2DLCX

Crystal structure of the ternary complex of yeast tyrosyl-trna synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
339
Chain Sequence
DPNEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/trna
molecule keywords T-RNA (76-MER)
publication title Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 118
structure length 339
sequence length 349
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2dlcX02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dlcX01
2OQ2A 1TYCA 4YP6A 3AL0C 4Q16A 3PXUA 2QUKA 1KQNA 1O6BA 3G5AA 5H7XA 2D54A 4KR6A 5J59A 3FH0A 2RE8A 1WXEA 4G6ZA 3D6UA 3DO8A 4OUDA 1X6VA 3SP1A 2ZP1A 4L2IB 2D13A 1QTQA 2CFOA 1WXHA 1QU3A 4MW6A 2CYBA 3CVXA 3ZJTA 1R6XA 1S4MA 1QRSA 4CQNA 2G36A 3A2KA 4UZFA 1Q11A 4U63A 1QQTA 1PG2A 1Q19A 3FETA 2QUJA 5JBNA 1YULA 3FOCA 2DXIA 4EG1A 3IMGA 1ZUNA 4F4HA 1M1ZA 1U3DA 2BTEA 1NZJA 1JEDA 2ZUEA 3COZA 1IVSA 1G59A 5DEOA 1T6XA 4CDNA 5J58A 1PFVA 5FO0A 4ZT2A 1O94D 3F3MA 3RFFA 1U7DA 3IUEA 3FY4A 4K0RA 2V0CA 4MW0A 2X1MA 2E0IA 4EG5A 4PBTA 3TQIA 4NDAA 4MUJA 5FO1A 4EG6A 4YBRA 3C8ZA 3H9BA 5LLTA 2CT8A 3RBAA 2YWCA 3ILVA 3RJZA 3IOEA 1WQ4A 2CYCA 4DDHA 4ZCQA 1KAMA 1V8FA 1R6UA 1HYBA 1I2DA 2GM3A 3AKZA 1JIIA 3ND7A 2XRZA 3IOBA 4EFKA 3N9IA 2JAXA 3RK1A 2DR2A 4ZT5A 1N1DA 4KPUA 3QTBA 1OD6A 3KT0A 2A1TS 4ND7A 5DB4A 1WJGA 3ZUGA 4H3SA 1OBCA 1WXGA 3IVCA 1KR2A 1VBMA 1ULHA 4EG8A 1KH3A 1O5TA 1EFPA 5IJXA 3BL5A 3DPIA 4MW2A 3N05A 1H3FA 1I6KA 2GOYA 4ARIA 4XSVA 2PG3A 3QE4A 3FWKA 2QUIA 1ZH6A 1FYDA 3ZXIA 1N2GA 4DE5A 2A1UB 3COYA 4PBSA 1KH2A 1KQOA 3IMCA 3P0IA 1KQPA 3A04A 1OWMA 1IRXA 3PNYA 4CT0A 3H9CA 1NUSA 4X0EA 4AS1A 1A8HA 1N2EA 4F3RA 4ZCRA 3OTWA 3Q12A 3OP1A 4U7JA 1EFVA 4ZCSA 4EG3A 2QJTA 1JGTA 3CR8A 4MW4A 2JANA 1G8FA 3CLTC 1O96A 2A86A 3AG6A 4QREA 1O95D 3MMXA 4MWBA 1KH1A 2HMAA 4HPWA 4HJXA 1DNPA 2O5RA 3CLRD 3LE8A 3X1KA 3CVVA 4P2BA 4NAUA 4S1OA 1TEZA 5TEVA 1BS2A 4OJMX 4L2IA 1NUPA 1MB2A 3IMEA 4MQ6A 1OWNA 5IHXA 3HL4A 3IVGA 5KHAA 1YIAA 1KKUA 2E21A 1EUYA 3JXEA 2NZ2A 4DLPA 1M8PA 3Q4GA 4HK4A 2WB2A 3NBKA 3H05A 1G8HA 3ZGZA 1N78A 3RHSA 3X1JA 5DK4A 2WQ7A 1T9GR 2QTMA 3DLAA 2ZUFA 3PNVA 2H29A 2PZAA 3FNRA 3MLBA 1VLHA 3SEZA 4BWVA 1MAWA 3ZJVA 2QUHA 1IQRA 1SURA 3TNJA 4K03A 3COWA 1N77A 1WXIA 3FIUA 1EJ2A 2C5SA 4ZT7A 1VL2A 1N3LA 2DEUA 2E18A 1H1TA 2J08A 4KKVA 1IHOA 1TFUA 2QTRA 3P52A 3INNA 4MWCA 3KT6A 1WQ3A 2PFSA 1Q15A 2AG6A 1TQ8A 2J09A 3G59A 5LFAA 1JMVA 1P7PA 1VBNA 1J21A 3G6KA 4MVXA 1GN8A 2QJFA 3CLUC 5TS2A 2AKEA 2PZBA 1EXDA 1F4LA 1JZQA 1PFWA 3TZLA 4MVYA 4HJRA 4PY2A 5TGTA 3VGJA 1PG0A 3MUEA 1D2RA 1F7VA 1QNFA 3CLSC 3NBAA 1JZSA 1MC1A 3UK2A 4ZCTA 1PFUA 3U1VA 2IELA 2J4DA 4ZCPA 3UMVA 1GLNA 1VBKA 3LOQA 4MUNA 2PXHA 1NSYA 3GMIA 3GUZA 3TQOA 1K4KA 1NUTA 1NURA 1J09A 3A05A 3HV0A 3HZRA 1V47A 1TYBE 4DJAA 4E1AA 4G5FA 1MOPA 1NI5A 3AG5A 4MUFA 1IQ0A 1K4MA 3DV2A 2E89A 3H99A 3A4IA 1NP7A 4KR9A 3ZJUA 1WOYA 1QJCA 3PRHA 2VTBB 1Y42X 1O97C 3CA8A 3GLVA 1ZJWA 4DDKA 4JYZA 2YWBA 2CV0A 1O0CA 4MUEA 3ND6A 2YY5A 2X0KA 4MW9A 1U0BB 1EE1A 1CT9A 1X8XA 1GPMA 1M8JA 4NX2A 3HGMA 3M5WA 2B7LA 4NZPA 1O0BA 4ARCA 4AQ7A 1MB9A 1O94C 1ILEA 3LCJA 1EFPB 3QTTA 2DPLA 4NAHA 2A84A 3VRHA 1TYDE 4J76A 4QRDA 2X3FA 3UOWA 3KFLA 5F23A 3HMQA 5J5AA 2NSYA 1QRUA 3SZ3A 4XFDA 2EL7A 3IOCA 2VXOA 2CSXA 4NATA 4RPIA 1N2HA 4U8HA 3HFJA 4MLPA 3H97A 4GRIA 4EGAA 1IFXA 3UY4A 3VU8A 1YUMA 1YIDA 2DLCX 1KORA 4EG7A 1J1ZA 1NUUA 3RK0A 1K97A 1M8KA 1GTRA 3CLSD 2V0GA 4WSOA 3NV7A 3CVWA 1T9GS 5AHWA 2IJGX 1JIKA 1J1UA 3L93A 3KT3A 1NYLA 1F9AA 1RQGA 4OUDB 4RUKA 3MLAA 2I1LA 4KR7A 3K9WA 2CUZA 2X1LA 3ISJA 3SDBA 2PZ8A 4R2LA 1Q77A 1N2BA 1YI8A 1KAQA 1XNGA 3FHJA 2QTNA 3CVUA 3IH5A 4DNXA 2RD2A 1MJHA 5KCMA 1J20A 2O8VA 4UZEA 2BYTA 4A91A 4MWEA 3P0JA 1JHDA 3IVXA 4PBRA 4MVWA 4ZT4A 1XNHA 4GU5A 1M83A 3FG9A 2A4MA 1O97D 4ZT3A 1N2IA 3Q10A 3N2YA 1IH8A 2QJOA 1WKBA 3FI0A 2A88A 3KT8A 1T6YA 4EF6A 2JA2A 4WNYA 1WZ2A 5HUJA 1LI5A 4MVCA 1COZA 1H3NA 4YP7A 3ZIUA 2J07A 3UC5A 3I05A 1LI7A 4MWDA 1KP3A 3IDFA 1WXFA 4XFJA 1OWLA 4I6EA 3CVYA 2CV2A 5K0TA 1FFYA 3D6VA 1ZH0A 5TEWA 3ND5A 2A7XA 3E27A 5KWVA 1GTSA 2DETA 4Q93A 4ZT6A 4YMIA 3SZGA 1KP2A 3SEQA 5H16A 2WQ6A 1MRZA 1O95C 3CLTD 1JEEA 2GKSA 1QRTA 3CLRC 3S3TA 2DUMA 5HG0A 3TZEA 1J70A 1XNJA 1I6LA 4MW1A 4QBTA 3COVA 2PIDA 4MW5A 1I6MA 3L92A 4KPUB 4MUIA 4J75A 5FNZA 4MUGA 4CDMA 3P0HA 1MAUA 2TS1A 1EUQA 1U3CA 4R2MA 1OWOA 1JILA 4MW7A 5LM3A 2Z3VA 4MUKA 1OBHA 1N75A 4MAFA 4ND6A 1B6TA 2HGZA 5HUHA 5K0SA 2VTBA 1K92A 4JZYA 4FZJA 1M8GA 4I6JA 1GZUA 2Z09A 3N8HA 4JXZA 2YXNA 2A1TR 2WSIA 2AZXA 1IQUA 1UFVA 5BNZA 2J5BA 2XRYA 1N2JA 4YP5A 1G8GA 5DASA 1YUNA 2A1UA 2R5WA 2DERA 1T6ZA 1MBZA 1WY5A 1QU2A 1F7UA 1JECA 3PNBA 2HZ7A 2OV4A 1H3EA 3SYTA 2IP1A 2Z08A 3MXTA 2D5BA 3X1MA 3K32A 4MULA 4JXXA 4G5YA 1U7XA 1XJQA 4I6GA 4MUHA 4DDMA 1OWPA 2H2AA 3CLUD 3AFHA 3ELBA 3FDXA 3ZXSA 4EG4A 2CYAA 4R0NA 5EKDA 1NUQA 2EJCA 1TYAE 1GAXA 1JIJA 4JFAA 1EFVB 1PFYA 3AIIA 1N2OA 2CV1A 1R6TA 3IUBA 3TS1A 1LW7A 4TS1A 1O96B 1M8FA 3IODA
chains in the Genus database with same CATH superfamily
2H1SA 1AZLA 3C39A 3DT6A 3GZTB 2BWJA 4KZKA 4BIIA 2WDPA 3WSWA 3EZXA 3PNPA 4JP3A 1IBRA 2D54A 2WD8A 3BXEA 1N7JA 3KPYA 3MOGA 4CLXA 4EK9A 1TE2A 1CBUA 3FOZA 1IZZA 1KHTA 3RHZA 5E4FA 3R7FA 2Z04A 1A50B 4WZBE 1WY7A 3LZDA 4LRQA 1WXHA 4BTLA 4M7RA 3Q8LA 3BAZA 1DRUA 2CVOA 1FY2A 2OT3B 2QMQA 3E3OA 3AL3A 4MARA 3STWA 3UT0A 5JPCA 3P94A 3BT7A 3HUFA 3ZJTA 2F1RA 2XWPA 3K9HA 2DOKA 1UCFA 4H6XA 2ZBEA 2GLXA 1GP2A 1UM9B 4BQSA 1QE5A 5BXYA 1IHDA 4LWOA 1N5IA 4YCLA 2GNAA 3I45A 5JBQA 3TUZC 3OA0A 4D4MA 1JDZA 5E8RA 4DA9A 1EJBA 1NVTA 1Y1SA 2VYVD 2HO5A 3D81A 3H9GA 3PFGA 4E46A 4E5VA 1AM4D 4QM6A 3LJKA 1QJ4A 4J0EA 4TMKA 3IKLA 1ITZA 4NEQA 2AXNA 5CU7A 5FRDA 1XDWA 4MRAA 4WKPA 1J2UA 3WYBA 2BTEA 4UVEA 5CVCA 3W4KA 4EUSA 1IVSA 4ZCIA 3WYFA 3ZDAA 5ALGA 1RWMA 3DL7A 4QICA 1FW6A 1AXEA 3KTFA 1P9WA 1SXHA 4NYIQ 1TK2A 1FK8A 1EAYA 1L4LA 3SZOA 1CQXA 2H1CA 1L6RA 4JC0A 3FY4A 4UXHA 5FI1B 3V4VB 3I9FA 1Q74A 2IVFA 1TDJA 3RS9A 1VLZA 2YJTD 3KUCA 1UWVA 3QKSB 3VDNB 3WIUA 1C2YA 2WILA 4M1YA 1ZD4A 4WQMA 1S6YA 1E8NA 4AZ0B 4FOTA 1UBCA 3RTCA 5EKSA 4X1KA 4NRDA 4MUJA 5FO1A 5H70A 1CRPA 1UXGA 4RGYA 4YBRA 1N7HA 1WCIB 3FNFA 4MLZA 1COWA 4OY3A 4ZZ2A 1KL7A 1D4ZA 3ZW7A 4E32A 1JJ7A 1E7MA 1IZ0A 1XQWA 2YWCA 4CUJA 2UAGA 1GARA 1ULAA 1AKVA 1UP6A 5B2FA 2VF5X 5AJUA 4MYUA 4X3OA 3FROA 4G8JA 3BE4A 1JPJA 3EXFB 4EB0A 1H4VB 2P69A 3GHYA 4K40A 5ER9A 2VK4A 4RH0A 5GWXA 4DGSA 2JEYA 1PX2A 1XRLA 2XB4A 2ZI5A 3F5FA 8ADHA 1HA3A 2W5UA 2X4IA 4HEA1 1EXVA 3DDNA 4P4GA 3ZHOA 1LLQA 1YAJA 4C4YA 2ZQYA 4E7OA 7REQA 3CBGA 2HMTA 2FVXA 4FYWA 3MWFA 1BA2A 1ZI9A 4JUIA 2FW0A 1SQGA 3PVZA 2NXJA 3AQ4A 5AKLA 4ESEA 2DJIA 2QEQA 2JEOA 1J0EA 5IF9A 3U7QA 1GRVA 1PR4A 3DJYA 4MITA 1N5KA 3AUUA 3FUVA 3MXOA 5LBTA 4JI3B 4XJVA 5FTNA 4NBUA 5HJ5A 2AUMA 3TW8A 3TF5A 4WA7A 1CJBA 1JG1A 1YRYE 1E6KA 1AV6A 2Y71A 4Q4JA 4DIEA 1B8VA 2CBZA 1ULHA 3BXPA 2Q1TA 4DRXB 2EW8A 5DW3A 3DL4A 1B6RA 3TLGB 1ZI8A 2PYIA 1WE2A 1Z5GA 4QG3A 1DJQA 1LB1B 4FFBB 1KAOA 4MV7A 3ABOB 4MW2A 4O2AA 3NH6A 3QE2A 4HUJA 4HWOA 5LA6B 1N5OX 4DIFA 2W58A 5JH7A 2D5IA 2WF8A 2GVZC 4PC6A 1YHZA 4UOEA 2WICA 2OQVA 5K4GA 4S1WA 4KGZA 1MN6A 1BGWA 3VZPA 4BNVA 2XE7A 4RW0A 4P92A 1OA1A 2GM4A 4OAPA 4RXMA 1B15A 3SC4A 3P0IA 1GADO 4NYJR 5GONA 2MOKA 1Z56C 4NECA 5I48A 3M6FA 1MIHA 1RKUA 4GSLA 2G7MC 3U09A 4MV6A 4AZ3A 2WYUA 2ZBUA 4QGHA 2P9ZA 2I3GA 4RACA 4EW3A 1C2TA 5AH0A 1QKKA 1WS6A 4ZCRA 4CL8A 1IZ9A 1EVLA 2X76A 4M0MA 4EBBA 5I8ZA 1JXAA 3TW0A 4B4VA 3SYNA 1P3Y1 1L8LA 1KMMA 3C6KA 3PGXA 4G8CA 3OP1A 2WTAA 1NW5A 4EB6A 1BN7A 2B99A 2DQ4A 1EFVA 1M76A 1ML3A 2I4IA 3FCSB 2R11A 1Y80A 3KDAA 5B7GA 2JANA 3CHYA 3SHVA 1RPAA 1BE0A 1ETHA 4J16A 2VNJA 3A0RB 3FW1A 4ZI3A 1EGMB 2EX1A 1Y3IA 3A9CA 4S1NA 1BXKA 4PICA 1M34E 4I4NA 4U2CA 4D0GA 3P19A 1J8FA 1PT5A 1EYZA 2PZMA 4Q9DA 5CBKA 1XNRB 1OUMA 2CHVA 1ICIA 4R1LA 4OA8A 2FPXA 3HV2A 4P0TA 1OIXA 2PT5A 4YRIA 1W8DA 1SB9A 3DE5X 4KXYA 3BJEA 3PEEA 4C20A 3KR0A 4RHXA 3FVVA 4DEYA 1TJ3A 3RUCA 1CRQA 4LG1A 1BX3A 2UU9B 5F98A 1ZJ6A 1CUWA 1Z7EA 2AH5A 2VEDA 3PCXA 3LT4A 2L69A 2H4YA 5GAJA 4DV6B 3EJ6A 5K3FA 3PQ2A 1G2OA 2FWMX 2WVGA 2YVAA 3C97A 4U2BA 3CC8A 2XB2A 2MSLA 4OOFA 2XZOA 3F6YA 3X1ZA 1WABA 3RF7A 5LL6P 4ZXFA 4XLLA 2OK8A 1QZUA 2QUHA 2J3KA 1X7XA 3AR4A 3OPVA 4WBNF 3ANTA 3H1FA 3HLKA 3PX2A 2PA3A 4K03A 4WEOA 3H1TA 2PXXA 1CNFA 3REOA 3S99A 3GYBA 4OXYA 4CM1A 1WZNA 4X1IB 3O8BA 3UFXB 2QD5A 2B4QA 2B94A 3TNYA 4F56A 1NL3A 1RXUA 4FNGA 3R0JA 1SC4A 1Z75A 5EJEA 3LUFA 1DFGA 4QTYA 4ROSA 3G8AA 2NVWA 4TWBA 3H2BA 3HJBA 4KO1S 2CMGA 3Q3HA 3PF8A 3PJGA 3ICOA 4G84A 5KYYB 2A57A 3HVIA 4JJKA 3PHGA 4B8ZA 5GV7A 5KNCA 3G6KA 2BJHA 4MVXA 2TMDA 5E6RA 3SF8B 1E63A 1SIUA 1YL7A 3PQ5A 3KBBA 5HCUA 1MVOA 3HEMA 4GVXA 4QRHA 4V39A 4X24A 3PFKA 4PZ0A 3IS3A 4RH3A 1KYYA 4DGQA 5TQJA 1UBSB 3F6CA 1VECA 1V3UA 2CFSA 2QL6A 3C6XA 3FDZA 5EGSA 1MC1A 2PLFA 3QBDA 2JATA 1PBNA 3TPFA 3SQLA 3UXYA 4U7HA 3VU9A 1EFTA 1G19A 3NOQA 1G8KA 2IU6A 3HM2A 2I2FA 4L85A 3MS7A 5C5DA 5I45A 1D4FA 1R6DA 1V9SA 2WKSA 4PS0A 1W5TA 1SCDA 2OORC 3M33A 4DLAA 4HNAA 4JI2B 5KCZA 4MRMA 1SKUA 3SQXA 1ZNQO 3AVUA 4M4SA 1F0NA 1TJ4A 4Q3LA 4WVLA 4GMXA 3T5DA 1OI3A 4QASA 4H1TA 3GFSA 4I1SA 1ORVA 4KXUA 1NP7A 1JKXA 4N40A 3N58A 4U6QA 3KKNA 2EFJA 4GQIA 1W93A 3UJAA 2BM8A 1UPTA 1SIWA 2Q3JA 1JTEA 3UBMA 4HWKA 4INZA 1PNRA 3GJ3A 1IL0A 2OQIA 3CSUA 3EDMA 4KQWA 4Q00A 4DA6A 1AS2A 5FOQA 4HGYA 4D57A 1GGMA 2A3NA 2PS3A 2CV0A 2RIPA 3ZTTA 1FP4A 1R9GA 4JBNA 3W6NA 4ETNA 4I7EA 4C14A 1JFRA 4DMGA 4HH1A 4DG9A 3K8QA 4Q4JB 2VNKA 4ZRNA 4B2LA 1U8EA 1O0BA 3CONA 4PLGA 3I2HA 4K6KA 4AQ7A 5FLEX 2NSHA 1JN0A 3K05A 3KQWA 2FQXA 4ZALA 2WV7A 3HJCA 3GA0A 4A8JB 4Q3NA 5K3AA 2AOTB 2JC3A 3KTAA 3UGTA 2VSYA 4M9UA 1A5BB 2IWRA 2Q5JA 2K2QB 4KIUA 3S1LA 3HB9A 1JBKA 3KQTA 1ZN7A 1K98A 4GL2A 1Z8DA 3D7SA 4DZRA 3UENA 5KB3A 5JAQA 2UYOA 1DAEA 4LHWA 2OHHA 3ZOZA 1N9ZA 2EJTA 1M2VA 1AT1A 2SKCA 1XZCA 2XD4A 4JBWA 4ABYA 4AZ3B 1QTRA 3KFVA 2QZJA 1Z2EA 5BP7A 4JS0A 4KAXA 3S1SA 3LPLA 4KWHA 3BVPA 1EWVA 5K8LA 3SJAA 5CB6A 1D03A 1DKNA 2CE2X 2IRWA 2AYYA 3GEPA 2D0OB 3PCTA 4IBOA 4OVKA 1T26A 5JNLA 5J2UB 2JNWA 4W5JA 4D26A 1PWYE 5TQVA 1THTA 2ANBA 4HDSB 4WN3A 2OVBA 4AJLA 3B9PA 1LPSA 5LBUA 1SXQA 1YB2A 2PD6A 1KEPA 2ZS7A 3FFAA 1JIKA 2PX5A 3IIKA 2LRHA 1XMXA 3TCXB 3C16C 4C21A 5JT1A 1DCKA 4WRRA 5AW5A 4DABA 4LOLA 3DTVD 5LMCA 4CUKA 1M3SA 1EBUA 1YQXA 3C43A 3G5MA 3I53A 2HN9A 2ZIEA 2FN3A 5KYWB 4A15A 2QN7A 1TXGA 3F5QA 5P8WA 2M32A 2X5NA 3RVRA 1KAQA 2NYRA 5IKMA 1IHYA 4PGMA 3RUDA 1EX9A 2EBHX 4P5PA 3IPLA 2CEKA 4NENA 4ESOA 1ZSVA 1A5SB 3DH0A 4MKRA 3FWHA 3B70A 1H65A 4X90A 5JEDA 2DWPA 4ATNA 2WJVA 2F1KA 4AJKA 1DBSA 1HYQA 2OYSA 3CR3C 1A4XA 4WBXC 1EWYA 3WLFA 4G26A 1IXSB 2JCBA 4PZCA 1J2YA 4ZT4A 1R12A 2O1SA 1YB1A 3M82A 4O2BA 4PIMA 4QNMA 5K3FB 2QX7A 1Z16A 3PQ6A 2JFWA 1W5EA 2J6BA 4L8YA 4N5HX 5I7OA 2BUCA 2IPOA 4NV1A 3ONEA 2ZRKA 3EIWA 5JV5A 1T5LA 3FBWA 4M54A 2JFGA 2PL1A 2WLTA 4R54A 3ZQ6A 3FMOB 3WXMA 1X7XB 4NMLA 1J06A 3EFBA 3TRIA 3W5IA 1TCVA 1R5NA 1E1RA 3ORSA 4U00A 4IXTA 1L7MA 3V8QA 4DMHA 3K30A 3SIWA 4X61A 1W2GA 4G25A 2I3ZA 3F49S 4Y1RB 1D0VA 3IPRA 3EJWA 3GDWA 3KJNA 2G3YA 3UW3A 1F6DA 2C07A 3G17A 4HGNA 1C14A 1NHGA 3HB0A 3Q9UA 4IDAA 1OWLA 4J0GA 5JR3A 1NQUA 1PVOA 3B53X 3DEHA 5K0TA 1GQOA 1J8MF 2AG5A 4CG2A 3S8YA 4DUZB 3OESA 3HL0A 2VHXA 4LYJA 5E6RB 5EMHA 5LMNB 2F43A 3EVGA 3R09A 2ZRJA 3E23A 3RIYA 1THZA 2DU8A 5HYVA 5JRDS 3OOEA 4KN5A 1U8CB 4UQPA 1V16B 1T9KA 1X8LA 2PKQO 4G0QA 3EPHA 1A2OA 2H4ZA 2Z3WA 3JD0A 4NKRA 4P33A 1DC4A 1CUSA 1QRTA 4N3GA 1ECLA 3W9SA 3WZLA 3DBHA 4U5QA 5HG0A 4UCFA 1J70A 1RQPA 5A06A 4MQBA 1R3UA 2W8BA 4KXFB 3UK1A 2YJ6A 3GJTA 3C15C 3HU3A 4M3NA 2GUWA 5BR4A 2W48A 4MW5A 1O5OA 3VU9B 1EWKA 4Q3EA 4D9NA 1YOVA 3DYIA 3A37A 2Y0PA 4HZIA 4OHRA 5EE3A 3HY6A 3W77A 4QBHA 4YVFA 5JSYA 2C42A 1U3CA 1V25A 4F4DA 4UVIA 1NW4A 2R00C 3KAPA 3D4PA 3KVNA 3KYDB 1Y1KE 2YJ4A 3O31A 5TXGA 3REGA 2XT9A 3UWPA 4BATA 4BP3A 2B4TO 3N8NA 1RAIA 1S2DA 3P4XA 4MAFA 3S7ZA 1QIDA 4UAVA 1OXBB 4IIXA 2ORWA 2WZBA 5FUXA 3T7EA 1Z25A 3QI2A 4EFLA 5JD5A 1NE7A 1P2SA 3G1WA 4KMRA 4H0FA 4LMAA 1DFHA 3IJEB 5KVCA 1F1BA 2PUJA 4EPRA 4AUNA 1PT7A 1MFPA 1IDN1 2CHEA 3FUUA 5C4GB 5C3UA 5ED0A 3FM9A 4I5GA 4R9VA 4BN4A 3MJRA 1FP4B 4I19A 2X2OA 4C3VA 2JGRA 3DXYA 2GBIA 4LRYA 4IJKA 5B1YA 4YCCA 2WOOA 3KHTA 4CFYA 3C98A 3GQBA 2ZBQA 4QYTA 4E0BA 3DZFA 5F4ZA 5JQGF 3MTDA 1EA5A 4CV1A 3R4VA 3NVAA 2PCLA 4D4HA 5C1PA 3BQNB 3HKDA 2QTFA 3BG5A 2P62A 3OTGA 4J1QA 3I5MA 1X19A 1KKLA 2C2XA 2ZYGA 3LOUA 4RETA 5EZYB 4Q19A 5JZBA 4LJRA 2O5EA 3BULA 4LAFA 1ZUHA 2IK8A 4KV9A 2Z6UA 2B2XA 2GD0A 3CTMA 2DT8A 3CM0A 5ECYA 3KTAB 4JI5B 2B25A 1G38A 4W9RA 1DKQA 1G5IA 4Q6WA 4F9EA 1V5WA 2FLVA 3ELBA 2R68A 4UEJA 4EG4A 2XE4A 2NP6A 3SM9A 3OLYA 1UJNA 2C4TA 2RGNC 1TYAE 4R3UC 1V7ZA 3IILA 5M3BA 2UUBB 1N2OA 3BSYA 3S4YA 4DS3A 3LRXA 2UVQA 4RD4A 4C7OA 2MSKA 2XUZA 1N5DA 4EPVA 1GGVA 1QX4A 1I2ZA 1ZNXA 1NXOA 2POCA 3UQZA 3H75A 1X1SA 3I12A 3ML1A 2WIDA 4LYFA 4UHFA 3EPLA 5EIFA 2O6LA 4FWIB 3QVUA 2SHKA 3TLXA 1TVKA 3R41A 3ROEA 4BLWA 5A9RA 1G8JA 1JJIA 1MG0A 1DV1A 2COEA 4WFJA 1XLTC 4EUHA 3DAFA 3AEKA 4HFRA 1OASA 3GRKA 1YE5A 3VISA 4MW6A 4OHWA 4NVRA 4BPRA 1QO0D 4XGQA 2GLTA 4YV1A 2J6HA 3G9QA 4ZOLA 4NZ9A 4F3KA 4QHYA 3A2KA 2PA0A 2BFCA 3ENKA 1ESCA 4R1NA 3TW4A 5E6UA 1YVUA 5MFZA 4E5YA 5IJAA 5ETJA 4DCVA 1T6NA 2QUJA 3U26A 2IH5A 4D6XA 1I7LA 3HBFA 2VJBA 4WDQA 3SQDA 3P9PA 3TIFA 1E79D 4QXRA 4JHXA 1I10A 3RW9A 4EGCB 1XHEA 4HXFB 2NOAA 2CW5A 3GEEA 4K5QA 1FXUA 1YR7A 2AMLA 1ZK3A 2FZEA 3L0IB 1MHPA 3MYYA 4XDZA 3FCXA 5AM4A 3GFPA 1K8ZB 1BGVA 2IXFA 2QIOA 1JKFA 1HOTA 1VPLA 2OLKA 1M2GA 1ZXBA 1DTSA 2P9GA 1ONPA 3I3SR 1QV6A 2QGFA 4RK6A 4B2PA 3MCUA 3QVSA 4AB1A 4N39A 4AJ1A 3GZJA 3TX6A 2C5GA 3ANMA 2E0IA 4JVNA 3MW8A 2O8DB 1F51E 1O54A 2I78A 3VR2A 3CJQA 3A9WA 2OYCA 4HLUA 1DAPA 4PM4A 1U2DC 3H2SA 5SZHB 1KPHA 2QGNA 2JW5A 1WLSA 3BF8A 1W0CA 1UK7A 1QZTA 3IAS6 2BR3A 3TJRA 4IFBA 2ZSDA 5LZ9A 4OJYA 3DT9A 3RAFC 2YWRA 2FY8A 2QPLA 3DW1X 5JCXA 5MN6A 2A9QA 1HDGO 2I2XB 3EW9A 1JJBA 1A7AA 1J2TA 3F46A 5ALKA 1TIBA 1O77A 1Z18A 3L4SO 1XTIA 4DDUA 1NF2A 4K05A 2F43B 4FEAA 3BA6A 4BB9A 5IVIA 4Q9HA 5A7FA 4F7WA 1JRLA 4MIKA 1RYZA 1UKVY 3C45A 3M3HA 1XPJA 2G08A 3PNQA 3JQGB 1L5MA 1XQYA 4IKPA 5CFZA 3FBTA 3RS0A 3I01M 1Z5VA 1UBTS 2HRQA 1RQ2A 3AKDA 2VP2A 3ZJ4A 1T2UA 2A1TS 1X7YA 3R5XA 4O59O 5FCDA 4B8WA 4DARA 4Y6RA 1JMKC 1IN5A 4YMTA 5B3LA 3D1LA 1A0OA 2NVOA 4EAQA 2Q28A 4O1IA 3E5RA 2PBFA 1E7SA 2WJPA 3LGXA 5HFNA 3T9AA 3UWSA 4DXAA 2DJ5A 2ZJYA 2ZDQA 4LVOA 4P58A 4XD7A 3T9DA 3AVQA 3OSZA 2G1PA 1RJGA 2QI9C 3I9NA 4NCIA 1ACJA 3M6LA 4I9GA 2QTZA 3IEPA 4LJ9A 1KDOA 3A3KA 1QOQB 1ZH4A 1DC3A 3KUKA 1I94B 1L4HA 1ZP6A 5FBHA 1RRKA 5HK9A 3IEVA 4W5OA 3BCHA 3OJCA 1A4RA 4CQNA 4XYEA 4HYEA 5A5EA 1QK3A 2I6FA 4HPJB 4J3JA 3EISA 4UU0A 2KB0A 3MMZA 5CDYA 3I83A 3FKQA 3BL5A 2MTBA 1SG9A 4E2WA 1QO0A 5B12A 2WUGA 1GL6A 4YMGA 3DTVB 4CMIA 3IKMB 4ZKDA 3CBQA 1E77A 3OY2A 1VMIA 3D2BA 4CLDA 4RKFA 2QUIA 2AMFA 3LX5A 4KXQA 1P39A 2Q2OA 5I4IA 3FWZA 3LA6A 4Y7DA 3WYCA 5DWDA 4PXSA 1EFDN 3DFUA 4BNDA 4BO6A 1L2TA 2C2KA 3SI7A 3ZKAA 1U9CA 2Q3MA 2QRQA 3IULA 4RD6A 5IBQA 1VLLA 1XKXA 3LY8A 1AA9A 3OICA 4KSYA 2ORED 2N3ZA 4MJLA 1XPOA 3JQ8A 2R2GA 2VUIB 2VA8A 4PZDA 1WW8A 4LSGA 3C70A 1SEPA 4K9OA 4P4NA 4BMDA 4ZCSA 2R9VA 3B6JA 3DAGA 3G79A 3CR8A 2QWXA 3R2JA 2YDXA 1YT5A 2VHUA 3IB6A 3TEJA 3TSAA 3U5TA 1UBNA 3QM1A 3WGGA 4E2XA 3NJRA 3OUUA 5ABPA 3N5CA 4LZAA 4MWBA 3DKIA 2P8JA 3UJ6A 3M4NA 3ZVNA 4J3FA 4YRNA 1QHFA 2JPDA 5FKJA 5L3QA 1EBFA 5DYIA 3EW7A 4A03A 5CPBA 4NFYA 1LC0A 1ESMA 4KWEA 4RHTA 1MB4A 1NUPA 3DA8A 3GJ4A 3VR5D 4CF7A 1QIMA 4RIFA 2CL6X 1YIAA 4GPBA 4YAFA 1RIIA 4M0CA 4LYHA 3DCIA 4O3FA 3JS5A 1Q0HA 1NIJA 2JH3A 4C6SA 1U3UA 5IAKA 4DFDA 4TMFA 1FP1D 5U9CA 2Q2VA 4RYLA 1HFWA 5JS8A 4J6FA 2AK2A 4Z2AA 1U04A 1W30A 3AEKB 4P84A 1GSHA 4NNJA 5GP1A 2DBVO 3FFBA 3AUAA 2H16A 1U3VA 3PNVA 5SYMA 3NS7A 4ZOLB 5B7PA 3SEZA 2I2CA 1UPUA 5J3JA 1B74A 4O1HA 4S0ZA 2FA9A 2V96A 3FYTA 1INLA 3HN7A 4KX3A 2OUKA 3PE4A 3HXOA 2ZRGA 5JXIA 2ERXA 3UAYA 5LXTB 2ZYVX 2FPPB 1O7JA 2OBFA 2WE7A 4Y1GA 1WXIA 1EZZA 3LXMA 2WUVA 3ESDA 4YPOA 1XNQB 3C4JA 4F3TA 2HPZA 1YRQA 3WK8A 1EFCA 1N3LA 2E18A 3N0RA 5AM2A 1LS6A 4DEXA 1P0FA 2GN1A 3ZKWB 1C1DB 4EFNA 4N5DA 4CLEA 3LUCA 1U9JA 4BVAA 1K86A 3D4LA 1C7JA 2ZYAA 1ZJ4A 2NN3C 2JGDA 3JALA 1DFIA 2C57A 2DF8A 3FOAA 4L02A 4O4IA 3F5DA 3HJGA 4X91A 1RM5A 3K4PA 4QDUA 1G5PA 1BDBA 1XA0A 4Q7MB 3QVTA 1Y7HA 2QW8A 3AP2A 5HMMA 3P71T 1C81A 4FU0A 4LSWA 5JFOA 1XD8A 1FFAA 3HR8A 3HCCA 4HZGA 1BXZA 3INYA 4V2UA 3E35A 4AJNA 2Z9DA 2IZ5A 2QLLA 3ED5A 5ADWA 1WLYA 2NZ8A 4BNNA 2A5JA 3JTMA 2R4UA 1I51A 3U6BA 1Z9BA 3SXUA 4KQKA 4PYIA 4MP8A 3TWOA 2PXCA 1RTKA 4FGJA 3CE9A 4OA5A 1R9MA 2IQIA 2WIKA 4LRSB 3DOUA 2WU0A 3BIXA 4A8HA 4B6EA 1GFSA 1N2CE 3ND9A 1NYTA 3HG7A 3OVMA 4G86A 4M99A 4OLBA 1D0SA 2TECE 3DV2A 4HD8A 4JQCA 2E7ZA 1FTQA 3EXEB 5GOTA 5CFLA 4QQFA 1ENOA 3MIIA 4ILEA 4G65A 3GLTA 3U4IA 5I9TA 2IHZA 4B6OA 5A9SB 2OCPA 4YMSA 3AFNA 1USGA 4QNRA 2AMJA 4G1MB 3CMCO 2SKDA 1GO2A 1DTWB 1JEJA 5HF9A 3ANNA 1X9GA 4GI7A 1ATZA 3MK31 3VR5A 1OLXB 3AI2A 1PR6A 1JDPA 2NNLD 2XNJA 3GV0A 4AKGA 4MYSA 3SQWA 3UQYS 4DR3B 5U1PA 3TAXA 3ZWVA 2O8DA 3CGGA 3M83A 5CB4F 4YAGA 1SUIA 2R0QC 2HHLA 1GRNA 3Q41A 5FF9A 2AJLI 2XVAA 4GEKA 1WSAA 1OJLA 2GCGA 1EK1A 2BTOA 1AQUA 2QSZA 1Q1QA 1K6XA 2QT1A 2QN2A 1TYDE 1NAIA 2F64A 2WHEA 3JAWA 2D1YA 4P6VF 4HMPA 4CMIB 3EH2A 2ON6A 2P7HA 1GJRA 5GVRA 1CXZA 3ZWYA 1WQ1R 3F97A 4M1SA 4NJEA 3ZI4A 4IIJB 2HR1A 2HNAA 1JIXA 2F3PA 1YUBA 3R3VA 4FM9A 2EL7A 3IOCA 3VDRA 4AY5A 3VNQA 4IOMA 3AFOA 1XE3A 2A14A 1RWVA 3GAFA 3HDJA 1PK9A 3E05A 4G1EB 4M55A 3E9ZA 3FBGA 2DAPA 3F1LA 3O8NA 2WMYA 2OL4A 4L5BA 3KKKA 4NZNA 4EGAA 1GFWA 4IJWA 2H4WA 2WIGA 1PEYA 1H4SA 1FLAA 1NW6A 2V3CC 1KMHB 4CQMB 1Y37A 1SXJA 4YMLA 3QWFA 2FUCA 3Q88A 1DC7A 3Q8KA 4IY1A 1R8SA 1CZKA 3WGKA 4F3YA 2XSZD 1XTVA 2AI3A 4DV4B 4RO0A 3MAAC 3Q9LA 1KAEA 1E6UA 1OU0A 1GPDG 1W29A 1YBVA 3AR6A 1PR0A 3SR3A 4D5GA 3WA7A 2VT7A 1BDIA 4B33A 3D0QA 3ZD9A 2C94A 2GK6A 5T7BA 3W4IA 3I04A 5HBRA 3KLMX 5IT9A 2O8CB 1DXQA 4CMJA 2F6RA 2PUBA 2OQRA 3PPWA 5IASA 2WWYA 2QI9F 2ZWMA 2P5SA 4R2LA 3NYIA 3IDAA 4GVPA 4F06A 4DNXA 1WL8A 5FOXA 3V4OA 2CMDA 4UVGA 4OFBA 4PONA 2OV8A 1E9VA 3DDCA 4ED9A 1TO6A 7GPBA 3HABA 3A70A 4RIHA 2H5IA 4KITB 1NBWB 2I34A 4Z4CA 2ZRPA 4LTNA 4MVWA 3KCQA 1NRWA 4G07A 2PWZA 3TD9A 3UC9A 3C1OA 1HSZA 2O52A 2ZRNA 5CA1A 1H2AS 3ZXUB 1PHRA 3EXG2 3FYCA 1HLPA 3MJTA 1W96A 1SG6A 2GSWA 3O3NB 3OCVA 4J90A 3T4XA 2BGIA 2HBRA 5CVVA 5KQRA 2GVNA 1G3RA 1T6YA 3A58B 1WZ2A 2AT1A 3LZ6A 2ZS9A 3GNLA 4MB2A 5DPMA 4CKCB 2GX6A 1TCCA 1JFTA 4FZVA 3HYRA 1ENPA 3UK6A 2J07A 2QNIA 2BFMA 1BFUA 4RBNA 4LCBA 1PR1A 1TU0A 1PDVA 2FUNB 1GPJA 1R8XA 4ZA2A 5I7FA 1SJ9A 1YE8A 1ZH0A 4N82A 3KUXA 1CETA 4O4IB 4JKOA 2CNKA 1XWIA 4N7BA 2I4RA 1XZ8A 4S1VA 2W71A 2DWCA 4JDPA 1PNQA 1URPA 5DT2A 3WB9A 3UHJA 3ZZNA 4L9WA 5BWOA 5JXJA 1ZNZA 1YC5A 2HJ9A 3CZMA 4ZOCA 3IAEA 4Z0HO 4XH9B 1JKJA 2COUA 3DEFA 4R05A 2CHUA 2OCLA 3O2QB 1AD2A 4L4RA 2JFYA 1CUYA 2VWHA 5F78A 3WL6A 4U2EA 3KXDA 2IYPA 3M8KA 1XNJA 1ECFA 2BKVA 3F7TA 5C8DA 1YKFA 1TVCA 4F6CA 4EI2A 3WL7A 3IOMA 1Q3TA 4KVGA 3RC1A 3D2CA 4CMHA 4X6YA 5JNWA 4MCIA 1DAMA 4MRRA 2G9VA 1Z17A 2QM3A 4NBNA 4HN2A 4D9BA 1OWOA 2X8JA 3ZE6A 2QRZA 4NJMA 4XR4A 1CVIA 1QPBA 1IN1A 3L7AA 4B0OA 1REQA 2WU4A 3H4TA 2WT9A 1T0UA 4Q3AA 5H3LA 4EFMA 3DOEA 5DM60 1DHTA 4BQEA 2VTBA 2JBAB 4QGGA 4ENTA 4XR9A 3VTFA 5DGIA 2FQWA 3IURA 1UJ5A 1X74A 2PMCA 3P2IA 3Q5DA 1QGYA 4PEVA 4E21A 1YACA 1NBIA 5FYDA 1WB5A 4EM6A 3NBQA 1UFVA 3B7PA 2OESA 3SLKA 4BRUA 5BSEA 3AL2A 4S3MA 5IVKA 1C9JA 3H0EA 4PC3A 1L5HB 1QK5A 4DC9A 4DWWA 4EO9A 3ZTYA 4PSUA 4KE6A 3S1AB 3U31A 2AWOA 5E1DA 4DA0A 2PZLA 1MBZA 1TPZA 1R0ZA 2X5XA 1TQ6A 3DQQA 4WOKA 1GUAA 1TGYA 3NGLA 2FW9A 3PNBA 4JL8A 4NOKA 2RCNA 1OLUB 1TQHA 5H3HA 3C8MA 1EVQA 3KR1A 2E48A 4GMHA 3EUEA 2BEKA 1EE9A 4L3OA 5T4BA 2CLOB 4CG1A 4A27A 3PYXA 3JAWB 3FPGA 1LSSA 1X0VA 5ILOA 3VSAA 4OXNA 4S1TA 3HGTA 1QLJA 2QPTA 3C6YA 3PZRA 1EJ0A 1TM2A 1YC2A 2TMYA 3GRYA 4MVJM 2JFHA 5BR7A 3STUA 4E1BA 3OIVA 2VNHA 2CJXA 2O2CA 4D96A 1GAWA 2CYAA 5FBLB 2V65A 3NKVA 4V24A 1GAXA 1WULS 4RAQA 2H8GA 4TZKA 1J8QA 4KIWA 5LB2A 1L5WA 2FPOA 2Q4DA 3OOWA 4LSMA 3LOPA 1T29A 5C35A 1YRWA 4QTZA 3FTEA 4AP6A 1N1MA 4MKIA 4LC9A 4XWGA 2FSGA 3DTYA 3BWEA 2OQ2A 3F4BA 1UT8A 10MHA 2XUOA 1JA1A 3EAFA 3FWYA 2WWWA 2UUAB 2C5LA 1KQNA 3U44A 1JBQA 4PLHA 3B2NA 3EEBA 3VYVA 3WAGA 1BROA 2RE8A 1M6EX 5J5CA 3T5TA 4MEJA 1XMVA 4U5XA 1OTYA 2FNAA 4DLUA 4TKVA 1AKUA 2OHOA 4BU0A 4DSOA 5DCWA 1N5RA 1BA3A 2O07A 5AYVA 4JLDA 4YI3A 4EY8A 2YHAA 2UZ1A 4YECA 1BJTA 4JJIA 1T9HA 3JQRA 4C2TA 5DYGA 2Z5FA 1Y7LA 1F3LA 2ZVJA 3CISA 2NTVA 4CM4B 1D7OA 1DXYA 4H2DA 4YP9A 3LAWA 2YVUA 2JGAA 4CE6A 1T9BA 3EFOB 3P4YA 4MPJA 4P93A 3TR0A 1RMQA 4QECA 4YGXB 2P3SA 4IFTA 3NEPX 5CITA 3GH1A 3JQQA 4LOAA 3CZQA 3DBIA 3DUFB 4ZZ1A 1SC9A 5AVUA 4OHUA 2AZTA 4DAEA 3RYTC 1SUWA 5DBFA 1X15A 4HWGA 3ROGA 2Z2ZA 3U3DA 2HV9A 3HUTA 3EDYA 3K5IA 4XTRA 1CDDA 5AW1A 2ZIUB 4Q48A 1GAQA 2R44A 4B3FX 5CT9A 2FZGA 4RLHA 3FHCB 4QYXA 1CS0B 2Z9BA 5K8UA 1KEEA 1TL7C 1V8PA 4KRYA 4MAMA 2FPMA 5CA1B 3ZTWA 4EKGA 4JCOA 2WPDD 1C30B 1TRHA 2BGNA 4OXRA 4OXIA 2ENWA 3HC7A 2W70A 4FS3A 1KZGB 5TPWB 2GK3A 3EXIB 5IYZF 3GD7A 1BVYF 4PLYA 2WVJA 7AT1A 1DJMA 3FPJA 4OI4A 2B35A 4YFVA 1HEIA 1I7NA 2RGUA 2WABA 5EIHA 3ILVA 4IDCA 1NUHA 2ZK7A 2ZI7A 2ZRFA 2ZSAA 3IQZA 2CYCA 3LUBA 1D6JA 3ZE2B 5IAAA 3H1GA 4KH0A 2H3HA 4C9BA 1JAYA 5HHTA 4M98A 1GAEO 3TRJA 4U6NA 5KQLA 2O7QA 1Y1LA 2EEPA 4IV0A 1Z5ZA 2ZBFA 3H18A 4XW2A 3ZYZA 2AWNA 3OEED 5AI0A 1BE1A 2XAAA 3TZKA 5CCXA 2BJVA 3CLHA 1NJSA 3EPRA 1FSPA 2C20A 3ZHYA 1J8YF 4WACA 2OO7A 3RK1A 2Y1WA 1N1DA 1KXZA 3QSYA 3TJZA 2IPNA 4YNBA 4AJOA 2BCEA 1YJXA 3E61A 3QFFA 5H3CA 3CUEF 1P0PA 1R8QA 2CHFA 3OZEA 4K9RA 2I6QA 1LH0A 1L5LA 4C4PA 3EARA 5AQ1A 1C3JA 3WX0A 3QFRA 4WY5A 1GV1A 4K9NA 1C7QA 3O2JA 1ZHFA 4NPHA 4YC7A 1IPFA 3VPAA 3UMFA 4BFTA 3FHTA 1ZSYA 3VKHA 4NMWA 2AMYA 3TL3A 1KI6A 1V3TA 2X8JB 4UPEA 4CEHA 4NJMB 2KM1A 3LZCA 1FFSA 1WMDA 5LP6C 3QLVA 4JYCA 3FWPA 3ZZ1A 2RHCA 1REQB 2Q45A 1Z8HA 5K8VA 3KWLA 4ZRMA 2PT6A 5A4JA 1KH3A 4ZWNA 2ASEA 4MS4B 3UKJA 5LYYA 1C8BA 1K06A 1LLUA 1K88A 4HNGA 4OI0A 1M6WA 2ILTA 2BR4A 4J7XA 1TT5A 3SHFA 3TJMA 4XVUA 1X39A 1G16A 1Z88A 2TSYB 3AHCA 3CY6A 4YP1A 3NAGA 2UZ0A 4V1CI 4PVDA 1JQJC 3EB9A 4YK7A 2UV8A 5FLYA 2FN4A 1U0TA 2ZE6A 3PUXA 2GZAA 2PGDA 4Z9BA 4CT0A 4NMMA 3W5JA 3VTKA 4WECA 3D6TB 1KJWA 4NPAA 4NCKA 4TUYA 4YN3A 3SY8A 4R2HA 1QH1A 4D3DA 2BGKA 1SCJA 3Q12A 5AHXA 2FTKE 3OIWA 4YLYA 1UBJS 5LQSA 4G9BA 5K3SA 5CYOA 3QF4B 2BFOA 4R2KA 3N59A 4FFPA 2PVSA 2WPDA 1U80A 1VFNA 3EBLA 4DJFC 3HB5X 3BMOB 1AB6A 1I7PA 3MT8A 2NSJA 5IRCD 3RVLA 2NPIA 1L5RA 4G0VA 2H4XA 4ZQGA 3DE3X 2HMUA 1E6WA 2X0IA 2O5RA 2QMUA 4U7FA 3JQBC 2IZ6A 4MMXB 1OTHA 4R4JA 5AVYA 1TMYA 2AR9A 3IHWA 2HWUA 3F6PA 3GOQA 4IHJF 4NAUA 3RREA 2CCGA 4CV0A 4TS4A 1WCWA 1HTBA 4OPMA 2BZSA 1CDZA 5LWHA 4PCUA 2IP4A 4UHCA 1UK9A 3AETB 2PH1A 3THWA 1BS9A 4NCXA 3EZ9A 4UFPA 3GNSA 4MGKR 3OEEA 1NVXQ 1J8DA 1DWQA 1V1RA 3A2NA 5BN5A 5DHTA 2A0XA 3MNFA 1S3GA 3RVKA 2HQ1A 1T9GR 2QAGA 4QGBA 1V7QA 1G4HA 4LX0A 4LHXA 1KAGA 4PZYA 2H29A 4UE2A 1KFEB 2FW1A 3THYA 1J5EB 2RBEA 2A94A 1MC5A 3RUEA 4BWVA 2O1WA 3HKBA 3D9QX 1QGZA 2V7QA 4CF5A 2DTDA 4FMPA 4M37A 3H5WA 1BW9A 1BCRA 3O8QA 4MI3A 4CVNA 5GV8A 2EHDA 4W5RA 1TQDA 5DI3B 3T15A 1QG2A 2XQIA 3DVAA 3JR7A 5GY7A 4HDMB 2JS7A 2XJ9A 4ASUD 1AQYA 4DL9A 4RF4A 3CF2A 2GEFA 4Q7JB 4KKVA 4Q3BA 1P2GA 5AW4A 1YA4A 5BW8A 2XDWA 4TSFA 1IHOA 1TFUA 2VP5A 3DFIA 1N36B 1E5QA 2O2HA 2YNMD 3HU5A 4LBVA 2AG6A 5HS6A 4BMOB 2XMQA 1JX6A 3A6DA 3JVIA 4ID3A 3RSHA 2QP4A 5NULA 5CVUA 1R4NA 2FWBA 1AN0A 1UM8A 3OJLA 4FDLA 4EI7A 5BN3A 1YFJA 2R7NA 2O2SA 2XHEA 3ROFA 4ITUA 4MDEA 2JIZA 1M6HA 1L1RA 1PBTA 2PR2A 1X70A 5TGTA 2B5WA 4KDRA 4YASA 4DLYA 3A8TA 2J5RA 3QPUA 5EMJA 3QXSA 3FPEA 4CCYA 3DMTA 3OJOA 4C0HA 3VHQA 3MT9A 4ZCPA 1V9CA 4AO6A 4Y98A 2KX7A 4GI1A 2QVLA 4PX2A 3BBPA 1JR2A 4A1OA 4EX6A 3RYFB 4FDTA 1C8VB 2B8NA 2OECA 2HNKA 1KO8A 2V9ZA 1ECPA 3O90A 2XNHA 5ALQA 5MDHA 3V00A 4O3MA 3TW6A 1PFQA 5KJFA 1J90A 1FFBA 2NO0A 3AUSA 3B3FA 4KX5A 2V03A 3FD8A 3RFXA 1UFQA 3PLAE 2WAAA 1K4MA 2AQKA 4J4BA 3KE9A 2DRIA 2VPQA 2OZKA 4XCQA 6GPBA 3IQHX 3PDHA 2WSLA 1HL7A 3L7NA 4IUCS 2R60A 4KN6A 4TZTA 3DMNA 4Q1EA 5AVTA 1VL8A 1ZD2P 5BSGA 5KVQA 3RBXA 5C7YA 4ER7A 5LUAA 2L82A 2WF7A 1Y42X 1N0UA 1N0IA 1UBEA 2G72A 3CA8A 2W11A 4HDQB 2E4WA 3WWOA 1M1XB 2BGMA 4TOIA 5DDIP 1P2VA 3CRQA 4L6CA 1CUVA 3HCBA 3IPYA 1TEHA 2DUWA 2F2TA 3LKZA 1GPMA 3LLUA 5KYUA 3T3PB 4CEHB 1GOTA 3U3XA 4XVCA 3I30X 5TLSA 2F4VB 5C51B 3ROZA 4ARCA 1BGXT 5KNDA 4L08A 3LQRA 3LCRA 3RC8A 4FSDA 2XCIA 4RFSA 4MV9A 1J49A 2FG7C 1KWKA 5EGNA 2QN9A 4FYJA 2OV3A 3L1KA 1J2EA 3FMGA 1UJ2A 1A2QA 1PUJA 3SHOA 4RE5A 3UKDA 5CB0A 3BWBA 2R97A 5FBQB 2J5XA 2GTHA 1OZFA 3HXKA 1YBFA 1CS4C 3I9JA 3FKSD 4WBSA 4M9SA 3C5WP 3PXGA 1SU4A 4Q3OA 1P0QA 5DNUA 5MFPA 1VE6A 1QRUA 3EF0A 2ZBVA 1BEUB 3NXSA 3NHLA 2X0EA 1LRJA 5EXTA 3SU8A 5AI4A 2IHUA 3WWDA 1DMRA 4A0QA 5BV0A 5JZOA 5T3UA 2C8KA 3ADOA 4RPIA 1U65A 5KWJA 2YOFA 1EFUA 3QOFA 4ASUA 1KPIA 3NO4A 3TSCA 3LQKA 3FTCA 4TUYB 3UMGA 4FWTA 1Q12A 4AL4A 4BO3A 3HU2A 2VQDA 1IFXA 1RFGE 3FNQA 4RULA 2GEUA 4OX9Y 1ZN9A 1YUMA 2VTVA 1NHWA 3IEIA 2NZYA 4TKLA 3NDRA 1UJ4A 1AQ6A 1R9JA 1K7XB 3QE3A 3OCWA 3ZVRA 5ICFA 4L9RA 2I8CA 4ZDKA 5KNCH 1GPWB 3FE2A 1FU8A 4GR9A 4MPDA 4URZR 1PRYA 2C2WA 3WV4A 4ZO8A 5K2MA 4L76A 5T6BA 2WM2A 2FAXA 4Z9FA 5FOWA 3INTA 3ZHTA 3FFTA 4HQKA 4DN6A 4G4SO 3ZWOA 1FX1A 3WB0A 3S8EA 3MWKA 5EWLB 3AR8A 3PHJA 4EBFA 5HPYB 1DRWA 1N5MA 3ER6A 3OUTA 16PKA 2NUAB 1X9IA 3ODGA 5J2TF 1JWAB 5DT9A 4UTVA 1P6QA 3NOOA 4J9UE 3D3WB 4AT1A 2WIBA 1U0JA 4KQ6A 4HGPA 1I80A 3U9SA 4G09A 3OO1A 2ENUA 2WIJA 3M89A 2O8VA 7ADHA 5IHPA 3ZZMA 1FPMA 3THWB 4MR9A 4DDVA 1F2UA 3W5VA 5GPBA 3JWGA 4MI6A 5E0KB 4PBRA 1E64A 1UODA 1V4NA 2X2FA 1YA8A 4URUR 3WGUA 4CDRA 421PA 4KOAA 2QAGB 2ZYSA 3CNLA 3L1HA 2J7PD 4KO4S 5E38A 4BP9A 2B6NA 3K92A 4QUKA 2ODTX 5SV2A 5IJ9B 3LVFO 1HL3A 3NWOA 3AF4A 4RD0A 1ZM4A 3V9AA 1QYRA 1N2IA 3HKBB 4MXDA 4YDSA 5LLSA 3LKBA 1M10A 5SY6A 3KB2A 5BUZA 1P81A 3ZDQA 2PKRA 3DKRA 2BF4A 3Q8MA 2RJ3A 4R71A 5LR6A 4Q15A 1NWCA 2I4TA 3HLTA 1MO4A 3NP9A 1QPZA 2ZQZA 4IW3B 1GA1A 2CDRA 5KDDA 4R68A 4YP7A 1XEXA 2OBXA 4AZVA 2WJIA 3I05A 4CM5A 4GI3A 4N0QA 2VK8A 3DZ8A 3E58A 4JBYA 3HM9A 2P2NA 5T4HA 1RD4A 4BNGA 3FX2A 3CVYA 1ZA1A 3LP5A 3I9MA 1U0OC 4DM4A 3D7RA 1NFRA 1PE0A 3GDFA 3I58A 4L15A 2WKWA 4EUEA 1ZR4A 1XVIA 1XV5A 1R4NB 5F7JA 1ISPA 5GQSA 3GK3A 3G0GA 2MDTA 4FJ0A 2I33A 3DC7A 3QVLA 1Z08A 4O6VA 5L40A 1TADA 4BKQA 4HPXB 1UMCB 1HYEA 1Q20A 4ZQIA 4I66A 1C7ZA 2X9QA 5KHLB 2CHGA 3TZEA 2PPLA 1VKHA 2QTGA 4WESA 5EPUA 4A1FA 3P9SA 4CCYB 5MN5A 2CCJA 1XDZA 1I6MA 3KXPA 4ZK2A 3W2FA 5B1SA 3QVJA 1YXMA 4M89A 1KHHA 1NLYA 3D6JA 1ZXXA 4CDMA 1U28C 5IEJA 4A92A 2CGEA 2ZG6A 3GCXA 1K7YA 1U6IA 4CODB 2OZLA 2VP6A 3PXXA 2IE0A 3DXFA 4EHNA 1A1SA 1CF2O 2QMHA 4WK2B 2BISA 1OBHA 1YBAA 1B6TA 1JR3A 3QLTA 4WK6A 4NOLA 4G97A 3KEFA 1NF8A 2EJBA 3PUVA 1GM5A 2G5TA 2XF2A 1F60A 2QTWB 4YRBA 3TECE 2QRVA 2RKOA 3QQ5A 1K8XB 3H2YA 4FTWA 4TT3D 5HKBA 4JUDX 2X9VA 2OORA 1M1YA 1C9NA 1DU4A 3GZ4A 5IXSA 2LP4Y 1ORTA 4RMHA 3UO8B 2AOWA 1E60A 2Z6QA 5ICMA 1GZHB 3GB9A 2RC5A 2H48A 3PD0A 4IG9A 5EEGA 2C4UA 3FB4A 3P20A 2QN3A 3ZCRA 4AWAA 3SSMA 3UIEA 5DYNA 1VM6A 3O4JA 4FC6A 4IQ0A 1CUGA 3H04A 2AN4A 3EDRA 5IVHA 5JD3A 2Q7DA 2DUNA 2K7ZA 2IXEA 2OC4A 4RFSB 2VDMB 3DDWA 3EODA 4G9GA 1KI9A 3DSRA 2E4ZA 4LWZA 4X9XA 2GESA 4Y2RA 1M6YA 2VSXA 4NY1A 1ZD3A 4WOBA 2ZUTA 3BGIA 3R7BA 1L7BA 3I2KA 4AKSA 5L3ZA 3TUIC 2D3TA 1ILWA 2AR7A 4G5SA 1VMKA 4KN8A 4TRNA 2X4LA 1Y4SA 5EIEA 3FDXA 1HWYA 1YCDA 5ESRA 3T7IA 1N9GA 2X6QA 1DSSG 3P9CA 1LPPA 3PSAA 4JEHA 4JP5A 4Q1AA 4BQOA 4F12A 1J39A 1QGAA 1UEXC 3TAHA 4IOKA 3TTWA 2Q9CA 2CLDX 4ZJPA 1GGHA 2J9GA 2VZ8A 4IQ8A 5HTOA 2F59A 6REQB 1ZFNA 1QYCA 4GP6A 4UHJA 2VOJA 1J7KA 2RHBA 2QUKA 4D4LA 3AIOA 3NAMA 5IZCC 4WVFA 1GR0A 2JZCA 1U63A 3QXJA 3GJRA 1SKQA 3BWCA 5FV7A 5KX5A 2ZJ2A 2ZWIA 1A97A 1E3IA 1L7EA 2BKXA 1SC6A 4JP1A 5CFNA 5IH3A 2PRYA 3P96A 4BRSA 5KWIA 2W8ZA 1YU6A 2CFIA 4LWQA 5KSYA 3CVXA 3AERB 3HSSA 1FDTA 1G7RA 3OJWA 4IIBA 1UMKA 1N0HA 2BI7A 3VH4A 3LV8A 1HF3A 1HZZC 2JCYA 3G7NA 2ZS8A 5LOVB 2HU5A 3QMWA 3W04A 5DGXA 3EIFA 1W59A 3PDIA 1NKTA 1VE7A 2CF5A 1GGKA 2JGLA 5JZVA 2WU8A 2REQB 4HX2A 2W6ID 2FGKA 2FQYA 2Y0EA 1C3LA 3KOOA 1QVVA 3B89A 1CNMA 1GVNB 1PZXA 2XB8A 3MUFA 2V4ZA 7MDHA 2JGMA 1TUBA 3G0BA 4JK3A 3M6XA 2CB0A 3N87A 1VHDA 4ND8A 4F2DA 4NZOA 2CNOA 3AX6A 3N70A 1BS1A 1ODLA 2PLAA 2W2TA 3LWBA 2O7RA 3KJGA 3UBTA 1MGPA 1CJTC 2R8YA 5FPQA 2Q62A 2YHUA 3CKMA 1NM5C 1SXIA 4J4TA 1ZCAA 4JA2A 1G20A 2EW1A 5BN1A 5J4HA 3G0OA 2VYND 5BSMA 1GSIA 4KDFA 5DNEA 1DBQA 1JL3A 1CY0A 1RYMA 3V7WA 3QNMA 5AXBA 4A0FA 4OAQA 3RVQA 3PNSA 4KFTA 3GWGA 2H18A 5ILGA 3SYLA 4KPEC 1TM4E 5IUNC 4FB4A 2P6UA 2CXHA 1VGRA 1LV7A 3EUWA 2BZ1A 4BMSA 4BVFA 2QRHA 3B8HA 2J6IA 5KO2A 4KE8A 3IUPA 4U7PB 3VR3A 1BKYA 3ZBPA 4Z7OB 2ZZNA 1XCLA 3SVLA 3OJ0A 4WJKB 4Z4IA 4MQLA 1JYEA 5FOVA 2GFQA 3T7TA 3PGA1 3PE6A 3CW8X 3W2EA 5EVCA 4YTEA 3RHTA 1P9NA 2SKEA 4C08A 5LVAA 2D06A 2OD7A 2P11A 1DBIA 4WL0A 4F93B 1FDUA 3E1KA 1YZNA 2AFHE 1XF1A 3O8CA 3VYUB 4ENUA 3ZD6A 1USUA 3VSBA 5J9FA 4WESB 2HPAA 5DB4A 2XCUA 4PO3X 1NMEA 3WB1A 1JNXX 1BE8A 2OSBA 4KBFA 4ZO9A 3VVLA 4EHIA 4KWCA 1V4BA 1Z29A 1RMTA 4WIAA 3UGQA 1IN6A 1N25A 2DQSA 1JDTA 3CSSA 2LR0A 4M0PA 3AOEC 5JALA 5E3HA 4YAEA 2XUAA 3EMBA 5IKXA 3BEOA 4IIHA 1E0AA 1NJGA 4CM9D 2Q5OA 2IEBA 1KBQA 2XCOA 1P4RA 4HWSA 1M73E 4I3GA 5TIIA 4NCHA 1JXQA 2WYVA 4OHVA 1E6MA 5ALIA 5IJXA 1EB8A 3SS9X 1H3FA 1HT1E 4BO0A 5FTMA 3EYAA 3GRVA 3FHOA 4FNAA 2PL9A 3RGGA 3R5FA 3U7IA 2PQ0A 3QE4A 3H17A 3IQIX 3HR7A 4HB3A 4K6HA 1T1GA 4Y7CA 2HCFA 1SHZA 5IM4A 1DDOA 2WU1A 2EKZA 1R66A 1BD4A 2R00A 3C74A 4RGQA 3UHAA 1HDZA 1Z8FA 3ZD8A 2A4KA 3QOWA 2XBUA 1BG6A 4FKBA 4DVJA 2XDAA 1I01A 5AUNB 1JDSA 5DLEA 2PNJA 1CQJB 3PNYA 2W6IA 3VYRB 2F1HA 1DI0A 2FFRA 3WR5A 3MWEB 4RZXA 2QY9A 3ZEIA 2VNIA 2JK1A 3GIDA 5EZQA 1ORIA 3WNVA 2N46A 3A6KA 3FI9A 2W4QA 3A7EA 3BRWD 3IALA 1LCIA 1CRZA 2CVFA 2OMKA 3A06A 4HXYA 4JIMA 1FSSA 2W2MA 2BL4A 5I3CA 5ALEA 4LQDA 2IXBA 3U39A 2IVZA 1NQ5A 3TAUA 4TVOA 2KI5A 3Q85A 1CF9A 2W2LD 2I3DA 3GX1A 1AF4A 3QE0A 3UT5B 3JQFC 3LO5A 4CCWA 4DBLC 1F6WA 5C1BA 1M2KA 1MGOA 3IAAA 1KJZA 2P2DA 4PYQA 2RHTA 1CB0A 1M9NA 1PU2A 3OOJA 2AD5A 3COPA 1PL6A 1WUYA 2HU8A 3DZHA 5I01A 5DGTA 3UXMA 2GHQA 3HQ4O 3LE8A 1SHKA 4Y9RA 3VKGA 2EJVA 1U0GA 5AJVB 4J1SA 4O1MA 5CT6A 3HL4A 3C5CA 2C9YA 4ER3A 1ZVVA 3FCOA 3ZLUA 5FI3A 2WB2A 2DWOA 5KX5B 4M38A 2RGNA 5JD6A 5CDUA 1I7QB 1FTWA 1KVUA 3ZLBA 4LXUA 1N78A 1HM5A 5GJVC 4B3GA 2H7VA 4FFVA 4YUYA 1MIOA 4O4LF 2MSEB 2A9KA 4UJ5A 3E84A 4LJLA 1ABEA 2FZCA 3ABZA 4EJMA 2IZ0A 2C9MA 3B3JA 4FYMA 3KQKA 4B74A 1E69A 5A9TA 1K27A 2FPWA 1DC6A 3ELWA 5FTJA 1MAAA 2F8TA 3HFGA 3OZFA 4ENPA 2PHZA 1KO4A 4E2ZA 1XHFA 2I87A 1SD2A 1M33A 3DONA 2B2NA 1YJCA 1XLTA 2SCUB 3LQ2A 1TZJA 4IJUA 5AKXA 1MV5A 3WWZA 1EFKA 4YCBA 3JTEA 5TE9A 3GJYA 1CB7A 1TM7E 1UDRA 5F12A 1AGRA 1TUBB 3I39X 3WQBA 2AFRA 1VYUA 3CINA 1Y6RA 2UYCA 1NGSA 4KGVA 5IK2D 4A73A 1QTIA 2PFKA 4F5WA 4BTVA 1C0LA 1WQ3A 2H08A 2GB4A 2PL3A 1PZHA 2D3WA 4CCAA 4XCVA 1I7SB 2EGGA 1IOZA 3DKVA 4YRJA 1T2VA 2CUTA 2Q6IA 3B38A 2YVKA 3M4YA 2QYTA 5FEMA 4LDRA 3IP1A 4IF4A 2ECKA 3T3DA 5KI6A 5ES4B 3I62A 3AH8A 3UMBA 1HNWB 4PIVA 1I4DD 4G5HA 1F7VA 2VUTA 4Z99A 4P0PB 4AF6A 1PJ8A 3TVDA 3ZI7A 5EESA 3C3DA 1TW2A 1RVDA 3Q7IA 3OPQA 3R6GA 5CB4A 4EHJA 4I5DA 4X1YA 1G0OA 1OMOA 5E2AA 3R7WA 1A7UA 1NSYA 1C9EA 1P33A 1VXOA 1Z0ZA 3I92A 3W6PA 1GZ5A 3BRWA 3WTCA 2IZZA 2X0NA 3FLEA 4N5MA 4U2DA 2GPSA 1TEXA 1L8XA 4ZMRA 2G4CA 3H2IA 4PSAA 5CNJA 5AIBA 2RGBA 5CEJA 5EUQB 3OU6A 1U2DA 4FHZA 4PTLA 4BC0A 3EIQA 3KHSA 4B4UA 3RIHA 4DYDA 2VPIA 4RTRA 4XGRA 1JIVA 2DWQA 2E89A 3ZQJA 1JHYA 2QSUA 1RKQA 2X22A 4PLZA 3N0VA 3ZIDA 5ELXA 1IIRA 4MS3B 1TVMA 3IR6A 3QV2A 4UUOA 4PG4A 4YMWA 4W5QA 3D4OA 3EOBI 3RT1A 3R23A 3T3MB 2IP2A 5HDQA 4ENVA 3PRHA 5DP1A 1LWNA 2JEZA 3SCZA 1H6CA 5CT4A 3LNCA 3LUGA 4LKOA 4TVBA 5BNFA 5TX7A 3RWBA 3H16A 4E09A 1PJBA 5BSHA 4OTZA 4V0KA 4MTCA 4UNSA 4AJ4A 3GG9A 2HIHA 3G2OA 3HRIA 3Q98A 1RW4A 1ZOLA 2GAAA 4PIPA 4KGDA 5CA0A 2VDVE 1CKEA 3DKPA 3M49A 3OM9A 4IH1A 1TKCA 3NEYA 3UYLA 3CNNA 4II2A 1WCXA 2JDID 2ZTVA 2MINA 1O94C 3HJNA 3KWFA 5AKIA 1SELA 2VI5A 2OEPA 1I5EA 2AEJA 1JVSA 3HDVA 4M7WA 4BZWA 2ZWOA 4RZUA 5IP5A 4QLBA 3PQFA 2GILA 3JAKA 4GYKA 1KQFA 2QX8A 1W0KA 1E9AA 1Z33A 4LNUA 4F8JA 1G8AA 1WVIA 4P36A 2B5VA 1JEAA 5TARA 3B2QA 1WOMA 2R8BA 2DCMA 2QGZA 4GE0A 2ZQ5A 2JB9A 5JO0A 4L22A 1RTTA 1QUFA 4IQGA 3WGNA 4Z3DA 1LEHA 1C9MA 3GJ0A 3IO5A 4XVRA 2V7GA 3LUPA 1NNEA 4K0KB 4AI6A 4V1CA 1NN5A 4U8HA 2EF0A 5F77A 2C1ZA 5ALNA 4AZWA 1N6IA 5HVNA 3INGA 4UHBA 2WYHA 1L5QA 4NG5A 4UZSA 4EGSA 4BGEA 1LRKA 2O6HA 1ZQ1A 4DPMA 3UY4A 5ESXA 1TK3A 2GA9A 3EY4A 3M1LA 3OZGA 2IHVA 2YIMA 4E31A 1GU0A 1JHOA 3ZCVA 3RK0A 1FZQA 4B7AA 1Z22A 3DZJA 4YREA 5K5EA 1T9GS 3WLHA 4V0ME 1FOEB 3PI6A 1OX4A 4QG7A 1S2MA 1C7RA 2HC9A 5AKYA 1NYLA 4EO4A 1OH5A 4TGLA 1FNNA 3DB1A 4IDOA 4QGSA 3A9VA 1RQXA 4ESVA 3HCFA 2I1LA 3EXHB 1RWXA 1ZK2A 2ODAA 3GLHE 3PXDA 3SDBA 3ROXA 1ICEA 1U4NA 1ZM3A 2PMBA 1N2BA 3ZR4B 1LBEA 5FIUA 5FUQA 4D41A 2BYTA 3KAJA 4UM7A 2QDXA 4IV8A 1GR1A 5J1TB 4E4TA 3I6BA 4EVQA 3LFTA 3B9RA 4MVJD 3AGQA 1FDRA 4MZDA 4RESA 1NRIA 2VTKA 1G8MA 2I2WA 3FSGD 2Q3HA 3PJFA 2ADOA 1MIOB 3UUEA 1E2IA 3NI2A 3JYOA 4G1VA 2B1RA 4EB8A 2WKRA 1E96A 2IYSA 3HDQA 1T1SA 1P18A 1Z73A 1FP6A 2OBYA 4BX3A 1UZLA 4MA5A 2P68A 3A31A 3V33A 1FJXA 4UMEA 2OUIA 2P40A 1T5OA 2GI4A 3Q10A 1UKEA 4BAGA 1IHXA 1U2PA 3KJIA 4GF5A 2ZWVA 5KQMA 5KU7A 3IQXA 2QLMA 2Z2IA 2YZMA 2VO1A 1RZRA 1VCMA 5A6VA 2GWRA 1XTZA 4TWZA 3VR5H 3T9FA 3HSYA 5FWXB 1W5SA 3ACDA 3B3QA 3MZ0A 5HUJA 5D1HA 4LJYA 1IPEA 4EI9A 5ENVA 5IMSA 1TK9A 4FDUA 3NT2A 4EKNB 2W6OA 4EITA 1QFYA 1ZW1A 5KAMA 1FLDA 3AHFA 2HA6A 3ZH9B 2VRCD 1P7YA 3O9VA 2C4MA 3AKYA 1E3MA 2P0EA 1NR7A 4U7DA 2HRRA 4ZO7A 1RJEA 4TQ9A 2XNCA 2ZT8A 4ND5A 4Q9IA 1WRBA 4RPLA 5KSOA 4X65B 4ZT6A 1NMSA 3G6WA 3NX4A 4HH3C 4BFSA 4RJ2A 5CLFA 1XWWA 2JBHA 1IM5A 1GQ2A 1G64A 1MRZA 1R10A 1SHLA 2BLLA 2NZWA 1JEEA 1JQ3A 2GKSA 1Y1QA 3P27A 5E4YA 4WCFC 4RANA 3AY3A 3SXJA 3GJ8A 3AZPA 4RV4A 3NVKI 4BNTA 5T57A 3G68A 1YQQA 4EKDA 4LMRA 1Q95A 1NY5A 5C32A 5JS2A 4AROA 3CTPA 4ZAZA 4X1YB 3EA0A 3V4LA 1XDSA 1U1EA 3ZC3A 4W9NC 1E3WA 1SC1A 3LUHA 4JLWA 1B8NA 3ACBA 2TS1A 3I5UA 3QYPA 3A1TA 5HF6A 3U61B 4N3AA 1EUQA 2ZZKA 1MXFA 1V95A 2QORA 2ZJ0A 4NOMA 3NAQA 1L6IA 3AUFA 4ZKEA 3QKRA 3KQHA 4ND6A 5CNKA 2BHLA 3EEQA 2WTMA 3KVVA 4EW1A 3QU7A 1EFHA 3B12A 4LY9A 3SC2A 3A27A 4YHBA 1ISIA 4W5NA 3BMCA 5HIKA 2QVCA 3B85A 1XX6A 3T1OA 4BNKA 3MTGA 3ORFA 3N0TA 3UV3A 4DG5A 3TBHA 3S2IA 5H9VA 4FGKA 3D8RA 4RX1A 2A1UA 2Z3ZA 5HM6A 2PD4A 3CIFA 2R7LA 2G83A 3DD1A 4GLOA 4ER5A 1JECA 2I0FA 5CA0B 1HTTA 4DCOA 4RJTA 1LGYA 1E2UA 2JAWA 3O82A 1HORA 3OCZA 1P1IA 4RPCA 1NJ1A 3WIOA 1LDBA 3FUXA 3L02A 4C05A 4YDQA 5BYKA 4ZAYA 2MINB 3FSGA 4HAXA 3RS5A 5C4IA 5IABA 2HFKA 1U7XA 1I3KA 1XFDA 3GJ7A 4KO3S 1YZKA 1ZIOA 3JAKB 5TV2A 3UA3A 2YL2A 3H65A 4DDMA 3Q0IA 5EHNA 4Q4DA 2JLSA 4PYJA 1BRTA 4C0BA 2HSGA 1SOVA 2ZUSA 5BR1A 3Q6IA 2MYPA 4R81A 4EEKA 1O1YA 2B1QA 2ZLBA 3AV0B 2Z8XA 3FUWA 1AGYA 3LXUX 3I2YX 1YB5A 1OFGA 2FI1A 3BJMA 1VB3A 3QKTA 3M1YA 2G9NA 1PGQA 5AICA 1NJ6A 1X2BA 3SSOA 3II6X 3RRJA 4V1CB 3OF3A 3TS1A 2MYTA 3PDJA 4H77A 1V5GA 3IAS1 3L46A 4PW0A 4RKQA 2F1OA 2WSSD 2JLXA 3LBIA 4ENSA 2I29A 4TV8B 2Z4RA 1MQ9A 3NAZA 2OFOA 2QL9A 1PO7A 3PGVA 2A92A 4XQEA 4ZQHA 3KZOA 5G1NA 3Q87B 2QTVA 1Z0UA 2G5PA 1KMIY 1NWHA 4TV9A 1EVKA 3H8WA 4CZ2A 4IKOA 5J59A 5K1ZA 1HR0B 3E2MA 5CDFA 3IT3A 3A6ZA 3PLRA 1SNYA 4UARA 4BBZA 3VJKA 4YXFA 4XPZA 3GUUA 2ISQA 1QVRA 3MT7A 3B7GA 4LISA 1ODFA 1WSBA 3EWNA 1OX4B 4M60A 4OK5A 4ZEWA 3W2HA 4C78A 4Q7QA 4XRGA 1ATIA 3OPXA 5IYZA 4DWVA 1SPBS 4JVOA 3LIPA 3RVDA 4US0R 4KPYA 2XCQA 4GG1A 3O1JC 5ARBA 3CN7A 4H7DA 3AU9A 3DAPA 3PPIA 4C7VA 2YXEA 2H1WA 5DBOA 4LBYA 2ZW9A 2V8BA 1MD9A 1RDFA 4RJJA 5A1TA 4F7DA 4PCAA 1FIUA 1U9YA 4GNKA 4WE3A 3V4SA 5F64A 2XEDA 4JLMA 5EIBD 1OOEA 2AK3A 2XYVA 2GEKA 4PXYA 1A04A 1BHO1 2A5GA 3L8YA 5DZSA 1RHJA 4ARUA 2P2SA 4F8EA 3E9DA 1GNLA 2XQKA 4WEQA 1V4VA 4COKA 3DR5A 3PQEA 4P4SA 4O2RA 5FO0A 1WIWA 5BMVA 3LBFA 1JHZA 2GO1A 4QWWA 5JNSA 2C7QA 1R37A 2VDRB 1XRQA 1UBMS 5AW7A 2VT2A 4UBKA 2ISCA 4UXIA 3ERCA 3T6KA 1IY0A 1DDGA 1WV0A 3ESZA 4BX9A 5EPOA 4BU1A 1E2FA 2XOEA 4HP8A 2FK8A 4YO8A 2HF9A 3EGXA 4WXMA 1Z7GA 5JJBA 4QOJA 4B5LA 5DW0A 1CZNA 5LP1A 2FR1A 4IDPA 4ZOAA 1WA5A 1BDMA 3BE6A 3ZQUA 3R6LA 2C83A 1Q21A 1I7DA 4DPLA 1H0HA 1MOSA 1JBEA 3IUMA 3O84A 1HKHA 4NS1A 4ZEXA 2XWSA 2PRSA 5AJHA 1QF7A 5BWNA 2H9IA 1GYQA 1L5SA 3QY0A 2J85A 3WYNA 5LQMA 4UCXA 1EE2A 2X0JA 3GJXC 3UKOA 2ZAOA 3U48A 5FNVB 1WMBA 1XDGA 3BHJA 3VOSA 4B2YA 3SM3A 3MTAA 1SOWA 4ZYUA 3JQAA 3PXBA 3KKPA 3GVXA 2BMDA 1KOLA 2OCXA 3GBSA 4ZI5A 1JSLA 4RK1A 3CQ9A 4CETA 2ODBA 2AMVA 1SY7A 1HQDA 2C9CA 1RAGA 2P1ZA 4F4IA 4NK4A 1M6NA 4ND7A 1HTWA 1PS0A 1RJDA 3W5UA 2ID8A 3E7PA 2BFDB 4JR1A 1G21E 2VH5R 3T94A 1WJGA 1XT6A 3R7SA 1E5VA 3ABIA 3KPUA 5EERA 2QTBA 3CNEA 3GA5A 3M4XA 3Q11A 1E3WB 1J2JA 1P74A 1QIGA 4D9FA 4GLJA 4O4HA 3RU2A 4HB2A 4WXEA 4B6QA 1GA4A 1TD9A 5F21A 4B32A 2P78A 2IW1A 5EE9A 2JZOA 3R5JA 4IS2A 3NXKA 3DNPA 3QKRB 4TROA 3BSFA 1OU4A 5CHEA 4BL5A 3OTOB 2OILA 5EJ8A 4KO2S 2H00A 4QYMA 5C8YF 2FRDC 2HD4A 1JG2A 3OQMA 3A11A 4IVQA 1GHTA 1YVDA 4Q1BA 1WDLA 3QEJA 5JSFA 2AKAB 4JP2A 1E3EA 5E3IA 4IDGA 3BMCB 4IHJA 5H80A 3PTLA 3WHIA 1IHUA 5L3SB 4WZAA 2YIVX 4QVGA 4JUAA 3RSSA 4EMUA 3OF5A 1W8IA 2A1UB 3PHIA 3ELYA 2IOFA 3FPAA 3CNQS 5TY0A 4JYAB 5E8JA 4HDRA 3TDKA 5JZSA 1GDHA 5EKUA 1XHLA 1NNI1 2HZBA 1MX5A 2ZXUA 2GCIA 2P2YA 5B1IA 1H2EA 2QL5A 2FDXA 1XEAA 1A8HA 1FQOA 3CZPA 4X71A 2FZWA 1QG6A 3PRKE 4L27A 1SWWA 1DOAA 1GZSA 1IMOA 4DR6B 4UHEA 3T35A 1ZGHA 4U7JA 2L17A 3GU3A 2YQ5A 2OWDA 3F7MA 3ZU6A 4A16A 4B44A 3WNCA 4C87A 5JJ5A 1OB5A 1ZZEA 2XMGA 3QWBA 2R47A 2WG0A 4Q66C 3RG8A 1K8YB 1O95D 1IEXA 1GYRA 621PA 1IJKA 2FMIA 5BXQC 2HMAA 1YVPA 1P8JA 2YVLA 3CLRD 4U0KA 3Q40A 1ZWLA 3C6QA 2P9EA 2X8BA 3EWSA 3NHKA 1M75A 3AP3A 5G2OA 2H06A 2OG2A 3SQOA 1PKEA 2LZ0A 2DWUA 1DAGA 3RNLA 4TV9B 2FWNA 1E3DA 1V41E 5AD1A 2DPMA 1YQDA 2NZ2A 3GCGA 1QLWA 4AN4A 2FETA 4OU4A 2ZM5A 4R1PA 4H08A 1Y4ZA 2YS6A 3TIGA 2HA2A 3GRCA 1Z2CA 5KZMB 2YYSA 1GU7A 5EXPA 2AOUB 2XHZA 4PLVA 2BHSA 2HA3A 1SU7A 2IPMA 1PEKE 4MQEA 4D9GA 5DE3A 4Q3DA 5DSTA 1Z3CA 1Z36A 2ZUFA 1NMXA 1ADFA 3R4CA 1D2MA 3K0FB 1FP7A 1VHQA 2WWTA 3R3WA 2FEMA 4NMHA 4W63A 2K6GA 1DLJA 4K9SA 4FEGA 4D97A 2V74B 5BWBA 4B80A 6NULA 1ZRNA 2ACKA 3UAVA 4GXQA 5KNBD 2OPBA 4N7MA 1SOAA 3QITA 2VPPA 3KO8A 3P9XA 2V5UA 2EQ5A 3C8UA 1MEEA 2Y99A 4ZVRA 4RFVA 3PC8A 1X87A 4MR7A 1TAGA 3FYHA 3U6KA 2HSJA 2QVGA 3RBVA 4QOHA 4ARZB 3OH8A 3PUZA 2LBPA 4ZQEA 3OD1A 1P4GA 5BMVB 2V7PA 2WFMA 5DTQA 3KT6A 1CW2B 5DTRA 4DR7B 2AN1A 2XVZA 3BN3A 2SICE 4XUDA 3ZGVA 2XIQA 1QORA 2HBZA 2RH8A 3PEVA 4F9GA 2Y6VA 1JSCA 2B1JA 1XPRA 4PHHA 3UUGA 1P9LA 1KJ9A 1S3FA 3N7AA 1ZJZA 1YJ8A 3EGXB 1NLFA 2W6JD 4MVYA 1PV2A 3B78A 2XGSA 1QM5A 1L4MA 1PG0A 4BVLA 2XMZA 1H2XA 1BOFA 3T95A 3LQQA 4NLLA 3F6SA 1P9OA 1J5PA 2XNDD 3M6IA 3ZWDA 1PFUA 2J4DA 3L49A 1P4JA 2NZVG 2WUWE 2H92A 4Z49A 5HSGA 1QRDA 2NU8B 3MJHA 1V45E 2PFGA 3DE6X 1YFKA 4S1PA 5BWMA 5KWSA 1EVYA 3JPWA 3CNOA 2R1VB 3JQ6A 2XEXA 3N39C 1T36B 4DV1B 5E6SA 4DJAA 1M7HA 3L1VA 1XZKA 2NT4A 2X9NA 4BNXA 3RIEA 4HV4A 1KIMA 2PDAA 3SIPA 1L4GA 3QZUA 2YZGA 3T38A 3ZUPA 3KQUA 1ZVKA 4A8JC 3VR1A 4CQMD 4WOCA 1YL5A 4R0VA 3IQWA 3ENVA 3ZDZB 4E22A 4ZANA 5EJ9A 4TTPA 3JASA 3UJDA 1P7CA 3SNHA 3GLQA 3ITDA 3CX6A 4PV7A 3SS8A 4R3WA 3UF0A 1O97C 1ZAYA 1KR5A 1OC2A 4DSAA 1NMQA 3D8UA 5JNUA 2D7JA 2B7CA 2CJPA 4NBVA 3IHTA 1R00A 4O4HB 4COOA 4ZVOA 4F4UA 1DJLA 4JHLA 2V54A 4RZSA 2FOLA 2B0JA 2J45A 4QUJA 3PR3A 2H17A 1RLMA 2YX1A 1D3AA 3CN9A 4FEYA 4KEAA 2OV2A 1YDWA 5FL3A 1FSGA 3OE5A 2C95A 4YRTA 3JWIA 2ADFA 1AXGA 5K0LA 4RAOA 3SQMA 5DH9A 1R0KA 4YCNA 1VKZA 1H2HA 3QA9A 4KXLA 4EMBA 1VZ2A 3LCJA 3VX3A 4NCJA 2DPLA 1U0SY 4UTNA 1MJ5A 1PD0A 3STYA 1T9CA 3TTVA 4YJ3A 5KYXA 4EY7A 1Z4JA 4HSEA 3IQFA 5C1DA 1MEJA 4B6PA 2IH2A 3JYNA 5LUBA 2IBMA 3GRAA 4O63O 1ISJA 2HUNA 2DQKA 3B82A 4WX2B 2JASA 4KQFA 2WQZA 4WZAB 1OI7A 2X8AA 2EFEB 5DM2A 3TLCA 1JI0A 4H1VA 3N7UA 4G5GA 1WDWB 1N5JA 2Q8QA 4UUPA 5LP6A 2O19A 2FPIA 2VXOA 2ASVA 2ONKA 3AF5A 3DOFA 4DIMA 1OLSA 3NJ8A 1M0EA 5CXQA 1KI1A 1UEIA 2ZU6A 4AMUA 5G41A 2ZYIA 2YBEA 3H83A 4MLPA 1GNSA 4HS4A 4LZNA 4OHKA 4QDOA 4RPJA 4XI9A 3OX3A 2FZ5A 4MYTA 3TLAA 1KDZA 2VJMB 2JHFA 3G3EA 3BFPA 1FFHA 2DLCX 2QV0A 3KVRA 5A7GA 1H6AA 3TE6A 4ZHSA 1Y6FA 1XB2A 2QZZA 1KKMA 2Z9CA 1KY4A 4IP0A 4JT9A 4ODIA 4Q4AB 4R83A 3AUKA 4ZAFA 4RK0A 3L8FA 4NDZA 5JTTA 1U8AA 3K96A 2J9FA 2UUPA 2IUUA 1AUQA 3B1JA 3LRTA 3QMMA 5B1EA 2AVDA 1BCSA 5HQJA 4QOSA 3CUWA 4NFLA 2JJ1A 5JJIA 3GPCA 3Q8WA 4DVGA 1H0RA 3ZW9A 4HY3A 3VU0A 3CZ5A 2PVCA 5CLJA 1D2EA 1TKBA 1XQ6A 2XNDA 4YT5A 4DCGA 3K9FC 1RZVA 4V2IA 3IP5A 1X80A 1OT3A 1PN3A 3FHJA 2POQX 2QPOA 4LRXA 4M9ZA 3RQIA 1I4WA 3FPLA 4DY4A 2JLWA 1FFGA 4UXJA 1XU4A 5G0TA 3FZEA 5JE8A 1O5IA 5KU1A 4HEJA 1YKGA 2GN9A 3KTOA 3KX2A 4MV1A 4MWEA 1CUUA 1TMKA 1JHDA 2DE0X 2BFBB 4X41A 5IPFA 4BMZA 2J3HA 2ZEJA 4F0JA 3QMVA 3BQ9A 3QPAA 2YUTA 3O0DA 4GOJA 4HCJA 4MQFB 4AG5A 5BUQA 4G1UC 3PFFA 1X7GA 1LC3A 2A4MA 1MAHA 4FYXA 4PFSA 3RAGA 4EY3A 3MHTA 3O1LA 3IUNA 4AO8A 4LPKA 1T8PA 4RVHA 1UMBB 1XEFA 4YV0A 4ZYVA 2BBSA 3S81A<