4MIKA

Crystal structure of hpnmt in complex with bisubstrate inhibitor (2r,3r,4s,5s)-2-(6-amino-9h-purin-9-yl)-5-(((2-(((7-nitro-1,2,3,4-tetrahydroisoquinolin-3-yl)methyl)amino)ethyl)thio)methyl)tetrahydrofuran-3,4-diol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
255
Chain Sequence
b'AYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title To be published
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2013-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mikA00
4H0NA 2O57A 2V7EA 3CKKA 1D2GA 4RVFA 3OU7A 1VPTA 1JSXA 1KP9A 5CVJA 2ORED 1KPGA 1G8SA 4PNEA 5D1HA 3WSTA 1JG1A 5K01A 4MHTA 4DF3A 3UJ8A 2PXXA 1NT2A 2NXNA 4QQNA 5DX1A 5FA8A 4E30A 5DX0A 5P8WA 2Q41A 3T7RA 4F85A 2UYHA 4OBWA 2H00A 1KPIA 3BGIA 3NTVA 3P71T 1JG2A 5DPMA 5E2AA 3E23A 2WK1A 3MQ2A 4QDJA 3K0BA 2I6GA 2JG3A 4AUKA 3HM2A 1B42A 1ORHA 3FTCA 4PCLA 2IBTA 1XDZA 3OU6A 5LQUA 1L1EA 3NWEA 1X1BA 1RI2A 3GCZA 4GEKA 2AR0A 2VDWA 5FQNA 4PYJA 2AOTB 3G88A 5KS2A 2NP6A 3UJBA 2XYVA 1R00A 1UWVA 1R8YA 2IIPA 3LDFA 2Z6UA 3KQSA 1XDUA 3EGEA 4RTNA 1M0EA 1KIAA 1L3BA 3I58A 4QTUB 3R24A 5LQCA 1YFLA 4LG1A 5ICFA 3R0QA 5GOZA 2VDVE 2ZTHA 2ZLBA 5EKXA 3G2PA 1D2CA 1JQ3A 2ZIEA 3HCAA 1ZGAA 4FGZA 4BLVA 5JR3A 2ZIGA 3TR6A 3SX0A 2PX5A 2GAFA 3LBFA 4X1OA 3R6TA 2ERCA 1VL5A 3FUTA 3H2BA 5EZSA 5EOVA 4IV0A 3HCEA 2UYCA 2XBMA 2CMHA 5KVAA 3EMDA 2AOVA 3A7DA 4P58A 1QYRA 3KPYA 3THSA 5IKMA 5E1MA 3HTXA 3GRUA 3G89A 3FPGA 2OY0A 1VE3A 3ER9A 3FUXA 4HGZA 4PYIA 2JH8A 1WG8A 2YQZA 1AQIA 1ORIA 3DR5A 3R3HA 5HIJA 2YX1A 2C7RA 5CVDA 1INLA 2IGTA 2IH4A 3LHDA 4BY9E 1I1NA 3C6MA 4WXHA 5EMKA 3BKXA 3JWGA 3TQSA 3CBGA 1VIDA 5GM1A 3OFJA 1BOOA 5K0FA 4ER6A 2YUIA 3AWIA 3B5IA 3HVKA 5F2KA 4YUYA 1RI4A 3REOA 4AZTA 1R6AA 2B9EA 4V0QA 2P35A 4M37A 4ZTBA 4ISCA 1M6EX 5FULA 1SQGA 3EVBA 5EC8A 2DPMA 2O0LA 4DCGA 4C03A 4BP1A 2ZSUA 5K8VA 5GINE 3EVCA 4ER7A 5CCBA 3IHTA 4OQEA 3KR9A 5DRYA 4LWPA 1O9GA 2QM3A 3PTAA 4XUEA 2IFTA 3ELDA 3KQTA 4L7VA 5T67A 3PT9A 4YUXA 5C9ZA 2AOTA 3LGAA 5E9WA 3T7SA 4X60A 3PFHA 1ZHFA 2NXJA 1SUSA 3CJRA 3P9IA 3GWZA 3DXZA 4M38A 3UJDA 2O05A 5DSTA 4GC9A 2AVDA 3G8BA 2PX2A 1PRYA 3P9NA 4RVHA 1NKVA 2XYQA 4C06A 3A4TA 3PX3A 3S68A 3EPPA 3I53A 5T6BA 3ANXA 3M6XA 3HCCA 1JR4A 1P39A 2ZIFA 4HSGA 2OYRA 2YXLA 3K6RA 1R18A 3SGLA 4GF5A 4OBXA 4IV8A 2H11A 2QYOA 1KYZA 1XXLA 4BLWA 2R6ZA 3TMAA 5F2NA 3RIEA 1YUBA 3TKYA 2B78A 4ER0A 3BKWA 2HWKA 1Q0SA 4X61A 3EVGA 1EAMA 1G60A 1NW3A 3SR4A 1XJ5A 1AV6A 4ER5A 5DWQA 2IPXA 5DTMA 2P3QA 3TFWA 4FZVA 5DT2A 2IDKA 3SMQA 3EEOA 2PVCA 2CWWA 4EMSA 4E70A 3UBTA 4AX8A 3SSOA 1MHTA 3DLIA 3DUWA 2ZCJA 5BW5A 1G6Q1 5GM2A 3FTEA 5E9QA 3HVJA 2BR3A 1KHHA 2F8LA 3EEYA 3RODA 4A6EA 4R8SA 2Z6QA 3HA3A 1KPHA 3MERA 2OPBA 4E33A 3CJTA 1NV9A 5E1BA 2BR4A 2XVAA 4RTOA 1DUSA 3LCCA 4FS8A 3B89A 4K6MA 3OZTA 5H02A 3A7EA 5LSAA 2P1DA 3MB5A 1JTFA 3UJCA 3AY0A 8MHTA 1BKYA 2PXAA 5LQNA 3RW9A 4A6DA 2YR0A 3B3FA 4RTKA 10MHA 2OKCA 4KRGA 1G38A 3MTIA 2PGXA 3CCFA 3FRHA 2AS0A 4FR0A 5HILA 3HCFA 4IWNA 4DQ0A 4XCXA 3C0KA 1YZ3A 2UYQA 2AN5A 2ZFUA 3OE5A 4CTKA 4E32A 2C7OA 4AZSA 2P40A 2QRVA 5DTRA 2PKWA 4E2WA 1KXZA 4MIKA 3OZSA 2P7HA 3L8DA 2NNWB 2B3TA 3M6VA 4PWYA 4YUZA 4QPNA 1RJEA 3FZGA 5CVUA 5DTQA 3ORHA 4P7FA 3LDGA 1JQEA 1X19A 1PJZA 2IDJA 2BZGA 4E31A 5EHGA 1QAMA 4DZRA 4FT4A 1YZHA 4GUAA 5K0CA 1EJ0A 2WA1A 1FJXA 4FP9A 4QPPA 2G72A 3KQPA 5BW4A 5EMJA 1Y8CA 3LBYA 2HV9A 3LKZA 5FA5A 2EJTA 5C0OE 1SUIA 3LX6A 3PB3A 4PYOA 3DLCA 1VQ1A 2BM8A 2VZ9A 1RI5A 4KDRA 3UA4A 2BM9A 3PS9A 3FYCA 2HR1A 3EMBA 4RTSA 2C7QA 4FSXA 5E1DA 3BZBA 4EKIA 1TW3A 3TLJA 5GIOE 3ER8A 2NXEA 2PXCA 3HCDA 3EVEA 5CM2Z 2AOUA 2HTEA 1HMYA 3UJ6A 4EK9A 5LQRA 2P8JA 5F2OA 1N7JA 3KQVA 3NVMB 1X1CA 5EKUA 2ZZNA 5FWDA 1NBHA 3DMGA 2AN3A 4CTJA 3UJAA 3C3PA 3KPWA 3LKDA 4PYKA 3TKAA 5ICEA 3G5LA 3OZRA 4C08A 3ME5A 4MQ4A 2NXCA 2P7IA 2PWPA 5MHTA 1NE2A 3F4KA 1WXXA 2G71A 3EGVA 4R6XA 3HNRA 4ER3A 1QANA 4PYQA 4E2YA 2PSSA 3DMFA 2YXDA 3LCVB 3ELYA 3O31A 1SQFA 3DTNA 3GO4A 3O7WA 5EEGA 4HTFB 4PYLA 1RI1A 4E2XA 2FYTA 4QQKA 5B1SA 4KW7A 1IM8A 2B2CA 3E7PA 3B3GA 4PYNA 3BXOA 5HFJA 3EGIA 4CKCA 3M6UA 4R05A 3LPMA 4GOLD 4OA5A 2P41A 2FK8A 3QOXA 5CCXA 2AOXA 5T64A 2O07A 5CD1A 3FTFA 4KVZA 1MJFA 1P91A 2ONYA 5LQKA 3OFKA 3ID6C 4RWZA 2BH2A 2JJQA 3P97A 1JG4A 3I5UA 3G5TA 2ZWVA 2YVLA 3TM5A 3DH0A 3EVFA 2KW5A 4DA4A 5HIMA 3C3YA 3CJQA 3NDJA 4FT2A 3MAGA 3GIWA 1N7IA 4C07A 4RTRA 2IH5A 3P2EA 5DSXA 4RVGA 3HCBA 1BC5A 3FUUA 3A25A 4M36A 4MTLA 1L3IA 4CWAA 2QRVB 3KQOA 3P8ZA 2H1RA 3M6WA 4R8RA 3GDHA 3I9FA 1Z3CA 4PCAA 2HNKA 1G8AA 1NW5A 3FPEA 3IV6A 1NV8A 3FPJA 3KQMA 4HC4A 4MWZA 5DM4A 3KKZA 3EVZA 5DM1A 4KDCA 3Q7EA 5BP7A 3B7PA 4Z2YA 4QTTB 5ICCA 3C6KA 5DLYA 2QY6A 3KPUA 2PX8A 3GNLA 5DRTA 3DXYA 4PINA 4X41A 4YV2A 5KQRA 2XYRA 4C05A 2IBSA 2P3LA 3QOWA 1XCLA 3G2QA 5CVEA 1EIZA 2YTZA 5IH3A 1UFKA 3GRYA 1RI3A 3KQWA 4PONA 2B25A 4U7PB 2AOWA 5EMMA 4RTLA 3PFGA 1QAOA 2A14A 3M33A 5EQJB 5E8RA 4F84A 4EKGA 1QAQA 2VDUE 3D2LA 4CXMA 3TPZA 5G02A 9MHTA 3HEMA 3BGVA 1N2XA 4PYMA 4YMHA 3HA7A 4HTFA 4KIFA 1WY7A 2CKDA 5EGSA 3THRA 1U2ZA 2AOUB 4DMGA 2OB2A 4CKBA 1R8XA 2ZW9A 5DXJA 2I9KA 3LECA 5CIYA 4LECA 1UIRA 2JHCA 4NECA 2G8NA 2Y1XA 1RJFA 2PV0A 3PX2A 1ZKDA 5CVVA 5ERGB 2ZBQA 1ZG3A 1XVAA 3OCJA 2UYOA 5DM2A 3FUWA 4GOOD 3VC1A 5K0EA 2DULA 3AJDA 3TRKA 5HIKA 2GA9A 2CL5A 2OZVA 2VP3A 5EEHA 3E8SA 5LQAA 3FTDA 1NW8A 2PJDA 2O06A 5GWXA 3SSNA 5GIPE 4E2ZA 4QVKA 1VBFA 1SKMA 3FPHA 3M70A 5FWAA 4C04A 4OQDA 3KPJA 2AZTA 2V74B 3GRVA 1JG3A 1H1DA 1DCTA 2FCAA 4QVGA 1Q0TA 1VP9A 1IY9A 5FUBA 4DKJA 3DP7A 3BWMA 4RV9A 3R9XB 2HMYB 1FP2A 3NWBA 2BR5A 5EG5A 3SXJA 3UWPA 3BWCA 3VSEA 5EZQA 5HZMA 4V0RA 2OBFA 3ERCA 2YXEA 2GPYA 4HRAA 4XUDA 4POOA 5HOQA 2PWYA 1I9GA 1O9HA 1WZNA 3O4FA 5FADA 3V8VA 2CMGA 4Y2HA 1F3LA 5CUQA 2NP7A 3G8AA 2ESRA 5D1NA 4B17A 4YUWA 5EHIA 1AQJA 4OX9Y 3VYWA 1TPYA 3BWYA 3UJ7A 3JWJA 5EPEA 1FBNA 2ZBPA 4HGYA 5FHQA 2P3OA 1KYWA 5KYGA 2E5WA 2GLUA 3KHKA 2LD4A 2GH1A 3HVIA 3OPNA 3LCUA 4RTJA 2ZZKA 1I4WA 2FHPA 1T43A 4X63A 4FSDA 3IEIA 4RTQA 1EQAA 2JHAA 4G56A 2FRXA 3OU2A 3PLAE 2I62A 3DMHA 1M6YA 2ADMA 3KR2A 5K0GA 3GGDA 3BT7A 3NVKI 5JUWA 2K4MA 5M5BA 4RYLA 3Q87B 4LWOA 3CVOA 5EIFA 5EMLA 2PLWA 2WA2A 3P9CA 4HG2A 4R6WA 4YV0A 2G1PA 3LDUA 2EJUA 3MCZA 5EVJA 1FP1D 2ONZA 3PVCA 3V97A 3KR1A 2VS1A 3CGGA 3ELWA 1YB2A 3DXXA 1O54A 1NW6A 3MGGA 1BHJA 1RJDA 4RX1A 3NMUF 1JTEA 1VP3A 2PY6A 4AZVA 3GRRA 5E9JA 3UJ9A 2IH2A 1AF7A 3FPFA 2OXTA 1F38A 3UFBA 4C4AA 2ZVJA 3G2OA 2IP2A 3G2MA 5K05A 3HVHA 4YUVA 2G70A 5E1OA 4KWCA 3DOUA 3OE4A 4P7JA 3X0DA 3ELUA 5E8JA 1L9KA 3KQYA 3HP7A 2OB1A 2OO3A 3BGDA 3GJYA 4KIGA 5DX8A 1NBIA 3GRZA 2PT9A 3JWHA 5GP1A 5HIIA 4P7KA 4GBED 3T7TA 2PBFA 1JQDA 5K0BA 3P2KA 3G7UA 5K09A 2FPOA 1X1AA 2PX4A 3A27A 3U81A 4CKEA 4RTPA 5DXAA 2JH9A 1DL5A 1P1BA 3P2IA 4U7TB 5K0LA 2Y1WA 1VLMA 4GOND 4RSRA 4IKPA 1WXWA 1X1DA 1XDSA 3EVDA 4BLUA 4F86A 4UOEA 4ATNA 4WVLA 4BP3A 1HNNA 2EG5A 1QZZA 4OA8A 5FQOA 3SM3A 4DM3A 3DULA 4EVIA 3KPVA 4EQZA 3NDIA 5FTWA 1D2HA 1ZQ9A 3E05A 3FYDA 4M7RA 4XUCA 5HEKA 3SVZA 3VC2A 2GS9A 2C7PA 3KU1A 4GC5A 3P9KA 1RJGA 2Z6AA 3LL7A 1EJ6A 1XTPA 2JHPA 5FCDA 3SSMA 3TOSA 3NW9A 1NW7A 4DCMA 2XVMA 3QV2A 4JXJA 3TM4A 1YF3A 3MHTA 4YV1A 4RTMA 5K0JA 4AZWA 2PT6A 5ICGA 1KR5A 3GU3A 3A26A 3MCTA 2N47A 3BWBA 1L3CA 5FHRA 3AXTA 2QE6A 4Y30A 1P1CA 5LR6A 1ZGJA 3B3JA 1V39A 4PIPA 4GOMD 3FUVA 1FPQA 3CC8A 3AXSA 4PGHA 2AN4A 2EX4A 3NJRA 5BXYA 2I7CA 4O29A 4HH4A 5C1IA 3MTEA 3KQQA 1OR8A 3BUSA 3I64A 3M4XA 5K0NA 1YFJA 2UZ4A 2R3SA 1R74A 2ZBRA 2ZZMA 2GB4A 1WS6A 1IXKA 1JSZA 1TW2A 2EFJA 2ZWAA 5KQSA 4PGGA 3JWIA 5EIWA 4QDKA 3GXOA 3EVAA 4P7GA 4RVDA 7MHTA 3T0IA 4PIMA 3UZUA 5K03A 2NYUA 3HA5A 5E2BA 5U4XA 5LQJA 3KR0A 4YMGA 3LSTA 2AVNA 2FK7A 4GQBA 1EG2A 3FRIA 1G55A 1XCJA 5DM0A 2ZULA 3IYLW 3UA3A 1SVUA 1SG9A
chains in the Genus database with same CATH superfamily
2V7EA 5DW3A 3F7NA 4HAVA 3H97A 5CLHA 5ALXA 1I24A 1N2OA 2XCIA 3OQHA 4B48A 5K01A 1HC7A 4MRVA 4IDPA 4LV8B 3RYHA 4TSRA 4BFZA 4BO1A 4DUPA 3L7MA 2RFLA 3DGEC 3ONWA 4HPJB 3WGMA 4C2UA 1KH1A 4QOIA 3ASVA 1CY2A 3LCMA 3LX8A 3QKIA 1IQUA 4K9NA 1LBEA 4EHLA 1C8KA 4CLOA 1A9PA 4EKYA 4GX0A 4WKOA 5BT9A 1JG2A 1RLTA 1AC5A 2JGIA 2OHIA 4O08A 3IR7A 4WZAA 1Z0UA 1J5EB 2WIKA 1OUMA 3T7EA 3ZWAA 2Q5FA 4LJYA 3ONNA 4FMCF 3LQ4A 4RJLA 1GGNA 4ERXA 4GYYA 4PXAA 1C29B 2VDWA 4YV7A 2Z2KA 1YRYE 4I2VA 3V7UA 4CE6A 3DMYA 3K3PA 5EQTA 2YQ4A 1OA0A 1XHFA 2CNNA 2WAAA 4QBTA 5LZ7A 2Z6UA 1U1FA 2IYEA 2J32A 4OJQA 3UQZA 1SR8A 4WADA 5F7JA 3OUTA 5JNTA 1KEEA 2I2BA 3BIWA 3ROQA 3A6DA 2D1RA 3C6ZA 3R0QA 4X95A 4X1YB 4B2YA 2O54A 3WQBA 1RW4A 1E6EA 1BKDR 3N3BC 1GD1O 2ZIEA 2JH3A 3NNDA 4FHGA 4RV4A 2QTWB 5TQJA 5L40A 4AD8A 3SX0A 1XZEA 3TTTA 1E32A 3LBFA 4EM6A 2XSZA 2B1IA 4DSZA 3S70A 3H2BA 5HA5A 3W5VA 4EB6A 3IBTA 4BNDB 1U0BB 1WAMA 2ZIAA 3ZWVA 3EMDA 1PVOA 3CVYA 6ABPA 5EFZA 4YP1A 3GP8A 5ECYA 3JQ7B 1K63A 5IPFA 3G89A 5HQJA 2PEZA 4LDPA 2O4UX 4BX9A 4G86A 4GMFA 2E18A 3NBYC 4MGKR 4DJAA 5BR8B 1GNSA 1JX6A 2N42A 2WE7A 4NCAA 4IL5A 2YX1A 3RI3A 3OMWA 3OZCA 4FDUA 3N8KA 4J2TA 4GLBA 3AL0C 2IF0A 3LF2A 4M7WA 3B1JA 1QIEA 5FTJA 1G19A 1NJFA 3OQVA 1BOOA 3F98A 2H54A 3IMGA 4K40A 5K0FA 5CEFA 3GDWA 1QIJA 4Q00A 4UHKA 1T9GS 1U80A 1DWOA 4DADA 4QC2A 2C3UA 4CCYA 3N0VA 5I9LA 3O90A 4K6GA 4W6ZA 2ZK7A 4Q4JA 4RIFA 5ALHA 2HB6A 3C3AA 4LWPA 3A1EA 1R0ZA 3UB3A 3VYUB 3VNUA 5IRCD 2V6JA 3FSJX 2XE7A 1T1SA 4KR0A 1G8KA 2IU6A 2X1HA 2D8AA 5BUQA 4RHEA 3G0GA 4G1BA 3DBHB 4B73A 2FEMA 3HP4A 1P7WA 2MYUA 4G0OA 5JAMA 2ZUWA 4DREA 3WZMA 3KS9A 3VOSA 5K1ZA 1YBFA 3EGDB 1D03A 2IYVA 2RAVA 4KNWA 3BB4A 4Q9KA 4O25A 3U0BA 1Y8ZA 1V35A 2WJVA 5JYCA 2Q49A 3EWSA 3P45A 4HCJA 4PZZA 3FVQA 4H16A 1JEJA 3WKDA 2BUCA 4U7JA 1UH5A 2AMYA 2QYOA 3K9QO 5FYDA 1FEZA 1ONOA 2GZSA 1E5TA 5BQFA 4TXHA 4N3BA 2XUPA 3P9SA 4HAWA 2WQZA 3ZQ6A 2PUCA 4RETA 1H1TA 1SBNE 2F3RA 4EHIA 1TVEA 3KKEA 3WRWA 2SKCA 1II8B 2VYVD 1GITA 2XR1A 3BH6A 2J46A 4F91B 1U2TA 3L43A 5EHZA 1MAUA 3Q6NA 1IN1A 1F7UA 1FL9A 3T9FA 4O2AB 4DR3B 2YN0A 4KLRA 4Z7QB 1JHZA 2VT3A 3Q10A 2JC3A 2O5VA 3PKZA 4PLYA 1W5AA 4TMYA 2E4WA 4MUKA 1KMCA 3WWEA 1T2FA 4KQMA 3WQHA 5BN4B 4CM4A 1VLHA 3SSOA 1LWNA 1MPTA 2IXBA 3C24A 3KDSE 2VJKA 4LEIA 4LOJA 1N9GB 1OWPA 4QICA 5ULLA 3RK1A 3FTEA 4FEEA 4FYWA 1C4WA 4WGFA 4MAFA 3HVJA 2WQ6A 2PSHA 1KJ8A 3R6GA 1S7CA 2X9LA 2ZIZA 4J7CA 5HMLA 3RFFA 1J0AA 1CV2A 2X0DA 1CY8A 4K86A 1ZMBA 2WUEA 2WVJA 3PXCX 4RTOA 3S1AA 4ZCTA 1U8CB 3T1VA 4ZT2A 3JWPA 5H02A 3V4RA 4MA4A 1WQ1R 3T12A 1YDHA 4EHFA 1PEDA 1MGOA 2WU1A 5G1PA 1U5CA 3UQYS 4ETNA 4R0VA 4PZ0A 3W5BA 4N9QA 4X1IB 4JLUA 3Q5EA 1JYSA 3R0IA 1ZBDA 3RS0A 4FQ7A 5HKAA 4YXWD 4MROA 1W0CA 1HXHA 2I1LA 4EF4A 2P9CA 4G0QA 1KY3A 3OLQA 1BDIA 4EPYA 4Q3DA 3T5GA 2D5CA 3SJZA 4BXOA 4LF8B 1GO2A 2M2IA 2VZEA 2QIOA 1HRDA 1X1TA 3ORHA 4AMUA 1Z4JA 4JU9A 4AT1A 4GD3Q 4YMIA 3MTDA 4OB7A 3TI9A 1AE1A 2R7NA 4NE7A 1VBMA 5AVVA 1HG1A 1H5QA 5SY9A 5ECGC 3FFAA 3HWX1 4OM8A 1Z6YA 1L8AA 1K8RA 3LP5A 1QMPA 2ZI4A 3PB3A 3AEQB 1ABEA 1BE8A 1PJCA 4TYMA 1C1XA 2I2XB 4GMDA 2FW6A 4X20B 1RFGE 2GDJA 1E20A 3FX2A 2VZ9A 4QUBA 4BMOB 2BM9A 2EDAA 4NV0A 4WXPA 4G63A 2C7QA 2Q62A 1CUJA 5U9CA 1IRXA 4PZLA 1G0NA 2HU8A 4JT2A 4GSYA 2ZJ7A 2RJNA 5DBOA 4EG0A 3O26A 3WZ2A 1UR5A 4L6AA 2P8JA 4RORA 3G0HA 2I1WA 3FSEA 3L40A 4GKAA 4NCJA 2C2BA 5L45A 1N2IA 1E9AA 1GGHA 4PLPA 2BFEB 2XBUA 2JGRA 3A2KA 3SX4A 1DAOA 3COPA 1GAWA 2WSMA 3P5BA 4I4LA 4MCHA 2AIRA 2ORYA 1V5GA 3G02A 1FE8A 4ESVA 3ADKA 5KIAA 5GZ6A 3F4KA 3UGQA 4AURA 4EYEA 2WB2A 1QANA 1HA3A 1UANA 1WDKA 2PSSA 3DKVA 3EJ6A 2CLKB 1UC8A 4JUAA 4TKMA 4YT5A 4G9BA 1KO7A 3OEED 1O6ZA 3TG2A 4UBKA 1KIFA 1XPRA 3Q11A 3BIJA 2P9JA 3WICA 1E0AA 5T8KA 2PNJA 2HIMA 3IAXA 4BB9A 1U3DA 3H2ZA 1CD5A 1SVNA 4FEYA 2QHXA 3ZNQA 3D7KA 4KX5A 4MP3A 1LTKA 4MWCA 3RYIA 1AXEA 3RYTC 1D0IA 4JA0A 4WKNA 5ENDA 3ZCUA 1N0VC 4RLFA 1KEWA 2JI8A 2J0EA 4WECA 4OQZA 4DEVA 4Z5XA 1O97C 3N8DA 3P97A 3T9AA 1VJCA 2P0AA 4JKOA 3U49A 4DUGA 1B15A 2W2MA 2XCOA 3N9IA 2O3RA 3PZRA 1GCGA 2G3YA 5HIMA 4IG9A 4NAHA 4BNHA 1RMTA 4LF4B 2PMBA 1GAJA 5AT1A 3E7WA 3FUUA 2BMDA 3KQOA 4YMWA 3FWKA 2CXUA 2EEPA 3LYAA 4LZWA 5BYKA 4YJFB 4YECA 5FPYA 5CDYA 1KP3A 2ZETA 4O4LB 3CNQS 2JK0A 3GRAA 1L1FA 4LOHA 3ZH9B 5AUNB 4TS9A 1V5IA 1VLJA 1PGJA 4YRJA 4CM9A 3W1EA 1WUIS 4CJXA 2DQKA 2R0QC 2EBUA 1GA4A 3TZHA 3J7AC 4BNTA 1AHIA 2VRCD 2P9FA 1PSWA 1KIMA 1PU2A 4RPCA 3KRTA 5DRTA 1Q19A 5JO0A 1NWHA 5D86A 3RHTA 2OP1A 5BWNA 3RU7A 1TF5A 4NPAA 5AWFC 5CB4B 3THXA 1GSAA 1KC1A 1RI3A 1Z22A 2DR3A 2YJ6A 2P9TA 1RWQA 3KZMA 4HDRB 5U1PA 5JW6A 2FG5A 3JRWA 1WP9A 4HDSA 4JOSA 4EMUA 3DMNA 1EK0A 4EKGA 1T1GA 3BIFA 2Z8YA 3ZWXA 4F84A 2REQA 3FJ1A 4IBOA 3NWJA 4YBRA 4L51A 4BFSA 5HTOA 1IQRA 3KLMX 1P9LA 2OGWA 2F90A 5LUAA 1ZJ6A 2OQRA 4HLUC 3F5SA 621PA 1IULA 3AI7A 1BSVA 4NECA 2GK4A 2G8NA 4QARA 4TMKA 2O20A 1AKQA 3HBNA 1ZKDA 4R2KA 1CRLA 2P1RA 2HK9A 4RY9A 1NJ8A 3N2IA 4WNAB 3DW3X 3QE2A 4BJ6A 3R3SA 4NK5A 2OYSA 4EEZA 3RR2A 4YAKA 3SSNA 3ADPA 3KXKA 4B6SA 3HY3A 1E2GA 3AR4A 1IVNA 1VBFA 3IRUA 4MV9A 4X0EA 4KR9A 5LU8A 1SKMA 1Q95A 2QX6A 4HPWA 4IJVA 4QA9A 1TU4A 4H3SA 1XZ8A 3VH1A 1JYEA 3Q9UA 3BGWA 3OM1A 3BG5A 4AM8A 2CHEA 4N7BA 2VYFA 3INYA 3JATB 1F60A 1C7QA 3ZXYA 3C85A 3RUDA 1GPBA 1U0LA 3FYUA 3N70A 3GEMA 2YHAA 2ANCA 3BWMA 3CVJA 1LC3A 2BM0A 3BK7A 2G25A 1DJLA 3DBOB 4DWVA 3ZU2A 4L8WB 2X5NA 4TTPA 4I9GA 4O1MA 1VL6A 2JCGA 2NZXA 4GR5A 5GONF 4BJ3A 1I9GA 4ENVA 1Z29A 2QTVB 3OWOA 1OASA 2RC6A 5CUQA 1CPYA 4MEAA 3G8AA 3KLNA 2JK1A 1W5FA 3IS3A 1E58A 1IDOA 2DPHA 2WHRA 3F46A 3RAFC 1UBOS 1AQJA 4BO5A 1JQKA 4RDHA 1X3LA 1BWSA 5GQSA 3EISA 1O9BA 2HK8A 1W1WA 4GP6A 5TRTA 4S0XA 1A5TA 2ZB3A 3L46A 1QV7A 2GLUA 3G23A 4QFBA 1DKLA 1G21B 3GJ5A 3OPNA 6LDHA 2H51A 4K9KA 1TZ2A 4JODA 3AI1A 1KEZA 4RF2A 3MWLA 2PYZA 2PUVA 4Y6OA 5BWCA 1KI3A 1JDBB 2WWFA 3P4YA 3NVKI 2VHQA 3MWDB 1CY6A 2BGGA 1WXEA 3IHLA 4MMYB 3GHHA 2WBLC 3ABIA 2JJMA 3GPIA 4D7AA 4CMEC 1P5JA 4IHAA 1NDHA 3GJZA 4YV0A 2ZE7A 5KDOA 2G1PA 3N7UA 1KK0A 1T2AA 4NCKA 4QBKA 4EECA 2QBYA 2NVWA 4L0DA 3NBAA 4IEIA 1AKWA 1GZ6A 2PS1A 2YWHA 1QS0A 3B9PA 4F2DA 3CONA 2DUWA 5DZSA 1I0ZA 5DBHX 4I1OA 2FSFA 4U9HS 3WZLA 3QUCA 1EG7A 2BGLA 2PY6A 2ZSDA 2YXBA 3U1BA 1Z6GA 1LLFA 2YIJA 4QRIA 3VU3A 1F38A 1K92A 3P9QA 4PAGA 4DTIA 2GETA 3IDZA 4MV1A 4Q3OA 3IIJA 3A2NA 4L8FA 5EPOA 1BVYF 3RLIA 2X6QA 3MD0A 4OFBA 4TWZA 4XGNA 2AK2A 1ORVA 5GONA 4C29A 1X9HA 5JXJA 1KNQA 4QOHA 3X0DA 1TOAA 2ABWA 4GX1A 3OJFA 4TKUB 4BVHA 3AETB 3RYFA 1KTVA 2PKQO 2VC2B 2ZRJA 4DC9A 5DNUA 2IX3A 4GNRA 2CFOA 2JFHA 4AQYB 2F4NA 3W7BA 3HZOA 1N2SA 1YI0A 3C7TA 3T7TA 4XYMA 3G7UA 4ERNA 3GLTA 2QJFA 3QUAA 1C4XA 2AG5A 2O0JA 5DXAA 4DKXA 4H15A 5EP2A 3KAPA 3NTUA 4IKPA 1Y98A 2I03A 4AYTA 1R3DA 2J6IA 4M0DA 5HNKA 1YQUA 2QJOA 3JQEA 2D4HA 3MS2A 4D6YA 1DHTA 2BEVA 2UKDA 4YRDA 3HEBA 3MBOA 3OP1A 3RFVA 1NJ6A 4B4DA 2XECA 1VCNA 1WW8A 3BMCA 1CZHA 2LDXA 2AYYA 1UJ2A 2BFOA 3ECSA 1M2WA 4XYEA 4K9OA 1F6WA 1NAIA 3ZYZA 4KXYA 1KI4A 3IBCA 4QATA 4EG7A 1YE8A 3NGXA 1M10A 3ADOA 2Z6AA 2CHFA 2Q5EA 4P86A 2JHPA 3HFSA 1V4VA 3CPEA 3QFHA 1TE2A 2A67A 2WJAA 4IIJF 5JZBA 4IUCS 4A8JC 1L7QA 4G4JA 2O1SA 3VRHA 4QO8A 3SN6A 1SPBS 5E38A 1WMBA 3I6ZA 2DFDA 3GU3A 4E15A 2N47A 2IS2A 4NBTA 1T9BA 4OUDA 3G9ZA 2EZTA 4QOSA 3SQLA 4D6PA 1Q0HA 2EX0A 3B36A 3CX3A 3GI1A 4JL6A 2FCRA 5T4BA 2Q7OE 4YRBA 2NPFA 5HUQA 4PIPA 2Q4RA 2RC5A 3LQ2A 3W1WA 1Q2UA 3S28A 4O29A 4CL3A 5C1IA 3WGIA 1G1AA 3WK4A 1AUPA 2EZ4A 4NS4A 3KQUA 2I3AA 3TEFA 3LLSA 2J87A 4AROA 1E1RA 3OIFA 1V45E 2QQFA 2XUQA 3LK6A 3K53A 2Z3WA 1BZYA 4HTAA 4OXQA 2JJ2D 3AY7A 2P1ZA 3D81A 3FTPA 4PIMA 1LUAA 1ZWLA 1SC9A 2GA8A 2Q7XA 1ZNXA 3ILXA 4CQLB 1WDMA 3RC7A 1FP7A 3PCXA 1EZ4A 4LJ4A 4E30A 5CA0A 4ZCIA 3JQAD 4P84A 3GC6A 3OKFA 4ND2A 1JSXA 1F8FA 1KP9A 2VOJA 2GJ8A 4JGBA 1QCYA 5CVJA 3ZWOA 4B43A 2YFYA 2J6CA 4F7DA 1HEIA 5FLEX 1DIAA 3T3GA 4MWTA 3CUYA 5G1OA 2H9YA 2ZUEA 5LJLA 1TGVA 4F85A 4YN3A 2K2QB 3IX7A 3MSXA 2UYHA 1MRNA 3OCCA 2LCFA 4QOEA 1ND5A 1LX7A 4QDJA 3K0BA 3MMNA 4B75A 5HGXA 1W73A 2QUKA 2ZT6A 2GHRA 4G4SP 1ORHA 3GJQA 4HRVA 3TZLA 3LYHA 2PWBA 2YMMA 4IIYA 3H1GA 4ENWA 3A9CA 3U0VA 1YRWA 3CVXA 4BAGA 4KPGA 4DHEA 2Q7DA 4TYYA 1LD3A 4NL4H 4MZDA 4Z99A 3AVPA 1X7ZB 4YRCA 2PM8A 4XJTA 2BHSA 2VNKA 1A76A 3IMCA 1LVHA 2CDNA 3GLIE 4B3RB 5FFNA 4D92A 3WFIA 5A4AA 1M0EA 1NYTA 2QF7A 1J8YF 4QKQA 3KJZA 2V6FA 1FQKA 1QGAA 4LHVA 3BWEA 2Q2OA 2MSWA 1ZJWA 2OC4A 3HN7A 3BGSA 1GGVA 2ZTHA 4ZU1X 4LF9B 1V1RB 4Q16A 2HHCA 1JFTA 1Z88A 3WDLA 1FTQA 1FQWA 9GPBA 2ET6A 4HMPA 1K7SN 4HDMB 5BV0A 4LY9A 3PPXA 4FTWA 4IV0A 4I55A 1M7GA 2FEPA 3N2NA 3IIMA 3QU2A 2O2XA 4TV9B 5EXDA 4K0RA 4MUBA 4P58A 4KMOA 5CBPB 2QD5A 4HWPA 4L85A 4BU0A 1H2HA 4AAYA 3RF6A 4COKA 2ZJYA 4ZHQA 1DOHA 4BGIA 2PKEA 3JQPA 4GRDA 1MTOA 5I8ZA 5DO9A 1SXIA 2ZRIA 3KTAB 2OORC 3HY6A 3ZZ1A 4CQJA 4BY9E 3GL9A 4U6SA 3F9CA 4BRSA 4UFOA 1G6HA 4EATA 4QDUA 1IZYA 5JADA 2C20A 1GAQA 2ANBA 1CY0A 2X8JB 3IPLA 2EIXA 4E1AA 1DX9A 2CNBA 4J91A 2ATXA 2E4XA 4QXQA 5F2KA 1XCGB 1LDNA 1AB5A 4ZPXA 3TLBA 2J41A 1EPUA 5A7HA 2VDRB 1UFQA 3DL0A 2ACWA 3DGFC 4RH3A 2FZ5A 3ZW7A 5K8VA 5LOVF 1SHTX 1FDRA 1X7DA 1KO5A 3LS2A 5DNEA 3WKEA 1CUEA 1MAAA 1SOVA 4CF6A 2JAUA 3F8WA 5A3RA 1EYZA 1IUKA 3VSCA 2H1FA 3IQHX 4CL8A 3PT9A 4LOAA 1IZ8A 1N0WA 4QTZA 3QWHA 1UL1X 4B82A 5BVHB 3U4IA 4RANA 2WKPA 1ZHFA 3LWZA 4QBHA 1BVUA 2RONA 4IM7A 3UV6A 2PS3A 4AZ0A 4UTPA 2D2FA 4R71A 4RZXA 2GPWA 3PKJA 1U7UA 2CD9A 3WNZA 5ALSA 1ZGGA 5FL7A 4B3XA 3Q3VA 3EPPA 3I6YA 5IK2A 1QVZA 2QRLA 1V3VA 1BMDA 4ZAYA 4DGQA 4S05A 1B6TA 2O1WA 4CEHB 3A4VA 3BILA 3PNBA 4WN3A 1RMYA 4G2NA 4K05A 1CZOA 1P18A 2H11A 2ZJ2A 3Q0TA 4JGIA 4DV6B 2J9XB 2ZIUB 3CKYA 4BLWA 3PC7A 4JKIA 3OOYA 1L7BA 2QZPA 2WKSA 4LXQA 2J7PD 1ILWA 5TS3A 1OLXA 1JR3D 4PFQA 2Z43A 1BOFA 3AT1A 2FY8A 3CW8X 3KM0A 3VKVA 4BX0A 4ER0A 1ISPA 1DS6A 4Z1MA 1IK6A 1TQHA 3VPFA 2B2NA 2QZZA 1E4EB 1QKIA 3ZZ0A 3DE6X 4PLWA 3CN7A 4G24A 4JLDA 4C3UA 3LUFA 4G5XA 1PTJA 2BBTA 5C2JB 2A33A 4XSHA 1NVMB 2E4YA 3PITA 5DW0A 1TA0A 5BYJA 1QCCA 3E7FA 3VNRA 3JQRA 5KSZA 2L2QA 3EZ7A 3VSDA 1VGVA 5CTAA 4G25A 1F20A 4RJ2A 5IDWA 4EVRA 5JNLA 3A6JA 3VZCA 4B0PA 4DLVA 2ZQYA 4IIFA 3RODA 4F97A 3WHKA 1VECA 4B3SB 2C3YA 4KPEC 3MERA 3TNYA 3ZHVA 4E33A 1BWQA 1HYBA 1Z6TA 1K5PA 4LDRA 4WOKA 1JGTA 1CZUA 3LCCA 4DSNA 3AOEC 5A6SA 2OVBA 3A7EA 1SVSA 2P1DA 3B2QA 5AP9A 3KLOA 1BKYA 2B94A 4LE0A 1QK3A 1UM9A 3LBAA 4RMNA 2HNBA 3B3FA 4URWR 4EFNA 1FYWA 1X9GA 4FBLA 4PPYA 3SE0A 3VR2A 2WI8A 4QU0A 1QFSA 4L0CA 3LGSA 4KRGA 2X19A 3HABA 3CCFA 4MCAA 3OPYA 1FU8A 1JDSA 1MIOA 1NJ2A 4ZYWA 4XCXA 2YRXA 1QRRA 1GSIA 3B2NA 4UFNA 1MO3A 2GAIA 3COWA 2G67A 3GRCA 3ZKWB 4Q9IA 3ZU5A 1SAYA 3P2MA 1VJ5A 3DP9A 4TT8A 4A2QA 1RJEA 4WLOA 5IAKA 4BL5A 2WYWA 2IZ7A 2WWRA 1QHHA 4FNAA 4H4EA 2BZGA 3KAJA 5CITA 2JBAA 5K4HA 1RXUA 1MU0A 3OHMA 5C1PA 3O8OA 3M82A 3BMXA 2AJLI 3EG9B 4PLHA 3UIEA 3KO8A 3Q7RA 4ABYA 4MUHA 5T4EA 2JZOA 1TNDA 2D1YA 3BRQA 1UMDB 2ZYSA 2WIJA 2V55B 1LPSA 3HA2A 5KNDA 2PDAA 1HYEA 1NG1A 5HR5A 4DLPA 3FCEA 4NAVA 1FXWF 2XB8A 1X7XA 3EGXA 3OIYA 1T6BY 1ENZA 1XO1A 4A73A 2BFCB 2GCPA 4NZMA 5E95A 4DMRA 3RC1A 4RESA 1QVWA 3D6NB 3JQ9C 2GK6A 3VR3D 1CR0A 2XTZA 5DN6A 1U0TA 1RYYA 4B7XA 2WT4A 4FFWA 3MW8A 4CLHA 3N0TA 5JCOC 3OZRA 2Z8ZA 1YACA 1IVYA 2V7XA 4OQ4A 1H2BA 2PFKA 4UATA 5ALWA 4BNGA 3KDPA 2RAUA 3FSRA 3GF4A 4JT4A 3U3ZA 4UULA 2O2DA 5IP5A 5JAQA 5TF0A 5B30A 1OXUA 1M2OB 3CZ4A 3VVCA 1YUNA 1XZDA 3LLVA 1BXGB 1YDGA 2R1VA 3VNVA 3FNQA 1X38A 1JAXA 2TRSB 3EIWA 4HRYA 2JD1A 3OOSA 2ZSEA 3NHYA 4QQKA 4HR7A 4P2BA 5AR1A 2JIDA 2H1HA 2F3SA 3AU8A 3P4UA 4BV9A 4YGXB 5HFJA 3CG4A 4G41A 3K0CA 4Y2VA 3UW3A 4NU8X 3L6CA 1I3NA 1KH2A 2H2AA 4F38A 4WZZA 1WMAA 3PQ6A 4J0JA 1MX1A 4TLDA 4E13A 2H1WA 3K09A 4NDAA 4R81A 3QXCA 4AJNA 2C9MA 2JJQA 3QA9A 7MDHA 1IEVA 1KK1A 1JEAA 3QKRB 3HBLA 4M9XA 1OH7A 4HQFA 3FF1A 3TTUA 1Z2NX 4CIDA 4IS2A 1Y3CE 4FYVA 2ZYGA 1E1QD 4YRKA 4MDYA 4BMCA 2AXEA 3HFRA 2WAOA 1FXWA 3NIWA 1W19A 3A25A 3K96A 1K5DA 2D1TA 2QRVB 3LLUA 4IXWA 1CVIA 3TDMA 4AF7A 3L0ZA 5C35A 2IHNA 2CFTA 2XGGA 4W9MC 2HYDA 1PBNA 1YQQA 1WEKA 4B3IA 3BEDA 4L8VA 3GQVA 2HNKA 4HC4A 1TJ5A 3KVNA 3OPVA 4YB8A 1HDOA 1GZVA 1WQ3A 3O4RA 1XWIA 3LXMA 3VDRA 3A3YA 3JYOA 5HF6A 2H48A 4PX3A 1C4KA 1GKLA 3PDIA 4CMIB 1ADJA 3ED1A 5LN1A 2FN9A 3HN6A 2JGKA 4I4NA 4QTTB 1CUIA 4XX1A 2V6BA 2O2IA 3PXDA 2IKSA 5KNBA 5CJPA 1LSOA 2Y76A 1VOTA 4LJ9A 4AP6A 4NY1A 2UXBB 4IS3A 4P34A 5JMOA 4CU2A 4LY6A 4EW2A 2BGJA 2VL7A 1FMTA 4L22A 5EJGA 1NLUA 4G5HA 1QAOA 5J40A 5EINA 4QLOA 1P1RA 5DTJA 1AHHA 2XGOA 4P3OA 1ULTA 3MJRA 3PFKA 1DDIA 2PJZA 3DUFA 5JAHA 1Q84A 2A5FA 2I99A 3IJRA 4B87A 2D6FA 2QR2A 4U2DA 1T5DX 1ACLA 2R8EA 3PUJA 3RASA 3AIMA 1QTQA 4D46A 1BRTA 3I09A 4INAA 4NZOA 5AIAA 4H3HB 1WPQA 2XXJA 1XC7A 5ERGB 4QIHA 3F6PA 4R7GA 3PEFA 4YJKA 4DPMA 5KWJA 1JPJA 2EYUA 1C5KA 1QU3A 1R4MB 1FBTA 5BVGB 1KRHA 2X7XA 3DZCA 4AG5A 5K8JB 1RP1A 4S35A 2ZPTX 5TXGA 2XMPA 2FZEA 2O06A 5GIPE 2DR2A 3L8GA 4QVKA 3GMSA 4U8HA 2Q3MA 4IKOA 4BPBA 3E1GA 3NC1C 5HZGA 1A77A 4TUYF 3RGGA 2PZEA 2GX6A 4FFNA 3MILA 1XL0A 5I3ZA 3U61B 1DQSA 4KOEC 4G0VA 4RH1A 3T38A 5B3LA 1CG6A 2P2NA 2R7LA 4W5NA 4CV1A 1W5TA 2VUSA 4GPEA 4G8DA 5AESA 5BMVF 1WBBA 3C43A 4IXMA 3HNPA 3WB1A 1U8EA 4YYZA 3VR1A 5H9VA 1J39A 1RIFA 2JLQA 2OBLA 2XT0A 3IQWA 4HRAA 3U1TA 1XVLA 2P67A 4C01A 3EOZA 5JSYA 2DFVA 1P3DA 2TMGA 3EPRA 3GZ4A 5E4YA 4N8EA 4PEVA 1NA5A 3KX2A 3A1NA 3V42A 2JPDA 2QG9A 4OX9Y 2I67A 1WDLA 4YAFA 2WF6A 4KR2A 2ZPAA 2MSKA 5ALDA 1PFWA 3IP8A 5FHQA 1H66A 3GW8A 3I39X 1BJRE 1ZC4A 2EFCB 4RDCA 1W85B 2WICA 3L7LA 4LGCA 4MYHA 4F0JA 2VHXA 3KKKA 3E9ZA 1TYCA 3QEMB 3MA0A 1O8CA 3QFCA 3VC3A 1QCZA 2ZEJA 4HYTA 1MIHA 1ADFA 2J33A 1KSFX 3WWCA 2F8TA 3OU2A 4PZEA 1XXHA 2YIMA 1EX6A 2VXBA 3PNMA 3PWZA 1M6YA 3QX7A 5EMNA 4LVCA 5KO2A 5FOXA 1KMIY 2VAWA 4KQ1A 3LWDA 4BX3A 1ULZA 5CXUA 1ZR2A 4ZD6A 1NBME 1VKJA 4QQFA 4R1UA 4XGRA 4XQEA 3X3HA 4A03A 3GCWA 2EJUA 3EFOA 1B43A 2ONZA 3CISA 4TUYA 3H5AA 2W6JA 5AOCA 3S0JA 3U5ZB 1UKYA 2FWJA 1ZJJA 4ZOLF 2H17A 1FLNA 3UATA 1OX4B 2IPAB 2Q4EA 4MS1B 4OXYA 1XVIA 4WCFC 4V1CB 3H5WA 2IH2A 3FPFA 5BMVA 2QRUA 2WFAA 3PKIA 3DS8A 3W8EA 1FW8A 2PPVA 2NVUA 2O6HA 1YL7A 3UUWA 1NBMA 3NTLA 1ORWA 3A0UA 4H18A 3EE6A 2IQIA 1UDXA 2I7DA 5DYYA 1GZ7A 1BVRA 4HN9A 4W1PA 3HJRA 1Z34A 5BN5B 4KRFA 5TPWB 1VI5A 1NRIA 2VRWA 4OQPA 4KFTA 1W36B 4GWKA 1L5YA 1V9CA 3F2IA 1U2SA 1V48A 3TTSA 4DY6A 2DBVO 1O03A 3E82A 2E4UA 4PS1A 4A0HA 3QVXA 4J0DA 4NYJQ 5JFOA 3SICE 1B26A 4Y6GB 13PKA 1ZJZA 2JDID 4GOND 4RFSB 1XDSA 1U1DA 2MSEB 2PBLA 3GIDA 3NORA 3OFSA 4G9EA 3CY6A 1PVVA 3MYRA 1EB9A 4YRRA 4ATNA 1PNRA 2QM8A 3KHUA 4JGGA 2RHRA 1QZZA 1RQNA 2AW3A 2W6ID 3OEWA 1QPGA 1ECPA 3GBVA 4QUDA 4JI7B 1JWLA 5K7SA 1FSPA 3OTOB 4QNMA 3CURA 4ZZ3A 3GBPA 3ZWPA 3T9CA 1A9YA 4FGLA 3E35A 4TQGA 3D1JA 4REOA 2XRFA 1ADGA 2FLVA 1NW7A 3QTLA 3UANA 4RA9A 4JXJA 3VR6H 4EGAA 2IU0A 1SOUA 3ZJYA 4Q7KA 3AR9A 3HLYA 3D2AA 3RE1A 3NTQA 1OC4A 4KXNA 2QL6A 2Z1DA 3VAYA 1NNLA 2GRAA 4NOKA 3VOBA 1D6MA 3O8RA 2GXSA 2HRBA 3C16C 1Q1EA 3WGOA 3GT7A 1JV2B 1H8ED 1PW7A 2QZSA 2C95A 1QC5B 3C4JA 3WFJA 2YKGA 1LNSA 4TV8B 1QRAA 3WWPA 1Z36A 3PGLA 2GZ3A 1XCMA 3U19A 1D4FA 1IB0A 2VK8A 3SKXA 3CCBA 2FRDC 2HXGA 2WP0A 3IFSA 3KFXA 2WIDA 2BEUB 3AZQA 2VLIA 3MJHA 2NW6A 1XGKA 3TLMA 3QE4A 4GPZA 4L2IA 5EJEA 1MG5A 4HLDA 3QW2A 3U7IA 3DA8A 4RKEA 4RZQA 1QQ7A 5IAJA 4ASUD 3GLHA 5EA2A 1GPKA 3T5PA 2AXNA 1WX1A 4FN4A 3QXXA 2FDCA 5A5EA 5G1NA 2MINB 4Y3UA 3IP5A 3CKKA 4KQJA 2O1XA 4CM8B 2WYOA 5I7RA 1ENOA 1JKIA 1W49A 2X0RA 1NN1A 3CUEF 3QBEA 3QLUC 4CIXA 1G5TA 4EJSC 1IZZA 2UV8A 3C8DA 1DG1G 4JR1A 4WOBA 4DF3A 2VHJA 3GH1A 4KX3A 1CQPA 4NMHA 1O5OA 3E9DA 2Q41A 2XCRB 1EWYA 4BATA 2CDBA 3QVMA 5HDQA 5JS7A 5FL3A 3I0ZA 1PN3A 3C3MA 1EGHA 3DFKA 3ORSA 1U0SY 2WOJA 4A8PA 4GL2A 1BMFA 3NIGB 3OZEA 5HWSA 1I10A 3ESRA 1P0CA 4Y7DA 5LQUA 2ZUVA 1UMCB 2PE5A 4H08A 1BX3A 1Z5NA 1JNXX 1LBQA 2AR0A 4ZAFA 4D42A 1ENPA 1UDRA 1NMYA 2HBQA 3KB1A 3PFBA 3ICOA 4H1HA 4XR4A 3T0GA 1GCAA 1OLUA 4BO3A 1JALA 1OB2A 1XAJA 1M2HA 1KH3A 1XG5A 1WUTA 3LV8A 4P5PA 1MJ5A 4BUZA 1J20A 4DJJA 1YFLA 4FCCA 2WHYA 5KDDA 3DYBA 1JI3A 3GPDG 4R84A 2X4LA 3BRCA 1ODFA 2HIAA 1ICEA 3NALA 1YR9A 4X6LA 5B58C 1I2MA 4MI1A 4CKYA 4U7GA 2W8BA 2OT3B 2A1TR 1O89A 1OQAA 1R9GA 1ZN8A 1MA0A 2Y9PB 3CZ9A 5CP8A 3NC4A 4ZT3A 1YKSA 1R0XA 2UZIR 2WTMA 3FUTA 3Q6IA 2QM7A 4JV5B 1IEQA 3C41J 2PAFA 1BGXT 3DM5A 3EGOA 3MBIA 4LRXA 5TPZD 2FUCA 3MTQA 3UJPA 1M2GA 4E12A 4CEJB 2CUKA 3L06A 3UC9A 4FW9A 1GZUA 2DE0X 3QVVA 4AZ3B 3D59A 4V0ME 1HL7A 3CE9A 1ZM3A 5L4LA 4HWRA 4AMGA 3ZDDA 2O8NA 2Q27A 4CMJA 1FVOA 2W6QA 3JYQA 4QODA 5IYZF 1R0CA 4QDZA 4QM6A 4YLYA 4QGSA 1I7QB 1NUAA 2IUFA 1FUKA 4RY2A 5D7BA 5FAXA 1CP3A 3OFJA 4ZJYA 2WUFA 2VPXA 2YOFA 3PFWO 4DDHA 4CRWB 3BIXA 5EUQB 1H4VB 1R6AA 821PA 4FFPA 4DPLA 3CLTD 4OJNA 1XRLA 2DPMA 3G17A 1E66A 3MJCA 3ZCVA 1PD0A 1NVBA 3N53A 1Z8FA 1T4CA 3RREA 1NN5A 3WIVA 3OY7A 3I32A 4Z9AA 1YCFA 1FK8A 2VJCA 4DIUA 4ZI7A 2ZRDA 4ZI3A 2FPLA 1MJGM 1ONNA 2WMOB 3WADA 4CG1A 5T3YA 3VPCA 3ZIAA 2CL0X 3KKLA 5E9WA 4AG3A 1Y80A 2EBWA 3WDMA 3REQB 4DMKA 3CJRA 1EXMA 3LBNA 4G65A 5DHFA 4YNBA 2K2WA 2O7VA 3WRXC 2WSSA 3QP9A 4WUVA 2VQ6A 4K88A 3C14C 2WTBA 3FCAA 1E3TA 1H65A 1XTZA 2MMCA 3CE6A 3T5DA 3UH1A 5JSHA 1FTYA 2X8BA 5EWLA 2KSQA 1HBJA 1QYXA 2X6TA 4HJXA 3AFMA 3Q3EA 1ZA1A 4RWEA 3U7QB 3K2IA 4C43A 5MF6A 1KJNA 2M6LA 4Z0NA 1BMTA 2VP6A 4L8YA 1ZRSA 1AUOA 1MA3A 2QTGA 4Y1EA 2XUGA 3RGWS 4Q3EA 1MRZA 5IYZA 1M6VA 1SZDA 1ISHA 1SK9A 1W46A 2Y9MB 3RIEA 2AR7A 2DUUA 4KQ9A 3PF9A 4YI5A 4Q7LA 4B7CA 2UZ3A 2F4VB 1C1YA 2WTNA 1XVVA 1U4NA 1TJYA 5BSEA 4YS6A 2VQFB 1DGQA 3RSZA 1ECCA 2DR0A 2Y1GA 4RK5A 1F4VA 3DCYA 1Z4NA 1GXSB 2XMCA 3D7MA 1LSSA 1TYDE 2OMEA 3WLPA 2O8DB 1PK7A 3RJMA 3HXTA 1F9EA 5C1OA 1M0WA 2YFHA 3K15A 4LDJA 4XWWA 4ND7A 1ZISA 3G2IA 4V02A 4FC7A 5BW5A 1JLLB 1VE6A 4A92A 5E9QA 4B79A 4BHTA 2C31A 2B8NA 2BR3A 4GM0A 1R6VA 2C7VA 4JC8A 3UKDA 5HIAA 3TFQA 2Z6QA 2NPIA 1PGNA 2OQIA 1KPHA 1ZUNB 3HG7A 3HJNA 3LL4A 3DR3A 4QUKA 3RWOA 2XE4A 5B12A 2OLJA 3CLSC 2B20A 2IIBA 2YOGA 2BBWA 3PYXA 1QBGA 3ZLJA 1GA1A 2QSUA 1LQTA 5CFNA 4CIYA 4IJ5A 2G5GX 1KJQA 3AHCA 3HDGA 1QK5A 2ZRHA 4V2IA 5CH5A 1BJTA 4I46A 5J2UB 3B8EA 4ALKA 5ED4A 4N8DA 3OJ0A 3KTDA 1G38A 4NJEA 4EX7A 4AN1A 4BMYA 1DEXA 1T24A 2RGDA 3HSYA 2Y05A 3HCFA 3MMXA 4I3HA 5CEEA 3BVPA 1HE4A 4PWZA 2FP4B 2IUTA 5JPIA 5H8WA 1XU4A 3R7NA 3UWMA 1PJ4A 3N5KA 2P40A 4LXUA 3GUYA 4HXEB 3NNNA 4KBGA 2PKWA 2OHVA 3TSCA 3KOXA 1SUPA 4XB2A 3GMTA 2B3TA 3HB1A 3MCAA 1IQ0A 3I62A 4PANA 3OQIB 1J97A 3BJIC 1E1CB 1PJZA 1BGVA 1SOMA 2VF2A 3R9IA 2MYPA 4US0R 2INGX 3D4NA 4E31A 3TGLA 5C1DA 4NNOA 4UMDA 4D9BA 1TFRA 4NEQA 1P19A 4QU9A 5F4BA 2WA1A 3L8YA 4FP9A 4OJYA 3HXPA 3KUUA 4OBBA 1TM1E 3UPUA 3HB0A 1VMEA 4WBSA 3UGJA 2E9SA 5KWIA 2NAFA 1A69A 1U5BA 2I34A 1XZFA 1T1EA 2R6CA 3A14A 3G5MA 1SKYE 3OTWA 4L4ZA 5LQSA 3SR0A 3EIQA 4ACAA 2BF7A 2P2GA 4BMXA 4Y1RB 5CDSA 1RKQA 3HCDA 1P0IA 1T8YA 2XF2A 2V7PA 1Y5RA 3FCXA 4XRGA 2PS9A 5ABPA 3ANSA 1YS9A 1UEIA 3KSRA 3VX3A 4QXMA 5G4LA 1D4OA 2RHDA 2O2ZA 4ILKA 2OGSA 4XOIA 4E5YA 4G26A 5AVSA 5E6UB 2NXWA 5DHRA 5BWOA 1GPMA 2QKYA 3JVEA 2G71A 3HNRA 4D9MA 4E2YA 1DC5A 2R44A 1VIAA 2LIPA 3TPCA 1PR2A 1J0XO 4Z6KA 2EEZA 4RK4A 1Y7PA 2FW8A 4DFDA 1RLUA 3OLWA 2OBMA 3ZG6A 2QRKA 2GJSA 4BVLA 3BXOA 3QI2A 3CF4A 2QN1A 2QMUA 4PZPA 5KREA 1RJ9B 1E99A 3QOXA 4GICA 5T5QA 4FZRA 2BFBA 3KZXA 3RCBA 1TF2A 5I51A 3I23A 2OAP1 2DKNA 5JJCA 5IM4F 1SCUB 2QN3A 3TTVA 1ST2A 4LJRA 4IIGA 5TMDA 3IEMA 2ZDGA 3GY0A 2GSWA 1G1MA 1Y8RB 2FZVA 3DTVD 3ZCPA 1SZCA 4BNWA 1EUDB 2XA1A 4Q18A 3D3NA 1NXVA 4CWAA 3O95A 1OSNA 3O9ZA 4UVIA 1E0DA 1VPEA 2OEPA 4OAPA 4YVFA 4LSMA 1ZEJA 3OQ1A 4EGJA 3I8XA 4N47A 3N1UA 4E4YA 3D8NA 4OHCA 1TQ4A 1YRBA 2CL6X 4ZIRB 1OHHA 1ULAA 3NCHA 1V3TA 1VBNA 5BXQC 4LJ5A 2PX8A 2YW2A 3HN2A 2WVAA 2XVYA 4Q48A 4YV2A 3SC4A 3HUDA 1EGQA 2ZJ3A 2AH5A 1SD2A 5IARA 3H7IA 3BXEA 1Y42X 2IYPA 1YA4A 5AK3A 3ZLVA 2RB4A 1XV5A 2W2LA 5MFZA 1B93A 2E1RA 2F3QA 2QAIA 5KSPA 5G02A 4HNGA 1PR0A 2IOHA 3JZDA 3K2EA 1JAHA 1HQDA 2XD9A 4JBYA 1F2TA 2EWMA 4WZBE 2WY2D 4MPJA 1EDOA 4G07A 2J8ZA 2QVXX 2ZW9A 1ESZA 5IM4A 1OFUX 4W8GA 4MITA 3V8QA 1FZQA 5D3QA 1D2AA 3NHAA 4QFMA 1IQPA 1YVUA 1B2RA 3ZV3A 4HYYA 2AA3A 3A4IA 4ANFA 3DFUA 2GCOB 4FD3A 4TOIA 2XT9A 4CN9A 1R5BA 1ZN2A 4OHVA 2JGDB 5LLSA 5LQAA 1A1VA 1NW8A 1BHSA 3U3RA 1J99A 5THXA 5K45A 1FFYA 2WD7B 1GZ4A 3H4TA 5C3UA 1CY1A 5KYYA 3CRVA 4OATA 4ICIA 2XCUA 1CUUA 3UEOA 1YZYA 2BGRA 1Z0KA 2FCAA 2IITA 5TR9A 4XIJA 2VEOA 5H70A 2QN8A 3CF4G 1LRJA 1I30A 2RGAA 4B44A 1EGAA 4BVAA 4CNQA 4K9PA 4JSRA 1K6IA 1ZC3A 1USIA 3K5IA 5E4TA 1PT9A 3PJGA 4V0OA 1YDEA 2X1MA 1CF2O 4IZHA 4KUGA 4ZO4A 3TL2A 3IAHA 3TEJA 4DNFA 4QXPA 2WHPB 5I6DA 3EZNA 1ZICA 3O4FA 1TLFA 3RRJA 3BS4A 2EKBA 2QVLA 4BO7A 3JQ8B 3SEZA 1CUZA 3S27A 4L74A 4B17A 1V8OA 2KMLA 3WLFA 1WP4A 4M8IA 1VL1A 5K2MA 4MRMB 2P3OA 3MJTA 3HXOA 1CQJA 4Z8XA 3PX7A 1MP0A 2FF5A 3LZDA 1X2EA 2PKRA 4FILA 1JFRA 4I5FA 5LLTA 3PEYA 2YBEA 4JJFA 1NBEA 2EHDA 2IDMA 3SZGA 4AX4A 1NSYA 2JHAA 4D4KA 5IT4A 1LW6E 1ZSVA 2FKAA 2D0PB 1Q7RA 2ZRGA 4MB6A 3BFXA 3DTVB 1MUUA 1KU6A 3K7EA 1XTTA 2WTUA 3TVTA 3HBFA 4OHOA 1EHYA 2IEGA 4LBWA 2QAGA 4XVCA 1MC4A 2ECOA 3G2HA 3N59A 4FS3A 2GJ4A 5CG1A 4OOFA 5AVZA 5THKA 2JIZA 2LGJA 3MGGA 4FMDB 3LTNC 1KQOA 1ZD3A 2R6FA 3OA2A 4RX1A 3OMLA 3R5KA 2H1VA 3PU6A 5IULC 3GRRA 1QFXA 1YB6A 4KKXB 1UPFA 4BMVA 5JNVA 3STYA 2WJYA 5H3HA 4PQYA 3EAGA 1GGMA 4E5SA 5EQDA 4BQPA 2OXIA 1UDWA 3AR8A 4DDUA 3SXUB 1E3MA 4CHTA 1PZXA 2AFIB 5JXIA 2OECA 3DC2A 1P6XA 2OHJA 3HXLA 4G5YA 3NHRA 3ZWYA 4EFDA 4JL8A 5MN4A 1LSUA 4U7WA 1S0UA 1JPUA 3NIFB 3QNMA 2JAOA 4QL3A 3IJEB 2IYFA 1NC1A 3LHSA 4BV2A 2ZJ0A 3KOOA 4XPIA 4MO2A 3ODPA 2DT5A 3H86A 4DQVA 1GUYA 1DAEA 1JXQA 4DM4A 3HI6A 1WCYA 3CWQA 3VU8A 5IKPA 1N33B 3VR0A 4FLMA 4KGXA 1IN8A 1VLMA 2UDPA 1X1DA 2J3JA 4GRIA 3UYLA 3O2SB 4D0LB 5AJUA 1YR2A 3OC0A 1QGDA 1HNNA 1V2HE 1E2MA 3FLEA 1G59A 2OQ2A 4JI2B 1T4BA 4FHCA 4O02B 4EVIA 5YASA 3QYJA 1OXKB 3V1NA 2B36A 3HVUA 1XEXA 3VV3A 3ZS9A 4GKKB 2GZ2A 2ORWA 3TGWA 3R6LA 2IHBA 3ORQA 4HADA 1M8JA 4X1YA 1JQLB 2R11A 3AQ4A 2GM5A 2HFJA 3GFVA 3NQ41 4FMBB 2YHIB 4REQA 3L01A 4B3BA 2B8JA 3JQCA 3H0EA 5B3KA 5DGDA 1X86B 1YXMA 2AWOA 2BEWA 1Z6AA 3HDJA 3L7OA 5JS1A 5KB3A 3L1VA 4BNDA 2VDLB 1YIAA 3LA6A 4ZXFA 1DC4A 4HGNA 3UMFA 3UTCA 1BEZA 1QGZA 2R4TA 4EDFA 1PUIA 3LO8A 2VK4A 3RROA 1GP2A 1YWGO 5FD8A 2PUBA 1M76A 1H0KA 4DR4B 1NLMA 3CRRA 5J2TB 1M5RA 5GMOA 4JC0A 4RPJA 3DVAB 4D25A 1R15A 3LY9A 3QE0A 3BAZA 4O2LA 1ZUIA 4XFDA 5K0NA 5K8IA 1CR1A 1NMSA 3I2KA 4S3MA 4QQRA 5EXTA 4MHOA 2ZZMA 2C0CA 1DQYA 2OGZA 3QU4A 1JSZA 4Q02A 1J6UA 3TW4A 2I8CA 3WK9A 4YT8A 1P2VA 1W4AA 1HKUA 3IULA 5IT5A 4YCBA 5K4AA 2IK8A 3EVAA 3ETLA 2BE7A 4LBYA 4DBLE 5IAGA 3GFTA 3QLJA 1ZW1A 1QHIA 1QR2A 1Z38A 4US1R 5L3QB 3B7GA 4MRNA 5JFTA 1KFJB 3H05A 2Z2ZA 4DWOA 3K5HA 5EZYB 1AHPA 3NDBB 1Z17A 3WBJA 3F73A 2J7KA 3S2FA 3U9TA 2DJ5A 4LKOA 3ZC3A 1XHEA 1STOA 3CRZA 4EHDA 1XK7A 3AFIA 4HGOA 4MQEA 4MI6A 4JCCA 1QCDA 1UXOA 3AEUB 3PR3A 3NHUA 4BWGA 1KMMA 5K3FA 1CRQA 2XYGA 3OZ7A 2VAMA 3UJ8A 3O5AA 4NOMA 4YDSA 4HF7A 2LCIA 1I3KA 3VDQA 3DBHA 3BAFA 2FW1A 3AH8A 3QZUA 3R4VA 5LBTA 2JJ1A 2G06A 3FMFA 1FNSA 1YR3A 5AK5A 1YQGA 3KKPA 4MB2A 3EX7C 1DIGA 3E4CA 3ITNA 4N82A 1U7HA 4DHWA 3THWA 3ENKA 3U31A 5IJ9B 2R6AA 2QSZA 3DE3X 2K6GA 3VVBA 4AY4A 5T8KC 4CYMA 5JCJD 4QDTA 9LDTA 1L7EA 3LK7A 4MB0A 4PF1A 4A10A 2DETA 4R40A 5AUQA 2QZJA 2VP0A 3ZGYA 2XYVA 5MFPA 1XN4A 3OQJA 1P2BA 5C3MA 4YRGA 4K9RA 2B4QA 3KQSA 5JSFA 4RJTA 5IFLA 3HS3A 2BGWA 1II8A 2D5BA 1XK6A 2VIIA 3JWEA 4P08A 3RS2A 2C3MA 3BL8A 3L8EA 2C7GA 4QG7A 3V1LA 1M75A 2J67A 2ZWPA 2CVFA 4C6SA 2AD5A 3EC1A 4PBTA 4XIIA 3SQDA 1JR6A 3I04M 3C3DA 3V7FA 3LE8A 2JBHA 4WFIA 5I7UA 1UK6A 2WV9A 3CF0A 2UYCA 1M2VB 2WDPA 3GG9A 4TLLB 3WI7A 2C2OA 1SG0A 1DARA 3T7AA 1HE5A 3CB2A 2BYTA 5T4HA 1RLIA 1N9KA 1YRQA 3FPGA 3EZGA 3O8LA 2ONCA 2AN1A 5AM2A 4TLCA 1YQTA 2A2ZA 1H2YA 5KSWB 4DV7B 4BFVA 1M83A 1INLA 2IGTA 3K1ZA 2P4HX 1C3EA 1CUGA 3BRWD 1X39A 2RSLA 4JJIA 4IKEA 4W1RA 1S2MA 1X7WA 1MFZA 2BFAA 2HF2A 3FAKA 3HU1A 3JWGA 2OK8A 4XTCS 3TQSA 1PQWA 2Q50A 4OGLA 3F90A 4G3XA 3V48A 1L5WA 1G20B 1MG0A 2JAPA 2RMKA 4YUYA 3SWWA 1NXQA 4LNHA 5AKGA 3D1VA 1WOYA 1WO8A 2QNBA 3EAFA 3L0SA 4M37A 1YHNA 4N40A 3THOA 5C18A 4RV5A 1U3WA 3R74A 2ZTUA 4ZRMA 3OJCA 2IELA 3JU3A 5B7NA 3KJHA 4R2MA 5ETJA 3R76A 3FLMA 3BWVA 1EZ1A 4PFSA 1KO8A 4HNAB 6PFKA 4GPD1 3WLRA 2ONKA 1UOEA 3AUAA 3LGAA 4GQAA 5CLGA 3GZNA 2F00A 3ZWQA 1ZR4A 1FZTA 2CB0A 2WLTA 3EZYA 4IHQA 3P9IA 3LX5A 1EFPA 4CVNA 1KHTA 3UOWA 1L4EA 2NO1A 1Z73A 3IAUA 4KYUA 4M4SA 3O3CA 5TQ2B 4URZR 1RKUA 3P9NA 3QU7A 4X7BA 3A2MA 1VI6A 3ZZUA 2AMVA 3HZRA 2Z4SA 2JIOA 4ZVVA 3TNLA 1CQIB 1Q1QA 1TA4A 3AEQA 1Z25A 2YICA 2IOYA 3QHQA 2QTRA 1QTRA 5H1YA 4AYWA 4BQEA 4GF5A 2ZI7A 3FYUC 1M33A 1A8PA 3U17A 2N1BA 4BCCA 3FM9A 4Q1DA 4LZJA 3DCNA 3EB9A 4LZLA 1J00A 3HKCA 1NUUA 3PC6A 2B78A 3PDUA 4BASA 2CJFA 3NRBA 1CR6A 4UAUA 3ZE7A 2RK3A 5G0WA 4BZZA 4MUMA 3QF7A 1AA6A 5E7QA 4O4LF 3OPXA 4IDOA 4YQYA 3WJ7A 4JI3B 1UMBA 4W9RA 4MV8A 3K35A 2WF8A 4QDOA 1XCBA 4CDRA 1MD9A 1U3VA 3GLSA 1EZZA 1PWYE 4ODIA 4MDEA 3NVAA 2OSVA 3P20A 4OI2A 5IDXA 4FUTA 2V03A 2O23A 3HV0A 5TY0A 2HLNA 1G0OA 1GRQA 4MEBA 4NCBA 2Z6VA 3DAPA 1E8MA 3Q8MA 3RSQA 3ENNA 4N8SA 2OWDA 1GUDA 2ZSKA 3PUYA 4IGIA 4H35A 1OLSB 4CN8A 4ETMA 1BFKA 3GK3A 4EJSB 1POXA 1SIWA 2EL7A 1XZGA 3BK2A 3QXSA 5HX7A 1N2CB 1B73A 1U8XX 1V8BA 3EJWA 1BWRA 2A35A 1EXDA 3RVJA 4EPTA 4RULA 2FPXA 2VP4A 4MICA 1OIXA 3COZA 4MCJA 3TG8A 3FWHA 3DF9A 3HB4X 1KSHA 3J81A 1J8VA 2ACVA 2ECKA 4TRJA 1IH8A 2OV8A 1YI8A 2HMTA 2VSNA 1JJVA 3UT0A 1NOKA 5FUQA 1UZLA 2GCEA 4L08A 2R60A 3NZEA 1LWOA 1LZKA 1JVBA 4RZUA 3UT6A 4EYKA 1G4HA 2HDNB 1PD1A 3AI2A 2QL5A 3Q1KA 5L4SA 1U8ZA 3BXZA 4YJFA 1ECJA 4LA4A 1PZHA 3TINA 3VVLA 4QPNA 3P96A 2D8MA 2OZKA 4O4HB 4O4LA 4P4TA 4YALA 5A4MS 1JQEA 4CIAA 2HHAA 3FHCB 2F7SA 2LKCA 2E89A 3VNQA 5EHGA 3PEVA 5A06A 1J8QA 2ZJBA 5FJIA 3QK7A 3I4LA 2C54A 5L7YA 1A2OA 2ISSD 1CX9B 2BKVA 1SIBE 3FKJA 1XNJA 4NRDA 5AXAA 1PX0A 5T3UA 3RKSA 1IUNA 4JMLA 5SZJA 1PKEA 2KX7A 4M0CA 5CK4A 3SBOA 2H8GA 4HDRA 2QTAA 1D8AA 4LTNA 1S4QA 3W04A 3WL6A 4CBVA 3LI2A 2A0YA 2DBQA 3ZE8A 3HB9A 4RD4A 1BHQ1 5E1DA 3FMIA 1BAPA 2QDXA 2QNIA 2QXUA 3IQZA 1SKAA 1DIBA 3V4LA 3ETNA 4BB6A 1XEWY 2ZE5A 4UQLA 5LQRA 2D2IA 5F2OA 2VR1A 2YN4A 2XXBA 4N1AA 5ILOA 3PXAA 2C2YA 2OCYC 4Q6WA 1V9SA 1FS6A 4PYKA 1TMKA 2W7TA 3NLLA 4G5GA 2P0EA 5JOQA 1ZP6A 4JFRA 5F3RA 2NXCA 3I01A 4L3VA 1EWRA 1A4IA 3R5SA 1RZVA 3KSMA 3LCVB 4UU7A 1EI9A 1NVDA 4DLTA 3O7WA 5B55A 2F1HA 2FETA 1GNPA 4M0LA 1TB4A 4B5LA 1P6UA 1CIJA 2HRQA 2B1JA 5KI6A 3G0DA 1RAIA 2GZRA 1MW9X 4JIGA 4UMEA 2FYTA 4UXJA 3ZWKA 4E2XA 3JATA 3BDIA 2B2CA 5FEMA 4L27A 5I48A 4M9RA 2PUEA 1XCOA 1TTQB 5JNSA 1E3SA 1OI4A 1T34A 3DHNA 1FVFA 4Z9XA 1JLHA 2RGCA 2J59A 4LQLA 2FN3A 4JYCA 1G21E 1UBRS 1QPZA 3HC7A 2PZ8A 1ISSA 1E4VA 1Z35A 1MB2A 2Q4OA 2QTVA 2X8AA 3OKPA 4QYSA 4KAFA 1HV8A 3EIUA 2CD7A 2Q0XA 3I5UA 3DWIA 4ITUA 4NBRA 2AKEA 4RTRA 4NXMB 1GQRA 2W2VA 3MAGA 3O75A 3OEEA 4KXQA 3P2EA 3UO8B 3RJ9A 1NY5A 4DN6A 2GJKA 1U7PA 1TJNA 1Y3FE 1P62B 1WCWA 3AV0B 3H9GA 4J7AA 3KB8A 1LEHA 1AGXA 2B4KA 2WD8A 2WF9A 3P2OA 3UOGA 4DCPA 3PHLA 3T15A 5JI3E 3B52X 3BXGA 4MDHA 1L5HB 4IHJB 4R1QA 5KTOA 1HLPA 4KXUA 5D5PA 2WMYA 1L4BA 3AILA 5FTNA 1SKUA 4EHBA 2NUPA 4I50B 1DBIA 3MWDA 4X97A 1N8TA 2NSYA 2YYZA 4YJ3B 4EB8A 3EZ9A 2OFXA 1H4QA 3M1AA 1U9CA 2WJJA 3VU1A 1F1BA 1W5EA 2FSGA 5LZ9A 1L5NA 1TXGA 1WBJB 1NHGA 2MSNA 3VXKA 2XKKA 4PONA 4AKTA 1MABB 2OO7A 2FE4A 3L6EA 5EMMA 1KZ6A 2VQEB 1IG0A 3EY4A 1B3RA 1X15A 4CXMA 4B8WA 2HXSA 6AT1A 3TPZA 2ISQA 1Z0ZA 1CJVC 2X22A 2VSQA 1QLWA 2BI8A 3EDCA 3EUEA 2GFHA 3HKDB 4PZCA 4YASA 3SYTA 1TO1E 3MIZA 2HD4A 1YZQA 2FJ0A 2F17A 2YIVX 3NGMA 4BLRA 2RKBA 3DL4A 4J0HA 4BJ5A 2I22A 4W99A 4YJGB 2VUIB 2O19A 1TJ4A 3F74A 2PGJA 1L7DA 2PV0A 3N8IA 4K6KA 5DP1A 1V71A 4H6XA 5BUZA 2FB9A 3R8FA 5DM2A 4CR8A 5BN1A 2PRSA 4KVGA 3VC1A 4KR3A 2GK3A 1USGA 2BZ0A 3COSA 4MO9A 2CL5A 3I9MA 3IKVA 2CMFA 2R7KA 4Z9FA 4NX2A 4YRAA 1LDEA 2Z4RA 1FUEA 3M70A 3KEMA 4C2AA 1LTHR 1Z5VA 4Q5IA 1J56A 2CLIB 2FZKA 3II6X 3PQCA 4AKSA 2H5LA 4ZDKA 1U98A 4RV9A 2A1TS 1ZD8A 3G2NA 3S5UA 4CDGA 1EFAA 1PS0A 3NYRA 4LYFA 3VSEA 2ETXA 1W44A 5KYKA 5A3VA 4DZZA 4V0RA 2YXEA 1T9HA 3BH0A 4IEFB 1JJAA 2Y68A 3HCOA 3OQMA 2GZHA 2YV3A 3B51X 4ZZ0A 2KYRA 4XLZA 4J0CA 1DAMA 1DXOA 1H5NA 3D6AA 1L6IA 2PG3A 2Q8PA 2I0FA 3EA5A 3O1JC 4ZVRA 3RS8A 3MWEB 5AVQA 3QE9Y 2AW5A 3MUOA 4G0WA 3B9RA 1B8UA 1TPZA 5EPEA 4XLTA 1QP7A 3DZDA 1RYEA 1PUJA 1VCHA 4HGYA 5GADl 1WD5A 4MYDA 3T6KA 3CA8A 4B45A 2OL4A 5F7ZA 1OKKD 1RHKA 2QS9A 3H5NA 3KBBA 4GHWA 3REGA 2IPLA 2LKDA 1EBUA 4FSDA 4E11A 1I7NA 4GX2A 1AG9A 1P77A 1PFQA 2G9ZA 3A9TA 1G8GA 4G56A 1Z4MA 3FJYA 5H16A 2NLOA 3DMHA 1OPXA 4JOBA 4JR2A 1XRQA 2X0EA 1C8LA 3WBFA 1JFFB 2N9UA 1WA5A 3OAAD 2HM7A 2WA2A 1V96A 3DYIA 4JY7A 5GVRA 3MJFA 4GEGA 4BNMA 3LUBA 1TL7C 2C2XA 2XGMA 2V45A 3OT4A 1D5WA 4Z53A 4G0MA 3RUPA 1I2DA 3LBIA 3NXSA 3H1PA 1O54A 1MQAA 2HEGA 1S3SA 1U0FA 5REQB 4YCSA 1KAHA 1JTEA 1LPMA 3CW9A 5TDHA 4CQLA 1L4LA 1JIKA 2NSJA 4AQDA 1T0IA 4Q9JA 2MDTA 4KV9A 1KK2A 2ATIA 2IY9A 2GM3A 2HO4A 3FZEA 3L7DA 4HBGA 4LYJA 3E1KA 4DABA 1T91A 1NJ5A 3HYCA 4OXRA 3SR3A 1TUBA 2HRRA 4BMNA 4JP1A 2G70A 3PFCA 3QMWA 1YNSA 2BISA 5LZ4A 4O8ZA 1PT6A 3B6KA 3GUHA 1SCIA 2PBZA 4EUHA 3V2GA 1NFRA 4C30A 1CWUA 2RH5A 2CE7A 2QIPA 1HOTA 1PTJC 4FJ1A 2OBXA 3BFVA 4J07A 4JJZA 2FQ1A 3PXUA 2XTAA 3DBRA 2PBFA 3E9NA 3EH1A 4JVSB 4WE3A 4BNLA 1KAOA 3ISVA 1FRQA 1MAVA 1Z5WA 4TKZA 1GVHA 1LPPA 1GV1A 1P1BA 2QVCA 4O63O 4F7WA 3AP1A 4CV2A 2JFWA 3DTYA 3EVDA 2H8KA 3PPWA 5ER9A 4UBNA 4EGQA 1WL8A 1D1QA 1KRXA 2AJ8A 4CT0A 5JEEA 1A9ZA 1W8DA 2VHVA 3QV1A 2OR3A 3RYHB 2SBTA 1E1MA 3OA0A 4C7OA 2ZBUA 1H2ZA 1GGFA 1Z0FA 2I2DA 1R4ZA 2ZJFA 3NDIA 3WJAA 4M7RA 1Q1GA 3SVZA 1SNYA 4CDNA 2P69A 2I3GA 4GGOA 4CLOB 3IA7A 1EJ6A 2Z0MA 3W3AD 4XH9B 1G5PA 1UQTA 4U3JA 1JLRA 5BR7A 1V1RA 2G6BA 3FHJA 1AQUA 4WZAB 5SZHB 3VU9A 1QF6A 4HWGA 4I14A 2AF4C 2Q3CA 1Z4PX 2BMWA 4HDMA 4PNHA 5FKJA 4LF7B 2XAUA 2HHJA 3M9XA 4I1IA 3K70C 2VDWB 5IDQA 4RE6A 1C1HA 1HNXB 3I45A 2AFVA 3B3JA 3RDPA 3KHSA 1ZGBA 1DBPA 4OP2A 3SZ3A 3HJAA 2Z2YA 1ZONA 5CBPA 1CUYA 3MS7A 2M9MA 1R9JA 4QSMA 3TDKA 2I33A 1HF3A 2G4LA 5K8UA 3L0OA 1F17A 4F9EA 5CA1A 4Z9BA 2C5SA 1TUGA 2CKMA 4Y18A 5AOAA 2DBZA 3BHNA 2UU9B 3AVXA 4OVKA 3RIGA 4BTVA 5AUOB 3D6MA 4DSTA 3GXOA 2OGUA 2NU9A 4P5EA 4PFKA 5A6VA 1HT3A 1X0VA 4NIMA 3UZUA 1GKYA 1O2DA 1U2QA 5FPKA 2NYUA 1L8OA 3G0CA 1W34A 3I9V1 4GKVA 4GMGA 4XB1A 1PZFA 2NACA 2AVNA 3F3MA 4JYMA 1CQWA 3ZGOA 1RNLA 4B9AA 1S6YA 4RXTA 1V25A 3ZHTA 4OJKA 5CFZA 4H0NA 2DWUA 4H7EA 1NVWQ 2E6UX 3LUKA 3BFJA 1JXOA 3AY3A 2GZ1A 3W5IA 4S1WA 3GVCA 4DIMA 5JNUA 1DU4A 5COQA 2IVZA 2QUBA 3ETEA 2XKAA 1ZIOA 3DDWA 3FZNA 4MYUA 1YDFA 2WM9B 4LYGA 1NGSA 3O8BA 5FI1B 5AKLA 4FLEA 1RYNA 3H17A 5ES4B 4FMCB 3IP6A 5DPMA 4NAUA 4A36A 4TTSA 3VNAA 4BEVA 1KI7A 3FHLA 1C3JA 2IPMA 4Q4JB 2CXOA 4R9UC 2B3DA 5KKCA 1Q74A 2GEVA 4CEHA 1L1EA 1HWYA 3JQAA 4M99A 3FPCA 4KIWA 1X1BA 3H6HA 3Q72A 1GU7A 5TQ0B 3K0CC 5CT6A 1ZH8A 5AVKA 2FEOA 1R0KA 2F62A 4PQEA 3KT3A 2B83A 2PR7A 2QLMA 3K09C 1U8YA 3WMEA 1KBOA 1KZ7B 2BUBA 3GZJA 4KPYA 5CMLA 2O14A 1YBVA 1JI0A 2ZB8A 3G2KA 4IAOA 3KOZA 1E2JA 3OJOA 2N46A 4NE2A 4X1KB 1O5IA 4C1NA 1ZZEA 1ZHOA 4G0UA 1EDZA 2ZIGA 5FDFA 4K6FA 1WNTA 1GQFA 2IQ5A 3UMRA 4I9FA 1IN7A 2P79A 3NUZA 3EBOA 4OEHA 5AM5A 5EZSA 4RK7A 2VQDA 1JLMA 1JHPA 2Z09A 1M8FA 1PK9A 1Z0AA 1W6UA 2FTKE 3QQ5A 2LWIA 1WZEA 4JT9A 4EHKA 4UFPA 5GZ1A 3WB2A 4NZ9A 1SHLA 1K4YA 1FYXA 1KZYC 2D1SA 4PYIA 1JRLA 4NYMQ 5JXHA 1O58A 3CRMA 4BB0A 3JD2A 1CFZA 4BIMA 4D9FA 1HZZA 1T6YA 3LPLA 2QQEA 4YPFA 1EJ2A 3FRJA 3H5LA 3KSUA 3U4GA 1ID1A 2WUGA 3WGQA 2ODTX 2YS7A 3WX0A 4C0WA 1JU4A 5LUBA 4ALLA 1T0BA 5DXFA 2VDNB 3KAKA 5IC5A 1TK3A 1BRMA 2JLAA 1NY6A 3QKSB 3WV5A 1QIGA 4Z4FA 4KAJA 3OQBA 4U9UA 3TGPA 5GINE 1MNAA 1X0XA 4G5QA 4DLAA 1MXHA 5A0VA 5DGTA 4KAXA 2FWRA 3L02A 2Q5LA 3QVWA 4MKXA 4D4GA 4LZNA 1P1IA 2NO0A 3OWHA 3PRYA 2ZSAA 5AJZA 2V7QD 4QXRA 5DRYA 3NPAA 4PR0A 3TF5A 3VJRA 3E9RA 1P7VA 1R6XA 3ZKWA 2PL9A 3ZHOA 3S1AB 5K20A 1KETA 1WZIA 5EN4A 3TQFA 4KWTA 4ZARA 4S04A 1AQYA 4O0LA 4WV3A 1DIHA 5DYTA 4NMMA 3ZLBA 2CYAA 1C9YA 5F4ZA 3TD9A 1W30A 1QO7A 1IAQA 1Z0SA 2JRLA 2AUTA 4FHDA 5AI9A 3UJDA 1EVQA 4AXBA 3P2YA 1M6HA 3M5DA 1NVUQ 4C5CA 4GPBA 4RVHA 1M34E 3V8EA 4KDEA 4N39A 1HNZB 5DOZA 4QUEA 3LPAA 4JSYA 3WYNA 5KTRA 1DKUA 3ANXA 4PM4A 2JLUA 4WKPA 5CH3A 1JR4A 3CRQA 1Y1QA 3DTTA 4AVYA 4XM1A 4A0SA 4OXXA 2V96A 3IAFA 3MTJA 3PZBA 1I0IA 4G37A 2IP1A 3TDNA 4BXOB 3MWKA 1OJLA 2BFFB 2GBIA 2Q8NA 2VXOA 1R16A 3E5HA 3EIEA 3G3EA 2A3NA 3G2LA 2BFCA 3TKYA 2FSHA 4YCCA 1VPWA 3K2QA 3UK6A 2NV0A 4X61A 1W0KD 2FJUA 4LHWA 2CNDA 4D0GA 4IMRA 3IUPA 5AFSA 3BQ9A 1JR3E 1C0IA 1XDGA 1EGMB 3U2QA 3RHZA 4RCYA 1XTIA 2BGMA 5ADVA 3C3JA 2Z08A 5DT2A 4C3ZA 2JLXA 1ZD5A 1FNCA 2VI5A 1C1XB 5BWMA 2HK7A 3P0JA 2O8CA 3GAFA 8AT1A 1M2OA 1O6BA 3HU5A 1G16A 4ZQBA 3B8HA 3RB8A 3ET5A 1MO2A 1PIWA 3JALA 3LHFA 1TZJA 3ZI4A 5C8XA 1M1XB 2HU2A 2HHLA 2J7PA 1JR3A 1JUDA 1Y63A 2VPYA 3I04A 3R7FA 4ZYXA 1WABA 5KNBH 3H4VA 5B4UA 4ZJZA 2QD3A 3OTGA 1RQ2A 3PDHA 4J4TA 4K87A 4Q7EA 2V7UA 5F5LA 3AM1A 3PNLA 2GPSA 4YCDA 4J16A 8MHTA 4DMCA 2PXAA 3JRNA 3PBKA 1YSCA 4KO8A 3LRPA 4LVUA 4CMBA 1Z7GA 4MW5A 4KI7A 1E2NA 5JCPA 2OOKA 4KI0A 2EJBA 2XB4A 3MJ4A 1G8YA 4C0XA 1PJTA 2WNHA 3RARA 1PI3A 3TQHA 1X8JA 2AN5A 2OCIA 2R8BA 1KNXA 3PXXA 3WSWA 4E6EA 2C7OA 3N2YA 3U56A 1CJMA 3TZBA 2QRVA 2XI4A 5JBQA 2FP3A 3NHLA 4Q7JB 4YLGA 4YUZA 4MKHA 4UUQA 5A2QA 1XALA 2YN2A 3I52A 3ZDQA 4P7FA 2XZLA 1TCUA 1F2DA 1X19A 3EMVA 1LY1A 3HO8A 4Q3AA 1SOWA 4I9UA 2D0OB 3Q88A 3AV3A 1YIOA 5KOIA 1XRRA 3ZW9A 3PDWA 4CMIA 4DZRA 4Z0TA 1DWPA 2R87A