1E3SA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
241
Chain Sequence
b'SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 85
structure length 241
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3sA00
3VPFA 5JY6A 3F47A 1UDCA 1UZNA 1VKOA 2Q3EA 1HLDA 4NJMB 4IDCA 1YVEI 1Z73A 3NV9A 3F46A 4YPOA 2YUTA 4DPKA 1U8XX 3GVCA 5TRTA 1NFQA 4IDBA 2BFAA 3C1AA 4RV9A 3U4IA 4O0LA 4ZJUA 4Z3KA 1AE1A 4FIZA 4IJVA 1DIBA 2HDHA 5JY1A 4C4OA 4CV3A 3PWKA 3I4FA 1AUPA 3ZV3A 5ICSA 4AJHA 4DMLA 2Z1NA 4JBGA 4RPGA 4FOOA 5TJ9A 1BW9B 5JW6A 3U5TA 2PD3A 3W4KA 5KJEA 3E82A 1EVZA 1UXKA 5DP2A 2D2IA 1GV1A 4ZRMA 4ALNA 3OIGA 4IIVA 5KJ6A 3OJLA 3NRCA 3PXXA 2VOJA 2B4QA 3P2YA 3QHAA 4ZQEA 4BMNA 2JD2A 5AQ1A 2DAPA 1JDJA 2HKIA 4ZQGA 1MXFA 2CMDA 4JROA 1NP3A 2GUGA 3RQSA 2IYPA 2FOIA 3DFUA 3ETDA 4WEOA 1ADBA 3JQCA 1XU7A 3BIOA 4IJUA 4RDIA 3U4DA 5HS6A 1Y9AA 2P68A 5A02A 1BHSA 2BF7A 1LI4A 3JQ7B 1DEHA 4DIFA 4FFOA 2NU6A 1V3UA 1P1JA 1P74A 2XF8A 2C82A 1ZIDA 2UAGA 1FDWA 3WGGA 2H5LA 2BGMA 1F0YA 4WPGA 1QKIA 3ITKA 4PVCA 4RO0A 4ND2A 4BGEA 1DRWA 2IZZA 4LISA 3FPCA 1HRDA 5TS3A 4CM4B 4YRDA 1H5QA 4U0JA 5ENVA 3CE6A 3JYQA 5CEEA 4XKJA 1RM0A 3WWZA 5EMHA 3ZWCA 1BXZA 5EPOA 2HSDA 3KYCB 1P3DA 3GN2A 1WDKA 3WIDA 3RJ5A 2RIRA 1N9GB 3UCEA 3KETA 1ZK2A 4YYZA 3GHHA 4MVJD 1P1FA 2UDPA 3OECA 1MX3A 3U4HA 4E5MA 4J2HA 1P45A 3OA2A 3H9QA 3ZWPA 3OSUA 1SOVA 5CDSA 3Q11A 5JCJD 4NJOA 1K6XA 1LQTA 3CEAA 1I24A 4FOSA 2PTGA 1Y8QA 3D4PA 4WASA 3CZMA 1XA0A 4WEQA 5T64A 1MUUA 3Q3CA 4WJZA 3R3SA 4PLVA 3RD5A 2NU9A 3PYXA 3QVSA 2HO5A 1V0JA 2W4QA 3I52A 8LDHA 4Q3BA 5DNAA 3L9WA 1DIAA 4TRMA 1WZEA 2HCTA 5BSFA 2AG5A 3GNQA 1C14A 4E30A 4E33A 3ZW8A 3K30A 5A9SA 4M87A 1F06A 4F45A 1JKIA 4YT5A 1X0XA 4D45A 3DB2A 2NSDA 1ZJYA 3D4NA 5ITWA 1PS0A 1HF3A 2NUAA 5H81A 1IL0A 1X13A 3JQ6A 4BO6A 5K0ZA 1WVGA 3PHLA 3PQEA 4Y6RA 4CM7A 4TZKA 1G6KA 1W4ZA 4LRTB 4U7WA 4XQCA 5FEUA 5F5LA 2Q1TA 5JAMA 4R1NA 3P5SA 2A35A 4YAEA 2D0IA 2WD8A 1XEAA 5G2OA 1U1IA 4E12A 2X4GA 4F6CA 1NAIA 1WZIA 4WNIA 2BGLA 4FQ8A 3PGXA 2V6BA 3A14A 4OAQA 3A06A 1SPXA 2BLLA 3WGTA 3PK0A 2HMSA 2VNSA 3C1TA 4GWGA 3DOCA 3BMQB 5GZ6A 3SC6A 4DLAA 3TFOA 1ISIA 3UXYA 4HFNA 1PZFA 3TQHA 2C07A 4OL9A 1I8TA 2X6TA 2GZ2A 2VNAA 5FYDA 3H9GA 3TNLA 3PIDA 2J5KA 4YQYA 3S2IA 5T6BA 4J0EA 2LDBA 3GEMA 3GRPA 3AI1A 4IIUA 4UULA 3FWZA 5B4VA 2W98A 2O7SA 3PFWO 1CF2O 5I9MA 2FZWA 5EERA 4DQXA 1XLTA 3FNHA 1HYEA 2FRDA 5A5EA 4E5PA 2HK9A 3H3JA 1E7QA 3DBRB 4OXYA 1E1MA 1JWAB 1A7KA 3STHA 2AQHA 3AM3A 3OQ1A 1JA9A 1PL6A 3BMNB 2Y1GA 1C1XB 2HRZA 4GMGA 1PJCA 3BTSA 2C5EA 4LMRA 2Y1CA 3F4BA 4E32A 5BSGA 1NR7A 4GSKA 4U8GA 5FWNA 4OMUA 4BQRA 2P9GA 3ANMA 4QT0A 5C7LO 1NVTA 5IXYA 3VDQA 2J3HA 1O0SA 2J5QA 1EK6A 2W2LD 4HX5A 2YDXA 4L4SA 4EZBA 1YL6A 3DFZA 4WNCA 2EHDA 2EJVA 1CQJA 5TX7A 1D4FA 4H15A 5JCJA 1HDOA 2YQ5A 1KVRA 2B4RO 2QIOA 4AFNA 3ZDFA 2PGLA 2Y1OA 4TVBA 3S8MA 3TF5A 4IDFA 1GYRA 1B16A 1Y81A 1YOVB 2G76A 5CFZA 5C37A 5KOIA 1CEQA 4R16A 4J1NA 2HMUA 1CIVA 1GTMA 1O9BA 1VLLA 4CUZA 3S2EA 4DPMA 1HYGA 1VL8A 1EDZA 2VYND 4K6FA 4HWKA 2UYYA 1KVQA 1WAMA 1PZEA 1ZNQO 1JU9A 3PLNA 3EK2A 5F21A 3KHUA 3PZRA 1B3RA 4BNIA 2Y66A 1SZJG 1M67A 3FR8A 1O89A 4NG5A 2DUWA 3H5RA 5L45A 3D3WA 2IEBA 1TT5A 3JQFC 2FP4A 2AHRA 3WIEA 3S2GA 1NQTA 1D8AA 1DC4A 1I10A 1PU2A 2QRLA 3PYMA 4ILKA 1R4MA 1YQXA 1DDOA 2X1HA 2R6JA 4M1QA 2TMGA 1W6UA 4JJGA 2NQTA 1ADGA 1DBVO 3Q2IA 1U3UA 3OM9A 4FDAA 2OMEA 2ZJ1A 3GF4A 4IUYA 2WE7A 2CSUA 2FHSA 1T1RA 4CLXA 3KYDA 4BS9A 4J7XA 2JCYA 3F6YA 4I5DA 4M54A 2PD6A 4HFJA 2JL1A 3E9QA 3JQEA 3HDQA 3GOHA 4Z9FA 1FJHA 3CINA 4XZ3A 3NTQA 2BGKA 4WOJA 4TSKA 3WGIA 2JFFA 5DCYA 4AICA 3DMYA 2V65A 1GZ3A 1P0FA 5I7EA 4J43A 1YWGO 1YRLA 4ZQBA 1PWXA 2BI7A 4R1UA 1QSGA 3ONFA 3WB9A 2Q4EA 2FMUA 3AUUA 1PGQA 4E31A 1YB1A 4DWVA 3V2UA 4DVJA 4OH1A 3IP3A 3MOIA 4GKBA 1WWKA 1E1KA 4P22A 4FJ1A 1ULUA 4YJFA 3NEPX 3UW3A 1E3WA 1F17A 1PX0A 2I6TA 2Z1MA 1O95A 4B79A 3C7CB 4K28A 4ESOA 4DLLA 2VUSA 2OGUA 2Q99A 3ROKA 3MJSA 3KM0A 1V6AA 2DPGA 1N7HA 3KV3O 1ZO8A 1PJSA 1QYVA 1WNTA 3PYLA 4PG4A 3PHIA 3RASA 2B83A 2O2YA 3ETEA 3O26A 3MJVA 2W2LA 3H9JA 1A4UA 2Q1UA 1Q7BA 3K6JA 1E3LA 2VZ0A 5A3VA 2D3TA 5CAEA 3FBTA 4DIOA 3E1KA 5ICMA 4D7AA 1P77A 3FR7A 3H3FA 1T2CA 3BMOA 4XRGA 2AQIA 4R5MA 2OZPA 4LMPA 4XJSA 4JP2A 1B7GO 5COAA 1BXKA 3ZCXA 3NDJA 3VH1A 4RJTA 2F1KA 1KVTA 4WK6A 2ZK7A 1PJLA 2NVWA 1DJQA 4ONEA 2GSDA 1P44A 2JHFA 4WKGA 4J90A 3B20A 2G17A 3GGGA 2VYNA 3HG7A 1NPYA 2GNAA 4E5YA 3WGOA 3RWBA 4CL8A 3TZCA 1K6IA 4KDFA 3K2BA 3OJOA 1BDMA 1XIVA 5L7TA 4JK3A 4CM8A 3DDNA 5U9CA 1AHIA 1HEUA 1XQ1A 2P2SA 3KBOA 1GEEA 1TI7A 2OBYA 3VTZA 3ZU4A 2RH8A 3NAQA 1OI7A 2VN8A 1I3KA 1XGKA 1NFRA 1ZEMA 5A9RA 2ZJ0A 4DIBA 3U3XA 5DBGA 4XQEA 1FDTA 3WOHA 4D3DA 1LLDA 2FR8A 1WDMA 2GPTA 4MKRA 3FI9A 4BUCA 3C7AA 4FC7A 4XR4A 4RVDA 3C1OA 5IZCC 4KP7A 3ZNPA 3H2SA 4CUKA 2O3UA 1ZUD1 4JJFA 3I3OA 4E2YA 4O5OA 2GZ3A 8ADHA 1GU7A 4Q3AA 3G17A 4J9VA 4D3FA 5MGBA 1DAOA 2AEJA 3JQBC 3NT5A 3GHYA 2C59A 4W7IA 4YJGB 4YT4A 5KVSA 4BNFA 4PG5A 1MC4A 1F12A 2B5WA 1T2DA 1WMBA 3ZU5A 2I66A 2VCYA 2OP1A 2E49A 3QY9A 5IXSA 2NADA 2C2YA 1MV8A 3GC6A 3UAGA 2FPPA 4NZ9A 3MWEB 4I5FA 5G0VA 1A9ZA 1HETA 1N5DA 4XYMA 3IJPA 3RAJA 2JAHA 4BO9A 1R12A 3IAHA 2OOSA 1HYHA 3SLGA 1K6JA 2VHZA 3GMDA 4BNYA 1DC6A 2YV3A 5BQFA 1XCBA 4N5NA 3WYEA 4KUHA 1AXGA 4WUVA 2J3JA 1ZH8A 1LLQA 3RFXA 4BVAA 1HSZA 4YTEA 3UFXA 2B69A 2EKLA 1LRLA 3R1IA 3TZ6A 3AU8A 2PD4A 3WICA 1PTJA 1LC3A 4Y6PA 5B37A 1E7SA 4E5KA 3EAGA 4WCFC 5TC4A 3LC2O 3UGKA 4IMPA 5G4LA 1T25A 3DHYA 4BO4A 4PLTA 3QV1A 3H5AA 3MEQA 5T8KA 1E7WA 1GPDG 4E2XA 4BNGA 4YAKA 1I32A 1BVUA 4N7RA 1GCOA 1ZXBA 3DBVO 4UVGA 4UVDA 2E4AA 3VKUA 5A06A 2NU7A 4JX8A 1LTHR 2EWMA 4CR7A 2PZMA 1E3SA 2NACA 4QO8A 5LDGA 4KWIA 1J5PA 1XSEA 1ARZA 3QQPA 3VHRA 2JFGA 1WW8A 1V3VA 4JN6B 3C24A 5JLAA 3OETA 4BNMA 4U5QA 3DXFA 3W8DA 3AOEA 4HP8A 3QWIA 1IPEA 4QXMA 4RVGA 4RL6A 3GVXA 1VSVA 1YJQA 3O8QB 3SBOA 1LDYA 3AFMA 2WD7A 1PGNA 1PEDA 3RIHA 2AXQA 4XB2A 2W90A 2QZZA 1LEHA 4J4HA 4M86A 9LDTA 5IDWA 3RFVA 5CEJA 3AUTA 4PZDA 4ALIA 4WLEA 1IPFA 4OHUA 2VRCD 5JYEA 4CM9D 4FGWA 3AOEC 4QQRA 1MG5A 1H94A 1YQGA 5JE8A 1Y8RA 5ER9A 5C3MA 4H7PA 3GPDG 3LT1A 3U09A 2Q49A 3A9WA 1I0ZA 1TEHA 1ENYA 1ZCJA 5ENDA 4GLLA 3M2PA 1BVRA 4J1SA 2IEDA 3QVTA 1EVIA 2YHIB 4MVJF 4W9NC 2AQKA 4E2ZA 3AK4A 2VHXA 2I76A 4JLWA 3GFGA 4ZGWA 3EMKA 1VE9A 4KUEA 3SVTA 1QYXA 4J4BA 4QFCA 4KWHA 3JQDA 4ZHSA 1MXHA 1T2AA 3QVWA 5ILOA 1GEGA 4PLHA 1P33A 1QYCA 1CJCA 1T2FA 1WXDA 4D79A 2Y0EA 1XHLA 2AG8A 2F00A 2G82A 3P19A 4D42A 1E3IA 4W7HA 3X2EA 3I4CA 3K5PA 2P5UA 4Q39A 4IDAA 1U28A 3WLEA 3PWZA 4TMFA 4RCVA 4X54A 1Y7TA 2WYUA 3AOGA 4FBGA 4BO7A 4FFRA 4B3HA 5JBIA 4I1IA 1I5RA 3OIFA 4B4UA 1I01A 4XGKA 1I3LA 5DF1A 4CLDA 4C7KA 4ZQHA 1G0NA 1PJ2A 4YQZA 3QP9A 1JAXA 3VKVA 2C7GA 3S2FA 4FPXA 3EY4A 4QO7A 4UVEA 4BGUA 3OEWA 1T4DA 2JCXA 3P7MA 5AXBA 4PLGA 3GAZA 2B4TO 4DQUA 1A27A 3ZWAA 1J49A 1H9AA 2NM0A 5JAIA 2Y68A 5G0TA 1PJTA 1M2WA 3ZWNA 4AVYA 4GQAA 4IXTA 3RJ9A 3OP4A 5BNFA 2O7QA 2XXJA 4EJ0A 3LU1A 1XG5A 4CM1A 2RCYA 3WS7A 3GNTA 2GCGA 1BXGA 3GH3A 1DRUA 3D7LA 1M75A 5F5NA 1U3VA 5GZ1A 3DZBA 2AE1A 1D3AA 3JQAB 4M55A 1N1GA 4XYBA 4MJLA 1PL8A 2EG9A 2WJPA 4CUJA 3ZWOA 3PZBA 3ZV6A 3ZNNA 1MGOA 2CVOA 2PV7A 2EERA 5F1OA 1NVGA 5AVOA 4N54A 3U4CA 1HE4A 4NIMA 1W8DA 1GPJA 4BGVA 5JNLA 1EEHA 1IULA 1EUCA 3E03A 1LX6A 3JSAA 3BHIA 4CMIA 1DPGA 4IBOA 4DGSA 3WG9A 5A1TA 3F1KA 4Z9XA 3ULKA 2D8AA 2X5KO 3WX0A 4CMHA 3RUEA 3N58A 1DAPA 3N74A 4MKXA 1R16A 1IHYA 3DZHA 1O94A 4IINA 2P91A 3VPSA 4BB6A 4UVHA 2VRCA 4E6PA 3WLFA 4PG8A 4ALLA 3ZH2A 1JN0A 1NHGA 1IHXA 3ZWBA 2QHXA 4TROA 1U7TA 2YDYA 5TF4A 3LT4A 4R68A 4GVLA 4TVOA 3DZKA 4FFPA 3UICA 3V5NA 2UVDA 4QSMA 3PGJA 1K5HA 3ZN2A 4B4VA 1F14A 5L4LA 2NQ8A 2DFVA 1A71A 4P4NA 4Z3DA 3HUDA 2JJYA 3EZYA 5C7IO 1Z7EA 3VH3A 1XWFA 3FPLA 5HS4A 1R6DA 4QEDA 1VL0A 2YV1A 3E6AA 4FN4A 5L40A 4W82A 2NTVA 4RLHA 2IXAA 1EE9A 4GH5A 2D5CA 4IDDA 3U9LA 4BNVA 5L53A 1QR6A 5IFLA 5THKA 3OICA 2D5AA 3L9XA 3RC7A 1MC5A 4E2WA 1YGYA 5CP8A 4OQYA 2O3JA 1X7GA 3IKTA 3UHAA 5JFOA 1QYWA 1IZ0A 4B3IA 1NNUA 4GLOA 4H16A 1MB4A 1PGPA 3GZNA 4HY3A 1CDOA 4O59O 4FJ2A 4G5HA 3H9UA 4TQGA 2HLPA 1YL7A 4HBGA 3V1UA 1XELA 4YCAA 3AJRA 3D5TA 4RQTA 1J6UA 4DLBA 5I7VA 2VWGA 4IPTA 3HHPA 3RC9A 2X5JO 2GZ1A 1HE3A 1E7YA 1LQUA 2DM6A 2EJWA 4XGIA 1UR5A 4JIGA 3W6UA 1ZSNA 3QE3A 1GR0A 4XRRA 3CUKA 5CEFA 3TWOA 4DL9A 3OQ6A 1KEWA 1XR3A 2GASA 4G81A 4CQMB 3EUWA 3GAFA 1ENZA 2BRUA 3OA0A 4BNHA 3HWRA 3LT0A 4GMFA 4RPKA 1B8VA 3A28A 4YJHB 1NQ5A 3UOGA 3VVBA 3UH1A 1X14A 1P0CA 1MP0A 3G1TA 4PRLA 4DQVA 5AXCA 4MVJP 3H4VA 3RBVA 4OOFA 1LRJA 5CDGA 2PR2A 1BXGB 3VZPA 1HTBA 1LSSA 1ISMA 1HZZA 2JD1A 1E6WA 3I23A 4IJKA 4JJIA 2YFQA 4CV1A 1LDNA 3TOXA 3JQGA 3BMCA 3NX4A 3I9OA 4NFSA 4F3YA 2XOXA 2VT3A 4EYEA 2V6FA 1E0DA 1YJ8A 3ABIA 3GR6A 1U4OA 5FI3A 4B4OA 4GL4A 1JKFA 1QORA 2DC1A 3GT0A 4JBHA 1SO8A 4XB1A 1QXSA 3F4LA 4G65A 4OKNA 2EP7A 2GO1A 2PZKA 1A7AA 3R6DA 1Q0QA 1PGJA 4LVCA 3W6ZA 1E1LA 4OKIA 1U7HA 2AW5A 4IXWA 1E7MA 2R2GA 3MOGA 4CMJA 2OBNA 3GPIA 5AOVA 1DLIA 4WLVA 4GPD1 2JD0A 2C5AA 4XIJA 3DC2A 4CJXA 4LGVA 2QYTA 4WGGA 1I2ZA 1LDEA 3CSDA 3PP8A 4WECA 5LC1A 3D5QA 1UAYA 1R0KA 1HZJA 4IMRA 1HDGO 1OMOA 3WWYA 4BNXA 4CV2A 4WCDA 2HRBA 3AM4A 4OSOA 4EDFA 2E37A 3PWSA 5A9TA 5G0SA 5L9AA 1PWZA 2X9VA 3O9ZA 1Z82A 2CDCA 2HMTA 1SAYA 3VPHA 1P9LA 1R0SA 3DZFA 2RH4A 5KJCA 2ZB4A 1HKUA 4L76A 4R41A 4IS2A 1ZK0A 4D0RA 1KC3A 1KETA 2XPCA 2ZCUA 4WE3A 3GGOA 4CLEA 3G1UA 1K89A 1PIWA 4NH4A 5BT9A 5KJ1A 4D41A 1Q1NA 3WMWA 1RKXA 1I3NA 1DO8A 2UUPA 1GL3A 3D1LA 3JV7A 5B4UA 1N8KA 1OZAA 3TZKA 1RYEA 5DOZA 4J1QA 3F9IA 3DZJA 3NGLA 5KVVA 3ZW9A 1MFZA 4RPHA 2H63A 2O3RA 3ETGA 4MP3A 2VUUA 4BMSA 4BNZA 4OYRA 5KJFA 5FFFA 1KIFA 2ZQZA 1PL7A 2EIHA 3EDMA 3ADOA 2OP0A 1SB8A 1RPNA 3M1AA 3OJEA 3ZV5A 1E92A 4BB5A 4CMCA 1YXMA 4BNKA 4MVJA 4KTTE 4CMAA 2HU2A 2X9GA 4MOWA 4Z0TA 5BSHA 4R1SA 3COSA 1WPQA 4ZD6A 4J49A 1Y8QB 1NPDA 3HE3A 3LDHA 5IDXA 1SBYA 5HA5A 4PFJA 1VJ1A 4MIEA 1XDWA 4J3FA 1A4IA 1SEVA 4IY1A 3BMCB 2WSBA 1A9YA 4Q9NA 5AXAA 3ZWVA 5TGDA 1JVSA 1GQYA 1SB9A 3DZGA 3OH8A 4XJTA 4IQGA 4B8ZA 4IJWA 3ZNOA 1UP6A 3KUXA 4IZIA 3H7AA 1Q0LA 1Y6JA 3JQFA 2D1YA 4E5NA 1OOEA 1LXCA 2DT5A 4Y98A 5A9SB 3ORFA 3JTMA 4L73A 1D1TA 4HADA 3ZWYA 3DBLA 2Q1WA 3ST7A 1NYTA 1P31A 3I6IA 1JLLA 4KDEA 3ROPA 3T4XA 3V2HA 3PJDA 3DZIA 1U3WA 3KOUA 4LN1A 3QLJA 5CG1A 5EQFA 2GYYA 2B36A 3HFGA 3L0DA 4BV8A 4LCEA 3BHMA 1A5ZA 1HE2A 2WE8A 5JYDA 4CMGA 3KEQA 2GDZA 2VWHA 4CMEC 1IOLA 4XDZA 3R0IA 3G49A 3ICPA 4GX0A 4U6SA 3EVNA 4CQLA 1TXGA 3DMTC 2EW8A 1DSSG 3WFIA 4GVXA 2X0RA 1A72A 2VHWA 1LSUA 1KC1A 3NJ4A 4GGOA 5IJZA 2V7PA 3FCOA 3I6QA 3RUIA 3JD2A 3CPSA 3DEYX 5CDYA 1H6BA 3RROA 2GN8A 1OC4A 1WP4A 3EGOA 1ZKMA 5JO9A 3VZSA 5JMWA 3KSZO 2QZ9A 3KB6A 1ZSYA 3HJAA 4L0QA 4EBFA 3DBHA 5THQA 3SXPA 4BL5A 2LDXA 2EGHA 2B0JA 5F1KA 4DC0A 4EW6A 1CETA 1EBFA 4IS3A 1NWHA 2B37A 3O03A 4KUGA 2ZTLA 4L75A 2QRJA 4MVJG 3WTCA 3INRA 2VT2A 3IKVA 3ROQA 1ID1A 3K92A 2GN9A 3TL2A 4I5GA 4EEXA 4HV4A 3ASVA 1Q7GA 3I5MA 4PG7A 2OORA 4RLSA 5EL0A 2B5VA 2VOEA 2CDBA 2G1UA 2RHRA 3HNPA 4TZTA 4NBWA 2VRBA 4YJDA 1ADFA 2DBZA 4XDYA 3BTVA 4YAGA 2ZCVA 1PQWA 4UVIA 1GDHA 2GERA 5BNIA 4J9UE 1PJQA 4QTZA 2WEKA 1DHRA 4NFHA 4UAGA 1V35A 2O50A 4DYVA 3QVOA 2O4CA 3IC5A 1OBFO 3KSUA 1S7CA 2UUOA 3DTYA 3KSDO 4S1VA 4ND5A 1BGVA 3AI3A 3HDYA 2WDZA 1VC2A 2Q1SA 2PLAA 3KLMX 1ZXLA 5EQDA 1V3TA 2JHGA 2VWPA 4R3WA 5EESA 3F5QA 1WDLA 2DBVO 3IMFA 5F1PA 2QX7A 7ADHA 2B35A 3C85A 3Q6IA 2C2XA 3LLVA 2GD1O 4EI2A 4N5MA 1BRMA 1H2BA 1K2WA 1KERA 3TL3A 1KVSA 1PJ4A 3GNSA 4FFLA 4OIMA 4Y67A 2CF5A 5T67A 2I3AA 2VWQA 2CD9A 3PHGA 4L8VA 3DBLB 3T4EA 3W8FA 2Q50A 2WWRA 3TRIA 4BKOA 4P8RA 1YBMA 2IXBA 2Y93A 4R9SA 1LDBA 2HJSA 2E6UX 4FB5A 4LSMA 4MKZA 3D3WB 4YRAA 1TT5B 2BKAA 2YV2A 3BHJA 3AM5A 4UREA 1VPDA 5J23A 2ZYAA 4IQ8A 1HXHA 3INTA 2HUNA 3EHEA 1R4MB 4XGNA 1X15A 4EUEA 3B1KA 1G0OA 5IZCA 4GGPA 4TWRA 5GY7A 1PSDA 2AEMA 1EZ4A 5DZSA 4D44A 5JDCA 2ZB3A 3HB5X 1SEPA 1KOLA 4BNWA 3KYDB 3ON5A 3LVFO 3INGA 4RQUA 5JC1A 1U8FO 3IL2A 1PGOA 5G4KA 1ZBQA 3NDIA 3OFSA 3JQBA 2G0TA 2P5YA 1SC6A 2PNFA 4CPDA 4B3JA 3BTOA 3K8ZA 5ADHA 1UXIA 4CLHA 4NBUA 3JYOA 1GY8A 5K9ZA 3E9MA 5IDQA 3SEFA 4BNUA 5JDCC 1L7DA 3TFQA 2C7VA 2DTXA 2SCUA 1GZ4A 2QG4A 4OSPA 3FRJA 1EUZA 5HTOA 3QVXA 1DJNA 2AE2A 2IDZA 2CVZA 3PDJA 4MVJE 3ROMA 4ND3A 1VRWA 4HNGA 4PIVA 4HUJA 4JCOA 1C0PA 1UP7A 3LSYA 1X7DA 4MP6A 3FBGA 1JW9B 1YH3A 2J8ZA 3ZV4A 1B0AA 1C0LA 1IUKA 1U4SA 1F8FA 4B4WA 4W6ZA 2NVUA 4J1TA 4XD2A 1D1SA 2PH3A 3PDUA 1GYQA 3MJEA 3PFFA 3B1JA 4WCFA 5A5FA 4YJFB 4CLRA 3TPCA 2OFPA 1Z6ZA 2W8ZA 3I9JA 1R0LA 1E3WB 2X0NA 4ND4A 3ENNA 4MIOA 1ZK3A 3GLQA 2V6MA 3FTPA 3NDRA 1F8GA 1V9LA 3SLKA 1H6DA 1TVEA 2DQ4A 4YBZA 2WM3A 1JTVA 2CNBA 2FR0A 2W2KA 1HDZA 1GCUA 1UUFA 2VZ9A 4FC6A 3FTNA 3OJ0A 4R54A 3WGHA 2BFOA 4LVUA 3HDHA 1Z7BA 3VDRA 3ONEA 4CLOA 1C1DA 4AG3A 3KZVA 1IZ9A 2EF1A 1FK8A 3WXBA 3MJ4A 5BNTA 1H93A 4G2NA 4II2A 1GV0A 1JQBA 1LJ8A 2WYVA 3WYCA 4B7XA 3DHNA 1PQPA 4A26A 3WMXA 3BMOB 3UKOA 3WQRA 4CM6A 4Z0PA 1ZFNA 3W1VA 4ND1A 4BNJA 2BELA 1BMDA 3QWAA 4J7CA 4BGIA 6ADHA 1CQIA 2YJZA 1WMAA 4GI2A 4J7UA 4ALMA 3OIDA 1XKQA 2PH5A 3PTZA 3ZU2A 4NI5A 2GF2A 3G79A 2VTEA 1Z75A 5FF9A 4UEOA 1W73A 2ZKLA 4L4RA 1C0IA 5ILGA 3TZHA 5H83A 3UVEA 1GAEO 1ONOA 1NR1A 2OO5A 1O5IA 1DLJA 5IAAA 4BKUA 5TIIA 4QX6A 1R4NA 4CM8B 1DIGA 3JYLA 3M6IA 4ROSA 2GR9A 1YB5A 4PZEA 3GA0A 3O4RA 1DHTA 4W9NA 4NJMA 1LBEA 1EVYA 4UUNA 3LF2A 3NKLA 2VHVA 4Q3NA 3RUDA 1BDBA 3GEGA 3PJEA 4FS3A 3ZU3A 1QG6A 4LCJA 3MWDB 4GKVA 3LYLA 2NTJA 4BHTA 4ID9A 3VAZA 5LDHA 3MJTA 4Y8VA 5I7SA 3DQPA 1OFGA 1W0CA 1H6CA 1HDYA 2E48A 4A03A 3VTFA 1BW9A 3LC7O 1BG6A 3IIEA 1IE3A 5COQA 1PZGA 4XCVA 3GFBA 1EFKA 4J16A 4RF3A 1UJMA 2VYVD 3L4BC 1NAHA 4FGSA 3WGYA 1PZHA 3GGPA 4JP3A 4KQWA 4MP8A 5B1YA 1SNYA 3O38A 4NK4A 1GUYA 2PK3A 2QYSA 4OXNA 3AI2A 4P4LA 4UUMA 4OXKA 3P2OA 5TSDA 1EUDA 2CUKA 2FWMX 2BHLA 2X5OA 3CZRA 2WTBA 1EE2A 2QW8A 2PGJA 2NTNA 1I2CA 1NQAO 5DOVA 3QJ5A 1ZZEA 3JQ7A 4I8XA 1LA2A 2EV9A 3E5MA 3KEOA 3F3SA 2X9NA 5AYVA 2DLDA 1B15A 3FNGA 3LLSA 5T5QA 4B8WA 1ZK1A 3TDKA 3IS3A 3L6OO 3T7CA 4WLUA 4YT8A 4YDRA 3ADPA 3U0BA 2BD0A 2NLOA 4YACA 4DRYA 1Y5RA 2R00A 4ZVVA 4XYLA 3ANNA 3H65A 1EDOA 2I5PO 4J6FA 1CWUA 1C1DB 4XYEA 3ASUA 2EXXA 1DIRA 2IE0A 4BNNA 1UP4A 3BTUA 4PCVA 2ZTVA 3GZ4A 2CFCA 4YA6A 4CM4A 1R66A 2G5CA 2O2SA 2JKVA 4IZHA 3OJFA 2R00C 3ENKA 1LC0A 3K9QO 1I36A 2DUUA 2BMAA 3KYCA 3L77A 3TOZA 3U62A 4ITUA 4H3VA 3PQDA 2YHUA 4OQZA 2O3SA 3K96A 4LW8A 5EINA 1ISGA 3ZHZA 4F46A 4AJNA 4YT2A 1YDWA 1RJWA 3DAGA 5BSEA 2DPHA 1NXQA 2PZLA 4MINA 1ONNA 4RORA 5DN9A 3T7EA 1JKJA 4UEJA 4BO8A 3WJAA 3KTDA 5MDHA 2HMWA 3I9MA 5U1PA 3ZHYA 1Q0HA 3WSVA 3MZ0A 1R4NB 2WD7B 3SJUA 4K1LA 3PVZA 1J0XO 1N92A 4OJNA 4YEDA 5FI5A 1QLHA 2FSVA 5DDIP 3GQVA 4A73A 4GX2A 2RHCA 3NYWA 3CTMA 4GSLA 4EEZA 4RVUA 4NBRA 1H2HA 3BXXA 3L4SO 3WGZA 2P9EA 3D0OA 4A10A 4FR5A 1Y8RB 2DU8A 2VUTA 3MJCA 4CM9A 4P38A 5EJ2A 4IDGA 3H6KA 1S6YA 4TKMA 5ITVA 4KTVE 4CM5A 4NU5A 3FD8A 5JDIA 4FD3A 4E13A 1YONA 3QW2A 3ZNQA 4NK5A 1DFHA 3WGQA 1IY8A 4EUFA 4ZN6A 3MTJA 4C7JA 2CF6A 1ENOA 2BI8A 1L7EA 2BFMA 4IDEA 3DHEA 1QMGA 5JSFA 2VYVA 1KEVA 4ZRNA 3S1LA 5HWSA 1ZK4A 1PS9A 3AUSA 4DXHA 1P1RA 4F6LA 3H5NA 5JDIC 1K3TA 4HKTA 3V1TC 2PKQO 3PQFA 3BMQA 1B8UA 3QA9A 3QSGA 1BTOA 3UF0A 3F5SA 4BO1A 4ALJA 4EUHA 1SCUA 5L7WA 3EW7A 2PY6A 3GDOA 4O1MA 5HRUA 3WNQA 2O3TA 4MO2A 1NBOA 1I33A 4CMBA 2ZATA 3E9NA 2C54A 4YR9A 5CG2A 1T24A 2PA3A 3RC1A 2J6IA 2DTEA 1UZMA 2H6EA 5LCXA 4AJ4A 1M66A 1XU9A 1VI2A 4LK3A 1D7OA 2X0JA 4D43A 5AXDA 4II3A 4CM3A 1M76A 4IGEA 3SX2A 5JC8A 5A4DA 3GVIA 1T4BA 5JO0A 3DBRA 2O48X 3EC7A 3NTOA 4R1TA 5IZ4A 1J4AA 4ALKA 3WFJA 1V8BA 3BMNA 2X7HA 4BO0A 1C1XA 4NQZA 1KEUA 3KXDA 1N2SA 3NT4A 3X2FA 1PR3A 3RCBA 3LZ6A 1E5QA 5I9NA 4GWKA 1B26A 1X1TA 4XR9A 4K6CA 4W99A 3EZLA 4OGWA 5DCUA 3WQSB 1KY4A 2FN7A 5B4TA 2D4AA 4RVSA 3VZQA 1P1HA 1HLPA 1UXHA 2JCVA 3WYBA 4DMMA 5JS6A 1HT0A 5KVQA 4ZA2A 3RBXA 4I9HA 3G0OA 4R01A 4MIYA 1U3TA 1KYQA 3V2GA 1EFLA 4MVJI 4DC1A 4Y6SA 3PLRA 4I9UA 4PRKA 4A7PA 4CMIB 1VJTA 2YY7A 4N5LA 1DRVA 4K9DA 1CRWG 4CMKA 2NV6A 3HB4X 3QWBA 1Q2XA 3IP1A 1SMKA 3ZHXA 4CL3A 1YOVA 3PJFA 5DCWA 2IODA 5L95A 3DO5A 1VKNA 1QLJA 1NM5A 3VC7A 3I83A 3H8VA 3VH4A 4DPLA 3LT2A 4KZPA 3TN7A 2Y05A 3LC1O 1B2LA 2EW2A 2YYYA 3IUSA 3PEFA 3VVCA 4JNKA 5JCXA 1OC2A 1LSJA 5DBFA 2POQX 1U5AA 3B6ZA 4PLPA 2Y0DA 1AGNA 3Q2KA 1CYDA 2AEFA 2NWQA 4TRRA 3UUWA 4NBTA 2PWZA 1YBAA 3RUFA 4BOYA 4PLFA 1GD1O 4XX0A 1HWYA 3KRTA 4J2OA 3FN4A 1DOHA 4JQCA 3CMCO 5DP1A 4BO2A 2PGDA 3RUHA 1ISJA 3GZNB 3PPIA 4NBVA 1ONPA 5JXWA 2JAPA 4JXKA 4ZICA 1Z74A 4AJ2A 1E3JA 2ZTMA 3GN1A 2OXIA 2H1SA 3L07A 4R9RA 1ENPA 2GGSA 1LDGA 2O3QA 4WLNA 3N7UA 5HBRA 5GZ3A 3RUCA 3HZZA 1UDAA 4RF4A 1UXGA 5ES3A 1Z45A 3FWNA 5TQVA 1ZVMA 4AJOA 2FY8A 4B7UA 1K0UA 3EYWA 5TT1A 5ER6A 2UV8A 1KBZA 4BMVA 4U0KA 1QV7A 2Q46A 2YW9A 3AW9A 4N18A 2I3GA 4NU6A 3K73O 5HM8A 3GRKA 1GYPA 3FNEA 1RM4A 1SOWA 2P9CA 1VM6A 1Y1PA 4O6VA 2IRWA 3R3JA 4LRSB 5IN5A 2VTDA 3B70A 4GAEA 1FDVA 3ZZNA 1L1FA 3ITDA 4RZIA 3D64A 1E5LA 3JQGB 4YAIA 3Q9UA 1XQ6A 4OM8A 1XYGA 1M6WA 5B12A 3JQ8A 4Q3DA 2ZB8A 3AU9A 3IOYA 2OUIA 4Z0HO 3ZWMA 3TZQA 1KVUA 3V1YA 3WTBA 4R4JA 1Y5MA 4FCCA 3KVOA 4KQXA 1N1EA 1O6ZA 4HFRA 4LSWA 4CMEA 4CODB 2VQ3A 4E4YA 3IJRA 5L51A 1GQQA 2J3KA 2ILTA 5IG2A 3DMTA 1Q7CA 4BIIA 2PKRA 4WLOA 1ULSA 4PLWA 2X22A 4HFMA 3GG9A 4I08A 4PVDA 3OBBA 1E6UA 1I2BA 2CY0A 5L3ZA 1MA0A 1I3MA 1H6AA 1RYDA 1H9BA 3PI7A 3L6EA 3QWFA 4GX5A 2ET6A 2DFDA 2P4HX 4NMHA 5A03A 5DT9A 4BO3A 1PQUA 5EN4A 1LUAA 2H9IA 2DTDA 2DBQA 3FF4A 2VZ8A 3MTGA 5EIOA 3BZUA 4EITA 5KIAA 3NJ8A 1BSVA 2IYOA 1PR9A 2IZ1A 3SJ7A 1YO6A 1KEPA 1DFIA 3ONDA 1QRRA 4FFMA 5A05A 3W4IA 5DULA 3DWFA 1AHHA 2JFHA 3GUCA 1R37A 3JD1A 4DYDA 5KTKA 3I9NA 2TMDA 1E77A 2QQ5A 1H0KA 5TT0A 2WYWA 3JD0A 1LU9A 3WNVA 1EVJA 3UCXA 3GMSA 2Q4BA 2IZ0A 1YL5A 3HDJA 3GVHA 1LLCA 2FPGA 3G3EA 3H9EO 4FW8A 2WMDA 2FR1A 3CH6A 1DC5A 1LRKA 3RVDA 1E6EA 4RGBA 1FDUA 3AY6A 3VPGA 4BKRA 1RWBA 3AWDA 4FFNA 3WBFA 3KLPX 2EP5A 3FNFA 3Q0EA 1EQUA 1ZSVA 5L4NA 1M6HA 3ICCA 1UAGA 3AY7A 4KMSA 4AJIA 2EKPA 4QUKA 5JMPA 3NTRA 4AJKA 4AJJA 2BFPA 1HL3A 1U9JA 3OF2A 3QWHA 2EKQA 4RDHA 4URFA 3I1JA 3GDGA 5KKAA 1UXJA 1ZEJA 3I9LA 4HNHA 4YJGA 2GLXA 5KVCA 1R15A 2Y67A 4D0SA 5JAZA 1EBUA 1UDBA 3Q1LA 1JVBA 3DAFA 3E48A 3IQDB 3VZRA 3JYNA 1NTOA 4K26A 4R51A 2ZTUA 1DIHA 2YZ7A 1LSOA 1GUFA 2EGGA 4UEKA 4UUOA 5CPFA 2Z95A 4E0BA 4J0FA 1EQ2A 4DREA 3RU9A 1GADO 3OHSX 3ZWXA 1U2GA 2C0CA 2J5RA 3D3EA 4DA9A 6LDHA 2J3IA 4J4TA 4IGFA 4P4GA 1HDCA 3DOJA 4BV9A 4PLZA 3JQ8B 5GMOA 3DR3A 1NFFA 1NHWA 4CR6A 3GK3A 1NVMB 3KYBA 4BKQA 1YS4A 1X1EA 5CDTA 1E7RA 3RC2A 1JAYA 3C7DB 3RFTA 1PS8A 4L9RA 5CDUA 1ISHA 4NNJA 5I8WA 5A04A 3IUPA 3A1NA 5JPIA 3ZGYA 2Z5LA 1FDSA 3OQBA 3JQAD 3M2TA 4DBZA 3RSHA 4M8SA 1PJ3A 3AY3A 2OL4A 1NQOA 3PHJA 2YQ4A 5F3RA 1ZMTA 3LQFA 2O4UX 5C7OO 5DBIA 1I30A 4BNTA 4CQLB 3AUAA 4BKPA 1X7HA 2NVBA 2Q2WA 4PN3A 3VH2A 1DXYA 1NPTO 1RM5A 1DFGA 3QIVA 3RI3A 1NASA 2AQ8A 4Y9DA 3O8QA 1YQDA 4HXYA 4RVHA 5C5IA 5I7FA 4PLCA 5KWEA 3GVPA 3DBHB 5L4SA 1ISFA 4WOKA 2GRAA 4R69A 3GG2A 2AA3A 2I65A 4Q3EA 2X86A 4D46A 3OEYA 5IDYA 3NGXA 4YB8A 1C3VA 4EJ6A 3C8MA 3JD4A 1AXEA 1KY5A 3BYZA 4I5EA 1DB3A 2PFGA 4TKLA 4CR8A 2DKNA 3KO8A 2HQ1A 4Z9YA 3CMMA 3HN7A 4XWYA 2GN6A 1B14A 4QFDA 4NDNE 4YRBA 2YHIA 2E82A 1RM3A 2ZYDA 3UN1A 2X0IA 1EK5A 2C20A 3RKUA 3W4JA 2X58A 3NUGA 1KS9A 2HK8A 4ZQFA 2GN4A 3RBZA 2I99A 4NHEA 3WJ7A 4YAJA 3I9KA 1CERA 2ZYGA 3LF1A 1U2DA 3S55A 1HDRA 2FPIA 5KCZA 1JWBB 2CDAA 4GX1A 5CPBA 2PKQP 4TRJA 1QP8A 1C0KA 3HSKA 4UUPA 1VJ0A 3ANLA 2HJRA 1MG0A 1IYZA 2DVMA 1VSUA 2EEZA 1HE5A 4RF2A 3HQ4O 3CKYA 2DBRA 4J91A 2XXBA 1AN9A 3U49A 2D59A 1HSOA 1TA4A 2Y1FA 5L7YA 1TT7A 3NT2A 2RAFA 4W4TA 4A27A 3M1LA 4JGBA 3PIIA 3JQ9A 4AJ1A 4CQMD 1LDMA 2X8LA 4GBJA 2VHYA 2PZJA 4DBVO 3DL2A 3ZWWA 3GY0A 4MVJM 1LLUA 1E1NA 2CVQA 4S3MA 2Q45A 1YE3A 1GUZA 4NPCA 3MCVA 3LK7A 5I9LA 1ADCA 1U5CA 3JD3A 3JCZA 3JQ9C 3ZHBA 1FMCA 1T2EA 1P1KA 4AL4A 3EVTA 4FSHA 4XYGA 3JQAA 5T57A 4INAA 5T8KC 4I9NA 3W8EA 4PG6A 4A2CA 1P1IA 3WBBA 4XQGA 3GDFA 2OHXA 4AJPA 4MPDA 2BH9A 3PHHA 4Q3CA 3GUYA 1GFSA 4L4XA 1NWCA 2O23A 1OAAA 4B7CA 4BO5A 3HFSA 3L4BA 4XIYA 2ZB7A 4E3ZA 3SC4A 5G4KB 2CZCA 3B1FA 3CIFA 5I8ZA 5IN4A 4EJMA 1YB4A 1YDEA 2I9PA 1B8PA 4IM7A 4YXFA 1UZLA 3DOOA 4PZCA 3QRWA 4XEHA 3E8XA 1B3BA 3DTTA 1QV6A 3GEDA 2QRKA 2A92A 4M49A 3TSCA 3PJGA 7MDHA 3HADA 1MLDA 3ZI0A 2HAEA 4AJLA 1UH5A 3Q9NA 1FXSA 1BWSA 1NX6A 3E5RA 4KOAA 1YKFA 4YVFA 4EGFA 3A4VA 2Y1DA 3E18A 2I67A 2HMVA 2NNLD 2Y1EA 1QYDA 3WR5A 4RPLA 2A94A 1WLYA 3TJRA 5JAQA 2X23A 5A3JA 1YBVA 5TLSA 1GQ2A 1TLTA 3FHLA 2NU8A 4OOEA 1T1SA 1G1AA 2NVUB 1T26A 3V8BA 1ML3A 4CLRB 4WCFB 2P4QA 1GZ6A 3WQQA 4L74A 5KKCA 3JYPA 4XA8A 4FJ0A 4IQ0A 1ZMOA 4R3NA 5K6AA 3AFNA 3RUAA 3VPXA 4M89A 2W2KB 3UCFA 4NR0A 1X0VA 4TRNA 4U6QA 4AJEA 2C29D 4PGFA 4XQ9A 4A0SA 1ORRA 4DUPA 3DONA 4MDHA 3FSRA 4WLFA 1N7GA 4CLOB 2Q2QA 3RKRA 3PRJA 4BQPA 1ZJZA 4NFYA 3BA1A 1ZW1A 1DC3A 4RF5A 4D3SA 1LNQA 5BR7A 4YWJA 4RVFA 5U4QA 5K6AC 3HN2A 2XAAA 2RBEA 3D4OA 3WSWA 1O8CA 3IDSA 5TJHA 4DTIA 2Q2VA 4QECA 4R5HA 1PJBA 2A9FA 3K31A 4MVJH 3DAPA 2Y0CA 2A4KA 2Y99A 2ZQYA 2FSSA 3CXRA 3RU7A 3VOSA 4E21A 1N9GA 4RZHA 1IB6A 3WDSA 1MFPA 3F1LA 4JBIA 1TB4A 4CQMA 5IF3A 5COBA 3H2ZA 3OMLA 4PLYA 1E3EA 2FZEA 2HK7A 4O63O 5CHEA 4YJHA 1HDXA 1Y9EA 2AMFA 2YFHA 3C3XA 3K2EA 5G0WA 4A5OA 4Z6KA 1VL6A 4CV0A 3L6DA 2ZIZA 5G0UA 1EMDA 5TNXA 2V6GA 1FF9A 5H82A 4ZU3A 3BAZA 9LDBA 4OO3A 4BNLA 5KNLA 4RPJA
chains in the Genus database with same CATH superfamily
3VPFA 1GFIA 1CY0A 1VKOA 1UZNA 1XTZA 2VPYA 5A2GA 3WMEA 2IHUA 1YFKA 4RZUA 2CJPA 3AG5A 4UU7A 1VJ5A 4PF1A 3NV9A 3F46A 5CRIA 2PUTA 4LQCA 4NLLA 2WNIA 1CJUC 3AI7A 3HGQA 1NFQA 2PGOA 2BFAA 1K66A 4N3AA 1L5KA 4C4RA 1Y1LA 2ZYVX 3NP7A 4ZJUA 1QZTA 2J0QA 3AQIA 3D0QA 9ABPA 3G2QA 1MB9A 4PY2A 4QAQA 1E9EA 2WHEA 5F5XA 2GT1A 4IUCS 1EGVB 3R24A 4RDXA 3J7TA 1SCQA 1Z6YA 4C4OA 4UBKA 3MBOA 5JY1A 3PWKA 1ZC3A 1AUPA 2GN1A 2ZSJA 3BSWA 3EG5A 2FN8A 3EQZA 3ZV3A 4AJHA 1Y1QA 4CKEB 4K81B 4B33A 5ICSA 4JP1A 1N2GA 2XWPA 2PD3A 4Y2YA 3AEKB 3L7MA 1EVZA 1E9SA 4ZGGA 1KAGA 2YS6A 4KPUB 1C3LA 4ZRMA 4ZAFA 2HWYA 4TV8B 3TYXA 3ZBUA 4ALNA 4YRNA 2BMEA 2CB9A 2CXXA 2D62A 1AZTA 4I19A 2JCBA 1KFCB 2B4QA 2VOJA 3QHAA 3DCIA 4LQDA 4ZQEA 3QX9A 1M2HA 4F6RB 3PXDA 4DZZA 5ELXA 5CVJA 5BSVA 1P5FA 5K4GA 2BFEB 2IYPA 2W22A 1RADA 1NBMA 2QMUA 1XU7A 2R66A 3BIOA 3L8CA 4QUHA 1N2JA 1RWVA 3DCNA 3R5JA 4KBGA 3EVAA 3G9TA 2NU8B 1Y9AA 2P68A 3U4DA 4ENUA 1KKMA 2Q0QA 4JT8A 1K9VF 1LI4A 1JDSA 4N3NA 1YULA 1ZHHA 2ECFA 3D7NA 2JG3A 3HJBA 1X77A 3JQ7B 1GSIA 2GUWA 4JYMA 3SEAA 1DEHA 1J06A 2P30A 5KSYA 4Y9RA 4HS9A 1FUIA 2V74B 2NU6A 2G6TA 1DDIA 1P74A 1XDZA 2XF8A 1DU4A 4GPAA 4LHEA 3CJTA 1XVTA 4Q7JB 4LFAB 4KIGA 1W4LA 2WQ7A 1OBCA 2P7HA 1A97A 3QBVA 1VKJA 3WHLA 1LB1B 3HCWA 5KYGA 1X19A 2QTCA 2VUHB 4K6GA 3TTXA 4QAJA 2BEUB 4NMXB 3SKVA 3I01M 4EFNA 2O0JA 4L6IA 3H8JA 3R3ZA 1Y89A 4U2BA 3ZIAA 4AROA 5A4IS 1MR3F 1E5VA 1SD1A 2IZZA 3A4LA 4LISA 1JHOA 1MC1A 3R5FA 3C14C 2ZXFA 2AC4A 3HVHA 2XH8A 4MULA 4X85A 2QSZA 1Z4KA 5HK8A 1FL9A 5ENVA 3TIGA 4R6XA 1MO3A 4JVSB 3EQ9A 1D2GA 3O1JC 5EMHA 3VDXA 1L7BA 2XYHA 3KYCB 5BMOA 3CN9A 2AG1A 3W9UA 5K0FA 3UMVA 5A0VA 3M7IA 1UPXA 1VL1A 1N9GB 1U0TA 2BMFA 4IQFA 2BH2A 2HRRA 3F74A 3DGFC 2ZS9A 1ZK2A 5DE3A 4B47A 2FMXA 3GHHA 1VKHA 5A7FA 3U4HA 4Z49A 1WEKA 2FZLA 3HVIA 1A77A 4MUAA 3PUYA 3IOMA 1B1CA 4J2HA 3OA2A 3W6NA 4C4ZA 5FRDA 3L01A 3H9QA 3IDFA 1Z5OA 3E1SA 3PNVA 2JGLA 3PXAA 4PBSA 1AIPA 5CDSA 4ZCQA 3RSQA 1NONA 1CRPA 2NIPA 4ZEVA 2QBYB 1K6XA 3KXKA 1LQTA 4QDXA 1I24A 4FOSA 5LZ7A 4EG3A 2A5DA 3RIGA 3UFBA 1SCNE 1WCYA 3CH5A 3R3SA 2FN3A 2XTAA 1PG0A 2JGJA 3IA2A 3R77A 4PLVA 5BSRA 3RV3A 1YFLA 5DHPA 1SBCA 2AXPA 2CXOA 5BWOA 3UKJA 2O59A 2ERCA 5DNAA 2DSNA 1DRJA 3GT3A 3PBKA 4HBZA 4NBNA 1TYEB 4Y0AA 2C2WA 4YECA 5F98A 4P7GA 4R8LA 1WZEA 2QD5A 3GNQA 4HB4A 4MV9A 4DDVA 2HLDD 1VYHA 1SC1A 4OBWA 3ZW8A 2LXNA 4D45A 3DB2A 1NURA 3RYHA 1AKNA 1PS0A 2NUAA 5IYZA 2WINI 3S70A 1JR3A 1A7JA 2PFKA 3LOPA 4UPVA 3U0VA 4FHDA 1WVGA 1WXGA 3A6HA 4G1EB 1ZESA 5KB3A 4NAHA 4X44A 5T4BA 2YVKA 5JAMA 5C3MA 2MTBA 3GT7A 1Z4PX 5CVDA 2X4DA 2A35A 3ABRB 2D0IA 3EAFA 1W5FA 3P5SA 1QRDA 2C3YA 2RK4A 1H8EA 2X4GA 1TPYA 3K0AA 4FOTA 4TYNA 4Z4FA 1P80A 2QS9A 3PWTA 5SZJA 2J4CA 3BCHA 5H16A 3PDIB 4FXOA 3BKXA 1N2HA 2BLLA 3WGTA 3A2NA 4XVUA 2VNSA 1NXXA 4GLBA 1D0SA 2LPMA 1WKVA 4Q66C 5ALYA 4KR3A 3DOCA 3BMQB 4YCSA 3SC6A 2JAWA 3C70A 3V3KA 1ISIA 1R64A 1GCGA 4MGIR 1PZFA 1SUSA 2BFCA 2QN1A 1ZRHA 4GR9A 3CV3A 2GZ2A 4DF3A 1OJ7A 3E27A 2XGGA 5LP6C 5JATA 4AI6A 3H9GA 4H27A 2QSUA 3DAHA 4YQYA 2CVFA 4MAMA 4IEEA 3R4VA 4Q6BA 1PF7E 4ZI7B 2LDBA 2GILA 3FZNA 5M2QA 5JJCA 3AI1A 2B1JA 3GZTB 4WINA 4UULA 2H2WA 5J47A 2BONA 2W98A 3KFXA 4Z2YA 1WJGA 3RVQA 1EIZA 2O7SA 2B8NA 4JJEA 5I9MA 1Y98A 1E59A 5TVGA 4ARSA 3AJ9A 3GP5A 2R7AA 3E05A 3P2MA 1JAZA 4W5TA 2Z6QA 3H3JA 4XVHA 1AU9A 2C4WA 3IILA 3OQOA 4N5HX 3DBRB 3W9YA 1ZCFA 4NP6A 1A9QA 1JWAB 1LF0A 2C88A 3C3EA 1QDUA 3JY6A 3AM3A 4XW2A 3STHA 1QB7A 4GMGA 2O8VA 1SCBA 1N2EA 2AJCA 3BTSA 2XNHA 3QE4A 1EJ0A 1CDDA 2Y1CA 2V7GA 3K94A 4IIJF 5JCOC 2CK3A 5BSGA 1KSFX 3CE9A 4ARBA 1U11A 4QBHA 3ANMA 1YZVA 5C7LO 1W4BA 4A16A 5K8LA 3VR3A 1EP9A 4PYIA 1J2UA 1HORA 3CYFA 1FDIA 3BORA 4HAYA 1ZXXA 1EXMA 2HPHA 1ZN2A 3JVDA 4I14A 4X7PA 3ZOZA 7REQA 5JHHB 4HX5A 4JYZA 3O5AA 3MCAA 3R2JA 2KLHA 5I5GA 4DNFA 5B57C 4EVQA 2OV6A 3PE6A 3MFYA 5JCJA 1DTWB 1KVRA 1UBUS 1D2NA 2P62A 2QRVA 2Z3ZA 2QIOA 4HQFA 3ZDFA 2PGLA 4A1OA 2Y1OA 2TMYA 1XWIA 2JFPA 3TF5A 1BIFA 1KJ8A 1TKCA 2PH7A 2D2VA 3KWMA 1YOVB 2AG0A 3JYHA 1T6ZA 3CM0A 3PEVA 3A1UA 3LC0A 2HMUA 4J1NA 4UHBA 5FEMA 1N0IA 1CIVA 1GTMA 2PMFA 2BMWA 2QN3A 1O58A 1O9BA 4I4IA 2EBWA 2OZLB 1Y1RA 2K2QB 3NFRA 3A6JA 4BC1A 3S2EA 1EDZA 4EPYA 1KVQA 4QPDA 3Q41A 1U1GA 1PZEA 3R44A 1ZNQO 4DSZA 2PUEA 3RREA 1GTRA 1W5BA 3KHUA 2Z9CA 4JR2A 2EQ5A 2GM3A 4MQUA 1SZJG 1NI5A 1M67A 1RD4A 1K3UB 4ZVTA 3U7JA 1T0HB 4RY8A 2DUWA 3FM9A 3HFJA 2FK7A 4MDYA 3AP1A 4GSYA 3W5HA 1MJGA 2XBMA 4L5JA 3X1KA 1CJBA 3S2GA 1IPHA 3ONWA 1NQTA 2W6PA 4R8KA 1PU2A 5K01A 2ZAOA 3EA5A 3V1KA 2RI0A 4G0UA 2QN2A 2TMGA 1W6UA 2OZKA 2FSUA 2WJIA 4DJ5X 3QXCA 2GPSA 3Q2IA 1U3UA 4K88A 1JJVA 1AD2A 4QDOA 3NHKA 3ROXA 3CUSA 5E4JA 4PX2A 1TDJA 1MHPA 4HDOB 4CLXA 2O8FA 4PONA 2GKGA 3L7JA 3RLIA 1JFTA 3REFA 4J7XA 4I5DA 3DVLA 3EGCA 4HFJA 1U0GA 1I1NA 1PW7A 3C3DA 4J07A 1CX9B 1F8YA 3U16A 4QNRA 1A2QA 4UAVA 1J33A 2G63A 4HQNA 1KI8A 4PPNA 4BWGA 1NQXA 4P92A 1NN0A 4BX3A 3RSCA 4I4NA 5EWMA 3W5SA 2OCYC 3FE2A 2ZPTX 1ZGHA 2PHZA 4KI7A 1SXIA 3ECAA 3AHFA 3I2FA 1GZ3A 1Z0ZA 3KSMA 4ESHA 4FFVA 2UYHA 3ROEA 1YWGO 1YRLA 1PWXA 5K5EA 2GJ4A 4OLHA 3PR2B 2BI7A 4WD3A 5JFGA 1W6RA 4M53A 3ZCSA 1Y7LA 3BXPA 4FMDB 4EG7A 3GJ0A 1XCGB 2OC4A 3ZD8A 1PGQA 2OHHA 1TX4B 4G8JA 4RNCA 1ORWA 4KDRA 1NMSA 3EZ2A 4B84A 4DWVA 4TKVA 4GUDA 2C9OA 4DV2B 3DMDA 3IP3A 2WHPB 5AICA 2JKYA 2IXTA 2R2AA 4FJ1A 1ULUA 2EG5A 4YJFA 4RMNA 3UW3A 4FHGA 2ORYA 3D8UA 1G60A 3TDMA 1F17A 5CT5A 2WFLA 4WW0A 3U44B 2W43A 4E46A 3QKWA 4MIKA 4P32A 3RBAA 2XA2A 1ZISA 3KZNA 4JL5A 4Q0MA 1PW5A 4DUYB 1F2DA 1XXHE 2XMZA 1LJUA 1QCCA 2VUSA 1FUUA 2MCFA 2CLFB 1JHQA 2OGUA 2HTEA 4Y0VA 1JT2A 5FX2A 1FFAA 3GPLA 2KBFA 4YCNA 1QHHB 4Q7EA 1V6AA 3OE7D 2IUTA 1N7HA 4KPGA 2XYVA 1PJSA 2QUIA 4Z8YA 1WNTA 2ZLBA 2JJMA 3DO8A 2X3FA 3V4ZA 2XB4A 4HSGA 3AFHA 3O26A 4KU4A 4XLZA 3FUVA 1MQSA 5E6SA 4YWHA 5C53B 3BB3A 4YROA 2Q1UA 2ZSBA 2GA9A 3AESB 2PS9A 1E3LA 3E22A 3HB9A 2YXPX 1A1VA 5CAEA 2D3TA 1UBLS 3EXFA 4PZ9A 2RSLA 5IUNC 4GOMD 1QVRA 3LKBA 4CU2A 3DUFA 1MH9A 3I6BA 4FE7A 4IVNA 3UH0A 2OZPA 3LQKA 2B3DA 3BERA 1GXSB 4XRGA 2QTAA 4HWSA 1L7OA 3ER8A 1NI3A 4MVYA 2CLDX 2P2NA 1NKSA 2Q4TA 2F1KA 2H7YA 3BWVA 3I5YA 2ZK7A 4OB7A 2NVWA 2XWBF 3N2NA 2P6PA 2GSDA 4CRWB 2AR9A 2K87A 3I1YA 1HFKA 1P19A 3HCRA 3B20A 4E14A 3TLZA 3GGGA 4H18A 1KK2A 2D6FA 3R7WA 1NNLA 1IZZA 5K2OA 3ZVNA 2VHEA 3Q87B 1XKXA 2P69A 2R8PA 4WKNA 3DA8A 3RWBA 1E2GA 4BZXA 3KQHA 4AN0A 2J0VA 3LPNA 2P11A 2AX3A 1XIVA 3HXKA 5B5SA 4PICA 5L7TA 1EG7A 1SIBE 1UADA 1VBKA 5U9CA 4ZTZB 4HVCA 1KNXA 3LZCA 3MWFA 3CNHA 1LTKA 1OTYA 2OBYA 3OI7A 2ZZMA 2EL7A 2RH8A 3OTWA 3VDMA 1OI7A 1H23A 2VN8A 4MI6A 3BXEA 1JQAA 1SHZA 1NFRA 3F8WA 4EB0A 3NIDB 5A9RA 3MUFA 1GUAA 4BWVA 2VTBB 4XQEA 1SOMA 1N2ZA 1NVXQ 3MWDA 5EI5A 1UFOA 4HTAA 1RI1A 1D9XA 1LLDA 1RYMA 2W2QA 2FR8A 4XLLA 5DGTA 5DSZA 2GPTA 4GP7A 4C7JA 3O82A 4LI3X 1YAJA 3MLAA 5FOTA 1X8LA 2Q4DA 4HAUA 1UKBA 3C7AA 5ADWA 2VIIA 3L1IA 3L02A 1W19A 1RDFA 1GNRA 2DQZA 2O3UA 4HDNA 1V7PC 4OU5A 4CUKA 3ZVMA 1RI5A 4FMBB 1PNRA 1V37A 4JJFA 1SZCA 3N2GB 2B61A 1A2BA 3PUWA 5IPFA 1Q16A 2JLWA 4YRLA 8ADHA 1BMQA 3C48A 4EAQA 3IQHX 4PC7A 3R9WA 3HY4A 4LJSA 2HQSA 2EATA 3P9SA 4D3FA 1DAOA 1RAGA 2L18A 3TEMA 3JQBC 5MGBA 4AU1A 1KK3A 4YT4A 2PBFA 1MC4A 4RA6B 3ZU5A 6AT1A 3ERCA 1LVGA 3N8GA 3E81A 2VCYA 2OP1A 3LDUA 5TMPA 2E49A 2ZSHA 4PZZA 4GEKA 1C4WA 2ASVA 4OA8A 4LNUB 4OPMA 3UAGA 4AAYA 1GAJA 1ZL2A 2FPPA 3MWEB 5G0VA 1JFFB 4UTPA 1HETA 3ZE1B 2FWAA 2YWCA 4KO4S 1DGQA 3IAHA 1G5QA 3SLGA 4NS4A 1K6JA 3DL4A 3GMDA 4QHTA 1PK7A 3WL7A 3HJNA 3H11B 4OG2A 1ZH8A 4BVAA 1HSZA 1CRZA 1BKDR 2HLHA 4HJRA 3UFXA 4CKWA 4GC5A 4DEXA 2C3MA 1B6RA 4RTPA 3B3QA 2VT6A 4AYXA 2ZWIA 8OHMA 2MOKA 3AU8A 1XN4A 3CW8X 5J4HA 1PTJA 5U4XA 1LC3A 2OQ2A 3NVAA 4Y6PA 3RSOA 3U7QA 3M6VA 4ZYYA 3EAGA 1KO8A 1B93A 3EOZA 1XLVA 3NWJA 5H7XA 5TC4A 3UGKA 4IMPA 5G4LA 2C3OA 1EBBA 1ZNZA 1HLFA 3MEQA 2DHRA 2QV0A 4E2XA 4BNGA 2HD4A 5GIOE 1OGJA 1Z0JA 2HA7A 1BVUA 3QI2A 1GCOA 2I6XA 3DBVO 4X90A 3WK5A 5A06A 4OK3A 1Z6TA 2QL6A 1J9GA 5KX5F 1IBKB 4UXJA 3L49A 2Y9PB 5EUBA 3F6RA 2WJJA 1JXAA 4JCCA 4Z4QA 4CR7A 3WLKX 4KRGA 1OLOA 4C6HA 2XD9A 1BJRE 4QO8A 1VCHA 5BVGA 1LNSA 1SKAA 3W2IA 4PC6A 1F20A 2J45A 1LVUA 2JFGA 3LVRE 2IDMA 3S99A 3I8SA 4AO7A 4F8EA 2CHVA 2FPLA 1TMKA 4JN6B 3C24A 4G63A 3M6AA 5AIAA 5E8JA 3X1XA 1QC5A 3BEOA 1EG2A 1GDDA 1ZL0A 2BSAA 4MR7B 4BLRA 2UXCB 3L7YA 4WFKA 4BVKA 2XUPA 2PL9A 1IPEA 4J2TA 4QXMA 3RS2A 1N8NA 5CDFA 3GVXA 1DQYA 1VSVA 2C57A 5K4AA 4X65B 1CEYA 1FFGA 5DTJA 5MGNA 3BL5A 4HNRA 2V03A 4XD7D 4L7VA 3SZOA 3N76A 3BGOS 3RIHA 4XB2A 1CFZA 3RYFB 5JZ9A 3AUTA 4PZDA 1XBTA 3U3RA 1Y6QA 4WLEA 4ALIA 4B35A 4EHLA 4URVR 3RYCA 2V9CA 2O8BA 3AOEC 2XZOA 5BWNA 1YRWA 2H18A 2QDKA 4K2AA 1TYZA 2CLCX 4QQRA 5JE8A 4FFBA 1Y8RA 2PA0A 3A1VA 5ER9A 2C4MA 4NMMA 3I42A 3ADKA 3OOHA 5FXMA 2Q49A 1XNQB 2OM6A 1I0ZA 1ZCJA 1UT6A 4KH0A 4QQFA 4BX8A 3FKQA 1MX1A 2KWIA 4YCDA 1BVRA 3RVSA 4J1SA 2IEDA 3GCDA 4EG4A 2I03A 1EVIA 2YHIB 5CH8A 4W9NC 3LHFA 2QE7D 3RODA 3BHNA 1UC4B 3T61A 1WXQA 1YQ9A 5F52A 4CWAA 3ZE6A 2V7VA 1VE9A 1XNGA 4ZI2A 2VBFA 4QPCA 3SVTA 4QJ5A 2C4UA 3M9XA 2WPDA 3LCVB 3NPMA 1NBEA 2JLRA 2QRNA 2ZAYA 4KIUA 1LVHA 4V0ME 2A0KA 3IOEA 3LWBA 3OFKA 1P33A 3P71T 1QYCA 1UK8A 4HJXA 3PGLA 4K9LA 4PU0A 1HTTA 1NSTA 1CJCA 5IBRA 4DT1B 5BVHB 5BR4A 2Y0EA 5LL6P 4L8GA 2PM8A 2XE6A 4WRRA 2FPIB 1SBHA 4D42A 2CLHB 2BFNA 5D85A 1QIMA 3I4CA 3IEKA 1DUVG 1HYBA 1YUBA 2XODA 3D8NA 4IDAA 3KEMA 1Y7TA 4FFRA 2JEZA 2ZRGA 3OIFA 3VU0A 3CEPB 3FDFA 5DB4A 4JY7A 1X2EA 4GZ5A 4EPVA 4BEJA 4EJFA 3C6QA 4HH1A 2O1XA 2OKCA 2QUKA 1NE2A 2XNSA 1D2CA 2XTZA 1LLFA 3KZXA 3O3MB 4UVEA 4U7TB 1QX3A 1X7XB 4B6PA 5ALWA 1D4ZA 3E70C 5EWJB 2BFDA 2DQYA 3CVOA 1FZQA 2X14A 3GAZA 4MAFA 5AXBA 3ZX5A 3ZWAA 2XA9A 3LQRA 3OT1A 3OTQA 3ICWA 3K8OE 5JAIA 2QD3A 4WNAB 1TM5E 4NX2A 4WTOA 4I50A 4CYMA 4DRXA 1L4KA 1PJTA 1QMPA 4TS4A 3ZWNA 4GQAA 2EARA 6REQB 2PEYA 3KP1A 3S44A 3OP4A 5J4KA 2O7QA 1X9IA 1YZ3A 3S7TA 4H77A 1IATA 2ATVA 2CLOB 5AVRA 1W88B 3WS7A 1P2GA 5HKKD 3PQ8A 3GU3A 4YQFA 4FYYA 1BXGA 4LXTA 5F1YA 2GCPA 2J6BA 5F5NA 2JK0A 3IP7A 3JPYA 3JQAB 3URKA 4D9BA 1N1GA 3E2IA 2EG9A 4ENRA 3EOBI 1MN6A 4HXGA 2EFJA 4MCIA 4CUJA 1E3QA 2BTQA 4LXUA 2W6IA 3GUVA 3ZNNA 3S8YA 3N86A 2IPAB 3AX6A 1MGOA 1QNFA 2PV7A 3TO5A 4F93B 3LBIA 3SNHA 1NVWQ 4N54A 4CCAA 3U4CA 1DXHA 2ZBPA 2TECE 3HR4A 5KQLA 1ORTA 3CF2A 4IIJB 1KORA 3K9BA 2O06A 2C4VA 4RYDA 4RBNA 1DP4A 3B1VA 3Q12A 3EIOA 3E3LA 3BHIA 3HVKA 3WK7A 2DETA 1DPGA 1IN8A 1EDBA 1L4UA 1N2CA 4MITA 4IIGA 3KTAB 3GLIA 1P61B 1NRXA 2E18A 4Z9XA 3WL8A 4ZJZA 1XTUA 2QUZA 1LV7A 2X5KO 1EGAA 4R6WA 4CMHA 2VPWA 1X92A 3H17A 4MKXA 7YASA 4BB6A 2QLJA 1DBIA 3OX1A 3RTBA 3JVUA 3WLFA 3AGQA 4EMTA 5I5EA 4L57A 2V7QA 5E4FA 2V58A 2WVHA 4C20A 5KQSA 1NHGA 3ZWBA 2HL6A 1U7TA 3L5KA 2YDYA 1K4KA 3UBMA 3ZHCA 3MS4A 2XUFA 4GVLA 4HNAA 2D5LA 1K3FA 2M1XA 4JZYA 3VMMA 2UVDA 4JLSA 4ATNA 4QSMA 2NNWB 1RFGE 1X9GA 2CC2A 1QAMA 3LM8A 2ZAMA 4ZO7A 4H2DA 3ZN2A 2DFVA 4UKDA 5AJVB 5JCZA 3HUDA 4S1PA 5C7IO 1QIFA 3FPLA 2B6HA 1SXJD 2IUUA 5HS4A 4P93A 3NAZA 3U7GA 3T8YA 5FBWB 3AL2A 2QNBA 5DGXA 1YIOA 1E4VA 2H8KA 3PUXA 1VYUA 1WV0A 2BHNA 2IXAA 4R7TA 3U9LA 4NE2A 4F4HA 5IJ0A 1QR6A 2ODBA 3MUEA 4R83A 2QM0A 4XWAA 4QVIA 3RC7A 4K9MA 2ZI6A 4YREA 2YL2A 1QE0A 4PR0A 3ZXXA 4E2WA 2R9VA 6CHYA 1Q1ZA 1X7GA 2XDAA 1E0SA 3ZQ6A 4H0NA 4QYMA 4AN4A 4BMYA 5A4KA 5JFOA 3IKTA 3NVKI 4QKQA 4B3IA 5E7JA 1KI2A 4H16A 4FWBA 1AA9A 4FGKA 2C00A 1SHTX 2XB6A 2VT7A 3QE0A 2FN9A 5DMHA 2QPLA 1FEZA 3TTYA 1N75A 3V1UA 1RRPA 3D6HA 4HPWA 1P17A 2IKSA 1ICIA 2XI4A 3D5TA 3I9V6 3B3AA 4ID3A 3V4OA 1OGIA 3TK1A 4DLBA 2X5XA 4Q37A 1R6UA 4EA9A 5FTNA 1F2TB 3LQ2A 4C0KA 1HE3A 4HDMB 1LQUA 2H1CA 3KKOA 2JFYA 3GPCA 5ALXA 2EJWA 2OFFA 2R5NA 4JIGA 3TLBA 1FNMA 3BB4A 4TZ6A 4E5VA 1ZSNA 2IK8A 4D8YA 4XRRA 3B3JA 4ZREA 1FFXB 5EIBD 1H4QA 2WUEA 2Y1XA 4GM0A 3ZK8A 2VTBA 4BFWA 2B8WA 1KEWA 1XR3A 4G81A 3S0JA 3SOZA 3SQNA 3V1MA 4CQMB 3F0TA 3UIEA 3GJ6A 2I2XB 1PT5A 2A88A 4P0TA 4ZT7A 1Z37A 4BNHA 2HA3A 4RPKA 4EY4A 1B8VA 1ZH0A 2HV8A 2OCAA 1X14A 1JECA 2ADOA 3G1TA 3L7OA 2HHAA 5AUNB 1V8DA 4PRLA 5B64A 5AXCA 3FG9A 4W9RA 4XDHA 1W2HA 2RH5A 1VYVA 1WCIA 4JQSA 5DHAA 3EDYA 1Z56C 1GGNA 2EF0A 2ODPA 3KR0A 1II0A 1SKYE 4K3UA 4JJIA 1ISMA 1YU9A 1PNVA 2JD1A 3EVFA 4IJKA 2VJPA 1JTFA 3AONB 4CHGA 4S04A 3PX7A 2CNWA 2Z9DA 3OTHA 4CV1A 1LDNA 1UJBA 3TOXA 4AIRA 5K3EA 3BMCA 1RRCA 3UAYA 3T9AA 2HPAA 4NFSA 2B1IA 2XOXA 2VT3A 1TADA 2WKPA 3UT6A 2F55A 2H1OA 1NXOA 2G5GX 4E4RA 4F96A 4GZ6A 1RLMA 2WTEA 2P4EA 2JFVA 2XT9A 1SCJA 2GMWA 1NL3A 2AOTA 1XQYA 4GHWA 4GIBA 3DL7A 4UNNA 4B4OA 1ZNXA 1VDZA 4BVGA 5KSOA 3GT0A 3K32A 1HZZC 2B99A 4BLUA 5GADl 1F1BA 3UAVA 2ZR7A 2EP7A 4RWEA 1IWOA 5HF8A 1YU6A 4CI9A 1PGJA 4LVCA 1ZD9A 4ACBA 1Z39A 2F1JA 2PZEA 1GCAA 1RKVA 3FVVA 1DG1G 3U26A 3RVJA 1IHUA 1P6XA 1G2IA 2IEZA 2R2GA 2W4MA 1XPRA 4BP3A 2C94A 3GPIA 3KCQA 3EIHA 3NHRA 5BNZA 1DLIA 4H60A 2AJBA 2C95A 2HXGA 3KOWA 1M1YE 2JD0A 3SG0A 4XIJA 4P5EA 4P6VF 5LP6A 4LGVA 3AVTA 2WHRA 4WGGA 3VNSA 4UEWA 1V5WA 5AW7A 1LDEA 4KGVA 5HF9A 3SC2A 3SAJA 4CCSA 5LC1A 1UBKS 4UQOA 4TKZA 3VGJA 1UAYA 4IMRA 3E8MA 5EVCA 1GFZA 1OMOA 1SIOA 2QZJA 4R1LA 2BP7A 2CL7X 3VZBA 4WCDA 4CDGA 3N8HA 2FA9A 2HRBA 1XK6A 5ETJA 4AUKA 2NU6B 3H2KA 1TU4A 1QHGA 4TXLA 4EDFA 3VBCA 4RZ3A 3QUAA 4RGVA 1ORVA 2B3TA 3T12A 2JJ8A 1VJCA 4MWSA 1Y5NA 1J9ZA 4WY2A 1PHPA 4B34A 4G1FA 2XYGA 2IW3A 3O9ZA 4YJ3A 3IUQA 1ZY2A 1RHMA 4G2TA 3RT7A 4REQA 1CY2A 4MGZR 1R0SA 3DM9B 1AZSC 2ZB4A 4W5NA 1YJXA 2HCRA 4L76A 1HYQA 2E3JA 3D2CA 5JECA 1NA5A 1Y42X 3OHPA 4IS2A 2G28A 4QELA 1LK7A 1DO0A 3HZHA 4MW2A 3G1UA 1K89A 1UINA 1NN5A 4PZPA 4Z4HA 3QFTA 1R6XA 5DRYA 4D41A 4A6EA 5KJ1A 5HOEA 4KI0A 4LDAA 4MKIA 1GL3A 4O4HA 1IM8A 5B4UA 1USUA 1XUOA 3KJEA 3M33A 4KCGA 4QLAA 5KAPA 4C22A 1Z2PX 4CHTA 1N8KA 2PX3A 5C52B 1ICEA 4G86A 4X84A 1L5FA 2ZI5A 1N6LA 1WBDA 3OCVA 3F9IA 5D3MA 3DZJA 3MUNA 2PAFA 3NGLA 4GPTA 1DAHA 1Z7WA 2IHJA 2O3RA 4DDWA 5BP7A 4RGYA 4QWWA 1UC8A 4WZBE 4BMSA 2J6CA 1SVIA 3S8EA 1XD9A 1KIFA 2TSYB 2ZQZA 4N0DA 3T7KA 2IYFA 2ISCA 3K70B 1KTIA 1IJFA 1NW4A 2WVJA 3KL4A 1SB8A 3M1AA 2IUYA 1Z63A 1YXMA 1T3GA 4FYVA 4KQKA 4Z7OB 1T9GS 2QQEA 5IP5A 3GJSA 4Y1GA 4CMAA 1RABA 1Z8NA 2I2CA 2X9GA 3OIUA 1T9KA 4PC3A 4R1SA 3COSA 3QUBA 2HX1A 1F51E 1FRFS 2BMJA 3U61B 1NPDA 4AB1A 3LDHA 4BLVA 4F9TA 3P9IA 1XROA 3SHWA 3AUJB 3WNBA 4PFJA 1JDNA 3FYCA 2K5UA 3NWEA 4MIEA 2X0FA 3TS1A 3ZDQA 4F7DA 5CM2Z 4ZPXA 3NQ41 4YFVA 4QNMA 1F3LA 2Q7OE 3ZDZB 1ECBA 1FYDA 3KZCA 3TAHA 1AOXA 1TMYA 5AXAA 2QKYA 3TOSA 3ZWVA 4CCYA 1GQYA 1JLHA 2D7CA 1DWUA 2JI4A 2XBLA 4QOIA 4B8ZA 4NOMA 1CKEA 1DADA 2PGXA 3GEHA 2PKEA 3J80A 2RKOA 1YE5A 1Y6JA 4EF5A 2QY6A 3SEZA 1LXCA 2DT5A 3HL0A 3ONNA 4Y98A 3ORFA 3ONVA 3K05A 1AS3A 1M7BA 3RYHB 2FJPA 2Q1WA 2YINC 3JR7A 2NUAB 1Y0BA 1JLLA 3I6IA 2HLDA 1V16B 4KDEA 4QBIA 5IYZB 5MN5A 2PE5A 1OVMA 3BBPA 4KLRA 5DNWA 1DTEA 1RWOA 1L5GB 3PJDA 3BUSA 2ZRKA 2PRZA 2GBCA 4LN1A 5KHLB 4MVXA 3LO8A 4LYJA 4JOSA 2DZDA 1EXWA 2WF5A 1YA6A 1QNLA 1AM4D 1J8QA 1SHUX 2QZ4A 1QPGA 3KE8A 4ILEA 3CF6R 4IF6A 3C7KA 3L0DA 3A6PC 2VSXA 1Y3IA 1HE2A 2WE8A 3BFVA 3FYTA 3ZBQA 3K0AB 4CMGA 2I3DA 1IEQA 1R50A 1I7PA 1L4BA 2HH9A 4LE1A 4ZEXA 1K06A 1OU0A 4M98A 4NQRA 3PNQA 4KVGA 5KX5B 2DB3A 4AXXA 4B3BA 4HDAA 3SYKA 1WZNA 5JBQA 1TQ4A 1K8ZB 1GCIA 2QI9F 3N2ZB 2XCUA 3OLWA 1JEEA 1KC1A 4A2WA 2A1IA 4ERXA 4TYMA 1NDUA 7ABPA 4AM8A 4OHOA 3ZY4A 3H84A 5CDYA 1H6BA 1TQ6A 1MW9X 1WP4A 3EGOA 1ZKMA 5JO9A 4EVRA 1N0UA 3VZSA 1QF9A 4DNQA 3HJAA 2FHPA 4I50F 1ODSA 3LY5A 4BL5A 2P0AA 3GI1A 1S2OA 3WLOA 1QGUA 4D74A 4Z8XA 4DC0A 1GPMA 1IZ7A 2WIJA 1LS6A 2ZTLA 4FQ7A 1Z4LA 4BYMA 1CUDA 3B6EA 3QLVC 3WXMA 2B7BA 4JL6A 2RCNA 5JMOA 2VT2A 3E58A 5IS2A 1XRLA 3MB8A 3KQNA 3ROQA 1CUBA 3IT2A 1A95A 1WVMA 4RJKA 3TL2A 3H99A 4QPNA 3MTIA 3ASVA 1EJBA 3C97A 5C1PA 2R3SA 3L7NA 4RLSA 4OJTA 1FFWA 1JHZA 1M8FA 2B5VA 5DM1A 4CG1A 3EYAA 4COOA 3HNPA 4TZTA 1XDSA 2NO4A 1R8QA 4YJDA 4UE6A 5HZKA 5FT9A 1QQAA 5JS7A 4UVIA 1OYWA 3IELA 4L16A 5F78A 2PMEA 5IK2D 1VKZA 1XZHA 1GG5A 1UMCA 2V3WA 2WEKA 3LO5A 3FCEA 4IIXA 3EQ6A 3UATA 2EJCA 2LIPA 1A04A 2QU8A 1R7RA 4DVGA 3IC5A 4DYVA 1TNDA 5KNBH 3KSUA 2IX3A 4RD4A 5C4GB 1T3ZA 1ZIXA 7REQB 1TAGA 1YI1A 2AFRA 2G8LA 2XB9A 3UC9A 4DWOA 3HDYA 1NG9A 3FMPB 5GJBA 4QOFA 2WDZA 2CN1A 5EQDA 2FWNA 4YRMA 3ADCA 7MHTA 3QPCA 4BQFA 2MMGA 4RGQA 1Z28A 2X9LA 3UKDA 5JNSA 2QRVB 2VWPA 4R3WA 5DNDA 2O2CA 4G1VA 5EESA 5LQDA 1EHCA 1USKA 2DBVO 1HOXA 4LTMA 3H8SA 2B35A 1AVTA 2C2XA 3GFQA 5CIQA 3LLVA 4H7JA 4LY3A 2GD1O 4RE5A 2Z5FA 1H2BA 1KERA 3BD8A 3ET4A 3HCBA 4N5MA 3ZCPA 4DR5B 5CFOA 2BTEA 3SZRA 3A2MA 3OX4A 4JXZA 1ZIYA 2VWQA 1S3FA 3C8UA 1Y4DE 3DBLB 4YUAA 3W8FA 2ZE8A 2HQRA 1AS0A 3A1FA 1OI4A 3PITA 3C3MA 3KKZA 4GU5A 2IXBA 4OBXA 5KI6A 4ZT2A 3K0CC 1KL7A 1L5RA 2QF7A 4LXQA 5H68A 4H7HA 4BFLA 4JUAA 1YS1X 5L3SA 4MQ6A 5TGZA 4LSMA 4HNUA 1Z2NX 3ZK9A 3AVYA 1SWVA 4GT1A 4HH4A 1RYBA 1TD9A 2H1RA 4XQ0A 4R2JA 2PUBA 4Q9KA 1GVNB 4Z4GA 1ATZA 1MJFA 1SG0A 1ZN8A 5IUJC 2OWDA 3Q6NA 1G0OA 4EUEA 1QF6A 3EDQA 2ID9A 4TWRA 4KXQA 4NATA 2AEMA 5KOHA 1GLVA 5ICEA 1UOOA 5JNUA 1TM1E 3HB5X 2ISQA 2GBFA 4YMHA 3F2VA 2O8FB 3FI0A 3DVAA 1WB9A 1FIUA 2OM2A 4LRXA 3ON5A 4ZV9A 4OF4A 1AK1A 5C8ZA 2V0CA 2YIMA 4YMIA 2MWMA 2RHDA 3NDIA 4CTNA 3JQBA 3P32A 3AETA 1R0BA 1QGOA 3GCZA 5BSUA 3K8ZA 3N0WA 4OM7A 3QMVA 3I04M 4NBUA 1EDEA 2E89A 3E9MA 4ZALA 2BKVA 4JGGA 4QOGA 5GPBA 4BFSA 4ZDIA 2VDLB 5EWMB 4NYMR 3WZ2A 4CGYA 2B7LA 2I33A 2QUJA 4JEUA 2BEWA 3FRJA 1EUZA 4B76A 1DJNA 2AE2A 3QEOA 2CVZA 3PFBA 4G0OA 1IXZA 4DLNA 4P1ZA 1V4NA 2F1RA 4ND3A 1EKXA 1NF2A 1OPRA 2CV0A 4PNPA 1UP7A 2QUHA 3LSYA 2O7VA 5TDHA 1G4HA 1VRVA 1C3XA 1JPNA 3FBGA 3ILXA 4OI2A 2Q9AA 1YH3A 2J8ZA 5AJXA 3ZV4A 1C0LA 1JVNA 1IUKA 3WDLA 4OYYA 4A0FA 3M6XA 4B4WA 1ETUA 2BCJQ 1OLUA 1WSAA 3PNYA 5DTIA 3IMGA 1TCUA 1JXOA 1R5OA 5A5FA 3B1JA 4H1HA 3TKYA 1LBSA 4YJFB 1XP8A 2UUBB 2I0FA 4NZMA 2X2OA 4QUJA 3EWIA 4NBLA 4MIOA 3NW9A 4E7PA 2OLJA 2P9YA 3DOHA 5B3KA 3GLQA 2X77A 3NBQA 3GFRA 3NCHA 1XHFA 3NDRA 1V9LA 4RC9A 4MV6A 1RZVA 4YBZA 1HG0A 5CXUA 1PJZA 1RPJA 3CX6A 2FR0A 2ZTSA 1UUFA 2A9JA 3FTQA 1GZ7A 3O8BA 1OHHD 3LZDA 3WGHA 3UANA 2IH4A 4GQBA 3HM9A 5TY0A 3RU3A 1S02A 1L7MA 1GARA 1Z7BA 1K6EA 1VYTA 4YRPA 4QG7A 2NT3A 5AD1A 1UJ4A 3DEKA 4UDOA 4G5YA 3B1XA 3B6IA 2B82A 3KZVA 2B4KA 2CBGA 2L2QA 3N1UA 4U4AA 5E6SB 4B6OA 1TF2A 5LP6F 1WE2A 1XQWA 1EIWA 3WRYC 1FK8A 3WXBA 5AM2A 4HSEA 5BNTA 3EXFB 1E2BA 4QU9A 3N5KA 5KTTA 4YXWD 5GM1A 1FBNA 4B7XA 1G5TA 2A5FA 1XTJA 1XC7A 4MYDA 1M0SA 3QFCA 1U2DC 3WLQA 4EJSC 3DUFB 4PGHA 4OI1A 3WQRA 1EXVA 2OBMA 4CM6A 1G7SA 2DF8A 3EFOA 5K7SA 3WRXC 2CHEA 1YV9A 1NMYA 2AKAB 5KC9A 2QB5A 3KQUA 1K5DA 1N2OA 4F4JA 2C31A 3Q85A 3LHDA 2H16A 3OZFA 1YZHA 2YJZA 3IXLA 1KJIA 5E2AA 4J7UA 1UJ6A 2BT4A 5K0BA 2YVLA 3DV0A 3MXTA 3O92A 4N7JA 4YJ3F 4ALMA 4EUKA 4F9FA 4ZI3A 3ZU2A 4C76A 1Z0KA 4JBWA 1YA8A 3R7WB 3AYZB 1DEXA 5JD3A 3T1QA 2VTEA 3K5WA 5BQ5A 4Q03A 4M1TA 1T9CA 2P27A 4LI0A 3TZHA 3UGQA 3MXOA 4QM7A 1E2EA 2NPOA 1PFKA 1GNLA 1VXRA 2ZIFA 3PRKE 4QX6A 4DM7A 4DUGD 5SICE 1DIGA 3EFEA 3F9CA 3Q7PA 4FGJA 2YMMA 1NUAA 3M6IA 4ROSA 2IU0A 4RSMA 2FOLA 3SOPA 4W9NA 1WCXA 2ODWA 2XSZA 5BN5A 4WAUA 1C7ZA 1KO4A 2ZSUA 1K8XB 2YW2A 3H7IA 1X87A 2VP9A 2WA1A 4Q3NA 1BDBA 3GEGA 5GVRA 3R7SA 3USES 1FFYA 5AI8A 4FZ3A 4LCJA 3MWDB 4XEUA 4M0EA 4NC9A 4NEQA 5FUYA 3GJRA 1Z5UA 2VAMA 3NBYC 4FYXA 1KFKB 5ALLA 1MNQA 1SVLA 5G53C 5J5CA 3FFWA 3MJTA 1KH1A 3VAZA 3W3ZB 2ZRAA 1IN4A 1XZCA 2OFXA 3DQPA 3B6JA 1H6CA 4HI0E 5G3YA 1PV2A 4CQJA 1LPBB 3SK0A 3VTFA 1ILEA 1E9VA 1W5AA 2ZW9A 3OZGA 1XOIA 4HDNB 1BW9A 1JGTA 2ASEA 1D6JA 2IIBA 3I1IA 4IOJA 4BE9A 4O4LA 4YC7A 1PZGA 4XCVA 4ENSA 4YR7A 1UANA 2SICE 4JDPA 2D1QA 3ZLJA 4RF3A 4MV1A 1YZUA 3G7NA 3IAS6 4BEBA