1UC5B

Structure of diol dehydratase complexed with (r)-1,2-propanediol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural rationalization for the lack of stereospecificity in coenzyme B12-dependent diol dehydratase
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
molecule keywords diol dehydrase alpha subunit
total genus 60
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1uc5B00
1UC5B 1UC4B 1NBWB 1DIOB 2D0OB 1EEXB 5D5QA 3WB2A 1IWBB 3AUJB 3WB0A 3WB1A 2D0PB 5D5PA 3BRCA 1IWPB 1EGVB 1MMFB 1EGMB
chains in the Genus database with same CATH superfamily
2QJFA 2WUDA 1X42A 3G2OA 3LF2A 1NAIA 4WLOA 2P5TB 4IDGA 4PG7A 1IWBB 4JBWA 3A9TA 3GLSA 3KAJA 4OLAA 4U7DA 3TR0A 2CJWA 3IDFA 1MRZA 2YN0A 4W9NC 1FNNA 3NBKA 2PYIA 2W4QA 4P93A 5HCUA 4BMCA 3V8RA 3JAWA 1NI4A 1PL7A 2WB2A 4EG6A 2Y1OA 2Z8YM 1UKYA 1JEQA 2XDAA 4HYQA 4B8YA 3AVQA 3CNHA 5KHAA 4DNOA 5KQSA 2CMHA 2RC6A 1EFTA 1UP6A 2Z8YA 3AKCA 2GAAA 4J9VA 5FB3A 3WGGA 3KB2A 2GAJA 2HN9A 2JJ2A 1V16A 1DAKA 4B5LA 3ZBUA 1O3YA 1E1DA 2GVZC 2YUIA 3RG2A 4UCFA 5LR6A 1NSYA 1ZN8A 3DXZA 1ODSA 3GPBA 3IP8A 1C0PA 5BMVA 1WD7A 4C5CA 5JAHA 1QX3A 1SQ6A 2ZBFA 3B9BA 5J40A 1T1RA 1LUAA 3JU3A 3HQ4O 3DEHA 1L8OA 4EYQA 4UBOA 5EZYB 4D4MA 4EY8A 4ZZ2A 4EHFA 4DR2B 2CJYA 4XJSA 4AP6A 1SOVA 1DC3A 4EL5A 1IM2A 2JFWA 3B1JA 4FNGA 1VHDA 1L5NA 2Q6VA 2J3KA 4QGFA 2GZAA 2Z04A 2I91A 3H8SA 4RCYA 9LDTA 5CITA 3BQ9A 2EKPA 4KO3S 1GT6A 1I6KA 3R9KA 4AKIA 1U9YA 1KU0A 2XYGA 1ABEA 4EB0A 2VZ8A 4DXDA 5A1JA 4P4SA 3I2HA 1G19A 1USKA 2Q2OA 3N53A 5ENVA 2Q1SA 2V65A 1XWWA 1H85A 2B7CA 3A9SA 4B9EA 1OZHA 4B82A 3RRMA 1LNSA 2I7TA 3Q8WA 1EVQA 5L3SB 1B23P 2GI4A 3S55A 2DJ5A 4MHOA 3HJAA 3SOPA 2CFTA 4QJ3A 1UMBA 1IRIA 4QOEA 1OXKB 3DJYA 1R6TA 3PHHA 3SHOA 1MEEA 1U28C 2VPXA 5HPYB 4NP6A 5LMCA 1G3RA 2OZVA 3WLJA 3EXIB 1S01A 5B3LA 2AOVA 1SCQA 1SEVA 4RKYA 5KWSA 2GAIA 2DJIA 3FPHA 4PLFA 4EGFA 2VVTA 3FMFA 3MCVA 1I80A 3HUFA 2GYVA 2KBFA 2BPOA 3LXUX 3Q0IA 5TQ2B 4EYGA 3HFSA 4G1VA 5IDVA 4CFZA 5JS7A 4HNTA 1EFRD 3HA3A 2YN4A 5TNXA 2Y1DA 3RNLA 3WLTA 2B1GA 3UOWA 5JC8A 3T3NA 1E3EA 2F00A 2Z5LA 3KU4A 5BXQC 3CZMA 2V5AA 3MW8A 1UT6A 2HJVA 3E70C 4C1NA 4D9FA 1VIDA 4CIYA 3T41A 3RK1A 1NR5A 5FUYA 2W6MA 1CTQA 2Y93A 4JBHA 4DFDA 5BV1A 3DZCA 2W83A 2EDAA 3NHRA 1KK2A 1SA0B 3P9IA 4DQUA 4Z1OA 2HWXA 3E5HA 1PSDA 5E3IA 3OTQA 1KMQA 4Q47A 1A7UA 1V5WA 2DCUA 1UPAA 1KMIY 2DMRA 1VCIA 2ZIGA 2A0WA 2J32A 2HIHA 2PH7A 3OZGA 5ALMA 3TW8A 4D9BA 2O8EA 2Q0QA 1M54A 1OWMA 2PYDA 2XUOA 3DB2A 3FPFA 3K0FB 3OCXA 3OI7A 3Q4GA 2C9CA 2AE2A 3FWKA 4UHJA 1WAMA 2AN1A 4ZA2A 3TRHA 4L8FA 4LZJA 4YA6A 1NNLA 2YWHA 3BRSA 4G5FA 2RAUA 4HDRA 2FSGA 2DB3A 2Y27A 1SXIA 1Z38A 2IXEA 2OHXA 4S1VA 1SKUA 1LSJA 1SBQA 2JAXA 3T7SA 3TQCA 3VPAA 2G6BA 1JH9A 3GT3A 4TQGA 3RNOA 4OY3A 3ERCA 2DBZA 2PH3A 1ZIOA 3G8BA 3PE3A 2C2HA 5EQFA 5HBRA 5DOZA 4QIHA 1XL0A 4UE6A 3RVPA 2HIGA 4FLEA 4WBSA 5A3VA 4IKEA 3CF4G 1SNYA 1XFAA 3LVQE 3RHZA 5ALPA 1AUOA 4J3JA 4JUBA 4KU4A 4Y2PA 4OI0A 3ZV4A 1R6UA 4R2MA 3WDSA 3HMQA 2BTQA 1WL8A 2UVDA 4PGHA 5F64A 5K6RA 1WBJB 3WZ2A 5JYEA 3KDAA 1BSVA 4WXYB 4G41A 3RR2A 1IQRA 2GCIA 5DGCA 4Z7QB 1XAJA 1CS4C 4HF7A 1CEYA 1P74A 2IZZA 3PUXA 2PZBA 4EO4A 4MPRA 1C7ZA 4X7PA 3JZFA 1J06A 2H59A 4EW3A 1N78A 2YZMA 3U09A 1DIHA 2I8AA 1EXWA 2DECA 3AR6A 1AN9A 1JGTA 3EPPA 4UFPA 3RAEC 1PJRA 4H4EA 2C00A 2HF9A 3KU1A 2FG5A 4NYJQ 5JI3E 5M04A 4DCGA 1TA0A 2Q0SA 2V7GA 4B4KA 4ER7A 1JPNA 4Q4JB 2V9ZA 3MMPA 2NYRA 5ICMA 2PWBA 2WILA 3H5IA 4G9EA 1Y1KE 4FI3F 1AX9A 3L0PA 4KLNA 5B3JA 5CFOA 5AW4A 4PIPA 5ERXA 2NXCA 4DUYB 2FPMA 1UT8A 3AHEA 3G0BA 4ITVA 4ZI7B 5AUOB 3KR2A 2CBZA 2XADA 3A1CA 1A2QA 1PTJA 3F2VA 3K0AA 3NORA 1JHXA 3DHEA 3S4YA 1FYEA 4IV8A 5A0VA 4JK3A 4BQIA 4JCOA 4LFBB 1YRAA 1OTXA 1OX6A 4DCVA 4YRFA 4D3SA 1E3MA 1CDDA 3H86A 1QHHB 1VLLA 4KQIA 2BVNA 5LXTF 4BNWA 4ETMA 4LTNA 1JAYA 4MWDA 1E0DA 2LV8A 4EFMA 3ZHQA 1PU2A 5FAKA 3B1FA 4IUDS 4IXDA 2FPXA 4TMZA 4WUTA 1I5OA 5JXIA 1TM5E 2YS7A 1XMVA 5BQOA 2ZREA 1T5TA 2IC5A 2BI7A 3I1YA 4J6EA 3L1JA 821PA 3EAGA 3U2QA 3M4XA 2IF0A 3C39A 4PGAA 5IT5A 4NE9A 1QNFA 3NRBA 4M55A 1VKHA 1BMDA 4TVKA 2FRXA 1Q44A 2DRIA 3L1KA 5AVSA 2BZ1A 1JHUA 1AC5A 3KYCA 4TXJA 1GLNA 4Y6PA 3TEFA 1NQVA 4OBEA 3NBAA 1LPPA 4YTEA 5AKLA 1WB5A 4XQGA 2ZJ0A 2JAPA 2A7QA 3GD5A 3IGFA 2VBGA 4JENA 4KRYA 3BULA 5EIEA 2FW9A 5K0FA 1W4BA 5J2UB 3CF0A 3A37A 1F5NA 3NCHA 3THXB 1RM3A 5B3JC 1GG9A 1KRWA 1JQDA 2WHRA 4U3JA 5DLEA 2V9PA 3WDKA 4OUDB 5THQA 1EUQA 5EIAA 4ZK2A 3F3SA 4UTXA 3FOWA 4YCNA 1G3MA 1JBQA 1D7AA 1N5JA 2OZLA 1ZUD1 4NY1A 4QGBA 2PSEA 3WLLA 1R6AA 1E20A 4IOMA 1S7CA 1QIJA 2R9VA 1KTVA 3FPGA 4K9OA 4KTTE 2UVQA 4EBBA 2J33A 1EX7A 2R6R1 2FPLA 3H16A 3H1TA 4MGHA 5A7FA 4PCAA 2A33A 2CVHA 2I7CA 5T4BA 4DUZB 4YCBA 1SK9A 2GBPA 2ZVDA 4YCCA 2HHLA 3MBIA 3O1IC 4K8OA 2VOEA 2O2GA 3PYMA 4O4JA 1Y3IA 3OOEA 5DYNA 4RL6A 1NJ2A 3RUCA 3I2JA 1RYFA 3T5CA 3UNXA 1XLUA 3HBLA 1GPAA 2H3HA 2QPOA 1NDUA 4EQ6B 3N8DA 2TMKA 4UAJA 2Q4BA 3UT5B 2G1KA 4JLBA 3WL4A 5AI6A 4KE6A 1FUYB 4GKBA 1WTAA 1M6VB 1QX4A 3QHPA 4ZHQF 1MVNA 1CJTC 2I7XA 4HVCA 4D7AA 2D5BA 1YK0A 4P2BA 4BC1A 3TUZC 5B7PA 3KTDA 1EWTA 1IJBA 5AH0A 4RZIA 1Q74A 2XVAA 3BXGA 6REQB 1R4AA 2RJOA 3KZMA 1ZUHA 2PS1A 4Y1RB 3CZ4A 2B69A 3I4CA 2GPSA 1QP8A 3MAGA 4NEGA 1SR8A 3KSUA 3EUFA 5KVSA 2OV3A 4O4IA 3QSYA 4BFWA 3O0DA 4E4RA 4PC1A 2WU0A 4S2UA 4D82A 3PI6A 3WGTA 4XWGA 1C3LA 4V24A 2NWQA 2WINI 1NBMA 3O95A 2QMYA 4LOLA 4UJ3A 2I54A 3DT9A 3U48A 1UXGA 2AA3A 3UT5A 5KPDA 3RS3A 2Z08A 4I36A 2O0KA 1Q0HA 4G8DA 1JEDA 3N70A 4P54A 4QX6A 1OFTA 1PL0A 5EZ5A 1E4OA 2I7DA 2NV2B 5IBCA 3PTLA 2VTBB 1MEOA 2PO5A 3GA7A 4QYIA 3TQQA 3K1AA 5KOJA 2I2CA 1MHTA 1DIBA 2FTKE 4QICA 6REQA 2QR5A 4FU0A 3B6KA 4RHFA 3IVGA 3TOXA 1IWOA 4J1NA 1E4VA 1CUXA 1XD2B 2C5LA 2V7VA 3NFRA 2QU8A 5G1OA 2R6AA 1G21B 4UNRA 4S1WA 2RARA 2X5OA 3D3WB 2F4VB 1Z25A 2O5RA 1ZGZA 2C7RA 1QHSA 1WTCA 2DU8A 2WFLA 2IUSA 3I6QA 3MIIA 3PVCA 5AW2A 1L5RA 1MAWA 2BDEA 2JNWA 2X9LA 3B8HA 4MQ5A 4CMHA 2J3HA 2JPDA 4C1BA 4GMKA 1XZFA 3DWIA 1UWKA 1B16A 1JB1A 1Z68A 3FWNA 4CGYA 1RMYA 1Z45A 4BRWA 5MDHA 4JYAB 5C4GB 5ELXA 5C53B 4RPGA 2CJWB 3PX2A 4MRMA 3NHMA 4GUDA 4OFWA 13PKA 2BDTA 2JLQA 1N3YA 2CK3A 3M6AA 4BATA 4YT2A 1PLJA 1ATZA 4AIIA 1MOSA 5KTMA 3VVMA 1RKBA 5DBIA 4P83A 4DM4A 3NHYA 3NWEA 1LNQA 4GSYA 4N3BA 5BT8A 1JMKC 2WUWE 1OXVA 1DINA 2ORYA 4LG1A 3WWYA 5JATA 1PE0A 2YHUA 1L4LA 2UZ1B 3ND7A 4I14A 1WP4A 2JATA 3MEQA 5JS8A 5TMEA 2IHJA 4TXMA 1QG6A 2NXNA 1QH9A 1X2EA 4OGKA 5DHTA 4WA7A 4KR7A 1KJJA 4C20A 1QWSA 3C24A 4MR7A 1MPTA 5JZMA 2Z9CA 3QMPA 2AMFA 4F3KA 1J90A 1DQYA 3M4JA 1C3VA 1G4UR 1SU8A 2ZI5A 1XRQA 2CUKA 4OFXA 4R1MA 1VLQA 4BQFA 5KUTA 1I4OA 4PZEA 1X1BA 4NOMA 1WNFA 2D5CA 3AB3A 1I13A 3O1HB 3PFNA 2I4IA 4K81B 5DBOA 5DBGA 4EHJA 1L2TA 3LLCA 3AILA 1F0PA 1LLUA 1JHAA 2NSJA 3GFBA 2YC2C 3EGEA 3KJGA 5CLFA 3B2QA 4WA8A 3UK6A 4IWXA 1YBMA 1FQKA 2VZLA 3P0JA 4G36A 2B3DA 1KFBB 1QCYA 3C8UA 4RUKA 5KJFA 2XXBA 3SFVA 2X76A 2V74B 5L3SA 1BZYA 5IT9A 4WFIA 3EHEA 4NENB 3ONWA 2VKTA 3LHSA 2VPZA 1I51A 3TQTA 2ZIZA 2BEVB 1CQXA 4IL5A 3EXEB 5ALTA 5JT1A 1X6VA 2DWPA 5DI3B 2OO7A 1XDSA 3DQPA 4EMBA 5JXWA 2R751 2OXTA 4BEWA 1OFIA 5KPJA 2Z3VA 2XA2A 2O54A 3RF7A 4KKVA 4DMMA 3ICCA 2PX3A 2Q1YA 4CBVA 3ITNA 2HCJB 1KI3A 3PWZA 4KIWA 4ND1A 4BECA 2XYQA 4RK4A 5K8IA 2CFCA 2MSWA 4ZVOA 4D9JA 3ZWQA 3PUVA 2RGNA 1AG9A 1J25A 2XVZA 4U63A 4G0PA 3MS7A 1KEWA 2QRZA 4JXZA 4COKA 4O29A 4E5KA 2ZIXB 3BUSA 3U4GA 5KYTA 1JEYA 1UFRA 5HM8A 3SU8A 4L4SA 1VKZA 2L69A 2C2GA 3ANNA 3T3HA 4D8TA 1Y6GA 4QTXA 3DYVA 1B1AA 1UPTA 2QGFA 2WIFA 2Z56A 4R2KA 4UOQA 4AUKA 1O58A 1OF1A 4C4PA 2POCA 1SIWA 1JI0A 2X5KO 1K4MA 4URHA 1KZ9A 1KO8A 2JH9A 4Q4HA 4TVSA 4A27A 2BP7A 1FP1D 1B3BA 2QM7A 3PC7A 1ODKA 2P41A 2XGSA 3C5HA 4NBRA 3WNZA 4B40A 1USGA 3A27A 3MT8A 3NAGA 4H3KB 1JG3A 1R2QA 3NKFA 3PPYA 4PIVA 3LQFA 1ZONA 5E1DA 3VISA 3ZJYA 1G16A 1VMDA 1YS9A 3C3BA 2IITA 2JAOA 3QZUA 2G5GX 2HTFA 2W2KB 2JGMA 1FVOA 3BMCB 2Y92A 3QJGA 4IIJB 3REQA 1XCLA 4YLGA 3DEJA 3OOHA 4ZT4A 4AO6A 4F86A 5JJBA 2W6JA 1V2GA 3H17A 3PG5A 4MV8A 1B74A 1JSCA 1NLFA 3ES9A 4GVXA 4UD6A 3W04A 4E4TA 5CG2A 3EG9B 1JT2A 3RUEA 4A0QA 4Z7NB 5KC9A 5AKYA 4JV5B 3INYA 1X14A 4Q9JA 3OCWA 1Z2DA 3PNKA 5D87A 4RGQA 4BJ6A 1ZN2A 5KNCA 1W7AA 4H7KA 1L4UA 1Y8CA 4QXAA 2H11A 3W9BA 2C9YA 3NC0C 1DX9A 5LCXA 3HY4A 1F14A 3VR6H 1BVHA 4V0NA 4WBNA 3HB4X 1AY0A 3MPOA 1PWYE 1ZD4A 2H7CA 2V0NA 2XRZA 2WIAA 1UJMA 5IHPA 3P9NA 1T1IA 4DLYA 4F6CA 1F9AA 3MWFA 4NOJA 1CRQA 2C2MA 1H2HA 1VQ1A 2A57A 1YD7A 5CCXA 2R4QA 3WL3A 4MCAA 3VNVA 3OLWA 1JDJA 1F8UA 3ZVRA 4BCBA 1SHTX 2YVKA 4IDOA 1NM5C 4H3HB 4GX2A 4IQ8A 1Z36A 2AUNA 4NAHA 3TM4A 4DV7B 3MJEA 1ADGA 5DGXA 3EQ7A 1EE9A 5B6PA 2EQAA 1IHUA 1RXCA 2OAP1 2HWWA 1E9RA 3RYHA 1OX4A 3T8YA 3BXFA 2B4QA 2P6UA 3E9YA 3A1TA 4FCTA 1TQHA 4RTSA 1NW7A 4G4JA 1QZZA 3OF2A 1A50B 3QE3A 3RSFA 3P0IA 4URUR 1B3RA 4X7BA 1D8AA 1MJHA 3O03A 2D4AA 4UUPA 1LJLA 2WQ6A 2PNFA 5FA8A 3N07A 3W4KA 1ISSA 1OI4A 4X1IA 1NASA 1BCRA 4UMVA 1E0KA 1XUOA 4MUEA 4BDTA 1KYXA 3BA1A 4RHXA 1W47A 4XX0B 2X0DA 1XZAA 3AL2A 3LC1O 2PK3A 3WIVA 2R1UA 1USUA 3ORQA 5D85A 1P0FA 4DUGA 1KI8A 2EKLA 2J4FA 3ECCA 5ALNA 4WFKA 4G26A 1NMQA 3NC4A 4LYFA 3IUBA 3KSMA 4TV9A 1VLVA 3MOIA 3TOZA 1K8QA 4B3JA 2AFRA 3T1QA 2C9MA 4RADA 3U3DA 5LQRA 3PBKA 4OQEA 4WNAB 1H3EA 2C82A 3JPWA 4NS4A 1Z5NA 3FNBA 4F92B 4ZT2A 1T34A 3GT7A 2ID9A 4RKEA 3CKKA 1S8NA 4BU0A 4OF4A 3MC1A 3Q6IA 1P6UA 4IMIB 3OPNA 2EX1A 3UMCA 4J3NA 3WADA 2ZSUA 3T5MA 1MB4A 2P77A 1QS0B 3GVCA 1SM4A 3BGWA 4YHHB 2CDNA 4TL6A 2APJA 1L9KA 1Q1EA 1ONOA 2Q28A 3MB8A 3EOZA 3IDSA 1XJQA 3SIWA 5EJIA 2ZUFA 1U0HC 3BIWA 1Y42X 3DKVA 2I3ZA 4K1LA 5LD2C 2FKNA 1O03A 3FX2A 4B79A 3ED5A 5BWNA 2MIIA 4XQEA 2EWMA 3JTEA 3ZV7A 4DN6A 2AW3A 2RI6A 4Z0TA 1BHO1 4IIGA 5IUJC 2GSWA 2P9TA 1SUSA 2NTEA 2I2AA 4M3NA 1GGMA 2FZLA 1FPQA 2QTHA 2WLTA 4WCFA 4CG0A 4HK4A 4WESB 1Z3CA 1Q0LA 3BGOS 4PGMA 4KR2A 1KH2A 3LQRA 3NJ8A 3MSCA 4MAFA 1FW8A 1LJ8A 3LO8A 1KJNA 2BJVA 1SCNE 4OIFA 3KXPA 2ZBVA 1ZMXA 3IAM6 2L18A 2YC4C 3FPSA 3I9NA 3K9GA 2H2GA 3KTFA 3U7RA 3Q88A 4YMVA 4YPFA 5FLXA 4YLYA 4G37A 1AJEA 4MUAA 5COQA 2Z5VA 4IRUB 2VNIA 2G76A 3OO0A 4OEHA 1T6ZA 3AKYA 3W6UA 1SHJA 1SUFA 1GCOA 1DOAA 3GFGA 1FS5A 3WGMA 2BKXA 3O4FA 4W6QA 1SY7A 1DHRA 4ZIRA 1OCEA 2OFXA 4Y18A 2W6JD 4MUMA 4BP9A 4MLZA 3ADBA 5KOIA 1WEHA 1TW2A 4R6WA 3PHCA 3C3WA 3T4EA 2IY7A 1EFPB 1YQWA 4ZQHA 2R2GA 2F48A 4YC7A 2TMGA 3DAFA 2W2LA 4N0PA 2ZWOA 2YFKA 4A5OA 3F6EX 1Z29A 2WTXA 1O9BA 3CUVA 3E9NA 3L7LA 1CR6A 2HT6A 1HEYA 2Q9CA 4H4CA 4JH0A 2IYVA 1D6MA 3Q8LA 3FSRA 2D3WA 2EIXA 2EFYA 2GEJA 2YVUA 1ZLYA 5AIBA 1V11B 3CBQA 1PAUA 1PI3A 1I32A 1MOPA 2FUEA 1K7YA 1G9TA 3TLBA 4RIIA 2IP4A 4BVHA 2OHIA 4LUCA 2BF7A 4RTMA 3NVKI 2O8CB 1QG4A 3QWIA 1HDRA 3FZYA 4JDPA 5FBZA 4K6HA 1Q7EA 3CN9A 1HBJA 1LLFA 1RJEA 1XVAA 3QPCA 4HT3B 1GR1A 4XIYA 3WAKA 3ZVMA 2CHQA 4BGEA 2IL1A 4QLAA 5E38A 5KU7A 4A2PA 5KQMA 1U7PA 4EZBA 4QPNA 1XVUA 4ZKEA 3JQAA 3Q2OA 1XCOA 5JNRA 1FDSA 2PUEA 3T7RA 4UZFA 1JIVA 4RA6A 1IJKA 3UV3A 5ITWA 5IVIA 1BHSA 5FWXB 2XZLA 4KDCA 3GNTA 1PDVA 1URPA 4B3SB 2PGAA 2POQX 5ITZA 5CUQA 2VHJA 5HXAA 1VCMA 3PGLA 2HHJA 4Q39A 3SC4A 1DKRA 4CUZA 3KXIA 3EIWA 4WPGA 1NW4A 4AT1A 3BGSA 1IZZA 1SCUB 2J3EA 1SHKA 3W7AA 3BL8A 3RKSA 4RE5A 1JI3A 3AIIA 4NBLA 2IELA 4RQBA 221PA 4MRMB 2Y1XA 3NI2A 2H63A 1XQ9A 1FTSA 4IJ5A 5F3RA 3PNBA 1OH7A 4LF7B 2PS0A 3IPXA 2GDZA 3TAHA 4K40A 2Q7DA 1N34B 4LCJA 3LC0A 4AJOA 3NZEA 3JQAB 3ETLA 4AZWA 2L2QA 2GYYA 3OQVA 2EBWA 1XMJA 4X8HA 3U5ZB 1M74A 2WVJA 1SUAA 4X71A 3G2LA 4MRPA 3A3PA 3PI7A 3U80A 1GPWB 5AUQA 4YRPA 4RORA 4BNKA 4GKAA 1NHWA 3ESXA 4U2GA 3EDCA 4MWCA 4LHZA 3IXQA 1G20A 3N59A 5CLIA 1RBYA 3O75A 5DNCA 3ZYCA 1MHPA 4UD2A 1M72A 1YK1A 4ENUA 4HWSA 1Z33A 1D6SA 2OHHA 4XVQA 1ZR4A 3ROZA 3WAJA 2H31A 3NIFB 4B4OA 1QTIA 2G36A 4GRIA 5BWMA 3DBOB 2O7QA 5AJZA 3JAKA 4V03A 3WB1A 3FHTA 1E6MA 3ZIAA 4ZCRA 3G79A 3ILVA 4KQEA 4KIGA 3T1VA 1RU3A 1EX6A 1EVZA 2ZJZA 3JQBC 1NX9A 5FFFA 5IYZA 2BFCA 1Y8AA 2R1VA 4JKYA 3AX6A 3L0SA 1G1AA 2BHTA 4MTLA 3RS9A 4V1CA 1RJ9A 1A4RA 1XQVA 2QRLA 1KVQA 4G07A 4KR0A 4BLQA 4X1KB 3TBKA 1T5DX 2HQRA 3OJCA 4LMRA 4TSKA 1RKQA 1JDVA 3R9IA 2HQBA 3JYHA 4A0RA 2XCOA 3GAMA 2IXDA 2X86A 2JRLA 1IJEA 4NBNA 3CX3A 3EXEA 3SLRA 3FPCA 1FRQA 3DUWA 4Y0AA 1TEZA 3DTNA 1JIIA 5EMLA 3WRYC 4TUYB 3R23A 4YALA 1ST3A 2BLNA 4I4CA 4R83A 1ZKMA 1NW6A 1W5AA 3C7KA 4G89A 4NMLA 4Q3DA 4TMVA 4DA7A 1ESNA 1ZC4A 1VGQA 3VOTA 4YT8A 4LDNA 2GB4A 2FQYA 4L2IA 3CX6A 3H1GA 4GLFA 1U2GA 2QTAA 4LRXA 4CQMD 4XOIA 3H2GA 1P7ZA 4FFNA 4NXMB 2PVSA 4IS2A 3MCZA 2PGNA 1O6CA 3GK3A 3W79A 5BXYA 3A9UA 3H84A 3OH8A 3RLIA 1P5FA 3TOVA 1PGPA 3H5LA 4RVGA 5H16A 1IN5A 3GT0A 4A8TA 1K8YB 4O4JF 3HYCA 4ZVRA 2GARA 3BRWA 4KE9A 4EATA 3AVWA 3VR5A 1NLMA 4JJ8A 4RVCA 1II0A 2H7XA 2WWTA 3ZCPA 1O0SA 4BFVA 3UT0A 1YMUA 2NVUB 5CT4A 1ORHA 2AD1A 2IYLD 2P30A 3K70D 2C9DA 2Z57A 3DE3X 4DKXA 2CXHA 2H9AA 3FMIA 2AL7A 1NA5A 2X3UA 3BQNB 5A6SB 3QWAA 1KETA 3ZCTA 9ATCA 1NU8A 5HR5A 3OQNA 1X7ZA 1L4KA 1YBFA 4EKYA 3OIGA 5AI9A 5AJWA 1R5OA 5HWSA 1E4YA 5KEIA 1GTVA 5ARBA 3Q5DA 3LXXA 4HNQA 2VUSA 4C7KA 3R9XB 2ID4A 5DIZA 4JI6B 4CM8A 1NAHA 1V45E 1IDOA 4ALLA 3SD7A 1RKXA 3B1WA 5ADHA 3AFMA 3PNOA 8ABPA 2ZJFA 2IYRA 3JR7A 3QG5A 4MOWA 3WJ2A 4RFVA 4Q9IA 5JO9A 4PSKA 4E5MA 2VH5R 1FXSA 1YH3A 1KVUA 3ROEA 1YKSA 2DBQA 2OLEA 3P9CA 1YXMA 3KCNA 4FDVA 4TWZA 5AKEA 3RT9A 2FXIA 3ZE0B 5BNTA 4M9UA 3DV0B 3O1LA 5IUNC 1JXAA 1CY4A 5T8KA 1Y5MA 2A5LA 3DC2A 1O96A 2HV9A 4PV7A 2ZUBA 2C7QA 2FHPA 4LVNA 5B5SA 3R3HA 2DERA 1U9ZA 2I7VA 2AJ8A 4R2WA 2AJDA 5JDCC 1PLLA 5AYVA 4OQFA 4EKNB 3KELA 4MGKR 3DFKA 1H9BA 1IG3A 3K8YA 4IOLA 1OBOA 4BVJA 4V0OA 4F5EA 4CV0A 3EK2A 1XZBA 5GVSA 1EHYA 1WLYA 4J0DA 4XDHA 2WZDA 1OGJA 4H6PA 1RVDA 1N8TA 2KJQA 2WFMA 4W5JA 5G1NA 5GP1A 3TX6A 4JB8A 4OUKX 3A36A 4MR8A 1ZZGA 4QUJA 5H59A 3V32A 5C8XA 4RY0A 3TTYA 1YDWA 2Q3HA 3BE8A 2YCBA 3UXMA 1IK6A 1DPGA 2ODNA 5A05A 5KWEA 1PKEA 2VTVA 1MMFB 3J80A 3IHTA 3PVZA 3P0FA 1R0CA 3Q12A 2NVWA 4ZO6A 2PL5A 3FIJA 3D6MA 1MDBA 1NNUA 2ZS8A 1T9HA 2G1UA 5HIIA 4IDCA 3V4SA 2SKEA 1OH5A 4MLPA 1Z15A 4L5CA 1F4PA 1I9CA 3S1AA 1GLVA 1GIAA 1L3IA 4WNIA 2AH5A 4NS1A 1A5BB 1JQAA 7ADHA 1DTWB 2GXSA 2VWHA 2XNHA 2B6NA 2OVFA 3PCTA 1ZOPA 5EKDA 4MQBA 3DAHA 1BCRB 4ML3A 1LB1B 4FGUA 3WMRA 1E7QA 3EWAA 3QITA 3ITKA 4CM5A 4URYR 3SHFA 3RCBA 3SJBA 1BX3A 5AW3A 1TIBA 3E48A 3H13A 3SM9A 3TIGA 4S1PA 4C3VA 2OSBA 4WOJA 2GJ4A 3D3KA 4JYCA 1AF7A 2N1BA 1AHNA 2GSDA 3PTZA 4G0NA 3EVCA 1NJSA 1XTZA 1HM5A 2XF2A 2PRIA 4IOJA 2W4MA 3NEPX 1TT7A 5FOSA 4K0KB 2NU6A 1L1FA 3CS3A 4QOHA 5FTWA 2TMYA 1GILA 3GDOA 3MSXA 3N6RA 4YRGA 1N9GA 2MT9A 3QOYA 4I6GA 3SLKA 4F6RB 4BNLA 3R0IA 4XGIA 3USCS 4ZZ3A 1CUZA 1KFEB 1ZK4A 1BJTA 1G17A 4WKCA 4ZU1X 2QQ0A 3GVXA 2X5JO 3LO5A 3VR3D 2BFEB 2GBLA 4L85A 3E1KA 4LC1A 1UMCA 1N7IA 2W48A 4TSRA 5DVZA 3WWDA 3H3XA 4F91B 3LC7O 3NR2A 2V58A 3BD7A 1ZJJA 4WXPA 4HZUB 4L08A 1B42A 1D07A 2IYFA 3IMGA 3N1UA 2K2QB 3CJTA 3CEMA 1TVMA 4C87A 3R76A 1MAAA 1QF7A 5HZGA 2D2FA 1YJBA 2K87A 3AHGA 1AQ6A 2FR1A 2ONYA 2YZ7A 2BCJQ 1A9OA 1N1DA 2OO5C 3BVPA 3F6YA 4GR9A 4HFJA 2QLFA 2NSLA 4BKUA 2JJ2D 2BT4A 2YQZA 1RBMA 1MFPA 3TSCA 1Y82A 1UBSB 3MWEA 5C8YF 3VJMA 3GGGA 2RGDA 4RMHA 2JCXA 4KOAA 2F9FA 2IIVA 2A1TR 4YMSA 2PKCA 4WCFB 4YAOA 4YN3A 2FF5A 1PJSA 2CLMB 1LI5A 1P73A 2XWJI 3FPJA 3N8KA 4HYTA 5AJHA 5ETJA 3TRDA 2EZ8A 2QMQA 5BQ3A 5FL7A 3FVQA 3KUDA 4IXMA 4G9BA 4ENSA 2B4YA 4EVSA 1MQAA 5SV2A 2NU7A 4BLWA 1KL7A 1FTNA 1Q1ZA 2BFPA 2V4ZA 4JVLA 4PGFA 1KDTA 1Z3IX 4WKPA 1SG6A 2NZWA 5D3MB 5TPZD 3F4LA 3WLFA 1X39A 2BMWA 4J8PA 5IWAB 1WW2A 3DBRB 4G63A 1DTSA 1A72A 4O4HA 2YOGA 2CLDX 2QAGA 5HIMA 2ZRMA 1Z5PA 3AONB 2OM2A 1VPWA 3OLCX 4YCJA 5DP2A 1L4MA 4YJ3F 2GBIA 5K1ZA 3O94A 2D1FA 1E1YA 4IGIA 3S7TA 1QB7A 5DCYA 5EINA 1CQIA 3O0TA 4ZDJA 1PYDA 6AT1A 2YJZA 3WNCA 1N5LA 2R8XA 4UNNA 5HRCA 1XZHA 2AE1A 3DLBA 2RIPA 1TPZA 4TKUA 2FMTA 1B26A 1C1YA 2Q2VA 5E4TA 2M6LA 1R10A 2FUG6 3KWLA 1LV7A 4OP2A 3KR9A 3RYIA 5LPNA 1JVNA 2Q5EA 3OCVA 3BHNA 3ONNA 4JHXA 4ZYVA 1USVA 1SGWA 1XRMA 2R6DA 1O0BA 4UREA 4G0ZA 1WXWA 4DLAA 3AHFA 3JWJA 3ML1A 3HDJA 1MJGM 1OAOC 4WZBB 6YASA 1RJDA 1I3MA 1IAVA 2O8CA 2Z8ZA 4ZREA 4B6JA 4ZCTA 2C77A 2QTTA 1QVZA 3K0EA 4J43A 2Y1FA 2ADFA 2J3IA 4KFCA 1MA0A 1PNTA 1V4BA 2VT2A 3MJ4A 4PIMA 1LC3A 1A8IA 1Z16A 1CSEE 2AJBA 2GN8A 4M9SA 5BQXA 2CXUA 4TMKA 4JJFA 3LOUA 4MVJD 1U6KA 2ICAA 5BNWA 4Z3DA 4QOSA 1EX1A 2V7XA 5DOVA 2AW5A 3P2YA 3LW8A 1XJCA 3LL7A 3B5JA 4CMAA 5EIXA 3AB7A 4G1EB 1GVNB 1K0FA 1PJLA 2QQGA 3V6MA 4DUPA 5KTNA 4AAYA 3GIDA 4HNSA 5DTMA 5F5NA 2GYUA 4D9EA 5C1DA 3DT6A 2QXUA 4YGXB 1WMAA 1FFXB 4XH9B 1D2CA 4E0BA 1BGWA 4WY2A 2ACVA 3IV9A 5LZ2A 1HFEL 5JEDA 1E8DA 4GP9A 1J8VA 4C43A 4FSXA 3WLAA 1J56A 1U2EA 4O1HA 3X1DA 4N41A 4KQCA 2HKIA 2WSSA 1A88A 3EVTA 1PZFA 2O05A 2ZKIA 4MITA 1M76A 4LI3X 4R2XA 4WLVA 5KKAA 1JR2A 3F9CA 4C4YA 1USWA 4PAMA 2NADA 3QBTA 1H93A 3WA6A 5LSAA 5FTLA 1KMHA 2EGUA 3JWGA 5DK4A 3S8YA 5G2OA 1IEWA 2WKPA 3H1EA 3D3JA 1HFJA 2IYEA 1YE3A 1ZJ4A 1G0OA 1I7NA 4DR1B 1SD2A 2AZ4A 3IL2A 5ER6A 2XVMA 5F1OA 4YCMA 3THYB 3VC7A 3WLPA 3GLHB 1L0BA 5G0TA 3ZOZA 4N3AA 4Y9RA 1KEVA 4ZHQB 4LBYA 3RTCA 1KK0A 4C6HA 4EA6A 5KO2A 2QZJA 5HCNA 1FMJA 1VYTA 2Y1EA 2SICE 2WPNA 1P8AA 3JQ8B 4MDYA 3R24A 2QMHA 1E4EB 3TI9A 1UKEA 3N3AC 4FFLA 4PLHA 1AKMA 2J67A 3PGJA 3FTDA 2QRVA 3UJCA 1IZ0A 3CWQA 2QMEA 1OT3A 4EHHA 3GJ8A 4A5SA 3VNUA 2GDJA 4M4SA 3HGMA 5G53C 2V3CC 3MT0A 4FNMA 3RGWS 4AXXA 3FCXA 4MA4A 2HGZA 1Y3DE 2PZMA 2HZBA 1L5HB 4MYRA 2SCUA 4W9MC 1PL6A 3W5JA 5AXAA 3P9PA 5I7UA 1AKNA 4PYJA 4CG3A 2HEIA 4Y7DA 3OTGA 5KX5B 4GLBA 1TAUA 4FBGA 3AKEA 3K0HA 5AK0A 1E1KA 4AJEA 1HYQA 1QO9A 5DYGA 2H4HA 2B8WA 2DLDA 2UUPA 1YV9A 4U7GA 2JBAA 2O2JA 3F7MA 5EJ2A 4I2VA 4GXQA 3TW0A 4DR3B 4RIGA 4LZZA 4U5QA 4V1CI 1H0RA 1O95D 1L8AA 4C4TA 4FHEA 4GVLA 4CCYA 4DHEA 2W6IA 1DGQA 1QF6A 2AKYA 4D42A 3FM9A 1SG9A 2E9SA 3LH5A 1GZHB 2F55A 2YYYA 2ZAMA 1JRLA 3K0KA 4J76A 2X14A 1FEZA 4N9WA 3T1YB 4KQKA 3VYTB 1L6IA 1MO6A 1MAHA 4DV5B 3D8UA 3PEYA 3DZJA 1TVKA 3ETGA 3ISTA 3VR0A 1GY8A 3F5MA 4GKVA 2VQ6A 1EK6A 1E63A 2ZE6A 4JLVA 2IE8A 4KV9A 4LMAA 5EXDA 5FPTA 4DJEC 3HABA 5A3RA 5G0UA 4CQLA 4EUKA 1FU8A 2RB5A 3FVTA 3CH6A 3G2MA 2RDMA 3HB7A 1EFUA 1YU6A 3KXKA 3QLUA 3VPCA 2GUGA 4PBSA 4C76A 5A5FA 1XHLA 3NUQA 3FNFA 1G1MA 1HT2E 5AHKA 3KYBA 1ZOLA 1UM9B 1CIPA 4BIMA 1X7YB 3NIWA 4C14A 3C3KA 5HKBA 1G8SA 3STTA 3I9KA 4BY9E 3UHFA 2RONA 4CEJA 1FPMA 1EXVA 3EFEA 3UM9A 5EE5B 3RIGA 4D6YA 4E14A 5K0JA 2I03A 1AMUA 4IYRA 4WN9B 3U61B 2VTKA 4XQCA 3BRWD 1H2EA 3HNOA 5MHTA 5HFJA 3R5TA 3PR3A 3WOVA 5BUQA 5IAKA 1V4NA 2IH4A 1BDMA 3ZHYA 3KSDO 4FEAA 1GHTA 1QORA 2WRZA 4CQLB 2FQXA 3N39C 1L4YA 3B3GA 3C6QA 3KB8A 3IMKA 3R6WA 4G4SO 2W71A 4O4LA 4FZVA 1KJIA 4XD7A 1AK9A 5CJJA 1SC1A 3NIDB 4YO8A 3NP7A 5IARA 3SNKA 1R0YA 2JFBA 2GZMA 4B7ZA 3FMOB 5D3ZA 1AKRA 5KAMA 1IFXA 4C4OA 1FRVA 3H1BA 3I1IA 4R71A 1ISPA 3FYUB 3WYFA 2P2SA 2MSNA 1PHPA 3GCXA 3AZPA 5AT1A 4DA0A 4MW9A 4WJLA 2XD4A 1R8QA 1PDWA 2UUAB 2QRQA 4DXHA 3U7FB 4RWZA 1KJ8A 1WDLA 4A6XA 5CB6A 4LV5B 5GV7A 4HVAA 3UY4A 4CLEA 5BYKA 1M5RA 1YE5A 2JEZA 1BGVA 2O2YA 2RE8A 1E9FA 4B47A 1HDGO 2WJJA 4L4ZA 1EK0A 4D44A 5CA0B 2IHUA 1XZLA 4OG2A 2MR6A 2WWFA 1V25A 4IFEA 3N2KA 2OCIA 4MWSA 4X24A 3VNSA 2ZJ2A 4D92A 1M2GA 1UIMA 2EU8A 4RJLA 1RC8A 3KJQA 3L0OA 5JASA 3B9QA 4MZDA 4G1FA 4ES6A 5FOUA 3N05A 3R75A 1A1SA 1N5DA 4J49A 3JQFC 4TV8F 1QPZA 3EGCA 1JW9B 4DLXA 3IMEA 1DKUA 2ZZKA 2W2PA 4QJ5A 1M8KA 3D43A 3L79A 4NJEA 3I37X 2ZSBA 4HDKA 5JFTA 2V7TA 1AQLA 1GQFA 3HB0A 1Z0KA 1TCVA 1V9SA 2P69A 3P2EA 1FRZA 2UKDA 3U3JA 5CH8A 2Q8QA 2B82A 3WB0A 2ERYA 4IH9A 5K3SA 2BDUA 3ILXA 2VNKA 2BEJA 4M0KA 1R0RE 3ZWPA 1MD9A 1GAQA 5IWCA 1GPUA 1E5VA 1JPVA 5ALGA 5EMKA 4QEZA 2HMUA 4JEMA 3DCIA 3W7VA 4KPGA 4MPJA 1QFMA 3ND6A 4DC9A 3E84A 3DYIA 1WV1A 2QUHA 5ER9A 1M2OA 4E3ZA 2WZQA 4KPEC 1WE2A 2QU7A 4OKNA 3SYTA 4LKOA 1CUVA 1OIWA 1W73A 2N9UA 4EJSC 3ZQ6A 1IDN1 3AQ4A 3UGKA 3H9GA 4ZT7A 3IUJA 4P0PB 3KP1A 4N01A 2H85A 3OCZA 4UDXX 5LP6C 4FC7A 3WLQA 3JZIA 2F3SA 5AOVA 5HFNA 3HXOA 1JMYA 5CD1A 2YIMA 3JQ7A 3OFJA 5A06A 3PLRA 3B70A 2VHQA 2Z2JA 4QBFA 2D3TA 3PWTA 3QXJA 1RWWA 2GAFA 3DCNA 4J1TC 3V7WA 3AP1A 1L4NA 1U3TA 2GH1A 5F9HA 2WIBA 4B2LA 4JL8A 2HIAA 3DOCA 3G8AA 3ORHA 4FJ2A 3H75A 5T64A 1UBFA 4AZ0A 3P71T 1XRPA 2BKEA 2DHQA 4L5BA 4BFTA 3OE7A 3KYCB 2D2XA 1GAWA 1GZ7A 3F6PA 4NECA 4UUMA 4AWXA 1RCUA 3IKVA 1YUMA 5EJGA 3GJ7A 5AVZA 5EJ6A 1EG7A 4FKMA 4L0QA 1E1CA 1NSFA 2W0SA 4JASB 4N8DA 3B6JA 3HKBA 1U80A 3FI9A 2PMBA 4ZMRA 1P5JA 1OROA 2O0HA 1T4DA 2ZU0C 2UZ0A 5CPFA 3OF3A 4GPIB 621PA 4LECA 4GMGA 1G6OA 2A0UA 1U7TA 3K0FA 4JIGA 5ESXA 4UMEA 5AKGA 4LGVA 4A0FA 1RC1A 3JQ7B 4MH0R 5M7EA 1PQPA 2BV3A 1C30A 1LLDA 1O57A 1T9DA 2F90A 3CPHA 3M4ZA 4I0WB 4RW0A 3ZU4A 1KR2A 3ACCA 3BWYA 4ZOAA 3RIMA 4KO4S 5LKAA 4H7DA 1MIOB 4GC5A 4G8CA 3LG2A 5HZHA 1P2FA 3DE4X 3PJEA 2R6JA 4IG4A 2P2GA 4KQJA 1PL8A 2ZROA 1II8A 3LGAA 3X1WA 3L0IB 2QVXX 1UBRS 4O2AB 3TQOA 3W5UA 3Q3IA 1S89A 3ZKWB 3K31A 1TLFA 5D84A 1U7UA 1NVKA 5DGHA 4MX8A 5DWDA 1RR6A 3SHVA 4AO7A 5CFLA 1PLKA 2P5YA 4WRRA 2AS0A 3D8TA 3N87A 4B6PA 1YS4A 2RGXA 3CPJB 3HDQA 2H1WA 4IYJA 5F2KA 4E46A 2RGUA 4RPCA 2AFHB 3QUCA 4JOCA 1O87A 1RZRD 2J8ZA 5BVGA 4DIMA 1KYZA 4Z2AA 1NQXA 5DNEA 1MNQA 1ZH6A 2NN3C 3A3NA 4IJWA 1MRSA 4HWTA 3E5MA 4QO7A 3VU1A 2QG4A 1OXTA 1Z2CA 3ESAA 2OYRA 2C3PA 1GARA 1DEHA 3PGVA 4BWYA 4QAQA 4OQXA 3LAWA 4R1QA 1GCGA 5CIYA 1UK6A 2QGNA 3MHPA 4I46A 2R8YA 4AKEA 4CL2A 4PPFA 4WOBA 5C80A 4PCLA 2W4IA 3COSA 5LWHA 1EYZA 1F1BA 1QUEA 2LUOA 5CCBA 1J6UA 2ZRFA 3EEOA 3C98A 1J0XO 3EXG2 4EHLA 2FDCA 2BD0A 4D43A 1APBA 3TSYA 5CDUA 5F3DA 1M66A 1AURA 2WAYA 4J4BA 3QV2A 2DXIA 1CBUA 1PP4A 4HFMA 5FPKA 2JGLA 4GEGA 4UNSA 4DL9A 2G5TA 1U63A 5H02A 4L0CA 1CUWA 1U3WA 5IXSA 3HA2A 2BMAA 2IP1A 2BUBA 3EOBI 4LOAA 2NG1A 1WHSB 3JASB 3K0AB 1EFKA 2YQ4A 2B7LA 5ULLA 3P2IA 1S1MA 2OFFA 4B75A 3RTEA 4L75A 2ZZMA 3Q3VA 2QD4A 3G6KA 4DLNA 1ZBDA 2Q3EA 1O5OA 2DFTA 3GT4A 3QH4A 3SX2A 2AF4C 3G5TA 4F2DA 1UXOA 3LA6A 3TD6A 3OY2A 3CNNA 3V8MA 4NG4A 4DCCA 2GXQA 3NANA 3KT3A 1M1YE 3G1WA 2X9NA 1JF8A 1CG6A 1ZO8A 4ZO8A 3L40A 2R5WA 4UU7A 1PQWA 4LXUA 2AC4A 3PYLA 5LP6A 2J31A 3KTAB 4DA8A 3G1UA 2PUTA 4YRMA 2FEMA 1C41A 3MJDA 4JR1A 1O0CA 4I55B 4BP3A 5TPWB 2BMVA 2MINB 3A06A 1G20B 1HI9A 1NLZA 1PJ2A 3QV1A 2DTDA 2WWYA 3KS9A 1EMDA 2G7MC 5KSOA 4P81A 1NFRA 2EARA 2PEYA 5K8VA 1R0KA 2BBTA 4XDZA 4DDTA 5LOVF 1G7TA 5AVTA 4DRZA 1F8FA 1U2TA 1LLQA 1T2AA 3JAKB 3QVXA 4F38A 3FYTA 4J2TA 5C37A 2JLXA 2ZW9A 3JQ9A 5BSHA 4YRTA 1SKYB 3X1XA 5EWMA 4FE3A 4OQPA 1MG0A 1RPTA 1SUBA 1AXRA 4U2BA 4Z0PA 3RUIA 4FOPA 5JQGF 3KQUA 4GC9A 3DD1A 4H31A 2NAFA 2G83A 1RJWA 3E7XA 3IKLA 2VFAA 4JR2A 2BKAA 1DCFA 5E8JA 3NX4A 1T15A 1INLA 5GADl 1BIFA 3DLHA 5LJIA 4PLCA 1M8PA 2CBGA 5EHZA 1IHXA 4KQFA 5K3AA 4CM6A 1JLLA 3IEPA 1IM5A 4KNWA 2XGGA 3TSWA 5KQGA 1V6SA 1NR1A 2J85A 3DHVA 2I78A 4E12A 1TMOA 2PNJA 2FP3A 1HFKA 2XECA 3WG9A 3OQOA 2AK3A 4S1OA 3MQ4A 3F98A 1I0ZA 4JB0A 4O4JB 4WACA 2DFLA 5TB5A 3NB0A 3GH1A 4CKEA 1ODLA 3HCRA 3QPDA 2RH5A 4RY9A 4W9RA 3OZBA 4CIWA 2ZJ5A 4F1WA 2BSAA 5EN4A 3TLCA 4DLVA 1BWSA 2Q3LA 2MMGA 3MTDA 2I22A 1G8YA 1GA4A 4Q7EA 2ZE7A 2DPHA 2CGEA 2RH8A 4ZC1A 1N6OA 3KD3A 3TXAA 4BEBA 2GRUA 1B73A 1SIBE 2PN1A 4ER5A 3BWXA 5DSTA 2HK9A 3N7UA 3HGTA 2ZBUA 2ZYWX 4CG2A 4DJFC 5BN1A 2NT4A 2VIIA 3ANXA 2WYHA 1CFJA 1BEZA 1KE2A 3EVDA 3EW9A 1HTTA 4NNPA 2E4UA 1QAQA 1F2DA 1F4VA 3D6TB 4RIHA 2MSKA 5TQ0A 3CNEA 4FUQA 4YMTA 4F9EA 2F43B 1X7DA 4PCVA 8ADHA 3T3MB 3VKWA 4CRWB 5TMPA 1HDZA 5ALUA 1HE3A 3DV9A 5HKAA 3WSTA 1JDUA 1UJ6A 1Z13A 4X8MA 1H9CA 4EK9A 3TECE 1QFJA 4IZIA 5B58T 4EYOA 5BPHA 1M0EA 3O90A 3Q85A 2NAPA 3HDYA 5T6BA 5I6DA 3C48A 3BE4A 1OTYA 4P58A 5FCDA 2GCEA 2Z2YA 3R7NA 2FXVA 2B78A 2VJKA 4WXEA 1FQWA 2VXYA 2ZYIA 2RFLA 3EZNA 2DULA 2FSUA 3AEUA 3OA0A 2WTNA 3EZLA 1DO8A 3EZ2A 4FFWA 1D2NA 2BP7B 4OJMX 4PSUA 4TVBA 4UEWA 4DMHA 5K8LA 1ORTA 2ZUEA 5JROA 2F43A 1PS9A 2BFAA 1L5MA 3FROA 3GUCA 3GAAA 4JSRA 1JEEA 4KODA 1WLSA 2ESRA 2OCLA 4NDNE 4OFZA 1UK7A 1NTOA 3A9VA 4EDHA 2V1UA 2ZJ8A 1ORRA 3K2QA 3OOWA 1U2PA 5T3YA 4MQEB 3SF8A 2E48A 2JI7A 4Q4AA 4C0SA 4ZYZA 3T7JA 5LQUA 1IZ9A 1RPZA 2OHOA 4Q9AA 4X94A 3LUPA 1HDIA 5ARDA 3UG7A 5HW0A 4KR6A 4D0NA 5HGJA 2VCYA 3VKHA 2PPLA 4L3WA 2DQ4A 1PVDA 1CZLA 1IWPB 1QVVA 1T4CB 3DZHA 4XI9A 3MWYW 4D98A 4X6YA 1JHRA 2HHHB 2M98A 3LMKA 1WMBA 1RKVA 2YDXA 3Q7TA 1I2CA 4HVLA 2JFGA 4HSEA 3IB3A 1EZ1A 2Z9BA 3FSGA 3K8OE 4FT2A 1IYZA 2IIBA 4ZU3A 4J0FA 3TNJA 4EMUA 1WCV1 3F73A 4ZDKA 1CF2O 1E2GA 3LI2A 4HXEB 1R6VA 1Z4MA 1Z26A 3AXSA 3L43A 4N6OA 3V8QA 4PNEA 4F3NA 1BJKA 1JS1X 4UUBA 4BNGA 1U65A 1DUSA 5AXCA 2PX2A 5CLQA 3OT4A 1QKKA 3W8FA 3M1AA 5EP3A 4FGWA 4JGBA 3L7BA 1LK7A 1GKKA 2YFHA 1YDGA 4N82A 4O2BB 2QP3A 2C2OA 5LQCA 3OM1A 1YDFA 3DM9B 1XNRB 4N65A 4HB0A 4AM8A 4PCUA 2VTDA 1L7QA 1XZGA 1CR0A 5KQPA 5H70A 5EA2A 1N1GA 1DEOA 1Z39A 1TO2E 1M7HA 2PDAA 1F8XA 3OE5A 1O8BA 1KK1A 1TZCA 2GF2A 3OESA 2J5XA 1CULC 4KQXA 4DWWA 3EDOA 2GCGA 3CLSC 3E15A 3IE0A 4KBYA 2HB6A 2X0NA 2CHVA 1U99A 5KIAA 1NMSA 1W2WB 3WBFA 4H3VA 5LKRA 3MOSA 3T4PA 4FFSA 2C7OA 5EUMA 2WF8A 1AOXA 2ORED 3NIGB 4LGYA 1FZTA 4H6XA 4F4DA 1M34A 1N8KA 5BN4A 3PRYA 5DU2A 1HO3A 2BFFA 1OWLA 4R5HA 5TJHA 3FYHA 1WBDA 3E22B 5DKFA 4R1SA 3ZXIA 2BEVA 3TKAA 3I53A 1E5XA 2QGZA 2J7KA 1AKTA 4AQ7A 1A9TA 4AI6A 4M0LA 4AICA 2VXOA 1MJGA 3F96A 2YV5A 3M5DA 3THSA 5HK9A 1CVRA 5JAIA 5CA1A 4Z3OA 3GPCA 4GZ3A 1I8TA 1PW5A 3ILYA 3WHKA 3BX1A 4BGIA 2QE7A 1QM5A 2B34A 4WOPA 2RHWA 1GNVA 4GYWA 5LQDA 3GLFE 4IGKA 5HTOA 3SF0A 4IIEA 1NLYA 3PJGA 2QRJA 5TVKA 2IV7A 1NG9A 5B64A 2QM3A 2C2WA 2X4GA 2WA1A 3DHNA 2F64A 1OVMA 1IMOA 1HDCA 2OB1A 1JUDA 3U0BA 2VO1A 4P3OA 5FADA 5M29A 1CR4A 1NVXQ 1LEHA 5DT2A 5LDGA 3BM5A 4OSOA 1B2LA 1YB1A 2WB4A 4XYLA 1Y4DE 3AY6A 4ZJYA 4AY2A 5D2CA 3V7YA 1NL3A 4OHVA 2D8MA 4Z5XA 1SKYE 4GHWA 3GEBA 2O2DA 4LYHA 4OXIA 4QGHA 1YI8A 2AMYA 4ZJPA 4IRXA 1VKRA 1O8CA 3AR4A 3RHTA 3ZDBA 4WBNF 1FLNA 1NTRA 5BYJA 1AKVA 2YWJA 2D2EA 2Q2NA 1IY9A 2O8NA 3AI1A 4QPPA 4CZ2A 1IMJA 4CLRA 4AJNA 3VZBA 4JFAA 3UWDA 1X1TA 1UPCA 1P2DA 5CW1A 2CDCA 4ENTA 3EIQA 4CL0A 4CN8A 1Z2OX 3REQB 4MKXA 2CB0A 4INAA 4UHEA 1SUWA 4NI5A 1Z4OA 3WRVA 3OEED 1GQ2A 3Q8XB 1JVSA 2VATA 1MVOA 2VZ9A 1KRHA 3UPTA 2XZPA 1IG0A 3I04A 1U04A 2WTAA 3WQRA 1U0FA 3ROTA 5CH5A 1H1DA 3HB9A 4POOA 1X7GA 2ZOSA 5B1YA 3C1AA 3KHKA 1MJNA 3TW8B 3DBLB 1KIMA 2YWEA 3KLMX 1YB6A 3NETA 5CG1A 2FEXA 1OKKA 2YUTA 3DEKA 3KVNA 2W42A 1RXSA 2HBQA 1BGXT 4P5PA 5AW9A 5FUWA 4MWZA 1FNSA 5FFNA 2FSSA 1HK7A 1P29A 2P4QA 3T34A 2PQ6A 2OBXA 1GFIA 1JQEA 3LKDA 3WSVA 2GPWA 4FR0A 5AVQA 2ZSAA 3DOEA 5CVTA 4HOYA 4KUHA 5EUCA 4PSDA 3P97A 2XH8A 3GP5A 3LS2A 1RWPA 4QQNA 3UA3A 2P11A 5DM0A 2VDLB 3I01M 1XCBA 2I4LA 1QVAA 1LK0A 1GUBA 3LXMA 4MVXA 4II7A 3TIFA 3CNQS 4BEJA 3E0QA 4CHGA 4UUAA 2G4LA 3MRXA 3DFFA 3GUHA 3OM9A 4A8JB 4B4VA 3I6ZA 2HZ7A 4RWEA 3CVYA 5DMHA 2X40A 2QBYA 2OKGA 1J20A 1VSBA 4NATA 3K6JA 4RS3A 1ITZA 5FXMA 2OE2A 1JIUA 4FZ3A 2NU9A 1I6MA 1LPAB 4O4LF 5H3HA 2FE4A 3HL4A 5SZIA 3VR1A 2CNDA 4L0DA 3SEZA 1JQJC 3GDGA 4EMSA 3LKVA 1V7CA 4PBRA 1RWVA 3NDBB 4KDEA 1KJYA 5PNTA 4D4JA 4KEAA 3T7KA 2YBEA 3ADCA 1W30A 2Q1UA 4MUHA 4R7ZA 2XUIA 2OD7A 1D09A 2E2WA 1ZCJA 2Q4DA 2R7LA 4MVJM 3RTDA 3ZZ0A 4E7OA 1E9CA 3WGUA 5JAUA 5F77A 1PWXA 4ARZA 3CUWA 4S05A 3P20A 4I55F 5KJ6A 5JW6A 1BXGB 1U1IA 1ADBA 3L7OA 3MFYA 2NO1A 4AU1A 2RGAA 4OHKA 2WJZB 3JZMA 4Q1DA 2IIQA 2P6PA 4A8JA 1TQ2A 3FCSB 4KXMA 5JLAA 5GTDA 1OJ7A 1W36D 4HN4B 1IOWA 2JGDB 1UEJA 1I2AA 5ALDA 2QBYB 1IRXA 4G24A 5IAEA 4DCJA 4YRSA 5FULA 3S2ZA 3THYA 3I2GA 4GVPA 3AR7A 1BWRA 5DWQA 1ZSVA 2RK6A 2YCLA 1KEKA 3SY8A 1R8SA 3FNQA 1YCHA 2C7PA 3IUSA 1GYQA 4O33A 4PZLA 5DGDA 1QV7A 1MQ8B 1O4WA 1TF7A 2PX6A 3IQGX 3KQOA 4M9ZA 1FNDA 1SBCA 2Z98A 5CT5A 3EG5A 4BS9A 3EGIA 3INGA 3ZXSA 2NMVA 1A7KA 2E6UX 2GGSA 2P2ZA 3NOVA 4M1MA 1A9YA 2JGIA 1VBKA 1W6RA 1A2BA 2GZ3A 5AM3A 2I4MA 5E3HA 5ALLA 4CMEA 2O3RA 3NYWA 4UTPA 3NW9A 1U2DC 1KSJA 5CB4F 1E92A 1Q92A 3TX2A 1TI7A 2JVKA 2YN2A 4Z8YA 2OILA 4G4IA 3WOHA 3SCZA 1KXJA 1P2TA 2W2TA 3HYTA 3QUTA 4R2HA 3RFUA 2UZIR 1YZQA 5K0EA 2HGSA 3L84A 1KU6A 4RHEA 3KE9A 2QTWB 2AN3A 3D0RA 4GE3A 4RFSA 4E3WA 2HD4A 4PRLA 5LUAA 1XTSA 1V7ZA 5GM2A 4R51A 2PFKA 3RAGA 3L6BA 3EXAA 5TGDA 3TLGB 3CKYA 1NNSA 3K6RA 2GPBA 1U0JA 5K3OA 3LE8A 1Y4ZA 4LV8B 5I8ZA 5EFOA 3FLEA 2BMDA 5TX7A 1P4AA 3LT2A 1FFAA 1JLMA 2GFQA 3RS7A 4HGZA 1Z8FA 4D8WA 2FEOA 2P6OA 3CF6R 3DE5X 3MYRA 5KSWB 1ENYA 3O3NB 3ADOA 4P3XA 1MG5A 1E1RD 2ZBDA 4PYIA 1E5DA 5EZQA 1U9CA 5IDWA 5LFAA 1H2BA 3PDIA 3AF2A 2OBLA 1FX0A 4PLVA 2QMUA 1TVCA 1X8LA 4QC2A 4H1WA 1TZMA 5B1DA 1FYWA 1KERA 5JAQA 2D1RA 1E18A 5CFMA 2CXOA 5IC4A 1GRVA 1ZRMA 4Y2GA 4B3HA 2BEUB 3AHHA 3PXAA 4M8NE 3I64A 1TD9A 2V6IA 3MJCA 1U1FA 3N2ZB 1TAGA 2CUNA 4U6NA 2Q6LA 3G6WA 2J5RA 2VA8A 2QK4A 4A8JC 1Q1QA 3G2IA 5BRJA 3JQFA 4P80A 2G25A 3E8SA 4A2WA 1C4KA 2UXCB 4GI3A 1D2GA 1NM5A 2W2VA 4MWEA 1K27A 1XD2A 3AF1A 3K05A 3IBCA 3ER8A 4NK4A 5F23A 4UPVA 1VJ0A 4XYMA 4JLOA 1GUZA 1RJFA 4JVMA 5A0FA 3H5OA 2AD5A 5B3KA 4NKRA 3T6KA 1ZH2A 2FU5C 4B9AA 4YDSA 4YRKA 1SQFA 4B80A 4N47A 4NU0A 3P5BA 1BVYF 1U2QA 1KKUA 2EZTA 1QTQA 2ZCVA 3RIHA 1U4NA 4HLNA 3JATA 4MA5A 3OFNA 2ZKLA 5K5EA 2J5QA 1U1DA 1E1LA 2DR2A 1W87A 5CFZA 3UHPA 1IQPA 4BXOA 4CT4B 1CT9A 3MCTA 1FDRA 4EJSA 3Q8KA 1WCXA 4YQZA 4H7IA 1X1QA 4RVSA 2NSHA 1DS6A 3PVSA 4LY6A 1Z0DA 5FLEX 3U31A 4XLZA 5B55A 3TOCA 1PV1A 2X9VA 4F93B 5K3EA 4OCZA 1NMYA 4ZYLA 5K6TA 4XM0A 4CODB 2WFZA 1E1QA 5C8VA 3RRFA 2BYTA 3DFZA 1HMPA 4ARVA 1EJ0A 5E9JA 1Q7BA 4DMFA 1I3CA 1W5FA 3LCUA 3TIVA 1L4FA 2C5BA 3TLXA 1IBKB 4EF5A 3IAS6 4Z4FA 4MV4A 1KA9H 2OO3A 5KOJB 5D01A 5TGTA 3NTOA 5A3JA 1R6DA 1Q7RA 5AJVB 2XCSB 2XUDA 4UVEA 4O4IF 4ARSA 1BQ4A 1FYVA 3GCWA 3FDFA 4W5HA 3V34A 1OLUA 4O1IA 4U8GA 3TTVA 1DB3A 1QE0A 2DE0X 4OOFA 5LD2B 2ZE8A 1S4QA 3GARA 4HPXB 4CMIA 2ZTMA 2XYVA 2VKQA 3CVXA 3JYLA 2FUG1 1QRDA 4JC0A 3HA7A 1N2XA 2GZHA 2PAAA 4CKWA 3PGXA 2FPGA 3MT9A 4KPUA 4OGFA 3UOGA 5JECA 3KAKA 5B6IA 1GPKA 1QDLB 5EAIA 4TXNA 3G9UA 2P3LA 2CUZA 4PAQA 5AKIA 1HGXA 3NO4A 2FN4A 3TJMA 4BMSA 2OFWA 4PYQA 4UC0A 3UFXA 3UJDA 5CA0F 1UXJA 3QVGB 2XQGA 4MDHA 1WABA 1JXQA 3IRVA 1J5EB 4MYSA 2IBMA 4M6WA 3OY7A 5C2JB 4RY2A 3AJ8A 1KDVA 3NH9A 4JI8B 2AOTB 1UXHA 1WKBA 4GYKA 2CV0A 3GAZA 1LTKA 4B2YA 1YR8A 1VI5A 1S2MA 2OHVA 4ZV4A 2C42A 1A5ZA 3UJ6A 5FWYA 3KRTA 1C4WA 1UBLS 3B82A 3EQZA 4YXWD 4TLAA 4KDFA 1XRLA 4QUAA 4ARCA 3DL0A 4NARA 1RAAA 4RMIA 4S04A 4LZNA 1CZOA 1FFDA 4R1LA 1P80A 2ZJOA 2QJRA 3ZWAA 2HSGA 1PNQA 3RU9A 3R4CA 4DDHA 2JFZA 1LFAA 1U8CB 4PZYA 4WWHA 3GLIA 4RTLA 1WG8A 4S1TA 1I4TD 3TXXA 2VYVA 5GONA 1QANA 4WL0A 2KB0A 3T54A 2O5CA 2GQ0A 1YMQA 2QVCA 3HNRA 4UUOA 2VP3A 4LOKA 2HT1A 2OORA 1ZBQA 2HAEA 4INPA 4JIMA 5JSYA 5J43A 3PQFA 4II2A 3TRFA 5H3LA 2WM9B 4LXQA 4KQGA 1PRYA 3WK4A 2ODTX 3YASA 1G3IA 1JQKA 2WEKA 1UF9A 4MUFA 3RVSA 3ZVNA 3CT4A 5H3CA 1E2PA 5C3MA 1J49A 4M83A 1I3OA 2Q0XA 3K5IA 4RELA 2I6UA 3AGPA 1CR1A 2BGGA 1GGNA 2VT6A 2JEOA 2VK1A 4MQFB 1NYTA 4PXYA 1M5UA 1SA0A 1MENA 1RTKA 1C9JA 4QDKA 4YT5A 3UW1A 1SOMA 4JDUA 5I8WA 5CX1B 2BKVA 4D46A 3BSSA 2RKWA 1RQLA 4K3VA 3B60A 3KETA 2EBHX 1GL3A 1PSZA 4C7OA 1EEXB 2OENG 3QKUA 3BDIA 3MA0A 1H65A 3DTVA 4DDKA 1R5JA 1AMNA 4TYMA 3P5SA 1Z2EA 5LXTA 2GCPA 2N42A 4S35A 1IU9A 4Z9XA 2CVQA 2IYYA 3ACDA 1XF1A 4HWRA 3IUEA 3S2IA 1L7VC 3UUGA 3E05A 3QA9A 3KJIA 3GBVA 3NYIA 4EECA 1EUDA 2XUJA 2O4UX 3DLCA 2VHEA 5F4ZA 1YB4A 2RGWA 4CEHA 2HPZA 3GQVA 3IODA 4HDNA 4OMUA 4WKNA 3LC2O 4BVEA 3NAQA 2SKDA 1FDTA 3U37A 3QJYA 4G8JA 3G5UA 1KZ7B 3HBNA 4J16C 2BC9A 3MBKA 3HXTA 4KRGA 2VAVA 3VNRA 3ZHBA 1R37A 1YQTA 4L76A 1LS6A 1ZA2A 1ABFA 1ONNA 1HORA 2MTBA 2YS6A 3PUWA 4B73A 1IQUA 2C54A 2RI1A 3P2KA 1I3NA 4OM8A 2ZYGA 3JYNA 4X65B 3SIXA 1VJGA 1YR3A 3I3SR 4RKFA 5TVGA 3TSOA 1J0AA 2LZ0A 1TJNA 1XROA 2GF9A 4I8XA 4DLSA 2AOUB 3TVTA 1GG2A 4IR7A 3HZOA 3INNA 1BEUB 3AVTA 2EL7A 1GSHA 1GZ6A 2ZITA 1SBNE 4ZRDA 4YAJA 3GJSA 2YOFA 4BZXA 2B0JA 1SN7A 2B8TA 4EB3A 1TTHA 2BTOA 1JDZA 2E1RA 3NT5A 3IAEA 2HEGA 1CUCA 1N2CB 3R1IA 4RM3A 1S5PA 3FLMA 3PXCX 3HNPA 2WWWA 4WZBE 5C8DA 2XJ9A 1Y1LA 4R01A 4GIBA 4MGEA 5BR7A 2NZUG 1NJ1A 3CRNA 2DX7A 3TZKA 3NRJA 4TZ0A 2CXQA 5CM2Z 2UUOA 4B4DA 3B38A 3NEYA 3EGWA 3D2LA 1DKPA 1ZVMA 1JV2B 1OZFA 2C5GA 3QPAA 4YR9A 5E6SB 3LSYA 3B3FA 3GCDA 1TW3A 3KPWA 4Z4CA 2VSNA 5EMMA 5LMUB 3LCCA 1QYXA 3AF4A 2O20A 2YJTD 4DA9A 2JLVA 3DDHA 1OV4A 4PZ9A 4V0LA 1QBKC 4FQ8A 5CDFE 1DX4A 3BMQB 3QPBA 4MHSA 3I72A 4RSRA 3IAAA 5CAEB 1ZNWA 3P0HA 1JQBA 3AEXA 3DEIA 4M0PA 3SXUA 4NQZA 3MMSA 2BAGA 3OIVA 3ZDRA 1W96A 3A1FA 4C0AC 4DT1A 1Y4AE 2J87A 4DEVA 4G5RA 4YQFA 3K70B 1UJ4A 1EXNA 1RZRA 1QRTA 4HDMA 4KTVE 1Y5LA 2HXGA 4Y0NA 1TKCA 3Q0EA 5C8YA 3ZG6A 2QUIA 4D57A 4IHJF 3SQNA 5BPFA 1GQRA 4JJKA 4ZOLA 3CUYA 2ZSKA 4EKEA 2B4TO 4MO2A 4NTZA 4PRZA 3HZZA 4EPTA 3EBOA 3LQKA 4ZOEA 2Y9MB 4NR0A 3WMWA 2OLKA 3CNBA 2WQ7A 4L57A 2I2DA 2XIJA 2ZULA 2RHHA 4UUNA 2RBKA 4YIKA 3UUFA 3V1NA 1FIUA 4F1KA 1FJHA 1FQOA 1FYDA 2JW5A 5IPFA 2JG3A 2OECA 2VJDA 1OI2A 3IO3A 7REQA 4B3GA 2LCIA 3VPSA 1GN8A 1R27A 4X60A 5KWVA 2Q3JA 3GLKA 4KN6A 3WJ1A 1NBIA 3HB1A 2WF9A 2KX7A 1EUCB 4L4XA 5DZSA 3G02A 4FFBA 5C8YB 1RI4A 3OT1B 1IOVA 1JVBA 3FGZA 3HN7A 4JGIA 3GLHA 1TM2A 3LX6A 5HHTA 5U9CA 1JYEA 4G01B 1IUPA 1NUPA 2M32A 1DL5A 1TQDA 2GRJA 2UYGA 1ODTC 2C1EA 4L07A 2IH2A 1ACMA 1V3VA 3F46A 3KPVA 1DAHA 2AVNA 2EOAA 5D51S 2XT9A 2V7BA 4PC2A 2J3QA 3QBEA 4D4GA 1EP1B 2B6HA 1Q1AA 1VE1A 4HB2A 4ITUA 4K86A 8MHTA 2OC9A 3C5VA 1BE6A 3ABZA 1AZLA 4CUKA 2HR1A 4NBTA 4W8OA 1YTUA 1FXWA 3GEPA 5DM2A 4JZKA 5IZCC 4F9TA 3R9WA 1SXJE 1CUBA 2QMOA 2WSYB 2ZIVB 4QBKA 4RMJA 3S1LA 4EY6A 2YY6A 2QKYA 3FFXA 1HFWA 1W5SA 5CP8A 4EUHA 1YQEA 4EKDA 4EVIA 2B30A 1NBAA 3I9OA 3OPMA 5JU6A 3SDBA 1VSUA 3G68A 3BC1A 2PKQP 4WZ6A 3ASZA 4X20A 4UNQA 2X2OA 9GPBA 2G0NA 4C08A 3W6OA 1VMKA 4HNAA 4D9HA 1VKNA 2ZRJA 4QAJA 4DZZA 1J2EA 4D6PA 2X0KA 4OXYA 3UJHA 2ZUWA 1V8ZA 4XSVA 1FDUA 3T15A 4NNOA 3RS5A 4MWOA 1SC6A 4PAGA 2YWRA 1ZH4A 5BMVF 4WLUA 4EWLA 2ENWA 3NVDA 1SKAA 4ND2A 3VI3B 4LISA 1OA0A 1DJLA 1XXHB 2AYZA 2I4TA 3JVUA 4YONB 4G5QA 4CCYB 1YOVA 4X0EA 4OX9B 1JWBB 2PS3A 5BVHA 1YDHA 2VNSA 3MT7A 3T06B 2PXCA 4JB3A 2Q1WA 3M1IA 1AKWA 1IATA 1Z83A 5F9FA 3FRHA 2UVPA 1DDOA 1XJ5A 1DE0A 2FJPA 2X8LA 3TVYA 1ZSYA 2E5LB 1GQOA 1CRPA 1U31A 2CVPA 4WMLA 4LI0A 1UINA 1ZN7A 1R8YA 4IFTA 4NCJA 4PQEA 2HU7A 4XM2A 5CTJA 2XT0A 4NZNA 3ZWMA 5KJEA 2QTNA 4L5YA 2WKWA 4UEOA 1FUEA 4FT4A 5CBKA 2BBWA 1ZMOA 1QRRA 2Q99A 1KRXA 2E4ZA 5A2GA 2QUAA 5K8CA 1QE3A 3VU9B 1IUNA 3HJBA 1ORWA 3IUPA 1UBNA 2G7ZA 4EJ0A 4Q7MB 5LOVA 1KI7A 2GTPA 4L7QA 2HJWA 2FSHA 3KYDB 1UKCA 2ZRBA 3KOZA 4RD2A 1QGAA 2H57A 4YAIA 4I1PA 2DCMA 2ZP1A 3EGDA 3IVRA 3IV7A 4E07A 4IEIA 4ZQCB 3ST7A 2AHOA 3H1AA 1G4HA 2ROQA 3E1GA 3CW2A 3KEMA 1KQ3A 3RC1A 3ZK7A 5I47A 2H4FA 3FBWA 3LKZA 1MB2A 3CNLA 5HSGA 5EZYA 4UM9D 3UK0A 1G6KA 1T6XA 4OYLA 2PT6A 3L49A 3IEIA 2N0SA 1DXQA 2HXYA 4E15A 1ICIA 4DB4A 5A4KA 2LDBA 2QX4A 1H1LA 5JVDF 3NMUF 1QO0D 3E4CA 2VSFA 4HFNA 3SQMA 4EA8A 4ZI2A 4QUDA 2CZCA 4UEKA 3PR2B 3SM3A 1EZ4A 3DNFA 2QVBA 2H4ZA 3GC6A 5FF9A 3QYAA 3AF0A 3KQYA 1SQ0A 3H65A 2PLFA 3U13A 4D0GA 1CNEA 1ODFA 4ZZ0A 1TKRA 4ZQFA 2O6HA 3K30A 4BIIA 2CK3D 4CM1A 1S6YA 2HRDA 2ZR0A 1Z5VA 3H9CA 1QQ7A 3I1JA 1V1JA 3OIDA 4PLZA 3SX4A 4EFKA 4K2AA 4Y30A 5FR1A 4F84A 1L7MA 3TZ6A 3P9YA 3H83A 4AURA 3TTSA 2VHYA 3DE0X 1YGPA 4US0R 1U0BB 4E33A 4ZI3A 1WOYA 4K9LA 3RYTC 1KNXA 3VV2A 3OQMA 3D8HA 1KZYC 1NUQA 5EHQA 4ZVLA 1K66A 1N57A 2EX0A 3LPLA 4O63O 2ZT5A 1WBBA 4YAFA 1T3HA 3OSZA 3OIYA 2BY4A 2BFBB 2I2FA 2BM9A 4G2TA 3PFGA 3KC2A 3VNBA 2A8YA 2YICA 4M6WB 2NQ8A 5GZ1A 3DFMA 1YNSA 3KYIB 4ISBA 4K9QA 5TQ2A 3CUKA 2P4SA 1XR3A 4HDSB 5SICE 3G8DA 1WKVA 3PPXA 4EEKA 3TTXA 2CY0A 1JA0A 3F3MA 3G49A 3PLNA 1NZJA 3T7CA 4BNUA 3L4JA 5DN6A 3TF5A 3WWPA 5JANA 1ZK3A 1XLVA 2VDPB 4L22A 4EY4A 1BCSA 3L4SO 1RWOA 3NNNA 4OHZA 2CL0X 1VE7A 3D2AA 3U4IA 4JBIA 1GV0A 1SKQA 2GVDC 3F90A 3OZDA 4E03A 2HM7A 4CKBA 3OCCA 3QX3A 1U2SA 4N0EA 3BCSA 3HJNA 5IEBA 2NLOA 3O5AA 4DPMA 2HU2A 3QVTA 5JCJA 4X84A 3FFTA 3CGGA 2AR0A 2XRYA 4RABA 1XJWA 2P9YA 4XWAA 1NQUA 3VKUA 3FPAA 2Z5GA 4LCBA 4KYTA 2XUKA 4WLFA 2WHPA 1G5PA 3FKSD 4UVGA 1FMFA 2CMFA 4MRRA 3OJOA 1CY6A 1J2RA 3D3QA 1VG9B 2E5FA 1VHTA 3L7KA 3B1ZA 2C2YA 2H2DA 3PRKE 4EGJA 2W93A 4GLLA 2X3YA 4RIEA 2C20A 2EBFX 3JZAA 3N8NA 2E18A 1CRLA 4UNIA 4ENVA 1AKUA 1TDJA 3CQ9A 3EDRA 3GZ4A 1DADA 1LDGA 5FO1A 3WR5A 5IDXA 5HQTA 4JVSB 5J3JA 1J9EA 2YJNA 1RPJA 2VHVA 1E1CB 3GGJA 4RLHA 3TCXB 4RHYA 5EIWA 5AM2A 3L1UA 4HQKA 5CT8A 1F2TA 3ICOA 4DJAA 3HXQA 1QYCA 1Y1SA 3STXA 4JI2B 3IT0A 3D8BA 5SZHB 3DZFA 3QNWA 4MKIA 5LQSA 5DRYA 2EJCA 3WQBA 3PNPA 2XF8A 1XEWY 1E2EA 5T67A 1ESCA 1G7CA 4HUQA 2RGNC 2EWWA 4IQ4A 4MIEA 5JRJA 2XNSA 5L4LA 4JT2A 4XUGB 4FFMA 1ND6A 1RWQA 1T8WA 2UYQA 2ERXA 3HDVA 1W85B 4DJJA 4K46A 3D64A 2JA2A 2WE8A 1OFUA 1D2MA 1Q83A 1YZGA 3FOEC 4I3GA 3R44A 4JC5A 4PANA 5CURA 5DNWA 2X4DA 5DYWA 4XGRA 1VECA 2OTCA 2CZGA 1QMGA 3EG9A 5IDYA 3BDAA 3VUFA 4RJIA 4E2YA 3CZQA 2WSBA 4IO0A 2NTVA 3LOQA 3OQBA 2JZNA 1C7EA 3CRZA 4KFUA 1KZ6A 1N0IA 2AG8A 1YZVA 1Y3AA 2MSCB 2CDBA 3GEGA 1COWD 3JVIA 2IOQA 2CLSA 3QBDA 4PY2A 5FWNA 1EQ2A 1X1CA 3NUZA 3OQPA 3M6XA 5B7QA 1DTWA 1UXIA 1O77A 2RC5A 1YFZA 4ABTA 1E2UA 4QSMA 3GJ4A 1Z74A 4KAFA 3RVMA 2HFJA 2VSOA 4LJ5A 3UIEA 3O73A 3MTEA 1IXZA 4UTZA 3DWGA 2AQKA 2PSSA 2EGHA 1X1SA 3ZE1B 2Y0EA 5DXAA 1MX5A 1U8AA 1XTQA 4HQOA 4BMNA 1WJGA 1Q50A 4TWJA 2FYTA 6NULA 3NV9A 5EJ7A 5JQGB 1PFWA 3EWNA 2ODBA 2RGGA 4KKXB 2BTEA 4QGGA 1EXMA 3PJDA 1IBLB 3EZYA 3D59A 3HRKA 4MP6A 5JYDA 3RK4A 3FDZA 3BJEA 3PUYA 4ESVA 1PV4A 1RQXA 2C98A 2YFYA 4FR5A 1QGDA 5BT9A 4FYKA 1U5BB 3GNLA 2YWCA 4BCCA 4MW5A 1T5HX 2I6QA 1FMCA 3K1YA 3VGJA 2I66A 4DLTA 1H4SA 3IAXA 4UBMA 5IZ4A 4FYYA 1QO0A 4TTIA 3SEAA 3USES 5IJZA 4XIGS 1QYIA 4E21A 3VC3A 4EYKA 1C3OB 1TYAE 4LZPA 3AOEA 5B30A 1Q0RA 1F20A 1I7DA 5KBYA 4PX9A 2PMEA 5IULC 3UMGA 4EB6A 1UADA 1U0RA 3KJNA 2XB4A 1NR7A 1VE3A 4B2PA 4U3JB 1PG2A 1P4RA 2I2BA 3S5UA 1C3EA 1KMNA 2YTZA 3EDQA 1NE7A 1JHMA 2A1TS 2W58A 5C1BA 3PLAE 3RU2A 2O6LA 3NNDA 1GA1A 4CDNA 3R7FA 2DBRA 3HN2A 3R6GA 2PMWB 1CY8A 1TA4A 1GU0A 4LNUA 1IAQA 3EXHB 4R1TA 2B94A 4FHDA 4B3DA 3KO8A 4FYMA 1SZCA 1KDPA 5AHOA 4C4XA 3BYZA 2ZTUA 4UCXA 1AUXA 5DDIP 3BXPA 3H19A 4AQYB 2Q27A 1CEQA 4UU0A 1ADFA 2NSYA 4AECA 4OQDA 4X41A 3LDHA 2VBCA 2WBLC 2CL6X 4OQMA 2O14A 1RXVA 4Y0VA 3TUJC 4TS9A 3AL0C 1RW4A 2O06A 1R8XA 1C9YA 2BOVA 2C96A 3MD9A 1TEHA 1OAAA 4Y2UA 4R8MA 3UF0A 4HV4A 1V8DA 5J47A 3H2IA 3AETA 2D2VA 3WE7A 2ZIWB 3FJ1A 3AUXA 1CJUC 1ZOIA 1UAGA 4GOMD 1XP8A 3H6GA 1ZVVA 4M8KA 4RH3A 4LNUB 5AHRA 4EVQA 3TG2A 3HLYA 2V7QA 2OD9A 4TX1A 3JQ6A 4EKGA 1YVDA 3HSKA 3ZHUA 2G9RA 4GGOA 4EX6A 1T5IA 3B8EA 3F9IA 3N0RA 4KAXA 4MGZR 4OI2A 2MOKA 4KK4A 5KYWB 4YIHA 3NHSA 2XMQA 3U0VA 3O74A 9LDBA 1EU1A 2ZAGA 1HL3A 5FEMA 2QTVA 4OHRA 1AUVA 3ZDFA 2VJMA 4EX7A 5TV2A 4EITA 4U7JA 2IHVA 1PWHA 4I5FA 3DC7A 3M9WA 4PLPA 4ZVPA 4HMQA 4WCVA 1ZJ6A 3IR6A 2A4MA 1JLHA 3NTXA 3ZI4A 1NVTA 3T1OA 3OKCA 4DLBA 2WVHA 1C9EA 1EDEA 1TIPA 4ZVSA 4LJ4A 3UN1A 4QU5A 2FCRA 3ESYA 2RJ3A 3OX3A 4GI2A 3ZCUA 5JTUA 2AJLI 1THZA 5IT4A 1R15A 3CEJA 3EH1A 3O93A 2EJTA 4K6MA 4YRLA 1K0UA 5THKA 2CNWD 1ZVJA 3UJAA 5JY1A 3KKEA 3HO6A 1O95C 2RGEA 5LVAA 1UC8A 4FHFA 4ALIA 4YYZA 5J58A 1DAIA 1HXHA 5U4XA 3H04A 1OE0A 4F06A 4WT7A 2X15A 1I4DD 3P9QA 4LJ8A 1VTKA 4XWWA 3DBRA 2WF6A 1GZ4A 2Q0HA 4NPAA 1JQ5A 1K8ZB 4RTRA 1WZUA 1DIGA 4EELA 5G40A 4TTRA 5J59A 3MTJA 2X58A 2YASA 3S28A 5JNSA 4IUCS 5CDHA 1V8OA 2J5BA 1YZ3A 5CNIA 3LTNC 1NN3A 2B37A 3SDZA 5ALZA 1G5QA 4UBLA 3R3UA 1JYSA 1ESEA 3QVWA 1OH8A 1CJKC 1EM8B 4PYMA 5AVKA 1O94D 4IHKA 3ESCA 5C0OE 4MQUA 2FCAA 3BWEA 1SRRA 5JS2A 1L7PA 1Q0PA 1WXGA 2A92A 4ND4A 3EY9A 4RKQA 1F3LA 1UP7A 2FFJA 4CCWA 3DDWA 3IC5A 2XLBA 4UHFA 4P3PA 4E7PA 3MILA 5I3ZA 3KDPA 4QKQA 5BUCA 1PJ3A 2W0MA 1T2EA 3AZOA 4M7WA 3TDNA 2DPXA 4WE3A 5EE9A 5JWRA 5A6VA 1RJGA 3JRWA 3GJQA 4JQCA 4WY8A 1Z4LA 3KT8A 3BICA 3CLUC 4RHTA 1W5TA 4XEHA 1MBZA 4P7GA 4RKRA 4Z1MD 1T9AA 2HOQA 4BFYA 3LUDA 1ZVQA 4X3CA 4ZJUA 2RMKA 4KJXA 2IHTA 4JP2A 4AJKA 4ZV7A 2YJ4A 3L93A 4Y7CA 1K3FA 1P62B 3AM5A 4LJ6A 4MEAA 2JBHA 4QJBA 1GPBA 1ZM9A 1A3CA 2R8OA 4FYPA 1VBMA 2CXTA 5AKHA 4H0FA 4CN9A 2IPXA 5AW1A 3G59A 5ICSA 1MC1A 3CNOA 3BPSA 2J9XB 4BV2A 5KNLA 1J23A 2W7TA 4PNZA 3N28A 1BS1A 1TTQB 3BWCA 2XCRB 4FWBA 3TZQA 4TWBA 2GZRA 3NKLA 2PGDA 4UDNA 2V0GA 3GXBA 5K9ZA 1LPMA 3OVMA 1CX9B 2F3TA 2K5UA 3DW3X 2G1JA 3EUEA 4TV8B 3F4BA 4P2GA 1SUDA 4ZT3A 3UKDA 5LZ5A 2QUBA 3B1KA 3IKTA 1HLFA 2A30A 3EQ2A 4HMOA 2ETXA 2YHBA 1KFJB 4Y9SA 3R8XA 3RVRA 4AF7A 1KP2A 2XXAA 2PA0A 4L5AA 3D81A 2GX6A 1LNZA 2WNSA 3QKRA 1E79D 1QVWA 4V38A 5F73A 4HWPA 1Y9ZA 1PO7A 3PGKA 4P38A 4EJ2A 4YJHA 2XQKA 3L7DA 3LX8A 1ZWLA 4Q3LA 5JDCA 2IPNA 2JK0A 4HDSA 2YVAA 1KDZA 3MBOA 1J1UA 1T2CA 2JGJA 2VDRB 3H11A 1Y5NA 3HEAA 3P0RA 3K9LA 3N86A 4BNDB 2XCTB 5IKMA 3G9XA 1OWPA 3PF9A 1AF4A 1AZTA 1T0UA 4RF3A 5D6NA 3CEAA 3QKIA 1UPBA 3HEBA 2O52A 3ZYZA 2XAUA 4HAYA 2H1SA 2YMQA 3RKUA 4KWHA 4B2IA 4GR4A 3LRTA 3EYWA 4MCHA 3WL5A 1XYVA 3M6IA 1BE8A 1O1YA 5CPBA 2DY1A 3IMCA 3VR2D 4JU8A 1WUTA 5LLDA 4CQNA 5CRIA 4DYDA 3V2HA 2DFPA 3HCFA 2OV8A 1RHUA 2PIDA 3L0CA 2NYAA 3SS8A 2F8MA 3QY9A 5JD4A 1FW6A 4DTCA 3ET4A 5I9IA 1Y7IA 3QFFA 4KREA 2OCYC 121PA 2FB9A 3K6SB 1H23A 3ICWA 2H00A 4C2BA 2ET6A 2WKQA 1T8RA 4FHZA 4J75A 1T6BY 1OV6A 5CVUA 5FHQA 3STWA 4CEJB 5DIFA 4R9RA 1G291 1O89A 3OZTA 4RZUA 4MYTA 3CEPB 3BS4A 3WP0A 4CNBA 4TRJA 1YAHA 2FDXA 2BGRA 2G71A 4HDNB 4IDPA 4OD0A 4OQQA 2OBFA 4ENPA 2DY0A 4BTLA