4ZWNA

Crystal structure of a soluble variant of the monoglyceride lipase from saccharomyces cerevisiae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
SAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFSPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIRDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMKQWLDKHTTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Saccharomyces cerevisiae monoglyceride lipase Yju3p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase
molecule keywords Monoglyceride lipase
total genus 114
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zwnA00
5EHZA 4CIAA 5EHXA 1H2WA 1CR6A 5CURA 1QO7A 1EB9A 1YSCA 2OLEA 4H35A 1C7JA 3LCRA 3C8HA 4AMZA 2VQ6A 4BP9A 2PX6A 4V2IA 1BE0A 1YA8A 4CCWA 5HKAA 2XQFA 4MEAA 2ZYSA 3H1AA 3DKRA 2XLCA 3EIOA 1EX9A 4BVJA 1F8UA 1YAHA 1GKLA 3IUQA 4GW3A 5AIBA 3DJYA 4OB7A 2G5TA 4WY8A 4X6UA 2OGTA 4KRXA 5ALNA 4H0CA 2VSQA 5ALQA 1TKRA 4KYVA 2GYWA 4U2CA 4H18A 4X97A 4EB0A 3V1KA 1K8QA 1XQYA 4KE8A 4N8SA 4C4YA 3FAKA 4UBOA 4N5IX 4DNOA 1EDBA 3FWHA 4UHEA 1ZJ4A 2BKLA 4QDOA 5T4HA 3G02A 1A7UA 2HA7A 1EVQA 5A62A 2WUDA 2X8BA 5CH3A 4GBGA 1R9NA 2XUGA 2HA6A 3STWA 1CQWA 1EHYA 3ZLUA 4FKBA 1JKMA 2J3QA 5AH0A 2QVBA 4B7ZA 1JMKC 4AO6A 1XZHA 4BDTA 4BCBA 2RI6A 3R3YA 3CCBA 1LLFA 1DT3A 3H2HA 1DX4A 2PUJA 1EK2A 1FJ2A 2HFKA 3OTQA 2G63A 1JJBA 1TQHA 1BN7A 2WU3A 2WG1A 5K3BA 1QJ4A 5JALA 4Y2RA 4PNZA 3HJUA 3JYHA 4UHFA 1ZI8A 1SOMA 1LBTA 2J3DA 4KR0A 1TAHA 2XUQA 4QLOA 1SCKA 2GYUA 1XRQA 6YASA 2BAGA 4FNGA 4RE5A 1MAAA 3B3QA 1CUDA 3IUMA 2QRUA 4CCYB 4FDMA 3KOOA 5HF9A 4M0FA 1U65A 3QMWA 1JT2A 5CW2A 2HRQA 1BN6A 1DQZA 4GDMA 1CUFA 1SCQA 5CH8A 3RM3A 2FJ0A 4DSAA 5AI4A 1DT5A 4G4GA 5HKBA 1BRTA 4MEBA 5LZ5A 4KAFA 3H2IA 1ZI6A 5A7HA 5CT5A 2QXUA 4E11A 3T4UA 3WMRA 2BGRA 4L0CA 3D2BA 1HBJA 3QYJA 4FOLA 5AM3A 4JH0A 3A2MA 2GYVA 2HA0A 3MGAA 4QA9A 3C70A 2WFLB 3ED1A 4FBLA 1XKTA 2W6CX 3KWJA 1CPYA 4KE9A 3G9TA 2DCMA 2V96A 2PBLA 2ZJ7A 5LKRA 1QLWA 2UZ0A 5D3ZA 1YR2A 3E4DA 1R88A 3U1TA 2H9YA 2RGUA 2P8SA 1CUEA 3G0IA 3WZMA 3IULA 3FNBA 2WQZA 5JAHA 3I2GA 4ZV9A 2BGNA 4QDXA 3KDAA 5T4BA 4B0OA 4EY8A 3LLCA 5AKYA 2QR5A 4UPDA 3H04A 2AJDA 4OYYA 2BFNA 4TGLA 1MJ5A 2BUCA 4CG1A 5A2GA 1GXSA 4AN0A 5LZ9A 3F9CA 5A6VA 5FP0A 4K5QA 4UBLA 4FMPA 4U2BA 1EDDA 2VJBA 4J3JA 1EI9A 5K3CA 4Y2PA 1WM1A 2CJPA 3EQ8A 4Z49A 4F21A 2WJ6A 2WSLA 3O4JA 3ILSA 1YS1X 2WHQA 4KAAA 1XZJA 3ZI7A 3STXA 2XMBA 4X93A 3UMJA 1YA4A 3M81A 4X71A 3I6MA 1E8DA 3WWDA 1R1DA 1RP1A 4EY5A 2XLBA 1QIIA 4RGYA 4Y2XA 4KRYA 2XMQA 3IDAA 4AXBA 4CIBA 2JGKA 5DLPA 1JJIA 1JU4A 3IB3A 4U2DA 3PFBA 1RWQA 5FXMA 5ALPA 4AN1A 1CRLA 2XQKA 3STVA 3VKFA 4QZVA 3G9XA 1TRHA 4KE7A 3ANTA 7YASA 3RLIA 4OB6A 4HS9A 2G5PA 4H7KA 3FYTA 5BOVA 3H17A 5FUMA 1QTIA 1XQWA 5AM2A 3A70A 3O4IA 5DJ5A 2WM2A 2XQJA 5F4ZA 5T4EA 3A2LA 1HQDA 1U4NA 2AJBA 4G8DA 2EEPA 5JAOA 4FLMA 3EQ9A 3AILA 5LP1A 4JNCA 4BVLA 3WIBA 5AHXA 1TCAA 5IKXA 3HEAA 3N2ZB 1MTZA 2YH2A 4QDZA 3IUJA 4BC1A 1ACLA 3R0VA 5CT6A 2XB6A 1LPAB 3EBLA 1UK9A 1CEXA 1E66A 2QMQA 2XUJA 4XX1A 2WTMA 5DYTA 3G0DA 5CT9A 2AXEA 4KACA 1HPLA 1MPXA 1E89A 1QIGA 3FCYA 4E15A 1QFSA 4UFPA 1R50A 4EBBA 5AOBA 1H2XA 4WJLA 3DL7A 3STYA 4JEIA 1LPSA 4CG3A 3R3VA 3OOSA 3GBSA 4UBKA 1F6WA 5HZGA 3ESDA 1Y37A 3WL8A 1CQZA 3LS2A 4BZWA 1XLVA 5ALXA 3QVMA 4UHBA 1DU4A 4E46A 1K6EA 2CKMA 2RAUA 4EY4A 4ROTA 4N5HX 1QIDA 2DQYA 3G0CA 3PICA 1QGED 1N8SA 2OGZA 1AX9A 4JUIA 5AOAA 2WFZA 2WIJA 4X00A 3VDXA 3D5EA 5AI9A 4BAUA 4B0PA 4DMKA 4N8DA 1NU8A 4HRXA 4TVKA 2HRRA 4FHZA 1H23A 1Y7HA 1FFAA 3DQZA 4Y7DA 1XZIA 1B41A 4Y2UA 2YXPX 5ALDA 3HRHA 2JIDA 4X95A 3BL8A 4Q34A 3W9UA 1MO2A 4DNQA 2IX9A 2VTVA 2HHAA 5D6OA 5ALRA 1B6GA 3STUA 2OQIA 4AQDA 3V1MA 4DMCA 3W04A 1PFQA 4BP8A 1E3QA 5JANA 2CUTA 5DNUA 4IH9A 3WA6A 4RNCA 3C8DA 1Q0ZA 4BRZA 3H2KA 1FFDA 1X2BA 4GXNA 5HFNA 5JAPA 4MWTA 5E4JA 2JEYA 4CI9A 1H2YA 4GHWA 5YASA 1A8QA 4FLEA 4LIPD 1ZIYA 2GBIA 4QEKA 3QM1A 5LZ8A 2AJLI 2XUDA 1YB6A 4RPCA 3EF3A 5AKHA 4C87A 3K9BA 3DCNA 5ALVA 2ZJFA 5JYCA 3QPDA 4EY7A 3LIIA 4IQ4A 3FSGD 1XZMA 3HC7A 1MAHA 5EGNA 2XE4A 2OAEA 1FSSA 1AMNA 1QO9A 3E3AA 1GQSA 4BC0A 1Q83A 2RHWA 1ORWA 1CUCA 4U2FA 4FBMA 1BS9A 3WJ1A 2HA4A 4EUSA 5ALMA 2XUKA 5JD4A 1KU6A 2DSNA 1ZD5A 2ZSHA 5I8PA 3PE6A 5JIBA 4EZIA 4X90A 2I03A 3ANSA 3O0DA 5C8XA 4C89A 2HM7A 3WWCA 5CMLA 2H7YA 3WK4A 3DKKA 1BROA 3IIIA 1VZ3A 5CH5A 1AURA 1N1MA 3DEAA 3TRDA 1E8MA 4KJXA 2QS9A 3FVTA 2B9VA 3DYIA 4BRSA 1I6WA 1WB4A 2PSDA 4BZZA 3WQHA 3CN7A 2NW6A 3BDIA 2Y6VA 2ZVDA 1XRPA 4UUQA 4W1RA 5EI5A 3ZPXA 3C6XA 4OPMA 1ORVA 4A5SA 2HU8A 4PO3X 4CCYA 4YK7A 2XMRA 3BIXA 5SYNA 4C4XA 1TCBA 1AZWA 3V48A 3WKEA 5J3JA 1WPRA 3C5VA 3PFCA 4UFNA 5ALEA 4BBZA 3WWOA 1XRMA 4FWBA 2GBFA 4U2GA 4GEGA 2ES4A 5HK8A 5HQ3A 4I4CA 2XQGA 1P0IA 1LPBB 2C0QA 2Z8ZA 1E8NA 2EDCA 5AK4A 4LYDA 1TK3A 4QLAA 2O7RA 4PSUA 3GROA 2WIDA 4J03A 4H7EA 3H19A 2FUKA 1CUJA 3ICWA 4UHHA 1J06A 5IVIA 5C7YA 5ESRA 1J1IA 2C7BA 1XLUA 4GWLA 1MNAA 4X94A 1HKHA 4B80A 1VOTA 4Y2QA 2PPLA 3VJMA 4J0JA 1MN6A 3QITA 5AI6A 4YASA 4B81A 2VATA 2ZYHA 2FX5A 3O4GA 1J2EA 3QBJA 4FTWA 3FCXA 1DWQA 4A23A 4PW0A 1ZGCA 3ZLVA 3R41A 3D7RA 1FFBA 1O6FA 2CBGA 1EK1A 3GELA 1UZAA 4HTAA 5CRIA 4J0DA 1WPXA 4KE6A 1IZ8A 2R8BA 3G9ZA 2XUAA 5IVDA 3ZLTA 1K63A 2DHEA 4ARAA 3VJKA 3I1IA 5HF6A 2HADA 5CBKA 5AO9A 3B5EA 1R9MA 4BVKA 2ZJ6A 5AKKA 3SC2A 3FSGA 1BEZA 3ICVA 2ACEA 4NVRA 3G0GA 1AUOA 4ITVA 1CUAA 2C5GA 4HRYA 1KEZA 3ZV7A 2D5LA 4J0GA 3QPCA 4HXFB 4FFWA 3RK4A 2OGSA 4F60A 4B9EA 4BDSA 2VEOA 3D0KA 3FYUA 4K6HA 3L1HA 1XKLA 4N8EA 3A2NA 1HL7A 1ZGBA 2O7VA 3WYNA 2JGFA 3HACA 2DFPA 2Z3ZA 4QDTA 4LXGA 2ROQA 3H2GA 1VA4A 4H7IA 4IO0A 1GQRA 4DMHA 3M3DA 2YYSA 5JD5A 3STTA 3O95A 1GPLA 3R3XA 1QFMA 4Q3LA 1AQLA 2WHRA 3F96A 1VE7A 4Q3OA 2ZSIA 3VVMA 2WIFA 3TGLA 5AJHA 4PSDA 2DHCA 3H1BA 2VAXA 2Z3WA 4ZXFA 4Q82A 3I2HA 1DINA 4WFJA 5AKLA 5AKEA 2WG2A 2WG0A 3H18A 1YAJA 3V9AA 4AZ3A 1UOQA 2WHPB 5K3AA 5C81A 2XUPA 3ESAA 3QH4A 1MT3A 4AX4A 1PJAA 1CUVA 3DNMA 2C5FA 4MQMA 5CXXA 3HABA 4UBIA 3Q0TA 1UOOA 3E1GA 1LZLA 2WU4A 2PU5A 5AM4A 1U8EA 2XMDA 4BE9A 5AIAA 4AMYA 2C0PA 3VXKA 3FOBA 1IZ7A 3LP5A 3AZQA 3MUOA 4QDUA 4F0JA 4YX9A 1UWCA 4Y2SA 1L7QA 2XT0A 5IVKA 5ALKA 4B9AA 3F8SA 4H7JA 1CUUA 1CIJA 3V1NA 1XROA 3L1JA 2XMCA 3C6ZA 3D2CA 1XRNA 1ODSA 2Y2VA 1ETHA 3WK8A 4XVCA 2OQVA 2PKYX 4J0KA 4WY5A 2FJPA 2GBCA 2GZSA 1AC5A 1DWPA 4B6GA 1Y7IA 1R3DA 2V9ZA 5FRDA 2OAGA 4H7DA 3VVLA 3FBWA 1LPPA 1VJ5A 3HLKA 5ALGA 3IBTA 1XZFA 2QKYA 3L1IA 4QWMA 5AI5A 3K6KA 3WYDA 1EVEA 3FVRA 1DQYA 4K2AA 1VLQA 3PI6A 2WKWA 5AICA 4C6HA 1W6RA 3KXPA 3K2IA 2WFLA 1GT6A 1UT6A 3BIWA 2ZYIA 1WOMA 3R40A 4UBNA 5DNVA 1DWOA 2AJCA 2QUAA 4MJ3A 4IHAA 2Y2UA 2ONCA 1VKHA 2O2IA 3I2JA 4DMFA 3TEJA 3WZLA 1XRRA 1ODTC 3C43A 5AKGA 3DYVA 2K2QB 2PU7A 5LZ7A 1CUYA 2BCEA 4Q1VA 4Y2JA 3AIKA 3DLTA 5ALHA 4MYDA 3NGMA 4MXDA 4B83A 5HF8A 1CLEA 4S0XA 3C6BA 1VA5A 5LZ4A 3WL5A 4BAGA 4X85A 4M0MA 5DTJA 3QZUA 5AI8A 3BXPA 5C8ZA 2JGMA 1NU6A 3ESCA 3WA7A 4NS4A 4J0IA 4X92A 4UFOA 4QE3A 1H2ZA 4OYLA 2G4LA 2JGLA 4BE4A 4FLFA 5KBYA 2QM0A 1GZ7A 1UFOA 2HU5A 2I3ZA 3GUUA 5DYWA 4L9AA 4X6XA 2XMGA 1UK8A 4EA6A 1UKCA 3A6ZA 3W2TA 2HU7A 1CFJA 4X6YA 5AM1A 3F97A 1CUXA 4QNNA 3D3NA 4W1PA 2VA9A 1C4XA 3G0BA 4DNFA 2HFJA 1XLWA 1UOPA 5EIHA 2Y6UA 3N0TA 4UBJA 3D2AA 4DIUA 3WWPA 3OURA 2JGEA 5JADA 3PUHA 1YB7A 1LPMA 3OPMA 1ZD4A 4W1SA 1OCEA 1UKAA 4OD0A 1E5TA 1W52X 3HZOA 4B84A 3AJAA 4M0EA 2IITA 3DD5A 4XIIA 1MNQA 4FFVA 3EQ7A 3O4HA 4BTLA 1W1IA 4BATA 2OCGA 2LIPA 4JYPA 5FLKA 3R3UA 4L3WA 5K3FA 3PF9A 1BCSA 3W9BA 1D07A 3WKDA 4UHCA 3DS8A 3RKSA 1T4MA 2WJ4A 3WJ2A 4C01A 3AUKA 3QPAA 2GBGA 3WWEA 3F98A 1O6GA 4MWSA 2W22A 2Q0XA 5FKJA 2XMSA 4A16A 5JZBA 1EINA 1G66A 4LHEA 2AJ8A 5K3FB 5AP9A 5CT4A 4HXEB 3NOXA 3KD2A 3PDCA 3DDUA 2RHTA 5CTAA 3OM8A 2D0DA 3S2ZA 2JF0A 5D3KA 1FFCA 3HXKA 3TJMA 2OPHA 1A88A 1EH5A 2QXTA 4ZI5A 1WB6A 4AO8A 4P08A 5EIAA 5ALFA 1W4LA 4GI1A 3S8YA 5FV4A 3NUZA 1CVLA 4W63A 5H3HA 1VZ2A 1ZJ5A 2QZPA 3CCCA 5A71A 3I1YA 2XUOA 3C87A 1LBSA 1J07A 2EDAA 1IUNA 1N5MA 2PSEA 4BYMA 1M33A 2WHPA 3CXUA 1QZ3A 4UHDA 1GGVA 4KEAA 3DL4A 3FLAA 1SC9A 4BAZA 3H2JA 1Q84A 1QE3A 1PV1A 2E3JA 3JWEA 2VT6A 3WKCA 2ZYRA 3OC0A 4DM7A 1QOZA 1VXRA 2PSFA 1P0PA 1ZOIA 1XZEA 2RONA 1YS2X 3SWWA 1P0MA 2CB9A 2PSJA 4KAJA 4OUKX 2CEKA 4HXGA 1ACJA 2O2GA 3MVEA 1MX1A 3WK7A 4GLBA 2OXEA 1USWA 4XJVA 1EXWA 1GKKA 1QIHA 1UK7A 5HFAA 1HDEA 4GECA 2PSHA 1MX5A 1YCDA 2V97A 4BB0A 3I2KA 3UUFA 1TIBA 1VE6A 5ALSA 1T2NA 1GPKA 3WIOA 5ALWA 4W9RA 4XWGA 4AZ0A 1JMYA 1RYYA 4WFIA 4P92A 2WIKA 3KSRA 2WLSA 4I3FA 3ESBA 3AZOA 1ODCA 3FLEA 3FYUC 1WCYA 1XQVA 1QONA 1X2EA 5JATA 4OU5A 1C7IA 4OSEA 4E14A 1ZIXA 2PVSA 3AZPA 4BCCA 1LPOA 1F0PA 1QIEA 4QWWA 2XMZA 5BV7A 2WUGA 2XDWA 1S8OA 3WK9A 3P2MA 4H7HA 3U0VA 2C58A 4BTVA 2VJAA 4CFSA 2QT9A 1LZKA 3I2IA 2HL6A 5AK5A 2PL5A 3KWFA 3SK0A 2JBWA 2GZRA 1XZAA 2BUAA 3DOHA 5FPPA 5JAUA 3BJMA 2OCLA 2X76A 1JU3A 2C4HA 2I78A 4Q3KA 5FPQA 2JEZA 4DSZA 3IURA 1QIJA 4EY6A 3HYSA 3C5WP 1UKBA 2WTNA 4H77A 1TCCA 4RE6A 4L72A 1FFEA 3WLAA 3BE8A 1XZBA 4MYSA 4LKOA 2QOEA 5AKXA 5AI0A 1EB8A 3W06A 4PQEA 2RIPA 4G9GA 1KU0A 4OB8A 5HK9A 1XRLA 4LXHA 2VJCA 1H22A 1BU8A 5JZ9A 5JD6A 4O08A 1ZD2P 2JGJA 3QMMA 5DYYA 5HQ3B 2ORYA 3AIOA 5LZ2A 1A8UA 4C88A 1Z68A 2VJDA 1XZKA 4W1QA 5ALOA 1Q0RA 2WUFA 5T4FA 5BWBA 3WL7A 4TPKA 3C45A 2R11A 4HAIA 3WKBA 5ALZA 5ALUA 4PSCA 5HF5A 1XQXA 2JGIA 5KWJA 2ACKA 1CUGA 3C6YA 3ZWQA 5K3EA 1L7AA 3Q8WA 3FYUB 2H7XA 3NWOA 2HA2A 4DGQA 3VISA 2HIHA 2OCIA 1IVYA 1QIKA 1CUSA 1ZICA 4CG2A 1LGYA 1AGYA 1VXOA 1IUOA 1SCIA 5ALTA 5ALLA 5E4TA 5LIPA 5AK6A 4D9JA 4OCZA 1LPNA 3AIMA 1JI3A 1G4HA 4ZRDA 5CT8A 3B12A 5AK3A 5FOQA 1WHSA 3VJLA 4G8CA 2QUBA 5D7BA 4AO7A 5EIEA 1XZCA 2WIGA 2PM8A 3HI4A 4JYMA 3WI7A 2BJHA 3T52A 5KREA 1THTA 5A7GA 4WCVA 3HSSA 5DTIA 2VT7A 4I19A 3JW8A 5AOCA 5BWCA 4NZZA 3I28A 3MUNA 2QJRA 3I6YA 4NMWA 5AKZA 4EHBA 5EHNA 2CMFA 4G4IA 2XI4A 4MQLA 4B85A 2XQIA 1ZI9A 5EHQA 1W75A 2PUHA 3CN9A 3H0CA 4IH1A 2QJWA 1XZGA 3G8YA 3FLBA 3QMVA 3GFFA 5AKIA 5I9IA 2I3DA 3BWXA 5DWDA 1IMJA 1OXMA 4P9NA 3R3ZA 2H1IA 1BEEA 5LLSA 1DTEA 2Z5GA 5LYYA 1L7RA 2O2HA 1U2EA 2V98A 2QTBA 2VF2A 3IVMA 3WL6A 5IH7A 1OILA 2WUEA 3D59A 4ZREA 1CUWA 5JZSA 1F0NA 1HLGA 4K6GA 1SFRA 1G42A 4Q05A 4LXIA 4Y2VA 2OCKA 1K4YA 1QIMA 4F5ZA 4DYHA 3BF8A 4WDQA 1QTRA 4PV7A 3V1LA 2XUIA 3WK6A 3M83A 3GZJA 5AM0A 1CUIA 2XUFA 5ALJA 1BCRA 4U2EA 4OU4A 5KWIA 1X70A 3BF7A 2DR0A 4Y2TA 3O9VA 2OG1A 3G7NA 2X5XA 1LNSA 1P0QA 3W05A 4J7AA 4ZGBA 4H7FA 2ECFA 4WFKA 5K5EA 4X3CA 2B4KA 1AKNA 2B20A 1EA5A 4Y9SA 1THGA 5EFZA 4ETWA 3PUIA 5HCUA 3SX4A 1IUPA 5E2IA 5ISMA 3WK5A 4INZA 4G5XA 3BJRA 4YPVA 1XFDA 1EDEA 2H7CA 2YASA 4DLNA 4P93A 4DTCA 4HZGA 1UK6A 4WDRA 4BCDA 5CXUA 2Z8XA 3PF8A 4G1FA 4IH4A 3GA7A 5I7UA 1WB5A 3OG9A 5IVHA 3UUEA 5C8VA 4ZV7A 5E4YA 5K3DA 2BUBA 2J4CA 1UXOA 5SYMA 4PF1A 2Y1KA 2WFMA 1G5FA 2IIVA 4G4JA 1JFRA 5A7FA 1CUBA 5ALYA 1XZLA 2VAVA 5ALIA 3O9MA 1YASA 2DHDA 4K6KA 1CV2A 5DNWA 4C4ZA 3E0XA 1K5PA 4LYEA 1MU0A 3R3WA 1ISPA 1W76A 3IA2A 1GPNA 4X7BA 4Y2YA 5AKJA 4FNMA 4B82A 3G9UA 3WKAA 4G9EA 1A8SA 3M82A 3D4LA 1WHTA 3I2FA 4ARBA 1CUZA 3F67A 1DX6A 4AB1A 5FDFA 3YASA 2WJ3A 1R4ZA 3IUNA 4HVTA 2WILA 4J0HA 4G8BA 5LKAA 2HA5A 1MX9A 2CZQA 1QIFA 2B61A 3I6ZA 1N5RA 4J0CA 1XZDA 1JJFA 4DNPA 2J4FA 3DOIA 1NX9A 2DQZA 1ZD3A 5JARA 4ZWNA 3AINA 5AM5A 4X91A 3BDVA 2XUHA 3LIPA 2HDWA 3X3HA 5JASA 3RARA 1CUHA 4UBMA 2HA3A 3AFIA
chains in the Genus database with same CATH superfamily
4AT1A 4XYEA 3TIVA 1HFWA 1XLTC 2ZWPA 1YV9A 2IZ0A 3H9UA 5EHXA 4LOKA 1QGUB 1VDMA 4YAIA 4N7JA 4AY5A 4QUJA 3MERA 1ESZA 1V43A 1XTTA 3EWNA 3NYWA 1SG9A 2D1FA 4UQLA 2Z9BA 1WXIA 4RFLA 1YBFA 3RFVA 1YSCA 2BEVA 2GXQA 2ZIXB 1B8OA 3E8MA 1C7JA 2IYOA 4LGCA 4J1QA 3TMAA 4KAXA 2QAJA 3QBVA 4GSKA 1W30A 1FTGA 4BP9A 2PMBA 2P75A 2F6RA 3VR6A 2RHDA 5HJEA 4V2IA 2XR1A 1J22A 3NKLA 3CX7A 4IHJA 2VHVA 2QP9X 1FNSA 4I1YA 1Y3FE 1U0FA 5SY4A 5EE3A 2HIGA 2ZS8A 5BWOA 3JQAB 1A9PA 4H3HB 1XGKA 1JXMA 3OQIB 3ZHOA 2VAPA 4CCWA 1PR0A 4I7EA 4EG4A 5IT4A 3W7VA 1JNYA 3CIFA 4QXMA 3KYCA 2AMLA 1NVGA 1QH9A 5IWAB 4KI7A 3KYCB 4OMCA 1HA3A 1U2SA 1C7ZA 4KVGA 5HW0A 4X8OA 2BDUA 2XLCA 2DBZA 3CLUD 2CSUA 1XEFA 3ROZA 3B1YA 1II8B 4GGPA 1C7RA 1ZLYA 3G2PA 4EB3A 1X1QA 5AIBA 2XF8A 1U5BA 2AOTA 2B92A 3DJYA 4F97A 2FI1A 2I2BA 4N4AA 4OB7A 2HUNA 2XZDA 3L7AA 4HUQA 2OGTA 5KX5F 5G1PA 1EUYA 1HFEL 2WE8A 4MUAA 3UAXA 2VH5R 4TL6A 1DBVO 4ES6A 3OFND 1DAOA 4RVUA 5ALQA 1O94D 2C59A 4LNHA 3GRAA 1UMDA 2QLTA 5BSWA 2GYWA 3IQZA 2O6HA 3LBHA 4ZICA 2B1IA 4YWJA 4QHSA 1GG9A 4Q3BA 1E9AA 4JQSA 3V1KA 5G3ZA 1XRJA 1XQYA 4KE8A 4N8SA 4J75A 3SQNA 5U1PA 2ZBVA 2WU1A 2PWAA 4A6XA 1G21B 1LSOA 2A5LA 2UYQA 4JC4A 3D31A 3LD9A 3N7AA 1EG7A 4CM3A 1SZPA 3RC7A 1PT6A 1LI7A 4ZHQB 4QGGA 2SCUB 3ELWA 6GPBA 5J2UA 2KPOA 3CH6A 4OQLA 5K51A 1JLLB 2OP1A 3TDMA 4U5QA 2JEOA 4GF5A 3EVTA 3REGA 3H1EA 1U0HC 1Z4LA 1ZFNA 5U4QA 4E2FA 5F9HA 3G02A 1IY8A 1LI4A 4JJIA 1V5WA 2N3ZA 3B89A 4E30A 3PJRA 2HA7A 5EZ5A 5KNBH 3HCEA 4KQWA 1P7PA 2OHVA 1JALA 1VTKA 1THMA 2X8BA 3E9RA 2BHTA 3IKVA 4FJ0A 4UATA 5CH3A 1RRGA 1L7PA 1KS9A 2CJYA 3ABRB 1EK5A 1JIKA 3E8XA 1Z2OX 4V38A 1SNYA 1Z16A 4KBFA 5I7RA 4OFWA 1D6NA 2X1MA 4ZT5A 1BCSB 4V0RA 3U13A 2UUCB 4ZYZA 4FKBA 3MCTA 3GGDA 4X61A 1IEXA 4FYIA 4BBAA 3U09A 1WZNA 1RWBA 1ZH8A 3A9SA 2D5CA 3N2EA 3ZCPA 2GAIA 3CEJA 3FUTA 2ZS9A 5EC8A 1ZVVA 2NZYA 5C34B 4L3VA 3VR2A 1CF9A 3KAQA 2DBYA 2DU8A 2XVZA 4JUAA 5D01A 1UQUA 2C9MA 5I8ZA 4G56A 1KZGB 4WN9B 4JZKA 1XZHA 5JCOA 5AWFC 3TN7A 1UJ4A 4RGBA 1OBHA 5E1DA 1E6EA 4BCBA 3ER8A 1G5PA 4HP8A 2NXWA 2RI6A 3N2GB 2BGJA 2QX6A 3NH9A 1P5HA 3L0YA 4CQLA 3AI2A 1CZKA 1DX4A 2QT0A 3P71T 4PYMA 3QLTA 1GG2A 3TPCA 1QQBA 2IHBA 3IQWA 1C7EA 1NXXA 2VRBA 2I2XB 3RKRA 4Z4EA 2BHLA 3EGCA 4RD3A 4NCXA 1X7WB 4HQRA 4B3RB 4OYHA 1ONNA 1W48A 2G63A 1P2BA 3ITEA 1FMLA 3D8RA 5JYBA 1RMQA 3H75A 5DGIA 1UZUA 2VPWA 5KTKA 2XJ4A 2P69A 1VL5A 2D06A 2OXCA 3S40A 1D2NA 1TFRA 4KGDA 3NAQA 2WG1A 1B6TA 3NLLA 4GP7A 4K05A 5JNRA 2BGMA 1Q20A 3ZBUA 3ES9A 5C7LO 1E7WA 5F77A 4Q7JB 4Y2RA 5KNCD 5CCEA 2IIBA 1KHTA 1YGPA 3CW9A 3G6KA 1H1LB 4Q3EA 3FHOA 3WADA 2EP7A 4REQA 3BOSA 3GZNA 3ND8A 2B82A 1SOMA 1NW8A 2QUJA 5LB2A 2XYGA 1VI6A 4AYTA 3MTAA 3TSWA 3EVAA 2OYRA 2XUQA 1CKEA 3C85A 4QLOA 5DXJA 3MJ4A 1KHHA 3U7QB 4IG9A 4YPOA 3NBZC 1XRQA 2C8VA 5G53C 2BAGA 6YASA 2WSYB 4HDNA 1PR5A 5AW6A 2A30A 4IILA 3UFXA 5JU6A 3LH5A 1MAAA 4RCVA 2RJNA 3HBMA 3RSFA 3IUMA 3T38A 3CNLA 3LHIA 4EFNA 3WA7A 4TWJA 1KDYA 3WLLA 3T15A 3WGVA 1F6BA 3H1PA 1QZUA 3NM4A 1RJGA 2OM2A 4I8DA 1FFSA 2YWJA 4PXYA 3JPYA 4HLUA 5HMMA 2FMTA 3AGQA 1I7LA 2NQ2C 3D4PA 4FDMA 1BXRA 2YNMA 4LYJA 2GPSA 2Y1CA 1WRBA 3DO8A 3KOOA 4M0FA 5HF9A 3VR5A 4IGKA 1NJ1A 2EG5A 2IYSA 4LI0A 3WB9A 3X1MA 5LQDA 4ASUD 1V96A 2ZREA 4NOJA 4H17A 3AHCA 4TRRA 2O7SA 3AKCA 1CUFA 1BHQ1 1P77A 1KPHA 2F1JA 3U2QA 3Q8XB 2FEWB 4WK4B 1SCQA 4IUYA 2Y68A 1RMYA 5DOVA 4PYRA 4RA6A 1F7UA 1DJMA 1XEWX 3RODA 1XMOB 2XGSA 4YJ2B 4G4GA 1OSNA 5HKBA 1ZVJA 2HZBA 1G21E 2BHSA 1PQ4A 2IDKA 2MSWA 1MOQA 2HT6A 3VI3B 5E9QA 1T8TA 1V11B 2I80A 3ZC3A 2R96A 4KAFA 5GJVC 1RXEA 4P3OA 3COJA 2DE0X 3EXAA 2O7NA 1IQ0A 3C5HA 3QGMA 3B7GA 1E4YA 2BF4A 5CT5A 1GNTA 2VP9A 5ECDA 3VO2A 1TPYA 1EK0A 3T4UA 3PQ2A 5DNCA 3ZE0B 1OFUX 1G41A 4D3DA 2R8YA 1FQJA 4JVNA 2BGRA 1BVYF 4WI1A 4TYMA 2NYAA 4L0CA 4O59O 3D3QA 1HBJA 2IWRA 1SVWA 3JYNA 3SCZA 3MGGA 4NHEA 5HCNA 4QGAA 3MGAA 1DKUA 2GEUA 4GQBA 3QNWA 3J7TA 3ROXA 4ZT3A 1UMCA 4MKHA 4BGIA 5AHWA 4CFYA 2G0AA 4KODA 4IDGA 2H48A 3EGDA 1KZHA 4QA9A 4PPQA 3C3BA 2OHIA 2WFLB 3E4CA 4YWHA 4LVOA 4QL3A 1CIPA 2FZKA 5IFLA 5LOVA 3IHWA 3RTBA 1LSUA 1GGJA 3SQXA 4XOIA 3QE9Y 4ZZ3A 4OV6B 1X7XA 3ETCA 2V96A 4C2TA 2PBLA 2VHXA 1R0KA 3R3SA 1H4QA 3ER6A 3TM5A 1VE9A 4WLOA 1WMSA 4D4LA 4KB5A 2CK3A 3NVDA 1BQ3A 4ESEA 1LC3A 4BHTA 3G88A 1QLWA 4YJ2A 2UZ0A 1XHEA 3VO8A 4JT2A 4N40A 3UTCA 4C0BA 4ZYLA 3CPSA 1M8GA 4EUFA 1I14A 4CMEA 1R88A 3AIIA 3FYSA 4IQGA 2Q9UA 3LDGA 3R76A 3VU0A 3ZGOA 1KO8A 3K9HA 3THXB 4D0SA 2BI8A 2AK3A 1KI2A 1SHLA 2AC7A 2H2DA 4KPGA 4JHLA 4E0BA 7MHTA 2V7PA 4ZVOA 3UEOA 1LDNA 4FFPA 4NS1A 1AXGA 4OATA 5FAXA 4MZDA 5DIFA 4GP9A 1N1GA 4G5HA 4ZQCB 2DECA 3IVGA 3B1XA 2XHZA 1YZNA 1IZ9A 3HWSA 4OHUA 4YMIA 1Z0FA 5FBVB 3HVRA 5HCIA 1WDTA 4EY8A 1Y6JA 5C3UA 3LLCA 3RRNA 2QR5A 4HVLA 3ANMA 4EEXA 3BWVA 2R6GA 1Z56C 3C5CA 1DUIA 2BFNA 5G0TA 4EO7A 4X9XA 3R6WA 3HCDA 1UBGA 1H2HA 3QK7A 4QBHA 2CGEA 4AKIA 1AV7A 3WHLA 5BSFA 4TLEA 5KX5A 3VAYA 4XLTA 1ZBDA 3TJRA 2XAUA 4QELA 2RHLA 4L2IB 3H5IA 1PLJA 1MB3A 3KVVA 1ES9A 4J6EA 4PFSA 4YNBA 4U2BA 1A76A 1BQEA 3RREA 4ASUA 4BIMA 2BGWA 1WQ4A 1NSFA 2C9DA 3GI1A 5TEWA 1GAWA 4QOEA 1B1CA 2OC4A 3K2BA 1UQTA 2YCBA 2I8LA 3GEEA 3V00A 5GONF 2PD3A 5K3CA 1G9XA 3SYKA 3DULA 2FW1A 2HEGA 3EPRA 3LRTA 3AF4A 1W2GA 1B8PA 1P2UA 5U4XA 5JVDF 3ABQB 3JQBA 7REQB 4Z9YA 3WMXA 3RYTC 1GTRA 4A0FA 4UULA 2EYUA 3R8XA 1NR5A 1E2EA 5BQPA 1TC2A 3TWOA 3K9CA 1ZOOA 4BGVA 1ZNWA 5MN6A 3JALA 3QFFA 2XMBA 1ENPA 3DPUA 3V7UA 3G23A 3HMKA 1XELA 2CHGA 3HQ4O 1ULUA 1M2WA 3E5RA 1U04A 3A6DA 4PQGA 5JLJA 3M81A 1TJNA 4KUHA 2MOKA 3CURA 1E8DA 4PR3A 2ODQA 2ZJ8A 4MUKA 2NXEA 3ZHUA 4EY5A 3SHTA 2WF8A 3BCSA 4PIMA 3T9DA 2BKVA 2GS9A 5EIWA 3EA0A 2JGNA 1KYWA 2AK2A 3IV6A 2NMVA 3ANXA 1FUKA 2XMQA 4KRYA 4AXBA 1YKGA 4CIBA 1MEEA 2BGUA 2ZJ4A 3HJGA 5BR7A 1JU4A 3IB3A 1QVZA 3GUYA 3WIVA 4IGAA 4IDPA 3GFTA 3PFBA 3DEHA 4F2PA 2D0IA 3VH4A 1N2SA 4D26A 4DLLA 2C2WA 2ZJ3A 4GX5A 2R4UA 3H9JA 2VDOB 1GGKA 2EJWA 4HAWA 3KE9A 3RIXA 4X7MA 5JS8A 1FYEA 3IHKA 5M29A 3E61A 4U00A 2OAP1 3EG9B 3MJEA 3IR5A 1CHDA 3UC9A 4B8WA 3KYIB 3LHFA 1VG8A 3PLAE 1VPVA 1RAFA 4H7KA 2GGSA 3PD7A 2OBYA 3WP0A 1U7XA 3TTVA 1XXHA 2DTXA 3GLHA 3OCCA 4X84A 2XOXA 1Z06A 3E3LA 1PNVA 5FUMA 4QYWA 2IPLA 3IMEA 1QTIA 4ZYWA 4WINA 1K2WA 2GOYA 4J7XA 1J2YA 1KE1A 3PQFA 1E2FA 3A58B 3WR5A 5LMCA 4JA0A 2C03A 4UXJA 4D8WA 4H3SA 1PZXA 2VDNB 4YI5A 2JZCA 3ZX5A 1ZMXA 2Y66A 2PZLA 3FJYA 3KUDA 4EI7A 3A8TA 1KO1A 1T9KA 3S8MA 2R86A 5CAEB 4E5PA 1HC7A 1HQDA 3K0FA 2W6JA 3NV9A 5KOJA 5BOSA 5K7SA 1RU3A 1NVUQ 2AJBA 3GJTA 3IIKA 1RJDA 2XWQA 3Q5EA 4G8DA 4J2HA 3PYLA 2EEPA 5EXPA 4R1MA 3TCXB 4BKPA 3EQ9A 3FTEA 3N70A 1I4LD 5LP1A 2CCJA 4HQOA 2PMEA 1C81A 2XWPA 1YUNA 4ZCRA 4HAOA 1TCAA 5JNVA 2R97A 4R9SA 1AQ6A 2BFFA 1KY4A 3MJTA 4IOJA 1P8AA 5DBHX 3VHLB 1ST2A 5GM2A 4XIFA 3DNPA 1UMKA 4IIJB 5J2TA 2G40A 2JKZA 4OA8A 2JRCA 4EAAA 3R0VA 1A2BA 2ZIAA 3I4LA 1JAZA 3GUVA 2FZVA 3OJWA 5JDIA 2FGJA 1Y1KE 4UXHA 2R2GA 2VJNA 5LQJA 1WSDA 3OBIA 1BS1A 2Z8YA 5BQOA 3UMFA 3ZK8A 4BLSA 5HOQA 1DRJA 3RFXA 3UKJA 4JI2B 2QP4A 2QLLA 4LGYA 1L7BA 5C8YA 2HV8A 5DYTA 4GLFA 4EENA 1ZU4A 3OQIA 4BMSA 4ZMRA 1D2MA 1HPLA 4HWTA 3ADCA 4PNPA 16PKA 1MPXA 2Y4NA 3JQAA 4JKIA 4L7VA 2A3NA 3F6YA 3FCYA 5GQSA 2X6RA 1I6LA 1OLXB 1GR1A 3JR3A 1E1QA 1R50A 3EEQA 2GZDA 4HPWA 3VZCA 3ACCA 2LIVA 5AOBA 4NYMQ 1H2XA 1M2EA 4BL5A 3VTKA 5H3CA 1N6KA 4S1PA 2VP5A 2HSWA 4DWJA 3SKYA 4DRZA 3H4IA 1ADFA 2C54A 2QRJA 4YRCA 2VQSA 2DRIA 4YXWA 4Z53A 1DBPA 3UHJA 4B48A 4CG3A 2YQZA 1UXGA 3H5LA 3OOSA 4LRXA 1DCMA 1V4NA 3GBSA 4COKA 4G23A 2J0UB 3BWDD 2FY8A 1A5TA 4ZQIA 4LY6A 5THKA 5CNJA 5BN4A 2OO3A 4D9BA 3VAZA 1AZTA 1H8ED 1ZWLA 3GFGA 4MR7A 3ZWYA 2TMGA 5FFMA 3D6JA 3G5LA 3LRPA 1WSWA 1W4AA 1PW5A 4MQEB 3QVUA 4P34A 1SC3A 4BKOA 2F9FA 1ETUA 3IMCA 5TJ9A 4MP8A 1BCRB 2ASVA 4MYRA 4OHZA 1YI1A 2C83A 3EC2A 2GESA 1NW9B 1S1CA 2RAUA 4IIHA 2GM4A 4KLRA 4ROTA 4N5HX 5CVUA 4QQ8A 4F7DA 1BWPA 1NVTA 1QIDA 1I4DD 1TZJA 2DQYA 1U0GA 1PFKA 3CR3C 3KAJA 1QGED 5E1OA 1P91A 4CLHA 1M5RA 3DUWA 1Y1SA 4RD0A 2OGZA 4Y3UA 5B58T 3RS4A 3K9NA 1QHHA 5L51A 2I4IA 3GD7A 3LK6A 4YUAA 2L42A 3SSMA 8LDHA 2VF8A 3DE0X 2WIJA 2DBRA 4WLUA 1N92A 1BW9A 1PR3A 1UM9A 3IILA 2Z4TA 2HMSA 3PWKA 4PWZA 2HJHA 5CX1B 2G8LA 2VZLA 2XITA 3RVMA 1MP0A 3VDXA 1G6Q1 4KR7A 3JAMA 4BAUA 4H2DA 4B0PA 4DMKA 1JR3E 4XR9A 4B7CA 2J33A 4LCJA 1FMFA 4HRXA 3CNNA 3EVGA 2YS6A 3HU5A 4BRUA 1NNUA 5M3BA 3QE4A 3BD9A 5ADUS 3TLEA 4D6XA 1ADYA 1FFAA 4TLDA 3ASZA 4DQVA 3MRSA 1GZ5A 3DQZA 4TQ9A 3OICA 2O0JA 2ZYWX 1TVEA 3L0SA 3RSQA 1XZIA 2FCAA 3U40A 4B45A 5CPFA 4Y2UA 2DJ5A 5DZSA 2UVPA 1V7CA 1YACA 2MMCA 4X95A 3BL8A 4Q34A 3WB2A 5JV5A 2KBFA 1MAVA 1P9RA 3G1UA 3W9UA 5EXDA 4DNQA 3HYLA 2O7QA 4L0DA 1CQPA 3K92A 1JKIA 4WSOA 2VTVA 3RS3A 3K0BA 5J4KA 5JCJD 5BSUA 4D9NA 4N18A 3TOSA 3NRCA 2I4TA 2JCXA 4J16C 5D6OA 4EFDA 2IFTA 4DV5B 5KTPA 5C3MA 5ALRA 4NV0A 3STUA 2BEUB 3FKJA 4M9UA 5DBOA 1NULA 3W1WA 3W9SA 3LBNA 3V3TA 4EY3A 2H16A 2DXIA 4DT1B 2OZKA 2VPXA 4BP8A 1TM5E 3DE4X 1XZPA 3OMXA 2XT6A 2ZBQA 3BB4A 3MTQA 4RVOA 3R0JA 1CBUA 5A3QA 3RSZA 5F3WB 1TW3A 3CF2A 3PX3A 4DQKA 1G8AA 4NFHA 2KWIA 4N48A 4FIZA 3LG2A 4R2MA 5HIMA 4IUDS 1SK8A 4IH9A 3ZXUB 3KWLA 4F2DA 2ID4A 1M1YE 3FTNA 4AIIA 2AX4A 1SKYE 1K7XB 1UT5A 1ZCZA 2EYQA 3H2KA 3JVDA 2JHGA 1S8AA 4GRAA 4N03A 5TMEA 4BQPA 1TFUA 4FFNA 5IJZA 5GIOE 1L5OA 3BL6A 2G09A 4DEXA 3ANLA 4TVBA 4N6NA 2C04A 4TSFA 4P3KA 2JEYA 1QLHA 2B1QA 4XWTA 5FWYB 1OAAA 4DDVA 3SSNA 1NJ2A 3FN4A 5DN6D 2VWGA 5AVKA 2ZUCA 1XB2A 1NKVA 1PBTA 2PMCA 5KHAA 1YOVB 3V46A 2W48A 3FCEA 2BEWB 1F8FA 2Z57A 3KJXA 4LFCB 2HYIC 5CEEA 4QSHA 1CNFA 1RWOA 3D3WB 4O4HB 5E95A 3SOPA 5YASA 3U1VA 1A8QA 1QE5A 5DULA 1NLFA 4FDVA 2NNLD 4QEKA 2FZLA 3DVLA 2ZE5A 3KB2A 4ID3A 1KZYC 2AJLI 2XUDA 9ABPA 3RYHA 3NRJA 3TNJA 1NW7A 1OLSB 1XPOA 3BSYA 4CMJA 1RWWA 3BSWA 2CN1A 4JBNA 1IY1A 4MUNA 1E2IA 3PE3A 3CWQA 4JD5A 3UH0A 3FR8A 1YFKA 2VDKB 4LTDA 4WGFA 1SD2A 2C4TA 3HGQA 3UA4A 3IT0A 1PZEA 4HYYA 4ZAGA 1F8YA 2YRXA 1EFRD 4R2JA 1ST3A 4QPPA 4YP6A 3VNAA 1ZC4A 2BMFA 3LUKA 1C4OA 3Q0EA 3UICA 3SFVA 3CT4A 1MAHA 2E4ZA 3NDRA 3HLYA 1FSSA 1L9XA 1H8EA 2OZVA 3PKJA 4UUMA 3OZFA 3SF8A 1AMNA 2JGRA 3QEKA 1NPDA 1NW5A 3WMFA 4NK5A 2VRCA 3IEIA 1UEXC 1UIMA 1UC8A 2W2NA 4YJ3F 4LBVA 1CUCA 3SJZA 1Y6FA 1JDNA 5DHAA 2CL5A 4FFBA 3NT4A 1NJ5A 4KI0A 2NZJA 4FBMA 4XIGS 4C4SA 2P6NA 4P4SB 2Z6VA 3WJ1A 4DUYB 1KGSA 3WFIA 3ZKWB 1LS6A 4CKBA 1U2DA 2EZ9A 3CH4B 1XE3A 3T54A 5C5IA 4U6NA 3ZIAD 1KAEA 4R2HA 4Y98A 2ZSHA 3LGSA 1EP2B 2NV6A 5J43A 2POQX 3EIFA 3O8OA 4FSHA 3LXXA 3QVJA 1WXXA 1BX3A 3F73A 2A0XA 5CDFA 1KJ8A 4JBLA 4IIGA 1WPQA 4Q1FA 3DT6A 4EG0A 3NWBA 4AZVA 1KJZA 2G25A 1XQ9A 4TUYF 4OY3A 4Q0MA 1P4JA 2O6LA 4X7PA 1Z2PX 2GAFA 4EJSC 3EDYA 3TFOA 1BROA 2GPTA 4QAJA 5ICMA 2XYQA 2X8JB 4ZQBA 1N1MA 5AW5A 3WYEA 3BN3A 3PQ6A 4MH0R 4NEQA 1I30A 3FOEC 3B2QA 2P5YA 3ZLTA 1LU9A 3BXHA 4KJXA 2QS9A 4PINA 1N78A 3IAM6 3GEPA 1NVDA 2QD5A 5H9VA 2PMWB 1PUXA 1SXQA 2WBLC 4W5WA 2A6PA 1WTAA 3WWYA 4BRSA 1ANKA 4QM7A 3ZNQA 4NCAA 5BN3A 2V7UA 3OPYI 4IFTA 3J81A 1UXIA 4ECEA 1ZAYA 3WQHA 1UPXA 2CJWB 3CN7A 4C7BA 1T0IA 3SBOA 5CDSA 3KB6A 5BUCA 2ZRCA 2FMKA 1K8YB 1XRPA 3AB7A 1BSVA 3A1TA 3E9QA 2D8MA 1XC7A 5K6AA 2YW2A 5DB4A 1B3RA 1NZDA 4K8RB 1RHKA 1X3SA 2GJKA 2YMMA 4RTSA 3KWMA 2JAPA 4DVJA 3MLBA 4O29A 4A5SA 2HU8A 1HDXA 1XDUA 3E48A 3FUUA 4FBGA 4P7KA 3WOHA 3NIWA 4ZCLA 4OHRA 2I99A 4XWYA 3JS5A 4NV1A 3ENKA 2Z2YA 4OJMX 4XGNA 5SYNA 3LUHA 1MF7A 2O54A 4AVYA 3KXDA 3BFJA 1Y4AE 2EBFX 2J4DA 3GAFA 1QGAA 1S2MA 5HWSA 3EIXA 4YHHB 4FSDA 5L8VA 1VGVA 2VNSA 5J3JA 1BE6A 2JJ8A 4MB2A 4XM1A 1VP3A 5CNKA 4LRWA 2QGFA 1WQ1R 4MV6A 4BNUA 3JQFC 4FFOA 1CE8B 1KXZA 1MBZA 3BBPA 2EU8A 4KO2S 1R0CA 4L2IA 3GHYA 3I37X 3WWOA 1QAQA 2QN2A 3HM2A 3CZQA 1UKYA 3SNHA 5JNLA 1NVWQ 3GJ5A 4GEGA 5HK8A 2Q3MA 4URXR 1GILA 4BLOA 3OPXA 5K8UA 4JOCA 2XMPA 1UIRA 2WWVD 5AJVB 5IKEA 3Q6IA 4X1KA 3FIUA 4G9BA 4GRIA 4D9MA 1SRQA 1E5DA 3DWIA 3EPLA 4P7FA 1C2TA 3FE2A 3MWFA 1MFPA 2O06A 4XGRA 3CFYA 5FI3A 1J8DA 1XAIA 1AO0A 4M1TA 2UYGA 4HNSA 3WHIA 2EHJA 3DBLA 3PD1A 3AQ4A 2V54A 1NRXA 3KQOA 2H31A 4XX0B 3C0KA 3PNSA 2QSYA 4PGAA 4WZAA 5KNDH 3Q3CA 5JSYA 2XNDD 2DBQA 3ICWA 4UHHA 1UPCA 2DFLA 3K5HA 2WTEA 3OP4A 3KQSA 5IVIA 1XTKA 2KLBA 1AJEA 5C7YA 2YN4A 1BDBA 4MPTA 3LYHA 3NEJA 1J2TA 2CMHA 2JD2A 2H4JA 4HV4A 3F5DA 1QXSA 3KSZO 3MWGA 4GWLA 2BFPA 2PNFA 3CQ9A 4D81A 3EZFA 2VRCD 5B1YA 3VGPA 5IDWA 1XV5A 3N2KA 1SO8A 4RY0A 3F6CA 5G4KA 1JEDA 2PPLA 1S3IA 3JZMA 3VJMA 1WHTB 4FNAA 1P2VA 1KK0A 3A6FA 3HA7A 4LCEA 3RJZA 4WOKA 5KJ6A 3EPJA 2DPLA 3A1DA 4J0JA 2Z6UA 4QXOA 3M34A 4L5YA 2VHYA 3HS3A 5AI6A 1SWVA 2CF6A 4B81A 2VATA 4F6LA 2V8OA 3JASA 1FTQA 1RHMA 3P0IA 4RBNA 1QZTA 3DBOB 4Y8VA 4BECA 3RVSA 5KDDA 2O8FA 3EEFA 1AIPA 1RXVA 2MHCA 1DWQA 1CDOA 2FSFA 4H15A 4A23A 1GNQA 4PLCA 4PW0A 1ZGCA 4CQMA 2QBYB 4M0UA 4M3NA 5DBEX 1NN0A 1BC5A 1AQUA 1FFBA 1P80A 2CFSA 2HWXA 4HAZA 3SZOA 5TIIA 3GELA 4JP5A 5MN5A 3IOBA 1MW9X 2GCPA 2ZE7A 1XVLA 2HAEA 3H05A 1UBHS 2RGNA 4G0OA 4AJOA 4NWIA 5KINB 5EP2A 3JQ8B 5LUAA 5LYJB 4RPLA 2RK3A 1GRVA 2V4UA 2YTZA 2Y1FA 4HTAA 5CRIA 4YRPA 1P7YA 1NV8A 1BMDA 1WPXA 3M8KA 4MO2A 5EIBC 5BT9A 2R8BA 3IQXA 2QRLA 3G9ZA 4X7RA 3TLJA 3CJRA 1Q0TA 5IVDA 2ZJZA 2WAOA 2DHEA 4ARAA 5ED4A 2CUZA 4RYDA 1E7SA 4S24A 4B4KA 1TTPB 2HADA 4U4AA 1NKTA 5CBKA 4P4NA 1DC6A 5C1PA 3MHTA 1IFXA 1DDOA 4PZEA 5DHSA 3EMVA 5BSMA 3TECE 4CL2A 1C7FA 2YVUA 3NYQA 4BVKA 4UPEA 3AUYA 1KTIA 1IVSA 3TTYA 1G38A 5AKKA 3HCOA 4LJYA 3FSGA 1JPJA 2FQXA 1BEZA 1Y8QB 2WAAA 3SC2A 5JPDA 4S2EA 4W5OA 2E5WA 5J5VA 4D1YA 4ENSA 1H8HA 3LX4A 3MF4A 1OPRA 4D57A 3DV0B 3R0XA 3ZJ4A 5A0TA 3G68A 3R77A 5T6MA 3O2SB 4G1BA 4HXFB 1QG2A 1XEXA 2PS9A 4FFWA 4Q7EA 4RZQA 4XYMA 3T3HA 3WVNA 4B3FX 1Z8HA 1USGA 1VI2A 2OGSA 3EBPA 4EGCB 4GX1A 3OF3A 3RSLA 3WQBA 3T95A 4CT5A 3B3AA 4D8VA 4E5DA 3D0KA 2Z5LA 4WCFC 3L82B 4KVZA 1KKLA 5EP3A 1G0OA 3GNTA 5A1TA 4AUKA 1HL7A 3C3KA 5AHKA 3M70A 4I2VA 2FDCA 2O7VA 3WYNA 4B4DA 2JGFA 3HACA 4TRMA 3AVYA 1M5TA 2ZUDA 2DFPA 2X4LA 4QDTA 1G55A 1BDHA 3MLAA 4CETA 2HV9A 4E7OA 3L0PA 4JKYA 4J2TA 2YV3A 3VQTA 2ID8A 4B6PA 5H4HA 1FPMA 2D1YA 1QYCA 3C3JA 1PUJA 3KOZA 4YP9A 4BNYA 5BW5A 2WVHA 1SCAA 2EC5A 3E5NA 4X5OA 5THXA 3UWPA 3GU3A 2H11A 5KSZA 4UTVA 3AONB 2ZYGA 1LXCA 4N0EA 4NG5A 4C03A 5CFQA 5FADA 4OGLA 1RBQA 4NK4A 2XQVA 4MDEA 1E0DA 5TV2A 4F56A 2A3RA 4DJTA 1C8KA 5HKKA 2XNDA 4JWTA 2Z5VA 1JG4A 1N7HA 1AQIA 1E0KA 3MINB 1O89A 4U7JA 3DV9A 2OK8A 3K4HA 4B2YA 3LTEA 5FPKA 5TQ2B 3KQMA 2ZSJA 4GZMA 3RVDA 3TGLA 3U44B 1OASA 1XIVA 4WBNA 4LISA 1NBMA 3KXLA 4CKBB 4NBKA 1R0SA 3GVIA 4RWEA 3NBYC 1V26A 4RXMA 4TLMB 2NXCA 4UTPA 1OXSC 3OZSA 1LLUA 2GXAA 3D8HA 3ZI4A 1Y48E 2Z3WA 2FSIA 4H7PA 3BB3A 221PA 5FWXA 5LD2C 1P5ZB 4WFJA 4BQNA 3LPAA 3ZV5A 3DF9A 1CS4C 1TZ2A 2Z2XA 3ENQA 4NMHA 4E4TA 4KXQA 5E1MA 1IOVA 1G7SA 2BEKA 3P27A 3H18A 2V8BA 1RQXA 3QWAA 4YP7A 4CTNA 2I9KA 3V9AA 2HK9A 3SDSA 1XP5A 2CFRA 3JPWA 4EPYA 2WHPB 4MRNA 4U0JA 4IR7A 1ESNA 4KR9A 5DMXA 2ZPTX 3ETLA 3NHAA 3Q7QA 4LVNA 4PBRA 1BD3A 4CRWB 4YRMA 1N2CB 1R66A 2WPNA 3MZ0A 2YXBA 3SZRA 4AX4A 5JCOC 5EWMB 4J1TC 3AR9A 2HLNA 3DNMA 3DZKA 1AVTA 4Z8XA 1U5AA 1R8XA 4UKDA 4RJJA 1X13A 3AEUB 5D51S 3ZDYB 4ZIRA 2K7FA 4O4LA 1I6MA 3E1GA 4DCSA 4Q9IA 4XUGB 3WGKA 3VC7A 3NGLA 3ZHBA 2C4MA 2JCBA 3ASVA 1XF1A 1Z7GA 2AZ4A 2FN4A 3ADOA 3EVCA 5GZ6A 4BE9A 1RT9A 1X19A 5JWHA 2X9LA 2Z95A 4P4UA 4TTAA 4O4JA 1C0EA 1H3NA 3VXKA 2AV6A 4PG7A 1JDBB 3CYFA 4G24A 4MMYB 3EYAA 4F91B 2FE4A 3EXIA 5JZOA 5I7OA 2PKRA 5AVYA 1TEZA 1YT5A 1IG0A 1IHYA 2WJWA 2ISSD 1F4LA 1JDZA 5G0VA 4JC0A 3RAGA 4B9AA 5CBPB 5PGMA 4BLRA 4PNEA 3CEAA 4G65A 5EXSA 1A4UA 3ZY3A 4AMUA 2BP7B 1C9YA 1M2JA 3CZRA 2G9ZA 2RAPA 4HXYA 1KVQA 1NUQA 4N5NA 4OQQA 1RE0A 1XROA 4EKYA 3L1JA 5LVAA 3OEYA 5JFOA 2W58A 1E2DA 5GINE 5E6SA 1ZJZA 1JSXA 3OM0A 5FORA 5KDLA 2JI4A 1IDOA 2BOVA 4TZTA 2RKWA 4EBFA 3OLZA 3FYHA 2Y2VA 1ETHA 4JB2A 3WK8A 2ZJ5A 4FWIB 5AVVA 4BFZA 1YE5A 3K09A 1JE1A 2LWIA 1QYXA 2AS0A 3EVFA 5HKLA 4A2QA 4B6GA 5HKOA 1HYQA 1GTVA 1TMYA 5BUQA 5CB4B 3B36A 1EQAA 1P9LA 3GMDA 4ENVA 4ZOQI 2JLUA 1LFAA 2QM3A 1Y6ZA 1RJEA 1TAUA 2L69A 6LDHA 2OAGA 2JJ2A 2H4ZA 4Q3DA 1FUIA 1I8TA 4HWKA 5EE1A 3A1EA 4LY9A 1RLMA 4OIMA 4JOQA 5P8WA 5IKMA 1EZ4A 3RV4A 5BW4A 1OHHD 3B7PA 3RRMA 1XZFA 2QK4A 2COEA 2ZTSA 1M74A 4JASB 1RYDA 5AI5A 4G84A 1RZUA 2D5BA 1SBCA 3KHTA 4B3IA 4PAGA 3UWKA 4K2AA 3CVJA 2RHBA 3TXAA 3ZY5A 2PS1A 3PC7A 4BO1A 4HUTA 5DCLA 1CP2A 3JQDA 2DJIA 3SXPA 4D2IA 3K2IA 4FUTA 1ABFA 3UCXA 4ZTZB 1U6KA 2WKQA 3OPYB 3QOWA 5AVQA 1H66A 1GT6A 4H0NA 5IS2A 4D4KA 2G80A 2V65A 3O91A 4FSXA 2XOKD 2IE0A 1UAAA 2G1PA 4JC8A 2WYWA 5L7YA 1O4VA 5CEFA 3ZHYA 2YWCA 1WOMA 3AUFA 3NBUA 4EI8A 1G3RA 2F3PA 3L9WA 5CLJA 5E1BA 2DH6A 2AJCA 2OFOA 2WDPA 3FWZA 4MJ3A 4TXHA 3HKEB 1T5BA 1TGVA 5FOTA 2P41A 4OBWA 4BLVA 4BLQA 1HE2A 2O2IA 2P3OA 3LT5A 2MYNA 3R74A 4FC7A 3WGOA 1IN6A 2CDCA 1Z25A 5AVUA 2NTNA 2YC2C 4ABYA 3WJ7A 3X44A 2WU0A 1GRRA 3FETA 4TS4A 1YQ9A 4XD7A 3TEJA 4CLOB 4ZJYA 4MV1A 5JRDS 4XYGA 5HQTA 4MVWA 3K6SB 3FFAA 4FIDA 1OI7A 1X94A 2FHSA 4FDTA 4RXUA 3OQHA 5AKGA 5A06A 1K88A 2K2QB 3PFFA 4ED9A 3H16A 4UHJA 5LZ7A 5LQNA 2ID7A 2FR8C 2CE2X 4MV9A 3PJGA 3BMNB 2J67A 1RI5A 2FK7A 4HWRA 3BWCA 1M6VB 1U31A 3MIIA 3GRYA 1V16B 2F64A 4I9UA 1US8A 2DX7A 2WWWA 3GH1A 3NGMA 3VGJA 1QU2A 3KUUA 2AEEA 3LHSA 3UW1A 2IGTA 3MCUA 5D84A 3V55A 4BPBA 1VA5A 1GU0A 1T0PA 3K4PA 4JYCA 1ONSA 3WL5A 5AJZA 1EPUA 1F06A 5EMNA 1LJUA 5CCBA 4R54A 2P9TA 1U2RA 2F62A 1Z0DA 1HNNA 1A9TA 5A03A 1DCKA 4I5GA 4WKOA 3VH3A 1HGXA 2JGMA 1KZ9A 4IMIB 1L7VC 2WC1A 3C8ZA 3ESCA 3HUEA 2D1TA 3QPUA 4M4SA 5FL7A 1Q7RA 2BJWA 3L7NA 1NMQA 5TQJA 5IJ9B 1JZTA 1P3DA 1N4DA 2VJKA 3GC6A 3I39X 4HB4A 3CCFA 5TQ0B 1T34A 4UU1A 1M2NA 2O8FB 2G4LA 2C8JA 2JGLA 4BE4A 4FLFA 4HI0E 2CKDA 3WLRA 2ODTX 1OLUB 1M6HA 1UFOA 2HU5A 3UXMA 4JKOA 5B7QA 5ECYA 2ODAA 2CNDA 3V8MA 2X9QA 3KKKA 5E6SB 5G41A 4L9AA 2GRJA 4OKIA 1IQRA 1O57A 2CJFA 4X6XA 5C0OE 2PQ0A 3G0OA 3KZCA 3SBDA 3MN1A 4C78A 1LV7A 1Y34E 2F9MA 4RVHA 3FUVA 4IL5A 3A6ZA 4W5NA 2FWIA 5DGXA 2PWBA 2FH5B 5DHUA 1WMEA 4OHMA 2IHKA 2QN6A 3W2TA 4JI0B 1E2BA 2HU7A 1XVUA 3G2LA 3TR5A 3W6NA 3NVKI 3SSOA 3ZGNA 3FCAA 3NWEA 5K05A 3DTTA 2Y1WA 3F97A 5CA0A 1KY5A 3GFRA 3WFZA 5KOHA 1CUXA 3DFUA 1BMFA 4MW5A 1LA2A 4N0MA 2IS2A 3EYWA 3N6RA 4W7SA 2GBPA 2D1QA 4W1PA 2ZBDA 3CF0A 2VA9A 4Q12A 4KDRA 1LQTA 1RHRA 1VSUA 4DNFA 3HDYA 2E4WA 3PS9A 3JVUA 4RZXA 3EH1A 3THSA 1UOPA 4GPIB 5EIHA 1VL6A 4QQKA 1T0UA 2VPTA 1ZGJA 3OSUA 2V3VA 1P2TA 3E15A 4ND8B 1P81A 3TEFA 2EQBA 3D2AA 3D6HA 4R6WA 3UAOA 4P31A 4ND3A 4A6PA 1W36B 3NP9A 5DE3A 2NGRA 4OREX 3BHNA 1T5DX 1J99A 3L6UA 2JGEA 3OURA 3PUXA 5JADA 2VUUA 2CFTA 3KU4A 3LU1A 2J07A 4I50B 1LPMA 1PTKA 4Q9AA 4YJKA 3R6LA 5C5DA 1JIVA 1T4CB 4L73A 4W1SA 1OCEA 2C98A 5BVGA 1E3SA 2YHAA 3CGWA 4FWTA 1NMXA 4X60A 3RAFC 1UKAA 2EARA 2P4UA 3I4FA 3K2QA 4OD0A 3URMA 5JECA 1E5TA 5L6LB 2PZAA 3HZOA 4G0PA 3ND7A 4GL4A 4JR1A 4RHUA 1NA5A 3DD5A 3PXXA 3QENA 4WOBA 1DAKA 1N0VC 3NFYA 1SKAA 3S68A 4DADA 5FPSA 1VJ1A 4EKDA 3QKSB 2ZR9A 2PN1A 1WLSA 3T35A 3NHSA 5GOZA 4D9EA 4A0HA 1D0SA 2JI7A 1SXJB 4IRMA 4HDOB 4XAQA 5TXGA 2VQEB 1J2UA 2JFHA 4DR4B 1BG6A 1NDUA 2GZ1A 2QTGA 3R3UA 3SIPA 4ALNA 4CMIA 1I4EB 5K3FA 10MHA 1RMTA 4G5SA 1WXQA 3DA8A 3EZNA 4KFRA 2HB6A 3LL7A 4OI0A 1E2JA 2QI9F 2JLBA 2R6R1 3A31A 3K7EA 1C8LA 1E1LA 2EFEB 4UHCA 5KI6A 3PCRB 2WJ4A 3CRVA 3EB9A 2J32A 1KEUA 2QRVB 4II3A 4GOXA 1CZLA 1JIIA 3WLPA 5DEOA 3L4EA 3S2SA 3EX7C 4U8HA 1X38A 5ED0A 4GVXA 2FEKA 3HA3A 4GLOA 4I81A 4EHFA 2GBGA 4RD4A 1AS0A 3F98A 3WE7A 4D4JA 4YMUA 5FLXA 4OM8A 4WZAE 2PMKA 1XTVA 4G67A 4KC0A 4RW0A 4H1WA 1QP7A 2IYUA 3MAGA 5DX0A 2O19A 5CJPA 3WTCA 4L8VA 1DUSA 1ADBA 2FMHA 1LX7A 4MGKR 3HUDA 4MUEA 4QHYA 1Q95A 3RDPA 1X8XA 2W22A 3MQ2A 4BN4A 1EWYA 3VR2D 1YZHA 1G66A 1G5RA 2AOWA 3GCXA 4TKVB 4OLBA 1R8JA 3PNKA 1BGXT 4KXYA 3UJBA 2BTEA 4R31A 2DH5A 1UXKA 4PS1A 3FZEA 3BH6A 2I6FA 2R66A 3DE1X 1YR7A 2G76A 2H2WA 2J5RA 2ZFUA 2HLDD 4HXEB 3U48A 3NOXA 4MICA 4URFA 4PN3A 5AUPB 3KCQA 4JLUA 1TA9A 2BF7A 2NO5A 5AUQA 3HUTA 3DT9A 2JBAA 3MYRA 1NM5C 3GA5A 3HJCA 2GPNA 1D1TA 2RHTA 3I9JA 1D2HA 4X24A 3I53A 3IESA 3OBBA 4JL6A 4TV8F 5JDCC 1X3LA 4I9HA 1Z6PA 1RXCA 3O31A 4RV5A 3UAZA 5CFMA 1FVOA 1NVEA 1GZ3A 2ZRQA 5P21A 3WV4A 3NMUF 5DM70 4MMXB 3TDKA 5CLGA 2IUEA 4HC4A 3CX6A 2JHPA 2C4KA 2BFAA 4XM2A 4AFNA 1MABB 1TQ2A 3ZVLA 1A9SA 1U8YA 1M34E 2P2NA 3B13B 3EW7A 1PYOA 3DOOA 2P5SA 4D9FA 2Q3JA 2VFAA 4BNJA 1W19A 1ZINA 5LM3A 4B3MB 5F2OA 3L79A 3KOMA 4YV0A 5HIAA 5HZHA 3SC2B 4KREA 1V7QA 3GFSA 1EVKA 4M1ZA 1M8FA 2VYQA 3HXKA 4L4RA 1PP4A 5KNDD 2OPHA 4NE9A 4UMDA 1IHXA 4R81A 2D1SA 1LJLA 4AZ0B 1XDZA 4BMZA 4OOEA 3OIDA 2QN7A 1W5SA 3IDFA 4EWLA 2CNLA 2ZRGA 1OX4B 2K5UA 4FS3A 4UCWA 5CW1A 5H80A 4D97A 1W4LA 2QTTA 1NW6A 3AETA 5JE8A 4F93B 2V6MA 1Z9BA 4YJGB 5J2TF 1SBQA 2Q7OE 3FB4A 3AGPA 3PI7A 1COWD 5E9JA 4MNTA 1O9GA 1WP4A 3QJ5A 4DIDA 4TKVA 4A8HA 3NUZA 1IHUA 3MMNA 3HXTA 3UIEA 3V9PA 3MWEA 3FKQA 3HN7A 4TX1A 4G0YA 3BZWA 1IK6A 3EXG2 2ZWAA 2G5CA 4L28A 4UEKA 5H3HA 5L7WA 1E1CA 2HQ1A 2QZPA 4Y6PA 1NPTO 1ORRA 2QZSA 3EXIB 2ZG6A 3QHPA 2O2EA 4Z9BA 5FTNA 3SYLA 1N32B 4GBED 3EFEA 4OHXA 1VLHA 2FZGA 2QUKA 5KQSA 1BZYA 3EA5A 1HDZA 4QASA 2WD8A 4Z8YA 1J07A 3H8JA 4BNWA 2EDAA 5CDFE 3ELDA 4Y1GA 1QRDA 2OQRA 2E1RA 3CXUA 3LCVB 1IBMB 4U7DA 1P0CA 4M76B 5HJ5A 4EHLA 5JCPA 2C0CA 3HI6A 3N58A 2LR0A 2PXAA 1HZZA 2YIJA 4BAZA 4ZARA 2UKDA 3F2IA 4J7CA 1Q84A 4KNVA 4CMHA 1PV1A 1VHDA 4FHEA 2R68A 2ZBEA 2WD7B 2JD1A 3KG2A 3WKCA 2REBA 2A9RA 3M4YA 1P2DA 2J9XB 4URHA 4B3CA 2IDMA 4MAAA 1VXRA 1KERA 2I6UA 2PSFA 1GT91 1P0PA 3KQKA 2ZAOA 1X86B 2WABA 4Q9LA 5MFPA 2DR2A 3GLIA 5D3QA 2AYYA 5EJ9A 2RONA 5H3LA 1T6NA 2QU7A 4MW9A 3ND9A 1P0MA 4EGAA 2B35A 4KAJA 1UDRA 3V7WA 4OUKX 2XIQA 1E92A 5FX2A 2Q3BA 1Z7WA 2YVKA 1ACJA 3SMQA 1ULZA 2GXSA 2YW9A 3NHMA 4LRYA 3UK1A 4QJ5A 1GSAA 2O2GA 4I9GA 4D79A 5FWXB 3DDNA 1JDJA 2W00A 3MVEA 4G85A 2Z2JA 2GEVA 3QSGA 4AY6A 1JG1A 4DY6A 4RH0A 3UENA 3MNFA 4BGEA 2AFHA 2OXEA 4GLBA 1USWA 3C39A 4OMFG 5HIIA 3ZKAA 1ODKA 3Q15C 3VVBA 2ZGVA 4JI5B 1GKKA 4JDUA 2LKCA 3OIUA 2ILTA 3LCMA 3WSVA 2VI5A 2PSHA 2GR9A 4RMIA 2WWTA 1SHJA 2ZT6A 2PY6A 1XJ0A 1EU1A 4GR9A 5KWEA 4G0XA 3UV7A 4E2ZA 3OHSX 3DO6A 1SA0B 3I2KA 3UUFA 1TIBA 1G59A 3O8CA 1IXKA 4ZU6X 1TLFA 1OX5A 3LT1A 4YO8A 2BT4A 1EVJA 4R7TA 1ZOPA 3OE1A 5CVCA 1YHNA 3IIMA 4F1JA 4A15A 3NUGA 3E53A 4N0PA 1HQYE 1QCCA 3D3KA 3LLMA 4QJBA 5JTTA 1HFJA 4AZ0A 1JMYA 4ZKDA 2GRAA 4ZVTA 3U17A 1LH0A 4QSMA 3GLIE 3EUEA 1XPJA 1KI1A 4KMMA 1UBLS 4CTOA 4DG5A 4E5YA 5KJFA 1I7QB 1X7WA 1N5LA 2CVHA 1FE8A 3B9BA 5EJ2A 1HYHA 2HQSA 4N76A 5LWHA 2PWPA 1HQCA 3FLEA 3H5RA 3ZHRA 4Z2AA 1QONA 2RH9B 2ACWA 4EW3A 5JATA 4KR3A 2ODWA 4RYLA 4XFJA 1C7IA 3TNLA 4ESHA 2Q3HA 3ZHZA 3PITA 2AGVA 4CNBA 3LE8A 4LBYA 1CYEA 5FV7A 4ZV4A 2J9GA 1Z35A 4FOOA 5I5EA 2IU4A 3RRFA 4BCCA 3GEGA 2V4MA 4OXXA 1B0AA 1D2EA 4RQUA 4K3UA 5FOUA 5B6JA 3L0IB 8ATCA 4JSTA 1N0HA 1T13A 5I47A 4HNAA 2PKXA 1D0IA 3RHTA 3LPNA 2CXOA 4K26A 4JR0A 1EE9A 1V5IA 5BV7A 2A2ZA 1DAIA 3QYAA 5H0IA 1M2GA 4BO5A 2NNWB 1OBVA 3O8LA 1K6JA 2CNWA 3P45A 1M6EX 1PI3A 1WEHA 2QI9C 1OT5A 1SKYB 2WUGA 4MUMA 4QYSA 4X20A 3QNUA 4U6SA 3WK9A 4LX0A 1D9ZA 4PQRA 1ZR2A 3G8CA 1G8YA 3O6VA 5AVSA 1NXTA 2C58A 2C9ZA 3ETHA 2OM6A 4URYR 2POCA 1NOJA 1HG0A 5ARDA 3QEMA 1T8SA 2BC9A 2OE2A 1U0JA 4DS3A 1X7GA 1JLLA 1NGSA 1NMSA 2WINI 4ETNA 1OFHA 3DLPX 1YCGA 3K0CC 3KWFA 1A9ZA 3LQKA 3GGJA 1OTYA 2H08A 3K1JA 1P74A 5FA6A 3SK0A 3TRIA 9ATCA 3U60B 2IOQA 1ZM2A 1L8OA 3KLMX 2XKBA 3PKZA 1U8ZA 2J0EA 3BQNB 2CLKB 1SB9A 2VBFA 2X7XA 5CEJA 1G16A 3DOHA 5ESDA 2QR2A 5EMKA 2XRFA 3TQSA 4HH1A 3ZE7A 3BXGA 2BN4A 4G3XA 5JAUA 3NTOA 1K0FA 1Z5OA 2UYYA 2OCLA 2X76A 2ZRJA 4IUCS 3EOAI 3EUAA 3IBCA 4IIVA 2VTBA 2JEZA 8MHTA 3DKIA 3FVQA 5EQDA 4DL9A 3IURA 1QIJA 3E18A 1DKOA 3KBOA 3ELYA 3HYSA 4AULA 1Y4ZA 3BMQB 2H1CA 3U4DA 2VDVE 3WL4A 4AWXA 4CLRB 2H4YA 1TCCA 3EXG1 4BJHB 4ITUA 1FFEA 4M6WB 4PS0A 3WLAA 2GEJA 3MWLA 4MKFA 3SVLA 1PR6A 2C9OA 4OH1A 4RTKA 5IH3A 4YIKA 2WQ6A 2GBLC 4MYSA 4O8ZA 1I3OA 2QOEA 4WN3A 4BFLA 4ZRNA 1NNEA 1DC8A 2QD4A 2QRHA 4HDKA 4MCJA 3QVWA 3HWX1 2I1VB 2PX2A 1DTWB 5CVDA 3TXYA 1CRWG 1PJRA 1MDBA 1E2GA 2VUSA 4MWZA 4QOJA 2AFRA 4WASA 1Q21A 4OI4A 1R5OA 3OA0A 4YDQA 3DL0A 3HU2A 1QC5A 1NVFA 2VJCA 2VRWA 3W5DA 4ZOEA 4WKPA 3TNYA 4O4HA 1ZD2P 3GG9A 3R9XB 1YB1A 4QFCA 1CVIA 4EVSA 1T8PA 4WAUA 1YL6A 1P5JA 3QMMA 5F52A 4B6FA 3R8FA 1NBWB 1EFTA 1IWPB 4BWGA 1QP4A 4MVJD 3PXUA 2WSIA 3WLEA 2F1IA 2GN4A 2E48A 4HEA1 1Z26A 4ZYTA 3G2QA 4YH1A 2QE7D 4QGSA 3W3AA 1U0OC 2PBFA 4C88A 4CXMA 1WV1A 1DIOB 2BTQA 2Q28A 2ZI6A 3HNRA 1XZKA 3ZH2A 5DLQC 3GT0A 2R44A 3JZFA 5ALOA 3FPGA 2VP3A 5BNZA 5ERXA 3KXKA 3Q9LA 4CGYA 4R9VA 4I55B 5IM4F 4E1BA 2I1WA 5T4FA 5BWBA 1PL7A 4R8RA 3QY0A 2HT1A 3I12A 3OZVA 4JS0A 4NZPA 4MVJI 4NU8X 2WTXA 5HF5A 1JR3D 3FZGA 4E51A 4BEWA 1RPZA 3C5EA 5JO0A 5KS2A 5KWJA 1JE0A 1FIUA 1K0UA 1CUGA 2ZVJA 1A4RA 4GQIA 3UT5B 1RIFA 4BNTA 1FL9A 1T29A 3HFJA 1JEYB 4BB6A 4DGQA 2WK1A 3DTNA 4MLCA 4IV8A 4PLYA 2R00A 1P73A 4HQLA 1PO7A 2OCIA 3RIYA 5F64A 3PHLA 2H4WA 3QU9A 4RY9A 3A26A 3PGMA 2X3FA 3AOEC 4NOLA 3OLVA 4OK6A 3WHKA 1QIKA 2CDRA 2V5AA 2IP4A 1C50A 2XEXA 3GLHE 2ZT7A 1WXHA 4YAUA 3DAYA 3ZD9A 1VRWA 3ROTA 1XZNA 3CLVA 1ONOA 1Q1BA 3ZE8A 1RW4A 1WUYA 3CRZA 4I4TA 4UNIA 4GKKB 4MIOA 2W8BB 4BJ1A 8GPBA 4OH7A 3W9YA 3LCJA 2YV1A 1Z82A 1WBDA 5ALTA 1O6BA 2R8OA 2XV1A 3A37A 5ALLA 5E4TA 4D9JA 1WZIA 3RTCA 3EIHA 1VIYA 3AIMA 1IAVA 4ZRDA 2P3QA 3OIVA 4EJSA 1Z75A 1MH1A 1RXUA 4C5AA 2W2TA 1QRUA 1PDWA 5TDHA 1NURA 3OT1A 3V42A 2O5EA 1H2AS 1DLJA 1Z36A 5KKCA 2HQBA 3H5OA 2HIAA 1HH4A 4IKPA 1WHSA 2SKEA 3SICE 5K0ZA 5T5QA 1QBKC 3U7RA 4G8CA 2QUBA 3K94A 3ZJ5A 1O95C 1UDBA 3ID6C 5D7BA 2ZRLA 4JL5A 1TE2A 5A3RA 1U2GA 3FTDA 3K9GA 3H65A 4YBZA 1XZCA 2V5VA 1XVTA 1C41A 3LK7A 1U9JA 1QNLA 2PM8A 3HBFA 1NV9A 2IEYA 3Q7TA 3ZQ6A 3HNOA 5DM60 4RC9A 1H6BA 4HB0A 1JEAA 4PXAA 3T52A 4YRNA 4R41A 1Y0BA 1DEKA 4CR8A 2ORED 4QFBA 4ND4A 5L4LA 1O03A 1Q14A 3HSSA 5DTIA 2VDMB 2NO9A 4I19A 2V1UA 3JQ9A 4L27A 3FHTA 3L1UA 3W1EA 1U98A 2YFHA 1K3UB 5HBRA 3OI7A 3W8RA 4AF7A 4US2R 3PPXA 2NT3A 1P5FA 2FQ1A 2WZBA 2GFHA 2J85A 3D6TB 3EPPA 3MUNA 1G3UA 5A0VA 2PVCA 4E31A 4UEWA 2GK6A 3R7SA 5LBTA 4E21A 2HCJB 2V3WA 1ZHOA 2HR1A 2R6FA 4IINA 4HMOA 4WFQA 3C8MA 4TMVA 4LA4A 1V7ZA 5IT0A 1VBFA 4GICA 4OQPA 1B8NA 1G2QA 1F9EA 2XI4A 4HSGA 3ONWA 4RTMA 4RZIA 3KNZA 3PNYA 3PR2B 3IAHA 1KI3A 2XQIA 3KVRA 3QX9A 1ZI9A 1QCZA 3R7AA 3QOYA 1OWMA 4ZT6A 1DAEA 1TYCA 5G0SA 3AF0A 1HYEA 3LXUX 3ICEA 5KYNA 3IMGA 4FMDF 3FLMA 5DH9A 4ZVMA 1AF4A 4H4DA 4P36A 2NPIA 1DG3A 1RI3A 1YJ5A 3CNOA 3FLBA 3HH8A 1PRYA 3KPYA 2F43B 3R24A 4I3GA 3ZIUA 1C9EA 1V4VA 3VNUA 1XWWA 2I3DA 2Q3LA 5DWDA 1JEEA 1DG1G 1I2BA 4NENA 4WD3A 5B1IA 1QGOA 4RK7A 3WYAA 1SXJE 1XCMA 2PRKA 3KC2A 2ZDHA 5TARA 5IJWA 5M2QA 4KRFA 1MIOA 4YCAA 4FZVA 4UJ5A 5KU1A 1DTEA 1SIUA 1VJGA 2VK8A 1A9XB 1UBCA 3MG9A 4A9AA 4N6GA 1N6LA 1WCIB 2YVLA 4OFZA 3VDRA 3L02A 4HNVA 3KZNA 3UWDA 2O2HA 1U2EA 3C6KA 2XZOA 2ANBA 1V6CA 2V98A 2QTBA 4DV7B 2ZP1A 1Z7EA 3A3KA 3H3FA 4RF3A 2HPAA 3TQQA 5KYUB 3R9XA 1T2EA 5D1HA 2Q41A 3IVMA 4MZXA 2GD6A 4HZUB 4B75A 2O8BB 3F78A 5CA1F 2O2JA 3L77A 4CDNA 1WMFA 1KFCB 1OILA 1GJRA 5FEUA 4CLXA 3GLHB 2X0FA 4KR2A 1ML3A 4QG3A 1ZISA 4OGKA 4AY2A 4NBNA 4QLBA 4YAJA 4ZYXA 4KPUA 2G04A 4ONEA 3T5AA 2YUIA 3CGGA 3NM6B 5ADWA 1T0JB 3RIMA 3T9AA 3G2NA 2ZB7A 4Q05A 1R0LA 2RCNA 1YS9A 2OILA 4N1AA 3T6KA 1IOZA 3HZHA 4R8SA 2A0WA 1P29A 4HGNA 4S1TA 5DCYA 2E0IA 3H1GA 3WBJA 1DAMA 1K4YA 3AEKA 3PPVA 3T5CA 1MB4A 1QIMA 4V0LA 4FCCA 5JMTA 3N2KB 1BH2A 2VCEA 4US1R 4PCVA 2PZFA 3SR4A 1G9TA 3BF8A 4DYHA 2WD7A 2FPPB 2FWJA 1X7DA 1ZVKA 3OMWA 3TQRA 5CFNA 1YZTA 4ENUA 5IEBA 2C95A 4LOIA 4PC3A 3QFRA 1PCXA 5BSEA 3B48A 2CXTA 1BOFA 1CD5A 3W90A 4NU6A 1ZK2A 3WK6A 5M7EA 1CTQA 2OHHA 3T7RA 3U7HB 1R6XA 4CG0A 2HO5A 1KK3A 1QHFA 3DB1A 1G8PA 5CX1A 5IZCC 1QFYA 1T2FA 2Q5QA 4F12A 3OT4A 3VR5D 3FGNA 3GJ0A 2KI5A 5KWIA 2FW7A 3JWJA 4YRKA 3KVNA 3MPUA 5BSHA 3IC5A 4IS2A 5DHRA 2YBEA 3N07A 3M6FA 3TRFA 1KI9A 1ZIDA 1PFUA 3LA8A 5DTEA 1QHSA 1WVIA 1JMVA 2OG1A 4KLCA 3K6SA 4NP6A 1X39A 3DVQX 3DZCA 2ECOA 1A69A 1GQYA 3V4OA 1H94A 1P0QA 1N3LA 3WGGA 4ZGBA 4H7FA 2ECFA 2Z58A 4ZKEA 4N3CA 2NSYA 4Q6WA 4YJ3B 5ADHA 2BONA 2IYAA 4BVGA 2OO5C 1ZVQA 4JJFA 5A4FS 2YKGA 1AKNA 3FOCA 4AKHA 1GZSA 1P75A 1WUIS 2W2KB 3C3XA 3W5IA 5KSOA 4LDNA 1YS7A 4DV1B 3OTHA 3PG5A 1C3VA 1IEVA 1FDRA 4Z51A 3M6AA 3DLIA 1QFXA 5EFZA 3HGTA 2P27A 2A1TR 1SC6A 4MR8A 4OLJA 3VJRA 3I5MA 4RSHA 5EQFA 2EFHB 3IAS6 4WADA 2FRDC 3WK5A 2KMLA 1UBKS 3N8NA 2PZKA 4TYNA 3F3SA 1ZL2A 2OA0A 1XNJA 4E70A 4W9NA 1E64A 1QO0A 4M0LA 4YPVA 2D7DA 3JR7A 1X8LA 4MR9A 1Z29A 3DBHA 4Y7CA 5KTOA 3S1AA 3DW3X 1R18A 3H7IA 3ND5A 4KO3S 1KZ6A 2Q3CA 2Q8NA 2QPLA 3LCCA 4WDRA 1ZLXA 3X1DA 3WYFA 1S9DA 3KKEA 5DK4A 1MHTA 3H5VA 3PF8A 2P2CA 1Z37A 2QX9A 1OB5A 3OCZA 3QU2A 2IXDA 4IH4A 3KAKA 1RM5A 3V2HA 2FVYA 2C8KA 3AJ9A 4K9QA 1Y3AA 1N2GA 4R40A 4F9TA 4J8PA 2GF2A 3GUZA 5FQNA 1E18A 5C8VA 4GT1A 5E4YA 4PFKA 5DSTA 2FWPA 1U8AA 4UZFA 4B4VA 2UYCA 3OECA 4U7WA 1UXOA 3C97A 3PU6A 5SYMA 4XJSA 1FXUA 3L5OA 2IIVA 3N6VA 2ZSKA 2UVDA 1SVLA 4JV5B 4EB6A 4IHKA 2Q4TA 2C20A 1SPXA 1VL8A 3GQBA 2GASA 4R7ZA 3OQOA 3PDJA 5ALYA 1V6SA 1MKYA 4RABA 4BVAA 5TSDA 3P0RA 1ACMA 3HUFA 4C0KA 2GDJA 2X8JA 1NUUA 1T8WA 1E3DA 5I4IA 2FMXA 4FB5A 1NVBA 2Z3VA 2ZBPA 3RNOA 3I32A 3RVOA 3HPRA 1B6SA 3ZG6A 4E2WA 1Y7TA 2W2LD 4XFKA 1OXXK 4DCPA 4BP3A 1G6HA 3T41A 3PFNA 2C00A 2HQRA 1K5PA 2PMFA 1VQ1A 3AVOA 3TLGA 4OVKA 4EPXA 1IB6A 3WRYA 4O0LA 3NATA 4FHFA 1NT4A 2PANA 2R7NA 4GVPA 3DCJA 5I01A 2PTHA 4CIWA 1BVHA 1W76A 1PZHA 3E1KA 3IA2A 4O4JB 4EF6A 2QV7A 1PVOA 4LDPA 1HWYA 1WPGA 2PX3A 2R7AA 2YWFA 3B6EA 1YK1A 4A6DA 4CFZA 2G3YA 3B2NA 4ZAZA 3TRHA 2JVKA 2ASEA 3IAFA 1WHTA 2F1RA 4UHKA 1CUZA 4IQ8A 4Y9UA 1TTHA 3O03A 3HADA 3Q41A 4B79A 2G9UA 2HSGA 4L3OA 3PC6A 2IKQA 2D5IA 3OCVA 3O8BA 1DJLA 4WACA 2PIAA 2VNHA 4KIUA 3I73A 4FGLA 1XP8A 1ZOLA 2RHGB 4AJHA 4B3JA 4DE5A 3CUSA 3IP3A 2NXJA 3EHEA 4ZODA 4N3AA 3FA2A 2XD4A 4PG6A 4QPDA 5IDYA 5LXTA 2J3HA 3QVKA 4G1EB 1OBFO 3P9IA 5C1OA 3K0EA 2WHYA 4KOAA 4S1NA 3FDZB 5LXTB 1MQSA 1GAXA 5LKAA 2W2QA 4WWHA 2PLAA 2OV8A 4L76A 4ZT2A 4M1YA 3M4JA 2G83A 4DAOA 2NSJA 1GPBA 5DYIA 5F33A 3KEMA 3IQIX 1EWTA 1ZAKA 4ER5A 3DXZA 2OHOA 4MK4A 4IFIA