4OGLA

X-ray structure uridine phosphorylase from vibrio cholerae in complex with thymine at 1.25 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
247
Chain Sequence
KTVFHLGVTEADLNGATLAIIPGDPARVQKIAELMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVPDFDVATAMKAAAQESGATVHMGVTASSDTFYPGQERYDTFTGRVVRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRTQKEIPLKETEARSIKVVVEAARKMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title X-ray structure uridine phosphorylase from Vibrio cholerae in complex with thymine at 1.25 A resolution
doi rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 93
structure length 247
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oglA00
3KUKA 4TS9A 3ENZA 1ODLA 1JPVA 3ODGA 4WKOA 5CCEA 1PR6A 3EMVA 4DABA 5CXSA 2ISCA 1Y1QA 4U2KA 1ZOSA 1TGYA 1A9SA 5IU6A 2B94A 4F2WA 1OTYA 1OTXA 1Y6QA 1VHWA 5DK6A 3DF9A 2IQ5A 4GLJA 4OJTA 1SQ6A 4R2XA 4TXMA 2I8AA 2OXFA 1PR1A 4L5CA 3DJFA 3F8WA 1U1FA 5B7PA 1RYZA 1V3QE 1PBNA 4TTAA 4G8JA 3BGSA 3ONVA 3IEXA 3NM4A 4DA0A 1RCTE 3UT6A 1ODJA 1U1CA 4F2PA 2BSXA 4LNAA 3E9ZA 3PHCA 1Z5NA 4BN0A 1RXCA 4R31A 2QTTA 4DAOA 1CG6A 1VFNA 3NBQA 1PW7A 4GMHA 5JPCA 4ECEA 2HWUA 1OV6A 1PKEA 4QARA 3DDOA 3OZDA 4D8YA 4MARA 1LVUA 1RFGE 4LZWA 4QFBA 1T0UA 4JOSA 4KN5A 1JDTA 5F77A 1VHJA 2AI1A 4DA8A 3OCCA 3E0QA 1PK9A 4E1VA 1Z37A 4R2WA 1A9RA 1Z35A 4WKPA 1RT9A 4WKCA 4L5YA 1K9SA 4TXLA 4JWTA 5F73A 4L0MA 1PR4A 1K27A 5B7NA 2HRDA 1T8YA 2ON6A 4DA6A 2AI2A 3KHSA 1RXSA 2A0YA 1A9TA 4F3KA 4M7WA 2XRFA 3DPSA 4D8VA 4TXHA 1NC3A 3OZCA 1SD1A 2P4SA 4I2VA 3SCZA 5B7QA 1V2HE 5EFOA 5K1ZA 4FFSA 2A0WA 2A8YA 1B8NA 1ULAA 3UAVA 3LGSA 4DANA 4JP5A 1CB0A 1V4NA 3O6VA 1Z39A 1A9PA 1Z5OA 3DP9A 3U40A 4MCHA 1Z33A 4EARA 1JP7A 1PR0A 1V45E 1XE3A 4YO8A 4DAEA 1PR2A 3IOMA 1ZL2A 4LNHA 3OZBA 1YQQA 3PHBE 4MCIA 3FNQA 1WTAA 4DARA 3EUFA 1VMKA 5CXQA 3OF3A 1JDZA 3PNSA 1RXYA 5EPUA 1FXUA 1T8RA 1YR3A 1LX7A 5IFKA 1K3FA 3KVRA 1ODIA 4PNPA 4TXJA 2A0XA 3OOEA 4LKRA 2QPLA 1B8OA 1RXUA 1ULBA 3P0FA 1LV8A 3MB8A 3UAZA 4EB8A 4L5AA 4OF4A 1ECPA 3UAXA 3FUCA 4GLFA 1Z5PA 3FB1A 4D9HA 4OGKA 2OECA 1A9OA 4X24A 4G89A 2I4TA 3QPBA 1PF7E 2HSWA 3FOWA 3NM6B 1N3IA 4RJ2A 1A9QA 1RSZA 1JE0A 1PWYE 1RR6A 2AI3A 3T94A 1ODKA 3KVVA 3BJEA 4OEHA 1Z34A 3EUEA 1JE1A 1Y1TA 1NC1A 5FAKA 3O4VA 1OU4A 4F3CA 3BL6A 3OZEA 1T8SA 5ETJA 3KVYA 3OPVA 2PGAA 1TGVA 2OC9A 4OY3A 4TS3A 3FWPA 2AC7A 1JDUA 1YQUA 2H8GA 1PK7A 3INYA 1YRYE 1Z38A 4M1EA 4BMYA 4NS1A 1QE5A 3P0EA 1V48A 1YBFA 4H1TA 3EEIA 3GGSA 1Y1SA 2Q7OE 4G41A 4BMZA 3LBAA 1TCUA 4BMXA 1U1GA 1OUMA 4YJKA 4IP0A 5F7OA 3UAWA 4YNBA 1Z36A 5F7ZA 1PR5A 4LDNA 4UC0A 4QATA 2RJ3A 4TTIA 4D8XA 5F7JA 1C3XA 2QTGA 1OVGA 1NW4A 1Y6RA 3KU4A 5CCDA 3PNPA 2QSUA 2OC4A 4D98A 5F7XA 5KB3A 3D1VA 4DA7A 3LA8A 4OGLA 3OOHA 3K8OE 4WKBA 4NSNA 5CYGA 4GKAA 3GB9A 4YMLA 2QDKA 1M73E 3BSFA 4M3NA 5F76A 1Y1RA 4TYMA 4WKNA 3UAYA 1JYSA 5B7GA 4QEZA 1A69A 4QAQA 4TTJA 4P54A 3TL6A 3E9RA 1TCVA 1TD1A 1V41E 5CYFA 1I80A 1SD2A 4TXNA 5EUBA 3NM5A 4PR3A 5F78A 1JDVA 2HN9A 1U1EA 5I3CA 4F1WA 1G2OA 4L6IA 2GUWA 1Q1GA 1T8WA 1JDSA 3FAZA 3C74A 5C80A 1U1DA 4QASA 4NY1A 3K8QA 3MMSA 4K6OA 1SJ9A
chains in the Genus database with same CATH superfamily
3LUFA 4JL5A 5JSKA 4QOIA 2H11A 2XH8A 4J76A 3QEOA 2EARA 4AC9A 2XA9A 4YV7A 5BQXA 2IW1A 3FUUA 3SOPA 1US8B 4HDMA 2BISA 1E1CA 5EIHA 4DDKA 1VPVA 2BHSA 2AT1A 2XGGA 1SCNE 4IHJA 3PK0A 1XQYA 4G8BA 1TZMA 1P77A 3E8XA 1D6JA 2P2SA 2Z8XA 4RLSA 5FR2A 1SUSA 2FGJA 2IHKA 2BMAA 1JKXA 3HU1A 3HB9A 3JYHA 2R8OA 2D5IA 1GITA 3EASA 2WWHA 3VOTA 5I7UA 1TVMA 4XCXA 4D4GA 3RG2A 3VMMA 3DVLA 3NR2A 1IG0A 2WHEA 3T7CA 2ZYIA 4QOSA 1IZYA 1H2XA 5L3SB 1HTTA 3LC7O 4BXOA 3A1VA 2IEIA 1U7WA 4U5QA 4B4KA 3CPSA 2IHVA 4WERA 3JCZA 3OTQA 3TVDA 4XVUA 1PT7A 2DQSA 1V7CA 2JIMA 2PE5A 4Q7KA 2AVNA 4KQKA 3SIXA 1YS7A 4A82A 3VYWA 4JBHA 2PSSA 1QGAA 3QNUA 4TRMA 4AJOA 1QC5B 4IKEA 4ND4A 1ELOA 3TQFA 4IQGA 4EVRA 1FS5A 1V8FA 2C00A 2ISSD 2PV0A 2FUNB 4NH4A 3U39A 4ARZA 4QODA 3TGLA 2NLOA 4B34A 3SQWA 5BR8B 1IBRA 1R50A 3M70A 3ER9A 2E55A 1E3MA 3ZLVA 1YTUA 2IYZA 1T5OA 2ZB7A 2OBMA 3A4IA 1BJRE 2W6ZA 4Q4AB 1FA9A 4MPDA 1ZZGA 2FLVA 1FF9A 1T5LA 1TF2A 2I78A 2Q5JA 4LHVA 3FRHA 3W8RA 3UAOA 2BKEA 3ITNA 1M10A 1CRWG 2Z2IA 5T3UA 5CX1A 4F8YA 1EQAA 4B48A 2JIRA 5IKMA 4C0BA 1JJ7A 2GEKA 1ZUNA 2O5RA 2VH5R 3P9IA 4N5IX 1E0SA 3DL7A 5DLEA 4JHXA 5EEGA 4FVTA 2YZ2A 2JEZA 1S3GA 1VE6A 3JAWA 1HH4A 1HZZC 1BRTA 3GGOA 3KYIB 1IM5A 4LSWA 3GGCA 3O74A 4GOJA 4P92A 1PTKA 4K9DA 5IKEA 2I4LA 4HATA 5DYYA 2DF8A 4E11A 3C3BA 4JLDA 2A9QA 2GHIA 4ZZIA 3M1IA 4BNIA 5FBRB 3FMVA 2BCGY 2OK7A 1Z7WA 1KI2A 2W58A 3D3JA 3NBQA 1AQLA 1J2YA 4HDNB 1EGAA 1PZGA 4BNLA 2HD4A 1GZVA 1PW7A 5FF9A 5FJJA 5JPCA 4W1QA 3GEIA 3OKFA 4EKNB 4DB4A 1X3SA 2PZAA 2HA7A 4FNMA 1N5IA 1SRRA 1YB4A 2HU2A 2ZETA 2JFZA 2P2LA 3MXOA 1ZD8A 2ICAA 3R6GA 1W9HA 5TVGA 1WO8A 2PUFA 3KHKA 4F04A 1BE6A 3WO0A 1IWBB 2JIOA 4BBPA 3SC4A 3VJMA 5LMNB 1IC6A 2WYIA 4JI2B 5MHTA 5LDHA 3KZOA 1JDTA 1GA6A 3FZGA 3I9MA 3CLUC 1HDOA 1D1PA 4R0MA 3MUNA 3FW1A 3U3KA 3W2TA 4YN3A 3AU9A 3OPQA 4IXDA 3Q1KA 4N5LA 4RFSA 2D1YA 3CVYA 1YJXA 1HNZB 5DTIA 3N0WA 3G2OA 2RAPA 1A9RA 3EXHA 4OMUA 4JY7A 3ZWAA 2G88A 2V5UA 2YWXA 1XHLA 1OAOA 2JZOA 3COPA 1JIXA 1K97A 3DT9A 4U1RA 2CNDA 3QQ5A 4HUQA 5DNEA 1BMFD 3S1AA 2C4KA 1DMSA 4BBJA 4RPKA 5CK4A 1K9SA 3DLBA 2ROQA 3O7WA 3GNTA 2FEXA 4M88A 4NEHB 5C8YA 2CLIB 1KJ8A 2R6JA 1J20A 3K9WA 1U6KA 2GJ9A 3QP9A 3WLRA 1XXHE 1PR4A 4PLCA 5KQGA 1Z4NA 4I6GA 1LRJA 2HB6A 2PMWB 2G40A 1R9JA 3L6UA 3D8TA 3MK31 4U2EA 3RHTA 4B6GA 5IW8A 1DOAA 1I1OA 4FHDA 2C58A 1O1YA 4PNZA 2NMVA 1QIIA 2WJAA 3D6TB 3IEPA 2DETA 2MDTA 1Q7EA 1UZMA 4Z8YA 1I7QB 1BCSA 1JHDA 3GG9A 3PD7A 4C6TA 3ROZA 1MA0A 4ZYXA 5C18A 2ZYDA 4YT5A 1U3GA 4HB4A 4TWRA 1GG8A 5B58T 4DFDA 1R0CA 3D9QX 3HEBA 1IBKB 3CZ4A 4EFLA 2HAEA 4FFPA 5HZKA 4II7A 4EGJA 2VAPA 3FR8A 4V2IA 3TLKA 4LX8A 1CR2A 1YZHA 4CCSA 3QLTA 1GGKA 2J5BA 1RPJA 2A8YA 2SICE 5BMOA 1W4ZA 5L6MB 1C4WA 3QQPA 1G3IA 4GUDA 3ZDZB 3OM1A 1U8ZA 2XWJI 4OCZA 3PXXA 4C0SA 4CQNA 2YR0A 4YALA 1HE4A 5HIJA 1ONOA 2ZIFA 4DXAA 1XR3A 2Q99A 1O97C 3MLEA 1XCJA 4FFLA 4KXUA 4Y0AA 3RVNA 4AZWA 4DW8A 5KHLB 3Q8KA 1AKRA 1GT91 3BIWA 3QTBA 1FSSA 1GUFA 5FO0A 5AYVA 4XSVA 2BY4A 4U7GA 5M29A 3VHLB 3QKUA 4QBIA 5EERA 3AFGA 2R1TA 4ZGGA 4PLYA 2ECPA 2IIQA 3IESA 4JI5B 3AOEA 1A27A 4WINA 5IMSA 5DGHA 4Q3DA 1KJQA 4ASUA 4PLPA 1E5QA 2DPLA 2JGKA 2VSNA 1K88A 3C43A 4Y2SA 4I50A 4P83A 4L8WB 5LOVF 1YZNA 1U5BB 3HGTA 3UJDA 1EI9A 1RM4A 4EAQA 2CWWA 3ZEAA 5L95A 1GL9B 2NSHA 4B82A 5JU6A 2D2IA 2R7KA 3R23A 4UHBA 1M8PA 4FYVA 4YLGA 1BEZA 4WCVA 4F4IA 4RHFA 3STXA 4ZJYA 1PR2A 3IOMA 3AL0C 1UK7A 3O2NA 5CR9A 3FPSA 2X8LA 3ERCA 2R2AA 4XRRA 3U49A 2HF8A 2Z57A 3IPAA 3HMQA 4XKJA 4A8JB 3OO1A 1W5TA 4QD3A 2QUIA 3PA6A 3C3MA 3D31A 1SA0A 4QDJA 3TFQA 4RPHA 5LIPA 4HY3A 4RTJA 1JQEA 3EUFA 4LJ7A 1RHRA 4MKGA 3EXEB 4RFLA 4H7KA 2OCYC 5CXQA 2Q4OA 2O2ZA 4LXGA 4R8VA 3RK1A 1BDJA 1SVSA 3ACBA 3QVOA 4JXKA 3OZWA 3B70A 4ZKEA 1NAHA 4Y6LA 3C5HA 2FF5A 3SDSA 1JTEA 3F5QA 5JS6A 4KGDA 3PA8A 3FUWA 3I34X 3KBOA 4TZ6A 3MWDB 2YJ5A 4LWQA 4FEEA 4XYGA 1YJAA 2JVIA 1VDZA 2AB0A 1L7DA 1MV8A 2B9VA 1QC5A 1FRFS 3I0ZA 1NVEA 3EIHA 5CA0A 4O4JA 2CY0A 1VB5A 2UZ4A 2JI8A 1TW2A 1E3SA 2QRUA 3HABA 3SQNA 3WKCA 1FDWA 2QROA 2Q29A 3OZSA 2W2PA 1EVJA 5TC4A 3WJ7A 3VVMA 3WOHA 1GGHA 2H5EA 2C3PA 2OO3A 5BT9A 5I9BA 4MVJE 3RS8A 4AY5A 4BVFA 2PXAA 3NU1A 2QGZA 4I8XA 4TMYA 1Y81A 2YWBA 5JZVA 4JOQA 4XRGA 1Q57A 2I99A 2C2BA 3MELA 4WOJA 1QE3A 1SHKA 3A1UA 3HDYA 1XMSA 3LKVA 3JATA 2Z43A 1G2PA 4DYVA 2RG7A 3ZNOA 4J0DA 4MGHA 5FBKA 5J58A 1TMKA 5REQB 3JQBC 2FWAA 1EFAA 4BGEA 4IQ0A 1W30A 1GCIA 1Y3CE 4MI3A 5BPHA 1TKCA 1KOFA 2WP8J 5GVRA 3AZPA 3TDKA 4U3JB 3DWIA 3V8EA 1BMFA 2PQ2A 6PFKA 1CY8A 1XTIA 2D4AA 5C1PA 5KQRA 4HR7A 4YMSA 2VNSA 5I45A 1B3BA 1NMQA 1E4VA 1YB1A 1GSIA 2W00A 2CD9A 4L4YA 2JLUA 4DV6B 1LPPA 4HDNA 2OP1A 3SC6A 2AYZA 3UUGA 4DIKA 1M7BA 1YQGA 1IZZA 1REQA 1Z6XA 3QKRB 3TLYA 1N3IA 1WD7A 3RIXA 5TLSA 3KLOA 5IT4A 3B85A 5FPKA 1QV6A 3SZRA 5AQ1A 4NCBA 1RHUA 3PNQA 1BWRA 4Z4HA 5JIBA 4R3WA 4MUJA 3C70A 1DBPA 3A25A 3E15A 4NQZA 1QFSA 4FHZA 4NZZA 3VFDA 1BW9A 1HLPA 4ZTBA 4TOIA 4CT4B 1OT5A 2FPKA 1XJCA 2CXQA 2PBLA 3F0TA 3OQ6A 1SOVA 2BR5A 1ESEA 1Z34A 5K8VA 3MHPA 4YRGA 2WAAA 4JVMA 5J4YA 5DT2A 1EJ0A 5ARCA 4MP6A 2EDAA 5BN5A 2EAUA 1IG3A 1Y8QA 4QHYA 4OHXA 3LTNC 2ZRQA 5A4DA 4FGKA 4LDZA 3QMWA 2F1KA 2NVUA 4O25A 2Y77A 4RQBA 5HWSA 1AGYA 5JPDA 2HT1A 1NXOA 5JSQA 3GRYA 1L7QA 5A6SA 1C0LA 3ETHA 3DXZA 3GEDA 3PI6A 3MWLA 5JS2A 1K75A 5JTUA 2VP0A 4I1OA 5D5HA 3P97A 4QLOA 4AY2A 3AF3A 3QVJA 1PJSA 2ZUSA 1SNYA 4HRXA 2XRMA 1B3RA 1RBMA 3MBKA 4R84A 5JG7A 3B12A 3HUDA 4LXTA 3A14A 5JAQA 4OGWA 4EJSA 1P5HA 4M1EA 3EPRA 4IDAA 3EXIB 4DEVA 4DVJA 5I7RA 1BU8A 5LJIA 4BUCA 5JARA 3ZDAA 1ZJ4A 3ITDA 3OPNA 3RQIA 5G3ZA 2OAGA 4LQLA 3L8CA 4F9TA 3EB9A 3KZNA 1CUGA 1WDWB 1I51A 4IFBA 4UTOA 3TK1A 2H00A 2P0EA 1P3Y1 1RYHA 2Q62A 2QDXA 3DQQA 2JAWA 3FWKA 3H6KA 2Q7OE 1WR8A 3KTDA 5AK4A 3RF7A 5KTRA 5LSAA 3EXAA 1S01A 5JAMA 3K5PA 2MYTA 5F2NA 2OWDA 1OFUX 2OZKA 3FYDA 4CM3A 1YJQA 2FSGA 3FNGA 5TT0A 4JHLA 2IH2A 1KOGA 5ER9A 1CB7A 4MQBA 5FOVA 3L0YA 1JUDA 2JAHA 1J06A 1Z28A 3FYTA 5C5CA 1Q50A 3E3AA 4HDKA 4BMPB 4FT4A 1Q83A 3B6EA 1MXFA 1XLVA 2COEA 2R2GA 3F4BA 2EKQA 3ZBPA 1RWXA 3ZZMA 4HVAA 3KJZA 5AHOA 4DR1B 3UMGA 3HO1A 4NL4H 5FTNA 1MMFB 1WOYA 3OUUA 3QVUA 1SHLA 4QPPA 3ZOZA 4AY6A 1NW4A 3ZDYB 3OE7D 1FLVA 2J9RA 3WIVA 4G4JA 5DYGA 2FFBA 4DGSA 4KYTA 4EVIA 1J90A 2O9JA 3GCXA 1JBEA 2IFTA 4RD2A 5JZMA 1Z0ZA 1LJLA 2ZJ6A 4IIUA 3EGOA 1T5BA 1VRCA 4LCJA 2A58A 4PGMA 4D6XA 2JLZA 3EWNA 3N0VA 3WYFA 4Z4EA 2ZTLA 2HDOA 1E7RA 9ATCA 1Z56C 1JHVA 1I2DA 1PQ4A 4HLDA 5EVCA 1GQSA 5JTTA 4JBYA 2H1FA 3K15A 3WDKA 1QF9A 2RONA 1BMTA 1KORA 3H87A 4PZZA 1YF3A 2UZ1B 5JBIA 3T4EA 3AHCA 4KR2A 4YJ3F 4QQFA 2YJNA 3WOVA 1EG7A 3JD1A 3R44A 1A88A 2PS1A 3A1DA 1EUDB 3HJUA 1L4BA 1C8KA 3LDGA 4IICA 4MYCA 1IVYA 2GSWA 4IOMA 3C87A 4YJGB 2IZZA 3BPSA 2FU5C 2P2GA 5P21A 3V5NA 1M54A 4YI5A 2NV2B 4BIMA 1ISHA 1XLTC 4GGOA 4EGAA 2PGJA 2WIBA 1ZDMA 1MC5A 2BGKA 2AFHA 3CNEA 3CX4A 2NZWA 3RARA 3PQ3A 4BFTA 4Q47A 3LVQE 3B5EA 4TYMA 2QL6A 3G6WA 3DLHA 4WADA 5ICFA 4BJHB 5H70A 1JXQA 3K0KA 2YV5A 1CHDA 5A62A 4IIEA 2OHHA 3CWZA 4ND3A 4Z9XA 5EMMA 4TVSA 1Z3CA 4ZDJA 5I9NA 1I10A 2RE8A 2Y1CA 3LCJA 1AKQA 2JATA 2OD2A 5HEKA 1YIDA 4H1WA 1LU9A 3V8PA 2NU8B 4BV8A 3DD1A 1E60A 1JBKA 2YMPA 3MWDA 2XMGA 4K0RA 3IYLW 2RHHA 1G20B 1TLTA 1U3DA 4BCCA 2OD7A 1F17A 1QHEA 2J3LA 5EUBA 3QSGA 2P9YA 4RXTA 2Y1WA 3GVHA 3BD8A 1PL8A 3TOXA 4URUR 3LC2O 1SAYA 1CJTC 3KZMA 5AI6A 1VL5A 2X5JO 2XY4A 1RJWA 5I3CA 2CNWD 5KYXB 4LF5B 4LRQA 1FNMA 3TPFA 2QRLA 2QRPA 2Q5EA 4H7JA 2JJ8A 3F74A 4ZWNA 3SS7X 3KXPA 2O48X 1BA3A 2MSNA 1BVRA 3JAKB 1W0KA 2WFAA 3OQIA 5AXBA 5I47A 1Z2OX 3HU5A 3ZEIA 1OFGA 5LOVB 2XF2A 3U1BA 1JR2A 2OZEA 2WAXA 4DG8A 2PUVA 3C3PA 3QVTA 5E8JA 2HCRA 2O7RA 3JD4A 3MCTA 5PGMA 3GH1A 5REQA 3TDMA 3U4GA 4RZHA 2GK6A 4RMHA 4HVTA 4D0RA 4KJZA 4RKRA 1QMPA 3EGCA 3FOBA 1M2WA 4U3JA 1BN6A 1R7RA 2ETXA 4V3BA 3OIGA 2XTZA 5FQOA 1JPVA 3NIDB 3OO0A 3WWEA 5L51A 4ID9A 1NHGA 2RCYA 2MCFA 2PD6A 4IH1A 4DSTA 5CM2Z 1JB1A 4PQGA 2GM3A 2WU3A 3SJUA 3BXGA 2HQSA 1BHJA 1J9GA 1WHSA 4PYOA 3AGQA 3IXMA 1QFZA 1XRPA 2PU7A 4JJ6A 4LHZA 5JNSA 3QKRA 1P7CA 4QECA 2XMDA 3KSAC 5J3JA 2ANBA 4JQZA 1J0AA 4URXR 3M83A 3FTNA 1WY7A 3TFOA 3VPSA 1UBLS 5JNUA 1OJ7A 1WL8A 3N3BC 2EDCA 5ALDA 5K6TA 4NCXA 5LUAA 4HSEA 4DMFA 1YWGO 5GVSA 3MFYA 4AIRA 4MQEB 3MQFA 3EZ6A 4RL4A 1KI7A 4D44A 1M74A 4KDFA 3HLKA 3CZPA 4EPWA 1ADBA 2KMLA 2P62A 4C2AA 3AETA 3DE5X 3D8NA 3JRNA 1OBHA 3M4YA 1EE1A 1NLMA 3OZAA 3D7NA 5A0TA 3BKWA 1W0JA 1P4SA 2F9MA 1SZDA 4Q4HB 4RUKA 3V4RA 1WP4A 3ETJA 1H1TA 3ZGLA 1SWWA 5T8KA 1WPRA 4MUKA 2IOFA 3HR8A 4Y2PA 1A98A 2AMYA 5AM3A 1MPTA 3B7PA 5JCPA 3O2JA 1EAYA 1JV2B 1P9NA 2W5UA 3GV0A 3W4IA 3KQLA 1AZTA 4Y6PA 2GDZA 4RTLA 3G9UA 4EFNA 5IWCA 1OB5A 2EF0A 3MBIA 1J2JA 2OSVA 1QG4A 4UEKA 1GPJA 3QV2A 4UXIA 1E64A 3TTVA 1XU4A 5AJZA 3PEYA 2GWHA 3ZUPA 2WUFA 5GM1A 2I87A 2UXDB 2XW6A 4XYMA 5DEOA 3UT6A 4Z4CA 2ZM6B 4M86A 3G8BA 3GLHB 3W2HA 5A4FS 3KT8A 4E22A 4GZLA 3H2SA 4II2A 1UWKA 1DKMA 5CNKA 4JKIA 3VPCA 4EWLA 2QLTA 3UANA 3P2YA 3GT0A 2AQHA 3KQKA 1RCUA 4C3VA 1XVAA 1CIVA 4HTAA 2H4FA 3ESQA 1PGQA 4JWKA 4REQA 3L1KA 2QTTA 1CG6A 3V7UA 4TTSA 3B1ZA 3NHWA 1XIVA 5KCZA 3CZ9A 5LJLA 3HXMA 1C9JA 1Z2EA 1CETA 3MTQA 5ULLA 1P8AA 5C8XA 4U2DA 5DHRA 2LVBA 1PKEA 3GJZA 4L0DA 3B5IA 4XTCS 5A0FA 2BGIA 3PJRA 3OZDA 2M9MA 2XQVA 1U0SY 4WK2B 2F1HA 1DCMA 4FCCA 2C5FA 1DEHA 1RFGE 4LJ6A 2OKCA 2ZUUA 3ECSA 1OLXB 3T1OA 5H3LA 4OHMA 4Z86A 1JL3A 4CKEA 3IE1A 1V8OA 2E89A 2H7CA 1K08A 3MRXA 4N49A 3WBFA 1J1IA 1NHWA 3GN2A 4R1PA 3BHMA 4C5AA 5M04A 3T3GA 2DSTA 4PZLA 5IJWA 1ZXXA 4R2WA 2EXXA 2JASA 4DLBA 2FPIB 2OV6A 2V8BA 4K1XA 4MUEA 1YE5A 3TW0A 1XDBA 3NHSA 3N75A 4Q9JA 3V6MA 2QUBA 2FG6C 5BMVB 1E7YA 3QVGB 1U2PA 4EJFA 2QX9A 1EUDA 4HX5A 3Q88A 2QAJA 1BJKA 2CNWA 3A9WA 5AOAA 2AR0A 3ZTTA 3FLMA 5KNBD 3FBGA 4U7JA 2IL1A 1QPBA 2WFZA 4O4HF 4CUZA 1HLGA 2B69A 2LKCA 5C7LO 3TR6A 2JD0A 4MDEA 3IBFA 4Y18A 5HW0A 5KYYB 2FWBA 3PUYA 4OHKA 3ZQUA 3U09A 5BV2P 1YQEA 4HQLA 2ZIVB 5ENZA 2ZP1A 3T9DA 4IMIB 3U62A 4ZFNA 2IP4A 1N5KA 2O3RA 3L6OO 4O6VA 5EP1A 3KB2A 4NBLA 2XKBA 3R6TA 3IJPA 2QRHA 2ZTMA 4M7WA 4RV4A 4JT8A 1OF1A 5KOJB 3DPSA 4OQXA 4EEZA 2PZEA 1XU9A 3OLXA 5KKCA 1G7RA 2VHYA 3TBHA 5E4YA 2GD2A 2VF7A 3GJ0A 4NP6A 1FYFA 3OSZA 1ESNA 4FR5A 2XZOA 3KPYA 1QZ3A 2O4UX 3SXUA 4KHZA 2XUAA 2ALJA 1ZJWA 4F46A 1F4LA 1S8AA 1X2BA 2GK3A 3NI2A 4UUQA 5K1ZA 3ZXIA 4GZ3A 3RI3A 2JFHA 2PQ6A 4NONA 2WJYA 2W4IA 1BE1A 4PSAA 1YB7A 1A82A 1YHZA 2P8SA 4R8RA 4BNZA 2XCRB 3IB6A 4J16A 4YJHA 4C4TA 3OT5A 3S70A 2GK4A 4A10A 3IR5A 4O2AF 1GZ6A 2PKWA 2R6CA 3DBRA 3QFHA 4O1MA 4QYWA 5C1IA 1FW6A 2YFKA 1FUYB 4WN3A 1CQXA 3TZHA 2JCXA 2ZYHA 3RU2A 3HGMA 2QR5A 3MLBA 4ZVKA 1Z2NX 3T9EA 2R8PA 3LYHA 2VNHA 4GMKA 5ALIA 1L4KA 5GJVC 3WZ2A 5HVNA 1TZBA 3ZY3A 2Q5HA 2B30A 1KEEB 5AUPB 4YJ3B 4E94A 4JJ8A 1VIMA 3AONB 1VE7A 3T1NA 4ZVTA 1ZK0A 2QUZA 3R5FA 4HH4A 4J1NA 3U44B 4EG5A 3JQ7B 4KFTA 1FZQA 2CFTA 2MMGA 2Y1LA 3HJTA 3NEJA 5AESA 1YVEI 2DKFA 3LUHA 3IRVA 3TZQA 3NUQA 3OE1A 2QL9A 3SZ3A 3TBFA 2WJZB 1P1RA 3C14C 5JNTA 3AQIA 4XCQA 3U37A 4CTOA 4OSEA 4Q9DA 4CM9D 4CEIB 1P4GA 1TJYA 1TU0A 1Z4MA 3C8HA 4DTIA 2HHLA 4JXXA 2V54A 3PNLA 2G17A 2W70A 2W71A 3NRCA 1ZMOA 1KFKB 2W98A 3K5IA 3OM9A 3TZLA 2F7SA 3ELWA 2J32A 5C5DA 1CUSA 3ER8A 1T29A 4GOLD 3V3KA 1WA5A 5A2GA 1WW3A 3ROTA 1Q12A 5JZ9A 2I1LA 4N0DA 1U65A 2AYXA 2XMQA 5GZ1A 4MQEA 2Y0DA 4NCNA 3QPCA 3PFBA 3RVRA 4YDRA 2ZAGA 2ZJFA 4LF8B 3QMPA 2OE2A 3CKKA 3T4PA 5KTYA 4FGUA 3Q8LA 4F5YA 1R0SA 2R8YA 4DMHA 5F23A 3HY3A 4UVEA 1E2NA 5HCUA 4LC1A 3A9TA 1BDMA 2DULA 4UCWA 4W9RA 4JR0A 3TDNA 1AN9A 1ZIDA 1W8IA 1WV1A 2JW5A 4Q4HA 3ZCQA 3WHKA 1XDSA 1CR6A 4RA9A 3UOGA 3ABSB 3KOUA 1M3SA 2JLQA 4LX0A 1OWOA 3QE9Y 2UAGA 1CUVA 3BICA 4U2BA 3GJ5A 3U5TA 1JEJA 2H5JA 4GU5A 1DDGA 1G3QA 1NE7A 3KQHA 1QHHA 3HJHA 2BH2A 3LUJA 3P0FA 4NJEB 4GW3A 3EJWA 4NF2A 4OYLA 1Q0RA 1HKUA 4IPTA 3E9MA 4OHWA 5G0UA 6CHYA 2HZ7A 3JQFA 3SFVA 4C7VA 1FIUA 1R6DA 3E05A 1CJVC 2ZR7A 3RSLA 5KBYA 4ZICA 1XKLA 4BQEA 2TSYB 4US2R 1L4GA 4RTKA 2WUWE 4EYQA 4QO8A 1CJMA 4QZVA 2NUTB 1YOVA 1HDCA 1MO4A 1MEJA 1DFHA 4W5OA 3M6UA 4NU0A 4O02B 3SBEA 3O1HB 1OU0A 4EL5A 2AZDA 3JD3A 3KWJA 1R4MB 2VHXA 3P9QA 3PQ7A 3B20A 5FA8A 1NE2A 1Z6ZA 3GFOA 2DAPA 1ESMA 4UMDA 2H54A 4OH1A 1S2IA 4TMFA 1EE9A 1PLLA 1THMA 5KNBA 16PKA 3DGFC 3KEMA 5HGJA 2YW2A 3ZGNA 2OZPA 2PZBA 4L8VA 4G0XA 4MW7A 4RWZA 2PH3A 2ZRMA 4GPD1 1J8QA 3U80A 2RGEA 1HRDA 2LP4Y 4BVGA 1G1MA 1UJ5A 4L2IB 5IJ9B 4CEHA 1KI9A 3RAPR 4D82A 4TSFD 3N05A 2Q46A 4HN2A 4LQCA 4U8HA 3NHRA 4D9MA 2A7QA 1Q1QA 5DJ5A 4QQKA 3NORA 4WJLA 4UVHA 3RSZA 5T67A 2ZVDA 4B76A 3UH1A 3EHEA 3TLAA 5DHUA 3UK6A 3GVIA 2BFPA 2WA1A 3RAFC 4WW0A 2X6TA 4MPJA 4CDRA 1P9WA 1UAGA 3TXXA 3Q10A 3GLGE 2A9KA 4EPYA 1C2YA 2ZSEA 3OHSX 3L41A 3WMFA 3VDRA 2PZJA 2H9AA 3IX7A 4FNGA 4WZAB 3A37A 2BHNA 4DCVA 2H1HA 1IB0A 1NLYA 1VSVA 3I5AA 4PAOA 3EBLA 3MWKA 4YHBA 5AICA 3K9NA 1FL9A 1SQGA 2AC7A 1W5EA 3R7NA 3AM3A 2W2NA 5HFAA 1BD3A 3TQRA 4RD4A 4BQPA 1PDVA 4REOA 4XGQA 2VAXA 4FE4A 3AT1A 1Z0SA 2PAFA 4QOFA 4F06A 3CRVA 2NSJA 2MTBA 3UWOA 4CV1A 5I01A 1QRTA 3ZQ4A 4BLSA 1QYXA 1PHRA 3CM0A 4E14A 4KQWA 4L5BA 3TAXA 3BRWD 5L4NA 2FVXA 4JUAA 4ZYLA 4UXJA 1W34A 3MUOA 2ORWA 2DWUA 1YBFA 1HDYA 3E2IA 3KJGA 3LW7A 4ND2A 4Q7EA 3CSUA 3X2SA 5KDOA 2JLBA 4HNAB 5KOJA 1GRCA 4JSYA 1WQ1R 1PJZA 2PZFA 1RI5A 4LC9A 3VSBA 4EY6A 3CRW1 4C01A 4XR4A 2OBLA 1FFEA 1VG8A 3CEAA 3E5MA 2QJWA 2YDXA 5FUVA 2EZTA 3ZZ1A 1YZ3A 4KRGA 4QIHA 4GVLA 3UMCA 2XCOA 5DTQA 3CUKA 4Y2HA 2QP9X 3UAWA 3H0EA 1Z36A 3OCWA 3V1YA 2QY6A 4DY6A 1DG3A 2ZQYA 4QUGA 4DR2B 2B8TA 1GPUA 1X7YA 3ORFA 3MQ4A 4MRMB 3BJZA 3NAZA 3RS3A 1AG9A 1Y3FE 3PCRB 4COKA 5CFLA 3QVSA 4YUXA 1FDRA 1Z5WA 3SJBA 1PX2A 2CV0A 3GX1A 2O2SA 4E5NA 4CLRA 1TK2A 4DQKA 1MHTA 2ZTHA 3OP1A 2AJBA 1J56A 3DKPA 3EG5A 4JLPA 5B1HA 1P9RA 3B3AA 3QUBA 4KR6A 4URVR 2O52A 2FWIA 3F2IA 2QSUA 3GNLA 1P17A 4NE2A 1JEDA 2VUTA 4D3SA 3NDIA 1SG6A 2CFSA 4MGKR 4YJ3A 1HK7A 4UBOA 1Z7YA 4E09A 4AJ2A 4H7EA 1CUXA 1S6YA 2OCIA 2GAAA 3LQQA 1Y82A 4MVCA 1ISPA 3PJFA 5IYZA 1F5NA 2OEPA 1T1IA 2ZQ5A 3JQ7A 5T5QA 1LNZA 2CKMA 1ISIA 2HNAA 3K8YA 4O4HB 3CFYA 3AOGA 2LCQA 3C15C 3RAJA 3OFNA 1UXIA 4LOAA 3SKXA 2CK3D 3U3ZA 5KWSA 3H4MA 3GA5A 1O94C 1WW2A 5DKFA 1DAOA 4G36A 2ZUTA 1Q0ZA 2Z04A 1HQKA 2HNKA 3OPYA 1OYOA 5I4CA 4GWKA 5CT4A 3C4JA 2XI4A 1MIHA 1I7LA 2RD2A 1WSBA 2BFMA 4CEIA 1AHPA 3JVIA 2GAJA 1EXWA 2R00C 3QEAZ 3WBKA 5LP6F 1SVMA 1E3QA 1Y7LA 2FSIA 1L2TA 4ZO8A 1NJ1A 2J5KA 3M4NA 4GSLA 3BGIA 4LDAA 2KS6A 2GKOA 5I5GA 1RWPA 4L9WA 3R75A 5BSVA 2XV1A 3KKQA 3CLSD 4ZXPA 5IZCA 1EUZA 3DEZA 2NTYC 3KT3A 2J5RA 4WKNA 2HCJB 3CNOA 4F4FA 4Q3KA 3KAJA 5FNVF 1KDTA 3I5XA 4X1IA 4J3NA 3GLKA 3HCCA 5HQ3B 4A7PA 1U0NA 1KDOA 5JS8A 4JUDX 5CIYA 3LO8A 3GMIA 5HK9A 5DNCA 4ITVA 1G8MA 4NDAA 3ST7A 1KSFX 2O1WA 5DNDA 3RBXA 3PLAE 2C8JA 3AR4A 3Q8WA 2QLFA 1THZA 4O2AB 1OH8A 1UOOA 2JFBA 3GELA 3SQOA 1QVRA 1E2MA 2QTVB 2Z2JA 4KGXA 5LU8A 1IXYA 3OETA 4RVCA 2L18A 4K86A 2UUCB 2P3SA 3OLYA 4JLNA 4CG0A 4BC1A 2HHAA 1XYGA 2JFXA 3AR9A 1RWBA 3W2IA 3ZHZA 4TSFA 3SWWA 3ZDDA 4TQAA 1EFKA 1W1IA 4KK4A 5FUQA 1PWZA 4NCAA 2GNOA 1FC0A 1P0IA 1TX4B 2H85A 3JVVA 4M99A 4NJEA 1J0BA 2I2WA 2WNIA 1HEIA 4OU5A 4CMBA 4GX2A 1DJLA 1VHDA 2SECE 4LRXA 1EFRA 1IIBA 4L6IA 2Q6LA 1H65A 4IGFA 1JPUA 3NFYA 3B6IA 4G6ZA 2OV1A 5ESRA 2JLXA 3CG0A 8LDHA 3AERB 1U1DA 3AWIA 3ZU2A 4JGIA 3MMSA 2DKOA 2VJNA 5IWAB 1HEYA 2HA4A 1Y8ZA 4MA4A 1K5GA 1FPMA 1DC4A 3PCXA 4Q1DA 4RESA 2OCPA 2UZAA 2ZWVA 4BO6A 4OUKX 2IWRA 5AUNB 2D5LA 2GXAA 4V0SA 4HNUA 4D0GA 2PN1A 4QX6A 3ZBUA 5CDGA 1LW6E 1R4MA 2WSSD 3AF1A 1GN9A 3QFFA 4K03A 1AT1A 4KFSA 5EIXA 3GPLA 3EMVA 3N2GA 2BCJQ 2PZGA 4BEBA 1EZ1A 1L8QA 2LPMA 3HA5A 1TXGA 4KUEA 4M53A 3ZX5A 2C4TA 2GR9A 5JH7F 5AKEA 4GLLA 2WIGA 3H5RA 2V7QA 2RKWA 2QJTA 3GXOA 1VL2A 4FWIB 4OK5A 5G53C 3TQIA 5JD4A 2Q1SA 1P3JA 5F9FA 4FKMA 3AEQA 4QE3A 3ZE7A 4FB4A 4HJRA 4ZHQA 1CP3A 1P9OA 3P7MA 2Q8QA 3KDPA 5EVJA 4C0LA 3H4VA 5JEEA 3AUUA 1GTJ1 2XJ4A 3BRWA 3MXTA 3CGWA 5IJ9A 1O5TA 3VPAA 3OLVA 4EPXA 2YIDA 3ESCA 4JLAA 4X20A 2XLCA 1AGXA 1JDJA 1USUA 2B8EA 2EL7A 2G4VA 2GUGA 2ZANA 4U0KA 4LJRA 1XOIA 3VR4D 1P5ZB 3AP3A 1VHWA 4E0BA 5E9AA 2R5FA 5ECYA 1NDHA 1VLQA 3GOQA 5IT0A 3A6EA 2X41A 2B9EA 2FR8C 3JW8A 2XYRA 3W3ZB 3O4GA 4A4DA 2EQBA 4Q7QA 5JY6A 3U6BA 3HA7A 2EX4A 2IZ5A 3H11B 4WXRA 1KYWA 4A5SA 1DLIA 5K09A 1UMDA 3GIWA 2RBGA 1XVLA 4L08A 4ENQA 1LNSA 4HNSA 2WJJA 4I36A 5AP9A 5CYOA 2AV6A 2RGAA 4BNVA 1TUGA 1WB9A 3LMKA 3I9V6 5AM5A 5DYTA 1Y6FA 4WY2A 1DIBA 2ZRBA 4BLQA 5E7MA 5K8CA 4JBWA 5AJVB 1KQPA 1CNEA 2Z2ZA 3FVRA 3D6FA 4HDRB 3VSEA 3F1KA 3D4IA 4LGYA 5FBQB 1S2LA 3SHWA 5FOQA 1NX9A 4EVSA 3S7TA 3M2TA 5T6MA 5JLAA 1A2QA 3DAHA 1ETUA 2XGMA 3BGSA 3P9SA 2VDKB 2K7FA 1YACA 2I2BA 3KVNA 1K2WA 4RADA 1O0SA 1AKUA 4ZGBA 5A0VA 5K0NA 1MX3A 1N2HA 1ILWA 1KS9A 2GX6A 4UZEA 3UJ6A 1IONA 1OXMA 5C31A 4HNAA 3CLTC 1DXHA 2VK1A 4C6SA 2PXHA 4CR8A 4ZTZB 4PC3A 4ZI2A 1E59A 3PC3A 3UOWA 1QTNA 1OMOA 3L0CA 1OC4A 4BWYA 5IVIA 3OKCA 1RYMA 2JIPA 2BEUA 2C4MA 3G49A 3L6EA 4HFMA 2HF2A 1RBZA 2ZJZA 5FYDA 1Z5NA 1K7FB 4R31A 3ZKWB 3T3MB 1NQUA 3VNUA 3O2SB 4FYIA 5D7BA 2HMWA 5K8LA 1XVTA 1T2AA 3PSAA 4P3KA 2I6TA 3FR7A 4GL2A 1YZYA 1ZJJA 3LM8A 2HBRA 3N0TA 4MRMA 5MGBA 3WWPA 2HWUA 2VBIA 2FUCA 4MVJI 5K0GA 5JDIC 2GN2A 3CCCA 1IY9A 1VRWA 2VDLB 1RTTA 1L1FA 4QGHA 4ER7A 5DBGA 3IDFA 1X39A 2IHZA 2NU6B 3Q3GE 3NEYA 4RGQA 4CDNA 1JT2A 4GRAA 2B61A 3AHEA 4S3MA 1L7AA 1RJDA 4G8DA 1U0OC 1MW8X 1E79D 4PHHA 3VHRA 3ANMA 3D7LA 4G4SO 2C0PA 1I7PA 5DOVA 2H3EA 5AQEA 4R0VA 5C9ZA 2BTEA 1U2DA 4AX4A 4A6PA 3COVA 4O4HA 1SKBA 3K70D 3TG2A 4CR6A 1MDBA 1ECCA 2FFAA 1NRXA 2PKRA 4RK1A 3MW8A 1STOA 3JVDA 1MFPA 1C14A 1H9BA 2QB5A 2Y93A 3KYCB 3SP1A 1FVXA 2WYWA 4FYHA 4Q7LA 1A2BA 4TXLA 5EPOA 4OI1A 3AJEA 4EG4A 1YRBA 1ZH8A 3P94A 4IJUA 4CQJA 4PHCA 5BNIA 3CVXA 1N92A 3AY0A 2WF8A 4CLDA 3E9NA 4BFSA 1X74A 2FWJA 3GBVA 3MIZA 3O8LA 2RKOA 4TTPA 3V80A 1KWKA 3L8EA 4G23A 5DT9A 2VJAA 2ZPAA 3FFTA 4JJAA 5FWXA 1ECLA 3WBBA 4LY6A 2IU4A 5EJ9A 4Y3UA 3PYMA 2QNBA 5LUBA 1KK3A 4OQNA 3T7KA 1C9YA 4CI0B 2GJSA 5HQ3A 3IKTA 4ZPJA 1GGMA 3RVBA 2AFRA 3CEJA 4AG5A 1R9MA 4BVEA 1G5TA 5ALKA 1Z68A 3VR0A 1NV9A 3K16A 2K87A 1J0EA 5HF5A 2FR0A 2TYSB 2ZS9A 5AIBA 1WXXA 3L7OA 3UUEA 4B0PA 2CCGA 4YVFA 1V2HE 1V5WA 1KMCA 4I9GA 1RIIA 1G8SA 2PK3A 4NJOA 1XRRA 1NNI1 5FTMA 1GLGA 2CLOB 1JQJC 1VBNA 4TLMB 2J6IA 3RYIA 2GF9A 2YNMD 2JS7A 4G5QA 3LY5A 4Q4JA 2BE9A 4WZBE 5AI5A 3MOIA 3PIDA 4LDQA 4GSKA 3H8SA 4FYJA 4ETIA 3WLTA 3ASUA 4LQ4A 5KC9A 2HREA 1EKXA 4RHTA 4BNDA 4JUCA 2QZPA 5DHQA 3EGXB 5KKNB 1PJAA 1TIBA 5FBWB 3GU3A 1VCNA 3THWB 3CKLA 3ICCA 4NEGA 3WIEA 3VC2A 3N5CA 3W1VA 1Z5OA 3RWMB 1H23A 2HK8A 1ORRA 5C4GB 2J41A 2A1TS 3E7DA 2QPTA 4FYMA 3O26A 3U40A 3VX3A 5FUMA 3OICA 2XKAA 4ZYVA 4EGQA 3D59A 5B36A 4GR5A 4D92A 4U2GA 2A3NA 4AM8A 5E1DA 2COUA 2YHBA 4N6NA 1RZUA 4D1YA 5LP6B 1V45E 2QTHA 2P7IA 4H27A 4KIFA 1E2IA 5H16A 3VJLA 1M0SA 2A9PA 2BN4A 4IFTA 2GVZC 4E2ZA 1YA8A 4Y30A 3B2QA 4LJ9A 4ME6A 1IEXA 3QX8A 5FNVB 3L92A 1HE1C 4WH0A 2CVHA 4MOWA 3AVQA 3A11A 3H2JA 3RODA 4BZXA 2BR4A 3Q3HA 4ZU6X 1JLMA 1M34B 1KQFA 2WIFA 4OLBA 3OTHA 3HY4A 4EI9A 3ZDCA 1Y9AA 3OQJA 1P60A 2OBXA 2EJWA 1G17A 3OJXA 5AOBA 1RWNA 5E9WA 4IDEA 2D13A 3F7TA 3P1JA 2G4CA 2HSEA 3KE9A 1KZGB 3FLEA 5JW6A 4MZXA 3SSMA 5TDHA 2HQBA 5HRCA 1DRJA 2FOIA 2QMHA 4V0NA 5IFKA 1R74A 1CRLA 2R5WA 3LDUA 5LD2B 1OFIA 4C30A 4DNFA 4RPLA 1P2DA 3WWYA 3SZMA 2Q4BA 3GRKA 1W4BA 3QUTA 4XLTA 2EP5A 5DVZA 5JNLA 3ENKA 3DMNA 3N7TA 4R9VA 5AXCA 4BLVA 5DW3A 5TQ0A 1G7SA 1N8NA 3EGIA 3ETEA 1MO2A 2A0XA 4WNAA 1KBOA 4D9FA 1M6NA 2ZRJA 1D0VA 5HIIA 1B7GO 1RLTA 2ZM5A 3A1TA 4HTFB 5J1SB 1MTZA 4NYMQ 1NURA 1MD9A 5B53A 4FWTA 3V4FA 1C9NA 2JJQA 3AVTA 1F6DA 4AS2A 2QRMA 1G5RA 3IAAA 4YRJA 1CV2A 3FIJA 3KL4A 2WU0A 2G1PA 4PVCA 3G68A 3UAZA 1E79A 2DFKB 3EZ2A 1S5PA 1G4UR 5FNZA 3A6FA 2F8MA 2P0AA 2YDYA 4L8LA 5IM5A 4F93B 1E7WA 1O87A 4EATA 2NV6A 2EYQA 1GN8A 1ZOPA 3DCNA 1E9AA 2DEUA 5FV4A 1YQXA 2IYXA 1EWQA 4D5GA 1PRYA 4Y9TA 4HB3A 5JH7B 3AESA 3NAGA 3AEYA 4P3OA 1JI0A 3T12A 2HSJA 5HDQA 4MQ5A 1CF2O 2G0AA 1P73A 2NO0A 3C45A 1XG5A 5A5EA 5K7SA 3EQ7A 3SYNA 2G63A 3SD7A 4G0ZA 2O3TA 1YI8A 3HYLA 4XLLA 5ALRA 3BGWA 4YAEA 2BMVA 4KYVA 3GI1A 4GE0A 3TL2A 3QF4B 2P6UA 3NTRA 3SJCA 5BV0A 2R97A 2X9NA 2XTAA 1OAKA 3AHIA 4YV1A 1CS4C 4RVDA 1HXHA 2ZXUA 1TMYA 3ESDA 4XJXA 1XZAA 3ND8A 4GICA 2HMUA 3BGDA 2GD0A 2XMBA 3DWFA 4MV9A 2BGWA 5I7HA 1QGED 1LRKA 1PFQA 3AKCA 2JCYA 3OJ0A 1UANA 3KVVA 3KWMA 3D3EA 1MA3A 3ZJVA 5KO2A 1RJFA 1DUVG 5JS7A 1JE1A 1H8HD 3O95A 4NOMA 5LQRA 2WZCA 1Y1TA 2P9GA 3I64A 4ODIA 3SVLA 3SC2A 4D25A 1OWNA 5JAPA 1Y98A 1JFFB 3ZCTA 2DY0A 1TIPA 3MERA 3K6KA 4CCYB 2H29A 4HGOA 1KAMA 2YBEA 4GXTA 3HCEA 3KVYA 1P62B 1HDZA 1VZ3A 3KXKA 3RTDA 3R7AA 4B09A 1D4FA 5HYVA 4EG6A 1RAEA 2IHNA 1MEOA 1BQEA 1CERA 3KLBA 4C0QC 4RY2A 1N36B 1Z5GA 2AZTA 1JDUA 2OMKA 3PWKA 1L7EA 5D6NA 1HFKA 4J4TA 2G1AA 1M9NA 4YR9A 2ERCA 2CVQA 5A71A 2R87A 1IUNA 3OX3A 4BFXA 4EX7A 4HVCA 5BP7A 4LYYA 2Q5QA 2YFQA 1CIPA 5A4JA 2X0IA 2CHEA 2RHJA 3PE6A 2OCBA 2AOTB 2GBGA 1KYXA 1XK7A 2B99A 4I3FA 3BWXA 3DBHA 3I28A 1UBGA 3RW9A 2NUAA 2ZITA 2C57A 4CM8A 1Y1SA 1O95C 5L4SA 5CG1A 1SK9A 1SXJC 2F1IA 2OO5C 3G13A 2WAOA 4OP2A 1OPRA 1D07A 2HW8A 3RFXA 4JI8B 3AUTA 1TCUA 1GZ3A 2O0HA 3BWCA 3TG8A 1I13A 2Q07A 1M2FA 5LXTF 1PGOA 4IS3A 5BNTA 2AZ4A 3QNMA 4QYMA 4O8CA 4CU5A 4BKUA 5B3LA 3EXHC 1PR5A 2YQ5A 2ZI3A 4YUWA 5WRFA 3K1ZA 2PLWA 3IUYA 1OAOC 2BR3A 3LUDA 3AXTA 3DDHA 2DFPA 2FW0A 4BNUA 4EQ6B 4D3ZA 3QLVA 3KP1A 1PN3A 3H9QA 2WWFA 2PPVA 4L02A 4JP3A 4D8XA 2VHQA 3Q3IA 3QGMA 1FMTA 3SLKA 3FZNA 1GFSA 1Y6RA 1JAXA 1YZVA 3MAGA 1NJGA 1OZ0A 1U80A 1UUFA 3EOAI 1Z4LA 3NIFB 3RUDA 4ZQBA 4S24A 5B6IA 1G4AE 2O8NA 3DFFA 5AVTA 4UTRA 1TEXA 4UUPA 3AB8A 3L2OB 3GFGA 4YP9A 3STUA 4DUYB 1CZKA 1USKA 4I5FA 1NSTA 3P9ZA 1FU4A 4OBBA 4D98A 4BUZA 3L6CA 3I42A 4JEMA 3WL4A 1DGQA 1U3TA 1CU1A 4NJMB 4OHYA 3AEZA 4FZRA 1EK0A 4P4LA 1WPGA 1RXIA 3PFIA 4HC4A 2GYVA 1ZHOA 1HGXA 3TZBA 3H2YA 3ILXA 2BP7B 5HJ5A 2AN5A 2IY7A 3FCYA 4QM6A 4ZT7A 5HF9A 4DIMA 1U0BB 3QBVA 4B3BA 1PJCA 1QHSA 3FUVA 2R6ZA 4RM2A 5CYGA 5ABPA 4LFAB 1M7HA 3TLJA 1KVQA 1U2EA 2Z2YA 4JD5A 4NYJR 5BYJA 4WJKB 4B6RA 5FNVA 1QCYA 4I6EA 3UWMA 2ZTUA 3BSFA 2PGNA 1BXKA 1RCFA 2GVNA 3JWIA 3ESXA 3F49S 1BRMA 2NOAA 3RGGA 2BJVA 2M6SA 3H99A 3AY3A 3PQFA 3ZW8A 1Z8NA 1MN6A 3NBYC 4O4LF 4DSAA 1FLDA 3VX4A 3EAFA 2Y27A 3HV2A 2PV7A 1Y9DA 2WWRA 4Z3KA 3DAFA 5K9ZA 3CCFA 4PAQA 2NZUG 3WIUA 1ADCA 1U31A 2ZRPA 1JEEA 2HV8A 3TECE 3ZWBA 3SX4A 4E13A 1A69A 1KK1A 2RAFA 1C7ZA 3LKDA 4GF5A 2AN4A 2BL4A 4MSUA 4ONEA 5IJ0A 2Q1UA 4M7RA 2ZWIA 5FBVB 1W46A 2R96A 4ZOCA 1OLSB 3VC7A 2IH4A 3HYNA 5UKDA 2ENUA 3ID6C 5DHSA 2QMQA 4IZOA 1QIDA 3VHXB 3PS9A 3ZE8A 4GUAA 1I80A 1VJCA 5HS4A 2IHYA 2QXTA 3LOUA 2AC4A 2CVPA 4S05A 3B1VA 3R4VA 3ABOB 4PR3A 2RK6A 1U0TA 1G60A 3NHPA 1MC8A 5F12A 1KFEB 3FKSD 4HTFA 4AJKA 1N34B 3WLFA 3CWCA 1DQSA 1LLCA 2ZCVA 3LX8A 1E6CA 621PA 2A5FA 4Z2YA 1OVMA 3TKYA 2FJ0A 2PKQP 3ICEA 4D3XA 4MYRA 2HCFA 1UADA 1KU6A 2CJWB 2KSQA 2WVHA 2DGDA 2ESRA 5FOWA 2OYCA 4YCLA 3WLSA 5CLJA 1Z4PX 4DR3B 2EQ5A 4GWLA 2CLLB 4BO7A 1ZR2A 1OJLA 4DQLA 1OBFO 3EA5A 4YCJA 4Y6GB 1GEEA 4M9CA 1DAMA 4MR8B 4EELA 3PC2A 4YLYA 3RS4A 1QGUB 1A95A 1NR5A 2CMFA 1S2NA 3ZDBA 2PZLA 1SUFA 2J08A 3FJOA 2O8DB 3GPIA 4TN5A 1RC0A 3CVUA 3UJ8A 5H4GA 4QTZA 1JVSA 2V4UA 4UTVA 2CYAA 3SMQA 5JC8A 1JIVA 1Z16A 4DPMA 3UN1A 5GAJA 2VPYA 3VU1A 4TM8A 4ZYWA 1J7KA 1J8YF 4DNPA 5HFJA 4M7PA 2AMLA 4LGMA 3TTUA 1PFKA 2J7PD 4H16A 4LZOA 4BLPA 1MX1A 3CS3A 2EEZA 6ABPA 3GLIE 2FI1A 3W04A 4HZUB 4TLAA 2NYVA 2E82A 4OFBA 5AI0A 1MQAA 1GKYA 2HJ9A 1HI9A 5K6AA 3DMYA 1Y1PA 3BULA 3MGBA 4MV6A 3VNQA 1QP7A 5IN4A 3OEWA 3IKLA 4C7KA 4L78A 5FR1A 2DQZA 3G1UA 3T7JA 2EGUA 1NY6A 3E58A 3VUEA 4MUAA 4A27A 1JHYA 3TLMA 4JNCA 1EYZA 4WA8A 3ORRA 2E1RA 4EUHA 5C0OE 1JFFA 3KSMA 5J4HA 2PL5A 3T5DA 1DINA 4CCYA 3H1GA 1PR1A 3VDNB 1F8GA 1MW9X 5BW6B 2GH1A 4L5CA 1W48A 3TQOA 2GZMA 3C3JA 4B33A 5KMGA 2X5OA 4V1CI 1PT5A 3LUCA 4TL7A 2JNWA 2JCVA 3AV3A 4B73A 4LE2A 1U9JA 1MTOA 1NA5A 1FDOA 2I3ZA 5A3JA 1RJ9B 5AW9A 8OHMA 1PNRA 3H5LA 4Q3BA 3TMKA 5BNZA 4PWYA 1X7XB 1DKRA 5I8WA 4CV3A 4IIJA 4L27A 4LGVA 3RC3A 3L7DA 4XWOA 3C97A 5I8PA 5K0FA 3E7FA 2EYUA 2F00A 4HDRA 3AC0A 3H4TA 3LQFA 3JWEA 2FP4B 4B6EA 3HJGA 4AS3A 1DEOA 2OL4A 4B2PA 4BJ1A 2BSXA 5TX7A 1RE1A 2NYRA 1OC2A 4HWSA 4QQRA 5TV2A 1JTFA 1XD8A 1FMJA 3TO5A 3O8QB 5IK2A 1HY3A 1RVV1 3S2IA 4FFRA 2BRUA 2RH5A 4EP1A 5DGCA 4ENUA 4UFOA 3CZ5A 5CJ2A 1YS6A 3OFSA 3GPBA 2BLNA 5FPPA 1N1MA 3R0IA 1VFNA 2CEAA 3LXRA 4KZPA 1E96A 1ORHA 1ECBA 2E48A 3QK7A 4NATA 5AKZA 4EYGA 3REOA 4ILEA 5BW4A 3NTQA 4KPGA 4L6AA 3W5IA 1Q3TA 4LK3A 3UWSA 3DC7A 4DM7A 4DDTA 3H7IA 4BQNA 3HCRA 1EDBA 3H16A 3HLYA 4UM8B 1ZSVA 2RGCA 2YXPX 4J91A 4WFKA 4W5HA 3DDOA 5EESA 5EXXA 8GPBA 3UTCA 3EZYA 1J70A 1NVVR 2A9VA 3JR3A 2VHEA 2DERA 4CMIB 4OQFA 1ZBDA 5IEBA 5JOQA 4LTMA 3ZY6A 2CDCA 3PUZA 1GCAA 5T64A 4HFRA 1B6GA 4JLOA 1S9DA 1UK6A 2FPMA 1ZH0A 3UB4A 4PNHA 2XQGA 3SX2A 1H4SA 3ORYA 3H17A 5L45A 2RHTA 2HK9A 3W0LB 3MJSA 2PWAA 2PL1A 3RYFA 2ZBEA 3RSHA 1IJKA 1J8VA 1VXRA 1JG1A 4Y6QA 2G5PA 3R2JA 4IZ6A 3SQXA 3VSCA 1U99A 1PSDA 3TOSA 1TO2E 1ZK1A 2H1IA 2CLEB 4MQMA 4UDOA 1U28C 4RA6B 4CCAA 3D81A 4ZZ3A 4DV7B 4DR4B 3DZGA 2R6R1 1I9CA 2PT7A 1E2QA 2AF4C 5L3ZA 2IU3A 5H8WA 3KYJB 3P2KA 5HOQA 3Q3VA 5CBPB 1NM5A 1PNVA 2E7ZA 1NZDA 2XA2A 4JS0A 1M1UA 7REQA 1GAEO 4GMFA 2FN7A 1LKZA 2BF7A 5C2JB 3DXXA 2R3SA 5LXTB 5AVYA 2ZBQA 5CAEA 1PR3A 1OBOA 3DWEX 3BWMA 1A9TA 3NWBA 1B23P 1DBIA 1RQGA 4N8EA 2JFYA 2O2CA 3ADCA 2HOQA 3G2QA 2YIJA 3OZCA 1WXDA 3U7JA 5KQLA 3D3WA 1RXEA 1ST3A 3WRWA 2RGNA 1OLSA 2M6LA 3V34A 3Q7EA 3W9UA 3VHXA 1XBTA 4M9SA 3FIUA 3WICA 5H9WA 2O59A 1LBHA 5EFOA 3BRSA 4NK5A 1I24A 4PLGA 3D4PA 5JHGB 1QOQB 2EJBA 5D85A 4F4HA 5EP3A 4PC1A 2DY1A 3MT0A 5SV2A 5KWEA 3PUVA 3E61A 1IE3A 3PXDA 4XGIA 2JBHA 3WGVA 2GCOA 3GFTA 3HHPA 2WIAA 3OEHD 4I4NA 4MA5A 3W2EA 3GZ4A 5ICEA 3R7DA 2JL1A 3CUUA 4BMDA 5HRUA 1TL7C 1QHNA 2CJWA 1GADO 5JE8A 3LVRE 4D7AA 3M5CA 3HI6A 1AV7A 4A8JC 4R8LA 4ZI3A 4FM9A 1CIJA 4BDSA 1L0BA 2ID8A 2PTHA 1A5SB 3EW9A 2QL7A 4UE6A 3N58A 4J0QA 3H1BA 5FPYA 1HE5A 3KSUA 4J1TC 1UKZA 3G0DA 4D80A 4X90A 4RE6A 2YWGA 2TMGA 1WVIA 4D4IA 5C37A 5KPJA 5KZMB 3J81k 4M37A 1E99A 2J85A 4HNRA 2BOVA 2BM0A 5F1OA 4EARA 4F85A 2QV0A 2R86A 3BKXA 3TNLA 3AL2A 1JIUA 2RC6A 4O4LB 3UFBA 1AQJA 2XUOA 1JHAA 3L7YA 1ZGGA 1T0IA 4MHSA 1EHYA 2C2HA 4LRYA 4R6XA 1U3VA 1YMVA 2H5LA 3FLBA 1I3CA 2FWPA 4XXHA 5EMJA 5J9FA 5JVDA 2FMTA 3PJEA 1GL6A 1SOMA 4RSMA 1CP2A 1OI2A 3AF6A 2BFCB 3DA8A 4HZUA 1P2TA 3PPWA 3C1UA 4E51A 2PO5A 4Q3OA 3UB2A 2MR5A 4G5HA 4FLEA 4J07A 2H0RA 4DARA 1JLKA 2GM4A 1VBFA 3DMFA 1GAJA 3L0IB 2B37A 3MGCA 5LNK6 3PQ8A 2WNHA 4UAUA 1JDZA 2JG3A 2BLLA 1T9CA 3FETA 3LV8A 2V7BA 1SVOA 3SHVA 4CL8A 1FDUA 4FFNA 4DMGA 1P5FA 2IOQA 4GKKB 2Q3MA 2QEQA 4E6EA 2WV9A 4QEDA 1YZUA 4P35A 4YO7A 1OH5A 2ONZA 1DRKA 3F46A 3I5UA 1FXWF 5BURA 1V7ZA 3UA4A 3RD5A 5LQDA 1UQTA 4UAGA 1XEWX 4PNPA 3TOCA 1IBMB 2GRUA 4TUYA 5BV7A 5JSZB 2G08A 1AZWA 3GFQA 4RMJA 2QMZA 4MTCA 4YQEA 3UJHA 4W4TA 4Z4GA 2H48A 5EMKA 2WJ6A 3NBAA 5TGDA 3LAWA 3NS7A 1T9BA 1OWMA 1YCGA 2XYPA 4UHDA 1NUTA 4KXLA 1BN7A 1NVMB 1WDKA 2DPHA 4Q4DA 4DL9A 5MFZA 1ICEA 3QI7A 2M32A 1J39A 2VPXA 1EVYA 2Q7XA 1UIMA 3DE1X 2G70A 2ZRNA 4R7GA 4I9NA 2YHSA 2FP4A 2B7BA 1PZHA 1QH1B 4F56A 4MQUA 1DEAA 3A2MA 1M66A 1ZC4A 1U0FA 2WC1A 2YW9A 1H1LA 1P75A 3PUHA 1HNWB 5F2OA 3VJKA 3GWGA 3D5EA 4GLFA 5AVVA 3O8QA 1JSCA 5SY4A 1UC5B 1Z5PA 3ILVA 3LX6A 1JX6A 4KACA 2DG2A 2WMOB 4D4KA 1AA9A 1RC1A 2B2XA 2OECA 3FM9A 3LDHA 3WK6A 3BEDA 1E5LA 3ULKA 1FDVA 3WGYA 3DCYA 2JLCA 3QPBA 4QRHA 1KQNA 4YRKA 5HBRA 3JWGA 1FJHA 2JFFA 2ZS8A 3FOWA 4KFUA 1JQLB 4W7IA 4DM3A 1DCTA 4M36A 3GJYA 3M1AA 4JKOA 3A1WA 4BASA 2V6GA 4JP2A 5AVRA 3JAMA 1GYPA 1V5FA 4JB2A 3CSDA 4N39A 4YRRA 1AIPA 3R3ZA 3KC2A 2OPBA 4M0CA 4EG8A 4C29A 4D02A 2Q0SA 1XSEA 1PEYA 4WZZA 3RIGA 2RJNA 2X8JB 1YFLA 5IUKC 3F67A 4DCTA 4C05A 3T94A 4XJVA 3SKYA 4CG2A 4D8UA 2X1HA 1SCBA 1M6YA 1X9GA 1ZRSA 1I1QB 2ZRLA 4LV6A 5HUQA 1C4OA 5EWMA 1GNPA 3L0BA 4QUAA 4XOIA 4AY4A 4MPPA 5EFZA 1H2WA 4R1NA 1QVZA 2XJ9A 2GPWA 1Q84A 2V9PA 1N9GB 3GJSA 4F5ZA 1AKMA 1QG2A 2GMWA 1ULZA 1JAIA 3NHJA 4H17A 1ZCZA 4DV0B 1LWOA 1ZCBA 1PNQA 2O14A 1FQOA 1DC5A 1UM8A 2E4ZA 1NNLA 1O9BA 2P6PA 4UAJA 4CMCA 4HV4A 4YRAA 1ZN7A 5HJEA 1FNBA 3C7KA 2AOUB 4L51A 3OEHA 4LF7B 4RA6A 4C0HA 2D5CA 2P5YA 2CZGA 1YQUA 5K0TA 3HACA 4R1UA 3BB4A 1MUUA 1NBMD 4D4LA 3EZLA 3QX3A 1F6WA 4UBNA 3QF7A 3ABRB 1WVGA 1PUIA 2MMCA 5CBPA 1GR1A 4FLMA 4BX2A 4UHKA 2EKZA 2DUJA 2NV0A 4MLCA 3FMPB 3GAFA 2NO4A 3S2SA 1JHXA 4BMYA 2ET6A 2VJLA 2M1XA 3A7EA 2BMFA 3H1EA 1VRVA 1TEZA 1ZQ1A 1PK8A 1ZVJA 2OUIA 3BZWA 1VCMA 3BSSA 5SZKB 5HILA 4MEJA 2WEKA 1LK5A 4PM4A 4PEVA 2IZ0A 3ESYA 1JHZA 2ID9A 3LUAA 2W2OA 3O82A 1YR1A 2JRLA 5FQNA 2EU8A 2JAQA 2XDYA 2PJDA 3PGXA 4ZJPA 1F2TB 5DX0A 4GOND 5F7OA 1PQPA 1ZM2A 1FNDA 3F4KA 3UFXB 5KQSA 1ORIA 3IQDB 1I94B 3DTYA 3K0AA 1LBEA 4AUEA 2O5EA 2Y6UA 4KTVE 3GD7A 4Y2UA 5DWQA 3RJMA 5LIRA 1QAQA 3TD9A 5I51A 4EGSA 1R00A 1T1JA 1NP7A 1ACJA 5F7JA 3FH0A 2GVDC 4Y67A 5A04A 2OQIA 2QPAA 1G5FA 3CVOA 2C9ZA 4EBBA 3B52X 2J3JA 2Y99A 4K9RA 1I6KA 4PANA 4AVYA 4QU8A 4F6RB 4CKCB 4MR9A 3RADC 1E3LA 2W4MA 1XTUA 1CZNA 3CUWA 2V03A 3KPVA 3L8ZA 4UHJA 4QDXA 5T4EA 3WYEA 4BEJA 3AVYA 3FYUB 5DI9A 3VM6A 1ZLYA 1VKHA 1WVMA 4RWEA 4AO8A 1M2OA 3FSJX 4LNUB 2H52A 4OAPA 4YQZA 3I39X 1JB9A 3RC7A 2MHCA 1GPKA 3MS2A 3EUAA 3T5TA 4BAUA 1QU2A 2Q6TA 3WTBA 2HU8A 4DDHA 1H8EA 1IM2A 3VZRA 4CMHA 4GYJA 2P9EA 1LFDB 2FPSA 2RGDA 3DBLA 4ERNA 3I52A 5CNIA 1EESA 4L9SA 3E18A 1VHTA 1W581 1M0TA 2C9OA 2M6KA 2C1EA 3UMVA 1YMQA 3PRHA 1NONA 1U98A 1VJ1A 4AJHA 3L07A 3EVDA 4M46A 3RJZA 3VPBA 5FD8A 4IMPA 4PXSA 4WXMA 4DSOA 4GM0A 1PZMA 4ITRC 1CEXA 2WD8A 1Z7GA 2PGIA 1U2GC 3DB2A 1T4DA 3MC1A 3K32A 4Y2TA 5CH8A 3AVVA 2BGNA 3EVZA 4MW4A 4URWR 1BD4A 1U0LA 3ZCPA 5AVWA 2EVWX 1YVRA 3CRQA 3QWBA 4HZIA 4ZI7F 1Q77A 1O6GA 4G0UA 3SIPA 1ZVMA 3URMA 1S2GA 5JALA 2GA9A 1DADA 2QTLA 4WK0B 4P3XA 5BVHB 3H8WA 2J48A 3WE7A 1BE8A 4QXAA 3WLIA 4QYTA 1PUJA 5K99A 5EMNA 2RK4A 3STWA 3EISA 2JLAA 2PQMA 4PBSA 4DMRA 3PRYA 2P9BA 4KPUB 1YGYA 2WIJA 2P4UA 3DMTA 1RWVA 1PTJC 2LTAA 1KA9H 4OAOA 4XYLA 2B1GA 2VDOB 2WZBA 1NN1A 1R6AA 2YVKA 3QBTA 1PV2A 1D9XA 3I4CA 2GEVA 2G06A 3IQFA 3H9CA 4RQTA 3H42B 5JSZA 1SD2A 1RZVA 1W96A 2I65A 2V59A 3ZK8A 1F7VA 1LS1A 3UJNA 2C42A 2R8ZA 2EW8A 1V0JA 3TSYA 3QTTA 1CDEA 1UKVY 3VNBA 3L5OA 1LRLA 1U1EA 2XZPA 3GNSA 4WBNF 1M76A 1VI6A 1O89A 4UMVA 4EPVA 1PUXA 4DLSA 5JMPA 3ZD7A 3MD0A 1ADJA 1Y3IA 3DFZA 4XZ3A 3IOYA 1IN8A 1VB3A 1I2MA 2BWJA 3B60A 1WZUA 2GHTA 3V2IA 1NG9A 1JDSA 5CNJA 2GBLA 4DTCA 1W93A 5E3HA 1NSYA 1HYBA 2W2VA 3I4LA 2DCUA 4BCDA 1XMQB 2I4IA 4Q1EA 1RXVA 1ZRMA 2LV8A 2UUBB 2FY8A 4HEA1 5C81A 2C61A 1EQ2A 1XNQB 2Z2XA 1WLYA 3PHIA 4J0CA 2B21A 2EF1A 1VGRA 1XAIA 3O8NA 5AKHA 3FLAA 3NVAA 4QVGA 3VH4A 1AQYA 3D3NA 1U8FO 4KV9A 2XWQA 1SU8A 5D5PA 4DZRA 3FOEC 1BHO1 3UMFA 1NBMA 1LB1B 4TWAA 3KQQA 3II6X 2XRYA 1MO5A 2AFHE 4WCFA 1ODCA 3IOBA 4YP7A 3HDJA 3BBPA 4HYEA 2B8NA 2G04A 3RRNA 2ZB4A 3ZTWA 4AF7A 5I9IA 1GPH1 4Q39A 2Y05A 4IYRA 5E2AA 1DV1A 3GEGA 1EVIA 1K8RA 1MU0A 2VYNA 2WDPA 4N7RA 4NOLA 4N3BA 3W1EA 3WL5A 4DLNA 5DO9A 5L40A 4FDLA 5HE9A 3ZOKA 4KDEA 1ZVVA 1MB4A 1ISGA 1V5GA 1DDOA 1UJ6A 2QTRA 3UG7A 1G18A 3I92A 4YP5A 2YZ7A 4RTQA 3IODA 3ILYA 1GNTA 3K1AA 2GS9A 3EZGA 3PTZA 1BYIA 3C5WP 3L1IA 4OBXA 2VNKA 4Z0PA 2C96A 3PSHA 1VA5A 3RYHB 1WMSA 3HU3A 1ZLXA 2OHFA 3H5VA 5AM4A 5IKOA 1LPOA 3VR3D 3CLUD 4UU0A 3ZCVA 4D79A 4D4JA 3T5CA 4KPEC 5LQCA 2BTQB 2AH5A 2GRJA 5FTWA 4B7ZA 1ZVQA 4ZQFA 4A23A 5FP0A 3H6GA 3DSRA 1YRHA 3U4QB 5TSDA 1XNHA 1D8AA 2AOUA 4UTZA 4BKPA 2C7GA 4DT1A 2V45A 1XDDA 4FEYA 5KYWA 1BZYA 2QORA 3HXOA 1YKFA 5GJBA 4KN6A 4C07A 5ESXA 4ZYYA 1VPTA 3LF1A 4P22A 4F97A 5D7NA 4IIGA 5IAOA 3UV6A 5KSOA 2OK8A 2FN3A 4UBJA 3ZCUA 2XNJA 2Y66A 1DIOB 4AKSA 2MIIA 3KD2A 3LLCA 3IJEB 3NGMA 4M9ZA 2VP5A 1Z0DA 2BSAA 4G84A 2XTMA 4PO8A 3RJ9A 4LG1A 4LDRA 4B4DA 1T26A 5F33A 4CN8A 5HZMA 2QM0A 1Q0HA 3ETDA 4OXNA 4QAJA 2Z3WA 3GJXC 2R84A 4ZARA 2DUUA 1K8YB 1UP7A 1TECE 1L5WA 2C59A 2YX1A 3GRFA 3O3NB 3BB3A 3FWHA 3I1FA 4UD2A 5A7HA 3M6XA 3ZY4A 4ZHSA 4RIIA 3PQCA 4MJ7A 5DI3B 4UZFA 4B8YA 3PV0A 3VZPA 4JT9A 5JCJD 5JUWA 4ZU1X 5JZOA 1B2RA 1VL0A 2IE0A 2PSEA 5FB3A 5BOVA 3TMYA 4EHDA 3KQSA 3L1JA 1WMDA 3LFTA 3TE7A 5GIOE 2WM9B 3DL2A 3PT5A 4UUAA 2QT0A 3L8MA 1YULA 5H3CA 1F2TA 2Y1DA 3IXLA 5HA5A 3RJ5A 1U3WA 2WU8A 4RZXA 1ECGA 1ZKDA 2PL9A 1G63A 1O2DA 3T3HA 2VS1A 2WWVD 3ITKA 4I4TF 4YP0A 3DMPA 1NTOA 4JQOA 5D6OA 1M2JA 1XDWA 1UQUA 4KE9A 5H81A 4DQXA 4BAGA 3MILA 1CUJA 2CF5A 2Q5IA 2E3JA 2BGTA 1RRVA 1MAAA 5LYJA 3F8TA 3GP5A 1U7HA 2OHOA 1Y1LA 4CKCA 2ONKA 3QE4A 3RU3A 5DV9A 3LT5A 1O3YA 2VDPB 2X86A 3JTMA 1C30B 1T0UA 4P0PB 2XYQA 1MOPA 2JHAA 2H51A 3DFUA 4KN5A 1MJHA 1QGYA 2P2CA 1XZEA 1IY8A 2AJ8A 3G9QA 3PYXA 4DV2B 1HQCA 4NVRA 1O97D 4RF5A 2X1VA 1T6YA 1QIFA 1X1EA 1FVFA 3SSAA 1PK9A 4GBMA 1XHFA 2CHQA 4PLFA 3BXHA 4UNSA 4EY5A 1MAVA 5CTJA 1YRAA 4B3TB 1CJCA 1ZN8A 1PGPA 4IOJA 4WKPA 4WY8A 5EXEA 4BATA 3HKBB 4D4HA 3LFUA 4E5MA 1N5DA 2W2QA 1FZTA 2FN8A 1BTOA 5IX8A 1U8UA 5E7QA 2HR1A 2IYTA 3OUTA 4BV2A 1N1GA 1F9EA 2QTNA 2Z4TA 4GRIA 5ALHA 5EZ6B 5EJFA 3ZBQA 4B2IA 1EVKA 3AZQA 3TNDA 3BA1A 4EX6A 1X7WB 2OA0A 4CETA 4DB2A 3A58B 2Q5OA 4PFJA 1Q20A 2RGYA 1U8CB 1VP9A 3DUFB 4BX9A 2VHUA 2BEVA 1EFPB 4JT2A 4LSMA 4K2AA 1FLAA 3FCUB 1VPWA 3IKMB 5BVHA 3PJDA 2CVOA 5GOTA 4YI3A 3H7AA 3DLAA 5ALXA 1M83A 1PYGA 3JWHA 1H9CA 4MYUA 3UA3A 3C1OA 1BXRA 2I3DA 3KSRA 4BKQA 4W8GA 2YKGA 2WYOA 5JAIA 5BN3B 4YRCA 4OQPA 2UUAB 2XMPA 4KPUA 5E8RA 1RHKA 1HZZA 3V7YA 1M72A 3IVAA 3SXJA 3A2LA 4G5YA 3U26A 1ODTC 2FN4A 1ESDA 4RU1A 2BFDB 3KKOA 1BXGB 3HFJA 5ESDA 3DVQX 1R16A 2IDMA 4RDIA 3EZ7A 1ONPA 1JNXX 3DEAA 3GLSA 4I5GA 2GN9A 4DQ0A 3U7HB 3O8OB 1S1MA 2XE8A 2XCUA 2OG2A 4JEIA 3WKAA 2QNIA 1T3GA 4G09A 4C7JA 4CM6A 3HYRA 4E46A 1UWVA 1GDDA 5FUWA 4C6RA 4E15A 3D1JA 1HT2E 3PGLA 1E69A 1WKBA 3OUZA 3RTBA 1G66A 1QNLA 2B1IA 4V02A 5E2BA 4AZVA 5LWHA 1TADA 2J30A 3L7JA 1TEHA 2YWRA 3GN1A 3ZU5A 4ES6A 3IV9A 4JI6B 4KQXA 3VR5H 3PF9A 4YAGA 5A4MS 4IH9A 4KVFA 1U8EA 4XX1A 4KSCA 1Z6GA 4PZDA 1TCBA 3AIIA 3V2UA 4M1TA 2HMVA 3GY0A 1QKJA 1XTVA 3NG1A 1EFVA 1Z4KA 5IRCD 4W99A 2A2ZA 2FW9A 5GONA 4BVBA 3U19A 4JLSA 3EVGA 2XZDA 3AHJA 3ZC3A 4LYGA 1Z6QA 3BCHA 3HWWA 2ZS7A 3IUJA 4X1YB 3T95A 2V1UA 4J9UE 2XTJA 3NTUA 3Q6NA 4OGGA 1OZHA 4H35A 2YHIA 3GAMA 4PGGA 3HADA 4S12A 1E9EA 5IAAA 4ZI7B 1HX7A 3NJ8A 2CBXA 1C3VA 5EI5A 4MWTA 2Q4RA 5AKXA 3DZBA 4KAJA 1FVOA 3ZWDA 3WLQA 4ARVA 9ABPA 4EMUA 1KQGA 1LLFA 2PH5A 1SM4A 1T1SA 1KP3A 4KAFA 2NPIA 1C9DB 2FPXA 1XV5A 2Q9AA 2VCYA 5B1EA 3ZWYA 3ZIAA 4F92B 1VKNA 2GOYA 3O92A 3T7RA 3OF3A 2HYDA 4INPA 4YBZA 1V35A 1R6BX 2R62A 2CLHB 3WLEA 2AFIB 3MCUA 1A76A 2Q2WA 4M9QA 3LHDA 5JCJA 2ST1A 1GPLA 3OG9A 1R10A 4F72A 2QW1A 3CLVA 4UBMA 1CJKC 2QL5A 2VP6A 4WA7A 1EP1B 5FI0B 1ORDA 3L46A 3KJHA 3N2IA 3RWBA 2JVKA 1Y7TA 2Q27A 2X3FA 4B0OA 3AVUA 4O33A 3FYCA 2QRNA 4WBNB 1CY2A 4RZIA 1N8SA 1BCRB 2W2MA 1YBVA 2YV1A 4LJKA 3OOEA 1VDMA 1YMUA 1N8KA 4QJ3A 3QKWA 3TFWA 2Y1XA 3L8GA 3U4QA 2XZLA 1Q1NA 1TJPB 2YIMA 1UDCA 2CD7A 1V25A 1XQ9A 3D6HA 4JUFA 1D1SA 4HX2A 2C78A 4C5BA 5M34A 4DIFA 2ASEA 3D3QA 4MQ6A 4DBLC 3PEEA 4E7PA 4S1NA 2H07A 4Q5IA 5DM0A 2BFEB 2UYHA 1XMXA 1IXZA 3BAZA 1NQAO 3HFRA 3TZ6A 2B35A 2H7XA 3CGGA 4BE4A 4C87A 3K6RA 4S2EA 3FB4A 1E2DA 4LYAA 3IT0A 1E0AA 1WU8A 4BO4A 1PJRA 2QR2A 4HMPA 1NYQA 1AURA 1G8HA 3UVEA 2E6UX 1PJ8A 3DF7A 2ZIGA 3UAXA 4AN4A 4LIPD 1Z18A 2HGSA 3A4NA 3FUCA 3RRBA 5DI3A 1MVNA 3ZI0A 1A3CA 2O3JA 1HV8A 2PZKA 4DPLA 3GZNA 3JQAB 2FGKA 4OKSA 4RTPA 3Q7QA 1JAYA 4PCVA 5DYNA 1WX1A 3BWBA 1Y5NA 1H5UA 1FTSA 2OZVA 1Q7RA 4WCDA 3HTXA 1Q0PA 1X1DA 1LLQA 5BUZA 3IEMA 2DC1A 1IPFA 2ZTSA 1CE8A 4ARBA 3AHFA 5JADA 2BMEA 1KSJA 1USVA 2G76A 3IUBA 3AXSA 3K9QO 1IN5A 4J94A 3JYPA 5B3JC 3SMVA 1G8JA 1XZPA 4DJFC 4A6XA 5CDTA 4WN9A 3BTSA 3NIBA 4G81A 2ACVA 2EG5A 3D54D 4L07A 5DNUA 3HVJA 4XVHA 4G97A 3DHNA 3FKQA 1SUWA 1ZMRA 4J03A 4YLEA 1Y8CA 1G3MA 2UYQA 3D6JA 5IH7A 1RHJA 1KH3A 5CFZA 4NYIQ 3QIAA 3ASYA 3T61A 3WZMA 1RAHA 4C21A 1T36B 3IQXA 2GK7A 2YXNA 4TVKA 2OR3A 5JJKA 4CQMB 4FBMA 4F3CA 4MCJA 3L04A 4K9SA 1FJXA 4OQQA 2ZZKA 2A9FA 2OG1A 1LZLA 2Q6OA 4WZ6A 2EW1A 1QO0D 1YS4A 4LOLA 3KKKA 3WGJA 3HKBA 3HWRA 1HURA 5TPZA 1D6NA 3FZYA 2QI9F 4M1ZA 1MEEA 1QORA 4POAA 5EJAA 3VDMA 1FB5A 5AK6A 1YNSA 1NL3A 3S81A 3SFZA 5CX4A 1RMQA 2C3YA 5DW0A 1DQPA 4BMCA 3DKVA 1AQ6A 4D9BA 1KEPA 4KLCA 1V9CA 3PQ2A 4TVBA 2B4TO 2DWPA 3RVKA 1X1QA 4GGPA 3DUFA 3MRVA 4BJ6A 3L6RA 1E6KA 2H1RA 3GK3A 3TI7A 1D2CA 5KNCH 1N32B 3A4YA 3C1TA 2VUHB 4PQEA 1XRSB 1V48A 4RJKA 1XQ6A 5GJCA 1SCUB 3TAHA 3V1LA 3REFA 1W88A 4C14A 2AMFA 3N6VA 1VCHA 3JQBA 5BSKA 4XDZA 1QIHA 2ZDHA 2W93A 2FDCA 4DA4A 2XOEA 3OE5A 4FC6A 5C7YA 3ZY5A 4KHPB 1TVKA 3JWJA 1CUBA 1F0NA 4AMZA 4I4TB 3M5PA 4Q12A 1JLLB 2BH9A 1GD1O 3R5JA 2BFDA 5CXUA 1ODSA 4TS4A 1GV0A 1NG1A 1WY5A 2BGMA 4YPFA 4AYTA 4IP0A 2AD1A 2HPHA 2J6HA 3FCCA 3ZVKA 3BMNA 3ES9A 3RASA 5JY1A 3KS9A 3CBGA 4J3FA 1NULA 1XRQA 3TEFA 3IOCA 1S8OA 2PNFA 4XQ9A 3CUSA 3P4UA 2QTGA 2PBZA 3EUWA 3HCBA 4N0PA 2V55B 4RVSA 2W8BB 4MGEA 2P2ZA 2FSUA 4BKOA 2L42A 5ITSA 1JLHA 4QGFA 1JWAB 1QBKC 1MH9A 3L01A 3OT4A 5G0SA 5JJ5A 1KYIA 3V55A 2QN6A 3ODPA 3BORA 2HQRA 3UMSA 5HKLA 1E8DA 5FOSA 1TMGE 1Y4UA 3KIPA 3RTCA 4E31A 4EB0A 3DE2X 5HCNA 5HIKA 1E2HA 5F7XA 4FJ1A 2Q5LA 4GLBA 4LVCA 2C99A 4K46A 3SEZA 2C8VA 2N9UA 3ZV6A 4X1YA 2JZCA 3E3MA 1XMJA 2DM6A 1PJ3A 3Q12A 1E1RD 1RQLA 1KPGA 3AL3A 3R3JA 1YDHA 4WWHA 3VU0A 5JHHB 2IUTA 3STYA 4W9MC 1MPXA 1AGRA 1VZ2A 4N7MA 4ZI7A 1NBOA 2VDJA 2CL0X 3LO5A 1ZHFA 3NWJA 3R0XA 2DFVA 4PZ0A 4LJ8A 3E7PA 4XQCA 3T3PB 1GY8A 2H2GA 3DHEA 1U5AA 2B5WA 4M3NA 3FOAA 3OH8A 3BHJA 4P4NA 4X1KA 3W5HA 2WSLA 3GLFA 4B3MB 1UEIA 1TU4A 3BFVA 4TTVA 3RBAA 5KNDD 1MQSA 2WQ6A 2VH1A 3BRCA 3TSOA 1FFCA 1QF7A 2A0KA 4DAOA 5EJ4A 4M6WB 5DXAA 3VNAA 2ZAMA 3V1MA 4BLUA 1ZAYA 3L1HA 3ZUGA 1A8PA 5KWJA 4Z5XA 1KMNA 1SB8A 1VE3A 3FTEA 1ZCAA 5CK5A 2CJYA 3WJ2A 4J0FA 2YV2A 4J3JA 1NMXA 3S8YA 2CMKA 3K0BA 3URKA 1IEVA 4FHGA 1EUCB 1TD1A 4GR9A 5EZQA 2NYUA 5G40A 5ICGA 5GY7A 1I30A 2PFGA 3AG6A 2D0DA 3ABZA 2QKYA 1T2EA 3HO8A 2PTGA 2GPSA 5B2ZA 2QQ5A 3MVEA 5BSRA 1ZONA 1B76A 4FFBB 3VI3B 2EWVA 5ALSA 5LM3A 5M7EA 2HN9A 1EDOA 4LYDA 1L7NA 5JYDA 3TVTA 3UWDA 4BBAA 2CCJA 4COOA 4D3YA 1J5PA 2JLWA 2PUCA 1FYDA 1U1IA 1YS2X 2BFEA 3RIYA 4CMEC 4DSNA 5BNWA 5HKAA 4HH0A 4URZR 3B89A 3E4DA 3NPMA 1EWRA 1XMIA 3MN1A 5A6VA 1G8PA 1MX5A 3M6AA 5F3RA 1I8TA 1T8WA 5G4LA 2Q1XA 1W4LA 2A33A 3DCJA 3FTDA 1K3TA