1E3SA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
241
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
total genus 85
structure length 241
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3sA00
3INRA 4BNGA 1VI2A 2Z5LA 3JV7A 3FTPA 5JAQA 1GEEA 2DPHA 3P2YA 5JSFA 4J4TA 3C7DB 5JC1A 2NWQA 5EESA 2CZCA 3N74A 3SLKA 2I99A 1LRLA 1GEGA 1U3TA 3PLRA 3WIDA 1Y8RA 4FOSA 1XIVA 2OUIA 4WCFB 4LRTB 3WMXA 2GZ3A 1Q1NA 4M86A 4W9NC 4YRDA 4E4YA 3ZWAA 4RVSA 4LMPA 3PHLA 3GH3A 1NAIA 5K6AA 4CMHA 2QYSA 2VYVD 3RAJA 5JDIC 1XDWA 1Q2XA 1WZIA 2V6MA 4NJMA 1NPYA 1ONPA 3UFXA 4O1MA 4H16A 4CLRA 4HBGA 4E30A 3DC2A 3CKYA 1PZHA 3OEYA 4LCJA 2EKQA 4KTVE 4L4RA 2FY8A 3FBTA 2HDHA 1YJQA 1CF2O 3HDYA 1NVMB 1IPEA 1YL6A 4EITA 3OFSA 4CMCA 1H2HA 4YT2A 2Z1MA 2HMVA 4CPDA 1SC6A 5KJCA 3KSDO 3GVCA 3WQRA 2GDZA 2IE0A 2Q50A 1U8FO 3WFIA 1ENOA 1CDOA 4UVDA 1H6DA 3OECA 3UN1A 4BO4A 4B79A 4NJOA 1GCOA 1BXKA 3NTQA 3KRTA 4DQVA 2E4AA 1TXGA 3VTZA 1IYZA 5CEFA 5T8KC 4DBZA 4INAA 4KMSA 4CM9A 3PZBA 3PP8A 4M55A 4J90A 3WNVA 2ZB3A 1D4FA 2H6EA 3VAZA 2ET6A 4CUKA 1YGYA 4XD2A 2ZTLA 4Y67A 4D0RA 2VUSA 3DOOA 4IQ0A 2AA3A 3FNEA 1O94A 4BNFA 4CL3A 5TQVA 3INTA 1C0PA 1PIWA 4BNJA 1N92A 2BHLA 2E82A 3NDRA 3VKVA 1TT5A 1GYRA 5I7FA 1HE2A 3CTMA 3R6DA 3Q11A 4OKIA 1P1IA 3JTMA 2PD3A 3JQ9A 2A94A 3DZIA 4OOFA 4LK3A 3ZZNA 3N58A 2NM0A 1ZKMA 4LMRA 1F8FA 3FWZA 4F6CA 3GG9A 5G2OA 3PEFA 2NVWA 3JQAA 4G81A 3V1UA 4RF5A 4WCDA 4EEZA 5COBA 4ONEA 1HDZA 5AOVA 4UVHA 2FSVA 4ZN6A 5CHEA 1N7GA 3B1KA 3GLQA 4CUZA 1QXSA 3IUSA 4FOOA 4BUCA 5CPBA 5F1PA 2OORA 3QWHA 4WCFA 1VE9A 3MJEA 1UZNA 4MVJP 2AQKA 3I5MA 3U4DA 2JCVA 1TB4A 4BKQA 1YDEA 4E0BA 1KY4A 2UVDA 3PIIA 4XWYA 4IS3A 5B12A 1KVUA 5ER6A 2GYYA 3H9QA 2JFGA 3PFWO 1EVJA 1SAYA 3UW3A 4LRSB 4B3HA 2W8ZA 3WJAA 3M2TA 3UCFA 1P3DA 4ESOA 1LDBA 4CMJA 5KKCA 1WDKA 5CDYA 3V1TC 1ADCA 2E49A 2O3SA 4DIOA 4DGSA 1BXGB 2BGLA 3KUXA 3L4SO 1H6CA 4YACA 4D0SA 4PLCA 7ADHA 5A4DA 1F12A 3DO5A 3PYLA 5BNFA 4Z6KA 2PGJA 1HE4A 2GRAA 3MOGA 4NBRA 1DRWA 4FS3A 2X7HA 4ALIA 3O9ZA 4JQCA 3LSYA 1KBZA 4IQ8A 3C7CB 4EJ6A 3BIOA 4KP7A 3OHSX 4WGGA 1LEHA 3FNHA 3LDHA 4CODB 1H9AA 2RHRA 4IGFA 1IULA 1PQPA 1LA2A 1DRVA 2YDXA 1JLLA 3W8EA 1E1LA 4BL5A 1T2EA 5BQFA 1PQWA 1MFPA 3G1TA 3L6DA 4R54A 5L95A 1X13A 5A5EA 4AJLA 3GUCA 1P77A 2DUUA 3LZ6A 1JKIA 1E3WB 1MLDA 4D42A 1HZJA 4U5QA 2VWPA 3LQFA 4MVJM 4NI5A 3OH8A 1VKOA 2FN7A 4TZTA 3AUUA 3RBZA 1T2AA 3V2GA 2HU2A 2ZB8A 1WDMA 2ZK7A 1WPQA 3K30A 3KSUA 5G0TA 4RPHA 3L77A 3W4KA 1HLPA 1WLYA 3RJ9A 3AM3A 4IJUA 4CQMB 4H15A 3WYCA 4L4XA 1I3NA 2BFMA 2E37A 4RLHA 1YL5A 4IDBA 4IMPA 3JD4A 4N54A 2VQ3A 1I3LA 2O50A 2OOSA 1SOWA 1UXIA 3COSA 4FFOA 3GG2A 3HJAA 1IB6A 4IBOA 4EJMA 4D3SA 2VT3A 5JO0A 2P9CA 4R3NA 5TRTA 2EP7A 1NFRA 3QVSA 5L7YA 4PLGA 3RVDA 5CDGA 3U5TA 1DEHA 1PZFA 1SEVA 4W9NA 4CM1A 1PL7A 1ZJZA 5JC8A 3PJEA 4QUKA 2CMDA 5JDIA 1YH3A 4QXMA 1KEWA 4N18A 5CDUA 1PZGA 1HDCA 2CVOA 4I9UA 4DC1A 1UJMA 5C7OO 4BNLA 3DHYA 2ZYGA 2C82A 1NASA 2G1UA 5AQ1A 3RBXA 4R9SA 5KJ6A 1O89A 3ZI0A 2IDZA 5GZ6A 4BNIA 4BOYA 3NV9A 1KETA 4YAEA 3P7MA 4QTZA 1P0FA 1WW8A 3K6JA 1LDMA 4ZVVA 2PFGA 3PRJA 2X0JA 5KJFA 2FZEA 1M6HA 1V35A 3E03A 3AUSA 3P2OA 5IDQA 3C7AA 1UXHA 5T8KA 3B6ZA 3ZW8A 3TOXA 3PZRA 3F46A 4FPXA 5ADHA 1KEPA 3C1AA 1HEUA 1QR6A 2XF8A 2FR1A 1EVZA 2CDAA 3SJ7A 2CDCA 1JQBA 4PCVA 1R6DA 1CWUA 4HNGA 4KQWA 1ZFNA 3H9GA 3PWKA 1GZ3A 1KY5A 2DTEA 1UZLA 4KUGA 4J1TA 3LK7A 4TRMA 3ZN2A 4HV4A 3WGQA 9LDTA 1ZK0A 1ISJA 4IY1A 1RM5A 4HXYA 1NVGA 2OMEA 3AUAA 3OIGA 3TL2A 4BO6A 6LDHA 3OIFA 1LSUA 2BD0A 4GWGA 4NBWA 4NBVA 2ZQYA 4CQMA 1ORRA 1HDRA 4PZEA 2AE2A 4UEKA 2HAEA 3TN7A 1A9ZA 5MDHA 5KVVA 5JAZA 4CQLB 2CD9A 3B20A 4BO0A 3KLPX 4A5OA 4F45A 2OBNA 4XYBA 4RVUA 4NPCA 1P44A 3LVFO 4BKPA 1U4SA 5HRUA 4GH5A 3QVXA 3VPFA 4PG7A 3LF1A 3EC7A 2O3QA 3LYLA 4TROA 3ETGA 5A9TA 1I2BA 1YJ8A 3RU7A 5IG2A 3RC2A 3GA0A 2D59A 3JD2A 3D5QA 3GZNB 5A04A 5DBIA 1XHLA 3M1LA 4MO2A 3GF4A 2TMGA 3IP1A 3K9QO 4QQRA 5AXAA 4RL6A 4LVCA 3UUWA 5DOZA 1ID1A 2ZTVA 5TJ9A 5HM8A 1E6EA 3GVIA 1RWBA 4XDYA 3EW7A 4EBFA 4PLWA 2D8AA 4TVOA 5B4VA 1R4MB 5U9CA 3BMNB 5DDIP 4CMIA 4YRBA 4IM7A 3W8DA 1NQOA 1ARZA 1LQUA 3FR8A 1FXSA 5BR7A 4I08A 5TC4A 3DBHB 4D3DA 4HFNA 4IJWA 2NTJA 1LBEA 5JYDA 5F3RA 3C8MA 5KCZA 3PWSA 4Z0TA 2BLLA 3I1JA 3ZHZA 1E7WA 4D79A 4NG5A 4Q39A 2WE8A 3WFJA 3CMCO 4KQXA 2WJPA 1OAAA 3U9LA 1ZK4A 1FDSA 4EGFA 1NVTA 1YE3A 2DT5A 3RC9A 2IEDA 4K6FA 2AEJA 3E5MA 4I9HA 4MIOA 4JBHA 1VJ0A 4OH1A 1HSOA 3ITDA 1YWGO 4JBGA 2H63A 4OJNA 1OMOA 3GVXA 5EERA 1DC5A 3T4XA 4BNKA 1V8BA 1EQUA 2X0RA 3Q2KA 3G3EA 4B4OA 1DO8A 2PGDA 4OHUA 4YQZA 2VYNA 2HQ1A 2Y1GA 3G1UA 1PJSA 3ITKA 2ZJ0A 3M2PA 1ZVMA 4PRKA 2P9EA 2OL4A 2P9GA 2WD8A 2Z1NA 3RKUA 4XB1A 2A92A 4CQLA 1ZZEA 1Q7CA 3BMCB 3FTNA 2EIHA 2D2IA 4TRJA 4BNHA 1GADO 3WGOA 4R1NA 5IN4A 4AJEA 2JJYA 3Q0EA 3H2ZA 4KUHA 3GGGA 3I23A 3ORFA 3WBFA 2IODA 1YQGA 4FGWA 1U2GA 5HS4A 2D1YA 2JAPA 3DZKA 3IP3A 4BNVA 3KO8A 4DREA 3GZNA 1K0UA 4WOJA 1MP0A 1U9JA 3O38A 1NFFA 5BSEA 5CG2A 4W82A 2QG4A 4DVJA 4GI2A 2UYYA 2EGHA 2O7SA 2EKPA 4UUMA 1R4MA 5GY7A 3BMNA 1VC2A 2X5KO 2QRLA 2ZYDA 1RYEA 3PDUA 3V5NA 4DIFA 5G4LA 1BMDA 2AQ8A 4E32A 4YQYA 1CETA 1EK5A 4HADA 3E5RA 1HWYA 3SEFA 3QLJA 3GN2A 1NBOA 3KOUA 3MJVA 4Q3EA 4R41A 2AEMA 1E3JA 3CUKA 3WS7A 2DKNA 4NH4A 4WLVA 4S3MA 2BFAA 3RCBA 1ONOA 1LU9A 2Q3EA 4PRLA 2VWHA 1YL7A 4BB5A 1DLJA 1ZMOA 4PVCA 4AJOA 2G5CA 2BI7A 1WVGA 2O2YA 3VZPA 5T5QA 1W73A 4NZ9A 1KIFA 2VHYA 1ENPA 3IL2A 3QWIA 2DTXA 3AOGA 3KM0A 4ZRMA 1J0XO 2AEFA 1PR3A 1W0CA 3KZVA 1C0LA 1W6UA 1E3LA 3DEYX 3NT2A 4L75A 3Q9UA 2BH9A 4GWKA 2O2SA 1PJTA 3UF0A 4R1UA 4FC6A 2DAPA 2I76A 3HADA 5ER9A 1EUDA 4P4NA 1HETA 1KVTA 1ADFA 4IIUA 3DBRB 4L4SA 3RFVA 4YPOA 4R1TA 4C4OA 5ITVA 1EZ4A 4XEHA 2PGLA 1EQ2A 3E9QA 4CLXA 3D4OA 4J4BA 5DN9A 3BMCA 1U28A 2D3TA 4DYDA 1SCUA 4HFMA 4I5DA 5DBFA 1VLLA 3S55A 4DL9A 3AY3A 4II3A 1GV1A 4YB8A 4HY3A 1X7HA 2GLXA 2JD2A 2OO5A 2OFPA 2O4UX 3ICPA 4A73A 4EI2A 4NFYA 3GAFA 5IZ4A 3GT0A 4YJFB 4CL8A 1NWHA 3WYEA 1SEPA 1T4DA 3VPSA 1X1TA 1HYHA 1GPDG 4GSKA 4W6ZA 4CM7A 3HN2A 2E6UX 4ALNA 4YWJA 2FHSA 3WJ7A 4JJGA 2Y1DA 4DWVA 2DQ4A 4JN6B 1PZEA 4L9RA 1P1HA 2EV9A 4EUEA 4RF3A 3WNQA 3GQVA 4CM6A 3HFSA 1JU9A 3ZU4A 5EPOA 4DBVO 1V6AA 4F6LA 2QYTA 4GQAA 1EFKA 3EHEA 4FIZA 4PZDA 4IDDA 2NU8A 3WWZA 1FDUA 1ZH8A 5L40A 2XAAA 1O8CA 4IXTA 2GCGA 1O9BA 5TJHA 2QW8A 2Y93A 5CEEA 3WGZA 2FSSA 2BKAA 3PLNA 1GQ2A 4Z0PA 5F5NA 3VZQA 1OOEA 3MTGA 1H9BA 3LLSA 1VSVA 1Q0LA 2J8ZA 3VTFA 4EZBA 1WMBA 3L0DA 3WWYA 1PGQA 1KS9A 3DMTC 4NJMB 4QECA 4CJXA 3TFOA 4LCEA 4GKBA 3D5TA 1ZBQA 4YRAA 1WWKA 3WTCA 4CLRB 4DA9A 1XYGA 3OJLA 3I9JA 4DLBA 2PWZA 1I8TA 2UDPA 1GV0A 3SVTA 5L51A 5DT9A 1X14A 3IMFA 1MG5A 3AWDA 1YO6A 1ZSYA 1NHWA 1CYDA 3H5RA 4AJPA 3AY7A 3V1YA 1T2CA 2C5EA 4NHEA 5L3ZA 3U09A 2ZYAA 1HLDA 3GZ4A 2AMFA 5FYDA 1G1AA 1SB8A 4BB6A 4L76A 2FMUA 1DC4A 4RDHA 4HX5A 2C7VA 1LLQA 1WDLA 4J6FA 3OEWA 5C7LO 4UVIA 1RM3A 3EZLA 1IZ9A 5JXWA 2X58A 3C85A 3JCZA 3I9NA 3PHJA 3WDSA 4GBJA 1P1FA 4XYLA 3B1JA 5ENDA 4E5MA 3I9LA 3M1AA 1EUCA 1H94A 4YJFA 3UH1A 3O03A 2CFCA 2ZQZA 3JD0A 3JQ7B 2J3IA 1ULUA 4LSMA 4UREA 3RASA 4B8ZA 1GPJA 3A1NA 3CXRA 1DHRA 4OKNA 2DC1A 1NQTA 2HCTA 2OP0A 1AXGA 5EL0A 1BW9B 4I5GA 4IPTA 3VH4A 1IHYA 2VZ0A 3LT1A 4NU6A 4G5HA 4QO7A 4E2ZA 2J3KA 2GN8A 5F21A 4BNMA 3FN4A 1D3AA 2VOEA 2X23A 3UXYA 4OL9A 2B35A 4HP8A 1YQDA 1V3UA 3KYDB 3ONFA 4XR9A 5L53A 1JA9A 4NNJA 4RV9A 2GNAA 5ICSA 4AFNA 1ADBA 2H1SA 3HB5X 3IS3A 3WR5A 5DULA 4B7UA 2FPPA 3QVOA 4MIEA 1IPFA 5U1PA 4J1SA 2Q1WA 1XLTA 3GNQA 4M49A 1JN0A 2H5LA 3D4NA 2ILTA 1PS8A 2EJWA 1P1JA 3VVBA 4YAKA 5CDTA 4RQUA 3KSZO 5KWEA 4GX5A 3EVTA 4QFCA 3AU8A 5IZCC 3ZWOA 4KUEA 2F00A 2PH5A 4GGOA 3S2IA 4J0FA 5DNAA 3H3FA 3DR3A 2X1HA 4NK5A 5JMWA 2YQ5A 1E6WA 3Q1LA 4ITUA 1DHTA 4OQYA 3F9IA 2GGSA 1HZZA 1JW9B 3F47A 9LDBA 4J2HA 2VRBA 3R0IA 1K2WA 3BHJA 4FC7A 2GN6A 3K8ZA 2NQ8A 2Q4BA 4Q3DA 3A06A 3IUPA 4ILKA 4JX8A 1LQTA 2Y1FA 4XYGA 1RJWA 2GF2A 2W98A 4BMVA 1L7EA 5JLAA 4DLLA 4IQGA 4CLOA 4TKMA 4BKOA 1DPGA 1HYGA 1ZCJA 3D0OA 2VCYA 1XU9A 4DMLA 1DSSG 3B70A 3DZBA 3LF2A 2IZZA 2VTEA 1DB3A 1EBFA 1U3VA 1HF3A 3DL2A 2UV8A 5T64A 4MKXA 3EK2A 1L1FA 3PI7A 1YXMA 3TRIA 4UEJA 4J1NA 4D44A 1UAYA 5JY1A 1UZMA 3JQ7A 3TQHA 1PJ4A 2B37A 3S8MA 4W4TA 4GVXA 1BW9A 1Y8QB 2AW5A 4EUHA 2QHXA 3HNPA 1X7GA 2X4GA 4ZRNA 3QVTA 3W4IA 3QWBA 2CF6A 3F1KA 4GLOA 1BRMA 2DVMA 4F3YA 3TZCA 2RH8A 2PD6A 2I6TA 4JJFA 1JWAB 3BA1A 1P33A 2DTDA 2X9VA 2XOXA 3DMYA 3KYDA 5C3MA 3U49A 2RH4A 5EMHA 3NKLA 3PJGA 2DBQA 2O48X 1PL8A 2NADA 3ULKA 1SMKA 1NPTO 3DZFA 4AJNA 5ITWA 5EINA 4CMBA 2HMUA 1HE5A 3EZYA 3W6UA 1A5ZA 4YJGB 1OFGA 4FJ0A 3TL3A 3OIDA 1EDOA 4Z9FA 1DIRA 3UKOA 1VL6A 4ND1A 2Q2VA 3DMTA 1I36A 4NDNE 1O0SA 4IZIA 3U4CA 1DC3A 2QZZA 4ZHSA 4HWKA 4J4HA 3S2EA 1R0SA 3QWAA 1J6UA 4OXYA 2P4HX 1BDMA 1YONA 4BNUA 1UP7A 4JROA 3ROKA 5H81A 3SC4A 4D7AA 1GY8A 4OQZA 1ULSA 5I7SA 2B69A 4CV2A 2BGMA 1KVSA 2X9NA 3H5NA 3T4EA 1UP6A 2X5OA 4LSWA 4JK3A 3FPLA 3JD1A 3LC2O 3ENNA 1U5CA 4KOAA 5EN4A 4AG3A 4FJ2A 2HO5A 2Z95A 2PR2A 1C0IA 2BI8A 2HK9A 4BO8A 1P31A 1F8GA 1AHHA 3KYCB 5COQA 1ZJYA 1I33A 3ENKA 5G0UA 1S7CA 4YXFA 1BG6A 5IDXA 1Z7EA 1X7DA 2JCXA 4JBIA 4ALKA 4FB5A 3NEPX 4XQCA 3F4BA 3A9WA 4K28A 2OZPA 4LISA 4UUNA 2Y05A 2W2LD 3S2FA 5FEUA 2NQTA 4OAQA 5ILGA 1T1RA 5T67A 1BGVA 3RD5A 2PNFA 2A35A 1E7MA 1BWSA 2PH3A 4CR7A 4E12A 3ZHXA 5B4UA 4ALMA 3U4HA 1Y8QA 1I3MA 5HBRA 1FDWA 1VL0A 2FWMX 4HFJA 1NQ5A 4QSMA 1A4UA 1NR7A 2YQ4A 1Y7TA 3HB4X 1V3VA 4BO1A 2DLDA 3A28A 4W99A 4RORA 4A03A 1GUYA 3WXBA 1O5IA 2PY6A 1Y6JA 1LUAA 4M87A 4OOEA 3BYZA 4J2OA 2WE7A 3RUFA 1ZMTA 2IYOA 1D1SA 4J9UE 2EJVA 3L07A 3QV1A 4MJLA 4ND5A 4JGBA 4WPGA 4H7PA 2DBZA 2EKLA 4GX2A 1PEDA 4YJGA 1PGNA 4J49A 3BHIA 4BO5A 1GU7A 4ALJA 5IXSA 2AHRA 1MX3A 1E6UA 2IZ0A 5BSHA 3X2EA 3CH6A 4RVHA 3VH3A 1B2LA 2AG8A 4XGIA 1C0KA 1H2BA 1SB9A 1I10A 1OBFO 4YJDA 1DJNA 4GMFA 4E5KA 3IJPA 5IZCA 5FI5A 4BO7A 4CMIB 4Z9YA 2P91A 2V6FA 1G0NA 4Q9NA 4IUYA 3UAGA 1NPDA 2I5PO 3UCXA 4XR4A 2X86A 3WQSB 2JL1A 5LDGA 2C54A 3K73O 4DUPA 2ZKLA 4CMGA 4YR9A 4QEDA 4RZIA 3MJ4A 3Q9NA 5G0VA 2AG5A 1DIAA 1I5RA 4ZJUA 3C3XA 1B15A 4R69A 4CLHA 2Y1EA 4BKRA 1SPXA 2CVZA 2YHUA 3DBVO 4X54A 1DDOA 5B37A 1U8XX 5JE8A 3WX0A 3L4BC 3KYCA 4MVJD 5JFOA 3D64A 1QP8A 2Q1SA 3JYPA 2OBYA 1HL3A 3AI2A 3FHLA 3JQ6A 1LI4A 5A03A 3GNTA 3I4FA 4K1LA 4PLFA 2WD7B 4YTEA 4AJIA 5AYVA 4DQUA 4E2YA 5GZ3A 3AOEC 4Q3NA 3RC7A 4XQEA 4JCOA 1EUZA 1QV6A 5F1KA 3OQBA 4BGEA 2Y0CA 1QYDA 3TZHA 4NR0A 3PHGA 5IDYA 2ZIZA 3N7UA 1R0LA 1ZO8A 3GPDG 3NRCA 4XB2A 2I9PA 4P4GA 2DFDA 4N5MA 5I9NA 3U3XA 1DFGA 2HLPA 1MXFA 1R12A 2R00C 3OQ6A 1M75A 4PIVA 1MG0A 3K31A 3BMQA 4IDCA 3GFGA 5CP8A 4E6PA 1WAMA 5U4QA 1VJTA 3K2BA 1XR3A 4IS2A 4XIYA 4YDRA 2X22A 1R4NB 5BNIA 4WEOA 3NJ8A 1PJLA 2WYWA 4GVLA 4RPJA 2NNLD 3H2SA 1SO8A 1K89A 1R16A 4PLZA 3ZWNA 4DPKA 4YT8A 4A7PA 1JWBB 3QJ5A 3U0BA 1PS9A 2PZMA 3SX2A 2GO1A 5EJ2A 4FD3A 5JDCC 4CMAA 1TA4A 4IMRA 3H65A 1HDOA 2PD4A 1DFIA 3ONEA 1NFQA 4YYZA 3F5QA 4GSLA 4K26A 3H7AA 3WSWA 4WASA 1PL6A 1YKFA 3E9NA 4J7CA 3LT4A 3K2EA 1BVUA 4YAGA 2JAHA 3DXFA 1R66A 1MFZA 1SZJG 2GPTA 3CSDA 3KTDA 5DBGA 4Z9XA 5L9AA 3ANNA 1UDAA 1FK8A 2B83A 1EBUA 3IC5A 2HK8A 3O26A 4FCCA 1BHSA 3KV3O 2E48A 2UUPA 5GZ1A 1AE1A 3DBLB 2VRCA 4PLHA 3KBOA 3JQAD 1XG5A 4XGKA 1NP3A 8LDHA 3AW9A 1N7HA 3CZMA 3MWDB 3MZ0A 5BSFA 5KVQA 1GZ4A 1Y5RA 4RPLA 1D7OA 1FF9A 2WM3A 2ZTUA 2OP1A 4ZQHA 2CDBA 2QRKA 3KB6A 4BNYA 4GX0A 3VC7A 3ZV6A 2WD7A 4GAEA 2OXIA 1GCUA 2AQIA 3E9MA 1LDEA 2VZ9A 3X2FA 1HDGO 1N2SA 4AJ2A 4XJSA 4HUJA 2CY0A 4RZHA 4RVDA 1I3KA 3HHPA 4B4WA 3DWFA 3TSCA 2RHCA 3E18A 1QORA 4EEXA 1TEHA 1LLDA 1U4OA 3OBBA 3C1OA 5JBIA 3H6KA 3VZSA 1CQIA 3C24A 3PIDA 3AFNA 3WLEA 5L4NA 1XKQA 1CJCA 3ON5A 3F3SA 4ZQBA 4D43A 1YVEI 2HKIA 4RQTA 4AJKA 3DAFA 4R1SA 1GQQA 1YQXA 4MVJH 5L4LA 3DHEA 1R4NA 5KKAA 3RUDA 4RF4A 2G17A 5JCJD 3GMSA 1ENZA 4M54A 3WGHA 4R9RA 3W1VA 2QZ9A 4BMSA 2QX7A 2XXJA 4U6QA 3WTBA 1BDBA 1T1SA 1E7QA 3GPIA 3BTVA 4NFSA 4Z3KA 4GL4A 2VYVA 4CM4B 5L4SA 3WBBA 4OYRA 4Z0HO 3OF2A 4BNNA 3D1LA 3PQFA 4LVUA 4ZA2A 1LLCA 1QRRA 4UEOA 2NUAA 1ZK3A 1JKJA 3RC1A 1PU2A 4QT0A 4TZKA 2ZATA 4MIYA 5KJEA 5JNLA 3H4VA 4B3JA 2YZ7A 4IDGA 4CM5A 5K0ZA 4OM8A 2X0NA 1QG6A 4R68A 2V6GA 3EGOA 1IE3A 2VNAA 2VOJA 3ZWPA 4WLOA 3JQEA 5IJZA 3DDNA 3RKRA 1L7DA 4YVFA 5B1YA 3E6AA 4XDZA 3DBLA 2Y0DA 1YDWA 4DYVA 2C2YA 5DCYA 2F1KA 5C7IO 1HXHA 2FP4A 4BVAA 2J6IA 2Y0EA 3GRPA 2JHFA 4XGNA 5LDHA 2JD0A 2EWMA 5KNLA 4WLFA 4BNTA 1BXZA 1A4IA 2BRUA 3BTUA 2FPGA 3ANMA 3WGIA 3BXXA 3E48A 3CMMA 3L4BA 4ZD6A 2IEBA 2A4KA 3NDIA 2GZ1A 4BQPA 1IHXA 3D7LA 1LXCA 3ZV4A 1WMAA 1U2DA 1MA0A 2QIOA 2R2GA 3AOEA 3PJDA 1EE2A 4IDFA 4IZHA 3PYXA 4OGWA 3ZNNA 1B8VA 1PJ3A 4GMGA 3WMWA 4A2CA 3E1KA 3H9JA 3NUGA 4TRNA 4XYMA 4DLAA 1E3SA 1Q0HA 4JJIA 3TNLA 3GOHA 5BT9A 4DTIA 4OSOA 1YB1A 4MPDA 3DZGA 3B1FA 1M76A 3UCEA 1KERA 4CMEC 4KZPA 2R00A 4RGBA 1NTOA 4MVJF 3KEQA 4GGPA 4RDIA 4A0SA 1ENYA 3GEMA 2B36A 3JYLA 1WZEA 3PVZA 3WSVA 3LC1O 4Q3BA 5KVSA 1ISMA 3SLGA 4CM8B 4CM4A 2CVQA 2BMAA 4G65A 4YT4A 3RUHA 4CV1A 3QY9A 3ONDA 2EERA 4PG8A 4JIGA 3TJRA 4FDAA 1D1TA 1N9GA 2NLOA 4ROSA 1H6BA 4XQGA 5H83A 1R0KA 3GDOA 1SBYA 4KWHA 1I24A 3GC6A 1QYCA 4K6CA 4IDEA 3BMOB 4BO3A 3ZWWA 5JO9A 4I5FA 5HA5A 3SBOA 2D0IA 4E2WA 1P45A 4WUVA 3PTZA 3DTTA 2O3TA 3WIEA 3GDFA 4AJ1A 5GMOA 3RROA 2VN8A 4O59O 4RCVA 2PKQP 5I8ZA 3O4RA 1ZEJA 4I9NA 1GAEO 2IZ1A 3PDJA 4FFLA 3NDJA 2I65A 1GD1O 1PGJA 1ISGA 4E5PA 3WOHA 3HSKA 2B4TO 4BHTA 3PHHA 3PXXA 4Y6RA 3ASVA 1HTBA 4MOWA 4CUJA 3KVOA 5EQDA 1E1NA 3ST7A 4G2NA 3DAGA 1BSVA 1U7HA 4FQ8A 5BNTA 4GKVA 4E33A 4MDHA 1RYDA 4MKZA 4WLEA 3AK4A 2Q46A 4P38A 5DZSA 3DZHA 3VOSA 3ZWYA 2HMTA 4BV8A 2W2LA 5A06A 4KDFA 1ISIA 4RLSA 5JY6A 5DCWA 1ZSNA 2ZCUA 3FD8A 3K96A 4DPLA 3SJUA 1UDCA 2UAGA 2GN9A 3I4CA 4PZCA 3ZWCA 1B3BA 5AXCA 4J9VA 4CV0A 1I2ZA 3C1TA 3ZNQA 4PG4A 3FSRA 4KDEA 1Z82A 3JD3A 5T57A 4ZU3A 4ID9A 4R5MA 4CLOB 3PGXA 4OIMA 2TMDA 1D8AA 4D41A 2V7PA 1GDHA 4LGVA 3NTOA 3NYWA 3QP9A 5A05A 4KTTE 3F4LA 4YJHB 1A27A 3TFQA 1DOHA 1J49A 1ML3A 3CIFA 4J0EA 1GUZA 4S1VA 5F5LA 5C5IA 4ZICA 4CM8A 2EXXA 4B4UA 5B4TA 2Y68A 1MC5A 4DMMA 4R01A 2C2XA 2VUTA 4N7RA 4RPGA 2V65A 3S1LA 2I3AA 3P19A 4Y9DA 7MDHA 4IJVA 2EW8A 2VNSA 3I3OA 2Q2QA 3HG7A 2FR0A 4M89A 4IXWA 3VDRA 4NIMA 1KVQA 3ZU3A 3BMOA 1XU7A 2CUKA 4WECA 4BNWA 1MC4A 3F5SA 2VHXA 5A9RA 2YYYA 1Q7GA 3IAHA 1U3UA 4EDFA 3ZWXA 4ZQEA 4A27A 1EFLA 1X1EA 4W7IA 2WYUA 1K6XA 1P74A 1CRWG 3FWNA 2FR8A 1B26A 2J5QA 3WQQA 2B4QA 1A71A 2J5RA 2X9GA 5I9MA 2J3HA 1XCBA 1BVRA 1LJ8A 3RUEA 2B5VA 2ZJ1A 1YB5A 5KJ1A 3NX4A 1TVEA 4MVJA 4ND3A 4BGIA 5TLSA 3L6EA 2RIRA 5FWNA 1YBVA 1X0XA 1XQ1A 1AXEA 1PQUA 4HFRA 4FFRA 2Q49A 1E77A 4DXHA 3INGA 3JQDA 1HKUA 5JPIA 3RQSA 4MP6A 1B16A 2PV7A 1B14A 3IQDB 3NTRA 1DRUA 2EEZA 3V8BA 2Y66A 3T7CA 3OJFA 4BNXA 2IXAA 3W8FA 3CZRA 2LDXA 5AXBA 4N5NA 2YFQA 2ZB7A 4BV9A 2PLAA 4JP3A 3PWZA 3ICCA 4O63O 3NGXA 1A7AA 4AJJA 1NYTA 4WJZA 1PJBA 3ZWBA 1HYEA 3VHRA 3EDMA 3I9OA 5EQFA 1IL0A 5KOIA 2WEKA 4PN3A 4UUPA 2RBEA 2YUTA 4J1QA 3QHAA 4J91A 2CSUA 2B5WA 5TT0A 4YJHA 4M1QA 1JVSA 2YW9A 2C7GA 4UVEA 1OZAA 2BGKA 2P5UA 4MVJE 2OGUA 4WEQA 4CMEA 1GYQA 2DBRA 2WDZA 1PSDA 3H8VA 4UUOA 4Y8VA 1RM4A 2OHXA 5J23A 3Q2IA 1NNUA 4EW6A 1VJ1A 2DM6A 1T2DA 3JYOA 3A14A 1R37A 3GN1A 5A5FA 5L45A 4FFPA 2ZB4A 5LC1A 4J7UA 3H5AA 4XKJA 1O6ZA 2JD1A 4CV3A 3L9XA 4U0KA 2Y99A 2YV2A 3GK3A 5AXDA 3KEOA 3PHIA 2C0CA 3OJEA 3ZGYA 5FI3A 3MJSA 3NJ4A 3I9KA 1DBVO 1T2FA 1LDYA 1HDYA 2RCYA 2O3JA 2Q2WA 3S2GA 1ISHA 3OICA 2W2KB 4HNHA 2B4RO 5DP1A 1KC1A 1T26A 1LDNA 4CR8A 4E21A 1Y5MA 2Q4EA 4BO2A 1ADGA 1H6AA 2A9FA 4UAGA 2EF1A 3ADPA 3NGLA 2G0TA 5LCXA 1DXYA 4DC0A 3AY6A 1O95A 4M8SA 3ZH2A 1CERA 2WWRA 1R15A 5F1OA 3EY4A 3AM4A 3WG9A 1KC3A 4O0LA 1T4BA 3ABIA 3G17A 4K9DA 1ZXBA 2VHVA 1XEAA 1B8UA 1I30A 3G0OA 5G4KB 2W4QA 4BO9A 4QFDA 3AJRA 1KEVA 5H82A 1JAXA 3VDQA 5IDWA 3JQBC 4JNKA 5K9ZA 2EG9A 3ROMA 1LC3A 3VKUA 2HJSA 3QW2A 5BSGA 3TZQA 4PLVA 2JFFA 2O3UA 1KVRA 4R4JA 4O6VA 3D3WB 2HMSA 1C1XB 1J5PA 3U62A 3DOJA 2QRJA 2DU8A 3F6YA 3AM5A 4TKLA 2YV3A 5I8WA 1V0JA 4TVBA 5HS6A 4Y6SA 2DBVO 2RAFA 2CF5A 2Y1CA 4AL4A 1X0VA 1QYVA 2VWQA 2DUWA 4LW8A 5JCJA 5DOVA 4DQXA 4NU5A 5A02A 1UXKA 3RI3A 4C7JA 1ZXLA 3DB2A 1FJHA 4RPKA 3LC7O 5TSDA 2FRDA 3PGJA 3MJTA 4II2A 4P22A 4NK4A 4UULA 1V9LA 3VH1A 3EYWA 2VT2A 3MTJA 3PYMA 3JYQA 8ADHA 1P1KA 1E7YA 4B8WA 3FNGA 5G0WA 4BS9A 4OSPA 3V2UA 1Z74A 3PPIA 4J16A 3GMDA 5L7TA 1N8KA 1UR5A 3DFUA 5CPFA 1A72A 1NWCA 3FR7A 3H9EO 2WMDA 4FN4A 3GDGA 4AJHA 2W2KA 4YA6A 3OA0A 2NU7A 3BMQB 4KWIA 4YEDA 3ROPA 2DFVA 1JDJA 1C3VA 2C07A 2VHZA 1DIBA 3R3SA 4OMUA 3EAGA 1BTOA 4E5YA 3EMKA 1E1MA 4DRYA 1ZW1A 3DQPA 3Q6IA 2B0JA 3TDKA 5ES3A 2FZWA 1I0ZA 4PLTA 4PLYA 1FMCA 3GUYA 1NR1A 3UVEA 4F46A 4B7XA 1OI7A 4NFHA 1CIVA 5JMPA 3QRWA 2YJZA 1X15A 1RPNA 3UOGA 3PQDA 1XSEA 2C59A 4JLWA 3TZKA 3BZUA 5G4KA 1T24A 2D5CA 4ZGWA 1KYQA 4PGFA 4MP3A 1EK6A 2BFOA 1GFSA 2FOIA 2NVBA 4TQGA 3GVHA 4XX0A 3A4VA 3D3WA 1Y9AA 2PZJA 3F1LA 3ASUA 1C1XA 3OQ1A 3QWFA 4U8GA 3W6ZA 3ZWVA 4DPMA 2ZTMA 3SC6A 3KETA 3GGOA 3JQGB 4NBTA 4I1IA 4E5NA 2GASA 3RBVA 1XELA 1BXGA 1PGOA 3L9WA 3RWBA 4P4LA 1MXHA 3IKTA 4Y98A 1TT7A 1MGOA 3UHAA 4CLDA 4BQRA 3NAQA 3BHMA 3IOYA 2X8LA 4L8VA 1N1GA 1PGPA 2NSDA 1RKXA 3D4PA 1T25A 1DIHA 1EEHA 2HMWA 1PS0A 3V2HA 1OC2A 3I6IA 2BFPA 3MWEB 1K3TA 1VPDA 3HUDA 1C14A 5C37A 3ZHYA 1JAYA 3MEQA 2IRWA 4U6SA 3DTYA 3ZV3A 4CMKA 1QKIA 2C5AA 1B7GO 4XRGA 2EW2A 1EVYA 1NHGA 1GQYA 3ETDA 4QO8A 1PTJA 2GUGA 3AFMA 2BELA 1NX6A 3I52A 2I3GA 1N1EA 3QQPA 2IXBA 1M67A 1UAGA 2PZLA 1E3WA 4E3ZA 1FDTA 3GVPA 4IIVA 4BNZA 1OC4A 4Z3DA 3ADOA 3IIEA 2X6TA 1PX0A 3NT4A 3JYNA 4GPD1 3E82A 3G79A 3IDSA 3ZDFA 5JCXA 4AJ4A 3O8QB 3U4IA 1Y1PA 2C29D 1LC0A 1QSGA 2VUUA 3OP4A 4IGEA 2X5JO 4GLLA 1WXDA 1HRDA 2GR9A 3VH2A 2P4QA 4U7WA 4RF2A 3GY0A 4CM9D 3HFGA 1VKNA 4NMHA 1IOLA 1GR0A 1Y81A 3DONA 4W7HA 5IF3A 2ZCVA 2NTVA 3ROQA 1GUFA 4RJTA 5TS3A 1U3WA 2D5AA 4IJKA 5A3JA 1DIGA 5COAA 3ZU2A 1ISFA 3DAPA 4IINA 1LLUA 1F0YA 5CEJA 3OJ0A 4H3VA 5IAAA 1GTMA 1PR9A 3ZV5A 1I32A 4TRRA 4XCVA 3JQBA 1YBMA 4LN1A 3CINA 3Q3CA 4R3WA 3RFXA 3MJCA 4MKRA 5THQA 1N5DA 3FBGA 3ANLA 2YV1A 4FR5A 5IN5A 5IFLA 2P68A 3SXPA 3BAZA 3OA2A 2Y67A 3OETA 3AUTA 3JQGA 1ZEMA 2GSDA 4FFMA 3HE3A 1QMGA 3ZHBA 1M66A 3OSUA 1M2WA 2HRBA 3BTOA 5I9LA 3OMLA 4MVJI 2D4AA 1EVIA 3LT0A 1WP4A 1LX6A 1IY8A 3IKVA 4CR6A 1TLTA 2X0IA 4DIBA 3KXDA 2NTNA 1V3TA 2IYPA 4NQZA 3GHHA 1C1DB 5THKA 2YHIB 4FBGA 4B4VA 1LRJA 2GD1O 2JFHA 3GAZA 4O5OA 2J3JA 3M6IA 1LSOA 1IUKA 1XA0A 2PA3A 1DJQA 1ONNA 3VPXA 2CNBA 1Z6ZA 1Q7BA 3EUWA 3RUIA 4FJ1A 5JW6A 6ADHA 3JQFC 3KHUA 3ZU5A 3WYBA 2VHWA 3GHYA 2HSDA 1P9LA 2JCYA 4I5EA 4RVFA 1Z75A 4OO3A 3GGPA 4TMFA 4CM3A 1A7KA 1Y9EA 1KOLA 3HWRA 4QX6A 4ND2A 1UUFA 4J43A 4PVDA 3TZ6A 2QQ5A 1E92A 5EIOA 4MINA 3VPHA 3LU1A 4Y6PA 1HT0A 1K5HA 3O8QA 4XIJA 1PWZA 1E3EA 4C7KA 4D3FA 2XXBA 1AGNA 3I83A 1UXJA 5CFZA 3ZCXA 1LSJA 4RVGA 3RIHA 3JSAA 3P5SA 5ENVA 1N9GB 1RM0A 1Z45A 2NVUB 1PJ2A 4WLNA 1E1KA 4FGSA 5FFFA 2DPGA 2PKRA 4HKTA 4PLPA 4ZQFA 5KIAA 3HDJA 4L73A 3K92A 3DHNA 4GX1A 1ZIDA 1ZNQO 3RUAA 4ALLA 3QE3A 1HE3A 5DP2A 1F14A 4JXKA 1W4ZA 2WYVA 5T6BA 4MVJG 4B7CA 1FDVA 3ETEA 1I01A 4TSKA 2NACA 2HK7A 4R51A 5FF9A 4UVGA 1EDZA 4ZQGA 4E13A 4YT5A 5A9SB 1Q0QA 3GFBA 4FW8A 1DC6A 3DBHA 5CAEA 1LTHR 3WGGA 1IZ0A 3UGKA 3H9UA 1C1DA 2Q45A 2AQHA 4JP2A 1DLIA 3FCOA 4P8RA 1A9YA 1GYPA 1TI7A 2HJRA 2Q99A 2YHIA 3JQCA 4WKGA 3L6OO 5K6AC 5JAMA 3EVNA 1QYWA 1DFHA 1EE9A 3QSGA 3CPSA 4WNIA 3KYBA 3HN7A 2O23A 3CEAA 5TX7A 3TPCA 1P0CA 1Z7BA 5A3VA 1PWXA 4XZ3A 1VL8A 1XWFA 3FF4A 4BKUA 2EP5A 4Q3AA 1E7SA 2PKQO 2Y1OA 1YB4A 3OM9A 2GZ2A 1WNTA 4D46A 1UH5A 3GEGA 3W4JA 3WLFA 1M6WA 1K6JA 4A10A 2FPIA 5TNXA 3PQEA 4R5HA 1GZ6A 3JQ8B 5L7WA 4XYEA 2I66A 1GL3A 2PZKA 4D45A 3HQ4O 2EGGA 4J3FA 5G0SA 3T7EA 4RO0A 1LSSA 3E8XA 1CEQA 3HZZA 3PJFA 4XRRA 1CQJA 2AXQA 3PFFA 1ZSVA 2VWGA 2O7QA 1NXQA 1PJCA 3GRKA 4AVYA 5DCUA 1NM5A 1J4AA 4Q3CA 1ZK1A 1DAOA 5KTKA 2Q1TA 5JDCA 4YAJA 4EYEA 5TIIA 5JAIA 2NVUA 4N5LA 3I6QA 1HSZA 3HDQA 3DZJA 3QVWA 3VZRA 4B3IA 5I7EA 1JTVA 4L74A 3RSHA 4BIIA 3HDHA 3STHA 1E7RA 3CE6A 4L0QA 1QLJA 3JQ9C 1YBAA 1G0OA 2P5YA 3LLVA 3PK0A 1QLHA 4NBUA 4EJ0A 1U7TA 1YOVB 3UICA 2LDBA 1UDBA 1G6KA 4J7XA 1B8PA 2GN4A 4XJTA 5ICMA 3MCVA 3H3JA 2Q1UA 2HRZA 2O4CA 1HDXA 1LRKA 3R3JA 3MOIA 2BF7A 1B3RA 4CQMD 1U5AA 5TF4A 1E5QA 1H5QA 2AE1A 3FRJA 4PG6A 2H9IA 2EHDA 5A9SA 2C20A 1YS4A 4PG5A 1QYXA 3RJ5A 4YAIA 4E2XA 4WCFC 1AHIA 5TT1A 3DFZA 3GEDA 3ZNOA 1VSUA 3WGYA 5JYEA 2NU9A 1VRWA 1LNQA 1Y8RB 2NV6A 2NU6A 5IXYA 2UUOA 1EMDA 4CLEA 3ZNPA 3DOCA 1ZUD1 3TF5A 4FSHA 4WLUA 3KLMX 1QV7A 2G82A 4PFJA 2PK3A 5AVOA 2W90A 2WSBA 3G49A 4R16A 2R6JA 1E5LA 5DF1A 1P1RA 2SCUA 3K5PA 3ZW9A 5HWSA 1MV8A 3FPCA 3IJRA 3D3EA 1LDGA 3JQFA 2HUNA 5A1TA 5HTOA 5ILOA 1E0DA 3JQ8A 1PJQA 2P2SA 3QIVA 2VTDA 4YCAA 5I7VA 2I67A 4WE3A 1S6YA 3WB9A 1NAHA 4EUFA 3DBRA 1U1IA 1Z73A 2XPCA 3RFTA 3TWOA 4BGUA 2POQX 4WNCA 4IDAA 4E31A 2VZ8A 2PTGA 3AI3A 1DAPA 4YBZA 1VM6A 1XQ6A 4OXNA 1H0KA 3LT2A 2VRCD 2JKVA 3ZWMA 1JKFA 4I8XA 2JHGA 1SNYA 4XA8A 4FFNA 4XQ9A 1AN9A 3RU9A 3WICA 3VPGA 2J5KA 4URFA 1NQAO 5JS6A 1K6IA 1MB4A 1SOVA 2WTBA 4U0JA 1F06A 1UP4A 1AUPA 4WOKA 3FI9A 2YY7A 2YDYA 5MGBA 3OJOA 3VVCA 1F17A 5CG1A 3NT5A 1KEUA 1MUUA 2O3RA 3I9MA 5CDSA 1W8DA 1TT5B 1YOVA 4BMNA 4MP8A 4TWRA 1YRLA 3BTSA 2VYND 3TOZA 3WGTA 3GNSA 1ZK2A 4AICA 4A26A 5KVCA 3AI1A 2GERA 1E3IA 4WK6A 5TGDA 1I2CA 2G76A 1B0AA 4OXKA 1H93A 1UXGA 3AU9A 3FNFA 2YFHA 3QA9A 4ND4A 3RUCA 4BGVA 1XGKA 1JVBA 3JQAB 3R1IA 2V6BA 3GR6A
chains in the Genus database with same CATH superfamily
3X1KA 4AKHA 1QFSA 1N3LA 2Z5LA 3JV7A 5E3IA 1GEEA 5JAQA 2BN4A 5IVKA 2DPHA 5ALQA 4TGLA 4ENWA 4J4TA 4RSHA 5JXIA 4MGIR 2IUSA 3C97A 2NWQA 2IYLD 1BQ4A 3ESRA 2NPFA 2DUNA 1BS2A 2HJ9A 4O3FA 4P5EA 4Y0NA 3P96A 4EHBA 5LLTA 1U98A 2GM3A 2FB9A 3WIDA 1Y8RA 1IY9A 4MV3A 3WMXA 3UGQA 2J5XA 5LBIA 1RAFA 2C2HA 4BEWA 3ZWAA 4UD6A 3WHLA 3MD0A 1KP2A 1YQEA 1D7AA 3K0CA 4P6VF 4TM8A 2A5YB 4CMHA 4G5YA 5HBGA 3D1JA 3JZIA 3TTYA 4Q4JA 1T0HB 2XRMA 5K45A 1NPYA 3EIXA 1ONPA 4KNWA 4S24A 1QU3A 1IM5A 1DQNA 2C96A 2HNAA 4H16A 4NTZA 3CKYA 1PZHA 4KTVE 2O57A 3FBTA 1IBMB 1YJQA 1NY6A 1CF2O 5JUWA 2O8EA 3JR7A 3RVNA 1NVMB 1UADA 4WOPA 4CF6A 4KDCA 3T3OA 3W8RA 4HB4A 4S0XA 4DS3A 2Z1MA 5FD8A 1GZDA 4N3GA 4ZT7A 5GPBA 3K9CA 2Y0BA 3HKDB 2B5OA 3OMWA 2JLAA 3GVCA 3WQRA 3K70B 4QYXA 2GDZA 2Q50A 2ZPAA 1YDFA 2OHOA 5SZKB 1ENOA 4M1KA 1X8XA 1CDOA 1I2MA 1ORHA 1GGKA 4QLBA 5CFNA 4BO4A 4B80A 1AGRA 1GCOA 5DI3B 3LA8A 4DRXA 4XTCS 3WKDA 3KRTA 1A98A 4GYWA 1TKCA 2IS4A 2E4AA 1GKUB 2WKPA 3VTZA 2AWNA 3KS9A 5EIAA 4CM9A 3BD8A 4M9QA 4F8EA 3PZBA 3IP9A 4MMYB 2ZSKA 2HX1A 4JASB 3UUFA 4MPTA 2CB0A 3BN3A 1MAHA 3BQNB 4QU8A 4X64B 1WG8A 5IT0A 1OLXA 2H6EA 3HJCA 1GDTA 1T2NA 5JNRA 5LD2B 1T5DX 4G07A 4MW0A 3ECCA 5DIZA 3DOOA 3CEHA 4FYVA 4IQ0A 2AA3A 3FNEA 2V5VA 3MJHA 3RVBA 3ZE9A 3FPGA 3DMHA 5EIEA 5TQVA 4WH0A 4BNJA 1PIWA 4MS3B 3CVYA 1N92A 2HA0A 3IOBA 3AP2A 3VKVA 5K01A 4GOJA 4HL6A 1JFLA 1T6ZA 1BQEA 2W6IA 1P1IA 4OKIA 4ZIRB 4QBKA 2NAPA 3JTMA 5FAKA 1GQOA 1ZD8A 2A94A 2OM2A 2QVCA 3ND9A 1K4KA 1J0CA 3E4DA 1FFDA 3DZIA 3P0FA 1QCYA 2EEPA 3T06B 3TRHA 4WHMA 2OHHA 2QUBA 1WV1A 5AT1A 1R8QA 3W7AA 1ZKMA 2IVFA 4O02B 5B1DA 2VYQA 2QJTA 5EVJA 1NLMA 2BFWA 4UOEA 1ZM9A 4ABTA 4ZC8A 2QY9A 5H59A 1GZSA 2P75A 3PTLA 4RF5A 5I4KA 1HFJA 2A0FA 3EAQA 1YDMA 3G0GA 2KI5A 5COBA 4ONEA 3RJTA 2HTEA 3GH1A 3C3AA 4MEAA 3EFHA 3I6BA 5CHEA 1N7GA 1XXHE 1IK4A 1BDIA 3IUSA 4FOOA 4FNMA 5CT8A 2XADA 2BGRA 3CJRA 1DZ3A 1I4TD 1BU8A 2JAXA 2VQDA 5SZIA 4MVJP 2AQKA 1VMIA 3I5MA 3VR6A 5FHRA 5IBPA 3SKXA 3SK0A 1TB4A 4LDRA 1YDEA 1E2IA 2ETXA 2EHJA 3Q9LA 1KVUA 2I7TA 4QATA 2HLDD 5ER6A 3EN0A 3H9QA 2MSNA 4A16A 2ONKA 4QPDA 1PHPA 2ZI4A 4IDQA 5TF0A 2A0UA 2ZJBA 2GEUA 5JISA 2V5AA 2Z1DA 3FUXA 3I53A 1DKMA 1P3DA 1D2RA 4OGKA 3UCFA 4PSVA 2JFYA 4GDFA 1AY0A 4LWZA 5CDYA 1J5XA 2I2XB 2ZBEA 3C3MA 3PSAA 1ADCA 1CUYA 4NZMA 2MJLA 3F8TA 1E99A 3HKDA 5K05A 3COYA 3KUXA 3L4SO 4RXMA 2CXPA 3NHUA 4LRYA 2WWYA 2HF2A 5ALZA 4HAOA 1ADJA 2REBA 3DBIA 2XUFA 4D9HA 4R7TA 4D4MA 2HF8A 3LNCA 5CYFA 1AV7A 1KQFA 1WRBA 5DI3A 3FCEA 3IDQA 3H9CA 5AK5A 3U9TA 3BL5A 3MOGA 5CFQA 1G8MA 2OBBA 1DRWA 4FS3A 4TUYF 4UBNA 5ALWA 5EMNA 1N36B 4G3XA 3LSYA 1XRLA 2WWXA 4AMUA 1KBZA 1K3UB 2IYYA 3DYVA 1KMIY 4IQ8A 3S2SA 1Z0IA 4KFRA 3NTXA 5AVYA 3URKA 4F5ZA 4MQLA 3NIFB 4V03A 3I64A 4XJXA 2I8CA 4Z4GA 3FNHA 2GEJA 3LDHA 3PGMA 4MPPA 2Q0QA 1PFUA 5JADA 1N77A 3VNUA 2Y4NA 1PQPA 2IHKA 3OUTA 1OXVA 5WRFA 5JZBA 1E1LA 4YUVA 4PGAA 4RY0A 1AKYA 4OBBA 5LNK1 3LLUA 4MS3A 3QLUA 4BEJA 5CA1B 2G8NA 1W9HA 2GTHA 4N8EA 4Q34A 1D09A 3GUCA 2ZLBA 3DP7A 4JC8A 1MLDA 1T8WA 4C06A 4D9BA 4ZIRA 2O0KA 2GZDA 4ZK6A 4MV5A 4EW1A 2NYUA 3T1NA 1RWWA 2IIQA 2C8KA 3FVQA 3OKCA 4KKVA 2ZK7A 2L2QA 1O9GA 1WPQA 5JG7A 3N5CA 2CV2A 3H17A 5G0TA 3Q7SA 3W34A 4ZEMA 1HLPA 1WLYA 2YFKA 3E22A 4M8KA 2X42A 4Q9JA 3BK1A 3IV6A 4P31A 2QBYB 3MAAC 1J1UA 5FPYA 4AKIA 1U0EA 3U1TA 4IDBA 4HXEB 4IMPA 1RVDA 5AJUA 1Q50A 2QL9A 3JD4A 4N54A 2B7LA 2IXDA 1D2NA 2F9MA 3BRWD 4Q7JB 3LXXA 4XSGA 2RGXA 2IY9A 4AECA 4EA7A 5HUHA 1QG0A 1SVKA 4W5RA 2JFNA 3B3FA 4D9FA 1JLKA 2VT3A 1NXXA 3IHWA 4F11A 1H3FA 3DHVA 1L5YA 3HCPA 2QUAA 2EP7A 1NFRA 2WWGA 1NUUA 4X3PA 5CDGA 4LYGA 5F73A 3D6MA 4O2BF 1SEVA 3PFCA 2EJCA 2QW1A 4RZ3A 3PF9A 1PL7A 1ZJZA 4DG8A 2GZSA 2VJLA 2B2CA 1Z4LA 3PJEA 2MSDB 4QUKA 3PUXA 4UU7A 4F85A 4CKCB 5ALOA 3GJRA 3CRRA 4LV8B 4QXMA 1AIPA 4W63A 2FSHA 1XMSA 2PXCA 4N18A 1O8BA 2JAWA 1HDCA 1UINA 4EFNA 4ENUA 3IJEB 5EOVA 5C7OO 1WZUA 1QCDA 2ZYGA 4ZVOA 2D7DA 3ZI0A 4GEGA 1UIRA 4GOXA 2GEFA 3NV9A 1KETA 4LDQA 4YAEA 4F91B 2ZZMA 1RHMA 3D7MA 1NF8A 2RAUA 3K6JA 1LDMA 1YZYA 3E3AA 1WO8A 4L85A 4M76B 3GROA 3OBIA 3VPBA 4JL8A 3IE2A 1XEWX 2C5HA 4KODA 4X8MA 4DLWA 2V0NA 5I4CA 1G8AA 3E03A 3QU9A 4Q1AA 1U2TA 2IT1A 2QMQA 2J7KA 3P2OA 1NI3A 4FZ3A 3DEIA 3C7AA 1UXHA 2WJHA 1N5JA 1PTKA 2F1JA 3B6ZA 4ILEA 4BJ5A 2FG5A 5BRAA 2B78A 4R05A 5BWCA 1SBTA 2ZIWB 4AZVA 3DMDA 2XUHA 2EAUA 2ZJZA 3EWAA 4IIJB 16PKA 2CDAA 3WGUA 2FETA 1C3JA 1J0AA 2CDCA 2O2JA 4HAYA 5CT5A 3RE1A 1HDEA 4C7XA 1SIBE 1GQFA 3DXXA 2GXQA 1R6AA 1ZFNA 4RJ2A 3TLCA 3UQYS 1BHJA 1JG1A 3TJMA 1ACLA 3GPCA 3DFIA 2R85A 1SU4A 2IPOA 3GMTA 2FKAA 9LDTA 3UT0A 1G5IA 1ISJA 4HPJB 3U31A 1WD5A 3T1TA 1VKHA 1LNSA 2OMEA 3AUAA 4NZPA 4HLCA 5FPKA 2HH9A 3TGPA 1TZMA 3BXGA 3KNZA 1CUZA 2FSUA 4HYEA 3NFRA 4GWGA 4N3AA 2LCQA 1ORRA 4G0PA 2WIGA 5KNDD 3IVGA 1A8IA 3KYIB 2QBYA 2CWDA 5FBVB 4GUDA 3U60B 4RZ2A 4PNEA 3U26A 3TGWA 4DG5A 1C7RA 4TYPA 2PDAA 5B3LA 2H4XA 4N5IX 3RTEA 4EQZA 1F48A 3HR7A 1YR2A 1Y37A 4DQLA 2H4ZA 4UDXX 4RVUA 1QG4A 3LVFO 3ZGLA 5HPYB 4DB4A 4MV7A 2CJPA 2V4ZA 3BRQA 5HRUA 1S01A 1Z8NA 4FOTA 1CUXA 4GH5A 2FN9A 3N07A 1HG1A 2YMQA 1J5EB 2P6NA 2O3QA 3CW9A 5A9TA 1YJ8A 3HM9A 4C6RA 5IG2A 1YC5A 3V3KA 3D5QA 1U6KA 3GZNB 4LJ9A 5A04A 5KAPA 4LNUA 1ZVKA 3M1LA 5AR1A 2TMGA 4CKCA 1QZXA 2BEWB 1WM1A 4PGHA 4LVCA 2CNWA 5DOZA 3VC1A 4U7GA 2WFZA 1YIDA 1VG1A 3AUKA 3NAZA 3SY8A 1A50B 5HM8A 2A0YA 4NEQA 4IKOA 3WYDA 5CHYA 4PLWA 2CNNA 4V3CA 1QGOA 1R4MB 2JGDB 5DDIP 5EP3A 4YRBA 4LC0A 3E61A 4IM7A 5LPNA 1LQUA 3M8KA 4DCUA 5BR7A 2VDPB 2QTZA 5LNK6 4GWLA 1GTG1 1Z4NA 1LBEA 1V8OA 4LRXA 2W11A 4D9JA 5JYDA 1I5EA 3JVUA 4Z0TA 3QXXA 2BLLA 1OBOA 4HDKB 5EI5A 1ORWA 4C04A 3GGSA 4D79A 3ZCQA 3WB2A 4BCDA 3CMCO 4RS4A 1DKRA 3DEHA 3IMKA 3SEZA 1SUIA 1JLSA 4MWZA 1A7JA 1NOKA 1NVTA 2QP3A 2ZJ5A 4GQBA 4O4JF 2P4SA 4YUYA 1DQZA 4NRDA 4NYIR 1DTEA 3HP7A 1YR9A 2RGEA 4I9HA 2LCFA 3SGLA 3RSFA 3N76A 2HD4A 2WHXA 4F38A 1AA9A 4IIXA 4IIJA 4EENA 3M4JA 4FILA 3DPIA 2PS0A 1ZMBA 1XKLA 3A4LA 1DC5A 4AG3A 2ORED 3K4HA 4C7OB 1TMYA 2BEUB 2GMWA 1AV6A 1ODSA 1MBZA 4OA8A 3BWEA 3KZMA 2IYFA 4KE7A 2XHZA 4YMHA 3ZVLA 2GARA 2PGDA 4LYYA 4OHUA 1Z0UA 5SICE 1ZH4A 3OG9A 1J25A 1P1CA 4K9KA 3TR5A 3AEKA 4DF3A 1VGRA 3G1UA 5ESRA 3FOAA 2ZJ0A 3KBBA 1PZNA 1H2XA 1GPKA 1L4MA 2P9EA 1FQKA 5J58A 3DFKA 3KKPA 3TVDA 4ZVKA 3QOWA 2FA9A 1M0WA 2ZAOA 3Q12A 2GEDA 2A92A 4ZJZA 2WJ6A 3THWB 2PRSA 3KXKA 4TRJA 1AN0A 3IPYA 1OCEA 1GADO 5KYNA 1U0OC 2FLKA 2LW7A 5HJ2A 3WK8A 5HZHA 1XRRA 4XB6B 3JAMA 1RE0A 2IBSA 2ASEA 2I3ZA 5LBTA 2CJFA 3Q0EA 5BMVB 2CLKB 3H2ZA 4TTAA 2PMFA 2BCJQ 1TD9A 5FNVF 1U2PA 1V6CA 2A5GA 1U2GA 1VMAA 3G7NA 2E4VA 1QVWA 1OTXA 3H6HA 4QYSA 4BNVA 3IVAA 4YMGA 2MINA 3KO8A 3OHMA 5TARA 2H4FA 3GZNA 2WVGA 4HNQA 4O1HA 1PVOA 1N2JA 2BEWA 4WCVA 4W8OA 5DWDA 1NFFA 2NSYA 1K4YA 1TLLA 1TEVA 2JFWA 3C4VA 2EGHA 2O7SA 3WHIA 3B8EA 3E0QA 2XLCA 2EKPA 1CJSA 1R4MA 2JGDA 4K6GA 4QICA 2X5KO 3PVCA 1YZQA 3KHSA 4LWPA 2MMGA 2ZYDA 4LBZA 1ST3A 1HA3A 1BMDA 2HRRA 3Q8XB 1E5VA 1NJFA 1XAIA 1CETA 2AQ8A 3CF4A 4E32A 9MHTA 3RSSA 1N5IA 3I2HA 4ZEWA 3CZ4A 1P29A 2NU8B 1OLOA 3KOUA 3K0BA 3MJVA 3P0JA 3P9RA 2I4NA 4HDKA 2F17A 4K9SA 4Q3EA 4AN0A 2HA7A 4DLZA 4WLVA 2WIKA 1HRKA 4MCAA 3A9UA 4RELA 2CLHB 3RCBA 2AZ4A 4DB2A 2C7RA 4CT5A 2ZBQA 2A58A 1Q17A 1QPBA 1FA9A 2Y6UA 2AOVA 3H5VA 3NM4A 4IH9A 3MJRA 1DLJA 4BB5A 3C8HA 3ZY4A 4IV8A 2ZS8A 1L8AA 1ZC4A 1F6WA 4JS0A 1LPBB 3NFYA 2ZRAA 1KIFA 4YFYA 1M1YB 3QPWA 2Y71A 1JIJA 4WX2B 1M3SA 3AOGA 4PQRA 3FPSA 4ZRMA 2ZCJA 1J0XO 3QVLA 3R4VA 3Q88A 4TSFD 1N2HA 5DHFA 5EKSA 1YFJA 1LFDB 1X1CA 1Q84A 1E3LA 2BEUA 3IAUA 3KTOA 3WKAA 3WZMA 1GLGA 1E2PA 2ZWVA 2BVNA 2P2ZA 2BH9A 3I3SR 3VSAA 2CYCA 2F7SA 2VK8A 4BTLA 4EJ2A 1PJTA 1REQB 1EVQA 2NW6A 4IX9A 3D7NA 1N1MA 3R7WB 1SELA 1GNLA 3MWGA 3ZY2A 2QV0A 3HADA 5C51B 5C7YA 5FUXA 1YRBA 2P65A 3I32A 1ADFA 3FDFA 4WDRA 4YPOA 1OWMA 2ZSHA 1UFVA 1J23A 1EX7A 2FPSA 3I01A 4MA0A 3KC2A 2AFIB 2HCRA 4H3KB 3LFTA 1H2AS 1EQ2A 2AXNA 5KSOA 4J4BA 5DN9A 3AR8A 3EXEB 1NC1A 1IWPB 1ABBA 1G9XA 1L4LA 4MHTA 4KRFA 1OPRA 4HFMA 4B7AA 3C87A 5EZQA 1ZESA 4FQ5A 1VLLA 4U63A 2XAUA 4LFCB 4N0EA 2NT3A 5BMVA 1Z6QA 5HCUA 4ZCRA 3ZD7A 2GLXA 2HEGA 1KIAA 4X7RA 5JSQA 2DR2A 2YJ6A 4EI7A 3L3BA 1G2PA 4CKEA 3TIIA 3W5UA 5EP4A 4ZOLF 3W5BA 2O4UX 5ICFA 3GAFA 5KSYA 3GT0A 4YCSA 1A9SA 4NICA 1NWHA 3ONNA 5A4IS 1HE8B 2Q1YA 2HLDA 3DKRA 4LDJA 3FNIA 4C3VA 4W6ZA 2VXOA 5D5HA 4MA4A 2E6UX 3O0TA 3WJ7A 1POWA 1E59A 1SKYB 5BXYA 4ZCTA 2FGKA 1Z37A 4WADA 1PP4A 3PHBE 3CRW1 4K87A 3MT0A 2H9AA 4RF3A 4PW0A 1U0TA 1G8GA 3EIFA 3GQVA 1RWMA 3WNQA 3GDWA 2H92A 4Q6WA 2ROQA 1E89A 1FS5A 1PUIA 1UMCA 2FUCA 1V6AA 3AR2A 2QYTA 3H0KA 4X91A 3T38A 4F6LA 4F6RB 3ZGXA 5LM3A 3EEOA 1EFKA 4ENTA 2Q5LA 4FIZA 4TWBA 3NIGB 3UAYA 3PQ3A 4BFCA 4DZRA 5AW0A 2HV8A 2NU8A 1FDUA 3BH6A 3LCCA 3WWZA 4BLWA 1O8CA 2ZW9A 2JHCA 2F59A 3W06A 3CS3A 5L3RA 2QW8A 8ATCA 1FQWA 4HB0A 1XCGB 3G8AA 3IUBA 3N2LA 4FBLA 3ZX4A 4E09A 3EOZA 4KGDA 5DCLA 1TA0A 4Q3OA 3HPQA 1EXDA 1H9BA 1JQ5A 1WS6A 4YBRA 1Q0LA 1FSZA 2FP3A 4KH0A 1WMBA 1ZJ6A 3DE4X 3SOPA 3VTFA 3ZHRA 4DSTA 5JZVA 4TTPA 1L7BA 2ADOA 4P80A 2HPZA 4QECA 3CF0A 3GFOA 3U17A 3G2NA 1AO3A 3WTCA 1J22A 5EZYB 4CLRB 4DA9A 1VPEA 2Q3CA 1UKAA 3OJLA 4X3CA 3H19A 3BF8A 3TOSA 4DLBA 2PWZA 2P2GA 4GGMX 4QQNA 4U1RA 1YUBA 4HTAA 5E7JA 1REQA 1XKTA 1FFEA 4FBMA 5LOVB 2O2CA 2VTBB 1ZSYA 2F8LA 3R7WA 3RS2A 4M8LA 1B6TA 2OCAA 3H5RA 3QPAA 1MAWA 1QANA 2FMXA 2G36A 1PFYA 4AY3A 1T2CA 2BHTA 3U09A 5I45A 1DZIA 4D56A 4D99A 1UT8A 1H1DA 1QIDA 3GZ4A 4JZYA 3IYLW 3SHWA 4MYHA 5FLXA 1TZKA 2F6RA 5AVXA 4PCAA 4M1ZA 1S7GA 2FMUA 3EXEA 4Y2XA 5CITA 2JIRA 1FTYA 2YN0A 2A1UB 3Q5DA 3SC3A 3MPOA 4QKQA 1JG2A 2VPQA 4GRAA 1QHSA 4KNVA 4CIYA 4RDHA 4HDNB 3FTEA 3A1CA 3VYWA 2O1SA 5L3VA 2XYVA 1QDLB 1T3GA 4IJ5A 3IBTA 1I6KA 1IOWA 3BRWA 4J6FA 1JFVA 3IPRA 1R7RA 2ZT6A 3OEWA 4OYYA 1JDTA 1KP9A 1L1EA 4H59A 1IZ9A 5JXWA 1U0JA 4MV8A 3C85A 2JC3A 1TLFA 2A9QA 5L6MB 1EP9A 3P9YA 2X4LA 4GBJA 6ABPA 1PVDA 4P5DA 5ENDA 4E5MA 2KS6A 4QREA 1BGXT 1QVZA 1M10A 5DXFA 1MO6A 3GD7A 3G6WA 2ZQZA 3JD0A 2W58A 4QOJA 1C8VB 1ESMA 2J3IA 3W9UA 4I1UA 2VL7A 3A1NA 4QGSA 1DHRA 3UWOA 2IHJA 2ZIVB 3A6KA 1IEXA 1QFZA 2OCBA 4MCJA 4JHXA 2E55A 3OJWA 4L51A 4QUIA 5EL0A 1YGPA 1AQJA 1E1DA 4MWGA 1UCFA 1IUOA 2YJGA 2DLCX 3K94A 5JI3E 1A5SB 4QO7A 1TYAE 4FYIA 4HC4A 2QNRA 5F21A 4BNMA 4D4GA 4F6RA 5IAKA 4GRDA 4AROA 2ZUSA 2IV2X 2FWJA 1WBJB 2QVBA 2X76A 4ZT4A 3TLZA 3PWTA 5LQRA 1XVTA 2Q5JA 1USUA 3DNMA 3SZUA 3ONFA 1HNZB 4NKRA 4XR9A 2QP9X 2MTBA 4NULA 4MTLA 4D25A 4F71A 4EAAA 2P6UA 4MIEA 1U81A 1IPFA 1X87A 2Z5VA 3GNQA 3T3NA 1JN0A 1ZG3A 3A4IA 3D81A 3D4NA 3HVIA 1VHLA 2NSLA 3RK1A 3VHXB 1HFEL 3HZHA 1P1JA 3VVBA 1NSYA 4D6PA 3MXTA 5CT9A 3X1WA 3FCXA 4UMEA 1XYYA 2JS7A 1OREA 1NBHA 5EZYA 1RLMA 3DR5A 3ZI4A 4DMRA 1Q3HA 2X13A 2YZGA 4QFCA 4Z49A 1J99A 3ZWOA 3S2IA 2ZQ5A 2XUOA 3U3ZA 3NR2A 4E22A 5K99A 1O97C 4TV8B 3CX4A 3H3FA 5FX2A 3DR3A 4NZNA 4JIMA 3GJ0A 4UQLA 3OZGA 5JMWA 2VTBA 4B3MB 3Q1LA 2Q0SA 3EXG2 3WSTA 4ZYUA 3JPYA 4LY6A 4DCSA 2PXHA 5D1HA 3F9IA 3RM3A 1HZZA 1JW9B 5C8DA 2IPNA 4X5OA 1QFXA 4IHQA 4J2HA 2MR5A 1G4AE 1D4AA 3I6MA 1M83A 4I2NA 1WHSB 4FGJA 1UC4B 2NQ8A 3E8SA 5KNDA 2I9KA 3A3OA 2DCMA 4ETWA 2A1UA 5BVGA 1POXA 5AW6A 2H85A 1RJWA 2W98A 3A58B 4HDNA 2QKYA 3CNHA 5ALHA 4DLLA 2QQ0A 3M9WA 1ZJ4A 1J8QA 1OX4B 2JGKA 2C2BA 3DL7A 3GUUA 4IQGA 5C2JB 1XZIA 2IFTA 3R6LA 1NKSA 4JYBA 1DPGA 2QD5A 4BKOA 4DR4B 1TU3A 3L82B 1XU9A 3CBQA 3STYA 1EP2B 1XLUA 3B70A 4NONA 3VDXA 1SCKA 4D3XA 4DJDC 2IZZA 4IHJB 5J4KA 3OWHA 1EBFA 4OFWA 3ROGA 1FU8A 1G6Q1 1HF3A 1VMEA 3KCQA 2UV8A 4QARA 3ILXA 3EH1A 4MGHA 3TUIC 1L1FA 1VG8A 2FFRA 1YXMA 4BGDA 4D44A 1ZIXA 4UEJA 2P3LA 1PT8A 2QW0X 3FYUA 3ZOZA 2DHDA 3IP7A 1HT3A 2KBFA 1BA3A 1HKHA 5IWAB 1I51A 4G41A 4RACA 1OYVA 3DWEX 3HJNA 3KUKA 4FR2A 3E9YA 5M3BA 1NMZA 1P9OA 3LK6A 1JIIA 3PNQA 3H5IA 1Y8QB 3COPA 1GFWA 5HRCA 3B3GA 3HNPA 1QRAA 1X94A 4ZRNA 1U99A 3QVTA 3W4IA 5A4FS 4QPJC 5YASA 5C5EA 3F1KA 5ALMA 1BRMA 1OLSA 3E0XA 1UQTA 3RF7A 1Y33E 1GTL1 3A2LA 2RH8A 3WRXA 2I6TA 5C4IA 3TLAA 1KYYA 1JFTA 1EX9A 1JWAB 3BA1A 4WFJA 4Z54A 2ZRIA 4ARCA 2WJYA 5C3MA 1TZ2A 3B53X 1GP2A 1KFKB 2O48X 1PL8A 2WSLA 2WAOA 1EA7A 4QNMA 2RC6A 5L8VA 1IDOA 1SMKA 1NPTO 1SUWA 4KIFA 1Z7YA 3B7WA 5EINA 2IZ6A 1BNCA 1GVHA 1HE5A 5EWLB 1JSLA 3L0IB 4P5PA 5C52B 1A5ZA 3DZ8A 3V8PA 1M7GA 2ODNA 3OIDA 1DIRA 4YAWA 1IXYA 1GGMA 3IR6A 1P2DA 4ND1A 1SWWA 3MQFA 4Q4DA 4TV8A 3U4CA 3E1GA 5BRJA 2QZZA 3GLSA 1FYEA 4KCGA 1EFPB 1SHLA 4J4HA 2OC4A 3H2GA 3W77A 2VTVA 2OCKA 3EDCA 3OCCA 1U9ZA 1VA4A 4JLJA 1UBGA 4OXYA 4FNGA 2R6GA 2YWGA 5EKDA 1K8RA 5NLLA 5K8IA 1Z62A 5JS1A 1SQGA 3QUCA 3SC4A 4NG4A 3UAWA 4OQZA 5F7XA 4RW0A 1WHSA 2BGUA 1JAIA 2B69A 4PYIA 4XJVA 3GELA 4EA8A 3E35A 3LZCA 1XRPA 3VR1A 2I8LA 2ECOA 3FZGA 2WNHA 1ICIA 3HUEA 5EN4A 1R6UA 1U94A 1IEQA 3TQRA 1OX4A 4QJ5A 2OV4A 4FJ2A 3JWIA 5JV5A 5B1SA 2IGTA 5LB2A 2W0SA 1V6SA 5LQUA 1JJVA 2BI8A 2HK9A 3HXPA 4BO8A 1P31A 1XO1A 1XVAA 5COQA 4AI6A 1YJXA 3UXMA 1ZMRA 3L8EA 1JS1X 4IHJA 3ENKA 1Z83A 1EE1A 3LAWA 3UW1A 4EB0A 3ZI7A 3R5KA 2WYIA 2O8DB 3WL5A 4IUCS 4K28A 3A9WA 4B81A 1E9FA 5THXA 4LOIA 4AMBA 4NXMB 3NBKA 3MMSA 5B64A 3CSSA 2VQEB 1GU1A 2XJ9A 4LZOA 1T0UA 2OZVA 5J5CA 3NNNA 2R8XA 2GFHA 3IT3A 2BBSA 2PT6A 3O3NB 4FWBA 4YIHA 4ALMA 2FLVA 2P41A 2EF0A 4LF7B 1Y8QA 5HBRA 5C8XA 3BWCA 1FDWA 1VL0A 2FWMX 3HZOA 3MWFA 1ANKA 3EVAA 2CYAA 3KXIA 4PHTA 5AKZA 1PLKA 2YQ4A 1JYSA 3MMXA 4AZ0B 3A4MA 3R7AA 1XZHA 4RHUA 3ZCUA 5A0VA 4P4UA 3H42B 2WDPA 3IUEA 3CCCA 4JHLA 4A03A 1V8FA 5LQNA 1GUYA 5HUJA 4PC1A 1PT5A 2PY6A 1TTPB 1H4SA 2B7CA 1NXSA 1RU3A 1P2BA 2YWRA 4LUCA 3TEJA 3AWIA 2WE7A 2HJVA 4FEYA 2OXTA 2PSSA 4U9UA 3LRTA 1QB8A 3FHOA 4HQRA 2FEWB 2EJVA 3E23A 4ND5A 3DFFA 3TKAA 3AVYA 3DMRA 1H1LB 4JGBA 4LJYA 4WPGA 1RYHA 5D3ZA 4TLAA 4DZZA 5HK9A 5ICCA 4J49A 1Z34A 4N5HX 4WL0A 1J0EA 1BGWA 3PL5A 3YASA 3ZDYB 1MX3A 2FPRA 1XAGA 4HH4A 3QEAZ 2G7ZA 2YIJA 3PDWA 2VPPA 3FZEA 4JLAA 3ROTA 1DU4A 4ZVSA 4X0EA 3L6CA 4NS1A 1A69A 1FE8A 4POOA 2O2GA 1Q6YA 4L8LA 1EFPA 4W1QA 1RHUA 3MN1A 1I10A 1MCZA 1Q6ZA 1Z0ZA 1QH8A 1T6NA 3HGMA 3PX2A 1JVNA 4GMFA 3L4JA 4DV3B 4NJEB 2HGZA 2JRLA 4QDTA 4CMIB 2PUJA 1G0NA 4Q9NA 5FULA 5JHGB 2I5PO 4XR4A 3LG2A 4UARA 1J8FA 2X86A 1K27A 3NVKI 2OBLA 3GLRA 3MBIA 2WJWA 5FO0A 2Q1XA 2IWRA 1VBKA 3RTAA 5IKMA 2J08A 5CVTA 2FSFA 2RMKA 4YR9A 1Y3HA 1CIPA 1Z7WA 2QD3A 3BERA 1NATA 4DMFA 1ORIA 2NXNA 4US0R 2O9JA 5AUPB 1FFWA 2DWQA 2QLLA 3AHDA 5KQLA 3G0HA 2JIPA 2Y1EA 3AR5A 1SPXA 2CVZA 5EG5A 2JDIA 3BSSA 3DBVO 1S8AA 1DAMA 3SIPA 4D4KA 2VQFB 1Q3TA 1XHFA 3C3KA 3NHZA 2CXXA 2GHRA 3L4BC 3MAGA 5CK4A 1OY1A 4MVJD 4RS3A 3LBYA 3STWA 2FQ1A 2VH1A 5JFOA 3FGNA 3G23A 1ZNXA 1T13A 2JBAB 2Q1SA 1NUPA 3NHFA 1GVNB 4WKNA 3QNMA 2O8DA 2XT9A 4K1LA 3TRKA 1GL7A 4B2PA 4AJIA 1WQ4A 1Y0BA 3SFZA 3S70A 4Q3NA 1EUZA 4HDRB 5F1KA 2DKOA 2WUGA 2OFWA 1EJ6A 2Y0CA 2UZ4A 2R7KA 3GJ8A 3IXLA 3TZHA 1ZR2A 3PHGA 3ZDEA 3HYTA 4HT3B 1G7RA 2B6HA 3ABOB 3NNDA 3QELB 4RHYA 2P8SA 4ZCPA 3AHCA 4QDZA 3GPDG 4NP6A 3IMGA 2I9PA 3LI2A 4P4GA 4GOND 4IKEA 4A5SA 3IR5A 5I9NA 2PS3A 1WHTB 4GR4A 1DFGA 1JHYA 3AYXB 2IC5A 3PITA 4BMXA 4AZ0A 1XDUA 3BULA 4C0WA 1BROA 3AP3A 2IPMA 4C0XA 5B2EA 1R0ZA 4PIVA 2ZAGA 1MG0A 3WGJA 2H2GA 4B2IA 1E5DA 4IDCA 3WLJA 1P4AA 4E6PA 5JBNA 4ARIA 1VJTA 3W3AH 1K8QA 3RVLA 4IS2A 2O0JA 1W2WB 4UDOA 1BN6A 1R4NB 5DWQA 1Q1AA 1SK9A 4FCVA 5BNIA 3RSOA 2G1JA 4HVLA 1T9HA 1U6IA 2G88A 3ABRB 1YKSA 3GFFA 1SH7A 2QTCA 1SVOA 3H2IA 3B3QA 5EGSA 4V3BA 1U7DA 1SO8A 4FONA 3ESYA 1R16A 3MGBA 3ZWNA 1UBNA 2EKZA 3WVNA 1BS1A 5D5PA 4JI8B 1GKYA 3NHPA 3PB3A 2HWWA 2PZMA 4ZARA 5JZMA 2GO1A 5AW3A 4FD3A 1FZQA 5JS8A 1E9CA 1FRFS 1TA4A 3KK0A 4O08A 3H65A 3OKAA 1HDOA 1PWHA 2QTGA 4B43A 5B7PA 1C7FA 2AC2A 3WKBA 1TF2A 3A36A 2VIIA 4GSLA 4XD7D 4BQEA 1GPWB 2ONCA 4QTTB 1Y1QA 2EBHX 3WSWA 2NUAB 4K9RA 3RB8A 3S2YA 2M6RA 4J7CA 1AKRA 1Y8AA 3TNDA 1MIOA 1G20B 2SKEA 1FSFA 3VZBA 1TL7C 4B7UA 2J4DA 3UUGA 3DXFA 5CTAA 3AJ9A 4J2TA 4YO8A 1SZJG 2GPTA 3DAYA 4ZAYA 3RRZA 3KTDA 4GT1A 5DBGA 4L02A 3ZW7A 4ZO6A 5L9AA 3T5TA 3RHZA 4MKFA 5EXDA 2B83A 2VH2A 3EA4A 3MSCA 1SCBA 4FCCA 3KV3O 1V7CA 3H83A 2I4OA 3MS7A 4UQPA 2BGJA 2P6MA 4FFBB 5GZ1A 3HUUA 4YC7A 1OI4A 1RNLA 2LZ0A 4HRAA 1W2GA 4FLMA 8LDHA 1KYXA 2P2YA 2XKKA 3MZ0A 2WW8A 3CZMA 3QUAA 3C0KA 5CVEA 2IHYA 5KVQA 5BSFA 3U44B 1F1BA 2HW8A 1Y5RA 2WB4A 1II9A 2JBAA 3IE0A 3MA0A 2ZTUA 1SZPA 3ZVRA 3GFQA 1U2RA 2Z2IA 4GECA 4N8SA 2I55A 3BRSA 2OXIA 3DTVB 3SHTA 1FTWA 3E9MA 3X2FA 1IOZA 2WQZA 2Z2ZA 3L02A 4Q0MA 3T9FA 4HDRA 4DMKA 1BA2A 4ZDKA 4XJSA 4HUJA 3R5JA 3HR8A 4ZYVA 1VHQA 1E1QD 3D6JA 4QIHA 1R0WA 4RVDA 2PJZA 2IDMA 1Y3DE 1J9ZA 4B09A 4B4WA 3P8ZA 3NORA 5FH9A 2ID9A 3NM6B 4EECA 3DYBA 5ED4A 3VU0A 4UBMA 2AZDA 1LLDA 1J33A 1U4OA 2ZJAA 3C1OA 2EOAA 3H6KA 4MK4A 3VZSA 4BB9A 4ZTUB 5CCXA 2QGNA 4EGSA 3P45A 2ZYUX 3OFKA 3L7YA 1L9XA 5BVHB 2XMSA 3ON5A 1V5IA 3F3SA 2B4KA 3GO4A 2GEVA 1NUQA 3QQ5A 4I4IA 2XCSB 1GITA 3TIFA 5KUTA 2YJ3A 3BEOA 1EFTA 4R1SA 2G0NA 2ZSUA 3ZZ1A 2BJVA 1R4NA 1E20A 3TL6A 1O0BA 5FTNA 3X1MA 1NDHA 2CE2X 3QBTA 3CT6A 7MHTA 2YL2A 2YXNA 3TTSA 1NN1A 4BMSA 4MW9A 1WPRA 3V9AA 3OMXA 5IAOA 3H4TA 1NT4A 2QT0A 4HDMB 1TVKB 4IG9A 5E1DA 1QO9A 2HWUA 2P62A 2YH2A 3FYTA 4TVKA 4LKRA 5L4SA 3PEUA 5BSMA 2QTFA 1BWPA 3GV0A 3RS8A 4CM4B 3WBBA 3FPFA 4OYRA 4UFPA 1E5TA 3NHYA 1W0KA 3AC0A 2VDLB 5ALTA 3LBNA 2RHJA 4PZLA 2QTTA 1JPJA 5GAJA 1UKCA 3D1LA 4LVUA 1EHIA 1TC2A 1OXXK 1LLCA 1QRRA 2EKBA 2WWTA 2X15A 4ZA2A 3B85A 1B1AA 2NUAA 3CW2A 3RC1A 1VMKA 4P0QB 1PU2A 3PPXA 4MYRA 1G20A 3M9XA 4M9XA 3VR2A 2ZATA 4HQOA 1RFGE 3LUKA 1H8ED 3LVQE 1PQ4A 2F4VB 2GZAA 2GJKA 4ETIA 3MJDA 4JSYA 1EVEA 2VJDA 2YVLA 3T8YA 2YZ7A 2FR8C 3OTIA 4IDGA 4MI9A 2X0NA 1QG6A 3KVYA 4OM8A 2O2DA 1UPUA 4DR7B 4R68A 1O6CA 3C43A 2Z6AA 2VOJA 4DA4A 4K0KB 1LVGA 1RBQA 5AHKA 5IJZA 4FFBA 3G2KA 3PEWA 4YXWD 1YVDA 2HJGA 4E1BA 1WKVA 2MMCA 2P0AA 3E6AA 3NBQA 3MTIA 4FHEA 4EA6A 4EY3A 1XP5A 5ESWA 4Z4FA 1KNXA 5DCYA 1J0BA 3T1OA 2PUTA 8AT1A 1U8ZA 4MW1A 3U44A 5DX1A 2PT5A 5LQAA 3QBJA 5LDHA 5AH0A 3DHWC 1PEAA 4S35A 3K1TA 3MGCA 3K1YA 2BRUA 2QTVB 3WGIA 3E48A 3CMMA 3DTVA 1EI9A 2IEBA 1JR3D 1RWKA 2A4KA 4RLFA 2V7WA 3NDIA 2GZ1A 5AW9A 4AKTA 4YPVA 5T7BA 1SRQA 4MGZR 3OAAA 1MA0A 5K7SA 3SZRA 1QFJA 2R2GA 4QXQA 3PJDA 1BWQA 5B1HA 1V5FA 2K87A 3FAZA 2CNOA 4B34A 1O6BA 1TA9A 3PYXA 2Q07A 3MB8A 2HK6A 3EXHB 4HWOA 1XTQA 1PJ8A 2O0MA 4GMGA 3T9DA 1NG1A 2H5JA 1E3SA 5BVHA 1HLFA 3E27A 4PYNA 1KE2A 1QGYA 3QPDA 3GOHA 4JBYA 4OPMA 2C2WA 1ZCAA 1T9ZA 1V8ZA 3WRYC 2IS1A 4YX9A 3DZGA 1H0RA 2I62A 1J8MF 2ZIEA 5KVAA 2AOXA 4L2IB 3UCEA 4BX8A 1RKVA 3ZWDA 1XZPA 2GWRA 4UNQA 4CMEC 1SQFA 3HY4A 3LUFA 4GBED 4RDIA 1M6VA 2AEEA 1FNDA 2JK1A 3GA7A 4EG0A 1AB6A 1ENYA 4JUIA 1TPZA 2CXTA 4TLBA 3ZVNA 3GT4A 3JYLA 2Z5FA 1J20A 1UMBB 3NHJA 4MQFB 3WSVA 1TVKA 3LC1O 3CLHA 1KP3A 5CVUA 1SVSA 1T5OA 4U2CA 3SLGA 1ZN2A 4K86A 1PFWA 1NX9A 2CVQA 2HCJB 2JW5A 3VR6H 4AWXA 4CM4A 3UAVA 5J47A 3ZEIA 1P75A 3RUHA 5B3JC 1TRKA 4OBWA 2CXHA 1N4DA 3TJRA 3BIFA 1D1TA 3UKJA 4ROSA 5BQXA 4ARBA 5FBRB 4I55B 4KWHA 4FYPA 4K6CA 2HHHB 3EPHA 3GRZA 4IDEA 2GPNA 3D2AA 4NBSA 5FI0B 3BMOB 5JMTA 1LBTA 2KB0A 3OTHA 1FS4A 5K3DA 3ZWWA 1KGSA 3C39A 2W2NA 1G2IA 5K8JB 1P45A 4WUVA 3WIEA 3IB6A 2A1TS 3H8JA 1OXBB 4HNUA 1DIOB 4CF3A 5E3HA 3QXJA 4AY4A 2NUPB 4ZMRA 1WSAA 4RCVA 5JLJA 4NECA 1JEJA 4U39A 1EM8A 4B6OA 4MKGA 3QFFA 1V1JA 1GAEO 1FFXB 1X3SA 1BS9A 2IZ1A 2JAQA 3NBYC 1O95C 2I65A 3ESQA 4GW3A 4JBLA 1ISGA 3CZPA 2G4LA 3QGMA 4AYTA 3O21A 1A9PA 1W36C 2B4TO 4BHTA 1DC8A 3DQQA 5T4FA 3PXXA 2R47A 5LZ2A 1RQGA 3ZGNA 3PE6A 3W2FA 1HTBA 1PNVA 2QTVA 3KVOA 1E1NA 3ST7A 4IRUB 5BNTA 1DWQA 3OEHD 3C4QA 5HG0A 1V37A 4D92A 4E33A 1QQ5A 2VA8A 4MDHA 5DTIA 2D6FA 2IYTA 3IIMA 5AM2A 2YIVX 4P38A 2XRFA