4ZWNA

Crystal structure of a soluble variant of the monoglyceride lipase from saccharomyces cerevisiae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
b'SAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFSPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIRDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMKQWLDKHTTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal structure of the Saccharomyces cerevisiae monoglyceride lipase Yju3p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase
total genus 114
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zwnA00
1XRLA 2XQJA 4YPVA 4LXHA 1N5MA 3WWPA 1CUFA 2I3ZA 4UFPA 3QZUA 5BV7A 1J1IA 3LCRA 5LLSA 2WILA 1XFDA 2WIKA 3A70A 4B84A 3FLEA 1CUCA 2WIGA 1O6FA 4FMPA 1VJ5A 1BRTA 3MGAA 4MQMA 4X3CA 3D5EA 1TCBA 2J4FA 2O2GA 4LXIA 1JMKC 5CTAA 5FXMA 4AQDA 4B9AA 4WFKA 3IUNA 2ZYHA 3BWXA 2OQVA 4H77A 4UHCA 5KWJA 1XZIA 5T4BA 2QM0A 4X97A 3D0KA 3H2HA 4DSAA 3WK7A 3QYJA 3W06A 3O9VA 3AZOA 4JEIA 4RNCA 3KXPA 3L1IA 2DQZA 3R41A 4UFOA 1ISPA 5AH0A 3HJUA 4ZI5A 4YX9A 2ACKA 4H18A 3R0VA 2Y1KA 1B6GA 3BDVA 3HRHA 3WL8A 3FYUC 5AICA 4DTCA 4G5XA 3AFIA 3G9ZA 1ZJ4A 2AJ8A 4G8CA 3EIOA 3V9AA 4QEKA 4U2DA 3H2GA 4QLAA 1VXRA 2CEKA 3VVLA 2CUTA 2JGMA 2HA7A 3DL4A 2V98A 3HZOA 4F21A 5CT8A 1QJ4A 1DX6A 2Z3WA 3TGLA 3V48A 2XMBA 4FBLA 3TRDA 4X00A 1U2EA 1CR6A 2ZSHA 1ZD2P 5K3DA 5ALFA 5CT5A 3VJMA 2C58A 1XZBA 4KAAA 2FJPA 3DOIA 2VAXA 2BUCA 4UUQA 2XMCA 3JW8A 4HTAA 1R50A 5AKEA 4W1PA 1VE6A 3WK6A 1DTEA 1LPPA 5LYYA 3FVTA 5JD4A 4BTVA 2XUAA 4CIBA 4OB8A 1L7RA 4NVRA 1JI3A 4J0JA 1RP1A 5FOQA 2QRUA 3DKRA 1J06A 4WCVA 5FKJA 3ANSA 1QIIA 1GGVA 3PFBA 5HCUA 4A23A 2O7VA 4U2GA 1LPSA 1HL7A 4QE3A 4Y2QA 3WK8A 1QONA 2XMZA 3BF8A 3FYUA 3R3YA 4Y2XA 2OCLA 1MAAA 1XLUA 1OCEA 5HF8A 1AQLA 2IIVA 1F8UA 5EHZA 1HPLA 1G4HA 1UKBA 4CG3A 4ZRDA 2PBLA 1CIJA 2GYWA 3STUA 4NS4A 5IVHA 3H04A 1T4MA 4QA9A 2I03A 3HI4A 5LZ7A 1LPMA 5ALSA 4ZGBA 5IVDA 3VDXA 3B12A 5JZ9A 3WKEA 4WFJA 1P0PA 1BN7A 4BRSA 5AI9A 4A16A 5LIPA 1Z68A 1VXOA 2XI4A 5JAHA 5ALKA 1UKCA 1EI9A 2OXEA 2PPLA 4Z49A 1R3DA 4K5QA 1WHSA 3QPAA 1H2XA 1LPNA 2WU3A 2XUJA 1ORVA 1RWQA 2BJHA 2QZPA 3DEAA 2HL6A 3CN9A 1X2BA 1EK2A 3HXKA 4AB1A 1SCQA 2DSNA 1HDEA 7YASA 2VATA 1DQYA 2RAUA 3OURA 2HA4A 3FCXA 3FYUB 3I2JA 4X71A 1AUOA 5AKIA 5AM5A 3BL8A 3O4IA 4MEAA 2Z3ZA 4UBLA 1UT6A 1XZJA 1F6WA 4DNFA 4EB0A 5JZSA 3SX4A 4UBMA 1QGED 5CXUA 2XT0A 4FLMA 3SK0A 3TEJA 2C5FA 2VJAA 4BP8A 3WYNA 3NOXA 1CUYA 2QTBA 4OYLA 5LKAA 2J3DA 3E3AA 2RIPA 2XLBA 4AMYA 3PI6A 2VF2A 3GROA 4Y2RA 1GZ7A 5T4HA 3IVMA 4X6UA 5K3FA 3BE8A 3WWDA 1MN6A 3GBSA 4HXGA 4H7HA 3H2IA 2OCIA 2I3DA 1T2NA 1BU8A 3O4HA 4HZGA 5H3HA 4BCCA 3I2IA 1UK8A 2PUHA 3FAKA 1KU6A 1TK3A 4LYDA 4GECA 5ALXA 1GKLA 3CCBA 4JYPA 5CH5A 5A7HA 1JJFA 2JGEA 1THTA 5AKLA 2OCKA 3FLAA 5K3CA 5HF6A 1LZLA 2LIPA 4IH4A 2O7RA 1IUPA 2ONCA 3PFCA 1WHTA 1GKKA 3QMWA 5JARA 5CXXA 2PSEA 2DR0A 2BGRA 3C6YA 4X90A 1ZIYA 5CURA 4B6GA 5ALWA 1EHYA 5ALOA 4Q05A 4F5ZA 4BC0A 2QVBA 1U8EA 4Y2UA 2G4LA 4Y2SA 1CUZA 2C5GA 2XQKA 1DU4A 3QBJA 1EH5A 3F8SA 3U0VA 3FVRA 1U65A 3R3UA 4OB7A 4X85A 3HACA 4BC1A 1Q84A 1CPYA 2WKWA 5AHXA 1QFMA 2ZYIA 3W9UA 3T52A 2PM8A 3I28A 1W6RA 4DMHA 1EB9A 1LPAB 3EQ8A 5AM4A 1UOOA 2PU5A 4H7DA 2WM2A 3BJRA 5T4FA 3I6YA 4GBGA 3RK4A 4D9JA 3N2ZB 3WQHA 1MNQA 1DWQA 1YCDA 4AN1A 2WJ4A 3ICVA 2JEZA 2XMQA 4K2AA 2YASA 4N5HX 1QIHA 2QKYA 4Q3LA 4DMFA 1H2YA 5AK3A 5JD6A 1I6WA 4G4IA 4C4XA 1RYYA 4ETWA 3IB3A 1F0PA 1XRMA 2GZRA 4TGLA 1QTRA 3WI7A 4AXBA 2J4CA 6YASA 1EDBA 1BS9A 2O2HA 3DDUA 1SC9A 3C45A 3I2FA 4S0XA 1SFRA 4FDMA 5LP1A 2V96A 5LZ4A 4L3WA 3RKSA 5LZ9A 1FFBA 1ZI8A 3DYIA 1CUGA 1YS2X 1THGA 3W9BA 4AO7A 4GDMA 2W22A 3ICWA 3G9XA 3AUKA 4H0CA 3EBLA 4I19A 4FLEA 2W6CX 3B3QA 4BBZA 2JGIA 3HC7A 4Y2VA 5T4EA 2IITA 4HRXA 1GPLA 4QDOA 2ECFA 4DM7A 4BE9A 3QITA 4H7JA 1EVEA 2DCMA 4AO8A 4M0FA 3ZLUA 1IUNA 2QJWA 3LLCA 2PSJA 2WFMA 3DCNA 1AGYA 5ALUA 4BZWA 1BCSA 2B9VA 1WB5A 3WL7A 3G0GA 1KEZA 2C0PA 4QLOA 5ALRA 1IMJA 1W52X 2VAVA 4J0HA 2X8BA 5JADA 5AKHA 1PFQA 4GHWA 1NX9A 3KSRA 4Y7DA 2RHTA 2BFNA 1AC5A 4PF1A 2WJ3A 3W2TA 5E2IA 4M0MA 4OPMA 1WM1A 1JJBA 3STXA 5CBKA 4MYDA 4LKOA 1BEZA 4Y2TA 4PSDA 1MO2A 5HQ3A 4LXGA 5CT6A 1YA8A 5KWIA 5I9IA 2AJLI 5AK4A 2HA6A 2R8BA 3VISA 3IULA 2WIFA 5CH8A 1XZDA 2JGFA 4L0CA 4Y9SA 3HEAA 4AMZA 3UUEA 2XE4A 4C87A 2AXEA 4WY8A 4PQEA 3I1IA 5JZBA 5AP9A 5AI4A 1LBSA 4EY5A 4UBJA 2XQFA 3WKBA 3WL5A 4GXNA 1UK9A 5A62A 4OUKX 1LPOA 3JWEA 4E15A 1YA4A 4JYMA 1K63A 2BKLA 2XMGA 1MAHA 4FKBA 1NU8A 2WLSA 5AKYA 1QIGA 1N1MA 5C8XA 3OTQA 1GPNA 2HU8A 1FFAA 4GWLA 1MX1A 2O2IA 2HFKA 4G1FA 1IZ7A 4E11A 5FDFA 1KU0A 3R3XA 2WTNA 4BAZA 3AIKA 2Z8ZA 4QDTA 5ALGA 1W4LA 1E5TA 2UZ0A 3WWOA 5AIBA 2DHDA 5HQ3B 1BE0A 3O9MA 3UUFA 5EIAA 4U2CA 5BWCA 5KREA 4KAFA 1TRHA 1WPXA 5LKRA 3GELA 1QO9A 3WIBA 3C87A 4U2FA 5A2GA 4I3FA 2OPHA 4LHEA 5CRIA 1W75A 4PSUA 1VLQA 4DSZA 2PX6A 4INZA 1Q83A 1ZI6A 5YASA 2VJBA 1H2ZA 4B81A 3FYTA 5A6VA 3WK5A 2JGKA 1IVYA 1EVQA 4LYEA 1LLFA 2CBGA 2CKMA 5I7UA 2HM7A 1ZD5A 4G9GA 4X7BA 4MQLA 1PJAA 3RM3A 2HU7A 3G7NA 1Q0RA 3PDCA 4N5IX 4W1QA 3STVA 2G5TA 3WL6A 1VZ2A 1E8MA 4ZV9A 3AIMA 2PL5A 5BOVA 4K6GA 4WJLA 4P9NA 3PE6A 4Q3KA 5FP0A 3DS8A 5AI8A 4ARBA 5DNVA 2H1IA 5C81A 5HK8A 1ZD4A 3OM8A 3I2GA 4C4ZA 4YK7A 1K8QA 5CMLA 2WTMA 5AOBA 3STYA 5JAPA 4IH9A 4FFVA 3IUJA 4KE9A 4ZWNA 1DINA 3M81A 1XQVA 4A5SA 5K3BA 1CQWA 4FWBA 2ZVDA 1XQYA 4EY4A 1HQDA 2J3QA 1H2WA 4GW3A 4E46A 1NU6A 3IA2A 4FTWA 5AO9A 3VVMA 2FX5A 5AK5A 5CH3A 1Y7HA 5HK9A 3QM1A 4ARAA 3WKDA 1WCYA 5JAOA 4FHZA 4P08A 4F60A 4XVCA 4H7IA 4OU4A 1P0IA 5JAUA 4C6HA 4UHHA 3L1JA 3FBWA 4ROTA 4Y2JA 2Z5GA 4WDQA 3F97A 4WY5A 4ZREA 1XZAA 2XUFA 5E4TA 4BVKA 3N0TA 3RLIA 2ACEA 4HRYA 1XZFA 3ESDA 4FBMA 1ZIXA 4RGYA 3ESBA 1SOMA 1AX9A 2OCGA 3D59A 5DNUA 3W05A 2I78A 5EIEA 3WJ2A 2ORYA 4EY7A 5LZ5A 4ITVA 3O4GA 3WZMA 2HA3A 1JT2A 3OOSA 4AZ0A 1CUSA 3BJMA 2C4HA 1MPXA 5EHNA 4XWGA 4PV7A 4BDTA 3EF3A 3V1NA 1EXWA 1XRPA 1LZKA 4X93A 2VQ6A 4J3JA 2ZYRA 4G8BA 3HABA 4BE4A 5DJ5A 5F4ZA 1CUAA 3QH4A 2HU5A 4DNPA 4TPKA 1CUUA 2WSLA 4QDXA 3VKFA 1OILA 1UK6A 4ZXFA 1QIJA 3E0XA 3E1GA 4Q82A 1DWPA 4OSEA 5C7YA 1CRLA 2XUPA 4BB0A 2WQZA 4JH0A 4YASA 1S8OA 5ALHA 5J3JA 1GT6A 3WZLA 4DGQA 5ALEA 1BROA 4UBKA 3EQ9A 3U1TA 1EK1A 2GYUA 2XMDA 1VA4A 3DQZA 5AKJA 1TKRA 5IVIA 4WFIA 4N8DA 2HDWA 5FRDA 4MYSA 3WK4A 1X70A 3E4DA 2G5PA 1ZI9A 3O4JA 2XQIA 2WFLB 1Y37A 2H7CA 3F67A 4OCZA 5AIAA 1HKHA 5HKAA 4IHAA 3DJYA 4KEAA 5CW2A 2VSQA 1ODCA 1XKTA 2YXPX 3STWA 4KYVA 4UPDA 4OB6A 3P2MA 1E89A 3I6ZA 2PVSA 3C43A 4LIPD 1XQWA 3A2LA 3HSSA 2OAEA 1YAHA 5K3AA 2XB6A 3I2HA 3K2IA 3AINA 4I4CA 2QJRA 1QLWA 4Y2PA 2XUGA 5LZ8A 2OLEA 1CFJA 3QPCA 2B61A 1O6GA 3A2MA 3QMVA 1C7JA 1QIDA 4BYMA 2ZSIA 1AZWA 4QDZA 1Q0ZA 3K6KA 1UK7A 5BWBA 1ZOIA 3S8YA 1A8UA 4X91A 3STTA 3IUQA 5DYYA 1CUIA 3KOOA 1XROA 2PSDA 2WG0A 1UOPA 3BXPA 2JEYA 4NMWA 4Q1VA 2OG1A 2H7YA 5DTIA 1ZICA 2WG2A 2WUDA 3D2BA 3AJAA 1XLVA 4ZV7A 1JU4A 1L7AA 2YH2A 5EI5A 3OG9A 5FLKA 3I6MA 5DYTA 4CG1A 2RONA 4H7KA 3UMJA 5JASA 3BIWA 3MUOA 1FFEA 4W63A 5AOCA 3W04A 2HIHA 4BP9A 3WYDA 1E8NA 2GBGA 3IIIA 2HADA 2B20A 2GZSA 3ZLVA 2HA2A 4Y2YA 3Q8WA 4V2IA 2BUBA 5ESRA 1A7UA 1QZ3A 1XRRA 4BCDA 1TAHA 4B7ZA 1R88A 1WPRA 1R4ZA 1G66A 1FFCA 2DQYA 2JF0A 2XUKA 3C8DA 2QUBA 1JJIA 5ALDA 1MTZA 4H35A 1TQHA 2CMFA 3G0CA 4EZIA 4RE5A 3ESCA 5SYMA 4C01A 5AKKA 5JD5A 1C4XA 3OPMA 1K6EA 4BAGA 3M83A 3LIIA 4BATA 4JUIA 4QWWA 5AM3A 3H17A 3WKAA 1R9MA 4P92A 5ALZA 1SCIA 2VJCA 4BTLA 1VA5A 4GEGA 2HFJA 3WWEA 3C6XA 1ACJA 4K6KA 4UBOA 1JU3A 5AKGA 4B80A 1XZMA 2PU7A 3QMMA 3DNMA 5K5EA 3PUHA 1QE3A 2QR5A 5AM0A 4G8DA 3NWOA 1ODTC 2JBWA 4RPCA 3H2JA 1QIFA 1A8QA 4H7FA 1J07A 2WJ6A 1W1IA 4AZ3A 3G9TA 1M33A 3DOHA 2X76A 4HAIA 3G0DA 2XUDA 5EHXA 1PV1A 4KAJA 3R3WA 1N5RA 1XZEA 4J0IA 1E66A 2XUOA 2BGNA 2G63A 1IZ8A 5AK6A 3H0CA 1GQRA 1P0MA 3B5EA 2WHPA 3V1KA 3WA7A 4MJ3A 3FOBA 1EA5A 4IH1A 4KJXA 2JIDA 3IUMA 5ALPA 1ZJ5A 1XZLA 4MXDA 2WU4A 3FSGD 5D3KA 3LP5A 4E14A 4X6YA 3L1HA 3AZQA 4CIAA 5JALA 4MWSA 2RGUA 4QZVA 1XRNA 4FFWA 4BVLA 4EY6A 5A71A 1MJ5A 3VXKA 2R11A 5D7BA 2ZYSA 1UKAA 4J0DA 4IQ4A 3KWFA 4AN0A 2BCEA 4B85A 3WK9A 3IBTA 4OU5A 1P0QA 1VE7A 1EX9A 2OAGA 3ZWQA 2FJ0A 2H9YA 1BEEA 3SWWA 2Y6VA 3DKKA 2QOEA 4G4GA 1EDEA 3H18A 5D3ZA 2WHPB 2FUKA 1GXSA 1CUXA 1K5PA 2WUGA 4C4YA 2EDCA 1FFDA 3D4LA 1CVLA 4GI1A 3WA6A 4AX4A 1J2EA 1ORWA 3WWCA 5C8VA 4PNZA 5DWDA 3ZI7A 1TIBA 2VA9A 3Q0TA 2ROQA 3H2KA 1CLEA 5ALQA 3WLAA 3V1LA 4BCBA 3AIOA 1FJ2A 5I8PA 2X5XA 3F9CA 4DMKA 5HF9A 2AJCA 2WIJA 2CJPA 1GQSA 2HRQA 5K3EA 3T4UA 1QIKA 1R9NA 2CZQA 4FNGA 3GFFA 3H1AA 2RHWA 5AKZA 1EDDA 1YAJA 3WKCA 2GBIA 5FPQA 5AKXA 2XMRA 4X6XA 4JNCA 2WIDA 3IDAA 1CUBA 1F0NA 4J0KA 1CUHA 2ES4A 4BZZA 2XUQA 4GLBA 5EGNA 5ALYA 5CT9A 2OGTA 1QIEA 1TCCA 1DT3A 1CUVA 5AI5A 2PSHA 2QXTA 4HS9A 3R40A 2WG1A 1CUWA 1DX4A 4X92A 4CI9A 1MNAA 3S2ZA 1CUDA 4QWMA 1QFSA 3M82A 4B82A 2VT7A 5JATA 2GYVA 2VT6A 1H23A 4J0GA 2B4KA 3FWHA 2RI6A 2QUAA 1MX9A 3FSGA 5KBYA 2QS9A 4IO0A 5IH7A 1G42A 1YB6A 3DYVA 1AKNA 3R3VA 4W1SA 4FNMA 3C6ZA 4CCWA 1MT3A 3RARA 2AJDA 2PSFA 2EEPA 1WB6A 3GUUA 2WFZA 4HVTA 3CCCA 1QO7A 5C8ZA 5ALNA 3R3ZA 3ZLTA 1WB4A 3GZJA 3ESAA 4B83A 4BAUA 1G5FA 1DT5A 3BDIA 5HFNA 4BVJA 5DTJA 1XRQA 5ALMA 1OXMA 1HBJA 4DNOA 3LIPA 5HF5A 5JYCA 1BCRA 1CEXA 2BUAA 3MVEA 1XLWA 2OGZA 4BDSA 3CN7A 4AO6A 1XQXA 1VZ3A 4BRZA 1BN6A 4HXFB 1Y7IA 3FNBA 5EFZA 1JKMA 3C70A 3G0IA 3KWJA 3OC0A 4XIIA 1X2EA 2WFLA 2QT9A 1AURA 1B41A 5ALLA 4X95A 4MEBA 4Q3OA 3G8YA 1ZD3A 3TJMA 5JIBA 4OYYA 2K2QB 4O08A 4CCYA 2DFPA 4KE7A 4MWTA 4KE8A 1XKLA 3I2KA 1LGYA 2Y2VA 3AZPA 1XZHA 2XUIA 3V1MA 1ZGCA 4N8SA 3WMRA 2Y6UA 2HHAA 3PF8A 4U2BA 4DLNA 1CUJA 2VJDA 2GBCA 3C8HA 1YSCA 4N8EA 5HKBA 1UFOA 1ETHA 3ZV7A 5AI0A 3WJ1A 4QNNA 5ALIA 1U4NA 1N8SA 5A7GA 2ZJFA 4FOLA 2GBFA 5AM1A 4J0CA 1LBTA 4KR0A 5ALJA 5AI6A 2JGJA 1XZCA 1A8SA 3I1YA 1CUEA 3ILSA 5E4YA 3NUZA 4EY8A 5EHQA 4EBBA 2Q0XA 2HRRA 2HA5A 5DYWA 5D6OA 3SC2A 4KE6A 4KRYA 2WUFA 1XZGA 1AMNA 3D7RA 1QTIA 3MUNA 4W1RA 4CFSA 4UFNA 5HZGA 4PSCA 5JANA 1EINA 3DD5A 3YASA 2E3JA 1WOMA 3KD2A 3F96A 3BIXA 2JGLA 2XQGA 3G9UA 4QDUA 1ODSA 4EA6A 2XDWA 5DNWA 5SYNA 4X94A 3QVMA 1UXOA 3ANTA 4B0OA 1YS1X 4U2EA 3F98A 4CCYB 3PICA 4OD0A 2ZJ7A 4W9RA 1QIMA 2EDAA 4DMCA 2DHEA 2Y2UA 4Q34A 3WIOA 3H1BA 1QOZA 3HLKA 1MU0A 3VJKA 4EHBA 3KDAA 3NGMA 3K9BA 2C7BA 5ISMA 3DL7A 4CG2A 2WUEA 2CB9A 5K3FB 4L72A 4B9EA 2Z8XA 5DLPA 1YB7A 4KRXA 1H22A 4PW0A 4DNQA 3LS2A 1E8DA 3M3DA 2DHCA 1HLGA 5LZ2A 2PUJA 1FSSA 3PUIA 1ZGBA 2V97A 5FUMA 3GA7A 3EQ7A 1C7IA 2BAGA 2OGSA 1DWOA 1E3QA 2D0DA 4WDRA 1GPKA 4XJVA 2YYSA 5IKXA 1R1DA 1USWA 3A6ZA 1CQZA 3QPDA 2WHRA 3G02A 4TVKA 4NZZA 3H19A 2P8SA 2PKYX 3O0DA 1YR2A 4J7AA 1A88A 2WHQA 1UWCA 4RE6A 1D07A 5ALTA 4DIUA 4C88A 3VJLA 4UHEA 5HFAA 4PO3X 3A2NA 4P93A 1LPBB 4FLFA 5FPPA 1YASA 2H7XA 4UHBA 4EUSA 4HXEB 3FCYA 4M0EA 2IX9A 2V9ZA 3D2AA 4H7EA 3HYSA 4L9AA 4K6HA 1VKHA 2XLCA 4J03A 2D5LA 4C89A 3AILA 5AM2A 4DYHA 3G0BA 3C5WP 2QMQA 3C5VA 5ALVA 1DQZA 2HA0A 3ZPXA 3IURA 4UHDA 1TCAA 2NW6A 3ED1A 1SCKA 1XZKA 5AJHA 1UOQA 3C6BA 5EIHA 5IVKA 4UBIA 5FV4A 2AJBA 3JYHA 5A7FA 3BF7A 1IUOA 4G4JA 1L7QA 4B0PA 2XUHA 1CV2A 4XX1A 3FLBA 1VOTA 2ZJ6A 1LNSA 3D2CA 1K4YA 1UZAA 4KACA 3D3NA 2VEOA 1JFRA 2C0QA 3CXUA 4G9EA 5AOAA 4UHFA 1EB8A 4UBNA 1JMYA 3X3HA 2QXUA 5CT4A 3DLTA 1W76A 4F0JA 1ACLA 2OQIA 1MX5A 5E4JA 2VTVA 3PF9A 2XMSA 3O95A
chains in the Genus database with same CATH superfamily
1ETUA 1MVOA 4X3PA 4DPLA 3RBAA 4YPVA 4BLVA 3R9WA 1ZXXA 1SUIA 2FWMX 5T6MA 3ZD7A 3ZCQA 4UCWA 3E2MA 2BEWA 2GJ8A 2CNDA 1QYWA 2R6FA 2F8TA 3VZRA 5TT0A 4CUKA 3N6XA 2L2QA 2NO6A 1JDTA 2R9VA 4KQHA 4QYMA 1FNMA 3OWHA 5BT9A 1AKUA 4LJ6A 4S04A 2WOJA 1TO1E 3Q0IA 3CUYA 4MWCA 5KJ1A 1CERA 1K86A 3DQPA 3MSCA 2V4UA 3TM4A 1P74A 1W9MA 3QZUA 2Y93A 2Y77A 4KIWA 4W6ZA 5BV7A 2ZR0A 1J1IA 3BSYA 2AUTA 3LCRA 4K9PA 3NKFA 2HJSA 4L2IB 2ZT6A 4WKOA 3A70A 5LLSA 3UWMA 5KVSA 2MSKA 4MDYA 2BEKA 4NFLA 4RF4A 4B84A 5JISA 4E4RA 3CO5A 3WDMA 5KTNA 1L4EA 2PVPA 4A6XA 8OHMA 2WIGA 5IUKC 3O8OB 4V3CA 4URVR 4WXHA 5M5BA 2M1XA 3MGAA 4MQMA 4F12A 1RJFA 4GQBA 2ZJ5A 4YJ2F 3T1OA 1X1SA 2IS1A 1TCBA 3K30A 5JCZA 2L19A 2DYKA 4XFKA 1VP3A 1W5BA 3AJRA 3AVPA 4W7SA 4JI4B 4HEA6 4JSYA 1JMKC 4JBGA 2E4VA 2AB0A 5FPSA 5HKKA 3MWEA 4CKYA 1PNQA 1YR3A 1ADYA 5FXMA 2NTYC 3THWB 3ER8A 1CJUC 1AKYA 4D4IA 2JJQA 2VS1A 5ADVA 3BWXA 3QU7A 4UHCA 3ZHVA 3K5PA 5F77A 2GFHA 4OQ4A 3I5YA 3PHJA 4RHUA 1QHYA 4TTJA 2FW8A 1VJDA 2IX3A 1DS6A 1PGNA 5B4TA 2QSZA 1IJKA 4X97A 3EPJA 3QF7A 4JFAA 5KJFA 3RAGA 4ALNA 3I39X 4QUEA 1T5LA 2ZTLA 1SC4A 2WVGA 2A6PA 1FU4A 4M6WA 4K6OA 4NOKA 5HM8A 2WV7A 3IJPA 2IXBA 4UDOA 3ROGA 1E92A 4AQ7A 2HCFA 2BEVA 2ZKIA 3L8CA 5JEDA 2ZRAA 1GFIA 3UA4A 2PSSA 4Y1RB 1RKXA 3TOVA 3K8OE 1DJLA 3PLRA 3HR8A 2IYNA 1ISPA 3R41A 5FX2A 1W8IA 2X2OA 3N70A 1JIKA 3BKXA 3UK1A 1F2TB 1QNFA 3DWGA 2P9BA 4TOIA 1WUIS 1Y4AE 4H18A 1QRDA 3SYMA 4EK9A 3R0VA 2QW8A 2Y1KA 3IQXA 5F1OA 3TI7A 4DJ5X 4PNHA 4CMKA 3W5AA 3HRHA 2O0KA 3COSA 4JQZA 1W88A 3WL8A 5DBFA 3FYUC 4QPZA 2H2FA 2X2FA 3OTHA 1ULZA 5AICA 1OQAA 3PFWO 5H59A 1ZJ4A 1ULUA 2ZRNA 3OZUA 1DX9A 1QDLB 4TWZA 4TXLA 4QEKA 3RF6A 3CNBA 2H11A 2GPBA 3GJQA 4ZRNA 1GPJA 1K98A 3F3KA 4ND2A 3PQ5A 4OHXA 1TUGA 3Q4GA 2H4FA 2HQOA 4U02A 1H0HA 4EO7A 4Y7CA 2F1JA 4I0WB 2CEKA 3BULA 5C46F 5JJIA 3VVLA 3D3KA 5K2OA 1RYHA 2IZZA 4EHFA 5DTEA 4Z0HO 5KTOA 2VRCD 3SLGA 2VP6A 1HRDA 1G59A 1U8CB 1FVXA 1YFZA 2HA7A 1TYDE 2V98A 4R8VA 2VXCA 3HZOA 1Z2OX 3AM4A 3LX4A 2GD2A 3P2OA 5CT8A 4RESA 2ZB3A 3G85A 1PV4A 2QJTA 1PE0A 2RC5A 5AJZA 2QRQA 2A4MA 1O57A 2Z3WA 2NZYA 3TGLA 1KO1A 4OQDA 3L82B 4FBLA 2H2HA 1Q0SA 2BJVA 2Y0PA 1UJNA 3PTZA 5A05A 2C4TA 3ITNA 2C07A 3MG9A 4R1OA 3AETA 1LJ8A 1U2TA 2VPYA 1HZZA 1ZD2P 4FWIB 1XCPA 5K3DA 5ALFA 3WLOA 3C1OA 3V4ZA 1T1RA 3CH6A 3LLVA 4CDRA 1TYCA 3DWFA 4RYLA 5B1HA 1L3IA 2N75A 2ZT5A 3D6HA 4C06A 4V2UA 4D9FA 5EMHA 3BPSA 4KAAA 5HGJA 2FJPA 3DOIA 4UUNA 2BUCA 1CY4A 3D9QX 3M6MD 3L8FA 1X8KA 1D2RA 1PDWA 1Z4JA 1MDBA 3LPLA 4IWNA 1JJVA 3RR2A 2DBQA 5KNBD 2F43B 4HTAA 3O8RA 4M76B 4POOA 3NANA 3BXXA 4XR9A 1XU4A 2CE7A 4M6WB 4YR7A 1XDUA 4TRJA 4LI0A 1BWQA 1II9A 2ZKLA 4F93B 1RM4A 1J20A 2D8MA 2BEVB 4URUR 3AOGA 5LMZA 2QGZA 1VE3A 3LL4A 4DC9A 4EEZA 2YZKA 4YPFA 3SMVA 5AUNB 2WYHA 1UBMS 3FVTA 1YIAA 3K0FA 1CF9A 1L8AA 2I1VB 1AS3A 1C81A 2XUZA 3QXXA 2R8OA 4AMVA 3RYCA 1I0ZA 3A27A 3C3KA 4US0R 1BHJA 4H1WA 1S2IA 3L7CA 4NDZA 1R0XA 3K9FC 5FOQA 2C5SA 4LMAA 2A9OA 1P2GA 2HSJA 4OMDA 3GG2A 2AE1A 2C7QA 4OLAA 1SRQA 2HJ9A 4L0MA 3QV1A 4EFMA 3RF7A 1NATA 4KR7A 1W88B 1QYVA 2YWGA 3DFIA 3I9KA 4JQYA 1SB8A 4Q6WA 3VU9A 1DADA 1Y5RA 3EXIA 5FQNA 2PMFA 1C5KA 3KE8A 1NY5A 1V95A 4YECA 2OYRA 1O2DA 1ZUHA 4F56A 1P9NA 1R0CA 1T6BY 3LZCA 2QR3A 5IK2A 4A23A 1OXTA 4YI3A 2O7VA 5C7OO 3HJGA 3E18A 2LZ0A 1NJFA 4ZOEA 1DPGA 2V5UA 5DM0A 1A98A 3H84A 2V9PA 4KRFA 4A26A 3CNNA 1NN0A 3LK7A 1E6KA 3MILA 5LQKA 4N40A 4I8XA 1SZJG 3UGJA 3LUHA 2VP9A 2RAVA 2XMZA 3ORYA 4HR7A 1L5RA 3O6VA 3OAAD 4Z1MA 1ESCA 1S7CA 1IM8A 2G9RA 3DCJA 3F9RA 1QOPB 2ZS8A 3FYUA 3R3YA 1KY5A 4PRLA 5ADWA 2OCLA 5HXAA 3AF6A 2PUBA 3E5HA 3MWGA 3WNVA 2BONA 4IS3A 4J0QA 4G0QA 1P1HA 1Q0HA 3ZQ4A 3EAFA 1ZITA 2Q62A 4C2AA 1J5XA 3AETB 3FCCA 4MINA 1NN5A 2IIVA 1EGMB 3KOYA 1U0SY 2WHEA 3BK2A 3EW7A 1D03A 4YNBA 3WGMA 1YMVA 4D9MA 4F6CA 1EJ6A 5BMVB 1SXPA 4ZRDA 3U4QA 2DC1A 3PGA1 4TRMA 1WDTA 2OMEA 1RC0A 3CZQA 4K8OA 1UAYA 2O2JA 1CIJA 3KL2A 1SXJD 4NS4A 4WJKB 3MK31 4LOHA 1OMOA 3NFRA 4PX2A 3TTXA 3H04A 2G9VA 1T4MA 5FBRB 3IALA 1ZNXA 2C9BA 4L27A 1OFHA 2KI5A 2LD4A 4IKOA 5BSMA 1R16A 4IG9A 1FUEA 1F60A 3UK0A 4L5JA 2G0NA 3TAXA 3KZOA 3T1NA 3HI4A 4N49A 3S5UA 4GKVA 4O59O 2DJIA 4WGGA 4CODB 3B52X 2HHCA 1GZUA 4U2KA 5E8RA 3UPUA 3T41A 4YT4A 2Y8EA 1EX1A 4WFJA 4YCMA 3EGDA 1T8TA 2IUSA 2Q3DA 2YYZA 2HQRA 3AF4A 3ME5A 2X0NA 5AI9A 5CCDA 3W2GA 5JAHA 1KK0A 2GZMA 2OBYA 2Z95A 4D4HA 1L8OA 2IUYA 5ENDA 4BWGA 1EXVA 2ISCA 3LBYA 1DEAA 4KNWA 1SHKA 2W5UA 2YNMA 4K6MA 2Z5VA 1R3DA 4UU1A 4C4SA 5CB6A 2EJTA 2ON6A 3S1LA 4PLFA 2P9TA 1WHSA 3W5DA 2XAUA 3HU3A 3P96A 4LVOA 3TX2A 4KK3A 2HSWA 3GUCA 4BP3A 1FUUA 1Q95A 1SIOA 1LPNA 2QRPA 3OZXA 4MUYA 5CDUA 4HNRA 4PG6A 4U8HA 5TF0A 1G38A 2PG3A 3VU9B 1X3SA 3EXIB 2EYQA 4Y0VA 4ARCA 2UXDB 1BAPA 1ZDMA 1II8A 3GUVA 5F73A 4DKXA 1JIXA 4HAWA 1KQ3A 1E3EA 3FYSA 4A7PA 2C8VA 4QHSA 3H11A 1E9DA 3HA3A 1ZRNA 3H8VA 1VMKA 1AQIA 2FW6A 3OCJA 4YUZA 1E9SA 1I6MA 4WLNA 4PSVA 4IVNA 4AB1A 2RB5A 3RJZA 3T3HA 1OWLA 1V48A 2DSNA 4AY2A 4L07A 3VPSA 1U5AA 4EUKA 2E89A 3NEYA 4K9OA 2H85A 3IPRA 2EX1A 1Q22A 2O3QA 3FYUB 2QLLA 1NP6A 2JGRA 3N3BC 1OJLA 3TTUA 3U80A 1AUOA 3V2GA 2AMJA 1DBPA 2GZ1A 3EC7A 3QFRA 3VPXA 2PZJA 4YAOA 1G2QA 1Z15A 3IUEA 1R27A 3ZXUB 2IXGA 2QVGA 3FRJA 4PFSA 1ZO8A 2YVUA 4HH3C 5BW6B 5BN4A 1H4SA 1OJ7A 2V4ZA 1P80A 4CT5A 3LFHA 4QVGA 5JHHB 2WUVA 3GEHA 3NOOA 5ICGA 2PXXA 2QN3A 5FTMA 3U4QB 3WDSA 1IXYA 5IYZA 2PV7A 5LDHA 1C14A 3H05A 4BBAA 4ZYUA 721PA 2X8AA 1XALA 4RX1A 2JVKA 3GOHA 4NMMA 4UBMA 2GN8A 1VIYA 5CXUA 1LF5A 1BZYA 1WJGA 3C6MA 1MD9A 3QIVA 4MH0R 5CTJA 4RTSA 2QUZA 4BP8A 4GI5A 4DT1A 4I1OA 1F0YA 1AM4D 1GAJA 1VPTA 3QA3E 3UYLA 4XASA 3CNLA 2J3JA 4NFYA 1PFWA 4TSKA 1EWTA 5DK4A 5LKAA 2J3DA 1TUEA 2RIPA 4E1AA 3TTSA 2ZBDA 4GUDA 4MKIA 1GZ7A 3EGDB 3I4LA 2FZLA 2ZXFA 4II3A 1EIWA 4OQEA 4NBWA 3ZXYA 5K3FA 1P7PA 1OBVA 1JHPA 4AM8A 2VDOB 3VSCA 1TRKA 1SCUA 2NVUA 1MN6A 2QMZA 3PGMA 4GLLA 2OZLA 1AOXA 4HXGA 1BSVA 4YXFA 1GRVA 1D2NA 2Y4OA 2NZVG 4F3RA 2OCIA 1YA6A 1GYQA 1NX6A 2OBMA 2ZWAA 3EDQA 3F4BA 3N76A 1GIAA 2I3DA 2F62A 1WV1A 3DOOA 4MP6A 2XZPA 2I66A 3BBPA 3L43A 5H3HA 4QBKA 3ZW9A 5M2QA 1KFCB 2DPLA 4N3AA 3C41J 1YL7A 1XTVA 2L82A 3EUFA 3QU9A 2Q28A 1LBEA 3FSJX 3SEAA 3KVYA 2WR8A 2OAQ1 4YRQA 4JJIA 3OD1A 3KKEA 4CM5A 4GZLA 5CHEA 4OQNA 3H11B 4GYYA 4UHJA 1TK3A 4LYDA 3W6UA 1Q7GA 1X1AA 3CRQA 5ALXA 4HZUB 4CV2A 4EAQA 3KBBA 5BRJA 2FPRA 4Q24A 4XDYA 5EJAA 1GSAA 1QORA 2ID7A 3VPFA 3CCBA 4MA4A 5A7HA 4WHMA 3S4YA 2G1AA 1S8NA 3FRHA 3RS5A 5CVTA 2GPJA 1JJFA 3O9ZA 2H65A 5ESWA 2XH8A 1KL7A 2P4EA 1R5OA 2FUCA 2ZXUA 4MGZR 2Q6IA 4FEGA 1Z7BA 1GUAA 4RHXA 5P21A 2CL0X 2RHBA 4RMNA 1XVUA 4ZEMA 2Y68A 5BP7A 1E1KA 5CCBA 1E99A 1SD2A 3T0IA 3KQYA 4PO8A 5LQCA 1IUPA 3I0NA 5JPIA 4IDQA 3M9WA 1L1RA 5F7JA 5JAZA 3ZXXA 2R48A 4B40A 1FXWA 1J9ZA 2C0CA 1ND5A 2HCTA 1RDFA 4TV9A 2QTMA 2BGRA 3C6YA 2P68A 4R2XA 5DV9A 3VDQA 1QH0A 3MHTA 5HSGA 2NT4A 1FYFA 1XAGA 3OJXA 1YHNA 1DKNA 3OQ6A 2H00A 4JLDA 4DT1B 4LQCA 5ARDA 1U11A 3W78A 3RKUA 3HJCA 4KXVA 5CURA 4B6GA 6ABPA 1R0ZA 2I2XB 1L7NA 1FRVA 1N6OA 5CUQA 3M6IA 5ALOA 1XIVA 2IODA 4KVGA 1KOLA 3RKRA 4BC0A 2QVBA 2YDYA 1WCIA 4Y2UA 2G4LA 3DDNA 4I14A 3W1WA 2NNLD 1EU1A 3ET4A 5D3QA 4HPXB 4NG5A 1PQUA 4AY3A 2C3MA 2M6RA 1IK4A 1WD7A 4BLWA 5EMJA 4JI3B 2IEIA 2VDQB 3ZWNA 3IO5A 5DI9A 5EP2A 5KQGA 3I58A 1OTYA 1C4KA 1TW2A 1SCUB 3T61A 2NVUB 8GPBA 4DLPA 5E95A 1JILA 2OZLB 2VG8A 2XF2A 1GDTA 1H4VB 2AZXA 1JALA 2PLRA 3U0VA 3AGQA 3I01M 3MWKA 1WWKA 4YROA 3GIDA 3IGFA 1EP2B 1ZCZA 4QTUB 5LWHA 3KALA 5KQLA 1QCDA 3ZVLA 2ECPA 3Q8XB 3BX1A 3TSZA 1IZZA 3W9UA 5IJ9A 2BE9A 3IHKA 3LT4A 4YQYA 4RF5A 1EB9A 1LPAB 4UCFA 4Y6SA 5DSXA 4YQZA 1Y6JA 1Z7YA 3BREA 1JEAA 2M6LA 1UJ5A 1RI4A 2MTBA 2W93A 3UJBA 3UMYA 3IVXA 5EJFA 1KS2A 3ITDA 1ORDA 3ORSA 3SR0A 3SKYA 2PX4A 1GL3A 4MPTA 1FRQA 3RVPA 2XCQA 2NACA 1DEOA 4MVJF 2PU5A 1U63A 4OHPA 3AHCA 3T3MB 3BJRA 2FSFA 2W58A 1D09A 1N6LA 1KBZA 2VN8A 4N0EA 4IDPA 3TGWA 1QRTA 1KP3A 1ZSNA 3FAZA 1TK2A 3R7SA 1FP7A 1WW2A 2IKSA 3MNFA 5FA8A 4OSPA 2CLOB 2QX6A 3ICVA 1RPTA 3ONFA 5KYYA 1EDOA 2GEJA 4DV0B 1CETA 1WY5A 2XMQA 5DCWA 3TLKA 3PL1A 2P79A 4J9VA 1MC4A 1ZYUA 1LV7A 2GWHA 2QKYA 3NWJA 1PCXA 4Q9AA 4DMFA 1H2YA 1P61B 4IIVA 3BGOS 3UUGA 5JD6A 2AVDA 2H5JA 4CNBA 2OWDA 3C7DB 1J5EB 4JDUA 1FJHA 4G4IA 1NYLA 4UEJA 3IB3A 3L0CA 3T12A 5LC1A 1KYXA 5FCDA 2DULA 4TV9B 4U4AA 3DM9B 1NBWB 3CPJB 2C7PA 4AXBA 4TXJA 2OXIA 2J4CA 4RKEA 3LQKA 3BTVA 4ER7A 2JFXA 4BEVA 5DGXA 2Y1GA 5BMVF 3SJAA 3HYCA 1PP4A 1ZNQO 2C2KA 1EDBA 4TL7A 2NZ8A 2O2HA 2G8NA 3LECA 4L4YA 2HK9A 3I2FA 4TRNA 3ZZTA 1GFWA 1V2HE 4EOGA 1MA0A 2WB4A 5EZSA 3TUIC 3G7SA 4JC0A 4MS4A 3OKPA 1YH3A 3KM0A 5G0SA 3WLQA 4YYEA 5LP1A 2W2XA 4FC6A 1WCIB 5H0IA 4EUEA 4GPZA 5J2UF 3NTRA 2IU3A 2XZTA 1FFBA 3EGEA 2J3IA 5EIFA 2AX4A 1I7DA 1TOAA 2XSZA 4IYRA 3VOAA 2SNIE 1KVTA 4G1VA 1JHVA 5KYXA 4JC8A 2R1VA 5L4NA 3NBKA 2XRYA 3ZNOA 5A03A 3DYIA 2C7GA 2PLFA 1CUGA 2ZE8A 3WISA 5K8JB 5LQRA 1SBHA 2UZAA 1PDVA 1YQEA 2RBGA 5JDCA 1FMJA 1MF7A 1CHNA 3GWGA 2F8LA 3K31A 3CW2A 3ONVA 3S8MA 2RHCA 3SE0A 4LRWA 5AYVA 3LQ2A 3TAHA 3LV8A 4S1VA 1KEWA 4MSUA 2HPZA 3U7FB 3NB0A 2VLBA 1GUBA 4I19A 1LLUA 1PBTA 3DMPA 2OK7A 3TB6A 2A94A 1KEVA 2PRZA 2EFDB 4UAGA 5IJ9B 2BF4A 1Y9JA 1CR1A 2H1VA 2W6CX 3GJZA 3RQIA 1H1DA 3S8EA 2ZM6B 4Y2VA 2B7BA 1PWYE 3MAGA 3MWDA 4DUZB 1GTSA 1GD1O 2ZRKA 1X92A 2R2AA 3DAYA 4WACA 5J1SB 4C08A 2WF8A 1N5KA 3AK4A 3JARA 3NRBA 1A9PA 3ZCXA 4K2HA 3RE1A 3UHPA 1GPLA 1JKIA 1JJ7A 3RIEA 4BE9A 5DFAA 1KF0A 3UCXA 1T9HA 5C1IA 3QA9A 4FYWA 4IDHA 4AS1A 4C0KA 1VHJA 1WU7A 4JJEA 2QTWB 4QUGA 1OZFA 5JMWA 2DCMA 3KUCA 1UPUA 2ZWIA 1IUNA 2E6KA 1GAEO 2E1PA 3VU0A 2AN9A 3EEFA 3R6DA 2I4RA 1P31A 1YKFA 3PG5A 4FHDA 3DCNA 1F1BA 2QD1A 3EXEB 1EVIA 3BWDD 2XNDA 1BCSA 3R7DA 5BSHA 5A9SA 5DOVA 3D6AA 1AKWA 1EYZA 3NBZC 4A0QA 4Q66C 5H16A 3WL7A 3DVLA 4EYGA 4C07A 4FZ5A 4AUEA 1ACMA 1T2FA 1NRJB 3PQ6A 4JNKA 4UASA 1TYZA 4UXJA 4EMUA 1ZVJA 2ZYAA 3MXTA 7ABPA 2E0IA 4GHWA 2A58A 2JAXA 1RKUA 4KMRA 4B48A 1XAJA 4DXHA 2WZDA 4DR1B 4QGHA 2YS7A 1AC5A 3ZZUA 3ROPA 3BHMA 4L4ZA 5EJ2A 4FGUA 3Q6MA 3W2TA 5LLTA 4WA7A 5HA5A 1T0IA 4YDHB 1TQ8A 4NSNA 2IOHA 3B48A 5IJXA 3WLMA 1U6KA 4ZAYA 4MS4B 5G2OA 1DOHA 1YE5A 4TLCA 3ELBA 2AG5A 2X2PA 4NJEA 1EZ1A 1WM1A 1JJBA 3ZDEA 5AQEA 1G9XA 4PZEA 3S6JA 4PGMA 3JYOA 5ETJA 3STXA 1O94A 3RO7A 1PTJC 4HD8A 2A78A 4WN3A 4A2QA 1RM5A 2O0MA 3DDZX 1N7JA 5KYXB 1ZL0A 2GBPA 4Y2TA 2R1VB 1V43A 4MKXA 3DZIA 4ZTZB 1LD3A 1Y9ZA 2YC2C 2DBZA 3MBIA 1NNEA 1PYDA 1CQXA 1JPNA 5HQ3A 4B5KA 4ZDKA 2FOIA 3BXGA 5KWIA 1R8XA 2YTZA 1CW2B 1OYVA 1FLNA 2DTDA 2YQ5A 2IYPA 4YLYA 2YCLA 1EBBA 2JD0A 3UB2A 2R8BA 1Y1TA 4EHKA 3IULA 4B6OA 2GN9A 1VI5A 3BJZA 1NVWQ 1L4GA 3FGNA 3QKSA 5CH8A 4LBYA 4M8SA 2JGFA 3TR5A 1IN6A 3I6BA 4DEXA 4Y9SA 2VYVA 1YRWA 3R7LA 2MOKA 2PMWB 2IYXA 3K20A 3OU7A 2ZFUA 3Q3GE 5D84A 5J4YA 3UXMA 4C87A 4HLDA 1FFGA 1Q6YA 3JARB 1ESZA 1NXVA 2Z2KA 3GFTA 2YHSA 4LBZA 5I4KA 2MSWA 2PGAA 1RPNA 1J21A 1BKYA 3DSRA 5AI4A 2J3HA 1XPOA 1PZFA 1EE2A 1VBKA 2H16A 4Q3BA 1B0AA 3V8EA 3GHYA 1E2FA 2J3EA 2GJAA 3NYQA 3ZHXA 5C2JB 4U6QA 1G21A 2DKOA 2H59A 4Y9RA 3A3KA 2PWPA 2YJ3A 3MCVA 1NFQA 2MYNA 5BNWA 5A62A 2PQMA 2YXLA 5HTOA 3SYNA 3ULKA 3QLUA 1AUXA 4HUJA 1QVWA 4BE7B 1KJ8A 1KZ9A 1SCJA 4E15A 3MJ4A 1BCSB 5HJEA 3SF8A 4HQKA 5A9SB 1EG2A 3KKKA 1GGKA 1BX0A 1YZVA 3HFRA 2BKLA 1XMIA 4RCZA 4B4KA 1E0KA 1WO8A 1TA0A 2ATEA 2W2VA 5JMOA 2XTAA 3EXFA 3B1VA 4FKBA 3OX2A 2FWAA 1BMTA 2OXFA 4QYWA 3EYWA 3FWKA 4DCCA 5KEIA 1NAIA 5AKYA 3PJDA 4FU0A 2Q5CA 2Q9AA 3PHGA 1GQFA 1GPNA 1N6NA 2BHLA 5EWMA 5G1PA 3PGLA 1FFAA 2LVBA 2GJ9A 4GWLA 1MX1A 3AU9A 3FX2A 5E7JA 1TAUA 2BZ1A 4G1FA 3QQPA 1MB9A 3OM1A 1H66A 5EVCA 4NJOA 4GP9A 1I4WA 2QRJA 2YWHA 3RVQA 5FDFA 3DVSX 2O0HA 4QT4A 2V7QA 4NJEB 3O03A 3SHOA 2WTNA 2YXBA 2J6HA 3O31A 2NG1A 2D62A 3CLVA 2Z8ZA 1HNWB 2Y0BA 1SO8A 3FY4A 2BSXA 4MGHA 3FSRA 1JDBB 2CHEA 3KB1A 4PZDA 1AHIA 4OFWA 1JP7A 5IH3A 3SDBA 3T9BA 1ADGA 3W8FA 1ZVQA 4ZQGA 2DHDA 5FA6A 3A8TA 3M6XA 1PZNA 1A69A 3PQDA 2I7CA 3EARA 4HLQB 1RQPA 1F4PA 1I5EA 1E6CA 2I2BA 2BGUA 3EDOA 1RKQA 1QPGA 2UUPA 4OUDA 5EIAA 1EEHA 3QLVC 2ATXA 3H6GA 1P5HA 1RQNA 2A1UA 3QTLA 4LVUA 4P54A 3WRVA 1TRHA 3QKSB 1WPXA 5ES4B 2OCBA 3GELA 4LW8A 3LKVA 1OPXA 3O8NA 1HX7A 5E6UB 3WWYA 4JJ7A 4P84A 2OO7A 2WJZB 2F9FA 4Q4CA 1BHSA 2PJUA 3SC6A 2FETA 2HBZA 3TBKA 4ZALA 1QHXA 4XFDA 4U2FA 5DT2A 3A9WA 3BWEA 4N9QA 3UAOA 3FR7A 4NULA 4DCVA 1VYUA 4Z6KA 5B58C 1QB7A 2WE7A 3V9PA 4OOEA 4Z4GA 4I3FA 1A50B 1XBTA 3QEJA 4B4WA 1PN3A 2VJLA 5BQFA 3O4FA 1E6UA 2BMEA 2K7ZA 2FPMA 3GCXA 4DSZA 1XFAA 1S7GA 3K2BA 4INZA 1G21B 4MW6A 3V55A 4NU8X 1ZI6A 4XUDA 2CNBA 5HG0A 3S27A 1U02A 4LDPA 3STHA 1E9VA 2VNIA 3NV9A 1KK2A 2FXVA 1AHNA 4MQ5A 4KREA 5TC4A 1U3WA 2VJBA 2BCGY 1SQFA 1OBHA 5FA5A 3K96A 4TX1A 4DLYA 4JN6B 4YO7A 4CM4B 3VHQA 4TS3A 1CCWA 4ZZIA 3VMFA 4WUTA 1FIUA 1C1XA 2DPYA 4P31A 1JE1A 5JC8A 3SF8B 2ZB2A 1QHFA 4J91A 4XR4A 3OF5A 2QK4A 1RHUA 3L40A 2WSMA 3FFAA 5KJEA 4GX5A 3LKDA 3LYHA 4LKRA 1EVQA 3PITA 5U4QA 4FWTA 3EXFB 1A9YA 2CBGA 2CKMA 2WHYA 3OZ7A 4MQEA 1G9TA 2HM7A 3N2KB 3UM9A 3UV7A 1Z83A 3MJFA 4BX9A 2YXDA 4YCDA 1C29B 2AXPA 4X7BA 1IHPA 2O7QA 3O84A 4TTPA 1W48A 1CQIA 2JB9A 1DTWB 2ZQ5A 1OH5A 3DE4X 4MI6A 3TFOA 1NR1A 4Y1EA 3TUZC 4C20A 3DDCA 1II0A 1SBZA 1CQPA 4RPIA 1TEZA 3M5CA 1XE3A 4W1QA 5JECA 4MJLA 1OLXA 1VZ2A 4DSUA 4RDHA 4JLBA 4D5GA 3GLGA 4KXXA 1V3VA 3QVJA 3RTEA 2YIVX 4JYBA 3C4JA 2V8OA 1ORRA 1HNXB 1Y3DE 2HC9A 3KIPA 2Q3HA 4MLDA 4WJLA 1R6AA 4P9NA 2FZ4A 2Y1LA 3QFCA 3NM5A 1QVZA 4OAOA 4KQFA 3UIEA 2FPKA 2XNSA 3KAPA 4NEQA 2NP7A 1C7RA 4OUDB 4AJEA 2GN1A 3M3PA 4RC9A 2YWBA 5AI8A 4DG5A 5BXYA 1NC1A 2A1UB 2JFUA 3OOHA 4JLVA 5HRAA 1Z0KA 4NTZA 5D8DA 3IESA 3L0YA 1L5WA 2WA1A 3PQ7A 2NUTB 2NMVA 1HT0A 6LDHA 2Q45A 2IY9A 2W37A 5CMLA 5EEHA 1TD9A 1G8MA 1Q77A 4YEDA 1PT8A 4WKGA 5JY1A 2H4ZA 2XWSA 1GKYA 3ZY5A 3K6SA 3RYIA 1WUJS 2LDBA 3PUKA 4P3PA 3X0DA 3UAGA 2E4UA 4ZWNA 4OY3A 2IFTA 5DASA 1AH2A 3NX4A 3QLVA 1MRSA 4FFRA 2TMKA 4GX2A 1Z2EA 1AZTA 4XYEA 5HBRA 1SIBE 2I8CA 4K46A 1GTZA 1U1IA 2H1FA 1DHTA 4QBGB 4KFSA 4J29A 3X2FA 4F3TA 4EW1A 4XWTA 5EZQA 3EEBA 4NARA 3INGA 9MHTA 3BD7A 3TQOA 1PU2A 1U28A 2RGCA 3HCEA 1C1XB 3L6EA 1JSLA 4GW3A 5JEEA 5IULC 1BDHA 4BKPA 2JI9A 3F6EX 4GPEA 2DOKA 3PXAA 4LZLA 4OREX 3IA2A 3L7LA 4UNQA 3U0BA 5BVGA 3JZMA 1IPFA 1YTLA 2L42A 4FTWA 5I7OA 3GJTA 2FX5A 1JEOA 4MQEB 3T3PB 1SULA 2V45A 4CF4A 4HB0A 1K0UA 1LA2A 1XDWA 1BQ3A 4HTFA 3TIFA 3RW9A 4YMLA 5JROA 4HLUA 3V4OA 1U0FA 4LCBA 5CH3A 2GR9A 3TOSA 3HVKA 2AD1A 2DGDA 4TLDA 5A6SB 3B5JA 4LFAB 2X19A 3RIMA 3UBTA 2JVJA 1D8AA 4G67A 4HC4A 5EQTA 5EWLA 4JI7B 3TIXB 3HRIA 4FS8A 1UBHS 2G09A 4M22A 5CBPA 2JIPA 2NVBA 2A14A 5BSWA 1Q1AA 3GFSA 2GS9A 2WWXA 3WAJA 1C30A 2NXWA 3LFTA 2QD4A 3FBWA 4ROTA 4X7PA 2X5OA 2Z5GA 2Q7XA 4HHEA 1CZNA 4MHSA 4G0VA 1T4BA 4YRGA 3ROFA 2XUFA 1Z4NA 2IIQA 3O4VA 1PV2A 4UQOA 4QL3A 5CJJA 5JWHA 4KPEC 4GH5A 4PTLA 2XOKD 3AR4A 2NUPB 9ATCA 3M6VA 1JMVA 1V4VA 1TM1E 4A0HA 1X15A 4BNJA 3NGXA 2O2CA 3CLTC 2JFFA 2C95A 3ZGNA 4YAWA 2QPOA 3TI9A 3C2QA 3ZXSA 1HDZA 1FTSA 3KXIA 4KH0A 3RU2A 3W0LB 4QEDA 3ZHYA 4BBJA 3HJBA 1PHRA 5FV7A 4PGAA 1CR0A 1JIIA 2WBLC 1SQSA 1U6JA 2R62A 5AR1A 4RTQA 5IKEA 1S3SA 2W6ZA 5JS8A 1COZA 4NZYA 3EMKA 3Q1LA 3SMQA 3RYIB 5AW6A 1NT4A 3ECSA 5BMOA 1AX9A 1KTIA 1Z6QA 4DREA 2JFNA 2R96A 4F72A 3GVXA 3ITEA 1Z17A 4BQFA 2NX2A 2VSNA 5DNUA 1TO6A 4JT8A 1T35A 2OM2A 4RKWA 2WC1A 2OHHA 2BJWA 1FE8A 1NFFA 3LA6A 1Y4UA 2B82A 5LZ5A 4XIJA 2GILA 2HA3A 2GVNA 1JT2A 4CIVA 4YMTA 1EKXA 1WETA 2AG8A 3ZIUA 1NJ1A 4N54A 4RQTA 1XVTA 4JGIA 5ED0A 5TX7A 1SUDA 1NYTA 1MOPA 5BVGB 1YI8A 2PKEA 3EF3A 3NHRA 3AI3A 3QYFA 3V1NA 3OCXA 1CF4A 2R25B 2LRHA 1G20E 4BFCA 2PUDA 1QQBA 3JQBC 2CMKA 3BE6A 1JR3D 2J3MA 3K4QA 1BS1A 4G8BA 3UKOA 3KUXA 3UHJA 4HTFB 5C53B 2NV0A 2Q5FA 1CQJA 3GFPA 1UDXA 3N53A 2PEZA 1QYXA 4ZXPA 3WHIA 4TQAA 2J5BA 4DNPA 2B6HA 4ZMRA 1M6EX 1ZOLA 2P6OA 3UWDA 13PKA 4PRKA 4FB4A 3ZHUA 3OQMA 1IE3A 4LHZA 1OF1A 2O07A 2VUSA 3CWCA 3KQOA 1I2CA 4OKIA 4OIFA 2C7OA 1D4ZA 5JS1A 4QECA 5EWLB 1ZUWA 2IXEA 2AOWA 2ZCUA 3TECE 1U4SA 1KOGA 4ZT4A 2V6IA 1RVV1 1QIJA 1AQJA 3PWSA 3Q5GA 1W5FA 5LBTA 5FPTA 1RS0A 2QT0A 4Q82A 3SX0A 2R6AA 4IXWA 4QUDA 1C30B 1CRLA 2BMWA 2BEJA 2XUPA 3H5LA 3TD9A 2AZDA 4KXFB 2W70A 3LXUX 1V5WA 4JH0A 1PQPA 2G4VA 3ZDFA 4F3NA 2C1EA 2NM0A 4FE3A 1S8OA 5TQ0B 2A86A 1DB3A 3WZLA 4B2LA 3EWIA 2SKEA 2C9DA 3LRPA 2ZB7A 1YVDA 5K2MA 3HJHA 1VMIA 2G9ZA 4BMZA 1UM8A 1YRYE 3F9IA 4KR9A 3ROMA 1OFUX 3U1TA 3PL5A 4UNRA 5KYWA 4K86A 2QXYA 3MA0A 4D82A 3HM2A 1Y89A 2NYVA 2C8LA 4HDSA 1RJDA 3EA4A 2JCYA 4MV4A 4NBKA 1C3EA 2QN2A 3AF2A 3NRJA 4IDBA 4O4JA 4KVAA 5CLHA 4D99A 4DCTA 2BTEA 1M0EA 3R6TA 3IV7A 3ORFA 3V7NA 3KTOA 5KNBH 1R74A 3IMEA 1SKQA 1PVOA 4B4OA 1OB2A 1ZI9A 4QTTB 3LUDA 3H2ZA 4LJ5A 5FD8A 3O4JA 3LL7A 4AMGA 5IWCA 5TPWA 4BKMA 1XEWX 3CVJA 4L16A 4OCZA 3DR5A 3IDQA 4MS1B 4PX9A 4H31A 4WQMA 3TFQA 4BB9A 3TRJA 5A5GA 5K0FA 1OR8A 5LMCA 1ODCA 1XKTA 4DIBA 1C3OB 4OB6A 3H16A 1T2EA 1I33A 1JSZA 4A8TA 1FSPA 2JJ1A 2F17A 5LVAA 1TEHA 2E4AA 3VHRA 4M7PA 4GRDA 5K3AA 5FBKA 1YC5A 4BVAA 2W2MA 2QE7D 3LZ6A 1F8YA 2FNAA 4C0HA 3K2IA 5JO9A 2XD9A 4Q4AA 1F51E 1P19A 5FL7D 5IP5A 3OCWA 1QLWA 3PX3A 1QF7A 1KEEB 4P35A 3OIVA 3WNCA 4RVFA 5E1BA 4S05A 2FCAA 4GXQA 3IAXA 1PJ8A 5ECYA 2FDXA 2WEKA 2QL5A 1U8ZA 2WJGA 5FWXA 2NU8A 1J8FA 4S12A 1R5BA 1X7DA 1KWKA 2AMYA 1QIDA 2OYSA 4TTAA 4MR8B 4G5OA 2C59A 4ZARA 3VSAA 4BYMA 2ZSIA 4TZTA 4R1LA 4JLNA 4PVCA 3MQ2A 4LGMA 4LFCB 1SXJE 4UQPA 4G2TA 3IJ5A 3B1XA 5G1NA 1KPIA 2QNRA 4QEZA 3V7YA 1A8UA 3WYAA 4C2BA 4X91A 1UBTS 2IPOA 3P9NA 5HS6A 3J81A 3IUQA 1T4CA 2X0KA 3IAFA 3GN1A 1XEAA 2UVDA 2VHWA 4IFBA 4C6TA 2CDNA 5KZMB 4R8RA 3HH8A 4YMVA 1NRIA 3ETLA 3GPCA 4NBUA 5FI5A 3QG1A 1Y7PA 3QOYA 4Q1VA 2HTEA 4OXKA 4Q7KA 3ASYA 1ZICA 3CSSA 5H7XA 4YMWA 4J1SA 2GD6A 4D0SA 2OD9A 1FS4A 5KYWB 3LC0A 3TVDA 1XLVA 1QV9A 2XMPA 4IFEA 4TS4A 2QN9A 5LP6C 5J23A 4ZV7A 2YH2A 4MVJI 4O4JB 4R8KA 1Q20A 3OG9A 4QXAA 4HT3B 2G4CA 5B6JA 2GB4A 3VR6D 2HNKA 4JB0A 5BY2A 4E3ZA 1QAMA 2X1HA 2P90A 4H7KA 5HDQA 3UMJA 2GPAA 1GL7A 1QO0A 2FWBA 4YRTA 1LXCA 4D42A 5AOCA 1Y33E 5LQUA 2O3TA 5I7HA 2GHQA 3FD8A 5TPWB 1M73E 1CP2A 4R5MA 2AI3A 3RV4A 1XEWY 2BP7A 1D04A 1E8NA 3CZAA 3Q7SA 2OXCA 1QPZA 1SVUA 2ZUCA 3E9RA 4UKDA 4CKWA 3AM3A 2B4QA 5D3MA 4ZO7A 4ZQCB 3P20A 3TEFA 2GBGA 2FEOA 2HADA 4Q1DA 1L6RA 3JD0A 5IAAA 1FNBA 2CDBA 4V2IA 2BUBA 2EC5A 3WFZA 2VQ3A 4GR9A 4N39A 2C4MA 4BCDA 1TAHA 2WYOA 1WPRA 2PN1A 3A6DA 1A4RA 1V35A 2B7LA 2C3YA 3FROA 1FFCA 3JZDA 3QLJA 1XMJA 3CR3C 3PXEA 2XNHA 4ESHA 4WRRA 2FFJA 1ZLXA 2H5EA 1N5LA 3C8DA 4Q4AB 1R0SA 4RPJA 4YP7A 1RW4A 2QUBA 1LDGA 3U6KA 2WVJA 2HNBA 2J9FB 1JW9B 1UFRA 2UKDA 2Y99A 1QG4A 2ZI9A 3BEDA 1FU7A 4GX0A 4KQ9A 5KKNB 2O06A 3WVNA 5IASA 2ODBA 4EZIA 3HBJA 3ESCA 2QY9A 1ZGZA 3QE2A 1E3DA 3DMHA 3U3OA 3V4VB 5FWXB 3RSLA 1NPDA 1VL1A 1C4XA 2QVLA 3P97A 4WW0A 4QODA 4DDMA 9GPBA 5K8LA 3UCFA 3OPMA 3WC4A 4LOKA 1ADCA 2J6BA 4UATA 1RZVA 3LIIA 1AK9A 2E87A 4YGXB 3M5PA 4MX8A 4ON9A 4RKYA 4BWFB 1A5AB 1QKIA 4NYJQ 4BATA 1RLMA 1WOYA 4KIFA 1ZR4A 1RWKA 4QWWA 3TZCA 4MZDA 3G2PA 3NWEA 4L22A 2Y71A 1XXHA 3RAJA 3VAZA 1HM5A 2OV2A 2BM1A 3P9ZA 5AWFC 3WKAA 1R9MA 3GI1A 1EDZA 4OJTA 3TDNA 4C6TB 3Q3VA 1SCIA 1Y6GA 1JG7A 3S5JA 3CVWA 3KZNA 3LGSA 4XQCA 2I6TA 3L8HA 4YI5A 4BNWA 2HFJA 4DIMA 3AY0A 3L7NA 3HCBA 2OWEA 5I7VA 1KOJA 2WJJA 5CDYA 5M7EA 1JU3A 3U62A 4IKEA 2D00A 2A1TR 2PU7A 1DE0A 2QTFA 2Y0CA 1IONA 3GJ8A 3QXSA 5K5EA 1Y9DA 4MMZB 2MYUA 1VYHA 2VUHB 3EEQA 3LY7A 1NQAO 3QEMA 3LVBA 2O6HA 3MAAC 2CJWB 4HYTA 1L4YA 3WBFA 4AWBA 3L5OA 1SR8A 2NO5A 1BMDA 1PUXA 1XNGA 5TQJA 3PPWA 5CFLA 5MFZA 3PJGA 4BFZA 5AM0A 3W2IA 4I2VA 4TM8A 4WOBA 4G8DA 5EP4A 5FI0B 3UAZA 1DAKA 3U4DA 1ZKMA 2K87A 3EA5A 3SFVA 4DLKA 4DR3B 1MGPA 1KH3A 2PMKA 4E5DA 3ZCPA 5GV7A 1ECJA 1UEXC 3V32A 3KCQA 4HF7A 5B2ZA 1A8QA 2BP7B 2WM9B 4TT8A 3BTUA 4Q9IA 1SXQA 2X7XA 3AY3A 3FWYA 4ZEXA 4JXXA 4Z4EA 1W1IA 2H63A 1UDBA 4AZ3A 4CKWB 3ICEA 1G3IA 1OZ0A 4I1RA 2BGLA 4JA0A 5D3MB 3X1YA 3PXBA 1HDOA 4HN4B 3LUKA 3R7WA 3G0DA 2BEUA 4PAMA 1LI5A 1OIXA 1U90A 1UDAA 4EW2A 4KAJA 1PJSA 4NENA 3QY9A 2YY7A 5AOVA 2BGNA 3UC5A 3LCUA 3ERCA 3GZ4A 4M49A 3D7LA 2BH9A 2DKFA 3QU2A 1IZ8A 3BRCA 1T6ZA 5AK6A 3AEUA 5P8WA 1GQRA 1HKUA 4TKVA 1BMQA 1VLMA 1XYYA 4KWIA 4ALLA 5G3YA 4B76A 2VOJA 2WNSA 2I34A 5J58A 3GC6A 3H0EA 3AKYA 1WTCA 2V7VA 2WHPA 1U8UA 3V1KA 4Z3DA 1RRMA 8LDHA 3H3XA 3WA7A 3ZLJA 1H0KA 1ISFA 3NTOA 3FOBA 1Y4ZA 5CPBA 1FLVA 1D0SA 1EA5A 1JIJA 3CPSA 2YJ5A 4CKCA 1E20A 3O8LA 4IH1A 4IGAA 3A1VA 1ORHA 3D6JA 2JIDA 3IP9A 2P4SA 2Q3JA 3IUMA 3OFVA 1ZJ5A 4FEYA 5E6SA 2GLTA 5F3RA 4MXDA 3UMBA 3BH0A 3IHTA 5D3KA 4C3ZA 2YN0A 4E14A 1ST2A 2C42A 1QHEA 4PYJA 5EJ6A 4RAOA 1XXHB 4PLYA 3AZQA 2OCYC 4G89A 1IIBA 4L4UA 2DLCX 4FQ8A 5CA0F 1BEUB 3I6IA 3M3HA 1L4LA 4L9SA 4NCHA 1ZNYA 5LXTA 1RZ3A 4R41A 4QZVA 1XRNA 2B2NA 2LKDA 1NPTO 3DNPA 3I30X 5SY4A 3CLUD 4FFWA 3ER9A 3CX8A 4M9XA 1CR2A 1H2FA 2Y1EA 3G2OA 3K32A 1X7XA 3CLRD 1USVA 1XMSA 1ZRHA 3AJ9A 3MFQA 1K88A 4EDFA 3O1JC 4OXIA 4OYHA 1HC7A 1Q19A 2J8ZA 3QEMB 1KMIY 3TLCA 2BBWA 2OMKA 3QELB 1JXQA 4CQMA 3OEEA 3LVQE 3F7MA 2VK4A 4OJMX 1R9GA 1UKAA 2V58A 4Q1CA 5IM5A 4J0DA 3KS9A 3W5JA 3DYBA 4IQ4A 1IWBB 1G7CA 4UTVA 2XWBF 1L5VA 1Z73A 4AN0A 1W2HA 3JU3A 4H59A 1ESNA 4D4GA 3MHPA 3E9EA 4KWEA 3WSVA 1IBMB 4LV8B 3Q72A 3LX8A 4M99A 3OTIA 4P6VF 4N3GA 4BNVA 2J5RA 2N42A 1KQFA 3EXG2 4RKFA 1LH0A 4ZYYA 4AZ3B 3AMVA 3HUEA 5J4HA 3UPTA 1LSOA 3R7WB 4F3YA 3CVVA 4LHWA 4U3JA 1I0IA 3VPGA 3VYUB 3W3ZB 2BFDA 3RSSA 2BI4A 4NCAA 2X8JA 2YKGA 2OGWA 4HGQA 3RUHA 4NENB 1Q2UA 5DW3A 3O74A 2APJA 3OPYI 1U7PA 3P5SA 4FYYA 3TWOA 2J30A 3CRMA 3MF4A 5TEWA 2AA3A 2EU8A 3FYCA 2SHKA 2WM3A 2BSAA 2K5UA 4IRUB 4JASB 1LU9A 4NESA 1N0UA 4BQOA 2DB3A 4LI3X 4XIYA 1SZCA 1FXUA 3RRFA 3HB9A 2G82A 2OC4A 2VDLB 4TKVB 5FLEX 4Z5XA 2JRLA 5THQA 2RHJA 1YE8A 4PQGA 3B7PA 2G80A 3RUAA 4C4AA 1EDEA 2K2WA 3FGZA 3THSA 2WHPB 1X14A 3ECAA 3KWMA 4YJ3A 4YAGA 1K97A 4EL5A 3CGGA 2FUKA 2EFGA 2CV0A 4GPBA 4P8RA 3X1KA 4CKCB 4HQ0A 1ZJJA 2EDCA 2UVQA 3PTLA 5FFMA 5THXA 4BHTA 5F3WB 3D4LA 1T15A 3BE5A 3B7GA 5DZSA 5TPZD 4TSRA 4JLPA 2PO5A 2ZIUB 3KELA 4LRTB 2X4DA 4GI1A 4WVLA 1VCMA 1ANKA 4M4SA 4EABA 4LY9A 1JIQA 5K0EA 1PYOA 3TJRA 2V1UA 1AG9A 3WWCA 3P8ZA 1ORTA 3B60A 4AG3A 2UXBB 1PD1A 1JR2A 4G25A 5DWDA 3C3EA 3GAAA 2R1ZA 4JKIA 4RULA 4Y98A 4K6FA 4D0GA 1T2VA 5CDTA 3B9QA 4IXMA 1TIBA 1BMFA 3WSWA 2W71A 1U7UA 3I1FA 4XE5A 4QGBA 2ROQA 3EVNA 1H2AS 5CAEB 5ALQA 621PA 1H9AA 3LWDA 3ZU5A 3D8TA 3EBPA 1OVMA 1RCFA 3G2LA 5GJCA 1KE1A 5I8PA 1X7XB 2X5XA 3NT4A 2Q6LA 4H6PA 3ZHSA 1UDWA 1RZRA 4DMKA 1UP6A 4P58A 5HF9A 2WYIA 3K9QO 2CN1A 2EX0A 4KPYA 1YE3A 2OK8A 3WRXC 1TGVA 4C6SA 3G0HA 2CJPA 1ZVKA 3F6YA 1QF9A 1YL6A 4G4SP 4M1TA 4BO5A 3PLNA 4CQMB 1H6CA 2A9PA 4RELA 3KEMA 1GQSA 2PUTA 4HBZA 4LDJA 1QFZA 4Z2YA 4G37A 1QIKA 1M8GA 2GAJA 3ZE9A 3SX2A 4AICA 4O4JF 3TX6A 4LHYA 5BYJA 2W6JA 2ZULA 1OTXA 1PR0A 1T1IA 3A1FA 1I6LA 3KQTA 4MYRA 4B33A 1JPVA 2E4XA 2PQ6A 3UW3A 1HT2E 4BPRA 3B1WA 3BIFA 3PDHA 2QTNA 3MGBA 4GM4A 3HLYA 5AKZA 4CEHA 1ZP6A 2IQ5A 2J3KA 2IF0A 1EDDA 1Z75A 1Q3TA 1YU9A 4TMKA 2GBIA 5FPQA 3K1TA 3CV3A 4HMOA 3RSOA 4Y3UA 2I1QA 2OO5C 1GZDA 3PTAA 2Z6UA 2X8JB 4HDQB 1P4GA 2JGAA 4E22A 5IC4A 5JSFA 4KQKA 2ZUEA 4E88A 3RNLA 2XKKA 3HR7A 4GZMA 4KU4A 2A0WA 4PYKA 4UAUA 4K8RB 4OGGA 2GX6A 4PIVA 5J1TB 2ES4A 2GKGA 3HCPA 4G85A 4I08A 4UJ3A 1I0LA 2YVLA 4ZCLA 4DMRA 4Q6BA 4GLBA 2X4GA 3AFOA 5EGNA 5ALYA 1G8AA 4XTCS 3B6MA 4LRUA 3AO0B 4CHGA 4DZRA 1QIEA 1TCCA 5JLJA 1XO1A 3FNEA 1EAYA 1P7YA 4HB4A 3F6SA 1NR7A 2JFWA 2MR5A 3WGKA 2GXAA 5AI5A 2MINA 2D6FA 3E7FA 3T7JA 1QLHA 4GOND 4B5LA 1IHUA 3TR6A 5IAGA 1IEQA 4IINA 3HJRA 3L2OB 3MWFA 4R6XA 5F9HA 3BXOA 1HE5A 4CR7A 2EW1A 1FTGA 3NVAA 4MULA 3IHLA 1W7AA 2IH4A 3GJ3A 2DQKA 4ZYWA 3N6VA 4JQOA 4L75A 1TZKA 3RJ5A 3WLRA 4Z7OB 4D46A 1DX4A 3LQYA 4K88A 4RU1A 1MNAA 4TLEA 4X92A 5FHQA 1A72A 1QFSA 4LF9B 4B82A 3PUYA 2VT7A 1A4XA 1ZIOA 1Z34A 2VT6A 3TQIA 2DR2A 4OX9B 3NOQA 4EQ6A 2A7QA 4QXRA 2D8AA 3V80A 4FDAA 2ZU6A 1MG0A 2OBNA 2OR3A 2RI6A 2QUAA 4R01A 3WV5A 1LQUA 4ZHSA 1JAYA 1ESDA 2PL1A 1S8AA 4IIYA 1KRXA 2JJ2A 1HDGO 1HEIA 3MJVA 3KT3A 2QS9A 1SOAA 1Y42X 4EGJA 1G42A 2C2XA 1WD5A 1NYQA 3CISA 3DYVA 2EBUA 3M9LA 4RIFA 1O97D 1GV1A 1AKNA 3I53A 4S1PA 2ZUVA 5EUQB 1UP4A 2ZJ1A 1NG9A 3FW1A 2AZTA 4I4TB 3X44A 3H5WA 4IM7A 1G3QA 4ZCPA 3TLYA 1HOXA 1NOKA 2GFIA 2VQSA 2G07A 2IIPA 3A58B 2GEBA 1B43A 3C6ZA 3QVUA 5TARA 3V5NA 5I3ZA 3CIOA 3SBEA 3LYAA 1VJ1A 3AVYA 2AJDA 2EKBA 1JIVA 1WP4A 4XVHA 1MQAA 4ZI7A 1T1SA 2PSFA 3THYB 4KW7A 4O25A 3Q5DA 4GDFA 2ZIGA 3HO6A 4WOPA 2OQRA 3LVRE 2IH2A 1Z2DA 1O9BA 1W2WB 2RKBA 1IJBA 3WGJA 4KN6A 3HP4A 1S2NA 2P9HA 3F78A 4AP9A 1XMXA 1DC6A 1QO7A 5C8ZA 4RGVA 2WZQA 1QHIA 3ZU6A 4D4MA 3ZGOA 3X43A 1QM5A 1YACA 3B6KA 4AX8A 5FYDA 4C0XA 1U3VA 3UMRA 1XMPA 2I7XA 1G5FA 2MDTA 2PGJA 2X42A 3MINA 2VQDA 4JUDX 4TMWA 3KTAA 1HFWA 1GRNA 3BDIA 3I73A 4GZ3A 1TTHA 1C9YA 2R66A 4XVQA 3NNSA 1OX5A 2AW5A 2DUUA 3ER6A 1PW7A 3LQ1A 2P3SA 5CNKA 5B3AA 2O8NA 5C1PA 1J8DA 1X6VA 3A9VA 1X7HA 4X44A 1HDYA 3ROTA 1P4SA 5B55A 1TM3E 1XI2A 4PNPA 2QX8A 2P1ZA 4HYYA 2R60A 3NTUA 1VKOA 1JGTA 2ZVPX 4ZT5A 3DOUA 4BMPB 4EY8A 3V3TA 4X7RA 2EFHB 4UZEA 1TCVA 2WU8A 3RAPR 4ACBA 1FTWA 5HKLA 2WT9A 2BUAA 3EY4A 2P3OA 4UCXA 1BA2A 5TXGA 4ZT3A 3MRVA 4Q01A 4CW7A 1XQXA 3AKEA 3B8EA 3VAAA 3NATA 3ZDQA 3KJFA 1VCHA 3MLBA 5FUYA 3ROXA 4BRZA 4DWWA 5LDDC 2D1YA 2FMFA 2IPAB 4IKPA 4ENVA 1AMOA 1BFUA 4RMIA 3L84A 3REQA 1MP0A 1Z26A 2VNSA 3WRWA 1BHO1 1GCGA 2JK1A 3EFOB 2P7HA 3LP6A 4TROA 3B53X 3U7QB 5HR5A 5B2EA 1W73A 3OSUA 5SICE 1KSFX 1E9CA 1P6QA 1QR2A 1L1EA 1W4ZA 2IXFA 2ZWPA 2FQWA 3G0IA 4TSFA 5CK4A 3W1EA 4CKBA 3AKDA 4RFSA 3DOJA 4ZOLA 3G49A 1ID8A 2P4HX 5DK6A 3IMFA 2O3UA 4EQ6B 1PNOA 1ADFA 1X2EA 1XCMA 1YQGA 1Z0ZA 4B8ZA 1W4BA 2QT9A 1E1MA 4Y30A 1H5UA 1EG7A 1I5OA 2J33A 4BPBA 1OLUA 1U0EA 1OZHA 4YV7A 4ZCMA 3M49A 3JD3A 2A57A 3WIVA 1ZD3A 3BRSA 5JDIC 3TJMA 1KYIA 1QV6A 4D6XA 2GZ3A 3PC6A 5ITSA 2K2QB 3FOAA 3F7NA 2ORWA 3K9NA 4O08A 2ZIEA 4PWZA 3BD9A 1PS9A 2BGIA 3D7SA 4X64B 3P2YA 1AO3A 2DFPA 4JB3A 4NE9A 4J0EA 4UPVA 5ELXA 2QI9C 4O4HB 4I1SA 5D1HA 4ROSA 3AGPA 3SS7X 3EK2A 5D5PA 1P3Y1 2JGNA 2Z8YM 3K2QA 4ND7A 1M74A 3CXRA 2P6MA 1N92A 1XZHA 1I6KA 2ZP1A 5HFJA 1KPGA 3IUBA 3IE0A 3IDOA 3ILHA 3WAKA 3DVQX 3CSUA 4ZYXA 3COJA 3L8EA 2PRSA 4PU0A 1NUUA 3VU3A 5K03A 4DLNA 1MDFA 5HIMA 4OXYA 1CUJA 1LUAA 2EFEB 1TPZA 2MYPA 2VJDA 3I62A 2X5JO 5FR2A 2VTBB 3FOZA 2F48A 5L3ZA 2ST1A 5BR4A 3KTAB 1ETHA 1U8YA 2OECA 1FRZA 3DP7A 3EY9A 4LJAA 4ITUA 5CGZA 3KZXA 5KI6A 2JLCA 1U4NA 1N3BA 1N8SA 1YT5A 3T06B 4Y8VA 4KFRA 5EXDA 2EJWA 1YVRA 2OOSA 1LW6E 4L15A 3UH1A 3EGXA 1FTQA 1RZUA 2H4YA 5TQVA 3P52A 4PM4A 5LP6F 3CVOA 1M0TA 3K6JA 1NBMA 3MT8A 3UV6A 4FM9A 1LRLA 2PTHA 3D6VA 4KO1S 3RC3A 1WSDA 5H80A 1JAIA 1P3DA 5GAJA 5HGXA 5FUWA 3MRSA 3DTVD 2UZ3A 3I3OA 4CLRA 3T1TA 2EFYA 2I2WA 5BR7A 1N0VC 5EHQA 4KOEC 3NTQA 3VGJA 1CNFA 3D4PA 3QVOA 4NABA 3CC8A 4OL0A 4XGKA 1IN7A 1NLZA 1ZD9A 4C6RA 1RRGA 2GPYA 5C4GB 3EVTA 4EO4A 2SCUA 5B57C 3UO8B 4E12A 2XQVA 1MB3A 2QYHA 3L8YA 4V0QA 4AXXA 2PHZA 4LDNA 3U4CA 4ZTUB 1HTBA 1L7PA 2WUFA 3EXHA 2B37A 1STOA 5CYPA 4OQZA 4OAPA 1QTIA 3REQB 3TW8A 4BGDA 3MUNA 1H5NA 2JI8A 4PHHA 4W1RA 1Z5ZA 2Q5QA 5GADl 1GPH1 2EF0A 1YGYA 2IY7A 3AM1A 2HYDA 3PPYA 2AFHE 5JVDB 1ZQ9A 4Z51A 5IT5A 3A26A 3KZCA 5AHWA 1VG1A 4Q4HB 4MVJP 4Z7QB 3IS3A 4M0CA 4RFSB 2JFHA 1LDBA 1UC8A 2W6PA 3HNRA 2W2LA 3PCRB 4ILKA 2E3JA 4ZOLB 3A06A 3UMSA 3EPPA 3WIEA 1HL3A 2OE2A 4YRRA 3VH4A 4FBGA 2CZGA 3OSZA 2W8BA 3BIXA 4HWGA 5DE3A 5IVPA 4L6CA 4TTRA 5EUMA 3NTVA 2GAOA 4JD5A 4KLAA 5DIZA 5SYNA 1BH6A 3QVMA 4NK5A 4PG4A 2YHAA 5E9QA 3QEOA 3E15A 3TQQA 5AJVB 1W25A 4U2EA 4CLEA 1BVHA 2OV1A 1E1QA 3F98A 1YCGA 2XBMA 1VKZA 3UN1A 4B3RB 4OD0A 4OHRA 2ZJ7A 1PJ4A 2W2KA 2XGMA 4JJZA 3UJDA 2CNKA 2EDAA 3KSMA 3LU1A 4JSRA 4V39A 4DV3B 4NEHB 3ILXA 2DHEA 4QGAA 4RZ3A 3I4FA 4ZVLA 5LWQA 2PUGA 3PA6A 1QB8A 3X1DA 3EG5A 1SU7A 3CU5A 4RUKA 3H3FA 1MU0A 1H2BA 4IJWA 4XZ3A 3VJKA 3KDAA 4C3OB 3K9BA 1YZTA 4LMPA 5JDIA 2W43A 3GMTA 4FYXA 1EK6A 4DEVA 2DLNA 3W4IA 1WLSA 4FSDA 1GCOA 1SOWA 3U9TA 3DBHA 5CIWA 3OZAA 4UCQA 4ZVVA 3IEVA 2JFYA 1OTHA 3E7WA 4BMYA 2TMDA 2OBBA 3OQOA 4N82A 2BIFA 1BXZA 2WPDA 3A0RB 5J4KA 4RTKA 4B9EA 1RWNA 2F3SA 3IB6A 3OJOA 3E5NA 2DRIA 1YB7A 3AC0A 4M7WA 4PYRA 3LO5A 3F2IA 2ORIA 1F8FA 1H22A 4IV0A 1GNPA 4L5CA 4PW0A 1GAWA 1E8DA 4QOHA 4DNQA 4Z4QA 4R16A 1ZKDA 5G4KB 1P1KA 4O29A 1OWOA 1CYDA 1NJGA 2DHCA 1HLGA 2PUJA 1ZHHA 1FSSA 3H7IA 3A3YA 3PUIA 3RS2A 5FUMA 3CVXA 3EPHA 1WMAA 4MKHA 4TYNA 1NKTA 2OGSA 3EQ7A 4R9UC 4Z4HA 4QHYA 2ZBVA 2GA8A 1ODLA 1WU8A 2EERA 4TLAA 4KXQA 1QK3A 3PFKA 3UATA 3EXHB 5U9CA 1B2LA 3E1KA 1YRAA 5E6RA 3VR5H 1FDSA 3QBTA 2PX3A 4G86A 2YYSA 1VLVA 1DJPA 1USWA 1YJ8A 2Q5EA 4MMXB 4PCAA 3T3NA 3G88A 3QPDA 4Z7NB 4MR7A 1M2KA 3F4KA 3G02A 4P53A 1R0YA 2CFRA 2BRUC 4NZZA 3QI2A 3SXPA 5GY7A 3JQPA 1YR2A 2RGWA 3O21A 3TLEA 4P36A 4X7MA 2OV4A 3ZDBA 1Q44A 1D2AA 1MAVA 2IEBA 4F4JA 2B1JA 5ALTA 3DZKA 1NVTA 3QW2A 4OTZA 4R9VA 4JODA 3VJLA 3DXZA 4UHEA 3FHJA 4MW2A 5E8JA 2OBLA 2O23A 2QZSA 4ZU1X 1UXGA 2XGJA 1TT7A 2IYAA 4AF7A 2CVHA 3PNYA 1G4AE 2G83A 5HQ3B 1K4MA 2J46A 4OMUA 4REOA 5FPPA 1P9OA 3RRMA 3VNAA 5JY6A 1Z8NA 1KIMA 2V6JA 4DQXA 5IU6A 1AIPA 1KMHA 2BKUA 3DAHA 4UHBA 1NN1A 1S2DA 4DCOA 2W2KB 3FCYA 4M0EA 3EDMA 1N0WA 4Z0TA 1PT9A 4I4TF 4GI2A 3W5UA 1KDVA 5JOQA 2V9ZA 1USUA 2A3RA 4U7TB 1FUKA 4L9AA 1BGXT 4EI2A 4C2TA 2ZRGA 4EO9A 5CXQA 3B2QA 3PUXA 4K87A 4RD2A 2XLCA 5TS2A 3ILYA 5KNDA 3HTXA 3OZFA 3FETA 2AE2A 2XX3A 4H1VA 1W0JD 4RL6A 4UM9D 3A4IA 5F1PA 3BB4A 1L4UA 3NIFB 5A9RA 1UC4B 1T26A 4B7XA 3DBHB 3AILA 1APBA 2LGJA 4A8PA 5IKMA 3L6RA 3G0BA 2FLKA 1E7YA 3FTQA 1XC7A 2JFGA 1VL0A 4GZ6A 3U16A 1IY8A 3GWZA 3MWLA 1KJNA 1TIPA 1GFZA 4BJ1A 4C0WA 2C2BA 4XWOA 2CW5A 2A9QA 2A9VA 3ZBQA 4A0FA 3TH5A 1VPDA 2II6A 3RVKA 2BF7A 4CTMA 3H2SA 2F3RA 1SWVA 4MAFA 3C6BA 2BM8A 3L0OA 4JC4A 4KPUA 4UVIA 3TQRA 9LDTA 1OYYA 2YX1A 1T8RA 3TEMA 4EF4A 1C7EA 4V03A 3SE7A 2XA1A 4HPWA 4MLZA 4MWBA 4ZANA 1W5AA 2AJBA 3MQ4A 2GTPA 5I5GA 1T9BA 1M2JA 3LSTA 4HO1X 4I7EA 1U2QA 3JYHA 5F76A 5A7FA 3ZV5A 3BF7A 1KIFA 3GT4A 3LA8A 2FZEA 2A92A 2CNWA 4KNVA 2BFMA 2FRXA 2ZT7A 3HKDB 1JR3E 3C5CA 3W3AA 5E6RB 4NCXA 3RHSA 3QFTA 5EOVA 4UTRA 1CRQA 2E5FA