The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
114
|
sequence length |
310
|
structure length |
310
|
Chain Sequence |
SAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFSPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIRDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMKQWLDKHTTTE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the Saccharomyces cerevisiae monoglyceride lipase Yju3p.
pubmed doi rcsb |
source organism |
Saccharomyces cerevisiae (strain atcc 204508 / s288c)
|
molecule tags |
Hydrolase
|
molecule keywords |
Monoglyceride lipase
|
total genus |
114
|
structure length |
310
|
sequence length |
310
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
3.1.1.23: Acylglycerol lipase. |
pdb deposition date | 2015-05-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12146 | Hydrolase_4 | Serine aminopeptidase, S33 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |