4IHKA

Crystal structure of the collagen vi alpha3 n5 domain r1061q
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
193
structure length
193
Chain Sequence
b'SGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDQVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagen alpha3(VI)
molecule tags Cell adhesion
source organism Mus musculus
publication title A structure of a collagen VI VWA domain displays N and C termini at opposite sides of the protein
pubmed doi rcsb
total genus 69
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4ihkA00
5KYYB 1AO3A 1CQPA 1Q0PA 2VC2B 4BJ3A 1PD1A 5E6UA 3ZQKA 5LN1A 1SHTX 2VDPB 1MHPA 3NIDB 4IHKA 4O02B 3EGDA 3HI6A 4NEHB 1U0OC 1YVPA 1ZOPA 3EFOA 2NUTA 3EGXB 4IGIA 3EG9B 2M32A 3NIGB 2NUTB 2VDQB 3EFOB 4IXDA 1LFAA 1SQ0A 3QA3E 2VDMB 4CN8A 3EGDB 3K71B 3NIFB 3TXAA 1FNSA 5KYUB 1DGQA 1BHO1 2QTVA 4G1MB 5E6UB 2I6SA 4PN7A 2NVOA 3PPXA 2XWJI 2ADFA 4HQOA 4WK2B 5HJ2A 1RD4A 5KYYA 2XGGA 1XDDA 3TCXB 1AUQA 3K6SB 1T6BY 2NUPA 2VDOB 1RRKA 1CK4A 1M2VB 3BQMB 5KYXA 3ZE2B 3EOBI 3PPWA 4NENB 3V4PB 4M76B 1NA5A 4UM9B 3ZE0B 5E6RA 3K6SA 1V7PC 4HQFA 2VDRB 4UM9D 1MF7A 1M10A 1QCYA 2I6QA 3F78A 1N9ZA 2ICAA 1OAKA 1JEYB 3Q3GE 4CN9A 1ZOOA 2VDLB 3VI3B 2XWBF 4HQNA 2ODPA 4HQKA 1JEQA 2VDNB 3BQNB 4MMZB 3M6FA 4WK4B 1BHQ1 5HDBB 3TW0A 3TVYA 1QC5A 1M1XB 1N3YA 3GXBA 4XW2A 2WINI 3EOAI 1L5GB 3T3PB 3VI4B 5KYWA 5E6SA 3HXOA 3BN3A 1IJBA 2ODQA 3ZE1B 1DZIA 2O7NA 3V4VB 4JDUA 1PT6A 5KYWB 3E2MA 1IDOA 1QC5B 3ZDYB 4A0QA 1M1UA 3EH1A 1ZONA 3FCSB 1MQAA 1YVRA 1PD0A 4UM8B 2IUEA 3K72B 1JEYA 3EH2A 4Z7QB 1TYEB 2WW8A 3ZDZB 3PPVA 4WJKB 5HGJA 1XDGA 4Z7NB 1MQ8B 1MQ9A 4Z7OB 5E6SB 1RS0A 1ATZA 1UEXC 4NENA 1U0NA 1AOXA 4F1KA 2B2XA 4WFQA 4CNBA 4MMXB 1MJNA 3ZDXB 1RTKA 4HQLA 2NUPB 1JEQB 3F74A 3FCUB 5KYNA 4WK0B 1JV2B 1FE8A 4G1EB 1IDN1 1IJKA 3HXQA 3T3MB 1T0PA 5KYUA 3N2NA 5BV8A 4F1JA 2I91A 1XUOA 3PPYA 5E6RB 1JLMA 2X5NA 3RAGA 3IJEB 4C2AA 1M2OA 3EG9A 1SHUX 4FX5A 3EGXA 4C2BA 1PCXA 3IBSA 5KYXB 1U8CB 1M2VA 4MMYB 4DMUB 2VDKB 4C29A 5ES4B
chains in the Genus database with same CATH superfamily
4OGGA 3W2GA 3K0CA 5IN5A 3DGEC 3V7YA 1ACLA 4PLVA 4WY5A 5KJ1A 1MX9A 1ZLXA 3CLVA 4CV2A 5AW6A 1D9XA 1QM5A 4W1RA 3TSOA 5FQNA 2JLUA 1FK8A 4OI0A 4MGIR 5DHAA 1YJBA 1HMPA 2ZM6B 5J63A 1V9LA 2GJ9A 2BHRA 2GN1A 2PR7A 1MAHA 3OQHA 4TL9A 3EGDB 4XM1A 1GR0A 1JZTA 2Q5FA 2QTWB 4IKOA 2C2XA 3ED1A 3LWZA 4EHBA 4CTNA 4CTJA 1H2RS 1RTTA 2VT6A 2FX2A 3C4VA 3QF4B 1PNOA 2HO5A 4IZOA 2W2VA 2CBXA 3L18A 3WGLA 2QE6A 3ZHXA 1JB1A 2PX6A 2VL7A 2I4RA 3CWCA 1IEVA 3TEFA 2PUAA 3A1VA 1U6JA 2F8SA 5EJ4A 2NZWA 4GMFA 2C5GA 2EEZA 4BP8A 3EXAA 1KZ6A 2SHKA 1FDVA 4J1TC 2VH5R 1K1EA 3DL4A 5KSWB 4GR4A 2QRVB 1F8FA 3BXHA 1BMFA 2Q3FA 1GQFA 5JNUA 2CUTA 2L69A 4OLFA 1OF1A 3E81A 3U3RA 1YS4A 3NC4A 2D74A 2IXAA 4QPJC 3U7QA 4TSFD 5B3LA 2I8LA 1ZAYA 5C7IO 4KOAA 1T9ZA 4K6GA 1BU8A 1W4CA 3Q7EA 5EGNA 5H02A 3SGLA 1ENPA 4XQCA 5I48A 2P0AA 2Z9CA 1VL5A 1SA0A 2E85A 3HVIA 4X7PA 3KXKA 3HXOA 2VSQA 3H4MA 3B5JA 4N8SA 5CH8A 2MWMA 2NXNA 3E3LA 5DTIA 2CHEA 1PR5A 1Y8QA 4MCHA 4X7MA 3T8YA 4BN0A 2Z6AA 3RABA 1VP9A 1FX1A 3DOEA 4WBNB 3E7XA 3G7NA 3JRWA 2OXFA 5DJ5A 4U9UA 3M6AA 3CNEA 4ZQFA 5E3IA 5KNCA 4W5NA 5AXBA 4CKYA 4TVSA 3DCNA 4WQMA 2NXCA 4BYMA 1V71A 1F2UA 3GD7A 4TLBA 3KJGA 3RNLA 4B6GA 1SU4A 2YZKA 2G3YA 3BB3A 5ALUA 1DQSA 2C20A 3FSJX 3NASA 4YP5A 5TS2A 1TXGA 2WT9A 3WBJA 3DFFA 2QMEA 2UV8A 3THSA 3ZZ1A 3P5BA 2VBCA 4MA0A 3OY7A 5TGDA 3UJBA 4NENA 3VBEA 5JLAA 4W5OA 4AS1A 2O1XA 2PXCA 1LS1A 1A5ZA 1ISGA 1UM9A 2UZ3A 1XE3A 1XKLA 3HCDA 2B8TA 3WRXC 1NXWA 1MOPA 4V0LA 5E1BA 3IGFA 5EMJA 3LPNA 1OPXA 2OCLA 4KX3A 4BC1A 2VWGA 1RE1A 3PDUA 4FYHA 5C1DA 1WA5A 2WZQA 4MB0A 5HFNA 3X43A 2IBSA 4NKRA 4ZVMA 3ND7A 5HNKA 4PO9A 1USIA 3PUHA 5CM9C 3TFQA 1HT0A 4RTKA 3DBLA 2DY1A 2H5IA 2YXBA 3WWYA 2HLPA 1XMPA 2YVKA 2Z5VA 5PGMA 5TV2A 2C92A 1YTUA 2IV2X 2M98A 3T34A 2R00C 1JQAA 2VDUE 2V7GA 2H5LA 3K1YA 4RGQA 4C2BA 4G4JA 3STVA 1C0IA 2ODEA 3BJZA 2BFPA 4BXOA 1FFCA 2W2OA 3I2HA 2BVNA 3AEQA 4IDOA 1Z6XA 3AERB 2UUPA 3HBJA 1FB5A 4IDFA 4Y9SA 3T1QA 3NONA 3ZCPA 5JO0A 4CLRB 1JQ5A 1EJ6A 1LTHR 2I5PO 2XYGA 4P58A 5K0NA 3M5DA 5JQGF 2W6PA 4FUQA 2OWDA 2Y76A 3CEJA 5LJLA 3K9FC 3ZHSA 3GRUA 3R7LA 3FYUC 3UJ8A 5JCOA 3OLVA 4PQFA 1OREA 3URKA 4PZ9A 1P9LA 5EKXA 1HE1C 1N5OX 3G89A 3GDHA 3ZHZA 4FZ3A 5JPDA 5KTOA 3FYHA 1K9SA 4D3XA 3EC7A 3LYUA 2GJ4A 4OLAA 1RAHA 2FN3A 2P9ZA 2UVQA 4FZVA 4LMPA 2WMNB 1V4NA 3V4ZA 1N75A 4IUCS 4PTZA 1P1JA 1IOZA 4B3FX 1JDTA 4S1PA 1F9AA 1INLA 2O0MA 5IHPA 1U7OA 4TXMA 2BMEA 4DARA 1I3NA 4CI0B 4L8GA 4BX2A 5KTKA 1ARZA 2EAUA 3LUDA 4Q4JB 2H06A 1NN5A 1JEAA 1GG5A 4NONA 1WBJB 3B1YA 4DY4A 2JFNA 1EVKA 4M0DA 3E5NA 5LUAA 2IHTA 3KD3A 3UYLA 1G5PA 3ZQ6A 1MIHA 3RSQA 3T38A 1VC2A 2RHRA 1WPQA 2MJLA 4GGMX 5K0TA 4I4LA 2PU5A 1ZK3A 1EP9A 3PWZA 1EHIA 1BN6A 1G0OA 4DCCA 7ADHA 4PCUA 1MR3F 2FY8A 3OX2A 2VDLB 1BE6A 1QKKA 5HFAA 4MWDA 5A7FA 4HD8A 3SDSA 4CL0A 2H11A 3HRHA 4WKGA 6NULA 3SDBA 4RKRA 4GI2A 2FEXA 4L7VA 5D7NA 5GADl 2D2IA 2MTBA 4IVQA 3AF0A 2Q2VA 4OBBA 5AJZA 1QBGA 4TKVA 5AXAA 3DZDA 1DC6A 1DZIA 2B98A 3LW7A 3SBEA 3VR6A 4BB6A 5CYGA 4ARIA 1Y42X 1H65A 4M1SA 3W3AD 3PQFA 4U2GA 1GP2A 3RVPA 4X66B 1CZHA 1Z17A 5JU6A 2H1IA 2QVYX 1JI0A 1RNLA 1QVZA 1G6OA 3KEQA 3ZZTA 2G88A 4CODB 1HZZC 3IE0A 1TK9A 4MUBA 4QIHA 3RVJA 4KXUA 2G76A 1ZRSA 2VFAA 4MYSA 1J21A 5EHGA 3AF4A 4CTMA 2B7CA 1GZHB 3LL4A 2QM7A 1E8MA 2JCBA 3BHIA 4HKTA 4DJTA 4ZOAA 3JVUA 1ULBA 4TRRA 5FLXA 5A0TA 1W36B 3UUWA 3ZGYA 1Q0SA 5CVEA 3ASUA 3HADA 2Q7XA 1AXGA 4B5KA 1DX9A 2PGXA 1J6UA 4ZQBA 3ILSA 1ZS9A 1Q7CA 3ETDA 3G5LA 1YB2A 2VKTA 5C81A 2JS7A 4YNBA 5DVZA 2IHZA 4PX2A 1VG1A 2BTQA 4INOA 4B3DA 2OORA 1KAHA 2PD4A 1RBQA 2FTKE 3CKMA 3U40A 4MWEA 1TA0A 1L7MA 2VLBA 1BFDA 4HQ0A 3PA6A 3JPWA 1ESZA 2ZQZA 3AM1A 3O2QB 4Q9DA 2DSTA 1JEJA 5F5LA 4L16A 4Q4HA 1E5TA 3BMQA 2ZTHA 3DC7A 3DO6A 1JR3D 3CE9A 2OCPA 1Z88A 2PWBA 2KMLA 3TW8A 4OK3A 1YR9A 2AMYA 3R5KA 1JKMA 1KIMA 2D13A 1EM8A 4RORA 1ZESA 3AESA 4KYTA 3TTWA 1JBQA 2VK2A 3LGXA 4RA6A 4S0ZA 3ZCVA 3VYRB 4DNXA 1V41E 4ZEMA 4BQPA 4QGGA 1U3FA 1U8ZA 2X1MA 1ONNA 2XNHA 3K53A 4OHPA 4V1CB 2IDZA 3K35A 1YONA 2JI7A 4OXIA 3F73A 3NDJA 4CKCB 1K4KA 4IUDS 2JBAB 1IOWA 1TYCA 4KZPA 3EGDA 1AHHA 4LSGA 3PXEA 5DI3A 4YRGA 1P8JA 3TNLA 2D7CA 3VPBA 3TW8B 1AU9A 5HOEA 2P91A 1PWYE 3DXYA 3OTIA 1EX1A 4OFWA 4M36A 4AWBA 2IPMA 1V6AA 3HWRA 1G6Q1 1KMNA 3BRWA 1Y33E 3A28A 1OZAA 1QJCA 1X0VA 2ZCUA 1Y1LA 4LXXA 1EIZA 1KE2A 5EQFA 5FEMA 3LBHA 1S0UA 5TGZA 2PE5A 1CY2A 4I5GA 3CT4A 1ZIYA 3ROFA 1R5JA 3FUWA 4FD3A 1RRFA 3QLUC 4L4ZA 4PYQA 1DKRA 2ODNA 5BRNA 2NU8B 2D1YA 1RHRA 2CNLA 2Y77A 2AZTA 1VL0A 3BDVA 4D0NA 3M1LA 2FMHA 4CF5A 3EOBI 3P97A 1XDWA 2FG7C 1K6MA 4DV6B 2VHYA 3GELA 4KPUA 1KDZA 3ENVA 4ENUA 2QIOA 3GLGB 1RVV1 1JNXX 3FDZA 2PMEA 2ZB2A 2JCGA 2ZUBA 3MPOA 1VZ3A 2QE7A 3MS7A 3MAGA 2WMDA 1KZ4A 3PFKA 3GVXA 1H8ED 4NJOA 3GFTA 2LDXA 2WFMA 4J75A 5A5DA 1RMYA 2ASEA 2VPTA 2ZIUB 4D80A 3QKRA 2ZJAA 3P52A 3K8OE 4RSGA 1GZ3A 1GADO 2QRPA 3JATA 4GHWA 3RS4A 2PV7A 3NVAA 4XCXA 3O8RA 1AUXA 2A92A 3EY4A 4BPRA 2X0IA 2XW6A 3C39A 1JPJA 4CT5A 1JR3A 3M9XA 2XUHA 3AI1A 2ZULA 4EFKA 2ZSIA 4LGYA 3SSNA 1EDDA 1GLVA 2MYNA 2GZHA 5T41A 4ND4A 1E3SA 3A0UA 1Z8NA 1JX6A 1FUUA 2QZ9A 4IDBA 4HB0A 4MS4B 5SY4A 4PHGA 1X87A 2IV7A 3GB9A 3NVKI 3QXHA 4G0ZA 1L7VC 3PC6A 4I46A 4DAOA 1I9CA 1M33A 1ZIPA 1AS2A 2EFHB 2ZDGA 3WRYA 5IT0A 4LYYA 3HKBB 1I4LD 3EZYA 3H9EO 1NVGA 1RZVA 3OJWA 4KKVA 4MGZR 5ALZA 3ZEAA 1H4SA 3FOWA 4GE0A 5I7OA 3U09A 2PL9A 1MV5A 1HDCA 3TX6A 4UBJA 4PYJA 3JY6A 3HFSA 3WNZA 4ZZ3A 3DL0A 3DWIA 3L0CA 3QV2A 4UZEA 4G41A 2IHVA 3B60A 4Z1OA 3GIDA 4KN6A 4E5PA 4Q4CA 5IBRA 2HO4A 2EQAA 4AY5A 3I9MA 5FOQA 3VC7A 3KSZO 3V8QA 4OHZA 4HRXA 1EJBA 1RTKA 2CHUA 4HQLA 3LFUA 4E94A 3K9BA 3DQPA 4JB0A 1Y3IA 2R2AA 4LXUA 4U8GA 1H4QA 4P1ZA 3ZHBA 5KYTA 4XSGA 4BGUA 3CC8A 5BSKA 1V5FA 1WVIA 3OM8A 5DNAA 3GEGA 2JIRA 3FIUA 4JXJA 5F7JA 3FSEA 2B4AA 5JWRA 4WEOA 2YIVX 4H2DA 1K68A 1NFRA 3DDCA 2CXTA 5EXDA 3G6WA 1M6EX 4DMUB 4MP8A 1KK2A 1VJCA 3GL9A 4D0LB 2DHDA 1ZIOA 2GN9A 1UODA 2Z3VA 3D3WB 4IYRA 4KE6A 1ZSNA 1UDXA 2EWWA 4ZDWA 3OHPA 2NW6A 2QTTA 4CLRA 3N3BC 5T3UA 3VBCA 1APBA 5JDIC 5CIYA 3VV2A 3ZHUA 1N6KA 3L8YA 4I9NA 1JEEA 1I3KA 4E2WA 1P61B 3GUYA 3IMCA 1GEEA 4BMNA 5JDIA 1N6IA 2XKJE 4JP3A 5ESDA 4F2DA 1FTWA 1Y4DE 4TS1A 3CRZA 1IY9A 4OYHA 4HMOA 4TOIA 5LYYA 2B30A 2GK7A 3NBYC 3ZZNA 2G1AA 2ECQA 1KFBB 2W2LA 4ALNA 2PVSA 3IIJA 5IDWA 4QBHA 2C00A 2FX5A 2DWUA 3HVUA 1OH7A 1TAUA 4QNRA 3ZY4A 3A9CA 5CD9A 3PNVA 2N0SA 5AW0A 2I3GA 2H5EA 4IOJA 2VTKA 3W7AA 2ZSBA 3GAFA 4X65B 1CNMA 1I32A 4QRDA 1PE0A 1UPAA 4RDHA 1W5EA 1C8BA 2Y1LA 5AKYA 5ICFA 1JXQA 5LIPA 3CPJB 4KQJA 3HCFA 3MYRA 1U31A 4IDAA 4S04A 3EW7A 1Z38A 4Q4HB 4BGVA 1CDOA 1PYOA 4H0NA 4KV7A 4ZWNA 5THKA 4YO7A 1IWPB 3R0XA 4BVJA 4BX9A 2IU6A 1YC5A 1RLOA 5E4FA 1AV7A 1XHFA 1G63A 4HAVA 4B6SA 5F7OA 2CL6X 4IDEA 3TSYA 1F2UB 3TIIA 2D62A 2ODTX 3EDYA 1KAEA 1JDVA 4YR7A 4OOFA 4X64B 1EX7A 3GJ4A 3WLOA 1NZDA 4IIGA 2Z5FA 1TIKA 2C4NA 4CDGA 5L7YA 3I9V6 5C3MA 2H07A 1S8OA 3QTTA 4H6WA 3PICA 4JUFA 4MPDA 1XRLA 1YDMA 3CZ9A 3IA7A 2HBQA 3QELB 2B83A 3VKUA 1P1RA 4F8YA 5KSOA 5L7WA 3GJRA 3HBMA 4QUGA 1Z16A 1DCKA 5C34B 3ZC3A 2C2MA 2QD2A 2O0KA 3EVDA 3UATA 4QM6A 3HFGA 1DEOA 1YS2X 3B53X 1T5OA 1XQVA 4WGGA 3V3TA 4EO9A 3T95A 3KKNA 4NV0A 3MQ4A 3GGPA 3A1EA 3LSTA 1QHSA 1GPDG 3O8OB 3T52A 4I4IA 1N25A 1Y0BA 4WZBE 3RVNA 3X0DA 2VHJA 2ZWMA 3DTVA 4YRQA 3OPQA 3AT1A 3TE6A 4INAA 2JAOA 2VTEA 2ACEA 3VYUB 3PB3A 2ROQA 3L8EA 1T8SA 3AM4A 4BRSA 4DLPA 4OQYA 1A82A 2OWEA 3HGQA 4G86A 3GYGA 4Z9AA 3VC1A 7REQB 2I67A 1AUOA 4Q24A 4URVR 2G5TA 1VIAA 3UAVA 3NWEA 3GVHA 4GL2A 4I50F 1P29A 4EUFA 3ILXA 2IOQA 2X9LA 3ZWBA 3ZU6A 3S44A 2O7QA 1V0JA 2SKEA 3KK0A 3WIVA 1X1AA 2VBGA 2GXSA 2X3FA 3RVOA 2PANA 3UGQA 2E49A 2OP1A 1FYXA 3X1YA 3O7WA 2G4VA 4ALKA 1M74A 1SD5A 4H6VA 5CJ2A 1LA2A 1AM4D 3H42B 1NI4B 1V5WA 4B85A 1KKLA 5IVHA 5GM1A 2GZRA 1GSAA 1V3VA 1GTSA 2WJ4A 2WHQA 1PK7A 3FYSA 2D4AA 2Z8YM 2FHPA 1MX1A 2QUAA 3CLUC 2ZPUA 4PEVA 5IT5A 4JL5A 1OHHA 1DQPA 3RBAA 4Q3NA 4GZ5A 5ICSA 3ST7A 3E27A 2ZTUA 1D4FA 1FLAA 3NXSA 3KKQA 3IR5A 3R7WB 3USZA 3K0AA 2PIDA 4LA4A 1Z22A 1BQ4A 3THXA 4OATA 2I3ZA 3GGCA 1E4EA 1YF3A 3G0HA 1Y3CE 5DGDA 1RKUA 4IJWA 4MW0A 1T8PA 3NC0C 1OLXB 4OP1A 5ALSA 2O7SA 4MQEB 4QUKA 5BSMA 4J0GA 4FYWA 4HATA 2GT1A 4II3A 1JJ7A 3WJ2A 2I2XB 3THYB 2WIAA 3Q9NA 3KUKA 3V9PA 1J25A 5IAAA 4IVNA 3QI2A 4FNMA 3KEGA 5LD2B 1V8FA 4HQOA 4KB5A 1ZSYA 5KVCA 1RRMA 3RTEA 4TYNA 5GVRA 4A8HA 3WK8A 4ACBA 1PF7E 2E82A 1ZCBA 1P80A 2F3RA 5IBPA 5DNDA 1PJZA 3SFZA 1GGVA 1N5JA 4D9EA 1EGMB 4XEUA 1AKVA 3ZNPA 2YCLA 1KK0A 1OXMA 5D6NA 5DLEA 5F78A 3FWPA 1J9ZA 3V80A 5FQOA 4G1UC 4BVKA 1BDBA 1PK9A 1U0GA 3H11B 4HS4A 3QEMA 1R8XA 2O0JA 3OOWA 3B6KA 4N48A 1VP3A 2LIPA 3VR1A 2BJWA 1ZOOA 4S35A 5DGCA 3S29A 3BGDA 2FLWA 2QUHA 1CJSA 3GARA 3B20A 4OMDA 3U39A 3HSYA 1J4AA 3KQPA 3WKBA 4B3JA 2PG3A 3IT1A 3IURA 4EVRA 5FH9A 1O1YA 3R0ZA 1BW9A 2OHVA 1UM9B 3QE2A 5T3YA 1Z12A 3ENZA 2WWHA 4G4IA 4R98A 4RD6A 2WY2D 3KPUA 4A73A 4KR7A 3SQDA 2V98A 3I9LA 4PO3X 3UWDA 2P0EA 2C95A 1O95D 2VJYA 4BJHB 3S8YA 1EFPB 2TMKA 3CNHA 1TKCA 4Z54A 2CMHA 1MPTA 3TIFA 3OA2A 2K2WA 1ISRA 1SURA 1C9EA 1M72A 1N8KA 4CF6A 3UK0A 1N3BA 3DFMA 3N74A 1Z2CA 1VL1A 2IYZA 3FKSA 4IWNA 5CJJA 5B1SA 5K4HA 1WQ4A 1KRHA 4HX5A 3WGNA 2UZ1A 2G0TA 4X8HA 3NHPA 4ZV9A 5I8WA 1O58A 1SC3A 2F67A 1I3LA 1PQYA 5AW8A 2WU8A 4MHTA 1Z0UA 2O2CA 2Q6KA 2D1SA 2B2XA 5CT8A 2A9VA 4EPWA 1AQYA 3EBOA 4URFA 1B0UA 1TQDA 1K6JA 1EE2A 2RGDA 3OD1A 1R8JA 2ZJ6A 3G5UA 4LV8B 2HA0A 2BFDB 5SV2A 5C5DA 3FUTA 3DLBA 1DXHA 2QRQA 4G5FA 4LI3X 2NXWA 2AJ8A 2BKAA 3IEKA 4R2MA 3FCAA 5CVVA 4QXQA 3RWBA 1YL5A 1E9DA 3HJAA 4GVXA 4O29A 1E1MA 4Y0AA 3AUUA 3SC6A 3RRJA 3UW1A 3DT9A 4ZTBA 4E08A 2Q7OE 1JKXA 1P9OA 4Y2XA 5ITWA 3SHFA 5AUNB 1PYDA 5K3DA 4ZFNA 4LJ9A 1NVMB 3UIEA 1KMHA 3VZDA 1DBWA 1NLYA 5G0TA 1BSVA 1X39A 2XMDA 4WJLA 1I10A 5BN1A 4IZ6A 2P4SA 1JLLA 5JBNA 3Q98A 3KJHA 2ONKA 3W8NA 2VTVA 4M0LA 5C1PA 1U8XX 1L7PA 2VF2A 1C7IA 1XU4A 4J2TA 5ETJA 4OFXA 5CD1A 3MTBA 3RC2A 5F2OA 3UMSA 3THXB 4P86A 2PX4A 4F93B 3R7BA 3R6LA 2BN4A 1G20A 1E94E 1XLUA 1J2RA 4C9BA 2TMGA 2BFCB 3ABQB 4KU4A 2GCGA 5CRIA 5F23A 2DLDA 4A1FA 1UFVA 3NHSA 3DMHA 3HCOA 2R1VA 3HGMA 3TSZA 5C32A 2BGNA 1AKEA 5EXXA 3AEQB 4OQ4A 2JVIA 1JF8A 2YJ4A 4YASA 4R2HA 4RKWA 3AUYA 5C7LO 4ZP1A 2VTBB 1HF3A 4BBAA 4MARA 1MBZA 3AF1A 2OOSA 2KI5A 4O3MA 4REQA 1NI4A 1PJ2A 2I71A 1BRTA 3HUUA 3ZVNA 2EKDA 4AMBA 1UWVA 3NHRA 1E0AA 5B3AA 1FJHA 1Z6PA 2V03A 3DV2A 2FW8A 3G85A 3KKOA 4JP8A 4EJ0A 5CFLA 4TWZA 2VT2A 3DBIA 5EJ9A 1YMQA 2VAMA 2GR9A 2ZSEA 3KDAA 4TTSA 3K2EA 4I9GA 3PU6A 4Y2GA 1IHPA 2OBFA 2Q2NA 2P1DA 4QGBA 2PL1A 4Z8XA 5JALA 2VNIA 2XJ9A 1C41A 1WCIB 3A4MA 3F3YA 4JYMA 5HDBB 3X1KA 2BBSA 5IS2A 1R8QA 1Z4NA 3I39X 1F4LA 3WX0A 4C6RA 3UMGA 4CM9A 2WUEA 4BO3A 1P1FA 1U28A 4JLWA 4CM5A 1FMTA 3DZJA 1QO7A 3IDZA 2W8BA 3M1YA 1RQRA 3KYIB 4Q1AA 3ZDYB 2NZ2A 3DHNA 2RH4A 2C0QA 4YT5A 4RQUA 1TQHA 4ZAWA 2ZPTX 2DLNA 1NT4A 4BNFA 1Y1KE 2OC4A 3Q3JB 4RZQA 1P7YA 2AJTA 4U3JA 3PEWA 3BF7A 4PANA 1FTYA 5ER6A 1MFPA 2R68A 1E2KA 3FYCA 5IDXA 1FP4B 1IK6A 3PGXA 5HF5A 4ZK2A 5LSAA 2A1UA 2W83A 3KBOA 3NEAA 3PXBA 3T4XA 2RAUA 4B74A 3WK6A 2AZXA 1UBSB 1LUAA 1T5DX 2HK9A 2IXTA 2WD7B 3RGGA 1GG2A 1UBRS 1J0DA 1PT7A 3I45A 3IP1A 1XJCA 5G4LA 4D3FA 1AZWA 4L73A 4LBZA 1C7FA 3JQDA 5BWOA 3C7DB 1KWGA 2F8MA 3MTDA 3ZDXB 1FCJA 4N54A 4N03A 2IXGA 4QUAA 4BV3A 3D5EA 2B6NA 2WFAA 3FSRA 2GVDC 1LV7A 1G3IA 3TGWA 3PUZA 5BSGA 3AR8A 4LWZA 2VQDA 3RK1A 1G5FA 3B3GA 4LCJA 5IH3A 3B3JA 3FW1A 5K0LA 3H4VA 1Y81A 4HTFA 3OQNA 1HLPA 4FCTA 2I91A 4AZWA 1FRVA 3KQOA 3K0BA 4EA6A 3WMEA 3ZGVA 3PL1A 1NYLA 2HXYA 3GP3A 4E5DA 3K2BA 1OW3B 1EK5A 2YWRA 3DTTA 3OOEA 5AHOA 2Y6VA 3P4YA 3SHOA 1PNRA 1IB0A 3GW8A 3ZIUA 3FN4A 4KXYA 4AJNA 4POOA 2AX4A 3QVGA 1Q0QA 2PSJA 4L4RA 4D57A 2H7XA 5LDDC 3W8RA 3JYLA 3FDXA 4ZAZA 3CV3A 3UJ9A 1QCCA 2PH3A 4IIVA 1YOVA 3GT4A 5EPEA 1WXDA 4AXBA 4YT2A 1EYZA 1NAHA 3HZZA 4X93A 1IJFA 3AKCA 5JIBA 4JYCA 2Q45A 2WJWA 3BFKA 3EG9B 3T7RA 3Q9SA 4W8OA 5AKJA 1PSZA 4IFBA 2FSUA 3DB2A 3UBTA 3PZRA 3MF4A 4A2WA 3T3NA 2FQXA 1JSXA 1QGYA 1XZHA 3PP8A 2ZRMA 1X2BA 4RGBA 4E2YA 4EEKA 4HGZA 3AG5A 2XDQA 4Y18A 4BS9A 3FSGA 2NM0A 1XEFA 4IFIA 5JTUA 2ADFA 3HA3A 3ZCQA 3IBYA 4DA7A 3D4OA 3MUOA 1II8A 3G0IA 4MVCA 2WIFA 4NBUA 3DE2X 1V5EA 5BXYA 2WP0A 3M7IA 2PDAA 2PH7A 3P0HA 2G8NA 1PWEA 2HJSA 2NLOA 3UWKA 3NUGA 4OOEA 5BSHA 1N5IA 2E4WA 3DYVA 3O4HA 3OKFA 4DV3B 1DKOA 5CTAA 2CSUA 2DETA 2ALJA 3HVHA 3OCXA 1WY5A 2VRBA 1J90A 3T99A 4HVTA 2XQJA 1DJNA 3ZWYA 2W2MA 3FMOB 3E9ZA 5B7QA 1JHXA 4L3WA 3K0CC 4HWOA 3D6AA 2ZXFA 3OZDA 3HL4A 1L5KA 1W30A 1COWA 4N9QA 1X7WB 2XIJA 1I7SB 4DCNA 2IYLD 2AI2A 3LXUX 3C3MA 3NNDA 3ZW7A 4L8FA 3H2GA 2Y1GA 3RANA 5FADA 2GXQA 4B6OA 1SZJG 1N0WA 2GRAA 3AONB 1I6MA 1SQ6A 1LD3A 2FR1A 4IICA 4M1WA 3IXQA 4JOBA 3FZYA 4HLNA 4LCBA 4OIMA 5KQPA 2ZUUA 1HZZA 1NMSA 2IIPA 3QJGA 1C0KA 1G8GA 4O4IB 2I76A 3AHIA 3WGJA 4DV7B 4DR7B 2P5YA 4M9SA 2X40A 1V35A 5DIZA 5A3SA 2BFMA 3PXAA 4F3NA 4XDGA 3E2IA 2V96A 3U3OA 1NQAO 1VBMA 2EGUA 3T7TA 1IL0A 1CE8B 2FRVA 3S2GA 1N7IA 4BKQA 4HAWA 2F1IA 3C5CA 4H7EA 2O0LA 2R1TB 2VJOA 4V2UA 3DLHA 1MQ8B 1XQXA 1FQJA 4HDRA 2F8LA 3M4XA 2QMYA 1L9XA 2OY0A 3RYTC 2BUCA 2R96A 5BQPA 3PGA1 4BNKA 1S6YA 4LMRA 2ZROA 2JGMA 4NI5A 3OT1B 1FRZA 4M9QA 1HI9A 4FILA 3BULA 4BMXA 4C87A 2HLDD 1GNTA 4B45A 2Y66A 1CJKC 8ABPA 1RIFA 1NBIA 3IDFA 1Q84A 4C4RA 4CHGA 4RHEA 1AQ6A 3JASA 1EH5A 3A8TA 3CF4G 4KQ9A 5AM0A 4J0EA 2Y1DA 2WAMA 3GOHA 4D9NA 4EITA 4QJ4A 1G20B 1SKMA 3WP0A 4XPIB 4ESVA 3NTOA 4K2HA 4IQ8A 4CMJA 2LPMA 3ETGA 4J1QA 1O94D 2I2CA 2GCNA 1FFSA 3SKYA 1QMPA 3KWLA 4BMVA 2FQ1A 2HRCA 1QJ4A 3FA2A 3NTLA 1DKPA 3U60B 1Q1NA 4ZKDA 3L82B 1W52X 4IXWA 2I3AA 3ZWWA 1GCUA 3D9QX 3SXUB 3WO1A 5IJ0B 1TRHA 1SCDA 1OZHA 2Y0CA 3D6NB 3RJ9A 2JD2A 2HSDA 1IZZA 2PKWA 1ZLYA 1EA7A 1KI6B 2Z9DA 3T3HA 2W4MA 3IH5A 1CEEA 3CW2A 3WYCA 3TS1A 3GLGE 3D1LA 2WIBA 3HDTA 1RYNA 3FNEA 1Z0FA 1XO1A 1V8PA 2WG2A 4GRIA 4JLBA 4EB0A 1OD6A 3BK7A 4U7TB 1LNZA 3CVUA 3LK6A 1DX6A 2D0PB 2FPIB 1YBMA 2NOAA 3CUWA 4GGOA 3CLRC 1GA1A 5ARDA 4DWJA 4LFAB 1SXIA 3G9TA 1QP0A 3UH1A 2H2AA 4PE5B 4M86A 3SAJA 3AY3A 4C04A 5KX5B 3TGLA 3V4RA 1E3DA 4BVFA 1OXUA 2VHCA 4MI6A 4RA6B 1T1SA 1U3VA 1AVTA 4R2WA 1M34E 3REQB 3IVXA 4ZEOA 1Y7TA 2PX5A 2QU8A 2XMQA 3V2UA 5CA1F 3NCTA 2F9LA 1UBEA 5EZSA 2DWPA 5LMZA 4W6QA 2YWGA 1ZCZA 3I23A 4YQYA 3N2EA 3C3DA 4NYJQ 1K8RA 1G3RA 1Z7EA 1E6MA 1XA3A 3WMWA 3UOAB 3TSAA 5HFJA 1Z9BA 1S7GA 1MH9A 1ONBA 3H05A 1ABEA 5A4AA 4R1UA 1E2QA 2WJHA 4OHBA 2O8DB 3OF5A 3ND9A 5P8WA 1G4HA 3DEIA 4XFDA 3OPYI 3F6PA 1U65A 2O50A 2JDID 2Q3JA 4LIPD 4WLFA 2B5WA 4GKAA 4IDCA 1E0JA 2QVZX 3OC6A 4CLOA 3AQIA 2KB0A 3L1HA 4JT8A 1E4YA 4RESA 4C3OB 1IN5A 3EVGA 4HZUB 4DCOA 4ZPJA 1I2CA 1MVLA 4LYFA 4EJSC 3UK2A 4Q34A 3W5DA 4RHFA 4QEKA 2DKNA 2UDPA 1N0UA 2XZTA 1JUDA 3GRKA 3NVDA 1J2EA 1GL6A 1UK9A 2XQKA 2BRUA 621PA 2ZTSA 1VJ0A 3NRJA 4DUGD 1P45A 5DYTA 1I9GA 3BEOA 3ENNA 1YB7A 4GX1A 3U17A 3WHPA 2IUEA 5AW9A 3A1NA 1M8KA 3KOYA 5AKZA 3WP1B 3PK0A 1WCWA 3E3OA 4IHAA 4OYYA 1KP3A 3O1JC 3LDHA 5AUQA 2BMDA 4RWEA 2VAVA 3U3MA 1CVRA 2DTDA 2Q1WA 3CN9A 1VE1A 3FFTA 2QD3A 2YWDA 3GJ7A 4JB2A 2WAXA 1VBKA 3QW2A 5AI4A 3TBKA 1YZLA 4D9FA 1UXKA 3SYMA 4ZZ0A 5CAEA 3KQMA 1QIJA 5AT1A 1A72A 1Z2OX 3VUEA 4Q05A 3UK7A 4I4NA 2NYVA 1C7RA 3TJRA 2PV0A 1E9AA 2O3TA 2QJTA 2K4MA 3QQ5A 3L79A 3V97A 1V43A 2YOHA 1MV8A 3ND5A 4BNVA 3SOZA 3R5FA 3UMRA 1W44A 5H9WA 1PV2A 2LKDA 5HCNA 1GO2A 4F92B 3C6BA 3ZZ0A 2D06A 2IX9A 2QXYA 1N1EA 3QIVA 4ZO7A 1IH8A 1K97A 1OLXA 3JQBC 3PPYA 2GK3A 3E23A 4JS0A 4JYPA 5AJYA 3RAGA 1M2OA 3O2SB 1LK0A 4UM5A 1QNLA 3CXUA 2AF4C 3ODGA 3PHBE 2ZDQA 1NRWA 4P4GA 2H1RA 4NARA 2CLKB 1E5QA 4E46A 5FL7D 4KXLA 1GKUB 5AUPB 2OFWA 1J2TA 1P2TA 3A1WA 1SBTA 4PXAA 4QOGA 1NXSA 1J09A 1VI5A 3SXUA 4KV9A 1U2DC 4B6RA 3FPEA 2AYXA 5LN1A 4FFWA 1BQEA 1RRCA 1MEOA 2CFTA 2XMBA 3D6JA 3ZWOA 4EQ6B 5JSZA 4TTJA 2QY6A 3C2QA 4XH9B 3WQBA 2VHXA 3HSSA 4BFWA 3SQXA 2C4HA 1I3CA 5AK0A 1CRZA 3EZ2A 4DSNA 2HI0A 5GVSA 1I1HA 3MJTA 3SYTA 3JQPA 3NHKA 3TB4A 4RH1A 3AR4A 5SYNA 4LKOA 1I2DA 4ARCA 5LOVF 4YUZA 1N6PA 3FZEA 1YGPA 2C9BA 1NE2A 1WW3A 3HJGA 4TVBA 3VNRA 4G4SP 4V3BA 4D56A 1T4GA 1VG0B 2FA9A 5BW6B 1O97C 3E4CA 4X1KA 2COKA 4QPPA 1NXQA 3RC9A 5KYYA 5D7BA 2V3CC 1EINA 1IAVA 3EZNA 2WF9A 4NXMB 1LJUA 2FZVA 2XITA 1R6DA 2OBLA 4O6VA 4FT2A 1YO6A 1OA0A 2O2JA 2JGRA 3U19A 4MR7A 2GAJA 2C4MA 1OI4A 1OX4B 2O23A 2VHUA 1ZJYA 1E9BA 3ZXIA 3O3NB 3ROQA 2CLHB 3H99A 1C7JA 3I5UA 1MQSA 3GT0A 1KYXA 3PR2B 4EPVA 3IO5A 1A9YA 1GVHA 1W1WA 1E9FA 1Z0ZA 2FWMX 3CX4A 3HY4A 3EBLA 4C3UA 1ZNQO 3OTQA 3DBHA 5DT9A 3O73A 2VHWA 5DXAA 2ZXEA 3QYPA 4FT4A 1U02A 2J6BA 3IHWA 4RYLA 1L8XA 2OM2A 4DCPA 3BF8A 2H8GA 2ZUEA 2WINI 5EIOA 3W1WA 5JI2E 1MO3A 2QRMA 5FA5A 2C4KA 3R0VA 4R5HA 4JY7A 3MT0A 5NULA 1YV9A 5C52B 1LQUA 3DDHA 1IM8A 1PT6A 3GRFA 4XZ3A 1E1RA 1ESMA 1GN9A 1ATIA 2FSVA 5KINB 3F3SA 4TN1A 1WXHA 3P2IA 5MN4A 1PQPA 1SR8A 1S1MA 4LVUA 2AG6A 4J9VA 2SECE 4NFLA 1T8TA 4CM7A 5EIEA 3B12A 5TT0A 5IYZF 5E3HA 4WZAE 4II2A 1Z0JA 1U0LA 2E4YA 2P68A 2CYCA 9GPBA 5I4BA 3KIPA 4TRJA 1ZNZA 1ZM4A 4LV6A 3ZWNA 1EFVA 4DBZA 1XQ6A 2XVXA 5DIFA 2I7DA 3W9UA 1H9CA 1MRNA 4GBJA 2IC5A 5CEEA 4IIJF 3O1LA 3OJLA 1VCIA 2CHFA 4M0PA 5A03A 2BTOA 4QWMA 2I6GA 4A2QA 2W2LD 3REQA 2GEUA 3IDQA 4AP5A 1RM3A 1YCHA 5D8DA 2QDKA 2NYRA 2V7BA 4QUBA 1O03A 3NS7A 3PDCA 4UULA 1JQ3A 2NYAA 2QRLA 2GFQA 3A36A 3FPLA 1IDN1 1Z28A 1L8OA 3ESRA 4X92A 5JYCA 4LJRA 3DUWA 2ZUTA 1RC0A 4Q48A 3NR2A 2EDAA 3VDMA 5JWOA 4P9NA 2Z56A 4KXXA 3KUXA 4MKZA 5G02A 1VKHA 3PXUA 1RKXA 1XQ1A 1QPZA 5CVTA 5I9SA 5K01A 2B25A 1J23A 1HG0A 1YHNA 1W8DA 4W63A 1N1DA 2CBZA 1XCJA 5D3MB 1VRCA 4PS0A 5DSXA 1KI6A 1V8OA 3ZU2A 2OHIA 3P9NA 3NPMA 4M87A 2ZRNA 4XD7A 4C7MA 3DE4X 4Q3BA 1KI2A 2R3SA 5UKDA 3HJTA 3CR7A 3L6CA 2VQ3A 5IJ0A 2PUEA 2VYND 1WW8A 3O8QA 4Q3OA 1NVDA 2KLBA 4MV8A 5E4JA 4RKYA 3TG2A 3T7EA 2R8ZA 1WUIS 3B8HA 1D0IA 1VFPA 1KYYA 1NXOA 3F7TA 3RTDA 1BH2A 4UFPA 1JSRA 4BX8A 3AUJB 5EIBC 5I7FA 2JAQA 2GEBA 3B2EA 3DD1A 4L72A 1OVGA 4QBFA 2OPBA 4WRRA 2B6HA 2YIMA 3B36A 3LUPA 2KS6A 3ZVLA 1BHO1 3JQAD 5ER9A 2Z08A 1LRJA 3RK0A 3USCS 3KXDA 1LY1A 1ZBQA 4XGQA 3GLHA 4XR4A 1O96A 4R8VA 4CKBA 4EG0A 4Y1EA 4H7FA 1KEPA 3CT6A 3VU1A 4LOLA 4C76A 2FWBA 4TTIA 4IUYA 4P3PA 1NUHA 5KHOC 2Q6IA 4QU0A 4O0MA 5CCDA 4BAUA 1GUFA 3UAXA 1Z08A 2XSZD 4AAYA 4AUMA 4JL6A 5JD3A 4KQIA 1XA0A 5JTTA 5KTTA 4OJKA 5L9AA 4ZCQA 2W2PA 4JJZA 2ZYUX 2P9JA 2OCXA 4K3VA 1T26A 4RLHA 3COJA 1T9DA 1X80B 2IYQA 2XODA 5GGXA 2R79A 5C53B 4BV2A 3Q8KA 1ZUNB 1TJ5A 2RHJA 2X9NA 5KNBD 1DJPA 1XYYA 3G59A 3H2HA 2BCJQ 4ZCSA 4R9UC 5IC5A 1N78A 4XGRA 4P3OA 2P6RA 4YJKA 4MCIA 1XZFA 2VJDA 4W82A 1P3DA 1FDOA 2H2WA 3CTPA 3T4EA 1JE0A 2C7RA 3LT1A 4YRDA 4C4ZA 1QTQA 3RYHA 3PE4A 2LDBA 4ERXA 4AB1A 3EF3A 2UUCB 1XNRB 1LDNA 1NLZA 3KHTA 3TTVA 1UP6A 3BTVA 1YIOA 3EWNA 1Z6GA 3NHMA 3IAUA 4HMQA 1YSCA 4OQMA 5J43A 3GJSA 4EG8A 1TK2A 3I28A 2FW9A 2IU4A 3TAXA 2Q3LA 5DXFA 2VUIB 1VMEA 1GL3A 2JL1A 5BXQC 1I4EB 1X8JA 1P7WA 4QDKA 3D3NA 2MSLA 1KL7A 3GLGA 3OTOB 2L42A 2J3HA 1Z6TA 3D8TA 3K0FA 2WKWA 4P54A 2J4CA 3GUZA 5ERYA 3ZDEA 4CQMD 1NVAA 3ZI7A 1Z3CA 1TD1A 3DVLA 3IQFA 1VPWA 1UBMS 2XUIA 1JNYA 4UTZA 1HDOA 1QAQA 3PTAA 3F9RA 2M6RA 2WHRA 4RIIA 2AHRA 5H16A 3SK0A 4PONA 2ZKIA 5D3ZA 2X2PA 1TKAA 1IN7A 2QXTA 4HDKA 4H1WA 1HQDA 1P7CA 1CQJB 2Q21A 2VH1A 1O6FA 1NRXA 2AEFA 4ZRNA 1C9MA 1B1CA 1JZSA 1QTNA 3BL8A 3P32A 4PC3A 1JDBC 1DE0A 3L6BA 4MVJH 3WB1A 1PCXA 1W88B 1P4HA 4JLSA 4LYDA 4I1SA 3WGMA 1QZ3A 2INGX 5JS8A 2JIDA 4P35A 1FDSA 1PFYA 2DP4E 3L0YA 3O4RA 3IP5A 1E96A 4RKFA 4Y2RA 4DRXA 3LXRA 3SI7A 5BPHA 2XBLA 2PSFA 2QPAA 5GM2A 5AVXA 1N0IA 3PDJA 1XZAA 4C3ZA 4UPEA 1XRMA 1JALA 4X97A 2GM3A 4JR2A 2HMUA 2VOJA 2V7XA 4R05A 5AKIA 2F4NA 1XRJA 4R84A 5ESWA 3K9CA 4EELA 5AO9A 4BP9A 4H6PA 4KLZA 4ENRA 4EJMA 1LPAB 2CFIA 3RS5A 9ATCA 2ZRIA 2M32A 4Y6QA 1REQA 4A1OA 5JAHA 1U8AA 1Q7BA 5JY6A 2VDWA 3GGJA 3HUTA 5K3FA 3DE1X 2GN2A 3TR0A 4ZJYA 3A6LA 2KLHA 3E7PA 4JAVC 3WGOA 3N2YA 2SBTA 3LWBA 4C21A 2ZUFA 2Z5LA 2AXPA 4M53A 1FQOA 2FMXA 2EKPA 3CEAA 3RDPA 2RK6A 2XDWA 3NGLA 1UBOS 2R6HA 4FCCA 5D1HA 3C98A 1FU4A 1UOEA 2WE7A 5GQSA 2O2HA 2RAVA 5CT9A 1Z73A 5TARA 3NYRA 4EX7A 4KR3A 3ZE2B 2B8EA 4DT1A 3JZFA 4DMCA 1MJHA 2HMYB 1AKWA 5KJEA 4F6RB 4DR1B 2WABA 1DMSA 5LP1A 1T5TA 2ZCVA 1M10A 4XKJA 3KR9A 1UK6A 4KQKA 4BQRA 2CLDX 1THZA 4KPEC 3BOSA 2LKCA 1XXHA 3SZOA 3SZLA 4I50B 2CXHA 4EHHA 3CW9A 4H0FA 1KEZA 4WD3A 1XJ5A 1AO0A 4E15A 3OIDA 1V5GA 3IV6A 3KTAB 1F4PA 2C2BA 1OBVA 3H5RA 3O9VA 1XPJA 4Q02A 4WK4B 1EFTA 1C80A 1RHMA 1KJNA 1YRAA 2B21A 4QDJA 1DXYA 1LVHA 5E4TA 3WYGA 1FSZA 3ZLTA 1AMNA 4RIEA 2LIVA 1HDRA 1U0BB 3SVZA 1K27A 5F76A 5HVNA 4AI6A 1I36A 4JI7B 4WESA 1JFSA 2YIJA 3AIMA 4MEBA 1IBKB 1X15A 4DMLA 3U49A 1XLWA 4XAQA 1NN1A 5K1ZA 1YIDA 3GQVA 1MOZA 2AEJA 2C5HA 3QVJA 4LZOA 3LLSA 1LJ8A 3IXMA 1EVJA 2CZGA 3F49S 3PEFA 3GVCA 4N18A 4FR0A 1XZEA 2EL7A 5J9FA 4E32A 5HQ3B 5L6LB 1TJ3A 2XHEA 1E1RD 2QY9A 4XIJA 4D46A 1CUUA 4XOIA 3OZCA 3PEVA 1BN7A 2JJ1A 1KYQA 2V7QD 3KEFA 1AKYA 3KKEA 4N12A 4JBXA 3LV8A 4UVIA 3ELYA 4I1YA 2CDAA 4EGJA 5KMGB 3I34X 2VLIA 1XMXA 2QNIA 1ZJZA 4IEIA 4KRXA 3UFBA 2Z2KA 4PLPA 1PI3A 2BAGA 1V7CA 3KZOA 4KRGA 1SXJB 5ED0A 4BCBA 2ZWIA 1Z36A 4FHZA 2PMWB 1RMTA 3E15A 3HVKA 5E2BA 4JJ8A 4UE3S 4YRMA 2X8BA 3QNUA 4HWPA 4ITUA 2M9MA 3B5EA 3ORQA 4IIDA 1F2DA 1RCFA 3KOZA 4CEIB 3AUXA 5CT6A 1E18A 2FSGA 3GFFA 4F46A 2WTXA 2H92A 4JBIA 2R66A 1BIFA 2D2EA 2RGUA 1Z7BA 2YQ5A 3FLBA 2H17A 4QTTB 4ROTA 4RA9B 5CNMA 4HPJB 2EWMA 4KR6A 4G9EA 4N6NA 3M1IA 2XDYA 4ES6A 3N2KB 1NF2A 4IDGA 4LYHA 3NNSA 2QSUA 4YDRA 5HJ7A 3TCXB 4KFUA 4I5IA 5T4FA 1R4MA 2QZZA 1BKDR 4GPD1 1ZMTA 1II8B 4KWEA 4NZMA 5KKNB 4PWZA 1R0XA 3TSWA 3C6KA 1ZVKA 4J0KA 4HBGA 1PR1A 3NYQA 2HT1A 5CM2Z 4ILKA 2P30A 5GOZA 2NXEA 2XBMA 3AH8A 3JD1A 3VVLA 1EWYA 4R0NA 2OLKA 4UEKA 3GPIA 2CUKA 2DFTA 3IPXA 2L18A 4HJRA 4P3YA 3CYFA 3NANA 3O26A 2BMJA 3U56A 2QA5A 1W1IA 4NNOA 2HA3A 2WYVA 3FJYA 1KC1A 3OX4A 4O2AF 1R50A 1CP2A 1I6WA 2HK6A 3OI7A 5HM6A 4JGBA 5AI0A 1OH5A 4Z8YA 1W19A 3C3AA 1R5OA 2ABWA 4G1MB 3COPA 2I6SA 3A6FA 4RKQA 4J03A 4B34A 3PNOA 2FMKA 4NRDA 3N8GA 3ERCA 1FSPA 2B36A 4K9LA 5FD8A 3DEKA 4R8LA 4DFDA 3A1TA 4GLLA 1G6HA 1CJTC 4OXNA 4F56A 1IRXA 1ZC3A 2GPYA 1TO2E 1ZG3A 5KI6A 3ZK7A 2ZLBA 1V3TA 3RUIA 1B1AA 3B9BA 3N05A 3AVYA 1XR3A 2A0KA 1FUIA 3QFCA 3GUHA 1L9KA 4OGKA 2GNOA 1UM8A 1ZYUA 3DAGA 3DTVB 1NYRA 4G0XA 1PZMA 3PT5A 4Q3KA 5GP1A 1RI5A 3JD2A 3MMZA 1H42A 4MXDA 3RKSA 3UCFA 1BHJA 3DB1A 1E69A 3I1JA 5IF3A 4YLGA 4JMLA 2WAOA 2XUAA 4OTZA 1R1DA 2X77A 4IO1A 3BC1A 4CW7A 3F1KA 4TKUA 1P7PA 5LQKA 1LF0A 4H3VA 4L3OA 4EI7A 5JNWA 2BGUA 3GLKA 2I62A 4ZODA 4UNRA 2DR2A 1ENYA 2GDZA 1G5QA 3O94A 4YH1A 1CKEA 5BVGB 1E4OA 3KETA 1TYDE 5AI8A 4ZOLA 3TL3A 2IYVA 3RG8A 1DKNA 4Y1RA 3CQ9A 4D5GA 4DLZA 2C99A 3D4BA 4O2RA 2ONYA 3R23A 4LW8A 5SZHB 1ENZA 1Q1QA 5E7JA 4N41A 4LJYA 3AHFA 1Y5RA 1VCNA 1KBOA 3E03A 3HJCA 5CK5A 4MUMA 2HV8A 5FNVF 3U7QB 4BEWA 2IP1A 4LSMA 4YDQA 5IVPA 1XNQB 2CE7A 1DRUA 1EWVA 3JYOA 1AKQA 4D9JA 4Z7NB 3B9PA 1VHTA 4RY2A 2P9YA 4CM6A 4DKJA 3CLRD 1U0FA 4MQUA 2YFKA 3PV0A 4ZVPA 1YQ9A 4OREX 4H9GA 4D8TA 4WAUA 4BNIA 2GD1O 1DUVG 1MJGM 1ECPA 1GCIA 1W85A 1Z07A 4MV4A 2P62A 3I9NA 2IS6A 1CB0A 3VSAA 1KYVA 1P5HA 4BATA 2Q1YA 4QC2A 1QH9A 3NOXA 1KY5A 4NMMA 5F1KA 1JTFA 1JDBB 1TTHA 4Q3DA 4QAJA 3HWWA 1W5AA 2Y71A 2Y92A 4JKOA 4W4TA 1K75A 1Z6ZA 3ACDA 3LPCA 4WBSA 5THQA 1JU3A 4UBNA 2I1WA 1FXWA 2ZSDA 2IEGA 4DHWA 1L7BA 1XA4A 4NH0A 1P1HA 5BT8A 3AETA 4E70A 4UDYX 4FFPA 3R7WA 3GH1A 3EQ2A 5G4KA 4Y9DA 1GAWA 4YRFA 4EJ6A 1YU9A 1UKEA 3GCGA 2GD0A 3TZCA 1EJ2A 3D02A 1Z7YA 3H5AA 3KO8A 5TQ2A 1CBUA 2LCQA 2XZOA 2HPVA 2HB6A 1PQWA 1Z26A 2IZZA 4LC9A 4NEHB 1DOZA 4OB7A 3JAWA 2EEPA 1QIHA 3D6TB 2A0YA 1EXNA 4AN4A 3RARA 3UK1A 3IAS1 3PXXA 4E33A 3DKRA 5FOSA 2GO7A 3E1KA 1X7ZB 3RUDA 2FFJA 4A0FA 3ED5A 2QLJA 1J0CA 5YASA 3N58A 4RV9A 3WLIA 4EG7A 3Q8WA 4FOOA 1U7XA 3KU4A 5CMLA 3M6WA 4UQLA 3H2KA 4H17A 4CJXA 3P71T 4LHWA 4PZ0A 1MORA 2QR3A 1QIDA 1BU5A 2WA2A 4PVCA 1VJDA 1KQ3A 3LF1A 4W5JA 5EXEA 4A0GA 4DA9A 2LXNA 4EG4A 3QPWA 1CUSA 4EF5A 1J2JA 1AK1A 4G65A 4YAIA 3AVPA 3EASA 4U2FA 3RVKA 3RS2A 1XBTA 4DUGA 1EFRD 1IZ0A 1G5HA 1T13A 1WCV1 2R1TA 4HWGA 5E2IA 4BBZA 4F3CA 5CLFA 1KBZA 5LZ7A 1RFLA 1L6RA 4ABYA 2QTRA 2UVPB 3T1OA 2ENUA 4DUYB 3U4QA 1OE0A 2A94A 4D4JA 1M6WA 4DM4A 3DPSA 3EXFB 1II0A 4KNYA 4MIYA 4MTCA 5AK5A 1FZQA 4ZA2A 5T4HA 3I4LA 3GJQA 2BM9A 3U1BA 2JGNA 4BQOA 1M1NB 3BREA 4G8DA 3GUUA 1GRQA 2GVNA 1LPNA 1VHDA 3H97A 2PKEA 3PFNA 2E2WA 3UFXB 2FEMA 5CDUA 2KQUA 5CEJA 5A5GA 2A3RA 3FUCA 4HN4B 1Q0LA 3DMYA 1YI0A 3N3AC 4PAMA 3EH1A 4EFDA 2AD5A 3UQYS 1X7WA 1XFAA 1CUIA 1A9OA 4RJ2A 3TZHA 1FSGA 1Q77A 2IYRA 2TYSB 3IAHA 3MMXA 3ZJYA 4DMRA 3SE7A 3J80A 3H16A 3SBXA 1PD0A 4Q00A 1RM4A 1JLKA 3JQ9C 1S2IA 1XTIA 3D6UA 3PRKE 4J43A 1QKIA 1UDWA 5E1DA 5E8RA 1UXHA 3UB3A 1KK1A 1QYDA 3AM5A 2NVUA 3GD5A 1U0RA 1UQUA 3V1NA 2WF8A 3KR0A 3RBZA 2ATEA 3EZLA 4X61A 2P2YA 4RTRA 1USWA 1QVVA 2XOXA 1XJ0A 1WY7A 3CY6A 3ZR4B 2CC2A 2W6CX 4HFJA 3L84A 4X00A 2UU9B 4FMCB 1P2SA 1CS0B 2NTEA 4LN1A 1KZ1A 3KKMA 4UTRA 1VXOA 2WYWA 1J7JA 4HSEA 2DUNA 5E95A 2JVJA 3UAOA 2XHZA 1I13A 1C8VB 3R77A 1D2MA 2ISSD 3A6DA 2XB4A 4G89A 2CCKA 4XR9A 4Q66C 4RCYA 4UTNA 1NXPA 4L5AA 3VHQA 4AWXA 1M0EA 5F12A 1FU8A 1ZINA 4LGVA 3TLXA 3EMKA 3X2FA 3MS4A 2ZI3A 4GXRA 4TZKA 1NGSA 4MV5A 1L4LA 2ILVA 3KCNA 4UNQA 1B41A 3ZGLA 2I6TA 1YK0A 2JI4A 5JARA 3K6SA 3KVYA 4P98A 4DG5A 2YKGA 4TT3D 2BGLA 3I6MA 2JFGA 1C3VA 5LQRA 4G5XA 5G2OA 1V6SA 4HZIA 3NHAA 5E9AA 2A78A 1C3OA 4KIJA 3KQSA 3LBIA 3FETA 3O75A 3LLMA 1T3LA 4Y7DA 5EWLB 4A6PA 2I9PA 1WDLA 4XVCA 5A4KA 3EFOA 4RZSA 4B48A 3QWHA 4V02A 2PT6A 4IGKA 1N57A 2EHJA 4LS3A 1Y7HA 4MHOA 2D5IA 4PBRA 2P9QA 3H9BA 4P2BA 5JW6A 4Y8VA 4LF4B 1FYVA 1TKRA 4R3WA 1WKCA 5FL7A 2H59A 3V33A 1D2RA 4DJEC 3INGA 2FR8C 2A59A 2F64A 2PVCA 1KZ7B 1S2OA 3HKDB 3ICEA 2AFIB 4KN8A 4CCYB 3AFGA 3NFRA 4UQOA 2CYAA 1K89A 4N49A 1K6EA 1HL7A 4DQ0A 1X70A 1QK3A 4W8GA 2MSWA 4RFSB 4RXUA 2YHAA 4H1VA 5LC1A 4ETNA 4PPGA 5WRFA 1PG0A 4P0TA 1IY8A 3DNMA 3K2QA 3SC4A 3IJRA 2Q62A 3WLNA 2GJ8A 4WGFA 1VL6A 4ZVRA 1FRQA 2E5WA 3QIAA 3QW4B 2O59A 1FYWA 4B8WA 1HH4A 2N75A 2YDYA 1K5GA 5EIWA 3G0DA 5LBUA 4BRZA 2WR8A 3K05A 3QI7A 1SHLA 1T3TA 2A5GA 3DEFA 5FBRB 1ULZA 4JI3B 2H9AA 4DRYA 2X2OA 2JIZA 3EOZA 7REQA 1KYIA 4AZ0B 1K3UB 3DZHA 1NQOA 3UJ7A 2HCJB 1FBTA 1NN0A 3C1AA 3DEAA 4AY3A 4ENWA 1X1SA 4X24A 1KE1A 2NVUB 3G79A 4KSBA 3P0IA 2YXDA 2X76A 4U9IS 3PUKA 4UNSA 4OXXA 1DC7A 1Q22A 2V5VA 1Y8AA 1C3LA 4HH4A 4W9RA 4WXHA 3RO7A 1I4OA 2F1OA 3H5LA 4L5CA 1N8NA 4D7AA 3OLQA 2GFHA 1NJ6A 2JFPA 2X7JA 4Q12A 3WNBA 2X15A 3TQRA 1OX5A 1IC6A 3RJTA 3I61A 2HA4A 1TTPB 3BTSA 3NALA 4LXTA 2PXXA 3FWNA 4IIYA 3TZBA 3LOPA 4UCFA 2VWPA 2XDAA 4BO9A 3PQ7A 5IWCA 4GLFA 1DAKA 1FW6A 1MJNA 3SJAA 1JA1A 4R9RA 1WOYA 2UYGA 3EK2A 4BMOB 5B57C 3UOWA 1E1NA 4TKZA 1T3GA 1UEIA 4P7FA 2IF0A 3L0DA 1SUWA 5LD2C 1P6QA 2QL5A 4F9GA 1YI1A 3BIXA 4OBXA 2G09A 3HVRA 2XUFA 2PKRA 4WFKA 2XQGA 3FZQA 2GTPA 2CDNA 2PL3A 2VJBA 1M8FA 1A27A 1Z8DA 2X86A 4GPZA 4IFEA 4IRMA 2JB9A 3GCDA 3G2HA 4MQFB 2QBYA 1LCIA 4F1KA 3BS4A 2RJ3A 3MEQA 3U81A 3T1NA 3L9WA 3VPDA 2JH3A 3BORA 2IVZA 4MQ6A 1MC8A 1YAHA 1ZH2A 3F7MA 4FIDA 1R3DA 3SZRA 3IDAA 3TRFA 5B1DA 4M60A 5DM70 4JIMA 1DTWB 1ZRHA 4TV9B 1HWYA 4WK6A 3OFSA 4D4LA 2X6TA 3JQAB 2DT8A 3S7TA 3ZGOA 5B7NA 1SUSA 2ZEJA 3OJCA 4I1OA 3DHYA 4URUR 1Y6RA 4PLYA 1UDRA 2BFEB 1CR4A 3X1ZA 5ED4A 1QIFA 4MVJE 2OBXA 3ROXA 4UXIA 4YI5A 1U5CA 1NVVQ 3PUWA 4ZHSA 1Y6ZA 2H0QA 3H18A 3QBVA 4BWFB 3PSAA 4Q6BA 1JKJA 1HNWB 1JAYA 4X1IA 5G4KB 3UWPA 3VH1A 7ABPA 1X77A 2ZVQX 3EC2A 3L8HA 3M9LA 4LSWA 4LZLA 3VRHA 4EZBA 4XYLA 4HNTA 1L4GA 3A31A 2XX3A 4L50A 2OHFA 3DFUA 3UMJA 3WLRA 3HA5A 1VXRA 3K70D 5GMOA 1OYWA 2IKSA 2BEWB 4E5NA 2I66A 2YWHA 2IU0A 3MTQA 3WKDA 4AF8A 1XN1A 3OQVA 4BTLA 5B30A 1WSDA 4B3IA 3F6EX 1MNQA 2QN3A 3M4NA 1R5NA 4PSUA 4MZXA 4RLFA 1VSBA 2FRDC 3EIOA 4H7DA 4B7XA 3QE9Y 2XEXA 4A26A 2ZSHA 1I7PA 3CLUD 4IV0A 2F9MA 2FPSA 1UANA 1MA0A 2GHQA 4RTPA 5I8PA 2P3OA 2CLMB 1Z4IA 5SYAA 3L40A 4HL6A 1HL3A 1PR6A 1Z63A 4GI1A 5LIRA 4FUTA 5HOQA 1Y5NA 4PNZA 1Y7PA 1JDJA 2AWNA 1PS0A 3D3JA 3PG5A 4NH4A 3ZE8A 4WHMA 5AW2A 4DUZB 1RM0A 4PZEA 4BFXA 2NMVA 3OX3A 4CETA 4RCZA 1RWNA 1S5PA 5B3JA 5LMNB 1NDHA 1ZN7A 1NIJA 1T0BA 2A6PA 3KLOA 4U6QA 4BLVA 2Q99A 3BL6A 1FJGB 2QP9X 1BJKA 1Z8FA 4R0VA 4B3RB 5B2EA 4R1TA 3RB8A 1H1TA 4PRZA 3F1LA 1RSZA 4IGAA 2H3EA 2QAGC 4B7ZA 4HV4A 1GHTA 3AI3A 2VZ8A 1MG0A 2NSJA 2TMDA 1T1GA 2C84A 3GN1A 1KZ9A 1Z5OA 3LT2A 3H5TA 3F7NA 3FNIA 1M1YE 4OSEA 2P4QA 2HK7A 3NH9A 2ZJOA 1RJDA 2FJUA 3C8HA 3DVSX 5D5PA 2REQB 2ZVDA 3THOA 4CF3A 1EDOA 4LRQA 5FLYA 4NZ9A 3CVWA 4Z4CA 1EU1A 2H4YA 2C59A 4FGUA 1A1SA 4Y2UA 4HNAA 2HGZA 5DX1A 3IXLA 3SHTA 4NBWA 3MINA 1UKBA 1EDZA 2YXPX 2DQSA 3OE4A 1JJVA 1GPBA 1QX4A 3MJSA 4DZZA 3HR7A 2IYSA 3A32A 1I5EA 4TLDA 1VHWA 4W8HA 3TIGA 4O59O 1HG1A 1HKHA 1XCMA 1UMBB 1EZ1A 1PWZA 2A1TR 3G49A 1F3LA 4KMMA 4RVCA 3TQQA 1K6XA 4F4UA 2JGLA 3KV1A 3HUEA 4S1NA 1C7QA 4ETMA 5B4TA 2FF7A 5HIKA 4UUBA 4DV0B 3TG8A 1OB5A 2YNMC 4L4XA 1G18A 4ARZB 1JHZA 1F2TA 2XZPA 5HQTA 1C7ZA 2DFLA 4W6ZA 3JVIA 2C8LA 1UMCB 1QCZA 3D0OA 1Z34A 3JVEA 1XWWA 3OEWA 4TMFA 1TTQB 4M1QA 3I1YA 2QLTA 3H17A 1A2OA 2CJFA 1JILA 2VIIA 2WKPA 5HILA 5KNBH 2WSIA 4BVBA 2P2ZA 3RJZA 2PRYA 1VSVA 3ZHVA 5K03A 1DC4A 2GTIA 5K4AA 5TS3A 3RF7A 5FBHA 2B61A 3CIFA 2EW1A 2RBGA 3C6XA 1EVQA 4K9MA 2AFHB 1A2QA 4HXEB 4CKCA 4UTOA 2CNDA 1UXJA 1P0FA 3CUEF 2BCGY 1U9IC 1RU3A 4YDHB 2GPTA 1M76A 4GW3A 1E6WA 3OFNA 4XX0A 4CKZA 5I5EA 4I55B 5TNXA 1TQ4A 2WU1A 1MO4A 1DINA 1W0JD 4ZRMA 3RADC 3L4SO 4OJQA 1KJ8A 4MGEA 2ID8A 3G8BA 1FNNA 4FHGA 5TF0A 3DDZX 1RXUA 4ZYVA 1W59A 4MQBA 3ADDA 4IXMA 3LI2A 1GITA 3JQRA 2NZXA 3HC7A 4RABA 4YC7A 1ZA1A 3JQCA 1QP8A 3A11A 4PC6A 3WMXA 3C3WA 3OZBA 1WB4A 1RRKA 1RJGA 2JIOA 4MRVA 5L3QB 1VPDA 4DCVA 2ZE6A 5IKOA 2JRCA 5EXSA 4DG9A 2OESA 2WWTA 2D1FA 5TR9A 3CUYA 4C78A 1QRSA 3O0DA 3HP4A 5CNIA 3DKIA 4GXTA 4NK5A 2OFFA 3TQFA 3PGLA 2IXDA 1IN4A 2J6IA 2YMPA 3R4VA 4L8VA 3WADA 3WVNA 4AYXA 1O6CA 2NUBA 4PTLA 5ALWA 3T06B 3BFPA 5CIQA 3O8NA 3UTCA 1AHIA 2C4UA 1AQUA 4MVJD 5GZ1A 2GLTA 4L95C 3TNDA 2WJGA 4ZV7A 5BSTA 3K0SA 4NK4A 3SC3A 1E2JA 2LP4Y 2QPTA 4B83A 3TLMA 3ZVKA 1A5BB 4M0KA 5TMDA 2H1OA 4JGGA 2K7ZA 3RC8A 5EWMA 1O9HA 2LCFA 3JYQA 3PC8A 3R09A 3Q7RA 4R51A 4BKMA 2QTFA 5A9SB 5GINE 1P5FA 2VJAA 1WKBA 3LGSA 4J7XA 3MIZA 4E1BA 1VRVA 1WLYA 3A04A 3M89A 3O4FA 4MCAA 4UKDA 2NT3A 3KYDB 3LL7A 4MR8B 1Q7TA 4UVDA 2H1VA 4NFHA 2R47A 4O33A 1E2MA 4QVKA 4KO4S 4WA8A 4CM8A 1DHTA 4P0QB 4YS6A 4A10A 2WYUA 1BWSA 1PFKA 2BHTA 4PRYA 2AG1A 3LQFA 4LOHA 1Z33A 3UJDA 5LUBA 3I09A 1F3OA 3QU2A 4N47A 2ZYRA 3W3AH 3NWBA 3RIHA 4ENPA 1WAMA 5KB3A 1Z74A 2WJVA 5BV0A 5JO9A 1B0ZA 4ZREA 4A2CA 2XT0A 4BQQA 3HY3A 3CXRA 3IESA 1IQUA 5ESXA 2FOLA 2YJZA 3SYLA 4DSOA 3ELUA 1GPYA 1QRRA 4PG7A 3UCXA 1HPLA 1VGRA 5CAEB 4B35A 1WUTA 4EKNB 3TEJA 3ZLJA 1CUJA 2JI8A 2RONA 1LPSA 1Q3KA 1ADBA 1R00A 1SD2A 3QOYA 4UNIA 4WNAA 2F48A 2DWCA 4DKXA 1OQAA 1A2BA 4TRMA 3CRRA 1T2DA 2CFSA 1XPOA 5JFOA 1XXHB 3BM5A 3PCXA 4C30A 4W5QA 2JFYA 5CLJA 1YR3A 2ZYDA 3OZAA 1I2ZA 2QTGA 2XYQA 5KPJA 3I9FA 4TS9A 9ABPA 3P9YA 5DMXA 3OIVA 3EEBA 3OESA 1OHHD 4Q4JA 4B73A 1JL3A 1R4NA 1XF9A 4MDYA 1O2DA 3GLFB 1LC0A 5ES4B 1NW3A 3DBVO 3NBZC 5BMVB 3LQ1A 5JQGA 4K81B 3RBXA 3RYFB 4P4SA 2HNKA 4BKRA 4BV9A 3FYUA 3TI9A 3V7WA 5A6SA 3I5XA 3QVOA 1Q6ZA 1OB2A 1GR1A 3H9CA 4M1MA 1EBFA 3LYAA 3ESAA 4KGVA 3WGKA 3WNDA 2HPAA 4NG4A 3KQUA 1SM4A 1P39A 1DEXA 5DYWA 2AVNA 2P35A 5DNCA 1PLJA 4F4FA 1AN9A 1Z62A 1QXSA 2CWWA 2XTNA 4YCCA 1RQXA 2FZWA 3MXOA 5CT4A 1FNSA 2Q4DA 2QTMA 1HT3A 2P4HX 2GZAA 1USVA 3MRSA 4K1LA 3CEHA 3NEYA 3R3ZA 4TM8A 4WZBB 4MR9B 3RRNA 2DPGA 2LW7A 2PX3A 4OB6A 4LZPA 4FLMA 1GYPA 4YYZA 2QTLA 3OZEA 4W9MC 3DTVD 1T6BY 3WSTA 3CZMA 2FF5A 4C06A 3QLTA 2G5GX 1LK7A 1FA9A 2C9ZA 3DNFA 3TINA 3W1EA 1P9RA 2BZSA 2G70A 2FSFA 1L5VA 1HEIA 1FP1D 3DT8A 3ZU3A 1OOEA 2V7VA 4C7VA 5ADVA 5TGTA 1CUVA 3RV3A 1OXXK 4C3VA 4ZYUA 4WFJA 1NVFA 3FVWA 3UO8B 5LMCA 3K8QA 2CXSA 3CUUA 4DLYA 1YZKA 1G6KA 2C9MA 2GILA 5FDFA 5JQWA 4DJDC 4D0SA 2VK1A 2NU7B 4GP7A 4MVJM 1CRPA 4BEVA 1S7CA 4PYNA 1QQTA 2AKEA 2EF0A 2X1LA 2G6BA 5EE3A 3ISVA 1PZNA 1C3XA 5AR1A 1GCGA 4JVOA 2C9DA 4AKIA 4XQ9A 2AXNA 1C14A 1ECCA 2IYUA 1KS9A 4DYDA 3FFWA 3R9WA 4FDVA 1GAXA 3V4VB 3TMYA 3OZXA 1V4BA 1BA2A 3DA8A 1B8UA 3R3WA 4I2VA 1RYMA 4HZUA 5ALEA 1W2WB 2EXXA 3RC7A 2EZ9A 1ZVMA 3GJ6A 4CLOB 1KHTA 1N2IA 2WZBA 1SWWA 4GQIA 5JMPA 2FFHA 1W47A 2FETA 1GPMA 4QJIA 1O0CA 1G8KA 3C7KA 4NVRA 4C4PA 5DISB 4X94A 5CW1A 4HPXB 4TS3A 3D0RA 2O2SA 4WDQA 3TKAA 2ZW9A 1XTUA 3EY9A 3V32A 2DXIA 4ABTA 2AKAB 3MA0A 2C07A 3FDIA 4K6OA 1CRQA 1CU1A 3TZ6A 4P2GA 2QUZA 4DW8A 4ZCIA 1ZD3A 1UDBA 4AY2A 2X58A 5H1YA 3JPYA 2LTAA 3P9RA 1I6LA 3PJEA 4KTTE 4M1ZA 5FNVB 1W4BA 3UT0A 5IXJA 2ZBRA 3KPJA 4BQNA 4E4YA 4KO3S 2WHEA 2EQBA 5K2OA 5C1BA 2P7HA 4CDNA 1KAOA 1FX0A 2Q5HA 3FRJA 4IOMA 4CGYA 4KQGA 4C6TB 2P9EA 4ISCA 3U4QB 3C87A 2H7YA 5HW0A 3HXQA 4MRSA 4PAWA 1YB6A 4BFSA 2WHPA 4MGYR 1AZLA 2FVYA 2YWJA 5HQJA 1N3IA 2ZR0A 2R4QA 4X6LA 5HP4A 4LPSA 2QMZA 5BSWA 2R1ZA 2OYRA 2JAXA 4KSYA 4CGZA 3OQJA 1GKYA 4Q18A 1DLIA 4HB4A 8LDHA 1YZTA 2Y05A 3HEMA 3NATA 4MVJP 4TTTS 3TZQA 4BNHA 1W0JA 821PA 1O08A 3HRKA 4OSOA 4BJ3A 4BVLA 4LY0A 4BWVA 1NY5A 2PBRA 3IILA 2NUAB 5C5CA 4DXAA 4E5KA 4L15A 1B0PA 2XRFA 2FSVC 2QN1A 1MHPA 3W6UA 1GZ6A 3CRQA 2BJHA 3K16A 4JXKA 4XD7D 4M4SA 1WOMA 5HUJA 4E03A 1X7ZA 3QMWA 3DMNA 3MCVA 4S1WA 1XTSA 4DDKA 1U8YA 3DCJA 4O2AB 1HYGA 4OAQA 4BRWA 3N6RA 4F3YA 4CF4A 5IVKA 4HUJA 1BKSB 1DBSA 3GAMA 4NU6A 3A4TA 3C7AA 4OHXA 4W1PA 2WJIA 3HMKA 3EN0A 2E4XA 4HDKB 4RK7A 5AJTA 3SX0A 5JD5A 1BWRA 5IAEA 4BJ5A 2NUAA 5LZ5A 3QNWA 2XUGA 3OE7A 1SUCA 4L28A 5EP3A 3AP2A 3NZEA 4FFOA 2JFUA 4BIIA 5CB4A 2OQRA 4Q1CA 2X5JO 3IODA 3QH4A 5KWVA 3IRUA 1U8EA 2C1EA 2MU1A 2R97A 1DAIA 2C7GA 3OMXA 2Q27A 1KXZA 4C14A 4MW6A 3I0ZA 4NYIQ 3DR5A 1RRPA 4KAXA 2BH9A 4LY9A 4AROA 4D9KA 1FFGA 2I3BA 1UJBA 2X23A 3BE6A 4MA5A 1DUSA 3CLTC 5BPFA 1V7PC 4LF9B 3WL4A 1FUEA 1QMGA 2O20A 3ILHA 3RU3A 5CA0B 5CFPA 2GPWA 3FB1A 4OQNA 4XE5A 4HVLA 2JLXA 4GRAA 4LYGA 2DYKA 3PQ6A 2QSYA 2DUJA 4JT9A 4RD0A 4RGYA 2Q6TA 1NW5A 1T25A 3LY7A 3UOGA 1SCKA 2BH2A 5EIHA 1K2WA 4RY0A 2ZI7A 4P7KA 4DSAA 2GSDA 4BQIA 1Y3HA 1Z4OA 1JR4A 3SQWA 3O47A 3NX4A 1U1IA 3ROKA 4A27A 1P81A 1AUVA 3FMGA 3HDVA 1SC6A 4LYEA 2OGSA 2VYVD 1ZH8A 3FGNA 2HIGA 3BERA 4EUNA 5C8YF 1G38A 2H9IA 3HCPA 4L9WA 1DTEA 1RJFA 1YS1X 1CZLA 1CQIA 1U7TA 5TRTA 5JMTA 1LI7A 4RZUA 4K5QA 4JSTA 1KDTA 1I0ZA 3PC4A 5GJCA 1OU4A 4OHMA 3TDMA 4KGZA 1O8CA 2VSOA 4IILA 4O4JF 1M83A 4U0KA 4PNHA 4CWAA 2FQYA 2GAOA 4KYUA 3NHWA 1T3HA 4TZ0A 2ZRHA 2I1VB 1P9NA 4M0UA 5CXXA 2PTHA 4JC0A 3MJHA 1JEDA 3SQNA 4PF1A 1QVAA 4DC0A 4ETWA 3BTUA 1WU8A 1PR4A 3KL4A 5GV7A 1IB6A 3EPKA 4UEOA 1JA0A 1EG7A 1JXOA 2OORC 3H1EA 3P20A 3SDZA 4CVNA 4RIFA 4EMUA 3ZY3A 1TLTA 4DJFC 4J7UA 4OB8A 4YAOA 5FUQA 1QO9A 4CKBB 1QDLB 5KX5F 1KPGA 4MWTA 1NUAA 4XEHA 1XKQA 1KORA 3EJWA 1Q0HA 1E9EA 3E9DA 2IOYA 3NORA 4NJMA 4RBNA 4X3PA 4C05A 3VO9A 3I1IA 4Z7QB 5IN4A 4ND1A 2FQWA 2IKQA 3H04A 3ZNQA 3UF0A 4ZKEA 4TL6A 4F71A 4KQEA 1WZEA 1D04A 4L22A 5A6VA 1WMEA 1UFKA 1J06A 1QG4A 2FLVA 3FFXA 4RTNA 3S2UA 1S02A 1V2GA 4B8YA 3UJNA 1N5DA 3K09A 2LGJA 2GQ0A 3SXPA 3R40A 5KWIA 3BMOB 1SVUA 4C29A 4QXRA 5DHRA 1GQOA 2CJWA 2C3OA 2J4FA 2QVGA 4PLFA 4UUNA 1RE0A 4YA6A 4XRGA 2DULA 5KYYB 2SKDA 3ZCUA 4C7KA 4WZBA 1R0SA 2Q1XA 1FSFA 4JNKA 3O21A 1RWPA 4UZSA 3FMVA 4IF6A 1XL1A 3PFGA 5B3KA 4FGSA 2VJMB 3FVRA 1OC4A 1YCDA 3K5IA 1JA9A 3NYWA 1FLVA 4O8CA 4TLMB 1E8NA 1DO0A 1BYIA 3EIUA 4CMEA 2WKRA 4CL2A 3GGGA 1NMEA 2D0OB 3IQDB 1HSZA 2N1BA 4H4DA 1XDBA 4YBZA 4PWYA 2HWKA 3KZCA 4JOSA 3B1JA 1TW2A 5CGQB 4EQ6A 5JSZB 1YRQA 3AWDA 4CIYA 2HF9A 2VNKA 1H3FA 5I7HA 4X71A 3ZBPA 1C29B 1PEAA 2BL4A 4HEA6 4A23A 5HKKD 1NRJB 5I7RA 2C8VA 5KNDA 5MN6A 5AFSA 5CNKA 2PZKA 3B70A 2X8AA 3DPUA 5C9ZA 1TA4A 3AZPA 4PYOA 3I37X 1PAUA 3GZJA 3TOZA 2P3QA 1SU7A 2GMWA 1FFBA 3I6BA 1PZFA 3RUCA 4HQFA 2P65A 1A96A 3B13B 1U98A 5COQA 2FKAA 3GZTB 1T91A 3UPDA 3G0OA 3OKPA 2OXRA 2DCMA 4C4OA 5C8ZA 4EHAA 2GK4A 5AK6A 1T2FA 2N42A 5FP0A 2Q7DA 2H2IA 1X8LA 2FSHA 2HFKA 1M5UA 2Y0DA 3BXEA 3D8BA 3L43A 2FP4B 3PYLA 2RGAA 2P9GA 4L08A 4TQUS 5BV1A 2E5LB 3AK4A 3T3PB 4LDJA 1G1AA 3L06A 1SUBA 3AKEA 5I7EA 1YZUA 4NBKA 2OCBA 5BURA 5JNRA 4RZIA 1PR9A 2W93A 3UMCA 2QTAA 3QZUA 3ZLVA 4D3ZA 1JG2A 2ZI6A 3KV3O 1CEXA 2Q4BA 4F7WA 4KLAA 3UPUA 2BGWA 1SH7A 3EGIA 3PQDA 4GM0A 2Z1MA 3LAWA 5IJ9B 2WFLB 3DNPA 3IDSA 3GO4A 3ELDA 4P7JA 1JQKA 1WUYA 3FSGD 5EE0A 2QHXA 1LZKA 1P6XA 1KYZA 3F9CA 3NC1C 4Z2YA 1TLLA 3AOEA 3HDJA 4GWLA 3VMMA 1W25A 1UBLS 5CA0A 1XZQA 1P3JA 1BG6A 1EK1A 3VR2A 4Z9XA 2DJ5A 1J8QA 3NHBA 3OPYA 4YMGA 3ADKA 4QGSA 2FWAA 1Q17A 2P78A 3JQBA 8GPBA 3DEYX 4MMXB 4C4YA 5HJEA 1QV6A 2OZKA 5DYGA 4A6DA 2V4MA 2AJDA 4G0NA 4YFVA 4ISBA 2MSKA 1T6NA 4LEIA 3ZS9A 3U26A 1ISJA 3F5MA 3H65A 4YV0A 5JC8A 3LRTA 2O8DA 1SVLA 3WNCA 4ZYXA 2HRZA 3B89A 1FFDA 1SCJA 1LDEA 4RV5A 1NU6A 1U2PA 4PO1A 3R7NA 3TTXA 1PX2A 1BMQA 2WMYA 2WTMA 1YQGA 3AILA 3GFOA 3Q2OA 3UANA 2OT3B 5L3VA 3RR2A 1CY1A 4CCSA 1GAJA 1TZCA 1Z8HA 2C7OA 1TT5B 1E3QA 4HEJA 1QVWA 4YCSA 3THRA 2CXNA 3M6XA 4TQ9A 1PYGA 2GGSA 3GV0A 1E3LA 3PQ2A 4QLAA 2CD9A 1AURA 2PYZA 2QPLA 1OZGA 2Q9BA 5LYJB 3D81A 2VA9A 2YJ3A 1U1FA 3BCSA 4EHFA 1L5SA 4M8NE 2W8ZA 2V1XA 4EAQA 4WBNF 2UYYA 5GZ3A 4RVSA 4UHKA 3U5TA 1KKUA 3M5PA 2HJHA 4MKIA 1OI2A 1R37A 1G3UA 2J9XB 4BO1A 1R6UA 3QEOA 5DM1A 1T4DA 3MTJA 3SE0A 2EGHA 3K6KA 1DKQA 1YMUA 4CL8A 2OCDA 3TEMA 5KEIA 3W8DA 3I5AA 2CF5A 1OIWA 2PKYX 1JR3E 5L3ZA 2WTAA 4LWOA 4OMCA 5LYJA 2AR7A 3RU9A 3BHMA 5DBGA 4G1BA 1QIKA 1WUJS 5IJZA 5D86A 3IIIA 2C4VA 3KVNA 5AJUA 3WLSA 3PDHA 2DTXA 4NDAA 3BMOA 5FOVA 3KZKA 4K9QA 5AVQA 4FZ5A 3C3PA 3DUFA 4WN9B 1UR5A 5A9RA 3PF8A 5FBVB 5HTKA 4BUCA 2VSNA 4WXRA 2VDRB 1H93A 3RFUA 2UZ1B 1VSTA 1F5NA 1JPVA 1FNDA 2Y0PA 1YDFA 3TVTA 3P4XA 4L1KA 3JASB 1A2KC 2EJWA 4KNVA 4R41A 2GXUA 3DOHA 4HK4A 4R7TA 3IT2A 5DNUA 1XMJA 4IYJA 4FFRA 5JDCA 4XUDA 3D4LA 1V9SA 4JUCA 4XJXA 3F8TA 2AC2A 5DLDA 1CZKA 1JU4A 4FBMA 5AOCA 2QR5A 5H3CA 3U3JA 3VA7A 3WK4A 1HNZB 3K9LA 1G8HA 4MIEA 3PHHA 1E5DA 5EXPA 3A0RB 1LSUA 4BE7B 2VSYA 4OHWA 3D2CA 2JA1A 2L17A 2PWAA 1FEZA 3K4QA 3M5CA 1NU8A 1RWMA 4XWYA 2OD9A 2YY6A 4P8RA 4GC5A 3O92A 3DCIA 3ZDFA 4Z0NA 1NURA 2W2KB 4BNYA 4B76A 2YVUA 2Z6VA 3NRCA 2YXLA 3LU1A 4QBIA 4MVJI 3O74A 5HIJA 3DAYA 5BW5A 2XBUA 3VDXA 2Y4OA 1Z82A 2CY0A 4ZD6A 4KXWA 3ER9A 2DJIA 3AVTA 4OQDA 1JAHA 2WWXA 1ZW6A 2JCVA 3HS3A 5E2AA 2A9KA 1LEHA 2FMFA 2W7TA 2EYUA 2Z83A 3LP6A 3UKJA 2C98A 1BE0A 2G0AA 1Y1SA 1BKYA 4M88A 4WFQA 2IYYA 3LLUA 3RROA 2PBZA 5CPBA 4OHYA 4R69A 4FR5A 3VNSA 1VJRA 2JH8A 3UJCA 3WFIA 4QE3A 5FYDA 5I3ZA 4K3UA 3OQIB 4BO6A 1TF5A 1YE8A 2ZBEA 3L7OA 4C7OB 2IY7A 1H3NA 4MUJA 4CU2A 1JWLA 3F9IA 5FWXA 3SBOA 3VOSA 4RPKA 2AN9A 5DHPA 3VVCA 4W99A 1YBAA 5CXUA 3RBVA 3BWEA 3UG7A 3P45A 1ST3A 1QS0B 2RHWA 3AHEA 3VKFA 4D9MA 4HH0A 3PHJA 3UXYA 2HKIA 1IG3A 3QOFA 3C6QA 1NPDA 2DUWA 5D51S 1MAAA 1ZN9A 5LYJF 3H2SA 1WL8A 1WHTA 2VDVE 1VJ1A 3LLCA 3AFMA 1TUIA 2P3SA 3R6WA 3ECAA 1Q0RA 3EVFA 2PUCA 1P77A 2V45A 3LYHA 3NHYA 4EQZA 3CZPA 1JT9A 1X1DA 2IHYA 4FE7A 4XIFA 2EDCA 4GDFA 3GLSA 1CRLA 1E64A 3EMBA 1IRIA 3LKVA 3OC0A 4FS3A 4K05A 3NJRA 4XVUA 4Z4HA 3OJFA 1G19A 2Z1DA 1GLNA 3NHLA 5FOWA 3ABIA 3NIGB 2FNAA 3U5ZB 2QLFA 1EESA 1J8DA 2GPBA 2IPXA 3LCJA 1OBHA 1T9GS 1R4AA 3HJHA 3HCAA 1CUZA 2RAPA 2XVAA 1NVTA 1DTWA 2PFSA 3FDFA 4IX1A 4JJEA 4LQDA 4TYPA 5REQA 3WL6A 4C5BA 5BSEA 4DDHA 2RJNA 5EWJA 1S4QA 1L5LA 3A05A 2W48A 1XRSB 2P9HA 3IR7A 2CKMA 3SY8A 2BLNA 2OP0A 1MX5A 2WSMA 4ERNA 1AD2A