2DLCX

Crystal structure of the ternary complex of yeast tyrosyl-trna synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
339
Chain Sequence
DPNEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/trna
molecule keywords T-RNA (76-MER)
total genus 118
structure length 339
sequence length 349
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2dlcX02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dlcX01
1M83A 1V8FA 4MUKA 4MW4A 3Q12A 1JIIA 4Q16A 3CLTC 5J59A 3ND7A 4ZT6A 1M8JA 2RE8A 1H3NA 4HK4A 1FYDA 3N9IA 4UZFA 1KQOA 1M8PA 2AZXA 1OD6A 1MOPA 5J5AA 3MMXA 2A7XA 3FH0A 2JAXA 2C5SA 3MXTA 1KR2A 1KP2A 3CVUA 4MUGA 1NUTA 3Q10A 1F7VA 3RK1A 3COZA 1O94D 1OWLA 1QQTA 3CLUD 1XNGA 2AKEA 2CUZA 1JEEA 1VL2A 2IJGX 2A4MA 1OBCA 1MRZA 4S1OA 2A84A 4XFJA 3DPIA 3FG9A 3KT8A 2ZP1A 4NDAA 5HUHA 3IOEA 4U7JA 4U8HA 1QTQA 1Q19A 4L2IA 3KFLA 1K4KA 3KT3A 3PNVA 1YIAA 4ARIA 3SEQA 1OWOA 4JZYA 3ISJA 2CYBA 4GU5A 2VXOA 1N3LA 3P0HA 1KQNA 3H97A 3SYTA 1WY5A 2RD2A 3GUZA 5EKDA 2D5BA 4AQ7A 1EUYA 4BWVA 2E21A 3TQOA 2QJOA 1N2HA 3DLAA 3OP1A 3F3MA 2CFOA 1QU2A 2CV1A 2J5BA 1WKBA 4KKVA 1TYDE 1QRUA 4ZCQA 1EE1A 1KP3A 1WXIA 4EG8A 1O0CA 4MW9A 2A1UB 2CV0A 3QTTA 1PFVA 3VGJA 3E27A 1KAMA 1TYCA 3GMIA 3CVVA 1Q77A 2ZUFA 1IVSA 3H9BA 1KH2A 3TZLA 3NBAA 1B6TA 4EG3A 1Y42X 1KKUA 3KT0A 4ARCA 2YXNA 2DXIA 4G6ZA 1I6KA 2QTNA 2J4DA 1LW7A 3IMCA 3HGMA 1N1DA 1WQ4A 2PZBA 3ZXIA 1QNFA 1R6TA 2X3FA 4NZPA 4RPIA 3HV0A 1O94C 1VBKA 4Q93A 4EFKA 3DV2A 4MLPA 3D6UA 1N2IA 2A86A 3IVGA 1N75A 4MVCA 1HYBA 2DLCX 4MWDA 2IELA 3RBAA 1YUNA 4MW6A 5LM3A 3LOQA 1P7PA 2DETA 3SDBA 4L2IB 5HUJA 4KR9A 2VTBB 4XSVA 2CYAA 1MC1A 3TQIA 1EFVB 3KT6A 1X8XA 1YIDA 1WZ2A 3RK0A 4WNYA 3IOCA 1T9GS 3ZJVA 1O6BA 4ZT3A 3N05A 3IMGA 4HJRA 1COZA 2EJCA 2D54A 1GN8A 4MW7A 3PRHA 1X6VA 4MUFA 1M8FA 3N2YA 4CDMA 4MW1A 2J07A 3TS1A 4R0NA 4MW5A 3K32A 4QREA 1TYAE 4I6GA 4I6EA 4MUJA 1EJ2A 4K0RA 1G8HA 1ULHA 4H3SA 4CT0A 3COWA 3C8ZA 4OJMX 1MJHA 3NV7A 2D13A 3ELBA 3BL5A 4NAHA 3UOWA 3CVXA 4QRDA 3AG6A 1FFYA 3FDXA 3PNYA 2OQ2A 3A05A 1MB9A 3UY4A 3RHSA 4MAFA 4MUNA 3IVCA 1KH1A 1IQUA 4JXXA 3HFJA 1O97D 1JECA 1NSYA 2NZ2A 2AG6A 3LE8A 5J58A 1J70A 3JXEA 2JA2A 1O95D 1O97C 2R5WA 2Z09A 3INNA 1OWNA 1R6XA 3IH5A 5LLTA 1O5TA 2PG3A 4G5YA 2TS1A 5TEVA 3X1MA 1M1ZA 2J09A 5BNZA 5F23A 1N78A 1JHDA 1K4MA 3IDFA 4MUIA 3H9CA 3P0JA 1VBMA 4E1AA 1T6XA 5TGTA 3PXUA 4PBSA 1IQ0A 1PG2A 1QJCA 3AIIA 3UK2A 2WQ6A 5KHAA 4ZT7A 1NYLA 4KPUB 5TS2A 2BTEA 2XRYA 4OUDB 1J20A 5H16A 1NURA 1KAQA 2PZ8A 2CV2A 3SP1A 4DDHA 1O95C 2QUIA 1IFXA 2BYTA 3RJZA 1F9AA 5IJXA 1T6YA 3NBKA 4J76A 3G6KA 4EG7A 1NUQA 3ZXSA 2HZ7A 2B7LA 3SZGA 4EG4A 2X1LA 1JMVA 3FNRA 3DO8A 2DR2A 3IODA 2YY5A 1EXDA 3VRHA 1JEDA 3CVYA 2EL7A 5KCMA 4A91A 2Z08A 2CYCA 2E0IA 1K97A 1XNJA 3CLRD 1M8KA 1DNPA 1O96A 2QUHA 3SZ3A 2O5RA 5LFAA 5K0TA 3QE4A 5AHWA 5FO0A 1G59A 2ZUEA 3RFFA 4NAUA 3IUEA 4HPWA 3G5AA 1LI7A 5DASA 3AL0C 4PBRA 3FETA 1PG0A 1YI8A 2X0KA 1VLHA 1ZUNA 3CLRC 4MUHA 4MWBA 3TZEA 4GRIA 1N2EA 1MAWA 4YP5A 4P2BA 2A1TR 1G8GA 1GAXA 3X1JA 3FIUA 3P52A 1D2RA 1U0BB 4MW2A 2PFSA 1O0BA 1NI5A 1NP7A 4R2MA 1J09A 3A04A 1CT9A 1ILEA 1XJQA 1XNHA 1H3FA 4OUDA 1WXEA 2Z3VA 1N77A 3A4IA 1OBHA 1WQ3A 3LCJA 1U7XA 3ZIUA 3H05A 1NUUA 4ZT4A 4TS1A 5IHXA 4R2LA 3VU8A 4ZCTA 4JYZA 4AS1A 1K92A 4YP7A 1YULA 2QTMA 4EF6A 3H99A 2JANA 4PY2A 1EUQA 3AG5A 1R6UA 3COYA 4EG1A 1WXHA 4KR7A 4PBTA 5DB4A 4DDKA 4NX2A 3CR8A 3GLVA 4UZEA 1WXGA 2CT8A 1PFUA 2E18A 4DLPA 1O96B 4EG6A 1Q11A 4WSOA 2QUKA 3HL4A 5FO1A 1PFYA 1I2DA 3ILVA 1OWPA 2YWCA 3CLSD 1T6ZA 4ZCSA 2PXHA 2HGZA 3IMEA 4MQ6A 1TYBE 2GM3A 2A1UA 4ZCRA 1TQ8A 4K03A 3HMQA 2A1TS 3K9WA 3HZRA 2QUJA 4EG5A 1JILA 3ZUGA 2V0CA 5DK4A 1EFVA 1J21A 1WJGA 3UMVA 3X1KA 2QJTA 3ZGZA 1S4MA 1JZQA 4DNXA 4DE5A 4ZT5A 3ND6A 4MUEA 1UFVA 4JXZA 3UC5A 1IRXA 1VBNA 1U7DA 2V0GA 5DEOA 3L92A 3CLTD 1PFWA 2YWBA 4DDMA 3MUEA 1IHOA 3IUBA 2CSXA 3FWKA 4I6JA 1MBZA 2IP1A 3FHJA 1H3EA 1ZH0A 2J08A 1ZH6A 4MULA 1NUSA 1MAUA 1MB2A 3AKZA 3ZJTA 1JIJA 3FI0A 2NSYA 4MVWA 2VTBA 1QRSA 1M8GA 1ZJWA 4ZT2A 1QU3A 2DERA 1GZUA 5KWVA 3IOBA 1GLNA 5HG0A 1KORA 2I1LA 4J75A 5TEWA 1JGTA 1EFPA 1QRTA 2OV4A 4MWEA 4MVXA 4MVYA 4F3RA 3ND5A 3S3TA 1IQRA 3I05A 1RQGA 3CLUC 3Q4GA 4ZCPA 3L93A 4KR6A 5K0SA 3MLBA 3N8HA 2XRZA 3COVA 4MWCA 4XFDA 4ND6A 3G59A 2WQ7A 1NZJA 2WB2A 2GKSA 3P0IA 1Q15A 4NATA 1N2OA 2GOYA 1G8FA 1WXFA 2PIDA 1IH8A 1YUMA 2O8VA 2QJFA 4FZJA 5H7XA 1GTSA 1GTRA 3U1VA 1GPMA 3M5WA 3OTWA 2H29A 1LI5A 4RUKA 4U63A 1H1TA 2PZAA 4YBRA 3A2KA 1T9GR 4YP6A 4X0EA 4F4HA 1U3DA 2DPLA 1U3CA 3AFHA 1A8HA 4DJAA 4JFAA 4ND7A 2E89A 2WSIA 1V47A 3QTBA 1WOYA 3CVWA 4HJXA 3CA8A 3FY4A 4CQNA 3ZJUA 1N2BA 1I6MA 1JZSA 4QBTA 2G36A 1F7UA 3FOCA 1TEZA 1I6LA 2QTRA 2H2AA 3MLAA 3SEZA 1BS2A 1NUPA 1J1ZA 3PNBA 3IVXA 4KPUA 5JBNA 1TFUA 2HMAA 1F4LA 4G5FA 1EFPB 1J1UA 1N2JA 4EGAA 2A88A 3D6VA 2DUMA 1OWMA 5FNZA 3CLSC 3TNJA 1KQPA 2DEUA 1JIKA 4MW0A 2X1MA 1SURA 1KH3A 1N2GA 4YMIA 4CDNA
chains in the Genus database with same CATH superfamily
2JEOA 4XPIB 2Q7DA 1Z7YA 3PT5A 4GZ5A 1GD1O 1RVV1 3MJRA 3H2JA 4I1IA 4R40A 1RQNA 3L8DA 4RCZA 4ZT6A 2ZKLA 3ESBA 4AECA 3WL3A 4HDSB 5KOYA 2FN8A 2GNAA 1L5FA 1ADGA 2ONYA 3GDFA 3LC2O 1CRWG 2CB0A 1KYZA 3H2YA 1QLJA 3UAXA 4XLTA 3W8NA 3MGCA 1Z83A 3SS9X 5EJ9A 2IUSA 3FH0A 4MIOA 2D2VA 1EP1B 4M0UA 1E3IA 5DJ5A 5E7MA 1VHWA 3T1OA 3H42B 5EN4A 3MJSA 3TLJA 1BCRB 3PQFA 3A32A 5AKXA 3N59A 1Y34E 5BO5A 4EI9A 4YV2A 1Q7CA 3DBRA 4MDEA 2RH9B 1QQTA 1KFEB 2FW6A 3T52A 2XKJE 1RI3A 2GAIA 4H60A 4CMJA 4YPFA 1D8TA 5EMJA 4P84A 3S2SA 1I4TD 2IZ7A 2J33A 4EY8A 3EE6A 1OYOA 2O2GA 1P7ZA 2D2EA 1V96A 3OZAA 5KHAA 2P90A 2ECPA 2V7XA 3DYVA 4DIKA 2IYOA 2Q1YA 4Q0MA 3EIWA 3I45A 5A3RA 2VRBA 1K6IA 1YIAA 3BMOB 3GZJA 1CZRA 3LUJA 3PFIA 4F6LA 1I2AA 2PL9A 4DYVA 3AP2A 1H1LB 3UB4A 1MOSA 7AT1A 1QZUA 3K15A 4D92A 5D85A 1C14A 1U2PA 3PNOA 5EYPB 5A6SB 1QZXA 1SBNE 1GNTA 2VXOA 3GFGA 2XEXA 3KJXA 3SF0A 4BLRA 3AO0B 4N4AA 5IBPA 2AI2A 4CLOB 4PYQA 2RD2A 1V5GA 2I8LA 2ID9A 1J25A 1WDLA 1F20A 1NE2A 2RGUA 2FUNB 3I2FA 5FYDA 3FNBA 3D6NB 3OKPA 3TVTA 4PPQA 5BP7A 4X94A 3NKVA 4EYGA 1LTQA 5LP6C 1WDMA 3KSZO 3U9LA 3WX0A 3R7WB 3QFSA 2DU8A 4LTDA 1EFCA 4ACBA 4JB2A 4B7CA 3E61A 3JQEA 1SC6A 4NR0A 3ONNA 4R68A 3B78A 2ODBA 3L4EA 3WYDA 4AL4A 4LJLA 4DAEA 1EA5A 3NAGA 2WFMA 5KWJA 1CJTC 2PMCA 1PQWA 4HAWA 4TZ0A 4EAQA 5CM9C 4WXPA 1AT1A 3I9V6 3N0TA 3RROA 3K4PA 4YJ2F 3VKWA 3WGTA 2ODEA 2V58A 3HYCA 1X3SA 5DX8A 2D5AA 3TDMA 4BVBA 1QWSA 3CG4A 3EH1A 3PC3A 4GR5A 2JGJA 2Q2NA 1KH2A 3I4LA 2FJPA 4L4RA 4PAGA 1R3UA 3ZNNA 4ASUD 4P7FA 4CPDA 5JY1A 4G0UA 3L0IB 1N5MA 3NVAA 4B7AA 5F51A 5LP6F 1YTLA 4CKEA 1GSOA 4Q7KA 4RPLA 1P5ZB 4HN2A 1E2PA 2VHQA 4QYIB 4YRLA 5LB2A 3DZKA 1QMGA 2W8ZA 1P80A 1PEDA 2EFCB 2I87A 4G6ZA 5BV0A 1IBLB 2L18A 3BRSA 4UNSA 2G9QA 1HDEA 2YXDA 2RJNA 3BDIA 3O91A 2QK4A 1R5JA 2IEBA 3RRZA 1BD4A 4QXMA 4A4DA 2OPBA 2RGNC 4F7DA 3QXSA 4NOJA 4XVCA 4AAYA 2C5AA 3ZVNA 4EGSA 2HK7A 4Q93A 4YR9A 3MD9A 4XDHA 3JZIA 4EJ2A 2KBEA 4OSOA 1TZMA 4BNHA 4B84A 3QBJA 3CSDA 3IQGX 2B7CA 4EDFA 4PQEA 1Y3CE 5G02A 2QD1A 4NSNA 4OUKX 3WDLA 5ADVA 5HUJA 1E3JA 3M4YA 4KR9A 1UBCA 4XSVA 1ZNXA 4YJFA 1XQXA 4TVBA 1XK7A 1SXJD 3RK0A 3K72B 2C3MA 4O4JA 2I65A 2GARA 2E4YA 2ZBFA 3PGVA 2EX4A 2VJMA 3WK8A 2L17A 3OE1A 4ZCMA 3W3ZB 3W1EA 1SBTA 3GEEA 1VA4A 2D54A 3B5JA 1G8JA 3I04A 4D9MA 2NADA 3CISA 4XRRA 4WAUA 4Z8YA 3O6VA 1WR8A 5IK2D 1LPAB 3B38A 4OPMA 3DOJA 3U6BA 3VO2A 5FPSA 3JARA 1KS2A 1RHKA 2QROA 3K32A 4XM0A 5AJYA 3RUCA 3UQYS 4YECA 5BR1A 4OJNA 2O8CB 3UHAA 1UH5A 4L75A 2YV1A 4LX0A 1MOZA 2EJWA 3CZ4A 3JASA 3MT9A 2W6ID 4LXGA 4CT0A 4ZOLB 2KB0A 1KETA 5JNWA 3I4FA 1G3MA 5I7AA 2A5JA 1CJVC 2BEVA 1O6ZA 2AXQA 2OEPA 3NPAA 5HHTA 3BGIA 1FX0A 3DZCA 5AK0A 5AJXA 2CVQA 4DY6A 4N6OA 3P4UA 2B1RA 3PXDA 2GPAA 3PHJA 3EH2A 1ZMBA 4HVTA 1SZPA 4LNUA 4NH4A 4JI5B 4F2GA 1B6RA 4FFBA 4NU6A 3E53A 4E5PA 3NQ41 4KQ1A 2ZM5A 2ATIA 5E6UA 3ZCVA 1VPVA 3HCDA 5FD8A 3EJ6A 4C7XA 1G7RA 1O97D 4MSUA 1HFJA 1F4PA 4Y6OA 5EEHA 1SKYB 3WDKA 2GJAA 4QHTA 1KOLA 3TINA 4UAGA 2GYUA 5IBRA 5CAEB 5B57C 3QXJA 1WDWB 4FFLA 5FP0A 1N7JA 1HY3A 1N6IA 4A03A 3IH5A 1NWHA 2H4JA 3E15A 2OXTA 2APJA 1LY1A 2P1RA 3I6YA 4GVPA 1QPBA 2C9OA 1YJQA 5CP8A 4E2ZA 2A59A 2DFLA 5CDHA 1LDYA 3QPWA 1Q20A 3SJCA 1FS5A 4MI3A 4MVJP 5C37A 3HMKA 5MN6A 3OCXA 1VL5A 4LBYA 3IEXA 4II3A 1UEJA 4NYIR 1H94A 4EM6A 2IV3A 2FGKA 3N7UA 3U31A 3P0JA 4HWPA 4M87A 3T5TA 2MYTA 2WIBA 2WG2A 4CKBA 5TGTA 3HH8A 2IYRA 4KJZA 3R09A 4AMVA 3GT4A 4A6PA 1NJ2A 4JDUA 2JLZA 7MDHA 2AEJA 4PVCA 4NBLA 5DNYB 3LRTA 3H17A 3CX7A 1ZA2A 4QPNA 2NTNA 1LSOA 4MR7A 4QBFA 3TTVA 621PA 1E98A 2ZREA 3OZUA 2PIAA 4LC9A 1WZEA 4GICA 4YRKA 1Y6FA 2Z9BA 3CGWA 1RXEA 3L1VA 1J56A 4OXQA 4F71A 1DTSA 1E3TA 1AG9A 2A3RA 2NXJA 1S02A 3OZFA 5FPTA 2O23A 5ALQA 4B2PA 3BREA 1M72A 2JIZA 1TGYA 1L7OA 4L6IA 1YFKA 4X71A 3IAEA 2EZ9A 2GHTA 3NH9A 5E1DA 1OVGA 3RR2A 4F4UA 2YDXA 4NE2A 5EKSA 1U5AA 1UP7A 2B4RO 4CM6A 5D51S 4ALMA 3NHLA 1EH5A 1HDOA 2X4LA 3LU1A 3RAGA 3OH8A 3JSAA 4G41A 1RWWA 3UCFA 4ZVUA 3DAFA 3OLXA 1E9RA 1KGSA 2XQIA 2A92A 1NMZA 4FHDA 5H68A 5GJCA 2QMYA 3JQ9A 4V0QA 4ZTZB 2JCVA 3AM4A 1UK8A 3PP8A 4NCHA 4WL0A 4GG1A 4MS3B 1N2ZA 1V3QE 4NPCA 2X1VA 2WC1A 3R6WA 4IY1A 1E6KA 1G5IA 2QLJA 2AN9A 4GUDA 4KGXA 2JBAA 1YRAA 1BNCA 3NU1A 3Q85A 1MH1A 1E2MA 2HH9A 3UBTA 4UVGA 4HNVA 5BN4A 1LW6E 4A8JA 3G5AA 3HY6A 3A3YA 3I92A 4MZXA 5FRDA 4DMCA 2P69A 1TA9A 5JISA 3SVLA 3O7WA 4KXUA 1YI8A 1QAOA 2O1SA 3CRVA 3E7FA 5FTWA 3W2EA 1GPH1 1VLHA 3OICA 3ANXA 3DQPA 1CY1A 1P4GA 1RLTA 4L0QA 3DYIA 2XF2A 3FCCA 3G02A 1FX1A 1HXHA 3FPEA 1Z17A 2AKAB 4DRXB 3G8CA 4IIJB 4DCJA 3KAQA 4TZKA 4EJ6A 1KMHB 4DWOA 4Q9HA 1GAXA 5C53B 4EA6A 4AJKA 3R5FA 2IY8A 1IDOA 3V7NA 3VV2A 2YXLA 2NVOA 2BT4A 3X1DA 1TMKA 3RW9A 4N0DA 1E99A 5KAPA 3Q87B 1QIKA 3ANLA 3CLVA 4LJAA 3ZTWA 1DS6A 4BU1A 1RXCA 2AN1A 5A05A 1BDHA 3HA2A 5IHPA 5SZIA 1PDWA 1PTJC 4U7HA 1UKYA 3E3AA 1NUUA 3FWZA 1KVTA 2R4QA 3Q5DA 3TVYA 2FPUA 1E2UA 3EUEA 4UHFA 3UV7A 4S0XA 4LMPA 2VLIA 3K0AA 2VYQA 1TW2A 4IL5A 5AOAA 4D7AA 5C5DA 2G5GX 3RT7A 3OX3A 1WBDA 1KEEB 3MIZA 4KXXA 4ZAFA 3MYYA 2ETVA 3ZCPA 2J3HA 3UCEA 4QWMA 5IW8A 4KNYA 1RMTA 1WIWA 2JZCA 4JKYA 4I99A 1JN0A 4LMRA 4P31A 2HSGA 3FA2A 4EY5A 3WRXC 1PJTA 3CBQA 4Q05A 1FB5A 1P1FA 4YUXA 3WLQA 4P36A 4E5KA 5AYVA 1DLIA 3RIXA 1YRBA 3BEOA 1KWGA 1KWKA 1ZCBA 1P7CA 1WEKA 3M82A 2VP4A 1RYDA 2I80A 4IHKA 2EW2A 1N6NA 2W43A 2ORED 1UC5B 1YI1A 2V6JA 4P7JA 5DNDA 2XT9A 4ENVA 1ABFA 2ST1A 2GN6A 4YCSA 2B0JA 4NXMB 1VCMA 1ZK2A 2VPPA 2GLTA 1CVIA 4I4TB 1GSAA 4ZCSA 3SYNA 3ZK8A 4BNJA 2C31A 3LLMA 2O2JA 5IT0A 1HI9A 3QXHA 1VIDA 2PGOA 1JKIA 1XVIA 1J8VA 3KWFA 3X2EA 1C1HA 1W4AA 3BRWD 4LJYA 4L8GA 3WFZA 4IIJF 1QC5A 4I46A 2LCIA 4ZVNA 4NOMA 3QM1A 3EZ9A 1G55A 3AUFA 3KJFA 3VZBA 1P0FA 2AEMA 3ZVLA 4EKEA 1R1DA 4Z5XA 5CFMA 4CF7A 1J0XO 1X0XA 1KDRA 3QHAA 2ZJYA 3W79A 4E30A 4EHHA 4DE5A 1V9LA 1XKXA 4N3BA 1IRXA 1VRCA 2V0GA 3HDJA 1SUBA 4JWTA 3R0XA 1Y80A 3L92A 3RYFB 2R0QC 4L9RA 1O2DA 3LUGA 2QRUA 5DPMA 3IIKA 5B1YA 5L95A 4C06A 2AZ4A 3A14A 5JCOA 2AH5A 3TQQA 3LAWA 4UJ5A 5JASA 1Q57A 2E4WA 2EKQA 3DNFA 4O4IB 1PO7A 3INRA 1VPEA 1KBQA 4YALA 1VPWA 1XN4A 3ZY3A 1HLDA 2PMWB 1IULA 2I71A 4G1EB 1N5OX 1NTOA 1PAUA 3SFZA 4DZTA 4B74A 1D3AA 3VR3A 5BOSB 3EXFA 3G0HA 3EULA 3SEAA 1MB2A 4YJHB 3K0SA 1ETUA 4CLRA 3ZWAA 2GCOB 4D4GA 4FJ2A 3JAWB 1A27A 1SVLA 1GSHA 1GTG1 2AWNA 4RIFA 3DH0A 3FVWA 4GBED 1JH8A 4KV9A 3MXOA 2QRGA 4EHIA 2JLXA 1U1IA 1GLNA 2IS6A 3FKQA 2ZUTA 4OYRA 1OXTA 1EUDB 2Z30A 4WHMA 1IEVA 2KHZA 1JGTA 1EA7A 1IUNA 3M6AA 3CRW1 3U17A 4DOMA 1SBCA 2LE0A 4BZZA 3STUA 1K66A 1L3BA 3L1HA 4ISCA 4MNTA 5JBIA 4CMEC 1IYZA 5I7SA 2WTBA 1VKOA 4DIUA 3EEIA 5K0SA 1L2TA 3N8IA 2NO4A 2WA1A 3K2QA 4Q4JB 3N8HA 4RTKA 2ASEA 3F3KA 4A92A 3QTLA 3L8EA 4NIMA 2ZRHA 3QKSA 1WV1A 2A57A 4RGBA 5KOJA 3OFND 4F6RB 3QFTA 1ST2A 1GR0A 1C4XA 4ECAA 2B4YA 1S2MA 1Q1AA 1R74A 4PHCA 4MPDA 1B43A 1WXFA 4IH4A 1BMQA 5FOQA 2QRNA 3EGWA 2XUJA 2YY7A 4OYYA 4AQ7A 3DHVA 1HE8B 2G80A 4JBGA 2MINA 3KTFA 1P61B 4M36A 4TQGA 3TB6A 4CQMD 3SHQA 1R0RE 1T1RA 3EZXA 3KBOA 3A4VA 2FOXA 4O8ZA 3QELB 4MVJM 4WBNF 3GJ4A 4I9GA 1J0AA 1VCIA 4X85A 3H11A 3R9KA 4DSZA 5B6PA 1P17A 1CK4A 4YJDA 5IJAA 1ZN8A 5JYDA 4RPHA 1I7NA 1C7EA 2V0NA 3KSUA 3I5YA 3HUTA 2WSSA 3DT6A 1U3CA 4PYKA 3HWSA 4KYTA 2H0RA 3G9XA 4W7HA 5BN3B 1F38A 5HZGA 4RTPA 4HX5A 4TXJA 3UAWA 3JX9A 5LQAA 4QUJA 3BC1A 4OK6A 3WMEA 4WH0A 3LBHA 1JTFA 3RRFA 3U62A 5I7HA 4W6ZA 4YRQA 2WFAA 2HNAA 4EPRA 4DR2B 2VZ8A 4YYEA 1YK0A 5DCLA 2NQ8A 4TSKA 2WIGA 5I7WA 4FKBA 1KXZA 4XOIA 4LNHA 1LLQA 1FEZA 1I6LA 2LW7A 2I6XA 5TRTA 2W2MA 2XYRA 1QHEA 2P77A 1CVRA 2EXXA 1LBIA 1XVUA 3QJ5A 1PZXA 4JODA 4LXTA 4QSHA 5B7NA 4GMHA 3SYLA 4X65B 3OOWA 5EWLA 4UATA 4D0LB 2BTQB 4LY3A 4ZALA 2FZCA 2FU5C 4WXMA 121PA 1J2JA 1X38A 1N5IA 4LE2A 5KYYB 1EVYA 3AZPA 5SZJA 3I73A 4IQ4A 1TM3E 2FP4A 3T35A 1VCHA 4B3MB 3Q7RA 1A8QA 1XMVA 3KPWA 5LMZA 4HBGA 1KQPA 2PSEA 4MROA 3WSTA 4C0WA 2LDXA 1CCWA 4WN9A 2ZE5A 3ENQA 2I7DA 4QFMA 3D4NA 4IH1A 5EP2A 3IMKA 1MPTA 1QOQB 3PHIA 4LCJA 4MW4A 5ALDA 3WGMA 2KW5A 1CS0A 3P2EA 5EIBC 3RYIB 3EEYA 1P4HA 1C50A 4C4RA 4XD2A 1NRIA 2UUCB 1Y9DA 4V02A 1H1DA 4Y1RA 5L4LA 1HT0A 2PBFA 1UMKA 3T4UA 5H82A 2NPFA 3BXGA 3GRCA 3PDUA 4EW3A 4JQCA 3OIGA 4KBFA 1C3OA 1XZPA 4FBLA 4D41A 4K9NA 5GGXA 3RVKA 3CSUA 2QVYX 5GY7A 1NXQA 5HTOA 2DSNA 4NZYA 2C8LA 3B2NA 1Q0HA 4P1ZA 4W1PA 1I32A 1MFZA 1PD1A 3THYB 2GZ1A 5CLJA 4QNMA 5A3JA 5BWLA 1ODCA 5FEMA 1SQFA 3QEMB 2YC4C 4GSYA 3TLKA 1LJUA 4KIFA 3AHJA 3K9HA 4L51A 2HI0A 3RUEA 3ZZ0A 4RVCA 1HFKA 4I1SA 4LHVA 4RM3A 1ECPA 2C95A 4RPGA 2H31A 1YA8A 3DCYA 2X9LA 4WADA 2CMKA 2E6KA 5TLSA 3G0CA 3WYEA 1UF9A 1Q2XA 2R11A 1K7EB 3H5NA 3ZHUA 2FN9A 3GEHA 3S28A 3FSRA 4JVNA 5GZ6A 1MJ5A 2PBLA 2CHUA 2HV8A 1LNQA 1N6RA 3MB5A 4X66B 3S2FA 3SF8A 2ZSUA 4BMZA 1YQQA 4BAGA 2EFHB 3K70B 3QFFA 4RZXA 3VZQA 3B60A 1EIZA 4R1SA 2FMHA 3LMKA 3MINA 3WL4A 1NKSA 4A9AA 4CIYA 5DM70 1RM4A 3AVVA 4GC9A 5B3JC 5B12A 2UUBB 1SCKA 2X14A 2BJVA 4LHWA 5C18A 4B8YA 3AR4A 4XVHA 5AMXA 2V9CA 1N2HA 2VVTA 1DKLA 1VMIA 4C6TB 4Q1CA 2W4QA 5BT8A 9MHTA 4D80A 2JFOA 2GZAA 4DPLA 4L0CA 4OLJA 2VHJA 4RF2A 3V7WA 2MYNA 3AETA 5EPEA 5COBA 3ZV4A 1YVPA 1C0PA 1WP4A 1Y5LA 3NBMA 2QW1A 4URVR 2B8EA 1H9AA 4DA0A 2QLLA 2FR0A 2AVDA 1T6NA 1BMFA 2JNWA 1M1YB 1RFLA 1ZM7A 3LL7A 5GOTA 3VYVA 2CV0A 4CM7A 2BEUB 4ZRMA 2GPWA 4O4HF 5EGSA 4MV6A 5FFNA 4AC9A 1T26A 3CVVA 5JS8A 1DTWB 2DLDA 1Q91A 1QV7A 4NBUA 5CVEA 1WMDA 4J1QA 3PNPA 1X3LA 1LTHR 1RWQA 2AN5A 3G7NA 3PNLA 4FYYA 2YMLA 2AYYA 4KQMA 1DIAA 3TLZA 4JZKA 3K0BA 4AK9A 4YCNA 3DTVA 1PK7A 3A9VA 721PA 4K3UA 3X0DA 3HFRA 3IIJA 4NZ9A 4Q1VA 3GEIA 3HVJA 3T7CA 3GLIB 2DXIA 1I6KA 3TJRA 1LW7A 5GTDA 4W9MC 2PXCA 1N1DA 3WLEA 4YP1A 3C3PA 1O9GA 4XM2A 3RTEA 3AX6A 2IE8A 2DBVO 3BD7A 1CR4A 3NATA 4KN9S 5EUCA 1JLKA 2AYXA 4JBNA 1ECBA 5EUMA 3DZGA 4YCCA 5A5GA 2IELA 2YQ4A 4C03A 3RTGA 3SZRA 3BJEA 1AQNA 2DETA 2WWWA 2NYUA 1JB9A 3DFZA 1U3GA 4G8CA 4L2IB 1BX3A 3FSGA 1AK9A 2R97A 4OYLA 3RDPA 1Q95A 2CYAA 4N9WA 4ENTA 4LA4A 3W3AA 3D81A 3FFWA 3GZ4A 1G6KA 2C0CA 3BDAA 2G76A 3LA6A 2GEKA 2JAQA 4C0AC 1BDIA 1T9GS 1IHYA 1EI9A 1QO7A 4GE3A 5IBQA 3KEFA 3WV5A 4EMTA 4UU8A 2OC4A 5ALIA 3A4TA 1UADA 1DC8A 1R3DA 2C2GA 2LVBA 2ZTLA 3JPYA 4KPEC 2P68A 4GLLA 4Z9AA 1Q74A 1IXSB 2PKWA 4CCYB 1E9SA 1JVSA 5KYWB 4CTNA 5K0ZA 2PZEA 3EZGA 3PICA 1NXWA 3B8EA 4G0OA 4G85A 3SICE 3ACBA 1NJ1A 1BDMA 2WJWA 3DONA 1Z6QA 3WHPA 5GONF 4YXWA 1PG5A 1N0IA 5D3MB 5EFZA 5F5XA 2QN2A 5AW2A 5TVKA 3LDFA 1NHWA 2AJ8A 4CJXA 4UBNA 2D13A 3Q8LA 3B1WA 2VQ3A 3ELBA 4HAOA 4UXIA 4X20A 1EAYA 1UBRS 3VJRA 1E1CA 3PR1A 4DCSA 3RYCB 5ILOA 1XVVA 3CVXA 3C4QA 3NC0C 4L74A 4D8VA 3FDXA 1MRNA 1WCIA 3D0OA 3AOEA 3KD2A 3DWGA 2FR1A 2ZIUB 3LQ4A 3V55A 1HE1C 2JKYA 4BJ1A 3LUAA 5A02A 4TYYA 2BHRA 3MS7A 1PSDA 2G07A 1UK9A 1H5QA 1X7XA 2IEYA 1KH1A 3UJCA 3W4KA 4EW2A 4WT7A 1MA0A 4XGQA 1WW2A 1X92A 2GXUA 1U31A 1U0TA 4PZDA 4JBXA 1XV5A 4Z54A 3LX4A 1T8SA 3HWRA 2BH2A 1XT6A 1QCZA 4BIIA 4C0HA 4F6CA 2Z09A 4D5EA 1TAGA 3AJ8A 2XCRB 1M2EA 4BTEA 1TAUA 3SHOA 4F5YA 4Z51A 3UGKA 4PM4A 1URPA 1BE6A 3GAAA 2M6SA 3M89A 3ONDA 4LF9B 3MQFA 1IXZA 3NXKA 3EVAA 4BEJA 4CV0A 1SC3A 3CCBA 3GJ0A 4Q00A 2WT9A 4CQMB 1M54A 4LRWA 3X2FA 4UTOA 3V9AA 3L40A 1FU7A 5IXSA 1Q0LA 1D6NA 1Z06A 4BKUA 1DHRA 4AJJA 2PT5A 1VBMA 2CLFB 2WA2A 4QFDA 4LZPA 4XYEA 2ZATA 3ILSA 1QRRA 3CB2A 3AIIA 1DX4A 3L6UA 3KLPX 4FFSA 4G1UC 4YUZA 1WNFA 1WG8A 4KGZA 4QG3A 2WKSA 3ELYA 3I6BA 3PUXA 5D2CA 1JAXA 3AM1A 1D2MA 5T4HA 4D8YA 1OLOA 3AKEA 3FYSA 3T41A 3W5UA 2FZKA 1EK2A 4ZO9A 3G9TA 1YHZA 3ASUA 3IERA 3K5IA 5B58T 4XQCA 4AKHA 1SR8A 2YS7A 1VE6A 5JSYA 3UANA 1JR6A 1RRMA 2IYSA 4C4ZA 4PSAA 3IAUA 4H4CA 2BYTA 4BFLA 4PQFA 1VKRA 1U28A 4WXHA 5IKOA 5HFNA 5CGZA 4BWFB 2G40A 3NCHA 4A2QA 1QAQA 1NUQA 3OD5A 4YJ3B 1JBKA 1ODJA 2B7LA 4FW8A 3SOPA 3WWYA 2QTBA 821PA 1AMOA 2YJ5A 4FI3C 1WO8A 1YA4A 1ZGBA 3OPVA 3I04M 4RJJA 4KK3A 5HCIA 3GQBB 4K1XA 3WIUA 4DBLC 4KVZA 4M8NE 2VG8A 3TTWA 3RT9A 1XELA 2XWJI 1RIIA 3QWFA 4ZHQA 1NJFA 4DC1A 2ZS8A 5FO0A 4EABA 1UOOA 1Z4LA 4N5NA 4A1FA 2Y71A 4BHTA 1NMYA 2IHUA 1FNNA 4LHEA 4HEA6 2RGXA 2HFJA 1PT6A 2X2PA 3E8XA 3MZ0A 5EXDA 5F98A 4PBRA 3FZGA 2G88A 5TQ2B 1WZNA 2GJKA 3JV7A 1OC4A 4WCDA 3U7HB 2FZLA 5BWOA 1Y3IA 1TM7E 4F97A 5CLGA 2A35A 5ER6A 2I29A 4JROA 3T9CA 3A36A 5F35A 4BTLA 5H9WA 5EWMA 3C3MA 2FQYA 1FF9A 2BI8A 3NJ8A 5HX7A 3L6RA 4JLSA 2QD5A 4OATA 3ZZTA 4CM9A 1Y8ZA 3T4EA 2YRWA 2XZDA 4K9RA 2VP3A 1QP8A 4NOLA 2PGNA 3N6VA 1E1LA 4H31A 4MWTA 1KI2A 3P52A 4BGVA 1PD0A 3I1FA 1RAFA 1GZSA 3LT4A 1NVWQ 2J5QA 4J0HA 3T3EA 4FWTA 3BCHA 2O8FA 5EVJA 3U81A 4B5LA 4DJEC 1G98A 2FHPA 3QV2A 2NMVA 3SQDA 1EVZA 4PLYA 4V0OA 1OJLA 3FYHA 4D6PA 1KJJA 2A33A 3UWDA 1DDGA 5LPNA 5LYJF 2JHAA 2YHIA 1AXGA 2CLMB 3I1JA 4OQXA 1UXHA 2FPOA 5KIAA 3THWA 4RK7A 4JVMA 3RWMB 1KI9A 3O75A 4FWBA 4YP7A 3B7PA 5AXCA 1F3LA 1E20A 3DGEC 1L4GA 2ASVA 1VSBA 2XODA 3GLFB 4QGHA 2C82A 1U3WA 1W5FA 4KQKA 5KCZA 2O7RA 4WZZA 5COQA 6Q21A 1LK5A 2JPDA 3VDQA 1VJGA 2IZ5A 2IPAB 2LTAA 3QPVA 2HWUA 4BKPA 4D3FA 4FVTA 4ZYLA 1RP7A 1WXGA 3JQBA 8OHMA 1I5EA 1OZHA 3LLVA 4WINA 1B26A 2N46A 2E18A 4EG6A 1AN0A 1O96B 1PR6A 3NHFA 1ML4A 4RDCA 4RVDA 3VU3A 1U2SA 1AIPA 5GQSA 5EY5B 1A4XA 4GIBA 4YTEA 1DXHA 1XRJA 3H9UA 1UZNA 1E2LA 1BXGB 4QYMA 1K2WA 1RYFA 2YFKA 5FWDA 5DXFA 4UQPA 1LK7A 2ZRDA 1Y3DE 2REOA 3IUYA 2PD4A 5D87A 4M88A 3WHIA 3OPYB 3LKVA 1IMOA 4YJGB 2CNWD 1CEEA 2CFRA 3B2QA 4JL8A 1E1RA 1N6OA 5E4YA 2QUJA 2I5PO 2QRVB 1M10A 4NU8X 1UDRA 4OFXA 1E3MA 4XKJA 1O6FA 5FOWA 1X1SA 1JHQA 1S1MA 2QJTA 4KE6A 1HQYE 4G1BA 4TSRA 1E3EA 5DX1A 2PN1A 4IEEA 5TQJA 4HN4B 4LE1A 5A4AA 4R5MA 5H59A 4JXZA 2HDOA 4RSHA 3FF4A 1G41A 1GT6A 3VYSB 3FFAA 1U7DA 3T7JA 1ZIOA 2EKLA 1H2ZA 1ZK1A 3CLTD 2OLJA 2H0AA 1Q16A 3BMXA 1MT0A 4YGYA 1QYXA 4WNAA 3S0JA 5JCOC 5FUMA 2WTAA 4N41A 2FMXA 2ZRPA 2DH6A 2H2GA 2JIDA 3CMCO 1IWOA 3IUBA 1A5AB 2OMEA 2QL7A 3LLCA 4I6JA 3UJ7A 1T3GA 4DDWA 1E2BA 1J0EA 3WBKA 3E1KA 2IP1A 2HJSA 1JEQA 1P5FA 1HE4A 4GF5A 3ZHSA 3UKJA 5FTNA 1OA0A 1W36D 1X9HA 4QUAA 1XTSA 5IM5A 4GP6A 1BROA 3B1FA 3LTEA 5FUXA 1KZ1A 3G5MA 3VYWA 5FV7A 3WSVA 4FNOA 2Y1DA 1SBHA 5K3DA 3D3KA 1I3KA 4YDSA 2QV0A 3JD1A 1A5SB 2AJCA 3Q8KA 2QTVA 1GCIA 1KY2A 1VE5A 4X3CA 5LZ5A 1KZ9A 1GRNA 1NXXA 2YYSA 5JNLA 4I5IA 3PB3A 3V4OA 3ROFA 1FE8A 1LA2A 1TYZA 4I1RA 4UDYX 1Y6QA 4D99A 1ESDA 1M0WA 3SZMA 3DBVO 2R1TA 3H6KA 3FMPB 4QOSA 1GEEA 2C7PA 2UDPA 3KJEA 3PSHA 5M29A 4Q15A 3JATA 2GEFA 5ALNA 3VO8A 4DS3A 5K0BA 1KYIA 3ML1A 3ADBA 3FTPA 4QVIA 1DV2A 3ETHA 5LP6B 2R6CA 3IT3A 4HADA 1DL5A 3GMTA 1WBBA 1KSJA 5K6TA 4NMMA 2IYAA 2CKDA 4XFDA 3OUTA 3NEJA 2WB2A 4IWNA 2GKSA 3P0IA 3IJPA 1ADFA 2C61A 1UJ5A 4N76A 5F5NA 5IWCA 3U16A 4KUEA 2HM7A 1DG1G 4FS8A 3LGXA 2IA5A 2HU8A 1VRVA 4JYCA 3TYXA 1PWXA 1SUAA 1Y81A 2XR1A 1NMXA 3FROA 3JQAB 3VNRA 2OHOA 3ZY2A 2GBLC 4BYMA 1QF7A 3TGLA 2B3TA 2EAUA 3M5WA 3R8CA 2B8JA 5IYZF 2DBYA 1HLGA 1TMGE 2OKGA 3LPCA 4G97A 1HORA 2GKGA 3TR5A 1AY0A 1S2GA 1N5RA 2GB4A 3BH0A 2JVJA 1ORHA 2IEZA 2ZR9A 3A2KA 3F78A 3RI3A 2QIOA 3O4IA 4Z9XA 3WY9A 5HQ3A 2VF2A 3R4VA 4YK7A 2OVBA 4RVSA 3TGWA 4BQPA 4BFXA 2FZWA 1Q0SA 1Q1BA 4BBAA 1SOMA 4UBIA 4LS3A 3RVLA 4HWKA 3VR5D 1PGQA 5DXAA 4V0LA 3ZYZA 1RI1A 5KTYA 2GRUA 2R84A 2YWEA 3GWZA 3K6SB 3R0ZA 2COEA 3CA8A 2P5UA 3WLLA 1VRWA 1QNLA 1XFDA 2R8XA 4X97A 2B5OA 4L4UA 3KQVA 3LDGA 1QIJA 1NOJA 5AK6A 1JDJA 1KS9A 1UBKS 4UHEA 5IKXA 5EZ5A 2OMKA 3SEZA 2BSQA 3WOVA 2MTBA 1NUPA 5FWNA 4NDNE 2ZT6A 4RO0A 4UM5A 2D5LA 3BE5A 3G0BA 1PR2A 1GY8A 4BZQA 5K9ZA 1T4CA 1GAEO 1P2BA 3BA1A 3P5BA 4OK5A 3BQ9A 3OEWA 1V35A 4JLVA 2IHNA 2XGGA 3Q0TA 4CL2A 2J9XB 3OF2A 2X3UA 5ENZA 4DCCA 1S6YA 1EPUA 1PLLA 3Q9UA 4GZ3A 4TTVA 1KH3A 3DS8A 2QW8A 5IH3A 4BVEA 3CE6A 2GESA 3VZPA 2Z0MA 4JOQA 4HV4A 5CB4A 1LZLA 3IQZA 4F3TA 3N3AC 3K1ZA 4MRVA 5M7EA 10MHA 1SB8A 2HQSA 2PMFA 2WINI 3AM5A 3KWLA 1OJ7A 2F1IA 4XQ9A 3M5CA 4M1YA 2MR6A 5DGIA 1V7QA 1JS1X 2YCLA 4TKUB 1NBAA 3P8ZA 4MQLA 2ZE8A 3RQSA 3QF7A 1NIPA 1FFBA 2HWYA 4HEHA 3DMPA 1BC5A 4AG5A 1W47A 1SULA 2G1KA 2Y1LA 3A1VA 2YIJA 3E9ZA 4HVCA 5C2JB 5HRCA 4DIFA 2Q0QA 5AVJA 5HDQA 3SKYA 5C34B 2HIGA 1F7VA 5EXSA 4Q21A 4KB5A 1GCOA 1YNSA 3COZA 1Y89A 2OZPA 4NZOA 3OHMA 2JCBA 1STOA 1U8EA 1VBFA 2IJGX 2Y99A 1Z9BA 4QUHA 4Y2JA 4O2AB 5F33A 1VIAA 5INTA 3MTGA 3N2GB 3DO5A 3DPIA 3IQEA 4QM7A 2WWGA 2Z1DA 2PPVA 3MBKA 4KVFA 1Y33E 2IL1A 3HJAA 1PJ4A 4OHZA 2ZBPA 1VXOA 1D9ZA 2HSDA 4IH9A 1AOXA 1VZ3A 1OWOA 3FMOB 5I9MA 1BH6A 4X1IA 3U0BA 3HWX1 4OKSA 3VO9A 4IAOA 1FMFA 1JQ3A 2R48A 3A1EA 1CF2O 1NQOA 1USWA 2X13A 3KAJA 1RXVA 3OKCA 1U28C 2IYVA 2R47A 3KZKA 4K2HA 4O4IF 5CCBA 5JEEA 4WLVA 2D5BA 2D8AA 2DHRA 4OX9B 1YS7A 1EUYA 1KNQA 4LCEA 1BWQA 1WPRA 1BFDA 5EE1A 1VL0A 3BGDA 2CFOA 2GO1A 1T2VA 5DN6A 5F76A 4OMCA 1AUXA 1IHDA 2QE7A 3NTQA 3C3EA 4IGAA 1YR7A 4KQJA 2JLBA 5FULA 4CM8B 4UEJA 3FUCA 4XWOA 4KRYA 3U40A 3UFBA 5KNCD 3V4PB 3O1HB 1HMPA 4WD3A 5LXTF 4EG8A 4WZBE 4DLBA 2FVXA 4DV5B 1XPRA 3TXXA 1TJPB 2P2LA 3MJVA 2R6JA 2D3TA 5ICEA 5C4GB 4FDLA 4AS3A 2OM2A 1NOKA 2PR7A 3ADPA 1I4OA 3L4BC 4M1TA 3WRXA 3OM9A 4ITUA 3TL3A 1F2DA 3PVZA 3WBJA 4R1QA 2RJOA 4O8CA 4ER5A 1UM8A 2XLCA 4I5EA 5GVRA 5JYBA 3UK6A 2OD2A 2L42A 2BZSA 1FLVA 5C3MA 1Y42X 4JX8A 1Z26A 4LYAA 3UHJA 3WKDA 1Y7HA 4AG3A 3OQHA 4X1OA 2GM4A 2P3LA 4OP1A 3F96A 1JAIA 4LWQA 5TPZA 1VJDA 1M73E 2C00A 3PEEA 4OM7A 1TZ2A 4K6KA 1G16A 4V1CA 3OWXA 1W1UA 4WWHA 5BRJA 1PFKA 2CJWA 1SHZA 3BBPA 3OFJA 4IJWA 3WYGA 3U1BA 3WYNA 1SC1A 3DUFA 4MVJE 4RELA 4CR6A 5B7PA 2Q3LA 3KQPA 1QIIA 4CEJA 1K6XA 2BGIA 3U7FB 2OPHA 1GDDA 4RETA 4RL4A 3FB4A 3RF7A 5LM3A 1EDBA 2AI1A 2NN3C 3E2PA 1TX4B 5BPFA 3TI7A 4ENSA 4N8SA 1G20B 3LF1A 1YBAA 4QD3A 1WDKA 4H59A 4UM9D 2LD4A 5AM2A 2GD2A 2RAPA 1GQFA 1AXRA 2QX4A 3KZ1E 2H65A 3AZOA 2WJ6A 4IJUA 4CMHA 5ITVA 3H04A 2H1OA 1XWFA 2R5FA 5AK4A 3TFQA 4EYSA 4HQ0A 3U48A 4DJFC 4CBVA 1I6WA 1XTZA 4PXYA 3QVTA 1XRMA 5DI3A 3UAZA 1GN8A 2BY4A 4JJFA 4KTTE 4LG1A 1TE2A 1M5UA 2J7KA 4XRGA 1MX5A 3SD7A 3DMTC 4AX8A 1M6NA 4CDMA 2ZQYA 4I55F 4MW1A 3KOOA 4I50F 4FJ1A 4K2AA 3G5TA 2ZWOA 2BONA 4MIEA 2G06A 5FPHA 2AOTB 2YOFA 2BFBB 4P22A 4QGSA 3MHTA 3COWA 3G8AA 2EYQA 3RS0A 4C4TA 2B2CA 1OE0A 2IXDA 1NONA 1T6BY 4H0FA 1GQQA 2IQ5A 2ROQA 3IHKA 4X6LA 2O8NA 2B37A 1W8IA 2GD0A 3DP9A 5CW2A 1SCNE 2Z4RA 3WMWA 1AU9A 2R1VB 3C24A 2PS1A 1UAAA 3AIOA 4R8LA 1H22A 2Y3IA 3CEPB 5BQ5A 1KVSA 1ZEMA 3NTXA 3ZHZA 4ROSA 4BFVA 1TTQB 3MWEA 3RIHA 2MU1A 2Z5LA 2W2LA 2P78A 1TPZA 3BMNA 2FQWA 2W90A 3FYDA 3QX9A 2LCQA 4ALJA 2VOEA 2ODNA 2NZ2A 3PPVA 4X6XA 5EIXA 2G5TA 2YVKA 3EVTA 3R6GA 1U7PA 3INGA 4GFDA 3T4PA 5EMMA 3CC8A 4L9AA 1VMEA 3AUAA 3QG1A 4YJ2A 1ZRSA 2P6UA 4OI1A 1HZJA 4OMUA 4F8JA 2P9QA 4QWWA 3TLEA 3FUTA 2YOHA 2LWIA 1DAEA 4F5EA 5TT1A 4XYMA 3HP1A 4AKGA 3H19A 4CUKA 4AKEA 4JLOA 1GZ4A 3E4CA 1A1VA 2GK6A 1GRVA 1D2CA 3QI7A 4I36A 4JMLA 5F2KA 4DSUA 5BN1A 3CVJA 3IKMB 4BNNA 5IDVA 3KV3O 5GJWC 1H8EA 1T6XA 1Y9EA 5I9TA 2RHHA 2NUAA 4M9SA 4QDOA 4FC7A 1Z0SA 5IP5A 2PH7A 3MWKA 1YKFA 3CB4A 3QUBA 2BTOA 3H87A 1FUKA 2OHVA 2XBUA 2NV6A 5DBEX 5FL7A 2RBEA 3DPSA 1SU7A 4NENA 4R16A 3WHKA 1UEIA 2R6GA 4QATA 1DARA 4UUAA 2WMYA 2YDYA 2ZJ4A 1KDPA 5JBQA 3TPCA 1U80A 3C1OA 3J81A 2QUIA 1UPUA 1YJ5A 2W2QA 3AU8A 1KGDA 1L4MA 1KQ3A 2IZ1A 2K4MA 3KVRA 5KVCA 2F43A 4XDYA 2VDPB 3HEAA 1D09A 3O9VA 2QM7A 2L0XA 3MCTA 1JIQA 3ZXUB 2FRXA 4QHYA 4XWGA 2B99A 2GM5A 4GPD1 5H9VA 3T38A 2Y1OA 4DGQA 1QVAA 5I7UA 2N9UA 1LSSA 5CIYA 1Z22A 3VZRA 5IN4A 1Z12A 3DO8A 2QRLA 3J7TA 3P9NA 2JS7A 2IHKA 3MSCA 4L8VA 2I3BA 4YRZA 4K40A 4ZI7A 2J48A 5KCMA 2LBPA 1PVVA 2E4VA 1WRBA 4BLOA 3USES 3GJ7A 3IC5A 4JYPA 3SBXA 1QU3A 1F8FA 4DJTA 1R4MA 5K6AC 1PJ2A 4EX7A 3PKIA 5DN6D 4JBIA 4HGQA 2CLDX 4BCBA 1PE0A 5KVQA 2ZUEA 1W4ZA 2Z5FA 4C5AA 3THXA 1GFZA 2G8NA 2PGDA 1HEYA 1R0KA 2IUFA 1Q1GA 2ENWA 1V8BA 3OOSA 4H3HB 3MS2A 5I7FA 7ADHA 2ZIEA 3LA8A 3OJEA 2CWDA 2W8BB 3OFVA 2UYGA 4L3WA 4MRSA 3WISA 1UXGA 3I9FA 2X0KA 4BWYA 2FK7A 2IS4A 4OHPA 3CLRC 4MUHA 1JHYA 5LQDA 3LFUA 1P0MA 4FINA 3UKDA 2JAOA 1DRJA 1Z4PX 2A0KA 2Y8EA 1XLUA 2YJ6A 3HB4X 1BQ4A 4IGIA 5BSMA 3RNLA 4CCAA 1PW7A 5EESA 4D9BA 4KQ2A 4N0EA 4D3ZA 4A36A 1FJHA 1I4WA 2R751 2E1RA 3NUZA 3U4DA 5AUPB 2QKYA 4DCNA 2QL9A 4X41A 3GO4A 1L7VC 3V6MA 2LCFA 3A4MA 3OZBA 4TTJA 1O0BA 5EFOA 3MEQA 4DGSA 2PV7A 1F5SA 5J43A 2C58A 5JW6A 3AVXA 1KKLA 1KJQA 3FAZA 3QZUA 1RAHA 2NVWA 1RADA 1AUQA 3KG2A 4G2NA 2A0UA 1W1WA 3A4IA 2R62A 4UJ3A 1PEYA 3ESCA 1PUXA 3KQTA 1IDN1 3N6XA 3HJRA 4MCAA 1YB5A 1MJFA 4XUDA 1EFTA 4Y6PA 3WMRA 1E1QA 1KQGA 3P1JA 2CJYA 4BFUA 3TJZA 1RAAA 1T2DA 3D6HA 5JFTA 3EYWA 3G68A 1L4HA 4RL6A 4LFAB 5K51A 4HB4A 1PK8A 1YQTA 5KOHB 5JTUA 6ADHA 2H5JA 3GZNA 4BMOB 3COYA 4LF5B 2XD9A 1AQ6A 1Q3TA 1G64A 2DZDA 2WIAA 4V0SA 3UA3A 4DJDC 4UDOA 4QT0A 3NH6A 3LSYA 5CIWA 5JZSA 4BFTA 5A4IS 1J8MF 2C59A 1MEOA 1SOAA 1T43A 3N2KB 3R4CA 1U9YA 1FRQA 2QYSA 2NIPA 2OR3A 1WHTA 3HN2A 3R5HA 4MYHA 4QVKA 4ETNA 4QTYA 2CV2A 3C4VA 4PYNA 1BS9A 1S7CA 2ODQA 3F4BA 1QZ3A 3FRHA 1F0PA 3VDRA 4Q4CA 4L5AA 4TKVA 3IA7A 4EJSB 3A4NA 2WVHA 4P5DA 3T7AA 2FUEA 3WSWA 3M4ZA 4OHVA 3TRDA 4RU1A 3ASVA 4O5OA 1Z7GA 4XB6B 3ZOZA 4C07A 3IEMA 1XEWX 1LF5A 1AGYA 3NVKI 2A1UA 1TNDA 3DE5X 1UPBA 1P6XA 5CD9A 3L2OB 4CMKA 3AR6A 4QKQA 1QRDA 4PC1A 3UTDA 1RXIA 1YRQA 5EHIA 4AMZA 3VNVA 2BCEA 1JILA 3PDCA 5JEDA 2CVZA 2F59A 4NH0A 1CQWA 4LXHA 4EY3A 2XJ9A 1AHIA 3GD7A 4R3UC 2QZJA 4CMAA 2XCLA 3NHBA 2Q4EA 3IJRA 1Q14A 1RZRA 3K4QA 3BGSA 1SVNA 3IPAA 1K88A 3KXKA 4H7IA 2OUIA 4TL6A 1YAHA 3HKDA 4U2EA 2O8EB 4B3RB 2Q1XA 3EW9A 3NOVA 2W4MA 4OLFA 5E9AA 1PEKE 2E4AA 3T3PB 5C32A 2PFKA 5ALTA 2CLOB 1FXWF 4YC7A 1PNTA 2NT3A 2CFIA 4AM8A 1KY3A 1JSLA 1RJEA 1QFJA 1QH8B 3OO0A 3G2NA 3CMMA 1IJKA 3DVSX 3R20A 1Z82A 5KUTA 3FHJA 2C4VA 2HA7A 3DBHA 5TGDA 2VDUE 3R7FA 4K9SA 4IZOA 1MAUA 3D3WA 2PWPA 1K7YA 1XQVA 2XY4A 3QMVA 3ITNA 1OLUA 4TLDA 3VAAA 2HEGA 2VTBA 2DB3A 1T25A 2GPTA 5HS4A 2IKQA 5EHNA 3VYUB 4OQDA 3IDZA 3EXEA 4A6EA 4RC9A 2AD5A 4QUEA 3F67A 4DR7B 3AGPA 2DFNA 2I2BA 3DBOB 2FF7A 1DX6A 2QRHA 4UMFA 4DIBA 3BICA 1RRCA 3BL6A 3OY7A 2I1LA 3I0MA 2M9MA 1QIDA 2VYVD 1ZITA 4FHZA 1RKXA 3NHAA 3OVMA 1N4AA 5HK8A 5KYXA 5TPWA 4C2BA 2FHSA 1MH9A 3RHZA 5CU7A 1IQRA 3ES9A 1ODKA 4R8MA 4BDTA 1R6DA 1RPTA 3DWFA 1UK6A 3S55A 3W2IA 1I7QB 1VPDA 1Z4OA 4RZ3A 3QGMA 1HLFA 2QI9F 2BMJA 4PZEA 1RJFA 1MRSA 2GN4A 1JL3A 1Y6GA 4J3NA 5GADl 1Y8AA 4K6OA 5DLPA 1MDFA 3CX8A 2JRCA 4NATA 2CJFA 4MGYR 4TYNA 1KAOA 4H6VA 2MSWA 4DA4A 1BRTA 3AR3A 1SHJA 1TDJA 3PEVA 3LC7O 4LPKA 2HXSA 3N58A 3VH3A 2Q5QA 1GQ2A 2GCGA 5EMKA 1NMQA 1L0BA 3KD3A 5I7RA 5D86A 3OQMA 1NW3A 1Q7TA 4PX9A 1USUA 4N54A 5EXTA 3RJ9A 3GRVA 4CF4A 2ZIVB 2LP4Y 3SXJA 1JFFA 4JBLA 2GYVA 2CZGA 2ZXUA 1I7DA 1SUIA 3RE1A 1ZM4A 2OZKA 3UWOA 3VR1A 4BVAA 4D4HA 1Y5MA 4AN1A 3GBPA 4YR7A 1Y4ZA 1DBVO 3I2GA 3W78A 1C9KA 2G5PA 5EZSA 3JQGA 3U9SA 1UPXA 3EN0A 4MV0A 2EF0A 4B3BA 1EG2A 2R68A 1UPAA 3OZVA 4FEEA 4DABA 1WOYA 3FN4A 3RVNA 2OBFA 1G21A 4I2VA 4R31A 1D0IA 3T9FA 4BN5A 4BWGA 5KTKA 4QXOA 4BE9A 1P1IA 1HA3A 1OLSA 4BNUA 5BRNA 1LUAA 3FOCA 3A1NA 1VP9A 1E1RD 2IOYA 1EM8A 3F49S 4OP3A 1P1HA 5EL0A 1A76A 1UKBA 3QJYA 4MLZA 3FCEA 3U2QA 5KEIA 1NXPA 4OU5A 3L7OA 1CF4A 3EXAA 2WYUA 4WCFB 4E3ZA 3D7RA 1MMFB 3FNFA 3KPYA 3L7YA 4PNPA 3I9V1 2IODA 2J5XA 4R2HA 2O52A 4JP5A 4E15A 4YAUA 3D6VA 1CUYA 2XA1A 4QVGA 4E7OA 4YRMA 1OWMA 2OL4A 4PE5B 4G0NA 4LJ6A 1JR2A 3KUDA 2IOQA 1TT5A 3MJ4A 2XECA 2G1PA 1M1YE 2BJWA 3IALA 3CJRA 4NECA 4DV0B 1ZK4A 5AOCA 3ZYCA 4DMKA 3BK2A 4HI0E 1NVTA 2BFWA 5U9CA 3OX1A 4JBWA 1PQPA 5CK5A 3DF9A 5AVSA 3ZR4B 3C3JA 3A3NA 3NBYC 4YEDA 3N7TA 5FQOA 5KO2A 4X93A 3ZNQA 1ZFNA 5CH3A 3L0DA 3OPNA 3U7IA 3B1VA 2WD8A 2BGJA 2YVAA 3HXKA 2WNHA 3KQLA 2H9IA 2JGLA 4GMFA 3VPFA 2V7GA 4KQWA 1XK6A 5EE0A 2O3RA 1CUSA 1GUYA 3FPHA 3Q10A 4AJIA 5HM6A 3I9KA 4D56A 2BR3A 4LZJA 4MVJA 2IH2A 2HHCA 2WF8A 3LKZA 3KOZA 1PT5A 3OTQA 3PZRA 5B4VA 2W6QA 3QOWA 1ND5A 3P9SA 4FFOA 1QFYA 2WSMA 3CT4A 3HRKA 5AWFC 5BSGA 1FNCA 1ZJJA 2BKEA 3UG7A 2PKRA 2VA9A 2ZRNA 4Q7JB 1VHQA 4PCLA 5ICFA 4BZPA 2J32A 3YASA 4U8HA 3WLAA 5GV7A 2NV2B 1OW3B 1RQLA 1JPVA 4GWLA 5FTLA 3C6YA 3BS4A 3O03A 2QG6A 1ZOOA 3FWYA 3TUIC 1ULBA 1ECJA 3WDMA 1SAYA 1EJBA 2BFDB 2EQBA 1EK0A 3OKFA 3VVBA 4E2YA 4UD2A 3FDZA 3PFBA 5JHHB 2FWJA 2C98A 2J7PD 2GFIA 2A8YA 3T1HB 4X64B 1AKMA 1EHYA 3A2MA 5HF8A 1Y9JA 3R3HA 5F7ZA 1ZN9A 3HZHA 3VSAA 1CIPA 4L9WA 1OB2A 4LF7B 2YWRA 4YFVA 1R16A 2C4MA 4W5NA 2JLCA 4FZRA 1KIFA 4M0PA 1OHHA 3TQOA 2QN1A 2FUG6 4C7OB 1VIYA 5DBFA 5FOVA 1ZQ1A 1L8OA 2NT4A 4LK2A 3EWNA 2C1ZA 4CIAA 1YJXA 4UNQA 1CB7A 4X24A 2NW6A 3H13A 3M6UA 4DBLE 5LJLA 2JZOA 5DN9A 3V7UA 4GOJA 4QULA 3UMSA 3O2SB 2ZYUX 2I7XA 1U8YA 3MTIA 2VDKB 3P2MA 2E5WA 4CEHB 4KVAA 1WXIA 1DOHA 1HLPA 3VTFA 3X1XA 2XQGA 4FGZA 3UMBA 1UINA 2ETXA 2IYQA 1W25A 1WL8A 1Z6ZA 2H92A 3PQ2A 4ND1A 2P3QA 1EX6A 1IVSA 1F8YA 4N47A 1DT5A 1UJNA 1ZD5A 4RY0A 1YC5A 4FDVA 1EXWA 5JSZB 5F4ZA 2VIIA 3A3PA 4M1KA 3S2UA 2DQ4A 5BUCA 5BORA 2Z56A 3EPLA 3LCCA 1FW6A 1KJ8A 3AWDA 3D5TA 2YWGA 4M7RA 2BM0A 1ZD8A 4M9XA 4X1YA 2PRJA 2NU7B 2UYQA 3G17A 4Z4HA 2OZLB 4B3XA 5DCUA 1U1EA 4R81A 4ZOBA 3C97A 1RC0A 2F64A 1DAIA 2I91A 3LXXA 2DGDA 1V0JA 1DQNA 3UUWA 1W6UA 1T3HA 5LQCA 3BK7A 4B46A 1FDOA 3CZRA 2OFOA 3ZWQA 1FC0A 4B4VA 1PLJA 4OM8A 3PV0A 1T8PA 2P4UA 5EC8A 1QYWA 2QRZA 3H9GA 3OOEA 1AKRA 5JZVA 4U7FA 3HXQA 2XMGA 2BFFA 2HYIC 4PZUA 1JXOA 3KUKA 1I1HA 4C29A 3L7KA 4FSDA 1ZI6A 2VHTA 1GP2A 1I2ZA 1QHHA 3C6ZA 3GG2A 3AFIA 3KCNA 3L79A 3B36A 3QHQA 1H93A 4JUAA 3FRJA 3X44A 4A10A 3KKEA 3UT5B 3GAFA 2X4IA 1ISRA 1YIDA 1QS0A 2GPJA 1GU1A 2ZYHA 4CQLB 3Q6IA 3OA0A 5L40A 5I5EA 5FFMA 2X23A 2ANCA 2EDAA 2A0FA 4KXNA 4OQQA 3C7KA 4TGLA 3ZEIA 1KZ6A 3A9CA 5JATA 2C42A 3AERB 3K6RA 4Y6RA 4DLLA 5BMVB 5EJ4A 5JMTA 3PUWA 2P6MA 2IUUA 1UMCA 1E8DA 1T8TA 1II0A 2ORVA 4QOFA 4ZU3A 3T3NA 2SBTA 4GLJA 4C2AA 2Q8PA 2QV7A 3QLJA 1SVWA 2Q4OA 4PSDA 1I5OA 4H1VA 3CUWA 3FZNA 2V7WA 5EKTA 3ZY5A 1PHPA 1E9BA 1NG9A 2ZW9A 4Q66C 3PCRB 4Z7JA 1XQYA 3RRJA 1TYAE 4P33A 2A5LA 2WJ3A 4PRYA 2QL5A 4B6JA 4BFWA 4BIMA 3ADKA 1Z2DA 3QNWA 2D8MA 3SZLA 3T5CA 1I9CA 1GQYA 1Y8CA 2O6LA 2VDOB 3C8ZA 2ILTA 4CIBA 2X40A 4EL5A 4HNGA 4BY9E 1E9DA 5DRTA 4G26A 4V0NA 4LHXA 4BQNA 1RR6A 1OCEA 2EJUA 1AKTA 2EEZA 2R96A 3H0KA 5L3SB 5JJIA 3B6EA 3CKMA 2VYND 1Q1ZA 5ADWA 1E2QA 2FNAA 2XQKA 3WAKA 4EA8A 4PINA 3GEDA 2X22A 5HKOA 4DIDA 1QJ4A 1KEPA 2F4NA 2W93A 3AEQA 4R01A 5G0UA 2R6HA 2VHVA 3C6KA 3P27A 3ZX4A 4D3SA 4DEVA 3DE1X 1QP0A 4QJ4A 1T2CA 2HEIA 1A5BB 1DKMA 2D4AA 3EPRA 1T5OA 1H2WA 2R5NA 3DC7A 3K9QO 2HUPA 1R0WA 3OQPA 2PRZA 3QWAA 1A9YA 4LGMA 4R4JA 2VF8A 3DNPA 5CD1A 1O97C 4LI3X 2NM0A 5E1OA 2WWXA 2LIVA 5FL7D 5IFKA 3GXOA 4UNRA 4YRDA 4N7RA 1P73A 2GHIA 2VH1A 4UD6A 5FUVA 3IPXA 2PG3A 2F00A 4A5OA 2IVFA 1YFJA 3SOZA 4EW1A 1YZGA 3FZEA 3RS8A 1OBOA 1P7VA 3V46A 3S8MA 4HBZA 1RKQA 1VYHA 1BKSB 5D7NA 1CLEA 4KDEA 4UUMA 2CGEA 2BZ0A 2PS0A 1LV7A 1ZW1A 3NHJA 3Q11A 3WZLA 2WICA 4DL9A 4PBSA 1BWPA 3ZU6A 3JD3A 2P9CA 2D1RA 2MDTA 2RB5A 4M0DA 3EUAA 3KB2A 3C3AA 4IGEA 4KN5A 4XEHA 4D4IA 3G6WA 1ZHOA 1AURA 4GPTA 5E1BA 4KAAA 3KQSA 4N9QA 3ZW9A 1M2GA 1RAEA 2H4FA 3OPQA 4KAFA 5CFQA 3MK31 1OU4A 5AHKA 1E9CA 1RWXA 1ULUA 4BX8A 5BVGA 3OSUA 4F5WA 3IP9A 2C9MA 2ZOSA 2V3WA 1RHJA 2CMGA 2PZ8A 2WF5A 5HS6A 3FNEA 5AUNB 1IUKA 2LNDA 4RVNA 3CUEF 1ZAKA 4RVUA 5JC8A 1X9GA 2XD4A 3TL2A 4XB1A 4EK9A 4WXRA 5CEJA 3Q3CA 1RYZA 2HJVA 2O0LA 1AA9A 3EBPA 3HJHA 1EE9A 4RD4A 1OA1A 2J0UA 4CE6A 5IDQA 1Z0ZA 2CNBA 3LK6A 1RQ2A 2X1LA 3SJBA 2IXTA 1J9ZA 1UXOA 2HSJA 2ZB3A 4RPKA 4WZBB 4I8DA 3EQ2A 4AY2A 3AC0A 4JR0A 4RYDA 3LH5A 1G4UR 2J5KA 2QUHA 4EI8A 3E48A 4ARZB 2J9GA 1N25A 4ECEA 4EPTA 5AHWA 3VO1A 2P4EA 5IUNC 1R9GA 1H2HA 3O8OB 1FFEA 4G1CA 5LBIA 3C87A 4XPIA 4F1WA 1ZP6A 2WE7A 2JFBA 3OEED 3WLOA 3ED1A 4ZI3A 4O2RA 1QRAA 3ET4A 4W9RA 2OXRA 4JSTA 4I0WB 5EP4A 1L5LA 4E5NA 3U4MA 3HSSA 3X43A 3DR5A 1IB6A 1ZMOA 3EEBA 1N9KA 2X4GA 1BQ3A 3A1DA 3P9RA 4UU7A 1G7TA 4UOEA 4DRZA 3A1WA 5BW6B 1AB6A 4AUEA 1MAWA 3W2FA 5K2MA 4Q9LA 3BJMA 5ISMA 3GNTA 1EJ0A 2B2NA 2FPWA 3FHOA 3B20A 1JI3A 3ZGVA 4RH1A 1PT7A 3H83A 4G5XA 5DWVA 1CT9A 1XDZA 1YJCA 2AB0A 2AW5A 2WM9B 4JT2A 4RW0A 1XCPA 2OCIA 3CG0A 2PCJA 3IDOA 5HWSA 2OCAA 2K87A 2VK2A 3BWMA 3H1TA 3BWCA 3O8BA 5D3ZA 5J5CA 4H7FA 4HDNA 4B4OA 1KZ4A 2HY7A 2IHTA 3QFCA 2BF7A 4GXTA 5A06A 1SC4A 4NK4A 4ZCTA 1XNQB 2RKWA 1XN1A 2N1BA 2RH8A 1E6WA 1CRQA 1FRZA 1SVIA 1GXSB 1GPNA 4L1KA 3VZSA 1DJPA 2ERCA 2VP2A 2JHCA 4A0QA 3J7AC 3IDAA 4XTCS 5JAQA 4D96A 1ZVVA 4LFBB 1EUQA 1JLLA 1R00A 2JFUA 2Q2QA 2H4YA 3PGMA 5EYPA 2NACA 4S24A 2BGKA 2W42A 5DHFA 1ABEA 1A98A 3L46A 1G66A 2C5GA 2A4KA 3PL1A 1NW6A 2YS6A 4RHEA 3HZZA 1ZUWA 3HN7A 2R7KA 1L5WA 3BTUA 4UBOA 5BSVA 1DOZA 5KQRA 1HFEL 1Y1PA 1MZPA 1QIHA 3KKOA 4GI7A 3M9XA 3IGFA 4EYOA 2FOIA 3EASA 1CNFA 2OZEA 4LV5B 3R7WA 5AM0A 5I4CA 1EXNA 4ER0A 1ANKA 1R27A 3IB3A 3MGKA 4CN9A 2F3TA 1VJ5A 5F9FA 3AMVA 3GPCA 4M1EA 4Z86A 4EHFA 4OHFA 2I3AA 1NKVA 3ENVA 4ZVRA 1XTUA 1NTRA 1JIXA 2ZUBA 3OCYA 2GM3A 4BQOA 2AEFA 3PRJA 2IZ0A 4UHKA 2VP0A 4H3VA 3VR5A 3HMQA 1ZGHA 3ZU2A 2PSHA 4DIEA 3RSHA 3SQOA 1K3UB 1CQJB 3A8TA 4RM2A 2ATVA 1TQ6A 2XMRA 3ZUGA 1XU7A 5B36A 4EMUA 2Z3ZA 4YH1A 2I22A 4AJ4A 1W52X 1XDUA 4ZT5A 2B61A 2EL9A 4EUHA 2K7FA 1N1GA 1RCUA 1VBNA 1TM1E 3EODA 5CVVA 2QD4A 4M46A 3TFWA 1J5PA 2WD7A 3CW9A 3NIBA 4P08A 4RKEA 3SI7A 1C9YA 1NNLA 3IJEB 1NBEA 3TM4A 2VH2A 2OXCA 5FOTA 5KU1A 1DXQA 2Z2IA 4RZHA 4D4KA 1V48A 3BFKA 1W85B 4AZVA 4EHLA 1MLDA 2IXBA 2I6TA 2QMOA 3CEAA 4L50A 4ENQA 1T15A 3DE4X 3IAM1 4RTRA 2ZE6A 3G13A 4DR5B 2CLEB 2GGSA 3AFGA 1Q0QA 3VDXA 4Q37A 3VDNB 1VI5A 1SOUA 1EHIA 4EGQA 4L07A 2GKOA 1JHMA 2XOKA 4AO7A 5EJMA 5JD6A 3U7RA 1YQGA 3C6XA 1XROA 1HRKA 3QOXA 4N7JA 3OZ7A 3PTZA 5DGCA 1FZQA 1G1AA 1R6VA 1F6DA 2QLNA 2YVUA 3C43A 5HJ5A 4AN0A 5KYVA 2HLHA 2PLWA 3EOBI 1CYDA 3SBDA 1XLTA 3JU3A 4MWEA 1RKVA 1LFAA 1VI2A 2EJBA 3RVSA 3FYCA 1SIWA 3NMUF 3AHEA 4WDRA 1VKZA 4RTJA 3K73O 2UUOA 4J0IA 1KDZA 2JJ2A 2GQ0A 4FMCF 3IAAA 4UM7A 5EIHA 4EY4A 2ZJ1A 2Q0HA 4N5LA 3G7SA 2XMQA 4PZ0A 3RKUA 4DXAA 1MABB 3QVMA 2QBYA 3ENNA 4ZIRA 2JLWA 3AR8A 1OKKA 2ZJ8A 4BB6A 2N3ZA 2YNMD 4PGMA 5GZ3A 1SZDA 3LVFO 3L3BA 3VI4B 1C30B 4NQZA 2A2ZA 2ODPA 2Q5HA 4E13A 4P4SA 5DNAA 3GC6A 1XD9A 1XHLA 5HGXA 1AGXA 2ZAOA 1FX0B 3HGTA 2WMNB 5IKPA 4IXWA 3GLGB 2AZMA 3QPCA 1U0EA 4IVQA 3IVRA 4BNZA 1GPMA 4HWGA 3LPLA 4MX8A 1ZXLA 1U1CA 1J22A 1J8FA 3KJZA 3QUTA 2FOLA 3UJ8A 1GGKA 4U63A 2H48A 3EVFA 4MGKR 2B82A 3HB5X 2H1IA 3B48A 3R44A 4MP3A 4WESA 1UKEA 5TSDA 5IYZB 3F73A 1QPZA 1DKUA 4MKHA 3SR0A 2QZZA 4PIMA 2R7LA 1VE7A 2VS1A 4JQYA 4WBNA 4AZ0B 5HYVA 1ILWA 1T3SA 4CTJA 4HZUA 2G09A 1CR6A 2D1YA 1RHUA 2K7ZA 2Z43A 3IUNA 1PV1A 4WUTA 4AJOA 3ZQ6A 4JUFA 2JK0A 2BFMA 5HRAA 1MB0A 1ZRHA 4PO3X 4XQEA 4EW6A 3CVWA 2FB9A 3FWNA 3LDHA 4GPBA 3LBIA 5CPBA 3SKXA 3ZHXA 5ARBA 2VTVA 3O8LA 2J3IA 4QBTA 4O4LB 2ZI7A 3HZOA 4ZODA 1OH5A 1ENPA 2IY9A 4YRAA 1F4VA 5BY2A 1FNBA 3EWSA 4QLBA 5TIIA 1GL7A 4EBFA 5BV2P 3RU7A 5JH7B 5JSHA 4KX3A 3DJYA 3AVUA 4QGFA 3ITKA 3LFHA 4TTIA 4M3NA 1FTNA 4QU8A 4I1PA 1C4OA 3ETLA 3OU2A 3UTCA 3PEFA 4J0DA 2V74B 3JQFA 3ROEA 5BN5A 4RZ2A 1EFDN 3UAYA 1SU6A 1N2JA 1KYVA 1N32B 2J3JA 1P39A 5IZ4A 2R6R1 4OD0A 3EXHA 5C4IA 3C3DA 2IX3A 4JVOA 4Y9UA 1KE2A 1GOTA 1WHSA 3IP7A 4MW0A 2C77A 2X1MA 2JLYA 3F2VA 1K7FB 2IVZA 4F06A 1DQSA 4MS4B 1QSGA 2BW0A 1BVYF 4E14A 2ZJ3A 2GZSA 3Q12A 3T7SA 1WVIA 4J6EA 4NMWA 1CQIB 2VBCA 2G6BA 3OFNA 2G1JA 2PQMA 3CLTC 1NW8A 4J29A 4JB0A 4CFSA 3HPRA 2LGJA 3T99A 4FONA 1OX4A 1H3NA 5IABA 5KNBH 2RE8A 4B31A 4LSGA 4FK8A 4E31A 1MOPA 1C1XA 2H18A 3PPWA 2WU3A 3R23A 4DLSA 2PKQP 1ULTA 2ATEA 3BM5A 1IN1A 4MS3A 3MXTA 3LBNA 5CPFA 4W5HA 5C8VA 2BL4A 4R05A 2PEYA 2PUVA 2VN8A 1SU8A 1G3IA 2QTWB 3I8XA 2D2IA 3LVQE 3U3RA 3ZDEA 1APBA 3UQZA 2LKCA 3HRHA 4KN8A 1YR9A 3VUEA 1FUUA 2Q5FA 5G3ZA 4NHOA 4AY4A 4H2DA 5B53A 2KMLA 4EUEA 4R2IA 3GJ8A 2AIRA 4A3SA 3AUJB 1UXIA 4IYJA 2IWHA 1J2RA 1DKRA 1MVNA 2I7TA 4WACA 2HADA 2J6IA 7REQA 5JTTA 3O8QA 3EFEA 2ES4A 1ML3A 3VR3D 3AF5A 2C5BA 4M53A 2IT1A 1G8MA 1XTIA 2GN2A 4IXTA 2FSIA 1YHYA 1CQPA 3Q5EA 4OAPA 1FFHA 3B1KA 1Z8FA 1K0UA 1UC4B 2P9EA 3LC1O 2RHWA 1EVEA 1P5JA 1MU0A 2Q3FA 2FDXA 2OG1A 4GECA 2TYSB 1KQNA 5KPDA 1WY5A 1W581 3E6AA 3GVIA 1KSFX 3CZCA 3UVEA 2OBMA 3AUUA 1IE3A 2ZXEA 4HHEA 3BB3A 3RD5A 1RRFA 1ZG3A 2Q3JA 3EA5A 1ZUHA 4KMRA 1U02A 1XRQA 4Y2TA 2ZIAA 3B51X 4MAAA 1J0DA 5ENVA 4H9GA 2H4XA 5BSTA 5HZHA 3HL0A 2ZI9A 1W0JD 1VPTA 2Q3MA 3VX4A 4PN3A 4LVCA 4ZANA 3ETDA 2Q9CA 4FUTA 2Q45A 5E8RA 1QRUA 4GYYA 4NBWA 2CFTA 1AHHA 4AZ3A 2IH5A 2F3RA 3OE7A 2X41A 5IG2A 5TT0A 3TTYA 3V8MA 4WKBA 4UFOA 3UIEA 2GJ9A 1M7GA 1VG9B 2CXSA 2YICA 4N12A 5BYJA 2CLCX 3WLFA 1ECCA 3KCQA 3GMIA 5KWSA 4DUPA 4CF3A 5FBZA 2XAUA 4RDIA 4IWXA 3V4FA 3H9BA 1M5TA 5DULA 5KKAA 4PGFA 1R7RA 1GFWA 4UCXA 1E6MA 1C8BA 5DLEA 2I1VB 2QQ0A 1B23P 2EDCA 3FOWA 3GRZA 3TI9A 1BJTA 1NP6A 3GEPA 1QHXA 3KTDA 2W2PA 2PMDA 2XKKA 4YRFA 3CH4B 3HR7A 1K8ZB 1MG5A 4L72A 3AU9A 2KE5A 2PZBA 3I30X 3UW3A 3K5HA 3LY9A 3DAGA 5TQ0A 1E2KA 4I4TA 1E4OA 1E3LA 5DO9A 1LTKA 3HV0A 2O14A 1VBKA 2R87A 4MLPA 3BMCA 3IVGA 1RJGA 1P1KA 3SJUA 4O0MA 4CKWB 1W1IA 1JJVA 3MCVA 3ZLTA 2GCNA 1LNSA 2NOAA 1CIJA 2A0YA 2ZJAA 4KO2S 3RAEC 1JP7A 2C9BA 4IKPA 2V3CC 4IG4A 3E9YA 4WXYB 4CL0A 4EJMA 1HETA 1L4LA 2NXCA 3NS7A 3TQIA 1GZ5A 3CHYA 1WMFA 1PVOA 3BTOA 1E5VA 4KGVA 1QG2A 1JJFA 3S8EA 4ZO8A 1N5LA 5FWAA 3T3MB 5A1JA 1UBNA 3CN9A 3Q6MA 4BRSA 3PC8C 1AQLA 4FILA 3OAAD 4N3NA 3TLMA 1REQA 3W05A 5ER9A 1XQ6A 4OXYA 2R6ZA 4IIGA 4MW7A 5E0OA 2YY6A 2C78A 1PT8A 1TECE 2QTCA 3LX6A 4MUYA 5CT6A 4ZDKA 4CMIA 4TTRA 4KW7A 4JA2A 3LQYA 4Q9IA 5T3YA 5IJ0A 4KIJA 1P2UA 3RIYA 1LQTA 2J0VA 2WKRA 4AUMA 5B1SA 2IHZA 2AQKA 2PSSA 1O58A 1K5GA 3GNQA 3I2IA 4A23A 1YDMA 3ETJA 1MC5A 1Y8QA 1LXCA 2CL7X 2QM0A 4Z7NB 1S2DA 1KERA 2OP1A 2QN8A 2W5UA 1SKAA 3OM1A 4DPMA 1FJXA 3SZOA 4QODA 2VZ9A 4INJA 5JNUA 2ZT5A 5EHZA 1I3CA 4QRDA 5FJIA 2VSQA 4O1MA 4DANA 3ZLVA 2XGJA 1T9DA 4YCMA 1PJLA 4L6AA 2OILA 3CCFA 4L4SA 4PZAA 3B53X 1AZWA 3IVCA 2X0EA 1IQUA 5KYWA 1G6OA 1CR1A 4QDUA 5JWHA 2EFYA 4DSNA 1NSYA 3OC0A 4KLRA 3NTOA 3I83A 4IDAA 4IDGA 3HU5A 4N7MA 5LXTA 4RF4A 1M6EX 2BFNA 2XKBA 5G4KA 2VQFB 4E1AA 3INNA 1OWNA 3TRFA 4Q9NA 1T91A 2FJ0A 2Q1UA 2AW3A 1KYTA 2J9ZB 3JYQA 4TUYF 2IU0A 2BP7A 1Q22A 4G5YA 1IEQA 3LP8A 3PF8A 4GKKB 3R6LA 3VHXB 4ESOA 2PUAA 3NAMA 1ZM2A 5F23A 1T5SA 2ECOA 3RODA 2VPIA 1V5EA 2A9QA 3S1AA 3L7NA 2MINB 3OZTA 1H5UA 1K8RA 4R9VA 5K3OA 2PUDA 3BWYA 3JZFA 1E2IA 3KAPA 5MGNA 4ESVA 1XRNA 2DFVA 3QELA 3B3QA 4GSLA 1E9EA 1LGYA 5IAAA 1ISJA 1L4BA 1U9IA 3KKMA 3O4RA 2PQ2A 5DYNA 3UK2A 5K3FB 4CF6A 3I62A 4U2BA 1UOPA 2G7MC 2PX8A 1NVDA 1QIEA 2RK4A 1J20A 4IIBA 4U2KA 5LLDA 1EGMB 2QTTA 1YDGA 1BA3A 1OSNA 3STXA 1AF4A 2BLNA 4BNYA 3GH3A 1RLIA 2WU1A 3FNQA 3HVKA 3LQ1A 5AW4A 4QA9A 2AD1A 2FWRA 1Q6ZA 4L5CA 1W29A 5FBVB 3CNLA 1W9MA 4NXNB 3HRIA 2EATA 5DISB 1BU5A 3AESA 1IQPA 4MRMA 3ZXSA 3OP4A 2GAJA 3C8UA 3FD8A 5F7OA 2C9YA 4J1TA 3H1EA 3HYSA 3AL2A 4FDMA 2QRKA 2CCJA 2QM3A 1D07A 2V55B 4WX2B 3ZU3A 3WNDA 4WK2B 2EL7A 4U7DA 3UFXB 4BNKA 3N0WA 4D8TA 2VNIA 2IS2A 4EYKA 1ACJA 1F48A 3QLUA 3V3KA 4ZQCB 2REXB 2PJZA 4LRTB 5D3KA 2CVPA 4NBKA 4QO7A 4X3PA 4INOA 1M1XB 3B3AA 1R64A 4WN9B 3DVAA 4EFDA 1R66A 2EP7A 3FKSA 2Y66A 4URWR 1VSUA 1AVTA 2XUHA 4XX1A 5JMWA 2P6RA 4NAUA 1QGAA 3IUEA 5AI9A 4EARA 3KK0A 3K1TA 5AW8A 1C7ZA 1DC3A 3ZHQA 5BSUA 3I34X 4UVHA 3I2HA 4OB6A 4ZO7A 4Y18A 3SJ7A 1VJCA 1E1QD 1OY1A 1T1SA 1R88A 3AHCA 1ZY2A 1ZOSA 3E2MA 3BN3A 3S6JA 3FPBA 3SQLA 3V2UA 2IH4A 2E2WA 3NYIA 3F1LA 2BFEA 4GYJA 4IHQA 5TMEA 4LYHA 3RSGA 1QHNA 4QJ5A 1G8YA 1SXQA 1J8DA 3JQCA 1X86B 3E23A 3ORHA 3SBOA 2WHRA 4ZAZA 2HMVA 5HJ7A 2ZSJA 2QRMA 4TWJA 4NCBA 4QYSA 3B6JA 1LD3A 1K89A 4ARUA 5JV5A 2BGGA 2PX2A 1NF9A 1NP7A 2FCRA 4LVNA 4LHSA 1UMDA 4I3HA 3RVPA 4E88A 3ZWMA 2ISSD 2BMEA 1FLDA 1V1RB 3TEMA 2YFQA 5JDIC 3MQ2A 2C84A 3VOBA 1Y6JA 4OREX 3QVVA 2RFLA 5BQOA 5LBUA 1A82A 5ITWA 1N77A 4D42A 4ES6A 1OXMA 1JHXA 2G9ZA 4PTYA 4TRNA 4K9KA 2Y4NA 1H66A 1TTTA 4R51A 3AVYA 5LZ8A 4DM3A 3DMRA 4IZIA 3DLHA 2X8WA 4BBZA 2J9FB 1LFDB 5LZ4A 4GW3A 1SXPA 2VJOA 5AKGA 4EP1A 2BGUA 1NLUA 4JB8A 4YDRA 3QFHA 1Z74A 1A4UA 2X86A 4MWSA 2REBA 5LCXA 3AFMA 5JHGB 2QN9A 1C1DB 1PNVA 2R6FA 4QLAA 2WJPA 4J94A 4RCYA 5CTJA 5ESDA 5J40A 5CXQA 4RIHA 5FIUA 2MMCA 1UBSB 4OBWA 4UUBA 2O4UX 2BFCB 4XJXA 2AKYA 5IJ9A 1NWCA 2IGTA 5L3VA 3PRYA 2JI8A 3FUXA 1AKYA 3M5PA 4QC2A 3QH4A 1JV2B 4NULA 3QK7A 3HSKA 4TQUS 5FI5A 4BX9A 2Q9BA 4C5BA 5FPPA 1EZ4A 2RGWA 4P86A 1FVHA 2JL1A 2HSZA 4DQKA 5I9IA 5BWNA 1WB5A 3DCJA 4LOHA 8ABPA 1PVDA 5IDYA 5BV8A 4UNPA 1UC8A 3IR7A 3R3UA 5J2TB 3HPQA 2IYZA 3L49A 5BRAA 5AUOB 2AXPA 4I1UA 3SK0A 2HGZA 4NF2A 1GPBA