1E3SA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
241
Chain Sequence
b'SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
total genus 85
structure length 241
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3sA00
3TFQA 5AQ1A 3WNVA 1PEDA 5IFLA 1QYDA 3GNTA 5MGBA 4FOSA 2YY7A 4G5HA 4L74A 5B1YA 2WYUA 1I5RA 5EMHA 1MC4A 2JFGA 1KERA 5DNAA 1E6WA 1PL8A 3RD5A 3UVEA 1I2CA 3GEGA 3GZNA 4DRYA 4MINA 4YT8A 1MP0A 4P8RA 4O0LA 4B7XA 4R1TA 4NNJA 3SX2A 2BGKA 5ER9A 1SAYA 4J0EA 4MDHA 4YAIA 1VPDA 1XGKA 2IODA 3RWBA 5K0ZA 1E6UA 1TLTA 2GERA 2XPCA 1Q7CA 1LLCA 1DIGA 2W90A 3RIHA 4YT5A 2Q4BA 5ENDA 1HYGA 2AEMA 2VUUA 4MPDA 4GBJA 2NU6A 3I6QA 4E5YA 3L77A 4GH5A 2VZ8A 4EGFA 5A4DA 2FP4A 4W7IA 3MWDB 1IHYA 5F1KA 4WLEA 1JKIA 4BGVA 4GKBA 1YS4A 3CKYA 2CNBA 3PRJA 4E13A 5A5FA 4Y9DA 1ID1A 2BRUA 4GAEA 3SLKA 2EGGA 1L7DA 3ZWMA 3GF4A 3H9UA 3WWYA 2Y93A 4OOEA 4PLWA 1CQIA 1R37A 3DFUA 3WG9A 2VQ3A 3HB4X 4B4OA 3DQPA 1Y9AA 1OAAA 3QWHA 3JYNA 3S55A 4CL8A 3U0BA 3W8EA 1EVZA 4ALNA 3ZH2A 4BMSA 3RC1A 3DMTA 5BR7A 1PGPA 1LU9A 3UF0A 4MIEA 4F6CA 4DPMA 1N7HA 4PLZA 3FR7A 4OYRA 3TZ6A 1BGVA 2WD7B 5KKCA 4XEHA 1FXSA 1UUFA 1IY8A 1GZ6A 4BVAA 2BFOA 3S2GA 1B15A 3IS3A 1XQ1A 2J8ZA 3OECA 4UVDA 4BNFA 5F21A 1B8VA 2X22A 5DBIA 1GEGA 2VNAA 2QIOA 3F5SA 3VOSA 2V65A 2GN9A 1CETA 4W82A 1VSVA 4R5MA 5TGDA 2QZ9A 1WXDA 3VH3A 2GASA 3BTOA 2Y67A 2VUSA 3TRIA 3MJCA 4NBRA 3NT2A 5B4VA 3Q0EA 2B37A 1HYEA 1W8DA 4BIIA 3M2PA 1XEAA 2QRLA 4DXHA 1X7GA 2VYVA 4NJMB 2X0JA 1ZSVA 3ZU4A 2GZ1A 4IUYA 1DHRA 3WDSA 4J4TA 1GPJA 2X5JO 1ZJZA 3CSDA 2IZZA 2VYND 5EN4A 3UHAA 3H2ZA 4NI5A 4NMHA 3JQBA 4XR4A 1H2BA 4EJMA 1OC4A 3GMDA 3LT0A 4MVJI 4YTEA 2PD4A 5G0SA 5I7SA 4L75A 1P33A 3HN7A 3BHJA 1PS0A 1K0UA 2YUTA 3OEWA 8LDHA 3E9QA 3ITDA 1NASA 3ZGYA 4NBTA 5IJZA 4C4OA 4ROSA 4J1QA 3RCBA 2O3JA 3E48A 4BHTA 1H2HA 2PD3A 3PZBA 1DLJA 1M2WA 4XJSA 1HLPA 1EE9A 1DB3A 2CFCA 4L8VA 4Y8VA 3HUDA 2BLLA 1QR6A 4DC1A 4UAGA 2HMWA 2Q45A 2Y1FA 1Q2XA 2ZYDA 4M54A 1ONPA 3ETEA 2ZB8A 3SJUA 2JJYA 3DWFA 1V0JA 2ZB7A 1IE3A 1VJTA 4R5HA 5L95A 4DIFA 1JA9A 1HE4A 3L6DA 2JD2A 4XCVA 3UAGA 2EJWA 1I0ZA 4DPLA 2DUUA 3LC1O 4EI2A 3O8QA 3RC7A 4DLAA 1ISHA 4I8XA 3TL2A 1EUZA 1KVRA 4UREA 3RQSA 1BMDA 3CUKA 3G0OA 4DC0A 1IZ0A 2C82A 2FPPA 4UVGA 3ULKA 5KJCA 2AE2A 4NK4A 1O0SA 1EZ4A 3MCVA 3U4HA 3TSCA 1M6HA 3TOZA 4YR9A 3DAGA 2GUGA 1YB5A 1PL6A 4CLRB 2H5LA 3ROQA 9LDBA 3GDFA 1ONOA 3AI3A 1DO8A 2AA3A 3QSGA 3H2SA 1PSDA 4I5GA 3U4CA 2AG5A 2UVDA 3H4VA 1Z6ZA 5I7FA 3LT1A 2R00A 4WCFA 2FR1A 5BSFA 1LSSA 1MFZA 4OIMA 1BTOA 4HNGA 4OQZA 4YA6A 1PQWA 1LDEA 3PQEA 4NG5A 2VRCD 4QQRA 2UUOA 1LRJA 4EITA 5B4UA 1HSZA 1PR9A 1Y9EA 1RPNA 1S6YA 5DBFA 5HRUA 1HF3A 4R1UA 4Z9FA 3RFVA 2CF6A 2CDAA 3SEFA 3MJEA 4E0BA 2G17A 5KKAA 2Q1SA 3PQFA 3G1TA 1I32A 3GK3A 4NR0A 3WICA 2UYYA 3L4SO 4DQXA 1LLUA 4CQLA 1ZSYA 1NR7A 1A27A 1A7AA 5CHEA 1JW9B 1V3UA 4BV8A 2DBRA 3M2TA 1FDUA 4GLOA 4QO8A 3NX4A 5JC8A 5CFZA 5L51A 3LK7A 1D7OA 4M86A 1P45A 3F5QA 1HDGO 4CM1A 4I9UA 4F45A 2R6JA 3HDYA 3KYCB 2X6TA 4FGSA 2X5OA 4GLLA 1YOVB 2GLXA 1UDCA 1ENPA 3VHRA 4D43A 5G0TA 4P4GA 3OICA 5JY6A 2AEFA 3LF1A 4CLEA 4NU6A 4M1QA 5A3JA 4BNZA 1RM3A 2FSVA 1YQXA 4WUVA 4IBOA 1KVSA 4MKXA 3V2HA 1YWGO 4CUJA 1YGYA 1P1KA 5KJ6A 4BNWA 4YRAA 2GN4A 3I6IA 4KUGA 3C1OA 3EVTA 3GFBA 4NBWA 4ALMA 4HY3A 4ND4A 1U2GA 2C5EA 3OF2A 1V6AA 3ZWPA 3AM4A 1AHIA 2Q4EA 2O3QA 3D5QA 4MP8A 1EDZA 2PNFA 3ZU3A 3I5MA 5G0VA 1DXYA 1HTBA 4J43A 4UEJA 3WMWA 3WYBA 3WMXA 1XHLA 5EERA 2Q2VA 2PKQO 5G0UA 3AW9A 2I67A 4GVXA 4KUHA 5DDIP 3MEQA 2Z1NA 3CINA 2DU8A 2VYVD 1F12A 1Y5MA 2BFAA 1HSOA 2EG9A 3I83A 4WEQA 5DP1A 3KO8A 4L4RA 3JQEA 3PZRA 4MVJM 4QO7A 3AY7A 3IIEA 1M76A 5T6BA 3AU8A 5JO9A 2C07A 4A27A 1GAEO 4D0SA 3WSVA 2DT5A 1IPFA 3ASVA 2NVUB 4KDEA 4BNKA 3G49A 4OM8A 4G65A 2AEJA 3L6OO 2CVZA 2GZ3A 1R4NA 5JO0A 2HO5A 4DLLA 3E5RA 1DRUA 4MOWA 1MXFA 2JFFA 4IQ0A 4YDRA 5HS4A 4U0KA 2I9PA 5I9NA 4XZ3A 3ADOA 5J23A 3VH1A 4FDAA 4CMHA 2NNLD 3UFXA 1IYZA 5JS6A 4I9NA 1E1NA 3OJEA 4YAJA 3V1UA 4S3MA 1BXKA 1VE9A 1ZK0A 1JVBA 3O8QB 4YJDA 3WJAA 2NV6A 1GADO 1EUCA 4GMGA 2EP5A 3M1LA 1E7RA 5JDIC 4CL3A 2WE7A 4J7UA 3CMCO 2XF8A 3Q3CA 4AL4A 1IPEA 1NVMB 4URFA 4DIOA 2X0IA 3BYZA 4UVHA 1DSSG 4CMIB 3HE3A 3INGA 4E12A 3I23A 5A02A 5IN4A 1HL3A 4FQ8A 3FBGA 2DC1A 1RM0A 3RJ5A 1DIRA 1DPGA 2YQ5A 4CM4B 1ZZEA 2OFPA 4J0FA 5B4TA 3GUYA 4K28A 4B3IA 4E21A 3OA2A 4BNYA 2BELA 3WIEA 3AOEC 3EHEA 3PWKA 1LJ8A 4IDAA 5KJ1A 2V7PA 3VKVA 4W7HA 3AFNA 1Q0LA 4LGVA 3BIOA 3K9QO 5EQFA 2Q3EA 3B1FA 1DLIA 1Q1NA 3I9NA 5COAA 3TNLA 1GYQA 1EQUA 3JQ8B 4KWIA 2EJVA 1PJCA 4XIJA 2F1KA 2TMDA 5T5QA 2DTDA 5L53A 1QYWA 1GEEA 4R9RA 4O6VA 5A3VA 1EVIA 2A35A 2O4UX 1H9AA 2PGJA 2PA3A 3BMQA 4I08A 4A73A 4GGPA 4UUOA 1PJ4A 2X8LA 1OC2A 3ANNA 3A4VA 4B4VA 4AJJA 4RO0A 3RROA 2HCTA 1CIVA 1GQQA 4YCAA 1P31A 3AUAA 1PJ3A 4O5OA 4R16A 5F3RA 3ZV3A 3ZWOA 4YRBA 2VHVA 1TT5A 4DBVO 1KY4A 1DIBA 1ZK2A 4C7JA 4IM7A 2ZQYA 3VPGA 3FRJA 3ZNOA 1HDXA 4BB5A 1MFPA 3I4FA 3VVCA 1PQPA 1V35A 2WD7A 1U3VA 2O3RA 4FR5A 4OKIA 4RVDA 2GD1O 2J3HA 2WSBA 3K2EA 4A26A 5A06A 4Z9XA 1A72A 4J90A 3VTZA 2Y0CA 1UZMA 3NGLA 5AXCA 3H9QA 4B4WA 4OKNA 2O3TA 3WR5A 3KUXA 2Z1MA 2PWZA 3JQCA 1HZZA 2ZTMA 1LQUA 1J49A 1TT5B 3BAZA 4H15A 1VI2A 4IS3A 2IE0A 1XKQA 3HQ4O 3PLNA 3X2FA 1I33A 2VRCA 4PLGA 3NYWA 3VPFA 4BKRA 2I5PO 1X13A 1ADBA 1TI7A 4YJHB 4CMJA 2YV1A 3WGQA 3WLEA 3VH4A 4ZN6A 2B5VA 1F0YA 1LA2A 4FS3A 2Q2WA 1UAYA 2JL1A 3A06A 5CAEA 5IDWA 3KETA 1GV1A 1ZXBA 3BMCA 3ZWAA 4BO5A 4IDGA 3MTGA 4WOKA 5TLSA 4FBGA 1ZUD1 3O03A 1B0AA 4BV9A 4R54A 4BO4A 3ICPA 1E3WA 5ITWA 4AJ2A 3CTMA 1U28A 4HNHA 4FFMA 3OJFA 2RBEA 1PJBA 4CUZA 1EMDA 3Q9UA 2YHUA 3WGOA 2DM6A 1Z73A 2EHDA 3QY9A 2YV3A 3GHHA 1UZNA 3KM0A 4WCDA 5L9AA 1PU2A 4HBGA 4CM3A 1PZEA 4C7KA 1Z75A 4Y6RA 3RC9A 5TT1A 3E9NA 5DP2A 1E7YA 2O2YA 4R68A 2O7SA 3DTYA 3PHJA 4DQUA 1SB9A 3ENNA 1EVYA 4FPXA 4ZU3A 3L4BA 3HJAA 2PZLA 3G1UA 5B37A 3A9WA 3C3XA 3WOHA 1QV7A 3JQ8A 3K6JA 3BTUA 3ETDA 1CJCA 3MOIA 2J3KA 2JCYA 3KSZO 3PYXA 4WKGA 1YRLA 1E3LA 2OMEA 1CDOA 4FB5A 2HU2A 2P5YA 4YPOA 2Q50A 2EWMA 4CLXA 2D8AA 4IZHA 3RI3A 5KCZA 1LDNA 3JQFA 1ZK3A 1EE2A 3F46A 2CVQA 3QIVA 2ZIZA 4RCVA 1H5QA 1R4NB 1DFIA 2NTJA 4MP3A 4DMMA 2B0JA 4IJKA 5AXDA 1WAMA 1CRWG 2FY8A 3GLQA 3D64A 4KP7A 4CMIA 2PKRA 4E3ZA 1K6JA 1I3NA 3LLVA 4IIVA 2J5RA 5I8ZA 1U9JA 2HRBA 3WLFA 4AVYA 3IJPA 5KVVA 4CLDA 4OH1A 2DUWA 4YAKA 3PTZA 3DTTA 3GH3A 2BH9A 4UEKA 1NQ5A 1LC3A 1H6AA 3KEOA 2QHXA 2E48A 4CPDA 4IPTA 1YE3A 4L9RA 4ZA2A 5DBGA 5TF4A 5CG2A 4B4UA 1JWAB 3T7CA 2OHXA 2C54A 2EGHA 1YQGA 4CR8A 4WPGA 5AOVA 5U4QA 1D1TA 3LLSA 1LSUA 2ZYGA 2UUPA 1ZFNA 2CSUA 4CMBA 3QWAA 5CDSA 1MG5A 3PFWO 3BTVA 1DAPA 4HFMA 1ISIA 5DF1A 5A5EA 5ADHA 2Y99A 3K2BA 3U4DA 1K2WA 1UP4A 4DA9A 1K3TA 3PVZA 1NXQA 1DC5A 3PLRA 4M49A 1PJLA 1UXHA 1YBMA 3D0OA 3E6AA 4CV0A 2WTBA 5T8KA 4XGKA 4PG8A 4IQGA 4E31A 5A04A 5JCJD 1GZ3A 2VHWA 1B8UA 1F8GA 4NPCA 1P44A 2ZTVA 3GC6A 3L9XA 2EF1A 1EBFA 2HJRA 1ZKMA 3HWRA 4D79A 3MJVA 4J3FA 3W8DA 4GMFA 1Z7EA 3DZGA 1B7GO 3F47A 3ORFA 2X7HA 4CM4A 1M67A 2DLDA 3GFGA 2FZEA 2G0TA 5I8WA 1YOVA 2YW9A 4RGBA 3W6UA 1HE5A 1E77A 3BHMA 3WJ7A 4XR9A 3WBFA 3ZWVA 1B26A 2C7GA 3HDJA 3UCFA 4W4TA 3W4KA 4BGUA 4HUJA 3INRA 4N18A 3I1JA 2W2KA 4A2CA 1MXHA 3S2EA 4K1LA 1R15A 3CH6A 3KB6A 2FSSA 4CQLB 4ZRNA 4RVGA 3ZNNA 2NTNA 3PWSA 4ZRMA 5JLAA 5C3MA 3UXYA 1VL6A 4S1VA 3TDKA 4AJ4A 1E0DA 1ZEJA 5H83A 3QVWA 3WGYA 3DFZA 3C7DB 4PLYA 3OJ0A 4M8SA 1NFQA 1PL7A 3KRTA 4N54A 2HLPA 1ISGA 1E1LA 4CQMA 4R01A 3F9IA 4BNLA 2ZJ1A 3H3FA 5CPBA 1PWZA 3RBZA 1QRRA 3OQ6A 1CYDA 4CM8A 2Q1WA 3H9GA 3KTDA 1DC3A 1I10A 1PQUA 1UZLA 2HK7A 4XJTA 4GX0A 1C0KA 1ZCJA 3H8VA 3AOEA 1BHSA 4JJFA 3WS7A 4BKQA 4MVJG 2NU9A 4Z3DA 3KXDA 2NVUA 4OOFA 2E37A 4Z0TA 2LDBA 3TN7A 4PLCA 3CE6A 4D3SA 2V6GA 4A5OA 2UDPA 5JBIA 4RDHA 1PJTA 2PFGA 2AQIA 4A10A 4Q3EA 4PLVA 5H81A 1NYTA 1Q0HA 4OGWA 5JYEA 5L7WA 5L4LA 1ZNQO 5TT0A 1Z74A 1LRKA 4XWYA 3V1YA 4XGNA 3WQQA 2GYYA 1A5ZA 1QLJA 1P9LA 3RFTA 4DIBA 3MJTA 3VKUA 3W8FA 4Q3DA 1ZH8A 3B70A 1HWYA 4TZKA 2DBVO 1DJQA 2JD0A 2VT3A 4BO3A 9LDTA 1E3JA 4OMUA 2TMGA 4U5QA 1EDOA 3FTPA 1DDOA 2J3JA 4H3VA 4PLHA 3QQPA 4DWVA 3IAHA 3IL2A 3RU7A 1GY8A 1SB8A 2O50A 2EERA 3O9ZA 3W4JA 5JMPA 1N7GA 3QE3A 8ADHA 4BGEA 1JWBB 1NFFA 2DFDA 4Z0PA 2WDZA 3HADA 3PYMA 4GI2A 4TRRA 5L4SA 5EQDA 1YL6A 1Q7GA 1GCOA 1YJ8A 1UAGA 5BQFA 3I4CA 3L4BC 2ILTA 1BDBA 2WYWA 4PG5A 4BQRA 1LX6A 3DBLB 3EZYA 4Q3CA 3VVBA 5CEEA 3D3WB 3OETA 3QA9A 2ZYAA 1I01A 1B3RA 3SJ7A 1EK5A 7ADHA 1P77A 2ZATA 3DZFA 3DBHB 1Y6JA 3U4IA 5L7YA 3Q11A 3NTQA 3G3EA 4OL9A 2DVMA 4I5DA 4YWJA 3ZWWA 5C5IA 3O38A 3GZ4A 5TC4A 4FSHA 3FBTA 3DBVO 1KEUA 4RVSA 4BO1A 1B3BA 1UJMA 2X86A 3HFSA 5THQA 3ZN2A 5ER6A 3UUWA 4E32A 4BNIA 3VPSA 2JFHA 3Q1LA 1QXSA 3ICCA 3RJ9A 1QV6A 3JQ7A 4WLVA 1NR1A 3OH8A 3D5TA 1ISMA 2NU7A 1F8FA 5CG1A 2WEKA 3GHYA 5C37A 1LQTA 4B7UA 1U3UA 3P2OA 2NQ8A 4P22A 2WYVA 3O4RA 1ZMOA 3GVHA 4NU5A 3DDNA 3EDMA 3JQAA 1H93A 1M6WA 4NHEA 5L7TA 3WWZA 5KNLA 1T24A 1VSUA 1V9LA 1WDKA 3OQBA 4FGWA 4YJFA 3VPHA 2R2GA 4XYLA 2UV8A 3ZHZA 2W98A 4WCFB 3GMSA 3B20A 2EIHA 2NVBA 3E8XA 5FI3A 5IDXA 1LLQA 4ALKA 3P19A 2AXQA 3SC6A 5JFOA 2QRKA 1GR0A 4NDNE 4CUKA 4XRGA 5A03A 4QXMA 2YDYA 3C85A 4UUNA 1ADGA 3IOYA 3NT5A 3KSUA 4IJWA 4CV2A 1GUZA 1ZIDA 2IDZA 5JSFA 4M87A 4B7CA 1VC2A 2P9CA 4K26A 1ZSNA 2YFQA 4BB6A 4IJVA 3DHEA 2HMTA 4Q3BA 2NSDA 1H6DA 3ENKA 1ZXLA 1S7CA 4RVUA 5A9SB 5JMWA 4TRMA 4E2YA 1GYRA 4LSMA 5DOVA 1YL7A 3R0IA 5JE8A 3GDGA 4IQ8A 1U8FO 2C7VA 5BNTA 3ANMA 1RJWA 5DCUA 3D7LA 5T8KC 2GDZA 4WNIA 4HFNA 3JSAA 5JDCC 3DL2A 3I9OA 4BS9A 4KDFA 3RC2A 1PZHA 4ZQHA 1GZ4A 1ISJA 1ZEMA 2O2SA 4R69A 1ZMTA 1TEHA 4BNGA 1T2DA 4EJ6A 2Y1OA 4J4HA 4EYEA 1OMOA 2QG4A 2X1HA 4YAEA 4IXTA 2GPTA 1I3MA 4HV4A 3FPCA 3ZW8A 3VAZA 1GCUA 3MJ4A 2Z95A 3GY0A 4JJIA 3DC2A 1FF9A 1RWBA 4QSMA 4OSOA 4U8GA 5FYDA 1E1MA 5TNXA 1HE3A 1I24A 1AGNA 3JCZA 2VN8A 4J2HA 4DQVA 4F46A 3C7AA 2BGLA 4ZQBA 4PIVA 5I9LA 2WMDA 3DOOA 2ZQZA 1TXGA 2V6MA 3GUCA 2J6IA 5CEJA 3E1KA 4PRKA 4HADA 2OZPA 2ZK7A 2AW5A 4LRSB 1XU7A 3AM5A 3PDJA 4FFLA 4XQEA 3OIGA 4BO6A 3EMKA 3JQ9C 2VWQA 1YQDA 3K8ZA 1R66A 2DPGA 4FC7A 4YJFB 1FDSA 1Z82A 2Y1EA 3WTBA 1ZJYA 4QX6A 1YBAA 1NBOA 2P68A 1Y8RB 3EW7A 3VDRA 1RYEA 2VUTA 4FW8A 3N7UA 3LSYA 4ZVVA 2ZTUA 3ONDA 3IMFA 2BD0A 5G0WA 1N5DA 2Q1UA 3GZNB 3NT4A 3H9EO 4JN6B 3U62A 1SOWA 3LC2O 3OBBA 5KTKA 2I6TA 1JKFA 4GSKA 1E92A 5BNIA 4RORA 3LT2A 5IN5A 2R00C 4BMNA 1O5IA 3JQ6A 2PGDA 1QORA 3WBBA 5KWEA 1F06A 5ITVA 3FSRA 3PJFA 4WLOA 4IDCA 1HEUA 3FTNA 2Q99A 2VWHA 1A4IA 2JCXA 3NTRA 2JCVA 2RIRA 1VL8A 4JBIA 5AXAA 2BFMA 3HNPA 1IOLA 2FOIA 1W4ZA 1J4AA 5ICSA 4O63O 1AHHA 1B16A 4BOYA 2P9GA 1ULUA 4MP6A 5C7IO 4PLPA 4Q39A 1FDTA 5HA5A 5JDIA 1BXGB 1XDWA 1LI4A 1VL0A 4E5PA 5I7VA 3GVXA 4EBFA 2FR0A 2O4CA 1LNQA 1T2EA 2VT2A 2X0RA 1P1FA 1EK6A 2AQ8A 3BMNB 5JPIA 4D41A 1NX6A 4Z3KA 2DQ4A 5IAAA 2AMFA 3F3SA 1EFLA 4NFSA 4R51A 3NJ8A 1XWFA 1E7QA 4MJLA 2YYYA 4LCEA 4WK6A 3BTSA 3AOGA 1U2DA 1KIFA 2E49A 1UP6A 4CMCA 2EW2A 4PGFA 3PWZA 3FNEA 1FJHA 3FNFA 3MOGA 4XA8A 4JK3A 2VTDA 4BNMA 2A9FA 1R0KA 1R12A 3PJDA 2OGUA 5JYDA 2IZ1A 2VZ0A 3ROKA 5TRTA 2YZ7A 1C0PA 1N1GA 2ZCUA 3EZLA 2IXBA 3DMTC 4GL4A 2Y05A 3OSUA 1HDRA 1VJ0A 1NHWA 1JLLA 3AJRA 4GQAA 3KEQA 1JTVA 3C1TA 4LMRA 1NNUA 5KVCA 1KVUA 4MVJF 3H5NA 1VM6A 3GDOA 4GX1A 1NPTO 1KOLA 2DKNA 2RCYA 3H9JA 2CUKA 1GDHA 1NAIA 3N58A 4JROA 3WGHA 3I9JA 4IXWA 2D0IA 4K9DA 2IYOA 3AU9A 1Y8QA 3DMYA 2HK8A 4IGFA 4BNUA 1J5PA 1SCUA 3ZNQA 1DC6A 4WLFA 2GSDA 5HS6A 5TIIA 3DAFA 1NWCA 5F1PA 4K6FA 1I3LA 2VNSA 1NQOA 4GWGA 3VTFA 4B8ZA 2GF2A 4BNJA 1JDJA 4HKTA 1AE1A 4KMSA 5JAQA 3TQHA 3ROMA 5EINA 1P0FA 3P2YA 5FFFA 3JD4A 5C7OO 4UUMA 4J9UE 4ZGWA 1AUPA 1OZAA 4TKLA 2G1UA 1YXMA 4MVJA 2AG8A 2VCYA 3UH1A 2POQX 4D7AA 1IL0A 4CV1A 1IZ9A 1QLHA 4LSWA 4DMLA 3Q2IA 1N9GA 4YT2A 1BXGA 5JDCA 1LRLA 4AJLA 1G1AA 5B12A 2QYTA 4LRTB 2PR2A 1PR3A 4B3HA 3EK2A 2Y68A 3FCOA 4PLTA 7MDHA 1ML3A 3DZKA 3IQDB 2GZ2A 4U6QA 4J1SA 3GG2A 5KJEA 2VOJA 4J6FA 3NDIA 3UGKA 1MUUA 5EESA 4J9VA 4JP2A 4YXFA 2CZCA 4RPHA 4GKVA 2EKLA 5K6AC 4CM6A 1EQ2A 3ZHBA 3K30A 3T4XA 4CV3A 1E5LA 4YAGA 4DYVA 4NJMA 4ALJA 3WX0A 5AYVA 4WLUA 3VZSA 4LISA 4RF5A 1JN0A 5I9MA 4XYMA 3FD8A 5F5NA 3B1JA 1XU9A 2CDCA 4P4LA 4Z9YA 5JAZA 2Y0DA 1C3VA 1T2AA 1YVEI 3HG7A 3P7MA 1WZIA 3O26A 3RBVA 1FK8A 4BNHA 4D0RA 4MKRA 4CLOA 1D1SA 2W2LA 3A1NA 3KHUA 5ILGA 1X14A 3WFJA 4QECA 3E5MA 2WM3A 4GGOA 2FRDA 3S1LA 4EEXA 1E7WA 3QV1A 4G2NA 1X1EA 1N8KA 3BZUA 3QHAA 3WXBA 3LYLA 5F1OA 4CLHA 4L0QA 4CR7A 5JXWA 4OXYA 3QW2A 3ANLA 2BGMA 1PJ2A 3JYPA 2YV2A 4OXKA 2HDHA 3PJEA 4AJOA 4PVDA 1XR3A 3FNHA 3AI1A 4RF4A 1P1HA 5IXYA 4BNVA 5CPFA 4JNKA 1QYCA 4DYDA 1X0VA 5L3ZA 1X0XA 1W73A 1TT7A 4TWRA 1KEPA 3FNGA 4W99A 5A9TA 3PYLA 4LW8A 4RF2A 3QVSA 3WB9A 2F00A 3P5SA 4FFOA 4XB1A 5G2OA 3UICA 4A7PA 2OBNA 3JD1A 2B4TO 1OOEA 4DGSA 4GSLA 1BW9A 4MIYA 5GZ1A 4E6PA 3ZWXA 2FR8A 3U49A 5GZ3A 1Y8RA 3BMQB 3FR8A 3G17A 4UULA 4XB2A 1U7TA 1E3WB 3E18A 3GG9A 1NTOA 1O95A 2HAEA 3RKUA 1CQJA 3NRCA 1KC1A 4TVBA 4O59O 5A9RA 3ZHXA 2PK3A 3BMNA 1N1EA 4P4NA 3F4BA 3HHPA 3PHIA 4P38A 4YJGB 4N5MA 5TJ9A 2P9EA 3EUWA 4BKPA 3C8MA 2RHRA 4RJTA 3TOXA 1GV0A 3ABIA 1SNYA 1LDMA 4YJHA 4BNTA 2EKPA 3PEFA 5TJHA 4BO8A 3JQGA 2Y1DA 2DTEA 3U5TA 3AWDA 1PGJA 2OL4A 4PFJA 3RUAA 5ES3A 4NBUA 4II3A 2HMUA 4EZBA 3JTMA 4W6ZA 3WGGA 1A7KA 3F6YA 2LDXA 1B8PA 1SEVA 4Y98A 4INAA 4HP8A 1PS8A 3QVOA 1FDVA 3ETGA 3H3JA 4IINA 2Q46A 2YFHA 1M66A 2UAGA 4J49A 4FJ1A 1U4OA 2IEDA 1LUAA 3LU1A 2I3AA 3EC7A 1R4MB 5CDTA 3RKRA 5CDGA 4LN1A 1EEHA 3QLJA 3DZJA 4I5EA 4M55A 4BQPA 1TB4A 2ET6A 4D45A 4JBGA 1GUFA 4WJZA 3WGTA 1EUDA 1ZO8A 2PH5A 3LVFO 2HMVA 3GPIA 4BKOA 3R1IA 3ZCXA 2O48X 1HZJA 1YONA 1UXKA 1XIVA 4W9NC 3WIDA 3R6DA 1X15A 4II2A 4GX2A 5JAIA 3KYDA 3IUSA 2ZTLA 3ITKA 1XYGA 3JD0A 2PGLA 3JV7A 4RL6A 2X0NA 4N7RA 1CERA 3KOUA 4UEOA 1LXCA 2IXAA 5JW6A 4RZHA 1GFSA 3WFIA 3DEYX 5EPOA 1BRMA 4Q9NA 3L6EA 3CXRA 3JQ7B 5FF9A 3T4EA 3ZDFA 4D46A 1IHXA 4WLNA 4MKZA 1YDEA 5EIOA 2J5KA 1GUYA 1O8CA 1TVEA 2VWGA 4K6CA 4ILKA 2BFPA 1DRWA 4N5NA 2XXJA 1HDOA 3QJ5A 4FC6A 3VZQA 4CMGA 1SOVA 4YQYA 5KIAA 4CQMD 1V8BA 4YB8A 1MGOA 1P0CA 4E5KA 3FN4A 3UKOA 2DAPA 2VHZA 2NLOA 1ZK4A 4QT0A 5COBA 2D4AA 4A0SA 4BMVA 1MA0A 3GAFA 3KVOA 4JQCA 3F4LA 2CVOA 1MB4A 1R4MA 2CMDA 3RUCA 2QYSA 3TZHA 3HFGA 3JQBC 3B1KA 5G4KB 3RASA 1C1XB 4CJXA 3DOJA 5LC1A 1EFKA 3EAGA 4BO9A 4WGGA 4FOOA 1LDGA 1YB4A 2X9GA 3OEYA 1ZW1A 2BF7A 1H94A 4PVCA 4TSKA 3ZNPA 4BUCA 4E2XA 2PLAA 4AJ1A 3C1AA 5TQVA 5BSEA 5A9SA 4IZIA 3D3WA 4OSPA 1PWXA 4NZ9A 3DR3A 2JHFA 1W6UA 5T64A 3OMLA 5HTOA 1AXGA 3GVCA 2VTEA 1QYVA 1NVTA 1I2ZA 3I9LA 1T1RA 1DAOA 1XCBA 2PZJA 4IMPA 3BHIA 4R9SA 5DT9A 5JCJA 4N5LA 3PGXA 2JAPA 3ZI0A 4D3DA 3EGOA 4UVIA 4R3WA 2EP7A 1RM4A 2OUIA 1XELA 4NK5A 3GN2A 4BO2A 3CEAA 4RZIA 4E2ZA 4CMEA 3AI2A 1H6CA 2V6BA 5CDUA 3C24A 3NEPX 3FWZA 3OFSA 4IGEA 1R6DA 5DN9A 3ZWBA 2VYNA 4XQGA 4NH4A 2YDXA 5DCYA 2B69A 2X9NA 5COQA 1DHTA 2D2IA 4ND1A 4AJPA 5KOIA 1R16A 4JX8A 1LSOA 1H6BA 3OIFA 3OIDA 1C0IA 1SEPA 3GGGA 1E3EA 3HZZA 1PX0A 4HX5A 3ROPA 2YHIB 4B8WA 5IF3A 4XIYA 2AQHA 3DHYA 4CLOB 2ZCVA 4LVCA 4U0JA 2EXXA 1UR5A 3BMOA 1FDWA 2AHRA 4FD3A 3ZV6A 3TF5A 1Z7BA 4ZJUA 3U09A 4RQTA 1H9BA 2IEBA 4TZTA 1NM5A 1I8TA 4DUPA 4EDFA 2O23A 3DBHA 3AM3A 3WQSB 2PY6A 1ENZA 3WYEA 1U5CA 2E6UX 1NQTA 4J2OA 1YKFA 2G5CA 2NVWA 1U1IA 2HJSA 4ZQEA 4Y6SA 3VDQA 4XQ9A 4Z0HO 2P4QA 2BMAA 4QTZA 3BXXA 1M75A 4YYZA 3VZRA 3L9WA 4RPJA 4CM9A 4KTVE 1A71A 2RH8A 2D5CA 3U9LA 4YRDA 1BG6A 1T26A 1U5AA 4FFNA 4QEDA 4CMAA 3ZU5A 4PG4A 3ZWCA 2ZB3A 1KBZA 3MZ0A 3X2EA 3HDHA 3OHSX 3E82A 4R41A 4WNCA 1GD1O 4MO2A 1PGNA 4Y6PA 4J4BA 4FIZA 4I5FA 1X1TA 1UDAA 2BHLA 1A9YA 2SCUA 1WDMA 1Y1PA 2PTGA 1KY5A 5ILOA 3LDHA 4B3JA 2C59A 2X9VA 4ND2A 4BNNA 2OORA 3OJOA 4BO0A 1I2BA 2FZWA 1HDZA 2QQ5A 4L4XA 1PJSA 3GGPA 3ZU2A 4E4YA 2HUNA 1X7HA 1A9ZA 3Q9NA 3KBOA 4IMRA 2G82A 1EBUA 1HDCA 3TL3A 1LLDA 1P1RA 4E2WA 2Z5LA 2X4GA 3STHA 2FWMX 3JYQA 2OBYA 1D3AA 4ESOA 4AJNA 1UXGA 3F1LA 1CF2O 1SBYA 4EW6A 4NIMA 3DZIA 3SVTA 2CY0A 1PIWA 1U4SA 2A94A 6ADHA 3CZMA 4TQGA 5JY1A 4M89A 3S2FA 3BA1A 4AJIA 4CMKA 3HSKA 1E7SA 3M6IA 3PJGA 2AE1A 1J0XO 1SZJG 1XA0A 4CM8B 4XGIA 2VOEA 2B83A 3GNQA 3R3SA 4DVJA 3FPLA 1DIHA 4JIGA 5LDGA 4KWHA 1RKXA 4YACA 5ICMA 4NFYA 5GZ6A 1WDLA 3VC7A 3E9MA 2CF5A 3B6ZA 1Q7BA 1WLYA 4UUPA 4EJ0A 1QYXA 2C29D 1Y7TA 1I36A 5CP8A 1LSJA 2DBZA 3MWEB 4WCFC 1C1DB 3TZCA 3SLGA 3G79A 2VHXA 2W2KB 1LC0A 3C7CB 3N74A 1B14A 1JKJA 3V2GA 4KTTE 4AJKA 4ITUA 5G4LA 4PG7A 4AJHA 4RVHA 4LMPA 4ZQGA 1DFGA 4R4JA 3AUUA 1N92A 5AXBA 5HWSA 1GPDG 4JGBA 5KVQA 4TRNA 5IDYA 3QRWA 1ZBQA 3KZVA 2ZKLA 4I1IA 3WTCA 1X7DA 5HBRA 2QW8A 3PHLA 3GRPA 4L4SA 3RUFA 2CD9A 4XX0A 4JP3A 5IDQA 1L1FA 1SMKA 3UCEA 2B35A 3PXXA 3GAZA 3JD3A 1H0KA 3EYWA 3PDUA 3WGZA 4OO3A 3KLPX 4Q3AA 5A05A 1MX3A 4LK3A 1DEHA 5EL0A 1BWSA 1QSGA 1JQBA 4JLWA 2O3UA 3HDQA 2WE8A 3Q2KA 4PLFA 4R1NA 4AICA 1GYPA 1HT0A 3IP3A 3RUIA 4Z6KA 4BKUA 1UDBA 1ADCA 1VLLA 1YJQA 4KQXA 4WEOA 6LDHA 3JYLA 3D3EA 2H6EA 4XDYA 4HWKA 1G6KA 2C5AA 1BDMA 3W1VA 4F6LA 3V1TC 2YJZA 5BT9A 2D1YA 2FPGA 2C20A 1K5HA 3JQ9A 5BNFA 4X54A 2RAFA 3H5AA 3K73O 4IJUA 3ZWNA 2RHCA 1MLDA 2NTVA 3SBOA 4BGIA 2JHGA 4ND5A 3OA0A 3TWOA 5LCXA 4GX5A 4O1MA 1PS9A 3GPDG 2B4QA 3L07A 2PZMA 3F1KA 1T1SA 4GVLA 1DFHA 1KVTA 5IZCC 3PQDA 3NJ4A 4RPGA 1U7HA 5JAMA 1KC3A 3TFOA 1T4BA 3TJRA 3WSWA 1UP7A 1QG6A 3L0DA 1T25A 2Q49A 4G81A 5IG2A 2GRAA 1C1XA 3KYBA 4E30A 4L73A 2C2XA 1D4FA 4RDIA 1GU7A 2I99A 2IZ0A 4E5MA 5BSHA 5MDHA 3LC7O 3TZQA 2E4AA 3A14A 2D3TA 3VZPA 1NPYA 2X23A 4PN3A 1G0OA 4EUHA 1DRVA 3ONEA 2YHIA 3NDRA 2FMUA 3T7EA 4I9HA 5I7EA 2EV9A 2QX7A 1SO8A 2O7QA 2QRJA 1RM5A 5DZSA 2Q1TA 4GPD1 2OP1A 1DOHA 1E5QA 2J5QA 2RH4A 3I9MA 4U7WA 3OP4A 4DTIA 1DIAA 1PZFA 3UCXA 1ZVMA 3WYCA 4CM5A 2XOXA 3KLMX 4TKMA 5FWNA 3GT0A 1R0LA 2PD6A 4FJ0A 1KEWA 2JAHA 2ZB4A 2P91A 4XYGA 4XYBA 3JQAD 1PTJA 3D4OA 3D1LA 3MTJA 3IC5A 2JKVA 4YVFA 5T57A 2HQ1A 4MVJE 5DOZA 3GRKA 1LDYA 3ZV5A 3RU9A 2HMSA 2BI8A 3K96A 4XDZA 4LCJA 4KZPA 2C0CA 2H1SA 2EKQA 4UVEA 4XRRA 3QWBA 2FHSA 3SC4A 3IKVA 4XYEA 2PKQP 3PGJA 4U6SA 2CDBA 2D59A 2Y0EA 4Q3NA 1EVJA 3E03A 4KQWA 1AN9A 4J1NA 2A4KA 1KVQA 5GY7A 3PFFA 1F14A 3QP9A 3DONA 5KJFA 2XXBA 1CEQA 1N2SA 1IULA 4PRLA 3RUHA 2PH3A 1K6XA 2XAAA 3BMCB 3EVNA 3JQGB 1MC5A 2BI7A 3DBLA 5G4KA 1ULSA 2C2YA 3MJSA 3HN2A 1XSEA 1P3DA 1JVSA 4J1TA 2WWRA 1J6UA 4D3FA 1NHGA 3U3XA 3UOGA 3PHGA 1GQYA 1HXHA 2QZZA 4RLHA 3S2IA 5L45A 1O9BA 3HB5X 4GWKA 4DL9A 3V5NA 4YT4A 1JU9A 2P2SA 3AUTA 2EW8A 1HKUA 5DCWA 2FN7A 1Z45A 3AUSA 3GEDA 1HETA 4J91A 3UW3A 3GVPA 3GA0A 2VZ9A 4WE3A 1KETA 4D44A 3RUDA 2PZKA 3DO5A 3ON5A 4CM9D 1JAXA 4CR6A 4F3YA 4FFPA 4AG3A 4EEZA 3OQ1A 3QWIA 3W4IA 1GL3A 1ORRA 2J3IA 5H82A 5A1TA 1P1JA 1Q0QA 4RVFA 3A28A 3SXPA 1YBVA 2NADA 5LDHA 4JXKA 4BNXA 1C0LA 3KYDB 5JCXA 2B5WA 1ONNA 1T4DA 5IZCA 3CMMA 3GR6A 3KV3O 1BVRA 4NFHA 1O89A 1VJ1A 4FJ2A 2B4RO 4RQUA 3ZWYA 3DZBA 3ZHYA 1ARZA 4J7CA 4DBZA 2IRWA 3FI9A 3GQVA 3JQFC 1AXEA 1QKIA 3WQRA 3COSA 5FI5A 2NQTA 1UXIA 2DTXA 3AK4A 3I52A 1XLTA 4FFRA 1K6IA 2I76A 5L40A 2A92A 3NDJA 3CZRA 4JCOA 4AJEA 2O3SA 1E3SA 4QFCA 2Y1CA 4JJGA 3ONFA 2OOSA 3TZKA 1NAHA 1IUKA 1O94A 3RUEA 3JQAB 1VKNA 2NM0A 5K6AA 4IDBA 4ZQFA 3PIDA 5GMOA 5EJ2A 5CEFA 4MIOA 4KUEA 1E6EA 3IKTA 1HLDA 1PZGA 3H5RA 1OFGA 2BKAA 4CMEC 1U3WA 1XG5A 4BL5A 1E3IA 1OI7A 5L4NA 3INTA 4BO7A 3GN1A 1P1IA 3LT4A 3H7AA 2DFVA 4JBHA 3GEMA 3R3JA 1WVGA 2I3GA 1MV8A 4PZCA 4TMFA 2Y1GA 1K89A 3DBRA 3RSHA 4KOAA 2B36A 1U3TA 2IYPA 4NQZA 3S8MA 2D5AA 1ZK1A 2GO1A 1YB1A 4RF3A 1L7EA 4IIUA 5ENVA 3DOCA 3OJLA 2NU8A 1HRDA 4ZHSA 1O6ZA 3WGIA 3IJRA 3GOHA 1NP3A 3BMOB 1HE2A 5IXSA 1HYHA 2GR9A 1WMBA 2VWPA 3ZV4A 4YJGA 5AVOA 1GTMA 1GQ2A 2VHYA 4PZDA 3ADPA 1W0CA 4IDDA 2GN6A 2HKIA 4PG6A 4IS2A 1NWHA 3M1AA 1LDBA 3RAJA 1RYDA 1QP8A 4R1SA 1T2FA 5IZ4A 4ALLA 2JD1A 1FMCA 3LQFA 4FCCA 2HSDA 3EY4A 1B2LA 5HM8A 4IDEA 5U1PA 1JAYA 4OQYA 4Y67A 3FF4A 1PGQA 1NPDA 3TPCA 1E1KA 3H65A 1BW9B 3NTOA 1T2CA 3NKLA 5THKA 2P5UA 4NJOA 1I30A 1ADFA 3ZW9A 3DAPA 4QUKA 4NBVA 1SPXA 3OM9A 3I3OA 4ALIA 3PPIA 3K31A 4TRJA 1LTHR 3DB2A 1NVGA 4EUEA 2OP0A 3DBRB 3RFXA 4ZD6A 1C1DA 4CLRA 2W2LD 1ENYA 4QFDA 5TX7A 2GGSA 4ND3A 3FHLA 3V2UA 2FPIA 4PCVA 2ZJ0A 2Q2QA 4RV9A 1OBFO 3RBXA 3KSDO 3AY6A 3NV9A 3LZ6A 3ASUA 2I65A 2NACA 3QVTA 4CQMB 3NGXA 4DREA 2EEZA 2WD8A 4ID9A 1YH3A 1PGOA 3AFMA 5JC1A 1LBEA 5T67A 1YO6A 2AQKA 1BXZA 1VRWA 4L76A 2NUAA 4RPLA 1WMAA 1WW8A 4W9NA 4AFNA 1V3VA 1WPQA 1KS9A 3JD2A 5C7LO 1F17A 5U9CA 3QVXA 1XQ6A 1WP4A 1C14A 4IY1A 3GVIA 3NUGA 4EUFA 3IUPA 1D8AA 1E7MA 1IB6A 3PIIA 4LVUA 1BVUA 3FWNA 3W6ZA 5KVSA 1KYQA 3Q6IA 1KEVA 3KYCA 4YBZA 1G0NA 4HFJA 2X5KO 4CODB 4J16A 4HXYA 3GNSA 1DJNA 2Y66A 1QMGA 4HFRA 1YDWA 4R3NA 5TS3A 2NWQA 4ONEA 4RLSA 1VKOA 2H63A 1SC6A 2DPHA 4PZEA 2HRZA 4D42A 2H9IA 3WNQA 1P74A 3K5PA 3PP8A 2WJPA 1V3TA 5CDYA 1LEHA 4H16A 3VPXA 2OXIA 2I66A 3NAQA 4OXNA 1Y5RA 3ZZNA 4WECA 3AY3A 4E5NA 1UXJA 2YQ4A 2GN8A 3JQDA 4WASA 2HK9A 2GNAA 3PHHA 1PJQA 1N9GB 3IDSA 3PI7A 2W8ZA 1A4UA 1WNTA 2X58A 4H7PA 2GCGA 1WWKA 2OO5A 1DC4A 3DHNA 4ZICA 2G76A 5BSGA 1BSVA 1NFRA 4TROA 1MG0A 1YL5A 4IDFA 2DBQA 4DPKA 1UH5A 2V6FA 4YEDA 4FN4A 5F5LA 4DLBA 2W4QA 2PV7A 3I9KA 3IP1A 4B79A 4OHUA 2P4HX 4XD2A 3H6KA 3DZHA 1WZEA 1DBVO 1U8XX 3GGOA 3UN1A 4XQCA 5K9ZA 3K92A 1R0SA 3V8BA 3CIFA 4OJNA 3RVDA 3PK0A 3D4PA 1ISFA 1ENOA 4WOJA 4A03A 4TVOA 4E33A 1HDYA 4MVJD 4RPKA 4CM7A 4MVJP 4XKJA 5JNLA 1TA4A 3D4NA 1CWUA 3VH2A 1NQAO 1Y81A 2E82A 1Y8QB 3LF2A 4J7XA 4MVJH 3DXFA 5TSDA 1I3KA 3QWFA 4OAQA 5DULA 3ST7A 4YQZA 3JYOA 5FEUA 3CPSA 2VRBA
chains in the Genus database with same CATH superfamily
3GW8A 3PQ5A 3WNVA 4F2WA 5LQDA 2FPWA 5AH0A 3QVGA 3QXXA 5BNWA 3BD9A 3IQWA 3VAAA 5F52A 4OTZA 2PTHA 4U7JA 4O33A 5FPHA 3NC1C 2PUGA 1GAJA 2YY7A 3DJYA 4L74A 3RK0A 3BAFA 5EMHA 1G6OA 3BN3A 1MC4A 4CFYA 1BXRB 2JFGA 4PAWA 5AW7A 4GE0A 4KXLA 1ONSA 2FPLA 1KERA 3NBFA 5DNAA 1RPJA 1KEKA 1E6WA 1PL8A 3UVEA 5AUQA 1I2CA 1WZNA 2A3NA 4R2WA 4DRYA 5JQGA 2VP4A 4U02A 4P8RA 4YT8A 3ZK7A 2I78A 2IYFA 2WFLA 3OOWA 5AJTA 3EH2A 4J0EA 4AY3A 2ZRBA 2IODA 1UPBA 3SC2B 3QSYA 1F20A 2V8BA 3OAAA 1YVPA 1P7CA 4HPXB 4DS3A 2K4MA 3NBZC 3GUZA 1N6RA 1UL1X 5EVJA 1LLCA 3K0KA 3VZCA 2GN2A 2QAJA 3RIHA 4F4UA 2YYZA 2P9JA 2ZULA 3TW4A 1JXAA 3HM9A 2RC6A 2IFTA 3C45A 2ZRMA 4DCOA 2BR5A 1UEIA 2RHJA 3VKWA 1DQZA 1V8OA 2GS9A 1NF8A 4GH5A 4QXAA 3OESA 2F67A 2FP4A 4W7IA 3MWDB 4B2IA 2RHTA 1U0FA 1RYZA 3CZCA 1NU8A 3F7NA 4JJ4A 2M6RA 1FEZA 1JKIA 4GKBA 4E13A 3DFFA 2CNBA 3OFJA 1RIIA 3PRJA 1SVSA 2ZLBA 4NJEA 4Y9DA 5D5HA 3SLKA 3MHPA 4YRNA 3A1WA 1QX4A 1A9TA 3KZCA 3GF4A 2FUG6 3EPRA 1A9RA 2QLNA 4OOEA 1CQIA 4YMUA 1ODFA 1SA0B 3DFUA 3H8JA 4DDMA 1GA4A 5DCLA 4CL8A 5EXSA 3WRXC 1A9PA 2P2CA 3WRVA 5EJ5A 5I5EA 3W8EA 4EZEA 3UYLA 3F6SA 4UBMA 1LS1A 1UBEA 4DQLA 5IBCA 4L6IA 3WZ2A 4DMCA 2XTAA 3ND5A 4HMQA 2QY6A 1KP9A 4S24A 2VDMB 5KOJA 5EE3A 2O8DA 1KMHB 1N7HA 3BBPA 3IIIA 3CCBA 2EJTA 4JWTA 2XKKA 3ORRA 4FMDB 3VJLA 1BGVA 2WLSA 4QQKA 3HVRA 4CI0B 3BH0A 5KKCA 2HF7A 1CY1A 5ARCA 5TPZA 2CFSA 3K0HA 1IY8A 4QSHA 6Q21A 3OZFA 3OZ7A 3DHVA 5HM6A 1XQ1A 2GCIA 4YO8A 2NV0A 3QF7A 1MN6A 1EPUA 2X22A 1ZPDA 3EYAA 4WOPA 2WWTA 5KYKA 5JQGF 5K3CA 1A04A 1L5VA 5LJLA 5LMNB 2QIOA 4LXIA 3VKGA 3G9ZA 4KAXA 1XBTA 4HQ0A 1Z8NA 2V65A 2GN9A 3AILA 4B81A 2N3ZA 1YFZA 2ALJA 5DTEA 2GBCA 1OYWA 3WKBA 1QOQB 3VH3A 1SXGA 3GRZA 4E5DA 2YBEA 3MSXA 3CNQS 3TRIA 1LPAB 3MJCA 4GPEA 4NBRA 3KFXA 3RIXA 5IULC 1I9CA 3Q0EA 5JJ5A 1W8DA 2VRWA 3M2PA 2UYOA 5DYYA 3IBSA 4NJMB 1CULC 2X0JA 1D4OA 2H16A 3C1UA 2YH2A 2V7TA 4EJ2A 2Q3CA 4PNPA 3WDSA 5AW1A 1V7ZA 2EZ8A 3TJZA 2CV0A 3TLEA 4FTWA 3C3EA 1D4AA 5BRAA 4WY5A 4BAGA 1Y7IA 3W79A 3ANYB 4DDVA 2P2NA 2A2ZA 3DTVB 4I1YA 3H2ZA 4EB0A 4EGAA 2AJBA 3RABA 3SQLA 4MQFB 3GMDA 4Y18A 4MVJI 1JSCA 5I7SA 3EVCA 2ASVA 1OFIA 3ZJ4A 1FP4A 8LDHA 3I0NA 3EIHA 3L7AA 1KMCA 1YB7A 1P19A 1J8DA 4B87A 1JVNA 1OJLA 2BDEA 4KRYA 4KO3S 1Q1GA 4C4OA 1UK8A 4W5NA 4NAHA 5I4CA 1RACA 4IICA 3A3PA 1EFPA 2PD3A 1DLJA 1HLPA 5AW2A 3PE3A 1N25A 1ZJ6A 1BROA 3N0VA 2BLLA 3AG5A 3SICE 1T4CA 2WJGA 1YZYA 1T0JB 1TLFA 2Q45A 2ZYDA 3FPKA 4DCUA 4JB0A 2C4TA 5CRIA 1VI5A 5JIBA 4RIIA 3ZZTA 4E70A 5JQGB 4V0NA 1Y1TA 1GTL1 2VK1A 2FOXA 4G0QA 4JHXA 3DP7A 4DIFA 5HQ3A 1CDDA 1DUIA 1HE4A 5ALMA 3L6DA 4TWIA 4FINA 4WXHA 4UFOA 2VO1A 2A0FA 4XCVA 3UAGA 5K5EA 5FV4A 1I0ZA 1E5XA 1T2VA 2DUUA 2P65A 2YV4A 3LC1O 1Q83A 4LDPA 4MPPA 3OEHA 4AKTA 3EVEA 3SX4A 4B3DA 1DC7A 1G8MA 4DLAA 4YUWA 2O2GA 4PXSA 4ZO6A 3AVVA 1EUZA 5J2UA 4BNDB 4K1XA 3WRYA 5ALEA 5D3ZA 3PX7A 1FTGA 4K2HA 1TA9A 1O0SA 3GFRA 4V0QA 4M9ZA 1Z5UA 1EZ4A 3TSCA 2HCFA 4D3XA 5KU7A 3H2GA 1NBEA 2GUGA 5ITSA 4G1CA 5EJ4A 3AERA 3GJTA 3ROQA 3TNYA 2IEIA 3K9LA 1ONOA 3AI3A 4IJQA 1EIZA 4NPAA 2B92A 2X41A 3QX9A 4ZVMA 4DM3A 1ACMA 1PSDA 2VQSA 5IKXA 4QJ5A 3ROXA 3L84A 2AG5A 1FFCA 2JLCA 3GLVA 3H4VA 4Z4QA 1Z6ZA 5I7FA 2R00A 3NM5A 3PGMA 4FS8A 4R84A 4AF6A 2REQB 2FR1A 3IRVA 5BSFA 3SIWA 4DDHA 4PN7A 2CNOA 4KE8A 4HNGA 3RS9A 3HVUA 2P6RA 1RLIA 2NXEA 5CMLA 4GQIA 5I9TA 2ONKA 2V9ZA 1BCRB 1PR9A 2W9XA 1Y9EA 1RPNA 1S6YA 1QIMA 4Y2RA 5DBFA 5HRUA 1HF3A 2RHWA 4Z9FA 3CWQA 2FNAA 2PEYA 2A5GA 1R0RE 2KSQA 5ETJA 3RFVA 2HQOA 4MI3A 1I2MA 2CF6A 5KQLA 4KDRA 2GN0A 1M7HA 2IGBA 3PUKA 3H4TA 4GXRA 3A6EA 2F8TA 5HF8A 5KYYB 3PQFA 3QBEA 2VK2A 4LFAB 3KWLA 3GK3A 1YQEA 3L4SO 1E3MA 3HDVA 4ESVA 8ABPA 3GGDA 2O8NA 4CQLA 2O5RA 1NVEA 4FT2A 4BV8A 4HRAA 2Y2UA 2DBRA 1SVIA 3NX4A 4Y2JA 4HH1A 2IYVA 3OKFA 4P7GA 2DETA 3ZJVA 5K8LA 1II0A 2BRUC 4DTCA 2GFQA 1HDGO 4KQJA 4P3YA 1VBMA 2P4EA 1J2UA 4ZPJA 5DHAA 2BGNA 4I9UA 5M3BA 4R7GA 3F5MA 5AKGA 1TZ2A 2ZS7A 4F45A 3HDYA 2V0NA 4EHBA 3NP7A 1A2OA 1T1EA 2NO1A 4C43A 1Q1EA 1RPAA 2GA9A 1E9EA 1YOVB 4GLLA 2GLXA 3NCTA 3AVQA 1E9FA 3L0CA 4OFZA 5ESDA 2QT1A 3L49A 4C22A 3GWZA 1ENPA 4UAJA 5HIJA 5G0TA 3BQMB 4B74A 3OICA 1WMDA 3SQMA 5JY6A 2GX6A 5HCIA 2AEFA 3B6JA 1O2DA 3R77A 4NNOA 3F5FA 3CIOA 3TZLA 3DO8A 1CB7A 1Q50A 2GEJA 3W5VA 2YKGA 3E7PA 1TOAA 2FSVA 2W6PA 1R0YA 3K2QA 3EXEA 1ECJA 4RL4A 2D2XA 5NLLA 3V2HA 3C6KA 4GR9A 5LU8A 1F2DA 1R4AA 2HZBA 3L8HA 4C78A 1WB9A 4KUGA 1MA3A 1Z68A 1YKGA 4AJ1A 5AVUA 3GFBA 3PL1A 4GBED 1D9ZA 1UBRS 3VKFA 4ND4A 1U2GA 5E2IA 2C5EA 3OF2A 1VLQA 4GUDA 5GP1A 1IHDA 1MRZA 3AM4A 3P71T 3WFZA 5IASA 4DM7A 1AK1A 1P2DA 4HN4B 4FLEA 5G0VA 2ZUBA 4UEJA 2EF0A 3TR0A 2O06A 4J0KA 5C80A 3FMOB 4OI0A 3WYBA 1JHQA 4GXTA 3GJSA 3VR3D 5C7YA 5LYYA 1U04A 2OGZA 4KREA 5DRTA 1PKEA 5HFAA 3CN9A 3FYUC 1ZUNA 4CBVA 1JDNA 5TQJA 4DFDA 3SVLA 3A2KA 3SBXA 4AROA 1IAQA 4GYWA 4DADA 1QDLB 1F12A 4CWAA 1NF3A 2PT7A 1HKHA 1Z6QA 4D97A 1D6NA 5HQTA 4G56A 2BFAA 1KI2A 1HSOA 3B7PA 2ZM6B 1DT5A 2EG9A 2HUPA 4JZYA 3VDMA 3JQEA 1PWHA 1JEAA 2D1RA 1XD8A 2RGBA 3AY7A 4QO7A 1C1YA 1M76A 1FFSA 2EWVA 3CISA 3QPUA 4E07A 3R0XA 4ZEOA 2C07A 3GH1A 2PMBA 2VF8A 4IUDS 1J56A 1SQGA 3GARA 1J07A 5J2UF 2YN2A 3Q88A 4BNKA 1W0KD 4M22A 1RP1A 4OM8A 3COZA 3OF5A 3PXGA 3UMJA 3N8KA 1OUMA 2CVZA 2GZ3A 5D5QA 1R4NA 2P6MA 5K2OA 1HNWB 4QVGA 1K5GA 2WJYA 1DQRA 1K06A 2ZJ8A 5FUXA 4H7DA 2C98A 3U6KA 4PZAA 4TTRA 2ZRNA 4EW1A 2H11A 4WKOA 4HXGA 1IN7A 4U0KA 3VPAA 3HYTA 2I9PA 3EOZA 3R3YA 5I9NA 1QQ6A 1WXHA 2MDTA 2RHHA 1JL3A 1K8RA 3O4GA 1C8BA 2JZNA 2PX5A 3K7EA 4XZ3A 5FR1A 2NU8B 3T7DA 2Q5QA 1G5QA 3VVMA 1HG1A 1QH1A 3CRRA 3NZEA 1G5IA 1OD6A 2VAMA 5C3UA 5JYBA 1B0PA 1P4SA 1DCFA 4RMGA 5IYZF 4JB2A 3WLPA 3KQVA 4JKYA 2H1HA 5KDLA 5KINB 2Q0SA 1E1NA 5IUJC 2GDJA 4FLFA 4S1OA 5JASA 3O4HA 1XRNA 1ZK0A 3MC1A 4TL8A 3WJAA 4B31A 2NV6A 2VYQA 2AXNA 1G38A 1KI3A 2HMYB 3TPFA 5K20A 3M1LA 4U7GA 1XD2B 3QM1A 2JGLA 1XVLA 4LJ7A 1T9DA 4BEVA 3Q3CA 4L22A 3NATA 5JXHA 1X7XA 2Z5FA 3P97A 2R25B 3ZQUA 1LNZA 2YWJA 4L9WA 3FGOA 2X0IA 4M1KA 4X1YB 4X71A 5IAGA 4JUAA 1N3LA 4C7VA 1QGUB 3ICOA 4E12A 4MHOA 5IN4A 4HLCA 1ID8A 4UKDA 1I3OA 1RM0A 2Z98A 2YIJA 1B1CA 4AK9A 2J3DA 4RGVA 3L92A 4BNYA 3WIEA 3AOEC 4B75A 4P98A 2XDAA 1BEUB 3L1IA 2FSVC 2VC2B 3FLEA 2VPZA 4MAMA 3AFNA 2J3QA 4TM7A 1W47A 1JQEA 5CITA 2B2NA 4C4YA 4XOUA 2H48A 2ZWVA 1U8ZA 4NULA 4RXUA 3RRBA 2WAXA 1DLIA 2HTFA 2NO4A 3B1FA 1SUEA 3MUEA 1NJ6A 3C8DA 4IP0A 2FAXA 1H3EA 2QK4A 3KSAC 5T5QA 1QYWA 2AIRA 1IBRA 4GGMX 5A3VA 2PIDA 3PHBE 2W6ID 3BMQA 2Q7DA 3RR2A 3KEGA 3JVEA 4JFRA 4UUOA 2JKYA 5FOXA 1DJOA 5BXYA 4JP8A 1Y4AE 2HCTA 4BZXA 1E66A 3EXAA 4R16A 1PJ3A 1TT5A 2GTPA 1MCZA 1SHZA 4IOLA 1H05A 2Q4DA 3NORA 4C7JA 3ZGZA 1J24A 2ZQYA 4US1R 4CYMA 3FMGA 4L6AA 2HQBA 3A9TA 3OIWA 1TZKA 2QTHA 4YGXB 5LIRA 1UWKA 2Q07A 1GRQA 3KJQA 4FGZA 5REQB 4OKIA 3THRA 1JSLA 2YNMC 3KKPA 4U2GA 3ZHSA 2FJPA 2XGJA 4I99A 1ESDA 4PAGA 1FFGA 4QNMA 4A26A 5A06A 1A72A 1ZNZA 1XRLA 4JSYA 4AZ3A 2Y0CA 4RMJA 3I1FA 2EG5A 4GI1A 1KI9A 1DT3A 1X80B 9ABPA 4QREA 5AVSA 1JPUA 5FP0A 4OKNA 2O3TA 2TMKA 6AT1A 1Z38A 2B8TA 4M88A 3QK7A 1NBMA 1LQUA 2ZTMA 2COKA 1TT5B 4H15A 4H77A 1VI2A 5J3JA 2IE0A 1XKQA 2F1IA 3OOEA 3PLNA 4F9EA 2V0GA 2OKCA 4EP1A 1GP2A 2VRCA 4RESA 4BKRA 5JNTA 1G9XA 3EMVA 3CLRC 1TI7A 4YJHB 3ZIAD 2YV1A 2X0EA 1P9WA 4DAOA 3M4YA 3B5EA 4DMGA 1YZUA 3KD2A 4OP1A 1KMHA 2JEYA 4HSEA 3ZQJA 4EIWA 3GLIB 2NP6A 1GL6A 2ZAMA 1R9MA 1E32A 1W1WA 3OQJA 3R8XA 2C7QA 4X1KB 4A0GA 5IDWA 2QLJA 2IPNA 3KETA 4NS4A 2XNCA 2OC9A 2Z08A 4BO5A 1TC1A 4R7ZA 3ZQ6A 3MTGA 3OLXA 4C07A 4ZMSA 5TLSA 2QD2A 2B3DA 6YASA 5E1OA 1DKUA 4IR7A 4PYNA 1GVNB 3ICPA 3VHQA 1W49A 3QUBA 5GAJA 4DUGA 4JAVC 2A9VA 4HNHA 5ITWA 1XZCA 1R8QA 5EC8A 1HQYE 2OLJA 3OTGA 1EEXB 2W4MA 2RBEA 4F7DA 5KU1A 1PJBA 2PJRA 1GPH1 3SGLA 1CUHA 1NXWA 1YA8A 2FW0A 4N5HX 4XLTA 2OQVA 1WUYA 4BP8A 4GOOD 2J33A 3HGQA 3K0AA 5I4BA 1QP4A 1OVMA 4WCDA 5FYQA 1QHNA 4D0LB 4HBGA 2WUWE 3FB4A 3MGAA 4WZBA 3WAJA 2YXNA 2FU5C 2AR0A 4GS5A 4MV1A 3MD9A 3A8TA 3PUWA 4LJ5A 4PZUA 1AZTA 2O2YA 4R68A 1DUSA 3DTYA 4FI3C 1QJ4A 5FUVA 4BQIA 3WGMA 1M6VA 5EIAA 4FPXA 4N6OA 1WABA 4QC2A 4UARA 2B1QA 3O93A 2X2EA 1TIPA 2EQ5A 3IMCA 4JBXA 4KR0A 3WOHA 4H7KA 1N0IA 3BTUA 3BIFA 2HTEA 2JA1A 4JASB 1W36C 4JU9A 3PYXA 1QB8A 4G01B 4JKOA 2C7PA 4YRSA 4KI0A 1SIWA 4R8VA 1NC3A 4FQ7A 2GPAA 2HU2A 4PIMA 2ZYHA 3WO0A 2VP3A 4HVAA 2YS7A 3C70A 2YN0A 3AEQA 2PBZA 2CCGA 3F46A 2ZJ2A 4KIWA 1IVSA 2Z6UA 4BY9E 2BH2A 2WNSA 3PQ3A 4RCVA 4RY0A 1H5QA 1RE0A 2ZUCA 3DL0A 1AMNA 1R4NB 1HNXB 3BS4A 4D9HA 4MYTA 4DOMA 1L7XA 4IJKA 1WAMA 2HWKA 3OWHA 4R9VA 5HIMA 3REQB 2H8KA 4HAUA 2IV3A 4MH0R 2QLTA 5ELLA 3GP8A 1WY7A 1T8WA 1TJYA 3MT8A 1N5KA 2HRBA 2W2QA 3NM6B 5L3QB 2FA9A 2P78A 4OH1A 1YCHA 2VK8A 2RB4A 2ZVQX 4RE6A 1J1UA 3GH3A 4O2RA 1R9NA 3WYFA 1QTRA 4EX6A 1Z2PX 4H1VA 3UB2A 3MTIA 4NV0A 2F4VB 1ES9A 4NXMB 4HGQA 4TSRA 1I80A 1TE2A 3BGSA 5SZJA 5EJMA 1RXUA 1PFVA 5DBGA 1IZYA 2QE6A 2OHXA 2E55A 2QPOA 4HO1X 2OKGA 2EGHA 3IUYA 5FADA 5H82A 5AK6A 2C2OA 4DCJA 5AOVA 1PLKA 2XTZA 5U4QA 5FV7A 1D1TA 3LLSA 1LSUA 5KOYA 4M7RA 3PNKA 4V3CA 2CSUA 3PI6A 2D1QA 1BMTA 2C2WA 3EGDB 4MR8B 2RHLA 3DAHA 1MG5A 5SY6A 3RVKA 4HFMA 4AP5A 1GKLA 5CDSA 3I04A 1T9GR 2Y99A 4QQ8A 1TMYA 2ZJ5A 4WXEA 4J1TC 2BBOA 4DA9A 1J8YF 4FUTA 1A9XA 5DNDA 4IHQA 2F9MA 4RAOA 4UNSA 2E2WA 3VR3A 4G25A 3C48A 1PK9A 2PLNA 1PJLA 5ULLA 4A4DA 1UXHA 2QLFA 2ZE8A 3E6AA 4CV0A 4YUVA 2C5GA 3UAVA 3U1BA 4WKCA 4PG8A 3VR6H 1JFSA 3IPXA 5E2BA 5FA8A 4XLZA 4IRUB 4E31A 1YT5A 3QPDA 2WIAA 3FUVA 5KHLB 1UKEA 2ZTVA 2EF1A 3WL3A 5F2KA 3AEYA 2PKWA 1QZUA 1ZC3A 2Q8NA 5BUQA 1J39A 2ISQA 3MJVA 4WDRA 3W8DA 4LGCA 3T54A 5ALZA 1J97A 1Z7EA 3DZGA 3F5DA 2WUFA 4CM4A 1P3Y1 2X7HA 4B3TB 1NI4A 1ABBA 4PX2A 3GFGA 3WB1A 5FOWA 3HXMA 2AOUB 4RGBA 3BX1A 1W0KA 1Y1LA 4DR5B 2AN1A 2ONCA 2X1LA 3F90A 1XZKA 3EQ6A 3FCXA 3FTDA 3ZWVA 2C7GA 3I8SA 5DWQA 1OV6A 3HDJA 3T15A 3T1NA 4QHSA 3H3XA 5JT1A 2BDTA 5IHPA 3FPEA 2ZAOA 4A82A 2W2KA 3AEUB 2BR3A 1MXHA 1YUBA 5BSMA 1MTOA 3K8OE 2PV0A 4IDHA 3THXB 4CQLB 1OXBB 2RFLA 2Z4TA 4IWNA 1US8B 1OF1A 3PWSA 5JLAA 1E2UA 2X42A 4JI0B 1JHOA 2ABWA 3MRTA 2RKBA 4S1VA 4QE3A 3TDKA 5GJWC 121PA 2WI8A 3IJEB 2UZ1B 4JI7B 3QVWA 4C08A 5DLQC 4A6DA 3OJ0A 2YRXA 1NFQA 3KEMA 4C01A 5IP5A 4MYSA 1H5UA 4LE1A 5DYNA 1RU3A 2ZJ1A 2DHRA 1XHFA 5GOZA 1K97A 1CYDA 4GICA 3UMGA 5EZSA 3H9GA 3TKYA 1KH2A 1Z16A 1Z2AA 4AWAA 1PQUA 4OHMA 4C0BA 1FQJA 1D0IA 1UZLA 2HK7A 2OILA 1KMIY 1QZ3A 2C1XA 1BHSA 1XDGA 4JJFA 3WS7A 4MVJG 3LI2A 4Z3DA 3KXDA 2F48A 2F6RA 2NVUA 3QELA 4ILEA 4JMLA 3VNAA 1JIUA 1BQ4A 4QG3A 4QARA 4O4LB 4X41A 4L5CA 2VBFA 3KK0A 3MS2A 2V6GA 3BQ9A 4Q1CA 1GLNA 1P2FA 2UDPA 5FI0B 4B1FA 3EX7C 1PJTA 2PFGA 2Z4SA 3A6ZA 4D8TA 1KPHA 4JKIA 1TNDA 4CU5A 4FDLA 1CEEA 1JTFA 3D3JA 3G0HA 4MV0A 3KUDA 1LPPA 3S28A 4KIFA 4WK4B 4Z4FA 2WF9A 3C5HA 1NYTA 2Z2JA 2ZSBA 2L42A 4FYHA 1ZNQO 4L27A 1HFWA 1Z74A 2W7TA 3L8GA 2FOLA 1TMKA 2QVYX 4L50A 2QUAA 3V1YA 4GLFA 1J09A 3K35A 4KK3A 4ACBA 1RWNA 3RFTA 4DIBA 2HWXA 3MJTA 1TVKB 2Q5JA 1XDSA 4Q3DA 3FUCA 3OQPA 3PR2B 5E1MA 1C4WA 1X1RA 1DQSA 3ZHTA 5IT5A 1HWYA 3IPYA 4TZKA 2JD0A 2VT3A 3K20A 5TMBA 4Z4HA 5B36A 4XWWA 2V4ZA 1E3JA 4UU8A 1TGVA 1RW4A 2N1BA 4TTQA 2TMGA 4EENA 3CRMA 2E4UA 4PHCA 2XSZA 5H3LA 3EIQA 1A8PA 3QQPA 5AJZA 3IAHA 3S27A 2N42A 3L8DA 1JUDA 3EIUA 1QP7A 1B41A 5CVCA 4C06A 1OYOA 3U44B 3R09A 3WA6A 1N7GA 2GD0A 4BGEA 8ADHA 4AS2A 3KG2A 1JWBB 2O0MA 2FX3A 3MPUA 3QYJA 1V25A 3E1GA 4I1RA 1WL8A 4Z0PA 1CC1S 1GKUB 2F2TA 3HADA 4X6LA 4C0JA 3V8VA 1CR1A 3F98A 2FEPA 3T5AA 3DL4A 4YUZA 5CAEB 1UAGA 5EIXA 2ILTA 2MU1A 2ZRGA 1BDBA 3W7VA 5JU6A 4ZYUA 4M9CA 3KOMA 1T10A 4PG5A 1FFXB 1SBTA 4AO6A 1Z34A 4TVSA 1T6YA 4S0XA 2ZYAA 4J07A 1B3RA 3NU1A 1HT2E 2IIPA 2C94A 3SJ7A 2OFOA 1P77A 2G63A 2ZI3A 1NBMD 2RGNA 3HBNA 4RX1A 4FQ5A 5K3AA 2QTCA 2UUBB 2QJWA 3DBHB 4HYTA 5IJWA 3MJDA 1NQWA 3G3EA 4YWJA 2AI2A 3EXHB 4I5DA 3ZWWA 4TWAA 2IJGX 2J31A 4WFIA 2FFHA 5F33A 3RYIA 4E08A 3SE7A 1KEUA 4RVSA 3CVJA 3ZN2A 5CURA 1ZESA 4BEWA 5D1HA 1DAMA 1OBOA 2ZVPX 1JU3A 4AU1A 1YUNA 4L5YA 1ZBDA 2D4HA 5CCDA 1MEJA 4H31A 1QV6A 2XODA 4JVLA 1OZ0A 5L3VA 2X9QA 4F9GA 4LDRA 2ZBVA 3T5CA 5IDVA 4EG6A 5K8JB 3EDQA 3N87A 1I4DD 1UJCA 1HY3A 3I32A 5JRJA 1IU9A 1UCFA 1COWD 2PANA 3VA7A 1TYBE 3UMMA 1AZSC 2PZBA 4MPTA 2JI8A 2XUHA 3RTGA 3UV7A 1LQTA 1WUKS 3H2JA 4EL5A 2QSZA 1TEZA 3PJRA 3S70A 2IYWA 1T4CB 4GPTA 2NQ8A 3UJHA 4B7UA 2ZSFA 3GVHA 4OX9Y 5AW3A 2JAWA 2ZJFA 1R5OA 4QG7A 2BIFA 2HFKA 3CHYA 3VHLB 4K0KB 4CG0A 1VSUA 1V9LA 3LCJA 5J40A 1VDZA 2IW1A 4QBIA 5GQSA 4IO0A 2R1TB 3ET5A 2VJOA 5K4HA 2W98A 3PFBA 1T6ZA 4WCFB 4DHWA 4ZDIA 3E8XA 3LJKA 3ZK9A 2OCIA 4MDFA 4MARA 4ALKA 2PVSA 1DJLA 1ZN2A 3S3TA 4CUKA 1BFUA 3WAGA 1GDDA 1P4AA 4QXMA 3VR6A 1J25A 3C85A 4U1RA 3A1UA 2O1WA 3DTVA 4ZFNA 5BR1A 4UBOA 4ZI2A 5CCXA 3OEHD 5A7FA 2IDZA 3EVFA 1VCMA 1ZY2A 1TQ8A 4UXIA 1AGXA 3P9PA 1MQSA 2P9CA 3HACA 1Q14A 2FH5B 2YFQA 2PS0A 2A67A 2QM8A 3C8ZA 4HAOA 1UBOS 2H0AA 5KNDA 2C2GA 5J1TB 4YMSA 4CCYA 2OXEA 4KPUA 3PC2A 5BSUA 4HZUB 5AVJA 4TRMA 4M99A 4E2YA 4LSMA 1PP4A 4IIHA 1E6LA 4PRYA 1AF7A 5J2TA 1DOZA 3FETA 4L2IA 2WIDA 3GDGA 2C7BA 3EBOA 5J4KA 3IT1A 2G3YA 5C8VA 4ZMRA 2ONYA 3FDFA 1SA0A 5DCUA 2BMWA 3GZTB 3ER9A 2HRQA 3UMCA 2OD7A 1SBQA 2IEYA 4AURA 1E4OA 3AR5A 4CCYB 3NKVA 2O57A 4HFNA 3S0JA 4IG9A 5H4GA 3RYCA 1GA6A 4UMDA 1ODCA 1O4VA 3RC2A 1SRRA 1B00A 1EGVB 1GZDA 4D8UA 4DCSA 4Q7MB 5FLKA 1CUJA 3LTNC 1OYYA 2RGDA 4MR7B 2Y1OA 3IQEA 2GXQA 4POOA 2A5DA 4FYWA 3WI7A 3OCUA 4LBYA 4UC0A 1HRKA 2BEWB 4AN0A 5M7EA 1SC4A 1CUCA 4IXTA 3B9BA 1I5OA 1NX9A 4LZZA 5EWJA 3ZW8A 2QD4A 3MJ4A 2J7PA 2JK0A 3Q5GA 3ZDQA 3DC2A 1FF9A 3LCUA 3M8KA 5K45A 3VDNB 5BR4A 1E1MA 2QUZA 1PQ4A 1AGNA 4MVWA 2Z8YA 5AOBA 4TV9A 2VN8A 5AT1A 4F46A 1A3CA 4HZUA 5K4AA 4EYGA 5AKLA 3LOQA 4DV7B 5EIHA 3R40A 1EK2A 3GUCA 1AZWA 3CS3A 4IVPA 3E1KA 3S1AB 1X6VA 5EMJA 1SKBA 2H7CA 4ICIA 1XK6A 1HL7A 2AD5A 1QGZA 3QEAZ 1ZGAA 1QAQA 1RR6A 4C29A 5JMOA 2ANCA 3C39A 2JJ2A 4HI0E 1Z29A 3AM5A 3PDJA 2FWJA 2EX0A 2O1SA 2VWQA 1YQDA 3BJRA 4FC7A 5LLDA 2PS1A 4MVYA 5JJLA 2AC2A 5C1DA 1TO2E 1WV1A 1NIPA 4DNXA 1NBOA 3IXMA 4G1BA 1EM8B 4Q1AA 3QKTA 2X8BA 5H4HA 1WETA 1UKAA 3EW7A 3I05A 2YWRA 1U2DC 4HMOA 1C7ZA 3STUA 4F4CA 4FW8A 1D5WA 1S9HA 3VVLA 1LW6E 3ISJA 3RSQA 1KOGA 2A58A 1IONA 2ARKA 1N5DA 5G0WA 3D2CA 3KVNA 1V39A 4NZOA 3O47A 4ZT5A 2OBXA 4GYJA 3LC2O 3KKOA 1QPBA 4YY3B 5CFPA 5TPZD 1MAAA 1JKFA 2VH2A 2O5EA 1JECA 2CEKA 3T7RA 3VM6A 4NMMA 5BNIA 2FN4A 4WBNB 1TCVA 3THWA 3LT2A 5IN5A 1NBAA 4EK9A 5CX1B 1GNQA 1RHRA 5KWEA 1F06A 2YBDA 4G8BA 4DM4A 1FCJA 3H75A 4H35A 1ADJA 2W2PA 3IURA 4WLOA 4IDCA 3LHFA 2IV2X 3HVJA 1JA1A 1KI6A 4IGAA 4TPKA 4WBSA 3R8FA 4UJ3A 5B6PA 1GN8A 1YTUA 2RIRA 1VL8A 4JBIA 1VJRA 4PNHA 5A0TA 4F2PA 3ZIDA 1K1EA 5E2AA 4EG3A 3SIPA 1MIHA 1W4ZA 5D1NA 4WRRA 2H9YA 2XVAA 4KWTA 2X5NA 3KDAA 4RTPA 4MP6A 4MYHA 1AGRA 2Q4OA 1BXGB 2JGIA 5ARDA 4E5PA 1J33A 1NLZA 1O6BA 1COZA 4GM0A 1KBQA 3GVXA 1RQ7A 3QFHA 1FDIA 1WCYA 2O4CA 2EZUA 3HS3A 1XXHA 1CUVA 2VT2A 3IDQA 3JX9A 4HB2A 5KNBD 2AQ8A 4YONB 4QDOA 2DQ4A 5A4AA 5BSWA 4AM8A 3DYVA 5KCMA 2AMFA 1JKJB 3A4YA 1GGMA 3DV0B 1ZGGA 3FBWA 3MTAA 3USZA 2ZT7A 1HZZC 4DLXA 2V7UA 4M8KA 5JS2A 1T3ZA 3UMRA 5FUYA 2HEGA 2YYYA 3EXIA 5J5AA 4M2LA 2WYIA 2OV8A 3H5LA 4HC4A 1UP6A 5HF6A 3OOJA 2EW2A 1BU8A 3PWZA 5D6OA 3MOGA 4JK3A 5L8VA 2B7CA 1XYVA 5IBPA 3RSGA 2AK3A 2QRGA 4EMTA 2X77A 4OH7A 2WHPA 2AZMA 3A36A 1CF4A 3LNCA 3TSZA 4Z1MD 2E0IA 2C5LA 2IHTA 4M1SA 3ROKA 5TRTA 2ZCUA 1C0PA 1N1GA 3W2TA 4FZ3A 4MMZB 5P8WA 1C2TA 3TW8A 3HCNA 3EQ7A 5E95A 5C1IA 1NR5A 2YTZA 3DT9A 2FZCA 4UHJA 4YI3A 4WJLA 1H5NA 1QYRA 2WKQA 3R3XA 3HB0A 3MMSA 1X8LA 4GQAA 2R8XA 3F8SA 3IP7A 2DSNA 1RYMA 4ZVSA 4ZPXA 3RS5A 1KVUA 4GMKA 5LA6A 4KQMA 2FLKA 1VM6A 1W0JD 3RC3A 1MZVA 1NPTO 1U11A 4JVSB 3K6SB 2VT6A 1EFAA 1ABEA 4O08A 1D07A 3IA2A 4O4LA 3R4CA 1J8VA 3UOAB 2A1TS 3I9JA 3WGHA 3V42A 3ICQB 1VP3A 3IMKA 1T8SA 3N53A 1JR4A 3AU9A 4JLVA 5C34B 2Y0PA 3TSOA 4BNUA 1SCUA 3O4JA 4RAQA 5JJCA 1XO1A 2CHUA 3VU8A 1NNEA 1NI4B 3D7KA 4RH0A 5HS6A 3DAFA 1MENA 4N76A 4RW0A 2HT1A 1S3IA 5FL7A 4Q12A 4K6FA 2VNSA 1P72A 2GPYA 4GWGA 3WRWA 4YH1A 2ZYTX 1E9BA 4HJRA 4KMSA 3STYA 1GN9A 5BWMA 4CEIA 1K4YA 3R76A 1GGHA 2XXAB 5EINA 1YE5A 3HMQA 5FFFA 1X7YB 3JD4A 1YIOA 4QRHA 2BC9A 4O4LF 3KWMA 2Q7XA 3SZUA 3KCNA 3MRVA 2FE1A 4TKLA 2WWVD 1XJWA 2ZI4A 2AG8A 3F8WA 3LW7A 2GK6A 2ORYA 4BVBA 4K7JA 1YMQA 1YBHA 4CV1A 1QLHA 2ERCA 4YV1A 4DMLA 1N9GA 1FU4A 3NNSA 4G6ZA 3H0EA 1LRLA 1XZEA 4AJLA 3NWBA 2Y3IA 3KYJB 1PQYA 1XJCA 1FVFA 1KPGA 4PYKA 4TXMA 1NY5A 3BA6A 4QOIA 3UB4A 1STOA 3TLGA 4B3HA 5K8CA 1MO3A 1ZG3A 2HF9A 3ENVA 3BD7A 4Q9IA 3B6EA 1ML3A 3BWXA 1CT9A 4LX8A 3H8SA 4DJTA 2VNHA 4HTFB 3SN6A 3DQZA 5AM4A 1MUUA 3EZ2A 5EESA 4LNUB 5IJXA 2CZCA 4KWCA 4NONA 3E3AA 3D2LA 3CW8X 5CX1A 2QRVA 2EKLA 4CM6A 2XDQB 1RKBA 1XHEA 4B83A 3THWB 3T4XA 4WVLA 5K51A 1E5LA 1G8AA 2RB5A 2ZIEA 3QBJA 5AYVA 4WLUA 2I8CA 3CG0A 3CC8A 2QD1A 3VZSA 1BDHA 4V0KA 4MI1A 4XYMA 3BFVA 3I28A 4LPKA 1Y33E 2YMLA 3K9NA 4ZTBA 2L18A 1T2AA 3M3DA 3IPCA 3WL6A 1G19A 2BM8A 3GUHA 1WZIA 1J23A 4DA0A 2G6BA 3HRIA 3H99A 1LKZA 2EU8A 4EHDA 2W2LA 4C3UA 1O97D 3HBFA 2PDAA 5G1OA 1RWKA 3AR4A 3UA4A 4BFSA 3FKQA 1JF8A 4HOYA 5TMDA 3UTDA 3AKYA 4YCDA 4YAFA 3S1LA 1NJ1A 3QV1A 2DSTA 2Z83A 4N49A 4UASA 1U31A 1FSGA 2WT8A 5MN5A 3QHAA 2WJVA 2HHCA 2PVCA 3LY7A 5HIIA 2BTEA 3AVYA 1IIRA 4NEQA 4LHXA 3DEAA 4ZU1X 3QW2A 1WSBA 2P9TA 4BZZA 2BGMA 5KVAA 2HBQA 4AKEA 4D74A 4FMCF 1GSIA 4RENA 1K92A 4AJOA 1AX9A 1M6NA 4PVDA 3W2FA 1VA4A 2X1MA 1KOJA 1XR3A 2ATIA 2C9BA 1KEEB 1ZIXA 2OVFA 1QWOA 1TM7E 5TEVA 1ISPA 1OXXK 5IXYA 4MWCA 1RLOA 2WU4A 4JNKA 3V8MA 1O5OA 4OBBA 4WACA 4HQRA 5T3YA 1M73E 4KNVA 1OYVA 3FNGA 1Y7HA 4F4IA 3GO4A 5A9TA 1BN6A 4LW8A 3QVSA 3P5SA 3EVBA 5G2OA 1VPEA 2G08A 2OHOA 3R7DA 3VMMA 1OOEA 3NHRA 4MIYA 4P7BA 1JKXA 4WNAB 2C9CA 2DKOA 4BCCA 1YASA 4C04A 4NARA 4E6PA 4KE9A 1X86B 5LQRA 3R5HA 4U39A 3O2SB 3U49A 4FEEA 4PEVA 2WD9A 4YHBA 1EM8A 5DM0A 1VFNA 4PSCA 4UMFA 1LTKA 4QDUA 4MR9B 4PC1A 1I4LD 3OPXA 4RM2A 5E4TA 2VPXA 4LF5B 4DABA 1E3WB 5DGTA 4AF7A 1O95A 4HD8A 2JANA 3O8BA 4MUYA 3STXA 3A1DA 1MO5A 1KC1A 5CA0B 2FQQA 2WSIA 4O59O 4UTZA 5A9RA 1C2YA 1P61B 3ZHXA 4TZ0A 3BMNA 3HA3A 3F4BA 2ACWA 5CDFA 3F6PA 4KLRA 3BDAA 4JT8A 2AT1A 4NEGA 5DASA 2P9EA 3C8MA 1X8JA 1TDJA 4N3AA 1MORA 3GPCA 3IT2A 3JRXA 1SNYA 2HNKA 2W6JA 1LDMA 2O0KA 4MUEA 4YJHA 4E1AA 2EKPA 1ULZA 4ZZ0A 4JR0A 4NV3A 3H17A 1OWOA 1PGJA 5KTNA 5J63A 1RLMA 4QRDA 1HT1E 4BMDA 3LBAA 4KOEC 4NBUA 4ZIRB 4NXNB 3TAHA 4KXXA 2C31A 4DLZA 2Q7OE 1U0EA 2FCRA 4EAQA 1VGVA 4QVIA 3ZHCA 5EWJB 2YZMA 3NHJA 8MHTA 1R6AA 5ALRA 4O4JA 3HJRA 3GFTA 5ED0A 4DMKA 3L1KA 3C3BA 3A7DA 5E1DA 2JBHA 4LEIA 4WX2B 3IAAA 1Z4QA 3QGMA 1N3YA 1V1RA 2PGNA 4INAA 2K2WA 3OZEA 1U7OA 3KZ1E 4JCCA 2H3EA 3NIFB 1KF0A 4COOA 2NZWA 1X8XA 3AUFA 4G5YA 3ETGA 1P80A 3H3JA 3I12A 2Q46A 1LI7A 2VL7A 2ZRPA 1Z6TA 2BMJA 2IPXA 2XQKA 3JALB 3D9QX 3L8ZA 3O0TA 3IUMA 5PNTA 3RREA 4DA6A 2NSYA 5CUQA 3Q7QA 2FN9A 1ZHFA 1VE3A 2ZEJA 2W71A 4ZC8A 1TTPB 1MAWA 2CL0X 5TE9A 5CDGA 5KX5A 1OE0A 1M9NA 1JG2A 3DZJA 1NULA 2DF8A 4YROA 2ET6A 5EXTA 4XPIA 3EDRA 3A1VA 1FC0A 3W9BA 3HZHA 2EQBA 3MN1A 4WKBA 1G66A 2OHJA 2P1RA 1YUMA 2IPAB 2VNKA 4M6WA 4REQB 4PONA 5JZMA 4B3RB 2O8EB 3D1VA 3GPIA 3LVFO 3KHSA 4JBLA 4DJFC 1F8UA 4YRKA 4H1HA 4UHDA 3R1IA 4WOBA 2ZSJA 1JH9A 3ZCXA 2O48X 1L6IA 2XHZA 1V3QE 2NTYC 1RMYA 1WR8A 1X15A 3E27A 4IDPA 4C7MA 5BOSA 3TVYA 5ALSA 4GX2A 3AR9A 3NUQA 4TV8A 3ITKA 3JD0A 1XYGA 1CD5A 1WUIS 4RL6A 4UNIA 2HI0A 2X0NA 5SV2A 5CXUA 1FMFA 3H19A 1KZYC 1CERA 1R9GA 1W5BA 2GT1A 1LXCA 4QDXA 4RACA 2HOQA 4UEOA 3GLUA 3ZE1B 5KTRA 5EPOA 4A73A 3L6EA 4BUCA 3UHJA 5LQJA 1NN1A 1WY5A 2F1OA 4CGZA 2MJLA 3BGWA 1XQ9A 2XNSA 4MKZA 2GBGA