2DLCX

Crystal structure of the ternary complex of yeast tyrosyl-trna synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
339
Chain Sequence
DPNEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-RNA (76-MER)
publication title Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/trna
total genus 118
structure length 339
sequence length 349
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2dlcX02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dlcX01
3LOQA 4A91A 3VGJA 1OD6A 1OWPA 4KPUA 1HYBA 4NDAA 3D6UA 4CDMA 3FETA 1M8PA 4MAFA 2ZUEA 1MC1A 4XSVA 1O97C 2E21A 3IOBA 4KPUB 2J07A 5TEVA 2YXNA 2A84A 2J09A 5LLTA 1FYDA 5DB4A 3SZ3A 4R0NA 4KKVA 3QTBA 3H99A 3TS1A 3CLSD 3RBAA 1LI5A 1ZJWA 3U1VA 3FH0A 1ILEA 3H9BA 2QTRA 4MW9A 3P0JA 4MW0A 2A1UA 4MUEA 1TYCA 2WSIA 3JXEA 3CR8A 3SEZA 1IQ0A 4YMIA 3CLTD 1KQNA 2A1UB 3QTTA 3AG5A 3L92A 1IRXA 1G8GA 4KR9A 1J20A 2A1TS 2NZ2A 4NZPA 1YUNA 3N05A 2CFOA 3L93A 1NUUA 1BS2A 1KQOA 4EG1A 3INNA 4XFJA 2X0KA 4ND7A 4YP6A 4MQ6A 2OV4A 3K32A 1U0BB 4DDHA 2V0GA 1EJ2A 2H2AA 1A8HA 2H29A 1O96A 3NBAA 3OTWA 1ZUNA 1KH3A 3ND7A 1GN8A 4J76A 4E1AA 2XRZA 4F4HA 3HZRA 1IQUA 1NUQA 2HZ7A 1KQPA 4U63A 2CSXA 1K4MA 4GRIA 2V0CA 4MUNA 4OUDA 4EG6A 3VRHA 4MWBA 5KHAA 2IJGX 4I6JA 4TS1A 4CT0A 3AL0C 1JMVA 4MUFA 4U8HA 3CVXA 4EG7A 1PFWA 3UK2A 1WXFA 3ZXIA 1ZH6A 1N2OA 2E18A 4JYZA 2DEUA 3FHJA 5BNZA 4EG3A 2HGZA 4DDMA 2VTBA 1KAQA 1O6BA 4MW5A 1PG0A 2X1MA 1O94C 3FG9A 2YWCA 2B7LA 4R2MA 1XNHA 2VTBB 1U3DA 3IVCA 1H3NA 5DK4A 4JZYA 1EFPA 4ZT5A 1S4MA 2QTMA 1M8GA 1MBZA 1J70A 1EFPB 2YWBA 4PBRA 1NYLA 2AZXA 3DV2A 4MVYA 1K97A 2CT8A 2GKSA 1Q77A 5JBNA 1OWLA 1KAMA 3ILVA 5AHWA 1T9GS 1T6ZA 2DUMA 1JIJA 1F9AA 4ZCRA 4MWEA 4MVWA 3UOWA 1ZH0A 4UZEA 4BWVA 1XNGA 3AIIA 3GUZA 1OWMA 1JIIA 1DNPA 4R2LA 4U7JA 4MUHA 1J21A 2C5SA 2AG6A 4EF6A 1KH1A 1OWOA 3NV7A 2QUKA 4PY2A 4EGAA 1U7XA 1JEDA 1MOPA 1YUMA 4GU5A 5H16A 2CV2A 1MB9A 3MUEA 5F23A 2GM3A 4Q93A 3A04A 1V8FA 1TFUA 3FNRA 1VBMA 3IUBA 1F7UA 5HG0A 1IH8A 3TZEA 1T6XA 4DJAA 2PZ8A 3BL5A 3IVGA 3SZGA 1YULA 3CLSC 4L2IA 4EFKA 4ZT2A 2BTEA 3SDBA 4P2BA 4UZFA 3GLVA 5IHXA 4L2IB 1QU3A 1U7DA 1V47A 3CVVA 5TS2A 4MW4A 1GLNA 2O5RA 1P7PA 3MLBA 3RFFA 3RHSA 1QRUA 1LI7A 2R5WA 3FOCA 3IH5A 4K03A 1MRZA 4J75A 3CLTC 1IFXA 1MJHA 4MLPA 3IODA 3IMCA 2WB2A 4XFDA 1KKUA 1VBNA 1QQTA 3KFLA 4ZCQA 4MVXA 1Y42X 2OQ2A 1Q19A 5K0SA 4G6ZA 2DXIA 1TYDE 1I6KA 2JANA 3GMIA 4MW2A 3ELBA 2CV1A 4G5YA 1CT9A 1NUTA 1VBKA 2Z08A 1J1ZA 3HL4A 1JZQA 4YBRA 2TS1A 1J09A 3AG6A 3G5AA 1I6LA 2WQ7A 4MUJA 1QU2A 1YI8A 3Q4GA 1TEZA 1Q15A 4DNXA 5KWVA 2QJOA 3F3MA 3IOEA 4MUKA 3SP1A 1EFVA 1O96B 1NUSA 2A1TR 3QE4A 1N77A 3COVA 5IJXA 4KR6A 2CV0A 1G8FA 1N2GA 2CUZA 1PFVA 3H9CA 1QTQA 1EFVB 1NZJA 2DPLA 1N1DA 2PFSA 1K92A 4MW1A 1G8HA 4OUDB 2J4DA 1QRSA 1LW7A 2J08A 4ARCA 4ZCSA 1TYBE 4QRDA 4Q16A 2CYCA 4I6GA 1J1UA 3HV0A 1X6VA 1O0CA 3TZLA 3ND5A 1KR2A 5FNZA 4NATA 2RE8A 1OWNA 3SYTA 1U3CA 3H97A 3KT0A 1M8JA 1G59A 1H3EA 2VXOA 1KP3A 5HUJA 4ARIA 1JGTA 3SEQA 4ZT6A 3X1JA 1M8KA 2AKEA 1XJQA 1TQ8A 1WQ4A 3P0IA 3CLRD 3COWA 2PZBA 4QBTA 3PNVA 2QUJA 1XNJA 5LFAA 3CLUC 4MW6A 3X1MA 4MVCA 5K0TA 1B6TA 1JECA 5LM3A 2CYAA 1R6XA 2E89A 1O94D 2QUIA 2PZAA 4PBSA 1IHOA 1T6YA 1WZ2A 3IOCA 4DDKA 2A88A 3C8ZA 1M1ZA 3MMXA 1X8XA 2PXHA 3HFJA 3G6KA 4MULA 3TQOA 4CQNA 4G5FA 3A4IA 3COYA 3HGMA 2RD2A 1EUQA 3FY4A 5TGTA 1JIKA 1GTSA 4EG8A 2DLCX 4AQ7A 1WY5A 2GOYA 1VLHA 1KH2A 3KT8A 1PFUA 3PXUA 2DETA 2A86A 4MUIA 3S3TA 3COZA 1T9GR 1WKBA 4NAUA 1NUPA 3D6VA 2J5BA 3VU8A 2BYTA 5H7XA 1O5TA 4JXZA 3ND6A 3E27A 3UY4A 5KCMA 1N2EA 4ZCTA 3ZJUA 4KR7A 1D2RA 4OJMX 4DE5A 5FO0A 1O95D 3PNBA 1O0BA 2QTNA 4WSOA 4MWCA 2QJFA 3M5WA 3RK1A 4NAHA 4EG5A 1GPMA 3CA8A 3CVWA 1TYAE 1O97D 4QREA 3TNJA 5DEOA 1GTRA 1N2BA 3OP1A 5HUHA 2QJTA 3N2YA 1JHDA 4I6EA 3CVUA 2ZP1A 4HJXA 2Z3VA 4ND6A 3IDFA 4HK4A 5J59A 3TQIA 1QRTA 2YY5A 4H3SA 2CYBA 5TEWA 3H05A 3FI0A 3KT3A 1NP7A 1R6TA 3ZXSA 4NX2A 2PG3A 4S1OA 5J58A 3AFHA 1JILA 3I05A 3FIUA 4X0EA 3ZIUA 1KP2A 3MLAA 3X1KA 2DR2A 1N3LA 4ZT4A 3FDXA 4PBTA 2QUHA 4JXXA 1WXEA 1COZA 1ULHA 1F4LA 4MWDA 4JFAA 2A7XA 3RK0A 4AS1A 1I2DA 1OBCA 1N78A 3A2KA 4HPWA 3MXTA 2X1LA 4CDNA 1YIAA 1QJCA 4ZCPA 4EG4A 1F7VA 4YP5A 2ZUFA 1SURA 3IMEA 1MAWA 3PNYA 3AKZA 1VL2A 3P52A 4RUKA 3FWKA 4K0RA 2NSYA 1M83A 3P0HA 1M8FA 1JZSA 1MAUA 1WXIA 1WQ3A 1K4KA 1N75A 3UMVA 3ZUGA 2JA2A 3G59A 3CLRC 1OBHA 2D5BA 1WXGA 2XRYA 3IVXA 3DO8A 5FO1A 3ZGZA 3A05A 4RPIA 3ZJTA 2D54A 2IELA 2X3FA 1YIDA 3NBKA 2PIDA 5J5AA 4HJRA 1GZUA 1WOYA 3DPIA 4FZJA 1GAXA 2EJCA 2EL7A 1NURA 3ISJA 3K9WA 4YP7A 1PFYA 3RJZA 4F3RA 1H1TA 2JAXA 2A4MA 2O8VA 1N2HA 1N2JA 1RQGA 4MW7A 3ZJVA 3N8HA 2G36A 2HMAA 3UC5A 1WXHA 1NI5A 1PG2A 3N9IA 3IMGA 4MUGA 1EE1A 1KORA 2D13A 2WQ6A 4WNYA 2Z09A 1I6MA 3CLUD 1UFVA 5EKDA 1JEEA 1QNFA 3HMQA 1EUYA 3LCJA 4ZT3A 1FFYA 2DERA 3CVYA 2E0IA 3KT6A 2IP1A 3IUEA 4ZT7A 3PRHA 3LE8A 1N2IA 3DLAA 1NSYA 1IQRA 1WJGA 1EXDA 1H3FA 1R6UA 2I1LA 1MB2A 3Q10A 4DLPA 1Q11A 1O95C 3Q12A 5DASA 1IVSA
chains in the Genus database with same CATH superfamily
1JHQA 1CQJB 2D8AA 3OQHA 1XTBA 3PRJA 1Q1ZA 4KV7A 5ESRA 1D8TA 5B7PA 5LWHA 2P3OA 2CBGA 3HRHA 2W6JD 1KVQA 3BMXA 3MMZA 1WVIA 3R0JA 2OKGA 1Z5WA 4I81A 2ECQA 4NC9A 1CZHA 3B1YA 3QEJA 1KE2A 4F21A 5EC8A 1R66A 3LCCA 1QOPB 4GKJB 3A3YA 4F1KA 4EB3A 4G0ZA 3REGA 3CR7A 2JKVA 4DHEA 2JDID 1PCXA 5KYVA 2GBLC 1UKAA 4Y9UA 3MJHA 3OM1A 2GT1A 1QIJA 4QDOA 1XA3A 3Q7RA 4JBYA 3G0IA 1NLFA 4HWKA 3VDRA 1D1SA 2WT8A 1GPAA 4IOMA 1AS3A 1XLVA 2QTRA 2WD7A 4XYEA 4QXAA 4X6XA 3BZUA 2PUCA 3KHKA 2PMWB 2AXPA 4MCIA 2O2CA 5CCEA 1L7VC 3AR7A 2W7TA 5FORA 3NHUA 3E9ZA 4MWTA 5A4FS 5D5PA 3IXLA 1I80A 3U81A 2B1JA 5DI3A 2G67A 3JQPA 1JMKC 1XROA 3DFUA 3R5JA 4KNVA 5AXBA 1UBUS 4DT1B 3RF6A 1H2YA 4YDSA 2P9GA 2PD3A 4N9QA 2F1IA 4Y2SA 3KB6A 4IWNA 1T4MA 3L0SA 5EMNA 3UPDA 4WINA 5C8XA 1R6BX 1SQ5A 5JPCA 2VDLB 3MMPA 1R7RA 2ZJBA 3BHNA 1E2DA 1XF9A 2O2ZA 4AZ0B 3INNA 3DHVA 2G9VA 1GSHA 2R00A 2IE0A 1LLDA 1GM5A 2WM9B 4CV0A 4GYYA 2FU5C 4X7MA 1SC9A 1JG7A 3BH0A 4O1HA 3HJFA 1TVKB 4LDAA 1NI4A 1KYXA 4M3NA 1VXOA 3NATA 1FFYA 3NEPX 1QHGA 1H0RA 2V5VA 1O3YA 1QNLA 1RIFA 1P2UA 2EQBA 1ECCA 1YT5A 3PXGA 3V48A 1GTVA 3ZWAA 3ZNPA 4BRWA 1YTUA 4MZDA 3KEMA 1K7CA 1UBJS 1E2HA 1YBMA 1Z75A 2QPLA 3QZUA 4L9SA 3EYWA 3RKRA 3TPFA 3WP0A 4D82A 4HLUA 2VZ8A 2IYZA 4PHGA 2Q5IA 2FEPA 1D6MA 3CO5A 3IQWA 4P7KA 3IP6A 5ULLA 2ZUSA 1FTQA 1NA5A 3DOEA 2EJTA 3B1VA 3MQFA 3Q72A 3GUVA 4JVNA 1JKJB 5E95A 3EXHB 3NHJA 3TNYA 3WL5A 1G20E 1N2CA 1Z15A 3ENWA 4AJJA 3HZHA 4GX0A 4DFDA 4DV0B 2QYSA 3OZIA 1B0ZA 2PR7A 2X86A 3DE1X 3L5OA 1PTKA 3IIJA 2EEPA 4X3PA 3SIWA 1S1CA 3HTXA 3ETJA 1JA9A 2AOTA 2HZBA 1BJRE 1D2HA 3MAJA 4J1SA 3QX8A 4ZQFA 1WY7A 2H0RA 1JIUA 3SYRA 5IMBA 1E2UA 1HT3A 3E0XA 4AWBA 1E9CA 5E38A 1EVJA 4MQEA 3TTTA 1H65A 1JSRA 4CQMB 4LNHA 4GI3A 2FR8C 4PV7A 3GVIA 4XJSA 1NE7A 2DBZA 1TYEB 1HGXA 3RRMA 1FJXA 3PPYA 3UYLA 1VA5A 5EUBA 2IEAA 3GHYA 4FYYA 4IIBA 4AN1A 1QZZA 4B76A 5ELMA 2O1SA 4A2WA 1TM7E 1E7RA 2E4VA 4P8RA 4YP9A 1D07A 5LP6C 2FLVA 4LYFA 4WN9B 3VPFA 3DV2A 3GLHA 3EGVA 3M5PA 3NHYA 2PE5A 5JALA 2CXNA 4AF7A 3IQHX 1SHKA 1GPNA 1GPJA 4FYXA 1Z0IA 4REQA 3D8UA 2B30A 4XVCA 1X1SA 4ER0A 2VP9A 4JLJA 4BO1A 4C1NA 2H5IA 2W37A 4OI0A 3NHBA 4PXSA 1BX1A 3F49S 1WBBA 3OFJA 4PNEA 4YONB 5BV7A 4G41A 4Q39A 1RDFA 2H1RA 4GP7A 4UBNA 3KTFA 3AKYA 4JT9A 4PAWA 4YRTA 3N7AA 4ZAWA 4LRYA 5BXQC 4OLAA 2H4JA 2W2MA 3I28A 3ENVA 2FSIA 2IU6A 3GX1A 4M9QA 3UG7A 1KNXA 1IEXA 2EC5A 1QFXA 4N48A 2IKSA 2QPAA 2UZ1A 1Q6YA 1ODIA 4R2KA 3CX6A 5IAJA 3H1GA 4DHWA 1BS9A 1LJUA 1NXOA 3ZWWA 5JWHA 4W5NA 2QTVB 4TKVB 1XMSA 1E6WA 7REQA 2QX7A 2GCPA 3OJEA 5C8YA 3DE3X 1XBTA 4WFJA 4OO3A 2BW0A 4MCAA 4JKOA 3ROEA 1FS6A 1XPRA 2QRVA 4XGIA 4QXRA 3EIHA 4GDFA 1T3SA 1PKXA 3BIXA 1KBZA 2Z83A 3TZEA 4YJFA 5JDCC 4DJAA 3LPDA 1LDYA 1IXRC 3NUQA 4WRRA 4ALIA 1BE0A 5HS6A 2PL3A 3K6SB 2SCUB 4PZ9A 2BH2A 5K3FB 2IYFA 2PBRA 4IXWA 4UZFA 1ZSVA 5ED0A 3KYCB 5FJIA 1J2EA 1RIIA 4ABYA 5ADVA 2L42A 1RCUA 2ZJZA 3TNLA 3DFKA 3KJEA 2HNBA 4KQHA 5KMGB 2AEJA 2PANA 5JASA 4GC5A 5ISMA 5IS2A 1LI7A 2X77A 3TH5A 4GDMA 4AKSA 3DW1X 4NBLA 4H4DA 1XOIA 4K03A 4IUDS 4PZAA 1E2NA 4H6WA 2QPOA 4J75A 3C3CA 3H4IA 1EDEA 1URPA 4KGZA 3RKUA 5GZ1A 1Z34A 2IWHA 3AEUA 4TSFA 3NPMA 4QFDA 4CBVA 3EWIA 3ICWA 1DC5A 4GPAA 1N0IA 1KKUA 4FNMA 1VYUA 4X60A 5I4CA 1DX6A 5TLSA 3P9CA 5LOVF 4DQVA 1VIAA 1VLLA 2QRZA 4LC0A 5IKPA 2CD9A 4KAXA 4YJ2F 3V4OA 5FB3A 4F3YA 4G5YA 4YC7A 3R2JA 3ZWVA 3A11A 1J99A 1Q0QA 1YU6A 3HL4A 3OSUA 4NBNA 4TQAA 1IHDA 1D5CA 1RLIA 1WV0A 1ZDMA 3A2KA 2CDCA 3QPBA 4G0NA 4GXTA 3MPUA 4OMUA 1ZJYA 2IW1A 3KG2A 2GK7A 1PS9A 5LL6P 3FVQA 1DV1A 2YWEA 3OTIA 2HY7A 5DYIA 1JWLA 3L8CA 1QHNA 1SZDA 2HBQA 4JUFA 1ZM3A 4EB0A 3DLHA 4DDUA 1GNSA 4Z0HO 2C83A 1V11B 2RCNA 3F3MA 4K7JA 2MTBA 3ADBA 3L4SO 2JIQA 2GSWA 4IV0A 2OB2A 2JGAA 4FMDF 1TU3A 4ZFNA 4G4GA 4P5EA 4F11A 5BMVF 1KJZA 5COAA 3VJKA 2HQOA 2PJZA 3AMVA 3ET5A 1HOTA 4GI1A 3RS4A 1K92A 5EJFA 1KK2A 2X14A 4TVBA 5IJWA 3OJ0A 1S3SA 1A4XA 2W8ZA 2ASEA 5JJ5A 1TYBE 4DRYA 3UK0A 2Z6QA 1SFRA 4NMXB 4JYCA 1KA9H 2W8BA 2J9ZB 2P2YA 3KHSA 3DPSA 4B81A 2LTAA 1ZM4A 3IIEA 1V37A 2VJQA 3AKCA 5AXAA 5IABA 5E9JA 1BWRA 1A88A 4PE5B 4TSFD 4CM5A 2LDXA 5H02A 5AHKA 4IFTA 1TJ5A 4MWOA 1PJSA 1T3ZA 4BE9A 1QORA 4PRZA 2BC9A 3DL0A 5HUJA 3PLAE 1O5OA 2DHRA 2FZEA 1QYIA 4AJHA 2XGJA 2P6OA 3W4JA 4H9GA 3O31A 2LBPA 4FFVA 5C5CA 3P0IA 3ASUA 3HA5A 3USCS 2JLVA 4QBTA 3LWDA 2K6GA 1TT5B 1V8OA 3FYTA 4GOOD 3QFRA 1Q2UA 4KMOA 4E5SA 2R47A 3UMCA 2VT7A 3O4RA 1XX6A 5K0TA 2YWXA 1ZC3A 3JQQA 4KO8A 1NRWA 1U28A 3A27A 5BYAA 1UMKA 3GVPA 4ZI5A 4Y2JA 3ZQ4A 1DBPA 2V5UA 3R09A 1O94D 3NWBA 4JWKA 2VJPA 3H0KA 3ER6A 1EVQA 4RHTA 3B9RA 3F6EX 4ZOLA 4GWLA 2AVNA 3N6VA 4LRWA 4KMSA 2E37A 1D2NA 2IXDA 2XVAA 3EK2A 3HNPA 4DWJA 4ZMBA 4ETWA 1K6XA 3A28A 4L73A 2PXHA 3G6KA 2MR6A 1E3DA 1XZLA 2YV1A 3NFYA 2YC4C 2VRCD 3DE7X 3B9BA 2EW2A 5TGTA 4JEIA 3ZCSA 3CV3A 4BNDB 3U4CA 5FLKA 3ZW7A 3T9DA 1JQ3A 2IUSA 3Q7IA 4UAUA 4EENA 5I7WA 4CN8A 1VZ2A 3FMIA 2V4MA 1GGFA 3FGPA 4DA9A 2BP7A 3UB3A 3NXSA 1I5RA 4CM9A 1KU6A 2EKZA 1TDJA 3ELWA 5FPSA 3VKUA 2ZGVA 3C14C 5FOUA 1NUPA 1T5SA 2GZRA 3OE4A 5JSZA 1ZRMA 5T3UA 3U4HA 2QSZA 3WLFA 4CLRA 3ASVA 1XZGA 1VMAA 1GAWA 2QRLA 5H7XA 3U9LA 1C1DA 3CURA 5F1KA 3UGKA 4TMVA 3TCNA 3QLJA 3HDJA 4P1ZA 4DR7B 2E4XA 2HV9A 3WJAA 4BVLA 2FQ1A 4DL9A 1JBEA 1FRQA 5JFGA 1QQBA 3W6NA 5JYCA 1NPYA 2I71A 4MP8A 3SS9X 3PFNA 4PS0A 3MK31 4MITA 4RPHA 3DKRA 3ZU3A 3ACCA 1TLLA 1P0MA 1NTOA 2JK0A 2ZFUA 1F20A 1I3KA 2O05A 4WL0A 4DJJA 3IXMA 4IUCS 4JLVA 1ODSA 2R0QC 1QYDA 1IL0A 1PT8A 1U0HC 3N8KA 1T29A 1NM5C 4NAHA 4X41A 3UB4A 5KEIA 3D6AA 3OFKA 2XA1A 5MN4A 3TGPA 1C2YA 4QOJA 4MYRA 3KJXA 3HKEB 2B6HA 3ZI7A 3OQVA 4TTJA 1I3LA 1O97D 4QREA 2C7BA 3ENNA 4JJZA 5JNTA 1GTRA 4P7JA 1RFLA 4YRJA 5HUHA 1Y82A 5FTWA 1L5YA 3LU1A 4HJXA 4F86A 3SG0A 4DIMA 1SPXA 2J33A 3IJEB 3OJFA 4R1UA 1U1EA 5DM70 4DB2A 3NHRA 1Z6PA 1QRTA 5NULA 3RRNA 4GLLA 2ONKA 121PA 1GYRA 3E15A 2BM8A 3TQHA 3CH4B 4LYDA 1SKYB 1Q92A 2CMDA 3WIDA 5AM3A 3KTAB 4X0EA 2HWYA 4KBYA 3RVSA 4S12A 3CEAA 4X84A 1ZCBA 4KK4A 3T5TA 4AJPA 2HT1A 2GLTA 3AYXB 4U3JA 2GAJA 3MJSA 3H5VA 5KSOA 2Z6AA 2BI7A 3DSRA 4PAQA 3HJRA 4OXRA 4B40A 3HCCA 3OTQA 1SC4A 3QEMA 4YO7A 5AP9A 1OLOA 2PGIA 2HJSA 1DC4A 4X3CA 5LVAA 3DHEA 1T4GA 1N1MA 3KR0A 1JHUA 2E5FA 1N3YA 4OK5A 5HIAA 2XT9A 3M5CA 2P1RA 4N5LA 4NOKA 1B73A 1F8YA 3I92A 3ZY2A 3PI6A 3NM6B 5SY9A 5D01A 5DW3A 3PGMA 2EX4A 1XELA 4EI8A 3LW8A 2DLDA 3CY6A 1II8B 2QT9A 4OSOA 1Z0AA 4OJYA 3RSGA 3GJ0A 2QRNA 5JJCA 2A8YA 2ACWA 3JWHA 4M1QA 3C2QA 1SURA 2OHVA 2PKQP 2XV1A 4GOKA 5DLDA 3U37A 2GZMA 3F96A 1I3OA 1NVGA 2H1SA 4EI9A 1C7EA 4LBWA 1TGVA 5DCUA 1E3JA 4MB2A 4YDQA 3FWKA 1D8AA 1Y37A 3RNLA 2Q3EA 3GBVA 3D7NA 1TKCA 3DC2A 4F7DA 3GLGE 1QB7A 1QH0A 2YASA 3D0KA 2H11A 3H9QA 1AK2A 3G89A 5HA5A 3TM5A 3RIGA 1KJJA 3ZCQA 1OT5A 4BY9E 3CLRC 4BV9A 2P67A 3AR8A 2XRYA 3KOXA 2A6PA 4BQFA 3F9RA 4UEJA 4ZJPA 3IIIA 5BW4A 2H31A 1U3VA 3IKLA 4CM1A 3MCAA 3L7IA 2D54A 3GJ7A 3E2PA 3WWOA 4BEJA 4I08A 3QEBZ 5LBUA 3R0ZA 1IJFA 4U8GA 5K0NA 3RJ5A 1A8QA 1PJ8A 1VFNA 4HQ6A 1YVUA 3ZY5A 4JC5A 1F38A 3TI9A 4EPWA 5AT1A 4NBSA 1S3IA 2JAXA 2WTBA 5KVSA 1E6EA 4ZJZA 2HL6A 3K7EA 1EFCA 1Y6GA 1KHHA 3WLIA 1Z22A 3JQBC 3RG8A 2C9BA 4N5NA 3SR4A 1PG2A 4WK4B 1E62A 3VM6A 3KYJB 3PJRA 3BMNA 4MUMA 3RVPA 3ZV4A 5LQAA 1G63A 4RKEA 3DBHB 3HMKA 5KNBH 3HYSA 1IRIA 4KG7A 4MVJE 1I6MA 2ORIA 1EHIA 2G82A 4V0RA 3V42A 3A58B 4IMPA 2EKBA 4PLGA 3TSAA 3B7GA 1KO1A 3NHSA 2OBNA 2WLTA 2CL7X 4J43A 1EFHA 3G8DA 1T3TA 2N0SA 4JMLA 2BSXA 4D9CA 4EGCB 2Y8EA 821PA 2L82A 2IDJA 3HKDA 4AM8A 3NDBB 3TEMA 4N49A 2JBAA 4ZAFA 3KT6A 3QKIA 2XX3A 5JT1A 5T7BA 1EFLA 2EP8A 4Q19A 3FTNA 1C1XB 3JYPA 1QFZA 1V3VA 1WJGA 1WLYA 4MPTA 1JFLA 1W8DA 2C9YA 3KYBA 4K9NA 4MVJH 3T7DA 2X8LA 4EW2A 1JH8A 3I6IA 4B6OA 3DDWA 5T4BA 4DR3B 1ZGCA 4RS4A 4DMMA 3HP1A 1SEVA 4ARSA 1C3OA 4FX2A 3VZSA 3WR5A 2HK8A 1NJ1A 2OQIA 2WB4A 2ZBUA 3ROKA 2FB9A 2Q4RA 4A91A 4HT3B 2F9FA 3AUXA 3MWGA 3GGCA 3GOHA 1IZ9A 1CS0B 1T8YA 2EX1A 1YZFA 2VYVD 3NUZA 5FBZA 3HLKA 2B35A 1J9EA 3I45A 4NBVA 5CHEA 2JL1A 3BD9A 3SSOA 4R81A 3WKAA 5K0BA 3NTOA 5DB4A 2VQEB 2K7ZA 2HSJA 1FMJA 3QMVA 4AMUA 4DLVA 4IJWA 3W9SA 2ODWA 3K0CA 3JW8A 5LA6F 1K8XB 3VR6H 1VYVA 3R6WA 3CYFA 3O03A 4DA0A 2EBWA 3QI2A 1TIPA 4GVPA 4RV4A 1C3XA 4KIWA 3LLUA 2IOQA 3HI4A 3ZQ6A 4LMAA 5F78A 4ITRC 4BMXA 4ZTZB 5DGCA 5JC8A 4OFZA 1GU1A 5CH8A 4RMIA 5ALKA 2NZUG 1T9CA 4XYMA 1IN7A 3KJZA 3NRCA 2C00A 4KFTA 2VOJA 4KN9S 3ZWYA 1LRKA 4L6AA 3JXEA 2WD7B 1ENYA 3FOAA 5JZVA 5HKKD 3GD5A 3FCOA 1MX5A 4Z8XA 4AWAA 3L92A 1IQPA 3L18A 4F4UA 1SK8A 4RZSA 1PT9A 1Z73A 4MKIA 1CUEA 3WWEA 5EJ5A 4MQ5A 5AESA 2O7VA 5B3JC 3T61A 1YB7A 3K8YA 3KV3O 1O0SA 3N7UA 5EXDA 2P9BA 5I7AA 3VJRA 2BKLA 1E9AA 1JT2A 1SXJB 4RESA 2X0KA 4M7WA 4DDHA 3FUCA 3R7AA 4FX5A 4B46A 2PA0A 3WGNA 2CFCA 2JGMA 3HSSA 3NM5A 1O96A 2ONCA 3OPMA 2XNCA 3FUXA 3ND7A 4BFCA 2VRNA 2R7MA 3ZK7A 4J76A 1CNMA 3OIWA 5TJHA 1NI4B 4DSZA 2VZ9A 1NQ5A 3B70A 3K0FA 4JJGA 5ENDA 3OO0A 4EL0A 4U00A 2YJ6A 4YUWA 4OK6A 1KDRA 4X45A 2IU0A 3UWDA 3URKA 4MWBA 1SUEA 4LCJA 1M0EA 1IZ7A 2FOXA 3SICE 4JLSA 1OGIA 4LTMA 4N12A 4YGYA 4V0LA 2HADA 1I4DD 1SHTX 1KI3A 4B83A 1TRHA 1N2CB 1C14A 1UUFA 4M1ZA 1ZOIA 2FPGB 1FXWA 4JUAA 4R8LA 1L8AA 1DB3A 1RBMA 2PZJA 4CQLA 2EWVA 3DM9B 3KEQA 3KQTA 4XWTA 5K2MA 1F2UA 1AXGA 1C9DB 2PX4A 2AOTB 4EY8A 1YZUA 1O94C 2YMLA 2FZWA 4G2TA 5EE0A 1OI2A 3G0DA 2B7LA 4ENVA 2R6DA 3LKVA 3MSXA 2O1EA 1RM0A 1KDTA 1L7RA 3IV6A 4MQEB 2LPMA 3VKFA 2A5JA 3UYKA 1LBEA 1YQGA 1WPXA 3CUYA 4RVSA 4JBXA 4FGWA 4ZV9A 3LTNC 4N41A 2QX8A 1HQYE 4DA6A 3CGWA 4P80A 3O5AA 1E1LA 1JEOA 3WHKA 1QF7A 1GGHA 1ZIXA 2ESRA 2Y1DA 3LYUA 4H15A 1K3FA 1E59A 1Y9ZA 1NW8A 1RI2A 2VK1A 3EVBA 4LXHA 3WIVA 2X23A 5J5VA 5F2KA 2PH5A 2GKSA 1YE8A 4PG4A 1SVIA 2ZYDA 1CZNA 4NULA 3VGPA 5HSGA 4G97A 5KJFA 1O6CA 3KUKA 3GLHB 3B3AA 3CX7A 1G6KA 3M34A 3HYCA 4C2UA 4REQB 4M36A 3H3JA 5IJ9A 1XLTA 3FI9A 4EUHA 3N0WA 4HNQA 4A03A 2XMSA 4ZT7A 1Z37A 2VJBA 3OM8A 4E33A 3GARA 3CVJA 4JLWA 2G9ZA 4MS4B 5EUQB 4CCWA 3KPWA 3B5JA 4ETNA 1Y34E 4HRYA 1E4EA 1KIAA 2GF2A 4GBED 4MUHA 1N2XA 1U9JA 2KSQA 3OIUA 2WE7A 4FU0A 5ECDA 2FRVA 4ZAZA 2FE1A 3G2JA 4H7IA 3DKPA 2XYHA 4I4LA 3A25A 2CLIB 4KXVA 3VZDA 3WO0A 2XBUA 4QT0A 1J5EB 4ML3A 1NP3A 4C7OA 2ALJA 4E94A 1GZVA 4TYNA 5FP0A 3WGLA 2A35A 2UZ1B 3FF4A 3UGQA 5HYVA 3OZXA 3FMGA 3VYUB 3I2GA 2NP6A 1AO3A 3SNKA 3AGQA 4BIIA 3X2EA 5JQGA 1HFWA 3QELA 5KVQA 4I7EA 3FJ1A 5C8YB 4DZZA 3GROA 3PGVA 3BJEA 3UBTA 5LDGA 4PVCA 10MHA 4RS3A 1UOOA 2QRVB 3L0BA 4IKOA 3SR3A 1SKUA 2YXEA 4OM7A 4DVJA 1B6RA 3IAM1 2DFKB 3SYLA 3U62A 3ZWXA 3U6BA 3UGJA 2BTEA 2BGKA 5MDHA 4WQMA 1P7WA 3A4YA 5H81A 3NVKI 4ZIRA 3Q9NA 5DTQA 3HJTA 4IVRA 4ZOAA 3O3CA 1QMGA 3PXXA 4R31A 2FRDA 2VLBA 3ST7A 5BR4A 5IJ0A 3WAJA 2OYSA 1U02A 3PDHA 3MBIA 1X8LA 2XMBA 4P08A 1SKYE 1N6KA 3RFFA 3RHSA 2VYNA 2BCEA 3QW2A 5I9TA 1VQ1A 2KBFA 5GY7A 2O7QA 3OTOB 1G38A 1DX4A 3WMGA 5FD8A 2C99A 4TUYA 4C6TA 1ZNWA 2ATEA 3PD7A 5IBCA 3QU4A 4E03A 1W46A 4G0PA 1LSJA 1U04A 2ZJ7A 4XFDA 1DELA 1YQXA 1QQTA 1EX7A 1UEIA 4ZC8A 4ZC1A 5AVSA 3W5BA 1QBGA 2IHZA 1RM5A 3AEUB 4RACA 5KAMA 4I1RA 5I6DA 1N5MA 2FW1A 3VVLA 4HAIA 2C2HA 2MSWA 4GEKA 2HIGA 4WXHA 3QLUC 4DJEC 2Z08A 3QE9Y 5DV9A 1MC5A 1SK9A 2C59A 2Z9DA 4R8SA 5AK4A 2P62A 4KGDA 5KDDA 2A9FA 1UDRA 4RK5A 2D1QA 2NVWA 4AUMA 4BJ5A 1QK4A 1P2BA 4MUJA 1DC3A 1TM5E 2KM1A 2V98A 2WWIA 3ZZNA 4L15A 4BV3A 1COWA 2W2VA 4W5HA 5B2ZA 3T7JA 4DNXA 3BICA 4LWZA 3LRXA 2WTXA 1XD2A 3OWHA 3R77A 1HSZA 3LT0A 5IT5A 4UHKA 1SUAA 2EG9A 4PICA 2G4CA 3LPLA 1SQ0A 2QW8A 2TECE 1J9GA 1T5LA 3N6XA 3VI4B 5ICGA 1U0NA 5FPKA 3PQ3A 1PJTA 4ETIA 1U2GC 1DJNA 4RCZA 1GFWA 1T9BA 3FYUC 4UBLA 3SIXA 3E5RA 3ZYCA 3RQIA 3MJEA 3AKDA 5A1JA 1UMDA 4K6GA 5C7IO 2X9LA 2C9CA 3HEBA 4JBLA 4XLTA 2VYQA 3DMRA 3ENZA 2PJDA 3GFVA 4WVLA 5I48A 1UK8A 4IWYA 2FPKA 4WZAB 1WD5A 1J07A 2DBRA 4KN5A 1BQ4A 1ZUWA 4B3BA 5FFNA 2R1UA 7MDHA 3FPCA 4X8MA 1RWVA 1T8TA 2VYND 3CTMA 2RH9B 3EXG2 2ZRGA 4J29A 4G01B 1XAIA 1MO3A 1YKGA 4UCWA 2I3AA 2ZSHA 5CJ2A 5FI5A 2P2SA 2XE7A 1BROA 5HCNA 3C3EA 2W8BB 1N6IA 3SYNA 4KVZA 4MMXB 3UAYA 2ZSKA 1UBEA 3MJCA 1L7AA 5DBFA 4IVNA 2CXSA 4HXYA 3H97A 4OYYA 2FQWA 1PTJA 3HYTA 1OMOA 2ZREA 1KP3A 1I1HA 3ZZTA 3THXB 1CULC 3CE9A 3DT9A 5C2JB 1ZICA 2ZYUX 4DLSA 1F1JA 3FNEA 3LGAA 4GMGA 2UYYA 3VZCA 4MYCA 3ZY3A 2FP3A 4YY3B 3DMTC 3KLMX 4FQ5A 3E7DA 3HQ4O 1GQFA 3N74A 3OE7A 4BB5A 4Z4HA 4Q3DA 5IF3A 3HDVA 2A5LA 3ZV7A 3QLVA 1AK1A 1GO2A 2CBXA 2YQZA 4P84A 4DLZA 4EA9A 2CEAA 3P32A 1COWD 1ND6A 5LM3A 3WGTA 3KU1A 5F9HA 4H6PA 4PPGA 4FC6A 5JTUA 1E18A 1R6XA 3FTPA 4OH1A 4RANA 3TINA 3V8QA 3S0JA 1KEKA 3ILXA 3U7GA 1WMFA 2P7IA 2QMYA 4MULA 3O90A 5YASA 5JDIC 5KJ1A 1RVV1 4ZOLB 2YQ5A 3C3BA 4WEQA 3OMXA 4LW8A 4Q9JA 1MR3F 2VA9A 2WA2A 3EDMA 3KTOA 4FDLA 3CTPA 3AX6A 3D9QX 2X6RA 4OFBA 4QDXA 1ANKA 3WGZA 4X66B 2IOYA 1EGVB 3P2KA 5AUQA 3WIEA 3R3VA 4BFZA 1L8QA 4DPLA 5CA1F 2XXAA 5EWMA 2AUNA 3ZDFA 4RYLA 4XB1A 5JS7A 1T1EA 4LHWA 1W6UA 4L16A 4TMKA 4KDRA 5B58C 3KT8A 1PDVA 3E9CA 2B2NA 4KQCA 4B44A 3SQWA 2H4YA 2PX5A 3CXUA 3OG9A 5LYJF 2D62A 1FW6A 4YT5A 4A5SA 3QEAZ 1QYXA 4ARAA 5HMMA 1RE1A 1ZCAA 3RUPA 3RFTA 3TPCA 4YAUA 4UNSA 5JSZB 3U61B 1MGOA 2PUBA 1EMDA 3OFNA 5F33A 1RXCA 1TD9A 4CLRB 3ZJUA 1E9DA 1TQ2A 3PEFA 3OE7D 4QU5A 3DVAB 1T2UA 3G5UA 4IHJF 4CFSA 1JHYA 5AVKA 2VJKA 4G4SP 1TZ2A 1N0VC 4U9HS 5JNRA 3JZMA 4WSOA 2ZZMA 4M7PA 3CUKA 2FPWA 4HUTA 1KVUA 2VDJA 3RVRA 2CJWA 2GFIA 1S5PA 4JROA 4O2AA 4DY6A 1EAYA 3N0VA 1LSSA 1JJAA 2UYCA 2UUAB 2YFHA 1OKKA 4OHMA 2VDKB 2FHPA 1QWOA 4U2BA 4YIHA 1NXQA 3ON5A 3PITA 1PGQA 2DPYA 4N3CA 1E6CA 2BGUA 3QFHA 4CUJA 2RSLA 1HQCA 3C7TA 3LUAA 3IDFA 1SXJE 3CZ9A 4H7EA 4QAJA 4L5JA 4CL8A 1V16A 3IT0A 3JQFA 4M8NE 4MTLA 3ZHYA 4QT4A 5CAEA 4J0QA 1KHTA 4CLEA 3VTZA 4URWR 2WZDA 2WVJA 1P17A 1BTOA 3MGBA 1Q1NA 3VZPA 4CIWA 4CIAA 2BEJA 1G55A 4F2HA 4ZT4A 4X62B 5JLAA 1DQRA 2XYGA 3FDXA 6GPBA 1QP8A 3ZK9A 3KKOA 1R0SA 4JT2A 1Q0HA 5DN6A 2XQKA 1BFKA 1OLSA 3ED1A 3TRDA 2M1ZA 2HXSA 3EGCA 4PVDA 4DSAA 1N78A 1UKBA 3NWEA 4GPIB 1GTJ1 1KY5A 1MT3A 1KY4A 4HMQA 1CY7A 2WU3A 4GKKB 4TV9A 1BA3A 1QTNA 4ZMRA 3T7IA 1N5OX 3QF7A 3BSFA 3KBBA 2QGZA 4XRGA 3BORA 1YIAA 1QJCA 4IINA 1KGSA 3KU4A 2R4UA 3ROMA 4XH9B 3TZ6A 1G3IA 4HG2A 3ANSA 5LB2A 1Y1QA 2VLIA 4RJTA 4BGIA 1ONPA 4J4TA 4EH1A 1EUDB 1R88A 3AV0B 3A6HA 1Y7IA 4UVDA 1AUPA 5EKSA 5IP5A 4AU1A 1LKZA 4BKQA 3VPSA 4BNXA 4MRAA 1KWKA 5E3JA 3EFOA 4RUKA 1SZPA 2R87A 1KZYC 5E7IA 1YRQA 2VJCA 3OZEA 4NBWA 4R1OA 1HDXA 4XARA 2AN9A 4U6SA 3CLKA 3F7NA 3QWHA 5K0JA 5IVDA 1AURA 2C4UA 1ISMA 5JNWA 1WTAA 3TLXA 2IYUA 2VHQA 2ZT7A 4DA8A 1A7AA 2ID4A 4NYJQ 2D5BA 1LXCA 1CUGA 4O8CA 1MJ5A 4FR2A 1RJ9B 3A1UA 3LLMA 1GZ7A 3VOAA 3PLRA 1LVHA 3WZLA 4E51A 4MUBA 5DNEA 4JHLA 4FCTA 4D9FA 2PTGA 1YI1A 1YRAA 1IBSA 3A4VA 2CVOA 3AEYA 1V5WA 3M3HA 4FKBA 5EWJA 4MV9A 4KPYA 3VZQA 3M6AA 4E6EA 2O8CA 1U9CA 1NW6A 3ROPA 1RHUA 3RJZA 4PLVA 4QOIA 1YR8A 4JD5A 5CA0F 2C8LA 3I04M 5FOXA 2NVOA 4B17A 1NRIA 3HU5A 4CKEA 4KQ2A 5DN6D 8ATCA 4WXMA 3ZJVA 4C06A 3UC5A 2V54A 4DUPA 1SU4A 3M1IA 4MUGA 2WQ6A 2PRIA 3GPCA 1GAEO 3T06B 1S2IA 1NBWB 5IBPA 4F3KA 3MEQA 1LDBA 2OR3A 3IELA 1UFVA 4I50B 3F2VA 3BMNB 1DSSG 2D06A 2NZXA 2VDMB 1WNFA 3D4NA 2V6JA 5E9WA 5LBTA 3VUEA 4ALNA 1I7DA 1QJ4A 4CM8A 3DE5X 3SXUA 2BGMA 3V1KA 1Z4OA 1HT2E 1M0WA 3HXTA 2W6PA 3I76A 3QPAA 3AQIA 5I9SA 1E3LA 1DVRA 1NR7A 4OKNA 4DIKA 1JR4A 2RHRA 2HD4A 4OJNA 3CN9A 4WKOA 1CBUA 1CRLA 1PG5A 1GTMA 4TSKA 1WETA 3EQ2A 3GIDA 2V45A 3KLPX 1UPCA 3LE8A 1E3EA 1UPFA 2AUMA 3HKDB 1ISPA 1Z47A 1IQRA 1CERA 3KXDA 3F6RA 5D5HA 1ZXXA 3NBUA 3SHOA 4HFMA 3SBXA 4UKDA 5CB6A 4RORA 1RE0A 4CNBA 1A4IA 2AJCA 2FFRA 5DU2A 3LYHA 3RS8A 5B7NA 5KNCH 3T41A 3PEUA 1DG9A 1PE0A 3MRXA 1IOLA 1PKEA 5DH9A 1RLTA 1ACMA 2AXQA 2WEKA 4M83A 5AKLA 1C3OB 3RKSA 4IGFA 1FNMA 1XCOA 4LRTB 4ROTA 4Y2PA 1FYWA 2B4QA 5EG5A 3OCUA 3G1UA 3LK6A 3ANMA 3UH1A 5JLJA 5CCXA 2COUA 5KINB 2CXQA 2J07A 5TEVA 3AP2A 1L5KA 5A9SA 4N82A 2OE2A 3ZTTA 5HM6A 2Y0PA 3CNEA 3H8JA 4R0NA 1VPTA 3L6OO 4UD2A 4RHCA 3BRCA 4RJKA 3TVTA 3VPAA 1TPZA 4LTNA 4NV1A 2PO7A 5ER6A 3H0CA 4DSNA 3U3RA 2V9PA 1RC8A 3NX4A 1N92A 4V0SA 3AUSA 3WBJA 1SKMA 4ZK6A 4LF4B 1SKBA 2AIRA 4H1WA 5LKAA 4KFCA 2VATA 3MHTA 1ABBA 4LEIA 1UK7A 2JHCA 1CNEA 4R8MA 3EZGA 3AHEA 1XG5A 3MWDB 4UU8A 1DT3A 3TQSA 4FZ5A 4KR9A 1L4MA 4BYMA 2E55A 2FR8A 3HDYA 2ZR8A 2ODPA 2RAPA 3OKAA 5CITA 1J33A 3VA7A 2AR7A 2BR3A 1SCQA 3NYRA 4IFEA 2HHAA 3WJ1A 3GLIA 3KVNA 3B1FA 1GJRA 4BGVA 2IS2A 1JFFB 1EWTA 2VCHA 1GNRA 1KIMA 4U5XA 4LGVA 3IURA 3PDWA 1VJ1A 4GH5A 2CXTA 4WZAE 3SN6A 1YFLA 2X8AA 4QE3A 2RK3A 1PS8A 1E58A 1F0PA 1W35A 3Q8MA 4RFLA 3F5SA 1XEXA 2AS0A 4AULA 1UM8A 2DPXA 2V55B 4XQ0A 5E1OA 3CX8A 3L6RA 4B9EA 4YJGA 5HZMA 1XZEA 1WXDA 1QTRA 2GLXA 3SKXA 1U90A 7YASA 1I7SB 2FMTA 1HLGA 2Z2JA 1NPTO 1NUQA 4G4JA 1KQPA 1CYDA 4LDNA 4KOAA 1CR1A 2GA8A 2OCGA 3A31A 3EMDA 2A58A 1Y7PA 1D7AA 3QOYA 3K73O 4P32A 4D3XA 4ZOQI 3K0FB 3DBLB 3SNHA 2XCQA 1F06A 5B6JA 1QIHA 2FFBA 1YF3A 4DR1B 4YP0A 8LDHA 1BVRA 3NBYC 3WMEA 4AKIA 2WD8A 1SCDA 3E9DA 3EVAA 3B7PA 3KZKA 3T12A 3II6X 2OGZA 5K2OA 1R8JA 2VHJA 1CQPA 1BWPA 1JVNA 2DU8A 5ALGA 3W6PA 1X7GA 3PCTA 3SX4A 4EG3A 2CDNA 6ADHA 4YYEA 4TYQA 4MW5A 1Y5IA 2X1MA 1NULA 4PPQA 4TROA 3WGJA 1XNHA 1YCFA 2WWWA 3DFZA 1M7GA 2Q3MA 1ZD8A 4WJLA 3BWEA 5IFLA 5CM8B 2NNWB 4ARUA 5D86A 3VJMA 2N47A 4KO3S 4C21A 3GG2A 5F1PA 3VOBA 1AUVA 1RAHA 2IVZA 2QTMA 3WMWA 3TSOA 5L95A 3PT5A 4Z9YA 4TVKA 2RJOA 2R8RA 1GZSA 2C31A 3EW9A 4M8SA 3RSSA 4B09A 3IQFA 4RY0A 3CNLA 2XNJA 3I5UA 3EEQA 3CSUA 3TNFA 1PV4A 2INGX 1F6WA 2C5AA 2FSUA 2PS9A 2J6BA 4OHBA 2QWXA 4RWEA 5CYOA 4F5ZA 1AKMA 3SE0A 3B1WA 2XDWA 2XYRA 3STXA 3ORYA 1LVGA 1L4NA 1PEDA 3F5MA 4PWZA 5FOQA 1F9AA 3VTKA 1PZFA 2BBTA 2FVXA 2G6BA 4A82A 1POWA 2H6EA 2ONYA 1ZH0A 4YJ3F 3UCXA 4AO8A 4UZEA 5IJ9B 5HF8A 5KOHA 3GEBA 3WBKA 2O7SA 2A9KA 4LI0A 3TLMA 1G7RA 1G4HA 1WB4A 2HRRA 4RLHA 3X1WA 1DC6A 2YUIA 2W2XA 3EMKA 4GRAA 4LJ4A 1VB5A 1C3VA 1P39A 1V35A 1OWOA 2Y1LA 5A4KA 2E4ZA 2ON6A 4AYTA 4NCIA 1AD2A 1E4EB 2YJZA 4U4AA 3M2PA 4DM7A 4YAWA 3WKEA 4AVYA 3CUEF 3KHUA 3G2MA 2ZTMA 1NDHA 1E6KA 3LHDA 1W94A 1RU3A 4G1UC 4CTKA 2XLBA 1VKJA 2BT4A 3WYDA 4KTVE 4EEKA 4IQFA 4I1IA 3NASA 3N2EA 4JS0A 4TMWA 2WF6A 3WSWA 4DQLA 3OESA 1A72A 2GILA 4JYAB 3OZBA 1SIWA 3PQ2A 3NO4A 1DCMA 1XZDA 2ZROA 5CCDA 2NQ2C 3QELB 2XB4A 1DJMA 4EMBA 2IDMA 4UVIA 4MS1A 1PWYE 2EHDA 3O9ZA 2WWGA 1LWOA 3C7CB 1C3JA 1ONSA 1RRKA 4G5OA 4WFKA 5KJEA 1A8SA 2HBYA 1W36C 1NU8A 3COSA 1EJ0A 4P33A 3D31A 4JI3B 2QYTA 1L4UA 1HLFA 5JADA 2QLFA 2ZS9A 3MLBA 1PR4A 4BO6A 5K4GA 4OHKA 3DDUA 1Q6ZA 5IJ0B 2IDKA 2GFHA 3IR7A 3QXSA 1FVXA 3GDOA 4L8VA 1SBQA 1G9XA 4P7BA 3S2IA 1BMFA 3C4QA 1R74A 2WQZA 4HB3A 1VJGA 3JSXA 4Y2YA 2UYQA 4Y6RA 5C4GB 3TQTA 4TUYB 4ZCQA 4C6TB 2BV3A 3TL6A 1L3IA 3QJYA 2OQ2A 1PV2A 2V7PA 1BHJA 2WM2A 4DYVA 5LN1A 2WSSD 4ZQCB 3HZZA 2AW3A 3LHSA 4Z0PA 3WL6A 3F3KA 2WDZA 5AJHA 3MJTA 2C04A 4LZZA 4ILEA 2FN9A 2XZDA 3RUEA 4R68A 5CIQA 3T5DA 4YBRA 1UJNA 5DWDA 1Q57A 1NXVA 4KH1A 3G5AA 4XUCA 1A96A 3JU3A 4O4JB 3SBDA 4H7PA 1O8CA 3GDWA 1P9NA 3L1HA 2C03A 4FEGA 2G4LA 1F48A 3A70A 1CLUA 1NZFA 2M6LA 4E5DA 3U56A 1K7XB 1NUAA 3ISTA 3OIGA 2ZYAA 2WUWE 3KXLA 3I4LA 1GWNA 4WV3A 2D0DA 4D9NA 2HSEA 3GFTA 3PTZA 4Z4QA 1H9AA 2A1TR 5E2IA 3UF0A 4AF6A 5IFKA 1XD2B 3ND8A 3D3WB 3EZXA 3L40A 4AXXA 2FUKA 2UUPA 4KR6A 2LCFA 4PAGA 1SKQA 2WV7A 5A5FA 1C4WA 1QTQA 4KRGA 4CCSA 4DGSA 3OT5A 4RTPA 5JHGB 5E2AA 1TVCA 1CKEA 3L02A 1YC5A 3NALA 4RDIA 2DQKA 1KYZA 3OQMA 5I9IA 1MV8A 4DDVA 4QRDA 4Q1AA 4UVGA 1TCCA 2XW6A 4V3CA 2P9CA 4HTAA 3COJA 2HF8A 1ZM9A 1B3BA 2NOAA 4ZA2A 1VL8A 1ISSA 3DMHA 3G9QA 1DQYA 2P5SA 1WSWA 4MPDA 4MMYB 2YBDA 1O0CA 1WD7A 1L7BA 4K81B 2IYXA 1UXIA 5IC6A 3SQNA 1VE5A 4KTTE 4AKHA 5A3SA 4BU0A 4EHKA 3CJQA 3JQRA 2FZ5A 1Y8QA 1OWNA 1R0LA 4BGDA 1UBTS 1AMOA 2XCLA 2QTCA 1IY2A 5EE5B 4UUBA 1Q17A 4N3NA 1OX4A 1F12A 1YDHA 1RI1A 2OHIA 1SBZA 3NAQA 1XDDA 4KAJA 4X5OA 4XYBA 1YK0A 2FDRA 2I6UA 3H9EO 3LBIA 4OHVA 2RIRA 1CUBA 4YDHB 3UWPA 2BFWA 4Z51A 4GQBA 3ZXUB 2DT8A 2RMKA 4W5TA 2O14A 3KVOA 3OPNA 2Q5QA 1T8UA 1R5NA 2ZQ5A 4DV7B 4NV0A 1H8ED 1DFHA 3ZS9A 4CF5A 3T4UA 1JDBC 3I4CA 5BQ5A 1E1RD 1YRHA 2CYAA 4RJ2A 4Y18A 3ZZMA 1HRKA 2R8XA 4BNJA 3E9MA 4F6LA 4LYEA 4MWSA 5TDHA 3R0XA 5AK3A 4F56A 5DE3A 3HWSA 3NHAA 3PNSA 1GQQA 3EDQA 1B8VA 2XA2A 3OX4A 3IKTA 4MR7A 4TV8F 3RHZA 4DDKA 2GVNA 4BECA 3IAUA 4LDRA 1G5TA 4ZVVA 4EW6A 5IK2A 2I2FA 4HXFB 4YAEA 2WYVA 3DUFB 4CQNA 2PRJA 2XWJI 1W5SA 4S1VA 1VGVA 3ZU6A 4JITA 1S0UA 2JFGA 3KJQA 2NXCA 1FDWA 2LCIA 2WWVD 1NXSA 3AZQA 1GY8A 4KEAA 1XYGA 2YWHA 3R3ZA 4NMMA 1J0DA 2OWDA 4PSDA 1AQIA 3BERA 3CEPB 4GLBA 4HL6A 4PM4A 4A8HA 2IYNA 2Z2YA 4MUIA 1PQYA 2ZU6A 3S3TA 5EWMB 1HTWA 13PKA 1JE0A 1T9GR 1Q0RA 5A02A 1Q7BA 4OBBA 3GNLA 4EHAA 3F78A 1NR5A 2IXAA 3UJCA 2WU4A 4BNWA 2J5BA 3Q3IA 2YJ3A 4AX8A 1ZY2A 3O1JC 4LV8B 3IQEA 1RLOA 3FNFA 4QATA 4FPXA 5IVKA 3RTGA 1I1OA 3FCAA 3LL4A 2B3DA 2DBVO 3RC2A 1KEUA 3DNPA 1L1FA 4M8IA 3OEEA 1CDDA 2XMRA 3G17A 3N1UA 3PEVA 4Y6QA 4KUEA 5AHOA 3JTEA 5MN6A 4CG1A 3RTBA 1E0KA 2QSJA 4ZOCA 3KL4A 4R2XA 1VZ3A 4R9VA 3S70A 4CMCA 3RK1A 2WJGA 4FE3A 3B20A 3W3AA 1V71A 5ALZA 1JAXA 1DV2A 5LQJA 1HBJA 1U3GA 1WSAA 5BN3A 2IZ1A 4LCEA 5C0OE 5FNVF 3HDHA 1YASA 5DZSA 4O4HA 3GLKA 3TNJA 2CJWB 3E2MA 1SB8A 2VH1A 3VOSA 4EYGA 4YCSA 5K0FA 2VHTA 4O2AB 4QOGA 2Q5LA 3W6ZA 4R71A 5IK2D 2B8NA 4DJFC 4OKIA 3PENA 4R1NA 1XCGB 1ZNXA 2IX3A 4ZGGA 3SJBA 3AT1A 1ZK3A 1G9SA 2WUDA 2WUFA 2OV3A 3JRWA 3TQIA 4EGQA 5JMTA 1P72A 2AG5A 1HYGA 5CK5A 3WNBA 1K0UA 1SGWA 1N3BA 1CK4A 3V8PA 4Q3EA 1R6TA 1ZGHA 4WCFB 5B7GA 5JEDA 2EARA 3CWCA 1IBRA 1V16B 1NJFA 3Q0IA 4F1WA 1EFTA 2GHIA 1X7YA 2W98A 1CUIA 5B3AA 1GGMA 5FUQA 3CKYA 3ZZ0A 4DG5A 3GNTA 2VTDA 2LR0A 4QG7A 2FZKA 4H59A 4QUGA 2Z2XA 3EC1A 3LAWA 5SICE 1SOAA 5LLDA 2QPTA 1TKAA 1TMKA 3HNOA 4UHBA 3E70C 4R1PA 3CVOA 3UWKA 5AI8A 1ZIYA 4A16A 2R6CA 6CHYA 2VIIA 2LRHA 1F4LA 5C31A 3AU8A 2YJGA 3TMYA 3ZIAA 4B2PA 2NU7A 3M3PA 1G0NA 1PSZA 4NU8X 1VI5A 4DYDA 4UOZA 1I0IA 1RWPA 4YRQA 4AMZA 4ZI2A 3BWXA 4WK0B 5AJTA 1E32A 3PL1A 4Z8YA 4HPWA 1X0XA 2KWIA 2AQKA 3FCYA 1SELA 4JEMA 5F9MA 1FUYB 4B0PA 1NN0A 3GZNA 3JQGA 3V34A 1WCXA 5AOCA 4G63A 3AFOA 2MHCA 4TV9B 3DVQX 2RGXA 1F7VA 3O26A 2J30A 3IMEA 1JQKA 3W3AD 4I5GA 5LC1A 3IDAA 3GVHA 2QW1A 5AJXA 3Q3EA 3WQQA 4H4EA 2PTHA 4AXBA 2V0NA 2O2EA 4QBIA 2FPIA 1UZAA 3AF0A 3KPJA 3FNGA 5DHUA 2NSYA 2R25B 1M8FA 4U7DA 1LK0A 2VC2B 5ILGA 3W77A 1M6VB 1CB7A 3EFOB 4BO0A 4ZYUA 4HWGA 5FI3A 2J59A 4GUAA 3LUCA 1Z28A 3G59A 3ETLA 3PXDA 4QGHA 5IANA 1VMIA 2Y2VA 5GOZA 3OC0A 3I9NA 1GUAA 5TMDA 3AW8A 2IELA 3IPAA 1NNUA 1YZVA 1HK7A 2OEPA 1E60A 2ZWPA 4DLTA 1P62B 1II9A 4KOEC 2QV0A 3PQFA 2ZTHA 1L4GA 3AVVA 1GL9B 3NH9A 1NI3A 3G8AA 2PL9A 1E4OA 1GPKA 2ECOA 1DPGA 2VCEA 3GXOA 1HEYA 4M0FA 4W9NA 4XZ3A 5EWJB 2QD3A 4CV1A 3PJEA 4YR9A 3P7MA 3PV0A 3WXMA 2O8CB 4MW7A 1QPBA 4KNYA 1ORWA 4OGLA 1USKA 3AUAA 2CL0X 3O2JA 3KKNA 1NQXA 4RY8A 3UHAA 3ZGLA 1WP9A 2JEOA 4CKEB 4NYMR 4GSYA 3IUYA 3S8MA 4HGOA 1JX6A 2MYNA 3DW3X 5ARBA 2V7QA 2QE7D 3I62A 5BV0A 3VVBA 1M7HA 1NC1A 2WMYA 2XQIA 2AD5A 4P6VF 4F9GA 1Z6ZA 1PL0A 1NLMA 3IQIX 3ESRA 3DULA 3U7JA 2G80A 2JVKA 3M4NA 4B3DA 1Y5LA 3OF5A 5JMOA 3KQLA 2DTXA 2NU6A 4O6VA 4A6DA 1AT1A 2XB6A 5FEMA 5GM1A 3SXUB 4BAUA 4AAYA 3IUEA 3EWSA 1GHTA 5CLQA 5BP7A 4L02A 1EB9A 2NT3A 2UVPA 3QE2A 2C92A 3FFTA 3FAZA 5C52B 2VZ0A 2Q3DA 3R3YA 4QYWA 2ATIA 4CPDA 2QYHA 1X77A 2PGXA 1RJGA 3PUJA 3DEKA 1UKEA 3KKPA 2DYKA 2PX2A 3G9ZA 4IIHA 3N2GA 2D5AA 2R6ZA 3RW9A 2GK6A 4AECA 2QRUA 2RJ3A 5JYDA 4M21A 3V8MA 3RB8A 3GLRA 5GM2A 4AJEA 1AXRA 1D2AA 2FWIA 4AJ1A 2ZYRA 1XTTA 3D4IA 2YXNA 3OHPA 3RC9A 1OREA 3O2NA 3PX3A 3IHKA 1Q16A 2O2XA 3A3NA 3N2IA 4NE9A 4PQEA 4QJBA 4C14A 3G7SA 3KSBC 3H99A 5EOVA 3CLSD 5BSKA 4LF6B 1WABA 4D4JA 1I2ZA 4OLFA 1CYEA 1MA0A 3HB4X 4K9KA 3ROQA 1HUQA 3BULA 1U65A 4F12A 5J43A 1J49A 3ILHA 3IHWA 5IVIA 4NH0A 4FJ0A 3LQFA 2V7QD 2EKQA 2ZJOA 1WX1A 3IEXA 3AEQA 5KAPA 2A1UA 4PYOA 1MXFA 2R6JA 2YRFA 3C3PA 4P31A 1TYCA 1GNLA 1XZIA 4J0CA 1VI6A 3WLAA 4HRAA 4F38A 4I8DA 2VAPA 3JZFA 2HA6A 4JELA 3U13A 1RQLA 1W1UA 3CLTD 4WUVA 4GAEA 3VYSB 3PE3A 3KVYA 3AG5A 1RYYA 2OYRA 3BK2A 4PYRA 5CLFA 1LK5A 4Y3UA 4JBIA 3LLVA 1UIRA 4X90A 1M2EA 2JW5A 4YDRA 3L93A 2C9ZA 3EXAA 2XXBA 4JUBA 1HQDA 1CCWA 1VJTA 2ZE8A 1U7ZA 3D0RA 4NU5A 3CSSA 2VZEA 1W4ZA 4Q37A 5EE3A 5TX7A 3UAXA 1H9CA 1OIWA 3K32A 4YCBA 1DJPA 1M6YA 3WTBA 3WGGA 2GERA 3GLIB 2WHXA 2IOFA 1CD5A 4IH1A 1XZKA 4YRCA 2QU7A 2NQ8A 4B32A 3ME5A 2C78A 3DLCA 1AKUA 4AP6A 3ZXYA 4HFJA 4K9MA 4DQKA 3WOHA 2X6QA 1K7FB 2AX3A 2OILA 3DOFA 4X1IA 2Y77A 1AGNA 2ZJFA 1PU2A 3OICA 4B9AA 1XEXB 4E1AA 2Q49A 2HBRA 2I54A 2WFLB 4BB9A 2QTFA 3EVTA 4EFMA 5HOEA 1BMDA 2Q5CA 3RYIA 3LF1A 1P6XA 1LPOA 3WGHA 1S2LA 2J9FA 4ZO8A 4MUFA 2XZLA 4IM7A 3MQ4A 4ZPJA 1RQ7A 5L51A 2PGNA 2XWQA 1VXRA 3G2NA 4AICA 4GI2A 1LLCA 2PGOA 2ZRJA 3E4DA 4FCVA 4S24A 3CZQA 1GGKA 1XZBA 1TJYA 2C88A 1J8DA 5CYFA 2NUPA 4GRDA 4PSAA 3GGDA 4QUEA 2R2AA 4AY4A 4EO7A 2K2WA 2W6CX 4HVTA 4LZJA 1P2GA 5EN4A 4BLUA 4BNVA 4ZK2A 4S05A 5L6MB 2B25A 4B80A 4PYNA 3HGTA 4BAGA 2HHHB 1GZ3A 2D3TA 3EAGA 4CIYA 1NY5A 3RLFA 1R0XA 3GEHA 1AVTA 3BL8A 3R7SA 4NL4H 3VO9A 3MXOA 5IDXA 2Q4DA 2H1LA 3UFXA 1Y9DA 4PC1A 2V7EA 1M8GA 1P5JA 4BS9A 1Z4MA 5GINE 3WBFA 1J70A 1RXSA 3O8RA 1E5DA 1RXWA 2AZXA 4TLCA 3ZHBA 2NMVA 2WYHA 1H42A 1VIYA 1EZ1A 4PFQA 2AD1A 1TTTA 4FYKA 4IDAA 3B2NA 4EFNA 4CGYA 4KV9A 3WOVA 3EN0A 4LF8B 4RTMA 4JL5A 2JI6A 1CRZA 2VS1A 3Q87B 3KKQA 1MTOA 1Q95A 3EXFA 3OT4A 4NEGA 4KXFB 4M9SA 1FUKA 4YXWA 4F4JA 2F4NA 4RL6A 1ECPA 2Q27A 2PSFA 3KD2A 4KJXA 4BVKA 2VPIA 5B3KA 4Z99A 3H1FA 3THYA 4BWVA 4DUGA 3MPOA 4N0EA 3U5ZB 4ICIA 3ZBTA 3QYPA 4KQ9A 1DQNA 1G8MA 3PUZA 4V38A 5SY4A 3BT7A 3OKPA 2G72A 4AG5A 1WG8A 4BQPA 4V0NA 2R1TB 4B1FA 4BQNA 4RM2A 2PU7A 3RUIA 5KOHB 4PG7A 5FF9A 3IBSA 1Z3IX 1JEDA 5IHPA 3BJIC 4DTCA 1RHQA 1MB0A 5BURA 3U6KA 3IX7A 1YONA 2PGJA 4OIFA 1C9NA 2DUNA 4LYAA 2Y1GA 4UEOA 3HYNA 1RACA 1Q14A 1DQZA 2PMEA 3C87A 1UBFA 2QRPA 3OZFA 4GO1A 1H4VB 5FCDA 2VDOB 5I7OA 1APBA 5L4NA 2PWAA 1VE7A 1EWYA 1YULA 5ALXA 3WP1B 3EZFA 2EFEB 4FHFA 2I3ZA 3S8YA 3FUUA 3W5CA 3LP6A 4O59O 4XJXA 1O4VA 1SG0A 4ZAGA 5EZ6B 3TBFA 4WERA 4KQXA 3M5DA 3DCIA 4AZVA 3SYKA 1Y6JA 4B4VA 4C78A 3ZHQA 4WZZA 2UYOA 2VSYA 4MS1B 5U1PA 4N40A 2AMJA 4FYIA 1QHHA 2I6TA 2VK8A 4WKNA 3ROTA 4D8UA 3R3WA 4F6CA 5LKRA 2NZJA 5U4XA 3LV8A 1QGUA 2FWAA 3HWWA 2ZSIA 4KXXA 4Q3BA 3CF4G 4KN6A 1DIAA 2V59A 3IODA 3WHLA 2RB5A 4BVHA 1E4VA 2ZU0C 5DPMA 3U9SA 3DD5A 1PR5A 1F2DA 2BZ1A 3QV1A 3ZCPA 1XVLA 3B60A 2X8WA 4DUGD 2DHQA 2JFBA 3KB8A 4G6ZA 5K0SA 2FSPA 2ZRAA 2WVAA 4HMOA 4H0NA 4AJ9A 1ZYUA 1C9EA 2VG8A 1DPFA 1KFEB 1FB5A 1OOEA 3QE3A 4EVSA 3PGKA 4U2DA 2TS1A 1E9SA 1K5HA 2J3DA 3AG6A 2BM9A 3B6EA 3T7RA 4KE6A 4ECAA 1QGYA 1Y1RA 4JJIA 3EVFA 3EUFA 3WLKX 3H5TA 5A9RA 1UH5A 1OIXA 5AO9A 3G2HA 4Z0NA 4JCCA 4NENB 3IOEA 2NT4A 1QAMA 2ECFA 1F3LA 3IUSA 2Q07A 2YNMD 1ZUNB 4I9UA 5I5EA 3ZW9A 1W4RA 1M75A 2QTAA 2XLCA 2ZIUB 1BGXT 3IVAA 3TR0A 1UAGA 2Z3ZA 1LK7A 3HU3A 2FSGA 5H3LA 1OFIA 2AKAB 2CUZA 2Z5GA 3SVLA 1BW9B 1X74A 3ILYA 1Y4DE 4J9VA 5CLLA 1OYVA 4NPAA 3JQAA 1ZCZA 3WGMA 1SOUA 2WIGA 3IALA 4G1MB 4PTLA 4DBLC 3UT6A 4KSBA 2ZRNA 2G0NA 2HKIA 1OHHA 4OP2A 1CZLA 3V2HA 1O9HA 1OX5A 2GBCA 2I9PA 2ZJ0A 3ND5A 3ABOB 4PF1A 2IH5A 3IBTA 4OXIA 4C3VA 5K6RA 1U11A 4ILKA 2BHNA 2DHDA 2BBWA 1DEKA 1EINA 4I1OA 2PAFA 2I9KA 1X70A 4D3ZA 1HE3A 1Y8QB 2PLAA 3R8XA 1S2DA 4TL7A 1P18A 1QQ6A 3D6JA 4LX0A 3V1MA 3TCXB 1YBHA 1OX4B 1DDGA 2QTTA 4IZHA 4Z54A 5EHQA 2GHQA 4YV7A 2MYTA 3RU9A 4ZRMA 1VPDA 1P5FA 3E18A 3HA7A 1KXJA 4OMFG 5ADHA 5IARA 4C05A 2ZRFA 3CB4A 1ZESA 4XVUA 3T9FA 1U8EA 1OLUA 4HYYA 4GZ5A 4B2YA 1OVMA 1Z8DA 2I78A 2OPBA 1K6IA 5DGDA 3W5HA 1Z83A 2ZS8A 4MI3A 5IAGA 4BFLA 1SUCA 4BNMA 3AJ8A 5JZ9A 1OILA 1VSUA 2FWRA 1PL7A 2QX6A 3HR4A 4JVOA 5KJ6A 1D1PA 1KZ1A 3T3PB 4DGQA 2E7ZA 1U1FA 2C3YA 2A88A 1MRSA 1ZXBA 2AJLI 3OTHA 4H31A 3GGJA 1EUCA 2I2CA 1Y0BA 3HJUA 4MR7B 4QM7A 5EJ6A 4KXWA 3WK8A 2RAUA 1TZKA 5C4IA 4L57A 4B2IA 2QAGA 2RH4A 1PW5A 2P9EA 3JQAD 4G1FA 1FFGA 1GT91 1F4VA 2G6TA 5EPEA 4AQ7A 1GD1O 1XTSA 4HGYA 3MA0A 3UWMA 2YICA 2IBSA 2VJAA 4QLAA 3L1UA 1OHHD 3GVXA 1N5IA 3TJMA 5AW2A 1MH1A 4ZKDA 2J45A 1XLWA 2QMHA 1QYWA 3FVRA 4LQCA 5K0LA 1KZHA 4D9JA 1JDTA 3DNMA 1AE1A 3KZ1E 4I4TF 3JQ9A 4BQRA 3F3YA 2JZCA 1OFUX 2AEMA 1RQPA 3KSMA 4C2BA 4JGIA 1T3HA 1J7JA 4UDYX 5KSPA 1DQPA 3HFRA 4RF3A 1UT8A 4LC9A 5H9VA 3VR5H 3U0BA 4DWWA 4IOJA 2ODTX 1T5HX 2NP7A 4RZHA 1NVDA 1D2RA 1I4OA 1A7KA 3LTEA 4QGAA 4BMYA 1JPNA 1KMNA 1I0ZA 1UJ5A 4UNQA 4LSMA 3D8BA 4BKUA 4OL0A 3K70D 4U9IS 1DEOA 4M1KA 2D2XA 3VMMA 3IQGX 2J3LA 4PLFA 5IUJC 1GG5A 4HDSA 2AA3A 3MTQA 4KPGA 1X7XB 2HM7A 1Z5NA 1YU9A 2G71A 3NDIA 3UV3A 5KTTA 1SWWA 1UC8A 2X0EA 3T5CA 1ZD5A 2RKBA 4V2IA 1TYAE 3D3EA 3EVEA 4KQ1A 2G9RA 4N03A 2RIPA 1E1MA 1XZFA 4J1TC 5DTRA 4UE3S 3CIFA 3AFNA 3FGNA 3FYSA 4Y9SA 5B1DA 2XA9A 1K7YA 3NBFA 3OECA 2WIKA 4J7AA 5LP1A 4O4HB 3ZHRA 3K94A 4YH1A 2PYDA 5DNCA 3RC1A 1LBQA 2DRIA 1JAHA 2Y66A 1E77A 3K1JA 4GFDA 5HIIA 1AMNA 1HT1E 2CW5A 5KNDA 2JKYA 4LRUA 5TEWA 1NF3A 3HI6A 3VOTA 3B6IA 5CG1A 2YKGA 2OKCA 1IBLB 4CKWA 1DZ3A 2PG3A 3NIBA 1BSVA 2OORA 2ZWMA 3DYBA 4HLQB 1PQ4A 2SNIE 4UVHA 3RYHA 3ZGNA 4HQ0A 4ON9A 2C82A 4AMBA 4BU1A 1UODA 3JWJA 1F8GA 1AQ6A 2B3TA 3ZDYB 4NDZA 1GCGA 1PRYA 5JFOA 1PLJA 3LBHA 4XWOA 4INJA 5L6LB 1X7YB 5AM0A 5AK5A 2NAPA 1EXMA 4IGAA 4IG4A 4P4TA 3SF8A 3G2KA 4J1QA 1EJ6A 1JBKA 1P2VA 2PX6A 4PYKA 3WV5A 4YMTA 3DEFA 1D9XA 3GXBA 4HWOA 2QIPA 4RKQA 1BH2A 1LJ8A 1Z4PX 3BGOS 1K8RA 3P97A 3RCBA 2NU7B 3P20A 5CVUA 5L3SA 4BDSA 3U16A 3LCMA 4Q15A 4NBTA 1FTYA 1G2PA 2CNWA 3NEAA 4AO7A 5I4IA 3GLSA 2DY1A 2W00A 3IE0A 4YP5A 3FNIA 3UIEA 2ZUFA 2EF1A 2VPYA 4HH1A 4P0PB 2PBLA 4ARZA 3GZNB 3BRSA 3JQGB 1LEHA 2CK3A 2C4TA 5D51S 3PNYA 4K9SA 2PH3A 2ZOSA 3K2QA 1IN5A 3W04A 3TQRA 2GH1A 2YS7A 2IUUA 4B73A 1NATA 3ZNQA 1VYHA 2PX3A 5JMWA 4FBGA 1W96A 3W3ZB 2H2FA 2AYZA 1V6AA 5F2OA 1OA0A 1PSDA 1Z6YA 2ANCA 3B6JA 2NVUA 4NAVA 4C5CA 2OLJA 4CKBA 5KTSA 1KWGA 2FPIB 1WV1A 2JFOA 7MHTA 2H3EA 2PM8A 2OFWA 4E21A 4EVRA 2JA2A 5KU1A 3RJ9A 3IVXA 1FUEA 5G4KB 3EGXA 1YA8A 3NCTA 3Q3CA 1K3TA 1RI3A 3GAZA 4V0MA 2DM6A 4Q03A 5JSKA 2P2CA 1F6BA 1RCFA 2V3CC 3GRRA 1JYSA 3BD8A 2I99A 1H0HA 5LNK6 3MGAA 4IEIA 3CISA 5J2TA 2GM4A 2Q99A 3ICCA 1YRBA 1U2DC 5JH7B 3P96A 4A92A 4DYHA 2I1QA 4LBZA 3SZLA 1EQUA 1R0ZA 2AGVA 2Q41A 2PPVA 1YS9A 4MV7A 3RV4A 3WDLA 2XUAA 5CNKA 5EKXA 3SX2A 3BRWA 3JWIA 5CXUA 3H1BA 1RXEA 1L3CA 3O94A 3OD5A 1SUBA 4PLYA 4WBNF 1GPWB 3L49A 3K1AA 3LIIA 1JLLB 4PWYA 3PR3A 4DG9A 3NNNA 3L0DA 4R98A 5H4HA 1BU8A 1FYEA 2CNWD 3A1NA 4EAQA 5EZYF 3RUAA 4DEXA 1UM9A 5INTA 1YE5A 4QYXA 5H0IA 2M1XA 5AXCA 2G1JA 3M4ZA 1YD7A 5A7GA 3USES 3V1YA 1P3Y1 4LYYA 4ERXA 1H22A 3LSYA 4GSLA 4Q4LA 1P4AA 5CNJA 4YMLA 2V96A 1XAHA 1IE3A 3OHMA 4FE7A 2IP1A 4Y2RA 2CLHB 4AS3A 5KWEA 2J7KA 3DLAA 3UJNA 2GN2A 4Z2YA 3GI1A 5DYTA 3KWFA 3DOIA 4A7PA 3VSCA 3JPWA 3FOZA 2UVPB 1SNYA 3FF1A 3ITNA 4L75A 4FVTA 2PVPA 1NHWA 2XY4A 1YDWA 2CL6X 3SZMA 4RABA 4DMGA 3EFHA 4UZSA 1YS2X 3ZN2A 1RYEA 2BM0A 1IAQA 2LW7A 3FETA 3WGUA 4JQSA 4B3HA 4WAUA 3G79A 2PUHA 2V6GA 2J09A 4C0AC 3AETA 3FFBA 4Q1CA 2YVQA 4E7PA 4L08A 2AUTA 3KQMA 5FUYA 2IYEA 1QP4A 2XB9A 2OFPA 1YZGA 5KU7A 1AZTA 2M6KA 4BCCA 2Q1YA 1ILEA 4PW0A 3W5SA 5LZ9A 1GPLA 1HTBA 3C45A 5H3CA 4E2XA 3OAAD 1M1YE 3E61A 2Z58A 1K9SA 4N0DA 4C7JA 2G28A 2Q1WA 5JIBA 1TLTA 3KR2A 3R6LA 1JHVA 4NPHA 2VXYA 4M9UA 3OU7A 4KWIA 1Y6FA 4CMEA 4ERNA 2HEIA 3GFQA 1IEWA 3HLTA 3OQ6A 1E2EA 3EIXA 2A1UB 2SBTA 1R4AA 3F1KA 1NBIA 1Z8NA 5D00A 4F6RB 4ZYWA 1TMGE 3EJWA 2YHAA 1K75A 1QX4A 4TWIA 4B4KA 4ZYXA 2A33A 2YNMC 4A0GA 1L4HA 1ZCJA 3EIOA 4FDAA 5M29A 3H84A 2DQYA 5CD9A 4CEJA 4QLOA 4YFYA 4LHSA 3CH5A 3C5CA 3IPXA 3HDGA 3Q3HA 4JK3A 2HSWA 4US1R 4YAFA 5CT5A 4YP6A 3DZHA 4MQ6A 1YR1A 4MAAA 5HJ5A 1TAHA 1BEUB 3OQPA 1QZXA 2YHBA 1Z8HA 5M34A 2CDBA 3FWHA 2BDUA 4F5EA 5F2NA 4NE2A 1CUZA 2IUYA 3NBAA 3OIYA 1D5WA 1UAAA 1K0FA 1AKNA 4DCOA 1XQWA 2G8NA 1CR4A 2XRZA 4Y2VA 1CU1A 2F3SA 5C5EA 3SXJA 1KYVA 2OM6A 1GL7A 2WHEA 4KFUA 4FSHA 4X1IB 3BHMA 1T0UA 2E6KA 3BJZA 2GD0A 1IUNA 1TADA 2DVMA 3EGOA 1AS2A 3BS4A 4UUOA 3QGMA 3B8EA 5PGMA 3VC7A 4UBMA 1L5QA 1USIA 3U3KA 4TQGA 3KAJA 2GPYA 3GY0A 4U0KA 5CP8A 2QRHA 2XGMA 5DBIA 3V1NA 4OYHA 3S5JA 5LMUB 1WRBA 2WHQA 3TZKA 3M6IA 4UHEA 1P80A 5TJ9A 1OFVA 2ID7A 3CCBA 3GQBA 4B5KA 4PLHA 1T91A 1JPVA 4X1KA 3EPLA 2G8LA 2DEUA 2CXOA 2IIBA 3FCEA 3QE0A 1XMPA 1UJ2A 1A76A 1MF7A 1H6AA 3HR8A 3M83A 5HTOA 1IBMB 1X1AA 4MWGA 1OB2A 3G9XA 3X44A 5BR8B 1EH5A 2B36A 2H9YA 3LDHA 3Q40A 3V33A 5CJJA 2NUPB 4L0DA 3V7NA 4RTRA 2WUEA 3FJOA 4Y9RA 4N18A 2VF7A 3ASYA 2Y9PB 2NPFA 5DK4A 1KETA 4XWYA 5AKZA 3V4LA 1DAFA 3QVUA 4IX1A 1D2GA 1FSFA 3IGFA 4ZT5A 3MWEA 5BSMA 3EF1A 2E87A 1K5DA 2IPMA 3M4JA 1UQUA 4BJHB 5FTJA 3HB0A 1Z9BA 4ONEA 3TX6A 4PBRA 3D7LA 4DBZA 1OVGA 2P3QA 1K97A 5G41A 1MLDA 2I80A 5CH3A 2ZRCA 1V7QA 4Q00A 3AUJB 4U7WA 3AESA 3BFXA 3FUVA 4RAOA 1P75A 5EIBD 1KAMA 2Q4OA 1GYPA 2Y92A 2ZCVA 3S29A 3TRHA 1GG2A 4HATA 1TUBA 3PTLA 4JXJA 3D54D 2XMDA 1DTWA 5HM8A 2ZDQA 4ACAA 2HA0A 3BDAA 2CMKA 1A7UA 5B1EA 2A57A 3TTSA 4URUR 2C7PA 3RIXA 1HX7A 4XGRA 4BNYA 2ZWIA 3U44B 2C8VA 3ZX5A 3EXFB 4OQZA 2BSAA 4HQFA 1DNPA 5LQMA 3A6FA 2MSKA 3I58A 3BTUA 4WOJA 1G2QA 3ZKWA 1K86A 3K9GA 3DAHA 3OI7A 4FWTA 3THYB 1N5DA 1PGOA 3HCOA 2Q7OE 2PLRA 3HHEA 5BNWA 1M2WA 2V65A 4OAPA 3JCZA 3M4XA 4FM9A 1TD1A 3AFMA 1CNFA 3TSYA 2J46A 3ZWKA 3MUEA 2QUZA 2YJNA 2GZ3A 4WDRA 1ZMBA 5CEEA 4PO8A 2Q21A 5J5CA 1SVLA 2ZB2A 1VPLA 2HQBA 4ZV7A 1P0QA 3ECSA 2JCGA 3BL5A 5AVQA 2Z8ZA 5I8WA 5IXYA 4XWWA 2ERYA 4I46A 3N2LA 3QVSA 4FZRA 4L2IA 4ZU1X 2ADFA 2IU3A 3A9RA 3L9XA 1LTKA 3UTCA 5LQSA 3OVMA 4HH3C 1V1RA 4C0BA 2GJ8A 3ZHTA 2R96A 2OP1A 3MYRA 3IJPA 4LS3A 3WRYA 5C8VA 5FA5A 3GH1A 3DLPX 3N59A 3CN7A 2DTDA 5DTMA 3PI7A 1SD5A 2REXB 2PZFA 2Y1FA 2AI3A 4DPKA 4R3UC 3S2ZA 4AN4A 4AL4A 3IQXA 1WQ1R 4J1NA 4ZARA 3T5GA 3I6ZA 3JALB 4RHFA 5A1TA 1XV5A 4YO8A 2BFCA 4REOA 1QHHB 5C7YA 1Q0LA 1X1BA 1DP4A 2R8ZA 1KQ3A 1W34A 5EKUA 3VAZA 1E9FA 2WZCA 3BKWA 2G1UA 1K89A 1QO0D 1TUIA 1QGUB 2FG7C 2L19A 2WU0A 4Q18A 1VL5A 4YGXB 1ORIA 3MJVA 4B71A 2GTIA 5JAOA 2VR1A 2B2XA 4GVLA 4UQPA 5HE8A 3LVBA 3UMSA 3LW7A 1G8KA 1L7QA 1JIXA 3HB1A 2B94A 1JNYA 3ELBA 4QGFA 3K35A 2X42A 5CW1A 2FMIA 2R4TA 5D3ZA 2QMOA 1T36A 1B42A 3B6ZA 4O0LA 4D57A 1PNRA 3I1YA 1HG0A 3L8GA 4O2BB 4ZCMA 3R9WA 3G2PA 3HU1A 3KK0A 1Q15A 2DQZA 2CCGA 4R40A 5D7BA 3W2FA 4PZDA 4C4SA 4HLDA 5E4FA 3VSAA 4EI7A 5EIWA 4TWZA 3ELYA 1E2PA 4TRMA 4AW9A 1O9GA 2D00A 2WD9A 2N42A 1L1QA 4M54A 5ALVA 3DG9A 4QJIA 1KFBB 2VHUA 4CETA 5IJXA 1D03A 5DKFA 1ZITA 3UKJA 2H16A 3QWIA 4DIFA 4J0EA 1GQYA 2V8OA 3FRHA 4GPZA 3NTXA 3T54A 1PFVA 1FK8A 2C97A 3A6KA 4PANA 4OX9Y 3R6GA 2ZT8A 4PPFA 5FWNA 2OXFA 3E35A 4UHDA 3W2TA 5HK9A 3HSKA 4YP1A 3A14A 3D1JA 3IUJA 3X2FA 4ARCA 4WY5A 4Q16A 1J8MF 1CUJA 4B3JA 5FUMA 1CJUC 3HUTA 1DFIA 2FG5A 2O1WA 2DSTA 1T1JA 2EJWA 1KI4A 2GZ1A 3MBOA 3MWFA 3SGLA 1SXPA 3E3MA 4NRDA 1C3LA 5MN5A 1FOEB 4ZD6A 4PONA 3I6MA 2XNSA 5CFLA 3UJAA 5FV4A 3NAGA 3PA8A 5IM4A 1XZJA 4HAVA 1M8JA 1PYGA 2GAIA 3CINA 2IIPA 3D2AA 1OTHA 2GB4A 5TMEA 4G23A 1Z5PA 1CEYA 2YN2A 3KDSE 3NOQA 4FXPA 2GEJA 3FYHA 2H5EA 1N3IA 2QW0X 2I2BA 3AVQA 3KTDA 4GNKA 1RWNA 4JLPA 4K3VA 3JAKA 2ZBVA 1G21A 4BNHA 1RWXA 5ES3A 2X4LA 3GT7A 3DHYA 3MS2A 1XA4A 4FLFA 3ONNA 3X1MA 1R6DA 3E9NA 5JVDA 1YZKA 2RGYA 3O95A 5G53C 1KI7A 4NEHB 1H2HA 1SB9A 4G25A 2ZKIA 1IBKB 1C0PA 2FPMA 5BW6B 3AK4A 4N39A 5K3BA 3K70B 3PDUA 4PBSA 4PFKA 1XZQA 3NKLA 5DVZA 5FLXA 1DKRA 1OLUB 3SWWA 5CPBA 2B8EA 1L5ZA 3W5IA 4UUMA 4Z0TA 2R1ZA 4B4UA 1I7NA 1W93A 2ABWA 3NT5A 1B7GO 4Y0NA 5BR1A 3B48A 5DM1A 4EMSA 3HGMA 4N1AA 4P35A 4ZI7B 2RD2A 4KWTA 3DAGA 4ZTUB 2QD1A 4E15A 3QQPA 5CLIA 3SC6A 4AO6A 5DP2A 4NBUA 1GG8A 1HTTA 2X7HA 1CVLA 3I9OA 1H6DA 2P68A 1OXVA 3GDFA 4DAEA 5HWSA 3AFIA 4RQBA 3VPCA 1N36B 3O8LA 3TLJA 4NAUA 1NMXA 2BGJA 1YAHA 2MDTA 2NU8B 3BWCA 4C4XA 2X5XA 4HYTA 3DL7A 2YVLA 1TGYA 4RETA 1H4QA 3DEAA 1U81A 4UFPA 2WI8A 2ZRLA 1GEEA 5KIAA 1AQJA 3EIFA 4IXDA 3UJ9A 3O8DA 1UP7A 2O2DA 3G5TA 1N2EA 3AFGA 1GPUA 3QUTA 3VZBA 2V7BA 5JCZA 4HGPA 1IXKA 2I87A 3ED5A 3AHDA 3DGFC 3P45A 4LHVA 4KGVA 5BRJA 2W2TA 1QE5A 4KU4A 4Z7QB 4F2PA 4D4KA 2ES4A 4ZEVA 4C7VA 3VHQA 5EEGA 4CMGA 4Q6WA 2PKEA 3GEIA 2P2NA 5EZSA 2I1WA 3KETA 2AFRA 1UANA 4W4TA 1CUXA 2QB5A 4BO2A 2BHTA 3LF2A 4KR3A 4RHYA 1UKYA 3ZEAA 3HJBA 1NNI1 4R2IA 2IHUA 1Q0PA 1U9IA 4HEQA 4WESA 1G291 1KI1A 5EXPA 3DB2A 5HCIA 4F92B 4G1BA 3CVWA 4EKGA 5FUWA 3UT5A 1NW5A 3TZQA 4TT3D 5IZ4A 5A6VA 3FOFC 1V9LA 5THKA 2QXUA 4HDSB 4ZYLA