1E3SA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
241
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
total genus 85
structure length 241
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3sA00
1IPEA 3A06A 3U4DA 2C07A 1D8AA 1XLTA 3ZWVA 3U09A 1P9LA 3FWNA 3W1VA 3EAGA 2UUOA 5DT9A 3RJ5A 4AFNA 2C82A 4NBWA 1LLDA 1E3IA 3W6UA 4B7CA 4I5FA 5CDUA 2IEDA 2BFAA 3PEFA 2HMWA 4DREA 2YJZA 1NYTA 2YY7A 3JV7A 1JA9A 1B7GO 1AHHA 4YA6A 4BS9A 5JO0A 4FN4A 3GK3A 4ZQFA 1ML3A 4LMPA 4D3DA 1NVGA 1ZIDA 2RBEA 4I5GA 4YEDA 1KBZA 2BF7A 2X9NA 2VZ8A 4HNHA 3HWRA 3LT2A 2WE8A 4UUOA 5L7YA 1ISFA 4E12A 2PGLA 4YRDA 3S1LA 1Q0QA 5F1OA 1FDUA 1IZ0A 1GY8A 2GN4A 4RPKA 4BB6A 4D79A 3KVOA 3SBOA 3JQCA 4JQCA 4MKRA 4DLBA 2VTDA 3CZRA 3QVWA 2H9IA 3WXBA 1TEHA 3K5PA 4GQAA 1U3VA 2X86A 4PG8A 3VH4A 1MA0A 4ZU3A 3OSUA 4K6CA 5KJCA 5T8KA 1UZNA 4TQGA 4GWGA 3UN1A 1B14A 1NHGA 1NAIA 4GKBA 2QRJA 3UCXA 3PGXA 3RKUA 3DO5A 5JMWA 5CHEA 5ILOA 1GADO 2OP1A 1SOWA 3JYQA 1KYQA 3QLJA 4HWKA 5TLSA 1XELA 3BHJA 1EDZA 1UJMA 3IOYA 4BO1A 4F46A 5I7EA 4R1SA 1OZAA 3KLMX 2VRBA 4GWKA 4JLWA 4L73A 2H6EA 1EVZA 4NPCA 9LDTA 1PJCA 3GAFA 4NG5A 2C0CA 3ZW8A 1Z7EA 3LZ6A 4G2NA 2JJYA 1CQIA 4R1UA 2EIHA 1QYXA 2VUUA 5L53A 1T2CA 1UP6A 4J4TA 4BV9A 3QIVA 4YJGA 3KSDO 3ZWBA 2FR8A 4BO3A 2YDYA 5TS3A 2GCGA 2JCYA 3TWOA 4F45A 2A94A 2EKLA 3CIFA 4A27A 3P7MA 4C7KA 2O23A 2NVUA 5KJEA 1HZZA 3WGHA 2O48X 3H5RA 4BNZA 4ND2A 5DCUA 1PTJA 2NNLD 2HUNA 4FOSA 4B4VA 1VKNA 1ZXBA 1N1GA 2AXQA 4GLLA 4KUEA 4MVJI 3D0OA 5JCXA 1I2CA 1E77A 5IAAA 1WZIA 3ROPA 1F12A 4XQEA 4W4TA 2VCYA 1LLQA 5COBA 2XOXA 5B4UA 1JTVA 4IS3A 1PQWA 4G5HA 4QFDA 4A0SA 4BNYA 4M87A 2IXAA 4BKRA 4M49A 3PFFA 2FWMX 2PKRA 3GVXA 1Y1PA 3EK2A 3SXPA 3ETDA 4WJZA 4D41A 3MJVA 1BDMA 5AXBA 5KJ1A 1QV7A 4RQUA 3GVIA 1VKOA 5COQA 2PZMA 1SC6A 3OIDA 1ENOA 1U7HA 2R6JA 1CIVA 3ORFA 4XIYA 4FR5A 2UAGA 4NU6A 2ZB3A 3F5QA 4NNJA 4MVJF 4R1NA 4S3MA 1UAGA 2GN8A 3H7AA 1WP4A 1K2WA 1XGKA 2OP0A 1XU7A 1ADFA 3TZ6A 1K5HA 3BYZA 4B3JA 2BI7A 1Z75A 4HBGA 4NH4A 3TJRA 2D4AA 4IIVA 3DFUA 4Y67A 1IOLA 3NT4A 2X4GA 1NBOA 1WDMA 1NM5A 1ZK2A 4GX2A 5DN9A 1Q0LA 3ANNA 3O8QA 1E6EA 2CF5A 4Q3DA 2E82A 3O26A 4UUPA 1EUCA 1ISMA 1B8VA 1E7QA 1WW8A 1V6AA 2RHCA 2AQ8A 4LMRA 4M1QA 5HA5A 3UVEA 1P3DA 2X6TA 1HT0A 4IQ8A 3HDYA 2BKAA 5EESA 2C54A 2BH9A 1EFKA 2NV6A 2O7SA 4UEKA 3WWYA 3HFGA 3QSGA 4WCFA 4CMCA 4DYDA 2PR2A 3JTMA 5COAA 1V3VA 4OOEA 1A9YA 1I3KA 1T26A 3MTJA 4XX0A 1C1DB 3VDRA 1H9AA 3N74A 1KEPA 4H16A 4U8GA 4RPLA 3BXXA 4YAKA 3GT0A 3E9NA 1C0LA 2DUWA 4YJGB 3DZJA 3AUUA 1XDWA 3PQFA 1NASA 1ZK1A 2QIOA 1IHYA 2JCXA 2J5RA 4XWYA 4IQ0A 1R0KA 4PLCA 2DTDA 1PS9A 3NDIA 4XR4A 5ITVA 5TQVA 2VHZA 3KEQA 5I9LA 1P44A 3OJ0A 4L74A 4MVJM 2Y68A 1EEHA 4CV3A 1WXDA 4Z6KA 1BTOA 3TSCA 2POQX 2XPCA 4ROSA 4WCFB 3LK7A 3KUXA 2VYVA 4CMJA 2VZ0A 1MGOA 4XRRA 2OOSA 3E82A 3Q11A 4WEOA 2CSUA 2JHGA 1C0PA 4YWJA 1R4NA 2EGHA 3ZGYA 1Z82A 2PGDA 3WNVA 3ABIA 3OIFA 4N54A 4D3SA 1HSZA 3K92A 3QJ5A 4QECA 3TQHA 3WQSB 2Q2VA 4DBZA 4S1VA 4HFNA 2HRBA 4XR9A 3WGIA 3UUWA 2DBQA 4OQZA 1T1SA 3FN4A 2X22A 2HRZA 3JQFA 2J3IA 1T4BA 4AJ1A 3RUFA 4XYBA 2ZQZA 5AOVA 2DBRA 4DA9A 3OQ6A 3ZU4A 3DBVO 3GLQA 4MVJP 1VC2A 4XRGA 3RC1A 3VAZA 1T24A 2ZIZA 1A27A 1GV0A 2X0JA 3KSZO 3E5RA 5JYEA 3V2GA 3JD4A 3TL2A 3F9IA 2P5UA 5GMOA 4L75A 3OETA 2E37A 4U5QA 4IQGA 4MVJG 3HFSA 3DR3A 3AI2A 3UOGA 3ZI0A 3H6KA 1EBUA 3GAZA 4I9NA 4J49A 1H2BA 4BNTA 5L9AA 2FY8A 3WGQA 1T4DA 3JQAD 1X0VA 3WYEA 3KHUA 1LX6A 1W8DA 2J5KA 3QV1A 4EJ0A 4JP3A 1U7TA 3EYWA 3ENNA 2AEJA 4BNIA 5IG2A 3A1NA 1XIVA 1PQPA 4EJ6A 3ZHYA 1LUAA 3Q3CA 3F4BA 4A2CA 1JU9A 3PHHA 1E5LA 1PSDA 3E6AA 3H9UA 1PQUA 1ZUD1 2VYNA 3N7UA 3KZVA 3DBHB 1RM5A 3ETEA 5T5QA 5IDXA 1N9GA 1F06A 4BMVA 2A92A 2D0IA 2VNSA 4RPGA 2I66A 3WBFA 1UZLA 3C85A 2WE7A 2CDBA 4NJMA 4FOOA 2OZPA 3H9GA 3WIEA 4NZ9A 4UVIA 2VHWA 4UEOA 3RD5A 4BO6A 1N8KA 3WLEA 1E1LA 1F17A 1G1AA 3INGA 3DHNA 1X13A 2YV3A 3HHPA 4E31A 5LDHA 3OA2A 3C7AA 4TRRA 3I4FA 5BNIA 1I8TA 3OICA 4Z0TA 3RUDA 3GF4A 1P77A 1QORA 2QW8A 1VL6A 2VT3A 3QHAA 2PD3A 4BNFA 1E1NA 3GG2A 1LC3A 4Q39A 4E5KA 3PPIA 3QA9A 5CDSA 1E0DA 1HZJA 1J0XO 1Z45A 4RF5A 1N9GB 1O6ZA 3V1YA 3DZGA 2DPGA 3I6IA 4XQCA 1GV1A 2NQ8A 3PXXA 2ZB4A 3VVCA 1HE2A 1DO8A 5C3MA 2CUKA 3ASUA 5EINA 4PLWA 2NU6A 1ISHA 4WK6A 1KC3A 3HG7A 1MX3A 4OO3A 4MVJD 4GPD1 2YHIA 2PKQO 4PLPA 3RC9A 2DBZA 2EP7A 4R54A 1XU9A 1N92A 1K6IA 1QR6A 1U9JA 3NJ8A 3QQPA 1B15A 4KUGA 3UAGA 3QWAA 4AJ2A 5L45A 2Q1WA 3VZSA 3WSWA 1U4SA 3GGGA 4CJXA 1UXIA 2WD7B 4TKLA 4NBUA 2Q4BA 3Q0EA 5DBFA 2C29D 1ZSYA 1XG5A 2JKVA 4RVDA 5KNLA 2J8ZA 1DIGA 5JO9A 1JWAB 5A5FA 4OJNA 4YCAA 4UAGA 1ZK0A 2NUAA 1HEUA 4XGKA 2CNBA 2A4KA 2YZ7A 1MUUA 3B1FA 3AU9A 3UKOA 1E3LA 1O0SA 1JKFA 5I7VA 3L77A 4AJKA 1V9LA 3NDJA 4DRYA 1YXMA 2H63A 3ASVA 4WNIA 5CPFA 4NDNE 3C1OA 2D1YA 5A02A 4CM1A 4FBGA 2X58A 1EDOA 2I76A 4DIBA 4IY1A 2RIRA 5F5LA 3RKRA 4CMGA 3SEFA 1E3EA 4J4BA 3FBTA 4E2ZA 1Z73A 1H93A 4AJJA 3PLNA 5A03A 1QYDA 3LDHA 1XWFA 1XCBA 4RF4A 2Y99A 1PJLA 1GTMA 4MPDA 4KTVE 5KVSA 2C5EA 3P2OA 4IDEA 1ZK3A 3G1UA 3JQDA 4HY3A 1C1XA 4XYGA 1NPTO 5F3RA 1FK8A 3VZPA 2CDCA 4IM7A 5TC4A 4DLLA 3LSYA 1M66A 1AGNA 4YVFA 1YJQA 2YYYA 2P91A 2Y67A 4BKQA 5A1TA 2FOIA 5I7SA 3C1TA 2RHRA 3ANLA 1BGVA 4B4UA 1ORRA 5T57A 1SMKA 1K89A 3OM9A 1C3VA 1IE3A 5F21A 2EEZA 5JS6A 2DKNA 4CLOB 1LU9A 3FD8A 3L6DA 3PDJA 4RLSA 3S55A 3DZBA 3WGYA 1JKJA 2AQKA 3KB6A 1QRRA 1W6UA 3VTZA 3WOHA 3MWEB 2IZ1A 3WIDA 1M6WA 1BW9A 5TRTA 4FB5A 4E4YA 2WJPA 4ILKA 3E9MA 3OHSX 1GPJA 2ZCUA 4ND4A 5DP2A 5ILGA 4YJFB 3UF0A 2Y1OA 2ZTUA 1U2GA 2UUPA 4R51A 2GR9A 3DQPA 5CPBA 2WYWA 2B5WA 3C7DB 3F4LA 3I9NA 2EP5A 1EK5A 2W98A 1Q7CA 3M2PA 5AQ1A 1NFFA 2HAEA 1E3JA 3SC4A 4OH1A 4XYEA 1YDWA 4J1TA 5A9SA 3PJEA 4JX8A 1HDGO 4LK3A 1AUPA 5I9MA 2VNAA 1GUFA 4KWIA 1YL6A 2VWPA 1C14A 4FJ1A 4BQPA 5FWNA 1QKIA 4E13A 1P33A 4E5MA 3AI1A 5EPOA 1X7DA 2V6BA 5CDTA 4OKNA 1UZMA 4KP7A 4D0SA 3T4XA 1P1RA 4WOJA 2QHXA 4GSKA 3KV3O 2EV9A 1D1SA 1TT7A 4RDHA 1M67A 1QLHA 3GVHA 1HYEA 1R4NB 4I8XA 2ZYAA 2P9GA 1CERA 2HK9A 3OEWA 4XJSA 3V2UA 1T25A 1PGOA 4LCJA 1BHSA 4A73A 1Z7BA 1DC3A 3WGGA 3QRWA 4KMSA 1U2DA 4ALKA 3JYPA 1QSGA 1EE2A 2CVZA 1DFHA 2G5CA 1S6YA 3GUYA 5EIOA 1FDVA 1DC6A 3LLVA 3LLSA 3PWZA 4XGNA 3S8MA 3BHIA 1Q7BA 2C59A 1UXGA 1RYEA 4GKVA 3ZV3A 1ISIA 4J1SA 4XB1A 5EERA 1BVUA 2DC1A 2GZ2A 4N7RA 4ZJUA 3VH3A 2VYVD 2Z1MA 2NWQA 2NU9A 4ALLA 1HF3A 3EW7A 2NVWA 4PLFA 1XHLA 1ONPA 4IINA 1Y8QA 4GI2A 3F5SA 3KSUA 3OIGA 2DQ4A 4K28A 4KZPA 4URFA 4BKOA 2O2SA 5TT0A 2YQ4A 3OBBA 4ZN6A 4JBGA 1KY5A 5FFFA 4J6FA 1I10A 1OAAA 3R1IA 4N18A 4YAEA 3FR7A 4C7JA 2Q49A 3ROKA 1GYQA 1HE4A 5DOZA 4E33A 4DGSA 4JROA 5U4QA 4EUHA 3LC2O 3DOOA 2Z5LA 3T4EA 1UXHA 5G0TA 4BOYA 3JQ8A 2Q4EA 1WDKA 3E1KA 1R4MA 3GEDA 5HS6A 5KVQA 3RJ9A 3ADOA 5HM8A 1Q1NA 2PGJA 4XDYA 1ZMOA 4JBIA 1KC1A 3AY6A 1IYZA 3DMYA 2G82A 1A5ZA 2HO5A 1GCOA 4PN3A 4NJMB 4F6CA 1DXYA 4LW8A 3WFJA 4PCVA 5A4DA 4G81A 2RH4A 1GYPA 3K6JA 3ZCXA 3ZZNA 1Y8QB 3DB2A 3RC7A 1NQOA 4GLOA 1TT5B 1RKXA 1V3UA 2JFGA 4XEHA 4BKUA 1K3TA 2DLDA 4L0QA 4Z9XA 1GQ2A 3ICCA 3PRJA 3Q1LA 3PWSA 4JCOA 4ZA2A 4LRSB 3H5NA 3JQ6A 3PFWO 5HTOA 2W2KB 4B4WA 4YT4A 2GDZA 4P38A 5KIAA 1KETA 3OMLA 3LQFA 4OXYA 4IJWA 4WCDA 3S2FA 2O2YA 1V8BA 4DVJA 1A4UA 2FPPA 3U49A 2HJSA 3HADA 4MDHA 2I65A 3NGXA 4RF3A 2NVBA 1E5QA 2Y05A 4R4JA 5A3JA 2GF2A 3MJCA 3DBHA 2GZ1A 1XR3A 2Y0CA 2EWMA 4GGPA 5ER9A 1GD1O 5IZCA 1GQQA 2D3TA 3GEMA 4MVJE 2YQ5A 1GAEO 1KVSA 2IE0A 4YBZA 1O94A 4FFMA 4L8VA 4NK4A 2DUUA 1F8FA 3S2IA 1MB4A 2WD7A 2CD9A 1NX6A 3G3EA 3NGLA 4O63O 4YT2A 4BNHA 5ADHA 1DIAA 3UW3A 3AK4A 1HSOA 2WDZA 4CR6A 1MFZA 3H9JA 3O9ZA 4CV0A 1IY8A 1KY4A 2I6TA 5JLAA 3TF5A 5MDHA 2DTEA 1N7GA 2B4TO 2JCVA 3WR5A 4YYZA 1BXGB 1LJ8A 5IXYA 4BGEA 1VE9A 3VKUA 1FMCA 2JD2A 5JE8A 5JPIA 2A35A 3NDRA 5HS4A 5AXAA 3OFSA 3ONFA 5T67A 3ON5A 3RI3A 1Z6ZA 1ZEJA 3DONA 4D43A 4D0RA 4LSWA 1HDCA 2BFPA 3VPGA 1PL7A 2Q45A 3PJGA 1HE3A 4GVXA 1TA4A 2ZATA 3TDKA 2Q3EA 3I9LA 5IDYA 4L4RA 3HJAA 4ITUA 2PD6A 1KVUA 1OI7A 3D5QA 1VJ0A 3GHHA 3TOXA 5DBGA 1T2AA 5LC1A 1JLLA 3DHYA 1V35A 2WYUA 3CINA 3CXRA 5BNFA 2E49A 1I01A 3RUEA 1U5CA 2QX7A 4TROA 4YACA 1H5QA 1VM6A 2B4RO 3MTGA 2JHFA 1ID1A 3RUIA 5B4VA 3TZQA 4OAQA 4A7PA 3AM4A 3MWDB 3JQFC 2QYSA 3ZV6A 3L0DA 1TVEA 1PR3A 3GG9A 5DCWA 1MC5A 4EEXA 4L76A 1JVSA 3JQ7A 4H15A 5TJ9A 1FJHA 2J3HA 2CDAA 3U5TA 3H3JA 1PGPA 1HE5A 4OSPA 3U3XA 4XQ9A 4CM7A 4IBOA 1UXKA 3A14A 4PIVA 1I2ZA 1HXHA 3RUCA 3HB4X 3MJ4A 3JQGA 1I5RA 4R41A 1KEVA 1ISGA 4RJTA 3UH1A 2D59A 1NFRA 2VHXA 5H82A 5JDIA 1KEUA 2D2IA 2ZYGA 1ZEMA 3FBGA 3ZV4A 3FPCA 1NNUA 4UUNA 4Q9NA 2BELA 3ZWPA 2PTGA 4ALIA 3IJRA 5JCJD 1SNYA 1DHRA 1DC4A 1HYHA 4FQ8A 4XD2A 3X2FA 4Y9DA 5KVVA 1ADBA 4GBJA 3IJPA 1I3LA 2VZ9A 3H65A 4NIMA 1E3WA 3CKYA 2C2YA 3L6EA 4N5MA 3W4KA 1NTOA 3I1JA 1U4OA 3PQEA 4BMNA 5KVCA 2Y1GA 1DJNA 4GX5A 4INAA 5BR7A 1LSJA 1EZ4A 4PLHA 3S2GA 2HJRA 1QG6A 5FYDA 1P0CA 1U3WA 2PWZA 4J1NA 3WMXA 2EG9A 4DL9A 1KVQA 4YJFA 3LF1A 4K9DA 1TLTA 3M1AA 5TNXA 5DZSA 3CSDA 3PTZA 4MVJH 4AJEA 4NHEA 3WGZA 4PLZA 2WMDA 1ENYA 5CP8A 5CEJA 4CV2A 1ARZA 1LSSA 1PL6A 3LVFO 5TT1A 3S2EA 2G76A 3ULKA 1U28A 4DPKA 2QG4A 3AJRA 1PZHA 4BGUA 3VZQA 1MLDA 2AEFA 3STHA 2H1SA 1KVTA 1E3WB 4YT5A 1GFSA 3AW9A 1SPXA 2IRWA 1FDWA 2W2LA 4HFRA 4XCVA 4EW6A 4WPGA 4CMIA 4XJTA 1CRWG 5B1YA 4IDCA 4J7CA 1LDEA 3VDQA 4CMBA 2VUTA 3WGTA 1Q0HA 4XYMA 4Z9YA 1QMGA 4NK5A 8ADHA 2X23A 3JQAB 3E18A 4ZQEA 3E9QA 3SLKA 3RROA 3WMWA 4RGBA 1YQDA 2HK8A 4X54A 1U3UA 4OIMA 1YOVA 2GN6A 3WGOA 4EGFA 2ZQYA 2P68A 1EQUA 2OGUA 1PS0A 2AE1A 4DLAA 4E3ZA 4DPLA 5BSFA 4FFNA 3PIDA 2VWQA 3GPIA 1Q2XA 2AE2A 5CEFA 2WWRA 5TIIA 3FNGA 1P1KA 1HRDA 3I4CA 4BGVA 4R16A 4II2A 3W4IA 3F47A 3NEPX 3QWIA 4JGBA 3I9MA 4ZVVA 4EBFA 2Y1CA 3HDQA 5CEEA 1YONA 1HDYA 1WLYA 2D5AA 2V6FA 4J0FA 4EUEA 5KOIA 1X7HA 1D4FA 5AVOA 1NQAO 3C8MA 2GGSA 2GD1O 1YBVA 2UV8A 1K6XA 4YQYA 1XEAA 4NFYA 3WFIA 3O03A 1OBFO 2Y1DA 2ZKLA 3NTRA 1A7AA 2PA3A 2Z95A 1KERA 4PZDA 3GZNA 1CETA 1J4AA 4FPXA 3Q9NA 1GEEA 1R6DA 1P45A 1PWZA 4KDEA 4RL6A 4FFLA 5AYVA 3WTBA 1B0AA 3BMQB 1JN0A 1NP3A 5JCJA 1TB4A 1RM0A 3ICPA 1MXHA 3D5TA 2EERA 1ULSA 4RVHA 4K6FA 4TKMA 2JD1A 2VQ3A 3GDOA 3WSVA 1ZH8A 2B37A 1B26A 5JY6A 4R5HA 4ZD6A 5KTKA 4WLFA 1RM4A 4WLOA 1JVBA 3ZWNA 1L7DA 1SO8A 2P9EA 3ONDA 4HFJA 3EY4A 3GRKA 4CMEC 3DAFA 3ROQA 4I5DA 1UR5A 3ZN2A 3TZCA 4OSOA 4KDFA 5KJFA 4ZHSA 4FIZA 2C2XA 1DB3A 5IDQA 2ZK7A 4R3WA 4CLRA 1CWUA 2NLOA 4O1MA 4PLVA 5T8KC 5JMPA 1N5DA 4R69A 4TSKA 5JXWA 1DRWA 4ESOA 2X7HA 3QE3A 1R16A 4LGVA 3VOSA 1E3SA 5LCXA 3OJOA 2X5JO 1G6KA 1HDOA 1VSUA 3LC7O 1YWGO 4NI5A 3TL3A 2FHSA 1YB4A 3TPCA 2VHYA 3BTUA 4W7IA 3SJ7A 1L7EA 1JKIA 2P4QA 4DC0A 4GVLA 4WLVA 1IL0A 1UP7A 3GA0A 1V3TA 4CMKA 1UH5A 3ITKA 3W8DA 1S7CA 1GUZA 4DQUA 3ZWAA 4PVCA 4XYLA 4O59O 5DDIP 2HMTA 1Y81A 4QO8A 4YRAA 4Z3KA 2I67A 4ZGWA 1H6CA 3C7CB 2AG5A 1LBEA 3EC7A 4XB2A 4JIGA 4FD3A 4DIOA 1ZK4A 5CFZA 4YDRA 1O95A 1EBFA 3E48A 2X0RA 3WWZA 3WQRA 3HDHA 3FTNA 4BGIA 4YRBA 1Z74A 3KYDA 5EMHA 3CE6A 5C7OO 4CMAA 2VWHA 1PIWA 5THKA 1A7KA 3MCVA 4C4OA 4TVOA 5HWSA 2OMEA 1H6DA 2BRUA 4W9NC 2VUSA 3KETA 4OYRA 3ZHXA 1LRJA 4HNGA 4CM6A 3BMNA 5H83A 4TVBA 1E7SA 1NFQA 4MVJA 4CV1A 3JQEA 2O3QA 2QYTA 3P5SA 2BMAA 3VKVA 1PZEA 2AG8A 3W6ZA 3MOIA 4J9UE 3RVDA 4CODB 1PJ2A 3GMSA 1HDZA 3KM0A 3I83A 4RORA 1VJTA 3IMFA 1LNQA 2NM0A 3DXFA 4RDIA 4YAIA 2GLXA 4BO7A 3Q6IA 1PEDA 1PJBA 3ZH2A 2Y0DA 5IDWA 5ES3A 1DDOA 3JD2A 4OOFA 2CZCA 3BZUA 4IPTA 1ZO8A 4WLEA 3I9JA 4CLDA 5L3ZA 1CDOA 1KVRA 4XA8A 3UCFA 4B4OA 2A9FA 3GEGA 5K6AC 1B3RA 1ZNQO 3ZWOA 4IDFA 3H4VA 2BFOA 3M6IA 2QQ5A 4CM9A 2V7PA 2B35A 2V65A 4TZKA 4P4NA 3D4NA 3F1KA 2WEKA 1NQ5A 3CMCO 1YE3A 4UVDA 3IDSA 5L95A 2OXIA 4AG3A 3B20A 1JQBA 1VL8A 1R37A 2C7VA 1AXGA 3NT2A 3DMTC 4J2OA 5ICSA 3OQBA 4DIFA 5CDGA 1EVJA 2V6GA 4D42A 5L40A 4BO8A 3OJLA 1ADCA 2P9CA 5C5IA 3LF2A 2BLLA 4R01A 4JJGA 5JAZA 3F1LA 4E5NA 4ZRNA 5DP1A 3JQ8B 5GY7A 3GPDG 1P1FA 1R4MB 4W6ZA 3ZWCA 4W9NA 1DAPA 1P1HA 2EKQA 1CJCA 4YAJA 4QXMA 4YB8A 3VPSA 2VRCA 2X0IA 5K6AA 1RJWA 1OMOA 1ULUA 3RIHA 3TFQA 4AL4A 4IJKA 4AJLA 2HMUA 3A28A 3INTA 3R6DA 5A9RA 1PGQA 1X1EA 2DBVO 3W8FA 5JC1A 2YUTA 3ZHZA 1BRMA 3P2YA 3KYDB 4AVYA 4PG5A 3FR8A 4B7XA 1P31A 3H8VA 1IULA 2OBNA 4FSHA 1Y7TA 1G0OA 3FCOA 1EE9A 3IAHA 1VL0A 3EVTA 3GH3A 1PJQA 3PI7A 2NU7A 1JW9B 3ZWYA 4GX1A 2XXBA 6LDHA 2XF8A 4J9VA 4CM8A 5JC8A 1BMDA 4BO2A 1VJ1A 3AOGA 3KOUA 1YQXA 1T1RA 3AUSA 4ZRMA 4UEJA 3AM5A 1XA0A 3PYLA 4E2XA 3FNEA 2OL4A 2Y0EA 5J23A 4QEDA 4FFPA 3LT0A 3SLGA 4G65A 1E1KA 4J7UA 4NFSA 2VRCD 3F3SA 4CLXA 3LT1A 5C7LO 1D3AA 3D4OA 4L4SA 2UDPA 3UICA 5CAEA 4BNNA 4LCEA 4XGIA 5TGDA 2DU8A 2PKQP 3H5AA 3HZZA 4WUVA 2NSDA 4E0BA 3GY0A 1DOHA 2OUIA 3GOHA 3KLPX 1LDNA 1M6HA 3DTYA 2Y93A 4RF2A 1QYCA 4ND1A 1P74A 5A05A 2HDHA 3WTCA 3AUAA 4QSMA 1C1XB 3JQBC 3WICA 3HDJA 4CQMA 4BO9A 3N58A 3AFNA 2R00C 4TMFA 4QT0A 2I99A 3BAZA 4TZTA 3PIIA 3C1AA 2JD0A 2DFVA 4RVFA 5L4NA 1ZW1A 2J6IA 5C37A 4CLEA 1XQ1A 1PX0A 3DZHA 5TF4A 2Q46A 3DZFA 4BNMA 2OFPA 3ZU5A 2WM3A 1UP4A 3AOEA 4UUMA 3VVBA 4BO0A 1LDMA 3R0IA 5G0VA 4P4GA 2EHDA 3ZNPA 4EZBA 3P19A 2AQIA 2EJVA 1Y5RA 3KEOA 3PHIA 3JD0A 1GZ4A 1UDAA 4BQRA 2I3GA 2HCTA 3NTQA 4FFRA 4AICA 1ENZA 1NR1A 2P2SA 3I52A 3RCBA 1SEVA 3D4PA 2FZEA 3KRTA 1EK6A 3GNTA 2JAPA 3RASA 3TRIA 3G17A 2GASA 2J3JA 5CG2A 4YQZA 3PZBA 1YGYA 1H94A 4BNKA 4A5OA 1M75A 5IN4A 3FRJA 1R15A 3BMCB 3K2BA 4H3VA 1I30A 1A71A 3ZWMA 4CMHA 1Y8RB 3K9QO 5G4KB 5BQFA 2O4CA 1YL5A 2DT5A 3V8BA 2UVDA 1LLUA 4PRLA 3F46A 1L1FA 4DMLA 2GERA 3JQ7B 1MG5A 2YFHA 4PZCA 3TN7A 3TZHA 1E7WA 3WJAA 3JYOA 3ST7A 2CVQA 1J49A 2E4AA 1CQJA 2BHLA 5JAMA 4BKPA 3GN2A 3NKLA 3VH1A 4CR7A 5AXCA 2O3RA 2I9PA 4B8ZA 4RVSA 4UULA 4YR9A 4J3FA 3JQGB 1GZ3A 1Y9EA 1B8UA 2PLAA 4OQYA 2G17A 2O7QA 3FSRA 3L9XA 4N5LA 1R0LA 3GFBA 3PP8A 4CQLB 2C5AA 3B1JA 1GDHA 1FDSA 2ZB7A 1CEQA 1VI2A 3ITDA 1WNTA 4BNJA 2PD4A 1ZXLA 3EGOA 1W73A 3DL2A 2YV2A 1BG6A 3AWDA 3O8QB 4R9SA 4FJ2A 4BNXA 3HE3A 4NR0A 2PZLA 3QVTA 1D7OA 2FR0A 4ND5A 4TRNA 2Z1NA 1DEHA 4LRTB 1M2WA 3V1UA 3F6YA 5FI3A 4EEZA 1X15A 1ZJYA 2VWGA 2ZTMA 4I08A 1LDGA 3FTPA 4AJOA 4NFHA 2X9VA 3JYLA 3LYLA 1I2BA 3DAGA 5GZ3A 5HRUA 1UDBA 4LN1A 4BO5A 4TRJA 4BNVA 4FDAA 2E48A 1LQTA 3GNQA 3JSAA 3M1LA 4AJIA 3VTFA 5KWEA 3IP1A 1Y5MA 2IYPA 3K8ZA 3C3XA 4NBVA 3IQDB 3TNLA 2BFMA 3PJDA 4YAGA 1U3TA 4PLYA 3HQ4O 4JN6B 4RVGA 4XKJA 2FR1A 1LI4A 3JQBA 4R1TA 4XZ3A 3GDFA 3MEQA 5H81A 1VLLA 1EUZA 1ZVMA 3T7EA 1EVIA 4FC7A 4LVCA 1PL8A 3L4SO 3ZNNA 4IUYA 4BNUA 5JFOA 1AXEA 3ZNOA 1GU7A 5JDIC 5ENVA 1AHIA 4WECA 4LVUA 2EGGA 2PK3A 4NQZA 3D64A 3GVCA 3WBBA 5CDYA 2NTVA 1LRKA 2B69A 2HSDA 1DPGA 3H9QA 5G0SA 1LC0A 1WMAA 1KEWA 1Y8RA 2JFFA 4IMRA 3LC1O 4MOWA 4OKIA 4FJ0A 3PLRA 5IJZA 3PVZA 3RBVA 4Y6RA 3IS3A 2V6MA 3D3WB 4GSLA 3B6ZA 4JNKA 4NBTA 5T6BA 5B12A 4JP2A 4QQRA 4B7UA 1RM3A 1JAXA 1ZFNA 3QWFA 1H9BA 4BIIA 3TZKA 4AJPA 1HDRA 4K1LA 1R0SA 5DNAA 2VTEA 2FZWA 3PQDA 1ZCJA 4NBRA 1DHTA 3TFOA 4HFMA 4DC1A 1R66A 3U4IA 1QYVA 3U9LA 3ZWWA 3L4BA 4Q3AA 4AJHA 3RFXA 2ZTVA 4Z0HO 1B3BA 1XSEA 5F1KA 1QXSA 4IMPA 4RCVA 4U7WA 4E32A 3HNPA 4DQVA 5JDCA 2VT2A 1YVEI 1LA2A 4EDFA 2RH8A 1PZFA 4IJUA 4R68A 4GH5A 5BNTA 2DFDA 3ZU3A 1Y9AA 1DLIA 3GGOA 4ALJA 1BDBA 2VOEA 1QYWA 4RO0A 2VN8A 3QVOA 1DIHA 1C0KA 2EJWA 3GC6A 3HUDA 4RQTA 3HB5X 3WDSA 5IN5A 4DQXA 2SCUA 1SBYA 1SB8A 4EJMA 3EUWA 4BNGA 4OXNA 4RPJA 3Q2KA 4IJVA 1OFGA 3COSA 4XIJA 3FNHA 5DULA 3VZRA 1LRLA 4Z0PA 5IFLA 3DBLB 3WB9A 3ZU2A 5ER6A 2PH3A 5JAIA 1ONNA 2X8LA 2JFHA 1BXGA 3Q9UA 2Q1SA 1PJ4A 3EVNA 2VHVA 3NUGA 4BVAA 1V0JA 3DMTA 1RYDA 4J4HA 2HK7A 3PHJA 2VOJA 4JK3A 4BNWA 3DC2A 1NHWA 2CMDA 1WWKA 4TWRA 1XQ6A 1MP0A 1B2LA 1N7HA 4I5EA 4Q3NA 1M76A 2I5PO 1FXSA 2IODA 3QVSA 1Q7GA 4PG4A 1N1EA 1EQ2A 2GZ3A 4YT8A 1XYGA 2YV1A 5CG1A 2CF6A 3K2EA 1MG0A 2AHRA 4L4XA 3PHGA 2Q1TA 2JAHA 4IZHA 1H6AA 3O38A 5EQDA 2DTXA 5G4LA 1YRLA 3PYMA 1O8CA 5ENDA 3SX2A 3WG9A 4IDAA 4Z9FA 4II3A 1C1DA 1D1TA 4JJFA 4K26A 4O6VA 4BV8A 2R2GA 2OBYA 4MO2A 4YJDA 5U1PA 1T2DA 4WOKA 3SVTA 1PZGA 4ID9A 1TXGA 2YW9A 1X0XA 4P4LA 4DTIA 3AY7A 3GMDA 4EYEA 3IUPA 2WD8A 2ZB8A 3DAPA 3PGJA 1HTBA 4B8WA 1DIBA 4QO7A 2QRLA 3M2TA 4BL5A 1OC2A 1NVMB 3VHRA 7ADHA 2ET6A 2F1KA 5F5NA 1UAYA 5ICMA 1I36A 3U4HA 3H9EO 3CPSA 5U9CA 2BGKA 2XAAA 2B36A 3GHYA 4GL4A 4J7XA 3DWFA 3WLFA 2PZKA 3BMCA 1LDBA 3BMNB 1LQUA 4Q3EA 3KYCA 3JQAA 1ZKMA 1AE1A 2FP4A 3E5MA 4A10A 2IXBA 1EUDA 1WDLA 3OF2A 4KUHA 3QP9A 2Q2WA 4ND3A 3A9WA 9LDBA 1N2SA 4CQMD 3FF4A 1ISJA 2IEBA 3GR6A 1U8XX 3RFTA 3CEAA 1YOVB 3AM3A 3OA0A 4NJOA 5I8WA 4CM5A 3WQQA 2O3UA 3PDUA 5G2OA 3KXDA 3VC7A 2HMVA 1E7YA 1PS8A 5IF3A 3KO8A 4P8RA 3E8XA 1EMDA 2AQHA 2QZ9A 4L9RA 2CY0A 3I3OA 1T2FA 4YJHA 3JD3A 1QV6A 4WCFC 1E7MA 1HETA 3MJTA 4IGEA 4MIYA 2FMUA 1ZMTA 4CQLA 1ZJZA 2CVOA 4IIUA 3FWZA 2DVMA 3PJFA 4IXWA 5HBRA 3PHLA 2C20A 5I8ZA 1DJQA 3GZ4A 4HX5A 4M8SA 4IS2A 3R3SA 3R3JA 2X1HA 3BTSA 5A9TA 2Y1FA 3WJ7A 3UHAA 2TMGA 4E30A 1GYRA 1HL3A 3NYWA 4IZIA 3SC6A 3DHEA 4W82A 5G4KA 3KYBA 2HU2A 3RBXA 2IYOA 4GGOA 2IZZA 1HDXA 3BMQA 3CMMA 2LDXA 3FPLA 2PFGA 3RU7A 4E6PA 1T2EA 3V2HA 4DPMA 1VPDA 1K6JA 3ZNQA 1F8GA 4CMIB 2W4QA 4OXKA 4PGFA 4A26A 4E21A 3GVPA 2Y66A 3BTOA 5G0WA 3WS7A 2RAFA 3AU8A 3BA1A 4IDBA 4OL9A 1R12A 5JNLA 2JL1A 3VPXA 3OEYA 3ONEA 1P1IA 2D8AA 4OGWA 3K73O 5A3VA 2J3KA 4R9RA 1I0ZA 2HKIA 1QLJA 3OH8A 2FRDA 2XXJA 1KOLA 1P1JA 4FCCA 1DFGA 5EQFA 4LISA 2P4HX 3DDNA 2NVUB 4BMSA 2P5YA 1NXQA 4IGFA 2C7GA 3AY3A 3CUKA 2TMDA 4ALNA 3DTTA 2GRAA 3IKVA 4MP8A 3HN2A 3NT5A 2GSDA 3MZ0A 5TX7A 4KWHA 3NAQA 4EUFA 3RUHA 5BSHA 1ZSNA 1HLDA 3ENKA 3IP3A 2HMSA 1QP8A 1GL3A 1MXFA 2PNFA 3KYCB 4IDDA 4RLHA 3QWHA 4IDGA 5K0ZA 4GMFA 2ZJ1A 2LDBA 4HADA 3PWKA 4D44A 4Q3BA 3RBZA 3GZNB 2GO1A 2ZYDA 3GGPA 2YFQA 1DSSG 1P0FA 3VH2A 3UCEA 3K96A 4YXFA 1WVGA 1C0IA 3E03A 4WGGA 5BT9A 4ZICA 3I6QA 2I3AA 3DFZA 1DC5A 4QX6A 5JYDA 2WYVA 4AJNA 2DPHA 4D45A 3ZW9A 1PGJA 3X2EA 3RSHA 3NX4A 1HWYA 4CR8A 1DRUA 1E1MA 1I3MA 1BWSA 4Q3CA 3RQSA 5DBIA 3VPHA 3B1KA 1E92A 2PH5A 1JWBB 3D7LA 1OOEA 4MINA 4NMHA 3L07A 3WX0A 3DBRB 4J91A 1YDEA 3DOCA 3RC2A 3W4JA 1MV8A 4QFCA 5I9NA 4JXKA 3JD1A 3K31A 1YBMA 2E6UX 1YH3A 1NVTA 3AOEC 4E2WA 4DUPA 4OM8A 4FW8A 1LTHR 5A06A 2AMFA 2NADA 3Q2IA 5DF1A 4CM9D 1PJTA 1ZSVA 5AXDA 1O9BA 4PZEA 1B16A 3EZYA 4GAEA 3U0BA 5FF9A 3D3WA 1VSVA 3GRPA 2R00A 3LT4A 4MP6A 4OMUA 2VYND 8LDHA 3UFXA 1I3NA 3GNSA 1SOVA 1GPDG 3GUCA 4QTZA 3O4RA 3D1LA 4JJIA 1AN9A 1IZ9A 5JSFA 1BVRA 3SJUA 3UGKA 3DBLA 1PJ3A 1WAMA 3IUSA 5L4LA 3DOJA 3PK0A 4M54A 4RZHA 4HXYA 3A4VA 4TRMA 1ENPA 3BIOA 4JBHA 3WNQA 1WZEA 1DBVO 1I32A 4B3HA 1X14A 3DZIA 1IHXA 3H2ZA 2IDZA 1H0KA 1GEGA 4MIOA 2NACA 2OO5A 4N5NA 3ZDFA 4RPHA 2FPIA 5KCZA 4WLNA 3CZMA 1KS9A 1GZ6A 2PZJA 4D3FA 4IXTA 2AW5A 5L4SA 1TT5A 1JDJA 1GUYA 4LSMA 1MC4A 4RV9A 1MFPA 2EXXA 4CUKA 4EITA 4WNCA 4UVHA 2YHIB 1ZZEA 2FSSA 1WMBA 1DAOA 3G49A 1ADGA 1IPFA 4CLOA 1SZJG 1NAHA 2O3JA 1E6UA 4CM4B 3I9OA 4M89A 2NU8A 3QY9A 2HQ1A 1LXCA 4W7HA 7MDHA 1YBAA 2B4QA 5EJ2A 2BGLA 2WTBA 1PGNA 3QW2A 4HKTA 2NQTA 2DM6A 2HLPA 4PLGA 4FS3A 1CYDA 2GN9A 3EMKA 5JW6A 1E7RA 1DRVA 5KKAA 4F3YA 1BSVA 3I9KA 3ZHBA 5KKCA 4DYVA 4ZQBA 2CFCA 2GPTA 3FHLA 3AUTA 5A9SB 2EF1A 3JQ9A 5T64A 4KTTE 4UVGA 1YO6A 5B4TA 4F6LA 3FNFA 5B37A 4DXHA 3BMOA 2GUGA 1YQGA 4E2YA 1W4ZA 3NV9A 4B3IA 1A9ZA 3KBOA 3WYBA 5ITWA 4R5MA 2ZCVA 5DOVA 3I23A 4J90A 5EN4A 3ADPA 2AEMA 4P22A 3EZLA 1EFLA 3JCZA 4FC6A 4O5OA 4BNLA 1FDTA 3U4CA 3RU9A 3UXYA 4D7AA 1HKUA 4CM8B 5L7WA 4CL3A 4DMMA 4WLUA 3C24A 4ZQGA 4KQWA 1U8FO 1IUKA 1RWBA 5THQA 1GQYA 2GYYA 1UUFA 2UYYA 5JAQA 5TJHA 4M86A 2O4UX 4RVUA 3QVXA 4J16A 3AFMA 1X1TA 3FI9A 3L6OO 4AJ4A 5BSEA 4YJHB 1HLPA 2EW2A 4J43A 5FEUA 4Y8VA 1DFIA 1IB6A 4UREA 4ONEA 4DBVO 1F0YA 4MKZA 3OJEA 4U6SA 3TOZA 2WSBA 1B8PA 1LDYA 1UDCA 1W0CA 2F00A 2QZZA 3MJSA 2G1UA 4M55A 6ADHA 4GX0A 4OHUA 4CUZA 1BW9B 3G79A 3WYCA 1YB1A 1SCUA 3W8EA 3T7CA 2Q99A 3ANMA 2Q2QA 2H5LA 1KIFA 1TI7A 2J5QA 1U5AA 1UXJA 2ZTLA 5IZ4A 4R3NA 5C7IO 3KTDA 3BHMA 4H7PA 5IZCC 4CLRB 5TSDA 2W8ZA 1ONOA 4YPOA 4KQXA 4D46A 4J2HA 2Q1UA 3DZKA 4U0JA 3RAJA 5MGBA 2YHUA 2D5CA 2Q50A 1LSOA 4PFJA 5JY1A 3IIEA 4RZIA 1JAYA 4BHTA 4HV4A 1WPQA 3G1TA 2Y1EA 3BTVA 1E6WA 3INRA 4ZQHA 4CM4A 4MP3A 2FN7A 2W2LD 2ILTA 1EVYA 1NPDA 3RFVA 1SEPA 1NWCA 4W99A 4J1QA 1H2HA 4J0EA 1FF9A 3ETGA 1VRWA 3H3FA 5LDGA 2EW8A 2BD0A 3LU1A 2YDXA 1A4IA 2B5VA 3PYXA 3D3EA 1PR9A 1OC4A 4NU5A 4FGWA 3AI3A 3HN7A 4MJLA 4Y6SA 1GCUA 2OHXA 1XKQA 3U62A 1K0UA 2PV7A 2X0NA 5JDCC 4E5YA 2W90A 4CPDA 2O3SA 3V1TC 1SAYA 3IC5A 4WE3A 3OJFA 3BMOB 1H6BA 1PU2A 3OQ1A 1U1IA 4I9HA 4QUKA 4U0KA 4B79A 2X5KO 4DWVA 3G0OA 3L4BC 1SB9A 1GR0A 2FSVA 1LSUA 1J5PA 3DEYX 2W2KA 1YL7A 3JYNA 4HP8A 3GFGA 5FI5A 3QWBA 2B0JA 1A72A 4WKGA 4CUJA 3PZRA 4UVEA 1RPNA 5A04A 4ALMA 2BI8A 3NTOA 5GZ6A 4PRKA 4PLTA 3MJEA 1YS4A 2QRKA 4BO4A 4CQMB 1BXKA 3IL2A 2X9GA 3RWBA 4YTEA 3MOGA 1ZBQA 1NWHA 3IKTA 4CL8A 4O0LA 1BXZA 2IZ0A 5L7TA 5A5EA 1DLJA 4PVDA 2ZJ0A 5DCYA 4EI2A 1X7GA 4BUCA 2B83A 4CM3A 5G0UA 4WEQA 1I24A 1HYGA 3ROMA 2DAPA 1DIRA 3B70A 3ZV5A 3NRCA 4XQGA 4GMGA 3DBRA 2O50A 1G0NA 4XDZA 2NTNA 3EDMA 3L9WA 2FPGA 4CMEA 4Y6PA 3GDGA 3GQVA 2GNAA 1CF2O 1O5IA 5F1PA 3OECA 4A03A 2NTJA 4FFOA 3V5NA 2PY6A 1J6UA 5K9ZA 4MKXA 3JQ9C 3VPFA 1LEHA 5EL0A 1O89A 3ZWXA 2RCYA 1Y6JA 3NJ4A 5GZ1A 1LLCA 3CTMA 4Z3DA 3H2SA 1F14A 1NPYA 4CLHA 4E5PA 5I7FA 2G0TA 1NR7A 4FGSA 4I1IA 4KOAA 3K30A 2BGMA 4Y98A 4PG7A 3CH6A 4PG6A 3RUAA 1YJ8A 4U6QA 3GN1A 1PJSA 3EHEA 2X5OA 5L51A 3I5MA 1YB5A 4BB5A 2AA3A 4HUJA 4MIEA 4WASA 2O3TA 4I9UA 5IXSA 5JBIA 3HSKA 1YKFA 1I33A 1PWXA 2EKPA 5BSGA 5KJ6A 3OP4A 2OORA 1NQTA
chains in the Genus database with same CATH superfamily
3U61B 4QA9A 3U4DA 3RIEA 1D8AA 4N0EA 1JLMA 3D7SA 5FUBA 3D1JA 3ETNA 5EYPB 1XZNA 2PMWB 3O93A 3W1VA 1RVV1 4WFJA 16PKA 1LH0A 2OHIA 4IDOA 4LY9A 3RJ5A 4AFNA 2C82A 3F67A 2DPLA 3IQXA 1J25A 1XAJA 2WKPA 4IEIA 4FNMA 3AYXB 1O58A 4U7GA 4UFOA 2IEDA 3V8MA 4UPEA 4BQOA 1IQ0A 2E4XA 3I6BA 1O6GA 2Q1YA 3ZLVA 4TWBA 3M4JA 4YA6A 4LMBA 5FOQA 4P0PB 3IOMA 2FW6A 4QGHA 4BS9A 5LQSA 1NQWA 4ZVSA 5AHRA 2R8EA 1Y6QA 1X3SA 3DT8A 3LQQA 4LMPA 3C15C 3BXZA 4YAOA 4AUMA 4D3DA 2IHBA 1ZIDA 4YEDA 1YJAA 2BF7A 4HNHA 1YDHA 2KPOA 3HWRA 3LT2A 5L7YA 1PI3A 1ISFA 1SCIA 2WILA 1TZMA 4E12A 2CV2A 3QFFA 3DDWA 4GRDA 4YRDA 5LQKA 4V2IA 3R3HA 3S4YA 1FDUA 4OP2A 4DAEA 1IZ0A 3MSCA 4UJ3A 1J9ZA 2QUHA 3NBXX 4BB6A 4ZCTA 3KVOA 3QKRA 3JQCA 4KLCA 4F5DA 1U1DA 4GOJA 4Z1MA 2H1WA 2H9IA 1YR8A 5FOSA 1L7NA 2IZ7A 4GQAA 4XQGA 2X86A 4IJMA 2QJTA 4QFMA 5A1JA 4J6EA 3ADCA 1A76A 4A5SA 3HN6A 1B14A 5D86A 4IRMA 1NAIA 2VK2A 3DD1A 3NPMA 2DB3A 2JFBA 4S1PA 4B6EA 4FSXA 3B53X 5JMWA 1GADO 1US8B 3BMXA 3GYGA 1NJ2A 1KYQA 1OZGA 1X39A 2BY4A 3JYQA 3ELDA 2AZXA 2ETXA 3UC9A 3BHJA 4BO1A 2D54A 3WKCA 4B6GA 4R1SA 4D9GA 2PQ0A 4NCAA 3KLMX 3DVAB 3EC2A 3NCHA 4IG9A 1VKZA 3JZMA 1DKQA 3O94A 3O5AA 4L73A 2ODEA 4ANFA 1ZN2A 3L6BA 1BD3A 1VL1A 2WMOB 4W1PA 1M1ZA 4BX2A 5FA5A 3GAFA 2RGXA 4MROA 1RQPA 3ZXYA 1Q2UA 2BR3A 3NETA 4DJJA 4KWCA 3RRFA 3BJZA 4P0QB 3EGCA 4ND7A 2BKEA 1W4CA 1I3OA 3G2HA 3LZ6A 4WHMA 4XD7D 3TNYA 3CVJA 4V39A 4NE9A 4R1UA 3IKLA 2EWVA 3IQIX 2EIHA 4PNHA 1DAIA 1FSSA 5L53A 4UPVA 4ZEXA 4MPTA 3QIVA 2VP6A 2BMDA 2JCYA 4F45A 2A94A 3IEXA 2EKLA 2AR7A 2IV2X 2H3EA 4TUYF 5LUBA 1JGTA 4A27A 4BFTA 3P7MA 3WGHA 1RT9A 3ESCA 1O9HA 2XR1A 2O48X 4RHXA 5ICGA 4ZODA 4HPWA 1H2AS 1PTJA 2VG8A 1VKNA 1ZXBA 4RELA 2MSEB 2IXFA 1L1RA 4LF9B 4GLLA 1JHRA 4WNYA 3D0OA 4G23A 2AVDA 5ARDA 1E77A 2EKZA 1PLLA 3ROPA 4X97A 4XQEA 1EBBA 4W4TA 2NZJA 2QT0A 2VCYA 3BGSA 3BSFA 1QRUA 3C6BA 5B4UA 5FBWB 1C4KA 3ZLJA 3LI2A 2ODQA 3RTAA 1P2UA 4BNYA 2AC2A 4M87A 4M9ZA 5JRJA 2IXAA 2X1MA 3LFUA 3W77A 1YZUA 2B8NA 4P7GA 1OPRA 2FPLA 3TSOA 1YZKA 4JOQA 3RC3A 5AHXA 3WB1A 3ZK8A 4WJZA 1CZUA 5ED4A 1ZS9A 3DL0A 4GFDA 4B3CA 1VHDA 3QKWA 1QHGA 3TXAA 4E1VA 1T35A 2H4WA 4MULA 4NZZA 4FCWA 1W36C 3FKSD 5EWJB 4DA0A 1VKOA 5CTJA 1MIOA 3OIDA 1YFLA 1V5WA 3URMA 3OIYA 5J4LA 1PFUA 3EG9A 5KNDA 5LN1A 1CIVA 3I28A 1KSFX 3ORFA 3GB9A 4BYMA 2K2WA 1LF0A 3OFVA 4FR5A 1WA5A 2ZUUA 1Q1EA 2SICE 4G86A 1Q7TA 4NNJA 3LX6A 4CDRA 3AESA 3ZOZA 2A9OA 1JXQA 1L6IA 2JVKA 1WP4A 3HI4A 1K2WA 4IMIB 1Z83A 1XGKA 1NSYA 1FNMA 2OP0A 4OBEA 3VU1A 4CVNA 5JVDA 1K5HA 3DB1A 2QA5A 4EGCB 1TEVA 4NH4A 4QDUA 3MHPA 3FSGA 5EQJB 3MLEA 4IXMA 3U1TA 4GS5A 1WDMA 3ZGXA 3ZQJA 2ES4A 3ANNA 4MH0R 3IP5A 1WUKS 3GJ5A 2VNIA 3VOBA 5LUAA 5FNVB 1NIPA 2B9VA 1ZH6A 3WK5A 4YS6A 4YP1A 4N8EA 3OCCA 5B3LA 3O26A 3EVAA 4UUPA 1EUCA 2JAXA 3UAOA 2DHCA 3M9LA 4PFKA 1ISMA 3W90A 2C7OA 1JHDA 3DVLA 1E7QA 2PRJA 3CQ9A 3ZJVA 3H04A 1O7JA 3ME5A 4PHTA 5MN4A 3VFDA 3UBMA 2AF3C 1G2QA 1H85A 1COWA 1L7PA 2GBLA 1C7EA 2XB6A 1TADA 3HDYA 4DCCA 5IX8A 5JCOA 2V4ZA 5A4MS 4TWIA 2O7SA 4WOCA 3ONVA 3WL8A 4N49A 4G1EB 2CV1A 1D07A 3M6MD 4OTZA 2WIKA 3FYUC 1AKUA 1KMQA 3FHCB 4GPAA 5DLEA 1YOBA 4N39A 5IJ9A 1M1XB 1OXXK 3JTMA 1V3VA 5HDBB 2AFHE 1ZESA 1A9YA 1I3KA 1T26A 3FI0A 4JP1A 5FNZA 5CA0B 2G88A 4ZT2A 1H9AA 5FBZA 1CEYA 5KNBA 3N74A 3D8UA 1V5GA 2DR0A 1JIQA 1KEPA 4ZPXA 2G40A 4RPLA 5IANA 3BXXA 2GXAA 2IPXA 3CF4A 1HURA 2WFAA 1Y3BE 4XM2A 5HZKA 1G20E 5IKPA 3ZGNA 2ZWOA 1OFTA 2B99A 3PQFA 3K09A 4ZVUA 1DDIA 1P9NA 4DJDC 1SHTX 3DLCA 4H6VA 2J5RA 4F6RA 1R0KA 3TIXB 2DTDA 1H2EA 5DW0A 3JAKA 3NDIA 3WL5A 5TQVA 4IGIA 1G20B 2FRVA 2HMAA 2R11A 3L7LA 5I9LA 1P44A 3QEAZ 3OX2A 4L74A 1G7RA 4MVJM 4Y1GA 2GN0A 1EEHA 1NZFA 2VDUE 2NOAA 3HU3A 3JWJA 4FEAA 4CV3A 3I5AA 4ROSA 2XPCA 4WFIA 1NQUA 3TSCA 2V03A 3EZGA 4OV6B 2VYVA 4PIMA 3O84A 3OEEA 1XDDA 3C6MA 4LDQA 2GPBA 4FMDF 4Q9JA 5DE3A 1SY7A 5LD2C 2VBCA 2GHQA 3EHDA 1ESZA 2AJ8A 3M6UA 4BX3A 4F5WA 1IZZA 2CSUA 4YWJA 4UEWA 2WM9B 1SC3A 1GKUB 1V1MB 2Q0QA 4ERNA 1RHRA 1Z4MA 3RKSA 1VL2A 1AXRA 2BISA 5HKKD 3KC2A 2FQXA 3F0TA 3OG9A 4JSTA 4D3SA 2FXVA 3QVKA 5EHIA 1WXWA 1H8HD 1GN8A 1GZDA 1KH2A 1TTHA 1KP2A 2RK4A 4TV9A 5E4TA 3FPJA 3KOZA 3MMXA 3QJ5A 4L16A 3EN0A 4QECA 5LDDC 2QAGC 3GV0A 4OIFA 3QEBZ 1U5BB 2HBQA 4HFNA 4XR9A 4C0WA 3WGIA 3P94A 4LBVA 1T1SA 2HADA 2PG3A 3FN4A 1A9PA 1CNFA 1BWPA 1G291 4KQ2A 5LLDA 3ND6A 1T4BA 5EAIA 4B5KA 3RUFA 4XYBA 2ZQZA 1IZ8A 3CV3A 2Z8ZA 4PSKA 1ECLA 1IBKB 2OA0A 4IVPA 3ZCQA 2O8BB 4N12A 3GLQA 1QH1A 3U80A 1QB7A 1SXJC 4QYWA 3RC1A 1RC1A 1T24A 2GFQA 2DR2A 1DOAA 4NOJA 5DO9A 1CHDA 2JH3A 3W1EA 1AKVA 3KWJA 2XYRA 4LGCA 3TL2A 4LV8B 3A6KA 2HWXA 5KYUA 3O92A 2ATXA 4GMDA 1Q57A 1Q1AA 5CH5A 3N5KA 4ENUA 3TS1A 4BDTA 2K7FA 4DGQA 1NDHA 3H3XA 3GLFB 1XRLA 3AI2A 3NOOA 1AV6A 1FTWA 2J7PD 3IRUA 2B25A 1H2BA 2ZJFA 4MUBA 2GK6A 4Y2HA 3RS5A 1QHXA 4MUJA 5LL6P 1W0KA 4EGSA 3ZEIA 3B12A 1QNFA 4M1WA 4LRWA 2YMLA 5E6RA 2IKQA 1GXSA 3U13A 3C5EA 4EZIA 1JLKA 3GP5A 3KJGA 5HGXA 1M74A 4RMGA 3JPYA 1OE0A 3G9UA 3EYWA 4G0XA 5BP7A 1M1UA 4NYIQ 5CVEA 4PN7A 5IG2A 2FPPB 3R4CA 1FNBA 3NCTA 3O90A 5K4AA 3W7BA 5KBYA 1N6OA 2KM1A 3UQYS 1XP8A 5L3QB 4EF6A 3SLRA 1U7UA 2VYNA 3N7UA 5T5QA 3DBHB 1XKTA 4XX1A 5TPWA 2YR0A 2VS1A 4KFSA 1GOTA 3F7NA 4Z3OA 4ZVLA 4TL8A 2VJKA 1BE0A 2PLNA 2I66A 3F6EX 3G5UA 2WTAA 4QOIA 4KODA 1X80A 4P3XA 1KPGA 3H9GA 2LXNA 3WIEA 2ZRNA 3QBJA 3I0ZA 5DM70 1LWOA 1OGJA 4X93A 2ATIA 1V43A 2DMRA 3PRYA 4S1WA 4S1OA 3EFEA 4YO8A 2BHRA 4D5EA 3WIBA 4AO8A 3EJWA 4WAUA 4EFMA 4F8YA 3DO6A 1F17A 4NP6A 1CE8A 3INGA 3DHNA 4OP3A 4WVLA 2YV3A 4E31A 2C2GA 2JBWA 4I19A 1C3JA 3C7AA 2E18A 2ONJA 3QFSA 1C2TA 3SC2A 2EJBA 2VPYA 3F98A 3L0SA 3OICA 4Z0TA 2BUAA 4ZEWA 2YC4C 3Q98A 1PT7A 1GPYA 4IDQA 3GG2A 5AJYA 4Q39A 2OV3A 3SNKA 3QA9A 3SIRA 1G4AE 6REQB 1J0XO 1ECPA 1PFWA 2XMDA 4ER0A 1ZITA 4PNPA 3K6SA 4H60A 3DZGA 3KLBA 5GQSA 1YDFA 1GV1A 2NQ8A 1EDEA 1I13A 4C7VA 2HL6A 2CUKA 2FPIB 3UM9A 2CXSA 2IC5A 5I45A 2G25A 1TQDA 2NU6A 4WQMA 1ISHA 1G66A 1G64A 4TM7A 3A4TA 4QHSA 2AW3A 2H5IA 1N4AA 2QQGA 1QE3A 3DAYA 3H83A 1YFZA 2WV9A 1PEAA 3HH8A 2ODPA 3PC6A 3LH5A 1XD9A 1QBGA 4U2GA 1FTQA 1SH7A 1U98A 3CRW1 4RM3A 5EJGA 2DBZA 3H5TA 4R54A 1XU9A 3GQBB 4HQKA 1B15A 1NT2A 3QWAA 5AKYA 5LM3A 2EBUA 1XQ9A 1P75A 4QZVA 2WD7B 5JAOA 4N6GA 4QG3A 4NBUA 3CXUA 1KO4A 1EFVB 2FK8A 3HPRA 1EFPB 5B7PA 5HR5A 2H65A 4WBNA 1FFXB 7REQB 1ODLA 1QFZA 1MH1A 2Q4OA 3L7DA 1DIGA 1FSPA 5IT0A 5HUHA 2HREA 2IQIA 4YCAA 4JSRA 1GPMA 2QE7D 3TDMA 1E20A 4BBPA 1JH8A 4M98A 2A4KA 3AU9A 1YB7A 1OB2A 2IEIA 3L77A 4RDXA 1QP7A 4AJKA 1N25A 5EZQA 1GGHA 1MJGA 2WPNA 1ZH2A 2UYGA 3M70A 3PQ5A 5ICFA 1H23A 3C5WP 2XYPA 4KI7A 1UINA 1YIAA 1BZYA 2WHQA 5CPFA 2VQFB 5K6TA 2WZCA 3R7AA 3C1OA 4OQEA 1J70A 2D1YA 5B5SA 2ILVA 4KRXA 5CFMA 1E9RA 4V0MA 1EDOA 1OHHA 2QJRA 1SOAA 3MWLA 2RIRA 4KO4S 1MR3F 1BHJA 4TLLB 4BJ5A 4DLXA 2QTGA 3G2PA 2OSVA 1D1PA 4GYYA 3SM9A 1Z73A 3UHJA 4E2ZA 1PFKA 2IE8A 1P3JA 2GILA 3PLNA 3U40A 3H7IA 3P1JA 5A03A 4YAUA 3LTNC 4C5AA 4WKBA 2F1OA 1GZ5A 4EYKA 1JAHA 4A1OA 2Y99A 4E07A 3ICOA 2HSEA 4KTVE 5CTAA 4M0EA 4RAQA 3P2OA 3KJHA 3R9IA 3CZAA 3FPSA 3G1UA 1EVLA 1ZI8A 3RIGA 1C1XA 1DTWA 2WU0A 3FF1A 3K0HA 4XYGA 3DGEC 5DM2A 2CDCA 4IM7A 4Y6GB 2BSXA 3Q3VA 2ZSDA 4HYYA 2WU3A 1UKAA 5EUBA 4GOND 5H4HA 3LS2A 3ED5A 3NDPA 2ZPTX 2E1RA 4X6YA 2YVAA 5BYKA 2RHRA 1BGVA 3ANLA 3E27A 2XMCA 3H16A 2Z6VA 3EVDA 3R23A 4IFEA 4B85A 2XKKA 1JVNA 1SMKA 4BE7B 2YZNA 4ZU1X 3EGDB 4X8HA 4RS3A 3KZKA 4PINA 5EWJA 1KEKA 1LU9A 1K88A 1SRRA 3VNUA 1B6RA 1I7LA 2AYZA 2DUNA 3R4VA 4KQEA 3GFVA 1XMIA 3L6DA 2AG6A 3S55A 5CM2Z 1GU0A 1QRRA 1W6UA 3MWEB 1Y8CA 3ISTA 2PR7A 5CX1B 2RGYA 4ILKA 2OC4A 1T3HA 1JR3D 1VDMA 3OHSX 4ND4A 2V7TA 2JGIA 4P58A 4YJFB 1PZMA 2ZTUA 3UF0A 4CNBA 1Q1BA 1U2GA 5HM6A 3RK4A 4R51A 3L4JA 3DQPA 1RR6A 3ER6A 4DMKA 3C7DB 3O1IC 1L4LA 1ZIOA 2QQ0A 2CXUA 1EK5A 4DV2B 1Q7CA 3RSZA 1M2OB 1NFFA 2HIHA 4ZOBA 1WHTB 3AEQB 2FHPA 2HAEA 3SHTA 2YWBA 1O1YA 2KBEA 3S7TA 4TMZA 1ULTA 3GYBA 4HRVA 4J1TA 4JVNA 3PJEA 3S2UA 4NSNA 4RPIA 1AUPA 4H18A 2R8XA 1Z0IA 3RANA 2O1EA 2R7NA 3GLSA 4FJ1A 2EAUA 2M9MA 2Z8YM 5HKLA 4PYJA 3DLBA 1JE0A 4AROA 5CAEB 2JJMA 1P33A 3NANA 4XOIA 3AI1A 1NUUA 1RVDA 5EPOA 2AFIE 3RSSA 2Q0XA 4JELA 4GE3A 1O96B 2V6BA 3DG9A 3HLYA 1M54A 3PV0A 4HNRA 4KVAA 4RCYA 5E1DA 3RB8A 3VNQA 1ZI6A 2PUVA 4WOJA 1F4PA 2QHXA 1OLSB 2EOAA 3KV3O 1J42A 3K8OE 3CNHA 2A1UA 3UJPA 1A98A 3VR5A 4RDHA 4WBXC 1M67A 1R4NB 3K9LA 2CD7A 2FKNA 2GJ9A 4FONA 4NYMQ 1DMSA 4RDCA 4N9WA 4C78A 4DBLE 3C8ZA 1NJSA 3SZUA 4EHIA 1AM4D 4P86A 4F96A 1CZHA 1Y37A 1TMKA 3VKHA 3T7KA 2ZYTX 1U2DA 5ALNA 2PX8A 4PCUA 2XBMA 1QO0D 5EXDA 3JYPA 1PDWA 3FOWA 4ND8B 1SHUX 3NIDB 4DNPA 4D97A 1YI8A 1WEHA 2G5CA 2GPWA 3FUVA 1ZDMA 1S6YA 5H80A 5B7GA 3TW8A 2O8EA 1DC6A 1J1UA 3N8KA 3LLSA 1JIJA 2AH5A 3QX7A 4QUBA 3PWZA 5JYCA 2WMYA 1Q7BA 2C59A 1KYZA 3T5GA 1G3UA 4X8LA 2A0UA 4QPCA 4LZOA 5A7GA 3L4KA 3GFPA 2W6OA 2CLEB 2AMJA 5B3JA 4P7FA 3DE7X 4XB1A 4CT0A 1BVUA 2OHOA 3TQTA 2JARA 5JS2A 3EXHB 1LWNA 3DVAA 3QKTA 1QDUA 2GBIA 4FUTA 2OXCA 4K2AA 3K6KA 1V47A 2DP4E 2I1WA 2ZAYA 3GPCA 4W1SA 4G3XA 5AM1A 1RI4A 3A11A 1PUXA 3CF6R 3NOVA 5BO5A 1WUJS 1W5TA 2XODA 3MBOA 1CKEA 3M33A 4TQ9A 4O4HA 2ZPAA 4QU5A 1ONPA 4IINA 1UPCA 4KZPA 3ITEA 4BKOA 2W93A 3S70A 3ZVLA 2RFLA 4Q18A 2PXCA 3Q8KA 3M4ZA 4S0ZA 1F6BA 5F9HA 4CCYA 4V0QA 2ONZA 1RU3A 2IYUA 4ZDWA 2Q5QA 2I62A 3W5HA 1JYFA 3QX9A 3FWHA 1OAAA 2VJQA 3R1IA 3LY7A 4N18A 2JLZA 2YIVX 2Q49A 4QG7A 2PAFA 4YUXA 1GYQA 3FDZB 3LVRE 4E33A 4DGSA 3LDGA 5U4QA 4PBRA 4BATA 2ZI4A 3H1TA 3PXGA 3KE9A 1UXHA 1CJSA 1L4BA 2X1LA 5IULC 2A78A 4AUKA 5KAPA 3JQ8A 5DNCA 1JHOA 3ANTA 2KHZA 2IH5A 5KVQA 1NDQA 1BX0A 1SXJB 1GRQA 1TAHA 3OE1A 5DFAA 4DMCA 1EX7A 4WXRA 5GONA 3PICA 1E5DA 4NMLA 2F9MA 5J40A 1GCOA 4YP6A 4F6CA 3ZGVA 1DXYA 3WFJA 4PCVA 4MV8A 5A4DA 4FZ3A 3T1HB 4K5QA 2WWVD 4QBTA 5HDQA 1V11A 1WO8A 1SRQA 1TT5B 1RKXA 2EQBA 2JFGA 2OSBA 3IBTA 1PWYE 1FS4A 2HF2A 4XEHA 3RSLA 2ZIAA 1K3TA 2G71A 3CX7A 5L3RA 2DEUA 1CLEA 1GQ2A 2AZDA 3ICCA 1JAZA 4KXXA 1QX3A 1TF7A 3Q1LA 2PVCA 5LA6B 4ZA2A 4NE7A 4C4RA 1K5GA 4HEA6 3H5NA 3JQ6A 1F3LA 1UKVY 4WINA 3ER8A 3LCUA 3LRPA 4P38A 4YJ3F 1A4RA 4ZCRA 3KVYA 4RW0A 1KETA 3OIVA 3OMLA 1RLUA 4E11A 2WJ6A 3LQ2A 1LCIA 1XRPA 2O2YA 2AUTA 3AESB 1FUUA 1XN1A 5DX1A 3S2FA 1V8BA 4YRRA 4DVJA 2J4DA 1SWWA 2HJSA 4G0YA 1XOIA 1D2GA 1MT3A 4QBFA 1A9QA 1QKJA 5IH3A 3QK7A 3S7ZA 4B81A 4DILA 1VI5A 2XYGA 2PUAA 3PA8A 2D1FA 1T3LA 3G5TA 2W8BB 1XR3A 3TIGA 3B8EA 2Y0CA 3KIPA 4KPUA 4I1SA 4IICA 5CT9A 2BMFA 4KX5A 3X1ZA 1GD1O 4IKPA 4LF6B 1GG5A 1ETUA 3GEMA 3D6AA 4MVJE 4KMOA 2PT5A 1QYRA 5KQMA 3PLAE 2QF7A 4UE2A 1Z0UA 3ENWA 1R9NA 1FYEA 5IW8A 3T3PB 1F8FA 3D6JA 1IEQA 1Q21A 2CD9A 2ZRLA 4O63O 1Z07A 5ECGC 4IHJA 1I2MA 4BNHA 3AHIA 3HI6A 3QY0A 3VSDA 1DIAA 5KU7A 1BE1A 1UBTS 1LTKA 1VJ5A 4GMHA 1SIBE 5AHOA 5CLQA 1LPSA 5CCXA 2I6TA 2OT3B 2R6ZA 5JLAA 5MDHA 4CDMA 4LHWA 4UKDA 4NXMB 4IIFA 5DEIA 4M0DA 2CYBA 1JHXA 4KLNA 1OKKA 2R84A 1LJ8A 1B0UA 2PGNA 1E2UA 4KHZA 4Y7CA 3SF8B 3SYTA 1NBEA 3CWQA 4N0PA 4DG9A 1OXVA 1Z36A 4N9QA 1L5VA 2YJ6A 5FA6A 4EYQA 4L4ZA 2HA2A 3ND7A 3U0VA 1PE0A 5LSAA 4JGGA 1P39A 2PRYA 3NDRA 3F5DA 4I46A 4QBIA 5IHXA 4EFKA 4K87A 1L5GB 4DN6A 3ON5A 1NKVA 3JWPA 3KFVA 1L5FA 3LZCA 4LOLA 4QLOA 3WRYA 4Q4CA 2BFPA 3K5WA 2ZATA 2Q3EA 1E64A 5IDYA 1GLNA 4ITUA 3TOXA 1KVUA 1KDZA 1OI7A 3HVRA 4LSGA 2FUNB 2AZTA 1UKZA 3FUWA 5DBGA 1JEDA 4FM9A 1HORA 3TRDA 1WVIA 2HRQA 2XT0A 5NLLA 3DHYA 3UW1A 1I3CA 2PX2A 3CINA 4C5CA 4P08A 1CHNA 2E49A 2QLJA 2QX7A 2QUBA 4GPZA 3NXSA 3MT8A 1WCXA 1IEWA 1H5QA 1NLFA 2UZ4A 4MW7A 3OY7A 3MTGA 2IX9A 5JH7A 1ID1A 3RUIA 1P2TA 4AQYB 3FNIA 1FQJA 5J3JA 4TL9A 5KNDH 3MWDB 2ZGVA 4KXYA 4NZMA 1AS3A 4JJ4A 4FYIA 3ZV6A 2WDPA 3QHQA 3IUMA 3O1LA 4BFWA 4P4TA 3P45A 2WJJA 3SIPA 3M83A 2A7XA 4H15A 3KQNA 3FZEA 5J2UB 2MSKA 3O91A 2RJOA 2YRXA 1HA3A 4BECA 1V2HE 3U5TA 2ZVJA 1HE5A 2VATA 1V4BA 4OSPA 5DXJA 1H05A 2AXEA 3IAS6 4N3AA 1PT8A 2YXNA 5CRIA 1QQTA 1JKJB 4KAJA 5CNIA 2PKWA 5CM9C 1HXHA 2SKEA 3RUCA 2P7IA 3LO5A 4CHGA 3KAKA 1UM8A 2H85A 3ZTTA 1C7RA 3SXJA 1BU8A 2FYTA 3DWIA 2JI4A 3D3JA 3L01A 4R41A 4AIIA 4BQEA 5JTTA 3U56A 2BR5A 4FQ7A 2VHXA 2G0AA 5HMMA 1X2EA 2N9UA 1KEUA 2QVGA 4BXOA 3VVMA 3BL8A 4L9AA 2FWNA 3FBGA 4Y1RB 2QMOA 3ZV4A 2WF9A 3MBIA 1NNUA 4H6PA 4MWCA 3S5UA 4UUNA 2I4OA 1EHCA 3DE0X 4RJJA 5LZ5A 2W83A 4DRZA 3AHCA 3IQHX 3HKCB 4ZO7A 5FAXA 3WFZA 1MGPA 2JI9A 2XE6A 4Y9DA 5JJIA 4LZZA 2NT4A 4GBJA 3ORYA 3IJPA 3ROTA 1I3LA 4PSCA 1G4HA 4RD1A 1FVHA 5ARCA 4ZANA 5T3YA 4CEHB 1WXQA 1FYVA 2VH2A 2I2BA 5GOZA 2HA6A 4B3DA 1E3WA 2WZQA 4M1MA 1AY0A 3L6EA 2P2YA 3W4KA 3PQEA 3I1JA 3W9UA 4BMNA 4D6YA 2IKSA 3FNRA 5K0GA 3MG9A 3MAJA 1XCOA 1GPWB 1DJNA 2HGSA 3H99A 3NVDA 5AVSA 3WY9A 4AMUA 2I3BA 3EUAA 4G09A 5BR7A 3H0CA 4HNSA 2Z4TA 4OHXA 1M0EA 1Q14A 3N8DA 1FMLA 1YU9A 4KNWA 4PLHA 3CZQA 3S2GA 4RD6A 3T61A 3VNSA 1JFLA 2AFVA 2Q0HA 4NV0A 5GVSA 2JGLA 5FOVA 4BVLA 4DL9A 1C9EA 2NO7A 2VJMB 1GNVA 1KJ8A 3LF1A 4ARZB 1TLTA 1I4LD 2F1IA 4NX2A 3CLTC 4NL4H 1RWNA 4FDUA 2WMDA 3RRBA 2A5GA 1QGYA 1G98A 1K7FB 3ANXA 4YAFA 1LSSA 4EH1A 2CJXA 3O8CA 1QHIA 3ULKA 1OXBB 4X1IB 1XNQB 4HX2A 1SKYB 1IBCA 1STOA 1JTEA 1VLMA 4BGUA 1MLDA 2AEFA 3I6MA 1KVTA 2NUBA 2W2OA 3K0AB 5DHSA 2FPGB 4HUTA 1J56A 3E5NA 1AQNA 1N8SA 3V1MA 1P0PA 2AYYA 1Z6YA 1FDWA 1QVZA 2IRWA 3LKZA 4G26A 4HFRA 2Z2YA 3FAZA 4MO9A 4WPGA 4XCVA 4R0MA 1CRWG 4W9RA 1K7YA 4IDCA 2D1QA 1LDEA 1GCIA 1XB2A 3CE9A 4QPDA 4ZYLA 4XYMA 4PAGA 2PUBA 2C1ZA 2ZJ6A 4NK5A 4YRJA 4RWEA 8ADHA 4ZHQF 4EG4A 3A9TA 3PCRB 4UATA 2HEIA 4XX0B 3D4IA 4FMCB 5E4YA 2FE4A 4BBJA 4MAMA 2LTAA 1EGQA 1H5UA 3CUYA 4NZNA 3HEMA 2HK8A 1U3UA 3JPWA 1LVUA 2XQKA 1YS2X 4FZRA 1FX1A 3W1WA 2VYFA 4EGFA 4W63A 5A3RA 3IOBA 2ZQYA 4B6QA 3D54D 1PS0A 4ZT5A 4LGMA 4DLAA 1TZCA 4O4IB 4P4SA 3T7AA 1C9DB 4QLAA 3BF8A 5ERGB 1RWWA 1Q2XA 3P9ZA 5CEFA 2WWRA 1HRDA 1NW9B 2AMVA 4R16A 1ABEA 4Y2UA 2J0UA 2J32A 3GQBA 3NEPX 1J1IA 2C3PA 2WT9A 2PO7A 4BTEA 4C22A 1I7QB 1JMKC 2B92A 4FW9A 2Y1CA 3C39A 1WLYA 2PBLA 1ECCA 4LE2A 4WERA 1D4FA 5AVOA 4L8YA 1YQTA 2QXTA 2GGSA 2GD1O 3ONWA 3OPYI 2LUOA 4YQYA 1Q22A 5JNUA 4NFYA 1Z0DA 2IZ6A 2ZKLA 4OK3A 1M83A 4QHTA 1KDVA 1D5CA 3CUEF 2BCJQ 3VV2A 2I9KA 3ROFA 1ZOPA 3H9BA 1I7NA 4D8TA 1KFCB 1Z2EA 2X2OA 4P7KA 3QVUA 5BRJA 1XK7A 1KDTA 3Q9NA 2EGUA 1R6DA 1K8YB 2YUIA 2UYOA 3DMDA 4F5YA 1NUHA 3FLAA 3HCNA 3PUKA 3BMQB 1NP3A 5JCJA 1UBRS 1NYRA 4QRDA 3R20A 3BCSA 4ESHA 3ICPA 2QR2A 2HU5A 1IBSA 2EERA 4C0AC 4RVHA 2PMDA 1MO4A 1W35A 5HIIA 2WVAA 3GDOA 4P9NA 3HJFA 4MI1A 4PC2A 2CL0X 2FJPA 1JSZA 4U7JA 2V58A 3OTIA 2QTFA 3GDWA 4RNCA 2ZYSA 3HM9A 4R1QA 3TPFA 1GG2A 4MQFB 1F2VA 4WX2B 4I8IA 3IODA 2P9EA 1Z12A 4M0LA 3LBYA 3WRWA 1BMFD 5AK0A 2ZIEA 3HV2A 4NAHA 2BFBA 1L7OA 4I5DA 5JHHB 4Z8YA 1LW7A 4KDFA 4OSOA 1BFDA 3O7WA 4LYDA 3KKMA 4U7HA 2ACVA 3V4LA 2BFEB 4FIZA 2C2XA 3WJ2A 2P0AA 4Q15A 3HDVA 1W0KD 4C14A 3WJ1A 5IDQA 5J1SB 4R3WA 5IHPA 2VCHA 3VDXA 1Y3CE 4UTRA 1CWUA 3KL4A 3JZFA 4G4GA 4ITRC 3LSTA 3PNKA 2ZT7A 3AI7A 1OWMA 2R6R1 2GARA 3LECA 4B35A 1XPUA 2ZULA 4R69A 4RKQA 3E3LA 4MR9B 3WC4A 3K70C 4FEEA 2X7HA 4PAWA 4C1NA 1NVVR 3ZCRA 5IMBA 3OJOA 3WB0A 4BLSA 2GFHA 2WM2A 2QYOA 3BSSA 1YWGO 4R0VA 3VHXA 1C1HA 2H8GA 4RYDA 3QG1A 3E2PA 4QXPA 3SQWA 4MCJA 1GDTA 1YB4A 2DETA 2AN3A 5ALZA 2VHYA 1U2QA 2HTFA 2AZMA 2PKXA 3KHKA 4HAWA 1F0NA 3ROXA 1AGXA 3KOWA 1JKIA 2P4QA 4V2UA 4DC0A 4WLVA 4DVGA 3GA0A 4KIUA 5FLEX 4G8JA 1UH5A 2X42A 3WNDA 4UNPA 1SQSA 1CR2A 3GCGA 4FWIB 4XJXA 2IHNA 1JQLB 1RC0A 3F8TA 1ZRNA 2P2LA 1RQLA 1O6BA 1OVGA 1N5LA 2F2TA 3ZVKA 3WDLA 1QFMA 2I67A 2X0EA 4Z3KA 4ZGWA 4BMYA 1BMQA 3C7CB 2FVXA 4ZXFA 4XB2A 2QV0A 2WWTA 5KX5F 3WLKX 3ZC3A 4EKIA 5AW6A 1U7XA 3D6TB 1GPUA 4BGIA 4RTNA 1UK9A 1Z74A 4NLLA 5C7OO 1RXVA 2NGRA 1ZMBA 2VWHA 3Q7TA 3DHVA 4TMXA 1A7KA 1W85B 4TKZA 4TVOA 3D6NB 2PTHA 5B64A 3EIHA 3GLRA 3EVZA 3KETA 4OYRA 3JX9A 4AK9A 2PS3A 3TLXA 2YCLA 4HNGA 1PR2A 1B1CA 4H2DA 4KGDA 2W6JD 4CM6A 4JKYA 3DUWA 2PO5A 1YRYE 4KEAA 1KGDA 4A91A 1UEJA 4HEQA 4CV1A 3HXMA 2FEWB 2R48A 5KYUB 4RIIA 3E9YA 1NA5A 5BXYA 3P0IA 2EFJA 1DELA 1Z62A 1BFKA 3LUAA 1HDZA 4LV5B 3VPCA 1KAHA 3K9GA 3QF7A 2C8VA 4RORA 1NU6A 2BGGA 2JLVA 4V0SA 4EFDA 1VJTA 3IMFA 2QTBA 3PR2B 2GLXA 4DMFA 3P9XA 3Q6IA 3NEYA 1PJBA 4MV7A 1SVUA 3Q5EA 4Q93A 2Y0DA 3JATB 3FLEA 1DDOA 3JD2A 5LA6A 5IBRA 3REQA 1JKMA 3TI7A 4H6WA 1R6UA 4GI1A 5IVHA 2P79A 5K20A 4CLDA 2CJFA 2W4MA 3QMWA 2FWBA 3S29A 3IEUA 5FPPA 3QX3A 3GEGA 4KPFC 5IT4A 1R50A 3VOTA 1B3RA 4M46A 1ZVKA 3F7TA 1NVEA 4LOJA 3N86A 4P35A 4AECA 4B46A 2QZSA 2PV0A 1AK1A 3HVKA 3JASB 5IVKA 2ZYWX 5DXAA 5CB6A 2B35A 5E6SB 1GGJA 3AILA 2GT1A 4BQIA 4A36A 3I42A 2WEKA 3BIXA 4H7DA 1JDPA 2HBZA 4UVDA 1A8IA 1XYVA 2JIZA 3BCHA 4AG3A 4WBNF 3ISJA 1XALA 1A8QA 1JQBA 1VL8A 4C89A 1MW8X 4AY2A 3DEKA 2C7VA 5FQOA 3N6VA 4H6XA 4K8RB 2ZBFA 1XZPA 1SKAA 3G7NA 3OQBA 4WOPA 3SFTA 3SGLA 4QYTA 4CKWB 4DA7A 1EVJA 5CDGA 4YQEA 1GPKA 1XYYA 4DWOA 1Q19A 5L40A 4FOTA 2YWGA 1NG1A 1BU5A 2O52A 4KQFA 1RPJA 2XCIA 5FTKA 2JA2A 4BO8A 1P2BA 3CLSD 4JI5B 2DGDA 2DPMA 4JI1B 1SD1A 4QKQA 2ENWA 1C3XA 1AKEA 2GKOA 3EZ2A 2WHRA 4KXVA 5KS2A 2DCMA 2J87A 2ANBA 4R01A 4RD3A 3RJZA 3OQNA 4JH0A 5GY7A 3JQ8B 5B3JC 2XWQA 3N7AA 1CBUA 1M5RA 6REQA 2C00A 5KINB 3VZBA 1P1HA 1Z4IA 2EKQA 2FWIA 2JEYA 2FB9A 4YAJA 4QXMA 2N47A 3VR5H 4HVTA 1W5BA 1S7GA 3OQHA 4NULA 1OMOA 2P27A 2G04A 2O2XA 1QPGA 3K53A 1WV0A 3RIHA 3TFQA 4JA2A 4GQBA 2C5HA 2YNMD 4J76A 4NBLA 1Q91A 4LFBB 5AKKA 1T9DA 2GAOA 5F52A 3KOMA 3ZDYB 5EXPA 2V0NA 4QDJA 2A9JA 3LHDA 2W9XA 3MGAA 5JC1A 3ZHZA 5D3KA 3P2YA 4L6AA 2WWYA 3COYA 3FR8A 1U6JA 3GPBA 1Q1QA 4PG5A 4JOSA 4TMTA 2I7CA 4LQ4A 3ES9A 3PD7A 3AF3A 4FSHA 3O6VA 1G0OA 3K9HA 2QTLA 4P4UA 3DLIA 1JR3A 2EX4A 2C8KA 1QMPA 2GJSA 2PS1A 4CKBB 2PKCA 4UU7A 2P9BA 1SQ6A 1YAJA 1VL0A 3IAHA 2KB0A 4LX8A 2PDAA 3RG2A 3T9FA 1CJVC 3ZD8A 1N1MA 1PJQA 4K40A 2PZBA 1FFXA 7REQA 4RVCA 2HT1A 2IY7A 1Z7WA 4GZ5A 1YR1A 5KNDD 2IH4A 6LDHA 3ZD6A 5JMTA 2WMNB 2VK4A 2ZUSA 3AOGA 4ME6A 5EMNA 1YQXA 4IL5A 4NH0A 2PXAA 3RT1A 1MA3A 1T1RA 3AUSA 4GOLD 1UQTA 4CI9A 4EIWA 4E2XA 1UPBA 1XZLA 1AOXA 3SPXA 2X5NA 2H2HA 1GA6A 2R8PA 4B3MB 2GPJA 4D4JA 4QEDA 5HQ3B 4G24A 3SLGA 2LCIA 4RJIA 1RJ9A 1SXJE 1VG9B 1E1KA 1VP9A 3AFHA 3G7UA 4J7UA 5A4AA 3CLKA 2I8LA 3V80A 4PNZA 4CLXA 4XEUA 4HTAA 4L4SA 5JNVA 2UDPA 1R0XA 3DHWC 4LCEA 4MDYA 4BNNA 3T5MA 5BQOA 3F96A 5A3SA 1KNXA 3A36A 1MRNA 1NBWB 3ADDA 4KBYA 4MCAA 4EMUA 5KWJA 3B51X 1QCCA 2OUIA 3LHFA 1EHIA 2PX6A 3MAAC 3MJDA 4RWZA 4TTSA 2FW1A 1DEOA 3GLGB 2C8LA 2Y93A 4XTCS 2AI2A 3PVSA 4JL5A 1L0BA 1QYCA 4ND1A 5A05A 5E6UA 2M6LA 3R5XA 3AJ8A 1C1XB 3JQBC 3WICA 2OD7A 4CQMA 4OQDA 3I9V6 1HQCA 3AFNA 1OA0A 3N58A 2W43A 4KXNA 5CFOA 4YV7A 1E1YA 4IHKA 3C1AA 3MM4A 4CFYA 5L4NA 3IP7A 3AV3A 2J6IA 3C48A 3R77A 1ZGCA 3N8GA 4CLEA 1PX0A 3KHSA 1TUGA 1LK0A 5TF4A 1Z5WA 4BNMA 2B94A 2OFPA 1EIZA 4UUMA 1J22A 3AOEA 3VZCA 2C92A 5A0TA 3QLUA 1CQJB 1VYHA 2EHDA 2R7LA 4P4GA 3ZNPA 4EZBA 1IBMB 2XNSA 3SXUB 3TB4A 1G8MA 2I3GA 4FFRA 4BQRA 3AEZA 5JLJA 4Z1MD 1UBGA 4F2DA 2XQVA 3DYVA 3MWEA 3PF9A 4LRQA 4ZC8A 3CLSC 1SEVA 1H2ZA 1XJ5A 1TMGE 3C97A 1QHHB 3R44A 3ACDA 3KRTA 1EK6A 3TTUA 2JAPA 3C4JA 4IDPA 5M3BA 4G0OA 1YJXA 4UTPA 5CG2A 2JFVA 1FP1D 1YRWA 5TS2A 2HT6A 2ZANA 4KKXB 1M75A 1E6CA 4W9MC 1LNSA 3ZKWB 3FRJA 5IN4A 1A2KC 5JADA 1U7OA 2XVAA 3K2BA 4CMHA 1ESNA 2BC9A 2DT5A 3V8BA 5IASA 2VLBA 5IM4F 4QWMA 3OCJA 3ZCTA 4DMLA 4V0OA 3GJ3A 3TO5A 3EOAI 3WYFA 2YFHA 4AY4A 1TYCA 4RY8A 4K81B 5B53A 3AL0C 5CYPA 3DL7A 3LK6A 2CVQA 3WGVA 1EX9A 3GFTA 1CX9B 3AZPA 1QTIA 1QFXA 3AF4A 4BKPA 4GICA 1IN1A 4YP9A 1X7ZB 4FHCA 4B83A 5E4FA 3SHQA 3BXHA 5D3MB 4RC9A 3W04A 4MX8A 4FLMA 3L0IB 4J3FA 4ENSA 1SC4A 3T38A 1GZ3A 4IZOA 2PLAA 1A4XA 3U44A 3C3CA 4QAQA 1JQJC 1CT9A 2IOFA 2C2KA 2G17A 4OQYA 3AY0A