2DLCX

Crystal structure of the ternary complex of yeast tyrosyl-trna synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
339
Chain Sequence
b'DPNEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-RNA (76-MER)
publication title Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/trna
total genus 118
structure length 339
sequence length 349
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2dlcX02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dlcX01
1V8FA 1PG0A 3TNJA 3KT6A 3VRHA 3SZGA 4PBTA 1OWLA 2QUJA 1IRXA 2PFSA 4DE5A 5K0TA 3ZGZA 2D13A 1QRTA 1QJCA 1YIAA 3N8HA 1KH2A 2IP1A 4ZT4A 3FWKA 1J70A 1ZH6A 1B6TA 4XFDA 1MAUA 3HL4A 4YP5A 1VBKA 3N05A 1I6MA 3JXEA 1MC1A 2DETA 4ZCQA 1EUYA 2QTMA 1ZJWA 1ILEA 3ISJA 3CVXA 1J20A 1I2DA 1M83A 1NUTA 2IJGX 5AHWA 1TQ8A 2TS1A 1KP3A 1J09A 4DLPA 4XFJA 1GZUA 4TS1A 5KHAA 1NUUA 1QQTA 2GOYA 1KQPA 1JIKA 4U8HA 1MAWA 3PNBA 3KT8A 4GU5A 4I6JA 4CDNA 1EFPB 4MWBA 2PZAA 1N77A 4HK4A 4KPUB 1WXGA 1EFVA 5TS2A 4ZCTA 5LM3A 4JXZA 1BS2A 3U1VA 5TGTA 1N2HA 3K32A 1O96A 1YIDA 1JECA 2DERA 1IH8A 3X1MA 4GRIA 4NAUA 4EFKA 1GAXA 1NP7A 4MUFA 1K4KA 4G5FA 4JXXA 4MVWA 2A7XA 3RHSA 1JIJA 3HGMA 3C8ZA 4MW5A 3RFFA 1N75A 2WQ7A 2X1LA 3OTWA 4EG5A 1WJGA 3BL5A 1ZUNA 1J1UA 2RE8A 1M8FA 1P7PA 1IFXA 1TFUA 2E18A 1NI5A 2BYTA 1KAQA 1U7DA 3IDFA 4HJXA 2R5WA 1N2IA 3ZJVA 3FHJA 4EG6A 2CYAA 2D54A 1VBNA 4MUGA 1Q11A 2A1UA 2X3FA 3COYA 3DPIA 4KR9A 4FZJA 4NATA 1KAMA 2XRYA 4MUHA 1PFWA 3TS1A 4K0RA 3F3MA 1MB2A 3TQIA 1H3FA 3Q12A 2YWCA 3NV7A 3RK1A 1J21A 1U0BB 1IQ0A 3H99A 1MRZA 2Z08A 1N2JA 4JZYA 1N2BA 1XJQA 1M8JA 3CLSD 1JEDA 1KQOA 5K0SA 3CVUA 4WSOA 1JZSA 4OUDB 2X0KA 3TZEA 3IUBA 3ZJUA 2H2AA 3IMCA 2A4MA 3MLAA 1T6ZA 1H3NA 2E21A 4HPWA 4YP6A 1MB9A 3IOBA 3P0JA 4EG3A 3Q10A 3ZXSA 3CLTC 1CT9A 4BWVA 2ZUEA 5FO1A 4DNXA 2E0IA 3H9CA 3DLAA 4MW6A 2CSXA 3AG6A 4QREA 1I6LA 1IHOA 4S1OA 1G8GA 2V0CA 1KQNA 1T6YA 3KT0A 3CR8A 5JBNA 2BTEA 2HGZA 4ZT7A 1COZA 3E27A 3A2KA 3SYTA 1TYBE 1G8FA 1WXFA 3UC5A 4AS1A 1U7XA 3MXTA 5F23A 1OWMA 3ZUGA 3G59A 1WQ4A 3QE4A 2Z3VA 3Q4GA 4DDHA 3HZRA 3FI0A 4ZT2A 1EXDA 4EG7A 4CDMA 1T9GS 3LE8A 2AG6A 2DXIA 4MUIA 2J5BA 2OQ2A 4QBTA 2CV2A 2YWBA 2D5BA 3P52A 3DO8A 3P0IA 1PFYA 1O95C 4X0EA 1QRSA 4L2IA 3QTBA 4UZEA 5HUHA 3NBAA 3CVVA 2A86A 4WNYA 3IVCA 4QRDA 4MWCA 1EFVB 1T9GR 4MQ6A 2QUIA 1Q15A 4OJMX 4JYZA 5HUJA 1F7VA 2WSIA 3FIUA 3SDBA 3L93A 2DUMA 1H3EA 5H7XA 1IQRA 4E1AA 1X6VA 1EUQA 1YULA 3FOCA 3CLRC 4R0NA 1QNFA 4YP7A 2WQ6A 1PG2A 1H1TA 2Z09A 1XNHA 2XRZA 1O0BA 1TYDE 1IQUA 1FYDA 3FNRA 4RPIA 2A1UB 3VGJA 1HYBA 2IELA 2CUZA 2A1TS 2DPLA 5J58A 3SP1A 4ARCA 1F4LA 2ZUFA 3MLBA 4PBRA 2YY5A 1KH1A 1M8PA 3G6KA 3AL0C 4ND7A 1GLNA 1VBMA 1EFPA 1NZJA 3KFLA 5FO0A 4J76A 1GPMA 1U3CA 3PXUA 4KPUA 1J1ZA 4DDKA 4ZT6A 3UY4A 3FG9A 2A1TR 4I6EA 1O97C 1LW7A 1O94C 1WY5A 1R6XA 2DEUA 1NUQA 1K4MA 2CV0A 3N9IA 3CLTD 3X1KA 2QJOA 1JGTA 1O5TA 3ILVA 1R6UA 3G5AA 1WZ2A 4Q16A 1KKUA 2AZXA 4R2LA 2ZP1A 3L92A 2PXHA 4EG1A 4EG4A 3HMQA 3IOEA 1TYCA 4YMIA 1KP2A 4ZCRA 1A8HA 1NUPA 4R2MA 5KCMA 4MUKA 3A4IA 2CFOA 5TEVA 3FETA 4NAHA 4MW9A 3COVA 4MVYA 3ND6A 4MWDA 3H05A 4MW2A 2PG3A 2YXNA 2PZ8A 4ZT3A 1M8KA 1TEZA 1JILA 1N2EA 1I6KA 1TYAE 1NYLA 2HZ7A 3GMIA 5DEOA 2VTBA 1QU2A 1PFVA 3I05A 1O95D 5J5AA 5HG0A 4A91A 1JMVA 1M1ZA 1F7UA 3IVXA 2EL7A 4OUDA 1KH3A 1OBHA 3NBKA 4U7JA 3DV2A 3K9WA 3SEQA 1N2GA 3ND7A 2HMAA 2PZBA 3CA8A 3IH5A 4L2IB 4MUNA 3AG5A 1GTSA 1G59A 2DLCX 4PY2A 4G6ZA 1VLHA 3P0HA 2WB2A 1D2RA 1GN8A 1M8GA 2QUKA 4PBSA 2NZ2A 2QJTA 4MW7A 4DJAA 3UK2A 4MW0A 3IOCA 5DASA 3FH0A 3GUZA 4CT0A 4H3SA 3LOQA 3CLRD 1IVSA 4ARIA 4Q93A 1JHDA 4G5YA 2JANA 5IHXA 3FDXA 1LI7A 1O96B 1KR2A 1JIIA 3RK0A 1K97A 1T6XA 1JZQA 1RQGA 1YUMA 4F3RA 1JEEA 4P2BA 1MBZA 5FNZA 3ND5A 2GM3A 5LLTA 3VU8A 2RD2A 3H97A 4MLPA 1Q77A 4KR7A 1U3DA 1UFVA 3M5WA 1PFUA 1O6BA 1VL2A 3ZXIA 4XSVA 4NX2A 3AIIA 1N2OA 2QTRA 3IODA 1G8HA 2CYBA 3SEZA 4MW4A 5KWVA 3RBAA 1V47A 3PNVA 1Y42X 1YI8A 3ZIUA 1SURA 3ELBA 3PRHA 3COZA 3X1JA 4MUEA 2DR2A 4RUKA 1KORA 1O97D 2O5RA 3INNA 1QRUA 5DK4A 4ZT5A 3IVGA 1O94D 1DNPA 4U63A 1O0CA 4F4HA 3AKZA 4AQ7A 2AKEA 3SZ3A 3UOWA 1WXEA 5BNZA 2CYCA 3GLVA 4KKVA 4MW1A 3PNYA 4EG8A 3HV0A 1XNJA 4EF6A 1K92A 2QJFA 2O8VA 3N2YA 2JAXA 1OWPA 5EKDA 4MAFA 2VXOA 2V0GA 4I6GA 3OP1A 4MUJA 2PIDA 3A04A 4JFAA 1N78A 2EJCA 4MWEA 1MOPA 4MVXA 3MMXA 1ULHA 1ZH0A 4NZPA 1QU3A 3CLUD 2J09A 2A88A 4ZCSA 1WXHA 4MVCA 4YBRA 2G36A 4HJRA 3TZLA 3MUEA 2J08A 2C5SA 1QTQA 2CV1A 4CQNA 1WXIA 2I1LA 4J75A 1OBCA 4UZFA 1FFYA 4EGAA 3H9BA 3IMEA 2J07A 3QTTA 5IJXA 2H29A 4K03A 3FY4A 3S3TA 3IUEA 5LFAA 4DDMA 4NDAA 3UMVA 1OWNA 3D6VA 2J4DA 3TQOA 2VTBB 1EJ2A 3CLUC 1WOYA 2GKSA 2X1MA 3CVYA 1WKBA 5J59A 2OV4A 1XNGA 1NSYA 1EE1A 3HFJA 3LCJA 1NUSA 3D6UA 3KT3A 3A05A 4KR6A 2E89A 2A84A 5DB4A 5TEWA 3CVWA 1MJHA 4ND6A 3COWA 1X8XA 1F9AA 3AFHA 1YUNA 1N1DA 4MULA 1OWOA 2B7LA 4ZCPA 1LI5A 2QUHA 2QTNA 3CLSC 1GTRA 2CT8A 1OD6A 1N3LA 1WQ3A 2NSYA 1R6TA 1Q19A 3RJZA 1S4MA 2JA2A 5H16A 3ZJTA 3IMGA 1NURA
chains in the Genus database with same CATH superfamily
4FZVA 4NENB 4JI7B 1RKBA 5BRJA 1EFKA 3I6QA 2X7XA 4MCIA 2QTVB 4EB6A 1ZU5A 4F6LA 1PZFA 2QUJA 4LZOA 3OPQA 2Q6OA 3QKRA 1OC4A 3HBLA 3IULA 1SZDA 2OECA 3TZKA 4I55B 3EIFA 4FNMA 3UQZA 2QQGA 2B8JA 4WN9B 2GPNA 1R5NA 3QRWA 5EWLA 3HL4A 5E8RA 3VR3D 1QGUB 5CD1A 4V0MA 5HK9A 2A94A 4HAVA 4U9HS 3OQOA 4W5HA 4OHFA 4IJWA 4BYMA 1I0IA 4ZCQA 4YMVA 1A0OA 2VH2A 3X44A 3LY5A 4QDJA 3K9GA 3TXYA 3B1KA 1P18A 5IVPA 1QIJA 1DGQA 4JGIA 3QEMA 3D4NA 4CLEA 4DLKA 9LDTA 3JX9A 4Q3KA 4ZKDA 5AJYA 1R7RA 2VHTA 2FUNB 2TS1A 2PM8A 4PIMA 2V5AA 2WD8A 1QAQA 1YQ9A 3EISA 3BREA 4QHTA 2P2GA 2YN2A 3HB0A 1RM0A 5SYAA 3GQVA 1SA0A 2GPTA 3DLCA 3JVDA 1QQ6A 3N8IA 4KW7A 5EERA 4DJDC 2MOKA 1U2GC 1V16B 1VGVA 3F6BX 2GAIA 4IHKA 1Z06A 2W6IA 3WAKA 4BB0A 3KT8A 4CMKA 4C7VA 1EZ4A 3QKIA 3SKVA 5ICEA 1I2MA 2X0JA 2Y1KA 5AI0A 1OH8A 1ZD1A 2VF5X 4H59A 2GPYA 2JRCA 1J99A 3EYAA 3KR1A 1R50A 3TYXA 6REQA 2J0UA 3GUYA 1KRWA 5B12A 4G5OA 3DM9B 1UQTA 2AHRA 3RASA 1B4DA 3OU6A 1O96A 4JLMA 4HG2A 5D3QA 2C4NA 3QXCA 3WZMA 1ZOPA 3NR2A 2NPIA 1CUFA 2QMUA 3RNLA 5G02A 2XCOA 3V7UA 2O8CB 2YHBA 2WFAA 1NQWA 1XB2A 2IU6A 1I4WA 3EBOA 3LBNA 4ARVA 2DAPA 1FMCA 1QVZA 3LO8A 3BMCB 4W9RA 3U3OA 3UW1A 1T36A 1KZ4A 3K5IA 5C5EA 4Q5IA 2A67A 1I4LD 2MSKA 1ZRMA 1GA6A 1AQ6A 1MABA 2MSDB 2CMFA 2ROQA 1SBTA 1TJYA 3T5TA 2Y6UA 4RY2A 1LRKA 4JCCA 4W7SA 2E18A 3R0IA 3DAGA 2BYTA 2CLKB 4ZYWA 3S2YA 4HBZA 1GQSA 4KQ6A 5JQWA 2VQSA 3O7WA 2O4CA 3HHPA 4RSRA 2WA2A 4C4ZA 1Q1GA 1U1EA 1W85B 2E4AA 2IHYA 5DYNA 4EYOA 1H5QA 3UV7A 1YIOA 2I8CA 2BGRA 4H7FA 4JKYA 4KE9A 4BFLA 4FHEA 4QJBA 4ZVRA 5SZKB 3R7NA 1RYNA 1T9AA 4B44A 4NWIA 3CX7A 4C05A 1T2UA 1F1JA 5DNAA 1MT0A 4D25A 1O6ZA 3BEDA 2R6ZA 4H1VA 4JUDX 3V4LA 3FCXA 2OHVA 4Q39A 1SU7A 1QH9A 4B45A 4K6KA 3LP6A 3LUJA 4E5YA 5JDIA 4RD3A 1ZOIA 4MVJE 1Q0SA 3SEAA 5IDYA 1SVSA 1UJ4A 4BO5A 2BFCB 2HLHA 3TRHA 3FFBA 1CUSA 3EF0A 3OE1A 1HDIA 1NG1A 2F4VB 1BFDA 1QS0A 1F51E 2QP9X 4HYTA 3NH6A 3H04A 3OPYA 4OFXA 4YJHB 3ESZA 3N0WA 1NUHA 2IPAB 3QNMA 1ZXXA 3KQMA 1JQEA 1NA5A 2M9MA 4G0YA 3RT7A 3BDVA 1PJQA 3OT1B 3SKYA 4DR4B 1KEZA 1T8TA 2WPNA 3HKDA 1E5LA 1Y8RB 2G88A 4PG5A 3KS9A 2Y9MB 3ZDYB 5B1EA 2VT6A 1ORIA 1U4SA 2C77A 4RHFA 3V48A 4E7OA 1LBEA 2PXCA 3KG2A 3SYNA 2BSQA 4AMGA 2AEEA 4BNDA 4U7TB 4UCQA 3AI3A 1LC3A 2C1XA 3L0BA 4DPLA 4L74A 4WADA 4ZD6A 3C87A 4UU0A 1GN9A 3I8OA 4GPZA 2QSUA 2K5UA 4GM1A 1WXFA 3UC5A 4A03A 1J2YA 5HSGA 5FA5A 4B79A 3K70D 2ZI6A 4AX8A 5M3BA 2ZJ0A 3G2KA 1C29B 1G3RA 2JIDA 3NBMA 4LDPA 1J5EB 5CIYA 2VAMA 1YR7A 2ICAA 4N4AA 3TVYA 1Y9ZA 2G72A 4IIUA 3UCEA 1E2PA 4V03A 3G59A 1B8OA 1DIRA 2GCGA 3MJVA 1EVEA 4KLNA 1XZHA 2NU8B 2UZ1B 1T8YA 4EG7A 4NABA 5P21A 1EVYA 4GR4A 1U7TA 4MS1B 1JPNA 4J49A 4D02A 2RK4A 2ZPAA 2ZJ7A 1WVIA 3MXOA 2JD2A 2FDRA 1HO3A 4ZAGA 1Y4SA 1JXAA 3EZFA 3TW0A 1N2CE 2F43A 4CTJA 2RB5A 2A9JA 4CKEB 3RVSA 1AG9A 1E89A 3FFTA 4R6WA 3H2GA 1VJ1A 4EKYA 2JI8A 1GR0A 3FR8A 5JWHA 3B1YA 2JATA 4GO1A 2CN1A 4S1WA 2FRXA 3A11A 1DOHA 4MWCA 3K3PA 5B7QA 2ECQA 4FI3F 1Q15A 1FP1D 4UNNA 2OBNA 3ZDAA 2WHRA 3WL4A 1F7VA 3HJBA 2RKWA 3I62A 3V1YA 2Z2JA 3J80A 1I3CA 1LLCA 4Y67A 4PFKA 3UMJA 4YUYA 4EELA 1VE3A 1E3WB 3FRIA 3WZ2A 2H17A 2PLFA 4Z99A 3HS3A 4QDTA 3X1ZA 4NQRA 2FMKA 4C4XA 5FV4A 3PEYA 4P08A 4TRJA 2LDBA 4GOND 3GLQA 2GPSA 4OI4A 4X9XA 3EVEA 2FFHA 4V3BA 1Y82A 5BNTA 2XUIA 3QVSA 4PGAA 1Z2EA 4P5PA 1N6IA 3FTQA 1HY3A 4K40A 4BNMA 4P82A 1JEAA 2GAOA 4NK5A 1N1EA 4A16A 4LF9B 2L82A 4OKSA 3HXQA 3L5KA 3LDHA 5FPYA 1SQ0A 1VXOA 4R83A 3U3MA 3ZY4A 4ASUA 5CA0B 4WGGA 4YH1A 3DMRA 3BIJA 3HXLA 3PUXA 1TYDE 3FUVA 3HCWA 3GLGE 3W6OA 3I4CA 1HT1E 3M1AA 3ULKA 4LS3A 4DV1B 1UT8A 2CLMB 2XA9A 1JG1A 3IVAA 1P1JA 2JZNA 2NO4A 1U8CB 2BLLA 3C8MA 3R5KA 4FC6A 4J94A 4FFBA 5K0NA 3DZFA 1U98A 3OAAD 1KH1A 5FBHA 3G6KA 1L7MA 3A0UA 4Z0HO 1FTGA 4YA6A 1PL7A 4S1TA 5JECA 1N8SA 1V71A 1DQYA 2W9XA 3VI3B 1SKMA 2P67A 1SD2A 5AVKA 4ZEOA 4DIFA 3CCBA 1AF7A 1W8IA 2OE2A 1U3CA 3FPBA 5FI1B 3ZKWA 4W5TA 1IUPA 4YCAA 1H1LA 3SXJA 3CO0S 4EKDA 1DU4A 5B6PA 3FYUB 4DLRA 1CRPA 1O4VA 1PGQA 3OEYA 3H2HA 3TXAA 1A69A 2DBZA 2JAQA 3HDHA 4BOYA 2Z1NA 1DBQA 3CGWA 3U0BA 3FNIA 3DQZA 1I9GA 1Q16A 5DHQA 1M1XB 1A2OA 2KX7A 1JP7A 1W5SA 1CF2O 1WW3A 5GJWC 3X1WA 1Y3AA 3UH1A 5K5EA 3N9IA 2J0VA 3PQ3A 5G1NA 5JV5A 4CHTA 2JCYA 2P77A 3OJLA 4FSHA 4GNRA 4YCJA 4M6WB 2SHKA 1U1DA 4P86A 5ALEA 4CT4B 2BGMA 4HH3C 2OB2A 1Y9AA 5MN4A 1FE8A 1A7UA 3GFOA 3R7WA 2ZIZA 4KU4A 5AJHA 3ZWMA 4DEVA 1I3KA 1T2VA 3BGSA 3OWXA 2JK1A 1XRNA 5IWCA 1L4EA 2HJSA 3B9PA 2ONZA 1T3HA 3BQMB 3BCSA 4IDQA 4DMFA 2MMCA 1JT2A 2BGKA 5TS3A 5BNIA 1GG5A 2X7HA 1Z6YA 5LJIA 1KP2A 1YGYA 2NU9A 3DHNA 1NXQA 2WWHA 4NOJA 5KYXB 1NW3A 2VSQA 5TMDA 3UB4A 2CNNA 4IJ6A 3VC1A 4JUCA 3UZUA 3KM0A 4DR3B 1GYPA 3F4KA 1C1YA 3V42A 4CG3A 3DPUA 3HVKA 5K6AA 1O03A 3K0BA 3FUCA 3PUYA 4D0GA 2HW8A 3ZHBA 1LI4A 1QFXA 1SUAA 2BEJA 2XYRA 3L7NA 2QW0X 1NRXA 3GRAA 3WP0A 2R86A 2YDYA 3OFSA 2OG1A 4J16C 5HIAA 2OYSA 3GJYA 3MW8A 5DCWA 5K0EA 3DWGA 4WXMA 5KAMA 1BH6A 2AN5A 4AZVA 4M1OA 2YV2A 4C3OB 1I14A 4G0UA 2O8BA 5C8XA 3OOHA 5HFJA 1JL3A 1QU2A 1K6EA 2GKGA 3IB6A 2QHXA 5L4LA 3ETCA 5CIQA 3OZWA 2QDKA 3OI7A 5BQPA 2XB8A 1FC0A 2WWWA 4AW9A 2G82A 3AO0B 2YCLA 3MM4A 2PZEA 3M1IA 3ND7A 3GIDA 4KZKA 2QTGA 3O8DA 3WL8A 5EHQA 3ZDRA 3SQDA 1COWD 2FZ4A 5JY6A 3FKJA 4HDCA 4FGWA 3DCIA 3ZXUB 2JFQA 2Q4RA 3IQIX 1E79A 4C5CA 3RRZA 4BO0A 4PGFA 3BS4A 1CERA 3OHSX 3OU7A 1QDUA 3DDNA 1M8GA 1V4VA 1KYVA 2ORIA 3D4BA 2BTOA 2ZT8A 3C7CB 2B34A 3QVGA 5D5QA 4TWIA 5IDWA 3BWMA 3THYB 4LSMA 4FFWA 3LY9A 4B17A 1JQAA 4EH1A 3U4IA 1SWVA 4WERA 4EI9A 1CXZA 2A1IA 4DLTA 4EHDA 5CYGA 3HU3A 5K8UA 4W5QA 2HYDA 1Z07A 4MZDA 1W36C 3KOUA 1NC3A 3PQ7A 1E2UA 1Y3HA 3W5DA 1MH9A 3U9SA 4MDFA 2FF5A 2VRNA 4KIGA 2V6MA 1JEEA 1PF7E 1ZONA 3D2AA 5BR8B 1XNQB 1ZK2A 4IMJB 3NC0C 2GM3A 2H5EA 4Q3NA 1L3CA 3RSLA 4LN1A 3LPMA 1K7XB 2O14A 5CDSA 5HJEA 3RTEA 4NYIR 4I1VA 2EP7A 3DL4A 4X90A 3THWA 3L79A 2JGMA 4K9DA 3NNDA 5ILGA 2IY8A 3B7PA 2O0MA 1O6BA 3GCZA 4RM2A 1JIUA 5B6IA 1HDGO 1N2OA 4OXKA 3IODA 9ABPA 5I4IA 3Q8LA 4Q7JB 1C9KA 1E3MA 3EODA 4Q7MB 1JEJA 1U0NA 2RGUA 4XX0A 4QDUA 4JWTA 1H69A 2I8LA 1OFUX 4QGHA 2W42A 1C0PA 4GSKA 3F6EX 4QEDA 2GEUA 2OCXA 3X1JA 1EHIA 2RARA 3BVPA 1UXIA 2HHAA 3PFFA 4NH0A 4MQEB 1TFRA 1RTTA 1EQ2A 2IEBA 3JRXA 2PV0A 3MEQA 3QIVA 1PI3A 4OF4A 3DBRB 2IZ6A 4TMTA 2AG1A 2Q6LA 4CQLB 4EUEA 3AKZA 4AQ7A 1ESDA 2GNOA 4UQPA 4PHGA 4CI0B 3CPSA 4DIMA 3H9EO 5JRJA 4A0QA 1BO6A 1J5PA 1XVUA 2GTPA 3NJ8A 1LDEA 2BEUA 4G0OA 1EFAA 3LT2A 2CLOB 3FYDA 3JAWB 4IHQA 5EINA 2BKLA 4ARUA 5KTYA 1UXOA 3ELUA 3W8RA 3L7OA 3JARA 1E4EA 2O8VA 4R8KA 2A59A 4HDAA 3AUJB 1E5VA 2DQZA 2ODQA 4MAFA 4UATA 1OR8A 4DMHA 4HNAA 1VJRA 2XWBF 3UGJA 2VPPA 3V2UA 3WFIA 4BATA 4OJKA 3A9TA 5KQSA 5IW8A 3A04A 5ALVA 1THZA 3G3EA 2NUBA 1N78A 1CZLA 1EM8A 4NCKA 4ZK2A 3PV0A 5ED4A 1PTJC 3E8XA 2GXAA 1ECFA 1YUBA 3TLGB 2JB9A 2AMJA 1YA8A 2VDWA 3AY6A 3K94A 3LXRA 3Q3CA 2NLOA 1XVAA 1P0PA 3OIWA 4NHEA 2NQ8A 4QUDA 4BZXA 3AW8A 4Y0NA 3WLRA 5CIWA 2QAGA 3MUEA 1OTYA 4HDNA 3E2MA 1HZJA 4IIJA 3RS2A 3CF4A 5B30A 2QPLA 1AUXA 1XALA 3D6TB 1YBVA 2DPXA 2RH5A 3QPAA 4S1VA 2J9GA 1DG3A 3OJCA 4UHFA 3C3CA 2N46A 4ZZIA 1O5IA 5LVAA 3BGWA 3JZIA 4CTOA 1WDLA 1L3BA 2Q8QA 1N0IA 3KEGA 1F1BA 3TO5A 1WABA 4BU1A 4CFYA 2WFLB 2WBLC 3I6BA 4FU0A 4BB5A 3JWGA 3TEJA 3KOYA 1BCRA 3NGMA 1NMEA 1XRRA 3R0VA 3U7HB 1Q91A 3CVYA 4CTKA 3IEIA 5DOVA 4TVOA 2RHHA 1Y9DA 1NDHA 3CUWA 4LQDA 2Z83A 3ORHA 4JYMA 5DDIP 3RKRA 4YCLA 4GM4A 5JAHA 4PO1A 3LS2A 2CJPA 1K4YA 2ZVDA 3GLHE 4L07A 5U1PA 3THXA 3SJAA 4V02A 2G5CA 2I2DA 1K06A 4EA9A 1ZH8A 3R6DA 1SUBA 2Q21A 3KVOA 3PGJA 4KO3S 4LCBA 4DS3A 5EJ8A 5LYJF 1M10A 1E1QA 1JDPA 1ZGCA 1RJGA 1ZKMA 1DKLA 3FSGD 4QELA 4F6RB 3QU4A 2H8GA 1LZKA 3V6MA 3R3UA 3CZMA 1T26A 4B4VA 3UBTA 2R48A 1Y7PA 1TQDA 2WD9A 4OQXA 3O0DA 5I9LA 3DFZA 4UE2A 3S29A 1AHNA 1Z8NA 1E0AA 5H16A 3HWX1 3QMPA 4NK4A 2WMNB 4ZV9A 2XDQB 1TUIA 2G07A 3BF7A 1W73A 4D80A 5DGTA 4LVUA 1DHRA 1XTJA 3PIDA 3V1TC 5JCXA 3IDOA 4RLHA 3VRHA 2ETVA 2YFKA 1KJNA 1GPBA 4UFOA 3ZGZA 3L7LA 1WG8A 1AUQA 1CRZA 4ZAXA 3T4UA 3SXPA 1JJAA 4NEGA 3WJ7A 2REXB 4IVNA 2AOWA 3FCYA 2YFHA 1ZH6A 4GR9A 5LYYA 3I04A 3ECSA 3RWMB 1ENZA 1MKYA 1KJ8A 3SQNA 4RTSA 1IUKA 2QBYB 3GAAA 4G8BA 3OX1A 4TUYB 2ZXUA 1O2DA 3H1EA 5JHGB 4CM4A 3P4YA 3P9XA 3NOXA 3GJ8A 5LSAA 3P2YA 3KTFA 3GEPA 1L5WA 4PC3A 2JFBA 2GBLA 1I6WA 3GRCA 3NEAA 3BZWA 1UBKS 3RGWS 3UICA 3WJ1A 5E0OA 2WIGA 5BN4A 5IYZB 2BC9A 1QQTA 1A9OA 2PMCA 2ISQA 2R8PA 3NKVA 1JSRA 1YRYE 2O7NA 4IQ4A 4O4LF 2CF6A 3FVQA 3AF6A 4K87A 4A92A 1YZ3A 4JJ7A 3AHCA 4RK0A 5KVAA 1E77A 1A97A 1TKBA 2QP3A 4MWBA 5AKJA 4BBPA 1HE8B 4RXUA 1ZBDA 2PXXA 5CG1A 1BGXT 2C42A 4PR0A 2XKJE 1PL6A 1KFEB 4JN6B 3KR9A 1M6NA 4HQNA 1S8NA 3LY7A 4ZOLB 4ZCTA 3A2NA 4I1YA 3O92A 4JL6A 4KXFB 5EKTA 3VBCA 3LBHA 3B38A 5FUWA 4P93A 1RABA 3INRA 3B5IA 2Q4BA 5EMNA 5AHRA 5EESA 1JECA 2EKLA 4IEIA 2PX8A 5EXDA 2WD7A 1WKCA 2BCJQ 5C8YB 3ILSA 5CB0A 1MD9A 2I2BA 2C4HA 4JLJA 3V7YA 2R4UA 5HKKA 4HRXA 3QPDA 1M2FA 2ZIXA 3QIAA 5IMBA 3C8ZA 1R0CA 5IN5A 2MYUA 4OH1A 2WQ7A 1RWKA 1RXUA 5AKZA 4R7ZA 1ST3A 1DG9A 3D0OA 3IXLA 2AFIB 3VFDA 4OFWA 1C8KA 4BWGA 5CA0F 5KSZA 4WBNA 3V8BA 1XRQA 4FHGA 3WGLA 3B12A 4OQ4A 5IUKC 4MCJA 3F7OA 1TECE 2X0DA 5M29A 5FBLB 4BNGA 5I7SA 2ZETA 3G8AA 1E5QA 1FEZA 2JASA 2OESA 1MQ8B 4WOJA 3S0JA 4RY8A 1YO6A 3LUCA 2X3FA 1KIFA 5E3JA 1A9XB 3ZVMA 1KAMA 2QLNA 4JBWA 5TJHA 5KVSA 5JAUA 4OM7A 1JFVA 2EOAA 1B2RA 5K03A 3E9EA 1DWOA 1RD4A 2DWCA 1XCMA 3R1IA 2JLCA 1OTHA 1IC6A 2O2CA 2WNIA 3EUWA 1W29A 4LJ6A 5DLQC 5ECDA 4LFCB 3TQIA 4XTCS 3TVTA 3VO1A 3WJ2A 4NCNA 1NVUQ 1VIMA 4DRXA 4Y9DA 3W5CA 4L8LA 5ICMA 3F73A 2XJ4A 1U0BB 2PS1A 2HMVA 4RZIA 3VPDA 4L9RA 1JKMA 1CQPA 1N1GA 5E6RB 1B26A 2BZSA 3DJFA 4MQUA 4HMOA 4GLLA 1PWZA 4EVSA 4F0JA 3BDAA 1W96A 2EV9A 4HRVA 3W6UA 3FOBA 4K2AA 5L40A 2YIMA 5FPPA 3UG7A 1KZ7B 1VFNA 2ZVPX 1NVTA 3AEUB 2G25A 3JYQA 3AF0A 3IUBA 3WSVA 5CNKA 2KM1A 4XXHA 2QRVB 4I4IA 3VU3A 5AM0A 3KAKA 2Q62A 3EGDA 5KCZA 1ISJA 4Z8YA 3VKHA 4F04A 4YP6A 1OTXA 4MZXA 3T35A 3OFND 2VATA 1U94A 3C6ZA 4EG3A 3P0JA 1Q1ZA 1UBNA 4IF4A 2HIAA 2FTKE 5ALOA 4GOOD 4R2JA 5TXGA 4BGUA 4E5VA 4ZHQA 3P2OA 2PZLA 3UJDA 2P6UA 3RF6A 1HFWA 1O87A 5BVHA 4AO7A 5LP1A 3SS7X 5DIFA 1CZNA 2DTXA 4MW6A 1VIVA 5IDVA 2FOLA 4L4RA 4YASA 4AS3A 3CUKA 4CFZA 3IPXA 1DPFA 3TPZA 3WS7A 4H4EA 3D54D 4GI1A 3G9UA 3PUIA 3ZWBA 1KQNA 4Q3EA 3ETLA 2V6BA 1NJGA 2BTEA 2HGZA 4OHVA 3R0XA 4EY5A 2AG8A 3T1HB 2Q1TA 2VO1A 2UXCB 1G8FA 2DT5A 1JLLB 4GLBA 2YRWA 4LOHA 1FVHA 1PR1A 2ZR0A 4GI3A 4TRRA 4LGVA 1JSLA 3D0KA 3ONEA 2HWUA 1KARA 4DTCA 5F23A 1ZFNA 4YDHB 4JDPA 2NYRA 2O8DB 4HDKB 2LZ0A 1BE6A 1NZDA 2Q3EA 4IFIA 3ZDEA 4DIOA 2G17A 2E4VA 1OPXA 3I9LA 1T2EA 3RS4A 1EQAA 1G55A 2YJ5A 2ZUTA 5HS6A 1IN6A 1SAYA 3OVMA 1PEYA 4GX1A 3AFGA 3VHXB 5KJCA 4MI1A 2AXQA 2PJZA 1RRCA 1Z7EA 4QBTA 1DQZA 2FG5A 4CPDA 2OZVA 3T6KA 4X94A 3KR2A 3FVTA 2C5BA 3I5UA 3FBTA 1SXJD 5FHQA 1XWIA 3NJRA 1WBBA 3WWCA 2A86A 4JAVC 3ETEA 3IPRA 1QWOA 1OH6A 2QM3A 3KPVA 5LWQA 1KMCA 1U6JA 2H51A 4B85A 2P40A 2VR1A 4OQFA 3EGWA 2XOEA 4B87A 4C21A 4YV2A 4RXTA 1ZISA 4EHIA 4Z9BA 4ZI3A 3SVTA 1PS9A 4CLRA 4YRMA 3BK2A 2V7WA 5AXDA 1YKSA 4R0MA 2HWXA 1SIUA 3DZHA 2DUMA 1TO2E 1DE0A 3OETA 3Q7PA 1A77A 1FX0A 2FP4A 4UUPA 2HWKA 2X22A 1IQRA 3TQSA 1MGPA 5EGSA 1N5RA 3X0DA 4HATA 4QO7A 1MUUA 3LYAA 3O95A 3PR2B 2GEKA 2YHSA 4HLUA 4RE6A 1L8QA 3EB9A 3FF1A 3CLRC 4NZ9A 1NI4B 3TQQA 3GLTA 4LE0A 3DQPA 2HO5A 1QQAA 3TW8B 2V9PA 2Y67A 1N8KA 2KE5A 4TTVA 4RGQA 4D5EA 1UF9A 3R40A 4IJVA 1FP7A 2CNKA 3DBHA 1JR3E 4KE8A 3LXXA 3A25A 1GGNA 2XT0A 3FTCA 3HDYA 5BN3A 1SVKA 3NDBB 2W2OA 4XR9A 3PUZA 3HEMA 2AX4A 3RU7A 3URMA 4DGSA 2VG8A 1EGQA 2FQYA 2PRYA 3M5CA 3L46A 3NTOA 5JCJA 1MJFA 4LDNA 5BRAA 2FUG1 1GDDA 4DCUA 4Q6WA 3GLIB 3GLKA 1W30A 2DLDA 1GARA 4KH1A 4HEQA 3QF4A 4CCYB 1QZUA 2DBQA 1EFPA 7ABPA 4YVFA 4FE3A 5EMMA 4INAA 3PUWA 4R71A 3G02A 5L4NA 1Q0PA 2Z98A 4O2BA 3UNXA 4QAQA 5CXXA 5ER6A 1DXOA 4OGWA 3MZ0A 2IA5A 4HQ6A 4EHBA 5LOVA 4F85A 2CK3A 4DHWA 2Z30A 3FHLA 1V26A 2GRJA 2GPWA 4DVGA 4LF4B 4KSYA 3OBBA 4YJ3F 4UBNA 2UYHA 2LKCA 1H6CA 1HFEL 3LI2A 2ACEA 3HYNA 1K4MA 2WT8A 3NHAA 5E7JA 5F1OA 4DA8A 2CBXA 1EE2A 1J2EA 3CLTD 5BV7A 2EX1A 3A9RA 1RWPA 3T3OA 3LDFA 3ORRA 2HRDA 4GVLA 4PHHA 2PHZA 4RAQA 5DN6A 3P9RA 3CWZA 1DFIA 3L92A 1IZ0A 1GFSA 3H13A 5EEHA 4WZBB 2HOQA 1U2TA 2P5SA 1FJXA 2QOEA 3RABA 1B16A 1PJBA 2AKYA 5LP6F 1AOXA 3FUTA 1K6JA 2PYIA 3OBIA 1YR1A 5EYPB 3QI7A 1MH1A 1A8HA 2G70A 9GPBA 2Y27A 2E82A 1X7XB 1IB6A 4RS3A 4EB0A 4TSFD 1U4NA 2AWOA 1O3YA 1AKVA 2GPJA 3H84A 5CPBA 1QPBA 4F3KA 5J2UA 2ZYRA 1MFZA 3U3DA 4UXHA 2K6GA 1HTWA 1TL7C 4UM5A 4B7XA 3SVLA 1JUDA 4IDFA 3DZCA 4Q7QA 1W1WA 2V6GA 2PRJA 1DEXA 1TE2A 1TYZA 2MT9A 3KSAC 1U2QA 1WB4A 3VOBA 1U0FA 4V0ME 2OFWA 3OO0A 2VP0A 1I6KA 3PQFA 1YJBA 4GBGA 1FLDA 1IQPA 2FSGA 4JT9A 1AHIA 1DXHA 4ZAZA 4BCDA 4LV6A 2XXAB 4DV0B 1Q0TA 1DX6A 4LV8B 2PGDA 5L6MB 2FN3A 4WBSA 1L5HB 2WMYA 5IHPA 2PY6A 4YRJA 1Q57A 3WISA 1G98A 2AC2A 2AOVA 2BLNA 3PJRA 3EFEA 3CJRA 4PO9A 5BSHA 2HMAA 2RK6A 4Y2JA 1WW8A 1DAEA 5GIOE 1ADCA 3SMQA 4GXNA 1GTSA 1ZIPA 2JLAA 3ABIA 5I47A 1VP9A 3HJRA 5F52A 5JPIA 2XUZA 3O4GA 4YIKA 1YV9A 1LDYA 1Y98A 2QNRA 3ASVA 4M8IA 1VM6A 1AIPA 4BNXA 1T9ZA 2E37A 4RV5A 1PSWA 4FLMA 3D4PA 4CV2A 5I45A 4D74A 4B3TB 2ZB4A 4S0ZA 1MEOA 3AUSA 2XLBA 4KL8S 3BXZA 4AY5A 3SJBA 4LQLA 4RVHA 3CWQA 2GVZC 3IPCA 3KQLA 5JS7A 2ZRPA 4CVNA 4JJKA 1W0KA 3K1AB 4YRSA 2QG4A 1C9MA 1KAOA 4G5YA 4BC0A 3TIXB 4N5HX 4ALMA 2VRBA 1ZWLA 1FVXA 3N0VA 5BRNA 3LUBA 1V7ZA 3VHQA 2VSYA 3HJAA 1S01A 4CMIB 4E2FA 4MUAA 3FR7A 1FNBA 2CZCA 3RKUA 3ZIAA 5LU8A 3TF5A 1JNYA 5IPFA 3UVEA 1W88B 3AVTA 4FEEA 4TUYF 3RUCA 1T0UA 3QEKA 2W6JA 3OX2A 1PFUA 3RQSA 1YOBA 1MRSA 1QZ3A 3V4SA 2QTRA 5H9VA 4BYGA 2E4XA 2F3RA 1UC5B 2R1TA 3IAFA 4KH0A 3F78A 3EGOA 3ZDDA 1QRRA 4QUIA 4CEHA 3DOFA 5GP1A 3WK7A 1O0SA 1YI8A 3ZIUA 3H1AA 1U0GA 2V7QA 1RJDA 3ELBA 3GOHA 4FX2A 1G9TA 4HWSA 3T12A 5K09A 1ODTC 5CT5A 2V74B 4V0RA 2KBFA 3AQIA 1VLJA 5C5IA 2H1VA 3ROPA 5DK4A 4AIRA 4GXTA 3REOA 4MYRA 1JXMA 4PICA 3FJ1A 1N7HA 1BXRB 3RQIA 1GTJ1 3E0QA 1Q83A 2XUFA 2QPTA 1PK8A 3SHFA 1NQUA 4K9NA 5LJLA 3H8VA 1JHQA 2UUBB 4RJTA 3L7AA 1JQ3A 2XNHA 4ZO4A 3DDSA 4DRYA 2I91A 3U4CA 4OQPA 3ZU3A 1FDIA 1JG4A 1NASA 4CDRA 5ALJA 3D0RA 3GPBA 3GJ0A 1W0JA 5EIWA 2IT1A 1FP2A 2OGWA 2AQKA 4IDPA 1P29A 2OHFA 1EB9A 2FSHA 2JAXA 4U3JA 1HEUA 2XUAA 3CTPA 1Q7CA 5NLLA 1LBIA 3LFUA 4ZYVA 4X6XA 3ABOB 2BGUA 2CFIA 4YQEA 5CTAA 2BGLA 2X7JA 2GO7A 3IBCA 1EVZA 3HDTA 1H65A 1LX6A 2DRIA 2FPOA 2R44A 3H5LA 1RRPA 3DC2A 3IP8A 4G85A 4AJHA 1TUGA 1VMIA 4DVJA 4PXAA 4F5WA 3ZLJA 2O0JA 2AJLI 2VKQA 3GFBA 1V9SA 1WF6A 2I2WA 1ZJJA 2QN3A 3R44A 4HAIA 2JKYA 4D2IA 3CLUD 4ZQEA 3NASA 4R4JA 4EMSA 2IH2A 2WE8A 5K99A 4MVCA 1CEQA 1EKXA 3ETDA 2QVGA 4MDHA 1JAYA 1GSAA 4J0QA 4YBRA 1IXKA 2FCAA 3VR0A 4DC1A 3U56A 1Q5PA 2AUMA 5BSTA 1MHPA 2OLJA 5EOVA 1E3EA 3T15A 1YJ8A 1P0IA 1K98A 2VHJA 3IMEA 2J07A 4ND5A 5HM6A 2C2HA 5HDBB 2VZ8A 1K63A 2CFTA 2CZGA 3EWNA 3WGNA 3TKAA 1F9EA 1RXYA 1USVA 3GIWA 3FUXA 4I8IA 3F0TA 1QJ4A 3E53A 5J43A 1VMAA 3UMVA 1G21B 1OWNA 3RUIA 1UJNA 4DILA 3ZWAA 1U2PA 1SB8A 1G5QA 1TMOA 1H2AS 2JFHA 3N2NA 4TSKA 1JHVA 4ABYA 1YHYA 2JLRA 4CF6A 2WIBA 3HB1A 3KK0A 4E3ZA 3DR5A 3FHTA 5DHPA 1DJPA 1NYTA 3K0EA 3I09A 4B3BA 2DC1A 4FW8A 1CVLA 1MJNA 1NUSA 3KT3A 1RJEA 4NR0A 4TSRA 2TECE 3VOTA 3RC3A 5JD5A 1VA5A 1MJHA 5B36A 3QXXA 4H4CA 4XGKA 1XL1A 4OQEA 2AN9A 2JRLA 2VYFA 2OXEA 2JC3A 1K2VN 2P30A 2ZBDA 1U2ZA 3FZYA 2OHOA 2RMKA 2DHQA 3W3ZB 2FVYA 4MEJA 2QR5A 3U5TA 3NVAA 3NIWA 1SBQA 4F4FA 2QRJA 3MFQA 2BDTA 1XCJA 3IEXA 1BKDR 3NPMA 4EWLA 5F3RA 1POWA 1DXYA 3ESAA 1Q1NA 4PXYA 3O8QA 1NJ5A 3T5AA 1GRVA 4F9TA 4HB4A 1WXWA 2CKDA 2QS9A 3IESA 1ML4A 4B47A 1SZJG 4C30A 4AWBA 4NXMB 1C9YA 5JCPA 2F6RA 4NU6A 1FDSA 3BMQA 2BHRA 2IH5A 5AJXA 1RWWA 2VZEA 5F7JA 1XJ5A 4XVHA 4ZALA 1QRTA 2NZVG 2ZBRA 5CVCA 2JEOA 1EH5A 1BCSB 1QZZA 3LQKA 4JWKA 4RM3A 1DBPA 1LBQA 3OZAA 4EHAA 1M0EA 1O57A 1L5ZA 1PX0A 3WQQA 3A1DA 4ENQA 1BD4A 2BR5A 1XQ1A 4EX7A 1NF9A 5DGHA 2XD9A 3BWVA 3F9IA 4KXMA 4WQMA 5FBWB 3WRVA 2O59A 2FZKA 1MC1A 1TM5E 1YU6A 1ORDA 2XDWA 4ZQCB 3VR2D 3F8WA 1ZJWA 3PLAE 4WOCA 3MSCA 1Y3BE 2QM0A 3GROA 5LD2B 3GDWA 2RGGA 1SVOA 3CSDA 3M6MD 2W2QA 4UUQA 4EMTA 4TZ0A 3AKEA 4A8JB 4LRTB 1T5TA 4CV3A 4QPNA 6GPBA 1JKJA 5JH7F 3UPDA 1GGEA 3MLEA 3AEKB 2VSNA 1YQWA 1N4AA 3MD9A 4N5LA 4WHMA 3KQPA 4XFJA 5LD2C 1FMJA 2ZYSA 4WDQA 2WTAA 5G0SA 1KVQA 4WMLA 5HILA 5EJ9A 1RIIA 2AEJA 3GVPA 4DR7B 4KAAA 4L0DA 4WCFC 4PYKA 3IUMA 1KVSA 3REQA 1VCMA 1RWQA 1EK0A 2NN3C 2Q0QA 3G2JA 4P0PB 2BCEA 2QL9A 3VJMA 1KNQA 4WESB 5JR3A 1U7HA 1CD5A 1MIHA 2BMJA 2HKIA 2YN4A 4ZJYA 4B73A 4TRNA 5ERXA 5HVNA 3DEKA 4MWGA 5FYDA 3B78A 3KXDA 2HU7A 1XN4A 3CUVA 3LT5A 2IZOA 4RSGA 2YHIA 4J43A 1Z62A 2QV0A 4MVWA 1P73A 1JIJA 4O33A 3R7LA 3RHSA 4XWKA 5J4HA 1JPJA 1N75A 1SJ9A 3GJQA 1YJXA 2FPXA 4E1VA 1R8QA 5E9QA 3OOEA 1SHZA 4ZGBA 1E3IA 4N3CA 1AU9A 1YRWA 3VPGA 3W2FA 2J3LA 3CX4A 3CFYA 4MKFA 5BW4A 4YB8A 1CJVC 1S2MA 2VNSA 3D2BA 4I5IA 1OH5A 1JFSA 2JAPA 2PJRA 2AOTB 4LWPA 4PGGA 1ENPA 2BKVA 2GPBA 2GN8A 3AHJA 4B3SB 2WHEA 2ZANA 1DIAA 1X80A 3SZLA 3AP1A 3L4KA 1T2DA 4MUGA 1IEQA 4QVGA 2O2XA 5D3ZA 5IWAB 4LMPA 5CFZA 2XRYA 1UWCA 3AFIA 3VYWA 5F2KA 4BGIA 2XVAA 3GP8A 2WJAA 1UMCB 2DVMA 2VJDA 1MB2A 3JRNA 1M2VB 4MEAA 1GUDA 3HCCA 4OP2A 3UJBA 2CMGA 2VH1A 5IJWA 1ULSA 4NCBA 1HWYA 3ELYA 3T54A 1YZYA 4BN4A 3SQLA 5ITZB 2QG9A 4HYQA 1WULS 3WWOA 2H16A 1Z34A 1VB5A 1RDFA 1FFBA 1TMKA 2HO4A 2ZXFA 4QNRA 4D5GA 2A14A 2UAGA 3NW9A 4KRFA 1CS4C 1EAYA 2ZU0C 3C8UA 2P9GA 5EXPA 4G8CA 5PGMA 4V24A 4AC9A 3FWZA 5H70A 2PSSA 2ZE5A 4KEAA 1GUFA 2CC2A 2DHEA 1LJUA 3QPWA 4G9BA 5CGQB 5IJ9B 3IAM1 3BBPA 1GG8A 3ETGA 4BUJA 5HQTA 5DK6A 3R75A 3CCCA 3WMRA 1RXSA 1BRTA 2V54A 4WFQA 2QNBA 4PR3A 1XI2A 2D7DA 4BNVA 2P6RA 2XUDA 3R7AA 5KSYA 4P58A 3WKEA 1PNVA 4NONA 1JH9A 1F4VA 3QUQA 2AMLA 1DKUA 1LDBA 2QN6A 3WMGA 4MLZA 1B8UA 5IKEA 4YV1A 4KXLA 3DMFA 1TEXA 3U4QB 1RQXA 4WH0A 3NNSA 3QYFA 4TKVA 4BVFA 1LQ2A 3RYFB 2V4ZA 4YUZA 2FSIA 2ZPTX 4ZTBA 1TUBA 5CLFA 2Z5FA 1KY3A 1W94A 4RV9A 5KREA 4PPGA 4Y1RA 3WX0A 2VDUE 4NJEB 3OD5A 4DNOA 1WMBA 1DQPA 1JEOA 3UWKA 5JBNA 4EVRA 1IAQA 2CXRA 3NIDB 1LK5A 5EZYA 4EUSA 3GA7A 1R00A 4FMDB 4HX2A 4MX8A 4ZO9A 4AS1A 1JYSA 1UP6A 4IOJA 1A4RA 3JQAA 3NEPX 2E2WA 1FYXA 1X9GA 4M1TA 3JASB 3ZHUA 4M76B 4RGBA 1QGOA 2VJOA 3NDJA 5CLLA 4Z3KA 1UDRA 3R4VA 1GITA 2HU2A 2VF2A 5AUQA 3HZRA 2FEMA 1PZMA 3E9NA 4ZT2A 1RYFA 4K6HA 3A6PC 3IDQA 4M60A 4ENWA 2IDJA 4UHBA 2AG6A 1L8OA 4YQYA 1SHJA 3BB3A 3QXHA 3KJIA 3MWEB 1USWA 1P44A 5BV1A 4CKXA 2FLVA 4OQNA 1X7HA 1UAYA 2I4RA 2KHZA 3VKFA 4CDGA 4BNIA 5KVCA 2Q3BA 2H08A 1ORRA 3TSOA 3WMFA 2IL1A 1CUDA 1RYEA 2B69A 1CG6A 2Q6KA 3FSJX 3WXBA 4YUWA 4RPHA 1BKYA 4I1OA 5BSGA 2Q6VA 2X2OA 3K30A 5HA5A 4MCAA 4DLXA 1CNFA 3K8QA 5B1YA 4Q4DA 3I52A 4WY2A 3W1VA 2B78A 1KSJA 2PX6A 3CONA 1DBRA 3W3AH 2J9RA 4M37A 4EDFA 5K0CA 4YMUA 1C3XA 3DTVD 4D8UA 1GNPA 2QMEA 4UVEA 4OBEA 3QHAA 5A05A 1KZ6A 4P7FA 1ETHA 5BO5A 1K8RA 4DLSA 2P78A 3I9OA 4POOA 7REQA 2F1OA 1B6RA 1I3LA 3QLUA 1DCKA 2G6TA 1M2OA 1X6VA 1SB9A 3CE9A 4UEJA 5EP1A 3I8SA 3S1AA 1DJLA 3KVVA 1RKVA 3WYAA 4D0LB 5CCXA 2J6CA 3FDFA 4NBTA 3GJ6A 1PG2A 2M1XA 4ZZ3A 2OFFA 1W75A 4PV7A 3LMKA 1DJOA 1Y4ZA 3RC8A 2R8ZA 3PF9A 1GNSA 4QXOA 3O4VA 3DEAA 1JPUA 3HH8A 3CH6A 3PPYA 1AK1A 3AHIA 4EHKA 5FLEX 3D2LA 3VR3A 2AJDA 3LA6A 4KBYA 2HA7A 3CUTA 2REQB 1VC2A 1ISHA 4S05A 1CQZA 2BM1A 2PKQP 3Q7QA 1R3UA 3UHPA 3UT0A 1UJ6A 2JEYA 5JU6A 4RVNA 3TSYA 3ZR4B 3GBPA 3ORFA 1J23A 2MR6A 3EXEA 2BGIA 4LVOA 5C3MA 2OILA 5IK2D 4NDZA 3BH0A 5HYVA 4RESA 5I4KA 2WWRA 3BZBA 3ENWA 1Z0AA 3BRQA 4LVCA 4AX4A 2VPXA 1QV9A 1GLNA 1H2FA 2FFJA 3BBLA 3BQNB 2D00A 3V4OA 3MWKA 5JZBA 1XZIA 4O4JA 3UAYA 4CLOB 4DDKA 1FBTA 5A4KA 3JQ9C 2VAVA 1V1RA 1RPNA 3ZKAA 1ABBA 4JR1A 3NU1A 5EEGA 5TR9A 1CS0A 3PVZA 1CF4A 2WIKA 4ERXA 2DEUA 2R79A 2XYHA 3LV8A 3K0FA 4N3NA 4RF2A 1FSGA 1SHTX 1Z2AA 2RHLA 4N18A 4PYRA 2Q7OE 2O2DA 1MORA 1BWPA 5K0BA 2O23A 4WNAB 5AW8A 1Y8QA 3NLLA 3RYIA 4ZOQI 2D1QA 1XZKA 1C1XB 1X87A 4IRMA 2LIPA 1RIFA 3C85A 4I4LA 3UYKA 1U1GA 2BI4A 1QIKA 2PIAA 1W46A 5DW0A 3SMVA 4DPKA 1GAQA 3GUHA 5CDFA 3VZCA 3OZRA 4JKOA 1YWGO 4M8KA 3OT4A 1BH2A 2O1EA 1FUYB 3AONB 4ZCRA 4ARSA 1PT7A 1AQJA 2PCJA 4JC0A 4LGMA 2BOVA 2BTQB 1RWNA 1W2WB 2EZUA 2BKAA 1UUFA 1ZJ4A 4WINA 5CJ2A 4G41A 5DTQA 1RAFA 3IPLA 3JD3A 3AJRA 1YFZA 5DP2A 1VZ2A 1PZGA 1ZI8A 2AI2A 2K4MA 3DVAA 4DLUA 4EFMA 3WB1A 3JS5A 2D2EA 3L6BA 1RXCA 5B55A 3R24A 2IS4A 1U02A 1SPXA 1ZJ5A 4O02B 3WGIA 1F20A 2OM2A 4RPGA 4EPXA 4OHOA 4COOA 5LLDA 2PMBA 2QUBA 4F72A 2P2SA 3FN4A 3QKTA 1TQ2A 2DHRA 2HZ7A 3EAGA 4TQAA 4TQGA 1NLYA 1X7ZB 2WYOA 4RH0A 1E6LA 1ZA1A 1PFVA 2CNDA 5IULC 1C2YA 4JP1A 3DFMA 5KDLA 1RJ9B 1QPZA 3KFVA 2Z5LA 4OUDA 1U3VA 5CBPB 1L5SA 1KXZA 4JX9A 2WJ3A 3BXHA 3HN6A 1JH8A 3WKDA 3KYIB 4AXBA 4G0NA 3EDMA 3KOMA 4KI7A 5DF1A 4ZQIA 5EFZA 4G6ZA 1P31A 2VK2A 3HA3A 3BTOA 8GPBA 5FEUA 5IDXA 1PEDA 1Y1SA 3A9WA 3H6HA 4ZPJA 1QMPA 1P8JA 2QRGA 3C3WA 3KHKA 4BQFA 5IJ0A 4JB2A 2WAYA 4MW7A 4ZEMA 1DAKA 1YMQA 4JR2A 1TM3E 1B43A 2CHFA 4JLUA 4HDSB 4KXWA 3GUZA 1EE9A 2HF8A 2HXSA 1XA3A 2VK1A 2X19A 3ER6A 4H3SA 4PHCA 4MR8A 1E8MA 2IHKA 2EQ5A 5FJIA 4L08A 4Y6QA 5EGNA 2GLXA 3R8CA 1DC7A 4C3VA 1FRZA 5AVUA 5DX0A 2QTFA 2CWDA 3OY2A 2IOQA 4L22A 1NBEA 3CEMA 5KYWB 2ZUFA 1IVYA 1NW7A 4FEYA 4KGVA 2CW5A 4FYHA 3WGUA 4HTFB 4RHEA 3D59A 3VNRA 1X70A 3INYA 5FWNA 4DZTA 4BRZA 1L5NA 3LTNC 2VDKB 3ZQ4A 3S55A 1JR4A 4OGKA 5L7WA 5FNVA 3ZD6A 5GOZA 4A26A 1ZXLA 4QXAA 2YNMD 4EY3A 4UTVA 1J1IA 1R6VA 2BHTA 2WAOA 2VYCA 2ZI4A 4J2OA 4JU9A 3ZDXB 2IHUA 5EIXA 4QOJA 1DLJA 4RS4A 3BAFA 1NQTA 1RHRA 3G8YA 2EBWA 1BW9A 2JEZA 1NV8A 1FVFA 2GJAA 3V3TA 1AMUA 4PLTA 3M49A 3TTXA 4G1MB 3PHHA 5L51A 5KYNA 4JS0A 2VAWA 4YAIA 3VDMA 3AY0A 2DR2A 1P7YA 5B4TA 4M86A 5JUWA 1GQRA 2PD6A 4E5DA 2QRKA 2X5XA 1Z0SA 2XB4A 4JELA 2VUIB 3GFFA 2D3TA 4KG7A 5JJIA 4DA7A 1I7NA 4BNHA 1M3SA 4G0PA 4ZZ2A 4NZOA 1JAXA 4IXDA 2BMAA 3SC2A 2D7JA 3O2QB 1YZFA 1MC5A 5B37A 2ZB7A 2V6FA 4U6QA 4XOUA 3OCVA 2BFFA 2DSNA 3O47A 5CLGA 2GK6A 1YXMA 3BILA 3L18A 4JZKA 4I8DA 1IDN1 5KPJA 2ZTHA 1MQ9A 2B8TA 4PRYA 1UQUA 1K92A 2BFWA 2QTLA 2ATEA 5IT9A 4HF7A 2JLUA 3MCVA 2OSVA 3K5PA 3OCUA 4XAQA 4ZOBA 3BGIA 1EEXB 4ZRNA 3IAUA 3G7UA 1M1YA 1PLKA 1U8EA 4PLFA 5BVGB 2WZBA 4EGJA 2PIDA 2RGAA 3OC0A 5FNZA 5B2ZA 3F5QA 1UMBB 1IK6A 2MU1A 4JVNA 3R6WA 2Y1XA 1JG2A 1MOPA 3KSDO 3L0SA 5JXIA 4M46A 3L77A 3QQ5A 2VCEA 3JAKB 4XPIB 2QMQA 3BYZA 3TZLA 2VF8A 5IVDA 1JW9B 1QDEA 2C98A 1JSCA 3CRNA 4A10A 4F97A 1OBCA 5GADl 4C03A 5BWOA 4UZFA 1XZGA 1FFYA 3HI6A 4JMPA 3I9JA 4CIAA 1JT9A 2L19A 4ZYYA 2OORC 1B15A 3N2GA 4JNKA 2JCSA 4GBED 4LC1A 1CQJA 2QE7A 3FUUA 3VR4D 3Q2IA 3L8MA 3WQHA 1ICEA 1R4NA 2GSDA 3NIGB 4PAOA 3L4BA 3CLVA 5BW6B 3H16A 3OD1A 2B2NA 1Q6ZA 3OAAA 2GKSA 1JG3A 5FA6A 2GEFA 1OU0A 2YOFA 3E2IA 1UK6A 5KWSA 1CYDA 3TDMA 1XNGA 2D2XA 2PAAA 3DD5A 1CKEA 4ZAFA 3VX4A 5KKAA 1J2JA 4R9SA 3CUSA 1HEIA 4A1OA 5BYAA 5LU9A 3EFOA 2QTTA 4XGIA 3N2ZB 1QV6A 2YJNA 4OI2A 3GLHB 4FCWA 2G4CA 4CN9A 3C3EA 1ZCAA 2JPDA 1TM2A 1UPFA 4ZA2A 1AB6A 4J3FA 1SN7A 5JD4A 2X5KO 3M6XA 2PMKA 4RHXA 4X5OA 4DKJA 3VR6D 3E81A 3FZNA 1QE0A 4KQMA 4MULA 1O54A 4RKRA 3TTUA 3V1LA 3DLBA 3BE6A 3VH3A 5GJCA 2GFIA 2I6XA 1B41A 5E6UA 2QTNA 5FORA 1G3IA 1YRLA 4HVLA 3VJRA 5B4UA 3UWOA 3ZV4A 1WQ3A 1MTZA 1R8YA 4YLGA 3CYFA 1RLUA 3FTEA 1V11B 3GPDG 3K09A 3GJ3A 4RHCA 1FCJA 3BIWA 1IXSB 3TTWA 2WG0A 1M5UA 1NURA 3K9BA 3SF0A 3FFXA 4LBVA 2VHWA 2MDTA 2CE7A 3ZS8A 4YRAA 3T1YB 4PBTA 4EQ6A 4J0EA 3QWIA 1BOOA 2PFSA 1ZNWA 5GINE 4BPBA 1NT4A 3M3PA 1QJCA 5CX1A 1T4MA 3X1YA 3HL0A 1QHSA 5KJEA 4BEJA 4QKQA 3GOQA 5LL6P 3WLSA 3DZGA 4FMDF 3R5TA 2G9ZA 3RBVA 2IP4A 4IX9A 2WF7A 3IV9A 5HIIA 1U3WA 4UVGA 4KFSA 2VT3A 3G8CA 4KR3A 4ZYUA 1CQXA 4WGFA 3TNYA 5B4VA 5F7ZA 2QU7A 3MINB 3FNGA 1QO0D 2CJXA 4OEHA 5FAXA 1O8BA 2OFOA 3KYBA 2ZRQA 4RY9A 2YMPA 2C2BA 4HUQB 1WMSA 3OICA 2H59A 4MJ3A 5ALRA 1P60A 3WG9A 2QX4A 4D41A 4EYEA 1GQQA 2VDPB 4P31A 4D3YA 2C20A 4DV5B 2XWQA 1FTWA 2ZB8A 1MW8X 1VSVA 1W5TA 3MMSA 1GNVA 3W5JA 3LCVB 2Y93A 5BNFA 1NPYA 2CDCA 3OQ1A 1HSZA 2O05A 2ZITA 4D0SA 1OLSB 2IGBA 1K5DA 2FPIA 3P9PA 1FPQA 1TT5B 1SQ5A 2IIVA 1KAGA 1G20A 1UDBA 1SRQA 4P4UA 1YR9A 4Q9IA 2I3ZA 1V7CA 5K01A 3PNBA 3U1BA 2J87A 1ESNA 2BHSA 4YI5A 2E55A 1IHPA 2XRMA 2JNWA 2ETXA 3MOSA 2PZAA 3GUVA 4G8DA 3QU9A 2Z4RA 1CQIB 1KDVA 1WXGA 3IP1A 4BY9E 3LXMA 3ZGOA 5D84A 5E9WA 1TTTA 1VI2A 1E1MA 2XNCA 2WHYA 1M2WA 1N2HA 1ZD8A 1FRNA 2F9FA 2PUEA 4RIEA 1ZRNA 2R7MA 3F5MA 1VYHA 3GNSA 3NTLA 4L3VA 2BH9A 5FKJA 1C30B 4UNQA 5K2OA 4W5OA 1EESA 2NT4A 1GT91 4UAUA 3PQ8A 2HSGA 4II7A 5E8JA 5H81A 2LIVA 3SR4A 1LSSA 1W35A 1ZVMA 4OXXA 4ZREA 4E0BA 3U37A 3F90A 3SYLA 4DSOA 5L53A 3NHFA 3EGCA 3KJFA 3LKZA 2EW2A 2CEKA 5EJ5A 1YAJA 1GGMA 4HAWA 2HMTA 1BE1A 4GQIA 3RV3A 3S2EA 1PVOA 2NQTA 1FFDA 4BO1A 2GEVA 3FE2A 4REMA 2JBAA 1OHHA 3SNKA 1DL5A 1ZMRA 2VWQA 3ADPA 4FGKA 5A1JA 1YBFA 2HSEA 3G17A 4U0JA 1YL6A 1C0EA 1N2IA 2JFWA 2R5WA 3IIJA 4R0VA 3QVVA 5AO9A 2CYAA 3O8OB 4JQOA 4LXXA 1XVTA 2WWVD 4BVEA 4N8SA 4CQMD 3ER8A 2IS2A 1FW6A 4GPIB 4HB0A 2Q41A 2VYVD 1AO3A 3EQ7A 3AF3A 4GEGA 4J1TC 2BD0A 4JA0A 3QVXA 4QDKA 5BPHA 1MJGA 3DEHA 3CTMA 1I7SB 1HKHA 3M6LA 2C8LA 4HWRA 4OXQA 1XPUA 4AI6A 4HPXB 2WRZA 2DH5A 3MSXA 4E31A 5G4LA 3GZJA 4JHLA 4G0WA 2H1LA 3ESYA 1Z12A 2XRFA 3PDCA 3QTLA 3SF8A 5HQ3B 4ZVSA 1EK6A 1H0RA 2Q5FA 2WB4A 3EXG2 4LCEA 1YU9A 2GNAA 3BSFA 3N8GA 2RHGB 1TM7E 4FBLA 1YCHA 4OSEA 2NADA 1KOLA 3QX9A 5P8WA 3MA0A 4Y8VA 2JLYA 4DWJA 4AZ0B 1T8UA 2EJTA 1Z15A 5AQEA 5JSKA 2V1UA 1EXNA 4IL5A 5IEJA 2ZYHA 3F96A 1NVBA 4ME6A 4HGOA 3HSKA 3KLOA 3PSAA 1WP4A 3OKAA 1W9HA 4BQSA 1V2GA 3ESQA 1JZTA 1T6ZA 2D5CA 3LGAA 4JASB 2C0QA 1U9CA 5K3SA 5LMUB 2ERCA 2GM9A 4ISBA 4KFRA 1WXDA 5AXAA 4ZEWA 2ZBEA 3LRXA 2A9KA 1P4HA 5EIHA 1YD7A 2K2QB 1KDPA 1UXHA 1T3LA 4CM7A 4CR7A 1CT9A 2DTEA 2PQ0A 2CCKA 4K1LA 3DMDA 4R81A 4DYDA 2OAEA 4J0JA 3OTGA 4H1HA 5CA1A 1EI9A 1VHLA 2YICA 3Q3GE 4UQOA 4E1BA 4BVLA 4XWWA 3HUFA 1WSBA 4J6FA 1NR1A 1JMYA 1CR2A 2A8YA 1P2VA 2FSPA 4TYMA 3SNHA 4MITA 4FBGA 4P7JA 1KFJB 3ZIDA 1G8YA 4ACBA 3KT0A 1T3ZA 4IGFA 4ZT7A 3AU8A 3WIBA 1E20A 3ZVNA 2I6FA 3ZDFA 3IDZA 3CY6A 1EP1B 4JP5A 1IN5A 4AFNA 2UVPA 3ZVLA 4DDVA 1KSGA 3UTDA 5DX1A 2AD1A 1UMDB 2GF0A 3KTAB 3N76A 4IZIA 3T5DA 3H7AA 5K4GA 2Y2UA 1KWGA 1JU3A 2BFMA 3VO9A 3HGTA 3RSQA 1EUDA 4ZU3A 1CSEE 1LDNA 1NBWB 2BWJA 3NAZA 4W8GA 4N9WA 5CVJA 3ZE2B 2ZAGA 2D8AA 3G79A 4BKUA 1FFXB 4OB6A 3R3HA 5F12A 4LYEA 4C43A 1TTQB 2A0YA 4FCCA 4YMLA 521PA 5CD9A 1TB4A 3OJOA 4W8HA 4Y6LA 2HM7A 2IE0A 3P52A 5EXXA 4K26A 1REQA 4X0EA 4HXFB 3PUJA 2O2YA 1NBAA 4X1IA 2WKSA 4KYVA 4W1RA 3NBAA 5KNDA 2I4LA 4GEKA 1YR3A 3FROA 2WHPB 1OMOA 1OXBB 3C3PA 3IB3A 4P92A 4X00A 3VC2A 5D1HA 4RL6A 4QLBA 4UTPA 5ELXA 2FSSA 4FDMA 4KQIA 4WNIA 4CU5A 3G9ZA 2IU3A 3BG5A 3P9YA 4L28A 1MB4A 1RYMA 3VC3A 4GC9A 5CXQA 1KRHA 4R2XA 1G3QA 3C3BA 4P3PA 5AM3A 4QYWA 2DQYA 1Y1PA 4WZ6A 3RSZA 3H3XA 1RP7A 4G3XA 3KYCB 1YZHA 3GFSA 4E5PA 3ZLVA 4ES6A 4XJVA 4FMCB 3DTNA 3KIPA 1USIA 2JK0A 1TIKA 2YZ7A 3I1IA 3HR8A 1YULA 1C3OA 2M6KA 4GGOA 1PP4A 3LBYA 2WQ6A 2H57A 4KAFA 4IUCS 3IPYA 4EYSA 5I5GA 2JFZA 2QEQA 4AY2A 5G3ZA 2W11A 2ARKA 3WIEA 3D7NA 4EF5A 1X7YA 5JTTA 2ENUA 3B3JA 1EFDN 3HLYA 4IIXA 2F67A 2ZTVA 4WKPA 5ECWA 1M5TA 4BRWA 4LQ4A 3KLPX 3TKYA 3JQFC 4NMHA 1JDTA 1V35A 1QKJA 1WMFA 2IUUA 4EHLA 2DPLA 1L7RA 2R6HA 1H2HA 4YJGA 5T57A 3LDUA 5CFMA 4TOIA 2J3HA 3AF2A 3IKMB 4PRLA 1KNXA 3QLEA 3CE6A 3MN1A 4K1XA 4D4LA 2PS9A 3LL7A 4YAGA 1KYWA 5AESA 1FIUA 3O1HB 1QHHA 1KJZA 1L9XA 2PT9A 2RGWA 3LOUA 1AQYA 4KPUA 4P54A 3ZDBA 2QMHA 4II2A 1O97C 2XMRA 1D4AA 3ZV7A 3F5FA 2JHAA 1WCWA 1OBVA 4O4IF 4YXWD 4Y3UA 1ANKA 1P5RA 3PRYA 5BMVF 4L3WA 2YINC 3VPBA 5EI5A 2NX2A 1WNFA 4Z3OA 4M54A 2QW8A 4ENVA 4GXRA 1B1CA 1JGTA 1ZO8A 4IXWA 4LTMA 5K51A 1TAQA 3E1GA 2AYYA 1SUDA 3C3AA 5IAJA 1NTRA 5DM4A 1RQ2A 1AT1A 3FGOA 3IKVA 1ECJA 3OZUA 1ATZA 1FB5A 1QYRA 4BLOA 1VKHA 4J0DA 1PX2A 3CX8A 1UPCA 2BKXA 2H4YA 1T0PA 5LKAA 2V3WA 2PJUA 2VXCA 2ZJZA 4R6XA 3KQYA 4RAOA 5COBA 2OV2A 5JTUA 4OJYA 1YK1A 3F7NA 3E1KA 3EC2A 3R23A 5TEVA 2N1BA 2R8EA 3R7DA 4EB6B 5J2TA 1MEJA 1W76A 3H5RA 4IGIA 4QYIA 4MQFA 5ARBA 1V1MA 1I32A 4QECA 1KJQA 2PS3A 2QL7A 4DV3B 2Q3FA 2NXEA 1T5OA 4FB5A 4ZAWA 3CU5A 4UVHA 3WLKX 2XTAA 2ZQZA 2DFPA 1BN6A 3D7LA 3KKQA 4P4LA 5EWLB 1NYLA 4NE2A 2B8WA 4RIIA 2X76A 2HFJA 5CT8A 2HMWA 3D3JA 1KQGA 5HG0A 1F7UA 3G7NA 2H6EA 4YRLA 1J39A 1TTHA 2DF8A 1SBYA 1KMHB 2PXAA 1OSNA 3PUVA 4Q0MA 1CY4A 2B83A 3AVOA 3EY4A 1EAMA 3BMNB 4GKAA 3U17A 1BXZA 4WCFB 1U8ZA 2UYYA 4KXXA 2GCPA 4NIMA 5KYGA 2BV3A 4UXJA 1DBVO 1LDGA 3I12A 4NI5A 1D2RA 3RTGA 2NU6A 1SOMA 2QR3A 3WKCA 1F60A 3Q85A 4R1OA 2N42A 4TM7A 3H1PA 4OMCA 4J91A 1E2GA 2YXLA 2GSWA 3DXZA 3DD1A 1XLTA 2BVNA 3OJ0A 2BEKA 2ZAMA 3QU7A 4LXHA 1GA4A 4NE9A 3WL7A 2PRIA 3RYCA 3LUKA 2O2SA 2RC5A 3A26A 4F2WA 1DO8A 1JB1A 1XDGA 5GJVC 6REQB 1DAHA 1U0TA 2QGNA 1NW6A 1IG0A 2R85A 4LRUA 4D7AA 3MJ4A 3CEHA 2JANA 2FAXA 1ZWKA 3JTEA 4Z4EA 2NO7A 1A76A 2DFDA 4TROA 1O96B 3CZRA 4YO8A 3EYWA 4TQ9A 3T1TA 1YUMA 3RIMA 4C08A 1P9RA 4GT1A 4BO2A 1LLFA 2I8AA 1MBZA 1LNSA 3PXXA 2F3PA 4JBIA 4FHCA 5KINB 4CIDA 1OIXA 3BICA 3VU8A 4TTSA 2H5JA 1PLLA 5I7UA 1H9CA 5HKOA 4OYHA 2JJ8A 1FQJA 4K9LA 1PSDA 1YS6A 1ZZEA 3RUHA 4YRQA 3SEFA 2RKOA 4RJ2A 1T36B 4XSVA 5WRFA 2VZ0A 5BXQC 5CB4F 1YL5A 1G4HA 1XFAA 1MABB 2DJ5A 3AUYA 3PDIB 3SLRA 3GLFB 3HNOA 3UXYA 1G8HA 2XD4A 1O77A 2GM5A 2BMWA 2W6PA 3AY3A 2XCTB 4OHKA 4DR2B 3D7SA 3DWEX 2DE0X 3BAZA 3LSYA 3NHLA 1XV5A 4UM9B 3EGVA 3PRHA 2RGNA 1PJLA 1OV6A 3STWA 1P75A 3Q72A 1STOA 3D1VA 3TB6A 4N6NA 4D6PA 5A3VA 2AWNA 2D0IA 4YRBA 4QHSA 1YVEI 4GQBA 1CIJA 3RI3A 3PXDA 4F2DA 3LVRE 4GZ3A 4CLXA 3SQXA 5EUMA 3ZJ4A 3G0CA 2DERA 1DCMA 2VOEA 1T8WA 3B1JA 3MWFA 1J5XA 2HA5A 4LHSA 2A5GA 4OAOA 3H5WA 1Y5NA 4IQFA 3LK7A 4F2PA 2GA9A 4J2TA 5FI5A 3PNYA 2FMUA 4QYXA 4E12A 4DV4B 1BEZA 5CUQA 1PT6A 1USKA 1ZEJA 2IYLD 1V43A 3EH2A 5GWXA 2ONJA 2OQRA 3TW6A 3AJ9A 2OCLA 3SLGA 3GN1A 4MXDA 2NAPA 1L7NA 4AF8A 1Y3FE 4UCFA 1WCV1 4G07A 3NT4A 2JDID 4NFSA 5KTNA 1G4UR 1THTA 3OPYI 4PFQA 4MV6A 4MUJA 4G1VA 4TMYA 4PLHA 2HPVA 3SE0A 3OPYB 3ZD9A 1R0RE 2UDPA 4B7UA 2V7UA 2EJCA 1XTRA 3A9UA 1UBTS 5JDIC 5JAZA 4K05A 1C1DA 1VKOA 3RVBA 1FTYA 1AKYA 2WUGA 4IGEA 4EATA 1IG3A 4G0QA 1EK5A 1WP9A 2IW1A 4PZCA 1JQ5A 3LUFA 3HK2A 4BAGA 5B2FA 1T9BA 3TRFA 1BJKA 1C8VB 4ZOEA 1KI4A 3EWAA 4JC5A 2B94A 4O2AA 2Z8XA 4A6XA 2NNLD 3JD4A 2WILA 2EVWX 3FPHA 4DIUA 3LSTA 1T0JB 4EGAA 3T5GA 1EXVA 3IELA 5LQJA 4HYEA 2HLPA 3G5LA 1NNUA 4YCNA 1FNNA 2R62A 2ABWA 3PDHA 1DC8A 2IZZA 2WM2A 2YYZA 3S3TA 3EPJA 3P1JA 1QIGA 2WTEA 3LT4A 1U8UA 3EFBA 2IQIA 2OLEA 4WLVA 5E9AA 7GPBA 3Q5GA 4HMPA 4XB6B 3UENA 4IX1A 2EARA 4PX5A 4BUZA 2DH6A 4LNUB 3ZBUA 3I5XA 4AURA 3DL0A 2VDMB 2XNKA 3II6X 4S2EA 4V39A 3A3KA 5EKSA 4C0QC 4FM9A 4LJ4A 1MZVA 1U0OC 2HDHA 2V55B 3DG9A 4C14A 5MDHA 2Q4DA 1KTIA 4K0KB 1V5IA 2A0KA 1CR4A 5A0TA 4AZWA 1HGXA 1SC6A 4D6YA 2QYHA 1RAHA 2YOHA 3A14A 4H3HB 5JLAA 2FY8A 3QA9A 4GPEA 1EM6A 4L0MA 3KE8A 2XW6A 4E7PA 5D2CA 1Z33A 3SN6A 2I3GA 2CNWD 2Q1SA 2ORYA 1PFKA 2FOXA 1JS1X 1KI6A 3KKLA 4MRAA 3C97A 5IF3A 3B7GA 4A2QA 2V9ZA 3AXSA 3T5MA 1XJ0A 2H2DA 3DMNA 3OEEA 4FZ3A 5EIBC 1HE4A 2AR7A 2E6UX 3UAXA 4KTTE 4M0KA 5AHOA 5HCUA 4BO9A 1PQWA 3QITA 1IBRA 3AV3A 4PM4A 5JNRA 2P68A 3SZGA 2FXVA 2GUWA 1XZEA 2ZR8A 1HDCA 2W2LD 3QUBA 5DBIA 1W4CA 2RHDA 2ERXA 4RD1A 1EWVA 4EMUA 2JD1A 2QQ5A 3BXEA 3ZG6A 4D1YA 4Z49A 2W70A 3L06A 2HK6A 1BX3A 2V5VA 3D7MA 5LMNB 4FNAA 4PSVA 3T4EA 2I6TA 1EVKA 2R2GA 3DYBA 3FCEA 5ENDA 4E2YA 2I3BA 1ILEA 2VQ3A 1P81A 3C15C 5CU7A 1ECPA 4YAKA 1QF7A 4JOSA 3DMPA 2OAQ1 3Q8KA 2JG3A 3IEVA 5HRCA 5AHWA 1BD3A 1TNDA 2ZWOA 2ZJFA 3VNSA 1FU7A 2FPGA 2Z58A 1V6SA 2P2YA 1DKOA 4OHYA 2HF2A 4I4TA 2AMYA 1D6NA 2RHJA 4PRZA 3PPWA 4LXGA 2AN4A 3TX6A 3GCWA 1GZUA 4G65A 4OFZA 4QU8A 3C48A 4Z5XA 5JNLA 1AV6A 3KTOA 5G0UA 4FFBB 3AUUA 4US1R 3TGWA 5DXAA 1FFGA 1US8A 2W5UA 3MYRA 2C5AA 1PLJA 4IICA 4QJ5A 3L04A 5H5JA 4IZHA 3VTAA 4BQRA 2M1ZA 3M2TA 4ZRDA 4DCJA 1X42A 4KO1S 1ISSA 1GL9B 2ZE8A 2ZI9A 3G0BA 2W43A 3QELA 1L5QA 2I03A 2QYSA 1PKXA 4TV8F 4KLAA 1C4KA 1H1LB 4LXQA 2LE0A 1QP4A 1EJ6A 1JA0A 1GZ7A 5KI6A 4E5NA 1GL3A 2VDOB 1AKEA 1RACA 2ADFA 2R9VA 1QG4A 4RYLA 2O48X 4ZV4A 5JRZA 3WGHA 4NBLA 1AX9A 3GMSA 1LPMA 2CZQA 3HN2A 3E22A 4LRSB 3M9XA 3PHLA 1QLWA 4FMCF 4I7EA 4MPRA 3FXAA 4H0CA 3VM6A 1GAXA 2QN7A 3HP1A 1KI8A 3QG5A 3N0TA 1AVTA 1MO3A 4MYUA 1TC2A 3BHNA 4TV9A 4BASA 4P22A 4D6XA 4EPWA 3U7JA 4BMNA 2OCKA 2ASVA 3NTVA 3VBEA 1N25A 3N70A 3BL5A 5CDFE 4RVDA 5K8JB 2BM0A 3HU1A 1CV2A 2FW9A 4Y2SA 1ECBA 2QKYA 1QGYA 4G9GA 3RDPA 3H9UA 4YAFA 3SDSA 5H3CA 1J1UA 4QEZA 2Z43A 3ILHA 1FFWA 2HL6A 2Q99A 1WPRA 3EBLA 4HVTA 4QLOA 4Q4CA 5DRTA 1KK0A 2DGDA 1NI5A 1QTNA 2GILA 2I2XB 3KSRA 3IDFA 4KK4A 3I76A 1IN7A 3IL2A 3AESA 4IYJA 1QH8A 2CD7A 3NHBA 3Q0IA 2D54A 3MVEA 3DPIA 2W6CX 2WM3A 3JQQA 2A3RA 4NICA 3SAJA 3AM4A 3CNNA 4NATA 1HURA 2FDCA 4M87A 5CLJA 3IT1A 3PR3A 1WBJB 3Q5DA 1TJ5A 221PA 1D7AA 3CPJB 2FF7A 2WAXA 5IF9A 2RKBA 1A5BB 1OXVA 3EGEA 1UAAA 2R8YA 3EE6A 3H9GA 1OOEA 3G88A 4JFRA 1LFAA 3M2PA 4M1SA 5TNXA 5LDGA 5CH5A 3KZ1E 5HQJA 2OPHA 3UJPA 3ZE6A 5K6AC 1DRUA 2O8BB 1G8AA 2UXDB 1ID8A 3OPVA 4OB7A 3PQEA 1T0BA 2IE8A 1NDQA 1U8FO 1MCZA 1ISFA 2AJBA 2HA0A 1GQOA 1JZSA 2IYQA 2WHQA 3TZEA 4G4SP 4NOKA 4XYEA 5HF8A 4Z7QB 3ERCA 1ZIOA 5FWYA 3NWPA 1HL3A 2I3AA 1GPKA 4C87A 1G9XA 5C7IO 2E21A 2J9FA 3QY9A 2CL5A 5FFFA 5I8ZA 5IVIA 3M8KA 2OGZA 4C5AA 5FCDA 4HUJA 3LT1A 5K3AA 1DO0A 3IE0A 1QVRA 3M4YA 1RBQA 3Q10A 2Z6AA 1BE0A 2SNIE 3CGGA 3TTYA 2GX6A 4BMOB 5DX8A 4WASA 4N5MA 1J8VA 2CVOA 4Q4AB 3QVGB 2Q3HA 1GRQA 1ZD9A 2XAUA 5AK0A 1XEXB 2ZBPA 1DI0A 3FYSA 4P3OA 5TSDA 3ZCQA 1Z29A 2PGOA 3I3SR 2PUFA 2QVXX 3LCMA 2AUNA 2HBRA 3BSSA 4QX6A 1OBOA 1TT7A 2B4RO 4RKQA 4X8HA 3E27A 1U7UA 2H9IA 3RIHA 4YQFA 4BXOA 2NGRA 1Z0UA 4MYSA 2J31A 4LJ8A 4UUBA 3TFOA 5KBYA 3L40A 4B33A 2TSYB 1JLRA 2XMQA 4QGAA 2ALJA 4CT5A 4ZDJA 1ZW1A 3ANNA 4URXR 1IBMB 2AE1A 1G2PA 1VI6A 4E3WA 2LR0A 2BJVA 4RHUA 1BMDA 1D09A 1DCFA 5LQMA 2B6NA 2WV9A 3I28A 1PHPA 1SCQA 3IJEB 2BELA 2H2WA 3L9XA 1KTVA 5AOAA 3FI0A 5GQSA 2WNSA 5HEKA 3C5CA 1RKQA 3VV2A 1T9GS 1ZLXA 5MN6A 4Q9LA 1FY2A 1W4RA 2BBTA 1OI3A 4CZ2A 2R25B 4Z4HA 3KOZA 4K86A 5T64A 3NALA 2PSHA 4XX0B 4D3DA 4OLAA 2FW8A 2WC1A 4MUIA 2DFKB 1JLHA 4RGYA 5CB4A 5EHIA 4RVOA 3BK1A 2EKZA 2NYAA 3EF1A 3FBGA 3PT5A 3Q40A 4QJ4A 4KX5A 4U2KA 3GDGA 3CVVA 2KPOA 1SUSA 2IRWA 2X5OA 2WV7A 5JFTA 2B1JA 1EFVB 1N36B 2YXEA 3IUSA 5IKMA 1D4OA 1WTAA 1QYXA 2VJCA 4YP9A 1SU6A 5THKA 3K6SB 3PIIA 2NUAA 2OD9A 4L9SA 1L7OA 3SDBA 4EW6A 3IC5A 1VI5A 2NSDA 2FQ1A 3ROTA 2X41A 1UC4B 4L5IA 4G63A 3GLUA 2R8OA 4JT4A 2BEUB 1XTVA 5A5EA 2PRSA 1JJ7A 1E3LA 3EQ9A 4JLSA 1JXOA 2QB5A 3AWDA 3BFKA 2D2VA 3HQ4O 4FFRA 5K8TA 1OJ7A 2GEJA 4X54A 1Z83A 3TWOA 2ZWPA 3TRJA 1H4SA 3OTIA 1M1YE 4L6AA 2J8ZA 4GKJB 1NBME 4FSXA 3G0DA 4HNAB 4CL8A 4EENA 1G41A 5AYVA 1QYIA 1Q0RA 1T9DA 1T0IA 4PZPA 5HUQA 1IEXA 5EWMB 2H1FA 5LQSA 3QKSA 5BUSA 3KQNA 1P5JA 1EM8B 2GRUA 2YQ5A 1BJRE 3ROGA 4LOLA 1ZM4A 1JVBA 2DLNA 2JHFA 1IOVA 2VDWB 1NQAO 4KKXB 4MJXA 3VR2A 4Q82A 4HZUA 3HFRA 4GZ5A 2QAGB 4FYJA 3P9KA 4HFMA 5DYGA 3STTA 3ZWQA 4A8PA 4CM9D 5ARCA 1AY0A 3M34A 5J58A 1OFVA 3STYA 1L3IA 4GUAA 1TVMA 4RMNA 2UYCA 1HM5A 1HRDA 4PBRA 2QLTA 2V0NA 4HQ0A 2VSFA 1EWYA 2W90A 2O2JA 2AFRA 4ND7A 4GSLA 3HC7A 4EHNA 2FW0A 1NZJA 2PGLA 2QAGC 2Y1EA 4I8XA 1RYHA 1YJ5A 4JI2B 1KP9A 3ZX4A 4YAJA 1RQRA 4E09A 2DFLA 3AL2A 3N58A 4M9RA 1X1AA 3ZE9A 2ZDQA 3VU9B 4OYRA 4FFLA 3Q3VA 3KJGA 1ZGJA 4F1JA 4MKXA 1BA3A 4DV2B 2FWRA 3TLCA 3I01M 3THXB 3FCUB 1A9RA 1UIMA 3FNHA 1M74A 1NXTA 4N3AA 5DNVA 3SZRA 1R0SA 2Q2WA 3G2NA 5E1BA 3VHRA 1DIHA 1A7KA 1U81A 2JVKA 3H5OA 3DLIA 3PQ4A 1IMJA 4OUKX 5ALFA 2RHOA 3PC3A 4DG8A 4EM6A 5EE0A 2CMDA 2MJLA 3SZMA 3NBQA 5JCOA 3BTSA 1NYRA 3WO0A 4ZN6A 1OYOA 1TRHA 3KB8A 2ZP1A 1PVVA 1LZLA 2PX2A 2NYVA 3DS8A 4C4OA 2PPLA 1UP4A 4GPBA 4EY6A 3EHDA 1G7RA 4JVOA 3O94A 1BDJA 2QVYX 4ENSA 1CFJA 1CTQA 4BGEA 4BFVA 5K3CA 3FWNA 1XMVA 2F3SA 5CK4A 2P2LA 5FPKA 5GONF 2XB6A 1R0WA 1TCVA 5JJ5A 2PGNA 3FETA 1AF4A 4H31A 5EZ6B 5DHTA 2QJWA 3EIEA 3IOMA 1GHTA 3R2JA 1SCJA 1UDCA 5AKHA 2HJ9A 2FEKA 1A50B 3BL6A 1YVRA 4EW3A 2YJ3A 3U39A 5DGCA 1VYVA 4S24A 3UGQA 5HS4A 1XFDA 2RIRA 1VMDA 3HADA 1ZN9A 1IRIA 3LLSA 3OCYA 5K6RA 1OVGA 3T7KA 1DO2A 1JXQA 3OZVA 6NULA 4ML3A 5THXA 2WEKA 5HKAA 4LK2A 1K6IA 4CM4B 2WICA 3SS8A 5G0WA 2C99A 3DGFC 3EDYA 3NBFA 1GILA 1N3YA 5HE9A 5J5AA 1ESZA 1QFYA 4F9GA 3FSRA 1QIIA 2EL7A 1OBHA 3PR1A 1FDRA 1V5FA 1BKSB 2Z3WA 2ZDHA