4ZWNA

Crystal structure of a soluble variant of the monoglyceride lipase from saccharomyces cerevisiae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
SAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFSPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIRDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMKQWLDKHTTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Monoglyceride lipase
publication title Crystal structure of the Saccharomyces cerevisiae monoglyceride lipase Yju3p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 114
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zwnA00
4FNMA 1BRTA 2QTBA 3W04A 3FYUC 5LZ8A 1CUHA 1N5RA 4RE6A 1DINA 1QOZA 1WHTA 4MXDA 4KAFA 2K2QB 3PFCA 4DMFA 3SWWA 3ZLVA 1YAJA 1XZGA 2GBIA 4J0HA 2HA7A 3VISA 4NZZA 3S8YA 3I2JA 4Q82A 2QXUA 1CUIA 4RE5A 4Y7DA 2BAGA 5SYNA 3G0BA 4H7EA 5CW2A 3Q0TA 5AM0A 2RGUA 3Q8WA 3P2MA 5A6VA 1MPXA 4Z49A 4FOLA 4X6UA 5DLPA 3IUJA 3V1MA 1X70A 4BAZA 2WIGA 3I2KA 4WY8A 4BTVA 4AZ3A 1J1IA 4FLEA 4LIPD 1UT6A 4J0KA 3HABA 2V97A 3DD5A 2QS9A 1DQZA 4EY4A 3F9CA 4OB7A 5EIAA 3WL8A 5JD4A 2YASA 5AKEA 5AJHA 3OOSA 5HF8A 4KRYA 5ALKA 2ORYA 2WFLB 3IDAA 5CT4A 1GKKA 2JEYA 2VF2A 4IH4A 4K6HA 4ZGBA 2CJPA 1EDBA 1NU8A 1WCYA 4H7IA 3HJUA 2PSHA 2OQVA 1SCKA 3QBJA 1UOOA 3WKDA 2OLEA 4BDTA 2QKYA 3L1HA 4H7KA 1UK9A 3IUMA 1FFEA 2I3DA 3YASA 4P93A 2G63A 1U8EA 5LP1A 3ILSA 1CPYA 3PE6A 2HA4A 1UOQA 4HXFB 4WFKA 1LGYA 1YB7A 1L7QA 1BROA 2WG2A 2WLSA 3DLTA 4AN0A 3O4JA 5I7UA 1CUDA 1ZJ5A 1ZD3A 3AINA 3D5EA 3WZLA 2Y6UA 2VAXA 2C58A 3QM1A 4FWBA 3HLKA 2BFNA 2RAUA 2RONA 5LZ5A 1YCDA 3STVA 2VJCA 3NOXA 3D2BA 2PSDA 4DTCA 4AO6A 1QIKA 2H7YA 5AKLA 4GWLA 2AXEA 5ALWA 1R4ZA 2WG1A 1ZIXA 2QXTA 4N5HX 5ALYA 5FRDA 4BVKA 3PF9A 4G4GA 1JJFA 3C43A 3ZI7A 1ZICA 2HHAA 3HACA 2HL6A 2GZRA 5CRIA 3SX4A 5EI5A 3EQ8A 1ORWA 3F67A 2HA2A 1HL7A 4BBZA 4IQ4A 3WZMA 3ED1A 4JH0A 2HDWA 5AKIA 1XRNA 3WYNA 2QR5A 5HF5A 3STXA 1QO9A 1OCEA 3S2ZA 2OGTA 1QTRA 3WL6A 1W52X 4CG1A 3BL8A 1USWA 3BF7A 3WK8A 4GXNA 5FUMA 1QIFA 2PSEA 3G02A 3UMJA 2WQZA 1WB5A 3WJ2A 5A7GA 2PKYX 4MYDA 3D7RA 4G5XA 1HLGA 1GPNA 1A8QA 1R9MA 5K3CA 1E3QA 3DOIA 2GZSA 3IB3A 1XLWA 1XKTA 1JMYA 5CTAA 3V48A 3AZQA 4KEAA 2V98A 3PUIA 3HSSA 4L9AA 1Q0ZA 2QM0A 4GBGA 1E8MA 4FFVA 2W22A 4DMCA 5ISMA 2BUAA 5EHNA 4MWTA 2Y2VA 5ALVA 1EDDA 1GT6A 3DCNA 5KWIA 3STTA 5FKJA 3DOHA 1AURA 2VT7A 3O9MA 4B0PA 4BCBA 1G4HA 3R3YA 2QRUA 3K2IA 5HF9A 1EDEA 2V9ZA 1JJIA 2D5LA 2XUFA 2C5GA 2EDAA 4G4JA 4Y2RA 2B9VA 5ESRA 3VKFA 4H7DA 1DT3A 2ROQA 4P9NA 1ZIYA 4U2BA 4ZXFA 1CUWA 1SOMA 2HM7A 5JALA 2JGMA 3KSRA 3LIIA 3R3XA 2YYSA 1MN6A 3DJYA 3C6YA 2HU8A 4CG3A 2ZJFA 2VSQA 3OC0A 1XFDA 5FLKA 2DCMA 3GELA 1M33A 3I2HA 1CUZA 5T4FA 4DLNA 4LXHA 1UOPA 2GBCA 4C6HA 3WA6A 4X95A 3DNMA 2XUHA 1P0QA 2OG1A 4FBMA 3FSGA 1IMJA 4PV7A 5CH5A 4BC0A 1JT2A 1SCIA 4DMKA 3W06A 3I2GA 3HXKA 3AIOA 2I78A 1CLEA 1QIMA 3STUA 2H7CA 1IVYA 5AP9A 2BGNA 3ZWQA 4BB0A 2WUFA 4UHEA 1CR6A 5AI0A 5JIBA 4PNZA 1CUBA 2EEPA 1MJ5A 2QMQA 4KE9A 4Y2JA 3D4LA 4G9EA 2DFPA 5AOBA 3W2TA 2IIVA 1MNQA 5HK8A 2XE4A 5DTIA 3ICWA 3FLAA 1BN6A 4X93A 1GPKA 5JAHA 2VTVA 2WJ4A 4C4ZA 5AH0A 5CMLA 2Z3WA 1FFCA 3CN9A 4WCVA 4QWWA 5AIBA 3AZPA 5AKKA 5HKBA 5E4YA 4BRSA 3WIOA 1ORVA 2QZPA 3CCBA 2GYWA 1T2NA 2ACKA 3A2NA 3STYA 3D2AA 4W1PA 1VE7A 2PU7A 1CUAA 3HRHA 3FOBA 3WMRA 3H2KA 1K63A 4XWGA 2IITA 3DKRA 4CG2A 1VZ3A 2RHTA 5K3FA 5ALHA 1IUOA 3WK4A 3MVEA 4B84A 1XZIA 1XZMA 3F96A 5AM5A 3H1BA 4X71A 4QZVA 3R3VA 2WHQA 5K5EA 5LKRA 1L7RA 1QFMA 4OUKX 1FJ2A 4CFSA 5DYTA 1J06A 5IVHA 4EBBA 1B6GA 4IH9A 2NW6A 4AX4A 3G0GA 1WOMA 3LS2A 3BDIA 4X00A 1HPLA 4J0IA 3G9TA 4Q3KA 5IVKA 1QGED 3AUKA 3G9ZA 3RARA 4PW0A 2JEZA 4ARAA 2ES4A 4N5IX 1AQLA 3FCXA 4H7FA 4EHBA 1FSSA 4QLOA 2XUGA 4KAJA 4OU4A 2XLCA 5LLSA 5JYCA 2CBGA 2WHPB 3A70A 1ZI9A 4Q05A 3C8HA 3PF8A 4QDOA 3WK7A 1GGVA 2WU4A 3ANSA 3DEAA 4FMPA 3H1AA 1CUFA 1CUSA 1G66A 3CN7A 2QT9A 1XZFA 1A88A 4Y2XA 5IVIA 1H22A 1LPPA 3ESBA 2Z8ZA 2C4HA 1IUNA 1F0NA 3GROA 3H04A 1ZGCA 1MAHA 2ZJ6A 3WL5A 2JGKA 3VDXA 5DNWA 3M83A 1K5PA 2P8SA 4FDMA 4RPCA 4UBLA 1AKNA 4DNPA 1G5FA 2FX5A 1CVLA 4UFOA 3OTQA 4EA6A 3WK9A 4XX1A 4HAIA 4FLMA 3MUOA 3GA7A 1C7IA 1WB6A 3V1KA 2HA3A 3DS8A 4AZ0A 4NMWA 1RWQA 3PFBA 2IX9A 2D0DA 1HBJA 5AM3A 2Q0XA 5JAUA 2ZYHA 4MEBA 4DIUA 4GDMA 4QDUA 1QIGA 3M81A 1LPSA 2Z3ZA 1EK1A 4TVKA 3VXKA 4JUIA 4UUQA 3TRDA 2BGRA 4A5SA 4B83A 3GUUA 1E66A 4PSDA 4WFJA 5F4ZA 4PQEA 1ETHA 4W9RA 1KU0A 4QEKA 4EUSA 5HQ3B 1W1IA 4FLFA 3I2IA 2AJCA 4W63A 1A8SA 2JGIA 3G9UA 3O0DA 5LKAA 7YASA 4C4YA 3FAKA 1XZBA 5FPPA 1EINA 3FCYA 1DQYA 3HI4A 4H77A 1VE6A 1W76A 3IIIA 3JWEA 3V1NA 4M0MA 4OD0A 4KACA 1H23A 4Q3LA 3FYTA 3PDCA 1H2XA 2QJWA 4ARBA 3WK5A 5ALMA 1CQWA 5LZ9A 3G8YA 1N5MA 1JKMA 5AK5A 3WWPA 3F98A 1SC9A 4C88A 1FFBA 1ACJA 1O6FA 5AI6A 3HEAA 2QJRA 4I19A 3LCRA 1MU0A 4YK7A 4UFNA 2FJ0A 1XQXA 1UKAA 4QDXA 1PJAA 4ROTA 2XUJA 3VJLA 2H7XA 4ZREA 5EIHA 1F6WA 4QWMA 4E15A 5HF6A 4KYVA 4ZV9A 2XMBA 4BVJA 2H1IA 2OAEA 1QJ4A 3F97A 4G4IA 1JMKC 4UBMA 3I6YA 1C4XA 5AK6A 3G0IA 4MQLA 5EIEA 2HFKA 5AKZA 3WIBA 2XB6A 1TK3A 2AJDA 2WHPA 3EIOA 2C7BA 2XUKA 4WFIA 4BP8A 1EHYA 1H2YA 1E89A 5EGNA 2O7RA 1ZD4A 4JNCA 2RHWA 1GXSA 1YR2A 3A2MA 1UZAA 1GQRA 2R11A 5AKYA 4G8BA 4EZIA 3G9XA 5J3JA 2WKWA 2WSLA 4UPDA 1BEEA 1EI9A 5LIPA 4AMYA 1Q0RA 4C89A 3VJKA 2XMCA 2XQGA 1YA4A 3GZJA 1VXRA 4W1QA 3ANTA 1HQDA 1WB4A 2WUDA 5ALDA 3IUQA 2OAGA 4JYMA 2OCIA 4DNOA 2FJPA 3KD2A 4XIIA 1TCBA 5JAPA 5K3AA 1C7JA 5IVDA 3G0DA 5D7BA 4MQMA 5ALEA 3W9BA 2J3DA 4M0FA 3IBTA 5EHQA 4F21A 3C87A 1U2EA 5AI4A 2E3JA 5ALNA 1DU4A 3TEJA 2GBGA 5IKXA 4F60A 1VA4A 1XZJA 3CXUA 4X85A 5CT6A 1ODTC 1ODCA 2WIFA 5HFAA 5HQ3A 4GHWA 4O08A 5AKJA 4X92A 4ETWA 5C7YA 5AM1A 1HDEA 1LZLA 1QFSA 3I6MA 5C8XA 2PU5A 4UFPA 5BV7A 4U2CA 2XQKA 2X8BA 1YS2X 1EX9A 1QZ3A 5DYWA 3FNBA 5JD6A 2BCEA 2XT0A 1TAHA 2ZYRA 3ZV7A 3W05A 1ZJ4A 4FNGA 1CUGA 4ZRDA 4X94A 4YPVA 1QIDA 5K3FB 1Q84A 2XMDA 3W9UA 2QUAA 4AXBA 3WJ1A 1CV2A 4DNQA 3D0KA 1U4NA 2J4CA 1JI3A 3FVTA 1WHSA 3DKKA 5KREA 1EH5A 5KWJA 1CUXA 1P0IA 1MX1A 2WUEA 3G7NA 4AO7A 4C4XA 1BCSA 3QH4A 3U1TA 4Y2UA 1F0PA 5I9IA 3X3HA 2AJ8A 2AJBA 4FFWA 4H7HA 4QLAA 2ZSIA 5AI9A 3TJMA 2XUDA 4MYSA 4A23A 4EY7A 4J03A 4BZWA 3G0CA 1PFQA 4H18A 2WILA 1MAAA 1A8UA 3CCCA 2ACEA 1XZDA 3EBLA 2GBFA 1K8QA 1AZWA 4QA9A 4HS9A 3T52A 1OILA 2Z8XA 1CRLA 4J0CA 1E5TA 4LKOA 1GKLA 5EHXA 2QOEA 5FV4A 5AOAA 5LZ2A 3FLEA 1TCAA 5AKHA 4NVRA 3OM8A 4N8SA 3WWEA 5C81A 1A7UA 2JBWA 3WLAA 4B82A 3FLBA 1LPBB 3FWHA 2JIDA 5ALPA 2XQFA 3ESDA 4OPMA 3I28A 4X7BA 1NX9A 3H2GA 2JGEA 4J0DA 3R3WA 2PUJA 4G8DA 5ALFA 3C5WP 2O2HA 1RP1A 3NUZA 3PUHA 5DNUA 4X3CA 5A2GA 4I3FA 4Y2PA 1X2EA 3R3ZA 3WKBA 5K3DA 4GEGA 3SK0A 1VLQA 1TRHA 3KWJA 2OCKA 4HXGA 5CT5A 1ACLA 4GW3A 2XDWA 3WKEA 4W1RA 4AO8A 3DL4A 2ZYSA 5DJ5A 1Y7HA 1DWPA 4LYDA 3MGAA 2JGLA 2PBLA 1KU6A 2Y1KA 1XZLA 4FTWA 3HZOA 1GPLA 4B81A 3H19A 3O9VA 2PSFA 3E3AA 4G1FA 2XUQA 4M0EA 4E11A 2WM2A 1P0PA 1O6GA 4DSAA 3RM3A 2WJ6A 2PM8A 4PF1A 5CURA 5CXXA 4QNNA 1LPAB 3R40A 2CB9A 5JAOA 4KE7A 1BE0A 5AK4A 1YAHA 4UHDA 3V1LA 5H3HA 2VT6A 1VJ5A 5AKGA 2XI4A 4EY6A 1XZCA 2I03A 4PSCA 2WFMA 4H35A 1Y37A 1XRRA 5JZBA 4MEAA 5C8ZA 4B6GA 1YS1X 1HKHA 4G9GA 2G5PA 4BZZA 4CCWA 3QPDA 3LIPA 5BWCA 3IUNA 3UUEA 4CI9A 4L0CA 2CMFA 1AUOA 2QVBA 4OSEA 4HXEB 1VOTA 1LPMA 5FOQA 1EA5A 2PL5A 3ESCA 2BUBA 1DX4A 3KDAA 1UK7A 3QYJA 1XROA 2GYUA 2G5TA 3QMVA 3C6ZA 5AICA 1CUCA 4F5ZA 4UBKA 5CBKA 2ZJ7A 4TPKA 5FP0A 1S8OA 4EY5A 3WWCA 4AQDA 2XMGA 5IH7A 4RNCA 1QIIA 1VA5A 5JARA 1R88A 2DR0A 3M3DA 1I6WA 1MX9A 4JEIA 5FXMA 1UKCA 3M82A 1LBTA 3BDVA 3R3UA 4INZA 2HU7A 2GYVA 3WA7A 2CZQA 4KE6A 4JYPA 2BKLA 3H2JA 1CIJA 2ZSHA 2X5XA 5C8VA 1EB9A 2WG0A 1CEXA 4AN1A 3WWDA 4OB6A 2PX6A 4J0JA 4OB8A 3KXPA 5EFZA 4G8CA 4BVLA 5D6OA 1BEZA 2V96A 3AZOA 2XMRA 4TGLA 1TKRA 2WIDA 2CKMA 3I1IA 2BUCA 2WU3A 2VQ6A 2HA6A 4DMHA 2PSJA 3LP5A 5HK9A 1CUJA 3ZLUA 2ZYIA 3N0TA 4MJ3A 3NWOA 4X90A 1YB6A 3I6ZA 3F8SA 2I3ZA 3BIWA 1QIJA 3IURA 3IA2A 1LPOA 4S0XA 3QZUA 1TIBA 3H2IA 3STWA 4UHBA 5JZSA 2XMQA 3DDUA 4CIAA 1Z68A 4Y2YA 3ESAA 1VZ2A 1XLUA 4BATA 3OG9A 3RLIA 3BXPA 3MUNA 1EK2A 1LLFA 3O4HA 4NS4A 5T4EA 1EB8A 4W1SA 3I2FA 4C87A 1ZD5A 4KJXA 4H0CA 3PICA 2W6CX 2OQIA 1EVEA 3FBWA 5ALGA 3VJMA 4DSZA 2WUGA 5JASA 3HYSA 4C01A 5A62A 5D3ZA 3L1IA 5CT8A 3U0VA 2DSNA 1YSCA 2HU5A 2VAVA 1CUEA 5CT9A 4HRXA 1R1DA 3A2LA 3FSGD 3DYVA 3EQ7A 1BS9A 3WKCA 3OPMA 3T4UA 1XRPA 4YX9A 4QDZA 3RK4A 4KAAA 5ALUA 1G42A 4K5QA 4YASA 2G4LA 4XJVA 4KE8A 4E46A 4LXGA 2Z5GA 3WQHA 2H9YA 4IO0A 4X91A 2Y6VA 4U2FA 5ALIA 3C5VA 4UHCA 4P08A 2HA5A 1ZGBA 1R50A 1U65A 4BE4A 3E4DA 5K3EA 3NGMA 4X97A 2ECFA 3IULA 4DM7A 1RYYA 4KRXA 4UHHA 4Q1VA 2XUIA 5AKXA 2WIKA 1IZ8A 3VVLA 5JADA 3WKAA 1THTA 3H18A 2X76A 1WPRA 2HRRA 5SYMA 4B9AA 2DHCA 3R41A 3FYUB 3ICVA 4WDRA 1THGA 2VA9A 1CUYA 5ALZA 5HKAA 3H17A 4FKBA 3L1JA 1XQWA 4UBOA 5BWBA 2VEOA 2XUPA 5A7FA 5FPQA 4CCYA 2B4KA 3EQ9A 5AI8A 1EVQA 1MX5A 2B61A 5ALLA 1N1MA 2O2GA 3C45A 2RIPA 3E1GA 5DTJA 1ZI8A 4QE3A 4LHEA 2WTMA 5ALJA 4P92A 3QMWA 3K6KA 2VJAA 5AM4A 4HZGA 2C5FA 1J07A 3BWXA 2PPLA 3DL7A 1UWCA 1ZOIA 1UXOA 2XUAA 2XQJA 2HFJA 6YASA 4BE9A 1FFDA 4BP9A 3V9AA 3D3NA 2XMZA 4PO3X 1QO7A 5T4BA 5KBYA 1XRLA 2OCLA 1XZAA 2LIPA 3I1YA 5ALXA 5T4HA 1DTEA 3C8DA 4E14A 3QMMA 2C0QA 4GECA 4K6GA 1LZKA 4DGQA 5I8PA 1IZ7A 4OU5A 2CUTA 4AMZA 2RI6A 1AGYA 1JJBA 2C0PA 2XUOA 1KEZA 5AOCA 3H0CA 1VXOA 3QVMA 3C6XA 2CEKA 4GLBA 4B7ZA 2QUBA 1WPXA 5LZ7A 2XQIA 3AIKA 4N8EA 4BCDA 4WJLA 4B0OA 2B20A 3E0XA 4PSUA 3B3QA 3QPCA 5AK3A 4B85A 1DWQA 3PI6A 2O7VA 1R9NA 4Y9SA 1CFJA 1UK8A 5JD5A 1DT5A 1GQSA 1MTZA 4XVCA 2YXPX 2DQYA 4U2DA 3WYDA 3LLCA 5LZ4A 2XLBA 1J2EA 4F0JA 2OPHA 3OURA 5HCUA 1AMNA 2OGSA 4UBIA 1YA8A 3N2ZB 4BTLA 5E2IA 4IH1A 5DYYA 3BE8A 3GBSA 2WFLA 2XMSA 4FHZA 4IHAA 1ZI6A 2OXEA 4Y2TA 3ZLTA 1MNAA 4B80A 2O2IA 3AIMA 1ODSA 3H2HA 4CIBA 3B5EA 2VJBA 4BCCA 2FUKA 3FYUA 2EDCA 1ISPA 1XRMA 3RKSA 2JGFA 3AILA 2DHEA 2DHDA 4MWSA 5CH8A 1XZEA 4BYMA 4GI1A 4EB0A 1QE3A 1QIEA 2ONCA 4LXIA 5ALTA 5K3BA 4Y2VA 3JYHA 4L3WA 4ZV7A 4N8DA 1XZKA 5E4TA 3R0VA 4AB1A 1W4LA 5DWDA 4UBNA 3A6ZA 1XLVA 5D3KA 1B41A 3DQZA 4DYHA 3ZPXA 1XZHA 2R8BA 1VKHA 4BAGA 2WTNA 3HC7A 2WFZA 3QITA 1XKLA 5ALRA 1BCRA 4A16A 3C6BA 1QLWA 3BJMA 3WK6A 1WM1A 2WHRA 5YASA 1SCQA 1SFRA 3GFFA 5HFNA 1X2BA 1YASA 2UZ0A 3DYIA 4Q3OA 4K2AA 2ZVDA 1LNSA 4LYEA 5AI5A 1XQYA 4U2GA 1L7AA 3O95A 5EHZA 3SC2A 2AJLI 5CH3A 1E8NA 1Y7IA 1ZD2P 5HZGA 3TGLA 4HRYA 1P0MA 3VVMA 5CXUA 2WIJA 5A7HA 5FDFA 5ALSA 1QIHA 5AIAA 1LBSA 4L72A 5E4JA 4UHFA 3O4IA 3D2CA 4J0GA 2JF0A 2PVSA 4WY5A 1UKBA 1TQHA 3AJAA 4HTAA 1EXWA 4Y2SA 3WWOA 2YH2A 1LPNA 3C70A 3D59A 1QTIA 4UBJA 1JFRA 5JANA 4I4CA 2HIHA 3K9BA 2DQZA 4FBLA 4J7AA 5ALQA 4D9JA 3O4GA 4BC1A 2OGZA 3WI7A 4KR0A 1BN7A 2HA0A 4OYLA 3BJRA 2Y2UA 4Q34A 1QONA 2WJ3A 4BRZA 5AM2A 4RGYA 5AHXA 3UUFA 1CUUA 1TCCA 4X6XA 4QDTA 1MO2A 4K6KA 4Y2QA 4V2IA 1W6RA 1CQZA 3AFIA 2BJHA 1DX6A 5DNVA 5BOVA 4DNFA 4EY8A 3IVMA 1GZ7A 3EF3A 5LYYA 1CUVA 2HADA 1OXMA 2VATA 1PV1A 4BDSA 3KWFA 4CCYB 4H7JA 1T4MA 1UK6A 1FFAA 2J3QA 2J4FA 4BAUA 1JU3A 1H2WA 2OCGA 4OCZA 1AX9A 1JU4A 4ZI5A 2HRQA 4U2EA 1H2ZA 4B9EA 1BU8A 2PUHA 1DWOA 4X6YA 5A71A 1UFOA 3KOOA 1AC5A 3BF8A 5ALOA 1XQVA 4OYYA 1XRQA 1W75A 3BIXA 3QPAA 4ZWNA 1K6EA 3FVRA 3B12A 1D07A 5JATA 1F8UA 3WL7A 1MT3A 1E8DA 1N8SA 4J3JA 1NU6A 1K4YA 1Q83A 5JZ9A 2JGJA 4ITVA 4HVTA 5AO9A 4WDQA 2VJDA 3JW8A 1R3DA 1IUPA
chains in the Genus database with same CATH superfamily
3O94A 3HU5A 2V03A 1IG0A 4QDJA 1NW5A 3NDIA 3IPAA 5E2BA 4B2IA 3K6JA 1ABEA 5LFAA 1CUHA 2PEYA 3MRSA 4URVR 1DINA 2B2CA 2FPGB 5C7IO 3FNFA 5BW4A 3SVTA 1WHTA 2EF1A 3WSTA 4B4VA 4WAUA 3DOOA 4FINA 4GMFA 4O0MA 4MV4A 1SQGA 3PFCA 3X43A 4D45A 1XVVA 4DMFA 2EJBA 2P4QA 1HUQA 2A0YA 1UQTA 2AF3C 2XZPA 2E18A 2A7XA 2X4DA 1GTL1 3PL1A 2XH8A 3SWWA 1VG8A 2CFSA 1YAJA 2QSJA 3ZLVA 1XMIA 1QJCA 1ZDMA 1RAEA 1XWFA 2AI1A 1KAGA 4RTLA 3E7PA 3NHAA 3GPIA 1LDNA 4BO4A 4GOLD 2X23A 3C15C 3LO8A 4HGNA 1T0PA 3JQGA 3LWBA 5IEBA 1AO0A 1M72A 3X2EA 5EJ5A 3FSJX 2WC1A 1SHTX 4ZEMA 5JPCA 1Z2PX 3JAMA 2XNCA 5KQLA 4RCVA 3S2FA 9LDTA 4YCLA 1N4AA 2BAGA 4LHYA 5SYNA 2AN4A 3KKLA 1P9NA 4F97A 4Q9HA 5CW2A 3RFFA 4EJ6A 1Z4QA 3G2PA 5J47A 4GPTA 1GNQA 1EUYA 3ZHXA 3PVZA 2Z9DA 1DBIA 4IXMA 5DF1A 2YBDA 3CLKA 4NBKA 2RGUA 4YRMA 4ZEWA 4QUAA 4CM1A 1B8PA 3Q8WA 3KXLA 5KB3A 5JFTA 3ZU5A 3TKAA 4WKCA 4Z49A 1TYZA 3PJEA 3PNQA 4FOLA 3WLOA 4F7DA 1QZXA 3DTVD 2II6A 4DUYB 3V1MA 4IIFA 4EARA 2Q5LA 1IIBA 2F90A 2FDCA 4BAZA 1U2DC 2F4VB 5CFLA 2G9ZA 1T2DA 3H5LA 4KW7A 3BFKA 3V2UA 5B6JA 5BNIA 4DLLA 5HCNA 1RZRA 3LYHA 2YWJA 1KY5A 5DW0A 4BTVA 4AZ3A 3HJNA 1MEOA 2GKGA 5IYZB 5LBUA 3HABA 1X19A 4PZPA 3COJA 1V96A 4PXSA 1ONBA 4OQYA 3TTVA 4FDVA 3WFZA 2P6OA 3VV3A 4YUYA 1RI5A 1KERA 4QM7A 3MTEA 4L6AA 3RVDA 1I1HA 1CZOA 3VZSA 2C4TA 3BGWA 5JY1A 1ZJWA 2ZUEA 2VZ9A 5EIAA 1DKQA 1PW7A 5DV9A 1KQ3A 1M8KA 5L6MB 3B9PA 4HEQA 2NZUG 1KQGA 1EVJA 1P81A 1OWPA 2QD4A 2IVFA 4IX9A 4DRYA 1JXMA 3L4BA 1NZDA 5FNVA 4CODB 5IARA 2DQKA 1OZFA 3M6AA 3PKZA 1OY1A 2C2ZA 1AQNA 4IY1A 5J2TA 2GVDC 4AJ9A 2ORYA 4X7MA 3UBTA 2XE6A 1TGYA 3BT7A 4Y9DA 1B1AA 2NXJA 4MWZA 4UU0A 5DH9A 4ARIA 1GKKA 2JEYA 1C3JA 2VF2A 5EZYA 1XIVA 3E9DA 1WUYA 1GPAA 3GARA 1ZJ6A 3HBJA 3ZV5A 2CJPA 3LM8A 2A30A 5CLIA 4UJ5A 4BMNA 2IHTA 1WCYA 3H6HA 4H7IA 4JHLA 1N0UA 1PJSA 4LKRA 3HJUA 3MINA 3OEYA 1Z22A 2KMLA 1XMVA 3PT9A 4WESA 5H02A 4DRXA 4DGSA 1XMSA 5I7FA 2VC2B 1EWVA 3ONDA 2PKXA 3LSYA 3PC2A 4Z2YA 5ENZA 2OQVA 1RM4A 3T61A 4MUGA 2IE8A 2XODA 1R8XA 4EI7A 3SHFA 3MRXA 4WNAB 2OXRA 4JQZA 1AKQA 2HCRA 5BN5A 3UJNA 4WK4B 3UXEA 2Q1UA 2OLEA 1P17A 2D74A 4JCCA 4MKGA 2I7CA 3B3AA 4P34A 1EVYA 1HLPA 1ONPA 4OJNA 3NT5A 4M98A 1YQTA 4C0JA 1ESCA 5TSDA 4C6RA 3BK7A 5LU9A 3DAOA 4XYEA 1EMDA 2I3DA 2XNDA 3EXEA 4M21A 1WCIB 4NCXA 4B7CA 1FXUA 2ZIZA 2X0NA 1YR6A 4WJZA 1RJEA 1VCNA 2WP8J 3PT5A 2P0EA 3JQ9A 4C0LA 4BB9A 3SSNA 2XKJE 4Q4LA 2L82A 4HXYA 4LW8A 4EHHA 3BFXA 4N5NA 4ODIA 3R75A 4TWAA 1IM8A 1N5LA 4HXFB 5DVZA 1CJKC 1LGYA 1YB7A 3CF4G 2C7OA 4GZLA 3Q87B 2CL5A 5H7XA 1XALA 2JFFA 1ZKMA 3MTIA 1M73E 3RWMB 1P7PA 1QOQB 2O8EA 1FJXA 4OFWA 3NW9A 5DGIA 4EYKA 3KOUA 4UD6A 5BT8A 1BKYA 1AQJA 1AV7A 1S6YA 2G72A 4ZO6A 1B00A 5A6SB 1EE9A 3RHTA 1GT91 3Q0IA 5IK2A 3OCVA 1TK9A 3UH1A 2GHQA 2VPTA 2YHIA 4Y1GA 5F9MA 3T94A 3TKLA 3FWNA 3CNLA 3RVMA 2IV2X 2FEWB 1GAJA 2JVKA 3LHKA 4HGYA 4J1TC 2ZSKA 1E1MA 4RVUA 1OW3B 5EPOA 3ZDEA 4HEA1 3KU4A 4DMUB 4E2FA 5CB4B 1Y3IA 2C8JA 4PRLA 4WGFA 1BDHA 1T0JB 2XOKA 4MUXA 3E18A 3NQ41 2V8BA 3L43A 1LRKA 2UXCB 2RONA 5LZ5A 3L4JA 4GXTA 4WPGA 1N2XA 4L73A 3PHLA 1O03A 3P4XA 1UJMA 3PR2B 3KJEA 3ZCRA 1J8YF 2QZ4A 5K20A 4UXHA 1H2BA 2H7YA 3GRRA 2QPLA 1G8AA 1RWMA 2A1UB 1TM5E 3GYGA 4TMVA 3TLBA 2TECE 4PQFA 1M3SA 4G23A 5FOWA 1Q22A 2QXTA 1U2RA 1YL5A 3LGSA 2EARA 4NZPA 5DO9A 3R8XA 3U3KA 4GAEA 3RU9A 1QF7A 5IAGA 6ABPA 2IXEA 5FRDA 4BVKA 1E69A 3N05A 4HGRA 5FFNA 1E5QA 1J39A 2J7PA 2OL4A 4R6XA 2BZ1A 4ZYXA 3MTBA 3Q7QA 1IQPA 4DG8A 1GCIA 2J41A 2QTGA 4HR7A 4UKDA 1BA3A 1Q1GA 3ZI7A 2APJA 2HHAA 1GGMA 1W5SA 2G9UA 3ORFA 2V1UA 4R8VA 1VJ1A 1XRSB 1VLHA 3ZHBA 1R6BX 2Q4OA 1PFUA 5CRIA 4C1NA 3EQ8A 1US8A 2B7BA 2VLBA 4J29A 1ORWA 3ZCXA 4MJLA 4OOFA 1VECA 5DI3B 2ZRLA 3AI7A 3F67A 3C3MA 1EXVA 4FW9A 1HL7A 4K9PA 4KN8A 4BBZA 1Q5PA 3D3JA 4IQ4A 3IMFA 1KAHA 3E9ZA 2R8XA 2D0IA 3F73A 2GZ1A 4JH0A 2JI7A 2HDWA 1BQEA 3K1JA 3SZMA 4NCAA 1ANKA 4L4XA 5IFLA 4DCCA 2R8ZA 2KWIA 3Q3CA 3ICEA 4W7SA 3C3AA 3M6XA 1RABA 2QVYX 3C39A 3T3IA 4DXAA 4FJ2A 3HCPA 1WAMA 2RAPA 4YT4A 2CZCA 2UYOA 3P2OA 3B3FA 4MV3A 4K6FA 4QUIA 4R81A 4MS4B 3VO2A 4Q1FA 4CQMD 1URPA 4L0QA 1P3DA 1SM4A 4KMMA 1Z36A 3BF7A 1QBGA 2DGDA 1NP7A 1E32A 1LKZA 5FUMA 2C4MA 3BZUA 3GLIE 1CETA 3PHCA 4E31A 4HMQA 2BKUA 1AO3A 1NW3A 2E5FA 2NU6B 5C1OA 3VHXB 2JASA 3V4RA 3M89A 4G1BA 3L6DA 3ETGA 2AFIA 4NH0A 3H9QA 4DREA 3BKWA 3JS5A 4R4JA 2J6HA 4U0JA 1CJCA 1TO2E 3DBHA 1MB3A 4MKIA 4N03A 1A8QA 2J48A 1PBNA 3EY9A 1RLUA 3DOIA 3PFIA 4M1TA 2GZSA 2VPXA 1UIRA 3A6EA 3O8OA 4CIVA 4Q15A 1YI0A 4CKCB 1Z6ZA 3O2QB 3QE2A 4LMAA 1JMYA 1PGJA 1T9CA 4JIGA 3ZVLA 5CTAA 2V7VA 2PLRA 5CDUA 3EXFB 4U6NA 4E3ZA 2HWYA 4BVAA 2HJWA 2FPPA 3BGOS 4TTIA 2WABA 4PC1A 4CM9A 1T35A 2GTIA 1VJCA 1QGZA 2HPHA 2WINI 4RHUA 4ZYYA 2QSYA 5AT1A 2AG8A 3NEPX 4L9AA 1Q0ZA 5GQSA 2Q1YA 5JDCC 2QM0A 4II3A 4WLFA 4B74A 1ELOA 1SKBA 3DM9B 4G85A 4I9FA 4BIMA 5ISMA 5EHNA 3QVOA 4RSMA 5LSAA 3V55A 1YDMA 1T1JA 3EE6A 4CJXA 1GT6A 4OHYA 4BWFB 3CO0S 1NLUA 3CZ5A 2ZE5A 2ZUUA 1E9RA 2V7EA 5KOJA 2FNAA 3DCNA 5KWIA 4ASUD 2X14A 3NVKI 1GSAA 1AURA 2XCUA 3I1JA 4B6PA 2XCTB 3DVAB 4M49A 2O7NA 4CEIB 5KTMA 3ZVMA 3KX2A 3O9MA 5B3JA 4LYJA 1P1BA 4DQLA 2R6R1 3LX6A 4LWOA 3R9XA 2HYDA 2P9BA 2VSNA 3MJCA 2GPTA 3O84A 3FYHA 1F60A 2QRUA 4INPA 4P4GA 4LF9B 1CDOA 1AUPA 5CLHA 2RHOA 2AOUA 3AFOA 1F06A 3DA8A 3E27A 4LC1A 5TPWB 4CDMA 5CFZA 3NAMA 5J4VA 3QIAA 2VJNA 4GVPA 4YP5A 1QQTA 2C04A 2W37A 1BWPA 1E2BA 4Q7LA 2OWDA 5LQNA 4GPAA 1GQ2A 3L7LA 2C2OA 2C03A 3AEKB 4TMYA 5CJPA 2VUIB 3WYBA 4XUEA 4AY6A 3WOHA 4NONA 1BRMA 4OSPA 2OB2A 1YD7A 3G2KA 3M2PA 1HYEA 1X87A 2XB4A 2X4LA 3OTHA 2I80A 2CCJA 4M76B 3OICA 5FWNA 1I4EB 1SC6A 2UVDA 4H7DA 3VDQA 3VKFA 2J8ZA 1JDNA 2MSNA 2K7FA 3U7FB 1IY8A 1NJ5A 1OX4A 1PL0A 2JBAB 2ROQA 1ZIYA 3MS2A 2OK7A 4P9NA 1YVEI 5JW6A 3DOUA 4LRUA 3T7RA 3PFFA 4U2BA 2ICAA 3K05A 4G5HA 3HKEB 2ORVA 3CJRA 2CNOA 3L40A 5JALA 4XWAA 1HF3A 1YRWA 2Q7DA 3DV2A 3LIIA 4WHMA 3HK2A 1RZRD 2ID9A 3E22A 1FK8A 1SAYA 3LBHA 4U7GA 2IVZA 3QOXA 1EUCA 1L3BA 3INNA 4PANA 2PUAA 3L8FA 2GCOA 4KQ9A 1V4BA 4PE5B 1E6KA 1FOEB 2VSQA 3OC0A 3TPFA 1T4CA 2DCMA 5DGDA 3T5TA 1ORRA 5DMXA 1N7GA 3JD3A 2XT9A 4B75A 1M33A 5T4FA 3N0WA 4LXHA 1ZGZA 1UOPA 1QP8A 1R64A 4NEHB 4TKUB 3ZY4A 1TZBA 3WA6A 2IHJA 3ZTYA 1HK7A 3DNMA 2XUHA 4TTSA 1P0QA 1D0VA 3ECCA 4FBMA 4A1OA 4MYRA 4GI7A 3R5XA 4MWOA 1YB1A 2H5JA 1Y4ZA 3AKZA 2X2OA 3HYLA 3E5NA 1T6XA 2HCFA 2Q1TA 3UV6A 2FMKA 5FCDA 4RULA 3L7BA 3EWNA 2O59A 4RABA 1JSXA 2WUWE 3B6KA 2NTNA 3DE4X 3TSWA 3VH3A 4M6WB 2XDYA 3I2GA 1O4VA 1L5OA 3TZLA 2F00A 2JAQA 3HSKA 2ZAOA 1CLEA 4KQ1A 1X38A 1FFYA 2FW1A 3B13B 3F2VA 2H7CA 1IVYA 3DZHA 5AP9A 4PVCA 2JFPA 4G24A 5H59A 2YWEA 4KUEA 3ZWQA 2NNWB 3REOA 4RLSA 1JWAB 3B6IA 4ER3A 2J33A 2GF0A 1PJRA 1CR6A 2C4KA 1EWKA 1XK6A 1I7LA 5FTLA 2AG1A 4E03A 5KJCA 4W5TA 2CB0A 1JIUA 1FQOA 1S2IA 2GFHA 4KQMA 1M34E 1JQDA 1MJ5A 3F71A 4XPIB 4ZCIA 1TPYA 2IYOA 1J25A 2YXEA 4J43A 4N1AA 3HVUA 4ZVOA 2H65A 4MARA 4R2XA 3W2TA 4CLHA 3MTJA 5HK8A 5DTIA 3SF8B 3D8NA 2NTVA 3DAYA 2ZU0C 1UPXA 1Z0JA 3JD2A 4E33A 1CDDA 3GB9A 2BEJA 1OXKB 3RSOA 1ISHA 3GPCA 2XNDD 4C22A 4A8JC 1P1RA 3N7AA 4IYJA 1EDZA 5B64A 5L4SA 3HO8A 3T7CA 1DE0A 4TUYF 3VR5A 3L6RA 2VTVA 3LQYA 1L8OA 4EJ2A 4DR1B 5BOSA 5FR2A 3H2ZA 2BDEA 1FFCA 1KYYA 2WD7A 1OTXA 2YZMA 3ZCPA 4EFLA 4WCVA 2YXDA 5AIBA 4G0UA 2JLVA 5EE5B 1TT5B 2LKDA 4I81A 1TVMA 4TMTA 1NMSA 5E4YA 2AZTA 2QU8A 4LQCA 2YY7A 1Z5WA 3FPJA 4KIUA 4PCLA 5IU6A 1DNPA 1L5LA 3H5WA 4MVJI 4TM7A 3E03A 1Y9ZA 5EJ2A 1REQA 4B3HA 1FLDA 3HGMA 4Q37A 5HEKA 2OSVA 5IXJA 1NMYA 4YJHB 3A2NA 3OCUA 2JH9A 3D2AA 4KQEA 3G8DA 4W1PA 3STYA 3TSAA 5IKEA 4UVHA 1XEAA 2CXUA 2VP4A 5DBFA 3TUJC 1CUAA 1KS9A 1EU1A 3B9QA 3C3YA 4EHNA 1LX6A 3WMRA 3H2KA 2CV2A 2XGMA 5IK2D 4MKZA 4P2GA 2B35A 2IITA 2YOFA 1IN8A 1GZ6A 5BR4A 1N1EA 5H4HA 5I7EA 2Y1FA 5K3FA 3RROA 1DC4A 4ZTUB 1OVMA 3D4IA 1B7GO 1IWPB 4LYFA 5BSHA 2QJFA 1IHOA 2Z2JA 3MG9A 4NAHA 4B84A 2VK8A 1FDSA 1YGPA 1KAMA 1MQ9A 2I87A 5BYKA 3SMVA 1Z0FA 1JR3D 1V3TA 1YZ3A 3GLGA 2BFMA 4Q1CA 4NCJA 3K6SA 2Z4TA 2ZTLA 5LKRA 4ZQHA 4HAOA 1L7RA 1LDGA 1X7WA 1RMQA 2GJ9A 1QFMA 4H27A 3HVRA 3C3WA 2DPMA 2VSOA 2XTNA 3EGIA 4BLSA 4C07A 4Q01A 4CFSA 1Q14A 2Q3CA 3R2JA 4HNTA 4IGAA 5DYTA 3WV4A 4X8MA 3RJZA 2O14A 1TB4A 1J06A 2V7TA 3D0RA 4JI2B 5IVHA 3AVUA 1N2SA 3GCXA 1P44A 3WB2A 3V3TA 1W4RA 1WMDA 1YACA 3VU1A 4BX0A 1EFTA 1QX4A 3CH7A 3BYZA 4ZI7F 2QAIA 3U44B 4CDGA 1AU9A 4ILKA 3IXMA 3PC8A 3WNQA 3G0GA 1P9RA 1S5PA 3H65A 1LX7A 4QUEA 2O8CB 4ZPJA 2FR0A 2VI5A 3FY4A 4K9MA 2H52A 4O4LA 2R4UA 1SKYB 4DV5B 1H5QA 5EWLB 3PWSA 5IVKA 3NRCA 2D2EA 5IMSA 2Q6IA 1J23A 1Q0SA 1TZJA 3T9BA 4B7XA 2FSSA 3OUTA 4CTKA 5TLSA 4XFKA 5DSZA 3ZW9A 4DCGA 2JEZA 3KEQA 1NKTA 2WAXA 3P71T 4FXPA 4BMZA 4EGAA 3CUYA 4GPEA 4GI3A 4K9QA 1KH2A 1PJBA 4I66A 2NUBA 2OO7A 4DOMA 2YN4A 1Y9DA 5IKMA 4HUQA 4TZ6A 4EHBA 4OQFA 5T41A 2NP7A 3DDZX 2NSHA 4QLOA 5FT9A 1K89A 4RZHA 2O2EA 2OZEA 4D99A 4Z1MD 3KTOA 1EFCA 4ND8A 2F4NA 1G3MA 1GNSA 4LHSA 3VYSB 1T3SA 2HWUA 4L9SA 3U6KA 2J31A 3WQHA 3ZQ4A 4TTJA 1ZVQA 1G7RA 1ZI9A 4CF5A 2FK7A 5BQFA 2PX0A 1V8FA 4XZ3A 1GGVA 2FPRA 2I22A 3HBAA 1GAEO 4PQGA 4QGAA 2BEUB 4IKOA 3DEAA 3IOBA 3ZNPA 1DDIA 1XK7A 1G19A 1GP2A 3H1AA 1G66A 3ZW8A 3RPEA 1A88A 3FPCA 3X0DA 1JBQA 4GO1A 4HDKA 3E82A 4HDRA 3TXXA 1LPPA 1ECGA 3ESBA 1T29A 1JFLA 3VTAA 5D7NA 4CKYA 2HUNA 2C4HA 4GKKB 1F0NA 2G9QA 3GN2A 4LVUA 1MB9A 1J1ZA 1MAHA 1V9CA 4CMHA 5KKCA 2ZJ6A 3WL5A 2D3TA 1NFFA 1E20A 1WDKA 2J9FB 1D7OA 3HYTA 3L04A 3OZCA 3PVCA 1ZM4A 1P8AA 1E7RA 2IDMA 4LRWA 4MR7A 5FA8A 1L5NA 3TH5A 3UW1A 4U3JB 2I8CA 4FDMA 2PR2A 3TWOA 4QU9A 3ZJUA 1K5HA 5THXA 4BE7B 2H2FA 2XVZA 4F5YA 2FWNA 1M1ZA 3BCRA 3T54A 3WS7A 4DQVA 1PNQA 4W8HA 5IT9A 4V1CB 4XQGA 2X5JO 4HAIA 4FLMA 5BRNA 1XCMA 1ZAKA 1ZHHA 2VDMB 3TBFA 4TN1A 1RMTA 3ASYA 3MUOA 3SR3A 4CM9D 1XA3A 2HJVA 2OMEA 4IXDA 4ERXA 4FX5A 2IYLD 2GT1A 4EO4A 2FJUA 4JQYA 2GXUA 2XYPA 3U26A 5AVXA 5DOVA 3FVVA 2JS7A 3CEJA 4NQZA 4Q16A 4QOIA 3V1KA 1P5FA 1ZBDA 3UYLA 1S8NA 5IXYA 4YJ2F 1RW4A 2J3IA 3FBTA 2QD3A 1YQDA 3F3MA 2QUJA 3MWFA 4NMWA 4AZ0A 3FFTA 5CM2Z 4F38A 5AVWA 4MWCA 3GRAA 3UJ7A 1N92A 2FQYA 2FPIA 2D0DA 3O93A 4TV9B 3N2KA 5AM3A 1X7YA 4BRWA 2Q0XA 4OL9A 3AL3A 5TEWA 4BO1A 2O1SA 4KO1S 2ZYHA 4MEBA 5F78A 4PTLA 2AX4A 3KYDA 3MCAA 2FUNB 5G2OA 3WE7A 2V1XA 3TW6A 1J5PA 1TVKA 3K8YA 1C8BA 3QFTA 1MQSA 4R9VA 3G5LA 1P75A 2XEXA 1CRQA 4GDMA 5TE9A 3RRJA 1EBUA 2R96A 2SNIE 4XLLA 3K92A 4PIPA 3PNVA 1TEHA 1H93A 2HIAA 1RQ7A 1F20A 4LPSA 4ZCLA 1LPSA 2FPKA 4B3MB 4TVKA 3VXKA 5AESA 3WHKA 1IY0A 4MW9A 2BGRA 3TRDA 4A5SA 5JAMA 2R0QC 2H2HA 3GUUA 1E66A 4MVWA 2NT3A 2WSSD 4MW0A 4PSDA 3GI1A 4UCXA 4W9RA 1C0KA 1KU0A 3ZXUB 1NBOA 2ZR8A 1DTWA 3U4CA 2GJKA 5GMOA 1UZNA 5FOSA 4BL5A 1PWZA 2A78A 3FSEA 1YTUA 2DSTA 3HCCA 4HQNA 4LOKA 2Q4BA 1SXJD 4KXXA 4BJ5A 4BFUA 1CXZA 2AJCA 4R2LA 1N2HA 2YHUA 4NYIR 5EG5A 4Q7QA 4CL8A 3MOSA 4WADA 3P2JA 1ULZA 1XZBA 2RHGB 3FNHA 2JI4A 4MWEA 4RO0A 3TQCA 4QGBA 4AWAA 4I3GA 1XTSA 3TIXB 3HI4A 2D7JA 2PGIA 3NTQA 3DEJA 1GFIA 3H9BA 4FCCA 2RGNA 3ESQA 5EN4A 4ZFNA 2CHUA 1RR6A 1WXIA 4FGSA 5ETJA 4ZU3A 2V7WA 1SC4A 4DY4A 2DHRA 5JOQA 2ERCA 1GPH1 5JMOA 1AMUA 2BLLA 3IPLA 5EXEA 3I6IA 4ZTZB 5AVTA 2HTEA 2PH7A 1XEXB 3H7AA 1XAIA 2AE2A 2KI5A 4XAQA 4ZARA 3PDCA 1SZDA 2BEWA 3AJRA 3IUPA 2Y1CA 4G5OA 5JAZA 3IT0A 2OZLA 4ABYA 4OUDA 3ETHA 4P3KA 4DW8A 2XAAA 3LUDA 3WK5A 5LZ9A 2Q50A 2XRFA 3G8YA 3IBSA 4OHBA 5CEEA 1UDAA 2K7ZA 4YR9A 1N5MA 1V11B 5AXDA 3EZFA 3B9BA 4UVGA 3O9ZA 5C1BA 4RLQA 5D8DA 3U9SA 3LT4A 3TMKA 3IKMB 3OLYA 3SOPA 1CB0A 3A06A 1JZTA 1FP1D 4PPNA 2NO5A 4WLUA 3ROGA 3ZD8A 1FFBA 1V5EA 2CMGA 2GD0A 4G0YA 5LP6B 4C7VA 5AI6A 2YHSA 4LSGA 3SBEA 2QJRA 3R5HA 1X7ZB 1EVZA 4I19A 3LCRA 4IIJB 5KOYA 5B1DA 2BBWA 1LFAA 3NU1A 3B20A 1UPCA 1WEHA 4NEGA 4RSGA 2ZSFA 2X9GA 1GNVA 5DGTA 2FN7A 5DOZA 4C0KA 2ZZMA 1QK3A 3D3EA 4E09A 5HJ7A 3PK0A 3IHTA 1KEVA 5HUJA 5ARBA 5F3WB 3OPNA 4QDXA 1E9EA 3FGNA 1ZY2A 5KYWB 3KJXA 4IWXA 3VJLA 3TD2A 4A6EA 5KYGA 3NALA 2R60A 3GCWA 2IRWA 2P30A 5EIHA 1R4NB 4I5EA 4DLRA 1ISGA 2AOWA 3S4YA 4NC9A 2JLRA 3JYLA 3KSZO 4ZV9A 1B0UA 5HF6A 3PXCX 1BWQA 1IEQA 2NZ8A 2D1YA 3GFBA 2RKOA 2GS9A 4G4IA 4NQRA 4UBMA 1TJ3A 2AV6A 3DDHA 3L92A 4H6PA 1FVFA 1G16A 3U5TA 4ISCA 1GUZA 3IUBA 4YAEA 2B4YA 2H1CA 5AK6A 1HV8A 2ZJ4A 5FV7A 1MW9X 3EIWA 3LE8A 5EIEA 4A15A 2HUPA 3HBNA 2FEKA 5AKZA 4BVFA 2BEVA 1AUVA 2RHRA 2JVIA 1LV8A 3VSCA 3KKPA 5JPDA 1WKCA 5IP5A 4RDXA 3B2NA 1TK3A 3SBOA 3AJDA 3AWIA 4H1VA 3Q6NA 1TYAE 2C7BA 4HX9A 5FBHA 5BQXA 1UEIA 1W19A 2D0PB 2XW6A 1RXEA 4IG9A 1K5GA 1EHYA 1E89A 3KQPA 4GRDA 3ROKA 3PWKA 3AB3A 2IH5A 3IQXA 3OX4A 1L2TA 3P96A 4JNCA 7ABPA 4HAUA 1E3WA 3DWIA 5G4KA 3KYCA 4UVEA 1WJGA 1GXSA 5DLEA 1TF5A 4MV8A 3I5MA 5J1TB 4WZZA 5B55A 2JGDB 3H0EA 1OLUA 4I50F 4J90A 1UZAA 2D0OB 2B0CA 1RXWA 1CJBA 1EFAA 2ZB4A 2D1QA 5EVJA 4LY6A 1SVKA 3OBBA 1GN9A 3G9XA 3Q3GE 4A27A 3ZCSA 2CCGA 4CMAA 4Z53A 1ZRHA 1EJBA 5F2KA 2WKWA 3BTVA 1NV8A 3OWOA 3DULA 1LRLA 4WZBA 4RV4A 2B98A 4KGVA 4R8RA 3PJRA 3CURA 4WASA 1FUIA 5HDBB 3SAJA 2WZQA 1WTAA 2VF4X 5EUQB 2PGDA 4C89A 2PFSA 3QBDA 1KZ6A 3W3AA 5ULLA 1EBFA 2KE5A 3OD1A 1T9AA 3GOHA 2QV0A 3ACCA 3S44A 2JFWA 4J76A 1WZNA 3U6BA 1OH8A 1VSUA 2RD2A 1B8VA 1JW9B 1C7ZA 1FF9A 5A5DA 5I9SA 5EEGA 4AZWA 4AKTA 1H66A 2CXNA 4EG3A 3H3FA 1A3CA 3A9UA 3DC7A 1H65A 3DZ8A 2AK3A 3LNTA 3IUQA 2KBEA 2AZMA 3CZCA 1IH8A 4HZUA 5TB5A 5JISA 2NUTA 4JGBA 3MLBA 3GCZA 4FFOA 1UXKA 3O4RA 4KDRA 3GFVA 3RHSA 4KR6A 1Z5UA 2QX4A 5J1SB 5BV1A 3D6TB 3QF4A 2FW9A 1RE0A 5JAPA 1H2EA 3DZIA 5CYFA 4Q4AB 1L8AA 2O4CA 1C7JA 1I94B 3UK7A 3OCZA 3BD9A 3F6BX 2ZCUA 1XLTC 3Q3IA 4BNMA 3W9BA 1G2IA 1UAAA 2ODBA 3C87A 4OJTA 1SHZA 4JUDX 2C8VA 5GTDA 5ALNA 1JG2A 5CAEA 4ZCQA 3ZD6A 3EJ6A 4YMHA 2CSXA 2FZLA 2QIOA 2AUTA 5ITZA 1MABB 5IKXA 4ZVVA 4F60A 4L4YA 3IL2A 2ZM6B 1IYZA 4HQ0A 3V32A 4JBGA 1IPFA 1NM5C 2AEFA 2G25A 4QC2A 3W9SA 4BVBA 3WQRA 4C0HA 2VUHB 2NXWA 3OA0A 2WWVD 1P4RA 1TYEB 3FCOA 4LVOA 3SSMA 1IG3A 2WSMA 1JHUA 3EVFA 2OILA 2YZGA 4M86A 4MMYB 2R1VB 2ZTSA 3CO5A 3AR5A 3GJYA 1ODTC 1V1MB 4B3BA 5HQ3A 4WMLA 1TLFA 1ZWLA 4GHWA 1FX0B 1M6VA 5DT2A 3PRHA 3QSYA 1DAEA 3HUTA 1JG6A 4GMGA 4NYMR 4QUKA 1GTRA 4BGVA 5JAIA 1R0LA 2G1KA 3LCCA 4P7GA 5I45A 1XCBA 3UJDA 3I0MA 5TVGA 1PLKA 5MFZA 4O1HA 3EXG2 5D84A 2IDZA 5BV7A 1V4NA 5G0SA 5KYYA 3Q5EA 1BVYF 1J0XO 3O8QA 3VYRB 1KYTA 2IOQA 3JR3A 4IOJA 4UMVA 4YO7A 1OGJA 5CW1A 1EX9A 4WVLA 1WUKS 3ER8A 4RZUA 4IO1A 5DYWA 4EA7A 3UT5B 5JD6A 1RHQA 3MXOA 5BQ5A 3T1QA 2ZYRA 2ERYA 2W8ZA 1BD4A 1Z8FA 4P58A 1M66A 1W88A 4RAQA 5GONA 4HGPA 1QDUA 2I7TA 4QFDA 1J4AA 2XSZA 1GYPA 1E2JA 5EXSA 4ZDWA 4QU0A 4BLUA 1AF4A 5D85A 1UM9B 4WCFB 2XMDA 3W9UA 1EXDA 3URMA 3INGA 3HGTA 4G26A 2XJ4A 5IT4A 1H4TA 3MIIA 4Z4CA 1TGVA 2IUEA 2D06A 1KP2A 4DR5B 5DX0A 5DWVA 1SCJA 2IUYA 3CPSA 1A5BB 3D7SA 3NDPA 1WHSA 1XT6A 2QDXA 3K0BA 5KREA 4OXKA 3VI3B 4WVFA 1BE8A 1X9HA 4TMWA 1Y42X 1E3MA 1ZSYA 4XD2A 1FRQA 1N0IA 3ZVRA 5FPKA 5ANRB 2GN8A 1XU7A 2ZRGA 1YZHA 3NNSA 1U7ZA 1W36D 3ZVKA 4AO7A 3P0RA 5FTWA 2PN1A 1PJ2A 4CM6A 4KPUA 4PHHA 5IT0A 4H3VA 3W6NA 2DE0X 2QBYA 3DV0B 3R5JA 3R24A 3NIFB 3JAWB 1H3FA 4ZHQB 3QEKA 2IIQA 1HQYE 2BVNA 5JC1A 5LQJA 821PA 4OI4A 4BKOA 1AXRA 2FR8C 4EUHA 1BVHA 1O5IA 1RS0A 1VKZA 2IUSA 3SR4A 4P7JA 3TLAA 2G1UA 1C3VA 3A31A 3TJMA 1NUQA 2ZZKA 4AY5A 2HW8A 5JEDA 5CIQA 1FQWA 4RESA 4A23A 1KQOA 1VFNA 4BFLA 2GEDA 2O3RA 4NYMQ 3TLYA 2B30A 5B3AA 4P0TA 1ZMTA 3WRXC 4R7TA 4J03A 5CA0F 1IZ0A 3IE2A 2EP8A 3G0CA 1BOFA 1MO3A 1XA0A 1WABA 3L1VA 3N6XA 3MRVA 1MDBA 2QNIA 3OHSX 3RV3A 3KHTA 1DAPA 2V7PA 4ENWA 3HCAA 2ACEA 2ODWA 3O2JA 2GBFA 1ECLA 3LBNA 2WRZA 5E3JA 1QBKC 5EC8A 2C20A 4Z0TA 1DBQA 4TLLB 2Z58A 1E0SA 1AZWA 2AW3A 2V7XA 1RXYA 2WA2A 2YN0A 3OEWA 4MR9B 5KX5F 4TYYA 4HS9A 1X6VA 1WULS 2RG7A 2LPMA 3AVQA 3R1IA 1CRLA 4YRNA 1KK0A 1NULA 2FEMA 1FYWA 4LKOA 3T5DA 3H8VA 1JIKA 2VHEA 2QOEA 3L7YA 3R7NA 4OI2A 1V1JA 4H1HA 4BNKA 2NTYC 1MQ8B 2ZVPX 4FGLA 1HT0A 1XVLA 3DFKA 1FP4A 3E5HA 4HC4A 4M0CA 4NF2A 1LDBA 3AKYA 2AFHA 2BM1A 5L3QA 1LQTA 3OM8A 3T7TA 4KQFA 4N8SA 1O9GA 3A1FA 3OCYA 2C5HA 3EZXA 2XGGA 1P2BA 4HN4B 4F3TA 3DP9A 1IJKA 2H07A 1FTQA 1RLIA 1OJ7A 1AGXA 1T4BA 4HYYA 4CU5A 3FWHA 4EW1A 4BXOB 4C7MA 1NQAO 2JIDA 3KQNA 3E05A 3G9QA 4MVJG 4EK9A 4CYMA 2JLZA 4RW0A 2VYFA 2QY9A 4BN4A 2H06A 1IQ0A 1G17A 3GGSA 3I28A 3H2SA 1JJAA 2L19A 2VPQA 3EHEA 4X7BA 5K2MA 3SVZA 1U63A 5A1TA 5MDHA 2JGEA 2QTLA 2A9JA 3D5QA 4I1IA 1XSEA 3CIOA 4MQFA 5I7VA 4MRMB 2JCSA 4KK4A 4C4TA 2XF8A 1EM6A 2QN7A 3VUFA 1I4TD 4IF4A 4MR8A 5JUWA 2PUJA 1O3YA 4G8DA 2XOEA 1N2CB 3BN3A 5HVNA 2CMKA 1KHHA 1M1NB 2WF5A 1QGUB 1IPEA 2O2XA 2RG1A 3PUHA 1VLMA 5KYUB 4MVJF 5DNUA 1IEXA 1M8FA 2A35A 2GEBA 5A2GA 2FSFA 2VRCD 1VBMA 1LU9A 4ES6A 4KH1A 1JECA 3CKMA 3U37A 2OD7A 1ISFA 1P31A 1V37A 2Z2XA 1H8EA 5BQOA 3VR6A 3RS0A 3WKBA 3RJ5A 3MTAA 4OFBA 3KSBC 4DLYA 5IYZF 1TRHA 2C9YA 5AW2A 1KPIA 3K71B 4YIHA 4DYDA 1E5VA 2OCKA 1JEQA 4HXGA 3BTSA 1LI4A 3O1JC 4C7OA 3DJFA 3TI7A 1PYGA 1P29A 1X0XA 3CTMA 3QNWA 4Q24A 4HRVA 1KC1A 1E2QA 4LZOA 1K7SN 4ZEXA 5GP1A 2NO1A 5K0NA 4L75A 1RBYA 4J4BA 3VAAA 1DZ3A 4Z99A 3WKEA 3BH6A 1GY8A 1OFUX 2Y1DA 3O21A 4AO8A 5HYVA 4OLBA 4MSUA 1Y8RB 5HZKA 2ILTA 4EHAA 2BOVA 1Y7HA 2GN4A 3C8ZA 3DCYA 3CUUA 3R6DA 4HD8A 5GY7A 3T5AA 4FFPA 2PBLA 2O5VA 3PHGA 5TX7A 2PGNA 3L82B 1CS0B 1Z15A 2XHZA 3U3ZA 4B81A 4B6SA 3EF0A 3RC2A 3T95A 3HVJA 3H19A 3IMGA 4BKMA 5G1PA 2C78A 4IOKA 2QRMA 4E94A 1EZ1A 1TTHA 3TZ6A 1JG3A 3E3AA 4RFSB 2OA0A 3EVEA 3CVOA 3TR0A 4YFVA 5F2EA 3WJ7A 4NV0A 5LR6A 4V0OA 4XM2A 1KTVA 3QUQA 4KSBA 5COAA 3L4EA 3S29A 4CF4A 4F6RA 1CS4C 3BWVA 3GLHB 1P0PA 1C8VB 1O6GA 3TLGB 1R0YA 2CVZA 4M46A 2XRYA 2EYUA 3L0YA 2KHZA 3U4HA 3RM3A 3DKVA 2Z0MA 4COKA 4HNUA 1D5CA 1Y4AE 4KR3A 1CF4A 4U0KA 3RREA 5IN4A 3NX4A 3EX7C 3ZWVA 3D3WB 3H5IA 4PZCA 2IP1A 5BWLA 3RYCA 4PF1A 5CXXA 3GLSA 3F78A 1DZIA 1G9SA 3HKBB 4IHJB 4X7PA 3KZ1E 2O6LA 3UAYA 4U6SA 1LC0A 3P19A 3JR7A 1YAHA 2VJLA 3V8BA 2QQFA 3V1LA 2PHZA 1W48A 3H2YA 5IKPA 1UBUS 2PBFA 2TSYB 3ELUA 1WXHA 1QNLA 3INTA 3JQFA 4E08A 1AG9A 2CT8A 5JCJD 1XZCA 5TDHA 1PNRA 1YR9A 5F77A 4RHFA 1PFGA 1H4VB 2ACWA 4ESEA 1C1DB 3W3AD 1Y37A 4P7KA 1XRRA 2XZDA 5JZBA 4MEAA 3FJOA 1MRZA 4B6GA 2QMUA 2IYSA 4KK3A 1T0IA 3TOZA 2ZRKA 2DPLA 3S7ZA 3LXUX 4OAQA 3MQFA 4C03A 1VRWA 2YWRA 3NJ8A 4KWCA 1GZ5A 1EX6A 1UBRS 3USCS 2X7JA 4XR9A 3DO6A 3GUHA 4Q7JB 5HJ5A 3AY6A 4M8NE 5CLFA 4GMKA 4BJ3A 3ISVA 3UUEA 4XJXA 1RMYA 4DB2A 3HXLA 6LDHA 1V5IA 4CI9A 3FN4A 3OCWA 4ARVA 1E2GA 2JB9A 2OFXA 5JROA 3PEWA 2QVBA 4OSEA 1J49A 1KO7A 4KPGA 4LOAA 4RZSA 1VOTA 1DCMA 3KFXA 1J8DA 2F43B 4N6GA 2V58A 5D2CA 5FOQA 3SQXA 3C14C 1A69A 3ESCA 1C30A 1R9GA 2GR9A 5KYKA 3QYJA 3B1ZA 1Y89A 3C3EA 1KZ9A 3GX1A 1J99A 2WTEA 2XWPA 3NIBA 2XNHA 3KAPA 3L6OO 4QQNA 2IZ6A 2QN1A 4JVMA 5TF4A 3VPSA 4AF8A 4BX8A 1B15A 4GM1A 4RVFA 2QLMA 5AICA 3K0FA 5CDHA 5KNBA 2IY7A 2R6ZA 2W6JA 5CB4F 2ZJ7A 4N49A 2DZDA 4TPKA 4B4UA 4KFUA 3BTUA 1S8OA 2XGOA 4WNYA 3WWCA 1EJ2A 3NLLA 2YL2A 3CX6A 2FFQA 3T3MB 3IOEA 3NT2A 1Q2XA 3FR8A 2PRZA 3TTWA 2N0SA 1KOFA 2ALJA 3EA0A 3V46A 5IH7A 3NAQA 3FIUA 2AOTB 3MS4A 3MMXA 4JY7A 4DHEA 1T2CA 4QG7A 5I9BA 2ZE8A 5BN3A 4QIHA 3QE3A 1WCWA 4GFDA 1R88A 1ZUHA 2DR0A 2PXCA 3EWIA 2OFFA 4EDHA 5LL6P 3BBPA 1ESDA 4JEIA 5K99A 1ADJA 1U3CA 3Q40A 3R0QA 4LZAA 1DO2A 3AGPA 4L0DA 3BDVA 1W0KA 1N0VC 3R3UA 2WQ6A 3KJFA 3QOYA 5DGCA 3HPRA 1QYRA 1TQ6A 1Y8ZA 1UADA 4O29A 3JTMA 3OFKA 3EBPA 1MC1A 3R44A 1ZGJA 2NO0A 2CL0X 3KJNA 1H3EA 3ESXA 4PBSA 4E2ZA 1N5DA 4GE3A 1W7AA 2HMTA 4UPEA 1AJEA 3RSGA 5A5FA 3L41A 3V80A 2WWTA 2IK8A 1FTNA 2X5XA 3LPNA 5C8VA 1DC8A 2WB4A 2P78A 2I33A 3TX2A 1F5SA 2VP6A 1OLXA 3MWGA 4OSOA 4URYR 3VKWA 5IEJA 3ZIAD 3IPXA 1K9SA 2ZSUA 1DRUA 2ZUVA 4J2TA 2Q7OE 5L4NA 4KTTE 4NDZA 4RIFA 3DXZA 1Z5OA 2IXDA 3DE5X 1TM2A 3TDMA 1LC3A 4D9GA 7REQA 1FDTA 3V8MA 3B6MA 1RLTA 2ILVA 3I09A 2LE0A 2P1RA 4NV1A 4OB6A 4PLVA 3OSZA 4BRUA 1FW6A 4MHSA 5LXTB 1NT2A 1TVCA 4FZ5A 5B2FA 2PX5A 1L8XA 3LUFA 5I51A 2X9LA 2B78A 1F0KA 1QUFA 1Z7BA 2OOSA 2G8LA 1PI3A 3EVTA 2X2EA 1JVNA 4X66B 1YBHA 1BEZA 3AZOA 3COSA 2F64A 4JKOA 4JVSB 4X60A 1WL8A 2R7NA 5DCLA 3V2HA 4CR7A 2H0AA 1PJ8A 1TKRA 4F4JA 2ATIA 2CC2A 2P4HX 2O9JA 2R86A 2P79A 2KJQA 2RC5A 2WIDA 3GEPA 3KLBA 3OPVA 3RUHA 4JMLA 4XE5A 4ZAZA 4QTZA 2WAYA 3BMCB 2ECQA 1D9ZA 4TLAA 3HS3A 3LRTA 5T6BA 2MSEB 3OIDA 4QAQA 4HWRA 1NBAA 4JLKA 2QV7A 3BMOA 3PGA1 1RT9A 1COWA 4DXDA 2R1TA 5IJ0A 2FW6A 2Q4DA 4CMEC 4GLFA 2B2NA 3GFQA 2I66A 1QQAA 2NO7A 5A3QA 3K0KA 5FQOA 4YAJA 3RJTA 2OFPA 3JARA 4KP7A 5EHIA 4DSTA 4MLDA 3NWOA 5ADHA 4X90A 3HFRA 3V4PB 2V6JA 3I6ZA 4KIJA 2KX7A 3IQEA 4K1LA 4PLPA 3K1ZA 4MPDA 2H5IA 3EH1A 4XQCA 3BIWA 3MJEA 3IURA 2KB0A 4NYJQ 1Z6QA 4S0XA 3SNKA 3JTEA 4FW8A 2FWMX 1P4GA 5LQKA 4X65B 3MERA 1NDUA 3N8KA 3MBOA 1G0NA 2ZIWB 1YK1A 4DV7B 4MINA 4RGBA 4RXMA 1PR4A 5FUYA 2PLAA 3STWA 3S8EA 1HEUA 2Z4RA 1Q1AA 2ZITA 1RHMA 4URXR 3E8XA 4I6GA 1LXCA 3FG9A 4CNQA 1KP9A 4TX1A 1BW9B 3A4YA 2M1ZA 4EEZA 1EP2B 1Z68A 2YVKA 4LZJA 4DV4B 1O9BA 3KQWA 4KMSA 5E1DA 3L7OA 2FV8A 3ITDA 3AEYA 4BATA 3DBIA 3LF1A 3UPTA 3P9NA 1VB3A 2N9UA 3CH5A 4KMOA 2Y1EA 3WLHA 5DYNA 4YP9A 1U7XA 1LVHA 4IJVA 3UJ8A 3IEMA 3KQMA 3PRJA 4BNYA 2RB4A 4G97A 3BXPA 4ILEA 1VSTA 5LBIA 1S8FA 4NTZA 4CN9A 4IRMA 4M1MA 1R5BA 4NENA 4Y6SA 2EHJA 3A37A 5AW8A 1VIAA 3FOEC 1EB8A 3CNOA 3FMPB 3ZYZA 3QKRA 5ADWA 2XZOA 1ZD5A 5AHWA 3U80A 2P9TA 1FP2A 3ICCA 1PTJA 4Z8XA 4HDCA 5BSTA 4QODA 4AJ4A 5BPHA 2D6FA 1H0HA 3HKCB 2CJYA 5C8YA 1I10A 3FTEA 2DB3A 1NBME 3I64A 4E1BA 4RD4A 5ALGA 4C7BA 4DSZA 1QCZA 2GARA 3MLAA 1O0SA 3U4QB 2EZUA 2ZRIA 1X8LA 2VOJA 1J21A 1Q1NA 1W2GA 1O6BA 1XVAA 2GZHA 2R3SA 3ADOA 3QWHA 1D1TA 2GD2A 1NHWA 2XKBA 1W4ZA 3CLVA 4P35A 4L4ZA 4AJOA 2BTEA 3DUFB 4RC9A 4WINA 1FXWA 4LI3X 1TYBE 3ZX4A 3D81A 4KKXB 1BMFD 1N6LA 2HU5A 4LSWA 2NTJA 3EEIA 5CVDA 2Q07A 4X7RA 4D9NA 2RBGA 3RVQA 3C3JA 3AETA 3EQ7A 3WKCA 2Y1XA 3DWFA 1WSWA 4YPOA 1U99A 2D2FA 4DEVA 3FTNA 3L0BA 4RHCA 1XF1A 3MCVA 1YQQA 4UUOA 1EGHA 3C24A 3TPCA 3RK4A 1G42A 1YUBA 4YASA 4F1KA 5SZHB 4LY0A 4LXGA 4NNOA 1IZ9A 3ZCVA 4C4AA 3WBBA 4ALKA 1S2GA 5BR8B 3TZKA 4ED9A 2OBNA 2WJAA 4CDNA 3BIFA 3RC8A 1R50A 1DJLA 3FZGA 4ZO4A 4UCWA 1BIFA 2MJLA 2ZUTA 2G04A 3VC2A 4AS1A 1MFZA 4QPDA 1U65A 1L4HA 2IZ1A 3JYNA 5ER6A 5EEHA 5SY9A 1N2EA 3ROPA 3E4DA 3UWKA 4B44A 3SXUA 4DNOA 1U0EA 3OQ6A 1UZUA 2DBYA 1UXGA 2Q3FA 2VF5X 1BQ4A 1CDEA 1Z4PX 3NHLA 4F2HA 1G63A 4OLJA 1EUQA 3WQQA 3HYNA 1QK4A 3IULA 3W5IA 4J1SA 1T3TA 1AN0A 2JLQA 3RF7A 3VVCA 2TYSB 1ZK0A 1SUBA 4UHHA 1YVDA 1L5VA 2BHSA 4Q1VA 5F2OA 4ZOBA 3ZWNA 2YIVX 3PPIA 5J2UA 4HPJB 3N5CA 2MINB 1S1CA 1K3FA 2IYAA 4R01A 2WIKA 1ZH0A 1IZ8A 4NBUA 4CKXA 2O8FA 3K96A 2BT4A 1BTOA 5KC9A 3L6CA 1KFBB 4LI0A 5BV0A 2W2PA 2HRZA 2X76A 4YGXB 4L28A 4QAJA 2TS1A 4R1TA 2X8LA 3AHGA 1F12A 3R41A 3EGXB 1N6IA 3QOFA 2UVPA 3RVJA 3SF0A 3N2GB 2AL7A 2FPLA 1E2DA 2VA9A 1TLLA 1KJQA 3PD7A 5ALZA 1SIUA 5HKAA 5IDYA 1Z7YA 3H17A 1NRWA 1SCUB 2E4WA 1UP6A 2Q62A 2CVQA 3B8EA 3DLCA 1JEEA 1F48A 3FHOA 4FKBA 3RODA 3UO8B 1VL6A 1L3CA 1XQWA 3EIFA 4ENTA 1GEGA 4OMFG 4FOTA 3LVBA 4IJQA 2P6RA 2VPIA 2D59A 4YAKA 2XUPA 1G4UR 3DEHA 5IJAA 4YV2A 4MAFA 3AQIA 2E5LB 4Q7MB 3OQIB 1Y1QA 5LYJA 1TF2A 3U7RA 2B4KA 4YUAA 1HT2E 3LC7O 1IJBA 3EOAI 3MJSA 1OHHA 3OZSA 5AI8A 1OWLA 2JAOA 3PENA 1PYDA 3H8JA 2IXTA 2OM6A 4DB4A 2B61A 5ALLA 3GEBA 3NI2A 1P3Y1 1XQ6A 2DLDA 4U8GA 1GD1O 4HNHA 4XD7A 5CG1A 4BYGA 1KY2A 3E1GA 4QULA 2CDRA 4BECA 3I83A 2ZJZA 1THZA 1YU6A 1T0BA 1WV0A 3KEMA 4XSGA 1Z7WA 1LQ2A 1VMDA 2ZOSA 1Z3IX 1JDZA 4JJAA 5CNMA 3UKDA 1LTKA 1KEEB 1VG1A 2JCXA 1DCKA 1RRGA 2QN6A 4XQ9A 4LRQA 3EULA 3KB8A 1T0UA 2QTMA 1LY1A 5PNTA 2OP0A 2WVHA 3KDSE 1MO6A 3K35A 2B82A 2MYUA 1ZNXA 3WNCA 1KI6A 2A0UA 4XDYA 2WM9B 2VJAA 3VFDA 5AM4A 3ZE9A 4EHIA 4EPVA 1TEVA 2C5FA 3THXA 3PCXA 2PPLA 1UWCA 3A05A 1ZOIA 5HPYB 1UXOA 1FDUA 3QTBA 1A9PA 1TTPB 2NXCA 2Q4TA 1W85A 2B83A 2HFJA 3GRFA 1QANA 1R0XA 2EEZA 3OOHA 3V4LA 4DQ0A 1POXA 3T3PB 6YASA 1TC1A 1DV2A 4DBLC 4BE9A 1JILA 2IPLA 4BP9A 3KSUA 3HU1A 4JYBA 3W5VA 1QAMA 3COWA 3N07A 3ZE6A 1KSFX 4J16A 1N7HA 3P2EA 1JYEA 4LSMA 3D3NA 3P45A 4LWZA 5TY0A 2ABWA 2FSVA 4PO3X 2GAFA 5GPBA 1F7UA 4WA8A 5BYAA 5CYPA 2O3TA 2XDAA 2C4WA 3OJOA 5AXBA 2OCLA 3EIUA 1JYSA 4CR6A 4KQWA 3MMZA 4ENQA 1OT3A 1VHQA 4IIXA 5ARCA 3RAGA 1M54A 3NBAA 1KKMA 5LM3A 2EBHX 2ZTMA 1YQGA 2QVZX 1MPTA 3QWFA 1W0KD 4WXRA 2Q3HA 3CUKA 4L4UA 4RKQA 1FDOA 2Z4SA 4IEFB 1YDFA 4OGKA 1DADA 4QBHA 1NVKA 4DRZA 1WDLA 1M1YA 3QMMA 1U28A 4IJUA 5H82A 4P53A 2FPGA 4MVJE 4CETA 1GCUA 2BFEB 2IYXA 3N76A 1QHGA 2YIMA 1LZKA 3A1SA 4MUBA 5I8PA 4UTXA 3U3OA 4BNHA 5G1NA 3RR2A 3E7FA 1JQ3A 3ZHSA 3FSRA 4H4CA 3PXDA 4KQIA 4OU5A 3ER9A 3VH2A 1ZHOA 1C0EA 2GEJA 2CUTA 4YQEA 5IDXA 2FQQA 4AMZA 1WKBA 2W7TA 4Z2AA 2RI6A 3ZGYA 4B09A 4RKFA 1AGYA 4D4HA 1QF9A 5K4AA 4E21A 1OB2A 2LD4A 4HDOB 4MI9A 4GC5A 5EERA 4UTNA 1KMQA 1U3DA 4ADSG 3C5EA 3GU3A 3KCQA 1KEZA 3IUYA 3WGHA 4JQCA 4M9CA 1W1UA 4OOEA 3RT9A 5AOCA 2H1OA 4I46A 1VXOA 3EODA 3BSWA 1IZYA 3E0QA 1RADA 4UQOA 1WPXA 2PQ0A 2FX2A 1K6XA 2YYZA 1YKGA 3EG5A 2F8LA 3F6SA 3I8SA 3PJGA 4KYTA 4D8TA 3B5JA 5KZMB 2B20A 3E0XA 2H59A 1A95A 3F5MA 4B85A 2BIFA 5EIOA 1RXIA 3V8QA 3OMLA 1NFQA 5EL0A 3D4NA 3QV2A 3VAZA 2A0KA 2AB0A 4KLCA 4JXXA 3IP6A 1R9NA 1GEEA 4MJ7A 4Y9SA 5BNTA 1WW2A 3PTAA 1ZLYA 4U63A 1YRYE 5FPHA 3W9YA 5EJEA 3EXHB 1JS1X 1ZXBA 2RHLA 4RZQA 2A57A 2INGX 5A4KA 3P0FA 3AJ8A 4YMGA 2J3KA 4PFJA 4X24A 4EF4A 4XARA 1XTVA 3OEEA 4P7BA 4KV9A 3NT4A 5FQNA 5JH7F 4DA4A 3NYQA 4D41A 5ELXA 5KTNA 2FMTA 1VG9B 3M6VA 2DQYA 2X5KO 3LLUA 3OPYI 4U2DA 5AMXA 5FOTA 2AN1A 1EM8B 4RK4A 3WYDA 3GLIA 3LLCA 4XKJA 4YXFA 4TXHA 3W4JA 4F9FA 1N7JA 1XBTA 2JKYA 7MDHA 4MA0A 1ZVKA 1KWKA 1Y1LA 3SDBA 1UWLA 2R2AA 3U4MA 4R71A 2HJRA 2OGUA 1FQKA 4KAXA 3ZHRA 1Z6PA 5I9LA 5JECA 1J2EA 4B8ZA 3KV3O 2FQ1A 2OXIA 2XVXA 3NAGA 4JXZA 1S96A 5NLLA 3Q1LA 5HQJA 1NQ5A 4JI6B 2SECE 2OPHA 1GU0A 4F6CA 5LUAA 3I5XA 4FD3A 3GDOA 4KNYA 1JLMA 4NICA 2FTKE 5HCUA 1U1IA 5C5EA 2HIGA 4UBIA 1YA8A 3D31A 3N2ZB 3MWYW 2GHRA 3T35A 2JHAA 4IH1A 5E2IA 1PAUA 4EGQA 4C0WA 3R6GA 1XPRA 5CB8A 2XECA 1P4JA 4TV9F 2C2XA 1W25A 3SY8A 3FUUA 3TLMA 1KDZA 3WL4A 1N5KA 4W82A 3ZK8A 1BS1A 4UQPA 4P8RA 1TKCA 1MNAA 1B1CA 2IEYA 3ZDQA 1JEDA 5FFMA 2EHDA 2O2IA 3VDNB 4MCIA 5DM0A 1EFKA 4QBTA 4JP1A 3KKZA 4GM4A 1JHPA 3B5EA 4I1YA 1N2ZA 1KY3A 3KT0A 3H8WA 5FBZA 1QTNA 4L5YA 3UG7A 1U0NA 3KU1A 1MAVA 1T2AA 4JAVC 2C4NA 3AVWA 3ICOA 3VNRA 5JAHA 1NSTA 4I4TA 3I9LA 3TGWA 1TAGA 4KG7A 4B2LA 3E2PA 4GKBA 3TZBA 1WD7A 1ZNQO 2QTHA 1V6CA 4GLLA 1QOPB 4NCNA 4N3CA 4PC2A 2JFUA 5JCPA 2UUPA 1WXXA 4QRDA 5ITWA 2E37A 5CD9A 2C2HA 1S3SA 3I45A 4GYYA 3L0PA 4DR4B 3LC1O 4N0PA 1GR0A 4XDZA 3WGLA 3GLQA 1PZEA 1ZXXA 1QVWA 1QYIA 5M7EA 4MWSA 2NIPA 3KLNA 3EFOA 1XZEA 4LBVA 4OHUA 1C41A 2FMHA 3P9RA 2P5UA 1Z34A 3IR7A 2VHTA 4M36A 4F46A 2JAXA 2TMGA 2PZLA 5L3SA 3FR7A 2PBZA 5C8DA 4ZOAA 4U7PB 1UFKA 2W00A 2W70A 1V26A 1W5AA 4NBSA 1YDGA 4LJYA 1HFEL 2RHDA 1Q21A 4QHTA 1NW7A 4ZA2A 2VQDA 5F1YA 1ZN9A 4DUPA 1RWWA 4ZAGA 3DEFA 4N8DA 2ADOA 5E4TA 1X1EA 3P4UA 4A91A 1E3LA 1UQUA 1ZK1A 2RGWA 3T7IA 4AUNA 4KIFA 4ENUA 3EUAA 4NBRA 1TZMA 3JV7A 2A0FA 1D4AA 2CNNA 1D4ZA 2I6FA 2NVUB 3RSSA 4JJZA 3O2NA 2FN9A 1CP3A 2HBQA 1E1NA 1XELA 1U2DA 2IQIA 2PY6A 5D3KA 4ZQIA 3VUEA 1B41A 1S1MA 3QUSA 1J22A 1DAGA 4HLUC 4Y98A 3RTDA 3UN1A 3FJYA 4Q21A 1XZHA 3CB4A 3CR8A 4WBNB 2O0JA 3ABIA 4PLZA 2HJSA 3WBFA 4LRYA 4NU0A 2WTNA 4FGZA 4K6MA 1XCLA 1BCRA 3PYXA 4A16A 1CERA 4G0ZA 3C6BA 1KWGA 4B35A 2X15A 1NDHA 4HB0A 3KOXA 3WK6A 1C2TA 5EJIA 4Q7EA 1Y5RA 1J2TA 1N2GA 2WF8A 3JYPA 1WM1A 4UU1A 5CJJA 4HBZA 1I3NA 1P2VA 1JSLA 4N3GA 1X2BA 1YASA 3D1JA 4GOKA 4PNPA 5LP6F 3HBLA 4HG2A 3OJFA 1T0HB 4IWNA 2UZ0A 1A9QA 2AVNA 3CYFA 4IIJF 4N12A 4NI5A 3VZQA 3D8UA 3S2GA 4KITB 2DWQA 1WSAA 3BVPA 4IZOA 4Y30A 3PFNA 4HWSA 2P1ZA 3Q8KA 3ZWYA 3SXPA 4D9BA 4E88A 1IN1A 1PZFA 2FRDC 1WHTB 3SZRA 2DFTA 1V3QE 1BZYA 1E9FA 5EWJA 3LQ1A 2OCAA 2BFAA 1MEEA 3FI9A 4IKPA 5CH3A 1ZD2P 4RJJA 1YL6A 4RD1A 5DRTA 3T5PA 2QK4A 5HZGA 1BFUA 3QLTA 4BKQA 2P6PA 1N5JA 5ES3A 3WGQA 1FDVA 2REXB 4Q19A 4W99A 1MJGA 1EAMA 2QLFA 2LTAA 2QRLA 3DV9A 2QXYA 4YRTA 4TL9A 3JQGB 4H15A 2CMDA 2D5BA 1TD9A 3A28A 3C1UA 4JBNA 4NK5A 3UAZA 4CL3A 4HI0E 5DI3A 3ZHCA 5HXAA 3TGLA 4HRYA 1Z75A 1U81A 1FNNA 1U0JA 5CXUA 4YBZA 5JSUA 1Z74A 2ZIVB 1KO1A 1KORA 4D9FA 1JKJA 4JS0A 1QKJA 1M34A 3U7GA 3L3BA 1VDMA 5FDFA 3AK4A 3ZW7A 3VR4D 3CF0A 5CVTA 1X42A 3GCGA 3AF0A 2WAAA 1X3SA 2A33A 1ZR2A 5LJIA 1ARZA 2A5DA 2WTAA 4S0ZA 4M1KA 1KZ4A 1ZW1A 3CLRC 1MLDA 2O0HA 3EPRA 2JF0A 2PVSA 1UKBA 3G3EA 4JJ6A 1EFVB 1XPOA 1UBNA 4HQ6A 1WLYA 1EXWA 2VYQA 4KOAA 2F7SA 1N2OA 2XZLA 3FTPA 4Y2SA 1FRFS 1NLZA 2AKYA 2Q5JA 2ZJYA 1LPNA 1T3ZA 1G8MA 3ZE7A 1SC3A 1KEWA 1Y3BE 3QPBA 3TNFA 4ER5A 1N9GA 1ST2A 4V2UA 4UCFA 5EIBD 5H83A 3AUAA 5HILA 2IL1A 3VNQA 3ZJYA 4YAFA 4AZ3B 4I4CA 2JLYA 4NU6A 4FE4A 4OK6A 3BWEA 3FZYA 1DCTA 3ZGVA 4EO9A 4JT2A 5JHHB 4FBLA 1K2WA 3KS9A 3OEHA 4QU8A 3K9NA 1OU0A 4ZAVA 1XD9A 1XEFA 1FUUA 1KYIA 3PA6A 4RTPA 4MRNA 4BQIA 1C9MA 4HPXB 4HX5A 2QL5A 4MP6A 4JL5A 4BFYA 4BC1A 3RBXA 1X77A 4HTFA 4IKEA 2FWJA 3WJAA 1JBKA 2PNFA 4YPVA 4J2HA 1ZA1A 3SC3A 5HIIA 1UBHS 5TEVA 4B46A 4DBLE 1T9DA 2O3UA 2Y2UA 3CY6A 3OJWA 3OSUA 3KR9A 4Q34A 3Q7PA 4Z8YA 4OYRA 5FNVB 1DFHA 2HF8A 3EZ9A 3TW8A 5JCXA 5JS7A 4R3WA 1IDN1 1TQ8A 5J2TB 1IQUA 1G8PA 2IU4A 3UH0A 2ZBGA 2GN2A 1JDPA 1W5TA 4J1TA 5I7OA 2AC7A 2LBPA 4GR5A 4R98A 1ENYA 2J09A 5EZYB 5FULA 1KDVA 4EJSC 5K8VA 3R9KA 2YJNA 1QHXA 4LJAA 3UB2A 2XKKA 1CIPA 3DHNA 1I6LA 3N58A 2G1JA 4WA7A 3WADA 2ZUDA 1XRJA 3FX2A 3MINB 4WESB 3PNBA 3EIXA 3CRNA 5T8KC 4DRXB 1XTBA 4ESHA 4DV6B 3HP1A 3ZK7A 3HEMA 1HEIA 1FYDA 4BO7A 1PF7E 4INJA 5C32A 2OQ2A 1DX6A 4INOA 3TIGA 3TNDA 2DHQA 3GFGA 3NR2A 4L5CA 5BN5B 5TNXA 4I6JA 5BYJA 3K5WA 4H3HB 3DWGA 5KVVA 4RWEA 2ZT5A 2VOEA 3HBFA 3WZ2A 1MO5A 3DVRX 2J6IA 4QYIA 3QHQA 1E77A 3GO4A 4N9QA 5DTRA 1SU4A 2ZWIA 2JAUA 3N8GA 3KEFA 4DLTA 5BNFA 5CITA 2OHHA 1SVMA 2ZJAA 4FDUA 4CQLA 4TL6A 3HZHA 3CRRA 4BDSA 3CKLA 1YXMA 4GSKA 4BO3A 1NUPA 1GFWA 1Y3DE 2EZ9A 1FYXA 2CHEA 3VR4H 2J3QA 3WIEA 4ZI2A 3AEKA 4FVTA 5JG7A 1EGMB 3L93A 2YY6A 1T1IA 2ZZNA 1GJRA 4QBGB 3ZHVA 9ABPA 1M67A 3LL4A 2OCGA 1A98A 2NV6A 2VWGA 4GI2A 3RIHA 4U39A 4D4MA 4DF3A 2XQVA 1AX9A 1N34B 3OIWA 3CPJB 3L1KA 3TNLA 2PMCA 2I71A 3NOQA 4IVNA 1NY5A 4G07A 4PAOA 4ZI5A 3F7TA 1Z4LA 3M6WA 1UP4A 1BU8A