1E3SA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
255
structure length
241
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 85
structure length 241
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3sA00
5DOZA 3HNPA 3U09A 2VYNA 5U4QA 3L6EA 1H0KA 4PLYA 2HDHA 1E1MA 1D1SA 1E5QA 2VTDA 1PGPA 1YJ8A 2NU6A 4ZD6A 2D3TA 3ZDFA 1NNUA 2X6TA 1KVRA 3RIHA 1R4MB 1FXSA 1UDCA 2G0TA 4NR0A 1CQIA 3HADA 3UAGA 4IUYA 4L76A 3NDRA 1EK5A 2FPGA 5G4KA 3Q9UA 1UJMA 3U0BA 1Z82A 3K2BA 2GGSA 2QG4A 2ZIZA 1JW9B 1U3UA 3QA9A 2RHCA 4ZHSA 1XQ1A 4FR5A 2BFPA 2D2IA 1FJHA 2W2LD 1IHXA 3F47A 3NDJA 4IJKA 1GFSA 4LCEA 4W7HA 3DMTC 2EWMA 3KUXA 2PLAA 5L7YA 3PJFA 3ZU2A 3C3XA 3SLGA 1ISHA 3JYQA 1QV6A 2AA3A 5F3RA 2OXIA 3KBOA 1JN0A 3OP4A 4OOEA 4EBFA 1MX3A 1EDOA 3K96A 2I67A 5LCXA 3LF2A 2EKQA 5K9ZA 1DBVO 1K89A 2BH9A 2GN8A 3SJ7A 4YJHB 1A71A 2Y0CA 1HYEA 1GUYA 1Y8QB 3D0OA 4RPLA 3U9LA 3CTMA 3FPLA 1AUPA 4G65A 1ONNA 3OJLA 3W4IA 3ONEA 4CR8A 3A4VA 3AOEC 1WW8A 1ZMTA 3PTZA 4J3FA 1NM5A 3O03A 2GD1O 3ZU3A 1ZSYA 1T1RA 4H15A 4I5GA 4HFMA 1B3RA 1X15A 1Y1PA 2JD2A 5FI3A 2B0JA 2V65A 1DIBA 2X23A 4L4XA 3F3SA 3GGOA 2Y1GA 3BHJA 4YAKA 1DFIA 5KKCA 1HE2A 1UXIA 1O6ZA 2C2YA 4XIYA 1F12A 2YHIA 4R9SA 1XYGA 2QRJA 4IMPA 3RFXA 4E32A 3L0DA 1XG5A 1MC4A 2ILTA 2FR8A 2UAGA 4CM7A 3PIDA 1WAMA 4IM7A 3WIEA 3AY7A 3D5QA 4RJTA 2AMFA 4W4TA 4BNTA 4E5MA 1YQGA 1R0LA 4PLPA 4JROA 4CM4A 4JBGA 3AY3A 2VCYA 3T7EA 4AG3A 5B1YA 1ENOA 3F1KA 3UKOA 5G0TA 3VPSA 1WMBA 3FBTA 3KSUA 4WASA 3VTFA 1XLTA 2GZ2A 2IODA 4RDIA 3VKVA 4GI2A 2C5EA 5AXAA 2XF8A 1U5AA 1KOLA 1M67A 1P1IA 3VH4A 5KIAA 1G6KA 2EP7A 5T64A 5TQVA 1DFGA 1H93A 1KEUA 1XEAA 4NNJA 1KVSA 3B1JA 4YA6A 1MC5A 3LT0A 1DLJA 1ENPA 2HO5A 4BKUA 1XR3A 5COQA 5TIIA 4NMHA 3HB4X 4QT0A 2X9VA 2BFMA 5TT1A 4DWVA 1DC3A 3ZWMA 2PGDA 4BQRA 1PL7A 1SBYA 1I3NA 2J3KA 3DBLA 3GPDG 1JWBB 1DLIA 1YOVA 2AQKA 4I8XA 3I4FA 4RPKA 5KVQA 4NHEA 3S8MA 3G79A 4YYZA 2VYVA 2GO1A 3AOGA 1NX6A 4GWKA 1E0DA 2DT5A 2EKLA 3LT2A 4YB8A 1SB9A 1P77A 4A10A 3WR5A 2HRBA 3AJRA 2G1UA 1QYWA 4FC6A 3TOZA 1I10A 1ZBQA 3DWFA 4TWRA 4IDGA 2NACA 2P2SA 4JXKA 4RO0A 4RVUA 2RH8A 5ER9A 4TVBA 4JN6B 1DC5A 1P1RA 4Q9NA 1ZK2A 1NWCA 3GVCA 1NFRA 3AI2A 2UDPA 4WOKA 2IEDA 5CDTA 1H9AA 5TJ9A 2OFPA 1D3AA 3TSCA 4RGBA 2NLOA 1YWGO 1ADCA 1LRJA 2ZB4A 3PEFA 3Q0EA 2VHZA 5TT0A 4D0RA 1WPQA 3H2SA 5GZ6A 1GU7A 1Q0HA 4GLOA 3W8EA 4L75A 1MXFA 1W6UA 2C29D 3H9JA 5KVSA 4N54A 3KSDO 1O5IA 4BO5A 3L4SO 4QX6A 3EYWA 2DQ4A 3R3JA 1U3VA 2CF5A 4MVJP 4M89A 3S1LA 3ZHBA 2DFVA 1B15A 1N8KA 3FRJA 1GPDG 3KTDA 1MUUA 4OIMA 2HQ1A 3TZCA 3CXRA 3E8XA 3GDOA 1ZO8A 4L73A 3RKUA 3UOGA 5ICMA 4R5MA 1KY4A 3IMFA 4K9DA 1NP3A 4RLHA 3RUAA 3V2GA 3FTPA 4UREA 1PGJA 3ROKA 3WX0A 1R4NA 2IYPA 3GEDA 2B35A 7ADHA 4O59O 3JYLA 3U4CA 1YVEI 5HTOA 1LTHR 3PWSA 3DZFA 4NJOA 1AHHA 1DSSG 3QSGA 1FDWA 3GVIA 2DTXA 3E6AA 4OQZA 3H9QA 4XEHA 2VZ0A 1RM3A 4N5LA 3F4LA 1BXGA 4II2A 1Z73A 3UHAA 4R01A 5JS6A 2PGLA 4TRNA 4Q39A 4Y6PA 3BA1A 2G5CA 1TB4A 3I4CA 4R16A 4P4GA 3DOJA 3HB5X 4J0EA 1VC2A 1JVSA 2QQ5A 3VH1A 4TSKA 2AE1A 2OBNA 4RVSA 3LK7A 1TT5A 4AJOA 3JD2A 2FWMX 2Q3EA 3CMMA 5ENVA 3U3XA 5KWEA 2PZJA 4D3SA 2NVUB 3WDSA 1LDYA 3M1LA 4UEOA 4XGKA 1UXJA 3FI9A 4CMIA 2YV3A 1W8DA 3GEMA 3WGYA 3EZYA 3MCVA 2R6JA 1LJ8A 2YDYA 3LLSA 4FJ0A 2W8ZA 4PLVA 3JCZA 4X54A 2EERA 1C3VA 4Q3AA 4TRMA 1HYGA 5ILGA 2ZJ1A 4CODB 2EXXA 4MINA 1GL3A 4R51A 4DLBA 4PG6A 3Q3CA 1FK8A 3G3EA 1XIVA 1C1XA 1NQOA 4CM6A 5IDYA 1L7EA 3UCEA 1ZSNA 3FNHA 2OBYA 5G0SA 3RAJA 1JAYA 1GCUA 4KUGA 3EAGA 2EIHA 1WVGA 5KVCA 4OJNA 5JCXA 3HSKA 2ZTMA 1MFZA 4DRYA 4FGWA 2DKNA 4B3JA 5B4VA 4I5FA 5GMOA 5DBGA 3KVOA 4CMEA 4LRTB 2X5KO 1VL8A 3X2FA 2GCGA 3MJSA 1K5HA 1PS8A 2PD3A 4MKRA 4AJHA 1SEVA 2PV7A 2Q99A 4YRDA 4BO6A 3WNVA 5I7EA 1ZW1A 4KUEA 3BMCA 1K6XA 1GQYA 1EK6A 1E1LA 4RPGA 3B1KA 3RWBA 3RROA 3I3OA 2BFAA 4E4YA 4UVEA 1XWFA 4XWYA 3WIDA 2D8AA 2HJRA 1ULUA 3ICCA 1KY5A 1H6AA 3MWDB 3AU9A 3ZV5A 4LISA 1MG0A 3JQGA 4M86A 1VE9A 1WMAA 3I9OA 4NDNE 5A9RA 1A72A 1WXDA 3DXFA 4NBWA 4CQLA 5HRUA 3LZ6A 1HZZA 1RYDA 2JHFA 3DFUA 3KEOA 2I65A 1W4ZA 3DZBA 4K6CA 1U8XX 1ULSA 3DOOA 9LDBA 1T25A 4N7RA 4GQAA 3V1YA 4D42A 2Y05A 1M75A 2I3GA 3QWIA 1KC1A 2WE7A 3LT1A 2O3SA 4AJLA 3JQ7A 5ITWA 3M2PA 5ADHA 5HBRA 4ALNA 2C20A 3N58A 3IDSA 4ZRNA 4EJ6A 2AQ8A 1ZFNA 2VYVD 3W4JA 4I9UA 4YJFA 1NASA 3AUTA 2V6GA 1NVTA 4UVIA 3D3WB 4OXKA 1C14A 1I8TA 4ZRMA 2F1KA 3O8QB 1F8GA 4BNZA 5L7TA 2QX7A 3LC1O 1ZCJA 4B3HA 2ZK7A 4RCVA 1ISIA 4Z0PA 3OIDA 1DOHA 2Q50A 3GFBA 4RDHA 1ISMA 4YQYA 3U62A 1EQ2A 3P2OA 3AFNA 1IY8A 1NR1A 2PZLA 2Q45A 4CLHA 2FSSA 4CL3A 4A27A 4L74A 1OBFO 2GN9A 2P91A 1MLDA 1MFPA 4FC7A 1FF9A 1P3DA 5ES3A 3ZH2A 3ZNPA 3QVTA 1QYXA 1LI4A 3O26A 1PJSA 3BMQB 4B8WA 4E21A 1B7GO 3GAZA 4NZ9A 4QTZA 4D7AA 3OEWA 2DLDA 5THQA 4E0BA 4ZGWA 2D1YA 3WOHA 1BSVA 3ON5A 4IIVA 2ZCVA 3ANMA 3TWOA 3GRPA 3DZIA 3DC2A 3GUYA 3C24A 4J7XA 4CR7A 3ST7A 2HSDA 3BTUA 3UF0A 1H94A 4IZIA 4LRSB 5HA5A 2EW2A 1ADFA 4W7IA 1K0UA 2ZATA 3JQAA 3DL2A 1BRMA 3D1LA 2YJZA 3Q1LA 4HFJA 4U6QA 4JLWA 1UP6A 4NQZA 1Q7BA 4KQWA 5JC1A 1UZMA 3EC7A 3O9ZA 5TS3A 3Q9NA 3TL3A 2Y68A 1TXGA 4XQCA 2VHYA 1LC0A 1ZNQO 2YQ4A 3E9QA 2YFQA 4Q3NA 1LDNA 3ZGYA 4CJXA 1GYQA 5ENDA 4R5HA 2FN7A 3V2HA 2Y1CA 3QE3A 3GG2A 3CE6A 4NPCA 4DVJA 1T24A 1G0OA 2O23A 1DJQA 5F1OA 4W9NA 4FFLA 4NU5A 4YJGB 4DYVA 3IP3A 3RBVA 4EZBA 2RH4A 4DGSA 3DBHA 1LLDA 5A02A 3R3SA 1D8AA 5B4TA 3CUKA 5BNFA 5I7VA 1BHSA 3LYLA 4UVHA 4CQMB 3MZ0A 4HADA 2OMEA 4S1VA 4Y98A 5LC1A 4JP2A 5H82A 4DBZA 2GN6A 5HS4A 5L53A 2FR0A 3CPSA 1U1IA 2VRCD 3BAZA 4YQZA 4CLOA 4D3DA 3K9QO 3ZW8A 3N74A 1PWXA 1VPDA 1HE4A 3RC1A 1O89A 4XKJA 4OHUA 2Y1EA 3B20A 3OIFA 4YEDA 3WTBA 3T4EA 3ZI0A 1LDGA 2NNLD 3BHIA 4J43A 2B69A 5JY1A 1RPNA 2ZYDA 3KHUA 4XYMA 3TPCA 2DBVO 1E6WA 2WM3A 4NK4A 3X2EA 4ALIA 4BNWA 4WNIA 5IFLA 3HDYA 4QSMA 3MJEA 2SCUA 1G1AA 3PRJA 1HEUA 4ND4A 4BVAA 5A9SB 5JMWA 1Z45A 1I2ZA 1YB4A 4WLEA 4D3FA 5DDIP 1JAXA 3SC6A 1WNTA 5JO0A 1GV1A 4HV4A 2X5OA 3VVBA 4E5YA 5A1TA 2GUGA 4BNFA 2NTJA 1U5CA 4W9NC 4MO2A 2DM6A 4WEQA 4J0FA 4MVJA 1LLCA 1KERA 3KLMX 4I1IA 2P5UA 4OXYA 5JAMA 1T26A 1V3TA 2OGUA 2OOSA 1R4MA 3FNEA 4L4RA 3F5SA 3IJPA 1BVRA 3ETEA 1BW9B 3UH1A 2CDBA 4DC1A 1P33A 3VZQA 1WWKA 1V8BA 3G0OA 3VPHA 2LDBA 4FOSA 4GKBA 3C7CB 3JYPA 1VM6A 3SX2A 3IIEA 3WGHA 1NTOA 3DMYA 5I9MA 1BWSA 2I66A 1UDBA 5ER6A 3GN1A 2R2GA 2XXJA 2AG8A 2HU2A 5TF4A 2NM0A 2BGLA 3S2IA 4J90A 1PJTA 4OKIA 1QKIA 1IZ0A 5IG2A 4W99A 2X1HA 3DQPA 2VUTA 1CF2O 3G1TA 3I52A 4OKNA 2XXBA 4E13A 2OO5A 2ZYAA 4JGBA 4YWJA 3IOYA 2YQ5A 1DIAA 4NFHA 4B7CA 1X13A 4P22A 1E3WB 2PR2A 3LDHA 3LU1A 1HLDA 3PLNA 4LN1A 4YJHA 4YVFA 3DONA 1UZLA 4B4WA 2NVBA 1Y8QA 3VPGA 2CF6A 4YT5A 1LRKA 3FF4A 1DB3A 3QVWA 2JKVA 3JD3A 3OQ6A 4FSHA 1QLJA 5F1PA 4BB5A 5F21A 2OUIA 1F17A 2VHVA 2V6MA 2CUKA 4K28A 2VN8A 2Q2WA 4II3A 2V6FA 1GY8A 3W6UA 5JAIA 2X5JO 1MG5A 5AOVA 3AUSA 2DBZA 3H9UA 2CD9A 4NH4A 3DZGA 1NFQA 3CEAA 5L7WA 3PPIA 4CQMD 1GV0A 3RBZA 3W4KA 1SAYA 3CMCO 5G2OA 2O2YA 1HLPA 1FDUA 2D5CA 4WEOA 3DBRB 1X14A 2GSDA 4OH1A 5L4LA 5DNAA 4DUPA 3DEYX 3ETDA 2IXBA 4YT8A 4ZQHA 1GTMA 2IEBA 5IJZA 4FBGA 2EKPA 3CZRA 1U4SA 2NUAA 4R3WA 7MDHA 1P1KA 3PQDA 2AE2A 4RZIA 5DT9A 2FY8A 4J9VA 3WICA 3JQEA 3HDJA 3KM0A 1MXHA 4NBUA 3JD1A 1GD1O 1Y8RB 1DAPA 2G82A 4WLFA 3DZKA 1LBEA 4GVXA 4MP8A 5IF3A 3JQDA 3ADOA 2JCXA 1V3VA 4MPDA 3D5TA 2I3AA 4QUKA 3FD8A 4XDZA 1PX0A 3H5AA 3GZNB 4DQXA 3QY9A 2Z5LA 4HXYA 1H9BA 1NHGA 4KWHA 1HDCA 2AEMA 5JCJD 2V7PA 4XYBA 5FFFA 2VWPA 1K6IA 5TC4A 4DPKA 1PL6A 2FZWA 4MIEA 2BRUA 1AE1A 4D46A 4D45A 2EV9A 3PZBA 3EMKA 4PLCA 5MDHA 4YBZA 3QVSA 2Q1UA 4J2HA 1PJCA 1R0SA 2E82A 4XQEA 4RF4A 5B12A 2WEKA 5A03A 4UAGA 4BNXA 3C1AA 1C0IA 5A3JA 3PGJA 1LLUA 2JAPA 4CLRB 4IDCA 3DFZA 4YPOA 1B2LA 1WLYA 3OF2A 4E6PA 3E9MA 3K2EA 4YXFA 2VWGA 3DZJA 4IZHA 5C37A 2IDZA 5GZ1A 4KUHA 3JQAD 4C4OA 1LDBA 4DREA 5H83A 2I9PA 1GYRA 2J8ZA 2O3JA 1HYHA 2B4QA 4LSMA 3W1VA 2RBEA 5A06A 4PFJA 5BNTA 2WSBA 5TGDA 3TZ6A 1A4IA 2DFDA 1UR5A 1B8PA 4NJMB 5IN4A 9LDTA 3DB2A 3MJTA 4BGIA 4NFYA 3ROPA 5JW6A 3S2EA 3GRKA 5DCUA 1DRUA 1IULA 2GN4A 1E3JA 3S2FA 3ADPA 1CWUA 2A92A 1E1KA 3ENNA 3ITDA 2YHUA 3WLEA 4FB5A 4PG7A 4PG8A 2VZ9A 4GX0A 1BDBA 3I9LA 1Y5RA 4BGUA 1T2EA 4DLLA 3HDQA 1TT7A 1Q0QA 1JVBA 5K0ZA 3G49A 2Y99A 1Z75A 2VUUA 3ULKA 2UV8A 3NT4A 4I5DA 1E5LA 4XX0A 3LSYA 5JC8A 1KEVA 2CDCA 3BIOA 3VVCA 4PLHA 1IHYA 3OIGA 1RM4A 5EJ2A 4ZQBA 3U5TA 3ZCXA 3INRA 3BMNB 1IUKA 1E7QA 4L8VA 4KQXA 2BI8A 4BO7A 3RBXA 4K1LA 4O1MA 3GNTA 1WZIA 4XDYA 1ZJYA 4GWGA 1E7MA 3QRWA 8LDHA 4F46A 5BQFA 1F8FA 2P4QA 1JU9A 2O7QA 4N5NA 3FN4A 3JSAA 3JQ9A 1DIRA 4R1SA 3AWDA 4WCFB 1DDOA 4UUPA 4XB2A 3NTRA 2FSVA 3PYMA 1BGVA 5EL0A 2Y0EA 1N2SA 3BZUA 4IJVA 4MVJD 4OO3A 3BXXA 1B3BA 3FNFA 3UVEA 2ZTLA 4MJLA 4ITUA 3ZWYA 2I5PO 2NTVA 3JYNA 4C7JA 3WGIA 4OSPA 1PTJA 1QSGA 2PD4A 3GN2A 4Q3DA 1HSOA 4FFRA 4LSWA 1SPXA 1PGQA 5BSEA 1E92A 2YUTA 3ZU4A 4PZDA 1YXMA 2CMDA 4J49A 3VKUA 2W90A 1PJLA 1YQXA 1YL7A 2E4AA 1I3LA 2DBQA 3FNGA 2Y93A 2Q1SA 4BUCA 4EDFA 2NVUA 1UXGA 3Q2IA 3ROMA 3WS7A 4BOYA 4D44A 3AM3A 3FWZA 2TMDA 4CM9A 3JV7A 2PTGA 1BXKA 5EERA 4A26A 5IDXA 1H6DA 1O9BA 3OQBA 3EVTA 2WTBA 4TQGA 5C5IA 4JP3A 4GBJA 3WMXA 4A5OA 3MEQA 1A9YA 4TVOA 2WYVA 3RUDA 3TL2A 1UH5A 3O4RA 1F06A 4YR9A 1M76A 4FS3A 3VH2A 2B4RO 4CMKA 2HK8A 5IXSA 3MJCA 3AY6A 4E5NA 2O3RA 5AXCA 5T57A 1CETA 1PQPA 4ZQEA 4FD3A 3GQVA 4Z0TA 3JQBA 3GHYA 2O4UX 4OMUA 4B79A 3ZWNA 1NQAO 1C0KA 2H63A 1U8FO 4W6ZA 4BO3A 4BNYA 3WGGA 2Q46A 3HWRA 4IDAA 4AJPA 3RCBA 2DPHA 2PKQP 6ADHA 1HE5A 1PWZA 3WWZA 2J5KA 3COSA 4XYEA 5KNLA 1I3MA 4IDEA 4KWIA 4DIBA 2WWRA 2P9GA 1HL3A 4I5EA 3T7CA 1PEDA 3A14A 1UXKA 1HDZA 1K6JA 3H4VA 2J5RA 4E30A 1CERA 1ZZEA 4P4LA 1DFHA 3L77A 4U7WA 1A4UA 1FDTA 3IJRA 5DN9A 1QP8A 4IBOA 1PQWA 1F14A 1ISJA 3CH6A 2ZB3A 2NV6A 5A9TA 2P4HX 3HQ4O 1UP4A 1I2BA 3QWHA 4QO8A 5HM8A 2BKAA 2PY6A 2X0RA 3PVZA 3QHAA 4WLVA 1EMDA 3NKLA 2O48X 4JBHA 3PHIA 3ZHYA 3RQSA 1PIWA 1HWYA 1P9LA 2YYYA 4RQUA 5CEJA 3CINA 4CR6A 5CDSA 2O2SA 4LGVA 2YFHA 2HMTA 3M6IA 5K6AA 3INTA 3OSUA 3ETGA 1H2HA 1A7AA 3JQBC 4U6SA 4MKZA 5LDGA 2GF2A 1V35A 4FIZA 3KYDB 5F5NA 4M54A 3IS3A 5CDGA 1T2FA 4JX8A 4AJJA 3KYCB 4GMGA 2FOIA 1E7RA 3A28A 3UFXA 1IL0A 2IZ0A 3I1JA 2VRCA 3TQHA 3EUWA 1Q1NA 4DPLA 1PJ4A 4DLAA 3G1UA 3HFSA 4J1TA 4KP7A 4ONEA 1O94A 3RJ9A 3B6ZA 3I6QA 1ZJZA 2ZTVA 4R68A 2EG9A 2UUPA 4GVLA 1P0CA 3ZN2A 1ADBA 1I33A 3D3WA 2C7GA 4LCJA 4E2YA 3SJUA 3O8QA 1T2AA 2X22A 5DBIA 1PS0A 2PKQO 4XCVA 3OICA 4LMRA 3FHLA 5T8KA 1VL6A 3PJDA 1J4AA 2PGJA 3PYLA 4OSOA 3E1KA 3F9IA 3P19A 3JTMA 2J3IA 1ORRA 2ZB8A 2FP4A 3DHNA 1PS9A 3KLPX 5CFZA 1HDGO 1Q0LA 4CV1A 5K6AC 1D4FA 3JQ8B 1ISFA 1DPGA 2NU8A 1XA0A 3DBVO 1ISGA 3BTVA 2G17A 4GH5A 3ZNNA 1LUAA 4AJIA 2GRAA 4CMGA 4GGPA 3GPIA 3WGTA 3H9EO 3BMQA 4YRBA 4BL5A 3IQDB 3QVOA 4IQ8A 3PYXA 1FDVA 1PZGA 1JQBA 4INAA 2F00A 2QRLA 4P38A 5KOIA 1UAGA 1A9ZA 1I36A 1ML3A 3I9MA 3ZV6A 3RSHA 5I8WA 4DPMA 5CG1A 1KS9A 1NPDA 2Q1WA 1X0VA 4CLDA 4CM8B 3OQ1A 2HK7A 4J1SA 3L9XA 3NX4A 3OHSX 1KVTA 4YTEA 1NVGA 3R0IA 5H81A 2O50A 4FN4A 4JJIA 3EHEA 2Q4EA 3MWEB 1XSEA 3VZPA 2J5QA 4NFSA 3PHGA 3UCFA 3AM5A 2VNSA 3LT4A 3I9JA 2IXAA 2Q4BA 3ONFA 1Y81A 3LC2O 5F5LA 3V1TC 3HHPA 1VI2A 4HBGA 2JL1A 4DBVO 5TLSA 2WD8A 1NVMB 4E2ZA 3SEFA 4M1QA 1ID1A 1E6UA 4YAIA 3F1LA 4WE3A 4YJGA 3H65A 1EZ4A 5CPBA 4CM1A 3ZWVA 3PHLA 1JA9A 1SZJG 3DAFA 5DP2A 1PZEA 4QFCA 3SLKA 5IZCA 5FYDA 3T4XA 1K3TA 4PLFA 2VT2A 4IS2A 4MVJF 4TRRA 1NXQA 2GPTA 3INGA 4AL4A 3ZWBA 3GVPA 3TDKA 4CQMA 1CEQA 1OC4A 3UCXA 1YB1A 4XZ3A 1EUCA 4BV8A 3ZWOA 3I23A 2X58A 4CMEC 4Z0HO 2X86A 4WECA 4KDEA 1I3KA 3OH8A 1P45A 1V6AA 3FR8A 4GAEA 1U7TA 1YRLA 1GR0A 4NK5A 4CM9D 5TSDA 3OJ0A 1NAIA 4OGWA 4J16A 4RZHA 2VT3A 1E7SA 1WP4A 1GZ4A 1ZK4A 5EN4A 3ZWWA 3W8FA 4DL9A 3AI3A 5I7FA 4Q3BA 1YKFA 5GY7A 5I8ZA 1UXHA 1DIHA 3KEQA 5A9SA 1QXSA 4XQGA 1RKXA 2UYYA 4ND5A 1GAEO 1QLHA 3JYOA 4F6LA 2D0IA 4BQPA 3MTGA 4YACA 2Q2VA 3VZRA 3B70A 2VOJA 5A3VA 1EBFA 5A4DA 3D64A 5JCJA 2HJSA 3C8MA 3E5MA 2BMAA 3Q11A 1KEPA 4GSKA 1NQ5A 1OC2A 4J2OA 5IZCC 2QRKA 3P2YA 3BMOB 1I32A 3OMLA 3TFOA 4RLSA 1UAYA 2C07A 1UZNA 1VSVA 1C0LA 1EUDA 2ET6A 2OORA 4MIOA 1BW9A 5AVOA 5C7OO 4PGFA 1ZIDA 4HNGA 4B3IA 2BFOA 4WKGA 4BNVA 3ZWPA 2B4TO 5I7SA 2DUUA 4YAJA 3L9WA 2A35A 1QYDA 1TEHA 2X0IA 3OEYA 2YV2A 4NIMA 1GQQA 4R9RA 1Z6ZA 3ASUA 5JAQA 4RQTA 4NBTA 1G0NA 4NG5A 4WLUA 4BNIA 2I76A 1AXGA 4Q3EA 1E1NA 4EUFA 3GHHA 4CM3A 5I9NA 4D41A 1XDWA 2GZ3A 2X8LA 1GUZA 5C7IO 3R6DA 1SOWA 2P68A 3PFFA 3H5NA 4J7UA 4L9RA 2C59A 4BHTA 4CMJA 2ZKLA 4KTTE 4MP3A 3U4IA 3P5SA 2C7VA 2ZCUA 2E6UX 4ZJUA 3STHA 1E3WA 1ENYA 2QW8A 1I24A 4IY1A 1IPFA 3GR6A 3K31A 1O8CA 2JFGA 4ND3A 2H1SA 4DMLA 1JKFA 3VZSA 1EFLA 3KB6A 3RU7A 4M55A 3D4NA 3SC4A 1ZXLA 3PK0A 5CHEA 4RORA 1Y9EA 5BSHA 5TJHA 3HN2A 1Y5MA 1DRVA 5GZ3A 3WMWA 1U9JA 5BSGA 5C7LO 4KTVE 2NADA 1I2CA 4BMNA 2EJWA 2ZJ0A 2AHRA 3WLFA 3L4BA 2Z1MA 5CAEA 5L95A 2Y0DA 1I5RA 1E7WA 1F0YA 3WG9A 1GQ2A 4DC0A 1SOVA 3KOUA 4Y6SA 2I99A 1V3UA 3DBRA 4WLOA 1PR9A 4F45A 1N9GB 1PGNA 3BHMA 1LDEA 1AXEA 1T1SA 4ZA2A 1UDAA 4EEZA 2OZPA 4OXNA 1QYCA 3IL2A 2AW5A 1CIVA 5KTKA 1MGOA 4B4VA 4HFRA 4WLNA 4I9HA 4GKVA 5G0UA 3H2ZA 1Y8RA 3JQFA 3IUSA 3SVTA 3W8DA 1DJNA 4G5HA 3WNQA 1HDXA 3UICA 1H5QA 3GG9A 4Z3KA 3GNSA 4QO7A 3ZWXA 2WE8A 2BLLA 3GZNA 3NYWA 2EF1A 2W2KB 1PZFA 4BKRA 5B4UA 4IIUA 1ZKMA 4OYRA 4IDBA 4UUOA 5BSFA 4TKMA 3IAHA 4G2NA 1SMKA 4BO9A 3WQQA 5EQDA 4CV2A 3L4BC 2FPIA 3F46A 4FFPA 2Y1FA 2RCYA 4PG5A 3IUPA 4JBIA 4J6FA 1ZUD1 2IZ1A 3OJEA 4FCCA 4R41A 4R1UA 1R6DA 4B4UA 4CLRA 1YDEA 1DC6A 2BF7A 2PH3A 2HK9A 4RV9A 3GOHA 5EESA 5KCZA 1DXYA 3HG7A 1MV8A 3V1UA 4BS9A 4ZICA 4J7CA 4HP8A 2Y66A 3F4BA 1N92A 3PDJA 4J4HA 4JQCA 3BYZA 1E3IA 2CVOA 5KKAA 3GDGA 1AHIA 4RF3A 3ZNQA 5JSFA 1H2BA 2OP0A 3DAGA 3V8BA 1CRWG 1S7CA 2BHLA 4R1NA 3Q6IA 1GPJA 5A5EA 2Z1NA 3JQFC 3LVFO 4NJMA 4PLZA 1U3TA 3AW9A 4Z6KA 3ZWAA 1RYEA 1X7GA 3S55A 1V9LA 1EE2A 2X0JA 5G4LA 3RUHA 3KXDA 5CDYA 1I0ZA 3PI7A 4I9NA 2XOXA 4OAQA 3MJ4A 4IINA 2YDXA 2P5YA 1DAOA 1N1EA 5IDQA 4JNKA 2WYWA 3WFIA 3WWYA 1EE9A 3HE3A 1LLQA 3FWNA 2VUSA 4ZQGA 4BV9A 1NFFA 1IPEA 4UVGA 3QIVA 3EGOA 3W6ZA 2OHXA 4J1NA 4D0SA 1XCBA 3PFWO 1KC3A 2CVQA 4ND1A 4QQRA 1N1GA 3ZU5A 1Q7CA 4XQ9A 1GADO 3PWKA 1Z7BA 1ZVMA 3OJFA 4Q3CA 3WGQA 1NYTA 4EUHA 3BMNA 4IQGA 1C1DB 1HRDA 3HZZA 1XHLA 1J0XO 4BNJA 5T6BA 1GYPA 4IGFA 4ESOA 1U2DA 1GEGA 5A5FA 2BELA 4B7XA 4HFNA 1I30A 4IDFA 1J6UA 4M49A 1LRLA 3DMTA 2HCTA 3MOIA 4O0LA 1LSSA 1U4OA 4HUJA 4L0QA 3WJAA 2WD7B 1YH3A 4WCFA 3H6KA 4GLLA 2DTDA 4PRKA 3R1IA 3GDFA 3M2TA 3D4OA 1R37A 4MDHA 2PZKA 1SC6A 1IE3A 4O6VA 4HY3A 1LXCA 2DAPA 4L4SA 4CLXA 3DOCA 4LVUA 2DC1A 1BXZA 5DCYA 4OOFA 1T4DA 3PDUA 4U0KA 1LEHA 2CVZA 1YGYA 3GGPA 4GX2A 2PZMA 5A05A 3AOEA 5FF9A 4P8RA 5COBA 5JO9A 4DQUA 4IXTA 4XIJA 4O5OA 5G0VA 1PQUA 4ND2A 3I5MA 4ROSA 5JFOA 3WGZA 5DP1A 3C1TA 2VWQA 4RF2A 5JYDA 1N5DA 1NPTO 4JCOA 4RPHA 3RFTA 4Z9FA 1NQTA 4MVJG 2EW8A 5EMHA 2YW9A 1JLLA 8ADHA 3Q2KA 3GT0A 5DOVA 4EYEA 2OP1A 3OJOA 3H5RA 4E2WA 5LDHA 1FDSA 1YJQA 1E77A 4JJGA 4FJ2A 1UUFA 4WCFC 4XRRA 3ZW9A 1S6YA 2HMWA 4BO0A 4UEJA 4BNNA 3SBOA 4FGSA 4CMHA 1E3EA 2H5LA 3EW7A 3D4PA 3QW2A 1NHWA 3TZKA 4BO2A 4WOJA 1LNQA 3IP1A 3NUGA 1FMCA 1M6WA 3VHRA 1NWHA 3OBBA 3C85A 4UUNA 4FFMA 5JE8A 4ZN6A 4DA9A 4R69A 1VJTA 2Q1TA 1H6CA 4H3VA 2NQ8A 3H3JA 4IJUA 4DTIA 1O0SA 4XYLA 1P74A 2AQIA 1ZK3A 2NWQA 2XAAA 5AQ1A 4B7UA 5IZ4A 1A27A 5U1PA 3K73O 2QIOA 2RHRA 3PXXA 3DTYA 1ZEMA 1WZEA 5JMPA 1OFGA 1QORA 4A7PA 2GYYA 3GZ4A 5C3MA 3WFJA 2PK3A 2XPCA 3TNLA 5JY6A 2UVDA 1SNYA 3HUDA 3WTCA 1NBOA 4PRLA 1W73A 1TVEA 3WQSB 1P1FA 4PLWA 1XU7A 5HS6A 2DVMA 2ZQYA 1GUFA 1A7KA 2QYTA 1HKUA 2PH5A 3RUCA 2HAEA 3DZHA 1ARZA 5L4SA 5L4NA 5ILOA 3VPXA 3ABIA 2J6IA 2GNAA 3QJ5A 5F1KA 3JQCA 3H7AA 3KYDA 3GMDA 4H16A 5HWSA 1HF3A 3ZHXA 1NR7A 4WCDA 2GASA 4PN3A 3GMSA 4RPJA 1M66A 3KYCA 4UVDA 4J91A 3GH3A 4FFOA 2HMVA 5TRTA 4XYGA 4CV3A 4G81A 3E18A 4BIIA 2AQHA 4AJEA 3VDQA 1LU9A 2BGMA 2PFGA 3WBBA 5EINA 2NTNA 3WYBA 3KSZO 2CNBA 1Q7GA 4MOWA 3FBGA 3S2GA 1O95A 4EITA 1ONOA 1R12A 4CL8A 3HN7A 2ZYGA 4WUVA 5G4KB 4XRGA 2B37A 2BI7A 3RU9A 1IB6A 1Z74A 3PHHA 4MKXA 2X9NA 5AYVA 3NGXA 3DO5A 2V6BA 1HETA 3G17A 1I01A 2HKIA 1HE3A 1H6BA 2IRWA 3VC7A 3KV3O 4K26A 1R66A 3EVNA 2BD0A 3QQPA 4NI5A 4XR9A 2PWZA 3JQ9C 5BNIA 2W4QA 1B8VA 3V5NA 1XGKA 4Z9YA 1N7HA 4DXHA 3WSVA 4JJFA 4ALJA 2AXQA 1KIFA 1XQ6A 3C7AA 5CEEA 3JQ8A 4MVJM 4YDRA 4A73A 4KZPA 1BMDA 5JBIA 2J3HA 4XR4A 5JLAA 1VL0A 4CPDA 1J5PA 3H9GA 3VAZA 4N18A 1JKIA 1M2WA 1D1TA 1EEHA 5IAAA 2CZCA 3TRIA 4E12A 1U2GA 4AICA 3F5QA 1B26A 5JAZA 1YBAA 2D5AA 3ZV4A 4MIYA 1DC4A 3KYBA 4EI2A 2LDXA 1NPYA 3NRCA 1VJ1A 3E03A 2ZQZA 4A03A 4E3ZA 1WDLA 4BGEA 1HT0A 3NGLA 3OA2A 3TN7A 5U9CA 3B1FA 2QYSA 3QWFA 4CM8A 3FSRA 2HMUA 3C1OA 1HDOA 1T4BA 3BTSA 5FI5A 4MP6A 2G76A 3C7DB 1QR6A 2EEZA 3FCOA 3PJGA 2YHIB 1Y6JA 4C7KA 4BNLA 3HDHA 1GDHA 1ZSVA 3PIIA 2H6EA 3I9KA 2B36A 1HDYA 1DIGA 4FQ8A 4BNGA 5CPFA 4OL9A 3QV1A 3IKVA 3PLRA 3RKRA 1DEHA 3JQ6A 4RL6A 4IGEA 1LSUA 1RM0A 4K6FA 4WGGA 2WDZA 4CM4B 3GA0A 3UUWA 4TZTA 1PR3A 4CM5A 2HMSA 3LC7O 3ITKA 3TJRA 4PIVA 4S3MA 1CYDA 3DHYA 3VPFA 4DIFA 4DQVA 3FPCA 4J4BA 3M1AA 1AGNA 1QYVA 2VYND 4W82A 5IXYA 1VRWA 3VTZA 1M6HA 4E33A 4R3NA 1C0PA 1DRWA 4HKTA 1LQUA 3ZZNA 1LA2A 2HUNA 2JCYA 3AK4A 4BB6A 5KVVA 2POQX 1Y7TA 3RI3A 4YT4A 1JTVA 3D3EA 3ROQA 2UUOA 1BTOA 4KOAA 3WYCA 4IS3A 3IKTA 1WDMA 4FFNA 3ICPA 1N7GA 3DBLB 5JDCA 3OECA 1YOVB 1HDRA 2BGKA 4LMPA 4XGIA 4CMBA 2EHDA 3ENKA 1RJWA 4EJ0A 3QWAA 3ANNA 3K5PA 4FDAA 2Y1OA 2TMGA 3A1NA 4BKPA 4PVDA 3KETA 4U0JA 2I6TA 3ANLA 3WBFA 3IC5A 3AI1A 3BTOA 1KYQA 3NJ4A 3U4DA 4YAEA 1VLLA 4PZEA 3PWZA 3K30A 4BNUA 3DR3A 1BVUA 4BNHA 2FRDA 1CQJA 2NQTA 4LK3A 1GEEA 3BMOA 3CZMA 1IZ9A 3RJ5A 5JXWA 2C2XA 2VOEA 4N5MA 4PVCA 4CMAA 2JFHA 3LF1A 4J9UE 1DO8A 5FWNA 2Q2QA 3EDMA 4OQYA 4E2XA 4RVGA 1YBMA 4Y67A 5AXBA 3KZVA 3NEPX 4KMSA 1U28A 1LX6A 4O63O 4CV0A 2DU8A 2GDZA 5DZSA 1UP7A 1ZK1A 3GC6A 4XJSA 4OM8A 4CUZA 5JDCC 3TF5A 1T2CA 3GUCA 3EK2A 2HLPA 5T8KC 1ZMOA 2FR1A 5TNXA 2JD0A 1SO8A 4BNKA 3LQFA 2YV1A 2VHWA 4QFDA 3NJ8A 1CJCA 3DTTA 4FW8A 2OL4A 4D43A 4B8ZA 4MVJH 1YO6A 4GSLA 3CSDA 1ADGA 3V2UA 2NVWA 4YAGA 5KJCA 3HJAA 3RUEA 2R00A 3VDRA 3HFGA 2EGHA 3NT5A 1KEWA 4IXWA 2IYOA 2O3QA 3UGKA 1VSUA 1R4NB 3OM9A 4HNHA 5EQFA 4RVDA 1MA0A 3AM4A 1X1EA 4AJ2A 3GF4A 4GX5A 1JKJA 2QZZA 5ITVA 4BO1A 5DF1A 4ALLA 4P4NA 5KJ6A 3NAQA 4UULA 2VTEA 1CDOA 4NU6A 3A06A 1L1FA 3GLQA 3GK3A 2GR9A 1ENZA 1LC3A 4AVYA 4GMFA 5KJFA 1BXGB 3O38A 1KVQA 3I9NA 1R15A 4XJTA 1N9GA 3L07A 1PJQA 5THKA 3OETA 3WGOA 3RUFA 3WXBA 1P1JA 1YBVA 4Z9XA 3AUUA 3WSWA 1EVJA 2P9EA 4J4TA 4UUMA 1TT5B 2P9CA 2Q49A 3PZRA 4R4JA 1HTBA 1HSZA 4CUJA 2VRBA 2Y67A 4ZU3A 1BDMA 1R0KA 4R54A 2R00C 4CMIB 4J1QA 1QV7A 4URFA 3K6JA 5MGBA 1B16A 1ONPA 2W2KA 1TI7A 2E37A 3GNQA 4U8GA 4CUKA 1Y9AA 1LSOA 3E48A 2FZEA 1J49A 4LW8A 1VKNA 2DTEA 4KDFA 4CMCA 1PSDA 1TLTA 3D7LA 1OOEA 4ZQFA 4F6CA 4I08A 5BT9A 3RUIA 4ALMA 3PQEA 1EVZA 1TA4A 2VZ8A 5L51A 4WK6A 4FOOA 5CG2A 2E48A 1C1XB 1LSJA 4Z3DA 1PL8A 4RF5A 4AJNA 5ICSA 3OFSA 2DUWA 5L9AA 3RFVA 3SXPA 3TZQA 1EDZA 1B14A 3UXYA 4IMRA 2B5VA 3QP9A 4ZVVA 2NU7A 3ZWCA 4IPTA 2DBRA 3VH3A 2W2LA 2C5AA 1SEPA 1PJ2A 5DULA 3EZLA 4PG4A 2C54A 3RC2A 4TMFA 4HX5A 2X4GA 3H3FA 1YB5A 3AFMA 3E9NA 3NTQA 1SB8A 3QWBA 4TKLA 4BKQA 4Y9DA 3AU8A 2X9GA 3AUAA 3KRTA 3WYEA 2Y1DA 3MOGA 4H7PA 1EUZA 4WJZA 1B8UA 2PD6A 3QVXA 3BMCB 2HRZA 2GZ1A 1ZK0A 3DHEA 1V0JA 1EVIA 1U7HA 1E3LA 3E82A 4HWKA 4AFNA 5FEUA 5EPOA 1YONA 4NBRA 1RM5A 1DHTA 4WPGA 1K2WA 2PNFA 3NDIA 2JD1A 4E5KA 1P44A 2VNAA 5COAA 2W98A 5J23A 1GCOA 2GERA 1ZEJA 3GVHA 6LDHA 1L7DA 4AJ4A 4EGFA 3L6OO 2WJPA 2X0NA 3NTOA 3JQGB 3FTNA 3TFQA 4MVJE 4CQLB 4TZKA 3GVXA 2IZZA 5DBFA 3WJ7A 1YE3A 4Y6RA 2CSUA 2JJYA 5TX7A 1X7DA 4YCAA 1SCUA 4Y8VA 2AG5A 1C1DA 1YQDA 2EGGA 4BO8A 5EIOA 2JCVA 1P31A 4BKOA 4GGOA 2E49A 1T2DA 3PJEA 4A2CA 3JQ7B 1B0AA 5G0WA 1ZXBA 2NSDA 1YS4A 2ZTUA 3K92A 2O3UA 2VQ3A 1U3WA 2A4KA 1IYZA 4JIGA 4YJFB 1P0FA 2C82A 4NBVA 3GGGA 1MB4A 3N7UA 4U5QA 4ILKA 5CEFA 3CKYA 3NV9A 4DMMA 3ZNOA 4PLGA 1E7YA 3DDNA 4QXMA 4BNMA 2WD7A 1X7HA 1PGOA 4GPD1 3TOXA 3U49A 3UW3A 5L40A 1GZ6A 1X0XA 1VKOA 1PJBA 1KETA 2JFFA 3A9WA 2D59A 4PCVA 4JK3A 1BG6A 4MVJI 1WDKA 3F6YA 2GLXA 2QZ9A 5JPIA 4EUEA 1OMOA 1Z7EA 2YZ7A 3GEGA 5KJEA 1OI7A 3U4HA 4LVCA 1OZAA 1EBUA 3TZHA 3PHJA 2FHSA 4CLEA 3CIFA 4PLTA 3RD5A 3RVDA 2A94A 2FMUA 2NU9A 1EVYA 2X7HA 4A0SA 4E5PA 3JD4A 4IJWA 5JNLA 5JYEA 2AEFA 3ZHZA 4ID9A 2O7SA 1EQUA 2IE0A 1ZH8A 4QEDA 4EEXA 1RWBA 1GZ3A 1A5ZA 1PJ3A 3ASVA 3I6IA 4B4OA 5T5QA 2H9IA 5IN5A 4BGVA 2CDAA 1JWAB 5I9LA 3LLVA 3P7MA 4YJDA 4XD2A 3L6DA 3MTJA 3WB9A 1NAHA 5L45A 4EJMA 2B5WA 2A9FA 3ORFA 1OAAA 3QLJA 1X1TA 4TROA 1PZHA 4PZCA 4BO4A 5KJ1A 3JQAB 3PGXA 3I83A 3E5RA 4RVHA 2YY7A 3DAPA 1YL5A 4ALKA 1LDMA 4QECA 4UEKA 2PKRA 1EFKA 3OA0A 5JDIA 3RC7A 1QMGA 3GAFA 2WMDA 3GFGA 4TRJA 4AJKA 3RC9A 3VOSA 1LQTA 2EP5A 2DPGA 2FPPA 1KVUA 3MJVA 1D7OA 4FPXA 5IDWA 3NT2A 2CFCA 5L3ZA 3ZV3A 4E31A 5CP8A 2PA3A 3H8VA 2JHGA 1VJ0A 1HXHA 1DHRA 3DBHB 1XELA 4XB1A 5DCWA 5BR7A 4BMVA 1JDJA 2J3JA 1IOLA 4DYDA 4XGNA 1QRRA 1YDWA 2RAFA 2WYUA 4IDDA 2CY0A 3KO8A 3PP8A 4YT2A 2VWHA 2Z95A 4FJ1A 4M8SA 2ZB7A 2O3TA 2O4CA 3ONDA 3UN1A 3RASA 1PU2A 4AJ1A 3EY4A 4CLOB 4GL4A 2C0CA 2JAHA 5A04A 1XU9A 1KBZA 2AEJA 4WNCA 1E3SA 1MP0A 2VHXA 2QHXA 4M87A 4DIOA 1QG6A 1R16A 1AN9A 4XA8A 2RIRA 3JD0A 2D4AA 2B83A 1E6EA 5AXDA 5B37A 3WQRA 4RVFA 1XKQA 1YL6A 1HZJA 4F3YA 5JDIC 4EW6A 4YRAA 3K8ZA 4BMSA 3PQFA 1Q2XA 3FR7A 4R1TA 5T67A 4IQ0A 4D79A 2EJVA 5CDUA 3GY0A 4GX1A 1P1HA 1W0CA
chains in the Genus database with same CATH superfamily
2VHTA 1ZU5A 2QRUA 3EPRA 3FJOA 2I91A 3UBMA 2VYNA 1ULHA 2QTCA 4PAQA 4PLYA 5DI3B 4NDZA 4AKTA 2BAGA 2HCBA 3GJYA 1HUQA 4RA6A 2A4MA 2VTDA 4ZVNA 1N6RA 4MV8A 3WKCA 1CQIA 4D3ZA 3HY4A 4Z54A 2DHCA 3NEJA 3A9TA 3NHRA 4LXGA 1Z4JA 1EK5A 2VDOB 4XGRA 1W1UA 5G4KA 5J59A 4U7PB 5DTJA 4N48A 1Z88A 2PMCA 3KB8A 3TGWA 2QG4A 4P3PA 1JW9B 3IUMA 3G8BA 1XQ1A 3T06B 2JJ1D 3KL4A 4UXIA 2IP2A 3SHVA 2VKTA 3C3WA 4CKCB 2RBGA 3F47A 1YZLA 3F97A 1NMEA 3DNMA 3AIKA 3DMTC 4OXIA 4D8WA 1FQKA 4TGLA 3B8HA 2HRDA 3C3XA 2JGDA 3MILA 4FGKA 4M0CA 4HNAB 4PONA 3LBNA 3JYQA 5BSUA 1CYEA 3N6XA 3BILA 2FPKA 1L5KA 1KHTA 2Q8PA 5AOAA 4CEIA 4G5RA 2P35A 2PL5A 4RVCA 1MX3A 5E4YA 3RWMB 1EDOA 2XUAA 2I67A 4XXHA 4RKQA 2CLDX 1S1CA 4N7MA 4EY7A 1P7ZA 5LCXA 4A91A 1NULA 3KOYA 1Y1QA 1DBVO 4RS4A 3T7TA 2D0OB 2NOAA 1JIXA 2GN8A 2J9FA 2WJWA 3LGSA 3BDVA 3PGLA 1YVRA 1A71A 2Y0CA 4P3OA 1HYEA 4YJHB 3WWEA 2K87A 4RPLA 2HJWA 4G65A 1UPTA 4NV1A 2DOKA 3FLBA 1FY2A 4ZOLB 5CB6A 1UZUA 3O83A 2OY0A 3QKRB 4IDNA 4OI2A 4K7JA 1VMEA 1T8PA 2ZW9A 2UZAA 3BWYA 1YVDA 3VYTB 3PRYA 3QXHA 2C8LA 4TSRA 3AVYA 1B3RA 1X15A 1XI2A 2IQ5A 3JQPA 2B0JA 4BJ5A 1N3IA 3C6KA 5IC4A 1QAQA 2X23A 5IUNC 4ZYWA 4FQ7A 4GYKA 4KSBA 1KI4A 3PICA 3GMIA 4PPNA 1YRQA 2XXAA 4EVQA 4YAKA 1AV7A 4BN0A 1O6ZA 4OJYA 1Y3DE 1XCMA 3CXUA 5IDXA 2LKDA 3IV9A 1F12A 4HDRB 4JI1B 2QRJA 3H16A 5INTA 3AF0A 3TD2A 5JVDF 1M73E 1WZ2A 1JFRA 4L72A 3SJZA 1YHYA 2A30A 2V58A 2ILTA 2UAGA 5TVGA 3BXHA 4CM7A 1L7PA 4B84A 1WAMA 1QC5B 1Q12A 5BN3B 5D2CA 2BJWA 3TNFA 4JI5B 2NUAB 3V8EA 3ZH9B 4BNTA 3A9UA 3USES 1YQGA 3A0RB 3SX0A 2WA2A 3RSOA 2D8MA 2A9QA 2ACEA 1LZKA 1Q1EA 1C7FA 1BGWA 2VCYA 1M72A 3AY3A 2PV0A 3PQCA 3ZX5A 3L04A 1C4KA 1NUQA 1IEXA 3F1KA 3KSRA 1DEKA 1WMBA 1AX9A 4C6HA 2OBMA 4JVOA 5CK4A 3VO2A 2GZ2A 4CU5A 1RBZA 4UMFA 3DEHA 3SHOA 4QPZA 5LL6P 3RRYA 1NXVA 3IMEA 2C5EA 5AXAA 1JFLA 3MWKA 1KOLA 3D6MA 4TZ6A 1GKUB 4J6EA 3B3JA 4LYDA 2AVDA 2EP7A 2VYCA 3HKDB 5TVKA 3OQMA 2PO5A 4CFYA 1H93A 3OD5A 1KEUA 4MI1A 4QYTA 1KEZA 4NNJA 1KVSA 1T29A 1YJXA 3B1JA 5IUJC 4YA6A 1F2TA 1Z6AA 1N5RA 4BKUA 1RYNA 2Q5OA 3B36A 3IELA 4OGLA 3UHOA 2P78A 5DBOA 4MUAA 4PYKA 2WKQA 4BVBA 1XZHA 3H5VA 1T10A 2Y4NA 4BQRA 2LUOA 2PZFA 2W6NA 5DHSA 1M74A 2C4HA 1PL7A 1D2MA 1I3NA 1SBYA 2E21A 3DBLA 5DEIA 4JUBA 3F6EX 5HILA 1MC8A 1WXIA 3AHIA 2IUTA 2CGEA 3FGPA 2RHTA 2X2FA 3NP7A 1R9JA 4I4NA 2JG3A 1INLA 2JVJA 3S6JA 3H19A 1GGEA 4YYZA 3WDMA 1E0DA 2DT5A 1BRTA 4PN7A 1FUKA 1NRIA 2HYDA 4LOIA 3CW9A 1XEXA 3HXLA 4KPGA 5GJCA 3WR5A 4DXDA 4QM6A 1WG8A 3AJRA 4EW3A 1QYWA 3A3YA 1ZGZA 2J3EA 1ZBQA 4HYQA 1FW6A 4IDGA 2QR5A 2IF0A 4RVUA 3CN9A 1B0PA 3ZLVA 1FDIA 1MPXA 4XWWA 2VYFA 2WZDA 3CRQA 1P1RA 4Q9NA 5LKRA 3KPWA 1GLGA 1ISPA 4KIFA 3AI2A 2W8BB 4JI3B 1GRQA 2H8GA 3BE8A 3BGIA 2J85A 2Q5JA 4G37A 1G4AE 3BXPA 3LDGA 2FFBA 2VHQA 2AR0A 2CYCA 2ZB4A 3M34A 3NEYA 3WO0A 3SJAA 1O57A 1WPQA 3OOJA 5DYTA 1XZPA 4JB3A 4D0RA 5GVRA 4XM2A 1OWOA 1GL9B 2GCIA 3JAWB 4GLOA 5AJYA 5JADA 2QVGA 2OESA 3B3AA 3CLTD 3DF9A 5EE3A 1QANA 2E4ZA 1P4JA 5TXGA 1X7XB 3H0CA 1FVOA 2NO6A 4G3XA 4PZZA 1I0IA 2DQ4A 3QG1A 3RT1A 5J2TA 2QSZA 1FTQA 3I2YX 4GXNA 1NL3A 3B60A 1F8XA 2DFVA 1V26A 2H0QA 2Y1WA 3AB8A 1GPDG 2VXBA 3UOWA 1ZJ5A 2UYCA 3RJMA 3BBLA 1WEKA 3E8XA 2EFJA 4X60A 2R87A 3RKUA 4ZMBA 2PLRA 5LQDA 5JJCA 3OPQA 4CTJA 3CNHA 4R5MA 3RU2A 4JUDX 1JEJA 4K9DA 5HE8A 3V2GA 4QBHA 5D3KA 2ZBQA 2ZAIA 2ZSBA 3LFTA 4BBPA 3BRWA 5C8YB 2V5UA 4KLZA 5CA0A 3KVVA 2IYPA 5JNRA 2B35A 1U2GC 2PWAA 3PX2A 3BG5A 3VOBA 5C2JB 2K6GA 1OLSB 1GR1A 3WZMA 4NJOA 1AKYA 5HVNA 4N8SA 3IDAA 1VXOA 1FDWA 2B1IA 3DAYA 5HJ2A 5JXIA 3E6AA 3TB4A 2A1TS 4C4PA 3H9QA 4QZVA 2APJA 4LJ4A 3UATA 4G0OA 3JWPA 2QIPA 4ZP1A 3BORA 4OFBA 3ZLBA 1WUKS 2D06A 1LS6A 1PAUA 4H3KB 3VKGA 4ZT6A 3W5BA 1MHTA 3GGDA 3I4CA 4R16A 3SZUA 4MKGA 4HWSA 4M76B 4P4GA 3L4EA 5MGNA 1L2TA 4J0EA 4N01A 3EEIA 1X8LA 4MA5A 4NNOA 2QQ5A 1QRAA 2H4YA 2P5SA 4RY0A 3PD0A 1KY2A 1C7QA 4NEHB 2AE1A 2IYSA 5EMMA 1FYWA 3R0JA 3WZLA 4G9GA 4PSCA 4F6RA 3ROZA 2WINI 2Q3EA 3NTLA 4RV4A 3UAZA 3U3XA 3V7NA 5KVVA 3O21A 3OAAA 5KWEA 2JIBA 4KPEC 1HRKA 2PAAA 2PGOA 3IPCA 3RTDA 2NVUB 3NKVA 4D3SA 1V96A 3HLKA 2PEYA 1SIOA 3T5CA 4N5DA 3M1LA 4PQFA 1QO7A 3HCAA 3A7EA 4CMIA 1XALA 2C84A 1W8DA 3KXLA 4UFOA 1K7CA 2PA0A 3O2QB 2R6JA 1V7ZA 2J9RA 5CCDA 4HAWA 3WGYA 3O8CA 4FUQA 2WJ6A 1UFOA 4PTLA 4M0UA 1MAWA 4IV8A 3SK0A 3AXTA 4PLVA 2EBWA 1GIAA 3COPA 2WB2A 4RPCA 1C3OB 1O0CA 1PYOA 3L1IA 3ZDQA 1KR2A 2Q9UA 4MVXA 1HYGA 4CODB 4L51A 3F6PA 4MINA 1GL3A 1MT3A 4JT9A 1IK6A 5HE9A 2HHLA 1YQ9A 4GBED 4CKEB 2C7BA 2W6QA 3AINA 3B2NA 4QA9A 1CQPA 5I01A 4HDNB 2R85A 3SSNA 4GZ5A 4XEUA 1NQWA 1REQA 4GG1A 1BCRA 3Q3IA 1U3FA 4JL8A 3RAJA 5LZ2A 1M1YB 3D6AA 3QZUA 4KUGA 2Q07A 3QXGA 1QU2A 2XB8A 4RV5A 1RACA 4BBAA 5JCXA 1T15A 4E4TA 1G2OA 5IUKC 2DHRA 4ZTUB 4BPBA 3OCZA 4DRYA 5FL3A 5BP7A 3O2NA 6REQA 3WC4A 1KU0A 3KVOA 5J40A 3KVYA 4LRTB 2X5KO 3ODGA 2RGNA 1RI3A 4BUZA 1K5HA 2I6FA 2PD3A 1PUJA 3L2OB 4LWZA 5DH9A 3L6BA 4MKRA 5ALKA 1SEVA 4DJEC 4YPFA 2WYIA 5C5CA 3WNVA 4OQFA 4UXHA 4YP9A 1PX2A 2G71A 1Z6YA 4LTDA 3VC2A 4DQDA 3C3JA 4AAYA 5I7EA 4KUEA 1K6XA 3ND7A 4H08A 4WESB 5KC9A 3PNKA 4H1HA 4NBSA 3SY8A 2OE2A 5ICEA 1RI2A 1SUFA 2MU1A 4P0PB 5ALFA 4UPVA 3MS2A 1QHHA 1M2OA 3DE7X 4MPPA 3I3OA 1EB9A 2Z30A 2DR2A 4UVEA 3WIDA 4K6MA 5D85A 2OPHA 1N2CA 3OWOA 5B2FA 2V3CC 3ICCA 3AERA 3PDHA 3QFSA 4UPEA 2MINB 3KELA 4WADA 3MJFA 3ZV5A 1A8SA 1I6KA 3L3BA 4DW8A 3E35A 4WXEA 2M6SA 4F8EA 1VE9A 3NIFB 1U11A 4NDNE 5A9RA 1W581 1WXDA 3DXFA 3EIOA 4G5XA 5HRUA 4CQLA 3LZ6A 4RS3A 4RXTA 1FRNA 2PGNA 4KIUA 5FTNA 1RYDA 3ONWA 2B94A 3E9EA 2I65A 1KKMA 2VO1A 2V7XA 2VQDA 1CY6A 3HUFA 3KEOA 3QFCA 4M0PA 4UBKA 5ELLA 4ENUA 1CK4A 3B1WA 4MCAA 1ULSA 3MMSA 9LDBA 4R6XA 2I2FA 2Y05A 1KC1A 1BFDA 2P77A 2QD3A 4A6PA 4KN8A 5BQPA 4YWHA 3KJHA 2OYSA 4C6SA 2QL5A 1E2QA 2O3SA 2FG6C 4AJLA 5C8VA 1ECPA 1C7IA 1W5BA 5HBRA 2C20A 2DBYA 3T9DA 3N58A 3IDSA 4ZRNA 2AQ8A 5AM4A 2V6GA 4ITRC 1NQVA 3CRVA 2RHMA 3D3WB 2ORYA 1C14A 1I8TA 3LV8A 4GECA 1E5VA 4OXKA 1JDUA 5CJPA 2BJVA 4ZRMA 2F1KA 1KH1A 1RVDA 1F8GA 2I55A 4BNZA 1X80B 1UK9A 3Q72A 4QUGA 3W2TA 4B3HA 3H1FA 1MORA 4YAOA 4Z0PA 1FP2A 4CV3A 5CFLA 5CFPA 5IPFA 3OCYA 2P4SA 3T3DA 3GFBA 1OCEA 1A95A 3OQVA 5FI1B 3TRHA 2IYNA 5LP1A 2PZLA 3DL4A 2PX0A 4U63A 3WSTA 4DDHA 4KXNA 3AJEA 4TXLA 5UKDA 3BULA 2I7DA 4AWAA 4CL3A 5DSZA 3FYUA 4L74A 5D5PA 5SZKB 1ZNWA 1EFVA 3GIDA 5KSWB 1TAQA 3ABQB 2QTLA 4QTXA 2AOXA 3OU7A 3E7DA 4NU0A 1JHUA 1O4WA 2IPNA 4B8WA 4AF8A 4E21A 3VU3A 1E3TA 2ZBDA 4X94A 5JHHB 5C9ZA 3IJ5A 3WOHA 4ME6A 1BSVA 3G2JA 2UZ1A 1GCIA 2WHYA 5ADWA 3JVDA 3GRPA 4QDKA 3DZIA 3DC2A 3T7DA 3C24A 3BTUA 1TUGA 1MJFA 4ZK2A 4I1VA 2PS0A 3FVWA 3T1NA 1I7SB 2IBMA 1QIHA 4Q66C 1ADFA 1KH3A 1NJFA 1UKVY 1XNGA 2BR3A 3H87A 1UOEA 3ZHOA 3URMA 4FIDA 3DL2A 5FWDA 2YJZA 2EKZA 3Q1LA 4HFJA 2AK3A 1C8KA 4U6QA 4KQWA 2E4WA 4B76A 4H4CA 4Q03A 2WF8A 3TL3A 4EPTA 1X1CA 1RXUA 3V1NA 1QUFA 1TXGA 2BMEA 4EX6A 3FWPA 3N2GA 4TWBA 1AF7A 1LC0A 2D1QA 1LDNA 3B2QA 3AP3A 4HLQB 1IY0A 1J00A 3BL5A 3FMGA 3X1JA 5ENDA 2PCLA 4QJ4A 4KFSA 3SYNA 4QOSA 4QG3A 1D9ZA 4FGJA 2Y1CA 3GG2A 2F62A 4NPCA 4UJ5A 5ESXA 2XGJA 3KT6A 1SOMA 1X8JA 3MD0A 4TYNA 1VYUA 4W9NA 3R9KA 3D8NA 1JDTA 4U2CA 5FA8A 3RBVA 2C42A 1OGYA 2RH4A 2H18A 3PXCX 4DGSA 1C7RA 3HPQA 2N9UA 4IXNA 4KG7A 3E9RA 1X9IA 3LJKA 5A02A 3IAM6 5F23A 1CR1A 1QPBA 1JHOA 4P7KA 1H1LB 5B4TA 2I4RA 1NLMA 2BUBA 4MHOA 1CZNA 3CLKA 3CUKA 3IDZA 5PNTA 1BHSA 5CM8B 1WPXA 3VO9A 2FWJA 3G2LA 4HADA 5H82A 4DBZA 2A33A 2GN6A 5E6SA 3UKDA 4G97A 4IIEA 1XXHA 3BAZA 2W6OA 1SZPA 3E05A 3EGXA 3I6BA 4G36A 2A78A 4KXYA 4W63A 3N74A 5IVDA 4DEXA 4E1AA 3GBSA 3R74A 3RC1A 1TMGE 1G38A 4A2QA 7REQA 4OHUA 2Y1EA 3SHTA 2Z2ZA 5CIYA 3HJGA 4REQB 1VE3A 2XF2A 4Z0NA 5DN6A 2NNLD 4RTPA 2IU6A 4Y30A 3I28A 4LF9B 4QOGA 2BUAA 4XYMA 5EHXA 1Q1AA 1U2PA 4UNPA 1PNOA 3OT5A 4QSMA 3K70B 3W2FA 4RFVA 1G1AA 1TE2A 4AN4A 2X40A 2B4KA 4U2KA 1V9CA 4PR0A 1HEUA 3BGDA 3OTQA 3QBJA 4GE0A 3ZY6A 2QRQA 3BB3A 1M6VA 2FXVA 1ODTC 2VPZA 3NU1A 4GGMX 2R48A 3PR2B 5JMWA 2QBYB 1ILEA 2FAXA 2IIQA 5A4AA 5DDIP 1JAXA 5ALPA 5JD5A 1GV1A 5JO0A 1UKCA 1KJYA 2Z08A 1TMOA 1LPSA 2DFKB 2JNWA 3DW1X 4KDCA 4NYIQ 4E5YA 1USIA 1FRZA 2XMSA 5EE1A 3OIUA 5HZMA 3KQLA 3C39A 4OB6A 1RABA 3KL2A 4MO2A 2L69A 2P8SA 3B1VA 2I8AA 1Y9JA 2EYUA 2Q4DA 3IVMA 2P0EA 4OFXA 3DT8A 5DI3A 3DOIA 3IH5A 4YLGA 3SYLA 3GJ7A 1PR5A 1W0KD 5IT4A 3VUFA 5CTAA 4HT3B 1ZD1A 2OENG 4QAQA 2GEVA 2OM6A 3H9BA 3MCWA 3GDWA 3KTOA 3NVAA 2AKYA 3A6LA 2ZJ2A 4GOJA 4PS0A 2QMUA 1EUDB 3ETEA 1BW9B 4DC1A 4IDQA 3VZQA 4GKKB 4RK1A 3GJQA 4P7GA 5MHTA 3RS3A 4M0FA 4FOSA 4CKCA 3K0BA 4M9RA 3R44A 5A5VA 3TEMA 3RADC 1SR8A 2FP3A 2HMYB 1XXLA 1BWSA 2I66A 2XVXA 3OE4A 4RHYA 1HQKA 3P9IA 5EJ6A 2R2GA 2XXJA 4FDUA 3SFVA 3S2IA 4HNAA 4J90A 5JS7A 4E94A 2X1HA 4ZO7A 4BMCA 1CF2O 5JCZA 2WFLB 1SQGA 3K9LA 3TQTA 2H1LA 1T0BA 1AKMA 3I52A 4JBWA 1UMBB 4B32A 1Q21A 4IX1A 4Q6WA 4OB7A 4EUNA 1BYUA 1XRQA 4YWJA 4FU0A 1GVNB 5IJ0B 3FIJA 1A9RA 1X13A 1X39A 2JIRA 3K0CC 3KB1A 4P22A 1OYYA 3LDHA 3RVRA 2OXEA 3L1UA 4MI6A 2K2WA 2BR4A 4FYXA 4P81A 4YJHA 4D9NA 2GVDC 2VHJA 1AU9A 2XMPA 3DONA 4HVTA 5AKKA 4B3XA 2NVBA 3KZNA 1EX1A 1GGFA 1OZHA 4D8UA 1LRKA 1U0NA 4H7EA 3FF4A 1DB3A 5SY4A 1S3GA 4OHCA 1Q2UA 4ZOLA 5I3CA 3EPPA 1MDFA 4FSHA 2QI9F 3NBUA 1S2LA 3QKRA 4BLPA 1G9XA 2QQ0A 5KQPA 1F17A 1JUDA 2PIDA 1ULBA 2CUKA 2CZGA 2V6MA 3N8IA 4K28A 4WQMA 4ZCLA 4ZCMA 1CIPA 1UEJA 3G9UA 3HN6A 1MG5A 1WMSA 5AOVA 1OLXB 2DBZA 2ZSDA 3QUBA 1JHMA 5KNDH 1KBQA 1SCIA 3FA2A 1C3LA 2I7TA 3QMMA 3PPIA 3PU6A 1SXQA 3T0IA 3DTVB 4FHZA 5H80A 3SFTA 4HDRA 4RL4A 2O2YA 1SELA 2I2DA 3FCUB 2QU8A 4LHSA 3C97A 3DBRB 4JUFA 5F51A 4QYWA 4KQEA 4IV5A 3CZ4A 3SX4A 3G2HA 4DUPA 4L8YA 1T4CB 1OWLA 4GS5A 2JFUA 1QC5A 1FYXA 1GTMA 1ZA2A 1MAAA 4E7OA 4XVUA 5BN3A 4RM3A 2CHEA 2BI4A 2JLBA 1XDUA 1KFBB 1M2KA 2WB4A 2NUAA 2IV2X 1T6ZA 2WUGA 2E89A 2OO5C 1P1KA 4LZWA 2BWJA 4MKFA 2RSLA 1CHDA 4RZIA 2I03A 5P21A 3MW8A 2VDJA 4LPKA 3LWDA 3JQEA 4CQNA 1P18A 4C7MA 3SR0A 3KM0A 3J81k 2G0AA 5HYVA 1MXHA 3HABA 2HZBA 3JD1A 4WLFA 4DNPA 1PWEA 3NZEA 4GVXA 4QRIA 4OI1A 3ADOA 2A0FA 4EPVA 3UUEA 4AZSA 3FD8A 1DBQA 2BEVA 1PX0A 2O1WA 1EI9A 4N7BA 3H5AA 4Q3LA 4XDZA 3W5HA 4MDFA 5E1BA 1XMQB 2KI5A 2Z5LA 1U7ZA 3C87A 3OPVA 5BOSB 1H9BA 1NHGA 3R4CA 3SM3A 4NXMB 4QGFA 5JCJD 3HKDA 2V7PA 1JEEA 3EASA 2JGNA 2VWPA 2PRSA 4HDSB 4XYBA 4DPKA 4IG4A 1FX1A 3IILA 4ILEA 4MDEA 3MA0A 5KNCD 1L5WA 2BRUA 4D46A 3GJSA 4BGDA 3U17A 2FB9A 1DXHA 2RH5A 4A1FA 1NP7A 3KBBA 3D6FA 1W9HA 3IXLA 2ORWA 1PJCA 2YHAA 5HIMA 4KRGA 5FPTA 1XVVA 1R8JA 4RF4A 2ZANA 5TGTA 2YZ2A 1JKXA 1L7VC 1OAOA 2WIKA 1C0IA 2PNJA 3UYLA 2JAPA 3NM5A 4EI7A 3Q9SA 1WUYA 2J41A 3WP0A 2H7CA 4YPOA 1JS1X 1WLYA 3OF2A 2QTAA 2FTKE 2YNMC 5J2TF 5JJIA 2PX6A 1GZHB 1NF8A 3MXOA 3T95A 1ZM4A 3TVTA 5GZ1A 5FOQA 4F84A 1O9HA 1D04A 5E4TA 1PTKA 4NARA 5LMNB 3GFTA 4DREA 2PEZA 5H83A 4IEFB 2J8ZA 5BNTA 1U6IA 2DY0A 2Z3WA 5FBHA 3VX4A 4KFTA 5ALEA 4L8WB 3OE7A 1LW6E 3A05A 1KZ7B 1RKQA 3TZ6A 1A4IA 2JJQA 1UR5A 5JPDA 1UJ2A 1Y48E 1AQLA 1A4XA 5FA6A 3M6LA 1Y7PA 5DIZA 4FFDA 4HNTA 4QLAA 2W8BA 4XX1A 4FYIA 5CA0F 2YWJA 3JY6A 5DCUA 2YJ6A 1IULA 1KHHA 5JAUA 1DTSA 3MTIA 2ZAOA 3IVXA 1CY7A 3K9GA 1CQWA 3S2FA 4I14A 5DM2A 3WLEA 1JB9A 2YHUA 5AW0A 1YDHA 4PG8A 2X6RA 3S2UA 4GX0A 4JLPA 3OM8A 1YDFA 1PWYE 2I6QA 3SOZA 4EHFA 2W7TA 3I9LA 4BGUA 4F5WA 4MA0A 4KXWA 3HDQA 4UNNA 1Q0QA 1P5FA 3JAWA 3HJHA 3I6YA 1S5PA 1Y6FA 3STTA 3TXAA 1NVKA 2XRFA 4PS1A 1DQNA 4NICA 3DMDA 4X6LA 1D2GA 4MVCA 3SN6A 2F1IA 4MDYA 4OUDB 1X7XA 3HXKA 3MT9A 4DA6A 1F60A 3NUZA 2Q0XA 3LRPA 3NT4A 1MO4A 1TEZA 5B1SA 2BKEA 2G36A 2QUKA 3DTVD 1AY0A 1W93A 1FMFA 2CDCA 1K08A 3H2BA 3WHLA 1PSWA 1IHYA 2H92A 1RM4A 4PLHA 3A26A 4AN1A 4ZQBA 1NONA 3U5TA 3ZCXA 4R2KA 1HT2E 2A67A 1NF2A 1TU4A 4ID3A 2WBLC 4M7RA 5CTJA 2BI8A 3DMPA 3O0TA 2MSLA 3DBIA 3P96A 3RBXA 3KC2A 1R10A 3T1VA 3R9WA 1GGVA 5JQGB 4TLMB 1WZIA 3TE7A 5L6LB 2HJ9A 2F3SA 5C8YA 3DZDA 1E7MA 4TN1A 4O4HB 4X8LA 1SC1A 4F46A 3N2KB 3MTDA 2D7CA 4QL3A 2O7QA 3H5LA 3FN4A 4N5NA 4DQVA 1NBAA 1OLSA 5BWLA 6AT1A 4RTNA 1MEEA 3WYNA 4UTPA 5AK3A 3K9BA 4EZEA 1DIRA 1RXEA 2YS7A 3AWDA 1G21E 4R1SA 1XYYA 1KO1A 2XKAA 1XFDA 4Q9DA 2ZJFA 1AO0A 1L8OA 5EL0A 2YKGA 5EYPB 3BZUA 3GEBA 4IJVA 1I4LD 4MVJD 2JH9A 4WZBB 2Q6OA 5U4XA 4PFSA 5EVJA 5AUOB 1TGVA 2BUCA 1J23A 2CHQA 2ZTLA 3A25A 3KPYA 4Y6LA 3TSOA 4D8XA 4NP6A 3PB3A 4IHAA 5EKSA 4C7JA 3WGIA 1Y5LA 4F4CA 3IURA 1BEUB 2IBSA 1E9CA 3M5PA 4F93B 1AO3A 1OXMA 4RE6A 1PGQA 5BSEA 1WW2A 4RNDB 4NV3A 6ABPA 1JIVA 4KFCA 2CMDA 3BD7A 3NM6B 4TL9A 2XTMA 2X8AA 3G2IA 1PJLA 3W5DA 3WB1A 1QDEA 2HLNA 4ACBA 3IHKA 1YRHA 2AH5A 2VIIA 1I3LA 2WT9A 5SYMA 2Y93A 4G8BA 4EYQA 2NVUA 4Q4AB 4N47A 4INJA 3AM3A 3QUSA 2TMDA 1EHCA 2Q6TA 1HYBA 4PBSA 2CDRA 4XWKA 2O0JA 1H6DA 4TQGA 3C1UA 3I0NA 5C5IA 5KDDA 1FXWA 2ISCA 1EGHA 1VCHA 4WMLA 2YIVX 4MV3A 4N39A 2D5BA 3QYPA 1SKUA 3CS3A 1J07A 1DQZA 3VR1A 1JLLB 1UH5A 1SVLA 2V7GA 3FJ1A 5GV8A 1THTA 1C3OA 2QI9C 1URPA 1N8TA 1UJBA 2QG6A 3NAMA 4D4JA 3GROA 2ON6A 2XECA 2B4RO 5FXMA 4LXYA 4W5QA 4KXXA 4CMKA 1OBCA 3ECCA 3P9NA 5FKJA 4LC9A 3MJCA 5K1ZA 4CKEA 1DAEA 2O3RA 1VQ1A 2FSVC 1CETA 3C8ZA 1A88A 2KPOA 3NB0A 4ZQEA 4OYHA 5I5GA 3KUKA 2AS0A 2JA2A 3BICA 3GQVA 2AFRA 1N6IA 4HDNA 4Z0TA 4LXQA 4HQKA 3PFIA 5FBWB 3ZWNA 3DEIA 1M1YA 2H63A 2ORVA 2YBEA 5F52A 4PGMA 3T9EA 4K87A 1CR4A 3TNJA 2WW8A 3DG9A 4QODA 1HE5A 3EWAA 5KNLA 1R8QA 4XYEA 4P0QB 1S9HA 3RSSA 4TT8A 2HPVA 3K09A 3L0ZA 4KWIA 5C7YA 5FPKA 5DISB 3VI3B 4I5EA 5BORA 1DELA 1PEDA 3QFRA 5FD8A 3SYKA 3UMCA 3FNRA 5F76A 1OVMA 1BMFA 3NDBB 5C46F 4E30A 4NDAA 3R77A 4HNRA 3IPAA 4A16A 1A4UA 1FDTA 4IJMA 1QQBA 1T8RA 2IY8A 3PKZA 4IBOA 5JCOC 1PR1A 1IVNA 3JVVA 3QNUA 1EUYA 2XTJA 2AZ4A 1KJ8A 1V71A 3CH6A 4I8IA 2NV6A 3B7WA 5FHRA 4AURA 2X76A 3AYXB 3PDCA 4WESA 1DJMA 3N8DA 1F7VA 3QWHA 4QO8A 1HDIA 1KYVA 4IWYA 3B85A 3QHAA 4WLVA 4X84A 2O48X 4JBHA 3W8NA 3PHIA 4NL4H 2QL6A 1ZOSA 1BX0A 1U8EA 4CR6A 1T0UA 1WBBA 5IANA 2B8WA 2CVFA 2P2NA 2YHBA 3TM5A 1DBSA 1I14A 2MINA 1EP1B 3F6SA 2ZBPA 2HMTA 3V4ZA 4TUYA 3WGMA 3LKZA 3IO3A 1KK3A 2QN8A 1FUIA 3IOMA 1ZHOA 4HQOA 3JQBC 4XTRA 4A0GA 4F0JA 3RGGA 2GF2A 1G2QA 2O20A 1XL1A 2ENWA 5DX0A 4UM5A 1T2FA 1W9MA 1Y4SA 4JX8A 1IXKA 4UKDA 5I9TA 1B43A 1RYHA 3VQTA 4RMIA 3HXQA 3Q8LA 3DS8A 2R6FA 3GUZA 5FOUA 1AMNA 1RQRA 2Q8NA 2OB1A 1V7CA 3A28A 1V8FA 4WV3A 4AIRA 2ZJ5A 4F3CA 2OLEA 3HGMA 3PUXA 4V0LA 5IKPA 1YAJA 1IK4A 3NBYC 4RTMA 3DFKA 4J1TA 4DLAA 2LZ0A 2EP8A 5I51A 2GK4A 3B6ZA 4C05A 4EO7A 1Q3HA 2ZTVA 3DZ8A 1DRJA 1NMZA 2EG9A 4R68A 3ZEAA 3ZN2A 1T8TA 4CI9A 2IP1A 4IH1A 3D3WA 5BXYA 1EAMA 4ECAA 3LPAA 2RI6A 3KEMA 3K9CA 4MRVA 4Q1FA 4DNOA 1X80A 3EDYA 5JXJA 4R1QA 1J33A 3KKPA 2CEKA 4LMRA 4QELA 4EB6B 1WKVA 1C9JA 1MCZA 1JU3A 1P5JA 1NKTA 1WBDA 3BZWA 2FPMA 2R0QC 2FFJA 3M6MD 4GYWA 1A04A 2P3SA 4LWQA 4E03A 2F3RA 4I3FA 4JQZA 4NCAA 4DANA 1TC2A 3LKDA 4O2AB 5DMXA 4AYWA 1U7XA 3Q88A 2ZSIA 1TTTA 2PMKA 2C95A 3F7NA 1ZHFA 1ZL0A 2ZXUA 4AROA 1DAFA 1IJKA 1VFNA 3H1BA 5E2BA 1ISGA 4ISCA 3MHPA 2G17A 3ZNNA 4DR4B 3TSZA 5KO2A 4Q34A 5WRFA 4B45A 4AY6A 3K0HA 3EGVA 5JNSA 3KQHA 3T7JA 3M49A 4K9RA 4PSKA 1HFKA 4YRBA 2XDQB 2J59A 2RGCA 1DQYA 1J0EA 1FDVA 1PZGA 2QRLA 1AMUA 4LTMA 4RHXA 4DIDA 4P38A 4DM7A 2WSLA 1ML3A 2WVHA 3CX4A 3LUCA 1K6EA 4L16A 4MWZA 1U04A 3HBFA 2CLFB 1KS9A 1NPDA 2Q1WA 4BC0A 2B8NA 2AN5A 5H7XA 1NDQA 1WOYA 3OQ1A 5KKNB 3L9XA 3NX4A 3WGJA 4N8DA 1KVTA 2VEOA 4HX2A 4FN4A 1IDN1 2A5DA 4MYRA 5J63A 5LZ4A 2O05A 9ATCA 2ZT5A 5K3EA 2VXCA 3WNZA 3IUBA 4PZYA 4C87A 3VZPA 2I7XA 1X8XA 3UCFA 1CV2A 5EIXA 1MJGA 4U9HS 3RAFC 3LS2A 5MFPA 1CZKA 3G5MA 4G84A 3H2IA 3VR5H 1DX6A 1Y81A 4GI7A 4PQEA 3DT6A 5FTJA 3P5BA 2PYZA 3HHPA 4DLNA 1XQXA 1L8QA 2JL1A 4R98A 1UEXC 3EVAA 1G8GA 1NVMB 3R5JA 4E2ZA 4EOGA 4CCSA 1ID1A 1E6UA 2KX7A 3EFEA 4KIJA 3PKJA 2CYAA 5CPBA 1XUOA 2HB6A 3DAFA 2X13A 3AJ8A 3H6GA 1PZEA 3PQ3A 5DP2A 4BE7B 2QY9A 1ZOLA 3BF8A 1H1LA 4IS2A 5HK8A 2IA5A 3HWWA 3ZWBA 1C3XA 3EDOA 3QU5A 3EARA 3W1WA 2WT4A 1WXWA 3WKAA 1ACLA 4OQPA 4P3YA 4TTRA 3TXYA 1OC4A 1E63A 1JNXX 1YB1A 2P65A 1VHLA 4H7IA 3CRW1 3GJTA 1OFHA 1R6AA 2CBGA 5BSTA 4BO1A 4WECA 5DCLA 2H4JA 3RU3A 4KDEA 3FPHA 5ARCA 2YMMA 1NRXA 3TW8B 4W5WA 3P4YA 4REQA 1YR8A 3OLWA 3FR8A 4GAEA 4YAWA 1CEEA 1GR0A 1RWXA 2FPLA 1M0EA 2JW5A 5TSDA 1MIOB 4KXQA 2ADFA 2QUZA 4W8HA 5HF6A 3LGAA 5KVSA 1GZ4A 4MJXA 1WMDA 4DMUB 1Y98A 1KPGA 3IUYA 4N03A 2NAPA 2H1FA 4TXMA 4M36A 1YKFA 3SVLA 5GY7A 3AR6A 3KR0A 1O5OA 2JJ2D 1Z83A 2I33A 3KEQA 2QBYA 2AWNA 3OBIA 5H4HA 1XTIA 1TC1A 2HIHA 2UYYA 3C7TA 3CZPA 3I76A 3SS9X 3WADA 3JYOA 4H2DA 3MTGA 1DG3A 4BQPA 2J4CA 2QJFA 2FUCA 5B57C 5A4DA 5AH0A 3HFJA 1E5DA 3SE7A 2QE6A 5JCJA 4AU1A 1G16A 2BMAA 1XKTA 1KEPA 4X20B 1JFSA 1OC2A 4US0R 3RTBA 2HA6A 1Q84A 1ECBA 3FSEA 1YBFA 4ZOLF 3VJKA 4V1CB 4IRMA 5IZCC 5JEEA 5KNCA 3OCXA 5IT9A 3OMLA 2YCBA 4FYMA 4DR7B 4RLSA 1UAYA 4YJ3B 1L7NA 3EQ8A 5BW8A 4KR2A 2FU5C 1C0LA 1EUDA 1SQ0A 2W6MA 4MIOA 1BW9A 4BVHA 5GTDA 2NO9A 1ZIDA 4PGFA 5EP4A 2JLRA 3KT3A 3V7FA 3ADBA 2DFLA 2B4TO 4FE4A 3ONNA 4TWAA 2CT8A 1TQ4A 4QPPA 1ZLXA 2Z4RA 1FA9A 1TEHA 4B44A 2XZTA 3OEYA 1VMAA 5K4GA 1DS6A 2I6SA 3MMPA 2X19A 1JMYA 1OX6A 3NIGB 4LBVA 4WLUA 2I76A 2WTNA 3KJEA 4LDPA 1GAWA 2YXBA 3GCZA 3IXQA 3WYAA 2CMGA 2GAAA 2Q3CA 2I3BA 2WFLA 4J7UA 1OXSC 1UMBA 3U3JA 4NYMQ 1IQUA 2C57A 3EXEB 1MBZA 4KGXA 2ZCUA 3VSAA 1Q15A 2CWDA 2V0NA 1CY8A 3AVUA 3CW8X 3HU5A 3ASYA 4B6PA 1ENYA 2R5NA 1TAHA 5FIUA 3OX2A 4AO8A 2ZR7A 1NRJB 5EUBA 4ND3A 2H1SA 4BX0A 3C16C 3UHFA 3FYUC 4J2TA 2EF0A 4M98A 4NKRA 1U94A 2ID7A 3EVCA 3RYFB 3T3HA 1ZXLA 3A4LA 1D5CA 2CFOA 3PK0A 1U0TA 3ABSB 4HB2A 5CHEA 5CXUA 3N7AA 3LSTA 1Y9EA 1DT3A 1PW7A 2IL1A 1NSFA 2HUPA 2VK1A 3NUQA 4ZALA 5LQRA 1E0KA 3UJHA 1DRVA 4G6ZA 4OJMX 4HMPA 2ZXFA 3WMWA 1OLXA 3VV2A 4CN9A 2DWCA 5C7LO 2QK4A 4KTVE 3CE9A 3O7MA 1WW3A 4R2MA 1KMMA 4B48A 1O6CA 1D07A 2VDLB 4OHVA 3HCEA 4BMNA 1BKSB 1U31A 1XDBA 2ZJ0A 5EXDA 4OIFA 4YMUA 3DTVA 4X1IB 3T8YA 1NDHA 1ZITA 4K6KA 3IP6A 1F0YA 2IYLD 3WG9A 2WFAA 4GT1A 4DC0A 4QPJC 2XNHA 3KOUA 1Z2AA 2I99A 3MPUA 1CKEA 3DBRA 4RVNA 4Y6SA 5E1MA 5B6JA 3D8RA 2YOFA 1AXEA 5JUWA 4OHFA 3IGFA 3TTTA 4M0KA 1T4CA 1NOIA 4ZO8A 1C5KA 1P7CA 2PAFA 4RZUA 2PH7A 2FSFA 2VPPA 3D2BA 3MYYA 3PNBA 2AW5A 2HF7A 4OXNA 3S5JA 4F5ZA 3K2QA 2VAMA 4L3VA 3QK7A 1IG3A 1R0YA 2CBXA 1CC1S 1OLUB 2GEJA 4HSGA 2GT1A 1UFRA 4WLNA 2W6ZA 3RVKA 3KQYA 3A36A 2G28A 1A1SA 2X15A 3HB0A 1TVKB 5G0UA 4BMDA 1M1XB 1T1IA 3FGZA 3GJRA 4DYHA 4MQ4A 2ATEA 3IUSA 4DIEA 4G5HA 3HP4A 1HDXA 1F9AA 4J8PA 4LNUB 4PHGA 5AKIA 1E1YA 1I1QB 2XOEA 3S2YA 1NN1A 2WE8A 4N4AA 3WK8A 2PN1A 2Q3JA 1S2NA 1X1QA 3NYWA 1UF9A 4ED9A 5BOSA 3CWQA 3FOWA 3D6HA 4R9VA 3IEMA 1AK2A 4BY9E 4POOA 2OG1A 2XR1A 3NCHA 4HDSA 4ZK6A 5IYZB 2BBTA 4RTOA 5LQNA 4PNEA 1W49A 4EDHA 3PXDA 1Q0TA 2IEIA 2C8KA 1A97A 3WI7A 4HS4A 1J2RA 1BFKA 3WQQA 5EQDA 1TYZA 4IMIB 4QQKA 3SU8A 3TZBA 2I78A 4XVCA 1WB9A 4ZHQB 1Y3HA 3L4BC 1E64A 4FFPA 2DERA 2DWUA 3SP1A 3KUDA 2Q2NA 4ZOCA 2GF0A 2J5BA 4B3CA 3DPUA 1QU3A 4JT8A 1QVVA 1GQFA 3M6WA 3QENA 5IK2D 2QD4A 1Y1RA 1R6DA 3KQOA 3OIVA 4TS9A 1DC6A 2BF7A 2PH3A 1Z5VA 2HK9A 3WFZA 5EESA 2JFQA 2NYUA 2ODTX 3FPBA 5AHWA 2G5GX 3UV3A 4G1CA 4GXTA 4CT0A 3U19A 1M0TA 4J7CA 4HP8A 4IKOA 2DFPA 3HKBB 4J4HA 4JQCA 4LCBA 4BX3A 1V9SA 5ALRA 1AHIA 1UT6A 1BCSB 1R3DA 2PRIA 3OZEA 1IBSA 1J8YF 2JIZA 1CRWG 2XTNA 4ZARA 3RAPR 3GUUA 4AY2A 4PY2A 4KGVA 4M83A 3U37A 2XITA 3Q6IA 1P2TA 3WLPA 3LVFO 1C9KA 3TI7A 1J20A 4CN8A 1BOOA 5AK0A 1U3TA 2W2PA 4KLCA 3ZWAA 1RYEA 3CF0A 3HJRA 2HW8A 1MRNA 3FOCA 2XYGA 2DHEA 5C8YF 1V9LA 2F4VB 3QF7A 5TMDA 3RUHA 1KPIA 1FLAA 3KIPA 4C1BA 2FUG6 1TZ2A 1I0ZA 4X8HA 4L07A 4UCWA 2P9FA 3MJ4A 5ETJA 4GR9A 4XSGA 3PJRA 3G85A 1WO8A 4JCCA 4I19A 4M1EA 5KTNA 1EE9A 1G5PA 1T5IA 3QVLA 1LLQA 5AJVB 4QT4A 3FMIA 1NFFA