZSUA 4JUIA 4BHTA 2C31A 2XOKD 1UOQA 1DBWA 5JQGA 3L07A 4DGQA 2PFSA 3EFOA 1DG9A 1HEYA 4LHSA 3HJUA 3IVRA 4LZZA 3B51X 2C9OA 4L16A 3TDKA 4TWRA 3NBFA 2WYVA 1FCJA 3QX8A 3WK7A 2CK3D 3BRSA 4HH1A 4P80A 4QLAA 2QROA 1E4EA 3H75A 3GI1A 4GF5A 4R1MA 4OLFA 4G4SP 4K3UA 3K1YA 3EQ9A 4V3BA 4EJ2A 4OKIA 1XMQB 4INPA 2JLQA 4HWTA 1DAMA 3A1SA 2YYSA 1VHJA 1X8JA 5TPZD 4MUXA 3IILA 4EPVA 1FZTA 4M4SA 3VMFA 4C0WA 2Q49A 3TCKA 4OFXA 2YIVX 4JLUA 5LYJB 4CM6A 3KSZO 4MCHA 4PYRA 1J70A 3JZAA 2EOAA 3E0XA 3U4QA 1SVWA 3LDFA 1TTHA 3RBVA 2ODNA 5E4JA 3U31A 4O4IA 1DX6A 4ZVSA 1YUNA 1M1NB 3IMEA 3IMFA 3QLEA 5EKTA 2WIBA 1V71A 5AVWA 2QTZA 1AXGA 4K46A 1DAIA 3NIDB 2JJ1A 4US0R 2DR0A 5AJVB 1COWD 2VT7A 3W9SA 3KAKA 3LGXA 3D3WB 3HA7A 4J1QA 3BULA 4QDXA 4ZVKA 5KNBH 1OKKA 1OPXA 3ZV4A 3THXB 3FYDA 3KDSE 3FWZA 3QFHA 1ISHA 1NMSA 4WJZA 1T15A 3P0JA 3NBXX 3MCAA 1S2MA 3ASZA 4G1CA 4EG1A 3F46A 4ND8A 3QFSA 4EJ0A 1N0WA 2C54A 3LC1O 2IZZA 1LQ2A 2TMDA 3I52A 3KKLA 5K0NA 3ANLA 3SIRA 2BZ0A 4Z49A 3PTAA 2EHJA 5ITSA 3OURA 4Q3CA 3PC6A 4RLQA 2XMGA 5COAA 2D62A 2B7CA 3AUSA 1Q19A 1DV1A 4N39A 3Q72A 3O7WA 4PG6A 5G4KA 2X8JB 2C3MA 2OCAA 3DBOB 4R0VA 1EA7A 3W90A 2IGTA 2B9EA 4AVYA 3EH2A 2QZ4A 1P0FA 2EW2A 4W5JA 5TMEA 5A1JA 4BWFB 4OHVA 2B36A 1G4AE 1MPXA 1ZEJA 1APBA 5JRDS 3KQVA 4RH0A 4XVCA 1R0LA 4ZOQI 2IF2A 2VTBA 4K8OA 3AM3A 2IWRA 1O7JA 1ZLXA 4M76B 2HV9A 1GZDA 3FZEA 3ZY2A 5CA0F 4OK6A 3E5RA 3EQ2A 1G7RA 5DVZA 1SR8A 5CVVA 1I2ZA 2QW0X 1JT2A 3C5VA 3IDZA 3L1KA 3VSAA 1KAMA 1CQIA 2QJRA 1X74A 3LQ1A 4DJJA 1ZOIA 4Y7CA 2WKRA 3A28A 4GDMA 4NBVA 1R16A 3A6GA 1PZHA 1FRQA 3FD8A 3G0HA 3H2BA 3X1DA 2RHDA 4KPYA 4BKQA 2R47A 3CZ4A 3UKDA 4CIXA 3L4JA 3WL7A 2HH9A 3P4UA 4XUGB 3RRXA 2AMJA 2PR7A 4KE6A 1HMYA 4PQEA 4XTCS 2C2KA 5TJHA 1H85A 3A0RB 3FPKA 3QXSA 1Z9BA 5FBLB 3OZUA 3SHWA 4YRBA 4BQPA 1XRLA 1G64A 1MAUA 2G9RA 1KJNA 1KDYA 2PEYA 1PR5A 1JA1A 1TUIA 1XZIA 3KB8A 4WACA 3VZDA 2H48A 3FJ1A 5EJ4A 3RTAA 3HCBA 2P4UA 3K3PA 2GO1A 4C6SA 2HWYA 3BIXA 2O2DA 3P1JA 3RGGA 2UZAA 3BD7A 2YZ7A 3NC1C 1D3AA 1H4SA 4HUTA 4MQFA 1W8IA 2QAGA 3OT1B 3I6ZA 3UJPA 1LA2A 3VDMA 2BCEA 3B7GA 1K63A 2DQ4A 2QMHA 4Q47A 1BMFA 4ZK2A 1IY2A 3R41A 1ZGHA 4CU2A 4GNKA 4PG8A 1E2JA 1TTQB 2YFQA 13PKA 1I2MA 4JR2A 3JATA 3JW8A 3N70A 4JUAA 4F1KA 2FMFA 2W6ID 3I3OA 2EBWA 2PE5A 2FKAA 3H7AA 1JIIA 2GM5A 3FDZB 2YIJA 3DDOA 2F3SA 4YGYA 4UVIA 5IC6A 3K0CA 4ZIRB 1F9AA 4NJEA 1WUIS 2ZSAA 5DB4A 1R5JA 4IJWA 2ZGVA 3LYUA 4L4XA 4Q1DA 1P2DA 2OCGA 2QMQA 2HD4A 1EUZA 2LXNA 4XCVA 3A2KA 1DAGA 1HLPA 1J21A 1T1EA 1WQ4A 2OO3A 1NBME 3P19A 4JBNA 4X1YA 1YHYA 3I9KA 2IYPA 5G41A 3WKCA 3LKBA 1XXHB 2C5GA 1FS4A 1QYVA 2OECA 2REBA 3CMCO 3FPLA 3JQBA 3O73A 5CIYA 5ECYA 1SQGA 1UXOA 2ZS9A 2PT9A 5E6SA 1RQGA 2JHPA 4N47A 3QKSB 2QWXA 2WPDD 1HQCA 2PWPA 3OZCA 4BN0A 1PKEA 4E2XA 3IEVA 2ZYTX 4XH9B 4BUZA 1HFWA 3K72B 2JLSA 3IRVA 1USGA 1DTEA 3MAJA 1GIAA 4CMEA 5BQFA 5CEFA 1BHSA 1GITA 4U7WA 3RC3A 3WRWA 3ZLBA 1XN4A 1VE7A 3TFQA 3PC3A 4D74A 2Z3VA 2CNOA 4ME6A 5MF6A 1MAWA 1MP0A 4Q16A 4JYAB 4MB6A 5AO9A 4JASB 5D8DA 5KOJA 2C9MA 1NNUA 4HDAA 3MZ0A 2I80A 4A8HA 3PQ7A 1FUKA 3HY4A 1LNQA 1VBNA 1Y5NA 2R68A 4FINA 2AQ8A 1DC8A 2UUOA 4YQFA 3BK2A 2PKEA 1QPGA 1RM0A 2IF0A 1LK0A 1CJVC 4IHJF 1NR1A 2BMWA 2HSDA 1G55A 2O52A 4YAOA 1EX9A 3AV0B 3KT8A 4GOKA 1M10A 3LI2A 2O5VA 1W52X 2OGUA 1VIVA 4D4HA 2F1KA 1TVKA 2AOTA 3KOMA 4GM1A 4G97A 1MFPA 4O2BB 3CG4A 4JLDA 3F4KA 2Z8YM 3JD0A 3REQA 3UXYA 2B34A 1ZBQA 3M6AA 1SM4A 3LG2A 3PHCA 1NKTA 4B3BA 4C87A 1NI3A 1PL8A 4ZQFA 4ML3A 3WNDA 3U16A 3HHEA 1GSIA 4I1VA 1K3UB 2OT3B 1JWAB 3R0ZA 1VLJA 4O4HB 4RV4A 5F52A 5GM1A 5JIBA 1FFXA 3GFFA 2NXEA 4B44A 1TYCA 2NZXA 2WA2A 5K0TA 1ZNZA 2NU9A 3GMTA 4ARSA 1R5OA 5CFNA 1BTOA 3ZCSA 3SEZA 1ULTA 4GT1A 4H1HA 5F1YA 1NKVA 1Z74A 2O6LA 4TROA 5ALUA 1GZ6A 2HJ9A 4NNPA 1DCFA 1PNRA 4P4NA 2D1TA 2YJ6A 3DV0A 3Q0IA 4IOLA 4QM6A 3FOWA 3TNJA 5DI3A 2CLOB 1X9IA 3FNEA 2J0EA 4IVRA 4NCIA 2XT9A 5IZ4A 5JAMA 3ZIAD 1E64A 3PQ5A 2VDUE 3ZE8A 5JQWA 1QBKC 2VFAA 4R2WA 4YAWA 4ZO6A 4IKOA 2IDJA 3RKSA 1SXPA 2X4DA 4M7WA 1RAEA 3WK9A 1SUFA 3DLCA 1Y7LA 2PJUA 2WJ3A 2DBYA 4Q3LA 4PS1A 4XGNA 1UBCA 2UUBB 3KT0A 3HZRA 2FXIA 1HA3A 1XTRA 3PFBA 1NDQA 5GONA 3P2KA 1VJTA 4RQAA 4RD2A 4XD7A 2YN2A 4GGPA 1NLMA 3VR4D 4IDBA 1CIPA 2XUDA 3ZCUA 4C78A 4CPDA 4DCMA 4OXXA 1XTSA 3CCFA 1WDLA 3R5JA 5MDHA 1FS5A 4DV1B 4C6TB 2W48A 1FX1A 3K0BA 5ECGC 1W2HA 4O25A 2H1WA 4REOA 3RFUA 2AXNA 1E92A 4W8OA 3N8NA 3A4VA 2GBCA 3ABRB 1E9RA 3L4KA 3AI2A 3N2LA 4N3CA 4UU7A 3EODA 3EEQA 3QKIA 2EZUA 4L7VA 1OB2A 4I4NA 1ODIA 1WDTA 1VKRA 1WHSB 3FGOA 1L4NA 3JQFC 4B73A 3QE9Y 1XQ9A 1GPDG 2QI9C 2DUJA 1LPSA 2WKSA 2XE6A 1PQ4A 4DCNA 4MGHA 3HVHA 3D8RA 5JNWA 3RS8A 2BKUA 4F8EA 4EH1A 4DR4B 4FR2A 1KMHA 4KR0A 1JBKA 3DXFA 3DKKA 3NWJA 2J9ZB 4Z9AA 2JF0A 4LDQA 4Z53A 4KQGA 1HWYA 1O94C 5J40A 3DMFA 3DKPA 3SYMA 4R1QA 1KHHA 3HM2A 4ZYWA 4NCJA 3H1BA 4Z3KA 1LTQA 2FW1A 1YZFA 4L4UA 4OQXA 4A3SA 1TDJA 3OVMA 3PQEA 1Q0SA 4LRQA 2J33A 2MDTA 3B89A 4DTCA 3AQIA 2CXRA 1UAYA 1ZOOA 4BCDA 4C4SA 1NE2A 1GR0A 4EW2A 2JGJA 4OOFA 1ZJ4A 4RJLA 2Y1GA 4YCLA 5C5IA 1YR2A 3EEOA 2OC9A 1JIKA 3CY6A 5HX7A 2JFFA 2QN2A 5L7YA 3OX2A 5DCUA 1BVUA 1QR6A 1FDVA 4FFPA 3UC9A 3GCWA 3RK1A 1TB4A 2YS6A 4D4GA 1E8MA 2IXTA 2X19A 4OYHA 3NRBA 2FEOA 4MJ3A 1UJCA 2P6PA 4PWZA 3PT5A 5J5VA 1MABA 4KODA 2H1FA 4TKVB 1B6RA 4B2LA 4ZOEA 5ITZA 3PYXA 3AB8A 3JWGA 3OD1A 4OB7A 1CJUC 4OQLA 3ETDA 3N28A 5LQAA 4RTNA 4TS3A 3L1VA 1UM9A 3H9BA 3USZA 1BVHA 3A1TA 4MVJE 4GVLA 4TWJA 1RYZA 2RKBA 2E2WA 4K87A 3HRKA 4BNWA 2E4AA 3EA5A 4N0PA 2WSYB 3CGWA 1B3RA 1P6XA 1Q50A 1RZUA 1ORVA 5AIAA 4B6GA 1Q7CA 3JQQA 4X92A 1OWLA 1YNSA 3JVIA 3JD4A 3NTRA 1XVAA 1KDPA 2NW6A 2FFHA 4HX5A 2ZB2A 1C8BA 1XO1A 2IVZA 1TGYA 2Z2KA 1NPYA 1AHHA 5B58T 4GUAA 4Q3OA 2PLRA 3JQEA 1XZKA 2XHZA 2YMPA 3E82A 1BO6A 3TQOA 2W6MA 3F6SA 2EQ5A 3MRSA 2GT1A 4ADSG 2IZ5A 4PIVA 4BTEA 5LIRA 1G6KA 3DVQX 2YRXA 1DIGA 1VCIA 4KX3A 3A2MA 5CX1B 2FZ5A 2HIHA 3UYKA 3L46A 1T34A 2LTAA 1FLDA 2HM7A 1T2UA 3LHKA 4FEGA 4U3JA 2PD4A 3V42A 2PUBA 2HBRA 1Z7YA 1EVJA 1Q0HA 2J08A 1PDOA 4M0EA 4RE6A 4LAFA 4KV9A 4IR7A 1Q84A 4XRGA 2C5BA 2GFIA 2OESA 1CZRA 1XEXA 1U2QA 1JLLA 1EUQA 2HIAA 5G0UA 3UH1A 1POWA 4CMIA 5KNDD 1ENYA 2G0AA 4CQMB 2HU5A 3OECA 2M6KA 2FGKA 1ZITA 5FBWB 1NYLA 3OIGA 1UCFA 4G5HA 2QAJA 1YJ8A 1NATA 2QLMA 3AVOA 2FDRA 4PQYA 3HSSA 4US1R 3O95A 3PD0A 4L9RA 3WGTA 4B09A 4CV3A 5AVKA 1FC0A 1IE3A 3RRFA 3ORHA 1DFHA 2P9CA 4IF6A 2WSLA 5HCUA 2NUPB 2ZRHA 5D7NA 4ZT4A 4LFCB 5DBFA 5CBPA 3Q11A 1I0ZA 2X7JA 3QI2A 5BN4A 3A36A 1VRWA 3O84A 4D9GA 4TLDA 4NDAA 2VWQA 3VU3A 3GT0A 2F62A 3HSYA 5A3JA 1CYDA 1GD1O 1M34B 1H2RS 1P7YA 2MSKA 4KKVA 4X3PA 2DH6A 3SXUB 3SHOA 3Q5DA 4MV8A 1CTQA 3WIDA 4X0EA 4OQMA 2CKMA 2I7CA 5HFNA 2ALJA 5SZHB 1D2CA 3TX6A 1W581 3K0HA 4LJ4A 3C24A 4LECA 2I1LA 4P3KA 2OO5C 4D5GA 1UT6A 1JKXA 4EGQA 3WAJA 1RWXA 1G5HA 1WB6A 2OORC 1C2TA 1DT5A 2VAWA 2ZE7A 3HGMA 1KZHA 3A37A 1IH8A 3CR7A 3QV2A 1WZEA 1SN7A 3WGIA 1SHKA 2X1HA 4V39A 3SXPA 3UBMA 1L7OA 2VSFA 4WJKB 1MCZA 4J2TA 3BWMA 1OJ7A 3EMDA 4K8RB 1IHOA 3QVJA 3U4DA 1QIHA 3NAQA 3NXKA 4ZJUA 2GJKA 4HADA 1CJCA 3TLZA 4KWIA 4Z9FA 5DV9A 2OP0A 3MW8A 3P2YA 3R09A 1NRXA 2XYRA 3QU7A 1WCYA 2DQKA 4LZJA 4N5DA 4ZCMA 5MHTA 1ECCA 2R00A 2APJA 4IJ5A 4BO8A 3PENA 4FMBB 3BERA 4MYDA 2F8LA 1IY1A 3HVIA 1DKUA 3GQBA 3UAXA 4QPPA 5CPBA 1L7BA 5FUYA 4XFKA 1X1EA 1CRZA 1ZD3A 4RIFA 3BMNA 1B3BA 1MEJA 5CCBA 2N46A 1FRVA 2GB4A 2DY0A 1QHIA 1C3EA 1SUWA 2I2DA 2JVIA 2P9JA 4W5NA 4LW8A 1F9EA 3KVVA 3QSGA 4DM7A 3UW3A 3B1ZA 4DV5B 3OC0A 4FS8A 2WR8A 1RQPA 1KJQA 2H1IA 4LJ6A 3VPHA 2NUAA 2SCUB 3JRNA 4FR0A 3R0XA 4HWRA 4A4DA 1DJPA 3L1IA 4BP3A 4D46A 1ZFNA 1B6SA 1KBQA 1TGVA 4KPEC 4D8XA 3EJWA 4W9NC 4YCNA 2YXEA 4I4LA 4NEGA 1M2FA 1RLMA 2BOVA 4RHXA 4HRYA 1AQ6A 2ORYA 2Q27A 4ZT6A 4BLVA 1EGAA 1FMJA 2VF8A 3LT4A 6REQB 5JALA 1JEYB 1NYTA 2JAWA 1UXIA 2CMDA 4WY5A 2IL1A 2Q4TA 3P5SA 4BS9A 3THYA 3DKRA 2QOEA 2VNSA 3BWVA 3HLYA 3O4FA 3F8TA 1O8CA 3F3YA 3OEHD 4WX2B 5AK4A 5KQSA 2A78A 4HN9A 4AKIA 1DWUA 5IF9A 3KYCA 1UXHA 1YRBA 1PV4A 3WSVA 3N87A 3LQKA 2FUCA 4U6QA 2P3SA 5JAUA 4RESA 5JMPA 5LXTA 3R5HA 5BSKA 2PA0A 5EI5A 2YWGA 4BN4A 2HRQA 4HGZA 3IVGA 1KAEA 1USVA 5DM60 3I28A 1VYHA 1VL2A 1JHUA 2ACKA 2BGNA 4H16A 3TW8B 3VNQA 4UTXA 1U2PA 1Z8FA 4YCJA 3KPVA 4Y0VA 3RG2A 2OZLA 1J25A 3IOBA 2NUBA 1C9NA 1FPQA 1X7WB 2IELA 2X8AA 3GB9A 3OKPA 5J2TF 1Z2AA 2NSYA 3VTZA 4FYJA 2HTFA 4ESOA 2CDCA 4XVQA 2R4TA 3LPDA 5FA8A 4BKMA 1U5CA 221PA 3KQPA 1ZBDA 2YFYA 1RRCA 4CM9A 4AF8A 1CC1S 1HRKA 2J87A 5K8UA 1P62B 1GZ5A 2QTVA 3LL4A 2I1WA 5F5NA 3TZ6A 3ZQKA 2UYHA 2A9RA 2LW7A 2HRRA 2OBNA 4URXR 2A1IA 4HN2A 5FAKA 1KDOA 1E6KA 1RBZA 1ILWA 1GCIA 2D5BA 2JEZA 3EMKA 3HNOA 3PB3A 3IFSA 1W4AA 4FOSA 3CRVA 1UFQA 4QOHA 2EATA 4PYOA 2V7QA 3MJCA 2IIPA 4DR1B 3G2LA 4N4AA 1N9KA 3MN1A 5EMMA 1FSGA 3K16A 3KIPA 4MH0R 5DI9A 5DMHA 3ZDFA 3S8YA 1WUJS 3GRYA 3L8FA 1QGDA 3OZIA 4JB8A 3WFIA 1GKKA 3DCJA 4NARA 5FBKA 1L5KA 2BMJA 2CFOA 4NK4A 1Z6PA 4IQ8A 4K9OA 4LY6A 2SKDA 4KIUA 2QQFA 1U1IA 4BNJA 1UINA 5BSWA 3TD2A 3VR6A 3S1SA 4CF4A 4U0KA 5IF3A 1QVWA 1FFYA 1AKQA 1KJIA 2IDZA 1NE7A 3GEGA 3OJOA 3QE3A 2P9TA 4RHTA 4H59A 5DBEX 3RNOA 5ALFA 3GCGA 2NV0A 4FIZA 3CH7A 3B82A 4HCJA 2A0YA 4JQOA 2P8SA 4JOCA 4L7QA 2BY4A 4LCEA 3EFHA 3P27A 4FYIA 4NABA 1XLUA 1TM3E 2NUTB 5JLJA 1YDMA 1ZA1A 4PN3A 1Q15A 3KLBA 2WKWA 3L7KA 2XDWA 4WKPA 2CXOA 5AKEA 4FXOA 4PSVA 1XHFA 1J39A 2ZSDA 2EW1A 5K51A 4WZBE 3FI9A 3WISA 3BGIA 3FOCA 1Z68A 3MB8A 3C6ZA 4MQ4A 3W3AH 5EZQA 1I3CA 5A62A 4B17A 2MT9A 3FETA 1XZPA 3M34A 4NE9A 2OCYC 2HF7A 4Z2AA 2DX7A 2VK1A 1IHDA 1XCPA 5JXHA 2ZFUA 2Y0PA 4MVJA 2BGJA 3WZLA 4WXPA 1HKHA 4ZT2A 1UPAA 4E09A 1GTMA 1SXJE 3EAGA 5FDFA 4G1BA 3ZZ1A 2O8CB 3UB4A 1RI1A 2J5BA 2WU8A 3AU9A 1FFHA 1B0ZA 1S1MA 1T0IA 2GAOA 1BH2A 3GA7A 3IA2A 3EE6A 1KY3A 1XRJA 3HCWA 4UMDA 1TA9A 1X38A 3O93A 3F6RA 4HB3A 4LYAA 3CX7A 3ID6C 3ZTYA 1MGPA 4UUAA 4AMUA 4I4TB 5LB4A 2HHJA 4MV5A 4NBLA 2O5RA 1T0JB 3BIOA 1HLFA 3K5WA 3TECE 5I9SA 2M6RA 4QQ8A 2BGRA 3UT6A 4WSOA 4EQ6B 2VP0A 1L5RA 1XQVA 1A95A 3GBVA 3P2MA 4QUHA 4ZVPA 2J5XA 2PTHA 3AR3A 4MI9A 2VXBA 3QVGB 3TQTA 1S1CA 4Z0TA 2FAXA 4BRUA 1L5OA 3C3PA 1E2GA 1VMDA 5BO5A 2G4LA 2Q5EA 2EKQA 1ZMBA 3GRPA 3BGOS 4QPJC 2WWVD 1JPUA 4B3RB 3CX6A 2IZ7A 4FKBA 3RU3A 3IAS1 1GADO 5K4AA 4DQVA 3TR5A 4Q3EA 4NU8X 3IH5A 2G9QA 5AXDA 5ES4B 1C0IA 4D42A 4P93A 1ISFA 1F4LA 1NI5A 1QK4A 3IR6A 4CMCA 2PZFA 3NIGB 4Z1MD 1X1QA 3HBFA 4IQ0A 1M2VA 2I4OA 2N1MA 1NUTA 2P0YA 2PPVA 4MP6A 2YWBA 4NTZA 3UK2A 5IPFA 5L3SA 3GGPA 2X0RA 1N6RA 2VF5X 5E6UA 3D3KA 3FLEA 1D4OA 1TKRA 2OAEA 1GNSA 3AG5A 3D7RA 2HBYA 1T43A 4G5GA 1MGOA 4QASA 4S2UA 1AB6A 5T5QA 3U60B 1X6VA 2G1AA 1PR1A 1AF7A 5BQ5A 1T1SA 2B4KA 2HTEA 3GJ5A 4YJ2B 5EWLB 1T6XA 2HJWA 1BSVA 2C8VA 2VDJA 1FQOA 5CA1F 1IJKA 2E55A 4FZ3A 3TN7A 1T3GA 1XMOB 2ZT6A 3OFNA 3M1YA 1JGTA 1NVKA 3FVTA 3C41J 2G36A 1JEJA 3C3YA 4ZGBA 3RABA 2V6GA 4FDUA 4HUQB 5B3LA 2PUAA 2ZJOA 3CZRA 2OV3A 3QJ5A 3L2OB 3S1AA