4ZWNA

Crystal structure of a soluble variant of the monoglyceride lipase from saccharomyces cerevisiae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
SAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFSPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIRDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMKQWLDKHTTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal structure of the Saccharomyces cerevisiae monoglyceride lipase Yju3p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase
total genus 114
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zwnA00
2VQ6A 1CUEA 3BXPA 4JH0A 1ODTC 3G0CA 3IURA 1DWQA 1UK6A 1GZ7A 1C7IA 4J0GA 4BCDA 5AO9A 1YAHA 1N5RA 1VZ2A 1F0NA 1WHTA 2ECFA 5DYYA 1UK7A 5CT9A 4RGYA 4AO7A 2ZSHA 5BOVA 3QMMA 1ACLA 3AZQA 2RIPA 1J2EA 4ZREA 3KWJA 4B80A 3C8HA 4X97A 2Q0XA 2XUJA 5CT4A 3H2KA 1CUJA 4CCYB 4QDXA 2XUOA 3HZOA 4JNCA 4Y2QA 4U2GA 4HZGA 1RP1A 1EI9A 4L9AA 4G4JA 2XMQA 2ROQA 5SYNA 1GKLA 2XQJA 3QPCA 4J7AA 1ORVA 1HLGA 1DINA 4TGLA 1R9NA 2C4HA 4QWWA 1QONA 1X2EA 5CT6A 1CUYA 4Q3KA 1DWOA 4WFJA 3R40A 3FBWA 3H19A 2VTVA 5EHQA 2C7BA 2EDAA 4A23A 1LPNA 3WZMA 2OQVA 1MPXA 1LPAB 3Q0TA 1VLQA 5D3ZA 1VOTA 1CUCA 3G9ZA 1W1IA 2HU5A 4G1FA 1XZJA 4ZI5A 1MT3A 1J1IA 1CUDA 1ODSA 5SYMA 2XT0A 2PSEA 3B12A 1CIJA 2R11A 3V1LA 5EHNA 3GROA 4X3CA 5D3KA 4FMPA 1USWA 3WA7A 3FOBA 1PFQA 3X3HA 5FKJA 2XQFA 1VJ5A 3M81A 4S0XA 2B9VA 2VEOA 4EHBA 4X95A 5CXXA 4NMWA 2OGTA 1E5TA 4G8DA 4IO0A 4X90A 4DSAA 4UBOA 4HRYA 4O08A 4X6XA 4CI9A 4BRSA 1F8UA 2JF0A 1EDBA 2VAVA 4HAIA 2JIDA 3JYHA 4AZ3A 4FFWA 3T4UA 3U1TA 1UXOA 2J4CA 5DJ5A 2WUFA 4J0DA 5LP1A 1ZOIA 3GA7A 4WJLA 3ZWQA 5C81A 4X85A 1A8QA 3O95A 5A7GA 2D5LA 1C4XA 4FBMA 2JGKA 4U2BA 3PUIA 5K3CA 4CG1A 4LYDA 4RE6A 5ALWA 2VAXA 1JT2A 2V9ZA 3E3AA 4H7DA 2PVSA 2DHEA 1EK2A 4MYDA 1S8OA 1CUUA 5LZ4A 5ALRA 3WK8A 3C6YA 4QE3A 4C4ZA 5JAOA 3B3QA 4BCBA 1BEEA 2V97A 4X94A 3D2BA 1T2NA 4W1SA 3G9UA 4B0OA 1GQRA 2Z3ZA 4HXFB 1UFOA 5JAHA 2GBFA 2WFLB 5AI6A 5CXUA 4FLFA 2YASA 5K3FB 2Y2UA 5HQ3B 1P0PA 5AKIA 3O4HA 2I3ZA 4ARAA 3UMJA 1ZIXA 2C0PA 2QS9A 5ALHA 4RPCA 1K4YA 5AM4A 5ALUA 3VDXA 5LIPA 2Z5GA 3AILA 4ETWA 2NW6A 1LPMA 4QWMA 4N5HX 4W1QA 4Y2YA 5JASA 4AX4A 3R41A 3H1BA 4W1PA 2GZRA 3KXPA 4AO8A 4WDQA 3ICVA 4UHDA 4Z49A 5JIBA 1QTRA 2VSQA 4KE7A 1OXMA 5I7UA 4Y7DA 1XRNA 1ZIYA 2HRRA 4J03A 5AM0A 3IIIA 1JMKC 3LIPA 4BP9A 5JAUA 1UZAA 1YSCA 3D2AA 1ORWA 5ALFA 4KYVA 4K6HA 2O7VA 5HF8A 1LPPA 2JGJA 3DOHA 4W63A 1HDEA 1GQSA 3WL7A 3HABA 1IUOA 3QH4A 1LPSA 4BBZA 5CW2A 1SCQA 3L1JA 5FPQA 2PSFA 2FX5A 3TJMA 3WKDA 4GI1A 1Q0RA 4F60A 4G8CA 1K5PA 2XDWA 2XMCA 4DLNA 5D7BA 1ODCA 5KBYA 5JD4A 4P08A 4BZZA 1UKCA 1OCEA 5FDFA 2XUFA 4TVKA 3FCXA 1QIEA 5ESRA 2AJCA 1AUOA 1H2ZA 3WWCA 1LBTA 4J0HA 1K6EA 5JAPA 4BP8A 4BAZA 2BUAA 3C70A 4K6GA 4CG2A 4FLEA 4B9AA 1MU0A 5JALA 4AMZA 1FFEA 4C01A 4LYEA 5AKJA 4XX1A 3VJMA 2RAUA 2QT9A 1H23A 2QXTA 4LXHA 4LXGA 1VXOA 3BDIA 5JZSA 4ZGBA 3RARA 5A7FA 3ED1A 2BCEA 4IQ4A 4P93A 2PU5A 2C58A 1B41A 4WDRA 3FVTA 1JU4A 2B20A 1MAHA 4X6YA 1AGYA 3RKSA 5AI0A 1CQZA 5E4TA 1EH5A 1LNSA 1E8DA 3WK6A 3G9XA 2OCIA 4UPDA 2UZ0A 1ISPA 1AC5A 4Q3OA 1LZLA 1FFBA 3STVA 1QIJA 4X00A 2QUAA 1DT3A 5CBKA 3WWEA 4X71A 1LGYA 4H7HA 2O2IA 2Z3WA 4UFOA 3KDAA 4F5ZA 4EY7A 1XROA 4GLBA 2QXUA 4BDTA 2G5TA 1UKAA 3WWDA 2XMDA 1CUVA 4CCYA 4QLAA 1WHSA 1ZI9A 3O0DA 4EUSA 3C5VA 3IUNA 2Y6UA 4Q1VA 3NGMA 3WK7A 4H35A 5AJHA 3PDCA 5D6OA 5AIAA 4B82A 1R1DA 1H2WA 1VA5A 5JATA 4DNQA 1G5FA 2BUCA 3EIOA 4BATA 4MYSA 4UFNA 3A70A 3WLAA 1CR6A 1QIMA 1MTZA 1BE0A 4P9NA 4U2DA 2K2QB 1EVEA 5DTJA 3AINA 2WFZA 5E4YA 3MUNA 5DYWA 2J4FA 3R3WA 1PJAA 3GFFA 1R88A 3D5EA 2XUIA 3H04A 4OD0A 5AOCA 4MEBA 3ANSA 3WYNA 4JYMA 5K3EA 1VA4A 4NVRA 1MO2A 2QRUA 4GWLA 4G5XA 1XZLA 3WL8A 4EA6A 5EIHA 1XZKA 3FSGA 4E15A 1IUPA 2DSNA 4J0KA 3WJ2A 1QIHA 5K3AA 2HHAA 4Y2PA 4BAGA 3A2LA 4IHAA 4KE8A 3HXKA 4J3JA 5LZ2A 4DMCA 2GYWA 1CVLA 2WTMA 2VT6A 4QNNA 3EF3A 1K8QA 2OLEA 4GW3A 4FWBA 3WKBA 2OQIA 2I3DA 4QLOA 4H18A 3F8SA 1UOOA 2QJRA 5C7YA 1Q83A 2VA9A 2ES4A 4KAFA 1QIIA 4BAUA 3WKCA 3I6ZA 1Z68A 1J06A 2CB9A 4Q82A 3IA2A 4OB7A 4C87A 3E1GA 1VKHA 2QMQA 1JFRA 3CCCA 4F0JA 1A7UA 3DEAA 4PSDA 2XUKA 3SX4A 3E4DA 2HFKA 2VJBA 3GUUA 5JARA 5JZBA 5CURA 1W75A 1XQYA 4E14A 4H7EA 2GYVA 1QIFA 2RHTA 2OXEA 1GGVA 2XUAA 3BF8A 2JBWA 3HLKA 5HF9A 5T4BA 3BWXA 3PFCA 4TPKA 2WFLA 4OYLA 1EINA 1THGA 5K3FA 1FSSA 3V1KA 5HQ3A 1XLVA 4BRZA 3GBSA 3H2GA 3OC0A 3M82A 4UHBA 3FCYA 1QIKA 5FOQA 2AJLI 5ISMA 1FFCA 3BL8A 2DHCA 1U65A 2HU8A 1GKKA 4G4IA 3AZOA 5ALVA 2E3JA 5JADA 1EDDA 1VXRA 2ZYRA 3HYSA 5AKZA 1U2EA 1H22A 5C8VA 3S8YA 1E8MA 5FXMA 2B61A 3WZLA 1TIBA 3WJ1A 3I1IA 1ZD3A 2PSHA 3FLAA 5A2GA 1AZWA 1QJ4A 4BCCA 1XRMA 2WFMA 3DKRA 2XB6A 1XZBA 4BDSA 3T52A 5E2IA 1XZIA 3BJRA 5ALJA 4OU5A 5AKXA 4X6UA 5EGNA 2YXPX 2RI6A 4K5QA 5AM3A 3BDVA 3AFIA 1YR2A 2JGFA 2WIKA 3FYUC 3D3NA 4WCVA 3I28A 5CRIA 1CRLA 4HXGA 4JUIA 3MGAA 2OAGA 3PE6A 4WY8A 4Y2RA 3D59A 5DNWA 4C4XA 1MX1A 2XE4A 3OG9A 5AK5A 3GELA 2ORYA 1ZGBA 3R3YA 2XMBA 4C89A 3EBLA 2CEKA 3IULA 2WUEA 2WHQA 1EB8A 3I2GA 5ALYA 5ALEA 3FAKA 1XRPA 2OGZA 4CG3A 5ALKA 1OILA 1ETHA 5BV7A 4OB6A 3AJAA 5JYCA 5LKRA 2IITA 3VJLA 5ALIA 4J0JA 3C87A 1FFDA 1XZAA 4F21A 1QIDA 1KEZA 3BIXA 3DL4A 3CXUA 3OURA 5AKYA 2VJAA 5F4ZA 5IVHA 5FP0A 1CUAA 4YPVA 1EXWA 1JMYA 1GPNA 2WIGA 3DL7A 3H1AA 2WILA 2QZPA 3WQHA 3NOXA 4QA9A 3DOIA 2Z8XA 3NWOA 5DLPA 3R3ZA 3EQ8A 5BWBA 1DX6A 3LP5A 5AKGA 4AXBA 4JYPA 3ZLUA 4QDTA 2J3QA 2WJ3A 2VATA 4UHHA 3WKAA 2W22A 2P8SA 2JEYA 2ZJFA 3DCNA 3PF9A 5CT8A 4UHFA 1AURA 2WQZA 5AI4A 4HVTA 5EHZA 5A7HA 4G9EA 4CFSA 1G4HA 1UOQA 3H2IA 3F67A 1QOZA 3FLEA 3FWHA 4WY5A 2BKLA 4DIUA 3QITA 4C88A 3FYTA 4UBJA 3JW8A 3QMVA 5AK6A 1H2YA 5AM2A 3JWEA 4BTVA 4XVCA 4CCWA 3IUQA 4FKBA 3UUEA 2OAEA 2WM2A 2ZYSA 5BWCA 4BE9A 4ITVA 1TAHA 3VKFA 1HPLA 5I8PA 3PF8A 4J0IA 4A16A 1TCBA 2JGIA 4QDUA 3F9CA 1O6GA 5ALPA 5AOBA 2BGRA 2DR0A 3UUFA 3F97A 4BYMA 4HS9A 1MNQA 5AH0A 5K3BA 1P0MA 3O4IA 5IH7A 4PF1A 4V2IA 2HU7A 4H0CA 2H7CA 3HACA 2OGSA 3C6XA 3QZUA 3CCBA 2HA4A 3L1HA 3W06A 1QLWA 2HA6A 3ILSA 3I6MA 5AIBA 3NUZA 1GPLA 1GXSA 2O7RA 4QEKA 4GEGA 1CEXA 1NX9A 2PUHA 2XMZA 3ESDA 3I2IA 4FBLA 2GZSA 1Y7HA 3DS8A 3C43A 1YAJA 3IDAA 2HA3A 4LHEA 3WK4A 1CUSA 4ARBA 4DNFA 2ACEA 2RHWA 5CH3A 4PNZA 1QFSA 4OSEA 3G0BA 4QZVA 4LIPD 3PUHA 3O9MA 2ZJ7A 3WA6A 2G4LA 5T4FA 1QFMA 3CN9A 5LYYA 3V9AA 1JI3A 4UBKA 1CUXA 4PSUA 1IZ7A 4X7BA 5KWJA 4BZWA 5C8XA 2G63A 5LZ5A 1L7AA 1P0QA 1Y37A 4OUKX 4Y9SA 1NU6A 3QPDA 3WKEA 1Q84A 5ALGA 2XQKA 5A71A 4DMHA 1ACJA 2HRQA 4AN1A 2GBCA 2VJDA 1NU8A 2VF2A 3A2NA 4UUQA 3P2MA 2XUPA 5HFAA 4AZ0A 1FJ2A 2QM0A 3STYA 5DWDA 2PPLA 1YB6A 2HADA 3G02A 1DX4A 2JGMA 1Y7IA 4B6GA 5KREA 2QOEA 1A8UA 2XUGA 1BN6A 4N8EA 4MQMA 4G8BA 2PKYX 2DFPA 4YX9A 5AKHA 1YS2X 4M0FA 3H0CA 4L72A 3IB3A 5HZGA 3U0VA 1G66A 2BAGA 1F0PA 1CUHA 4FNGA 2HA7A 3SC2A 3ESAA 1BEZA 3QVMA 4AMYA 2ZYIA 1YB7A 3OPMA 1BROA 3AUKA 5AKEA 2AXEA 3LIIA 2DHDA 4FOLA 4MEAA 3VVLA 1AQLA 4KAAA 3W9UA 1QGED 4X91A 4I4CA 1ZD5A 3BJMA 4G4GA 4OCZA 4RE5A 1THTA 1L7RA 2JEZA 3K9BA 2HIHA 5HKAA 5HKBA 3FVRA 4FFVA 2XUDA 2HA0A 3VXKA 1BS9A 2ONCA 5A6VA 4PW0A 2OCKA 4AQDA 2WSLA 2PSJA 2XMSA 2FJPA 1IZ8A 5HFNA 3WIBA 4NZZA 1EDEA 5T4HA 2EDCA 4BB0A 3IVMA 2GYUA 3K2IA 1EVQA 2WLSA 1MN6A 3AIMA 3Q8WA 5E4JA 4B9EA 5JD5A 2BGNA 3DYIA 2C0QA 4KEAA 1CUIA 2XQGA 2WHPB 1W52X 5HK9A 1A8SA 3C6BA 1JJBA 2XUHA 1BCSA 3AIKA 1CUWA 4KE6A 2QKYA 1ZICA 5DTIA 5H3HA 4B81A 2G5PA 1IUNA 5J3JA 5AM1A 2R8BA 3FNBA 4H77A 2X8BA 3DD5A 1LPBB 5ALQA 1CUBA 4KJXA 1UT6A 4UBLA 5EIAA 3I2HA 2H9YA 4GBGA 1CUGA 4B83A 2WIFA 2XMGA 3HC7A 3KD2A 3STWA 2I03A 3C45A 2PBLA 3RK4A 2IX9A 1F6WA 3R3UA 5AP9A 4EB0A 1UKBA 5LZ8A 3WL6A 5IKXA 5CH8A 1CPYA 3WWOA 3WI7A 1HKHA 4WFKA 3PICA 2O2GA 4HTAA 1IMJA 4KRYA 1G42A 1RWQA 4Q3LA 4ZRDA 4MWTA 1DWPA 1AKNA 3MVEA 2FUKA 4K6KA 2V98A 2H7XA 2I78A 3D4LA 3ZLVA 1CUFA 2CKMA 5AK3A 1GT6A 3W2TA 5LZ7A 2V96A 1MJ5A 4UBNA 3R0VA 3O4GA 1QE3A 4UBMA 3STXA 3W04A 5A62A 1XKTA 1BN7A 3I2JA 3GZJA 3IBTA 3HI4A 4PSCA 1JJFA 2XQIA 1L7QA 3IUJA 5KWIA 1XRLA 1YA8A 5I9IA 3ZLTA 1CLEA 4DMFA 1B6GA 5ALZA 3QYJA 5EFZA 2GBIA 4MJ3A 3I2FA 5ALMA 4U2EA 3QPAA 1H2XA 4E46A 2WKWA 4KRXA 1MX5A 1XZDA 3R3VA 1EX9A 5JANA 1WOMA 3IUMA 4QDOA 5AOAA 2HA5A 2CBGA 4DNPA 4Y2SA 1CQWA 3LLCA 4X92A 1CUZA 4P92A 4Y2TA 1LBSA 1HL7A 2VT7A 4AB1A 1XFDA 3WIOA 5CMLA 4DSZA 4L3WA 3CN7A 5AICA 3OTQA 1WB5A 2C5GA 3KSRA 1MX9A 1U8EA 2CJPA 2WG2A 5AKLA 4ZWNA 3OOSA 4Y2UA 4XIIA 1XZGA 2OG1A 4BC0A 2EEPA 3DQZA 4INZA 3EQ7A 1VZ3A 1QO9A 4UHCA 1X70A 3C6ZA 2D0DA 5ALDA 5K3DA 1JU3A 2H7YA 4GECA 4Y2XA 4PV7A 2AJBA 4DYHA 1LZKA 3PFBA 4BE4A 3B5EA 1WB6A 3D7RA 2XLBA 2JGLA 5DYTA 4DNOA 4U2FA 3G7NA 3STUA 2ZYHA 4CIBA 2YYSA 3WWPA 5C8ZA 1D07A 4BVJA 3YASA 1WPXA 1EA5A 3WK5A 1LPOA 4C6HA 1TKRA 4BVLA 4FLMA 2WTNA 3BIWA 5FLKA 3QBJA 4EY8A 2DQZA 2QTBA 2WG1A 2XLCA 5HCUA 4GDMA 4G9GA 3DNMA 4K2AA 1N1MA 3G0IA 6YASA 5JD6A 4B0PA 4BC1A 3H2HA 1W6RA 2XMRA 4C4YA 1M33A 5YASA 1P0IA 3HJUA 2X76A 1BCRA 5AK4A 2PUJA 3G8YA 4EBBA 1ZI6A 2YH2A 2QJWA 2RGUA 3DLTA 1XLUA 1YA4A 4X93A 2QVBA 5EHXA 4IH4A 4HXEB 4WFIA 4I3FA 1DQZA 1JJIA 1UOPA 3HSSA 4DGQA 4FDMA 5CH5A 2OPHA 2PX6A 1HQDA 3V1MA 5FUMA 1VE6A 4MXDA 4CIAA 1DTEA 2LIPA 5AI9A 1GPKA 4AN0A 3HEAA 2WUGA 1C7JA 4MWSA 2H1IA 3VJKA 2OCLA 3QM1A 3AZPA 4BTLA 1N5MA 3F98A 3C5WP 4U2CA 4GXNA 5IVKA 4B84A 4IH1A 1XLWA 4J0CA 4KE9A 5AKKA 5AI5A 3WMRA 1ZJ5A 4B85A 3ZI7A 1TK3A 2FJ0A 1SC9A 4OPMA 3I6YA 4OU4A 1BRTA 3A6ZA 2HFJA 1J07A 5DNVA 3PI6A 4DTCA 4N8DA 5EIEA 3HRHA 3G0GA 1ZD4A 2OCGA 2ZVDA 4H7KA 5LZ9A 1SCIA 1HBJA 5FV4A 1TRHA 4IH9A 5AM5A 1XRQA 1MNAA 1CV2A 1T4MA 1WPRA 3A2MA 1VE7A 3C8DA 3D2CA 3QMWA 4KACA 1XQXA 1W4LA 3DKKA 1R4ZA 2C5FA 1XRRA 2VJCA 3MUOA 4NS4A 3WK9A 5ALNA 1R50A 4LKOA 5FPPA 3VVMA 2HM7A 1A88A 5IVIA 5ALLA 4E11A 1BU8A 2WUDA 3O9VA 1TQHA 1QO7A 1SCKA 4BVKA 7YASA 5ALTA 3RLIA 5CTAA 3N0TA 1JKMA 4PO3X 5DNUA 3OM8A 2QR5A 2O2HA 3O4JA 4EY4A 5EI5A 4XWGA 3WYDA 3W9BA 4RNCA 4JEIA 1XZCA 1UK9A 1XZMA 1ZGCA 1W76A 1DT5A 3SWWA 2WHPA 1I6WA 4M0MA 2BFNA 1XZFA 1ZJ4A 5IVDA 2ZJ6A 2WIDA 3L1IA 5LLSA 3D0KA 2WG0A 2BJHA 2J3DA 3E0XA 1E3QA 3H18A 4Y2VA 4L0CA 1QIGA 1MAAA 1KU0A 5JZ9A 4OB8A 3DDUA 3ANTA 2HDWA 2Y6VA 1LLFA 2X5XA 1PV1A 3M3DA 4LXIA 4H7IA 2RONA 4ROTA 2ZSIA 1EB9A 2CUTA 1R9MA 1SFRA 4GHWA 3EQ9A 2PU7A 1KU6A 1EHYA 4ZV7A 5K5EA 4N8SA 1FFAA 3FYUA 1SOMA 1XZEA 5HF6A 3LCRA 2WHRA 1TCCA 5ALXA 3WL5A 1EK1A 4AO6A 4I19A 1YCDA 4HRXA 4DM7A 4XJVA 2CMFA 1CFJA 2GBGA 2PSDA 3STTA 3S2ZA 1E66A 4YK7A 5LKAA 1E89A 3ZPXA 2WJ4A 1N8SA 2Y1KA 3BE8A 4Y2JA 2AJDA 3LS2A 1WM1A 4N5IX 2W6CX 1AX9A 3ZV7A 4ZXFA 1XKLA 3AIOA 1ZI8A 2HA2A 5FRDA 4MQLA 3KOOA 4H7FA 2XI4A 1RYYA 3G9TA 4Q34A 4A5SA 4DMKA 3DYVA 4KR0A 1XZHA 1YS1X 3W05A 4OYYA 2Z8ZA 3N2ZB 5T4EA 3ICWA 2WIJA 1U4NA 4UBIA 1XQWA 2HL6A 1X2BA 4Q05A 1ZD2P 2CZQA 3F96A 3ESBA 1WB4A 4EZIA 3KWFA 3H17A 5ALSA 1AMNA 1Q0ZA 3TGLA 4H7JA 4M0EA 3H2JA 3SK0A 2B4KA 3FSGD 2BUBA 1QZ3A 3I1YA 5AI8A 3V48A 3ESCA 2XUQA 3I2KA 1QTIA 4FTWA 1IVYA 5CT5A 4W1RA 4FHZA 3BF7A 1YASA 3RM3A 4FNMA 4QDZA 3K6KA 1R3DA 2WJ6A 2JGEA 3G0DA 1XQVA 1K63A 1DU4A 4ZV9A 2ACKA 2WU4A 4EY5A 3VISA 2IIVA 2PL5A 3R3XA 4PQEA 4W9RA 1DQYA 2WU3A 1UK8A 1O6FA 3TEJA 4YASA 5HF5A 3DJYA 2Y2VA 5AHXA 3TRDA 4UFPA 5HK8A 4B7ZA 3FLBA 3V1NA 2PM8A 4EY6A 1E8NA 4UHEA 4KAJA 4D9JA 2AJ8A 1WCYA 1UWCA 3FYUB 3M83A 2QUBA 5ALOA 2DQYA 2DCMA 1TCAA
chains in the Genus database with same CATH superfamily
3CLTC 4NRDA 4WLUA 1CVRA 5MN6A 3BXPA 3QIVA 3OD1A 3FTPA 3D3JA 4WNIA 1X1RA 3SM3A 2X0EA 3V8BA 3VUEA 2X4LA 3LFUA 4F3TA 3RTBA 1K97A 5IK2D 2XXJA 2P67A 1G7SA 1LKZA 4ZDIA 1CZHA 2OB1A 4C22A 2AHOA 3B82A 1ZJWA 5BN5A 3BWCA 3OD5A 2LE0A 4IIYA 4JJFA 1DOHA 1U2SA 4RETA 3K2EA 3MLBA 2EQ5A 3PX7A 4HXYA 3LPNA 3I6IA 3TW8B 1XWIA 1VZ2A 3MXTA 5I45A 3FYCA 1YV9A 2JLWA 1N6PA 3W3ZB 5IDWA 3PHLA 4WEQA 4EB6A 3QHPA 4BASA 2O0JA 1CDEA 5E6RB 5C8YF 1M75A 2ODEA 3P97A 5CNKA 2JBAA 1GN9A 2FP3A 2IY7A 4FSXA 4DCGA 4YGYA 5ALQA 2VL7A 3FJYA 4PO8A 2DBVO 1RKVA 1ZMRA 2O5VA 4IXNA 5KJCA 4IHKA 3NHMA 2FCRA 1AY0A 3KV1A 1ISRA 1ISSA 3V9PA 2XUJA 5HJ5A 4ED9A 4G0VA 3Q41A 3HR4A 5CGZA 2B83A 3T9CA 3UANA 3IXQA 4KQCA 1U94A 3EVBA 3NBAA 4OI2A 5K1ZA 4HP8A 1SKAA 3Q9UA 5JDCA 1JDUA 4B4VA 4PQGA 3R5SA 3L0PA 5SY9A 4UDOA 2COUA 4OQEA 3V8RA 2ZI7A 4G5GA 3TZQA 4KQJA 3HL0A 8ATCA 4MV6A 1J5PA 1L8OA 1L5QA 4NPCA 3IP5A 1R6XA 1E2NA 1XCGB 4LGCA 3HCDA 2BGGA 1QZXA 1M34E 1RAGA 1SU7A 1RP1A 4REQA 3M6MD 3CEHA 1JF8A 1FTSA 3I0ZA 4QTZA 2BGMA 4MUYA 4HN9A 4KUEA 2VF7A 1Z33A 4N5DA 3NXKA 3LUJA 4QOHA 3GT4A 4RU1A 5BSUA 3M9XA 2BEUA 5SYNA 4GMHA 3GLSA 3GUHA 1SBCA 2A8YA 3NOVA 2XQJA 2YNMC 3AG5A 3EODA 3GUYA 5EJ6A 5JH7F 3SLKA 2ZIVB 1KQNA 4MRMB 4NPAA 4YV1A 2RGNA 2GWHA 3PFNA 4QOGA 1DINA 4UAVA 4I46A 2D8AA 2CVHA 2YXBA 1JBQA 1QONA 5CT6A 3HEBA 2I33A 4QRHA 1CUYA 1E1CB 4FFMA 1I14A 3V55A 4WFJA 4OX9B 2GFIA 1VG9B 3S4YA 1ZINA 4C04A 3COJA 1IXYA 4E3WA 1XCPA 2LCFA 521PA 4DCVA 1RZ3A 1XMJA 1GPAA 1K3FA 3AF1A 1AGXA 2J45A 2DUWA 3RTEA 1J1UA 2Q7OE 2VZ8A 4H0FA 4V1CA 3I30X 1SD2A 1F06A 4NCIA 2J41A 5EHQA 5CFNA 1S96A 2ZT6A 3GRZA 5F52A 3TECE 2C7BA 1G64A 2QEQA 2QUIA 1GZHB 3ANNA 2FPIA 3RS7A 4YRZA 1W36D 2FMXA 2FVYA 4N0MA 5EQTA 1MPXA 3LWNA 2HWYA 4TYMA 1WSDA 4MLPA 4WK4B 1L5GB 3OC6A 3NH6A 1AKWA 4ENPA 5M5BA 1EM6A 1VLQA 3A0UA 4PFKA 1VOTA 4F72A 3HU3A 4M7OA 3C3BA 1L4FA 3DVSX 5DM2A 1CDDA 4PAOA 4HN4B 2CDRA 1XZJA 2FP4A 3N39C 4ZI5A 4FWIB 2G1JA 2FLWA 1I24A 2P6PA 1BWPA 3ZHVA 3AY7A 1V3QE 2ILVA 1RHRA 2ZIFA 2BPOA 1CUDA 1G19A 1ODSA 2NU7A 2OHOA 3CZ5A 4K28A 4RW0A 1UQUA 4UMVA 5SYMA 4EF6A 1S0UA 3L3BA 4KLAA 4COOA 1ZU5A 4D4IA 4YTEA 1QH8B 2VTEA 1GPH1 4W5QA 3IUBA 3ER8A 2HO5A 1ZMBA 1OXSC 1X7WB 2Z2YA 2DBQA 3AY0A 3EGWA 5I7HA 4I2VA 1ZNZA 2H5EA 4M9CA 2XHEA 3FOBA 1Z2AA 2DKFA 3BERA 4XLLA 2Z98A 3HBLA 5BUZA 3GP8A 1P3JA 3R9XA 1RRGA 3OZUA 5F23A 2FEXA 4FJ1A 2ZW9A 1DIOB 4TVOA 2EQAA 5FKJA 2XQFA 1O03A 4GQIA 2LWIA 1N2CA 3TTVA 2B9VA 1J1ZA 4Z2AA 4ZJYA 2VEOA 5JW6A 3ZV3A 2X15A 3HSYA 2HF7A 3TX6A 4RV4A 3KR2A 2JB9A 4F12A 4G8DA 1Z16A 1H9BA 3C5EA 1RXIA 1JNXX 4X6XA 3PC2A 1F60A 2B1JA 2J9FB 3T3HA 4EMUA 1JPNA 2H0QA 4PR3A 3L6CA 4X6LA 5ULLA 5HS6A 1EFHA 2QTWB 1YL6A 4LJ4A 3OJCA 4CL8A 3CR8A 4QU9A 2AYYA 2J0UA 4C7XA 3CF0A 4JUAA 1NXXA 4B44A 4UZEA 3F46A 3UXMA 1BHO1 1I7PA 1PZGA 1UXOA 3D5QA 3HKEA 4F06A 4OV6B 2ONJA 2J4CA 3H8JA 4L1KA 5LNK1 5FA6A 5JJLA 4CEJB 3BB3A 3DKIA 5EZYA 5C31A 4EMSA 4POOA 5UKDA 2WUFA 4J0DA 4A8TA 4AKEA 1OLUB 3DL2A 3ZVMA 1TU3A 3SZGA 3D7LA 1PRYA 1WUIS 1BZYA 4MWOA 2R6R1 4H6PA 3EW9A 2V74B 2VP4A 4R68A 5B3JC 5KYXB 2I2WA 5IJWA 1BE8A 3UHFA 4LC1A 4F6LA 2KPOA 3ZZ1A 2FRDC 1C4XA 4FBMA 1Y89A 5FPYA 2A1UB 2VDWA 3RASA 3W34A 4CG1A 4OYHA 5J9FA 4KO3S 1KHHA 1ZIOA 4DAEA 3O92A 5KVCA 2C3OA 1JEOA 2PWBA 1KVRA 3OEYA 2QF7A 3E3AA 2XOXA 2HIGA 4QARA 1U1GA 4TUYF 1IXRC 2WYVA 5TQJA 2PVSA 4HN2A 1B6TA 1Z47A 4ZJPA 4KLNA 4PLZA 1S8OA 1HUQA 4JJ7A 4P34A 4NS1A 2OHXA 1GGNA 1R8JA 1J5EB 4DM3A 5KNDH 2VCHA 3DR3A 3FOAA 2JANA 4NCHA 4QASA 2VS1A 2I1VB 3C6YA 3AEXA 3W8NA 4XWOA 4ZAGA 2IOFK 2JIZA 4HEA6 1Z88A 1EG7A 3CLSD 3IPXA 4M8IA 1NNSA 3CWCA 4KMMA 1E0SA 5I7FA 1OTXA 1ZD1A 2QGZA 1Q95A 1YDHA 1AUQA 5M2QA 2KE5A 2H4XA 3ASYA 1O0CA 4PPFA 3I64A 3D2BA 3F3MA 1JHUA 1CS0A 1T2NA 4MYRA 3AUTA 4W1SA 4D6XA 4E51A 5J1SB 5GIPE 2ZYWX 4MW4A 4D3YA 1N5KA 1PQWA 3S0JA 3CX4A 2C57A 3GVIA 4QOEA 5GOZA 4HXFB 4OTZA 2I22A 3AW8A 2B0CA 5IHPA 5FBWB 1Y8ZA 2GASA 1EUYA 1G8SA 3T5CA 1CVIA 4D44A 2BOVA 4HYEA 1B3BA 2FEAA 1DKOA 2PG3A 4A91A 2YASA 4GRIA 4IXDA 4KXLA 5GONB 5FF9A 5CVVA 3MC1A 1DC4A 5K3FB 4DVJA 1NXPA 1UADA 1XNHA 2J09A 4MUIA 2GN4A 3I9V6 4QQFA 1D1SA 2I3ZA 3K7EA 1E77A 4L2IA 5TPZD 2W5UA 4YRRA 4V0NA 1G5TA 3VDMA 4QULA 4CUJA 4LF9B 1JXMA 3UMJA 1NQTA 1TADA 5ADUS 3KVNA 4KDRA 3LBIA 2G72A 1G20B 1SXQA 1CULC 1EWVA 2IZ5A 2H16A 1U04A 4GOKA 4RPCA 1GFZA 5HKKA 3DP7A 4GI3A 3CGWA 3CLTD 2NNWB 3Q2KA 5CCEA 1Q7TA 1XC7A 4I1UA 2Y68A 3LCMA 3R7FA 4WLEA 1RRKA 3R23A 3TW0A 4D92A 2VXBA 2PTHA 4P22A 4OREX 1C41A 3K09C 3RANA 3NC4A 4ND8B 4PIPA 3CVUA 1TW3A 5I4BA 4I0WB 1O96A 1ZSNA 3GGDA 3SHFA 1XJ0A 3SLRA 1LDGA 1CJBA 3DUFB 3NVDA 5T7BA 1CIPA 2MOKA 2VCEA 3SQOA 3ENVA 3BWVA 5C46F 3EIUA 3FCAA 1DV2A 1PG2A 3N2LA 4Y2YA 2B7BA 5JASA 1ZN2A 3BTSA 1Y3HA 3OZXA 3F49S 4PSAA 4D97A 2H11A 4MV3A 2IOYA 4EHNA 3WP1B 3ABQB 4FFRA 5B3LA 2WU1A 1BQEA 2E82A 5FEUA 3NAGA 5B12A 3NPMA 4AO8A 1I33A 1IN7A 3Q85A 3AVOA 4OF4A 5HOQA 1MJFA 2P4SA 3L9XA 5JFTA 3BWDD 5TQ0B 4AJKA 2HMUA 4Z49A 3NS7A 2QNBA 2VSQA 3BJEA 4A2PA 4ARUA 4YH1A 2IHKA 4UM8B 4KE7A 3F5FA 3N59A 4R8VA 1UXJA 3W2HA 4QJBA 2FR8C 5E6UB 1I8TA 3PGXA 4XE5A 3RYIA 4Y6QA 1LS6A 1HM5A 4RLHA 1EKXA 2RAPA 3PEFA 4RF3A 4BWYA 1XRNA 3C3WA 3PTZA 5CW1A 4Z4IA 4M37A 1T6BY 4IGEA 3PWKA 5J5AA 3KQTA 3IE1A 5FOSA 2RB5A 3RBVA 4HDRB 3K70C 2XWQA 3DTNA 2ESRA 2JK0A 4J03A 5AM0A 3IIIA 3O7MA 4B5LA 1QQTA 1F4PA 3DTVB 4XYMA 4FZRA 4D9IA 3VR3D 4YT2A 3HO6A 4UD2A 1OH5A 5JAUA 4PZAA 1YSCA 2K7ZA 1UZMA 2QP3A 3HP7A 5JPIA 4M22A 2Z6QA 1Z6GA 2CHEA 1K66A 2GNAA 2MYTA 4FJ0A 4MWZA 4C6TB 1RAEA 4M8NE 2GZ1A 3JALB 4JLVA 3UENA 2CNDA 3BPSA 4L57A 4RCVA 2JLUA 1VPWA 1BNCA 2HKIA 4H4DA 4TLAA 4WN9A 1ZVKA 2B1GA 1KOGA 1D2CA 4CL2A 1GQSA 5HZKA 2Q3CA 2CFIA 2EXXA 5SY4A 3KDSE 1WR8A 4PTLA 1FFWA 1T9GR 3WV4A 5K0JA 3VAYA 1WKVA 4CLHA 1NMEA 4K7JA 4BBZA 2YNMD 4IIEA 4DMLA 1J7JA 3NNDA 2VNSA 1CHDA 5T67A 1X80A 4ENWA 4S1OA 1SMKA 2R85A 4URWR 4MO2A 3HXPA 1N6IA 5FPQA 2ZE6A 2AIRA 2FX5A 3TJMA 1L5FA 3ZWAA 4CM4A 1NVWQ 3E9EA 3FFAA 4F60A 6ABPA 3ZWBA 3QVTA 5JXGA 4KMSA 1W44A 2B8JA 4G8CA 3X1YA 1K5PA 3RBAA 1M6VA 2PRJA 5ELLA 1M5UA 1N9ZA 4D6YA 2CNNA 3M9WA 2XDWA 4LVOA 3RVNA 3ZHXA 1OIXA 3BBLA 2PNJA 4J2OA 5EKXA 3LI2A 4EHJA 1Y7LA 1ODCA 5KBYA 2UUBB 5EA2A 3VO8A 1M72A 1T0JB 3QQPA 4BZZA 1QO0D 3H87A 4L9WA 4AQYB 1JP7A 1UKCA 1UDRA 4ESVA 3MFYA 4JEMA 2OMKA 3Q15C 1C30B 1P77A 3FCXA 4YJHA 2O0KA 2Q6TA 4Y9UA 3P9RA 4LOLA 2AJCA 3FUTA 5T3UA 5LQAA 4E70A 2QAIA 1ECBA 5GY7A 3WWCA 4Q66C 5K99A 3I01A 2CHFA 4GG1A 4Q4JA 5DPMA 5JU6A 4B6RA 4BP8A 4ZTUB 1J9EA 2C88A 4RVSA 3ZHOA 1QWSA 2PD6A 5EMMA 5CA1B 2YR0A 4K6GA 1DIGA 2ZK7A 4OHPA 5LQUA 4B9AA 1MU0A 2WF6A 2VNKA 4HGYA 1DKPA 3LHFA 1FFEA 1RMYA 3KHUA 5TEWA 2EC5A 4RLSA 2W4IA 4HEJA 1VKNA 4R51A 5IFLA 3Q6NA 1I32A 2OR3A 3JQDA 5L8VA 3FVQA 4XW2A 2QD2A 1VP9A 2WA2A 3O74A 3UWSA 2J9XB 1NUPA 2B5OA 1CIVA 3FF4A 4RD4A 1RWOA 1S4QA 4JX9A 4PLPA 1QOQB 1VXOA 5BW6B 4GX2A 1U0FA 2F1JA 3BDIA 3HYTA 3D8SA 1TD1A 5PNTA 1SG6A 3N2IA 2YZKA 2CZGA 3D3KA 1N0WA 5FOXA 5AXBA 3RARA 1SXHA 3SC6A 3NZEA 2ODBA 4XYEA 3UWOA 1KI2A 4D0LB 4OY3A 4A6DA 1NVBA 1SOVA 4G4SO 1JR2A 1G18A 3HZHA 2J85A 2OBMA 3NTOA 1N2IA 4UXJA 1RJEA 3HWX1 4ASUD 4Z7JA 5IAAA 2ZG6A 2DYKA 3HBJA 3HA2A 1QGZA 2JKYA 4C4TA 2CMDA 4IFEA 4J07A 4G81A 4KAXA 4P93A 2CL7X 6PFKA 2ZTSA 2ADMA 3EGIA 4J29A 4EPTA 1SHLA 4HAYA 4G67A 1A98A 1NP3A 4G36A 4CQMA 1JU4A 5IS2A 3MT7A 4X6YA 3RKSA 4DN6A 4YJ3B 1QF6A 1CQZA 1ZCJA 1Z2DA 3KJQA 4PHHA 3L6EA 1NVDA 1EH5A 3Q88A 4Q9NA 4QNRA 1OI3A 1JZQA 1XTBA 2TECE 3A6EA 1LNSA 2VRCA 5BSFA 2CK3D 3CZ9A 4LXYA 4NV1A 4DLWA 1ZD9A 2IQIA 2OCIA 3GC6A 3GQVA 4UPDA 3AVWA 4DA7A 2NGRA 4NEGA 4JJAA 2EBWA 4HLNA 4RABA 1CY8A 1UBHS 4MVJH 4KVZA 3IT3A 1AC5A 2AVDA 4EAAA 1KMMA 4V39A 4I3HA 1QIJA 4TSFA 3CLRC 4I5DA 1NVUQ 3DAFA 2W4QA 2O5CA 3TW8A 3WHPA 2DPXA 2CLCX 3NOOA 4IV8A 2X9LA 1BGWA 1TC1A 1NJ6A 3EZGA 1K9SA 3D4PA 4DQUA 5CDGA 4TS9A 1EGMB 5E6RA 4WXYB 4X20B 2HCBA 3GIWA 4EKYA 1K2VN 5A9RA 2UUAB 2ZWIA 5CX4A 4M8SA 4LECA 5JCOA 3SLGA 4BX2A 3PA6A 3URKA 3KNZA 4DAOA 4KXMA 3M7IA 4DJEC 4EY7A 2IU0A 4YLYA 1JHXA 1E6KA 3ZQ4A 2B8TA 1GSOA 2NT3A 4GLBA 2QXUA 2YMQA 3KR1A 4S2EA 3AOEC 3E2IA 3BGDA 1A5SB 1NVMB 4HBZA 4TSKA 3OI7A 4U5XA 3H9QA 5CD1A 1XQ6A 4M21A 4Q9HA 1KO1A 1NUQA 1V5WA 3II6X 1NJFA 1SU8A 3HDHA 4HG2A 4GAEA 5ETJA 1QHFA 1QOPB 2HSEA 2ZIZA 3QI7A 5EZYF 2Y6UA 2X1LA 3U61B 1PWYE 3FSEA 3FR7A 5FX2A 5JEEA 5L95A 3GZTB 4BQQA 1H3EA 1P0CA 3FSJX 1YT5A 2PXXA 1Z6XA 4PFJA 1NFQA 4DBVO 2J6CA 4BU0A 1THZA 3QKUA 2VZ0A 5IJZA 1AMOA 2PYZA 1H66A 3SZLA 1HLDA 3LKZA 1RNLA 5D6OA 1XEXB 4OYRA 5SZHB 3RC1A 1N36B 1KAMA 3UAWA 1H6BA 1PQYA 2AT1A 3KXLA 4YRTA 4A82A 3DONA 1KQPA 3H2SA 4RKEA 4ZQEA 2XADA 4B40A 3I61A 2LCIA 1E2BA 2AI2A 3PEVA 2A9VA 5L3SB 1JDBC 1F3LA 5EWJB 1QPBA 4RZ2A 5JYBA 1N5DA 5FFMA 3RT7A 4LWZA 5JATA 4DNQA 4V3CA 1PR1A 2GSDA 4HH4A 1F8GA 4Q6WA 5T8KA 1CNFA 4IDHA 4BATA 4O2BA 3L82B 2G67A 1DFIA 2GD2A 1W73A 4XASA 5GQSA 3UBMA 4XD7D 3SAJA 2A7XA 1QIMA 1MTZA 2F1IA 3EYAA 1BE0A 1ZKDA 3FDZA 3I9OA 1ZK3A 4MI6A 4XFDA 5ELXA 1OIWA 2HWUA 4E5MA 5K6RA 1WV0A 1L5SA 4G89A 3K94A 2P5UA 2YJ4A 4IZIA 3KSBC 5DTJA 4M2LA 3AINA 3GUCA 4JHXA 2R5WA 5BWOA 2BFFA 3VGJA 1NE2A 2R8XA 5E4YA 3LJKA 1PLJA 1Y63A 2DU8A 2ZRNA 4F4CA 5L4NA 1K98A 4IOMA 5DYWA 2UU9B 3QX9A 3VKUA 4Y6GB 2F8SA 4ML3A 3VJRA 2OCXA 2BI7A 2OK7A 2RHJA 3GFFA 2XUIA 3O3CA 4GP6A 3ICOA 1KDZA 4C0KA 4LJRA 3TLCA 3VQTA 5CHEA 3BX1A 4KIWA 2AZDA 3CT6A 1A5BB 2IYPA 1JEAA 4OD0A 3ANSA 3M89A 1Q22A 5HTOA 5F2OA 3GF4A 3LCVB 1P9RA 5IKOA 1W30A 4IQ0A 2FMUA 3PC8A 3RQSA 1T5TA 4AS3A 3MJFA 4GWLA 1ZSYA 4D25A 1G0NA 1TIKA 4NYMR 3F6EX 4Q1CA 5E2BA 3JYOA 1BSVA 4XRGA 5DN6D 1NVEA 1QB8A 3ZDBA 1IN1A 1SUSA 1PDWA 1QH8A 2O3RA 1GSAA 1QHXA 3BXEA 3H6HA 1SBZA 3MELA 3NT5A 2X2FA 3BIJA 1P60A 4BQFA 4JMPA 2C03A 4ZMSA 2JJ1D 1A96A 1QIHA 2MYUA 2O6LA 1ZZGA 3QUSA 3UJAA 1IN5A 4CDGA 4IWYA 3AY6A 2PRSA 5GJBA 3GO4A 3K1YA 5EESA 5LJIA 3D1JA 4R54A 1XTJA 3DW1X 1H3FA 3A3OA 3E18A 3K15A 1E1RD 2WWYA 1M67A 4IQGA 1WZ2A 4YJ2B 3K70D 5K3OA 2RG7A 4DCNA 1Y33E 4ZU3A 3PYXA 3SBXA 2YWDA 2E6UX 1H6CA 4KE8A 3HXKA 4MWCA 2UZAA 2JL1A 2IS2A 3HVIA 3L8CA 4MO9A 1SQ0A 5CYFA 1ZR2A 4OHOA 2VUSA 2PJDA 2Y27A 1MAWA 3I0NA 3H0KA 3D4OA 4MTLA 3WYGA 1CVLA 2IODA 1H0HA 4AG3A 4IDAA 2Z6VA 1C4WA 1HDCA 3EF3A 4PICA 4YN3A 1K8QA 1J42A 1FNNA 3DMTA 4FWBA 3WIEA 1OFVA 4UM5A 3ETDA 5F5NA 2PFSA 1E7QA 1HSZA 2I3DA 4J3FA 4OK3A 4Z4FA 3KD3A 1M2FA 3NHRA 4H18A 4IGAA 3QU9A 4BECA 3Q8MA 1RJDA 1UDXA 4C7MA 4UQOA 3MYYA 4CEJA 5BNTA 1KTIA 3JVIA 1X9HA 3T7AA 4BUZA 5C7YA 5H68A 1TZJA 1EGHA 1OLUA 4YO8A 4OKNA 3O8RA 2ES4A 3ZXUB 4CDMA 5AQEA 4ZGGA 1QIIA 3M2PA 1T5SA 4GZ5A 1NXTA 1VMAA 1PR3A 3EVGA 2AUNA 3MOIA 4JVSB 4BAUA 2LBPA 3WKCA 5CPFA 5IXJA 4HDKB 1DRKA 2JH9A 2PUFA 1X92A 1XSEA 3KU1A 1SVWA 1COWA 1ZFNA 1YRLA 1E5DA 3IA2A 2H4WA 1UC4B 3NHJA 4KUGA 4TLMB 5F1OA 3ET4A 1EFVB 5EJGA 1KKLA 4FHCA 1OW3B 1C0LA 4ECAA 2QMQA 5HJ7A 5D1NA 2V65A 3INYA 1YR7A 2XB9A 4ZYYA 5TDHA 3T95A 3OFSA 1A7UA 4LOHA 1KBOA 3DEAA 2ZJ5A 3KKQA 2C5BA 2PMDA 4M1YA 3RJ5A 3UMRA 4ADSG 1S1CA 2UZIR 4XQGA 2HFKA 5K8TA 3LFTA 4Z6KA 3PX3A 4IKPA 2AQHA 3AWIA 2XODA 3KJIA 4GVLA 5K05A 3SYKA 1PJ4A 4EI9A 4CTOA 1PT5A 4B4OA 3EVAA 4XPIB 4F3KA 1XQYA 4DBLC 2QZJA 1JQ3A 1SKYE 4J4HA 1OXXK 1SZDA 5B7GA 1ZM7A 4B46A 2HYDA 5FPKA 2DP4E 4H7EA 3DOJA 4D56A 4NMHA 1M8JA 1P4AA 5F1KA 2OYCA 4U7GA 4J6EA 2VUUA 3C3XA 3K8QA 4JX8A 1HG0A 4OH7A 4AT1A 5FI1B 4AUKA 2XGOA 2Y66A 4FQ8A 3V97A 4EG7A 1HQCA 4PQYA 2JBWA 1XP5A 2NWQA 3ZD9A 2G70A 2IZZA 2BM8A 3WQSB 5AVOA 3NKVA 2WWRA 1KERA 1W88B 1F8YA 2YWJA 1E0JA 2BONA 1QFYA 1G5PA 3BGSA 3H99A 3PFCA 4G09A 4G5OA 3KT8A 4L5JA 3A6FA 2TS1A 3FJOA 1XAGA 3GJSA 5GONA 5K3FA 4RK1A 3RS0A 5GP1A 1HNWB 1TFUA 3JYLA 2OBYA 4DDWA 3I3OA 3NCTA 2IZ0A 3QW2A 5B2ZA 3KJEA 2BFBB 4QJ3A 1F0YA 1OZAA 5AVSA 3EWIA 2HRCA 3PJRA 2A35A 1L5HB 1XBTA 2A5FA 2AFIE 3AJ8A 2H5IA 1KIAA 3MMXA 3R0IA 4Q7LA 2XRFA 3HJCA 2IDMA 2YV5A 1KAGA 3EIWA 3QXJA 3UK6A 1KSGA 1G20A 3B6IA 3H6KA 4KNVA 1SD5A 2DHCA 4IVPA 1VSBA 1UWVA 2HU8A 3JZFA 1JDSA 2BLNA 2D1YA 1EJ6A 1BVHA 4JI1B 2A9QA 1L4EA 1VXRA 2YOGA 1P91A 3AEQB 4DUGD 3AHFA 1HE4A 3I3SR 4Z0NA 2C92A 1KJQA 4F5EA 7ADHA 1SCAA 2W2PA 5DMHA 2AZTA 4XPZA 3SXUB 4ND8A 5JYEA 4LAFA 2A4MA 1RRMA 1M5TA 5DBIA 5AUOB 1TUIA 3BRCA 1M7BA 4Z4GA 4HJRA 1X8LA 4JR2A 2JRCA 4YPFA 1AA9A 1TPYA 3QLVA 3UAYA 5KI6A 3NIDB 1TKAA 1TIBA 2RFLA 3QOYA 3CLRD 1ZH0A 2FDRA 2G5CA 3H3FA 2EKBA 1ZD3A 5E7JA 3D8HA 2PSHA 2QTLA 3EIQA 4XCQA 5G1NA 3PUKA 2VH2A 2D0PB 2PO7A 2WSSA 3E5HA 3UW1A 3G2QA 1DTWA 2WFMA 1UPUA 1GAJA 4BDSA 3BWEA 2WZQA 3BD7A 3J81A 4ZOEA 5JNVA 1MV5A 5DXFA 1SRQA 4MR9A 1SUAA 1SVKA 2AUTA 1K8YB 2ZZKA 4OU5A 2AFHE 2PXAA 5ALJA 4R0NA 2ISQA 2IHYA 1BCSB 2CF5A 5E6UA 3UH0A 3KWLA 1SK8A 4ZOLB 4RQUA 4EUNA 3GRVA 1DRJA 1KYWA 1T26A 2WJZB 1KI1A 3ZXYA 3NQ41 5BRAA 4FWTA 4K5QA 1LVGA 1ZGGA 3HG7A 3OOYA 3U3ZA 4U0KA 5IKMA 4HDRA 4FB5A 1NFFA 3SZUA 1QCZA 2JGFA 1DQNA 3FYUC 3DTVA 2GN6A 4FOOA 1D2HA 4WCVA 1R5BA 2UVDA 4YMWA 3SJUA 1BMFA 1DMSA 4HXGA 1TK2A 1SXJE 4JUIA 2WSMA 4BNGA 4RBNA 1OXKB 5ARCA 1C8VB 1NXSA 2CMHA 1BHQ1 4C6TA 3VR4A 4BV9A 1W5FA 3JALA 1TCVA 3KC2A 4RZQA 2DUUA 3MD0A 3PE6A 1AM4D 1UJNA 3A9WA 3Q98A 2GVDC 2VHJA 3HCEA 3IH5A 2GCOB 4WY8A 4D3DA 5JC8A 1V1JA 2FK8A 2LIVA 4J16C 3SP1A 4JNKA 3LX5A 3VNVA 4AVYA 3L8ZA 4C4XA 3TDMA 4GMXA 1NBMD 2FX3A 2O1SA 4ZZ1A 1AN9A 2H51A 3THSA 4FYIA 3JWPA 3IDFA 3EDOA 3UT5B 3GELA 3F9IA 3GJ4A 2IHNA 2PSSA 2PGAA 3L4EA 3R3YA 2H1OA 1MG0A 3RFXA 1MIOB 1E5XA 4UMFA 1MHPA 1S2IA 1IZ0A 2WUEA 1FMTA 4V3BA 1G1MA 1YBHA 1ZRHA 3MCZA 1EE9A 2AMVA 2ZUTA 3MCAA 1GNSA 3BD8A 3I2GA 2ZBQA 2V1UA 1YH3A 2C9DA 4GMDA 3E5MA 1QU2A 5A1JA 3P4XA 2ZR0A 2VYFA 4PIVA 1IDOA 2EF1A 4MSUA 2I7TA 4NOLA 5ALKA 5TGTA 2JFBA 1W34A 1Y6QA 1IY9A 1FS5A 5ECDA 4BFUA 1OILA 3EZ2A 3TAUA 4OB6A 1C30A 2JZNA 2JLRA 2X0JA 3AJAA 4RLQA 2DHQA 3IKTA 4NZ9A 4KFTA 3BXGA 3IEKA 1P44A 1UCFA 1SHZA 3C87A 3UATA 3IP7A 4CWAA 3L5KA 4LI3X 4DV4B 2YBDA 3U3KA 3BQNB 4GZ6A 4K03A 4OHFA 1J0AA 1UJ5A 2R7MA 2QE6A 5LM3A 3I9MA 1QDLB 2VDNB 3GJ7A 1MQ8B 5TT1A 4JJZA 3WGIA 1KEZA 4DLUA 3CEMA 4UASA 3UYKA 3SX0A 4ZQGA 4JDPA 5AKYA 3D8BA 3Q8XB 2VJAA 5F4ZA 4B6OA 1JLLB 1TUBB 2HPZA 2ZB4A 2AW3A 2V0NA 2V6IA 2ZRJA 4GKVA 4PBTA 1EXWA 4EM6A 2A9KA 2P79A 4O2BF 3KHKA 4MCJA 1BVRA 4YRGA 4ZIRA 2HF2A 2QZPA 2X22A 4UUOA 3R8CA 3ZJVA 1UBCA 3DOIA 2AI1A 2Z8XA 1LLDA 4JOBA 1FK8A 4JP1A 2Y9MB 3PRYA 4Y0VA 2IKQA 2WAOA 4RPGA 1U98A 4LWPA 2QM8A 3R3ZA 4PLWA 3EQ8A 1VHTA 3EZ7A 4F5YA 1IB0A 1DX6A 5KSYA 4HPXB 1ML4A 4IYRA 4FKZA 5AKGA 1RI1A 1NW7A 2O7QA 4D4GA 5I8WA 2IBMA 2GAIA 3HB4X 1SZJG 1FNDA 3KQLA 3DMPA 1ECLA 3FI0A 3MWGA 2P9HA 3IBCA 2Q2OA 3ZLUA 1H2BA 4XWYA 1TZCA 4GYJA 4KPGA 3TOXA 1V96A 3WB0A 4UHHA 2IPAB 5C1OA 1BDBA 4MINA 2JEYA 3UG7A 2ZJFA 1QTQA 4H6VA 4G5YA 3CYFA 3IEIA 2FMHA 3IMKA 4YJ3A 4DC1A 1AURA 1P9WA 4FMCB 1TJ4A 4A8PA 4A0FA 3ITDA 2HRDA 3H2IA 1T9HA 3F67A 3EQ6A 3PUJA 1E0KA 3TBHA 1M8KA 3FLEA 4NDNE 1T5HX 4XTRA 2X42A 4WY5A 3HYLA 5CVCA 5EPOA 5C1BA 4R2LA 4IIHA 3O4VA 1E9RA 5F4BA 5CCBA 3RJMA 1RKBA 1PHPA 2PR7A 2N0SA 4CTJA 2WF8A 1QV9A 4G97A 1C3EA 3QITA 4HMPA 2C9OA 2C2BA 3LUHA 4MIOA 5D3MB 4Y1RB 4BNNA 3FYTA 3MTBA 4LZOA 3KSAC 2XF8A 4HAXA 5HRAA 4J43A 3TQTA 3DHNA 2ZJ8A 3PDWA 3QMVA 3NLLA 4J6FA 4DYDA 3TIIA 2NQ8A 5KYWB 4AJIA 4MUGA 4E5PA 2DETA 4PVDA 5AM2A 3D7KA 3QBVA 2SKEA 1Z5OA 1ISHA 2WKSA 1N25A 3I4FA 4C08A 4HNUA 1U90A 3ZJTA 2X19A 4YFYA 3LVQE 3GJXC 4X84A 1IPFA 2AOVA 1YDFA 2K2WA 2OAEA 4EB8A 3VNUA 4P4TA 5KQRA 3OJWA 3P8ZA 4MUBA 3EOBI 4QQRA 8GPBA 4OX9Y 1K1EA 4KU4A 3C8MA 3IAFA 1WSWA 2CLMB 4ITVA 4MR8B 4W9NA 2YWGA 3Q7EA 1HPLA 2CYBA 2QPTA 5SZJA 1RXUA 4D7AA 1JR6A 2DT5A 2ATCA 3PF8A 4H0NA 2YXLA 3FSRA 1HYBA 2DWPA 4A16A 2DQ4A 3AJ9A 5K9ZA 1RWKA 3PXDA 3MJVA 4ZALA 2JAWA 4QDUA 4Z51A 4XGNA 4D8WA 3OLQA 3V4VB 1O6GA 5FLXA 2QUJA 2BGRA 3OFNA 4DQ0A 5DBOA 1ZJZA 4KFUA 1RQ2A 2GTHA 3BHMA 5B57C 2QAGC 1IPHA 3F97A 4Q12A 3CR3C 4RXMA 3PCRB 4R3NA 1H6DA 5IJ0B 4XWWA 5DKFA 1MT0A 2X13A 1YIOA 1QZTA 3W2GA 2QU7A 4WECA 2LCQA 4BLPA 5T6MA 5L3SA 2CCGA 4JODA 5EWJA 3A0RB 4G86A 2AN5A 4PF1A 1E1KA 2IE8A 4WZAE 2V7QA 2ERCA 5E1OA 1R0WA 4G0MA 4KODA 1G4AE 2DR2A 3A1WA 2WQ7A 4KHPB 1A4UA 4H0CA 2H7CA 1LBHA 1NURA 3E15A 3HACA 3IRUA 1ABFA 2WU8A 4C6SA 1NV8A 1LSOA 3L1HA 1QLWA 1HLPA 2H63A 1ZH2A 3I6MA 1HKUA 3AF0A 1CG6A 1GUAA 4YRCA 3IO3A 3UOWA 1EWTA 2HB6A 3U9SA 1WRBA 1W46A 5BMVB 1FRFS 1MOZA 3EF0A 4GEGA 5LL6P 4AZVA 1EG2A 2MMGA 3CA8A 3W5BA 3ESDA 3F4KA 2GZSA 1Q5PA 1JTFA 1GTZA 2F17A 1GL3A 4UULA 3H3XA 1I1OA 2Q1XA 5FT9A 2V7VA 2M98A 3SNHA 2BMJA 1E2DA 3TLJA 5COQA 1G6OA 3B20A 3T0FA 4CIVA 3JXEA 4LK2A 3ON5A 4BQIA 3WIDA 5KNDA 3S5JA 1GCOA 3FUWA 4ZT2A 1ZN8A 4IDBA 4LHEA 5C1DA 2ZAGA 5D85A 2D2XA 5AK0A 4FS3A 3NPAA 4HDCA 3EY4A 1OYWA 2OXRA 1BFKA 4IQFA 3TSWA 2RHWA 1E7WA 2GGSA 5CH3A 3U4AA 3NDIA 4PNZA 4LF8B 2FEPA 5DGIA 1Z62A 5GONF 3TM4A 4ENQA 3HVRA 2DUJA 3HH8A 1N5JA 5EVJA 3WSWA 4LJ8A 2PJUA 1A8HA 4R41A 3G0BA 2YC2C 1Z4KA 3NIWA 4OSEA 4B43A 5F64A 3IIKA 4DLAA 1FF9A 3CKYA 4Y18A 1RM3A 1U7PA 3HFSA 3A9UA 4DIDA 3U13A 2C97A 4NESA 5BN4B 4TVSA 1VJGA 4HEQA 1UXGA 1AKVA 4CUKA 2DLCX 3OLYA 5CG2A 3CN9A 3LL7A 3OLXA 1EX7A 1IIBA 4G0YA 2XNKA 1V8FA 1JI3A 3WYBA 1E3LA 4LY0A 1OKKD 3VHXB 3I05A 1Y8AA 3TQHA 1CUXA 4NK4A 5K3SA 3QU5A 4I66A 4BLRA 5MN5A 4YJ2A 1IZ7A 1E6CA 3T3GA 2P2GA 4XQ0A 4C0XA 2AOTB 1DRWA 1HE3A 3NV9A 4C5BA 2HLDD 1RLTA 3NKLA 4PGHA 2O2ZA 5I3ZA 1GNPA 1OV6A 4R16A 3OHMA 2WSYB 2WPDA 3AERB 1FPMA 1P0QA 2DE0X 4MUAA 4QRDA 1U1FA 4Z9FA 3VR2D 3WWYA 2I2CA 1VPDA 4HYYA 2HK7A 1VJCA 1GR0A 1W29A 4XCVA 5AUQA 4YCMA 5CU7A 2WWFA 2OSBA 4NABA 1NW3A 1Q84A 4QIHA 5GOTA 2J3EA 3T5MA 4UTPA 4WESA 3VU8A 4RK0A 3TNLA 2OHHA 1PT8A 1KS9A 3L0CA 1B2RA 2XD9A 5LDGA 2WY2D 4DMHA 5DCWA 1Y9AA 3A31A 3UMSA 1N2JA 2VJDA 3KOWA 4UUAA 3HCBA 1QGAA 1CRZA 3PL5A 1C3JA 2O2EA 3PVZA 4OKIA 4OI1A 3NAZA 4UUQA 3AG6A 3G85A 1TJ5A 4F92B 3NHKA 4PLCA 4X1KA 2XUPA 1GVNB 3P9ZA 1FUEA 4A1OA 1MB0A 5A3JA 3SE7A 1GKIA 4PRZA 5DWDA 3TQFA 2PPLA 2IDZA 2Q5LA 1N4DA 3F3SA 2HADA 4ZAZA 2HQSA 4YUAA 1HETA 4OXNA 2SKDA 3LUGA 4HDKA 2WOJA 4ENVA 3GDGA 1NR5A 4DL9A 1C7FA 1RWWA 2QTAA 3Q5DA 4J9UE 1UPXA 4KIUA 2X0DA 4MQMA 1JG1A 3U0BA 3UZUA 1EFVA 5G0WA 3T94A 4RXUA 1TU4A 2GZDA 2P9QA 3UA3A 1U2TA 3PE4A 2V3WA 2YHSA 4M0FA 5HZGA 4YMIA 1YS9A 2BBSA 3U0VA 3OE1A 4LK3A 1G66A 2E37A 1SRRA 1F0PA 2OO5C 5EP3A 3D54D 3NNSA 5LMNB 3NHBA 4QT0A 2YHIB 3ZGYA 4WAUA 1KR5A 2CDCA 2LVBA 5IWCA 1YD7A 4EYOA 1X3SA 1BRMA 2R66A 1BEZA 4N3NA 3QVMA 3REFA 1QM5A 3KWMA 4Z4CA 4XPIA 2PAFA 3WLSA 4ZYUA 2IS4A 2H4ZA 3SQLA 3BWMA 3SVTA 2FFQA 1KETA 2ZWOA 3A9CA 3L7IA 2GZ3A 1BROA 1WU8A 1CTQA 1T15A 2FRVA 2P41A 3CONA 4TTIA 4TWAA 2PH7A 3IIJA 3WGVA 4DC9A 2AXEA 2MR5A 2QLMA 4OMFG 5CK5A 5JYDA 1RJ9B 1COZA 1D4AA 1BD3A 1XVUA 3PPWA 2FZLA 3QWFA 1NT2A 4FOLA 1AQLA 5CVDA 4E7OA 4F9TA 1FMLA 4LCEA 4LMPA 4OHMA 1KAEA 3NVAA 1ZD5A 3Q10A 2GPBA 4BWVA 2OCYC 4K3VA 3LVBA 3GLGB 4RZUA 5IJ9B 2NYUA 1JEEA 1EGVB 3N07A 4M7WA 1W88A 4G4GA 4HH1A 1Q7BA 4MLCA 4OCZA 4D4KA 3T7TA 3CUEF 3RADC 1N1EA 2BSQA 1WETA 1HQKA 1JA1A 4RLFA 4TRMA 1DKUA 1U99A 4BVEA 1KVUA 2GCPA 4OHVA 1BU5A 3CZPA 1RHUA 2BGTA 1UKYA 3KOUA 4QXRA 3VO2A 3IT1A 4HH3C 1XNQB 5EJ4A 3K9BA 3PNOA 5DBGA 2BFBA 1N2ZA 2E4AA 2TMYA 2ZSKA 4E2ZA 4ENRA 8AT1A 3FVRA 4NJOA 4Q9DA 3UBTA 4HI0E 4CM3A 4ZOQI 5AVYA 3R5TA 4PGGA 3Q87B 1E7YA 3THRA 1UPTA 3L4SO 4X8OA 4BMSA 4H2DA 1RM5A 1H5UA 4WOBA 1IH8A 4PZCA 4QBTA 5KAMA 4A2CA 3FROA 2FJPA 5DEIA 3AEQA 3A3PA 4QUGA 3JQBC 2NQTA 1JFTA 3FPEA 1PL6A 2PL9A 5HPYB 1EPUA 1TF7A 4CKYA 1N6HA 3HJTA 1TF2A 3SXUA 3HLYA 2OB2A 2EDCA 1HGXA 2AZXA 3K2IA 3ZU2A 1WUJS 1HTTA 3IKJA 2A5GA 1QGYA 2GYYA 2IELA 4AF8A 3W4IA 1HT3A 2VDOB 1UQTA 3G5TA 5JRJA 4ER3A 1E1LA 4N0PA 1QBKC 4NTZA 2NUTB 1IJFA 3ZDCA 3LDUA 4RMNA 2M2IA 1KI7A 1AGRA 1V1MB 1YO6A 4KEAA 3TRIA 3FHOA 3CH6A 1MO4A 4ZHQA 1YU6A 3SHTA 1DS6A 4PZEA 1OBVA 1QQ7A 2F7SA 3ISJA 1W52X 2HSJA 2OP0A 4KDFA 4RVHA 1A8SA 4CF7A 1BMDA 1KZHA 2ZIUB 2RJ3A 4BNIA 4E5NA 1AKYA 3S44A 3C6BA 2GM9A 4CLOA 3DE0X 3KTAA 1BCSA 2G1UA 1YR9A 2FW0A 4NIMA 4ZOLA 2VJQA 3WADA 4EF4A 2CDBA 2FW1A 1Y5NA 1ZMXA 1TE2A 2QKYA 1ZICA 4PU0A 4WH0A 1WCIA 2W2QA 4HD8A 4YJ3F 1GO2A 3ES9A 4YAFA 5DTIA 5B2EA 3T8YA 4TT3D 5A04A 1IM8A 2WM9B 2WWIA 4V0MA 1AU9A 3FE2A 2JGDB 4ZICA 3JTEA 16PKA 4OUDB 3RWBA 3CO0S 3HB0A 2C5LA 2C8KA 2PMEA 2CLSA 3ZE0B 2VNIA 2FWPA 3GMDA 3X1KA 2MYNA 4WNCA 4J0EA 4LY3A 4N76A 1YQQA 3DD5A 2BIFA 3JPWA 1FUKA 5DNEA 5BOSB 3VUFA 1NRJB 3WJAA 3CVXA 1MGOA 2PKEA 4RAOA 5EIAA 4ZVKA 5M7EA 2GCOA 2FSFA 3AR2A 1CUGA 3P2IA 4GBGA 4ZVTA 1E9VA 2R6JA 1P1JA 4B83A 1A7KA 4IUDS 1Q92A 1XWFA 1O5IA 3T4PA 2RGAA 9LDTA 4DBZA 2BV3A 2CWWA 2D7CA 3STWA 4QGHA 1V47A 5HIKA 1YUBA 4ZCTA 1RPZA 4YP6A 3M33A 1X38A 2JLXA 3CZAA 1F6WA 1RI5A 4I1RA 4MVJA 1RFLA 2OFOA 1NLFA 3RPEA 5AP9A 2HSDA 1MIOA 3E8MA 1KAQA 4OAQA 4OBWA 3T7CA 3WL6A 3O4RA 4EPRA 5I7WA 5IKXA 4AZTA 1QQAA 4TS4A 1I1QB 1MVLA 1VLZA 3KU4A 1T2VA 3NETA 3WI7A 1HKHA 3L18A 1NVGA 3PICA 4RPLA 4HEA1 4JLDA 3DBRB 3MTGA 2H1FA 4RPKA 2HD4A 1JG3A 5GMOA 3A3YA 1AKNA 1XCJA 2QW0X 4I5IA 3TTYA 5ANRB 4HAWA 5IK2A 1DIRA 2O23A 4Z8XA 4KH1A 1PN3A 4O59O 4E7PA 4L22A 3SFVA 2FUKA 1SUFA 2PZLA 3IMGA 2H7XA 1UC8A 1NZFA 4G41A 4CMEC 5BV1A 4KSCA 1DO0A 3SC2B 5FUWA 4CBVA 4AYXA 1JXQA 5CAEB 4YT5A 5IT5A 5A4IS 1MX3A 1GUZA 2Z9CA 3S29A 4CNBA 1P80A 1S2MA 1E9CA 1FFSA 1BQ3A 3K92A 2PLFA 1T9AA 5AK3A 3IUPA 2JPDA 3ZK8A 4EHAA 1UUFA 4KXNA 3DLHA 4ALJA 1JYEA 2BTQB 3PL1A 3K6JA 4OO3A 2P9CA 4EDFA 5LN1A 4QPNA 1T8PA 1T8SA 3PZRA 1JDZA 4CQLB 3TIFA 3JYQA 1JLLA 1TUBA 3SF8A 4CMCA 1TJYA 1MC4A 3HXMA 3EZFA 3HDYA 3I9V1 2YJGA 4NHOA 4ALLA 1YIDA 2QD3A 3D0QA 2GEUA 2IEYA 3FZEA 2YJ5A 3IHLA 1PI3A 3KJXA 3LDHA 3GRRA 5EEGA 3VZCA 1EE2A 3F7NA 3GPLA 2VRWA 3WLOA 1WZNA 2X14A 3HN7A 1L5LA 1BN7A 5ERGB 3TBFA 3GZJA 3IBTA 3OZDA 3HI4A 3BMOB 2ATXA 4PSCA 1T35A 3IYLW 4YUYA 1UFKA 4HWSA 1YQWA 3AKZA 1RQLA 3QEMB 2OY0A 4ZVMA 1ZRMA 3O73A 1XTZA 2AC7A 4CR6A 1L7QA 4RH0A 4FCTA 4F9EA 2HDNB 1DEKA 3N75A 1XRLA 2FPGA 1IUKA 3HB5X 1KY2A 4C5AA 4ARIA 3DBOB 1AHHA 1RQRA 3ZLTA 1SIUA 3EXIB 5JY1A 4LCJA 4DSTA 4WLVA 1R4NB 1UDWA 3KE9A 4X45A 1B6GA 1TO1E 4OBBA 1OC2A 4HL6A 1OGIA 4DCUA 2OZLB 3ER9A 4DV3B 1VSTA 1U3TA 2A78A 3NX4A 4IEEA 1KJIA 3I2FA 2O1WA 2VJPA 4U2EA 4U1RA 4V38A 5ALMA 2D62A 4HYQA 2ZVPX 4R2KA 5ILQA 4F04A 3TG2A 4GDFA 3KPYA 4E46A 4IM7A 1JHVA 4FIDA 4EH1A 2CWDA 4CV1A 4C3ZA 2KYRA 1A9ZA 1T5IA 4A9AA 4EA7A 3PHCA 1O6CA 1J2YA 2V7UA 1X13A 1JDVA 2BFEB 2PGOA 4EYQA 1X7ZB 3K9LA 1GIAA 4JT2A 2N75A 2VP5A 5F77A 4ZYVA 3ZVNA 2FK7A 3T3NA 3F0TA 1SHKA 2D00A 4L75A 2BSXA 1FTQA 2PNFA 1TRKA 1V43A 1K89A 2A6PA 2ZM5A 3L7LA 3I9FA 4CM8B 1IM5A 1KO8A 4DNPA 3OCCA 4QGFA 2AZMA 1TVKA 5D3MA 1GU1A 5ERXA 4BV8A 2BR5A 4CGYA 4X92A 4P92A 4Y1RA 2BGIA 3QOWA 4DLLA 2JJQA 3IL2A 3PCTA 1LBSA 3K8ZA 3SS8A 1XO1A 5KYWA 4O1HA 4YJ2F 4F97A 1R37A 4UPEA 5BUCA 3G6KA 5KMGB 2E89A 2H57A 4D0NA 3FWPA 2GM4A 4P3PA 4TL8A 2C31A 2IU4A 3QBEA 4EP1A 1W0KA 5JMTA 2BRUA 1GAWA 1CC1S 1E9SA 1TT7A 2H0RA 4Q1FA 4N9QA 5I3CA 5JVDB 1UOEA 4KWHA 4JV5B 1T6XA 2Z95A 3WC4A 1Z0JA 4X1YB 1KYTA 4WBSA 3ZE8A 4TM8A 2WG2A 1D2EA 2M1ZA 1G21B 3FKJA 3OOSA 4MR8A 2ZQZA 3DCJA 4BHTA 4LZNA 1EFKA 1K0FA 2KBFA 3H2YA 4XIIA 1Y82A 1IK6A 3HR8A 2OG1A 1DAEA 3BN3A 2WUWE 1C7QA 1WABA 3JQ8A 4G24A 4BC0A 3CG0A 3TJZA 4BMOB 2NPFA 4INZA 4C3OB 3NTXA 3ONWA 4TLLB 1FTNA 3C6ZA 1SBIA 4XM1A 5ALDA 3VTAA 4EGJA 5K3DA 2O2XA 3QBTA 5DOVA 5I7AA 3VR0A 2ZR7A 1VBKA 3SICE 3EMDA 5TX7A 1QR2A 1MO5A 2JCYA 1XWWA 5H81A 5AVTA 4ZVNA 3EEIA 4PV7A 2HXGA 1T4CB 3URMA 1PFUA 1X9GA 2C2KA 2D0OB 3D3WB 4DYHA 4DJDC 1LZKA 2XIJA 3Q7TA 5IJ0A 3B5EA 3K0BA 1M76A 1JG2A 2R65A 4S3MA 3E7PA 4W5HA 3UOGA 1OB5A 3DLCA 1DB3A 2XLBA 4RK4A 3WLQA 3K70B 1CETA 3CUTA 1HY3A 3TKYA 1AS3A 3LRTA 2MT9A 1DX9A 4IGKA 1IIRA 4B6SA 4O0LA 1RBYA 4GZLA 4P5PA 3DE2X 3F9RA 2R8ZA 2YYSA 3BTUA 4QAQA 2R4TA 3ZOKA 4IUCS 5IVPA 3AUYA 1U0JA 2XNDD 1NULA 2FG7C 1EA5A 1U0RA 2W2MA 4UNRA 4BGIA 2ZUFA 2N47A 3UMMA 2YICA 3IMFA 5DLQC 2C8LA 4IICA 3VSAA 4GMKA 4HDMB 4AD8A 3GEEA 3KYJB 2WE8A 2IHZA 3MIZA 5ESDA 5FB3A 4QGGA 5ED4A 2DLDA 4RTKA 3UQYS 4EJFA 2RBEA 4IS3A 1W25A 2WJIA 1R66A 5BMVA 1ZK1A 1MC1A 1I9GA 1TKRA 2F64A 5IAEA 2Q1UA 3BIWA 3N5CA 4EY8A 2JLBA 2VBIA 3ANMA 3V4PB 2QTBA 3PC6A 2UUOA 3GU3A 3Q3IA 2BELA 1VLJA 3D6NB 3DNMA 3PDJA 1AZLA 4YRKA 2SECE 4RSHA 4B0PA 3N74A 4EI2A 4U3JB 1IHUA 1OZGA 1W6RA 3QVOA 4UVIA 3OE7D 4Z53A 3BCUA 3DQPA 5A2QA 1M33A 1U7HA 1P0IA 3JASB 1Z26A 3K9CA 2YVQA 5DGHA 1T1GA 3JQ7B 4NQZA 3R76A 4IBOA 3ZBTA 2C77A 4B4UA 5A4FS 5CEFA 4UEWA 1A0OA 4B4DA 4PAWA 5L3RA 2EJVA 4MGEA 1A9QA 1I13A 4G1EB 4K05A 5JV5A 2RC5A 4XVQA 2QJWA 2P9FA 3TN7A 1AXEA 1XLUA 3C2QA 4B5KA 3KP1A 3LM8A 4TKLA 2QVBA 2QT0A 2OYRA 2HJHA 3GNLA 3DZKA 3ZDFA 2RGEA 3PUXA 4I3FA 1DQZA 5BN4A 5IABA 4KQGA 4RAQA 1VRVA 2B5WA 4WE3A 3UJ8A 3QG1A 3GJ3A 2J3LA 4DGQA 1W85B 4LS3A 3J7AC 2PX6A 4MROA 1QCCA 1HQDA 4RD2A 1JZTA 1NRWA 4KJZA 1JEQB 1P61B 1W49A 4REMA 4TRNA 2FSSA 5C32A 1HF3A 1VE6A 4D9GA 2FSIA 2YV3A 4MXDA 1DIAA 2AOTA 3UAXA 5FH9A 2CY0A 2SKCA 3H4IA 1XP8A 1WLSA 3W1WA 3EZYA 1LK0A 1TA4A 1JDNA 2VUTA 2WUGA 3D6FA 3AERA 3KLPX 2FWMX 3LG2A 2A94A 4OQQA 3VDRA 4A10A 1YUNA 1E94E 5KYVA 2VAPA 3EGDB 2HGSA 2X5KO 1R0ZA 1PVVA 2ENWA 3SCZA 1N0IA 3BRWD 3Q4GA 4JSTA 5BV0A 5JJCA 3VJKA 3LXMA 3V7NA 3AKEA 1NUTA 3OWOA 2ET6A 3O1LA 4TQAA 1WDWB 1N5MA 3EG9B 3O9ZA 3ZLBA 4B3CA 4M6WB 4BPRA 1P5HA 1O9GA 2WM3A 4LVCA 3COSA 4R8KA 1XLWA 4RSRA 3THOA 2V3VA 2LXNA 3SR4A 2FPXA 4XI9A 2HN9A 4O2AB 2R4UA 2CB0A 3R3JA 4ZOLF 1JLSA 4BFWA 4AN4A 4B85A 4DCTA 3FH0A 3VV2A 4JBGA 3ESRA 1STOA 4MMXB 2E6KA 1AIPA 2CVZA 4FX5A 4OPMA 3I6YA 4UVGA 1F4VA 4D8TA 1RHJA 4I9HA 4OU4A 3WNCA 3PHBE 5HIAA 4RPHA 1QRUA 1BRTA 5G4LA 1V26A 3IOBA 4RCYA 4NONA 3A6ZA 2ODNA 3DAGA 1C50A 2EYUA 2YXDA 4MUHA 3UV3A 1RP7A 2W2NA 3OKPA 4QUKA 5KYTA 3A1UA 1TGYA 5DO9A 2HUNA 3TQRA 1MOSA 4JI6B 4F3YA 1VMKA 2HF8A 1JIQA 2YHIA 3INGA 3J81k 2PKXA 3HRHA 2OV8A 3IOYA 1QZUA 1R0CA 4LZAA 4BNYA 1WVMA 1RYEA 2YZMA 4S12A 2ZBGA 1KK2A 3FPCA 2FZEA 5IKEA 2N1MA 2EX4A 2QVZX 1DXHA 1VLVA 4TL6A 2FPLA 5BURA 2ZVDA 2Q5OA 1PFKA 2KLHA 2W37A 1PTJA 3P9PA 3DB2A 3LT0A 3EVZA 4IIFA 4KXXA 3HP1A 1EQAA 1P2GA 4N6NA 4C30A 5AM5A 5JQGB 3AUUA 5EE1A 5CYGA 4L9RA 4PNHA 4MVJF 1FBNA 2SCUB 1RJ9A 3CMMA 5HX7A 3W9YA 3U6BA 4JJ6A 3REGA 3ZW8A 3OCUA 1IULA 1ZM3A 1A4IA 3IDOA 1Z0AA 1I5RA 1OC4A 2X77A 3IAAA 1D1QA 4DLVA 5D5QA 3V2HA 3K0FB 1L1FA 3GG2A 3QLUC 1IG3A 2C42A 4S04A 3BXOA 4GOLD 4Q7JB 2QYHA 2QXYA 3AP1A 3GLGA 1TNDA 5LU9A 2NTNA 5GAJA 3DUWA 4RVOA 1SN7A 4QTTB 1UAAA 1XRRA 3UN1A 4NE7A 5DXJA 3TB6A 1C4OA 4IDFA 4JYAB 3R8FA 4KWTA 1EFRD 3VR3A 4C03A 2O07A 4DQVA 2ILTA 2UVQA 1UBLS 3L0DA 4GE0A 3Q40A 4E1AA 4I4TA 1A88A 2H48A 2R62A 4K9NA 1NV9A 4E11A 4AZ3B 1UBNA 3CNOA 1YU9A 4IOKA 3JZDA 3L1UA 4JGIA 4B4WA 4OM8A 3LY5A 4EHIA 4CL0A 1RRFA 4DADA 1SCKA 1HURA 2IHTA 5LP6C 3SOZA 4D43A 7YASA 4EKNB 1P5FA 5CTAA 4L5AA 2JFQA 4KKXB 4U9HS 4UTXA 2C99A 2Q0HA 1F1BA 1SIBE 1JDBB 3GH1A 4ROSA 3UH1A 3S2UA 5LJLA 3A7DA 4WXRA 1P2SA 5EKTA 1BJRE 3SIWA 4JYCA 2Z1MA 4CJXA 3TEMA 3OM8A 2QR5A 5MGBA 3OZWA 3QUTA 5CYOA 4ZAYA 3UPDA 4EY4A 3F8TA 2B36A 5FUBA 3WSTA 4D5EA 3T5PA 5DX1A 1SCDA 1NONA 2QN8A 2BY4A 3BFKA 4MWDA 1SBQA 1EIZA 1XJWA 3GFBA 4R1QA 2HEGA 2GJAA 5JPCA 2NUTA 5C7LO 3SOPA 3UGJA 1U7TA 1XXHB 1V1MA 1N6NA 1UK9A 1XZCA 1XZMA 2DY0A 2NXNA 1DL5A 2XYGA 3DDSA 3L6UA 5K45A 5JNUA 2JLAA 5J1TB 2B98A 1GCGA 1PR2A 1EP2B 1L7NA 2CXSA 2V9PA 5DHPA 3WIVA 1O77A 1C0EA 2VXCA 3MTAA 2I80A 3B36A 1KY3A 1T5OA 3JAKB 5IUKC 1FLNA 3AC0A 4OHKA 5IVDA 1YTUA 3QBDA 1P2BA 1OY1A 4II7A 1JXOA 5LLSA 3GNQA 1HX7A 3SQWA 3OAAA 2WG0A 2XYVA 3RRBA 3QPVA 4PX2A 3T7KA 4GR9A 4FMCF 1VYVA 4GKAA 1GRQA 4BL5A 5EG5A 1Q12A 3RG8A 2JGDA 4JT9A 3PD1A 4HAOA 4Y6SA 1U8UA 3PS9A 4BLOA 4L0CA 3DLIA 1N9GB 2QSYA 3N8GA 3R7DA 4L7VA 3QVGB 4XWAA 3T7RA 5LA6B 3S1LA 1FJHA 5JZ9A 2W42A 4O4LB 3CF6R 2MIIA 1RSZA 1GM5A 5CLLA 1U0TA 3ANTA 3H5TA 4ETIA 2ZSAA 5CFLA 2X5XA 3EHDA 4WERA 2CSUA 4DR2B 1EXVA 2OORC 5BOSA 1RXSA 1T6ZA 2JFVA 5EMLA 2WNHA 1CD5A 3HJRA 4CHGA 1FXUA 4ROTA 1KJ8A 2RAVA 1RZVA 1IBRA 4X44A 2XUZA 2CJXA 2F67A 1QV7A 1ZIDA 2OQ2A 2PU7A 1I3LA 4P31A 1KU6A 1EHYA 1PAUA 4IRMA 4ARZB 4F6RB 1N78A 2ZFUA 5EIFA 1WTCA 3GFTA 4A2QA 4ASUA 1C1HA 1V41E 1K6IA 4MYCA 1ENPA 4MVJG 3UA4A 4MJLA 4E22A 1QHIA 1X9IA 1Q7CA 1SUEA 2E49A 3KM0A 1SOMA 1W2GA 2AZ4A 1XZEA 1DXQA 2P1DA 3IPYA 3LW8A 3VVBA 4EY3A 4CQJA 1UKZA 4ZVOA 4XZ3A 5HF6A 5IW8A 3UJNA 2WHRA 3S7TA 1TCCA 1FDIA 4RA6B 3WL5A 1G5IA 4EYEA 4CLOB 3BK7A 4D4HA 1RZUA 2HQ1A 1FFGA 1CZNA 3DBRA 3M6VA 4V24A 1PBTA 4HQNA 4KGZA 4J4TA 3STHA 4AO6A 3SHQA 2W93A 1YCDA 1J2JA 3KLBA 3GJ8A 3R3HA 4NEQA 5ERYA 4IX1A 3WGOA 5JTTA 4F91B 1QB7A 5L3QB 3IQFA 3BUSA 4Q7KA 4E5UA 1C7ZA 1POXA 4EEXA 3G2IA 2P5SA 4OJKA 1ZN9A 3QX8A 2QMUA 3NC1C 2ZETA 4WY2A 1P9OA 3A1DA 3ZH2A 4AK9A 4WI1A 4PS0A 5CAEA 3QIAA 5B3JA 4QG3A 3F7TA 2PQ2A 1E2KA 2E1PA 2TYSB 2I99A 2W4MA 3ROFA 3IQZA 5LKAA 3L06A 4B48A 4S1TA 1F17A 3ZPXA 2ZRHA 2BTQA 5DCLA 4UE6A 2FFJA 4YAEA 1CK4A 3BE8A 5F2KA 4F4IA 1MD9A 3KUCA 2C8VA 4RFVA 1A27A 1I3OA 2PAAA 2PXCA 1ESCA 1QAMA 3RTGA 3P9CA 5COBA 3OU2A 4ZV4A 9MHTA 2PEZA 2PFKA 2OFFA 3JQ6A 4QTUB 4UNQA 4CFZA 2Z8YA 3BXFA 2QLBA 3ZV7A 2IL1A 1SM4A 4YP7A 4DCPA 5BQ3A 2ID4A 1OU0A 2TMDA 1NVTA 1DAGA 5IBRA 5F5LA 4ZXFA 4E13A 1E2IA 2IUTA 4M1TA 2X2PA 4EVRA 5GM1A 1OI7A 4D5GA 2VQFB 2O4UX 1OV4A 2Z08A 1H6AA 3AIOA 3DEJA 1ZI8A 3LYLA 5BMVF 1GTRA 7MHTA 2QI9C 1XX6A 4ZO9A 5CM2Z 3OQNA 2FV8A 2C29D 3A9RA 1RYYA 3NANA 3K9FC 5JDIA 5LBTA 3SKYA 1RQPA 4DQLA 2QAJA 3KTDA 2P69A 3U4GA 4BKOA 1YE5A 5TVKA 3EXIA 1ES9A 1T4BA 2WC1A 2O0LA 3NEAA 4J8PA 4NQRA 3W05A 1R4NA 2B2XA 2D5BA 4N3CA 4P3KA 4ZN6A 4AJ2A 2OZLA 5DSTA 1UEIA 2Z8ZA 4RVUA 4L3VA 3P26A 4RHEA 5T4EA 3T06B 2W6MA 2UV8A 4JJEA 2FFRA 3EX7C 4X3OA 1EVIA 4GM4A 1VMIA 1SUBA 1NQAO 3AM4A 5JSUA 3RIXA 2OBLA 4N65A 1FRNA 1M1NB 5LUAA 1X2BA 2F8TA 3ITNA 1NN5A 3JQAD 4PCVA 2BFEA 1X7ZA 3R6TA 4MA0A 1C5KA 2HWXA 5G41A 2W6ZA 1Z39A 4YC7A 3TF5A 1CYDA 3P52A 3IHWA 2II6A 1Q0ZA 2NVUB 3LKDA 3KV3O 5H1YA 4CM8A 3QEKA 4UMDA 1II8B 1GJRA 4Q0MA 1QUFA 1TMOA 2LP4Y 1NYQA 3CV3A 3H2JA 4IEIA 4XD7A 2Q1WA 3S2GA 3MZ0A 4KO4S 2IEIA 1N32B 2PEYA 4L4XA 3IAM1 4QNMA 4BXOB 1R0XA 3ROEA 2FZ5A 3N2GB 4H15A 4DJJA 2M1XA 2YWCA 2D7DA 3RODA 5H80A 1GAQA 3ESCA 3ETEA 3I2KA 3A6LA 3NUQA 4LX8A 5G1OA 5KMGA 2NO1A 3Q5EA 2C5SA 4FTWA 5FWAA 4BQOA 1C2YA 4EYSA 2KWIA 5JVDA