1UC5B

Structure of diol dehydratase complexed with (r)-1,2-propanediol
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
178
structure length
178
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diol dehydrase alpha subunit
publication title Structural rationalization for the lack of stereospecificity in coenzyme B12-dependent diol dehydratase
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
total genus 60
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1uc5B00
3AUJB 1IWPB 5D5QA 1EGVB 1MMFB 2D0PB 5D5PA 1UC4B 3BRCA 1EEXB 3WB0A 3WB1A 1EGMB 3WB2A 1UC5B 1IWBB 1DIOB 2D0OB 1NBWB
chains in the Genus database with same CATH superfamily
4J2TA 2V8OA 1T15A 2ZAMA 1XXHB 2NTNA 2RG7A 2GZ1A 3TUJC 1D6NA 1Q1EA 1RKQA 4YRSA 1MNAA 1X1DA 3ECSA 1J09A 4DGQA 5JANA 4ZV4A 4WKGA 1Z75A 2OHGA 4ZAVA 1BFUA 3UCEA 2LXNA 2Z58A 3QVWA 4JZKA 5L7WA 5FA8A 2G06A 3A3OA 5E2BA 3CWCA 3VYSB 1CT9A 3DZCA 4YRNA 4KGDA 2WU1A 1LQ2A 3L1IA 4QXPA 1GZDA 4NZPA 3DZIA 3H2ZA 4CLRA 3EZXA 2HBZA 2G8LA 2WINI 2WKPA 2YFHA 4B4DA 1U80A 4YFVA 2JFZA 3DDSA 1CUCA 4PXYA 2VWQA 4ZOEA 4Y3UA 2XSZD 4E22A 1RBMA 4CMEA 2H4ZA 4YJDA 4PF1A 2VQSA 1KAGA 3S2SA 3UJ6A 2FZLA 3RM3A 3KAPA 1QGZA 4MKIA 1XD2A 3PF8A 1NF2A 3LVRE 4DVGA 1V7CA 2BHLA 4XCVA 4MV6A 3SHVA 1KDVA 4PY2A 2I3ZA 2XNCA 4G4IA 2UYOA 2WPDD 4NONA 2OBFA 4Y2TA 5CXQA 2Z2IA 3GVCA 3V8MA 2HZ7A 3NU1A 1K5HA 1FC0A 4WBSA 4X90A 5HS6A 4EA8A 2G1KA 3QTTA 4RESA 5BSVA 3G68A 4KQMA 1O97C 3NP9A 3U7IA 3JD4A 2A1UA 2QIOA 2YRWA 5ILQA 1T3HA 4IINA 4NZZA 1WHTB 3Q7RA 2O2DA 4MIEA 4XASA 4HDRA 5G2OA 3VR1A 3WKBA 1R8XA 4OSOA 2P79A 4P34A 3HJRA 3Q10A 3WJ1A 3Q7QA 1CUJA 1TCBA 3S2FA 1G8GA 2GAFA 1CR2A 1TM2A 2WZQA 4INPA 3O0TA 1QMPA 3MLEA 3QVKA 4NECA 1WZUA 3CNQS 3VH1A 1C9EA 2OORA 2GN6A 4Q1DA 4FR2A 3LX5A 3AVTA 2DM6A 3FCUB 3KR2A 2Q5EA 2AB0A 3SDBA 5CBPB 1L1QA 1SAYA 1VHLA 3AF4A 5FTKA 3U7HB 4HATA 4E3WA 1TJNA 5I5EA 2FDCA 2EGGA 2Q3EA 3V8NA 4F6CA 1VMKA 2WM8A 2YZ7A 1GV1A 1JU3A 2XWSA 5A71A 2JASA 4X3OA 1XCLA 5EMKA 3H5TA 2AG5A 4ZC8A 4X71A 2PU5A 1NYQA 2ZRQA 3K2BA 4EKYA 1NQVA 3HVUA 2VBGA 3TD2A 3RRXA 4GX2A 1JFRA 3A3NA 4L8LA 1M8GA 2C2WA 4FCTA 3VPCA 1EXDA 5FHQA 4EJSC 4RANA 1NOJA 5DYTA 1A71A 1OB2A 1BCSA 1P60A 5EXXA 3VR3A 1L5FA 5K5EA 3Q6IA 2WJIA 5KJFA 2JH9A 4PC3A 2V1UA 2HO4A 3WGGA 3JZIA 3FUCA 1HDCA 2Y66A 3LQRA 1NBOA 1XA3A 3P9XA 4FU0A 5ELXA 3FGZA 3U16A 1ZPDA 2X8BA 1WOMA 1C9DB 4R41A 2HQ1A 3QA3E 2QQ0A 4KGZA 2YRXA 3HVJA 4MYTA 5F33A 1Q1GA 1ISMA 2RGBA 3VKFA 5AYVA 1ZN2A 3FPAA 4QAQA 2VTBA 4B83A 1JHUA 5EUMA 4EQ6B 3TI9A 1TZ2A 5DE3A 4JCCA 3NZEA 3EPLA 4B6JA 3MTGA 1WQ1R 1SULA 2KHZA 3AEZA 2ZEJA 1BE6A 4PQFA 4JUIA 4LYFA 1YS1X 2WU0A 4QDOA 2Z56A 3PFNA 2FP3A 4HDQB 2P30A 4M9ZA 1VJTA 5EZYA 1HV8A 3LXRA 4OXRA 3GEGA 5JJCA 3LG2A 1LTKA 4J0FA 1GNQA 4P0TA 1IUKA 1G291 1YU9A 2IIQA 3GEPA 3WR5A 4FDVA 4D0GA 5PNTA 1GILA 1U6KA 2D1TA 2XTZA 2AOUB 2ZCVA 3FFWA 4JFRA 3BH0A 3AFIA 1R4ZA 4FDUA 5IF3A 3ZLTA 2VPQA 5JRJA 1ENZA 4MV7A 2E21A 4V0NA 1JKJA 1JA0A 3W5IA 3A26A 4U7JA 3TK1A 2DFVA 3ILVA 2FPIB 1E1NA 3WE7A 3ZE1B 4ARUA 4BV3A 2OG1A 1XQYA 1AQLA 1FY2A 1Z2PX 2WD8A 4X44A 4BX9A 3BPSA 4ZHQA 2WNSA 1J39A 1C8BA 5B1EA 4B76A 4OHOA 2ZB3A 4HAWA 5LOVB 3W5SA 4OHMA 4I4TA 4RELA 3E9MA 5BUSA 1E1CB 2VG8A 2GLTA 4Q7JB 4UDOA 1H69A 3T3MB 2AEMA 1C5KA 2YICA 3H5AA 4BFSA 4BE7B 1SG6A 2FOIA 2VT7A 3F8SA 2G77B 1E7SA 1TL7C 1Z6YA 4OFXA 1Z35A 3QKRB 4ROSA 4JK3A 5GY7A 3KT8A 4B82A 1VBKA 2GCPA 2H0QA 4IYJA 4RMIA 1ZDMA 3R0XA 3RVLA 2HF9A 1NW5A 3ER6A 4BX0A 4B35A 5L40A 3MC1A 2IITA 4G67A 1SURA 3IAM1 3SLRA 3TLEA 3COPA 1SQ6A 2FPUA 4GZLA 4MGIR 3ELYA 3DT9A 5HKAA 5KQSA 3EZYA 2YOFA 3K8ZA 3QELA 3HXTA 1NZJA 1WY5A 4GFDA 4AJJA 3P9ZA 3ZI0A 1LCIA 1SB9A 1WXEA 3D7MA 4UHJA 2QHXA 4DMHA 3PZRA 3NJRA 5LBIA 1AIPA 4RFLA 1A5AB 1G8AA 3E9NA 2NZUG 4RADA 3CRVA 4BVFA 1EMDA 1Y6JA 4WNAA 5DYNA 5H5JA 3SC2B 4AECA 2FPKA 4MKFA 3L06A 2YRFA 3T06B 1BX0A 3H86A 3WLPA 4B43A 1RZUA 5H3CA 1TEVA 1MENA 1ULAA 3AV3A 4D4MA 3KE8A 1TO1E 3JTEA 2SKDA 3NJ4A 4RZHA 4ZXFA 4HLNA 1E58A 3P9SA 1MVOA 2VNIA 4GXQA 3M1IA 4AMUA 1IWBB 1KOFA 1WO8A 2G1UA 2KPOA 2O5EA 4RTQA 1NR7A 3JVUA 1CQJA 3FJ1A 4WASA 3ZY3A 2VIIA 3K0AA 3I23A 3D8UA 3BFJA 2GNOA 3ITEA 4O2BA 4RNCA 4LGVA 4BJHB 3I1IA 3AHDA 3IP1A 4OQQA 4JODA 2FH5B 1E1YA 3T9AA 1UZNA 1WQ4A 2JGJA 1UPUA 2PSDA 2VHWA 2Q5OA 2ZT6A 3JVVA 4L8WB 1XZFA 3QPWA 4AN1A 3QY0A 3IEVA 1MEJA 4EL0A 5B3LA 3WDKA 1CEYA 2XZLA 5H83A 3VM6A 4EELA 5KX5F 2PJZA 3KOZA 2DPYA 2CGEA 3C8MA 3KB8A 3QOXA 4Q6WA 3WWEA 4C0SA 1GGNA 4C6TA 4D8VA 1Q15A 4FJ2A 3RFUA 1P2VA 4KIWA 2D7CA 2QR2A 2VK2A 3R8FA 1RQNA 3D9QX 2DG2A 4UAGA 3UUGA 3WIVA 3K9WA 4L3VA 4CL2A 2Y1WA 4JT8A 2II6A 1U2SA 3FSJX 3B9RA 3UA4A 4CLRB 3C5HA 3CA8A 3S29A 5JUWA 1D8TA 4YLGA 3LKBA 4GUDA 4FP9A 5JI2E 2RGNA 1CUSA 3FNHA 1E7YA 1NVAA 2E4YA 1GTVA 1JNXX 1S02A 1XPJA 2QTGA 2WAXA 5FB3A 4RTSA 1Q0ZA 1W19A 5AVJA 5HF6A 4OF4A 1MOZA 2PQ0A 4JBXA 5IM4F 2FZWA 4GX5A 5IABA 4LX0A 3G1UA 4U0KA 3ST7A 1IBMB 1WXDA 1BQ3A 2AF3C 2ZXFA 4WACA 3LCRA 4BGIA 1XDZA 2ZUEA 5AKLA 5FI3A 4G0OA 5JG7A 5M04A 3LLCA 3OX1A 3PWSA 3CLRC 2A1UB 2J3DA 4X41A 1VSTA 4TN1A 1KJ8A 1HT2E 1OXBB 4AJIA 3AI2A 3OP1A 5K8CA 1QPZA 3BXEA 3FZNA 4G4SO 4H35A 3UXMA 1C1HA 4JSYA 1TRKA 5CPBA 3V3TA 3ZE0B 4BN5A 3PT9A 4E12A 4LQCA 3K70D 2A57A 2MSCB 3GMSA 3TFWA 1IEVA 2DUUA 3EGWA 3S7ZA 2YS6A 3ZEIA 3RIXA 2LNDA 3AI7A 3HVHA 1DAKA 2PX4A 3HCPA 1C0LA 1EQAA 4IQ8A 2H2HA 2F59A 3V8QA 3I5MA 3ZN2A 1NMZA 1P91A 4I1IA 4XDHA 4BP9A 1PZHA 1EHYA 1GEEA 1W36C 5D85A 1H93A 1UANA 2H1HA 1XEAA 4C3OB 4F5DA 1G6KA 1KMHB 4Q9DA 2O7NA 2V54A 4L1KA 5F77A 1RTKA 3DVAA 3NWEA 3WWOA 3UG7A 4J1QA 5BYKA 1V41E 1FVFA 4QBIA 3R74A 1CZHA 1QLJA 5HKBA 1MAHA 1XRPA 4MUHA 1Z6PA 3EIUA 1KO8A 1EUDA 2HSJA 1U02A 5C7IO 2M1ZA 1E3EA 1ND6A 2WNHA 5C32A 4RYLA 3LCCA 4ZKEA 2CBZA 3HK2A 4N6OA 1D2AA 3BWYA 2C58A 3MG9A 3PX3A 3THWA 3GJ3A 2VP3A 4RZQA 5K2MA 2N0SA 4L72A 1SPXA 2V5AA 4AY6A 1L7BA 5AHRA 2F4NA 3PUYA 2JGNA 2QZ9A 4XZ3A 5DYIA 2OVBA 3SBEA 4MRRA 2ZB7A 1AKRA 1VG9B 3R7FA 2CDAA 4CG1A 5BWNA 5ALTA 4ZV9A 4CETA 1P1HA 1DIBA 2ZS7A 2ZZNA 4NV1A 1ZM4A 4OEHA 5C31A 2WWFA 4CQLB 3EG5A 5H4HA 2KQUA 4AXXA 4R0NA 2R6JA 3F6YA 5KU1A 3A6FA 3WRXC 5L3ZA 4D44A 3ZDCA 3ROMA 3DE0X 1YD7A 3RTEA 4EB0A 5LQJA 5JY6A 5IARA 1YR3A 1Q5PA 3KDSE 1HSZA 3GCXA 3I2HA 3CINA 5EZYB 4N5IX 2E4ZA 3BK1A 2X4IA 2XVMA 4G07A 3F73A 1DAEA 4CCSA 5JW6A 2HHJA 3L4EA 1N0IA 4XQGA 3RIEA 4E5MA 4FYIA 4DR1B 2FJPA 1ORIA 1UBHS 3MTQA 4I55B 5F4BA 4R05A 4IOJA 2AEJA 4YDQA 3L04A 1E32A 4RVOA 3VDXA 4C2AA 4DQXA 4BEBA 4YONB 3OPYB 2FW1A 4QG3A 2V03A 2OCAA 1UDBA 2I62A 3WYAA 4M86A 1JIQA 1VP9A 4HUTA 2BGLA 2VPXA 3VNQA 3DKIA 2J67A 3KTAA 1Q1ZA 2PRKA 4Q3EA 4RDHA 4Z7QB 2P4UA 1KTIA 2HA4A 3U80A 4D41A 2F1OA 2XXBA 4LCEA 2RI0A 4EEKA 4MWSA 4PO1A 3KWLA 4WZBA 5CFZA 2WFLB 4G8CA 1LTQA 1DTSA 2HJRA 1N6PA 4JYZA 4IJUA 3TRKA 1FUUA 2P5UA 5BQPA 3R3JA 4X95A 2QYHA 4MVJG 2H2AA 4F11A 2BM8A 3ES9A 1KXZA 3I5XA 3TXAA 4RS3A 4LE2A 1QHEA 4X60A 1PEDA 4FYJA 2L42A 4KJZA 2IYXA 1SHZA 4PYNA 4WFJA 1D2EA 1E1QA 4LTDA 2IUUA 1L5VA 4A8JC 1TD9A 5I51A 2FPGA 3LUAA 5ALGA 1NVVQ 1M7GA 1BG6A 4JVOA 1YRQA 4PG5A 2X3UA 2PUWA 5GINE 1GDHA 2EGUA 5IASA 1NUHA 1DUVG 2Z3VA 4Q4HA 1YOBA 2F1RA 3EVNA 2VJPA 4QDZA 3G9XA 4YUVA 1S7GA 2XNJA 1L5GB 1JXAA 4KN9S 2WEKA 1DT5A 5CDGA 3CVOA 4P4UA 5FLEX 3UB3A 1YKFA 2AFVA 2AR9A 4EY5A 2J45A 3R5KA 5F7XA 2VNKA 1PF7E 3ACDA 3JQEA 4NAUA 1TU0A 4B3MB 1M73E 1EFRD 3SYNA 1OXXK 2MSDB 3AR2A 2FKAA 4GOXA 5E7IA 5JE8A 1KK0A 2DBZA 3E61A 3IV6A 3QEBZ 5ANRB 3CLSD 5DXFA 5HFNA 4Z2YA 2FUNB 1VLZA 3DM5A 3HJCA 3HPQA 2JLRA 5KJ6A 2XOXA 5FIUA 1BA3A 1PD0A 4MUMA 1PWXA 2Y4NA 5C3MA 2Q2VA 2XEXA 4L2IB 5B5SA 1A9PA 2G08A 1FJGB 1NXOA 4Y7DA 2A5LA 2VJKA 1SM4A 4O4IF 1E4VA 1LWNA 3GJQA 3PUWA 5EKDA 5KOYA 3L8ZA 1FF9A 5BWBA 4AWBA 3GZJA 3H2HA 3N2KB 3KEFA 3QYJA 1TKBA 3RRJA 5AW6A 4F2GA 1DTWB 1KSFX 3A2LA 4MITA 4LCBA 3W4IA 1OH7A 1ZWKA 4L08A 4PTYA 1FTSA 4BIMA 3K9QO 4OXYA 3E9YA 5CLIA 2GLXA 1F20A 1VSQA 3Q6MA 2XQIA 2I2CA 1F51E 1YQQA 5C4GB 2IOFK 3IOCA 2MSNA 1RYMA 3DTYA 3L1HA 3VVCA 3FF1A 4P54A 3WGNA 2EX4A 3A9CA 3L0CA 2ZM6B 3W79A 2IPOA 3T52A 5T4HA 5KMGB 3MW8A 3VO8A 4CNQA 2K4MA 4M3NA 4HDMB 2V6BA 4OH7A 5DX8A 5DGCA 1K7XB 4XSVA 4Y98A 3D59A 1OT5A 2PA0A 1T3LA 2J3MA 2VWHA 4FW9A 4PLGA 4QRIA 3AY0A 3EXHB 4ZQGA 5BQXA 4G0VA 1T8WA 2HXGA 2GNPA 3Q9UA 2ZSEA 2A94A 4MCAA 3FETA 1W0JD 1I32A 4TQGA 4BQQA 4PBRA 2QVXX 2CVFA 4LJ6A 1G3MA 3GGPA 1NSTA 3FDIA 4QDUA 1SXJE 3GAFA 1P4AA 3KHKA 3ZNQA 3JALB 4EPRA 4LF4B 2IX3A 1Q50A 3WFZA 2GHQA 4FFBB 1IK4A 2Q7XA 4RKFA 3MWKA 3GIWA 3P4UA 4A0FA 3AR8A 4HLCA 1H0SA 1UK7A 2ZBUA 3FZEA 3GT4A 4MQEA 4O4JB 3RYHB 4G0WA 2Z08A 4JJZA 3RADC 4YRZA 5A3QA 1F0NA 1LW6E 1TK2A 1IG3A 2XNSA 1G59A 3DV9A 4MW6A 3HWRA 5DHPA 4C7VA 1RHQA 2HN9A 5LMZA 2FLWA 1C3JA 4DMGA 1OGIA 3DP7A 3RH0A 3TTSA 1KEVA 4LQ4A 2QP3A 1U0GA 3PQ4A 4EJ6A 1JAXA 4CLDA 2AEFA 2DAPA 4PU0A 1WETA 4XVHA 4XX0B 4GC9A 3R23A 4Y6LA 2O3JA 4LI0A 1QRUA 2IS6A 1JF8A 4F4CA 2ZJ3A 2XJ4A 3QKWA 1E9EA 1MZVA 3IUMA 3NCHA 1YK0A 3P19A 4CMIA 1O3YA 1R9GA 3M5CA 1FMFA 5JD5A 2HDHA 3ED1A 3S2ZA 1JQ3A 1NJ5A 1B3BA 3DUWA 3N76A 1TT5A 2DWQA 2XDQB 3RQSA 4CR7A 2FX5A 5FCDA 3CLKA 4Y6SA 4LYDA 3F5DA 2OGWA 1IRXA 5JH7F 2X0FA 4QG7A 1RYBA 1ZH8A 2YOGA 3HJHA 3NPAA 3ZD7A 3IHKA 5H8WA 2FE4A 3OPMA 4IHJB 4DR7B 1SXJD 3A2NA 3UMJA 4EI8A 3BG5A 4H1WA 4CWAA 3DR5A 4AY5A 5A02A 2CY0A 1EWTA 1MLDA 2H3EA 1UJMA 2P65A 2VDUE 1YDGA 4JBGA 3NVKI 4YWJA 2IELA 3PD0A 3ZVRA 4BOYA 1E2QA 2QF7A 3HFJA 4IFIA 4H6VA 3KFXA 5E7QA 5ESDA 4CDRA 5IXYA 1WXWA 3WJ2A 4P1ZA 1YB5A 3WNCA 1P8JA 2PX8A 1V3TA 3SE7A 2RB5A 2P62A 3K31A 3H04A 2B37A 4CEHB 2A0UA 3P2YA 3TLJA 2XOKD 3GP5A 4WKCA 2AR0A 2XWBF 4BNXA 2EATA 5F7OA 5JWOA 3O73A 2E3JA 1B1CA 5FL7D 2QBYA 2PXCA 3JQRA 2BKUA 2XBLA 2N1BA 3IVMA 1U1FA 1IOWA 1CR6A 2CLEB 1DQNA 2X41A 1X2BA 3LO5A 5D3QA 4NV0A 2NUAB 1IDOA 2X0NA 2GNAA 2NUPB 4RFSB 4RPLA 3HBMA 1LX6A 1KI8A 1JDVA 3W5VA 3P9NA 5JU6A 3CC8A 2A3NA 3G2QA 1PEYA 3U1BA 1M72A 4FHDA 3H4MA 5BSRA 4NHEA 2PZJA 2VWGA 4FHGA 4R16A 1JPVA 4PSVA 2QX7A 2CXRA 3H2IA 1ZA2A 3CF0A 4BNDB 1B00A 1M2EA 1L4NA 4FXPA 3J81k 2C88A 1EXNA 1H8HA 3OCXA 4C0KA 2BBSA 4W5QA 1Z4KA 4HEQA 2NP6A 2P4SA 1HO3A 1OKKD 4MVJH 4BLOA 3NANA 3OPYI 1Q3KA 3TE7A 3PV0A 1TTTA 3N0XA 4NQRA 4KR3A 4HQ6A 2C1ZA 1U0BB 3QBVA 5EY5B 3V2IA 1E2GA 1NBIA 1SC9A 5DXAA 3DE7X 3NFRA 4OHYA 2WP8J 1QV7A 4QX6A 1N0WA 4IIYA 2I6XA 4Y2VA 2HADA 1UMDA 3PWKA 4N03A 5TQ0B 4RZ3A 1FTQA 3F5MA 3QWAA 4N7MA 3GH3A 4RIEA 1CS4C 4WLFA 1J5PA 1PR6A 1T2FA 1GU7A 2R25B 4DABA 4JB8A 3MWEB 4UUBA 4DPKA 3A58B 5LQMA 2AFIA 4KMRA 3A1WA 4X3PA 3L8CA 5B4UA 4E46A 1ZA1A 1M1YB 3C3EA 4IXTA 4KDEA 4LJ7A 3K1AA 2QRHA 1GA1A 5K0FA 1NKVA 2ZJ7A 2SKEA 1E7MA 3HB5X 2BPOA 3E58A 2BISA 3GOHA 3K5HA 3R3XA 4MB6A 1BKDR 2IOHA 3DV2A 2NO6A 3CNEA 5IAEA 4EB8A 1V5GA 5K8JB 4F3TA 1N33B 4ZANA 3IP8A 3ZWBA 5JS7A 3MFQA 1G8KA 1N7GA 1IBSA 2AZTA 1F5SA 3DE6X 3HCBA 3WK5A 1P44A 3WQQA 5JAZA 3MOIA 1L6IA 1Y8RA 3EAFA 2J9GA 1TDJA 2Q7OE 2WJ4A 4PZ0A 4Q3KA 4TWJA 4Z4IA 4ESOA 2FG7C 4NEHB 1A95A 2MR5A 4EKGA 4EJSB 3VI3B 3HDGA 3PZBA 4D9JA 4OFZA 1DQRA 5IP5A 3TRJA 4EBFA 3LUJA 5A06A 1PV4A 3NVDA 2QE6A 1JWLA 5DWDA 4WESB 2YKGA 1Y8ZA 5NULA 2IEIA 3DOIA 2REQB 4PZUA 1G20E 5DLDA 3T7AA 1R2QA 5ECDA 1KO5A 4B3XA 5JAIA 1M6VB 3GL9A 3KR9A 2C42A 4WN9B 1I3NA 1MGOA 3EIFA 3FPBA 4TZ6A 1FRVA 2VSNA 1DKMA 4RW0A 5LP6C 4BLQA 4CV0A 4RHTA 1WSBA 2TS1A 1B4DA 2I4NA 3A6GA 3LECA 1AU9A 4X1OA 5CK5A 4UTRA 4CXMA 3HHEA 3KC2A 2QMQA 1FSPA 1ESMA 3WP1B 1UPXA 3QIAA 3QK7A 4JLOA 2NU8B 1AQUA 1M9NA 1YFZA 3R7NA 1D0VA 3C15C 3FAKA 5BR8B 2C83A 3IP3A 1LLQA 1I2ZA 2C2BA 3JYQA 1JYFA 4JS0A 1P7ZA 3H11A 3UQZA 2O3UA 4CM9A 3AKYA 1SC3A 2VDWB 3EGDB 3A9WA 2X0IA 4X93A 1OCEA 3K9NA 3D3QA 4J91A 2Y8EA 4QELA 3X1KA 2XNDD 3S2GA 2XGSA 1U31A 4AWXA 3PDIA 1BW9A 3FHJA 1NJ1A 2Q99A 2WJJA 3MGBA 5HKLA 1O96A 1U4SA 1RJ9A 2F00A 4FYKA 1PQWA 1V8OA 1PFYA 5SZHB 2OY0A 2QSYA 2W6JA 2F8MA 5LQKA 3EF1A 4JI6B 1KP3A 2FQWA 4G8BA 1IHPA 4YJ3B 3W8EA 3PCTA 2J9FB 3SGLA 1K6EA 1UPFA 2UVPB 3I8XA 4N3CA 1N9KA 4N8SA 4TVKA 5IBPA 3PFHA 4BNVA 1DZIA 1EB9A 2ZOSA 3ZCSA 3H9JA 2BZGA 2WSLA 3QMVA 1KFJB 1SHTX 3SMQA 2QW8A 3ULKA 5ALRA 2JBAA 4F4UA 1APBA 1EWRA 3RJMA 3LGXA 3NBMA 4IIJB 4AJ2A 4OHRA 2ZYUX 3ZI4A 3W3ZB 5E9WA 2VZEA 3R3UA 4CLOB 3LP5A 1Y8AA 3MQ2A 3OA0A 3T1NA 4EG5A 3RR2A 1RYZA 2YVAA 2WDPA 4MW1A 1VXOA 4DMUB 4EWLA 3G2LA 1HEIA 3C0KA 1P2DA 2JGDA 4TN5A 1UJNA 2EF0A 4C5AA 2JIPA 3W2TA 2BKLA 2C1EA 3NGXA 1R4NA 2LIPA 4AN0A 2NLOA 3F7NA 1B6GA 1BSVA 4M76B 4MVYA 4Q3DA 4Z0PA 3ZVNA 1QAMA 1G9SA 4G2TA 5CTAA 4QO7A 1T24A 3HB1A 1RI4A 2VWPA 5AVTA 3O93A 1NVVR 4GOKA 4JBIA 4WA7A 3T12A 4AQ7A 4HWOA 1V6AA 2QNBA 1ZJZA 2DHRA 3L0OA 3V8VA 4EATA 1EJ2A 2OG2A 4G4JA 4RK6A 4E0BA 3IVRA 3ZH9B 4TXLA 2JB9A 3AR3A 3UV6A 4OHVA 3VPDA 3X1ZA 1NQAO 4L75A 5J3JA 5FR2A 4Q9NA 1LNSA 1YB6A 1Q0RA 1VYHA 3HDTA 4NP6A 4ZARA 2JLQA 3I4FA 4KV7A 1LDNA 4U9HS 1K5DA 4W9NA 3IIEA 1XKQA 5EMJA 4DN6A 2UAGA 1R6VA 1KH3A 1CIJA 3OCUA 1RCUA 4WUTA 5CVVA 5FRDA 2GXQA 4PRKA 3JASB 3HYLA 1UXKA 1K7FB 4IIBA 4DEVA 1ISIA 3GQBA 3VKGA 1T29A 1K6JA 1KZYC 3MF4A 1DC7A 1MNQA 3R24A 2W2VA 1QPBA 4AXBA 5LN1A 4FDAA 3QXXA 4H60A 3ZE7A 4TXMA 3SU8A 3JZAA 3R0IA 4PZAA 5IJZA 4GXNA 5ITWA 3DOUA 1AX9A 2SHKA 1UZUA 4B74A 1KY5A 1NONA 1T8PA 2NQ2C 2J85A 3M1YA 1RRFA 4P81A 3RGWS 5IT5A 1TZJA 2FR1A 3DZBA 3KBBA 1U3FA 2QAJA 3DONA 3NX4A 3QKSA 4J4HA 3UMYA 1Z0IA 3PPIA 2R6HA 5CA1A 1MW8X 3LW7A 4XYEA 3W2FA 3O4JA 4MLDA 1ZXXA 1E1LA 2J1LA 2QLLA 2V58A 4MQ5A 4PX5A 5DOVA 1H6DA 3A05A 2QAGC 2XE6A 5JMTA 2JGMA 4LXQA 3OZTA 5EJ9A 1T2VA 2QMZA 3ZDQA 3ZWWA 2W2LA 3JRXA 2IRWA 2RGGA 2ST1A 5A62A 2WJWA 4PC7A 1T8TA 3EFEA 4FOOA 1M5TA 2B8NA 6NULA 4NCXA 3WHKA 3LUHA 5DNUA 4CQMB 3IPCA 2HUNA 4AQDA 1ISJA 5AVXA 3OESA 5IVDA 2WYVA 3T4UA 3IR6A 3Q8MA 4NE2A 1JZSA 1WVGA 4RHUA 1SFRA 1K89A 1N0VC 4HBZA 3LH5A 5BQFA 4NMMA 4TVOA 3AKCA 2FW9A 2OOSA 5KVCA 3IP5A 3MYYA 3IFSA 3ZD9A 2F43A 3L84A 4U8HA 5DLPA 3DMRA 2KBEA 5F64A 5B7GA 3FPHA 3ESDA 1AS0A 3HJFA 4OP3A 1JQJC 1KP9A 2HLDA 1Q0UA 2IQIA 1UMDB 4UPVA 2EFJA 4E07A 5BVGA 4E5NA 2WUDA 4BC0A 2ZRFA 3K1TA 1IAVA 1TF7A 1FFCA 2P9HA 5KVVA 3F3SA 2MCFA 5DN9A 4GPIB 2GRJA 5B6IA 2W4IA 3RKRA 1KS9A 4KMSA 4DRXA 1Q2XA 2A9PA 3E3OA 1Z18A 5K01A 5FTLA 1QYCA 4FD3A 4TV8F 3TJRA 1WF3A 4V1CB 3WB9A 2HWKA 2AYZA 3P52A 2AUTA 4HZUA 4C08A 4DMFA 1KI9A 4MS4A 4OXXA 1W36B 3CN9A 1YAHA 4RMJA 5KNCD 1XMQB 1HNWB 2HX1A 3RWOA 5I9LA 2QA5A 1T0BA 1WUKS 5GJVC 2VDNB 5CYFA 4BKRA 1P2GA 1QOQB 4I46A 2FJUA 3MJDA 4DTIA 4B8YA 5IKPA 3K09C 1NJ2A 3CGGA 4AY3A 3P96A 1FA9A 3GK3A 3OZBA 5BXYA 2ZROA 1TGYA 3O1IC 3LYHA 3G0DA 4KXVA 5HILA 1C3LA 1VKRA 2CJFA 3C3WA 5E1DA 5A9SA 2CFIA 2VDOB 3Q3IA 3HNPA 5INTA 4PYMA 5IJWA 3UPDA 2FFJA 3HJTA 2GF0A 5DTRA 4CEIB 1B73A 1L4LA 5DHQA 4JI3B 1XZGA 3HU2A 3WAGA 4EJ2A 3M0EA 1BVRA 1I6WA 2IY8A 4GT1A 1KQPA 4EHLA 2ORWA 2XF2A 3I0MA 2B4QA 3HLTA 3HEBA 4TMXA 4GKVA 4ZCLA 3TJMA 4ASUD 1I6MA 4TS1A 4XDGA 3WB2A 2YHBA 2VYQA 3DG9A 5A9RA 5FQOA 3SEZA 1BXRA 2XMZA 1L6RA 4X94A 4PFJA 4GH5A 2EFHB 3I3SR 3BZWA 4YR9A 3NASA 3CVYA 2E0IA 5HTKA 3KKLA 2JDIA 2J9ZB 2XTAA 4IJQA 4W8OA 4FWTA 3ZWAA 1HG1A 1CBUA 1TPZA 2AC2A 3KE9A 4U5QA 5K09A 2IP1A 4TTTS 2HF7A 4B7XA 3L4JA 2C5GA 1R64A 1XRNA 3LFHA 4B3RB 1G5PA 1N9ZA 4JSRA 1IEXA 3R9WA 4E2YA 4XWTA 1QIGA 3VZQA 3WL5A 3IHLA 4HNQA 4HWTA 5IAAA 2Z6QA 4W9MC 3QPBA 1RPZA 1XTIA 1T5OA 2VDLB 3G79A 4GLOA 4KWHA 1PJCA 1ZMRA 4NBUA 4GS5A 1XQXA 1P33A 3IUNA 1NE2A 1QG2A 3IQHX 1PS8A 1OBVA 3ZQUA 1A72A 3NQ41 2PKEA 3LKVA 2A9QA 2R6AA 1IZ7A 2BGWA 1CU1A 1JECA 3VKWA 1A4XA 3ZHTA 3I6ZA 1JYEA 1Y1PA 3VGPA 4DNOA 3AF5A 4Q4LA 4EPXA 3PIRA 1X92A 1Z4MA 2HJ9A 1VGQA 5K7SA 3DQZA 4FMDB 1ABEA 2D54A 2RCNA 1U5BA 4Z9XA 1QOPB 1PSWA 1ABBA 1GCUA 3FLMA 4DLXA 5BMOA 2CLIB 3GROA 3NMUF 3OIYA 1R9MA 1I0IA 2NZWA 4KQ6A 3FGOA 3KKZA 3MBOA 1ECBA 1W94A 3BMNB 2A78A 3P0EA 3PGKA 4NYIQ 5EIOA 2R62A 1HOXA 5DASA 1K8RA 3BSYA 3EMBA 3FPLA 3QIVA 4FOPA 1H9AA 2D06A 1I3CA 4E03A 1NYTA 4QVIA 3WQHA 1AKWA 3SKYA 2Y6UA 4A8JB 1YBHA 3ZXSA 1JJFA 2IHNA 2BR3A 4E32A 3PBKA 4YXWA 4CCYA 2IXGA 4N0PA 3C6XA 1OF1A 2VH2A 2FP4A 4PIMA 4R2MA 2AQIA 4UTPA 5A5DA 2GWHA 5MGBA 1E2HA 3F67A 3KZNA 4CU5A 4IWYA 4BZWA 3RSHA 4D3XA 1WV0A 3Q41A 1Z4LA 4JU8A 1PUJA 5L7TA 1O5TA 3AR6A 3FNRA 3UA3A 3D3WA 3DZGA 4EA6A 1OLUA 1UC9A 2GZAA 2BUBA 3ESAA 3LCMA 1Q7TA 3M6LA 4PONA 4Q19A 2EF1A 5CFOA 3GQBB 3RE1A 4NNJA 3PWZA 4FWIB 1NXPA 2D0OB 2F48A 2IPLA 3N2GA 3JD1A 4D9FA 5HX7A 4TWAA 3OX2A 3S28A 4FC7A 5JJBA 4KC0A 2WV7A 1JA1A 5BSEA 1VJ0A 1XZLA 4QD3A 4ARZB 2N42A 1BXKA 1IY2A 4R9NA 3C7KA 1BYIA 3QX8A 4UUNA 3WFJA 1R3DA 2DWOA 4N3BA 4F4JA 5JY1A 3DMTA 1N3YA 3UICA 2HRZA 3A06A 3WK8A 2WUVA 2GK7A 2R4TA 2RBKA 1XN4A 1FVXA 2HD4A 3CNHA 4KI0A 3JRWA 3VDRA 3DO6A 4CKZA 2Q2OA 4BX8A 3KR0A 1DINA 5KCMA 3IXLA 2WVJA 1LVGA 1NBHA 2EBWA 3DOEA 4V24A 5DBFA 1RSZA 5DP2A 2PFSA 3EASA 1IZ8A 1DC5A 1O4VA 1O6FA 1QE0A 1T34A 3EBPA 4IDFA 4QQFA 4OYLA 3EIWA 4GOJA 4CKEA 4C88A 5KNBA 3OOJA 3UFXA 4RIHA 2UKDA 3FUUA 4OK3A 4D74A 2IFTA 4KWCA 1GZ5A 1XGKA 4B3TB 1FS5A 5D3ZA 5LP6A 3CU5A 1JA9A 1H5UA 4QBGB 1TO6A 3FOCA 2HRBA 4MKXA 2B92A 4QUIA 1PYDA 4B6FA 2ZM5A 1MH9A 1A9TA 4BBZA 4GM0A 3KHSA 3MSCA 4ZCMA 5L51A 4FZVA 4O4LA 3ML1A 4HK4A 3RS3A 3VR0A 4AD8A 4FYVA 2A33A 4Q1BA 3CZCA 4NRDA 3KLMX 2GN8A 1H8EA 4I5GA 2YWHA 2OPBA 1PQUA 4A1FA 1PFGA 4XH9B 3HVRA 2WKSA 3RRFA 3DUFA 4C4XA 1OH6A 1GY8A 4M0LA 3LYAA 2VUTA 1YZHA 4LIPD 1EDZA 3FMVA 3IMGA 3LBYA 4MCJA 1C7EA 1ZS9A 2MOKA 1F0YA 1S1MA 4AG3A 2FEKA 4Y2JA 4B4WA 4MWGA 3FNIA 4CG0A 3GLGB 6AT1A 2GTHA 1OYYA 1KI4A 4B3CA 3TTTA 1AQ6A 1T13A 4QTXA 5ICMA 4NKRA 2ZUFA 1W581 3EF0A 5HBRA 1M1ZA 1Z74A 3OPXA 1X0XA 2ZRKA 2E9SA 2G67A 2BFNA 1YXMA 2H6EA 5G4LA 1TE2A 2E1PA 1Z13A 1BMQA 1GRQA 1UBCA 3H1BA 2PV0A 4MUJA 1MFZA 4YCBA 1FTYA 1ZH4A 3MMSA 4J4TA 5HR5A 4DEXA 1U8UA 3K96A 4OXKA 1RJGA 3D4PA 1MB0A 2WHRA 1U3DA 2B1JA 3LK6A 1JQLB 4LRSB 4WEQA 2I67A 3WZ2A 4YV0A 3Q5DA 3C3PA 5AKIA 3TAUA 2GUWA 1E1RA 1ZK3A 4X00A 5U1PA 3SKXA 1M6WA 1F1BA 3B7GA 3LUCA 3T4XA 6REQB 3MJVA 1FFDA 2UXCB 3STXA 4RA9B 2A2ZA 4I50F 4D9MA 3Q8XB 3VUEA 3IEKA 4UMDA 5JAHA 1QH9A 5D7NA 1LQUA 3F9IA 2XD4A 4R83A 1Y5NA 2Q2QA 4IEEA 2A5JA 1E2KA 1PSZA 3AW9A 5IDQA 3E1SA 4IWXA 3I4LA 1P5HA 1P1RA 4FR5A 2XRMA 2IEAA 2I03A 3K0HA 3U7FB 1FEZA 1IXSB 3RRYA 3UUWA 4RA6A 4WE3A 4MRAA 4A2QA 4MUKA 3B6MA 1XFDA 2ZBPA 2Y1OA 3FMOB 4TUYF 1KDZA 4OXNA 1KYZA 3SJAA 5HSGA 5KYXB 3EOAI 1QONA 1I7PA 3ZCPA 2ZSIA 1BXRB 4AMBA 4G1UC 3UAOA 3FNBA 1YT5A 3L05A 2R1VA 3QI2A 4KSCA 1ZU4A 4XJSA 2HPHA 2CUNA 1QQ7A 1MO6A 1JS1X 1LLUA 1UKAA 1I3MA 1C9NA 4UU0A 1I2CA 4LMRA 2WJPA 1RMTA 3PJEA 3RS4A 5J58A 5LZ4A 4S2UA 3LXXA 3NYIA 3T3PB 4B33A 3GBSA 1KOJA 3GRFA 1E4YA 2WAYA 3H9BA 3DVRX 1JPJA 2AOVA 3ADKA 4D56A 1SIOA 3AP3A 3LQFA 2GM4A 4LFBB 1I2MA 3DL4A 1NY5A 3AF1A 3HKDB 3LPLA 5A4JA 5C37A 3KLOA 4WI1A 4AW9A 2XA2A 1JEDA 4L7VA 4CUJA 2IY7A 3MPUA 3LU1A 3EDQA 3F5QA 1IWOA 4ADSG 2QAGA 4R98A 2QAIA 1W5EA 3CM0A 3TINA 4A8TA 3BMOB 3BRWD 3U37A 2Q6KA 1YRWA 1AMNA 1OC4A 2PANA 1L7DA 4U9IS 1F3LA 2F7SA 1V1MB 2IHTA 1XJ0A 5AXBA 2QYOA 4DA9A 1K66A 2HQOA 5JWHA 1DEHA 4CUKA 5DNCA 3E82A 3C7CB 4JOCA 5DHFA 1RC8A 4V2UA 4MROA 1EX7A 3IURA 2XDYA 3QSGA 2CE2X 5F5NA 1CF2O 3DL2A 2IUEA 2NU7A 3O21A 2ADOA 1Y1TA 2YASA 3KB6A 3E5HA 2GBLC 1EZ4A 3DJYA 3WO0A 1O4WA 4BVEA 5IZCC 1GYPA 3UAGA 3LHKA 1VSBA 4C0LA 3DKRA 4F9EA 5JJ5A 1E3TA 4MVJE 5EP3A 1ZEMA 3DB1A 4HDNB 1O6GA 2AZMA 3LY8A 3GEDA 2VTDA 4Q1EA 5JCPA 3BJMA 3H6GA 3TYXA 3HLKA 4QUEA 1KO7A 1TU3A 3A14A 2ZRGA 4V0LA 5B2FA 2HUPA 3BULA 4ZEXA 1T1RA 3FSGD 4U6SA 1IZYA 1O6BA 1VI6A 2VF8A 1R0XA 4XW2A 3S1AB 3VTZA 5JTUA 4LC9A 4WBXC 4YH1A 1FMJA 4D9BA 4BQEA 3WY9A 3RTBA 2ZJYA 4DJTA 4DLLA 1KVTA 4NK4A 1NQWA 1ZD3A 4NS4A 4LJAA 4WNYA 4DUPA 2CL5A 2LCFA 4NABA 5KYKA 2VEDA 5DWQA 1JB9A 2Q0XA 3NETA 1ZOIA 3AKDA 3L82B 3IERA 1C0IA 5A5EA 1IQRA 3BGDA 4D3FA 2VTEA 4FE7A 2WR8A 3ECAA 1FUEA 3R5XA 1KKMA 1P2FA 4Q3AA 5JAMA 2I3AA 1CRWG 4B3HA 1OXUA 2B9EA 5HCIA 5ICSA 1SKMA 3OJWA 1WEKA 1KY4A 4F04A 4JJEA 2O1WA 2QUZA 1JMVA 4F1WA 5H4GA 1A2KC 1OHHA 1EUCA 3UUFA 2W37A 3VYRB 3AKZA 3HO6A 3L0PA 3PRHA 3RV4A 2X8WA 4QPDA 3GLFE 4KLCA 3A04A 2AS0A 3MJRA 2ZYTX 2XT9A 4B3GA 1XN1A 1JT9A 2YXBA 3T5PA 3UMGA 3F3YA 4B6PA 4MVJD 1ZHOA 4DQVA 3EZ7A 1VE5A 1YBAA 4H2DA 1Z22A 1X1RA 5BW5A 1NULA 2YJ4A 3H8JA 1DBIA 1WSDA 3PQFA 2CNOA 2NYRA 2ZWIA 4NZYA 1QQTA 1SRQA 1U0HC 4AZ3B 4R8SA 2J7PD 3ZWMA 5EVJA 1CQWA 1PR0A 2FU5C 3QSYA 2GFHA 5JHHB 1ZI8A 2HH9A 5K6AA 1B0PA 3DW1X 3SLKA 5JXGA 4GBMA 3TB4A 4R2KA 2NYAA 5GJBA 3H5NA 5ALYA 4J6FA 1X86B 3IIKA 1RXYA 1LWOA 4JKIA 1RKBA 4PCVA 3O1JC 4P3NA 3ZD8A 2C2XA 3ESZA 3IBYA 4JLWA 2DECA 4LZLA 4ILEA 2E5WA 2PM8A 1K86A 4HMQA 4I9UA 4BFXA 1FSSA 1L7MA 1NXWA 3KQNA 3A9VA 1QIKA 2XF8A 3NTVA 3RI3A 1BKYA 2OYCA 4PC2A 1JQKA 3OT1A 3BEOA 3UWMA 3BJEA 2DSTA 3BIXA 2VT3A 1N2CE 3UMVA 1Y6GA 2JIOA 4LBWA 2PT9A 3PKJA 3PHCA 5CX1A 3RODA 3WYEA 3PNVA 9LDBA 4OM7A 3V1YA 2ZQ5A 4TYYA 4D79A 2Y0DA 1VJ5A 2ROQA 1BS9A 3N8DA 2O2XA 1TEXA 1U11A 2OPHA 4BZXA 3IJEB 2O23A 4RTOA 4LMPA 3KPUA 5CH5A 1Z5ZA 4OXQA 3L6UA 1GUBA 2J87A 1S6YA 4HTFB 1GNPA 3JAWA 3KZMA 2W70A 1KP2A 3NORA 1Z9BA 4OBWA 1JJAA 2BFCA 2BEUB 1RWQA 2AWOA 2Q5FA 3HCEA 5IJ0A 3CKMA 3WDSA 4I9HA 1MX1A 3GDWA 4NYIR 1A3CA 1MBZA 3SJBA 4H1UA 3HYTA 4IZOA 2WD7B 1H0HA 2DBYA 3ZJ5A 4ZREA 2J4CA 4X54A 1A5ZA 1S9DA 3RUHA 1PDOA 1BGVA 1UBFA 1GTG1 3WGOA 5JEDA 3S1LA 2PTHA 3RFCA 4NENB 4IICA 2DQ4A 3WGLA 4IG9A 1US8A 4OIMA 1E69A 2LRHA 4OFBA 4EEZA 2YCLA 4FZ3A 5LA6F 5J1TB 1P1FA 2PT5A 3CLTD 5IC4A 4PO9A 2FEOA 4ALJA 1T91A 3AXTA 3PPWA 4MYUA 3OQBA 4FHZA 1V1RA 4E5DA 4EUSA 5KPJA 2J3KA 2MYUA 3SF8A 4L02A 1ODIA 4K05A 5F5LA 6ADHA 3MJEA 4MS1B 4NMXB 3A6LA 4CM6A 4ZO7A 2CDNA 1JG2A 1BN6A 4PWZA 3ROFA 4QJ5A 4CCWA 4DANA 5J2UA 4YRFA 2CUKA 1NN0A 4G4SP 4W1RA 1BFDA 3CZ5A 1V4VA 2WT8A 2ZSDA 4XCXA 1SH7A 2EFYA 2XUIA 2HCFA 3I1YA 5BWMA 3CVVA 5FFFA 3Q4GA 3O8BA 2Q28A 1BWPA 4BNKA 3RFXA 4FQ7A 2C3UA 4EMSA 3B1XA 4XWKA 1A2BA 3EHEA 2I76A 1RWWA 4Y1RA 2C61A 3FMPB 2LGJA 3NNSA 1RQ7A 3I6QA 3PQDA 3W5HA 1SZJG 3BIWA 3PGXA 2PKXA 3PPYA 3QVUA 4RQAA 1IJFA 4XB2A 4GMGA 3W6UA 2IZ7A 2PH7A 1IN7A 2V5UA 1A7JA 5BR7A 2AFHB 4J8PA 1B93A 2OZKA 4BNYA 3V7FA 4BNMA 1H1LA 2WJHA 5AHXA 3CVUA 3FFTA 3DCYA 3SC4A 3V55A 2G07A 2OUIA 5G40A 5HMMA 3TMYA 3ZQ6A 3ZTWA 1R9NA 4Z4CA 5A03A 2PD4A 2Z4SA 4ON9A 1A9OA 2ZB4A 5FL3A 4JYAB 3L7DA 4AFNA 4M21A 1EFVA 3UH0A 4A2WA 3ASZA 1TNDA 3ELUA 3LY5A 3TTVA 4HAXA 3CYFA 5AKEA 3D1VA 3R3WA 1WKCA 4XFKA 3P2JA 1JU9A 4J1TC 1XPUA 1URPA 2RHRA 1O8BA 5E2IA 2ZIUB 2ZYHA 4GKBA 4UHKA 1I3OA 4B45A 3RK0A 3R7WB 5IMBA 4QEDA 1Y4DE 4PS0A 2GZDA 3UPUA 5ABPA 4IIHA 1F14A 4KZPA 5DW3A 5CCBA 1ONSA 3QJGA 4ETWA 4HGPA 1VCHA 3GGDA 2WFAA 2J4FA 2OECA 1R6DA 4WVFA 3DBLB 5KDDA 1MC1A 2JFXA 2NO4A 1Y89A 2XQKA 3FZGA 1R5BA 3LPAA 3SWWA 2VP4A 1WPQA 3BREA 3RU2A 4OJKA 3MRVA 1GTZA 2FSIA 4FFDA 2ZPTX 4HSGA 1FNBA 2E85A 2ZS9A 5AP9A 3SQNA 1GQOA 1LX7A 3AHHA 3HUFA 4JT9A 3IL2A 4WD3A 4UC0A 4PQYA 1OI7A 1NUSA 1O94D 4WSOA 3CF2A 3L0DA 1DJPA 4CPDA 1ZH2A 1W76A 4G1BA 2MR6A 4MVJF 3UJNA 5ITSA 2HMTA 1RFLA 2YQ4A 5BSMA 1P1BA 3TZEA 2ZE7A 1J97A 1BC5A 1QHFA 2OHJA 1Y81A 2QMEA 4HVAA 2AQKA 3K6JA 1U0JA 1GQRA 1LY1A 1W2GA 2MSWA 2R8YA 1GG2A 3C16C 1EUZA 1ESEA 4KNVA 5AJZA 5AQEA 4E14A 1DJMA 4P38A 1VKZA 2Q8QA 1QHSA 2W6ZA 4JXXA 1DJQA 4JVSB 2C5HA 3OO0A 5E0OA 2EYUA 4BVGA 1XP8A 2KBFA 3NDJA 2IBMA 2ZRBA 1ECPA 3ORYA 4XUGB 1N2SA 3UJBA 1YZ3A 4X20B 5BUCA 3MAAC 2F9MA 5LZ2A 4MVJM 3FOEC 1GLGA 5SV2A 4XIJA 1E61A 1YF3A 1FJ2A 1HT3A 2ZJAA 4Z0NA 5JD3A 4EGCB 1DRKA 4DUGA 3KQKA 5JFTA 1VE9A 4NI5A 1FFHA 2J9YB 4LYHA 1VHWA 4RAQA 4DADA 4IVRA 2HT1A 5C8XA 2C2MA 4EKIA 5EI5A 1IOVA 5FBHA 4QU9A 1JDJA 2ZE8A 3OQ6A 1HEUA 2C97A 3NVAA 4R1UA 5I4IA 3A3PA 4A0HA 4KXNA 4LRXA 4P2BA 3I9FA 3RSSA 3R75A 3FPFA 4RETA 5AI5A 5IBRA 1S3SA 3CRNA 4PYQA 1Z0SA 4ABTA 1L7XA 3N07A 3OQOA 3LV8A 4ZI2A 1DAPA 1DEKA 2F4VB 1ELOA 1F06A 1SVWA 2J0SA 1JHAA 1JIIA 2Y1DA 5B64A 1L7NA 2HBYA 2IZ5A 2V8BA 3AYXB 3EBLA 1C4KA 3I6IA 3KO8A 3LMKA 3OD5A 4RC9A 2PQ2A 5FBQB 1Y5IA 3DEFA 3SQOA 1GTJ1 4HLQB 5E9AA 4HVLA 1JJVA 4GL4A 4C4AA 3BERA 2X14A 3GBPA 3MRSA 3ICOA 4IO0A 1ONNA 1VECA 3F7MA 3NW9A 4JI5B 4JI2B 1DRJA 1H2RS 1GHTA 4H7EA 4X63A 4JQYA 5IAGA 2PD3A 1RT9A 3EEQA 1UM9B 1NBMA 3AFHA 1TQ4A 2GH1A 5CX1B 1J8DA 1GCAA 2I2BA 4PIVA 3GJ4A 3W3AD 3C6MA 1XA4A 3Q88A 5D3MA 1N25A 1P9NA 5E7MA 2P6UA 2RIPA 1BXGA 3LTEA 1OV6A 2AHOA 2OV2A 3GXOA 2JGKA 1ZAKA 2VYFA 4NHOA 5KX5B 2W6NA 2MSLA 5DLEA 4D9NA 1GGVA 1RPJA 3DL7A 3U7JA 4ZYLA 3FPSA 1JLHA 2JGFA 4A6XA 2QI9F 2H8KA 4YJ2A 1RLIA 3A6ZA 3PL5A 1E1MA 3NDPA 2QG9A 3JRNA 3B85A 1GTRA 4NU5A 4NFHA 4XTRA 2DKOA 2RBGA 1U2GA 1Y7HA 4MV8A 1YL5A 1KYVA 3AWIA 4ZYVA 4ZN6A 5KHOC 2HLHA 1VMEA 2Q1SA 4UHEA 2VZ8A 5JVDF 5LL6P 5JNTA 2M2IA 1ULHA 4HGOA 3OEHA 2GBLA 4K40A 3WX0A 1Q7GA 1QV9A 3AERB 3WIDA 4IFBA 4F2WA 5CITA 1YU6A 4MO2A 2GVDC 3ND5A 2PCJA 4F8EA 4DSAA 1FTNA 3ELWA 4FQ5A 1QGED 1SIWA 4J0DA 2FFQA 2NV0A 4Y1FA 5FPSA 1YDMA 1Z12A 4I8DA 4UNSA 5C4MA 1SCIA 2VP9A 3DH0A 2AMLA 2B36A 4EG4A 2FN7A 4DYHA 1TYZA 3GNLA 5C7YA 5K3OA 3W2EA 4EG6A 2INGX 1XK6A 3A6JA 1U3WA 1YL7A 1XMVA 5AH0A 3IILA 5EJ2A 1PHPA 3RV3A 2CLMB 2MYNA 2OP0A 2X19A 5T4BA 3U5TA 1W4RA 4OO3A 3UNXA 3I72A 1UINA 3L5OA 3SF8B 1O6CA 4V3BA 5E6UA 1AOXA 5GTDA 1N3IA 4W5HA 1CNFA 1J8FA 5D6OA 4KR7A 1QHYA 4OJYA 2GKSA 2OESA 3PWTA 3X1XA 2HGSA 3DPSA 3UN1A 5AVYA 1ACMA 3ZQJA 1PT7A 1QX4A 2VUHB 3DE2X 1M2JA 4UATA 2B4AA 5L8VA 4QTYA 5ARBA 4B8ZA 4LX8A 1L3CA 2NUTA 3ETEA 2ZP1A 2RHCA 3LBAA 4Q9HA 1CUZA 4F3CA 2ZE6A 3HYRA 1ATIA 3LY7A 3W5JA 2ZCUA 5ARCA 2QEQA 2VT6A 3D1LA 2B83A 5FOXA 5GM2A 2E55A 1RAHA 2XYGA 3QFRA 1NL3A 1OVMA 3Q1LA 2L2QA 1ZVJA 4KMMA 4N48A 3O6VA 3NATA 1MQAA 2PRZA 2AG8A 3WWYA 2HI0A 1KZHA 1W1WA 1AKEA 3IUBA 2QN1A 2DBRA 3EXEA 3RC2A 4FDLA 1EFCA 1Z7WA 3L77A 3DL0A 4HGYA 2WILA 4Q3NA 1FSGA 1RD4A 3AEQB 4TMFA 4D9HA 3W6ZA 1E79D 1K0UA 1SEPA 2GAIA 4EPWA 4MB0A 3VR2D 5EP2A 1T4CA 2OXRA 2X7HA 1XLUA 2XCLA 3TMAA 3U0BA 1QKIA 4ZFNA 2P3QA 2ERYA 4TKVA 3SQWA 1VJ1A 2W43A 1DUSA 3IBFA 4MKRA 4Y18A 1QHHB 1NWHA 4JP2A 1RQ2A 2QN3A 3OZXA 5EAIA 1ZGHA 2Z09A 1AS3A 1AF7A 3MS4A 4D45A 3UK1A 1MTZA 1TIBA 3HSYA 4OHPA 3OQPA 5LVAA 5AK4A 5IULC 1Z5VA 3J81A 3ZC3A 3R09A 2GETA 5I5GA 2NO9A 2JIZA 1KY3A 5KEIA 1O87A 2BH9A 2OZPA 1Z8NA 1F3OA 4WKPA 3GZNB 1TQ2A 3FW1A 4HTAA 2HWWA 2YY7A 4REQB 1D2HA 2NO7A 2VLBA 2OHVA 3UJCA 2V59A 1AC5A 2Q9AA 3NC0C 4PEVA 3CUUA 4OKIA 4QAJA 1Q57A 3RJTA 1YJ5A 2O8FA 4F9FA 1MJNA 5COQA 5IVPA 1VG8A 4O8CA 4DQKA 5A6SB 5JASA 1ENPA 3DHEA 2P4EA 4LPKA 3QP9A 3IPLA 4K9QA 5BSKA 1J0CA 5CLFA 2I8AA 2CXHA 2K6GA 3G02A 3KXLA 4HQKA 4IGFA 2WWVD 4BNGA 5AW8A 2PUBA 4OA8A 3VH3A 2VYNA 1PFWA 3GT0A 3OUZA 2Y1GA 4UM9D 3W5CA 4J4BA 4Z4FA 3OMWA 4QVKA 2PS1A 2R11A 5F3WB 2WB2A 4E5VA 3QEAZ 4BAZA 4Z99A 4FNMA 2XODA 1U8AA 3SJZA 5FI1B 3V4ZA 4KYTA 5KWJA 1M5UA 3FVTA 1IM2A 3EAQA 1PK7A 3MRXA 3HN6A 1JDUA 2OCXA 2WUFA 2BGJA 4HFRA 1Z07A 4UUQA 3KQYA 1G60A 1EGHA 1XU4A 2IHBA 4WIAA 4Y0VA 1DWOA 3ZDYB 3BMQB 1NR1A 3HP7A 3O2NA 3RU7A 2P1RA 1CNEA 1R10A 3IA2A 4HWKA 3U60B 1ECJA 3VU9B 4S04A 5J4VA 2OXTA 2CB0A 3ZGOA 5AW4A 5JQWA 3L4BC 2AYYA 4TROA 3O2SB 4YP0A 5FJIA 5DMXA 4DQ0A 1C1YA 2X9QA 1M2NA 4IDNA 4TV9A 2VYVA 4BMCA 5CYOA 1KMNA 2QD4A 1KERA 1DTEA 5HE8A 4K1XA 1KE2A 1OB5A 1JDSA 3EULA 3WGHA 1OPXA 1XVVA 1JDZA 2F1JA 1NW8A 4FC6A 5T41A 4AJKA 4RCZA 2AG6A 5JSYA 1FFWA 2PBLA 1C3OB 2Z3ZA 3OOEA 1OOEA 1CJKC 3COVA 3IT2A 3QV1A 2V6FA 4IGAA 1NPDA 4YP9A 1AO0A 4IUCS 4YYZA 3PG5A 1IE3A 2FW7A 1RJFA 4UDNA 3WRYC 2PSSA 2W6MA 3AUUA 3LCJA 3DDNA 3IQDB 4HB0A 3TEMA 1YC5A 2MTBA 4ZVPA 4DBZA 2C0PA 4DG5A 4B3JA 3LZ6A 1U1GA 5JLAA 5AVWA 10MHA 2IIPA 1CVRA 1FL9A 5JRDS 3OQVA 2XUOA 5A7HA 2C5SA 5F3RA 4BMSA 4BLVA 1ATZA 1PWZA 2H1LA 3WL7A 1E9VA 2XHZA 4ACBA 1HT0A 1OT3A 2XVYA 3X1YA 1T2CA 4LY9A 4CKWA 2H4YA 4C3UA 2HTFA 4QXOA 1VPDA 1RYHA 2DX7A 3U62A 4GZ5A 1VBNA 1Y1QA 4ND7A 4FONA 2JHAA 4RPCA 1Y37A 1OI4A 2JAOA 5AKGA 3AJ8A 1QTRA 3B9BA 5ENZA 2IDKA 2ZVPX 2B4TO 1SG0A 4V02A 5G02A 3UT5A 2HK9A 4R31A 4FFNA 4RXUA 6YASA 4IJ5A 5J4HA 4YK7A 1KAQA 1EFKA 1U5AA 2M9MA 3R3YA 4IDOA 4JHXA 4ZQHA 3G6KA 3JARB 4O4IB 3QF4A 5LQCA 3GEMA 3ZE2B 5C0OE 3UWDA 4WXRA 2ZJ2A 1EE2A 3C70A 3FKSA 3MT9A 2AW3A 2AN1A 1WUJS 5KNDA 1N2OA 2Q0SA 4AUEA 4I81A 4R1PA 4IO1A 1C0EA 5LQUA 1ZU5A 1GADO 4ZZ2A 1S3IA 1U7WA 3T4PA 3E9EA 2IZ6A 1XDBA 3B1JA 1IXKA 3DKKA 3E7DA 3PHIA 3QXGA 3DEZA 3AESB 3UENA 3FLBA 1CUDA 4C22A 5AW2A 4E33A 3AF3A 5ALIA 2BGTA 2Q8NA 2WOOA 4HX2A 4LNUB 1R37A 3K70B 1FRNA 5H81A 1XZAA 4YRKA 2O8EA 3AGQA 3LVBA 3HDYA 3MZ0A 3HRKA 2UXBB 1OLXA 2H11A 1ZK2A 1PG2A 3FNFA 3GFVA 2NVUB 4K81B 4XGNA 1SIUA 4JC0A 1UXIA 3FFBA 1HE5A 2H16A 2IP2A 2YUIA 1EQ2A 4FMCF 2PGIA 3U17A 3W2IA 1EK2A 3K0CC 4OREX 4ZYUA 1XYYA 4IKPA 4CIVA 1W5FA 4FEAA 2FWAA 4OFWA 3KVVA 1EFTA 1HDOA 5E6SB 3UK6A 1T6NA 3ZHCA 1IQUA 1J2YA 4DPLA 5E6UB 2OENG 1EGAA 1P9RA 4MQUA 5IT9A 3ZDBA 2HSWA 5HOQA 1QK3A 3HACA 2QD3A 2G04A 3QUQA 1DBRA 3ZKWA 4DIMA 2AD1A 3L0IB 3NEAA 4FS8A 2OHIA 4BASA 1Q0LA 1VPLA 1ZJ6A 4FNGA 3MWDB 4K0RA 3U31A 1KWGA 3L8MA 13PKA 1CR1A 4NBNA 5KPDA 1GD1O 2RB4A 5FQNA 2WE7A 4FOSA 4O2RA 1YCDA 5HF5A 1I30A 1ITZA 1QOZA 2JIBA 2VPWA 1E3WA 2HPZA 1GPMA 4L0QA 2OWDA 5KYWA 2QWXA 1PT6A 4NIMA 4GL2A 4C78A 2FQQA 2VHTA 2XWJI 4B5LA 4FGZA 1VL1A 4C87A 4F5EA 3F46A 3BQMB 3SR3A 1TIPA 1I51A 3I9NA 1G3QA 1A97A 5C8DA 5ED4A 2O0MA 3C4JA 1T2UA 4FILA 4NSNA 3BHMA 3A32A 2O54A 4LXGA 4Z3OA 2YNMD 2ZYAA 1WMSA 1BEZA 4U5XA 1W49A 4D0RA 2H5IA 3IAM6 4OSPA 1R8QA 3QH4A 4FFPA 2P9YA 2IHYA 3SIWA 4ZCIA 4N3GA 5MFPA 4DZTA 3JQ8B 3PI6A 4WLEA 2CJWB 5MF6A 1PO7A 2JFPA 2ACEA 3BKWA 1QYIA 5A0FA 4NXNB 2PMDA 5ER6A 5AT1A 3HABA 5JH7B 3IVAA 3R77A 5DHAA 2V7QD 4UZSA 1H85A 3MCTA 3UYKA 3A70A 1K6IA 3DMYA 3K0BA 4WCFC 3CWZA 4MPJA 5AI6A 3FH0A 1IVNA 2H9YA 2C99A 2BHNA 1A77A 4OQ4A 2CZGA 5AJVB 4JEMA 5FORA 4XQ0A 4BNFA 4A3SA 4CF6A 2CXOA 3EQ6A 1QYRA 3I45A 4AJ4A 1LLFA 3JQQA 1L5NA 3FTFA 3PJFA 3D3KA 3CB4A 1SZCA 3TG8A 2NU9B 1C4XA 1PN3A 1J8MF 4BV9A 4MW9A 1CQPA 2XVXA 3QEMB 2GN9A 4GQBA 3ROGA 3I61A 5DHTA 1IN6A 1GZ6A 2GEUA 2PDAA 3PNBA 4BGVA 2Q5JA 5KS2A 2OK8A 2Q3HA 3ICCA 3SZGA 2IY9A 1SCJA 1G1MA 1CZOA 1CY7A 3LPMA 1A82A 2ES4A 2ODTX 3H2SA 4HGQA 1D2RA 2SNIE 3ZHXA 3N74A 3DEYX 5K0EA 1P17A 2C2OA 4XRGA 4QJ4A 1D3AA 5J2TF 5AVSA 1XDDA 4UBLA 3REFA 1M2WA 3TR6A 1XQ6A 1Z63A 2GPJA 5DNVA 2NSLA 2BE9A 1Z4NA 4OG2A 2CK3A 3LT1A 4XQCA 1F4LA 5ITZA 1I36A 2P5TB 2R6CA 3GRYA 2ODAA 3WOHA 1NVWQ 1B14A 1QXSA 2P5YA 2I6UA 2VF4X 3FIUA 3HNRA 4GXTA 3SC6A 3VR4A 4C04A 2CFOA 3W7BA 5DULA 5JCZA 3J7AC 3M34A 4MQLA 2XAUA 1ZGCA 4QGHA 1N6RA 4XM1A 4PGMA 4H16A 4Z7NB 4X1YA 1JWAB 3OLQA 2AYXA 5EEGA 1HFWA 1MXFA 1N8KA 3ZK9A 4EW2A 5KQLA 4I0WB 1R50A 3GLHA 1BIFA 3E9ZA 1FYXA 3L0ZA 3NYRA 1PYGA 2I4IA 2Y1XA 4WOPA 3V80A 4EVRA 4C7OA 5DIFA 5JNUA 2I71A 4CEJA 1HQKA 3HB7A 3EG9A 4ZMBA 5EPOA 1QH8B 3LLVA 3PS9A 4JJKA 4R1MA 3AHIA 3VKHA 2H1WA 2PG3A 3CEPB 2VNAA 2PS3A 1W88B 3EGCA 3HB9A 3CEHA 3PXEA 2QPLA 4KVGA 3TW8B 1Q12A 3WGJA 2AOXA 3L4KA 2YWEA 1FW6A 3RNOA 5A1JA 4G0UA 3WAKA 5A3SA 4D8XA 4H0CA 2FW0A 2QTZA 3LDHA 5DF1A 4QUJA 5BMVF 2XY4A 2GOYA 2XJ9A 3BGVA 2Q3FA 2VAMA 3D8SA 3ESQA 2J0UA 2QRMA 1XROA 2W2PA 1VIYA 3B3QA 3Q7TA 1H6BA 1MV8A 3DOJA 3AW8A 3FM9A 1WPRA 3WMGA 3ZYZA 3OZCA 5BN5A 2X5JO 1XHLA 3GCDA 4HV4A 2OOKA 4YEDA 5CURA 2I4RA 3Q3JB 1IY9A 4GOMD 1FX0B 3I2IA 1Y8CA 3CKLA 4Q37A 3ITDA 3AIMA 1AJEA 1PLKA 1E66A 3T3NA 4OHCA 2OUKA 4NVRA 4QPCA 1E5VA 4BC1A 5AI8A 1JEEA 4YQYA 4M98A 3SZMA 4LJ8A 1R12A 3ZXUB 3FCEA 3RYIB 4PXSA 1JEQA 2PD6A 3QVMA 5AUNB 4WW0A 2J0VA 1COWD 1YVRA 3BOSA 3JSAA 1T5SA 1UOQA 2YFKA 1NASA 1F2TB 2COUA 1RMYA 1TGVA 2Q1XA 2Y6VA 3G82C 1NDQA 4ZRNA 5SZJA 1GM5A 1I7DA 3SYMA 1XJCA 3D54D 2A3RA 1KVSA 4PV7A 1SA0A 3OSUA 3D3JA 4K3VA 4BMXA 3AVPA 5LMUB 3WFIA 4ECEA 4KXFB 2QTMA 1P7PA 1L3IA 1DRUA 3N2EA 2EL7A 1EFPA 4TXHA 5SYNA 2PUCA 5BRAA 4XYGA 2HV8A 2WHPB 1UJ6A 3AQIA 3D6UA 2FJ0A 3NBFA 4PZZA 4YAOA 2ZUTA 5ES3A 4CM8A 1QYDA 1OLXB 2KS6A 1PJBA 2LVBA 2O5VA 2RDMA 5DHSA 1GN9A 1LVHA 3M70A 1TX4B 5K3AA 1IN5A 2ORYA 4P58A 1IXZA 4RPHA 2ZR7A 2QMYA 2BC9A 4WKBA 4BTLA 4D3YA 4O63O 2ZJZA 4AURA 5LLDA 3V8RA 1RXCA 1G7TA 1YS2X 3KJIA 4FEGA 1YHYA 3DJFA 1QGDA 4ILKA 3JY6A 4PFKA 2O7SA 2PX5A 3G8AA 1DLJA 1ETHA 1IPHA 1PK8A 3BB1A 1PK9A 4J3FA 5BQ5A 1OX4B 1TTPB 2A7XA 4JL6A 4JA2A 4JVLA 3UC5A 3VQTA 4PNPA 5LYYA 5BT8A 2GCOA 7ADHA 3BICA 2ISSD 2Q3MA 3MK31 1U9IC 2VF2A 4RACA 3D4IA 3G2OA 3E9RA 4U2DA 1HFJA 2Q3JA 4IHKA 4HVTA 1A8PA 1M0TA 2GBFA 2W48A 4MPDA 4N3AA 5K6TA 3S81A 5KSPA 1B6RA 1EGQA 2W2TA 1A4IA 4QDXA 3TG2A 3VO2A 3N0TA 2YHUA 3VPSA 2BMVA 1SUIA 3LW8A 5FWXB 8LDHA 2V3CC 5IC5A 5CT6A 4RZSA 1C3XA 4QODA 4ZYWA 3HEAA 1V3UA 4ZRDA 4GWGA 4MWCA 4IF4A 4NPAA 3F74A 2CLOB 5GM1A 4DOMA 1SXJB 621PA 3BCHA 3L4BA 5HRAA 5K0CA 1U2ZA 3SICE 2AK2A 2BP7A 2NQTA 4ARIA 5ISMA 1EDOA 3UJDA 4DW8A 1PFUA 3EGXA 3LUBA 2XE7A 3Q2IA 4JOSA 4DR5B 3I01A 5LBTA 4QATA 2LD4A 3D2LA 4FFVA 4J0JA 3MSXA 3BH7A 3QVLA 3DE4X 4G9EA 4EG7A 1PVOA 3IE2A 4AUMA 2LP4Y 1NM5C 4DQLA 3DDUA 1KETA 4KR2A 1QU2A 1I0LA 1KU0A 2EC5A 1H42A 4L8GA 4Q1VA 2QZPA 3CMMA 5JPDA 2JVKA 3KKKA 2VP6A 1JBKA 3GN1A 5HTOA 2FPPB 4KAJA 1KPGA 1PKXA 4G0ZA 3RVDA 5FAXA 1AD2A 4DKXA 2VEOA 3WLEA 3GFQA 4I3FA 3A4MA 3BILA 4HF7A 3U61B 2ECKA 3GARA 3U48A 3IUJA 2FW8A 3FHTA 1GPBA 3LS2A 1J90A 3N2ZB 1ZCAA 4J07A 3HHPA 1FFXB 4QBHA 2EP5A 2HJHA 4HDAA 2ECPA 1P3Y1 4RD6A 4RO0A 2XMQA 4JROA 5D1NA 4CR6A 5IT0A 3OU7A 1X8JA 2E4AA 2IYRA 2B3DA 4HR7A 4MIYA 3GDOA 4YCAA 1TTHA 3FB4A 4ZI7F 1L4GA 3T95A 4IDAA 3GVIA 2NOAA 4ZVMA 1KIMA 1ZGAA 2WTAA 1XZ8A 4M0CA 4M8IA 1JTVA 1ZRNA 2ZAIA 3BRSA 5AW5A 2UU9B 3IDSA 1XQWA 4URYR 2WA1A 3WDMA 1W0CA 1XEXA 1E7RA 2VHXA 4HDKA 3A6KA 5IYZA 3C3KA 4B6OA 2CCKA 3KETA 2JEYA 1N6IA 4F60A 2HQSA 2NXWA 4J75A 4RLFA 3V6LA 3FPGA 2FRXA 2QGZA 1BHSA 3NAGA 5T4FA 1EIWA 3BMXA 1CDEA 2IEZA 1T9KA 4HXEB 4W82A 4ZYYA 3G6WA 2Y68A 3QVGA 4TMZA 4R2WA 1NA5A 5TS2A 1JQDA 2QUBA 4R69A 3HBLA 2O1EA 2HB6A 2J3LA 4MULA 5C8YA 1DKPA 1KEWA 3BHJA 3BGSA 3PR2B 1MH1A 4QRDA 4R2JA 3WA6A 5I01A 3MWJA 4DBLC 1AK2A 3DNMA 1J0BA 3HBNA 4GBED 2FDXA 2WWWA 3GFOA 8MHTA 3HZOA 3E3AA 3QVOA 3REGA 2FWNA 1Z5WA 1ISPA 1PEKE 3AUTA 5BW8A 4YO7A 4BUCA 1DJLA 2CJPA 1K63A 2I7VA 1QAQA 1SCUB 1OYWA 2GFQA 2QSJA 2JARA 5HIJA 1E2UA 4MARA 3SAJA 3RRBA 1ZINA 4F6RB 2H1SA 5ESXA 4L74A 4DLVA 1FMCA 1JN0A 3KUUA 2B4YA 4FZ5A 5JDIC 1T9DA 1QWOA 4BKUA 3C6ZA 5L3QA 1H2WA 1BN7A 1M1UA 3ZGVA 5I4CA 4LWOA 3JQPA 2G71A 3OKPA 1SC4A 2H1FA 2OCBA 1MORA 2GKOA 2NX2A 2O0KA 1WZNA 3D7SA 1FLVA 2QYSA 1CTQA 3L6CA 4R1OA 3NUGA 1CULC 5CAEB 2QN2A 1NVDA 3QW2A 2BGKA 1YBFA 1L9XA 1BVHA 3W7VA 3TLBA 1IEWA 2HLNA 3QJYA 1MPTA 1PUXA 3IHWA 4JC5A 1K4MA 2ODPA 3K15A 4C2BA 4E2XA 2FPRA 3ANLA 2GA8A 4M1QA 1NW9B 3ZUGA 2VOEA 4TV8B 5B58T 2P2NA 4S12A 5TB5A 3HFSA 5LIRA 1E0AA 2PXAA 4CMHA 3ISTA 3AOEA 3HCWA 1HRKA 5E6RA 4PZ9A 4ENTA 3AL0C 3OM0A 4R9RA 3FVWA 3PJRA 3VGJA 2C92A 1U0OC 2XBUA 1C7QA 1W85B 4H0NA 2ETVA 2WTEA 1RZVA 1LPAB 1SHUX 4OBXA 2B25A 2QUIA 4KQKA 1CQZA 4DLNA 4EYOA 2Q4OA 5C2JB 4RFVA 3CPJB 1NRJB 3EXIB 4FEYA 5HZMA 4IILA 4M6WA 4AF8A 4OLJA 4BU1A 1V45E 1K5GA 4DTCA 1OFHA 3UB2A 4ETNA 4Z4QA 4BP3A 4FMPA 2ACVA 1ZJJA 2WVHA 1GCIA 4YRQA 1NVXQ 1R66A 2PUHA 2R6FA 3OQIB 2RONA 5ICGA 3LTNC 3RW9A 5DTEA 2X58A 1XCGB 1OBCA 2CNDA 1LBHA 2GHIA 1VHDA 5KDLA 3TAXA 4IUYA 2ATIA 3DNPA 3G2KA 3ZH2A 2MDTA 3HR8A 4LUCA 3S4YA 2WG0A 3WMFA 5J4YA 4Q4JA 4PZPA 4FNAA 4QDTA 3NWJA 3S3TA 4EI7A 1W2HA 1N78A 1USKA 4YJGA 2I87A 4Q7QA 1IY1A 5KQRA 4WCFA 4KR9A 5IKEA 2WNIA 1V47A 2IDJA 5FWNA 1FNCA 1ECFA 3CT4A 2FPOA 1UJ2A 4MV5A 3S8YA 1DOZA 1V37A 1NN3A 3PSHA 1G21A 4MLPA 3MVEA 5CIWA 2V7GA 1IAQA 2PWYA 2A9KA 4EZIA 5JAOA 3ZU4A 3DB2A 5HM6A 2FX2A 3MJHA 3LGAA 5H80A 4YRLA 1HNXB 4BO5A 1GG9A 1G20B 2HK8A 1W75A 3I76A 4EFMA 3EXFA 2G9RA 1VPVA 4TTSA 4F91B 2NYUA 1UXJA 3BIJA 2JFHA 2E18A 3FAZA 1OAKA 3Q7SA 1IC6A 4AMGA 4B4VA 4L9AA 3ESYA 1NXXA 2Q1UA 3VYWA 4ZAFA 3TM5A 2V6MA 2DFLA 2YTZA 1NQUA 1XCJA 2JFVA 2Q6TA 2QTFA 3MXOA 4WDRA 3BWVA 1UP6A 4CN8A 5JDCA 3MIIA 5GAJA 4AF6A 1OPRA 1T0HB 2ZBQA 5FAKA 3OBIA 5I7SA 2BEVB 2NP7A 3EB9A 2VUIB 4H3HB 3AX6A 5EWLA 1FXWA 4ZOBA 5I7OA 3AFGA 3QE3A 4S1NA 2C9ZA 3M2TA 4A2PA 2V7TA 4D6YA 3PQCA 5CPFA 1EAYA 1GZVA 3DVQX 3KT6A 1XTQA 4Q66C 5DGXA 4X0EA 2EKDA 4I66A 2QI9C 5AM3A 2XPCA 4YECA 1GRNA 4LE0A 2X5XA 4O8ZA 2ZWAA 3FNEA 4UBMA 2RC5A 2XI4A 1N5DA 4PM4A 2C7PA 1WVIA 4UPDA 4GBJA 1KQ3A 1PR3A 2VQEB 5FP0A 1CQIB 4OYYA 4GYJA 4KFRA 1OJ7A 4OLFA 5B7QA 1KEKA 2BP7B 4FBMA 1W48A 3ABQB 3VDMA 3KYIB 1N36B 1WHSB 4LOIA 5TSDA 2XCQA 4RY9A 2HU8A 1UBNA 1L4KA 3WLIA 5LKAA 1DBWA 1TF2A 1E1DA 2C3PA 4G09A 4ND2A 4HC4A 4MQ6A 3RC7A 1ZR4A 1ZI9A 4MRMA 1L2TA 3LE8A 4ONEA 3RT1A 1DGQA 3ZK8A 4R8LA 4MZXA 2ZKIA 3OKCA 2G9ZA 5KSWB 1P5JA 2MMCA 5K0BA 1XWFA 1J24A 3MWLA 3B1VA 1QS0A 3VJKA 4E15A 1K3TA 5EJGA 4JUAA 4EYSA 1P45A 4GMXA 4CFZA 3TIVA 2C9BA 2ZJOA 1TPYA 1X1AA 4HAUA 2M6SA 3AY7A 3KZKA 4QUBA 2WP0A 1HYBA 1E0JA 4DCPA 1ACJA 5CG2A 1C30A 3F7TA 3OJEA 4WLOA 3UGTA 5JV5A 2JFOA 1MIOA 4GW3A 1ADGA 1NFQA 2I3DA 4M1KA 4WY5A 3RT9A 3N3BC 4L07A 5D3KA 3GRUA 1MX3A 2ZI9A 4M7WA 5SYAA 1Z33A 3FYDA 2DCMA 3AP1A 3FROA 3RVMA 1LK7A 3SEFA 3I64A 4RJJA 3UHPA 3IP9A 2QG4A 4Q05A 3WG9A 4D96A 1E8MA 1SVKA 3S2IA 5DSXA 3ZDEA 1R8JA 1WZEA 4WLVA 2BF4A 1UZAA 2EBHX 3T3EA 4B46A 5KTTA 4RVHA 1WV1A 4TLBA 4D9EA 4KITB 5EGNA 3V4RA 1N1EA 3BFPA 5EZYF 5ALMA 1IN8A 2OSVA 3MMXA 3LC2O 2XZDA 1TXGA 4WZ6A 1KK3A 1C8VB 5E38A 4BWFB 2UYHA 3MCVA 1BE1A 2W8BB 3QVGB 1Z6QA 5DGDA 2IYAA 4TSFA 2FMXA 4NCJA 2JKZA 1JB1A 2PHZA 2Q3BA 2WT9A 5JXHA 2IXAA 4BCDA 1CW2B 1JDNA 3WHLA 4EUKA 2JLYA 4DZZA 2N9UA 3C3CA 1FDUA 2JBWA 2O57A 3TIIA 3ZGNA 2ZWVA 2FKNA 5JO0A 2NXCA 4ZHQF 1G64A 5HGXA 3HCFA 3I42A 5FL7A 4M0KA 4Q21A 5GJCA 4QVGA 4I4TF 1FTWA 3KSUA 1NI4A 1U1IA 2O06A 1CLEA 1F4PA 2FOLA 3D6JA 3O3NB 2REBA 4LXHA 5CXXA 2GN0A 2KJQA 2BVNA 5IKXA 1T1GA 3KAKA 1EX6A 1WDMA 2NU6A 2YV3A 4KIFA 3I5AA 1O8CA 5HDQA 1MRNA 2OO3A 5L3QB 2EKZA 3HCCA 4GNRA 1C2YA 1LV8A 3W1VA 3LDUA 3FPCA 3KSBC 1QRAA 5DCLA 3UHAA 5FOSA 1CY8A 1QZUA 1DAIA 3H2YA 4MNTA 5AFSA 4BNHA 3M4NA 2EZ8A 1SK9A 2R44A 1EHCA 2ZSFA 3NT2A 5FBLB 1U9IA 3VZBA 1UK8A 3F6CA 2F8SA 2I3GA 5E9JA 1J1ZA 1E2MA 1NMSA 1YQXA 2P7IA 2IWRA 1LJLA 4BFUA 1XAGA 3RREA 3SX2A 1SU6A 3MAJA 1PG0A 3QA9A 3EAGA 2GZ3A 2WVAA 5EJMA 1XU9A 1JVSA 4WXMA 3UATA 2XZPA 1XTKA 3G7NA 4U00A 5GVSA 1NLUA 3R6DA 4U7FA 2TSYB 4HX9A 4IX1A 3W8NA 4BNTA 4C20A 2BBWA 4XEHA 4KAFA 4PG4A 5EHIA 4MWBA 1VYTA 4MVCA 2PGJA 3QOWA 1ZMBA 3PK0A 4PCAA 2FHPA 5CXSA 2Y2VA 3ZIUA 3CJQA 5I9IA 3U09A 3DBHB 3RPEA 5IEJA 4Y30A 4OHWA 2ZI4A 4RGVA 1T5DX 4XFDA 4OKNA 1WZCA 5AD1A 4RY0A 3N7TA 1IATA 1KE1A 2J33A 1ISGA 2ZXEA 3ZS9A 2E4XA 4DJEC 1E1QD 4MUXA 5HFAA 5KNBH 3DSRA 5KYYB 1Y6ZA 5AOCA 2JAWA 3QPVA 4G5OA 4CZ2A 3D64A 1O97D 4O2BF 3OQ1A 7REQB 1R1DA 1XLTC 2YDXA 2NTEA 4I50B 4PE5B 3T3IA 2G80A 4XAQA 5BVHA 3ZLJA 2BFBB 2XQFA 1J20A 4HI0E 2IIBA 4D8TA 4BV2A 5LQNA 3D7KA 3M6WA 1NM5A 2JF0A 3EVFA 3JV7A 4Z9YA 3KOYA 1NBEA 3AQ4A 3DP9A 3M2PA 1ESZA 2FQ1A 3FMGA 5AOBA 4E1BA 1CNMA 1XHFA 4L4YA 2Q2NA 3DZHA 5GV8A 4TUYB 2QNIA 2HDOA 4L0MA 1CR0A 1D04A 1F2DA 2FWMX 3KXPA 5CFQA 1JEYA 4M83A 4A2CA 5L3SA 4RPKA 3UOWA 3I9OA 3SM3A 5I4KA 4I8XA 4UXJA 1SBYA 5HDBB 1CFZA 3H97A 3UT6A 2NPFA 4CTJA 1QUFA 4G25A 1RBQA 4UCFA 4WL0A 2ZREA 4PBSA 1T3TA 4PG8A 1NAIA 3ILSA 4LNAA 2O4CA 1MABA 1NBAA 3T7RA 1EWQA 1QANA 3NM4A 4F4FA 4CN9A 5WRFA 3ZVLA 1UBGA 3EXFB 3PNOA 4BO1A 4X1KB 4O08A 2B4RO 1Q0QA 1OYOA 2ZWOA 2OQVA 3CQ9A 4HUQB 4S1VA 4BNLA 4C4PA 1WOYA 4I9NA 2OGZA 2FRDA 1GPWB 3E5MA 1XV5A 2JIRA 3U4HA 4JDUA 2BDUA 3ZUPA 2Y92A 1UODA 1T25A 4B9AA 3E1GA 2HRQA 3OA2A 4PLPA 2FMIA 4M38A 2KW5A 4NE9A 4AS3A 1TAQA 2W4QA 4ZVQA 4J0IA 3J80A 2WIDA 3LIPA 3OHPA 4YNBA 4I1RA 3OJ0A 3SMVA 2DPMA 2FMKA 2WYIA 2Q4EA 4L5CA 4U2GA 4LF6B 1KI6B 4TT3A 4D8YA 1MMFB 5F9HA 4CU2A 4F71A 5EPEA 3KQMA 5THQA 3PXGA 1DBSA 1WMEA 2Y05A 4L9WA 4LG1A 1CP3A 2NQ8A 3EVAA 4GLBA 2ADMA 4LVNA 4RX1A 5E3IA 3SOPA 4BBPA 5KTMA 4UKDA 2I33A 2IYLD 3IBSA 4IDEA 4II7A 4MKHA 2PUTA 2RK6A 1VKJA 4FYYA 4FEEA 4LHXA 4M54A 1WU7A 4P83A 1E0SA 4I1UA 1EFLA 3QPAA 4R51A 1WPXA 3SHFA 3ID6C 4MIKA 3CUVA 5EUBA 5J1SB 2B61A 3NDBB 5JXIA 3HKCA 1JG3A 1Y33E 2A30A 1D4AA 1S89A 3Q7EA 4Y6RA 4Z53A 2CCJA 3BDAA 3SD7A 4YCCA 4IDDA 5JZMA 2V4MA 1WB4A 3GP3A 4R1LA 4EG3A 1RXSA 3OY7A 2P1ZA 3JWHA 3Q1KA 2DE0X 4YACA 4OX9B 4HYEA 1P7VA 5DZSA 2VTKA 1SK8A 2OD7A 2PLAA 2R1UA 3A1EA 2XNKA 1TYEB 1G1AA 4IG4A 1D0IA 2XMGA 2JZOA 3THOA 3ZNNA 1JFFA 2GD6A 5T6MA 2NAPA 5TMDA 2AOTB 1A9SA 2YWRA 3VR5H 5C7OO 4Q9KA 4RTKA 3DDCA 3FCXA 5GPBA 3U3DA 4N65A 2IJGX 5MFZA 2PMBA 2JFUA 4ZHSA 3UV7A 4D02A 3EWNA 4ED9A 1GOTA 4MMZB 1U5CA 5CH8A 4Q6BA 2IF0A 4RGYA 3SSMA 4B79A 5B36A 3BGWA 4KU4A 3AHEA 3OFNA 1MX9A 2F3QA 1QORA 3KNZA 4WZAB 3DLBA 1R15A 1YUMA 3FCCA 5GIPE 3Q40A 5I48A 4DIKA 3RIMA 2GPBA 1TKAA 2VUSA 1NJFA 3HA5A 3KPYA 1OIVA 2PNFA 3NI2A 4IZIA 2ZANA 1K3UB 2WK1A 2YJNA 3W9BA 1ST3A 4A1OA 3FBWA 1DVRA 1C7JA 1D7AA 2B99A 3MINA 1Z62A 1USVA 1JHPA 1P31A 3WNDA 1FYWA 1JKIA 1SVLA 2OKCA 4YCMA 3JQ7A 2JFQA 2VHCA 2ZIGA 3L8FA 4AZSA 1K0FA 4UMFA 4DR3B 1OAAA 4I5EA 3D4LA 5EJ5A 4ZTUB 2R6R1 1MRSA 1IJKA 3O8NA 4PGGA 4NPCA 5EJ7A 4C5CA 1VC2A 5DKFA 1YAJA 1JSRA 3EUAA 5ULLA 1P4JA 1JLLB 5B3JC 1GQSA 2ET6A 2J0EA 3NHWA 3O26A 4KQ1A 4LZPA 3BH6A 4Y2PA 3KKQA 3PRJA 1LSSA 1VKOA 3OQMA 4OI1A 3PC8C 1XZCA 2NVOA 4YAWA 2X6RA 1XVLA 3ZHBA 4X66B 3FHOA 4HCJA 3V4VB 4YRDA 1SC6A 2FGJA 4RK1A 5KOHA 3WMEA 1V4BA 1F5NA 2NMVA 5AQ1A 4HUJA 3K1JA 1KZGB 1GUFA 4F0JA 3KYCA 3W8DA 1J2RA 1R0WA 4KUEA 2Q41A 5EOVA 1SHJA 4G1FA 4RTNA 2QY9A 5A0TA 4JAVC 2DUJA 2P3SA 3OG9A 4QICA 2AFIE 1SUCA 2XA9A 1E6MA 3P9RA 4MUAA 4ANFA 4DCJA 4BRUA 2VR1A 3OWXA 3S8EA 1NPYA 3VA7A 2COEA 3F4KA 3GFPA 1ZBQA 3R4VA 1M83A 4V0KA 2WPDA 3U44B 1C3VA 4CKCA 1ENYA 5F3DA