4MIKA

Crystal structure of hpnmt in complex with bisubstrate inhibitor (2r,3r,4s,5s)-2-(6-amino-9h-purin-9-yl)-5-(((2-(((7-nitro-1,2,3,4-tetrahydroisoquinolin-3-yl)methyl)amino)ethyl)thio)methyl)tetrahydrofuran-3,4-diol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
255
Chain Sequence
AYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Phenylethanolamine N-methyltransferase
publication title To be published
rcsb
source organism Homo sapiens
total genus 92
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2013-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mikA00
5EC8A 4O29A 4EMSA 5F2OA 4AX8A 2UYOA 4Y2HA 3TM4A 2I7CA 3E8SA 1RI3A 2R3SA 3ELWA 4C05A 4AZVA 1R00A 3THSA 4CXMA 2PWYA 2OPBA 3K6RA 3O4FA 2PBFA 1KXZA 3HNRA 3OE4A 3B89A 4EQZA 2UYCA 5C1IA 3LCVB 1XTPA 3AJDA 3SXJA 3UJ9A 3G8AA 2ORED 3CVOA 4R8RA 2EJTA 4IWNA 3C3YA 3FTCA 3EMBA 3KU1A 3EEYA 1IY9A 3ELYA 2PX2A 4RTPA 3QV2A 5FTWA 4GC9A 4FGZA 3MCTA 4X63A 2Z6UA 5DPMA 2FRXA 2BR5A 3GRUA 3P2IA 3GIWA 3KR2A 1R8YA 2Y1WA 4KDRA 3BWMA 4R6XA 3TM5A 4EKIA 1NW7A 3OE5A 5LQNA 3P2EA 1ZKDA 1BOOA 2GA9A 1O54A 4OX9Y 1G60A 4YV2A 3IEIA 1P39A 3HA3A 1RJGA 2IPXA 4M36A 5EPEA 5E2BA 4ER7A 1IXKA 2HNKA 2I6GA 1RI4A 3G89A 4PYIA 5EIWA 3NVKI 5E9WA 1KP9A 1FP1D 1EQAA 1F38A 3PFHA 3G5TA 3UBTA 2VS1A 4QVKA 5E9QA 4YMGA 2JH8A 5CUQA 3P71T 2AZTA 4FSDA 3ERCA 3DH0A 4K6MA 4Z2YA 5ICEA 4JXJA 1WY7A 4HG2A 4OA5A 1SG9A 3A26A 3UJ6A 3LGAA 5D1HA 2PJDA 1P1CA 2QY6A 4E2WA 1N7IA 2FK8A 2XVAA 2ERCA 5K05A 1R18A 5DT2A 2CKDA 2AVDA 2PV0A 5FA5A 3MQ2A 3KPYA 3FYCA 4ISCA 5LQAA 3UJCA 4RTRA 2ADMA 4ZTBA 5FULA 1SUSA 1L3BA 5HIKA 3KPWA 4ER6A 3IYLW 5LSAA 1V39A 3DMFA 1YZ3A 3HCBA 1ZGAA 3SM3A 3ER9A 1VP3A 1G8AA 3NWEA 3U81A 4POOA 3B5IA 3UA4A 1B42A 3CJTA 4G56A 1X1AA 4C04A 1KIAA 1I1NA 4CTJA 3A4TA 2G72A 2VDUE 3DOUA 5DXAA 5FHQA 4F85A 4X60A 4AZTA 4MHTA 3M6WA 5GM1A 3FPGA 3DLCA 4HGYA 2FCAA 5EIFA 2ZIFA 3DR5A 4PINA 5EMMA 1BC5A 2AN5A 2E5WA 2V7EA 3SMQA 3GDHA 4PIMA 5JUWA 1JQ3A 1EJ0A 3FRIA 4HSGA 3O7WA 5LR6A 3EEOA 3VYWA 1NE2A 3G7UA 5D1NA 1R6AA 3GRYA 4PIPA 3LBFA 5HEKA 4F84A 2AVNA 4R05A 2OO3A 2C7PA 3FTEA 2NXJA 3EMDA 3P97A 3P8ZA 4XUCA 4GOLD 3UJBA 1TW3A 2IH2A 5DM2A 5DM4A 1QANA 1R8XA 3KQMA 4H0NA 3EVBA 2JJQA 5CVDA 4A6DA 2UYHA 1BKYA 1L3IA 1JTFA 1Z3CA 5KS2A 5GIPE 1KYWA 2OKCA 4GOMD 4GUAA 4ER0A 4RTQA 1H1DA 1N2XA 2NXNA 3KQSA 5HIMA 3PX2A 4U7PB 5U4XA 4RX1A 2P8JA 4M38A 3GCZA 1JSZA 2LD4A 1NKVA 4P7FA 3TOSA 1Y8CA 1N7JA 3HM2A 5FA8A 1P91A 5DX0A 5K0CA 2QYOA 4ATNA 3K0BA 4RTNA 2AOWA 4EK9A 4QVGA 3R9XB 2Z6QA 3L8DA 3JWIA 2DPMA 3I5UA 4YUXA 3KQYA 3KQQA 1JG4A 1AF7A 3OFKA 2FYTA 1X1BA 4DQ0A 3M4XA 3A7DA 2ZLBA 5DTQA 3UJAA 5CCXA 4GC5A 4KW7A 5EOVA 3SX0A 3DXYA 1RJDA 3I53A 4PCLA 4YUYA 2GPYA 3Q87B 3KPJA 4RVFA 2O0LA 5E1BA 3TKAA 3M6UA 2BM8A 4RYLA 3PLAE 2YX1A 1XJ5A 3KR1A 4P7GA 2NXCA 5DM1A 4BLWA 4QQKA 3LBYA 5T64A 5K09A 2GAFA 5CD1A 1L3CA 2P3QA 2JG3A 1ZGJA 4DF3A 5K0FA 1U2ZA 5DRTA 3BKWA 5E1DA 2PX5A 5GP1A 4BLUA 1UWVA 2B3TA 2AOUB 4AZSA 5CVEA 3FYDA 1X1DA 4QPNA 5DX8A 3SSNA 3TFWA 3REOA 4Y30A 2ZW9A 3I58A 1M6EX 3LPMA 5H02A 4DM3A 3VC1A 3A7EA 3BZBA 3C6KA 3DTNA 3GRVA 3KR0A 3QOWA 2B9EA 4GF5A 4P7KA 4QDJA 4XCXA 1RI5A 5FCDA 2YR0A 4AUKA 5BW5A 1JG2A 5K0EA 3NDJA 4YUZA 2JHPA 10MHA 2VDWA 3T0IA 4RWZA 2O57A 3MTEA 3C6MA 1NBHA 2KW5A 1QAOA 4QDKA 5EEHA 1WXWA 2PGXA 5K0LA 5ICGA 4M37A 1M0EA 3AXTA 5BP7A 1JG1A 1JSXA 2GLUA 1T43A 2HV9A 1TPYA 2ZSUA 3GWZA 4B17A 4E70A 3ELDA 3ANXA 2C7RA 3CCFA 2C7QA 2BM9A 5IKMA 5G02A 5K0NA 2B25A 5MHTA 3TKYA 4A6EA 3G5LA 3LKZA 3ER8A 3HCEA 2YUIA 2JH9A 5IH3A 4E2XA 3GRRA 4OQEA 5E1OA 2I9KA 5P8WA 4YV0A 3CKKA 3SGLA 4KWCA 1XVAA 2QRVB 5K0GA 3G8BA 1NW6A 4C08A 4RTLA 3EGVA 3EVCA 1G8SA 1M6YA 2CMHA 1UFKA 2QM3A 4KDCA 1I4WA 1KPIA 2OBFA 3B7PA 1ORIA 1L1EA 1Q0SA 2JHCA 3V97A 2BH2A 4RTSA 2O07A 2PY6A 2YXDA 2QRVA 2IDKA 3PT9A 4MIKA 3O31A 3PTAA 3DP7A 4DCGA 4RVHA 1EIZA 3E23A 1Q0TA 2EFJA 2OB2A 2EJUA 3DUWA 2P3OA 1HMYA 3V8VA 1FBNA 4RTMA 3LCUA 1D2HA 1ZHFA 4M7RA 2PWPA 7MHTA 3UWPA 5CVJA 3MAGA 4BP1A 3P2KA 2NP6A 2V74B 5HIJA 1YFJA 3OPNA 4IV0A 4QTTB 2PSSA 2QE6A 2N47A 3G2QA 3G2OA 3P9NA 1L9KA 4HC4A 3RODA 4L7VA 1MHTA 3OU6A 3HTXA 3HVIA 4PYKA 3AXSA 2XYVA 4RVDA 1F3LA 3THRA 3H2BA 5HOQA 5FWAA 3M6XA 5E8JA 4KRGA 1KYZA 4KVZA 3ELUA 2OY0A 5LQCA 2H00A 1XXLA 2O06A 3RIEA 4YUVA 5DWQA 2IP2A 4RV9A 4FT4A 2IDJA 2ZULA 4HRAA 4RTKA 1QYRA 3EGEA 1O9GA 1MJFA 4WVLA 5DLYA 3A25A 5M5BA 4OBXA 4ER3A 2XVMA 1JG3A 1XCJA 3BGIA 5EHGA 3PX3A 4E2ZA 5CIYA 1VIDA 4CTKA 2IH4A 4P7JA 2XYQA 3HP7A 9MHTA 1YF3A 2F8LA 3LHDA 5T6BA 1R74A 1NBIA 2OB1A 3C3PA 4BY9E 2HMYB 2ZZMA 2P7HA 1WZNA 5DTRA 3T7SA 4PONA 3UFBA 3VSEA 3A27A 3FUUA 4R6WA 4BLVA 4CWAA 1ORHA 3BWYA 5EZSA 3FPHA 2GS9A 2P1DA 3CJRA 5CM2Z 2XBMA 3P9KA 3IV6A 1VQ1A 5K01A 5LQKA 2K4MA 2FHPA 2JHAA 3HCFA 1XDSA 2Q41A 3JWGA 1KPGA 5E9JA 2IFTA 3HA5A 3KQOA 1WS6A 1X19A 3DMHA 3IHTA 1KR5A 2WA1A 5CVUA 2IBSA 3G2PA 2G1PA 1VLMA 5EMKA 1RJEA 1DUSA 3T7RA 4DA4A 3M33A 4GQBA 1DCTA 5KQSA 2AS0A 1PRYA 4PYJA 3KQVA 3FUXA 3FPFA 2CL5A 3I64A 3KPVA 2P7IA 4GOOD 1NT2A 2ONYA 4HGZA 3QOXA 3TR6A 3MTIA 2IBTA 5EMJA 1VL5A 3DXXA 5HILA 4YMHA 3BT7A 4OBWA 5K0BA 5EKUA 5EKXA 3FPJA 3OZRA 1I9GA 5LQJA 3E05A 3CBGA 3LDUA 3MCZA 3OZSA 1NW5A 5DXJA 3HVHA 5EG5A 3DULA 5FADA 4DKJA 5KYGA 3LKDA 5GWXA 3TPZA 4R8SA 2PT9A 2XYRA 4GEKA 1G38A 1G55A 2VDVE 4C06A 4CKBA 5HZMA 3MERA 4DCMA 2PVCA 4FSXA 3R0QA 4MTLA 2YQZA 1VE3A 5EZQA 3KQWA 2ZWVA 2BZGA 2CWWA 4PGHA 1QAMA 3NW9A 4KIFA 2AOUA 1ZG3A 4E31A 3DLIA 4FR0A 2ZZNA 3FTFA 5KVAA 5FQNA 1XDZA 4PYQA 2HWKA 1JQDA 2NNWB 4YV1A 1INLA 3BXOA 3GJYA 2A14A 4PYLA 1TW2A 2PXCA 3GGDA 5HIIA 5KQRA 3T7TA 5GM2A 1YZHA 2NXEA 3MGGA 5DRYA 2UZ4A 1SKMA 5EMLA 4XUDA 2AR0A 2IIPA 2PXXA 3EVAA 3FTDA 3EVFA 4QTUB 3BGDA 4KIGA 1VPTA 3P9IA 2WA2A 3LECA 5BW4A 5JR3A 3HCDA 3KQPA 3MB5A 3WSTA 2ONZA 2H1RA 2AOVA 3B3FA 3OU7A 4FT2A 2CMGA 3GRZA 4X1OA 3FUVA 3KR9A 2AN4A 3HEMA 2ESRA 4BP3A 2YTZA 2YXEA 3UA3A 4C4AA 4V0RA 3R3HA 3OU2A 1D2GA 1JR4A 2O05A 1YUBA 3P9CA 1SQFA 3SR4A 4RTOA 3UJ8A 3M70A 3HCCA 2H11A 5DX1A 2ZCJA 1IM8A 3OFJA 3MHTA 4FS8A 1BHJA 5GOZA 4HTFB 3SSMA 4E30A 5B1SA 2Z6AA 5CCBA 1AQJA 4OA8A 3BGVA 5ICFA 4LWPA 4V0QA 3PFGA 5EHIA 3OCJA 5LQUA 1D2CA 4HTFA 1QAQA 4E2YA 1JQEA 4CKCA 1P1BA 5K8VA 3UZUA 4FP9A 3SSOA 1ZQ9A 2B2CA 3NWBA 4AZWA 3AWIA 1EAMA 3G88A 3GNLA 3HA7A 4GBED 5LQRA 3R6TA 5C0OE 3VC2A 5FWDA 3FZGA 2WK1A 3TRKA 3SVZA 1HNNA 3LDFA 2OZVA 2PLWA 2P41A 3LSTA 5ERGB 5DSTA 3M6VA 2AN3A 5EEGA 4ER5A 4LWOA 3GXOA 2EX4A 2IGTA 5C9ZA 3TLJA 2ZIGA 1G6Q1 1FPQA 3HVKA 4X41A 5EVJA 2VZ9A 4P58A 2OYRA 3LL7A 1RJFA 3TMAA 2G70A 1FJXA 2G71A 4OQDA 4E33A 1NV9A 4PYMA 1KPHA 1SQGA 2FK7A 1O9HA 3BWBA 3HVJA 2EG5A 3FUTA 4RVGA 4PGGA 2OXTA 3RW9A 4GOND 3X0DA 4PCAA 4LECA 4RSRA 1NW8A 2YXLA 1QZZA 3EPPA 4U7TB 1RI1A 2ZBQA 2ZTHA 5T67A 3PS9A 1WG8A 4MWZA 2NYUA 4C03A 5BXYA 1EJ6A 1X1CA 3OZTA 3NMUF 1SVUA 5GINE 5EQJB 4QQNA 4PYOA 4UOEA 2GB4A 2PXAA 3KHKA 1NV8A 4EKGA 4RTJA 3UJDA 3R24A 4EVIA 3BKXA 3BUSA 4PYNA 5DSXA 2NP7A 1YB2A 1FP2A 5GIOE 2ZIEA 3ORHA 3DMGA 3CC8A 3CJQA 5FHRA 2BR4A 3ME5A 3NJRA 5HFJA 2PT6A 2ZBRA 2ZWAA 1WXXA 3DXZA 3GU3A 2I62A 3EVDA 3BWCA 3EVZA 3PVCA 5EGSA 2R6ZA 5E8RA 5ICCA 4DZRA 5DTMA 1JTEA 1VP9A 2AOTB 2BR3A 5K03A 3EVGA 2PX8A 3EVEA 4IV8A 5DM0A 2Y1XA 4FZVA 4CKEA 2UYQA 3FUWA 2HTEA 8MHTA 2AOTA 4PWYA 3NTVA 1EG2A 2P3LA 4LG1A 2FPOA 2ZFUA 3TQSA 2P40A 2HR1A 1OR8A 2IH5A 3JWJA 3ID6C 3LX6A 3EGIA 3FPEA 5E1MA 3KPUA 2G8NA 2PKWA 2ZVJA 3E7PA 3FRHA 4F86A 1YFLA 2DULA 2GH1A 4NECA 3GO4A 3KKZA 1DL5A 4IKPA 1XDUA 5F2KA 3LCCA 1XCLA 2C7OA 2B78A 3B3JA 3NVMB 1AQIA 1KHHA 4WXHA 5FUBA 4C07A 4MQ4A 4E32A 1AV6A 3CGGA 4QPPA 3HCAA 3UJ7A 2PX4A 3AY0A 4XUEA 5CVVA 3G2MA 5FQOA 3C0KA 2AOXA 3JWHA 1RI2A 1UIRA 3LDGA 3Q7EA 4YUWA 5K0JA 2ZBPA 4HH4A 3B3GA 1NW3A 3PB3A 5E2AA 3D2LA 3S68A 5F2NA 2YVLA 3KQTA 1SUIA 1PJZA 3I9FA 1VBFA 4DMGA 3F4KA 2P35A 3NDIA 4PNEA 4X61A 2VP3A 2ZZKA
chains in the Genus database with same CATH superfamily
3JR3A 4OH7A 3ZHOA 5P21A 1DG3A 1Y37A 1LU9A 2X1LA 3I45A 4DVGA 2M9MA 1MVOA 2W11A 1LKZA 3T4PA 4H4EA 2CCJA 5IP5A 1QPZA 4DY6A 3ICQB 1GG2A 2ATIA 4W1SA 5B3KA 4RFSB 3ANMA 4L5YA 1N2IA 1MX5A 1OSNA 1PGJA 2A4MA 2FOLA 2QB5A 1KY4A 1LBEA 4R1SA 4J0EA 3SNKA 3I2FA 4CHTA 1VSQA 4WCVA 4I2NA 1E98A 1ZR2A 5I6DA 4G5HA 2XNDD 1TGYA 3KHSA 2I54A 5EHNA 3DQQA 3GT4A 1XYGA 1ZO8A 4IIXA 2ZANA 6YASA 5KYKA 3W1WA 2FY8A 1ILEA 2KBEA 2CHQA 4GC9A 5LA6A 4B6FA 4ZYLA 1ADFA 1UPCA 1TFRA 1NUUA 1C2TA 1QJCA 1R88A 5CT6A 3SYLA 1M75A 1NBWB 1XO1A 2I2BA 3DBLB 1X1QA 3MCWA 4IRMA 3B2QA 3NGLA 1B74A 5T3UA 1NW7A 4PXAA 2Q4TA 2I3AA 4DLVA 1MX1A 5FTLA 4LGYA 1IOVA 3SQLA 3CIFA 3WDKA 3PRJA 4IIVA 4II2A 1NMYA 3KRTA 4U00A 1P5HA 3GT3A 1P39A 4Z4FA 1MQSA 4OPMA 2ODPA 1SHJA 3WQHA 1DJPA 5C1OA 1LQ2A 1IXKA 1HE5A 1G5RA 1VB5A 2AFHE 2Q6OA 1RKVA 3DHVA 3ETEA 2HPAA 3PLRA 2VS1A 2G0TA 5E9QA 3LUHA 3MXOA 3F6RA 3PDCA 3FBWA 4LOJA 4LOKA 2AZTA 2OSVA 1X42A 1RTTA 3T1QA 4DLRA 1X1EA 5BQPA 3D2AA 1YE3A 4AS1A 2JCBA 4JUFA 5HK8A 2CVOA 4I8IA 1BXRB 2GEFA 5D1HA 1EXWA 1L4UA 3NEPX 3Q3IA 5BSGA 1J8DA 1F8UA 1ND5A 1EVJA 1E7WA 2QPLA 4YJ2B 5REQB 3TGPA 2OUIA 5DNEA 1CQXA 2UXCB 1VSVA 1C9KA 4WKCA 2W5UA 3DOOA 3N2ZB 3ZTYA 4BX9A 3TI9A 4EITA 3FJYA 5JNSA 2DHEA 2C2ZA 1JKIA 1JILA 1N2GA 5CH3A 4ALKA 1Q57A 2Y1CA 1ZJWA 3CF2A 4BJHB 4HB4A 3NUGA 3EARA 5ED0A 1Y6GA 4QRIA 1EWYA 2J3QA 3E61A 4L85A 5EWMA 3RJ5A 1HT1E 3U81A 5CNIA 1UCFA 3Q8WA 5CA0B 4B4UA 1E3SA 4D0GA 2W8ZA 5ALRA 4QRDA 3KUDA 3EH2A 3IS3A 2PGAA 3IR7A 1WUJS 1A9QA 1RWBA 3IMGA 1ISIA 2DKNA 3N5KA 4B44A 1L4EA 4I50F 1QH1A 3U3JA 1U8TA 3Q1LA 3HXLA 4TMKA 4F85A 3QVXA 4ZDWA 1FZTA 2PSEA 3BIJA 3ZD7A 3SDBA 3H87A 1XRSB 4E3ZA 1DC6A 2IYTA 1A8SA 2FF7A 2B8TA 1Q83A 1NURA 1JEEA 1JA1A 1JQ3A 1SU6A 5DFAA 5ER9A 1EFVB 1I4OA 4IQ0A 3IRVA 3MGCA 3ZHBA 4TLAA 3HI4A 4BGIA 4ND8A 4B6JA 2O52A 4KBFA 4X65B 3ZGZA 2GZ2A 5IYZF 4KE7A 1PL6A 2GRUA 5D5PA 5I4BA 1UBLS 3U39A 2H6EA 4B4KA 3UJBA 2IH2A 1P29A 1C1XA 4RGQA 2HLDD 5DM4A 2JLCA 4V2IA 2QJFA 1AQNA 5IT9A 1A4RA 2D00A 1KSJA 3ASUA 3X1KA 4YV7A 5JSFA 1FRVA 2BFOA 2GK6A 1H3FA 4W5QA 2FPGA 4KUGA 4MXDA 4P98A 2PEYA 4K9DA 1EUDB 1EU1A 3EQ8A 4ZP1A 2EKQA 2WU4A 3H42B 1OXKB 5IPFA 4XAQA 4Y2UA 2A5FA 4BNIA 5BT8A 4ARZB 4O2LA 2XGMA 3M49A 2C88A 1TO6A 5KZMB 2WPDA 2H0RA 4ZI3A 2EOAA 5C51B 4TUYF 1W19A 3KS9A 2J7PA 3R5XA 2GARA 4M49A 3OX2A 3ZJ4A 3OA2A 1U0FA 3P2MA 4R2KA 4TV9B 3PDUA 4QC2A 3O0DA 5CIQA 1YCHA 5B6PA 2JAQA 4G0OA 3LDHA 2I7VA 5TMBA 2O1SA 4WOBA 3H6GA 2H57A 3O2SB 1J0CA 4LW8A 1OBVA 2EYQA 2GNAA 1GSHA 1N3YA 1DC8A 1DPFA 1U80A 1Z7EA 4NATA 4JBWA 3IOCA 4IJQA 4MRSA 1L3CA 1IN7A 4IIEA 1Q7CA 4P84A 3IEKA 4O2AF 1YZVA 1ZGJA 1VHQA 3PGXA 3G5MA 5K0FA 5JC1A 2XY4A 3SAJA 2BUAA 3GLSA 1CUJA 1EH5A 1XZGA 2JS7A 3ANSA 2BFEA 1HE8B 3LHFA 2BMEA 4GEGA 4QASA 5FBLB 1GV1A 1PNOA 4Y30A 3I05A 4PR3A 2AMFA 4GM1A 1D2EA 1JR3A 4YT4A 3SHTA 2SKCA 3BDVA 5FAKA 2XB4A 4IDAA 1R0SA 2TMYA 4GF5A 2ATXA 2W90A 5F73A 1IDOA 3WQRA 3NDJA 2D5BA 3ZH2A 2BCJQ 2PL5A 3KJEA 3QBJA 4YP5A 4HNGA 1DHTA 2IYNA 3QX7A 4QDKA 1N9ZA 4F9GA 3DAOA 3KEOA 3L04A 3D6TB 4MR9A 4F9EA 4PAQA 2QUHA 3WWYA 2JFQA 4V0OA 1GDHA 5CB8A 1IN1A 1G2QA 1VPVA 3W7AA 2DUJA 4LKOA 1XV5A 1CZHA 4LJ9A 3H5AA 1T6YA 3H3XA 3PXCX 2QZ9A 2F2TA 2O2CA 2VO1A 2W2QA 1RYEA 2R5WA 3PICA 4R1QA 4YJHA 3TZKA 3KQHA 1A8HA 4F6LA 3ZV7A 4ALJA 3M4YA 5KTRA 1C4OA 2VOEA 3F6PA 4B3BA 2YJGA 3TEJA 4ERNA 2IP1A 2C4VA 3GFSA 1KQFA 4ZO9A 4OJYA 1EP1B 3GJTA 4A0SA 4LXTA 3ZWVA 2VN8A 1UPXA 1HYQA 3PD7A 2JBAA 1ESDA 2XWJI 5IASA 4HEA6 4KEAA 1IQ0A 3PDIB 4CHGA 3QENA 2VDOB 1TLLA 1TB4A 2P3OA 4RELA 1JQJC 2C2KA 4MWTA 4PNPA 2WIGA 4EY7A 1ZHFA 3AQIA 2GFQA 4KQGA 1ZCJA 2B2NA 4RQBA 2FSVA 1Z47A 1GU7A 2R8ZA 4GW3A 1F6BA 1Z8HA 3GEDA 3RS8A 1YFJA 2WLSA 2B1GA 3FSGD 2QE6A 3KKEA 1NN0A 2VQDA 3P9NA 3QK7A 5DOVA 1U1GA 4HC4A 4JYZA 1SCQA 2VJPA 1V41E 1GQYA 1G1AA 1U90A 3EIQA 3FR8A 1Z12A 4JWTA 1OFUX 1S2OA 9LDBA 1A77A 1YS1X 4OQNA 5ALQA 5DGDA 4B9AA 1CFJA 1YULA 1J07A 1WDKA 2VP2A 3G6WA 3RASA 2VT6A 5JADA 4DW8A 3THXA 3WKEA 2VHXA 4EEXA 3H13A 1DKPA 4WEQA 3ADPA 2DBRA 4RBNA 3B52X 2OMEA 1FUUA 2O8VA 2PZKA 3G2NA 3K09A 4GAEA 1QP8A 1QYRA 1YZFA 2V7QA 4PLHA 4WVLA 4D96A 1GZHB 1NF3A 2FQQA 2G9UA 2R7KA 4QEDA 4EDHA 2TS1A 4O4LB 3VDXA 4EI9A 3E35A 1ZITA 1S4MA 2LV8A 3PE6A 4JU9A 2FUCA 1VIDA 3OZXA 1GCAA 4L9AA 4MMZB 3SLGA 4D4KA 4BCDA 1R16A 3NFYA 4G65A 2PUAA 4CM8B 3EUEA 5AUPB 4LYGA 1QYXA 2GBIA 2Q3MA 3MF4A 3EWIA 4NBWA 3UJHA 2ZSBA 3S28A 4DY4A 4DIDA 2XR1A 1VCHA 1XE3A 5SY6A 1O6GA 2BLNA 5FEUA 3ZK7A 4YXFA 5FX2A 4UNIA 3KZNA 3U6KA 1PG0A 1J00A 1SUEA 2JGMA 2JJ2A 3O92A 4A2QA 4YAEA 4LYAA 2JHAA 4TTIA 3LA8A 4LHSA 2P11A 3GBPA 3O9ZA 1G0NA 2D1FA 2XD9A 5KYWB 4UBLA 2YZKA 1Q17A 3AP1A 5CVUA 3JVDA 2VRCA 4DLUA 4IEEA 4KLAA 1B6GA 4LCBA 3ZJYA 2E89A 4CL2A 3R9XA 6ABPA 1EFPA 4QBGB 1QDEA 1RJEA 4F7WA 1UC9A 4YJFA 1PRYA 4ARBA 2I6UA 2C8KA 3FUXA 3ET4A 3T7JA 2R00A 4R9VA 3TR6A 1P60A 1I30A 3SQWA 5TPZA 1W52X 1R0RE 1YL6A 2C54A 2H2AA 3EZ6A 4K9MA 3EMVA 2RHRA 3JSXA 3IMCA 5ECDA 1K6MA 1Y8QB 1BCRA 4Q7LA 4NYMQ 3PVZA 1SR8A 4BB9A 1WP4A 4KMSA 2IYQA 3WNQA 4F9FA 2O8NA 2E82A 2ZJ0A 2XYRA 3B1KA 1S3FA 3F7OA 4RA6B 5F3RA 2COKA 3HO1A 3TBFA 3WTBA 3BF8A 5EERA 4ZVRA 4CV0A 3RS7A 3DV9A 3HJHA 2IYAA 4KLRA 4LGCA 1XA0A 3EXHC 3JZIA 3UAVA 3BL8A 4CMHA 3FTFA 3UCXA 3QE9Y 1F6WA 3EDQA 3UAXA 3VM6A 1BRTA 3RVPA 4R2WA 3R3YA 1I24A 5C8VA 3JQ6A 1K4MA 1WW3A 1QWSA 1RQPA 3JALA 3EGWA 4KQEA 2O4CA 4LOIA 4AKHA 5JXIA 2B69A 3EVAA 2P77A 4I99A 3EVFA 1NWCA 3CUKA 4YBZA 4JMLA 1U2DC 2DE0X 3T8YA 5A62A 1J7KA 5KMGA 4GFDA 5IF9A 2MTBA 3B1XA 1CZUA 1ENPA 1W94A 2NO7A 1QQ7A 2YRWA 2YHBA 1KGDA 4U4AA 5FFNA 4JQOA 1SBCA 2XXBA 1BVUA 2UXBB 5CNJA 3BSYA 4B76A 2VRNA 1IAVA 3IQFA 5A3JA 1YL7A 2GF9A 3BXEA 4R3WA 2WD8A 3T7IA 4YCMA 3ACBA 4V0RA 2OV8A 4FXOA 5JD3A 5KHLB 1RXWA 2OG2A 2EZUA 2HBQA 2CLCX 5F1KA 2GYWA 3L4BC 5D85A 3FPAA 4DV7B 1EWQA 1NATA 2I4OA 3NHMA 3FOCA 3N07A 4ZPXA 1FRQA 2RH8A 5JYBA 1I4LD 3OFJA 3UMJA 5IUJC 1PNVA 4BKOA 4BQNA 3DE4X 5GOZA 2IOQA 3AZQA 4ZO4A 3MWLA 3CT6A 2Z6AA 2Q3LA 1N1MA 4J0GA 5HJ5A 4R1NA 5BR8B 4FOPA 1L7EA 3N76A 1QSGA 3P9RA 4N0PA 4QSHA 2J30A 3AM5A 5CM9C 1FYXA 4E4TA 3AI7A 2V55B 1JS1X 4FP9A 1DEOA 1H2AS 1VG1A 2Y27A 4B82A 3AILA 2X9QA 3G88A 1MT0A 2I66A 4RH1A 3VHLB 1NHGA 3Q9UA 5TS2A 1RXCA 4LRQA 2GSDA 2QZJA 3CW2A 4FNOA 4UM8B 1HNNA 3KCQA 3I9V1 3LSTA 1KZ4A 1XN4A 4MICA 3TYXA 4HR7A 2QROA 5KPJA 1SCIA 2Z2XA 4INJA 4KP7A 3L5OA 3EPHA 4G0NA 2ZSJA 2LKDA 1F8GA 2QI9C 1L5ZA 3F49S 3BULA 4UNPA 4AKTA 3PJRA 2WJJA 3QY0A 2AYYA 2EJVA 3GGPA 3DL4A 2PUGA 3C5VA 1P72A 5TQ0B 3VVCA 3WFJA 2HIMA 3AERB 3QXHA 1TT7A 1O7JA 4IIYA 2CJXA 2FNAA 4IGIA 4PBSA 3CS3A 3NMUF 1E3QA 2Q49A 2QN7A 4IR7A 5GINE 1C7IA 5C5CA 3HJAA 4DQDA 4UOEA 4MZXA 3TZLA 2BFFA 3KHKA 1JXAA 1NFFA 3IERA 3R24A 3AY7A 5ALHA 2RCYA 1XKQA 2A4KA 4W5NA 3G2KA 3R0XA 5IMBA 3O7MA 3NOQA 3QVOA 3I28A 3MUNA 4GZMA 4YP0A 1AGXA 3OQMA 2J4FA 3K8QA 5DEIA 1NRIA 1XRRA 3B5JA 4QUAA 5JU6A 1KP2A 4DJTA 2YNMC 5BSRA 3G0DA 1RM5A 2LE0A 2XIJA 2E4ZA 3DPUA 4Q9LA 1EXDA 1U3CA 4L9SA 1I4EB 4G1UC 4G0QA 1A5TA 2RKOA 4AX4A 4BLPA 3SQNA 2Y1XA 3VR2D 1X2EA 5JJLA 3U3DA 3RS4A 2Z4TA 2A8YA 2HRDA 3AGQA 1ZH0A 1ZKMA 3NTVA 2AJBA 2P3LA 1MAUA 4LTDA 5ADWA 2JZOA 4D8YA 5TXGA 3OOHA 1N5KA 4M1ZA 3TCXB 3TQSA 4WLVA 1ABBA 4PC3A 1PJ4A 4GP9A 4Z6KA 1OYOA 3E7PA 4XDHA 4ECAA 3CUSA 4I8XA 2DULA 3HP1A 2W0SA 1ZIXA 4L4YA 4WNAA 2AR9A 2VZLA 3JQCA 2VHJA 4M1KA 3WJ1A 2QRHA 5TR9A 5KYYB 5BVGB 3VH4A 4DR3B 4WOJA 3IVGA 3OLQA 3Q0IA 2J59A 3EZYA 1BTOA 1MLDA 4BNDB 2FJ0A 1NBAA 1M1XB 2C7GA 1RI2A 4I4NA 1PJ3A 3Q7EA 4JX9A 2R11A 5AKZA 5K0JA 3OZFA 1N8NA 3LYHA 3KYIB 4LHZA 3S68A 4XYMA 2ECPA 4N8EA 3AVYA 2HH9A 2W6ID 3MUFA 1MVNA 2CFSA 2JEYA 2EJBA 3M6AA 1CLUA 3BTVA 3RYIB 2D0DA 4L8LA 3IE1A 1M10A 1TCBA 2VDPB 2NACA 3RTGA 4EENA 4MUAA 4V0NA 1JFSA 1QQ5A 1WXFA 3I6IA 1DE0A 5JY6A 1ORRA 3AMVA 3QPBA 4LNAA 4F4DA 4WZAE 5G0UA 5B7NA 1W36B 3GH1A 1Y98A 2MSKA 3CNHA 1PBNA 4LC1A 1TEXA 2BWJA 3RAFC 2PWYA 4J4BA 1I8TA 1OWLA 4PAOA 2BEWA 1Z2OX 3UMVA 3HYNA 1WE2A 4HNRA 1U4NA 3EIXA 4EP1A 2BT4A 4UUAA 4GPEA 1KH2A 4DEYA 1GNQA 4IY1A 2Q46A 4E5SA 5K8TA 4HSEA 4UZFA 3DDZX 3WGQA 1QHHA 1YR3A 4HXYA 2Z83A 3HJNA 3ZDFA 3DVAB 2H4JA 2ODQA 3CM0A 2HCJB 5K6AC 1W59A 4RF4A 4BNGA 2ARKA 4LA4A 1N6NA 1FFXA 2IUSA 2GK7A 2X86A 1FXUA 1W5SA 1J56A 1B73A 2ZQYA 2ZSHA 3OE5A 3TO5A 3P2EA 3WRYC 5M34A 1GM5A 2W42A 2JKYA 1VE5A 4TOIA 1NF2A 1PO7A 1BOFA 3WL4A 2NO1A 1DBSA 2GLXA 3VRHA 2C5GA 4UM7A 3DUFA 1UP4A 2C57A 1LBHA 1LBTA 3K9WA 4HQOA 1O0BA 3WRXA 1H2EA 4IO0A 4AMBA 3A9WA 4Q6BA 2VEDA 2BFBA 3KE9A 1XQWA 3G5TA 3UBTA 2AMYA 4EUKA 5BN3A 2F1HA 2V3CC 4A8JA 1J2RA 1KFBB 4QXAA 1RR6A 3MEQA 5BYAA 2ERYA 3L0BA 4QM6A 1YIOA 3M34A 3PNBA 3UJ6A 2VYVD 3W5IA 4FFMA 4N01A 4MGZR 4FHDA 2C3UA 2QY6A 1HWYA 2NZVG 2YWDA 2B20A 5ARBA 2CUZA 3I73A 3IP6A 3C7AA 1UDWA 4O0LA 5EUCA 3CUTA 3JX9A 3U1VA 3WYGA 3PXXA 1U7ZA 1EIWA 4WDRA 4RTRA 4K5QA 4ZTBA 3IEUA 1Z73A 4HN9A 3IYLW 4PHGA 1SXJD 4C0KA 3PCTA 4D57A 3OEWA 1SXGA 3KHTA 2DRIA 2WIFA 3SM3A 4IF6A 1LJLA 1V8FA 3BWXA 3MA0A 3NDBB 5JAPA 3W8RA 4MR8A 3NWEA 4CU2A 1PX0A 5DN9A 4E21A 5HKAA 1SBTA 2NO0A 4KLCA 4KVGA 1GL3A 3NVDA 4E6EA 2R79A 1GL6A 2ZUUA 1NBEA 4GKVA 3L7OA 5F35A 4HJXA 3X1YA 4FYWA 3A9UA 4DN6A 4BEBA 2ZYIA 4ZZ0A 2GD1O 7AT1A 4O63O 1FFAA 1QB8A 2Q4DA 2XI4A 1UFQA 3U4QA 1Y8AA 1ZL0A 2FSUA 3HYSA 3JARA 4G41A 3FJ1A 2VCEA 1SKAA 5EMMA 5HPYB 1G3RA 2JFGA 4MYDA 3UHJA 5IF3A 5ITZA 2BZSA 1NVUQ 2F62A 1EFUA 3U3MA 3FRIA 1YI0A 2AUNA 3ZK9A 2CVPA 2BW0A 5L9AA 1DXQA 1P4JA 4WK4B 4CODB 3LXUX 4H6VA 1FNDA 3DCNA 3P94A 5JPIA 2VPQA 4JLVA 4DNFA 4F12A 3FTEA 3PUJA 2XADA 5KI6A 1U04A 2RIRA 3ISJA 3KQMA 4JBIA 1IULA 4NAVA 3D8TA 2J7KA 1IQUA 3O8DA 4I55B 2YZ7A 1TU4A 2FUKA 1GZ6A 1KYWA 1RRPA 4U7WA 5EIBD 1I9CA 1CF4A 1YJ5A 2UDPA 2OVFA 2HBZA 3HB0A 3UXHA 1FX1A 4EHAA 4MKHA 4PRLA 3LJKA 1NA5A 1QIIA 2OORC 1FDOA 2LD4A 4JZYA 3IBYA 5TGZA 5KDLA 1BJRE 3DFUA 2IZ0A 4AJ4A 1MO4A 4DA7A 4G8DA 1FX0B 5CM8B 1ZI9A 1F4VA 1EBFA 3TLKA 4BFLA 1SEPA 3JWPA 1JG7A 1KS2A 4URYR 1N2EA 4RENA 5JCZA 5J2UF 4N7MA 5IARA 3VFDA 1E1MA 2EVWX 2JIDA 3QEOA 4R1LA 9ATCA 5LMNB 1YB6A 1A9TA 1NMSA 3QVTA 2ZYRA 3OCCA 4TQUS 4YUYA 1QCYA 2X3YA 2NAFA 2O3QA 3C2QA 3KPJA 3QPCA 2O0LA 4WN9A 1ISSA 1DCMA 3IVAA 2YWRA 9GPBA 3GLHB 3A2NA 1G4UR 5ALFA 1NG9A 4HB3A 3VU8A 1O8BA 1OPXA 3LQFA 1S8NA 1LLDA 2P3QA 4C4TA 4ZZ1A 1JJFA 1T5DX 3G2LA 4ZJPA 2QVBA 1G8GA 4M1MA 3ZCTA 5C8YF 3DBIA 4DF3A 1U2ZA 5CDFE 1BWQA 1ISJA 3OZVA 1CEYA 5DNWA 4HQFA 2BKAA 1L1FA 1WABA 4C3VA 4XR4A 3SYMA 3K0AB 1KTVA 3VR4A 2A0UA 2SCUB 2ECOA 2A3RA 1T10A 3GG2A 5AI6A 1O95C 2QTVB 5B1DA 4Q9KA 1ZCZA 1R4ZA 1XVIA 1Y6RA 2B9EA 2RHHA 4BFUA 4RPIA 1Q0ZA 4FCVA 3ZH9B 1L7OA 3JS5A 3G49A 1TA0A 1BYIA 3MFQA 1O94C 3CHYA 3VHXB 3GLGE 5IWAB 3IPCA 3DEFA 3I5YA 4CEHA 2PZBA 1RMYA 1SIUA 3JPYA 1IHDA 3D7RA 3GDGA 1CJKC 1EVKA 4LX0A 2VT2A 4B43A 4E1BA 1K6XA 2QT1A 4CPDA 2WINI 4Q1VA 4JI5B 1MTOA 3L41A 2JFUA 2X13A 1D4OA 1E8MA 2ZIXB 4NJMB 4WA7A 4F2GA 2FMUA 3WWCA 4OHOA 2IBMA 3A4NA 3ND5A 4KG7A 1MC4A 1KK1A 1VRCA 3SS9X 3SGLA 4JVSB 3BRSA 1ZK1A 4JBXA 3KKLA 3MBKA 4Z9YA 1DDGA 3EVCA 1QYCA 1JJAA 1ZRHA 4G67A 4GICA 4KDCA 2RKWA 3GGOA 2OBFA 4XIFA 5LDGA 4QGSA 4ZGBA 5AW9A 1SD1A 4CF3A 4YAOA 2HEGA 1G17A 4KYVA 4Q7KA 4E4RA 3FE2A 4Y1RA 5HS6A 4EW1A 4LHVA 5TEWA 4YJ3F 1TK3A 4XIIA 4YMWA 4ZYZA 1DINA 2XT6A 3ROFA 1WNFA 4A0RA 3ZX4A 4B3CA 4HQKA 2P9YA 3N59A 3GG9A 5IC6A 5LLTA 3JQFC 4BX8A 5KYUA 4ZEOA 2ANBA 3PGVA 4KGZA 3EY9A 4DA0A 4BP1A 1M7HA 1PGQA 5LJLA 2R60A 4ZQGA 1ZA2A 1FVFA 3PZBA 4ID9A 2R66A 4UFOA 1VL8A 1JIVA 2ZIZA 1XMSA 4MQFB 3RC2A 3C8DA 3PBKA 4FYJA 4KMRA 4LKRA 4NICA 2W8BB 1IXRC 2QMHA 1NLFA 1U1FA 2H1CA 3NHPA 2VQFB 1EXNA 4QL3A 5TY0A 3M6XA 3DE1X 3N7AA 3G79A 4OGGA 2GT1A 4TGLA 1DZIA 1HFEL 1MJGM 1VJ1A 1X7GA 2FN8A 2NZ8A 2WJWA 2XSZA 3LRTA 3SY8A 3ZI4A 4EY6A 3YASA 5LQCA 5CYPA 1XXLA 3J81A 1IG3A 1R6TA 2ORIA 1USUA 4M1YA 2CVQA 4WI1A 2OBMA 3R9IA 3C45A 4RD2A 3AL3A 2IOFA 2PX0A 3DHEA 4D02A 1GP2A 4DJJA 3TLCA 2Y8EA 3Q9SA 2M6LA 4ER3A 3NH9A 4UDYX 3PX3A 2IY7A 2W7TA 3PUIA 4W6QA 3FPSA 2CVHA 3K2BA 4UVGA 2G08A 2OD2A 1T25A 9MHTA 4MV9A 3R4VA 3K1AB 2WT4A 5LP1A 4HUQA 4Y9DA 5AK4A 4DCTA 2V98A 2XH8A 1XZNA 3IB6A 3TQFA 4BVGA 4C21A 1QU3A 2SKDA 3IP9A 4W6ZA 3VPAA 3KJNA 3E3LA 3A04A 1E7YA 4A0FA 4Z1OA 3IDAA 3FGOA 1XMVA 1KKLA 2FMHA 1U98A 2QM0A 3P9KA 4IKOA 1G8MA 4OM8A 1IIRA 3HCFA 5J3JA 2WNHA 4PBRA 2IFTA 5SZHB 4DLPA 4OHPA 4IJ6A 2O3SA 3SVTA 1X19A 1I2CA 2WA1A 5H4GA 2WWFA 1X7YA 4HX2A 4JR2A 1BDBA 1SULA 4BNFA 4YRDA 2GPJA 1QRRA 3QFSA 1ZLYA 1CIVA 2AFIE 2Q8PA 2Y4NA 4GKBA 1Y42X 1H85A 3TTWA 4BMCA 2CLEB 2MYPA 4PYJA 1F51E 2C5BA 1PWHA 4FOTA 1E3WA 1Z68A 1ZOLA 2JEZA 3MTIA 1FNNA 3NTQA 3FDXA 2V8BA 3H04A 4YJDA 1CZOA 2ZG6A 3A4IA 3H84A 1C50A 3WDSA 1FSZA 3K4HA 5EUMA 4QZVA 3ZE7A 2R7NA 1MIOB 4C2TA 2HNBA 5BO5A 1Z8FA 2VDMB 2WPDD 3DULA 4V38A 4NMMA 1WLSA 4GXTA 4R8SA 4IO1A 2G9RA 4I5DA 1U5BA 2P68A 1NJGA 4J0IA 2J7PD 4YPFA 2RKBA 3WIVA 1ESEA 2ZBDA 3THWA 2ZWVA 2H5LA 3KL4A 4PZCA 2CWWA 4PGHA 3T0FA 4GR9A 3WP1B 3T9FA 2IU0A 4ZC8A 1ZG3A 5F7OA 1B0UA 4KPYA 1MT3A 1S2LA 4DLWA 4G8BA 2HWKA 1NF8A 4BVLA 5AW8A 1TW2A 3HABA 4H7IA 1NXPA 5ILGA 2FSFA 2UZ4A 1XA4A 4BO7A 3VR1A 4CM5A 2FUNB 3AK4A 2EZTA 3NPAA 3BEDA 4O59O 4EGCB 5DYTA 1RZVA 4DFDA 1UQRA 3P5BA 3MB5A 2R6DA 4I1YA 4LDNA 3FDIA 3QVWA 1GSIA 3G02A 3MSCA 4Q3BA 3KSDO 4BO6A 1V25A 5E6SB 2UZ1B 3P0JA 4OK6A 3RO7A 2HSDA 2HC9A 3CLKA 3WLQA 2OLEA 4A7PA 1A9XA 3GLQA 1FRFS 1TT5B 3ZOKA 2VXYA 4MW7A 4I5EA 4BVFA 3UJ8A 4KWHA 1OF1A 3T7CA 4AQDA 2B83A 3SYTA 1HE3A 3IBGA 4LMPA 2BEVA 3RTBA 1E1QA 3E7DA 2V97A 4MW9A 4N5DA 4D9FA 5JNWA 5H8WA 3WK4A 3QEAZ 3H17A 4C7XA 4D9NA 2RGRA 3U7QB 4UJ5A 4UJ3A 4F2PA 4V0QA 4BJ1A 3D4PA 2WU3A 3IIEA 4YLGA 2IYOA 3S29A 1ZSYA 2GASA 1CBUA 1C5KA 2ZKIA 5JY1A 3KE8A 1LSOA 2ID4A 3HUDA 3I32A 1KU0A 1QIKA 3UOWA 1TYAE 4YRZA 1N1EA 1E5DA 3IMKA 3GNLA 4N8DA 2HIAA 2QL7A 3OFND 1OHHA 4JR1A 1NSFA 3JYNA 1D3AA 2BZ1A 3NWPA 1VL2A 4QOIA 5CLGA 4UTXA 4IDEA 4P53A 2UXDB 2FR0A 2BIFA 4CKXA 3U56A 1UOPA 4MTCA 4GPBA 4O0MA 3B1JA 3H9EO 3RVBA 3UJPA 4EHBA 5A6SA 2CNDA 1YUNA 3AM4A 3GXOA 4OMDA 4W7SA 4EHFA 2WQ7A 5A7HA 1YFKA 2FLKA 3QSYA 1G6Q1 2O20A 2VYCA 3HCOA 3D8UA 3E3OA 4NYJQ 2OBYA 2OCGA 4QX6A 2Q28A 3RVMA 3BMCA 4Q1BA 1T9GR 4MRAA 1RU3A 3QLEA 1G19A 2O2GA 3O9VA 4J03A 5J2UA 1ECBA 1L5HB 4L78A 3VH2A 1ZX1A 4MYSA 3WL6A 4R0VA 3X0DA 2Y1EA 1QZZA 1KE2A 5B4UA 4KWEA 4OBEA 3VDMA 1MCZA 1V6SA 2P2YA 1NAHA 3K4QA 4G9BA 1VRVA 1DEAA 3FSJX 1XTZA 2ONCA 4FFSA 2QVCA 2CYCA 5LQMA 1BG6A 1NV8A 5AUOB 1L7AA 1NQAO 4OQXA 2MYUA 2C4WA 1OROA 4PYNA 1C9YA 5JNVA 3RFTA 2GRAA 4MS4A 1UJ4A 1EUCB 1ZUHA 4D8WA 2FPWA 3UN1A 3F8TA 2WSIA 3CC8A 3RIGA 3EA0A 3VUFA 4BO9A 2H16A 3OUZA 3QBVA 4LBZA 3WGZA 3EVZA 5BV1A 2XKJE 3L49A 3BS4A 4S0XA 4QM7A 3VX4A 4DZRA 4DXHA 2W6ZA 2AOTB 3LAWA 3CB2A 3ND9A 3OZEA 5T4FA 4Q9JA 4KR7A 3TQOA 2DFNA 4RM2A 3D81A 4Z0HO 2G5TA 1RLJA 1OUMA 2VNHA 1MC1A 3LV8A 3RQSA 1A0OA 1C0PA 4D46A 2YBDA 3DNFA 5JSQA 8MHTA 4NQRA 4FOOA 2PX6A 5CITA 3BJEA 4FQ5A 4NS1A 3FTNA 3TMYA 1MOPA 1GUZA 1IC6A 1WR8A 4F38A 3ZDDA 4BO3A 1JHYA 2HA5A 4A2WA 1E1CB 3ZDZB 3HB7A 3GLIB 1T2AA 3GY0A 4WWHA 2BC9A 2WABA 1E5TA 4I5FA 3PHIA 5C5IA 5BWBA 4ENPA 3KKZA 1DL5A 1R5NA 1XDUA 2P6UA 4JBHA 3CKMA 6GPBA 3CZ4A 5CXUA 2UUBB 3ZQUA 1K92A 1KC3A 1C0KA 2BE7A 4PPQA 4R5MA 2H4ZA 3LTNC 2JLVA 1JTVA 4QPPA 3LX4A 2C77A 3ILXA 1SVLA 3SDZA 4BYMA 2XGSA 1FNBA 3OF5A 4TS1A 4C7KA 2Y0PA 2QM7A 4P86A 1PGOA 2ZR0A 4IXMA 4EUEA 3AFOA 1GDDA 1TCAA 2UZAA 1EWTA 2ZBPA 2IXGA 4HLUC 1AK2A 4MB2A 3UATA 1LSSA 1R37A 1XGKA 1S7CA 2HWXA 3CWQA 1XELA 2H7VA 2QN8A 4QOHA 2RGWA 1HM5A 4XYBA 5FOVA 2R8OA 4BB5A 1MBZA 4LVUA 1V4VA 5TPZD 5BPFA 1TCVA 2F00A 3ZV4A 1GKUB 1HK7A 1G20B 3S0JA 4TN5A 2MSCB 4OHXA 3EIOA 4YRPA 3WLFA 2FJPA 4EMSA 3QNUA 3STVA 3JV7A 4YRSA 1IHOA 3A1SA 2VWGA 3N7TA 4KQKA 4D9KA 2R3SA 1B15A 4I4TB 3LWDA 4UFNA 1R0LA 1RHRA 4QODA 5EHQA 4AZVA 1TJNA 3A8TA 3CVVA 1YNSA 3SZLA 3LC2O 4A2CA 5A03A 4DV6B 1BHSA 3C3EA 2C31A 2X0FA 1W88A 2WUVA 2YV2A 3BORA 3HNRA 3ZWWA 1CIJA 221PA 4JGBA 4AT1A 3N9IA 3RANA 3TSYA 1NVDA 2B37A 5A3SA 1MENA 3M6MD 3SXJA 3UJ9A 2CLMB 1FMJA 3RYHA 4MW0A 2EJTA 5EIOA 4O2BF 5TPWA 3UGKA 4MS1B 5BR1A 2CT8A 3EEYA 2SHKA 4YNBA 1M8PA 3NYIA 4RE6A 2X3FA 4MDHA 1WZCA 3ZWCA 3H8JA 4DYDA 2VQ3A 2DEUA 1XPUA 5IG2A 3PQ2A 3GGJA 1WOYA 3GCXA 3BWMA 2HSGA 3I37X 4Q3EA 1CPYA 3HLTA 1OTXA 2F6RA 2EATA 4UD2A 3UTCA 4MQEB 1H23A 2HWUA 4X90A 4CLEA 4LIPD 1Q92A 1JPUA 1J70A 4DG5A 4URFA 5L3VA 3R7WA 1I2AA 1U3UA 2C2GA 1LTQA 3HA3A 1WO8A 2XOEA 2JCYA 4HGPA 4JHLA 4B09A 1V1RA 4UVIA 5JNLA 4HXEB 1U7OA 1IY1A 3ONFA 1XLWA 2R86A 3GEEA 3PXEA 3R0ZA 3OOSA 5GY7A 4LSGA 2KM1A 3NVKI 2ZJAA 3ORRA 2HI0A 4IIJF 3C97A 1BW9B 3IAM6 3P9ZA 5E9WA 3RTAA 1MZPA 2BMJA 4ZU1X 5TJ9A 1HA3A 1QHXA 2XLBA 4QU9A 3WICA 5ADUS 4M76B 1MH9A 2A35A 3BEOA 3PQ6A 4JXJA 3ICWA 3W9BA 1OVGA 3TX6A 4Q39A 4AKEA 1V7ZA 1BWSA 3D1VA 3PHHA 1FCJA 2W2MA 4R1PA 4ZOLF 3U1BA 4JUCA 1E0JA 2VVTA 1HDEA 3KZKA 4K0RA 2IYRA 2ODBA 3DZHA 2JIBA 3OC6A 1S5PA 1CR6A 4RK6A 1PYOA 1RE0A 2AHOA 2Y68A 2BYTA 4MO9A 4YCCA 5TVGA 4QXMA 1C1YA 4FFNA 4U9UA 2HQ1A 2HBRA 2WQZA 2GJKA 2QR2A 2IZOA 1CQJA 2BBSA 3P96A 3Q2KA 2DBVO 3MHPA 3N70A 1DFIA 1ODKA 3NS7A 4S1VA 3G23A 2GD0A 2OGWA 3I8XA 1GEGA 1ZM9A 1YL5A 2XZPA 1DAMA 3PC8A 4XA8A 4B45A 4QOGA 5KJCA 5DMXA 2A7QA 1MRZA 3A4TA 4ZXFA 3RARA 2NV0A 1VKJA 1T1SA 1VLZA 3DMDA 1Q44A 1L5OA 2XUZA 4LXYA 3V1TC 1X7ZA 4PQFA 3JZAA 2J32A 3O4JA 1ZUNB 1T3TA 1ZPDA 1K08A 5H3CA 3ISVA 5I9IA 2IOYA 1U4OA 1W2HA 1U99A 2Y93A 3BAFA 3GA7A 4M9UA 4PQEA 3DMNA 2G8LA 3WIOA 1NE2A 3FBGA 4IMJB 1I6MA 2HK6A 4WV3A 2PZEA 2IHBA 4J2TA 3E6AA 1UKAA 4BU1A 3GQVA 2O8FB 4EI8A 4HZUA 1V5EA 4XUCA 1QFYA 4C3UA 4QOJA 3QQ5A 4ITUA 1W4RA 5AW6A 4PVCA 1XNGA 3TL3A 3U2QA 3PNOA 2E4VA 1X80A 4J16A 1Z3CA 2Q0HA 3GQBB 1J0BA 4R84A 4P4SB 4WKNA 5EJMA 3NDRA 4EG4A 1C29B 3HB5X 4TLMB 4PTLA 2PE5A 4WUTA 1QCDA 1PEDA 5AI5A 4NXNB 4D42A 5JVDB 3INRA 5CW2A 1Z4PX 5IJAA 2GILA 3VPGA 3WA7A 4UZSA 1Y8CA 5FA8A 1HE2A 5FPKA 1J8QA 4LVOA 4DA6A 3H5IA 5HQ3A 1AHPA 4ZREA 4YUXA 3AINA 1UK8A 1KY2A 3OX1A 2BD0A 1CJVC 4D2IA 5I8WA 4JI0B 4Q4CA 1Y8RA 1FMFA 4WKPA 4JITA 5L4NA 5E6UB 5EOVA 5CK5A 1MJGA 2ST1A 5LDHA 3IBFA 4PCLA 4C5BA 3WAGA 1Z74A 1L7PA 2Q8NA 2UUOA 821PA 3IUBA 3L7JA 4BOYA 3M9XA 3G0HA 2D7CA 3SOZA 1WCWA 2ZYGA 3KEFA 4IHJA 2V59A 2GZMA 3D3KA 3CYFA 2AK2A 5JHGB 3DA8A 1ZGCA 1I7QB 4F93B 4JUDX 3R7BA 5GP1A 2DTXA 1QBKC 3G68A 5CVEA 1I3NA 3ZCSA 2NUTA 3INTA 2ZW9A 2OYCA 3GMSA 2XJ4A 2ZROA 3AG5A 5B1HA 1G6OA 4ZQCB 1T13A 4LHEA 3VC1A 1C4XA 1GZ4A 1QFXA 2J09A 3TLJA 4CKWB 5LOVF 2YW9A 2LCFA 1C41A 1JFLA 3A4MA 4JSRA 2O3UA 4D4JA 2QN2A 3KFVA 1JG2A 3TG2A 3CE6A 3KTAA 2O8EB 2JHPA 3L01A 3HYRA 5JOQA 1EXVA 5ECYA 3C1UA 3M3PA 3OJXA 2YVKA 4B7XA 2M1ZA 3C85A 4MUEA 1DOAA 1NOJA 4AM8A 4BFZA 5H3HA 5BP7A 5I3ZA 5JSUA 1JG1A 1QF6A 1SKQA 1EI9A 2A78A 3KP1A 5EE5B 1T0PA 2AE1A 3Q8KA 1Q91A 3TSCA 3TRJA 2VTBA 5I7RA 3HLYA 1P7PA 2BM9A 3I4CA 4PU0A 2AFVA 2EEPA 2PZ8A 4A6EA 2GSWA 3ER8A 2ADFA 3M89A 4YONB 4LFCB 4COOA 3KJHA 1OX4A 1W49A 4FDUA 4OQEA 1NP6A 5DGXA 4J1TC 4OGWA 3RBZA 4DCVA 1R6VA 3ED1A 3PFCA 2IUUA 1UFKA 3TEFA 1NF9A 4IVPA 1G7TA 1K89A 3NB0A 3QQPA 1O08A 4I9NA 4PGMA 2YXDA 3HI6A 3FKQA 1J39A 3DB1A 3ZHCA 2KB0A 1U9YA 2YDYA 2JAXA 2PKEA 3IP8A 3IUEA 5EZYB 3MJTA 4OF4A 4DCOA 3LOQA 2R65A 1J2TA 2X40A 3VJRA 3AVOA 3QUBA 2ZSKA 3WWDA 4EHLA 2QF7A 2DPYA 4BB6A 1FBNA 5KB3A 3DDNA 5FBWB 3C8HA 4QREA 4E88A 7MHTA 2WT9A 1DG9A 3AB8A 2BGIA 3R5HA 4LTMA 4MW5A 3FF1A 4ZRMA 8ATCA 3OHMA 4NG5A 5KNBA 1T1JA 5DTEA 2GKGA 4Y2XA 3RG2A 1F1JA 4Z0NA 3RUAA 3L8MA 2E1PA 1AHHA 1KVRA 1JKMA 3BF7A 3RJ9A 1Z83A 5K3AA 2HXGA 1USGA 2CV0A 3UW3A 4RVDA 1RVV1 5KDOA 1AXEA 1VLVA 3UV3A 3THRA 3NRCA 5A5EA 2YHIB 4KXUA 4RKFA 5EXEA 1QF7A 4NR0A 4KQHA 4G23A 2NVWA 4KVZA 1TTQB 1S02A 4UQOA 2FOIA 3O4IA 3WLAA 4K8OA 5CU7A 1S8AA 3GUVA 3CN7A 4HUJA 4NJEB 1AE1A 1A4IA 1TM3E 4ENTA 1SMKA 2I4LA 4UCWA 1PQPA 1YO6A 4UOZA 3GUYA 2EQBA 3PFNA 4LC0A 2ACWA 2H3HA 2YNMD 3IHKA 2B6HA 4FIDA 5IDQA 1U8UA 3W1EA 1U7UA 1GGMA 1Y1KE 1I7NA 2VPXA 3NKLA 2XXAB 5ALYA 4OQYA 2I1LA 2OV4A 2XYQA 3E0XA 5DU2A 2PUFA 3NI2A 1WDTA 3JSAA 1MAVA 4GLJA 2WJAA 1UBCA 4WRRA 3ZHVA 4H3HB 3Q6NA 521PA 4DSAA 4HRYA 2JJ8A 3OEHA 1B1AA 4BY9E 1RFGE 2Y9MB 4QYIB 2C5FA 2E6KA 4Y2PA 3V9PA 4U7FA 1AGNA 1A2OA 4CTMA 3RREA 3B6KA 3IXMA 2YWJA 2JAWA 3ESCA 3P27A 3QVKA 2Z4SA 3HKBB 2YY5A 4AF7A 1HYHA 2WJZB 4BNKA 3U4CA 4FHCA 2EW2A 4PCVA 1R8JA 1BKSB 2ZE8A 3PHCA 5B3AA 3MJHA 2JJ1A 3DEJA 4MA0A 2VPWA 4JLOA 4YJ2F 4DDTA 3HA5A 1PR0A 1PK9A 4C5CA 2Z6VA 3ES9A 3W2FA 5K8UA 3RE1A 3JAMA 2HTFA 5T8KA 2R47A 1HPLA 2CLIB 3BM5A 4X91A 1NN1A 2XT0A 5CHEA 2HU8A 4DNOA 3RPEA 1FRNA 5C81A 1KBQA 3DQZA 4O2BA 1EP9A 1WW8A 2CL5A 3ABOB 3AY3A 4HGZA 2CV2A 3M3DA 2E37A 5CT5A 3HV0A 4N5HX 1G3IA 1JR2A 3W2TA 4NBLA 1DCFA 3CBGA 5DXJA 4H9GA 4QGHA 3RV3A 1W87A 3A31A 2NGRA 1V7CA 3VZRA 2DY1A 4ZDIA 3L7CA 2PQMA 1S0UA 3VPHA 4K1XA 1EG7A 3C74A 3UB4A 3DFMA 5BORA 5KYXA 3O8OB 1RP1A 1CDEA 1HQCA 4FYPA 2JI4A 4R51A 4RJKA 1V8BA 4S35A 3TRHA 4BFVA 4FIZA 2HF2A 5FT9A 1T4BA 2ZKLA 4IIJA 2IXFA 4R2HA 3J80A 2TMGA 1YMQA 1ZXBA 4J94A 3BXOA 4XWWA 2NUPA 1EK2A 3PJGA 5C7LO 3E5MA 1LNQA 3L84A 3VZQA 1BU8A 5GM2A 1K5HA 1E9AA 2JGLA 1SKMA 4OH1A 5B7QA 2PXXA 1PSDA 1JP7A 1OW3B 3FYUC 1NLUA 5KWVA 4WY5A 1A8UA 3H3JA 3SEQA 5CDGA 1YGYA 2XWQA 4RIEA 4ZOLA 1JX6A 2OFOA 2OK8A 5BW4A 5CA1B 3OMXA 4CCYA 1MV5A 2ONZA 3KT8A 1SO8A 5CB4F 5LQRA 5LVAA 4MROA 4FMBB 4PIVA 1A1VA 4HAUA 4L4RA 5DKFA 2I67A 1TCCA 2FKAA 2Z9BA 1S3SA 1Z38A 1QV7A 1Q84A 3ITKA 4AUEA 5JCJD 5LZ2A 4JJ4A 4MYRA 1LX7A 3TBKA 1HDOA 3B9PA 3T9CA 4HDRA 3D6UA 2H2IA 4MRMB 1U9JA 4RS3A 4DCCA 1QIJA 2BSQA 2XTJA 4Z4HA 1VMEA 2FG6C 3HUFA 1DS6A 1HE1C 2FAXA 2QUAA 2H11A 3HCCA 1SKBA 4QYXA 5AJTA 2NAPA 4HH3C 1T2NA 2DU8A 4P6VF 3RYCB 4ZCLA 2X2OA 1JQKA 4X66B 3MW8A 4INOA 4KR0A 1E9FA 4YAGA 3C3AA 1DEKA 1XIVA 1AVTA 1JPNA 3GH3A 4QATA 2Q62A 3R9WA 1KO1A 4QVIA 4EO9A 4YALA 2UVQA 3OCJA 4OQQA 2QX7A 5FL7A 2C4NA 4X6LA 1EFKA 5FYDA 4MB6A 4EA6A 3K15A 1LVUA 3SSOA 1RPAA 3ZG6A 1N75A 2Q5FA 3SWWA 3TXAA 4EAQA 4RXUA 4FINA 2QV7A 3UPDA 1LW6E 1O96B 4QUEA 4Y98A 5C0OE 1HQDA 1TKCA 2A2ZA 3QEMB 4TSFA 4FEGA 1SPBS 1UEIA 1OYWA 1Z28A 3EWSA 1NOKA 2QN1A 3M6VA 4U2EA 3UUGA 3ZXUB 4AJOA 4KQ9A 3IDSA 1E69A 4I46A 4DSNA 4IILA 4Q00A 2BN4A 2OZLA 2YRXA 3EZ7A 4BNMA 1JPVA 3LFHA 4L08A 4X41A 1H2ZA 4CR7A 4EY8A 4YHHB 3OY7A 3SBEA 2FZ4A 3HRHA 4HAWA 5H9WA 1TIKA 2FK7A 3JQBA 1O5IA 1O9HA 4PBTA 2RK3A 4NK4A 3FUTA 5CX1A 2OXTA 3RVKA 1J99A 4AJLA 2ZSIA 4DARA 5KOHB 4OLAA 1AZWA 3KLPX 2WHPB 4MVJG 2YXLA 5T67A 1Y5MA 3K1ZA 1EKXA 1GZ5A 1SBIA 4OXYA 4WJZA 1CIPA 3RSCA 5KX5A 2IZ1A 4UEQA 1HNZB 1RE1A 1PZFA 4FQ8A 2IYLD 2QU8A 2PCLA 3VYTB 3MVEA 4KODA 2YCBA 3Q1KA 2HK8A 3KJGA 3QHPA 3AEKB 4ND4A 5HZGA 3RV4A 2YMQA 3THOA 1DIHA 2Q1WA 4JDPA 3V2IA 2B4AA 3ME5A 3NJRA 2PT6A 5J59A 1DQRA 1G8YA 2OECA 5EJ5A 1LI4A 3Q11A 1PUXA 1A2KC 1GKIA 5K0ZA 1CULC 4XCVA 1L7QA 2I9PA 4GYWA 3DZGA 3FPLA 5TQJA 1OASA 3FNHA 2VBCA 2O8DA 3VR4H 4CKEA 3A3NA 2O5CA 2BTQA 5G4KA 2QRJA 4RVCA 5A9SA 4G86A 5JAOA 2RH9B 1W1WA 3H4VA 1E3EA 1EP3B 1Q2UA 5LOVA 1IY0A 1HFKA 3H9GA 3HXTA 4B3GA 4BMVA 3BBLA 2EZ8A 1SQ6A 2R62A 3NG1A 3ILVA 2A92A 3OFVA 4S3MA 3BHJA 3R6GA 3JAKB 4Y9UA 5FI3A 1Y80A 1YOBA 2WTBA 3OT5A 4D43A 1E2DA 5L7WA 3MHTA 3V3KA 1GCGA 2BGTA 1BWPA 2H1LA 2WAAA 3CSUA 1P2SA 1PJSA 4PQYA 3JAWA 4IUDS 1UKYA 2R7MA 1U31A 3A3PA 1KEEA 4EG0A 4CLOB 1E4OA 4LQLA 1XFAA 1U7WA 3MS2A 7GPBA 3IO3A 1YVUA 4XR9A 3USES 4BN0A 5HS4A 1EWKA 4DGSA 3EQZA 3LLUA 3F1LA 3G17A 4UMVA 3F74A 3MJSA 4GLBA 1ZM2A 3GJ7A 3UY4A 1ODLA 1ONPA 2R7LA 3M82A 3MRXA 5KOJB 1O95D 5JCOA 3LMKA 3PB3A 4O5AA 1T1RA 2ZITA 4IOLA 2QSJA 1N5OX 3ESYA 1Y3IA 3NOVA 4HYTA 1SJ9A 2Z58A 1G7SA 1Z34A 4NV0A 4Y2YA 1USWA 3GFVA 5AW2A 3NGMA 5EC8A 3RYFB 1JU4A 2VNAA 2IY9A 1WSDA 1CX9B 2MCFA 4AX8A 1WV1A 1F60A 4EA7A 3ELWA 3DBHB 3HWSA 4C05A 1O58A 3NKFA 2VPYA 2X0DA 3THSA 1ODSA 3A9TA 3CKYA 3PC4A 3QY9A 4EQZA 4Q9AA 3TL2A 4M0CA 3AT1A 3GFOA 3HDQA 4K26A 1P5RA 2A94A 1A8QA 2SNIE 2VK4A 3ENWA 3G8AA 2IF2A 3JATB 1Z45A 3JCZA 3Q12A 1OZAA 4J43A 4JJZA 4JIMA 1IY9A 3QRWA 4LWZA 2JVJA 5C1BA 1TK2A 2ZIAA 1H8EA 2ZI6A 3F3MA 4X7BA 4MRRA 2I4TA 2FRXA 2BR5A 3P2IA 2GZ3A 3DDCA 2XA2A 3T5MA 5CB0A 3TM5A 4DZTA 1GUFA 1N2HA 1XTTA 5EGNA 3V34A 3I62A 4JI6B 4HEA1 3NYWA 3R6LA 2KYRA 3DBLA 4BO8A 2QR3A 1HZJA 2ZR8A 4FFVA 3WGGA 3COYA 4ZQFA 2IPXA 5JQWA 1U5CA 4MA5A 3WVNA 1WZEA 5E2BA 3UJNA 3BMXA 4E5MA 4EJSB 5FI1B 4BNZA 4RKQA 2XUIA 2HADA 2YC4C 2ZI5A 1L4NA 1WDWB 3A06A 4IIGA 4LY6A 3WG9A 4QVKA 2Q99A 4O5OA 1H2BA 1S2NA 3WFZA 4F3CA 3A1WA 4N0MA 2F55A 2ZYSA 4WTOA 3QELA 3I52A 4WL0A 1UZLA 4MO2A 3ND7A 4OA5A 1X0XA 5B3JC 3GCGA 1G8FA 4ZCRA 2J45A 3LCRA 3STYA 2PJDA 2EEZA 4E2WA 4BE4A 4BJ3A 5FBRB 1D07A 5TX7A 3MQ2A 4MQUA 3FKSA 1N0IA 3U0BA 1ZUD1 1BXRA 3MPUA 4JLMA 2AUTA 5LQAA 3IEXA 2Q1XA 4A92A 1ZQ1A 1QPGA 5REQA 3WMXA 4YJ2A 4IGEA 2QI9F 2PJRA 2XEXA 3HA2A 1YZ3A 3HCBA 3ZDCA 1T3HA 1UJMA 2FFAA 1OBHA 4XUGB 5IH7A 1JDBB 2FEXA 2O3RA 1FSPA 3GD5A 4RZHA 4PGAA 5I7AA 5EP1A 3I9KA 2XECA 1BEUB 2NPOA 3MGBA 1GPLA 1QH8B 1UOQA 3PQCA 2JEOA 4MI9A 4N3CA 5CA0A 4U7HA 1HNWB 1RIIA 4GYJA 2UZ0A 3IFSA 4AZTA 4BNYA 3LQRA 3R7AA 4CMCA 5GM1A 4MHTA 3OEED 3IQZA 1PZGA 4NOMA 2H8KA 3W1VA 5JRZA 2JGRA 3H2HA 3LE8A 4TTJA 3SMQA 4PHFA 2V0GA 1FW8A 4N5MA 2AKEA 4YRRA 1Z82A 3LHSA 3KAKA 1T2UA 2X5JO 4PIPA 1B8VA 4L5BA 2JCSA 1PV2A 3GLTA 5HEKA 1V2GA 4G26A 2HN9A 1BD4A 1EFVA 2CFCA 2IE8A 3DFIA 4CGZA 2W6OA 1YSCA 1TI7A 4QHSA 1G7RA 4BQPA 5I4KA 3CBQA 1V96A 4KQJA 4U2CA 5TVKA 4UTPA 5J4HA 4X62B 3F8SA 4QEKA 5E9AA 3TSOA 1IXYA 4PVDA 2LIPA 4ER0A 1AY0A 1T0UA 2NXNA 2D0OB 1XD9A 3KQSA 4DDHA 1QZ3A 1WXEA 2CUTA 4BN4A 3MCUA 2C07A 1YKFA 2ZAIA 3DCYA 3DE7X 1P5JA 3GFFA 4BGUA 1PWEA 1VPLA 1ESCA 2VUIB 1EUDA 2AOWA 3K0BA 4B75A 4X45A 4BTEA 4BV3A 1P45A 1U3GA 1XJCA 2RB4A 4OKSA 1FMLA 3B38A 4Q1EA 3KQQA 4ARZA 5CB4A 1B0AA 1NNI1 1I13A 1NYRA 1FDWA 1I6WA 2H92A 3OETA 1MNQA 4W4TA 5AVKA 2EZ4A 3SEZA 2FPPB 3GB9A 4E4YA 3H5LA 4MGYR 1T5IA 3R3VA 1FYDA 5BOSA 1NIJA 1T34A 3DKRA 2A0WA 1JN0A 1MJNA 1X15A 2NSDA 1MVLA 2HO4A 3I9MA 2YMMA 3NC4A 4OUDB 4RYLA 4YMLA 3DDWA 4B8WA 3WC4A 4IXWA 5IABA 2OA0A 4HDMB 2QN3A 4CMEA 5DASA 3DVSX 1RAGA 2GFHA 4GKJB 1VECA 1GTJ1 1H4TA 3PHLA 4NZYA 1KO7A 3L0CA 1CRLA 3ZY3A 2HXSA 3N2IA 1N3BA 3LRPA 2QJRA 3SP1A 3UFXB 4ZYVA 2FEWB 1J7JA 4ZEVA 1E6UA 2PM8A 4PWZA 3V46A 2PD3A 4EB0A 1RP7A 3U09A 3N3BC 4EKDA 4DBZA 4AK9A 1GPMA 5H80A 1M6EX 4ZI7B 3C5EA 1LBQA 4MUYA 5D3KA 3DZKA 4RC9A 3RS0A 4BC0A 4H1WA 2CB9A 2B82A 2CK3D 2ZEJA 4KC0A 3RIXA 1NUHA 1SU8A 2R8EA 3C6KA 1Y33E 1J0DA 1P6QA 1T3GA 2RMKA 4HWRA 4JP1A 4QGAA 1JI3A 1XAHA 1E0KA 3MTAA 1E1DA 3O94A 4IM7A 2FJUA 2WOOA 2C9BA 3WJ2A 1AMNA 2PKQP 1EE1A 2FFRA 4OHCA 4R4JA 4M1TA 3T0IA 1KFKB 1GT91 2Y71A 3ORSA 1NIPA 1KVUA 2PGXA 3K73O 1S1CA 4HTAA 4WCFB 1M0EA 2QRUA 1K8XB 3N05A 2D2XA 4GSKA 1EVLA 4DTCA 1WCV1 1N6LA 3T5DA 1OTHA 3A1VA 3WYCA 1II8B 3NVAA 2X0EA 1UT8A 4E70A 1EDZA 1KYIA 5JS7A 2REQB 3X1XA 5HBRA 2LGJA 2AEEA 1XZQA 5KJ6A 1NM5C 3LKZA 2VXCA 2IODA 2X1HA 5KNCA 1WSBA 4YREA 4NKRA 1J22A 3K8ZA 5P8WA 1CU1A 3R9KA 3KD2A 4U6NA 4BAUA 1XZEA 2J5QA 3EGVA 1M6YA 1SOMA 2HPHA 2WJIA 5LFAA 1MABB 3L8ZA 1ORIA 5MFPA 1HBJA 1PNQA 2PA3A 3GLKA 2O07A 2PY6A 1FFYA 1Z5NA 3SNHA 5BMVB 4XQ0A 4HVAA 2KLBA 3WL5A 1LLUA 4ALMA 1LZLA 4JB0A 3H8SA 2J33A 1FK8A 1PGNA 4ZGGA 2GXQA 1XROA 1MDBA 4LI0A 4RDCA 4B3FX 4PS1A 4OYRA 2PWPA 3AHHA 1RKQA 3WDMA 3AL2A 3OBBA 4KYUA 2R0QC 3G82C 5E3HA 5HWSA 1ICIA 5KQMA 1QZUA 2NXWA 4N6OA 1XCBA 1YDHA 1FTGA 3G2QA 3H1EA 3ON5A 3PFKA 4ZT5A 3UWKA 4AN1A 3ADDA 4FDMA 2X14A 1JMYA 1Y7PA 4GUDA 3IQGX 2C8VA 4LJKA 1HLGA 4P08A 3FMVA 4Q21A 4RHTA 5IAJA 2E3JA 4AKGA 1KDZA 1ZCFA 2CBGA 4DMFA 4QDTA 2O1WA 3GROA 4AWAA 2HV8A 1Z4OA 2FU5C 4B5KA 1G66A 4ZYYA 3T35A 3WV5A 3PUHA 1U8EA 3QU2A 3ELUA 5DHAA 5EXDA 2C0QA 2ID8A 4KFSA 4LJRA 1Q12A 4Y7CA 2HZBA 1RS0A 3QFFA 1B00A 2IYSA 2Y67A 4L1KA 1F2VA 2CLKB 5EIAA 4NE2A 1V9SA 1TEHA 1Y9EA 3RRXA 4A36A 3ROGA 4C0LA 1A72A 4PSAA 4TTRA 5AJHA 3TK1A 4F2DA 4MEAA 1OZ0A 4NCNA 5GOTA 3WGKA 2M1XA 3GI1A 1BMFA 1SC9A 5F23A 3F2VA 3MQ4A 4ZAZA 1X8XA 4RO0A 1OKKD 1DG1G 5PNTA 3HP7A 2QP4A 2XCLA 4ZMBA 5I4CA 4N7RA 1FTSA 3ZD9A 5T6BA 4QXPA 4TTAA 2QG4A 3NIGB 2P7HA 5JTUA 2DCUA 2J0SA 4PONA 1EE2A 4R69A 4CM8A 5BNIA 4C6SA 4YTEA 2C5AA 1PZNA 2O2XA 3PG5A 3C4QA 4UQPA 4DJFC 1SHTX 4TQGA 1CUIA 2QA5A 2WUWE 2QMQA 3OZDA 3DM5A 4EIWA 4B6QA 3C7CB 4I3FA 1XQVA 3GEIA 4BKQA 3L2OB 3E1GA 1T91A 4F92B 2VUSA 1KFEB 2OCIA 4OFBA 3PPVA 3CR3C 1HETA 3F9RA 1M73E 4QICA 3H5RA 1YC5A 5IVHA 4NV1A 3FRJA 1DIAA 5KYWA 1RIFA 5IAAA 4KO2S 3O3CA 1DSSG 5LP6B 1NFQA 4O1MA 4GOOD 5BWOA 2ATCA 3RWBA 3QOXA 4WH0A 5A0VA 4IFIA 2GAAA 1Y48E 2R68A 2WW8A 2A1TS 4CKBB 3BVPA 3TVTA 3EF0A 1HL3A 1OI3A 1BGWA 5GZ3A 3FCCA 4X3CA 1GITA 1D09A 2H1IA 4NAUA 1PEKE 4LDJA 2PTGA 3NC0C 3ZXXA 5IAGA 4N6GA 2Q2NA 1Y8QA 1JEOA 2APJA 1UBGA 3QVLA 1P2GA 5H68A 2H17A 5HP4A 2XRYA 1Z4KA 2H65A 4RORA 5JBIA 3MERA 2ZUBA 4U7JA 1DTWA 3NATA 4LGVA 2XRMA 5ALPA 1UK7A 3KQKA 2P1RA 3RRFA 4FGJA 4LZNA 5BNTA 1K9SA 4RCZA 5LZ4A 1MA3A 4HAXA 3QLVC 1V37A 4RA6A 1IONA 5F7XA 4J0KA 2HJRA 1XDZA 2B9VA 1F0PA 4NOKA 3E8XA 3G3EA 4Y9SA 3SFTA 1KI2A 5KQRA 3T7TA 4PPGA 3Q3VA 2NQ8A 1IEVA 4HDKB 4MDEA 1JYFA 5AI0A 2VA9A 3Q41A 3HZOA 2IW3A 3BGDA 3E9YA 3MN1A 4LBVA 4QARA 5TARA 4XDGA 1SUWA 3B1VA 4GS5A 4KZKA 2ZBFA 3LECA 1E66A 4JP5A 4BNLA 1CJCA 3M0EA 3MLAA 3HCDA 4ZCSA 1COWD 1VB3A 3MS4A 2R25B 1PP4A 2JI8A 2X3UA 2FB9A 4MPPA 4ARSA 4KHPB 1A9YA 3HH8A 5H1YA 1R4AA 2JA1A 5LA6B 2RGUA 4G25A 4IH9A 4MV5A 1US8B 3ASVA 3UA3A 1OPRA 1THMA 4LDZA 1HEIA 1RWVA 1FU4A 2CDRA 2FSIA 3MUOA 4H7EA 3QPVA 1VBNA 3K20A 4F97A 4OHMA 4EBFA 3GEBA 3L8HA 1DXOA 1KK3A 3NO4A 3QJ5A 1OLXB 1JT9A 1IBMB 4NH4A 1U0SY 2VHVA 1TNDA 1GQSA 1OXTA 1PL8A 4RIIA 4BCCA 3UAYA 3PUKA 4YO7A 2IHYA 2WJ3A 4HX9A 3D8SA 1OAKA 2J3LA 2OC9A 3DEIA 3EA5A 1N32B 2ZBUA 1G21A 3BGVA 2EIXA 5ES4B 4M87A 1PT7A 1H9CA 2EP7A 3OECA 1SBQA 1XD2B 4WESB 5BV8A 2FPLA 3GMIA 1T26A 1U1EA 3G0GA 1RDFA 4QG7A 1UQTA 4W82A 3KYCB 1AH2A 1F14A 1C9NA 4E5PA 3CUEF 2EF0A 1RABA 4AZWA 3K9HA 4BTVA 2CUNA 4G37A 3ZTTA 2CJYA 5A4IS 2H5EA 3HN6A 2JIPA 5E95A 1E6KA 4JROA 4QUKA 2OFPA 4XARA 4J7CA 1PR2A 2OV6A 5FFFA 2PFSA 1QGUB 4DNXA 2WTMA 2XNJA 5JJCA 1XF9A 4L8FA 5DSTA 5LC1A 1XTJA 1V71A 3TF5A 1SXHA 2MR6A 4CRWB 4K9KA 2V0NA 5C9ZA 3HUEA 4P22A 2D1TA 4C2AA 1T0IA 3D31A 4MPRA 3CEJA 3KVNA 4AQ7A 3CLSC 2X2PA 2OYRA 5EWMB 3HUTA 4OQDA 5ARCA 3WL7A 4PYMA 2FFHA 3AC0A 2XUJA 4GI5A 4N1AA 1W30A 5KNBD 4H6PA 5LMZA 4PGGA 2VCHA 3DOCA 3GELA 4TL8A 3Q5DA 2IOHA 4DRXB 2CNWA 2ZBQA 2FPKA 3BDAA 5IVIA 4F8YA 1Q19A 5TC4A 4AF6A 3NP9A 1E2KA 1EJ6A 3TRDA 3IJRA 3K7EA 1VCIA 3H2JA 5TQ0A 1KZGB 1UPFA 3AIKA 3KOUA 5ESWA 5G53C 1BQ3A 5CFPA 6LDHA 3VPXA 3V9AA 1H5UA 2F7SA 2Q27A 4DEVA 1JMVA 4FD2A 1CRQA 3SZOA 2PDAA 5GVRA 2GN0A 3C5HA 5GIOE 1WWKA 1F3OA 2RAVA 4N41A 5FHRA 4DJAA 2PX3A 5IVKA 1SCUB 2HSWA 3HFSA 2I62A 4WLUA 1QP4A 4ETWA 4AMVA 4V0SA 1DZ3A 1TZ2A 5E8RA 2R1ZA 5DTMA 3K70B 2J9FB 3QA3E 2QDXA 1SG0A 1ARZA 3WKAA 1W48A 2PX8A 5M7EA 3ZCXA 1XOIA 2N1MA 3M5PA 1C81A 1N92A 1O4WA 1TMGE 3AUJB 3DT9A 4CG2A 4X6UA 4LRWA 4M9ZA 3PQ3A 5DMHA 3EF1A 1RLUA 2ZJYA 1KJ8A 3OAAD 5T41A 4DPKA 2V1XA 2P40A 9LDTA 4QE3A 4U9HS 5A4KA 3OEHD 4QGBA 5F77A 2GR9A 3FPEA 4P54A 1JAXA 2G83A 1H8HA 4MKGA 2E2WA 2EAUA 2PUVA 3NHBA 4P83A 1XCLA 1S2MA 2B78A 2FSPA 2G4LA 3UK1A 4WXHA 3UMGA 4ALNA 1EGVB 2YWHA 5HF8A 1NJ8A 4MI3A 5ALLA 3CUUA 2Q5OA 5FAXA 3DDUA 4M0PA 2EKDA 3JWHA 5KYYA 3QXGA 3TUZC 1LLQA 3TTTA 3TLZA 3F7TA 5IAOA 1LQTA 4PYRA 3TXXA 2YWEA 1FIUA 3WKCA 1AKVA 1ZZGA 4PXSA 1QDUA 1QOZA 3T1HB 4GQAA 1TM1E 4KQWA 4POAA 2QPAA 1M8GA 3ZV5A 4B6OA 5FBQB 4YT5A 3IEVA 3JYLA 4JB3A 4UHEA 1E63A 4HLDA 4PNEA 2HJVA 2I1QA 3G1WA 2WOJA 4P82A 5F9MA 4EO4A 3QGMA 5IZ4A 3S4YA 4XGQA 1ID8A 1ESMA 2IA5A 5DHQA 1W4AA 1P4AA 2OAQ1 3RYIA 2IEIA 3D4OA 3T7AA 2C83A 3LBNA 5BQ5A 4CXMA 3LC1O 4PHTA 2XA1A 4N12A 2B1RA 3OTWA 4PLTA 5L3QB 3ENQA 1LNZA 5KNBH 3N8GA 3AJDA 4RA9B 2XZOA 3MSXA 4JI2B 4IL5A 4FDVA 3ZY2A 3C3YA 1TEZA 3ML1A 4NZZA 2YWXA 2OFWA 1PZXA 3AJAA 4X63A 1HYBA 3CPSA 2NYAA 3OPYI 4FLEA 4NHEA 1FP4A 1VMDA 3GRUA 1R0YA 1R12A 4R6XA 1ISGA 4BASA 5JDIC 3T1VA 1RKBA 2ONKA 2JD2A 1NXVA 4ZALA 1ZKDA 2IPMA 3DVAA 2JFZA 1BOOA 2GA9A 4OX9Y 4BDSA 1DAIA 2WWRA 1G60A 3B20A 3QXCA 4YV2A 1CK4A 1BE6A 1ADJA 2V7BA 2P27A 3TPFA 1ZAKA 5AWFC 5FOUA 2JCGA 1LK7A 3O8CA 4UARA 1FFGA 2RAFA 1MA0A 2RC6A 4Z4CA 3V2GA 1JHZA 1OWMA 2HFJA 5ENZA 1CEQA 1JU9A 5DCUA 4F96A 3Q7TA 1PZHA 4DCUA 4ZK6A 4KDEA 4G5FA 5BUZA 2Y66A 2IY8A 3KFLA 2R1UA 3RK0A 1XCOA 4KLNA 3SJCA 5ICEA 5JZSA 3GAZA 3AR6A 3LGAA 4CF7A 1A9ZA 2PRIA 1N7IA 3D5EA 4LK3A 1ID1A 3HDGA 4DIBA 4F06A 4R71A 1SZDA 2AVDA 1R3DA 1SKUA 3LTEA 4TMYA 5ER6A 2CE7A 1IVSA 4K86A 4GZ6A 1JE1A 2AXQA 4UNNA 5HIKA 2RONA 4JLKA 1PZEA 5JRJA 3O82A 5FL7D 4DNQA 2PVPA 2HDNB 5HZHA 3A2KA 2VTVA 3PGJA 1Y4AE 1UDBA 2B21A 1AKRA 1RYDA 1YBHA 3A4VA 4POOA 4B47A 3HPQA 2NSJA 1XZFA 2RH4A 2ZYUX 3K0CA 4G56A 3LYLA 1XZBA 4ZCMA 2YFKA 4ZANA 4TSFD 4FNAA 4NEQA 4J7AA 3EFHA 2FGJA 1ZMRA 2G0NA 1J23A 1TLTA 2INGX 3IVMA 3LM8A 4CL8A 2RI6A 1U0NA 3D6MA 1ZA1A 1H1LB 4N65A 5EIFA 2JZCA 3MJFA 3WMGA 5CT9A 3R74A 4AG3A 3A6PC 1HG0A 1L7RA 2PQ6A 2G4VA 4RL6A 3TQTA 4C0JA 4EF5A 2GCPA 2ZE5A 3T3GA 2P2ZA 4BWVA 3EC2A 2DF8A 3V6MA 4AAYA 4AU1A 1O57A 3LBFA 4G0UA 4TYYA 2NQTA 1U2SA 3P97A 4MVJE 1TRKA 3C1TA 5SZKB 4HQLA 4DMKA 3GDFA 5FBVB 5F4BA 2WAOA 2FF5A 3BWVA 1SKYB 3TUJC 1XU4A 4ONEA 1NBME 1WVMA 4P4TA 4BMPB 1H2WA 4F4FA 1E4YA 4TL9A 1QHGA 2PMCA 3GZTB 4I55A 4KN5A 5AW5A 4I5IA 2FRDA 4GVPA 4XW2A 4P7FA 3NHUA 1N7JA 4CLRB 3WB1A 3ABIA 3A9VA 2PRJA 4IQ8A 4Q01A 3I5XA 3PQ7A 2RJOA 1JFTA 3R9XB 4RGBA 3HXPA 4K81B 1F7UA 1OIVA 4ZFNA 4OP3A 1N8TA 4YJFB 3AEYA 1YDEA 3I30X 1X1BA 3BQMB 4Y2TA 2ZRMA 1C3LA 1VHTA 3FOZA 1L4LA 3SX0A 4BZZA 1WKVA 1QE5A 3GA5A 1VPWA 3LUBA 3WMFA 2HOQA 4QDZA 1QRUA 4JI7B 2YBEA 4Q3NA 2ZJ4A 2QYTA 3M6UA 2BM8A