2DLCX

Crystal structure of the ternary complex of yeast tyrosyl-trna synthetase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
339
Chain Sequence
DPNEAFGLITKNLQEVLNPQIIKDVLEVQKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQFLDVDCQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKIGVADAINELLEPIRQEFANNKEFQEASEKGYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-RNA (76-MER)
publication title Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/trna
total genus 118
structure length 339
sequence length 349
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2dlcX02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dlcX01
1IH8A 1KP2A 4U63A 3IH5A 3U1VA 1O0BA 1TYDE 1NUPA 3DPIA 4MUIA 3RJZA 4EG4A 3X1KA 2YWCA 3FG9A 2HMAA 4DDKA 2GOYA 2PFSA 3CLTC 4H3SA 4RUKA 3IOCA 1O0CA 5IHXA 3TNJA 3S3TA 4MUFA 3PNYA 1MAWA 4MULA 3MUEA 2CV2A 1NURA 4GU5A 2YWBA 1U7DA 4MUEA 4MUNA 2HZ7A 1NYLA 4OUDA 3MLBA 3HL4A 3SEZA 3ISJA 3CVWA 5J5AA 5TS2A 4JYZA 3NV7A 1V47A 2V0GA 1EFPA 4F3RA 1MOPA 5TGTA 3CLUD 4MLPA 1J20A 1OWPA 2J08A 1KH3A 3Q4GA 4L2IB 2A1UA 1PFYA 1RQGA 3E27A 2PXHA 3IODA 3N2YA 1QRSA 2O8VA 3ZGZA 1J09A 2A4MA 3CLSC 2VTBA 1I6LA 1JIJA 5EKDA 3ND7A 3AL0C 3AKZA 4MQ6A 1N2BA 4I6JA 4ZT5A 1P7PA 4ARIA 3N05A 4CQNA 1R6XA 3SYTA 4J76A 3CVVA 3DLAA 4G5FA 1T9GR 1YIDA 1NZJA 2PZAA 3N9IA 3FNRA 1H3NA 1Q15A 4K0RA 4HPWA 2DERA 3FWKA 4MW2A 4RPIA 3RK1A 4MAFA 1T6XA 1MAUA 3VGJA 4PBSA 3AFHA 4NX2A 3P0IA 3H99A 3ZUGA 1GLNA 3H9CA 4ZCPA 1O97D 3L93A 2Z08A 1MRZA 1YIAA 2X0KA 4J75A 1SURA 4R2MA 2DXIA 1U3DA 5H7XA 3UY4A 3IUBA 1F4LA 5K0TA 1M8GA 1IQRA 2OQ2A 3CR8A 3SP1A 3ZJTA 3IMCA 3PXUA 1WQ4A 1N3LA 1I2DA 5HUHA 3AG5A 1M83A 2PIDA 2QUIA 1IFXA 3ND6A 2YY5A 1UFVA 3FI0A 4GRIA 5JBNA 1ZUNA 5IJXA 4EG6A 1I6MA 4KPUA 1IRXA 2A1TS 1QU3A 1JIIA 4OUDB 2VXOA 2BTEA 1T9GS 1WQ3A 1T6YA 1H1TA 1TYCA 1EXDA 3CVYA 1EUQA 1N2HA 1EFPB 2DUMA 1KQNA 4DDMA 1QU2A 3HMQA 3FOCA 1G8HA 2O5RA 3NBAA 2A1UB 1BS2A 2ZUEA 4HJRA 4ZT7A 4ZT2A 2VTBB 4BWVA 1IQUA 1JZSA 3KT3A 1R6UA 3OP1A 1N78A 4YP5A 4NZPA 4DE5A 3GLVA 1N2IA 4WSOA 4DJAA 1U3CA 3C8ZA 3D6UA 3FETA 2D54A 2AKEA 4CDNA 4S1OA 2CSXA 1EJ2A 2OV4A 4EG1A 1O6BA 2X3FA 4MWCA 4DLPA 1M8FA 5DB4A 1JHDA 3ZJUA 1MB2A 1TYBE 3IMGA 1QQTA 4NATA 3AIIA 5DK4A 1OBHA 2H29A 3K32A 2J5BA 1OWNA 1N77A 4MWDA 4AS1A 1V8FA 3A2KA 1ULHA 2JAXA 3ELBA 1JEEA 3INNA 5F23A 2AG6A 3CLRC 3IVXA 2YXNA 2GKSA 4QREA 1TEZA 3K9WA 2DETA 3X1MA 3H97A 2ZUFA 1QRUA 1VBKA 1J1UA 1ZJWA 4UZFA 3SZGA 1EFVA 2DEUA 1K4MA 1O96A 4YP7A 5K0SA 2CT8A 1U0BB 1NP7A 1N2EA 3MLAA 3UK2A 3IOEA 3KT0A 1JGTA 4A91A 5J58A 2A1TR 3FDXA 2D13A 4KPUB 3M5WA 4TS1A 1GPMA 1TQ8A 5HUJA 1IVSA 4ZT6A 2DR2A 1TYAE 1MBZA 3G6KA 3LE8A 4MVWA 1FFYA 1KKUA 5LLTA 4EG3A 2R5WA 4MUJA 3P0HA 1TFUA 1N2JA 5FO0A 3G59A 1O95D 5TEWA 3FHJA 1JILA 1KH1A 3N8HA 2PZ8A 1O5TA 2BYTA 2CYCA 1O94D 3SDBA 1ZH6A 3KT6A 2NSYA 1NUUA 4ND6A 1N1DA 4E1AA 1JMVA 4R0NA 4MW0A 1GTSA 3HZRA 2A7XA 1KAMA 1T6ZA 3HV0A 1LI7A 3L92A 3KT8A 4UZEA 1B6TA 1OBCA 5DASA 1G8GA 3JXEA 1QJCA 4YP6A 3VU8A 2XRZA 1NSYA 4KR9A 3CLUC 1DNPA 1VLHA 1XNGA 1K92A 2WQ7A 1OD6A 1QRTA 1U7XA 3RK0A 2QJOA 1F9AA 1WXFA 3TQOA 1KH2A 1N2OA 1M8JA 3Q12A 2ZP1A 3ND5A 1KP3A 4G6ZA 1WOYA 2QUHA 1PFVA 2CV0A 5H16A 1JIKA 3HFJA 1NUSA 4L2IA 1GN8A 2Z09A 4CT0A 3A05A 3LCJA 1YUMA 3ZIUA 1M1ZA 4MWBA 1O95C 2DPLA 3KFLA 4I6EA 3COWA 1EFVB 1YULA 1O94C 1ZH0A 1O96B 4MW1A 3LOQA 4QRDA 1VBNA 1O97C 1NUTA 3SEQA 2J4DA 4EF6A 5KWVA 2J09A 3PRHA 1N2GA 5J59A 1A8HA 2CUZA 3ILVA 4MVXA 4JFAA 3VRHA 2WB2A 3G5AA 1G8FA 3IVGA 4JXZA 4MW9A 3COYA 4K03A 4X0EA 3UC5A 3CVUA 2CFOA 4EFKA 1XNHA 2X1LA 3H05A 4R2LA 1GZUA 2QJFA 3GMIA 3COVA 3IDFA 1Q11A 1WXIA 1HYBA 1KQPA 4MW5A 3IOBA 2NZ2A 2QTMA 1F7VA 1PFWA 3TZLA 2GM3A 1VL2A 2JA2A 1JZQA 3SZ3A 3CVXA 3BL5A 4KR7A 1KAQA 3CA8A 4EGAA 1WJGA 4ZCRA 2WQ6A 4ZCQA 3HGMA 1OWLA 3F3MA 4ZCSA 4JZYA 5LFAA 2CV1A 2IJGX 1JEDA 1KQOA 2G36A 1WXHA 4U7JA 1X8XA 2RD2A 4ARCA 1EE1A 1MJHA 3P0JA 4I6GA 1H3FA 3A4IA 1I6KA 1Q77A 3GUZA 1X6VA 2I1LA 1PFUA 1OWOA 1ILEA 2E0IA 4MW6A 4PBRA 3TZEA 2C5SA 2E89A 2AZXA 2CYBA 2H2AA 4DNXA 5LM3A 4KR6A 1K97A 3UMVA 2IELA 2B7LA 1IQ0A 3RFFA 1OWMA 1WY5A 4NAHA 2QTNA 1NUQA 4FZJA 2PG3A 4ZCTA 4NDAA 2EJCA 4WNYA 4EG7A 4EG8A 2X1MA 1NI5A 4HJXA 4MUHA 1J21A 4XSVA 4MVCA 3FIUA 3QTTA 3TQIA 2QJTA 1S4MA 3RBAA 2V0CA 1MB9A 1XJQA 4HK4A 5KHAA 1XNJA 3QTBA 2Z3VA 3DV2A 4JXXA 4PBTA 1D2RA 3A04A 1KORA 4MW4A 3DO8A 2IP1A 3PNBA 3TS1A 3MMXA 1WXEA 5KCMA 1EUYA 3FH0A 5BNZA 4ZT3A 4PY2A 3IVCA 4G5YA 2JANA 4DDHA 3H9BA 1CT9A 4U8HA 2QUKA 2A88A 3UOWA 4Q93A 1J1ZA 4Q16A 4EG5A 1GTRA 3PNVA 1VBMA 1YI8A 5DEOA 5TEVA 1QNFA 2A86A 1G59A 1R6TA 3I05A 4YMIA 3OTWA 2EL7A 2RE8A 1QTQA 3D6VA 1WZ2A 4ND7A 3NBKA 3FY4A 2D5BA 4ZT4A 3QE4A 5FO1A 2QTRA 3AG6A 5AHWA 1GAXA 2J07A 3IMEA 4MVYA 1WXGA 2WSIA 4XFJA 2E21A 2PZBA 4QBTA 4KKVA 3CLTD 4MUGA 4P2BA 4OJMX 3ZJVA 1WKBA 2E18A 4YBRA 4CDMA 1JECA 3MXTA 4MUKA 1K4KA 4XFDA 1KR2A 1LI5A 4F4HA 2TS1A 2QUJA 1COZA 2A84A 1M8KA 3X1JA 4NAUA 1YUNA 4AQ7A 3CLRD 3P52A 4MW7A 1N75A 4MWEA 5FNZA 1IHOA 3IUEA 1PG0A 1FYDA 2CYAA 1LW7A 3ZXSA 2XRYA 1Q19A 1F7UA 2DLCX 3Q10A 5HG0A 3RHSA 1H3EA 2HGZA 1J70A 3CLSD 3COZA 1M8PA 1PG2A 3ZXIA 1Y42X 1MC1A
chains in the Genus database with same CATH superfamily
1IH8A 1R4NA 1C7IA 1D4AA 1XEWY 2PRJA 4OB8A 1E5DA 1HTTA 4AY2A 3I5YA 5B36A 2P6PA 1E5XA 2X7HA 3CR3C 1Z5UA 2AGVA 3R5KA 1JG7A 3UMRA 5KOJA 2C77A 3X1KA 4FYIA 3A7DA 3U31A 5A1TA 4BEWA 1CY0A 4ZEVA 3V00A 3GNSA 3HVIA 4PGMA 1PUIA 2HDHA 1QR2A 3EGXA 1NVEA 2FRXA 5FADA 2PVCA 3UIEA 3L6CA 3IPCA 1AZTA 4KNVA 1W4AA 3IOCA 1XP8A 3VQTA 1ECFA 2AV6A 5BSGA 1RADA 2BCEA 3OZWA 4F7DA 1TUIA 5CBPB 4HPXB 3IJPA 2XGJA 4Z0TA 4PWZA 4V2UA 3DOCA 4WFJA 4CN8A 3HRIA 2Q7OE 1SZDA 1NVVR 5AYVA 1GL3A 1U1FA 3BFKA 1RJDA 3QFSA 1Z7YA 1UMBB 1Z7EA 3ZHCA 3ZCUA 1J49A 1XVAA 1VA4A 2X1VA 3HDVA 3JVDA 2CNBA 4FCVA 3DOOA 4BP1A 4DC1A 4QUEA 3K6SA 3JARB 1S8FA 1VRCA 1XA0A 2E5WA 2HF2A 3RFTA 1OWPA 1OX5A 3KQLA 1KH3A 1QHHA 2D1QA 1E1NA 2HU8A 2FMXA 3ZH9B 3WL5A 2X7XA 1RQGA 5JI3E 4P34A 2Q2QA 1Z45A 4JI1B 4YHBA 3T4PA 1WB9A 5A4IS 1RE1A 1AHIA 1J09A 1DT3A 4JUIA 4D4HA 5AVRA 4WJKB 5HF8A 2OXEA 4D96A 4RF3A 4UE3S 3IR5A 4QJIA 1N2BA 2X0JA 4US2R 3FGOA 2HEIA 1IG0A 1EFTA 2E6KA 3PHIA 3ZGVA 5DOZA 3PDWA 4HDOB 4Z0NA 4ARVA 1KVSA 1YQUA 2AUTA 2RGUA 1XXHE 3TM4A 4A8JC 1XA4A 3N74A 3HB5X 2D7CA 2Z8YM 4HWRA 1A9XA 4LF4B 4ZIRB 4E2FA 3LGSA 3B78A 3DR3A 3WLLA 2JFOA 3N9IA 1X7DA 5CA1B 2F4NA 2JLCA 1M5UA 2C2BA 1NM5C 1BCSA 1ODTC 1HPLA 2VWQA 4KI7A 2FEAA 4RPIA 4ZMBA 1EG2A 3LK7A 2WU4A 4MAFA 1ATIA 2O05A 4JJ4A 2Z1NA 1MAUA 1TZJA 4NCJA 5DTEA 4G0VA 5EFOA 1H6DA 5I7SA 4KAAA 4P35A 2WJVA 3GRFA 1GWNA 4PEVA 4B81A 1E4VA 1NIJA 2IF2A 4G89A 4P4NA 4UM7A 1MRZA 4ZO8A 1GKYA 5G0TA 5THKA 3TSWA 1TE2A 2ODWA 1P1JA 2XZDA 4DWOA 3TRIA 3O74A 5K8VA 3UK0A 4ETIA 3INTA 1N32B 3DYBA 4LQDA 2MYUA 3HP4A 1W36D 4JZKA 2ODNA 3MG9A 1OYYA 4E15A 5GMOA 1E32A 4V1CI 1KBOA 4M53A 1F60A 2C5HA 5BW6B 1QDLB 1ZP6A 4QYTA 2B61A 5F3DA 2GXAA 3M8KA 1UWKA 5F9FA 1MOQA 1TTQB 1YA4A 3DDWA 3TLEA 2HA0A 4Q7JB 2B21A 2HK6A 2A33A 3SN6A 2QJWA 4ZVUA 1NN1A 3BWDD 2R4TA 1GGVA 5HXAA 1MQSA 1BSVA 1JSZA 1QYRA 1RAHA 1V43A 3QI2A 3OMWA 3X1YA 3ZK8A 1RWMA 3QEMA 1D1PA 1GPNA 1UKAA 4XTRA 4ZARA 1OX4A 4WOPA 6CHYA 3GL9A 5JLJA 5G0WA 3JSXA 3JRNA 1VE1A 1FK8A 2PX0A 5JR3A 1YA8A 2IYQA 3GROA 3O38A 1EFPB 1ZOSA 2QB5A 4CDRA 1DTEA 4FGWA 1J0AA 1KEPA 2GFQA 3KU1A 4QTXA 1JHXA 4R2WA 3KCNA 4I7EA 4UU7A 3ZV6A 4OXQA 5IRCD 2F1JA 2FZEA 2OZVA 2ATIA 3IFSA 4JAVC 4S0ZA 2AOXA 5AICA 2GZ1A 3BWMA 3GEIA 3ZLTA 5ER9A 1KQ3A 4CIDA 3D4NA 3IEVA 3MELA 1V0JA 4JUBA 3KZOA 1JZSA 5HDQA 4D82A 3W8FA 1VSQA 4G0UA 2VSOA 2YZNA 4NZPA 4WECA 4UTXA 3TAHA 3GLVA 1OZAA 1SKYB 1TQ2A 2HQRA 2P5YA 2P6UA 1IOVA 1E2PA 3LT5A 3GAAA 2M6KA 4P8RA 3IX7A 2AHRA 2VBGA 2VNAA 3QA3E 1C0PA 1A3CA 4K3VA 1FS6A 4PCVA 2JFNA 1WOMA 2H4WA 3RRFA 2V9PA 1L7RA 1TCAA 3WLOA 1Z8NA 3RTBA 4QBFA 4RZHA 2OHXA 1D04A 5BV2P 1ZITA 2FXIA 4NATA 5BY2A 2ZU0C 4MVJA 4RY8A 2VT2A 3U4GA 2NO1A 3TKYA 3QBEA 2H07A 1OYVA 4AS1A 4FFOA 2X5KO 2CF6A 3M4YA 2OGTA 2X8JA 5LP6B 4W1PA 1FDVA 3ICVA 2NUBA 4EABA 3QTLA 5COBA 4MQ4A 5IP5A 1LX6A 3LGAA 1YE3A 3A2NA 2B1JA 4NYMR 2O2HA 1E6MA 1Q0ZA 3TUJC 4PX9A 3LF2A 3AR7A 4BBZA 1RXVA 3ON5A 3SBDA 4CKBB 1Z2NX 4HDMB 3CE9A 3H19A 1ZD2P 3SYMA 1K4MA 3IAHA 3K9BA 3QW4B 2CT8A 3F47A 1XZCA 1GFIA 3CISA 3LDHA 1HNWB 1A9QA 1A72A 2OYSA 3N6RA 4MKIA 1PT7A 3IE1A 3T41A 1IULA 2Q6LA 3L7NA 1Y6QA 1B3RA 2ZROA 4WGGA 5KOYA 5CFMA 3NG1A 2PVSA 4ZU6X 4R51A 4PSDA 3E9ZA 2GPBA 3N0RA 3FDZA 1QR6A 3OQMA 1QCYA 1AN9A 3PQ2A 1XEAA 2XUQA 2P27A 1IVSA 1CD5A 2ORYA 1VJDA 4GX5A 1WMEA 3EXEB 4Q1AA 4CT4B 4DQVA 4EO4A 4AKEA 3GGSA 1NKVA 3TUZC 4NH0A 1NQ5A 1R0KA 1UBNA 1MJGM 5T4FA 2FW7A 3EFOA 3MINB 3R5TA 3R23A 3KJNA 4RTRA 5CCEA 5HK8A 4M0PA 1JBQA 2EFYA 2FN7A 4M86A 3DL4A 4Z4HA 3AVWA 2JI4A 3RODA 5JCXA 1PGOA 2QN3A 2Z3WA 1JMVA 1V35A 3LS2A 4R0NA 2OSVA 1ZONA 2P4EA 1U5BB 3SJAA 4BNHA 3DBOB 4DXDA 1BXGB 4LC0A 4WNAA 2QR5A 5BYJA 4CGYA 2GEFA 3FGZA 3ZTWA 3KB8A 4MVJD 4YP6A 3CF4A 1Y3IA 3L0DA 4D9FA 2PBZA 3IHWA 1RKQA 4BQSA 1VE3A 1VLHA 2BZ0A 4XUCA 4ER3A 3ND8A 1B16A 4WUTA 4EY5A 4XIFA 1E9EA 1MT3A 1V5GA 5BMVB 3F4KA 3U7HB 3AP3A 3GBSA 1XZAA 2EFJA 3G1WA 3KJFA 3EY4A 3TQOA 2ZLBA 4NZMA 4L8YA 1JHPA 1I4WA 3BYZA 3DZDA 3RUAA 4O2BB 3DE0X 4BGEA 1Y8QA 5B2EA 3GCXA 3GJ4A 2F1OA 3AVYA 1XTBA 3MB5A 1Q57A 1LBIA 2HRZA 1TL7C 1A1VA 1KAEA 1CRLA 2BPOA 1Y4ZA 4GH5A 3TL2A 4MYTA 2HV8A 1QHIA 1ZBQA 3DZHA 3KD3A 3BFVA 1U2EA 5AKXA 3TI7A 2NG1A 4FNGA 3EZGA 3QJYA 3TLGA 3TRJA 2C9BA 2ID4A 2OOKA 1O95C 1FJHA 3QELA 4V39A 4YAIA 5DXAA 1K4YA 1UKEA 3W5JA 5BRJA 1SGWA 4EG7A 2ZKLA 3MWEA 3ORFA 4Y2UA 2OLJA 1E1RA 4RVSA 2UYYA 3LOQA 2AKYA 2Z2JA 3DF7A 3K0KA 1XPJA 1LLQA 2JLZA 3OM1A 3H5OA 3DP9A 3PKZA 3QKSB 4G01B 2TMKA 3W5IA 4D81A 3M3HA 3Q3IA 1T5HX 4B3FX 4R71A 1K7XB 4G0WA 2FPPB 3OZSA 4S05A 2GPWA 4LDPA 3RVDA 3OVMA 4UFOA 1P39A 1Z17A 1NNUA 3AO0B 2CVOA 1Y3HA 4Q05A 3DUFA 3QVOA 3VRHA 1ZZEA 2Q6TA 4X93A 1ZD9A 3HLTA 1VHTA 3COYA 4K03A 1IY9A 1EP1B 1OXKB 1T5IA 2PL3A 4PANA 3SQDA 3BWBA 4YH1A 2YIVX 4EFDA 1W8DA 4OQ4A 3LKBA 3WLKX 1QK5A 5ELLA 1CDDA 2D2IA 2QM8A 3GJ8A 2JK0A 3THRA 3GZTB 1ODFA 3EMDA 1RBQA 4LMRA 4BVAA 2XMZA 4ZGBA 2JLUA 2R3SA 2W9XA 3U3XA 1T5SA 1X1EA 2EZUA 5TR9A 2BT4A 2UU9B 1A1SA 1H2EA 1U3UA 1B2LA 1LK5A 3AW8A 1QGAA 2VHYA 3BXXA 3EAFA 3NTVA 4LZLA 4NCNA 4R41A 4YUYA 3RU7A 3PX7A 4PLVA 1JZQA 5T5QA 5LL6P 1XCPA 1TUBA 1OZGA 3I9MA 2FPRA 4CTOA 3IKTA 1I3MA 2GAAA 3ETCA 2DPYA 2G6BA 4AJ2A 4DWWA 4DLYA 1QYWA 1G6KA 5FF9A 1EUZA 4D56A 2O3RA 1KU0A 2OSBA 3J81k 3B1WA 1JEDA 2WF9A 1LZKA 3ZD6A 4YT2A 4A26A 3L8ZA 4LF6B 4EJ6A 1ZD4A 2DT8A 4IXMA 2BFDA 2ZB8A 4LY6A 4UUPA 5C1DA 2X13A 5ESXA 1A9ZA 1NFRA 1XTKA 2OV8A 2PKQP 2HQOA 2XQGA 3K0CA 5T67A 4JLSA 1VSTA 4J0QA 4OA5A 2V5UA 2I1QA 1Y1LA 2IU0A 2B6HA 2UV8A 5K9ZA 1QAMA 3CZCA 1CETA 1RYBA 4KR6A 4NE9A 3NXKA 1QQ6A 4NS4A 1O2DA 3K09C 5DHFA 1E6UA 1PL6A 3C6KA 3UMGA 1SXPA 5F9MA 1P31A 1W47A 3KOZA 3NNNA 2OHOA 3W77A 1NI5A 5KKCA 3NEYA 1NE2A 4B3GA 1J21A 5THXA 4K6KA 4IJMA 2IZ5A 4EQZA 4YMSA 3GNTA 1ECBA 1S2MA 2HEGA 3Q0EA 4MCAA 4YGXB 3ND9A 4QPCA 1E1LA 1VFNA 3LBFA 4EHFA 5JANA 4AJIA 1OFVA 1FDOA 1IXZA 1UPCA 3DB1A 4AZ0B 4H4EA 3RU9A 3BS4A 3HACA 2FRVA 1VDZA 1KI8A 2P69A 3QQPA 4MGIR 4RK7A 3PUKA 4LYGA 4DR6B 1J90A 1UXGA 2GVZC 1ZK1A 2WM8A 5EJEA 3L7BA 2VF4X 3WA6A 4ZCLA 2Y6VA 3BIOA 4KFTA 4DDHA 3KOUA 4LVUA 1E2GA 4HYYA 2W4QA 2QWXA 3S99A 5CPBA 4RVNA 1RQNA 5IASA 5CBPA 4GXNA 3HMKA 2O1XA 4L51A 2C99A 3D4IA 1RWWA 1SA0B 2IOHA 3BMQB 5LNK6 1J8VA 3SFVA 4S1WA 1UMBA 3TD2A 3GQBB 4U6SA 1Z62A 5LU8A 2XVAA 2J0VA 3ZWQA 1K6XA 2D5BA 2ZUUA 3RVOA 4ZO7A 3BD8A 5MF6A 1OT3A 4C4YA 5HYVA 1KRHA 2Z6VA 1ZIXA 4Y67A 1E7MA 3WA7A 5HPYB 1U5CA 4L0QA 4B74A 2GR9A 1B0UA 4G97A 3WFIA 2E21A 5C8XA 1JG1A 3LF1A 4QOSA 1XMVA 4OJMX 4MWOA 1Z68A 3RUFA 3IA2A 2POQX 2PSFA 3I5UA 1MN6A 5HBRA 4B4VA 1R5NA 2BHLA 4R9SA 3SS9X 1EP9A 1T2CA 3V4PB 1Y82A 4AS2A 4QHSA 4G9GA 4TWAA 3A6HA 3V7WA 5I01A 3EPJA 4AVYA 1LLUA 1Z34A 4RORA 1KAHA 3W5SA 1E2UA 4ZIRA 1N7GA 3EA5A 3J81A 4LY9A 1DZ3A 2IGTA 1C7JA 1U9IA 1JEOA 1H2BA 2Q8PA 4KYVA 4NECA 4XM2A 5CA1A 1TM3E 5AW7A 1DLJA 2XY4A 5AIAA 4PVDA 3MGBA 4LSZA 4MAAA 4QPNA 4CM6A 3K70D 2P7IA 3LI2A 5IF3A 1KL7A 2I4IA 2ICAA 2VCYA 1U04A 2H2DA 2W48A 4TMFA 2RG7A 3DDCA 4TWJA 2XYPA 3N8NA 4M0LA 2JBAB 3W6PA 1ZCAA 4ENSA 3VISA 5KHLB 5JNRA 4LYAA 3T4UA 4CLRB 1W49A 1DG9A 2QQGA 4HL6A 4DR2B 3Q72A 4DBLE 1DKRA 3JQCA 1X92A 2HCFA 2ZI6A 1C3JA 4PC1A 4AC9A 5I7OA 1JLRA 2W6MA 1G60A 1WDKA 1YRWA 4ZQEA 4L0CA 1EX7A 5CB8A 2ERXA 2RGAA 1GIAA 3AR8A 3FG9A 3OTGA 2HMAA 1Y1KE 4C76A 5FFNA 4W5OA 3AIOA 5TJ9A 2GSWA 3DXFA 3Q7SA 4LQCA 1E0KA 5CNJA 3VNSA 4MUFA 3TTSA 3WNQA 3X2FA 2JVJA 4GQIA 3H17A 1C3EA 3GP3A 1MO2A 4UOQA 1NURA 3PEWA 1C7FA 1IB6A 1RHJA 1GZ4A 2R8RA 2BD0A 1WMDA 1V7ZA 3GRYA 3V4VB 5K3OA 3UAXA 1GFSA 4ED9A 4HLUA 1TGYA 3NHRA 1PZHA 2V5VA 4FJ2A 2AXPA 4C4AA 2YS7A 4M38A 4WK2B 3H16A 2FPMA 3RAPR 1NP6A 2VC2B 4EYEA 1K88A 2W2OA 3FHCB 1W1UA 2COKA 1EX1A 1EFPA 2I8AA 4MH0R 2PEZA 5EWMB 4INOA 2PIAA 3JTMA 1AQLA 3RS2A 4F97A 3ZDXB 4WJLA 1MOSA 2FMIA 2EYQA 2QD4A 4G1CA 3HK2A 3U13A 1FQWA 1SVLA 1UQRA 2I80A 4NPAA 3NFRA 3L8GA 1T3LA 1V1MA 3BQ9A 3ZJ4A 4F7WA 1YB7A 3ZEIA 1J8DA 1TIPA 1ZL2A 2HQBA 2P9EA 4PQGA 3ZLBA 1V8ZA 3JWGA 5DT9A 5IDYA 3UJ8A 5K0NA 2GN9A 2A2ZA 2DQYA 5CTJA 2G0TA 4GOJA 1RYFA 1IM2A 3ZDRA 1KMIY 3N05A 4IDQA 1C0KA 1U11A 3B6EA 4O2RA 1H5UA 4J76A 1N5IA 3L2OB 1EWYA 2H4HA 4CKYA 5L45A 2ZUEA 2SKCA 1BS9A 1BWSA 3QY9A 1D9XA 3CY6A 3EUEA 5FTKA 2PTHA 5G0UA 4AZSA 3ORYA 4ZYLA 4LV8B 5FDFA 5KNCA 1YIDA 3E1KA 3QNMA 1KIMA 3ZIAA 5LZ7A 1K8QA 4WAUA 4K6FA 1L7DA 4X44A 2POCA 4FZVA 1IBLB 1XTTA 4L95C 5IFKA 3P2KA 1VPEA 5CLJA 3L0SA 3VMFA 1J6UA 2AA3A 4ZQGA 1TD1A 2H3EA 4J2OA 2H1LA 5ICEA 4YR7A 2NAFA 4UFNA 1TI7A 4FOTA 1SG0A 2AMYA 2D4AA 1HI9A 2LDBA 3D7NA 3G0DA 4PO9A 5DGCA 4JJZA 3TJRA 3V1NA 3ZCXA 4R4JA 3V7NA 4A03A 2YWRA 4XCVA 5BUSA 2WHQA 3A1TA 1VP9A 3IP9A 5LP6A 4TKUB 5ETJA 5CFQA 1H8HA 1R10A 1ZNWA 4RCVA 1OREA 2QE7A 3IP7A 4JU9A 5ENZA 5ES3A 4EKGA 2OK8A 4PZCA 4RGQA 2VPXA 1G8AA 4RVFA 4EDFA 3NEAA 1KI6B 2MOKA 3U7EB 3DBRB 4KXUA 3W05A 6ADHA 1RRCA 4WOBA 2HCTA 3RIYA 4FDVA 5CUQA 2F9LA 2YW9A 1ORDA 3E5HA 1ZOIA 1NN3A 3JSAA 4URZR 3QV1A 2QT0A 3AR5A 4DYDA 5BNIA 5K0TA 3ZHSA 2VHWA 2AR0A 3AEYA 4HDMA 1DJNA 4CKBA 4E32A 5JROA 1PJBA 3GPLA 1H4QA 5EGNA 2PWPA 4UUMA 5FLKA 2Q41A 4RHUA 1G3QA 4L50A 4CL3A 2ZI4A 4FIZA 1U3FA 3ABIA 1KJZA 3GNQA 2P9TA 1JJFA 1G19A 2OZLB 3B60A 2DY0A 4QEKA 5DDIP 4BRZA 4PYLA 3ZWAA 2G4LA 5LBUA 3Q6NA 3BJEA 3OKAA 3JQGB 3ILHA 3LCMA 1WW2A 4O59O 2A1TS 3AXSA 3ZEAA 3WMFA 2RK4A 1ND5A 3H8SA 1Z38A 2E4UA 3GJXC 1MENA 4NHEA 4JLJA 1JDUA 4QNMA 4R16A 1NQOA 2PX2A 4A6XA 3IEUA 4JH0A 3RSCA 2H31A 3EXEA 3NBXX 2VSXA 2W6ID 1YNSA 1FSFA 5EVCA 5LZ9A 1QFXA 1NATA 1SUAA 1GDTA 3FBTA 3PNMA 2PMKA 3VPCA 4QWMA 4B87A 4NC9A 4B6JA 3LYHA 3JR3A 2C5LA 3M9XA 5CGQB 4YV1A 4ZYWA 1ZJJA 1VMDA 1ZCBA 2NTYC 3B5IA 1DBIA 2X8AA 1INLA 1XTQA 3ELUA 2I3BA 4FSXA 4AECA 1DI0A 4HLNA 4ZD6A 3UA3A 5CB4F 5IXSA 2O1WA 2M32A 4WY5A 3UW1A 1TW3A 4EX7A 5KNCD 3ETDA 3ZIAD 1CY7A 4DA8A 3BZBA 1YV9A 2F9FA 2YINC 3RB8A 1SAYA 1U5BA 3DFMA 2AN5A 4U2GA 4EVRA 1BXGA 3A31A 3DZFA 5EPOA 4ZJYA 2VQ6A 1WBBA 1ELOA 1RYNA 2W22A 2QLJA 3RC1A 4F3TA 3PX2A 2WIKA 3ZH2A 4CDNA 1X7XB 4QUHA 1VKJA 1O6BA 1Y33E 3DXZA 3N6VA 3PC8C 5T41A 3RASA 3E22B 4P38A 4YTEA 3C6YA 1E18A 1Y7LA 1MXFA 1MPTA 5CM8B 4Y2TA 5TV2A 1P4JA 4NEQA 3KEGA 3GEPA 4J0IA 4BQOA 4EZEA 1H8HD 3FX2A 3JW8A 1DJOA 1CY4A 2QE7D 3OX3A 4LMAA 4MZXA 2ZB4A 4PHGA 4TV9F 4KWCA 3SX0A 3DT8A 1FDRA 5HKKD 2II6A 1O9BA 3L18A 3AVXA 3CCFA 5AW8A 4O2BA 2I78A 2OG1A 3H2KA 1P9OA 1N1GA 3PWKA 1FU4A 4N1AA 3D2LA 4ISBA 4EDHA 5IJZA 5LSAA 3T5TA 2JAXA 5IT5A 2NTEA 1HOTA 4WCFB 3NTUA 1NHWA 2JIBA 3EJWA 1II9A 2XMPA 5DHAA 5K7SA 2SICE 2JGMA 4K1LA 1IHDA 5JZOA 5LDHA 3X0DA 3TGPA 1W75A 1GPDG 3KWJA 3V4OA 3OQ6A 2YJ6A 4FFMA 3E4DA 5U1PA 1M2KA 4HAYA 1HE4A 3WWZA 3AERB 3Q8LA 1WETA 3H75A 4AWXA 1ZHOA 2W2LA 1VI6A 3WXMA 3H2HA 4KIUA 1YVUA 4XGNA 2FPLA 3DTYA 1KS9A 2WP0A 4PZLA 4BLRA 4BNMA 2XRFA 1QHNA 1T4BA 2Q28A 3PYXA 4YP7A 3LQYA 2RJ3A 3T3OA 4K9MA 3HJCA 3Q9UA 3QVLA 1CEYA 1ZWLA 3QKSA 4IRUB 4Y30A 1AC5A 1NBIA 2NNWB 4V0QA 3IAS1 1N57A 4IDAA 3WBJA 4BC0A 1L5RA 1YIOA 3LUKA 4P3YA 3L6OO 4DF3A 4D4GA 3HXQA 3ASYA 5L7YA 3TR0A 3JQEA 3SR3A 5GZ3A 1WM1A 1AQ6A 2A3RA 2EBHX 4QODA 3R5HA 4C2UA 2I6UA 4HBZA 1FFYA 5JCZA 5IABA 4YUVA 3P0HA 1ZUHA 1TFUA 1U8YA 1FFSA 2QVYX 3BE5A 3LZDA 4QA9A 3S0JA 2PLNA 4GHWA 3OT1B 4J07A 3STTA 3I53A 1AK2A 3NIDB 3TBHA 1K8XB 2WMYA 5IF9A 2PD4A 3PXGA 3GF4A 4C1BA 2O2GA 1ZIPA 3F67A 2AFHB 3NW9A 4NV0A 1XDBA 3WVNA 5KYWB 4JYCA 3WJAA 3SY8A 1PJLA 3GIWA 3U0BA 5ESRA 2V7UA 3X43A 1GAEO 2A7XA 1EXWA 2DFVA 3QPAA 4YQEA 3OURA 4UTOA 1T6ZA 1ZN2A 2H4FA 2IPAB 4MV6A 4ZVPA 4B3JA 4CF5A 3OEYA 1DEOA 2BEWB 1MTOA 1ZSNA 2C8VA 4LRTB 3BAZA 4U9UA 3ZWDA 1MH1A 3E9NA 3ASUA 4HNUA 3AF6A 2E87A 3ZHQA 1ZGZA 3BB4A 3LCVB 5C7IO 5AJXA 2D5AA 2P2ZA 5EP1A 1DARA 2BUBA 1P81A 4JXJA 1QPZA 3B36A 3DBLB 4MWGA 4KN9S 1KEUA 1NYQA 2PWZA 3KJXA 3KQTA 3L43A 4DM7A 4GXTA 3R7WB 5KWSA 5AOBA 5K3BA 3VNRA 1KH2A 3U7IA 3GB9A 4HSGA 4PZPA 2ZFUA 4ZEXA 1SKAA 3SLRA 1JDTA 1WDWB 3IP3A 1JQJC 4TVKA 1BE0A 3EMVA 1XA3A 2O54A 1QMGA 3H8JA 5DT2A 3V32A 5DX0A 4XLLA 1R1DA 4PGFA 4RIHA 1G20A 3HFJA 4AO6A 1VIDA 4ZI3A 3PE4A 3ERCA 3I30X 2UUOA 4L15A 3W7AA 2JG3A 4J2HA 2VQEB 2FFHA 3LVQE 4LS3A 3RIHA 4XYMA 2WJYA 3E7PA 2CDNA 3OPXA 4Z7OB 3OU6A 1OI3A 1DEHA 3EHEA 1UZLA 4I6EA 4WXPA 5JPDA 4M8KA 3EVZA 4PXAA 2IZ1A 2R1TB 1OZ0A 3I34X 4AZ0A 1CF4A 4YAUA 3W7BA 2JLQA 4E7PA 3B1JA 3B53X 3JYQA 4H7JA 2IYZA 1HXHA 3O2SB 1FDSA 4CUZA 1R18A 3PPVA 4TXJA 2J09A 1XX6A 1K3FA 4R5MA 3STHA 4RPKA 1MX5A 4R6XA 2PUFA 2JZCA 1PNVA 5DN6A 3GEBA 3UKDA 3NVKI 4IV8A 2HPHA 5G4KB 1W36C 3AOEC 3OUTA 3PD0A 2HJHA 4HGZA 3IEIA 1RYZA 2AG5A 5A7GA 5ALVA 5BVHB 1SG6A 4MJ3A 4ON9A 2VJYA 1JKJB 1HORA 1PJSA 1SA0A 2FWRA 3BMQA 3GG2A 4FONA 2RGYA 3F98A 5KHOC 1KDZA 3GQBA 3LYUA 1UDAA 4LPKA 5JRJA 4WY8A 4WLFA 3GJTA 2A5DA 3SSAA 1W44A 3IDOA 5AKKA 4KYIB 2VNJA 1YB2A 3A1VA 4BE4A 5AP9A 3PVSA 2WAAA 3GEHA 3ITEA 2D00A 3IQGX 4FLFA 4MS3B 1W94A 5EMJA 2DOKA 7MHTA 1P77A 4I5EA 1T0PA 4E12A 1RACA 3CVXA 4Z99A 5HKOA 1OI7A 2BV3A 4MYUA 1M2NA 1PR4A 4ZCRA 3AVUA 3NP7A 5CH3A 3QYPA 1XSEA 1DADA 1OWLA 1H8EA 2IUEA 3F3MA 3HGQA 3HJGA 4LTDA 4ZCSA 3I72A 1N2CE 4C01A 4Q15A 4DEVA 1V1JA 1Q92A 2O3TA 2CL6X 3ILSA 4I3HA 4RIEA 1GT6A 5FB3A 4K1XA 1OFIA 1XF1A 3K16A 4HAVA 4BTEA 1X6VA 5FWNA 1OC4A 1JDVA 3C16C 1EWRA 3OE7A 4E5VA 1H93A 1XB2A 4NYJR 4TYPA 3Q2IA 3OPNA 2C2ZA 2WWHA 3UM9A 4YJ3F 3ZPXA 4CL8A 4BMDA 1GNVA 4D8TA 1F0YA 1HDRA 1TC1A 3E7XA 4LDZA 3DCIA 1V2GA 5JEDA 4KNYA 1TQDA 1U0SY 3PFIA 4IVQA 1CUDA 3MTIA 3ESBA 2F3PA 2IHYA 4QU5A 2BDEA 1E7RA 1HZJA 4MKZA 2JBAA 3I6MA 5DULA 2XKBA 2PKXA 2V6GA 2ORIA 5HCNA 4CLRA 5EEHA 4HNSA 2FV8A 1QPBA 2O3UA 4Y0VA 1P2FA 5E4FA 1KSHA 1RYDA 2OGZA 3IR6A 5DN6D 1MB9A 3PUYA 5LR6A 1C8BA 2VPQA 2R25B 4DQUA 1U2DA 5EFZA 1PFKA 1HDCA 1N9KA 2IUFA 2VHUA 4PZZA 2CL5A 4RD2A 4D2IA 4MQ5A 2NN3C 1KI4A 3RSGA 5SY9A 1R9JA 1R4AA 2JA1A 2O2DA 4N6GA 3SJ7A 1Y6GA 1I0LA 4R7TA 1ONNA 3FPEA 5H70A 1UC9A 4GPZA 3Q15C 4CR6A 3AP1A 2ZTUA 5ECYA 4C20A 4NMWA 5B7PA 1AUVA 1VZ3A 1DC6A 3K2QA 1UIMA 4C6TA 5A6SB 5KCZA 2J7PA 3OWXA 2OHIA 4IIJF 2FI1A 3L4SO 2PKCA 1JFVA 1XGKA 3UOWA 2ZBUA 1EU1A 1S8OA 2E1PA 3A9SA 3OZGA 1DJMA 3DGEC 3NHKA 1GITA 4MTLA 5GADl 4PFJA 2J0SA 1UODA 2EWMA 4LK3A 3BE8A 1Y3CE 2V6BA 1NSTA 1CERA 3WL6A 3GH3A 4IKPA 2BJVA 3I05A 1ISHA 1H9AA 1ZK4A 2AFRA 2G28A 2VK4A 3G23A 4IDNA 4BOYA 1E1QD 1H8ED 2ZYIA 4IL5A 4NONA 4ND7A 4IYJA 4D9GA 2JEOA 4ZVMA 5EWMA 4RHCA 3T0IA 3R41A 4EI7A 3UAWA 2B0JA 3KYCA 3IEXA 3Q7QA 1N5DA 2X86A 3OM8A 3WK7A 5AJUA 4FZ5A 4BMNA 5BW8A 5IDWA 4KKVA 1PR5A 3OE7D 1DQYA 1G291 1M33A 2QNBA 3FGNA 4LJLA 4IKOA 4NE7A 5F21A 4ESOA 3V42A 2R8YA 4JUDX 1SHKA 1FUKA 2CF5A 1ZJ4A 1LRLA 4XB1A 1K4KA 3L82B 4ZRNA 4N48A 1NXTA 1PN3A 2EFCB 1BIFA 2DPXA 4MLCA 2VDVE 2R7NA 1GU1A 4YQZA 2JH8A 1Z4KA 3DEYX 3MNFA 1P4AA 1VMEA 4V3BA 4C3VA 2TMYA 1AGXA 3H1FA 2NW6A 3MVEA 4KKXB 1F2VA 1DOZA 1G0NA 2XF8A 1PWXA 3OIDA 3P4XA 5FWXB 4MLDA 3WAJA 3U80A 3NIGB 3W8RA 1BE8A 1GKKA 3W6UA 3QU2A 2N46A 3H2GA 4MRSA 1AX9A 1RD4A 1Q19A 4GMHA 3W2IA 1EFAA 4CW7A 5DX1A 3LH5A 5AVTA 5JD4A 1K0FA 4HH4A 4NU8X 1E3DA 3H5AA 3RHSA 1M67A 1E3LA 2NU7B 4J16A 1H3EA 1NZDA 1ECJA 3QOFA 3R7BA 3S2SA 1Y80A 3U2QA 1J39A 2BJHA 2IA5A 2BM9A 4A9AA 4OTZA 5DU2A 1NVFA 2O7SA 1LEHA 3GRRA 4PQFA 4TKUA 1QWOA 2PLFA 3E3NA 4JP1A 3TQSA 4N3BA 2JJQA 3ZDYB 5FTNA 2NWQA 4DPMA 1KI6A 3DBRA 4L8WB 4JIMA 5JY1A 3MM4A 4EG4A 4FQ8A 5E3IA 4HVLA 1CQJB 1QBGA 4TLEA 4AJ1A 3NT5A 2ZXFA 4Z2AA 4MB2A 2P4QA 1KIFA 3LA8A 5EOVA 3ZY3A 3VR5A 3PCXA 5BNTA 2ST1A 3OF3A 3RSHA 3LJKA 2WG2A 4M1QA 3ETLA 4BX0A 1FX0A 3WQHA 3NAQA 2OZLA 1GCGA 1RXYA 3ANYB 2C2XA 2O06A 5HGJA 4RLQA 4FOOA 3JQGA 4MUNA 2IQ5A 1JSCA 1PX0A 2KQUA 3EIXA 1GOTA 4C22A 4EMSA 1DPFA 2PKRA 4N3NA 3NMUF 2HPVA 4PLWA 2HY7A 4TS3A 1T4DA 4U2DA 5EXTA 5AHXA 3IT0A 4FE4A 1G8SA 1YL5A 4F3RA 4BB0A 4KVFA 1SWWA 3GFRA 4QFDA 5G1PA 4BFTA 4Z4CA 3KLPX 2JVIA 3UPTA 3T35A 5DBIA 3CG4A 1BJRE 4UHCA 4FMBB 4JBHA 2YHAA 5EIEA 4K9OA 1PSWA 3MIZA 4JT4A 4IJ6A 5H1YA 5C34B 1XJ0A 1UK7A 4EECA 1UPTA 5B4UA 2XZOA 4FM9A 5AW4A 3M1IA 4J7AA 2WLTA 3LQ2A 4J1TC 4S2EA 3R9IA 3Q40A 1GQSA 1R0RE 3A37A 3L1VA 4JXKA 2BGKA 2I7VA 4O8CA 4A92A 3N5CA 3GGJA 1L5NA 1YI0A 3A9WA 2WHYA 4OL9A 4J6EA 3CVVA 1MOZA 1MJNA 3II6X 3NHBA 2CMFA 4G5FA 1NOJA 3OTIA 1X7XA 4TTJA 1H2WA 1T9GR 4GVXA 5LYJB 3E22A 4JMPA 1LBEA 1Q12A 2PJUA 1CJCA 2WUWE 2PZAA 2XADA 3DB2A 3ES9A 3QHPA 3QVMA 5AKGA 3X1WA 4QD3A 4D92A 3E9YA 4CKZA 1FDIA 2IYPA 3R3SA 3WWDA 4MW2A 5I7HA 5JZSA 4PAGA 1PUXA 2H1HA 5ALXA 1OI4A 2V7PA 2WA2A 2ETVA 4EELA 5JRDS 1Z0IA 1CW2B 3ADPA 3OU7A 1O89A 2JI7A 2M6SA 3HJUA 4UATA 1BMDA 2FDXA 1NW3A 3QKWA 4GPIB 3BBLA 1QPGA 4WCFA 3TD9A 2V7GA 3OTOB 1KVUA 4IGAA 1DXOA 3HYRA 3VR5D 4JLWA 3CXRA 4YT8A 2WJJA 3JQFC 4QPJC 4BFSA 4JBXA 4TQUS 1J97A 1QZUA 4B73A 1MMFB 2F3QA 1F8FA 3AERA 2I6FA 2Q9AA 1IK4A 3SDSA 5A9RA 2GBLC 3TPFA 3WGYA 2A9FA 3LL7A 1E64A 4RXUA 3DEKA 5ENDA 4REQB 3FOEC 1JFLA 3AILA 5A4MS 3U44B 4GP6A 4KFSA 2NUTB 5I9IA 3GLIE 3OESA 2A5GA 2RCYA 3CUKA 3QJ5A 2CNNA 1VSBA 5FXMA 1BU5A 2FMFA 3KUKA 3RANA 2OG2A 4AQYB 3M49A 1Q83A 2I2WA 5D00A 3F6RA 2LDXA 3U5TA 4O29A 1XLTA 5BO5A 4H0FA 4HEA6 1UDWA 5B3JA 3EEIA 5A4FS 2EFDB 5ITVA 3EGCA 3RS5A 1AF7A 1OXXK 2BKLA 4QTTB 4AFNA 4UTVA 3I9KA 1TVMA 1IZ9A 1NVKA 2FPOA 4TXMA 4TZ0A 1V11A 2H17A 5GPBA 1X13A 3JVVA 3NAZA 4WERA 4LE1A 1QU2A 4L8GA 1XRJA 1EX9A 4TV9B 3GV0A 4Q3LA 3OT1A 4YUXA 3PUIA 2PXCA 4ZQFA 5EESA 3WGJA 2O1SA 4RK6A 2EL9A 1XQ1A 4FBMA 4YV2A 4TYMA 1FRVA 3TINA 4L4RA 3OQOA 2QMYA 4GOXA 2AFHA 5KYWA 1XIVA 2VTBB 4H4DA 1IXYA 2ZW9A 4X97A 2C58A 3DDNA 4ZVRA 1WXWA 3P4YA 1AMOA 1G7SA 5LOVB 4FNAA 5IJWA 3VUFA 4RIIA 4I3GA 2BEWA 2R7AA 4Y6RA 4ZMSA 2AOUB 2LV8A 3HU5A 4FDUA 5D6NA 3OZFA 1Y63A 4S1OA 2XOXA 1USUA 4BWFB 4PYNA 5KINB 3PEUA 4R5HA 1QYDA 3V2HA 1JHDA 3JYOA 5DM0A 1WCYA 1MO5A 1ZESA 2VRWA 3DBLA 4MQEB 4NBNA 3E2PA 4QBIA 3L0BA 2CZQA 1KMQA 1VL1A 1POXA 1R3UA 4OREX 5J4VA 3SEFA 4OYHA 5DGXA 5DK4A 3OZCA 5AXDA 2AJBA 1JR3A 1KPHA 2CCGA 3MS4A 4ZPJA 3TXYA 1DAMA 1ULHA 1OPRA 1R5OA 1F6BA 2A5FA 5FAKA 1NDQA 3V8PA 4D80A 3JQQA 1ZVMA 2FLKA 5LLSA 2ZBGA 2FSSA 1C81A 2O2EA 2OAGA 3D7KA 1ZN8A 5C18A 3NUQA 1RJ9A 1HQKA 4FE7A 2QX8A 1RYEA 3LUHA 2G5PA 4IOLA 3H04A 3OT4A 4IDPA 1JWLA 1KYIA 2WUGA 3BBPA 3E9QA 4Q03A 1QO7A 2Z8ZA 1ABBA 2KI5A 1OC2A 2ZBVA 4RABA 3K70C 1H5QA 3HB9A 1ZJWA 2H63A 2DFKB 4NQRA 1JZTA 2E55A 4FMPA 3TLAA 3VSBA 1QFJA 2C5FA 2R1TA 2OBYA 2OILA 3BD9A 5BWNA 1UXOA 4JWKA 2GCOB 4DY6A 1JQKA 1ZUD1 5C2JB 5AQEA 4M1SA 3WGHA 4KITB 4OHYA 3QI7A 4L4ZA 4OSOA 1TCBA 1VLJA 4RLFA 3RU2A 2W4IA 1JGTA 1CY1A 1EXMA 1GPYA 4M0CA 1P6QA 2XVYA 3FCUB 4XAQA 3SPXA 1P5FA 2GYYA 4UBMA 5EPEA 1DAHA 5G4KA 3PR1A 3UQZA 3V3KA 1UZAA 2WAOA 1DOHA 4M9CA 1E4OA 3KJIA 3AUTA 4OD0A 4D9HA 1JIQA 1F0PA 1W96A 2B8WA 3PJDA 3ZQKA 4C7BA 5C5CA 5EMHA 4YPFA 5BVHA 3A1UA 3ORQA 1JKJA 1FQJA 2F00A 2PY6A 3DMFA 4DMHA 3F74A 5C31A 3DMPA 4FLMA 4FGJA 2CGEA 4LHEA 4WINA 3O91A 4B1FA 5BYKA 5E7QA 3TZQA 3RABA 5F3WB 2BLLA 5TQVA 2EG9A 4G84A 4HY3A 2BYTA 3TQRA 3Q9LA 1EGMB 3KT6A 5BN5A 1AQYA 1M2GA 3G85A 1FNSA 1HH4A 2BH2A 4LBZA 1U8FO 2QX7A 3FR7A 4MKGA 1XTJA 2K7ZA 4MW0A 4MS3A 1P2TA 1DG1G 2ZRKA 5CNMA 2Q7XA 4KHZA 4GI3A 1YBVA 3GFFA 2QPOA 3D2CA 1GYPA 2W2XA 2C9DA 3CSDA 3EDOA 3ZGNA 4ANFA 2B82A 4F3YA 2GM5A 3TTWA 4OYYA 3PQFA 2C03A 1JR3D 1M6VA 5M34A 4P98A 2ZIUB 1FRZA 1Z25A 2DAPA 4QUGA 2N3ZA 1JE0A 1KK2A 4YJFB 1VP3A 3Q5DA 3X2EA 2Z9DA 4DC0A 2AQIA 5TJHA 2IYOA 4F4IA 2QJOA 3IBYA 1F9AA 1L4LA 3SAJA 1YC2A 3JYNA 5CG1A 1LLDA 4F92B 3BSFA 5ALQA 1IN8A 4MV9A 4YRKA 4G07A 1JDJA 1Q0TA 3CRVA 4PM4A 2Z43A 3M34A 3W1VA 1M8JA 4PW0A 4YRFA 2WM9B 4W6ZA 3R8FA 1CKEA 1XRPA 4EL5A 2FP4B 4KR3A 4NZOA 4JGIA 1DWPA 3AF4A 4KQXA 4Y7CA 4F11A 3TPCA 1PFVA 1HDGO 3HR7A 2CV0A 1E8DA 3RC8A 3TQCA 2HKIA 3I4FA 1NVGA 1EVZA 5LYJF 4TYNA 4XGRA 1Z2PX 1RXUA 3RW9A 1O58A 1SXGA 4JCOA 3FCXA 3FVRA 4EY4A 3UJCA 2BGWA 1NI4B 2NACA 2AC2A 2WMNB 2BFEB 4F5ZA 4FZ3A 2LPMA 4MWBA 3MUOA 2FUCA 4R01A 4DWJA 3C74A 1YZLA 4K6CA 1FBNA 2UXBB 4QSMA 1ZUWA 4E4RA 2M1XA 2QVLA 1R64A 2DTXA 2DQZA 5JS8A 3ETJA 5J5CA 2R6JA 1Z8DA 3B8HA 3H5LA 4B3HA 3D3EA 2ZB7A 3LHSA 2ZETA 4IUCS 4UXJA 3HN6A 3IAUA 4D0SA 1ZINA 2DR0A 4J1NA 4Y9TA 1U1CA 4CLEA 1A8HA 1M72A 1GAWA 2ZREA 1BMTA 3HABA 3MD9A 4GBGA 4JLUA 1FEZA 2FPUA 4KMOA 3EG9B 4UM8B 5A6SA 1Y4DE 1GADO 1P1BA 1CUXA 7REQB 5KUTA 4I1RA 4NLLA 1D0VA 1YQXA 2OCLA 2G63A 1UH5A 5IJ0B 3AIKA 4LCJA 3FDJA 4HLUC 2NMVA 2O3QA 3KPJA 2B5OA 4R2LA 3KVOA 2QUAA 3FFBA 3WGIA 3ZW8A 5I51A 1YE5A 2YJTD 1TVKB 2Z98A 2JAWA 4O6VA 3COVA 3GFOA 2BUCA 2UYOA 4Q7KA 3SS7X 1ZLXA 4HSEA 3QK7A 2JGLA 3MJTA 1R8YA 3GX1A 3HY3A 2ZXEA 3CRQA 1ESCA 1YRQA 2KLBA 2VQDA 2VHCA 1JA0A 4I9GA 3RH0A 1YZUA 1C4WA 2JA2A 4G0OA 5DTJA 1NXOA 1PJ8A 3IESA 1ISJA 4WBSA 4ERXA 2NO0A 2I54A 2IWRA 1E2BA 3OCWA 1KK3A 1J0XO 1Z13A 3AY6A 1RC8A 2PMFA 1YA6A 2CV1A 4OBXA 5J1TB 2Q9UA 1U8TA 3GCZA 2PUGA 1XRLA 4U7JA 4HC4A 4UBIA 1NG1A 3FWHA 4Q9LA 2QSJA 1I6KA 3BERA 1WF3A 2ZTMA 3CKKA 3GYGA 1PEYA 1YB1A 1EB9A 1YFZA 2IIPA 2VDKB 3AT1A 3C3MA 3KYJB 5IZ4A 2QS9A 1I36A 4HDCA 1QOZA 5SZJA 5ER6A 4ZEMA 3L0CA 2W6ZA 4U7DA 1RAGA 1CEEA 3D02A 1TYEB 1KZ4A 2ES4A 4DNXA 3EOBI 4EB0A 1K97A 4QDTA 1IPFA 1W76A 3AXTA 4LOLA 1OWMA 1NUQA 5ENVA 2NVUB 4MHOA 3WQRA 3P2JA 3Q5GA 3QBTA 4YFYA 3VH2A 2J3MA 2OENG 4E88A 4LF5B 4BKQA 3V4ZA 2NU7A 3LY9A 2WFLB 5I47A 2D3WA 4DV7B 3WWYA 3VVCA 4QKQA 3R9XA 4B83A 4MPTA 1YU9A 1OV4A 2WIFA 1C50A 1IK6A 4COOA 3VZBA 1N8SA 1FSSA 3VR4A 4HK4A 1Q2XA 2ZSBA 1NXXA 1XNJA 4WDQA 3ZWYA 5J4KA 4Z4FA 5A3RA 2CDRA 3T12A 1E3JA 2VPPA 5JSKA 3JZAA 4ME6A 4X20B 3SQMA 4E5UA 3H11B 1UFQA 4N3GA 4BNZA 1ZU5A 5KSZA 2EC5A 2ZUBA 3BJMA 3RUIA 3U48A 5I7AA 3GAZA 4OVKA 1CQJA 2WDPA 1TAGA 4H0NA 5KNBH 1EGQA 1ZI8A 1G5FA 1CIVA 2IOFA 2OCAA 4GPD1 3V46A 4QT0A 4QASA 4HFMA 2CFIA 2ZJ2A 2MIIA 3NWOA 4ILKA 4C2AA 4AU1A 1OB2A 1ZVVA 3UO8B 3KB2A 2QENA 1GR0A 1T3TA 2HA7A 3NM4A 3PP8A 4WA8A 2YBEA 2IYLD 1FIUA 3HCOA 1K86A 1MHTA 3PC7A 3T9DA 4BC1A 1D2NA 4KBYA 1SG9A 3DE2X 2A86A 3IQFA 4Y1RB 2IKSA 1BJTA 5EKTA 3TMYA 1I4DD 4X8LA 3TOSA 3LWBA 4EYGA 1EK2A 2WA1A 3DMTA 3V1MA 4Q7QA 1X87A 2ZYUX 4C3UA 2VP5A 4KQ6A 2QEQA 3LHIA 3CT6A 1Z0UA 3BMCA 4UHJA 3X1ZA 1DXYA 3MJDA 3T3MB 5ALDA 3TI9A 1JXOA 2PZEA 3EODA 4YAKA 4P08A 1G7TA 5JY6A 2VK8A 3V8NA 4H6PA 5KTKA 3QUQA 1ZH4A 2GJ9A 1I7SB 1YZYA 2XUZA 4YBRA 1N9GB 3PA8A 5DHQA 2ZE8A 4ZREA 4D0NA 4V0OA 5IAKA 5FX2A 1GZ3A 2Y76A 1EQAA 2JRLA 1FRFS 2NLOA 4XFDA 1GL9B 1KNXA 2R97A 2QUJA 1OXVA 3RTGA 1EVIA 2FJPA 1ISGA 1KI2A 4IAOA 1Z39A 3C5CA 3OFJA 3GU3A 2ZSAA 2VH1A 5LC1A 5LYJA 3WX0A 2X5OA 2DHQA 2IPXA 2HWUA 2MSEB 2NXJA 1NJSA 4MDHA 2J59A 1CRZA 1TCVA 4HNRA 4QLOA 3VR4D 1SUSA 1HE2A 3ZXSA 1L8QA 2IUSA 2XRYA 3G9ZA 4TL7A 3ZC3A 2X76A 3B89A 5JJKA 5JJ5A 1CIPA 2O7VA 4X85A 1BQ4A 2P4SA 1SUBA 3NM6B 4B2PA 1AZSC 2FKNA 2NV0A 4HGPA 3LRPA 3GMSA 5ARDA 1F6WA 4YCSA 2AX3A 4IH9A 4HNVA 2J85A 1VCOA 1LY1A 3H2JA 3I5AA 2A35A 2QN7A 4L5YA 2LKCA 5TQ0A 2BHRA 5C35A 4MHTA 2FKAA 2C3OA 1FPMA 5F4BA 3K2BA 1DC3A 1TRKA 3UPDA 4CU5A 1XZHA 1ZI9A 4OSEA 3ABOB 4A6EA 3ZQJA 1CPYA 2JASA 2QP3A 5L7TA 2I65A 1X2BA 3B3QA 3CUVA 3G2OA 4L5AA 1A7UA 3ZZ1A 4D42A 2RFLA 3VKHA 1YZHA 4CCWA 4DDKA 4BAGA 4CLOB 3HS3A 4RSMA 5C3UA 1XRNA 2PZKA 3W5HA 3KQHA 1NVMB 4REQA 5CB4A 3JS5A 4K0KB 1OAOA 4LJAA 4H3SA 2GTPA 1U63A 1XEFA 2NUTA 3DC2A 2KW5A 3PXDA 4L22A 1RFGE 3IAAA 4LSMA 4NI5A 2PDAA 2PD3A 2YBDA 2YWBA 1FXUA 3I8XA 3RK4A 5JVDB 4RTPA 1EUCB 1B74A 3ER8A 3DXXA 1XXHB 3ZUPA 4TVOA 3IQZA 1FL9A 4O1HA 2JW5A 1CZUA 2DWOA 1PEKE 2FCAA 2A5LA 1Y4SA 1PYGA 1VJ1A 3JTEA 2HO5A 4UDOA 1JJ7A 5TS2A 3NV7A 2IV2X 1AZLA 1XN1A 1CLUA 2QTBA 3RWOA 3SKXA 5CFPA 1FDUA 3IAEA 5E8RA 1PVVA 2I34A 1QE5A 1TDJA 2AOWA 3GBVA 4O02B 5JNLA 4TV9A 3T4XA 1YDWA 1Y9EA 1K6JA 3GA7A 2IY7A 2BFFA 1DGQA 3BDAA 2XE8A 3E27A 2R8PA 2PXHA 1V16B 3D0OA 1L7XA 1N5MA 2RB4A 3ONEA 4AZTA 5AVSA 3DLHA 1IIBA 1JJBA 2A4MA 2CNLA 2IYUA 3ADOA 3DWIA 2IFTA 2AXEA 2V7BA 3ABQB 3GJ0A 4OBBA 3M33A 4W1RA 1RWBA 4F86A 2UYHA 2QPAA 1TO1E 1Y34E 5AK3A 3BRQA 1ZZGA 3FPFA 2G40A 4FNMA 2D0OB 2PO7A 5F5LA 1CVIA 2J9RA 2WI8A 4OQDA 3BF8A 2VP2A 1KVRA 2AOUA 4LXYA 3ADDA 1T1SA 1CEXA 1LQUA 1XU7A 4WOKA 2VTBA 1CUHA 3N0WA 1RBYA 3I01M 3LUBA 2NV2B 2HH9A 4N9QA 2VUIB 2H2FA 2YH2A 3MOIA 5DWDA 4MQUA 4MQEA 3B51X 4BNDB 3VXKA 4GUAA 3VAYA 4BLQA 2DPHA 3SJBA 4AP9A 3HCPA 4WXRA 2FPGB 3A1NA 3PUZA 3I3OA 4ZVVA 3DL7A 3F49S 1KDYA 2RH4A 3QVTA 3ZVNA 3C3BA 2YMMA 3VGJA 5KYUB 5CLHA 3KOXA 4X3OA 1Q7CA 3LPMA 4OQMA 5DMXA 4LSWA 1R8JA 3H9EO 4YUWA 4F4UA 5J47A 2O8EB 3M6AA 5FPTA 1XPRA 4RIFA 3OOSA 1O97D 2ZAOA 3HDJA 1KEWA 1U2PA 1DAPA 5EQTA 2JAQA 3LRXA 1P7WA 1WS6A 3IQIX 4Q1EA 1E2FA 4CMGA 1FU8A 4K9LA 3VDQA 5B6PA 2AEEA 3MWDB 1PQ4A 2W98A 4LF8B 1MIOB 4QGFA 3FMPB 1ORWA 2Y99A 3Q8MA 3RUHA 2ZTHA 1C4XA 1IQRA 2OGWA 1EH5A 2CNWA 2NSDA 3KQPA 2RBEA 1E20A 2RDMA 4IY1A 1P74A 2AZTA 3KXDA 3H6KA 1U02A 4EVSA 5CRIA 1YCGA 1A4XA 1I2DA 4PYKA 521PA 3BD7A 2GCOA 2EKPA 1WL8A 3OWHA 1X1QA 4E5NA 1AH2A 1Z36A 2CKMA 3C1UA 4IILA 3MSXA 4ZVOA 2DE0X 3BH0A 1M83A 4M6WB 2QUIA 4P33A 3ADKA 3D5TA 4NZZA 1GNQA 3FLEA 1YR8A 1Q95A 3W2EA 3WLAA 4Z5XA 3C14C 1MFPA 3A1CA 4QOGA 2Y9PB 1JIIA 3KJZA 4KGXA 2ALJA 2YWDA 3QGMA 4QJBA 1W59A 3KG2A 4D4IA 4ZDKA 2C4WA 4L5BA 3HO6A 3O73A 2BR4A 2HUNA 3FCEA 2MYTA 3PGJA 5ICCA 1EUQA 4J9UE 3GC6A 3KRTA 2OA0A 4UPDA 1WWKA 1W48A 3U62A 4UQPA 1PKEA 1QV9A 4J0DA 2J41A 2YMPA 3S2FA 2AZDA 4ZI2A 3SBEA 2ZBFA 5A4DA 3A9UA 1Q7BA 2R6CA 5EI5A 1WZNA 4KVZA 5CG2A 3G0CA 4IZOA 1MZVA 1K9SA 4P1ZA 4WESB 5H0IA 3OP1A 1RRGA 3ECSA 5KAPA 1NW8A 1OTHA 2YIJA 1YVPA 1Y1QA 3GO4A 2DSNA 4PNZA 4UHFA 4NHOA 1U0OC 3C8ZA 4YAGA 2HIHA 1ZQ9A 4DV4B 2CSXA 4OKNA 3G7UA 1PKXA 3IVAA 1LFDB 4MWCA 4Z2YA 4F06A 2R85A 3DMRA 4KB5A 4YJFA 5IBRA 2J3JA 3JR7A 2XHEA 2HQSA 5G0SA 5FBQB 1Q50A 1SD1A 2QG6A 1T91A 4LNUB 3D81A 1SZJG 2BISA 2VJMB 1BN6A 2DF8A 4MWSA 1XHLA 5I4CA 1ZK0A 4W9NA 2V9ZA 2WK1A 4XJVA 1VJ0A 2RIPA 3K32A 2BONA 2J5BA 1DKUA 1TAQA 1XZFA 2CLIB 1V39A 2FP4A 3CMMA 2HMYB 1K66A 2CNWD 3P71T 3QWFA 4RJIA 3VDXA 3FZEA 1E5TA 1E96A 2FN3A 5EZSA 1RLOA 3K53A 3CKMA 5TARA 1L5YA 4DS3A 2QKYA 5AVOA 3HSSA 5LN1A 4A3SA 1O4WA 1JIXA 2WJIA 4EP1A 2VZ9A 1VG1A 2ZRLA 4N18A 3UEOA 1HNZB 1NI4A 3AY0A 4WE3A 3GN2A 1U2DC 3D2BA 2BFEA 5IK2D 4IEFB 2W6NA 3LWDA 1A7KA 4OQFA 2KM1A 1WG8A 4H59A 2QQ5A 4FCCA 5T3UA 5EJ8A 5M3BA 1QAQA 1EFKA 4BQEA 2GKOA 1AUOA 4ZAFA 5CHEA 4FX2A 4C05A 3EQ6A 4JLVA 1A2QA 4MSUA 1FVHA 4DDUA 5U4XA 3FIJA 2CJYA 2DX7A 2YZMA 3RPEA 4BHTA 3E3MA 3LX6A 1Z16A 4J0HA 1P7VA 5IM4A 2FWAA 1AA9A 3DJYA 3FUUA 3IE0A 2D13A 1C7EA 1TA9A 4KPUB 5I4KA 4MITA 3EG9A 2X0EA 4B3RB 4LRWA 5DX8A 7REQA 5FBWB 4UDYX 3U61B 2VYVA 1GGKA 5DNYB 1QHGA 5CW1A 2OQVA 1EGVB 1NNSA 4NIMA 2BGTA 5ALOA 2ZSHA 4U1RA 2R4QA 3NHWA 1I1OA 4R2XA 2QD1A 5FO0A 3TDKA 4EFMA 5I6DA 1E89A 4JLBA 1PJRA 2YYYA 3DULA 3HB0A 1QIHA 1TVKA 1U2ZA 2RGBA 1ND6A 1OFGA 3GZ4A 3N2GB 4TT8A 2PT5A 2GH1A 3GPCA 1CZHA 3K1TA 4WZBE 4QSHA 2R87A 5TNXA 3VMMA 4PLTA 5HMMA 2AN1A 4D9NA 3ZDCA 2HRQA 4YJ3A 2W43A 3CNLA 1N2ZA 4LI0A 1ISFA 2EQBA 5BRNA 3AESB 1HT0A 3CFYA 1RHUA 2FWMX 2HQ1A 2YJZA 3Q98A 4KYTA 2IV3A 3CNQS 1IEQA 2YY7A 1HA3A 2XDYA 3PI7A 1C7RA 4PE5B 4Q4HA 2NVOA 3IQWA 4MINA 3WKDA 4I1PA 1ZLYA 4E5KA 4IDBA 2PH3A 2QD5A 4OCZA 1ST3A 2YS6A 4LYEA 2VNKA 3QVJA 2WTAA 1DNPA 4PZUA 3GDHA 1SQ5A 4QPZA 3EEQA 3UA4A 4BEVA 4RU1A 4YONB 2ET6A 4GEGA 3D4PA 1KJIA 4G41A 4K9RA 1WULS 3CTPA 4IGIA 1TZCA 3RK0A 2ZS9A 1EDBA 1ADCA 2NXCA 1NF9A 2OECA 1Q21A 3ACBA 1GFZA 4YP9A 4AWBA 1XQVA 5FFFA 3ANNA 5CFOA 2R79A 5LQUA 3O82A 4HAUA 3WJ1A 2JLXA 2CJXA 3LWNA 4KUGA 3CO0S 3M4XA 4WEQA 4KQFA 1JI3A 3RS4A 1Y5MA 2QTGA 3B2EA 2NVUA 4C08A 3TLKA 4POOA 1NUSA 4LDQA 3O4JA 3MGKA 4M46A 2HV9A 4QAQA 4RLHA 4UJ3A 2ENUA 5AHRA 1LFAA 2Q1SA 5JXGA 4KO4S 3EUAA 3O8OB 2OPBA 4DGQA 2O59A 1QIKA 1IZ8A 1QVWA 2YV5A 4RANA 3HXPA 3UUFA 1KVTA 2C97A 3H6HA 4IV0A 3MGGA 2M2IA 5DE3A 5FYQA 4OI0A 4R1MA 3BSWA 2MSLA 5EXPA 2I66A 1YULA 2F43B 4XW2A 1QH1B 1D6SA 3DE6X 5LWHA 1ZNZA 4X20A 2VYVD 1X8KA 2J9XB 1Y1PA 3H11A 3F7MA 3JRWA 3NM5A 5FPSA 3OJLA 2TECE 3M6MD 4EBFA 1NXWA 3QEBZ 5IPFA 3KDAA 1MP0A 1F2TB 1PGJA 2I8LA 2PR7A 1RRMA 2JIMA 3VPHA 4FWTA 2YASA 3Q7RA 1IXSB 4B6RA 1JHZA 2QYSA 3UMSA 3DE1X 3A6DA 4PC3A 3FGPA 4QXMA 3ZY5A 4ZGGA 2WB2A 4ZGWA 3KJQA 2BH9A 4ECEA 2DLNA 2ZYAA 2IW3A 3UWPA 5L40A 3IBSA 3HJRA 1NX9A 3N7TA 5AJWA 4MV5A 4MPJA 3Q7EA 3WDKA 2QJFA 3W06A 3DAHA 4Y1RA 4OHFA 1CDZA 4BX3A 4ZICA 4RK1A 3DWGA 3C6MA 3ZWBA 4AQDA 2EP8A 5KSWB 2NXWA 4XWGA 3F5DA 4W5JA 2J9GA 4M1YA 1K6IA 7ABPA 2G1UA 1ID1A 1M0WA 4YP0A 1PFWA 1CQPA 2WOJA 3JWHA 4KBGA 1XMXA 3ZBTA 1ZMOA 4HQKA 1VL2A 1M34E 2B20A 3NC1C 3SK0A 1DHTA 3SZ3A 3DWFA 2M98A 2XSZA 1P9WA 4X65B 1T5DX 4F12A 2WQ6A 4X24A 1J9EA 1G8YA 1N9GA 3VJMA 1SO8A 2KWIA 4OV6B 4EJSC 1KBQA 2IJGX 1AHHA 3TLYA 2G36A 1T2EA 2X2FA 2HCRA 3LK6A 3TNYA 2G4VA 4ZCMA 3K8QA 1EE1A 2A5JA 2FZGA 2YWXA 4L0DA 4LNAA 1S5PA 4LRXA 1QUEA 5HJEA 2QBYA 4OJKA 4LG1A 1FXWF 1UJNA 3GUZA 3ONNA 3RVMA 3L6UA 3LOUA 4XSGA 3FCAA 2R5NA 3UATA 5C8ZA 1WEHA 2PPVA 4XJSA 5EEGA 3T8YA 1DAKA 5JNSA 2FH5B 3O4GA 3KZNA 3TZEA 2C5SA 3NOQA 3VU3A 3ZWOA 2C0CA 4YPOA 3QPBA 4DCGA 4HZGA 1IQ0A 3GUHA 1U8UA 3MT0A 3WICA 5JAPA 4B4DA 1RRVA 3O31A 4MVJG 2JD1A 5LMUB 4GKJB 2R8ZA 4JK3A 4YWHA 1VE5A 2HIGA 1U3WA 2V3CC 4NENB 1GYQA 1HYGA 2AR9A 4HNAB 3B6ZA 3K8OE 3CT4A 3ONDA 3QTTA 3TQIA 4BQPA 2FUG1 3U17A 4HFRA 2D59A 3IPAA 3LZCA 2P9YA 4UVIA 3RBAA 2FX5A 3EFEA 1UK8A 2W2MA 1ENPA 1PD0A 5F51A 3D0KA 3ZKAA 3AVOA 2VAPA 1OH5A 3DDSA 1EP3B 3RUCA 1DKNA 5C1IA 2QZPA 3HUEA 3PNBA 3WLNA 5KYXB 3FUTA 5HSGA 1WXEA 1QCZA 1FYVA 2GPNA 4LWOA 3AB8A 4RW0A 4AZ3B 2BI4A 1DIGA 1ESZA 2ADOA 5JWRA 4CLOA 4YACA 4I55F 4ZT3A 1K6MA 4I5IA 5TLSA 1I7DA 4HQRA 4L27A 4M99A 2NOAA 5T8KC 3M2PA 2CSUA 4CCYA 2A88A 2PSHA 1U5AA 3PSAA 4EITA 5H3CA 4DB2A 1MV8A 1XLTC 2MMGA 3I83A 4X7MA 1L1RA 1NOKA 1YS1X 3GGGA 1Y89A 2XTZA 4P5EA 4CMCA 5K0JA 1RZRA 3QVKA 4QVKA 1EUCA 5F64A 3L77A 5JJLA 3GRKA 1XXHA 5CW2A 4YS6A 3C3WA 4KQJA 4TRNA 2GD1O 2XSZD 2AMVA 4NEGA 4QARA 4G0PA 3B9QA 3UJDA 1VYTA 2VPYA 2DRIA 3VVBA 3ZQ6A 3PUXA 4ZT4A 2VSYA 3WKEA 4PCAA 2FFJA 3GD5A 4X6XA 1EKXA 3OOWA 5FQOA 2AFIE 5JSQA 3R5FA 3T1HB 3MCWA 4BLWA 1GRRA 4ZV7A 2WWVD 1ZA2A 4QBTA 2X5NA 4B0PA 4ZDJA 5M7EA 2XB2A 4CF4A 3MC1A 5P8WA 2Z8YA 3FSEA 4RMIA 5K0EA 5KJFA 3RYFB 2HRCA 2P9QA 1A2OA 1L5LA 5A04A 2RAVA 1ECCA 4M9UA 5TSDA 1TW2A 3P9PA 5B1SA 1LNSA 1JHVA 2HK9A 2VT6A 3TFWA 4F6CA 3CF4G 4H1HA 5JW6A 3RNOA 4ABTA 5G40A 4QL3A 5T64A 3LKZA 1N0WA 5BSUA 1VJ5A 4AQ7A 1HV8A 3MHPA 3OPYI 5FL7A 1FYDA 1KS2A 3D8HA 4OHXA 4BNDA 4DA9A 5JAZA 5AI8A 3R0VA 1VYVA 5FYDA 2FPGA 3EPRA 4LIPD 3W7VA 2QI9F 4YDQA 1G7CA 5CIYA 4HHEA 3AEXA 2QD2A 4K9SA 1L6IA 3KWMA 1F3OA 4R1PA 5KYUA 2I87A 2I76A 2Q5QA 2BTQA 3EF3A 4P7JA 1HSOA 2QAJA 5GQSA 5ISMA 1O7JA 2ZANA 5HTKA 4CHGA 1P8JA 1X39A 1V8BA 1V71A 4ZV9A 4JC4A 1UBUS 3F6CA 4RDXA 2JCBA 1L4HA 2RK3A 2PA3A 3ZXIA 3EZ2A 1X1TA 3L04A 3R0IA 4M2LA 5IUNC 2X9NA 3OY2A 4Z86A 1R74A 3QE2A 4NZNA 4YAJA 1O9HA 1UQTA 4E94A 1S3SA 2WJPA 3EE6A 3MWDA 3D9QX 1MIOA 1RZRD 3FOZA 1Y9ZA 1YS7A 4O4JB 4F9TA 3GT0A 4DIOA 5J3JA 2O4CA 3ENVA 3OZXA 1BHSA 2GZHA 3FCCA 1FCJA 2OQIA 1H2HA 1EM8B 3CLTC 4IG9A 3PITA 2KJQA 4A36A 4B2YA 2I3ZA 1JH9A 1HLDA 4B82A 4DLBA 3CH4B 4MULA 1V7PC 4M6WA 1Y81A 4FT2A 2HN9A 2OV1A 1VTKA 1HDOA 2BZSA 1IOLA 1O6FA 1U90A 1E69A 3QRWA 2OFOA 2BHNA 2QOEA 4HQ6A 3AZOA 3ZDZB 3ZY4A 2MWMA 5U9CA 5EP2A 5FTJA 4G9BA 4DIMA 2N1BA 1CQIB 4WRRA 1KZ9A 4MPDA 4PFKA 3L7MA 3IHLA 1V47A 1Y8CA 2GZMA 3NCHA 5DW3A 3G2KA 4QM7A 3QENA 4OJTA 3CLUD 4YMGA 3JPWA 4I50F 1T0HB 1HUQA 2PQ0A 2ZVQX 2WHPB 1JPJA 3FNQA 1FTYA 3EAGA 2VSNA 2JGJA 2OEPA 4G8CA 1C9DB 4JVLA 1E9AA 5FL7D 3SX4A 4OFBA 4WESA 1IUOA 5JI2E 2OBLA 4HDRB 1M5TA 2AJDA 3E3AA 3KKQA 2XIQA 3A1WA 4P22A 1VZ2A 3VR3A 2O6LA 4BKPA 4UFPA 4DV2B 3DE7X 4II3A 2FTKE 4BNVA 2EZ9A 3PVZA 4W9RA 3DLAA 1YQ9A 3VH1A 1RXEA 2GUWA 2RHTA 1U2GA 4O4LF 1O77A 1E99A 3M6WA 4KO1S 4N01A 4WUVA 1U94A 3W9BA 1UXHA 1FYFA 5E7JA 2LTAA 3GVPA 3DPUA 1VLQA 3GDFA 1X9GA 3EVFA 4LHVA 1RFLA 2ZEJA 1A27A 3C5HA 3ZCPA 1L7AA 3UG7A 2PMBA 5JARA 1DTWA 4KX5A 1IZYA 1E79A 2FHPA 1Y8AA 4H08A 5JT1A 1RQRA 4PBSA 2JIOA 4XDYA 2ZUCA 2Y77A 2BP7B 3IP8A 5E6RB 4BFYA 1D5CA 1UM8A 2PS3A 3TCKA 5LD2C 1Z56C 2EX0A 3KQSA 3L8CA 4HBGA 4ZTZB 4M1TA 3T7DA 4ARZB 1AKMA 4NH4A 4V0RA 4YCBA 5LIRA 2DP4E 2M6LA 5B7NA 3QIVA 3DCJA 2B3TA 2Q5OA 4Q4DA 1HY3A 3KHUA 2XCOA 3HVRA 2BEJA 2Q3LA 2MSCB 2C7RA 2GAFA 5DM60 1D0IA 2K7FA 3DEIA 1EAMA 1IHXA 1M6EX 3HJTA 3QWBA 3SP1A 5B6JA 4OPMA 4R2JA 1VE6A 2J8ZA 4S1VA 1SXHA 4RHFA 3IO3A 3AKCA 5DM2A 3G7SA 3O4HA 3K20A 1V95A 2BKEA 3H84A 2VJBA 4IJUA 3SZRA 4NXMB 3RV4A 1DX9A 3F3SA 1SXIA 4P84A 4Q19A 3I61A 1E1DA 1RSZA 3R24A 2PIDA 5FAXA 5A7HA 1E9FA 2OCIA 1H0KA 3MCTA 3NYWA 3FI0A 1AKUA 2HIAA 2ZIWB 5EMNA 4XQCA 4AXBA 4KPUA 1GZ6A 3JQPA 1RPTA 4RD1A 4RMJA 4X8HA 5AJTA 3LT4A 5HE9A 1WZUA 3GCGA 4ZZ3A 3IP5A 1TYCA 3ZE7A 4C0QC 2Z0MA 3LT2A 3B8EA 2ASVA 2YRWA 4BMSA 1B6GA 2BZGA 4YI3A 3VR3D 5SV2A 3SC3A 4AJEA 4AG5A 4RGVA 3USCS 1GA1A 3ZWMA 4DDMA 5HRUA 4PICA 1G8HA 4F6LA 1WHTB 4GI1A 5D8DA 5K3EA 1VKRA 3NYIA 2V6FA 4ZODA 2B35A 3S7ZA 2Z2IA 3ESCA 2YXDA 3PC2A 3AESA 1YOVA 3GVCA 3KT3A 1KDTA 1RLTA 2ECKA 4DILA 3KQNA 3TIGA 2ECQA 1PYOA 4PLHA 1G4HA 2F59A 2XYVA 4GF5A 3H9UA 3BSYA 1KEKA 4ND2A 1E79D 4R1LA 4MRMB 4Q4AB 2PH1A 2I6GA 3C8HA 3HZOA 3DZ8A 2DZDA 1SUFA 4QICA 1UFOA 1BWRA 5EXDA 2XTMA 1VM6A 2C4UA 2ACEA 3GA0A 1TIBA 1ORTA 1C3XA 3EXIB 5JEEA 3VC3A 5B64A 4B46A 4IZIA 4OHMA 1MB2A 3BRWA 1BYIA 3DUWA 3I4CA 3IJEB 3TSCA 2PGLA 2WG0A 1KQGA 3EH1A 4GDFA 4A2CA 2B0CA 1NYTA 5CYPA 3AUXA 3WIVA 2C4HA 5HRCA 1UM9A 3PYMA 2PAAA 1WUYA 3HI6A 1FNNA 3LBAA 3A14A 4JS0A 4ONEA 3M7IA 1HQDA 1VGVA 3I32A 3NUGA 3OC6A 4U2FA 4XEUA 3U9SA 3MAAC 2C5EA 1EVKA 2QQFA 3NTLA 2X0RA 1O6CA 3VDRA 5JMTA 5LUAA 2FMKA 1KE2A 3IEPA 2VP4A 3CH5A 1JKXA 3PUVA 4XLZA 1UJMA 1HKUA 4E2YA 1A9RA 1KFBB 1YZFA 3HKDB 3QWAA 4LZNA 4MVJH 1E9RA 4DRYA 5A0TA 2GEDA 3O8OA 3HYCA 2NU6B 4XM1A 5E0OA 1HYHA 1Q7GA 3D3NA 4W5WA 4L7QA 3D4LA 1XELA 5EC8A 4TN5A 2VXYA 3DWEX 3A4TA 4QRIA 3ICCA 2EHDA 3RAEC 2F43A 3H2ZA 4NS1A 1QH1A 2QLBA 5ED0A 1T3ZA 3NALA 3N2IA 1DBPA 1RWPA 2W00A 4ZANA 2Q2VA 3DGFC 4Z3KA 2Z2YA 4AN0A 5FHRA 4FJ0A 1IOWA 3HSYA 4YCDA 4L5IA 4JJ7A 1J22A 2NQTA 4OGKA 2R47A 4QOFA 4MV0A 1L1EA 4HB2A 2CXNA 1WB4A 1ZO8A 1F2TA 2A1TR 3WKBA 4FEYA 2TMDA 3CNBA 4TLBA 2H7CA 3AEZA 4NK4A 1H6BA 1L5HA 1II8B 2B98A 4DR1B 2QA5A 2EKBA 3H1GA 3N7UA 2A9KA 2QVGA 2P0EA 4EG3A 2I9PA 1M7HA 2R5WA 3PT5A 3W5UA 2PYZA 1N2JA 4XX1A 5AW5A 3CBGA 2VIIA 1Q1EA 2OCPA 5TEWA 1B0ZA 3G9XA 1O03A 3RF7A 2DB3A 2C2GA 5JBIA 4PGGA 1GUFA 3DMGA 3KEFA 3L6DA 1B15A 3LVBA 3Q3GE 1USKA 5H02A 4K5QA 1YKGA 2JIDA 1VMIA 3BRWD 2P11A 5FI3A 4DVJA 5CITA 4L75A 3GT4A 1T9HA 4OHBA 4URUR 5HR5A 3M9WA 4GPBA 4ETWA 3HV0A 3V1LA 1DBWA 4CM7A 1X38A 2XRZA 1X0XA 2I6QA 4UBJA 1P9RA 3ZNPA 1A9TA 2GEUA 2PBRA 1L7BA 2ZBQA 3Q1KA 2C4MA 4OM8A 3T7TA 5SICE 1V7QA 2EWWA 4BGUA 4CIVA 4GLFA 4KSBA 5EIWA 1C80A 1RPAA 1YR1A 5H68A 3M1YA 4R84A 2FG5A 5C7OO 5C8DA 1ZD8A 1DKMA 5E1DA 2WWWA 2VEOA 1O87A 1JPNA 2B1QA 2GHIA 2YHBA 2AJTA 1X2EA 3RFCA 4JEIA 1U7HA 2PXAA 3X1DA 3ZGYA 3QQ5A 1I2ZA 3EWNA 3VI4B 2ZP1A 5FPHA 1GU7A 2GN2A 2PKQO 4HEHA 1T9CA 2AIRA 5K8IA 3I9V6 1BN7A 2ZJ8A 4GGOA 1CG6A 1U2SA 1CX9B 3S2ZA 4G5RA 2JHFA 4DRZA 5JJIA 4HQOA 3WYFA 2PJRA 1GGEA 2RAFA 2X2EA 1GN9A 4NENA 5A4JA 3INGA 4HNAA 4P93A 2JJ8A 1YUMA 4LJ8A 4TVBA 5BOSB 3GPBA 3VZCA 2UXDB 2VP0A 3I45A 4GECA 4GT1A 1D4FA 2BFCB 5FPQA 2BGJA 1C9JA 1EFVB 1RVV1 2YFHA 4OLHA 4BY9E 3IILA 1LA2A 1WSWA 4KXLA 1FP2A 2RC5A 1DINA 2FLWA 4IIBA 1MGPA 1FFWA 3SFTA 2SNIE 5JXIA 1O97C 2Y68A 4RHEA 1NUTA 5KYXA 3QE3A 2P1DA 3CIOA 4P4GA 1HLFA 2WILA 1JEJA 2Q1WA 4N8EA 4AMZA 6ABPA 1SKQA 1JQDA 4F3KA 3FAZA 4RQBA 5F1OA 4DQXA 2Y92A 3QVWA 3GEDA 3GZJA 4U3JB 3AI7A 1M0TA 3PNOA 4MIOA 2IEYA 1IIRA 4YRRA 2O3SA 4LZOA 1N2CB 4YQYA 2JRCA 2Z8XA 3I2HA 2YQZA 5FBKA 4KIJA 3H18A 1YCHA 3I8OA 1XNHA 3AUFA 4R1SA 1JDBC 3I09A 3ZTTA 2NZUG 3NLLA 3ZYCA 4YRLA 3QBJA 5B3LA 2XRMA 3M5CA 2FSPA 4KZKA 1SUPA 4F56A 4INZA 4MS4B 1HKHA 1ORVA 1R9NA 3L7JA 2W5UA 4QJ5A 3OZAA 1JALA 4JOQA 4QGAA 3WFJA 4DIDA 1Z6XA 1WXIA 2RAPA 2NZ2A 2QTMA 2R7MA 3QMPA 3GFPA 4LXUA 4JV5B 2I4LA 3G0HA 5KS2A 4NBUA 4J4HA 1RM4A 3GJ5A 3DMHA 3GY0A 4I99A 3OOJA 4NCAA 4LZAA 3GLGA 3W8DA 4OM7A 4BCDA 1T6NA 2QTFA 3FHTA 4OBWA 4IQ4A 3L6EA 3GLUA 4Q1BA 2XMQA 3F1LA 1C1HA 3LV8A 4TV8F 5JASA 2IH5A 3ZXYA 2WF8A 3ACCA 1GEEA 1L4MA 2BZ1A 2ZULA 3AUUA 4EKDA 2ZRHA 1KMMA 4C4SA 1IJBA 3RVNA 4OOEA 5EIAA 3T1YB 3T52A 4X1YB 1C0EA 3L7KA 3IYLW 4RO0A 3RVKA 5H9WA 1N2XA 3JQ6A 4JBLA 4BZPA 1W4LA 2WTXA 4EMUA 3K9CA 3ICPA 3KKLA 1C8KA 3BKWA 4Q24A 2Q5FA 2JPDA 4GOND 5LP1A 1LDEA 5HIMA 2E4ZA 3HQ4O 1MA0A 1U7WA 3LO8A