4OGLA

X-ray structure uridine phosphorylase from vibrio cholerae in complex with thymine at 1.25 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
247
Chain Sequence
KTVFHLGVTEADLNGATLAIIPGDPARVQKIAELMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVPDFDVATAMKAAAQESGATVHMGVTASSDTFYPGQERYDTFTGRVVRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRTQKEIPLKETEARSIKVVVEAARKMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure uridine phosphorylase from Vibrio cholerae in complex with thymine at 1.25 A resolution
doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 93
structure length 247
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oglA00
1PK7A 3FB1A 1RR6A 4F2PA 4NY1A 4ECEA 1VHJA 1PKEA 4R31A 4DARA 1RXUA 3FOWA 4OF4A 3DDOA 5F73A 1T8WA 1FXUA 1PR2A 4QEZA 1U1EA 4JWTA 4DA8A 5CYGA 4UC0A 3DF9A 4R2XA 2IQ5A 4OJTA 3C74A 1CG6A 3LA8A 4QARA 3UAYA 4H1TA 5K1ZA 2QPLA 4M1EA 1M73E 1YRYE 1G2OA 1ODJA 1PR6A 4F1WA 1JDVA 1PR0A 1Y6RA 4PR3A 1TD1A 3IOMA 4YO8A 1C3XA 4DABA 4R2WA 5F7ZA 1K27A 5DK6A 1ECPA 2B94A 5EFOA 3NM4A 1PR4A 2RJ3A 3DPSA 3EUEA 4OGKA 1LX7A 4NSNA 1Z39A 4P54A 1ULBA 2ISCA 1Z34A 5F77A 1TGVA 1V4NA 4LNAA 3KHSA 1PBNA 2HWUA 1V3QE 3EUFA 5CXSA 4F2WA 4TTJA 3FAZA 3E0QA 5F76A 1VHWA 1RXCA 1OTYA 3EMVA 1T0UA 4QFBA 1NW4A 2OECA 1CB0A 1OUMA 3KU4A 3UT6A 4LZWA 1U1DA 5F78A 4U2KA 1TGYA 3ONVA 4D8YA 1PK9A 2AI2A 1RFGE 1A69A 4TS9A 5CCEA 1WTAA 2OC4A 3NM5A 4TXNA 4GKAA 3E9RA 4YMLA 1OTXA 1JE1A 2A0WA 1PR1A 1ZOSA 1YQQA 4F3CA 3OPVA 5F7XA 3DJFA 2QSUA 5B7QA 4DA7A 4TS3A 1RT9A 3BJEA 3UAVA 1A9QA 4GMHA 1JP7A 3DP9A 4JP5A 3LGSA 4WKCA 1RXYA 4LKRA 4L6IA 2PGAA 3OZCA 1Z38A 3KVYA 5IFKA 1NC3A 4OY3A 1V41E 1SQ6A 3LBAA 4BN0A 3NM6B 5B7GA 2XRFA 4G89A 4BMZA 4YJKA 3OZEA 5CXQA 4PNPA 1YBFA 4G41A 3PNPA 3OZDA 1Z5OA 4DA6A 1I80A 3GGSA 4TXJA 1A9PA 3PHBE 4JOSA 3MB8A 5B7PA 3OOHA 1ZL2A 1Y6QA 4I2VA 1OV6A 4LNHA 4E1VA 1ULAA 3ODGA 5F7OA 3KVVA 1JDSA 1JDUA 1U1FA 1YQUA 4YNBA 1LV8A 4TXMA 4KN5A 1JDZA 1U1GA 2I4TA 3IEXA 5C80A 1T8YA 2QTGA 1Z36A 4EB8A 2AC7A 3BSFA 4G8JA 2OXFA 1JDTA 2OC9A 4QASA 4MARA 1Y1SA 1PF7E 3KVRA 1LVUA 1Y1QA 1PW7A 4BMXA 1Z5PA 4WKPA 1Z35A 2QTTA 4TTIA 1A9RA 3NBQA 1YR3A 1RSZA 4IP0A 4DANA 1Z33A 5KB3A 4TYMA 3OOEA 4MCHA 5CCDA 3K8QA 2HN9A 4M3NA 1Y1RA 1RYZA 3PNSA 5B7NA 4EARA 2BSXA 5EPUA 1QE5A 3OF3A 4K6OA 1NC1A 1JE0A 2I8AA 3BGSA 1OU4A 4L5CA 1Y1TA 4GLJA 3T94A 1RXSA 3FWPA 3PHCA 1VMKA 1XE3A 3QPBA 3UAZA 3U40A 5F7JA 2A0XA 4WKOA 4LDNA 1N3IA 4TTAA 5ETJA 1ODKA 2A8YA 1OVGA 3F8WA 5FAKA 1TCVA 3BL6A 4OGLA 2H8GA 3OZBA 3SCZA 1SD1A 4WKNA 1SJ9A 5EUBA 1Z37A 3E9ZA 1V48A 3FNQA 1ODIA 5IU6A 4OEHA 3O4VA 4GLFA 4DAEA 4QAQA 1T8RA 4D98A 3TL6A 5I3CA 2GUWA 4RJ2A 3FUCA 4MCIA 1V45E 3K8OE 3O6VA 1VFNA 4DAOA 4D9HA 1B8OA 2Q7OE 4DA0A 3UAWA 1TCUA 4TXLA 2AI3A 4X24A 3GB9A 2HRDA 5CYFA 1K3FA 4L5YA 1RCTE 1ODLA 2QDKA 1V2HE 4D8VA 3KUKA 2AI1A 2A0YA 1PR5A 3EEIA 4D8XA 4QATA 1K9SA 1JYSA 4BMYA 3ENZA 3P0EA 4L0MA 3OCCA 4TXHA 4NS1A 4F3KA 3INYA 1Z5NA 1A9TA 3D1VA 5JPCA 4WKBA 3MMSA 1B8NA 1T8SA 1JPVA 1A9SA 1Q1GA 2P4SA 2ON6A 1PWYE 1A9OA 1SD2A 2HSWA 3P0FA 3UAXA 1U1CA 4M7WA 4L5AA 4FFSA
chains in the Genus database with same CATH superfamily
4U7WA 1IONA 4QJ3A 1C7IA 2ZUSA 3BRWD 5JO9A 2BH2A 4FM9A 2XQGA 1EMDA 4B46A 4A2CA 1ZSNA 3Q5EA 1XFAA 4BVFA 4IM7A 1ZISA 1VIVA 3PEUA 5C46F 2BKEA 2WZCA 3L1UA 4RJIA 5KYXA 3COWA 5EJ6A 3A6EA 1MNQA 1P0MA 2PIDA 3FWNA 1C50A 3JWJA 5ALIA 5EMNA 1FP2A 1B26A 1NXQA 2ATCA 3UTDA 1V8ZA 1I8TA 3V8QA 2O5RA 1G21E 4FYKA 3HRIA 4U2FA 5SZHB 3GJZA 1LVGA 3D43A 1I3MA 2FGJA 2Z9BA 3IJPA 2YRWA 1O8CA 4FZ3A 4UUNA 5ALKA 1SK9A 3UG6A 4N65A 3Q0TA 3UATA 2A94A 2FSSA 3U56A 1GQRA 3CZ4A 2W2KB 2E5WA 3IPYA 4IIBA 1HGXA 4ARUA 4IFIA 3RUAA 1RKUA 3C41J 1DC6A 1YE3A 2CMKA 3PGXA 4DCGA 3MOSA 3E5MA 2QZJA 4PHHA 3IL2A 1Z4OA 3DZFA 3OZUA 4WLUA 3P94A 3F98A 1EWTA 1SWVA 2BC9A 2CJWB 3AUAA 4QUEA 3WOHA 3ZWAA 2BFBA 5ITVA 3SX2A 1NW8A 4QIHA 2JCXA 2P79A 3HKBA 1SZCA 4V0ME 5KHOC 5KVCA 3IDZA 5FUQA 2C54A 4US0R 5BVGB 4O2BB 1TLFA 4CG3A 1WPGA 1R6VA 2VXYA 2PDAA 4LSGA 4U9UA 2MYNA 3L02A 4EUFA 2Q5FA 2P5UA 1EFVB 2G25A 1IXZA 2DWUA 3SXUA 1ZCAA 4IXWA 1KYTA 3BGOS 4F8YA 4D4JA 1PL0A 1AF7A 2HX1A 5KNCD 2ESRA 2N1MA 3PZRA 2DPYA 4N0PA 5TRTA 2MINB 1J09A 2ZYDA 1E4VA 4YT2A 4DABA 4RE6A 2COUA 2WK1A 3MF4A 1P1JA 2BOVA 4FQ7A 5DK6A 1Y7TA 5DWDA 5TF4A 5EJ8A 3PX3A 1BAPA 3IMFA 3BJMA 1XA0A 1GR1A 4FEEA 1RLMA 4JJ8A 4JP1A 2E5FA 2XD4A 4KQWA 2VHWA 3IAEA 1KZ1A 2GHRA 4JLSA 3HBFA 5DNUA 4EO4A 2QPOA 3L07A 3UYLA 2DP4E 3MM4A 1FLAA 1Z29A 2QUJA 3AHHA 3Q6IA 1M2KA 4MZDA 4H7DA 3DTNA 4BNXA 4YRBA 3PGVA 1WKBA 5IK2A 3IIIA 2BKLA 5TQ2B 4NHOA 3HKEA 3PPXA 4BWFB 1SCKA 2UXDB 1X70A 4F0JA 3KHSA 2ZTVA 3N87A 2PWBA 5IJ0B 4DMCA 3CNBA 4AY4A 4IZ6A 1C41A 3O47A 4O1IA 4ISBA 1DEHA 3T7RA 3X1WA 4EVSA 4R8RA 1ZD1A 4ZI7B 4H3VA 1ISGA 4P38A 1D1TA 4F2WA 2AXNA 3WYAA 5TARA 1K8QA 1P0QA 3BXFA 4F91B 1X80A 1UBLS 2HQ1A 2VF7A 4PLFA 3WLSA 4BEBA 1VRVA 3EQ2A 1L7NA 4JMLA 4ZYLA 1KJYA 2RAVA 4N0DA 4D25A 1MOQA 4HNAA 2VSQA 1O58A 1RXCA 1Y3AA 5KMGB 1SUSA 3MWDB 5K0JA 1KTIA 3SIXA 3QE2A 2YWRA 1T0UA 2W8BB 2ZCJA 2BFMA 1DIOB 4H27A 3N8GA 5H16A 3CEJA 1RAHA 3DVRX 1CB0A 221PA 4P9NA 1ZINA 4FVTA 4GL2A 3OE4A 3ZY4A 4Q3BA 1ECLA 2FRDC 3ELDA 3R0QA 3TKAA 5MGNA 1S8OA 4FYVA 1PO7A 3E4CA 3VPSA 1JB1A 2KHZA 3TLGA 1UBCA 4OBBA 3ZGOA 1SKAA 4HUQB 4I3GA 4QYMA 3C98A 2D5BA 2HYDA 2FSUA 2B5VA 2OHOA 1Y9AA 1IN6A 1JNYA 2QMZA 4C29A 3ROXA 2WLSA 5ILGA 1Y5NA 5TGZA 4AJ1A 2BFNA 5IEJA 3NBFA 3BMCB 1QIIA 6PFKA 3L0PA 3T4EA 5JT1A 4OB7A 1Q7TA 1T1SA 2GAFA 2H1WA 1Z0JA 2Q28A 4E2YA 2C2XA 4I4LA 4XLZA 5CCEA 2JHFA 2QRQA 3AJAA 2EKZA 3BQNB 4OLHA 1M1YA 5HM8A 4TRNA 3RJTA 4DJEC 3RFCA 3QY9A 3MS4A 4EWLA 4LJRA 3IVAA 3LK7A 4G37A 2XCQA 4B3RB 1QAMA 3BBPA 1ISFA 2WWIA 2P8JA 3K0BA 1E66A 2GZSA 1QG4A 2PV7A 2XECA 2YYYA 3NCTA 4O6VA 4OI2A 3RYTC 3D64A 5G1PA 2O2XA 1IXYA 3PLNA 1T2CA 1U3VA 3K6RA 5JC1A 1R16A 1JDNA 2ISSD 1FUYB 2IE0A 2VP0A 2ZGVA 3DJFA 2PBLA 4IHKA 3DMPA 4MHSA 4PLGA 1ISHA 3S44A 1E96A 1Z12A 1P7YA 3ZWOA 2KE5A 1YS1X 4CUJA 2OXCA 1VYHA 2GLXA 5AH0A 2J0VA 2V8BA 4WZAA 4AJPA 2Y92A 1FRZA 1XCPA 3IIMA 3FYUB 2RGRA 4P4UA 1QX4A 1QHSA 3KIPA 2XW6A 2ZIEA 2Q4RA 1R10A 4LF5B 2X6TA 4HRYA 4KJZA 4V1CB 4OLFA 2F1RA 1QZZA 3LC2O 1X1TA 3EFOA 4DIDA 5KOJB 2VP4A 4EFNA 3RTAA 1P0FA 1HRKA 1N5IA 3S2YA 3CVUA 3OQIB 3EBLA 3OEHA 1S7GA 1J8VA 2IYXA 2VHYA 1XJ5A 3BEOA 4QVKA 3SEQA 4D0GA 1B8PA 3RBVA 4NYJQ 5TEWA 3SM3A 1V9CA 3ZLTA 2DBRA 2IPAB 3AEXA 2AA3A 5EHNA 1B6RA 1YRLA 1I7NA 3U09A 3A1TA 5GGYA 3KHUA 1I6WA 4DCTA 3NDRA 3REQA 4PG5A 3QBVA 1LW6E 2GZDA 3BD6A 4GECA 4MP8A 2AEFA 3FWKA 3C5HA 4IJQA 4N3GA 3TLJA 1RQRA 4KXVA 2OHIA 4IX1A 5CLQA 2B69A 2KPOA 5CM9C 5D86A 1AD2A 4EG8A 5IWAB 1FSFA 2P7HA 3BTOA 2YVUA 3FB4A 5CDTA 2CNKA 4X0EA 5BV2P 5AM2A 1QNFA 2ODEA 2WD7B 4RJJA 3SBDA 4D82A 5M34A 2NU6A 3RLIA 2AL7A 4G41A 5EJIA 3MILA 4QSMA 3LU1A 1KQ3A 3W1WA 1HTWA 4AUNA 2BSQA 1KQNA 4CM5A 4OX9Y 2DHQA 2Q3JA 2UYQA 2EFYA 3LY9A 4IDNA 4GEGA 4OQQA 1P7CA 4N6GA 4KFSA 2E48A 1PAUA 1V1RB 3PQEA 4RZUA 5CK4A 4AXBA 1Z4MA 3QEKA 1PGJA 3MB8A 3IRVA 3OEED 4DY4A 1TLLA 4TROA 1B2RA 3CRVA 3FMVA 3G2MA 4HAVA 4F3RA 3ZGZA 1HTTA 1N3LA 2OGZA 1VQ1A 3IKJA 4RQBA 2A7XA 2WHEA 3CH7A 1JRLA 3CX3A 4NEQA 3SI7A 4BQOA 1PDWA 2J41A 1FNCA 2RD2A 3SOZA 2UZ0A 5D8DA 4LNHA 1LQTA 2RBEA 4X61A 4MQMA 5DI3A 3EIOA 1XD8A 1M1UA 2YRXA 1GPBA 3PEVA 1EEHA 3RVNA 1NJSA 3NQ41 3ZR4B 1JFFA 1VLZA 5DHQA 3LNCA 1VI2A 4D3SA 1QTQA 1M0TA 1JDSA 2PPLA 3R40A 1PJCA 4LXUA 3V1LA 1Y82A 1KK2A 2FPRA 3E9YA 1SKYB 1FU8A 2J08A 2KW5A 3OZIA 1CR0A 4LZLA 3U37A 1R6TA 1K3TA 3AL2A 3ROPA 2C04A 3I5XA 4XQ9A 2XCUA 1APBA 1T4CB 3ICVA 5JRZA 4G1UC 5LZ2A 3CG0A 2Q3FA 1A1VA 2O4CA 1MDBA 3KSDO 4RLHA 1H69A 1B0UA 4UAGA 4FE7A 1UBMS 2Z8XA 2D5LA 1ZJ6A 2FPIB 4UHFA 4YCAA 1DOZA 1OGIA 4B3DA 4W8HA 1EGMB 2F3SA 3AUJB 3S3TA 4POAA 4B43A 1E2EA 4H6PA 3BDAA 5SY9A 3STYA 5FEMA 5IC4A 5IF9A 3EEQA 2VCHA 4I1YA 4KP7A 2O6HA 1KKUA 5JCPA 1V5GA 5ECYA 1SBYA 1E2PA 2RGGA 4G01B 4HI0E 4YP5A 3FPGA 4AD8A 1TX4B 1CUCA 3RUIA 3DE1X 3GFQA 2XYGA 4CLHA 4GGPA 3C4VA 1W36B 4O4IA 2J87A 2ZYTX 4HAZA 1KI8A 4L76A 1EE1A 4UTZA 5H9WA 4ZTUB 4DIFA 3LLSA 2QTWB 1AO3A 3U0BA 2QXTA 2A1UB 2YV2A 1W30A 1KJ8A 5FWYA 2VN8A 1F12A 2ZJ4A 1SXPA 3JWEA 3VNRA 5KUTA 2QNIA 4BU1A 4BX3A 1RBZA 3ZCQA 5JISA 3A1VA 4XGKA 2G88A 3WGUA 5JFOA 2FN4A 3R76A 1KKLA 2LGJA 1RZ3A 3FE2A 3OESA 4R1MA 3AKCA 2PVCA 4GM1A 3N5CA 2BZ1A 5CNMA 3FTCA 1R5BA 1BS2A 1M33A 4WHMA 4Q9HA 1SU4A 1OXTA 3TOXA 1PS0A 2JFWA 3NX4A 3ZVRA 2BZGA 2XEDA 3AERB 3H3JA 4HDOB 4I14A 4IV5A 2HA4A 1Y1RA 1C3VA 5CDUA 1YJ5A 4J0GA 1T2VA 1UPCA 1OA1A 3KR9A 4NOJA 4UDYX 3SPXA 3O84A 2OPHA 1XZ8A 2H4HA 2VKQA 1LI5A 3N3BC 1T1RA 2H54A 3BTUA 1WXFA 4HGRA 4YRLA 3WDSA 4DJAA 1M0EA 4FX5A 1SNYA 3AM1A 1W2HA 3HNOA 1HH4A 3BGSA 1CU1A 1QGAA 2DUWA 5IXJA 2ZJ2A 3F6SA 4HDAA 4WBSA 2GCIA 1AT1A 4Y2SA 4YRPA 1G16A 2ONKA 3C3YA 3MTQA 1VHTA 3T94A 2ORIA 1RZRA 2JGDA 1BEUB 1DQZA 2QRHA 3RT9A 2OFWA 3ZIAD 5EP2A 1E0KA 5I8PA 4DV6B 1UMCB 1YDWA 4YV2A 4AI6A 2IXAA 1N57A 4EB6B 4BV9A 2VVTA 4CTMA 3E9MA 2UYHA 3SR0A 1DLJA 2FPWA 4DM7A 1P4GA 5K05A 2UVDA 2XOKA 2O8BB 3PYLA 2IL1A 3LHDA 3GRZA 4JJ7A 5BQPA 4JYZA 2XEXA 3DP7A 4G5YA 2Y6VA 1Q21A 3MCAA 4UHCA 3CVVA 3DTVB 3ZWCA 2XNJA 1K7FB 4TX1A 4LY3A 4E1BA 2NMVA 2H8GA 3KQNA 3GFPA 3OHSX 2DBVO 1GG5A 2PTGA 3TIGA 4DWJA 5KPDA 1MT0A 4PS0A 4YP9A 4D8XA 4XZ3A 1O1YA 3B60A 1OC4A 4U7JA 2XZOA 1W96A 3H99A 3OMWA 5K6TA 4CETA 5D85A 5JSHA 3H2IA 1RZUA 2AK3A 1W0KA 2HR1A 3EG5A 4M0UA 2GUWA 5JAQA 4ED9A 4F6RA 3VH2A 2BTQA 5JZMA 4EQZA 1GV0A 2P9FA 4NZMA 3JWGA 1M7GA 2J8ZA 2QBYB 4D3FA 2JJMA 3HJBA 1EFCA 2OK7A 4NH4A 2E1PA 2FX3A 3NETA 4J0QA 5TXGA 1N7HA 2AZDA 3SQMA 3H18A 3K0HA 3VX3A 4DSZA 2IE8A 3FRHA 3OE7A 4ENUA 5J40A 4QBKA 3IQXA 1QKKA 3EVTA 5F9FA 4DMUB 4JI7B 3ZZNA 1OR8A 3LQ1A 1US8B 2VJNA 2D0IA 3GAAA 3WL4A 1G60A 1AJEA 4XVCA 4UBKA 3RC7A 3CRQA 4IZIA 1R0BA 3HTXA 4TZKA 2QDKA 3FD8A 1EK0A 1VTKA 2PRIA 3A4NA 2H0AA 3MJ4A 1NVMB 1KEEB 3P20A 4Q03A 3TH5A 2D4HA 3VHRA 4LGYA 3B70A 1ZC3A 1MX1A 2PL3A 1GFIA 2M98A 2VHVA 4BMYA 3EBOA 1CSEE 3FLAA 4WCVA 3QPDA 1BH6A 1TFUA 3EC1A 1YQXA 3GGGA 4OQZA 4P92A 5FBQB 4BS9A 1DEAA 1G3QA 3ESXA 1ISPA 2W2PA 2H18A 4MUHA 3IOBA 4L8FA 1QHNA 3FPLA 3QUTA 2ZUBA 4KR0A 2QAGB 2GR9A 4NBKA 1MJNA 3FGOA 4NICA 4ZQEA 5AT1A 1SCUA 5GZ3A 4WFIA 5AW8A 4F9GA 3EOBI 5LQAA 3ZJVA 1VLLA 1V8PA 3ABRB 1F7VA 1Y8RA 3TBFA 5BR4A 2BTEA 4UATA 2G5GX 1FNNA 2JAWA 3G0HA 5B1SA 4DILA 3BWDD 1GCAA 3A3PA 4YRIA 2OCAA 4Z3DA 3CSSA 3KZXA 5ELXA 1N8NA 1RLTA 2PSEA 4DJJA 3ZLVA 1ZAKA 4FOLA 4BKPA 2L2QA 3NRBA 2GA8A 1FFEA 3MZ0A 1BS9A 3H11B 4FWBA 3ZLUA 4AZ0B 4NCBA 4Q9KA 1JKXA 3MRSA 3NC4A 4JDUA 1S2MA 2C03A 5BSVA 1LPOA 2GM4A 3ENQA 2B5OA 2VDPB 4EFKA 1H2WA 2ON6A 5BY2A 1SC6A 3MOIA 4QDTA 3P0FA 3JD1A 3ME5A 3UAXA 3SVZA 2BGKA 3GNSA 4M7WA 1EI9A 3LUPA 3CLVA 4PLZA 1KMHA 4L5AA 4QEKA 5AOCA 4KW7A 4LKOA 2OO7A 3C8HA 4MQ6A 3VTZA 5AD1A 1H4SA 4XJXA 1DIGA 1X7XB 4IHJF 4TRRA 1E5VA 1OWPA 2CXUA 4EY4A 1TK2A 1NVAA 1IJBA 4Y98A 4ECEA 2W2LD 3RANA 3W2FA 1KDRA 1N6PA 1PJQA 2OILA 3HJRA 3HRHA 2Y77A 4OSEA 4PFQA 4D9MA 1JFTA 1AUVA 2C95A 3I30X 3EN0A 4BCBA 3CXUA 5EG5A 4P32A 3DF7A 4QO7A 4QVGA 3AZQA 3AEZA 2X2OA 3WQBA 3QPWA 3UBTA 1BCRB 4BLOA 4M1MA 4MROA 3QHPA 1FXUA 2PX5A 4R6XA 4EW6A 4WZ6A 5IJZA 4WZBA 5DLDA 4ASUA 1XPJA 4U6SA 2RBGA 5A3QA 2PGDA 2J3QA 1S5PA 1T5OA 4B6SA 3DF9A 1K7SN 2QV7A 2DG2A 5A3SA 1RWBA 3CSUA 1SVNA 4HCJA 1J0EA 3BJRA 3C74A 3K0KA 2H57A 3FHCB 4JOBA 1N2IA 3RNOA 3GCZA 3UJNA 1A9ZA 3IEKA 2Y9MB 3GBSA 4UHBA 1DDIA 2VDKB 4P4GA 4C5BA 4EYEA 5IKEA 1R4AA 4JHLA 1XMPA 1PE0A 1JEOA 3WP0A 3WKEA 4NAVA 2F3PA 1QFMA 3SZLA 1AO0A 2EQBA 5AXCA 3UCEA 2QPLA 5CA1A 4IUYA 1ECFA 2GTPA 3L2OB 5AKIA 1PL6A 4D57A 1XFDA 2DPXA 1JZSA 4IHJB 2ORWA 3C14C 3G7SA 4CODB 1YHNA 1YI0A 2WM8A 1GADO 4FYHA 4G9EA 2NXEA 2HK9A 4LGVA 1IZYA 2I6TA 5IDVA 3PYMA 4UBIA 2ATXA 4RZ2A 2QRVA 4EM6A 5JHHB 4CEHA 3EG9B 3FM9A 2PX8A 6YASA 1GTVA 3U9TA 1D8AA 4I5EA 1C3XA 1NDHA 2I3AA 3L4BC 3V34A 1KS9A 1UK6A 2V5VA 2RC5A 3SF8B 4CYMA 1PJTA 1FS6A 2ES4A 4Y6GB 5G41A 1RJ9A 5A9RA 3RRYA 2OZVA 1FXWA 1GG8A 2G8LA 2HV8A 2I2WA 3IUNA 3L93A 3KZNA 3M4JA 3OJXA 4I50F 4OQYA 5AI4A 2R7KA 3HXOA 3GAFA 3TR0A 5JZBA 3HVIA 3HS3A 2XBMA 1CRPA 4LXQA 1DQSA 1C9MA 1KVSA 1H8HD 1K7YA 1PJLA 2FG7C 2O2JA 3AU9A 3TBKA 5A9SA 5F4ZA 5C1BA 1RAFA 5L51A 3TJMA 1HPLA 4AJJA 3HJFA 1UP6A 1IY8A 3RIHA 1KSJA 2PUHA 2BUBA 1BDMA 5JS8A 1LZLA 1VOTA 1SIBE 1UBFA 2P2DA 4HSGA 1VLVA 5KOHB 2DY1A 4L5IA 3CNNA 4BP3A 3PE6A 1NVBA 4KMOA 5CPFA 1ORDA 3F2VA 3KWJA 5HJEA 1MXHA 4ZO6A 1ZJ4A 1IWBB 1PBNA 2HA2A 3ZU2A 2UVQA 2PO5A 2J5XA 3H86A 1R0KA 2ZDHA 4Q3NA 1R6BX 4G4SP 5FBWB 3WKAA 5F2NA 2VUTA 5F98A 4DVJA 1JI3A 3M1IA 4AG3A 2HPHA 3HFRA 2A92A 2WWWA 4GE0A 3AV0B 4WXYB 5BQFA 3HMKA 3N76A 1F6BA 1XXLA 4MR8B 1V6AA 4RXUA 1AQLA 5CVVA 5AR1A 2B21A 3AB8A 3KCNA 3FA2A 2E9SA 5D3MA 3NRJA 3D6AA 4R1NA 3L18A 3X2EA 2G6BA 2G9RA 5HKKA 3KSZO 4OQNA 4OP1A 5IMBA 2VRCD 2UUAB 4I50B 2OKGA 2PSHA 4R7ZA 3R6TA 2GCEA 2WWYA 4X62B 4DV5B 5IJ9B 4J1QA 1CY2A 1TKRA 3QHQA 3JQ9C 2C8LA 2H7YA 2WU1A 3OMLA 4Z4CA 5G53C 3AF6A 1DU4A 3SDBA 1QWSA 1CX9B 1GU1A 1TM4E 2XYPA 3E7PA 1YZYA 4QTXA 5IVDA 1XRMA 3DKVA 1OI7A 2HNKA 1ZSYA 3ONVA 4D97A 4N9WA 1UODA 3LLUA 1DRVA 2O8VA 3DLPX 5LJLA 1JVNA 2GRAA 1E94E 3HDVA 5P21A 1ONSA 2EGHA 2HA3A 3TLXA 1ZI6A 4QDUA 2QR5A 3FJYA 1Z47A 1IMJA 3ISJA 4KKVA 4LI0A 4N5NA 3NC0C 4TS9A 4UPVA 5P8WA 5C7LO 1H65A 1JLLB 1SHKA 4TXNA 1DJNA 4URWR 5U4XA 5ES4B 2EF1A 2ZWMA 1C30B 4WLVA 1IOVA 2V97A 2VHXA 4HDQB 4C3UA 3SEAA 4NVRA 4Y0VA 2A0WA 4PSKA 1BMFD 1TUBB 3GT3A 4DDKA 2J5BA 5GY7A 5CFNA 1ODFA 4MRMA 3MCVA 2YJ6A 4FFBB 2C7BA 1TAUA 1EG7A 4UQOA 4EJFA 4E51A 4RHUA 4ALMA 3OPVA 4RANA 1MORA 5CFOA 5CYPA 1HYBA 2XVAA 5JDCA 4E30A 3VPGA 2GZAA 1EX1A 1QP4A 4U2CA 2FR0A 4BMNA 5KQGA 2H1IA 5FLXA 3KWMA 4JMPA 3Q0EA 1KNXA 3RRMA 4KXFB 3KTFA 2YQ4A 3NEJA 4NBWA 5AHRA 5JS2A 3DFKA 2ZPUA 3AR9A 3H5VA 2BE7A 2RH9B 1W1WA 2JGAA 3HA2A 2I66A 2FPUA 1YOVA 4RVOA 5CEFA 2B1JA 4A6EA 3G3EA 4PGAA 3GFRA 4W9NC 4BCCA 5LIPA 2WWVD 3VUEA 1YTUA 3KFXA 5ELLA 4AP9A 2XWQA 1QG2A 4JB3A 1OH5A 1RJFA 5DNDA 1H3NA 2VP5A 4E46A 3AJDA 1ZK0A 2GHTA 3KKMA 1U3FA 4HXYA 1A76A 4UE6A 4RX1A 1J8DA 2Q99A 4I5IA 3PXAA 4GIBA 5BSHA 3KE8A 1RBMA 4A36A 2Y1GA 1IPFA 1G3RA 5I7UA 1N3YA 1L7XA 3DG9A 5CU7A 2MMCA 3ICWA 4HDSA 2WR8A 1Y7HA 5FPSA 3UFXA 2JLVA 4HF7A 2BYTA 3O8NA 4HVLA 3SF0A 4GSKA 5E4FA 2UVPA 4GI5A 5ARDA 4F3TA 5K3FA 3LUDA 5CNIA 2VXCA 2GOYA 1VJ0A 2QG9A 3A6LA 3BWCA 5L3QB 4G89A 5AXBA 1E2KA 3UKJA 3I5YA 1O0CA 2IH2A 4K1XA 4PNPA 4JLBA 5EPOA 1IPHA 1XAGA 5EEHA 2Z08A 5IAAA 1G17A 3QX3A 3C87A 2BEUB 1QO9A 2X58A 2C7OA 1JLMA 1SMKA 1LBIA 4GVLA 2FF5A 3N6RA 1VZ3A 2W6JA 3TNLA 4DA6A 1EUCB 2J3EA 2HXYA 3O4JA 4W99A 3ELUA 4JEMA 1PJ4A 2P2SA 3EFHA 4J7UA 3NYQA 1QH8A 3BHMA 1IH8A 3IBFA 3OOHA 4OX9B 2I8LA 1T2NA 4FHZA 1FY2A 1GV1A 1WL8A 1ZRNA 3E0XA 3OY7A 2EL7A 3DQPA 1F2UB 2PMCA 1OXBB 1VSVA 2FMTA 4MIEA 3ZYZA 2VNAA 4LFAB 4NU8X 3FSJX 3L8CA 4OLAA 1ZMRA 3E48A 4INOA 2FG5A 3K2BA 4MYDA 2HSGA 5AW1A 4G07A 4FZVA 3QKUA 1EUYA 1TM7E 1ND5A 4Y9UA 1EE2A 1Z4KA 3DHVA 5TB5A 2R8BA 1QE3A 3UWSA 3JZIA 3WOVA 4TUYA 1P77A 1SBQA 1XMIA 1KBOA 1U1FA 2PSSA 2EKLA 2WJ3A 4MMZB 4Z9AA 5BR1A 1H0KA 1VYTA 3IQDB 2UDPA 1GQQA 2ST1A 4I1UA 2Y9PB 2O3RA 2QTVA 2XXJA 4LY6A 1TTTA 1E2GA 2RGDA 3P2YA 3GLSA 4L2IB 1MW8X 5HJ5A 1GTMA 3W7AA 2ZWPA 2PYZA 2Q9UA 2EX4A 5C80A 1K68A 1FP7A 4M99A 4B3HA 1ID8A 2QDXA 3HJCA 2ZSBA 3P0RA 3UXEA 4G5HA 3O8OB 4V2UA 5CDFE 4PRYA 3PC2A 4IIJA 5ESWA 2Q4BA 4LK2A 3LVBA 2D2XA 3F49S 4LRTB 5E6UB 4DS3A 2FZCA 5A6SA 3N8HA 3AM4A 4URVR 3NBAA 1JXMA 5I9IA 1M2GA 2E4WA 2TYSB 4N47A 3CPEA 2G36A 3GV0A 5KHAA 1A50B 2OC9A 5L95A 4IJKA 3JVUA 3DH0A 1U9IC 2IBSA 2OFFA 5AVZA 4MVJD 1J8MF 2R1TB 3V33A 5LYJF 2J59A 2HYIC 4DYDA 2BCJQ 1IY1A 3EZ2A 3JYOA 3ETDA 4JB8A 5YASA 1YJ8A 3B1XA 5AKJA 4Q19A 3Q9UA 5EZYF 4C2TA 4NF2A 1KRHA 1XAIA 3CCBA 5GONA 4KVFA 2YWBA 4BFYA 1R8YA 4I5GA 1FP1D 1TVMA 5JLJA 2P2CA 1I6KA 2ZUWA 3IYLW 3QVWA 2OSBA 4JLUA 2C2HA 4ZT4A 2EIHA 1OVMA 5I9TA 3T3NA 1UBTS 3DL2A 6Q21A 1NUUA 4TTQA 4K28A 4KIGA 3ZV4A 2GEKA 3L5KA 1BKDR 1ZM4A 1NMSA 3VZCA 4ZT5A 1TUIA 3F97A 5JECA 4P0PB 1U8XX 2YX1A 3JR7A 1CJCA 4Q0MA 1QZ3A 4OQFA 2SCUB 3WP1B 2AOUA 1E0JA 2I1WA 2HI0A 1DIHA 1ZCBA 2FZLA 4TQ9A 5IXYA 5FFFA 1SVIA 1IQ0A 1ZJ5A 3AK4A 2YC2C 2ZSEA 2IPLA 2O2EA 3JRWA 3EPRA 3B6ZA 2OV2A 1T9GS 2KBEA 5EPUA 1W85B 1HORA 4X8MA 2O7SA 4M9UA 1AGRA 1E99A 4EF6A 3MRVA 2PVSA 4TWIA 4DCMA 4C0WA 3JRXA 4OI4A 5C51B 4NAHA 4CM9D 5DYTA 2QKYA 3LZDA 1ZQ9A 2HO5A 4GLJA 3L7LA 3HQ4O 4RVFA 1CDDA 1DAGA 2XMRA 3M6XA 3FDZB 3FWPA 3OZSA 4LE0A 3ZGYA 5C8YF 3F73A 2AYZA 2E4ZA 3ZIUA 5LYJB 4HDNA 1PT7A 4YT4A 2ICAA 1JG4A 4GI3A 3HSKA 3UWMA 1MPTA 3UAZA 4DHEA 1A8SA 1IVNA 1QIEA 1ZMTA 1TT5B 5EZYB 5F7JA 3UOGA 4E32A 2UU9B 3RS3A 2CFOA 3VBCA 4OP3A 5JS6A 2YMQA 1E79A 1N3IA 1EA7A 2FTKE 2OXRA 4PLPA 5HK8A 1DPFA 3EZFA 4FONA 1ORTA 1X42A 1MVOA 4EZIA 4YJ2A 2JFZA 2VH1A 2Q4DA 4UASA 4DSNA 1H5QA 2A8YA 4HPWA 3HBAA 4F4HA 4BXOA 1KY5A 4CGYA 1Y1PA 2IXTA 3HC7A 5EKXA 4HDRB 4EJSB 3BL6A 2JCBA 2IZ0A 4IW3B 4MV8A 4D8UA 1X7GA 4WXEA 5GJWC 3EPJA 1USWA 3AILA 3PKJA 4LJ4A 1P0PA 3P7MA 5H81A 5THKA 4B3BA 2IYAA 2WP0A 2BMFA 3ACDA 1KEVA 1M83A 1L7OA 1T5SA 4KV7A 3Q3HA 3CVYA 3WJ2A 4FFDA 5HBGA 3L7JA 3VO8A 2FW6A 1T0HB 2M6SA 3GCGA 3ETNA 2HWXA 2BR5A 4GAEA 1DAOA 1BX1A 1V45E 4INJA 4RXTA 4I66A 4QXQA 5JJCA 2FK7A 2JLWA 1KBZA 3CY6A 5B64A 4OG2A 4IYJA 5DHTA 2WVGA 4DC9A 4A8JC 4KX5A 1ZEJA 2IH4A 4DG8A 5C8YB 4MW5A 3UMSA 4ENRA 1POXA 3CF2A 3FGPA 1LI7A 2J6CA 5JZOA 1XL1A 5KNDA 4B3GA 3BIOA 4KXMA 2GESA 5GMOA 3KQTA 4PZ9A 4F5ZA 1WPXA 4NJEA 5BUSA 3HCPA 1DFIA 1P5RA 2DFDA 2LCIA 3FPKA 3ILYA 3KV1A 3KYDA 5IH7A 4UQPA 1NW5A 2ZRNA 3TCNA 2RB5A 3BF7A 2HHCA 4YLYA 5JD5A 1AK9A 1QOZA 2CNBA 5JQGF 2VBIA 4C0QC 2HWWA 3WK4A 5TGDA 2I2CA 3USES 1G8JA 1D2NA 3KUKA 3N2IA 4XGIA 5F51A 4UCFA 5GZ6A 2P78A 1RE0A 2HB6A 2AS0A 1PR5A 3QU7A 4H4CA 4UREA 1W1IA 3W8RA 4QATA 5ED0A 4B82A 4KXNA 1WETA 2GXAA 3TZBA 4UBLA 4NYIQ 3RODA 4AO6A 4EF4A 3ENZA 5LNK6 2WTMA 3P0EA 5CTJA 1JKJB 2WKWA 2ZLBA 1PX2A 4BFZA 4FE4A 1GYPA 1QNLA 1DC5A 3JYLA 1N2HA 4AX8A 4HLUC 4OQ4A 1OLXA 1NN5A 1VCHA 1M3SA 1P1RA 4IDDA 3E3OA 4O02B 4JT8A 4FINA 1DJPA 3UK2A 4AQDA 4EG0A 1SCAA 4JU9A 4LCBA 3TNJA 4LRYA 3U3KA 4EJMA 2CFTA 1XZAA 2JGKA 1NZDA 1C9YA 1MVNA 3BD9A 5T4BA 5JCJD 4HJXA 4PANA 1YIDA 2V4MA 3IIJA 1CRLA 2YYAA 4EA6A 1B16A 5JFTA 5IM4A 1VYUA 3PJFA 1Z7EA 5HF9A 4JLOA 4LXHA 2XMSA 3ZV5A 4IXMA 2PKWA 3VR3A 3FNRA 3O3NB 4FFOA 3ED1A 1ZJWA 2GHIA 5DTMA 4H4DA 2ZRHA 1W36D 4R3NA 2FU5C 1FK8A 4XQEA 3SFZA 3G0BA 1RQGA 1ZK1A 2X1HA 3GCDA 3W4KA 3HGMA 4JQZA 1X7ZA 3SGLA 1YB7A 1DCFA 1Q17A 3QKWA 5SY6A 3WGTA 4E0BA 4DDWA 5JQGB 1GEEA 3OTWA 1F3OA 2BMJA 2FUG6 3DCYA 1M2VB 2YV1A 2XQJA 4MUGA 3C5EA 4ZN6A 1AKVA 2P3QA 2PRZA 4DJFC 1KC1A 4LBYA 4EG6A 2RHRA 1XC7A 3TX2A 1ZGZA 4W1QA 3G8YA 4TVOA 4KWHA 1GL7A 1QAQA 5CVJA 5AOVA 4PW0A 2EJTA 4QE3A 3HYTA 3KQPA 3W5VA 3OQPA 4BCDA 5KYYA 3UKDA 1XZFA 2CDBA 3FOWA 4L95C 1O6GA 5LOVB 3GEMA 4N76A 3I2YX 4PM4A 4UAVA 3TI9A 1AQYA 5ADHA 1MAAA 3A6GA 4WK6A 3UJBA 1CUBA 1RJEA 3D9QX 3W77A 1K5PA 5B30A 1PR2A 4FX2A 2GI4A 5J2UA 2DERA 2BIFA 4ANFA 4DV1B 1GSIA 3Q7QA 3GT0A 2O5CA 3V2UA 5HQ3A 5LP6A 4BNHA 3HR8A 4HADA 4JUCA 5HFJA 1WHTA 4BQNA 1VPTA 2AN3A 1KYIA 5EIOA 4QBTA 1YQEA 4X00A 1CG6A 2A2ZA 3MJRA 2XGJA 1K3UB 4M1TA 4YMWA 3VDNB 1PGNA 1OAAA 3L0YA 5ALZA 2NO9A 3BGWA 3BCUA 3FY4A 3U0VA 3UMBA 4HDMA 4GC9A 1NVDA 3WGIA 1ABFA 5JJIA 1ES9A 1Y9EA 3TQHA 5HRCA 2R4QA 4WXHA 4ZXFA 3R8XA 5KINB 3DAPA 1M5RA 5HS6A 2JA1A 5HW0A 3G5UA 4YQZA 2J0UB 2I0FA 5BN5A 2BMAA 2VDLB 5A2QA 1B6SA 4L8LA 2H1FA 2HUPA 2YZGA 3DTVD 3RWMB 3VSAA 3VDQA 3KXIA 4C20A 3GDFA 3A14A 3E6AA 4IIDA 4C06A 3T1QA 3NJRA 3D4IA 3EZLA 4YRMA 4C7MA 4H1HA 3HKCA 1KPGA 2O20A 4R1SA 2C5AA 4JVNA 4Z1MA 2AOTA 3SSOA 1IM8A 1UDXA 3D59A 2W6NA 3KVNA 5IAKA 4BAZA 4XYGA 1KP2A 1R0YA 1WBJB 1YR1A 3OZWA 1WLSA 4D3XA 2OBNA 2X15A 2PWPA 3KT3A 1XLTA 4ENWA 3NM4A 2XR1A 3PSAA 4BC0A 4LZAA 4QGAA 3ZWPA 1PTJC 1CUEA 1PGOA 4ZT3A 1U98A 2EKDA 3DPSA 5HTKA 4Q4JB 2PNFA 3P2OA 3A2LA 2GYWA 1YB2A 1GQ2A 1Z0IA 2H7CA 1N2BA 1Y63A 1WO8A 2FPXA 2FPLA 3AP1A 3FKSA 4KN6A 2FSFA 5GZ1A 3U2QA 3S2UA 2OTCA 3GFFA 3VPBA 1U5AA 4Y1GA 3IMKA 5IAEA 3D8TA 3RH0A 3QVTA 1L8AA 3A3YA 2BR4A 2O1EA 1RM0A 5B2ZA 1O94D 4MVJP 3VTKA 1DI0A 4NBNA 4BFVA 1KDVA 1H2EA 2GCOB 4MLDA 4XFJA 3V7FA 3T7DA 5D5HA 3R20A 4FR2A 5AK3A 1VKJA 3CINA 1UXKA 4AMZA 5JW6A 1Z08A 2QRGA 1VSTA 3I9FA 1EVZA 1RPNA 5CCBA 5FR1A 2Z0MA 3K9WA 1FYFA 4IH4A 2XE7A 4K9QA 4L0CA 5K3BA 3RUFA 4WUTA 2JLQA 4JP3A 4WIAA 1WNTA 1EWQA 1NLFA 6LDHA 2WBLC 4PX9A 4JP8A 5F76A 3A1EA 2XQVA 3V1UA 4JI2B 1QF7A 2J9GA 2VOEA 3HCEA 2GD6A 2NSJA 4OB8A 3BFKA 3FUTA 1LGYA 1XROA 4RV9A 1JR2A 1ZXXA 3HKDA 2F64A 1CZHA 3O2QB 2FF7A 4ZTZB 1FX1A 4R69A 4DFDA 2Q21A 2QW1A 3PI7A 3STVA 1YULA 2W6ID 2Z2KA 2VSFA 4OHOA 1Z62A 1USUA 3ZHVA 5B6PA 1OXUA 4LVUA 4F4JA 3C2QA 2AYYA 1L3CA 1OZ0A 1TVKB 2OM2A 2YS7A 2FLKA 5E7MA 2ZSJA 1G3IA 1HLGA 4PGMA 1HL7A 5LB2A 3K1ZA 1Y7LA 5KX5A 1I7LA 1O95D 1NI4A 2HPVA 3I09A 1HEYA 3K94A 3CE9A 1K4MA 2H1OA 3AT1A 3S40A 5COAA 3IVRA 4ZZ0A 2Z95A 1A69A 1ZD8A 3FJOA 4L78A 2YVAA 3GEHA 1ZUHA 2AKYA 5IXSA 3PP8A 3WMFA 2N3ZA 2OOKA 1NM5C 1M1NA 3G68A 3HNRA 1G3MA 2WWRA 3L0ZA 1VJGA 2R751 2DSTA 2O1XA 4ZOCA 1IN5A 1NF3A 3E2MA 1YVRA 3C39A 2FFQA 2NO5A 2EWWA 3G1UA 3R3ZA 1B0ZA 4FQ8A 3GZNA 5TT0A 2C9MA 5KYWB 5AXDA 5FYQA 2IZZA 4EYGA 3GGJA 13PKA 5TMBA 1JLHA 2WA1A 1BHJA 1Q14A 3SHVA 3WRXC 3C3CA 3NALA 2J9YB 3FOBA 3U62A 5AVQA 5FFMA 2Q3DA 2OESA 2WV7A 2ZZNA 3ZX5A 1LY1A 2BUAA 2G1KA 1XU7A 3CF6R 5BNZA 1NQTA 2J9RA 3GPBA 3AHJA 1PYDA 2QQ5A 3TF5A 4TQGA 4JR2A 2YVLA 2FE1A 4TS3A 4BQQA 3RYCB 3DWGA 3I4FA 3MCZA 1DRWA 1JVSA 3CKLA 3U17A 3RFVA 1JN0A 3QU5A 4DNFA 2Z1DA 4ZRNA 2QM0A 2OV8A 4HMOA 3BSYA 3SYLA 2FN9A 3T38A 4CKWA 5KQRA 1CVLA 3QV1A 4NKRA 1JP7A 4JP5A 2I6UA 4GYJA 4ZQFA 1XDSA 2HCTA 3BK1A 3OPMA 2I2AA 3GPDG 4EHBA 1R64A 2BGMA 4EI7A 3GLIB 3ZD9A 3VKHA 2ALJA 3IOEA 3JQAB 1XA3A 4HXGA 4M76B 4NE7A 2GBLC 4ZYVA 5HKAA 3S7TA 5BUQA 2RKBA 2J0EA 1EAYA 2XT6A 3RS4A 1CE8A 1TA0A 5CBKA 2WEKA 3V6LA 1E2LA 2WJ4A 1XLUA 5IJWA 5K6AA 2XB9A 4J2HA 2YWDA 4EMSA 3W8NA 4D56A 3AB7A 4RQAA 5FTWA 5J4HA 2PQ0A 1A4IA 1GNTA 1Z2AA 3W0LB 5J4YA 1RYYA 1U02A 2B1IA 3EXFB 3JQBA 4MX8A 4X6UA 4BVHA 3L1HA 2VATA 2NUPB 1R0CA 2G83A 3ITDA 1CS0A 2MDTA 2XRFA 1FVHA 4R9VA 3ZY2A 4JA0A 4UDNA 5DGTA 3WWPA 5CXQA 3EA5A 4BTEA 3L6OO 3BCHA 3RTDA 1Z6GA 3E7WA 4BQPA 3OT1B 4UJ5A 4TMKA 4QPJC 4E2FA 3BILA 4REMA 2Z5LA 3I9JA 2F48A 3ICPA 1WB4A 1ZD4A 4RSRA 3RSGA 4IMJB 4S1VA 2P30A 1I51A 4LDPA 5IW8A 5LQRA 4RY0A 4UTNA 4EBBA 3FPHA 3MJEA 3N2GB 1BRTA 1SCQA 4I2VA 1Q74A 3E9QA 1MC4A 3LYLA 1RAIA 4AWAA 4RGVA 2O1SA 2VCYA 1UH5A 4S1TA 2QSJA 3BH6A 3T9FA 4FIZA 2ZYUX 4OCZA 5BV7A 3O93A 3GNLA 4IIYA 2FPGB 1H6BA 4KODA 4YAIA 2OENG 4DPMA 4KACA 4KITB 4Q00A 1KU6A 4BOYA 1KNQA 3TR6A 2AX4A 8MHTA 2I8CA 3IDQA 3PXCX 4AC9A 1RHUA 1GNVA 1MEEA 2CLKB 3WLAA 4CMBA 4CT0A 1MV8A 2IEBA 5K2OA 3I0NA 2BM1A 4BWYA 3QUSA 2VK8A 4R05A 4YBRA 5G02A 3S2FA 4DLZA 3HUEA 2ZBEA 1W4ZA 3WGQA 1EHYA 3MB5A 3TD2A 3WGYA 2OV1A 4LG1A 4YV1A 2Z6QA 2X4LA 3ONWA 1AMUA 2BEWA 1PWHA 5DTQA 5EFZA 3JSAA 3A4VA 1GL9B 3E5HA 1J9ZA 3DONA 1F3LA 2ID8A 1Y5IA 4Q9AA 1T8YA 2W4IA 2QR2A 1L7PA 1BU5A 1I5EA 4CF6A 3AHDA 3CT4A 3K1TA 5EPEA 1JH8A 3L49A 2HXSA 4HFNA 1XXHB 2NUAA 4JEHA 4S1NA 4XXHA 4BVJA 2SNIE 4DTCA 4E70A 1NYQA 3OLVA 5LLTA 2EJBA 2COEA 5G3YA 1UK7A 1KDZA 2VBCA 1V11B 4NZPA 5EMJA 4WBNF 3R8FA 1KVQA 4IQFA 1JYFA 5EYPA 4TMYA 3ONFA 3DMTC 3DHEA 4H15A 4UVDA 4ZJUA 1M8KA 2V6BA 1EEXB 1W5AA 4KR6A 4L7QA 3F1KA 2H2AA 4CV0A 4RTLA 3FNHA 4B3MB 2ZRIA 2J33A 5CH5A 4KMSA 2VWPA 3KSBC 2PGXA 2G1UA 3HV2A 4YPFA 2X86A 1EVQA 3LO8A 1F0NA 2BFOA 3I9OA 2ZTUA 1WV1A 3IP8A 4GPZA 2OV6A 3LZCA 3ONNA 2GJ8A 3OIDA 4A73A 1I5OA 5JV5A 3PZBA 1EWYA 4GNKA 5B3JA 1ECCA 1JR3E 2R00A 5KYKA 4KU4A 1HSOA 2G09A 1JQDA 3VPXA 3EGXB 1RWPA 2G17A 3D2BA 4C43A 4KWEA 2NP7A 3PRKE 4HAYA 1I3CA 1M54A 2VYVA 5FNVB 2HBZA 1QORA 2V3CC 4HLNA 3GX1A 3MTDA 2O3JA 3GEDA 4OGFA 4PNZA 4D4KA 2KM1A 4Z2AA 1KK3A 1SH7A 2X0RA 3UQZA 1EFAA 1K9VF 1C3OA 1P4AA 1L4FA 2BSXA 4B40A 5F4BA 3B5JA 3WZLA 4ZVMA 4WBNB 2CBZA 3FGZA 4TWZA 3GP8A 3VJRA 3M4YA 2I8AA 2DSNA 2DH6A 3K6SA 5FJJA 4PHTA 2AUNA 3TRIA 2WTEA 3ZDXB 1V47A 2YWJA 3PXBA 1SQGA 1TMYA 5F1KA 1XF9A 4LYJA 4KQFA 4BECA 4DV4B 1ZBQA 5HE8A 1BN6A 3HCCA 2BZSA 3NIGB 2F3RA 4F8EA 5JOQA 2WM3A 2FDXA 2Z30A 3N6XA 1D9ZA 1CJVC 2AJ8A 2FPSA 3U40A 4E2WA 3L7BA 4C0SA 3I39X 4QUHA 2QX4A 4MJ7A 5FL3A 1SOVA 2NXJA 3PDUA 5ETJA 3KTAA 5H5JA 1WMSA 2QVYX 3FCEA 3SEFA 1E77A 1PNOA 3LW7A 4C78A 4V1CA 4EVIA 2NU7B 2XLCA 4UHEA 3PX7A 3Q9LA 1LCIA 3EA4A 4MEBA 3CW8X 1TUGA 4M83A 3VH4A 1SD1A 5EUBA 3B8HA 5TSDA 1N8TA 1Q0SA 3Q3VA 2YHIA 1ZKMA 3D7LA 2HC9A 1RKVA 1PR9A 3IV6A 4XAQA 5C5IA 5KYNA 1CK4A 3B1VA 4MCJA 3ICOA 4HVCA 2OZPA 3GXOA 5WRFA 3PQDA 4EKGA 3C3JA 4KPEC 3P0IA 1IUNA 2IT1A 5LR6A 1V26A 3FUCA 2IBTA 3A04A 1ULHA 3B3QA 5AW9A 5BMVF 4R68A 1OX4B 4EHAA 1XJCA 3BERA 5DP2A 2OGUA 3I64A 1L8OA 3ER9A 3W04A 1WZ2A 2Q7OE 4PX3A 1GYQA 1ZOIA 1K63A 4C3VA 3OVMA 4RZQA 5HRUA 4IXNA 4B3CA 1UPAA 3WJAA 1E7WA 4HQKA 2IIPA 3N9IA 1FUEA 1J0CA 4N7JA 4DIOA 5E3JA 2PH5A 1RHQA 1ZY2A 4YQYA 4KBFA 5B55A 2NYVA 3CZCA 3KYJB 1NUAA 5EIWA 1V8BA 2GZRA 3D6NB 3CNOA 3VPDA 3QG5A 3V7YA 5J63A 5D3QA 4KG7A 3LXMA 3RU2A 4ZHQF 3V1TC 4K81B 5CP8A 5IZCC 3BB1A 4KO8A 1JG3A 1GU0A 1O97D 3VYWA 2ZQYA 5F1YA 4QUJA 2G04A 3DOOA 3NUGA 1A7AA 5MDHA 1YF3A 1NHGA 4IV8A 3DEHA 1WW2A 2W6CX 2VPTA 2CVZA 3ETEA 4XVRA 4AL4A 5CB4F 2QZZA 3I72A 2A33A 4L5JA 4RUKA 3NDBB 1E9RA 1MX3A 1Z8FA 3N0TA 5BOVA 5BMVB 2Q1UA 4MAFA 3HA3A 1XUOA 4XPIA 1EDDA 3KOWA 1UZMA 3JQFC 4HRVA 1TF5A 4G85A 2W4QA 2Y1CA 2V3VA 2NTYC 4UBNA 3D31A 3PVCA 3RKRA 4G5RA 4XWWA 1PT9A 2YY5A 1JFLA 4Z5XA 1NYTA 2Q4OA 4AF6A 3G2QA 4K26A 4LWPA 3VTFA 2I1VB 1DKOA 3LQ2A 4QNNA 4LMAA 5ALNA 1XEWX 4IOLA 4BX2A 2PXCA 1ZRMA 2CB9A 1PTKA 4YTEA 2SECE 5C2JB 1SY7A 2Q0XA 4HOYA 1BOOA 3BDVA 3WAJA 1E3TA 1ZI9A 2BHRA 2A1IA 5E2AA 1WW8A 1XL0A 2O0JA 3DLIA 2D62A 4KLAA 1XCGB 2A0FA 2A9JA 2XVZA 2FOIA 3MQFA 4GXQA 4J7CA 1ZL0A 2VIIA 3GA0A 4ZHQB 4Z99A 1CBUA 4HS4A 3JS5A 4ALIA 2YV4A 3PQ2A 4X1IA 2VT6A 1VKNA 4WJZA 2YYSA 4Z3KA 2XCTB 2MSWA 1OLOA 3QWHA 4XCXA 1FUKA 1WSWA 1VE7A 1YB4A 1Z5WA 4JLPA 1BVHA 1DMRA 1QVZA 2QI9C 1XTBA 1WDMA 1NR1A 4QECA 4RD2A 4GW3A 5CB4B 1Z06A 4RZHA 1N1MA 1XMXA 3G79A 5GM2A 4YHBA 5FI1B 4FGZA 1LDNA 4ND8A 1WCV1 3H42B 1OLSA 3RFXA 3GLVA 4MRAA 1UM9A 2JAQA 4QEZA 4ZVVA 5F9HA 4WT7A 3U4AA 1WJGA 5G0WA 3EZNA 3DZHA 4G9BA 4LBVA 3VMMA 1VE5A 3QTLA 3DOJA 2C4UA 1J0AA 5MN5A 4K9KA 4ODIA 1SC4A 5IVHA 4ZCSA 5TT1A 2RAUA 3TOVA 2C3MA 2HD4A 3I62A 1FYWA 1FU7A 4ZEXA 4DEYA 3QYAA 1KI2A 1MJGA 3HYNA 5HR5A 1TADA 2H5EA 3MQ4A 2DX7A 4LOJA 3S6JA 1O9BA 1KQFA 1PVOA 3C3MA 3CKKA 4QHSA 4YY3B 5K1ZA 3QYFA 4DMLA 3CYFA 1PFUA 2P4HX 3B6KA 3E1SA 5T4FA 5T7BA 4M21A 3WDLA 4I4TA 1YRHA 3MRTA 1GPJA 3ZPXA 2YFYA 2EBUA 4WMLA 1L4LA 1XDZA 4M86A 4EY8A 3H2KA 2CNOA 1DTSA 1YZUA 4WESA 3MSCA 4G1EB 4B79A 2O5VA 4P35A 3QJGA 2P9EA 2IEAA 1KARA 4HAUA 2IYFA 1PR0A 5EVJA 1Z0DA 1PVDA 1C3JA 1RLOA 3JAWA 3PF9A 5AJHA 3R9KA 1YB1A 4H16A 4ML3A 5KYVA 3UMJA 5JH7A 3NATA 4BO4A 4R8KA 1Q7BA 4A4DA 1DQYA 1QZTA 3RJ9A 5JXWA 1YFZA 2R5NA 5DYNA 2IODA 3OLZA 4DV2B 4A2PA 2Z8ZA 1UQUA 4FJ1A 4E13A 1UJ2A 3BOSA 4GQIA 5IC6A 3E8MA 1U3CA 1F17A 2QSYA 5B1YA 3GLIE 2QUZA 3VSDA 1Z18A 2BGWA 3EUEA 3IAAA 2QY6A 1W5FA 1H2RS 1VJ5A 2FEPA 1LQ2A 3BM5A 4NYMQ 4WY5A 5U9CA 3ADPA 3B3GA 4QTZA 2WQ6A 5LMNB 2ISCA 3JWHA 4IINA 3T3MB 4RORA 4BQFA 5IVPA 1RJGA 2QRMA 4JKIA 3KFLA 1CY7A 4IUBS 4QU9A 5F52A 4M0FA 5EIFA 3RIGA 5L4LA 1GTRA 2X3FA 4JC0A 3KD2A 2JI4A 1GD1O 1SR8A 3WRYA 3A6FA 4BMOB 2X2PA 1WNFA 2GRUA 3RS8A 3MIZA 2O06A 3AF1A 4RVNA 3HUTA 5SZKB 4BJ3A 4HX2A 3GHYA 3T7KA 5JY1A 1J99A 1X1SA 1Y7IA 3G13A 3RROA 1CZKA 3VKUA 1LU9A 3ZGLA 3FOAA 3E0QA 1V25A 1UADA 4Z2YA 2HQOA 3N7AA 4EZBA 4EW2A 2R6DA 1OB2A 1YS4A 3NKLA 2HF9A 3PUYA 3KPYA 3PEWA 2EP8A 4ZT6A 1K8YB 4AYTA 4OK3A 1R8JA 2Q4TA 4ZARA 4RSMA 4RYDA 1QGUB 3VKFA 1PG2A 3TFOA 5EWLA 1JR3D 1R27A 5D5QA 1SQFA 3ZE0B 1P1BA 5AW7A 2WVJA 2VJPA 2ZKIA 3FSEA 3PUZA 1JG2A 4MQEA 3KXKA 2G9VA 4RCZA 4IMPA 4F84A 4P4SA 5IM4F 4QZVA 5UKDA 2GPWA 1W9HA 2ZTHA 2NU9A 5DX8A 2YICA 4DQUA 2D7DA 4OXKA 3BMOB 4MUKA 2ZE5A 2AZXA 1NZFA 5TMDA 5DBIA 1V35A 2PSJA 2WHYA 2QRPA 1ACMA 3MT8A 4LZOA 4GXNA 1KEWA 1XYVA 1FTQA 2JCSA 2N9UA 4HNHA 4YMLA 4YAKA 1MVLA 2G7MC 6NULA 1WUIS 2ZJ8A 3SQNA 4Q9DA 3ZYCA 5HOQA 2GWRA 3GLQA 1GGJA 4RFLA 5HYVA 1YB6A 1AKUA 3GRCA 1LRKA 3EPPA 3VYTB 3TQTA 2QUHA 4IKPA 1CF9A 1XXHE 1CB7A 2GWHA 3L40A 1DKUA 3LTEA 4R9RA 4RGBA 4GYYA 4LVCA 4I9NA 2NPFA 3RVLA 4JX9A 3VHXA 4AX4A 4LDJA 4BUCA 4R71A 3EXIB 4V1CI 3OCUA 2PVPA 3ZW8A 5JBQA 4ZCLA 1FNSA 2B0CA 2WTNA 3JYNA 4R1QA 1XMJA 4G97A 4TV8F 2RHWA 1K88A 5FOTA 1NW6A 2YMLA 3JWIA 5CLLA 3ZTTA 4TZ0A 1VRWA 1MOSA 2WDPA 4Q4AB 5AM5A 5TS3A 1OZFA 3EXG1 1B6GA 2OAQ1 3Q8MA 4BGVA 4R7TA 4YMVA 1I3OA 1W25A 1RWQA 1CD5A 5ALTA 3K9CA 5BYBA 1Y4SA 1JHVA 4Q3DA 4S0ZA 5JDIC 3DOHA 1RZVA 4FXPA 3BF8A 1E1CA 3EJ6A 4LKRA 1HFEL 1T0BA 4IPTA 4OOFA 4ZDKA 2NUTA 3HA5A 1XZNA 2VJMB 4GEKA 1UC5B 4M1WA 4E4RA 1Z6AA 1Z38A 5AVXA 1RAAA 3MMXA 1K2VN 3R3WA 2Q2VA 3VVBA 1XNRB 2IRWA 4QUGA 4FYXA 1M74A 1DWQA 1XTPA 4NTZA 5CR9A 1QSGA 4LZPA 3KDPA 3EISA 2J0SA 2RJOA 2J9FB 1WQ4A 2E6UX 4YJFA 4ARIA 4RAOA 1USIA 1KMMA 4DLBA 2NVWA 4DZZA 3N6VA 2GXQA 3CTMA 1UZUA 3GUCA 3WQHA 1W0JA 4AY6A 5BQXA 4QYWA 3CISA 2WUEA 1ID1A 3PFNA 4Q82A 1FPQA 1GGMA 2UUPA 1DX6A 3QELB 5FUWA 3WKDA 1QFJA 5IRCD 1SUBA 1WMAA 4NE9A 2YNMD 3KT6A 4NECA 2FMIA 4TV8B 1L8QA 5LYYA 1JQ5A 5KQMA 1PL7A 2PN1A 1OFUX 3MXOA 3I61A 2CF5A 3WNBA 3CUSA 1GNRA 1NY5A 3HVJA 4I8DA 4CCAA 5JNTA 10MHA 3H8WA 2B8EA 2IXEA 1V0JA 3F2IA 3HU1A 3VDRA 5K0FA 4KREA 1NF9A 4JLKA 4CTJA 4ZKEA 4RESA 3UMCA 1KJQA 1XPUA 4AQYB 1DXHA 1ITZA 2C2ZA 2VUIB 4WQMA 2BH9A 1PQYA 2IS2A 5K0ZA 2X0FA 3I4LA 1JILA 3KXDA 2WG0A 5AKXA 5BR7A 4ND7A 1KYQA 4QGBA 5BWBA 5BQ3A 3TW8A 3L3BA 1W6RA 4EB3A 3PGLA 1VJ1A 3BKWA 1I1NA 1EK6A 1U2DA 1V6CA 2QB5A 4A0GA 5IBRA 1H2YA 3U49A 5A1JA 3K9FC 5K20A 1QLJA 1KI6B 2P9TA 3Q3CA 3U16A 1XVTA 1R6XA 3QPUA 4FXOA 1HDXA 4YO7A 3KVVA 4BPRA 3LCRA 1I7DA 3GJ0A 4PIVA 3DPIA 3DAOA 5FI3A 1G1AA 1GAJA 2RH4A 1NAIA 3W5CA 1JXQA 3GDHA 1E9SA 3IMEA 5KS2A 4C0BA 2DFNA 3KLNA 3QBDA 1WEKA 3DTYA 3LC7O 5JBNA 3NVAA 4NK5A 3PJGA 3S68A 1LLCA 2GM5A 2EOAA 2FUKA 2D2IA 1FNMA 3ECSA 3LX8A 4MR9A 2V6GA 3VA7A 1MIHA 1RYDA 1XDDA 1YAJA 2ADMA 4PO3X 1IRXA 1ZCZA 5B3AA 1NQ5A 1Y3IA 3O1HB 3TRFA 3VX4A 4EENA 1OF1A 3NR2A 2P9QA 3FNGA 4MGIR 3RS0A 5EJ4A 3J81A 3KK0A 1QIJA 1MG0A 4O08A 3T35A 4EB8A 3E3AA 4NDAA 3GVCA 5FHRA 1VG8A 3VI4B 3PEFA 4BV2A 5IPFA 1WSBA 1WAMA 2XAUA 3A3KA 1TTQB 2DUMA 4V24A 4EQ6B 1JAHA 4ZXPA 5FPQA 2W4MA 4IJUA 5J59A 1Y42X 3CVJA 3HCFA 1GO2A 1LS1A 1W0CA 1ZDMA 1TA4A 2I6GA 1WEHA 2ZJYA 3LWDA 2AF4C 3BXPA 3N05A 3QEMA 2WZBA 4JVSB 4WECA 4B7AA 4MDEA 3MCWA 4QASA 1T6BY 3PJEA 2CNWA 2TSYB 1HKHA 1GGEA 2O23A 2O7VA 3TRJA 1W5BA 2WT9A 2Y1DA 1TJ4A 4NR0A 1W46A 1HZZA 1MRZA 3RTEA 4PZ0A 1MO4A 1PG5A 3W05A 3NDPA 1OROA 1PNTA 5BQOA 1A9RA 3QQPA 2AHOA 4JVLA 1Y48E 2JL1A 3MINB 2VJKA 3GVHA 1YR3A 1C7RA 2BRUC 2HGSA 4FDTA 1NBEA 1G98A 1SXJA 3ROKA 1YZGA 2NLOA 4KEAA 3RYFA 3ZUPA 1OH7A 1E6WA 2JIOA 2BP7A 3X1MA 4MCHA 3DCIA 1C7JA 1MO2A 1YDEA 5DLPA 3REOA 2XUQA 3ZWBA 1Q22A 3H87A 1MIOB 4AVYA 1U7PA 1NNI1 1ZK2A 3F1LA 4FK8A 4FKZA 2XKBA 4RDXA 1U7HA 1Z5GA 3GRYA 3H9JA 4NPAA 1IJFA 1QF9A 2ZUVA 4PBTA 3EFBA 1IG0A 2AGVA 3P9ZA 3RHZA 4BX9A 3DHWC 5TV2A 5AQ1A 4NOLA 1PV2A 1EFPB 2OHHA 2V0CA 2ZZKA 1BC5A 2FZVA 3HB7A 1SHTX 3TOZA 2JANA 1VCMA 2CY0A 2YXEA 4FOOA 3K71B 2V74B 1A5TA 2ZJZA 2ZROA 3ZWNA 4MRVA 4TS4A 5DCYA 4CLDA 1HMPA 2PS1A 4OI0A 3SXPA 4CG2A 1VMKA 2PU5A 4IDEA 2C99A 3H6GA 3HJUA 4EDFA 3M6WA 5L6LB 3WLHA 1W93A 3IESA 2UZ3A 3HLKA 3LAWA 4E88A 2ZE7A 2VI5A 3JQAD 3KT0A 4LDNA 4XEHA 2OKCA 2IK8A 4QO8A 4Y6PA 3NVDA 2ZATA 4G2NA 4ZVUA 3SEZA 1UCFA 5DMHA 4M1OA 2WF8A 2JLBA 4X8HA 4BNUA 4KQXA 4C07A 2PEYA 3O8QB 3PFWO 2PK3A 1SJ9A 2IKQA 1Z37A 3K5PA 3T8YA 4KI7A 4MWTA 1UBJS 1H93A 3TIFA 4LZNA 1DCTA 1H4TA 1YKGA 1XZGA 3ES9A 1W4CA 2Y1OA 3C8MA 2VQ6A 1X9IA 3AF4A 4MVYA 4PG6A 3IP7A 3OOYA 1A9XA 4X20A 2AB0A 1INLA 1RIIA 3QVMA 4RFSB 1OJLA 3CNEA 1JIIA 4JJKA 1HYHA 4JN6B 4MP3A 5CFLA 1R4NB 3IEUA 2VA8A 4BDTA 2C97A 1QS0A 4HVAA 1QP7A 4YMIA 1UFOA 2G40A 3BN3A 3BWBA 4NNOA 1WG8A 2O48X 3TIXB 4C0XA 2RIPA 1GZ5A 4OHFA 4ZQBA 1TCUA 2UXBB 3ACBA 4UXHA 4EG7A 5HUJA 2C2GA 2GZ1A 1HQKA 1QDEA 2VP3A 2XUOA 4JFRA 5TR9A 5I8WA 3MUEA 1A7JA 4HWSA 2B2CA 2VPXA 2IYTA 2H7XA 4HQ6A 3HI4A 5FNVA 1UZNA 3B9PA 3KAKA 3QU2A 4QPCA 4RLSA 1OBVA 5FNZA 2I7CA 5C3MA 3WLTA 1SKMA 2K87A 1HXHA 2H65A 4IL5A 1J9GA 1SK8A 4QYIB 3OPXA 2WSSD 1V95A 2F8TA 1QQ6A 4MS1B 4DLTA 2YH2A 2FSGA 2WILA 2ORYA 1F2DA 1RC0A 1O4WA 3DNPA 1JDBC 1D2AA 1K75A 3OM9A 4NX2A 4C4XA 1KFBB 3DWIA 4TQAA 1PFWA 2DC1A 1BYIA 2GFHA 2I7TA 2WJIA 2WNSA 2HRCA 1R8SA 1YNSA 1N6LA 2IY9A 2OCIA 2ZYAA 4JJFA 5E6RA 3AFIA 1EGHA 4CCYA 3C0KA 3BXZA 1JU3A 3PUKA 1U2RA 3D1LA 2QAIA 1KOGA 2Z4SA 3Q87B 3NKFA 4DGSA 1YTLA 2ZXFA 4AKIA 1WXQA 4YUZA 3D1VA 3NWJA 4QD3A 2ZBVA 4HAXA 1RU3A 2GQ0A 1DJLA 1DC3A 2IEDA 2JPDA 2Q7XA 3P4YA 4ECAA 5KJ6A 4E12A 1JBKA 1PYGA 5DHAA 2JIPA 1ICEA 3ZBTA 1JAYA 1OT3A 2JF0A 2O2SA 2W7TA 4J90A 4MW1A 2J7PD 2AFHA 3HB4X 2G0NA 1W5SA 2VAMA 3QMVA 4QDKA 5HF5A 2LE0A 4F60A 3JD2A 3PUHA 1Q1NA 2C9YA 5A0VA 2G06A 1WW3A 1F2TA 1NASA 2P9BA 3THXA 5A5GA 2B0JA 2XVYA 4L3OA 2LKCA 2QUBA 4W5RA 1VM6A 2P90A 2X4IA 1EQUA 4WLNA 4YUVA 3RC3A 2Q1SA 4LXTA 4Z7QB 1V3UA 2H4YA 1PLKA 1XMQB 3EGVA 1J7KA 2KX7A 2POCA 3M5CA 2C0PA 4UUPA 3U7QB 5EHXA 5FDFA 1RMTA 2Y76A 4A27A 4DCPA 1WM1A 3IUSA 3JATA 1CXZA 1SD5A 1MO3A 4Z4HA 3DXFA 2YJ5A 1BXRA 4NARA 1KZHA 3W5SA 1R4MB 3IXLA 1YMVA 1LLFA 4ZA2A 7YASA 4L6AA 2QX7A 2UZ1A 2O5EA 2NQ2C 1NVKA 1SUWA 4DEVA 4FZ5A 9GPBA 3DDOA 4HV4A 3GJTA 3BZWA 4C08A 3C85A 4YI5A 3BRSA 4JWTA 4M9XA 4Y2PA 1UBEA 2PMFA 3CS3A 4YR9A 5JNVA 2YVQA 4TM7A 3TLEA 3DV0A 1KY3A 4OLJA 2MCFA 3DE0X 4FNMA 1X7WB 4ZU6X 3AYZB 5CITA 2HJ9A 3ASYA 3JPYA 1VMAA 1N2CB 4EB0A 4DA4A 3DUWA 4CLRB 3FI9A 3PUIA 3OOWA 2I65A 2BFEB 1LK7A 4CI9A 2AOVA 5D01A 3GFSA 3F74A 5J58A 5K0TA 2OHFA 1R5OA 2ZK7A 3GGDA 2RK3A 1DB3A 2AW5A 4ITVA 5DSXA 1P7PA 2PUVA 5HZHA 2X0EA 1G38A 4BE4A 2Q41A 2CXHA 1C0KA 3ADOA 3ZXUB 1R3UA 1UIMA 1UAYA 5ERYA 4PO1A 3B9BA 4HZUA 4E6EA 2LNDA 1MB2A 2VSNA 3V4PB 4BYGA 4ZV4A 2H85A 5JCXA 4JU8A 4KFCA 1N8SA 4Y6QA 2WHPA 3SVTA 2NTJA 3B12A 3R5HA 4L4YA 4H4EA 4LQLA 3F3KA 1JLKA 4GOJA 2C59A 3GCWA 4QUDA 1WKCA 1ISJA 1H6AA 1ZFNA 1F6WA 1XALA 2ORED 4S35A 1ZIPA 2X4DA 4HN2A 3C8UA 3ZHTA 2TMKA 4YT5A 4JJZA 3SQWA 3PRJA 4NENB 2V98A 5CDYA 4HDKB 4MEAA 3WLMA 2ZCUA 1UANA 1LTHR 4AFNA 4Q1CA 1RCFA 4CDGA 1Q0LA 3LWZA 2JFXA 5ER9A 4HMPA 2ADFA 2O7RA 3UEOA 4UE3S 3ZWMA 2EQ5A 2PT7A 5JEDA 4EUHA 3JASA 1YT5A 2WF9A 3OHMA 3YASA 2AD1A 3TS1A 2NW6A 5ENVA 2NO7A 4Q48A 1JJ7A 1C9DB 3HEBA 4IUCS 2XE4A 4IJ5A 1DC7A 4IWXA 3R4VA 4PQYA 1RWNA 4S1WA 1NIPA 4NMWA 4DRYA 4F9EA 4QU8A 4CQNA 3ZKWA 3WTBA 2WWHA 3K0FB 1MABB 1SQ0A 2G9UA 3LL7A 1RI5A 3PFCA 3TTSA 3V4ZA 4I4NA 1PLLA 1T2DA 1V4NA 1U94A 2PGIA 2O1WA 2REQA 3B2QA 3BHNA 4N54A 5AJXA 3WIDA 1C29B 4ZJZA 5JXIA 3W34A 1S3FA 1U6KA 3RSOA 1N1GA 2VT7A 4ONEA 4QGFA 1CVIA 1CT9A 2XD9A 5D1NA 1LDGA 1ZNQO 3ZWXA 3UXYA 1JEQB 1NWCA 3LX6A 4IRXA 4CKBB 2PUBA 1SM4A 4MVJH 3E22A 4U4AA 1ZRSA 2WA2A 2GTHA 4Q1BA 3A1CA 1D7OA 3I12A 3VU9B 3EQ6A 1NR7A 3OQHA 5F2OA 3TQRA 2ZOSA 2B82A 1JFSA 3AEKB 4L8YA 1U04A 4ZCQA 4K87A 5BUCA 4RCYA 2VEOA 1R0XA 3AF3A 5IKPA 4F38A 4CMEC 4IH1A 5BVHB 5ABPA 3CR8A 1UEJA 5DCLA 1N6OA 2H2HA 1WR8A 4BMPB 4DYVA 1JHOA 5CK5A 4F56A 4C4TA 3C43A 1IMOA 3OFND 1T2EA 5GPBA 2GCPA 4K9NA 1RBQA 5HGXA 1P19A 2F1JA 4RVCA 1SQ5A 1U0LA 2J32A 3E35A 1C1XA 2IU3A 3E8SA 3NTRA 4RACA 5KSYA 2ZR0A 3G0IA 3PA8A 4J4TA 4AJEA 1YJBA 2WKRA 1TL7C 3M6AA 5JVDF 3WNDA 1EDEA 2FX2A 3WNZA 2P6UA 2XCOA 4GPIB 1HM5A 1X7YB 3AUYA 5LWHA 3VZRA 3HB5X 4P0QB 5G4KA 4B6FA 4ZC1A 4TL7A 2AMJA 2AI2A 3CMCO 3RTBA 2DHEA 2FR1A 1W29A 1X0XA 4ZDWA 1IL0A 4E03A 5A4DA 3G89A 1U65A 2A35A 2X5OA 3LUHA 4RV5A 3SX0A 1AKMA 1HMYA 1XWWA 4ICIA 5KNBH 2NO6A 3EIQA 1SRQA 4RD0A 2WNHA 3ZDCA 1R15A 1I0LA 4XH9B 1DJOA 5KTTA 3IBSA 3RQSA 3D6VA 1A4UA 4JBWA 2ZSIA 2PIAA 1WPQA 1U8YA 4FFPA 1ULZA 4DF3A 5KC8A 3D4OA 1WVMA 4IOKA 4JXKA 4RWEA 1ESZA 2BMWA 3T52A 2FSIA 2C8KA 4NBRA 5F7XA 2BF4A 4UBMA 3ILVA 4O3FA 3MPUA 4YT8A 3DMNA 4X95A 1XZDA 3K72B 3FBGA 4LZJA 4LNAA 2DLCX 3FPJA 4COOA 4FPXA 5DYWA 3UYKA 4F4UA 4CT5A 4UDOA 1VCOA 3I2FA 4YASA 5JAHA 2IXBA 3TW4A 4IF4A 3AF2A 1T4DA 4DA7A 4C4ZA 5AI0A 1SVUA 1N8KA 3N53A 3NGMA 4M8NE 1HDYA 5JVDB 4X94A 3THRA 4ARAA 4HH3C 1BSVA 3EZGA 2G6TA 3LKDA 3NH9A 3LPNA 1D6SA 4ZVRA 3JAMA 2XIQA 3AM5A 3TTXA 1OPRA 5I9SA 2YIDA 3VRHA 5SYAA 1K66A 1NMYA 3KHTA 3ORRA 2FHPA 4YFVA 1JHXA 4Y0AA 2PL1A 2Y71A 4EK9A 3FYHA 1ZN2A 3K0AB 3CZ9A 1JQAA 1WE2A 3LK6A 3RVSA 4GOMD 2WAMA 5C3UA 2RGXA 1HYEA 3DMGA 4FT2A 1DRUA 5HQTA 4KPGA 2MSKA 3MTJA 4DQ0A 1PQWA 1R6UA 1U0OC 2VHTA 4EHJA 5HRAA 2WSMA 1N77A 2JLSA 4E33A 1JR6A 3HJAA 4OY3A 5KWSA 1H4QA 4CF4A 4A8JB 3R9XA 2ADOA 3HSSA 4QHTA 2Z4TA 2B8NA 2O8EB 4Q4LA 4C1NA 2HMYB 4HRXA 2D5AA 3VAYA 5K03A 5JASA 2J3IA 2ZYGA 3PG5A 1MH1A 1FSGA 2EWMA 3H6HA 2JGRA 1OX5A 4Q16A 3LPCA 2UKDA 3HL0A 2J3LA 3ZWWA 1IUOA 4G86A 4R6WA 3BFXA 1RI1A 4LJYA 3G2OA 1A82A 2G67A 1D4ZA 2HLHA 4JY7A 3ZIDA 3OT5A 1DKMA 2V9ZA 2J6HA 1ZJZA 4P6VF 3TINA 4B6QA 1ZUD1 3BRCA 3F9CA 4IHQA 3RBZA 1ABBA 1C1DB 3G2JA 3TZKA 1BMQA 1T34A 1GLGA 1Z15A 2BI7A 1Z5VA 3GL9A 4JYPA 1DWOA 3A6HA 4H3HB 1DAMA 3HUDA 1I80A 4TXJA 1OZHA 4BNFA 4FB4A 4CGZA 1RYMA 2RGYA 2QK4A 4UNRA 2L19A 5JMPA 1DBQA 3MPOA 4B4DA 2OG1A 3PGA1 3A6ZA 4LJLA 5COBA 1N92A 2V7WA 1QZUA 1JEDA 4LN1A 4Y2GA 1QFXA 4MTCA 4KHPB 4ZAYA 2PM8A 2ZM6B 3GOHA 3UJ9A 4LRXA 1ZN9A 2Y67A 1ULAA 4EABA 1NXTA 4Q7EA 1QONA 2QL5A 1W5EA 3A9WA 2HLPA 3BMQB 2IV2X 3TPZA 4M1ZA 1WUJS 4G5XA 2K2WA 4FN5A 2HQRA 1GJRA 2P3SA 2QRLA 2GEFA 2X8AA 3A9UA 4PAWA 1X1EA 4Q3OA 1RLJA 1FYDA 1KZ4A 2PX0A 4QBFA 3Q3EA 3WWDA 3PJRA 2FMXA 3ZWYA 1YJQA 1W581 2JKVA 2XMPA 3HDJA 1I3NA 4H59A 3AESB 2BT4A 1RFLA 1YFLA 1LSSA 5ALYA 1GKYA 1O9GA 4BTLA 2J09A 3ILHA 5ECDA 1NUQA 3A2NA 3JPWA 4GBMA 4YAJA 1TW3A 5H9VA 2DTXA 1BQEA 1RJWA 3BPSA 3C3XA 4XYBA 5B4VA 3T7JA 2SICE 4L9RA 3BTSA 1CPYA 1ZH2A 2C5GA 3L05A 4G56A 3U48A 3A05A 1K8ZB 1WXIA 1ZKDA 2GD2A 2I6FA 3EDCA 1UBSB 5DLYA 5DE3A 1Q95A 3KX2A 1JG7A 3KZOA 4LY0A 3ZDDA 3UB3A 4WCDA 3QMMA 4DNQA 4LF6B 1B6TA 1VKOA 4OQXA 1QGED 3TR5A 2HSEA 1A98A 2WUDA 1V7PC 2AW3A 1LUAA 1Y1SA 3G9UA 2HA0A 1K6JA 1OD6A 4TKVB 2XDWA 3ADBA 1H1DA 1YJAA 4FKBA 4QGGA 3P9CA 3KVRA 1LVUA 4M7PA 3WHLA 3WFIA 5L3SB 2V7XA 1FDIA 3NBQA 1XLVA 4FLFA 3COYA 3J80A 2VTBA 4GFDA 4HP8A 5KOIA 2O2GA 4RA6A 5IASA 2A6PA 3LPDA 5DHPA 4ZYTA 1EJ0A 1T24A 2OYSA 4TYMA 5HDBB 1JW9B 1E1QA 5H3HA 3ROTA 3T3DA 3DEAA 2O7NA 2KWIA 1UKEA 1CKEA 1WCIB 3MAJA 4LJ8A 4TN1A 3EMBA 2OXIA 2X7JA 3OCYA 4RTOA 4I1RA 4M3NA 3LHIA 4KPUA 3S4YA 2BDTA 3WLIA 3TB6A 4NJOA 3WYBA 4BO3A 4P84A 5GIOE 1XKQA 4L6CA 5ARBA 1P1KA 2J48A 1I4OA 1MXFA 4HDCA 1FL9A 3W78A 4HNSA 1MAWA 2O3UA 3GDWA 5FOSA 4PYQA 2JFVA 2CVHA 3OLXA 3JQQA 3VISA 2YZMA 4DIBA 2OWDA 1NC1A 3GVIA 3R0ZA 4QRIA 4RHTA 3RQIA 1GQOA 1YUBA 1GHTA 4AIIA 2Z3ZA 4CFZA 3AKEA 3CW2A 3WHKA 1P9RA 5J2TA 2XQKA 2PLAA 3DB1A 3UCXA 3D0QA 1JKMA 4X45A 1U63A 3KKZA 8LDHA 4AMGA 2GN9A 5JU6A 5E6SA 1HQCA 5LU9A 4Q21A 1B4DA 3CX8A 4ZIRA 1CTQA 2CLDX 3S1LA 1AM4D 4CMKA 4YUXA 3QPBA 1UMDB 2F1IA 3GYBA 2H17A 5D3ZA 5FUYA 3MLAA 2CL7X 2JLRA 3AOEA 4Y9TA 4E7OA 4IEFB 1LK0A 4AZWA 1IG3A 3KQWA 3TPFA 3T7EA 4Z7JA 3PUJA 1V3VA 3KQKA 1KO5A 4TYPA 5H0IA 3HP4A 1C0PA 4GX1A 3SXJA 3T3HA 2I91A 3ENVA 4QT4A 5L3ZA 1IOZA 4AULA 1ZIDA 1T6ZA 2HNAA 2QVLA 4HAWA 3VNSA 1UBOS 5HA5A 4RVDA 1II8A 2RB4A 3M6VA 3S1SA 1E3JA 3C6MA 2XWSA 2J3JA 4V0QA 1V48A 3D5EA 1G2IA 4YDRA 3TLKA 4ZCTA 3GLGB 4OEHA 5AVVA 5DRTA 4C4SA 4JI8B 3O4VA 4OXIA 5DP1A 2WE8A 2YBDA 4FR5A 4MR7B 1BKSB 1S8FA 2NWQA 3R7WA 3D8RA 2IOYA 1J8FA 1JF8A 1EZ4A 2JK1A 4WFQA 1HDIA 1P45A 9LDTA 2ETXA 1VFNA 2A5FA 2YHSA 3VC2A 3W8EA 2LR0A 3SZUA 2QM7A 1EXMA 3NH6A 2WKSA 3SJAA 4YJDA 1P5HA 4I9GA 1J07A 1TVCA 4CUKA 4HBZA 3UB4A 4F3YA 4FW8A 4US2R 2ZWAA 4OHMA 3CRRA 4DSOA 2H1HA 2IEZA 5LZ4A 1IHPA 3LVFO 3PD0A 5A5EA 2DWQA 1P81A 2OFXA 3V2IA 1OE0A 4TL6A 2JLCA 4MULA 4IS3A 3I53A 2OQIA 2E82A 2P11A 3LJKA 1JPUA 3NHZA 2CNDA 3I5MA 1FYEA 2X77A 2RCYA 3MWKA 1NU8A 1V4BA 3EEIA 3X2FA 3OQMA 4H0CA 5CXUA 4J0FA 1SU7A 4NG4A 1RYBA 1EP2B 4KB5A 3W2HA 4RIIA 2NSLA 2ZBUA 4L0MA 5AKEA 4A0SA 1BA2A 1L1QA 1UFRA 3BL8A 2IKSA 3T7AA 1N78A 4LV6A 1GPAA 2H59A 1G9XA 1U81A 2FQYA 1GILA 2VXBA 5CIWA 5I7EA 1P5FA 1OZGA 3IPAA 5LBIA 4RLQA 1A8HA 1N1DA 1O5OA 5DTEA 2YZNA 3GW8A 3WL3A 3KO8A 1KIFA 3HG7A 3LWNA 2PZFA 4B7XA 3EMDA 3TLYA 1CNEA 2NV2B 1TIBA 1ZGCA 3EODA 4JCCA 1WS6A 3QVGB 4M9QA 5LXTF 4B32A 1T35A 1O54A 1RM5A 1E3IA 2CEAA 4G81A 1DAEA 2IEYA 2PYIA 4WA7A 5JZ9A 4M55A 1PD1A 5BV1A 3JAKA 2I62A 5LMZA 3I2IA 2B4RO 4EHFA 5LU8A 4Q05A 1HT2E 2OB2A 2W2MA 2XRZA 2RDMA 5F2KA 2HMVA 3DB2A 1BVYF 3V00A 3NTXA 2W6PA 1Z88A 4FJ0A 1VL2A 3CONA 1T8SA 2GAIA 4YHHB 3M5PA 2GN4A 1QC5B 2PRSA 1U2GA 1JHDA 1OU0A 2H8KA 2Q6IA 3PTLA 4Q1VA 4ETWA 3O8QA 3PHLA 4GX5A 3KM0A 3BRQA 4GM4A 2R8OA 1PNQA 2G5CA 4R2MA 1J2UA 4PHGA 3HJTA 5ADUS 4ZYWA 5BSRA 5JC8A 4IDBA 1KP3A 1PK7A 5DX0A 4UEKA 4I4IA 2V5UA 4ZO7A 5EWMB 4DUGD 2PS3A 3AR4A 3OCJA 5DIFA 1GDTA 4JUFA 1I2ZA 4HTFA 4NONA 3L4EA 2J46A 3MTIA 3HZHA 2VNIA 2QROA 3FIUA 4A91A 2H00A 2Y0EA 3KR1A 1J39A 1XF1A 2JVKA 2O50A 1AA9A 2PKRA 2YOHA 3SIWA 2Q3HA 4XM2A 3NTVA 2QGFA 3DZKA 4QXAA 4RA9B 1BJTA 2VC2B 3DZDA 2JJ1A 4GS5A 5TQ0B 5AW6A 1J8YF 3RSQA 3T1OA 4LDAA 2GEUA 3R3YA 1MJHA 4CF5A 3BUSA 5SV2A 3HEMA 3QWIA 2PX6A 4ILEA 3H9EO 5LXTB 4B0PA 4C2AA 2WMYA 4L3VA 2DR0A 3CR7A 5FBKA 2V7VA 5EMKA 1OTHA 5LC1A 2E7ZA 1PFYA 4Q34A 2XUHA 4YALA 2R1VA 2P1DA 3OF5A 3Q7IA 1KMQA 2V7TA 5KJCA 3R0JA <