4M49A

Lactate dehydrogenase a in complex with a substituted pyrazine inhibitor compound 18
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 2-amino-5-aryl-pyrazines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 116
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m49A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m49A02
4M87A 4B4VA 1HYGA 2BFOA 3DONA 4C4OA 1HL3A 3AUTA 3HSKA 1AUPA 3MOGA 4Q3EA 3VZRA 2AQHA 4OQZA 3ZWVA 2BHLA 3EMKA 4E4YA 5K6AA 5CFZA 2BFMA 4GBJA 3H7AA 3WMXA 4FR5A 2HMWA 4WLVA 3TL2A 2FRDA 3Q0EA 1EQUA 3EVNA 3CIFA 1BDMA 1M75A 1PQPA 1VSUA 3OF2A 3OIDA 1JWBB 2Y1EA 2B37A 3D4OA 3CH6A 4W7IA 1LI4A 3V8BA 2ZB3A 3NKLA 3QWFA 3SX2A 3GEDA 3NT4A 2YV1A 3CUKA 4CUZA 5FI3A 9LDTA 2PZJA 4MVJD 4MIEA 1HLPA 2I9PA 3DR3A 5A9SB 3UXYA 1R4NA 3ZV4A 2HDHA 2YY7A 4PZDA 1GCOA 3L77A 4BGEA 3IKTA 2HJRA 1XU7A 3ONEA 4DQVA 2VWQA 5FI5A 3TRIA 1YH3A 3EDMA 1EUZA 4E30A 2Y68A 4NHEA 3DHYA 1DC5A 2X1HA 1EQ2A 1N8KA 3F3SA 1AXGA 3JD2A 4GX1A 4J4HA 3DMTC 4UEKA 3ABIA 4BUCA 3CEAA 3VVBA 2HJSA 4M1QA 6ADHA 3WTBA 4GLOA 3F9IA 3KYCA 2X9NA 5KJEA 3WGGA 3BAZA 4ND2A 1GZ3A 4NK4A 1O94A 4NFSA 4RVHA 3TZCA 3PWKA 4MPDA 1AE1A 2VUSA 2EW8A 3UGKA 4AJNA 5HTOA 5COAA 3E5MA 4NG5A 3V2UA 1C1XA 1X7HA 1O8CA 2CFCA 4F3YA 5DCYA 3DAFA 3ZNOA 3DOOA 4XJTA 2EHDA 1DOHA 4J0EA 1HDXA 4BO6A 5FWNA 4FFMA 2PKRA 4OXKA 1Q0QA 3ETGA 3ZN2A 1P33A 5BNFA 1HSZA 1R6DA 4CM7A 1VE9A 4NBVA 2EJWA 3L6OO 3JYLA 3BHMA 3MCVA 5DULA 4J7UA 2Y0CA 1BVUA 3NDIA 2YYYA 4ILKA 3EUWA 4E5NA 2EGHA 2VZ0A 3LT2A 2FZWA 2WYVA 3JQAD 3MJVA 1EE2A 4FPXA 1R16A 2Y05A 4XR9A 3DBLA 5IZCA 3WNVA 4IDBA 3KLPX 3DMTA 2B4QA 4FSHA 3CMCO 1H9AA 4RZHA 1YJ8A 4E2ZA 1J6UA 5DOZA 3GUYA 2H1SA 3VDRA 3H3JA 1PL8A 2C07A 1ZIDA 1DHRA 3KOUA 5F21A 1NTOA 4WEQA 4QQRA 4N54A 4YA6A 3QA9A 4PGFA 4GKBA 4DBZA 4NI5A 1D1TA 1JN0A 2VWPA 3GZNB 5L51A 3C7CB 1U9JA 4OYRA 4RVUA 1T1SA 4J7CA 4BL5A 1Z75A 3SVTA 3GRPA 1ISIA 2EJVA 3PK0A 4Y6RA 1WMAA 1YDEA 2AA3A 3PIIA 1M67A 4C7KA 4RF5A 4R5MA 3WWZA 5JCXA 3UW3A 3UF0A 1UAGA 3DHEA 5A3JA 5BNIA 1I32A 1KERA 2EEZA 3S55A 1QR6A 1HF3A 4RLHA 4K1LA 4BNIA 1ADCA 4JBIA 1E7SA 3EAGA 4DBVO 3OIGA 1SOWA 1SOVA 3H9JA 3K5PA 3U5TA 4A26A 1BHSA 3F46A 3F47A 4YJGB 4CLOB 2A94A 3W8EA 3HADA 1NFFA 4E5YA 3WGOA 4KOAA 1I2BA 4A10A 3ZW8A 2EP5A 3EK2A 4XRRA 2BH9A 1DPGA 3O4RA 4N5MA 1HYHA 2HQ1A 1NQAO 4GWKA 3PHIA 4J7XA 4JJIA 4JXKA 4G2NA 5AOVA 5K0ZA 1T4BA 2NVUA 1RM4A 3ZWXA 4YT8A 3AOGA 3DFZA 1C1DA 1HSOA 3H9GA 2GDZA 2B0JA 5CEFA 3L07A 4AICA 1GFSA 3W8FA 2AEMA 3RUHA 4PLCA 2VYVA 2J3IA 2H6EA 2AHRA 5FF9A 2Y1CA 3DEYX 4OGWA 5IZCC 3GN1A 1NAIA 3AFNA 4Q9NA 3ZNNA 3VC7A 3PQDA 3UAGA 4Z3DA 1MLDA 2QYSA 3QVSA 4FFRA 3I9OA 4CLRA 1BTOA 4B79A 1HEUA 1ZSNA 2NWQA 1W0CA 4IXTA 4CMCA 2QZZA 1P1JA 2CDBA 5ICMA 1MFZA 4XGIA 3U49A 3DBRB 4IJKA 1XQ6A 3DZFA 4BO9A 4O6VA 1GY8A 3BXXA 2AG8A 1OMOA 1T25A 2C2XA 3A4VA 3CINA 5KTKA 1RYDA 4I9HA 5KKCA 4PRKA 3E18A 3R3SA 4CL3A 3GEMA 4YTEA 1A4UA 2YJZA 2W2LD 1RYEA 2PWZA 5DNAA 4NJMA 4IGFA 4RPLA 4IJWA 3C1TA 3JD4A 3KO8A 1N9GA 1HWYA 3QHAA 4DA9A 1O95A 1IL0A 2J5RA 1XR3A 2IRWA 2GZ1A 1WZIA 4YCAA 5TNXA 2FZEA 3MJCA 1PL6A 1EE9A 2PK3A 2Y0EA 3HFSA 4YWJA 4BNLA 1W8DA 2JD0A 1TB4A 3JQDA 1PJ3A 1YL5A 1VSVA 3IKVA 3KXDA 1I2CA 3ENKA 2C7VA 4RO0A 4WLUA 4ZQBA 4E13A 4EW6A 2DBVO 5B37A 3WICA 1HZJA 1XYGA 2UUPA 2EKPA 3HQ4O 1WDLA 2RHRA 3OA2A 3GVXA 4JX8A 1LDMA 4MDHA 4U0JA 3QQPA 3QP9A 4BNXA 1DFIA 1NNUA 3GVHA 3K31A 3WGYA 5JXWA 3I9LA 2QIOA 4OIMA 3GAFA 3WBBA 3BA1A 3ZV6A 3TSCA 1E1LA 4DIFA 1H0KA 5C7LO 1E7RA 4XGKA 5H82A 4CM5A 1V6AA 3LT4A 3ZV3A 1LRJA 2ZKLA 4OOEA 2CZCA 1YKFA 4D79A 3U9LA 1IZ0A 1T2FA 5EN4A 1ISGA 3DTTA 2BMAA 2GGSA 1HE3A 4FW8A 4GL4A 2GO1A 3H9QA 4B3IA 5AXDA 4RF4A 1YONA 4PG4A 4WEOA 5ES3A 5JAZA 5A9SA 2Q3EA 3BHJA 1X13A 4NBRA 3QVXA 4IJUA 3JTMA 1C3VA 3PQEA 4LCEA 4XYGA 3OFSA 2Q4BA 1SCUA 4PG7A 5ER9A 5C7OO 4CLHA 4CQMA 5T8KC 5I8WA 2Y1OA 2C5EA 2X86A 3H9UA 3KRTA 1IY8A 1Z45A 4BO2A 1I3LA 2OGUA 4RZIA 5GZ6A 3IP3A 4IDAA 3WFJA 1A27A 4TQGA 4QX6A 4PLVA 3X2FA 4I5EA 1DAOA 3RC1A 3UN1A 1SZJG 2CUKA 3B1KA 2IXBA 4W99A 1OI7A 4UUMA 3RKRA 3OJFA 2PD4A 1EEHA 4FOSA 4YAIA 3AY6A 3SJUA 4E33A 1MXHA 2LDBA 5EMHA 3DMYA 5JAQA 3ITDA 2DFDA 3Q9NA 3KSDO 4PG5A 4ZQEA 1KC1A 1TEHA 4YDRA 2YV3A 2OP1A 4BHTA 3CTMA 4GSKA 4H16A 3HG7A 2XPCA 1UZLA 4J49A 1QYCA 1ZNQO 2DU8A 2B5VA 2BELA 1GL3A 3AY7A 4R16A 3KB6A 2QW8A 2I76A 3AJRA 3VDQA 1QV7A 3HZZA 3OSUA 3BMQA 5KVQA 2JAPA 3W6UA 5CPBA 3ZWMA 3RBVA 3RUFA 2ET6A 2B4RO 4CM1A 2F00A 1K3TA 2FR0A 4J1TA 1EUCA 1UP4A 2WMDA 1UZNA 4NFYA 5IZ4A 2A4KA 1NR7A 3WQQA 4OSPA 2Y0DA 4MVJA 5A9RA 1Y8RA 4LISA 4MINA 1NX6A 1C0LA 1XLTA 3VTZA 1KBZA 3WJAA 3RROA 3C7DB 3ROQA 1KOLA 1JA9A 2FPIA 3GEGA 1TLTA 2D59A 4R1SA 4BNWA 4CR6A 3LLSA 5CDSA 4B8ZA 1R4MB 4J4TA 4OOFA 4PN3A 3RWBA 5BR7A 1IYZA 1HDYA 4Q3CA 3P19A 4FC6A 4XWYA 4ZQGA 2CVOA 3M1AA 1GCUA 2E4AA 1JKFA 1SPXA 2NQ8A 4E5MA 3D4NA 3WDSA 1QV6A 3OECA 2FSVA 4XYMA 3LLVA 5L3ZA 2B5WA 2BLLA 5HA5A 4CMBA 3CSDA 4GQAA 4L9RA 1X7GA 3G0OA 3H6KA 2WE7A 2HK9A 4EZBA 1ZK2A 1ONOA 4CLEA 2YDXA 2OHXA 2VTDA 4NPCA 1LDEA 4WOKA 2O48X 2NU6A 2DLDA 3VKUA 5I7VA 3GOHA 1CDOA 4BB6A 4XYLA 1E7WA 2DTEA 3A1NA 4XA8A 4A7PA 2BD0A 1FMCA 2VUTA 1PEDA 2PGLA 1IUKA 3IC5A 2UYYA 4CMKA 4J91A 1IPEA 4NDNE 1YOVB 2F1KA 4XDYA 5L7TA 3DFUA 1V35A 5T8KA 3ON5A 6LDHA 1BSVA 2D1YA 4QFCA 1GZ4A 3JYNA 4RPGA 3IJPA 2QHXA 1J5PA 3UCFA 4E2WA 4AJKA 4DGSA 2NTJA 2GYYA 1Z82A 3W4KA 4K6FA 4DPLA 3JQCA 4RV9A 5L4NA 2NU9A 1ZZEA 3GLQA 5TF4A 4GH5A 4FQ8A 3JQBC 4FGSA 3UCXA 1KEUA 1ZBQA 2J3KA 2JFHA 2VN8A 2JCYA 3AW9A 1E3JA 1PS8A 5AXCA 3QE3A 4CM4B 4GKVA 2Z5LA 3OQ1A 3RJ9A 3BMCA 1FDTA 4J4BA 4IMRA 1BMDA 1BVRA 3MJEA 3B1FA 2DBQA 4Z0PA 3TOXA 1DRWA 4OHUA 1LU9A 4M54A 1KY5A 3FR7A 3LYLA 3ZWAA 2FY8A 4JP3A 4OXNA 2E49A 1BGVA 1TXGA 1S7CA 2J3HA 5BSGA 3W1VA 2HU2A 1F17A 5K6AC 2DBRA 3FWNA 4XJSA 3E9MA 4DC1A 3WTCA 1PL7A 4I5FA 3SBOA 2PGJA 3D3WA 1WZEA 3CMMA 1F0YA 3H65A 4AJ2A 2IYPA 4IDGA 5JO0A 3ONFA 1H6AA 3ZI0A 2X5KO 2HUNA 4YAJA 2AXQA 4J16A 1H2BA 3ASUA 2AEJA 2DQ4A 4E31A 2ZYGA 5A1TA 1MG0A 1ENOA 4HX5A 1H5QA 4LVCA 1B16A 4QUKA 4OAQA 2W8ZA 3AOEC 2B69A 3AY3A 4ND5A 2QQ5A 4P4GA 3RU7A 2VYVD 1NR1A 4CM9D 5DBFA 2Z1MA 1PWZA 3O38A 5F5NA 5G0UA 3VKVA 4G65A 2XF8A 2RHCA 5ICSA 4JP2A 3RVDA 3M2TA 3DZJA 4EUHA 2Q1UA 4Y98A 2CSUA 4NU5A 4BNVA 2NQTA 5FYDA 1B15A 3GNTA 1DFGA 3H2SA 4PVDA 4CQMD 2OBYA 4M89A 4J9VA 3MTGA 3ZHBA 4PLFA 4EUEA 3FN4A 3L9XA 1PU2A 2W2LA 3AM4A 4CM9A 3F5SA 4WLNA 3VH4A 2PD3A 4CM6A 3ZWWA 5A02A 4RVGA 3TDKA 4JLWA 3D7LA 2GR9A 5IDXA 3JCZA 4R51A 5BSEA 1N1GA 4CUKA 3WXBA 4I5GA 2I65A 4L4SA 1NHWA 4QO7A 4PFJA 1DJNA 1U8FO 1NFRA 5A4DA 5JAIA 2AE1A 2FMUA 5HS6A 4AFNA 4IBOA 5AXBA 1C0PA 5TC4A 5A3VA 4BKPA 1MX3A 2V6FA 2VYNA 4II2A 5CP8A 2C59A 2FOIA 4WNIA 5EPOA 5JBIA 1K6JA 4NQZA 1DDOA 1E6UA 4I08A 3GT0A 3AUUA 1E3LA 4XB1A 3GC6A 5KJ6A 2GF2A 3JSAA 4BO3A 4FS3A 1HETA 1YXMA 1JVSA 4XZ3A 3S1LA 4D3FA 5H83A 3MZ0A 3QV1A 3RKUA 5IAAA 2X22A 4XGNA 4AJIA 4RVFA 4KP7A 2PY6A 4L8VA 3B1JA 1TI7A 1R0LA 3E8XA 4ITUA 5CG1A 5KJ1A 4D3DA 3BIOA 3PTZA 4Y6PA 3LC7O 1BXGB 1P44A 1PZEA 3GRKA 3KYDA 4IS3A 4II3A 2Y1DA 1P1IA 2CDAA 3ZW9A 5AQ1A 3UUWA 4CL8A 2DKNA 4AJ4A 1UDCA 3C1AA 3HNPA 4CM8B 4L74A 1GV0A 3WQSB 2NM0A 3VPXA 1GUYA 4BNTA 1TT7A 3BMQB 1LJ8A 1P1KA 4UVGA 4OKNA 3DQPA 5DDIP 1GU7A 4CMEC 4IY1A 2IZ1A 1ZJZA 4AVYA 1ENZA 1WDMA 2J8ZA 2NNLD 4Z6KA 2GSDA 1QSGA 5TT1A 4FJ0A 2OXIA 4CMEA 2V65A 1M66A 5EESA 1VC2A 2VOEA 1YBVA 2ZTUA 3NJ4A 5L4LA 5TS3A 4MVJH 5EERA 3NDJA 1ORRA 1PTJA 4KUGA 3K6JA 1R4MA 4BKOA 1PIWA 1QORA 3O26A 5BQFA 1WVGA 1N1EA 4ONEA 3AM5A 2P9GA 3QW2A 4YJHB 4XKJA 3VH3A 2Y93A 1FDSA 2X7HA 1DLJA 4E5PA 3O8QA 3PQFA 1GQQA 3OQ6A 1SB8A 3STHA 2R6JA 1W4ZA 5JCJA 2ZTLA 1XSEA 1HE4A 2EW2A 4H7PA 1XHLA 4OH1A 1U4OA 2A92A 3PJDA 4D7AA 5DZSA 5MGBA 2DM6A 4QFDA 4YAEA 5U1PA 1DLIA 2E48A 3LVFO 5B4TA 4ZRMA 3WYCA 1XGKA 3B70A 1P1FA 1VL0A 2WM3A 1E6WA 3I52A 2FR8A 4HV4A 1NASA 3KV3O 3LT0A 1YBMA 4R3WA 1I10A 2V6BA 4G81A 4OJNA 1GQYA 4WCFC 2O3SA 1XWFA 4MOWA 1E7MA 3BMOA 1P0FA 2O3RA 3ETEA 3TN7A 3FNGA 3WGIA 1I5RA 4D44A 4IUYA 4B4WA 4YT5A 2H9IA 2X58A 2O4UX 3DOCA 1YOVA 2PD6A 3P7MA 4JNKA 5ADHA 1GV1A 3BTVA 4NBWA 2QG4A 3MTJA 3JQGA 5F5LA 1Z74A 3DZBA 2NTVA 2VWHA 4LW8A 2VUUA 1KY4A 4WCDA 1X1TA 3GVPA 4FBGA 1H6CA 1GD1O 3RBXA 1X0VA 1I33A 5CHEA 4R4JA 2YHUA 1IHXA 3WBFA 1MB4A 3IL2A 2PR2A 3H5NA 1R0KA 3FBGA 4UVDA 3L0DA 3TL3A 1VLLA 3GPDG 4IMPA 4XIYA 3HDJA 3GHHA 3QRWA 1ZKMA 5BSFA 4CMAA 3DZHA 4M8SA 3PP8A 3ZCXA 2HK7A 3B20A 3RUDA 3KM0A 4LK3A 1UXKA 4CM4A 1LDNA 1PZHA 1LRLA 4O59O 1PJBA 3KUXA 2VWGA 2JKVA 3JQEA 3RUIA 1O5IA 2W90A 3RQSA 3LF1A 1JWAB 4DUPA 3Q3CA 3RFTA 3I9KA 3AI1A 5DN9A 3ZH2A 2J6IA 3IUPA 4UVIA 3IOYA 4FCCA 1HDCA 1QLHA 3LSYA 2AQKA 4K26A 1ZW1A 4RPKA 1EK6A 2C29D 3I23A 4H3VA 1NWCA 3AK4A 1F14A 4WECA 5KWEA 3G1UA 2VZ9A 4UUOA 3D3WB 4Z9FA 1D3AA 3GMSA 4DXHA 2ZB7A 5CPFA 2R2GA 2WSBA 4J0FA 4Z3KA 3VPFA 4ZHSA 3Q11A 5EL0A 2Q1TA 3INTA 3PHGA 4CV2A 1YB5A 3QVTA 1NQOA 2OP0A 2PNFA 3Q2IA 5JC8A 5L45A 2Z1NA 2RH8A 1HKUA 3K9QO 4R01A 4ZGWA 4WKGA 1TVEA 2VTEA 4PLTA 2P4QA 1TT5A 1L1FA 5TIIA 1GEGA 3FNHA 4TKLA 4CR8A 1J4AA 3RJ5A 3MEQA 2GERA 2HMSA 3SLGA 4OKIA 4CODB 1WMBA 3WFIA 4Z0TA 2ZTMA 4BKRA 3ZWBA 3DAPA 4MP6A 5T64A 3ETDA 3DBLB 1ZK0A 1RPNA 4DVJA 3A28A 4UULA 1EVZA 1L7DA 1PGQA 1XKQA 3HHPA 3DC2A 4LMPA 1P45A 1QRRA 4MVJF 3PHLA 5L4SA 3IIEA 1ZEMA 3A9WA 4MVJG 3N74A 4TZTA 4RLSA 3ITKA 3JQFA 4XEHA 1Q7BA 4TSKA 1PR9A 1UXHA 2FHSA 2OUIA 1U3VA 3PRJA 1U28A 3GZNA 4AJHA 4PLZA 1OOEA 3F5QA 4MKZA 4P4NA 1GADO 3E1KA 4GWGA 1QG6A 3NGLA 3UKOA 3ULKA 4YQYA 3WLFA 5ILGA 2YHIA 1EUDA 5JMWA 4R41A 4W4TA 4D42A 4LSMA 2DAPA 3Q1LA 2HRZA 2DVMA 1KIFA 4ID9A 4U6SA 2FPGA 1LLDA 1KETA 8LDHA 4PLYA 1CQIA 2ZK7A 1ZVMA 3UH1A 5GZ1A 1ML3A 1DC3A 5GZ3A 1LDGA 1U8XX 1XCBA 4IQGA 4TMFA 1F8GA 1T2DA 4BNFA 2P5UA 4R9SA 3PHJA 3ANNA 4NFHA 4OM8A 2ZB8A 3U4HA 4YJGA 3VZPA 1DAPA 2VT2A 4CLOA 1UH5A 5JSFA 1Q0HA 5G0VA 5A03A 4GPD1 5C37A 2A9FA 1GR0A 3TZ6A 4B3HA 1LLCA 1LSUA 1ISMA 4IDDA 1AHHA 4LN1A 4M86A 1UP7A 3RFXA 1WDKA 2P2SA 4BGUA 3GFGA 4DL9A 3S8MA 3OQBA 4IQ8A 2ZATA 1NYTA 1HDZA 4B4UA 1BXGA 1XA0A 3CE6A 3KYDB 4PIVA 4RGBA 1DIRA 3GR6A 2NVUB 2Q2VA 2RBEA 4Y67A 4BNMA 4DQXA 2D2IA 3JQ7B 5G0SA 5DCWA 2JCVA 1VRWA 4F45A 5TRTA 5L7YA 1F12A 4CM8A 3L4BA 4BGVA 3DBVO 3Q6IA 2J3JA 4NJOA 4FFNA 3PWSA 4NIMA 4FJ1A 1KVUA 2OL4A 1HXHA 1VJ1A 4KQWA 2YQ4A 3CKYA 3RUEA 4DYDA 1KS9A 4DIOA 4WCFB 2ZQYA 2CVZA 4ESOA 7MDHA 2DC1A 1K2WA 1LX6A 1SEVA 4E12A 2QRJA 4UREA 2CVQA 4UEOA 2O7SA 2WJPA 4IQ0A 1YWGO 1A7AA 3HE3A 1K6IA 2C0CA 4KDFA 3EC7A 3PZRA 2VRCA 2EERA 1UXJA 3FCOA 3K8ZA 2PKQP 1UP6A 5EJ2A 1QKIA 1WP4A 3GGPA 3MWEB 5IN5A 4A03A 3FSRA 2C7GA 3AI2A 3NJ8A 1DC6A 2VRCD 5ENVA 3S2FA 4IGEA 1Q1NA 2YFQA 2ZJ1A 5JLAA 1ADGA 3QWIA 4B7CA 4B7XA 4XQEA 1B8UA 4FFLA 4ND4A 1RM0A 3QWBA 3O8QB 5DBGA 1E5QA 3BYZA 4KUEA 1FDVA 2NSDA 4JQCA 4QEDA 4IINA 1VL8A 4G5HA 1HRDA 4LGVA 5G4LA 4CV0A 4JJFA 1Q0LA 4EGFA 1SMKA 4IPTA 3U0BA 2PH5A 1K0UA 3FNFA 3NX4A 5JY6A 5HBRA 3JQAB 1LQUA 5A5EA 4HP8A 4Z9YA 3RU9A 4A0SA 4CQLA 2X9VA 2VYND 1JAXA 3I6QA 4UUPA 5COBA 4BO1A 1VKNA 3JYQA 4OSOA 2PV7A 3IUSA 2PH3A 3KTDA 3VHRA 3GNQA 4K28A 3GG9A 4XQGA 1VJ0A 1PJCA 1QYWA 4YQZA 3G17A 3G49A 5FFFA 1T2EA 4NNJA 1Y7TA 3HN2A 2EKLA 3GZ4A 1LEHA 2Y67A 2BRUA 5I9NA 1WXDA 3QLJA 1A4IA 1J0XO 2D4AA 3RUCA 1Z7BA 1LUAA 1DIHA 4HY3A 3LF2A 4NMHA 4ALKA 5MDHA 3HB4X 2O2SA 2CF6A 4E5KA 3AOEA 4GX5A 3V1YA 4FD3A 2DTXA 3OHSX 3PJFA 4FB5A 4BNKA 2O23A 2VHWA 5JYDA 1NQ5A 1QLJA 4F6CA 4B8WA 2VHZA 2X0JA 2VZ8A 2VNSA 3GPIA 3NDRA 4GGPA 3C85A 2R00A 4RJTA 1B7GO 1ZXLA 3ZU2A 4Y6SA 4RF3A 2CDCA 3RD5A 4RVSA 2PKQO 3RAJA 2HKIA 4DYVA 3R0IA 1MA0A 4GMFA 1EK5A 1PGPA 4Y8VA 2JCXA 1YL7A 3OJEA 5U9CA 3UCEA 3IS3A 4TRJA 1P74A 3FR8A 5TSDA 1H9BA 5HRUA 3FPCA 1NPDA 4ZJUA 1V3VA 2EKQA 1EFKA 3GUCA 3PVZA 4D46A 1LA2A 5L40A 4BS9A 1PJ4A 1X14A 2HLPA 4AJ1A 1H94A 3FTNA 2D5CA 1T2AA 3TZKA 4JGBA 2G1UA 1YJQA 1KEWA 2G5CA 1T26A 3ZWNA 2CF5A 3QWHA 4JIGA 2P9EA 3H9EO 1V3UA 4NBUA 3DTYA 4PZCA 4FN4A 5IXSA 2HO5A 3QVOA 4R68A 5H81A 3EGOA 5ENDA 3S2EA 2BI8A 1Y5MA 1JTVA 2GD1O 2NVBA 2YW9A 3P2YA 3Q2KA 2O7QA 2E6UX 4R54A 1PQWA 3EHEA 1RJWA 4BMVA 3ANMA 1I3MA 1V3TA 4E0BA 1E3IA 3DL2A 5T6BA 3RUAA 4ZD6A 1TT5B 4BQRA 2GN9A 1ZMTA 4OL9A 1X1EA 3V5NA 5KVSA 2BGKA 2Q2WA 1ZSVA 3JQ6A 2IODA 3V1UA 1P0CA 3S2IA 4E32A 3WWYA 3D3EA 4J6FA 2W4QA 1DJQA 1MFPA 2PTGA 1KVSA 4KDEA 2W2KB 3E03A 5TT0A 1DIGA 3AU9A 3IP1A 1HLDA 4PLHA 3LC1O 4E6PA 1AHIA 3DBHA 1ZH8A 3OETA 4RF2A 4U8GA 1Y8RB 5JAMA 4MJLA 4ROSA 1L7EA 4MP8A 3GNSA 1E1MA 4FGWA 1WNTA 2YDYA 2DFVA 4YJFA 1SAYA 3ZWOA 2JL1A 1Q7CA 5HWSA 2R00C 3C24A 2HMUA 2I3AA 4AJLA 4ZQFA 4PLGA 2Q1WA 5ITWA 4M49A 3D1LA 1Z73A 2EXXA 1EBUA 3WSWA 3F4BA 5L7WA 2YHIB 2PZLA 3TF5A 1IB6A 2G0TA 2RH4A 1A5ZA 1EDZA 5KCZA 3GF4A 4DMLA 1AXEA 4J1NA 2BGMA 1I3NA 5I7SA 2ILTA 2P4HX 4JBGA 3W4IA 5K9ZA 1B3BA 3PFFA 1I30A 1GPDG 1AGNA 3BHIA 4KUHA 3WG9A 1BXZA 2GN6A 2X0RA 2Q99A 4S1VA 4WLFA 4CJXA 3NT5A 3S2GA 3ENNA 1YBAA 4P22A 3ZU4A 2E37A 5G4KB 3L6EA 3PHHA 4AJEA 4EI2A 3RC9A 2D3TA 3D0OA 1E0DA 1LC0A 5DBIA 4CLXA 1BG6A 3RC2A 5CG2A 4WLEA 3DAGA 1NBOA 1UUFA 5CDUA 3I1JA 3TPCA 4RQUA 1PS9A 1P1RA 1YE3A 3MOIA 3NV9A 5G0WA 5U4QA 5IXYA 1ULSA 4BNGA 2EIHA 4HUJA 4BV9A 3W4JA 3L4SO 3DDNA 1GYRA 3K92A 1YVEI 2O2YA 1LLUA 4L0QA 1GQ2A 2BFAA 2VNAA 4EITA 4CR7A 3KSUA 1SO8A 5BNTA 2SCUA 1CWUA 3U62A 4E21A 3K73O 4Q3NA 4EBFA 3BMNA 2ZIZA 5TJ9A 4ZICA 1W73A 4B4OA 4ZN6A 2B36A 3KBOA 3ZDFA 1ADFA 1ID1A 4CLDA 1PJTA 1LTHR 4WCFA 2VOJA 4FFOA 1U3UA 1BW9A 1JKJA 5JNLA 1U5AA 3VZQA 2IEDA 4UVHA 1MG5A 2FWMX 1E6EA 3TOZA 4YRBA 4QECA 2HAEA 2NU7A 4YRDA 1OZAA 3JD1A 3WSVA 4RL6A 3PWZA 2YQ5A 2AW5A 1R15A 1U7HA 4ZA2A 5CDTA 1I24A 1HDRA 5DT9A 3GGGA 4R69A 1B0AA 1E3WA 5T5QA 1GAEO 1XU9A 2Q46A 1O6ZA 4N5LA 2OBNA 3HDQA 4HFNA 1KC3A 5B4VA 1U3WA 4GX0A 3F1LA 2A35A 5DP2A 2O3UA 3K96A 1ZK3A 2X6TA 5DCUA 4D3SA 1DEHA 1Y8QB 3ST7A 1Y6JA 3OEYA 1GEEA 4UAGA 5HM8A 5ILOA 1DB3A 2X5JO 3SEFA 3TFOA 2ZCVA 3JV7A 2CNBA 1IHYA 4J43A 3JQAA 1HTBA 2BGLA 3UVEA 2DBZA 4U6QA 2ZYDA 2HMVA 4GGOA 3ZNPA 3L4BC 5JDIA 4GI2A 4AJJA 1FXSA 2V7PA 5C7IO 1DBVO 1B26A 3ZGYA 4O5OA 8ADHA 1T24A 3JQ8B 1OBFO 2IZ0A 5IJZA 4UUNA 2PZKA 1ZJYA 4CMIA 2OZPA 4WE3A 1PS0A 2TMGA 3VH2A 5BSHA 3U3XA 4DPMA 5GY7A 4BO5A 5LCXA 1MC4A 3CPSA 1QP8A 5IDYA 1X0XA 4YXFA 3JD0A 3WOHA 5CDGA 1V9LA 1LSSA 2GCGA 4BO8A 2VHXA 3C8MA 1YL6A 3T7EA 3PYLA 1NVMB 5TGDA 4A2CA 2QRLA 3PLNA 1GDHA 1E5LA 4YRAA 3RFVA 3IQDB 1YQXA 1U2GA 4MKRA 4R1NA 5IDWA 4A73A 1YQGA 4EDFA 5L95A 3DO5A 2WDZA 1WW8A 4LMRA 4TKMA 4WASA 5C5IA 1LQTA 4WJZA 1WPQA 3T4EA 5JFOA 2H63A 3BTSA 1GYPA 1G0OA 3A14A 2YFHA 3WX0A 2VQ3A 4WUVA 1EDOA 3KYBA 2P91A 1R4NB 4KTTE 4BMNA 1JLLA 4NZ9A 4Q39A 4PG6A 2W98A 3PDJA 3RBZA 2P68A 4Q3AA 2UAGA 4FJ2A 5JO9A 4BGIA 2VHYA 5F1PA 1M6WA 3QY9A 4DQUA 1NFQA 5TLSA 1MGOA 4E3ZA 5JW6A 1E7QA 3NRCA 1NAHA 3WJ7A 1NM5A 1VPDA 4XX0A 4NH4A 4TRNA 2P9CA 2Q1SA 1F8FA 4BKQA 3KYCB 1KVTA 1I36A 1JW9B 5IFLA 2QZ9A 1I2ZA 3GY0A 1ADBA 3HFGA 4MVJI 1C0KA 3SC6A 1V0JA 1PJSA 3IAHA 3WYBA 3PGXA 4INAA 5AXAA 3TQHA 2IXAA 1AN9A 1NXQA 4N7RA 2OOSA 4URFA 3A06A 2JHFA 3I5MA 4XD2A 3VOSA 4RDHA 3DHNA 3EYWA 5B1YA 1S6YA 2BKAA 4ZQHA 1GZ6A 7ADHA 4J2HA 4HFJA 4OXYA 4ZRNA 1ARZA 4BNYA 4QT0A 1R12A 1WLYA 1C0IA 2Q4EA 3ANLA 3G79A 3H8VA 4EEXA 2X0NA 3N7UA 3TNLA 3VPSA 3I6IA 2NU8A 3PEFA 1NHGA 3ORFA 4M55A 4ALLA 4BQPA 1ZK4A 1XEAA 3D5TA 2Y1GA 2DPGA 3ZHZA 5A06A 3DBHB 1X15A 3PJEA 2GLXA 3Q9UA 4U0KA 1G1AA 4NK5A 5J23A 4YJFB 2AEFA 3ZHXA 3GDFA 1ENPA 1O0SA 3FF4A 3IMFA 5LC1A 2PLAA 3VVCA 5JDCA 3JD3A 1XIVA 3OH8A 4ND1A 1A72A 5I7EA 1T2CA 1MC5A 2Q2QA 3ASVA 4WNCA 5TX7A 3PI7A 1D7OA 3ROKA 2DUUA 9LDBA 1CETA 2EWMA 1DSSG 1FDUA 2HK8A 4PLPA 4TRRA 4CUJA 3AM3A 4U7WA 3WNQA 2XXBA 3H2ZA 5JC1A 5KIAA 3ZU3A 4LCJA 1LXCA 3OBBA 2O4CA 2HSDA 2C82A 1KVRA 4C7JA 3INRA 2EP7A 2GUGA 4XQCA 2H5LA 5EINA 4CPDA 2CD9A 1E1NA 1YO6A 3AI3A 5JY1A 2JJYA 4EEZA 3GAZA 2NVWA 2BI7A 3PPIA 3I4CA 4Q3BA 4HNGA 3JQ9C 2FN7A 5G4KA 2HMTA 4GAEA 3KEQA 2LDXA 4HKTA 4ND3A 4GVLA 3WYEA 3NEPX 1UXIA 4GSLA 3CZRA 5G0TA 1XG5A 1A71A 2J5QA 2IZZA 3DZIA 3EZLA 4A27A 4DTIA 1SC6A 3I9JA 4FIZA 1C1DB 1CIVA 3KSZO 3QSGA 4BO7A 3MJTA 4P8RA 4RDIA 3VH1A 3W8DA 3LDHA 4RVDA 1LLQA 5EQFA 5JS6A 1ZFNA 1EVIA 4O63O 2D0IA 3JQGB 1I0ZA 4EJ6A 3BMNB 2OMEA 2D8AA 5KJFA 4DWVA 3HJAA 2X5OA 4YYZA 1CF2O 3P2OA 2X0IA 4D43A 1UAYA 5A04A 2DPHA 4IM7A 5KOIA 3N58A 4HBGA 3GDOA 4AJOA 3GHYA 4BIIA 2AQ8A 4CLRB 5T57A 2Q49A 4HXYA 1ULUA 1ZK1A 2NADA 1PSDA 3LT1A 4PRLA 1ISJA 3F4LA 5KNLA 2RIRA 4JBHA 4BNJA 2JD1A 1E92A 3DBRA 1EVJA 1E3WB 4WLOA 1BRMA 1OFGA 2HRBA 3AUAA 1GPJA 1QYXA 3GGOA 1PWXA 1BXKA 4FFPA 4DLLA 5L9AA 3B6ZA 4I9UA 3E5RA 1EZ4A 2EF1A 2HCTA 4DLAA 4TRMA 1H2HA 4GX2A 2Z95A 4NJMB 1Y8QA 1UDBA 4D41A 3E9QA 1N9GB 1PZGA 3HDHA 1YB4A 4Q3DA 1CQJA 5EIOA 3M1LA 3M2PA 4O0LA 4L4RA 5KVCA 3OJ0A 2X4GA 3ZZNA 5F3RA 1G0NA 3MJSA 1C14A 4JROA 1YB1A 1RKXA 5DP1A 2TMDA 1SB9A 2GZ2A 1T1RA 1N5DA 1I8TA 1ONNA 2I99A 4BNNA 3X2EA 3DB2A 3EY4A 2VT3A 5GMOA 1XQ1A 3NT2A 3K2EA 1HE2A 1ISFA 3I83A 1A7KA 4W9NC 3PJGA 3PYXA 1ZUD1 1V8BA 1LNQA 5G2OA 4XYEA 3WQRA 4IS2A 5JE8A 3CZMA 1KEPA 4IDEA 4Y9DA 4MP3A 1A9ZA 4RPJA 4TVOA 3TJRA 1P1HA 1Z7EA 4ALIA 4IJVA 4CM3A 2AG5A 4DC0A 2NUAA 1NQTA 2JFGA 2FR1A 3GDGA 2DTDA 2GPTA 4DLBA 1BWSA 4U5QA 4W7HA 3TZHA 4PZEA 5HS4A 5COQA 1KVQA 1Q2XA 3H5AA 4FDAA 1VJTA 4KMSA 4HNHA 4R9RA 3GQVA 3WGZA 1IPFA 3UOGA 1VM6A 4P4LA 3HN7A 5B4UA 1LDYA 1FK8A 3HWRA 5JCJD 3ZU5A 4IZHA 3RSHA 1NVTA 2NLOA 1U7TA 1EMDA 3H3FA 3UFXA 5ITVA 4L4XA 1LC3A 1Q7GA 3R3JA 4F46A 4D45A 2AQIA 3BTOA 3R1IA 1HT0A 4CQMB 3OICA 4J2OA 1YGYA 1UR5A 3D5QA 2PFGA 5CAEA 4CMJA 2UUOA 1P77A 3EW7A 4PVCA 4YR9A 5C3MA 1HDGO 1MXFA 1YDWA 3LC2O 3WGTA 1Y81A 2ZQZA 4K6CA 3ROMA 4BMSA 2Y99A 4EJMA 4H15A 3E6AA 4XR4A 2WD8A 3GMDA 3H5RA 1P3DA 4BO0A 1T4DA 3SJ7A 1KYQA 4HFRA 1YQDA 3U4DA 3CXRA 3F6YA 1EVYA 1JQBA 1Y5RA 2GN4A 2Y1FA 3JYOA 4AG3A 3DOJA 5LDHA 1ZO8A 3ADPA 5JYEA 4KWIA 4XB2A 4EYEA 1JVBA 3JQ7A 4GLLA 2NTNA 4I5DA 3FNEA 2ZYAA 4J9UE 3ICCA 1P31A 4BNHA 1SNYA 1DO8A 2PZMA 1VI2A 2YV2A 4Z0HO 3WS7A 3E82A 3I4FA 4BB5A 1NPTO 4E2YA 1J49A 2OORA 5A9TA 4YB8A 2FP4A 1D8AA 3HDYA 4XDZA 3NGXA 4IDFA 1F06A 4YAKA 1UDAA 2V6MA 4BV8A 3BTUA 2VHVA 4TZKA 3C7AA 4I1IA 5CEJA 3FBTA 2I67A 1M6HA 3JQBA 5JDIC 4N18A 4X54A 2WD7B 4OO3A 4K9DA 4MKXA 1ZXBA 3FWZA 1N7GA 1PJ2A 1DIAA 3KHUA 2DUWA 3I9NA 4JN6B 4TWRA 2RAFA 1E77A 3RASA 4D0SA 2J5KA 5KVVA 4OMUA 4BVAA 3EZYA 1Y9AA 1HDOA 4DMMA 4B7UA 2XAAA 3I9MA 3PLRA 3RIHA 3FD8A 3PZBA 1B8VA 1LSOA 1QYVA 5AVOA 1B2LA 2X23A 2WWRA 3ZWCA 5I8ZA 3FTPA 2XOXA 4JJGA 4MO2A 4CQLB 2B35A 3JQFC 2IE0A 4WK6A 3FHLA 3HUDA 3E48A 2PGDA 2PA3A 3KETA 3JQ9A 2WTBA 1HYEA 3FRJA 2B83A 4OQYA 1K6XA 3V2GA 1KEVA 1OAAA 4RORA 4JK3A 3ZWYA 2Y66A 3BZUA 3AUSA 3IJRA 3JYPA 4UVEA 3OJOA 3O9ZA 1HZZA 2C5AA 3PFWO 3QVWA 2YUTA 3GG2A 1YS4A 2NACA 4XYBA 4YAGA 4CV1A 3UICA 4YT4A 5IF3A 3FPLA 3H4VA 2O3TA 4TROA 3W6ZA 3F1KA 3L9WA 2I3GA 2I5PO 3OP4A 3K2BA 3LK7A 5AYVA 5A5FA 1XELA 1MUUA 1ONPA 4L76A 4LRSB 4MIOA 4W82A 1N2SA 2UVDA 5I7FA 1E7YA 4R5HA 1NWHA 4IDCA 3QJ5A 1QMGA 4MVJE 2POQX 4YEDA 4DREA 4UEJA 1ZCJA 4J1SA 3ADOA 4KTVE 3WIEA 1DIBA 4FOOA 1G6KA 3OMLA 4QTZA 1U3TA 1M76A 4EUFA 4S3MA 1CRWG 2B4TO 5TQVA 3MWDB 3ROPA 1PJQA 3C3XA 5T67A 4IIUA 5IG2A 2JAHA 2NV6A 1QXSA 3GK3A 4B3JA 3L6DA 4CV3A 5EQDA 3T7CA 4EJ0A 2C2YA 1I01A 4DIBA 1GUFA 3NTQA 3BMCB 4AL4A 3GVIA 3WIDA 1UJMA 5B12A 2ZJ0A 5JDCC 1B3RA 3NYWA 1VKOA 4L73A 3ZHYA 1XDWA 1I3KA 1Y9EA 3VTFA 3V2HA 3WLEA 2DT5A 2VRBA 4BO4A 3WGQA 1OC4A 4YBZA 1O89A 4DRYA 2Q45A 1OC2A 4TVBA 1D4FA 1ENYA 4LRTB 3QIVA 1RM5A 3G1TA 4XCVA 4Z9XA 2C54A 2IDZA 4QO8A 1CERA 3SC4A 1PZFA 3NAQA 2XXJA 5KJCA 2EGGA 3RCBA 1W6UA 3ZWPA 3K30A 5F1OA 2V6GA 3INGA 1C1XB 3MJ4A 2GN8A 5ER6A 1NVGA 4QSMA 1B14A 5THQA 4MVJM 1DRVA 5CDYA 3LU1A 1U2DA 2FSSA 3GA0A 1GYQA 4R3NA 3U4IA 2QRKA 4R1TA 4YACA 2WYUA 4WGGA 3IDSA 3DZGA 1UZMA 2G82A 1FJHA 3PGJA 3DWFA 1FDWA 1ZEJA 4O1MA 2G17A 4J90A 3C1OA 2X9GA 2GASA 5JMPA 1RWBA 3UHAA 2GNAA 2ZB4A 3OEWA 1MV8A 1X7DA 3D64A 4J3FA 2W2KA 1DXYA 4I8XA 3VZSA 1P9LA 3NTRA 4IXWA 3KEOA 3TWOA 1R37A 2O3QA 4P38A 3E9NA 1MP0A 1ZMOA 3WGHA 2IYOA 4BKUA 3ONDA 3HB5X 4KZPA 5TJHA 1ZSYA 3OIFA 2WYWA 2GZ3A 1H6DA 4FC7A 4LVUA 4PLWA 4ALJA 1K89A 4BOYA 1SEPA 1PJLA 3EVTA 4ALMA 4QXMA 1LSJA 1A9YA 1CYDA 1R0SA 4ALNA 5IN4A 4J1QA 2EG9A 2G76A 2EV9A 5I9MA 3GH3A 1E1KA 4RQTA 2VCYA 3OJLA 2JHGA 1JU9A 3WR5A 4CMHA 5A05A 3ICPA 2OO5A 3G3EA 3I3OA 1NP3A 1B8PA 2Q50A 1PGJA 4BNZA 2C20A 3GN2A 4GMGA 1PX0A 2QYTA 1U4SA 3AU8A 5JPIA 4KQXA 1D1SA 1LDBA 4NBTA 3KLMX 1WWKA 4HFMA 2GRAA 5KKAA 5CEEA 2OFPA 1H93A 1NPYA 3U4CA 4XRGA 2WEKA 3AWDA 4LSWA 4BNUA 1E3SA 2X8LA 4YPOA 1EFLA 1EBFA 1H6BA 4IIVA 3RI3A 1PQUA 1ISHA 3OM9A 4RPHA 4D0RA 4R1UA 4HWKA 2FPPA 2E82A 1DRUA 2CMDA 4PCVA 2D5AA 2P5YA 3DXFA 1DC4A 4N5NA 1N7HA 5BT9A 1E3EA 1PGNA 3D4PA 1CEQA 1RM3A 3KZVA 2O3JA 3GVCA 1TA4A 5F1KA 4KWHA 5IDQA 1DHTA 2I6TA 3VPHA 3NUGA 5FEUA 4IZIA 4XIJA 4MVJP 3SXPA 5DF1A 1IOLA 1JAYA 1BW9B 3T4XA 1IE3A 3PDUA 3WB9A 4HADA 1JDJA 3P5SA 1Y1PA 4JCOA 2ZCUA 1IULA 1IZ9A 1GTMA 4YJDA 1FF9A 1PGOA 2O50A 1LRKA 2WD7A 1N92A 4A5OA 1HE5A 1YRLA 2QX7A 4WPGA 4ZVVA 4F6LA 5L53A 1VL6A 1QYDA 4NR0A 2BF7A 1WAMA 1LBEA 4ZU3A 4GVXA 1PR3A 3U09A 2UDPA 2CY0A 3TFQA 1O9BA 4YT2A 1U1IA 4YJHA 3R6DA 3TZQA 4RCVA 1K5HA 3LQFA 4WOJA 2AE2A 3LZ6A 3KVOA 5I9LA 2UV8A 3VAZA 3ZV5A 3NTOA 4MIYA 2AMFA 3M6IA 4I9NA 3PYMA 5DOVA 2RCYA 3WMWA 4L75A 1BDBA 3AFMA 2I66A 3DZKA 3PIDA 3GFBA 1UXGA 4PG8A 2YZ7A 1DFHA 1M2WA 5THKA 4XQ9A 3OA0A 1Z6ZA 2IEBA 4DPKA 3COSA 1CJCA 4W6ZA 4AJPA 1JKIA 4CMGA 4W9NA 3SLKA 3ZNQA 2WE8A 3O03A 4NU6A 3JQ8A 3VPGA 1U5CA 3FI9A 3BMOB 1GUZA 2JD2A 3V1TC 3RC7A 1SBYA 4CMIB 3PXXA 3QWAA 2ZTVA 2JFFA 2BFPA 5LDGA 4E2XA 4YVFA 1R66A
chains in the Genus database with same CATH superfamily
4B4VA 1PSWA 1DQYA 3IPXA 4QBIA 1FFYA 1P91A 3JPWA 3VZRA 2MMGA 2VL7A 3EMKA 1J8FA 3LCVB 1IB0A 4P4TA 3UHJA 4GBJA 5K6AA 1PG0A 2ORWA 2P0EA 3IQGX 4Y2PA 4CTOA 1MRSA 4LVOA 5KBYA 4EB6B 2E5LB 4YV7A 1EQUA 1AZSC 1OLXB 2IU4A 3EVNA 3P2JA 4NBKA 5H9VA 1M75A 4FE7A 4QUGA 2Y1EA 5KNCH 2VT6A 3LO8A 4JC8A 1P18A 4CQNA 1FTQA 1XTPA 2CNKA 2CK3A 3FNBA 4MUIA 3NKLA 3RG2A 4MH0R 3SX2A 3GEDA 1HDEA 1JPVA 9LDTA 5DWDA 4S0XA 5FT9A 2YVKA 3WV5A 1HLPA 1V5EA 2I9PA 3DR3A 3I8SA 5DM1A 1TCAA 3ZJ5A 4Z2YA 1N9KA 2CC2A 4BWFB 1JHVA 2XUKA 1FNCA 4F3TA 4QFMA 4KWCA 4BGEA 2HJRA 5JI2E 1L1EA 4DQVA 5C5EA 2FTKE 4DIUA 2VWQA 1F1JA 1NIPA 2A9JA 3EDMA 1VYVA 3EXIB 1XV5A 1Z17A 3CRMA 2ZI5A 1WLSA 2ZRPA 4NHEA 3T95A 1JPUA 1DC5A 2JFQA 1D0SA 2IEIA 1GUAA 3F3SA 4JWKA 1AXGA 5IW8A 3JD2A 3ZY4A 2QYHA 4ASUD 4TV9B 3ABIA 2B0CA 3CEAA 3VVBA 4CT5A 2X6RA 3QI2A 3SZRA 3F9IA 1MIHA 2YJTD 1XJWA 2B8EA 3L7CA 4BZXA 2X9NA 1A1SA 3BAZA 3M1IA 2XGOA 4ND2A 2NYRA 3IV9A 1SUFA 3R3YA 4QXQA 5C1IA 1Y6ZA 3AP1A 3FSGD 1AE1A 2VUSA 3NOVA 3ZLBA 5B1EA 3A6HA 2EIXA 2Q3FA 4NG5A 5COAA 3ROXA 3QLEA 4AI6A 4FTWA 1CUYA 1X7HA 3ECAA 1T0PA 5JD6A 1HT2E 3EY9A 1TEZA 4QQNA 3CPJB 5BN1A 1RQNA 3KVYA 5B3JA 3EVFA 5J2TB 4XVUA 2Y77A 1D6NA 4PYLA 1VIDA 1DOHA 4W8OA 4DDUA 3AETA 4TOIA 1P81A 3G88A 4RFVA 1VL2A 1Y9JA 4Q21A 1LBQA 2F8LA 2RB5A 4EB8A 1VE9A 2HMAA 5ALQA 2EJWA 3NI2A 4TM8A 4JSRA 3JYLA 5FUBA 5BQ3A 5AM4A 2Y0CA 3SE7A 1OAOA 4K9QA 1O0CA 3CPHA 3KT8A 1MGPA 1I4LD 1RWOA 3JQAD 3MJVA 4FPXA 4M7OA 3OEED 2DH6A 1QCDA 1V5IA 4ZMBA 3AJEA 3IQIX 1TCUA 3D0RA 3TNJA 3W6NA 5A5GA 1ZP6A 1II8A 1D2RA 2V9CA 2Y1WA 3ADKA 1H9AA 3CMCO 3DA8A 3RNOA 1UL1X 3TXXA 4URVR 4ZCIA 5DOZA 5C1PA 2YV5A 4MGKR 4NCIA 3BE6A 4JEHA 3H3JA 4X90A 4Z86A 2C07A 1C3OB 2H7XA 2IHYA 2XUAA 3M3DA 3RRYA 3M34A 1H9CA 1ZIDA 1U6IA 1MENA 2E1PA 4KYUA 1FQJA 4JENA 1Y37A 4MUJA 4MDEA 4LNAA 5DK4A 4PGFA 4CDGA 1VE1A 3RC3A 2GF9A 1R8QA 3CYFA 3EMVA 3JARA 4G5XA 3GZNB 1JN0A 2Z83A 3KPVA 4EA8A 3RS8A 5L51A 1JQLB 1ZVVA 1BS9A 3M6MD 1AGPA 1J0EA 5BQ5A 1EHIA 3BWVA 4U00A 4PFSA 1Z75A 1MC8A 1MOPA 4ZK6A 3SVTA 4JQOA 1GQRA 2EJVA 1SHUX 3PK0A 5K3FA 1BHJA 3HVHA 5KNBA 1YDEA 3PIIA 2PWAA 1HOTA 4KFUA 4MV9A 4C7KA 1IBCA 1ZIXA 1QGYA 2R4QA 4P3KA 4R5MA 3UW3A 3DHEA 4OM7A 5TQ0B 1I32A 3LCJA 3LMKA 3EF3A 5A3JA 1D2CA 3DKVA 5EJ7A 1J8MF 4IWYA 1NN5A 2ODPA 4K1LA 3HU3A 4M38A 1YCDA 1ZOLA 1XRRA 1O95C 4C06A 4PV7A 1SOVA 3W04A 1AF4A 3K5PA 4DF3A 4HYYA 3F47A 3HYTA 3NO4A 4RWZA 4YJGB 2B8WA 3VYVA 1K08A 1UBMS 2D1TA 3UB2A 4ZVKA 4G84A 1N77A 2DY1A 4DJTA 1WMSA 3IOEA 3PNKA 4IVPA 3RSZA 3P9KA 4XGQA 5FWDA 4FT2A 1U0RA 4GU5A 1R6AA 1RAEA 4KB5A 4B33A 4DZTA 2EP5A 2BUCA 1Z4LA 4XRRA 5CFNA 5C8YB 3JQQA 4N5MA 4XUEA 2QVLA 2HQ1A 3A9RA 4GWKA 4DLPA 3PHIA 4J7XA 1NG1A 4G2NA 1Y3BE 5TPZD 1BOFA 2GHTA 3M4XA 4HQ0A 5K0ZA 2SECE 1GAWA 2X13A 3FPBA 3V8EA 3AOGA 4L5IA 1D2MA 3HCPA 2OTCA 4J07A 3V48A 3GUUA 2B0JA 5CEFA 1ZUWA 2AJCA 2J4FA 4B0OA 1A7JA 1M0SA 1M8GA 1H4SA 2YNMC 1QO0D 3LT5A 5DHPA 1CUIA 3UBTA 4K9NA 3VTKA 4F4DA 2NO0A 5E4FA 2JH3A 1L4NA 1RC0A 2NT3A 2WOOA 4R2MA 2AHRA 5G40A 4TYYA 3DEYX 3UK6A 2H2DA 3DJYA 4AD8A 4Q9NA 1ZGGA 3AP3A 3IA7A 3VC7A 2NP6A 3FZEA 2JJ1D 2Q07A 1WETA 4YAFA 1Y34E 4TTPA 5IVIA 4Z3DA 4FFRA 3UUEA 1YSCA 3I9OA 1E2DA 2BFEB 1ABFA 2WG2A 4CLRA 3AKDA 1VXRA 1AB6A 1HEUA 1JBQA 4I2VA 4BZPA 1QPBA 4JXXA 1MHPA 3EOBI 2AR0A 2NTEA 4XGIA 1EJBA 2O1EA 3LECA 3A32A 5IBQA 4LDRA 3TQFA 4C04A 3PNBA 3GLFE 3DBRB 4XWWA 1FP1D 3DZFA 1XTTA 3BXXA 4EA7A 1N6LA 4O4JF 5KYWA 3A4VA 3CLHA 3W7BA 2XWSA 1RYDA 3KG2A 2XBUA 2Y1KA 3QLUC 4GR5A 4I9HA 4AO6A 4EKDA 3JZFA 1MVLA 3E18A 4F1WA 1OYVA 4YTEA 3OLWA 1KF0A 4LYJA 2I2WA 2GAOA 3NHSA 3INNA 4IGFA 1UBKS 3LUFA 4Q34A 4RPLA 5I7HA 1N9GA 1A2OA 4TV9F 4URXR 1HWYA 1W5EA 2Q1YA 2PBRA 2UZ1A 3B38A 3HM2A 3HU2A 1IL0A 3LKZA 1XR3A 2IRWA 4IRMA 4Y2YA 1WZIA 3C7KA 4TSRA 3BILA 3MJCA 1C3JA 2H4XA 2HDWA 2IGTA 3BE5A 2VQSA 3ET4A 2Q5OA 4LRUA 2C7RA 4C01A 3HS3A 1W8DA 3VR4A 2UXCB 2BMDA 3KAKA 4N8SA 1A50B 3MFYA 4A0RA 3BICA 4EFNA 5B7GA 1FQKA 1PJ3A 3N2ZB 1RCUA 3MQFA 3Q3VA 1PDWA 2C5LA 2BHTA 1Z29A 2P6UA 5CH3A 2IV2X 4C22A 4HX2A 3W3ZB 1DV1A 2DBVO 4E13A 5BW8A 2P6RA 3SI7A 3CVJA 2YCBA 1PEAA 4U9IS 5ECWA 3WA7A 4CYMA 1HZJA 3TXAA 1KGDA 2PH7A 1KZ7B 2AUNA 1XYGA 2FW8A 4UHBA 3VU9A 3FZQA 4HJXA 4EF4A 2RHRA 4HPJB 3U40A 1Q44A 1Y80A 4JX8A 5HE8A 5JARA 1XTRA 5KEIA 3HV0A 4ZAVA 4C21A 1DFIA 1RVDA 5F2EA 2VCEA 3DNPA 1M2KA 3K31A 4J0JA 3X1JA 4D97A 2PZEA 5IVPA 1SU6A 2CHFA 5JJBA 5JXWA 1BE1A 1D9XA 3HA2A 1C1YA 5K0NA 5JZBA 2WIGA 4OIMA 2Y27A 3GAFA 3IPYA 3WBBA 3HJFA 3ESZA 2Q9UA 3OHMA 4AB1A 3ZV6A 3UQYS 3T3IA 1UBEA 3E1SA 2FPSA 5FHQA 2QD1A 1LD3A 3OPYI 4MQEA 4RTOA 3TR5A 4S35A 4DIFA 1E7RA 4JT8A 4CM5A 4X92A 3TPFA 2BKEA 3U9LA 3LL7A 2ZRBA 3VKWA 1H2ZA 1T0BA 3DTTA 4J03A 1P60A 2QTVA 2W00A 4HZIA 4MQFA 3ANTA 4FW8A 1YRWA 5KNDH 4GL4A 3VKGA 2IU6A 4M21A 3HXOA 3GARA 1N3IA 4REMA 3RJTA 4PG4A 1NMEA 3FZGA 1IQRA 1KR5A 3AR2A 4J0GA 5ES3A 4M8IA 5JQGF 5LVAA 3FUCA 2Q3EA 1E8NA 2ZR7A 3QPUA 3H1TA 5LQSA 2F1RA 3JTMA 3QFSA 3PQEA 1RZUA 2PBFA 2PMFA 4RA6B 3HLYA 1KWKA 3EFBA 4PG7A 1RWWA 3TEJA 4CQMA 4EKNB 3NPAA 5M34A 2QZPA 5DNEA 2BMVA 2K7ZA 3KRTA 1Z45A 4TLLB 4NOLA 5DBOA 5E1MA 2OGUA 4RZIA 2HUPA 4H1TA 5D3QA 4IDAA 1Y1KE 3ZBTA 2QBYA 4MV0A 1X9HA 4BC0A 5AUNB 3HWX1 3IPCA 4FYYA 2W11A 2OCAA 1EDEA 4TLMB 4QYSA 3UN1A 1SZJG 1R0WA 1IOVA 1BKDR 4UUMA 2PUEA 4YAIA 3M5DA 4PC6A 1L5YA 5KYNA 1A9QA 4CR8A 4PBSA 1KU6A 3T15A 1Y3CE 1XZQA 3A8TA 3N2NA 1TEHA 4V1CA 4G0OA 3UV6A 2QP4A 1UC5B 3CTMA 5ECGC 3NYRA 4HC4A 1JEDA 1FYXA 4HQRA 3NP7A 3AETB 3LCCA 2AEEA 2EFDB 4N0QA 4XWAA 3UAXA 2B5VA 5C8ZA 2XKKA 4DM4A 2PGNA 4BZWA 2PLFA 5JDCA 3KB6A 1CIJA 1JB1A 2BV3A 2O2IA 3TG2A 2EKBA 5CT8A 1JAHA 4KR9A 1MNQA 4RK1A 3W6UA 3ZWMA 2W37A 3K20A 2ET6A 1IM5A 4XFDA 2V5AA 2VF7A 3ESYA 6NULA 3UGJA 2MIIA 3L1KA 4IUBS 5KC9A 4EY7A 1UK7A 1ZY2A 3JALB 1M9NA 3HYSA 5TVKA 2IZ6A 2WMDA 2FP4B 1UZNA 1TYBE 3ORQA 2A4KA 4NFYA 1EX9A 3KQSA 1EFCA 2P0YA 1HT3A 2WAMA 5M5BA 3O4HA 3WQQA 1CJVC 4IRUB 4OSPA 3GRAA 6GPBA 1U1CA 1R8SA 2P8SA 3IO3A 4G0YA 4MVJA 1X80A 1QO7A 3H0KA 3K0HA 1N4AA 2OD7A 1RYMA 4X1IA 4KSYA 4MINA 4NU0A 5DHSA 1XLTA 3IEUA 2ZYTX 4L27A 3RV3A 1KBZA 1XF1A 2BONA 3WJAA 3C3CA 4LCBA 1HQCA 4XDHA 3C3WA 2FPIA 1EFDN 4IDOA 3VPCA 5KWIA 3UEOA 3NV7A 4AN0A 5E6SA 3RWBA 4PC1A 4ER5A 3F5DA 1MJGA 3QUSA 5A3QA 1FYWA 4FC6A 4UQPA 4XWYA 4HG2A 4ZQGA 7AT1A 4JI8B 3HB1A 1QLWA 1GR1A 2JFYA 1RAFA 3OM1A 1VG0B 2COKA 5FI1B 1Z33A 5GPBA 3DLCA 3OECA 5J1SB 3TDMA 4BNDA 1YK0A 2B5OA 2B5WA 3EXHA 2EQAA 2DOKA 3CSDA 4I8DA 1G5IA 4L15A 4EZIA 4FYXA 5K0FA 1FRVA 2G3YA 1J5XA 2MMCA 4FFBB 1L9XA 2HK9A 3DE4X 4S1TA 5DX8A 3U9SA 2I55A 5EZ6B 1YF3A 4A6XA 1DCTA 1N5MA 4GC9A 5F9FA 5FTLA 1EFPA 2ZRMA 5D6NA 3OG9A 3EPRA 3QVKA 1L7XA 2GCNA 1HYQA 3VYSB 3PGLA 4WOKA 3VKUA 2DLDA 4D6XA 2UZ4A 3ZU6A 4QG7A 4OLJA 2DTEA 1QC5B 2O0LA 3H11B 3AEZA 3AHIA 4PZPA 2RBGA 1JL3A 2Y4OA 1RYZA 2ZW9A 4AIIA 3QENA 2VUTA 4Z4QA 5FNVF 3FCUB 2EDCA 1IUKA 4MROA 1X7WB 3MPOA 3WIOA 2ODQA 2PT7A 3RF6A 4AECA 4MICA 4UBMA 3HBJA 3MWKA 2QXTA 1G3MA 1EH5A 4DV3B 5FORA 1YOVB 1BJKA 1KYYA 1P7PA 2F1KA 2OHGA 2ZKIA 4JUDX 4XDYA 5BR8B 3BGVA 4YREA 5KQLA 2XY4A 1GZ4A 3IJPA 5KQPA 1J5PA 2E1RA 3H3XA 4AJKA 2O2XA 4CBVA 2ZRKA 2I0FA 3FTQA 1K7CA 4TS1A 1WL8A 2ECKA 2WSSD 1SC3A 2PKYX 5ED4A 4TMWA 3X1KA 1SOAA 3W4KA 4DIEA 3HUFA 4DPLA 3MGBA 4X9XA 3JQCA 1W36B 4RV9A 4A15A 1NVEA 1PI3A 3UMGA 4ECEA 5D3KA 2NU9A 5CR9A 1ZZEA 1ZH6A 5HRAA 3AF0A 3I0MA 4KVZA 5TF4A 4P36A 3JQBC 3LYAA 3UHPA 4D5GA 4F8YA 2K2QB 1QH0A 1KEUA 3I8OA 1SCIA 4N3AA 3N2LA 3VI3B 5DEOA 3ZE2B 4RVCA 5I4KA 4QPCA 1NMYA 2GSWA 2ZXUA 3MLAA 4XPZA 5JSKA 4B3XA 3BMCA 4C7XA 5A2GA 3PXEA 1BVRA 3ZCUA 4Z0PA 3L40A 2Z3WA 5FUVA 2F1OA 1Q21A 3ECCA 2K87A 1DRWA 3OX4A 1BWQA 4WFQA 1VB5A 4JDUA 3ZWAA 4E03A 2HRCA 1UBUS 2C4KA 1HE8B 1SURA 2E49A 5K3EA 4HXEB 3BAFA 1Z2CA 2PUVA 1BGVA 3P9RA 5F7ZA 2Y4NA 5BSGA 3W1VA 2ZRDA 5HXAA 3OX3A 2W2NA 2VLBA 4RYDA 5L3QB 4UMFA 1L7PA 2D0PB 3EEOA 4MVYA 2A14A 1IEVA 3E9MA 3LUJA 2B20A 1GG5A 2JAUA 3EVEA 3OU6A 5H80A 5DYNA 3SBOA 4DC1A 4N39A 4TT3A 3C5CA 5A3RA 1RQLA 2A9RA 2ATXA 2ZXFA 3H65A 3OZTA 4MWGA 3ZJUA 3CX7A 4X8MA 4H4CA 3T4PA 5CVCA 3C6KA 2AXQA 4J16A 3EPKA 3F6CA 1HE1C 2AEJA 4HNUA 3ZDRA 1MX1A 1AUQA 2QL7A 2RGNA 4NPHA 5EUCA 1T1IA 4OXRA 2ZSAA 5FKJA 5CX1A 1NI4B 4OI1A 3ZCPA 3RIXA 5F35A 2CZQA 2J48A 4H60A 2W8ZA 1J7KA 2Z6VA 1YHNA 3AOEC 3HA5A 2C2ZA 1DE0A 2VG8A 3AY3A 3SX4A 3W5UA 3W6OA 2JJMA 1RXIA 1B6GA 3PGA1 3Q5DA 4UASA 3PFHA 4Y2VA 2HPZA 3TEFA 2XUIA 2D1FA 2XCLA 1VJGA 1S1MA 3KDPA 3SS7X 2XF8A 2ECPA 2WMYA 4LFCB 4EUHA 2O2JA 4IX9A 4EABA 3ZHTA 1CC1S 1B0PA 1SBCA 1ZONA 3O5AA 3QYJA 1XXHE 5ARCA 4D57A 2E4VA 2GVZC 2OBYA 4M89A 4OLAA 1HNNA 1GKUB 3DTVD 5AKGA 4LIPD 4CHTA 4EUEA 1A4XA 3IV7A 1PU2A 4N4AA 2ZE7A 3F5SA 1PD0A 4DFDA 3UJ8A 3UMJA 3BSFA 3BCRA 4ERXA 4B5LA 4MYHA 1EM6A 1M6NA 1RJ9B 2P5SA 2GR9A 4ZOLA 3O93A 5IDXA 1Z6YA 1BGWA 1SULA 1XHFA 1IRIA 2KS6A 3HKBA 3C3JA 3ORSA 4OL0A 3TOCA 4JHLA 4LZAA 4YECA 1F3OA 1UJ4A 1NFRA 5HS6A 2HD4A 4IBOA 4B3RB 3MINB 5A3VA 4BKPA 1NDHA 5FWXB 1S0UA 4K87A 1ZUHA 2C59A 4MUXA 4WNIA 5EPOA 4KPEC 3W2FA 4LSZA 3HLTA 4HB2A 1PHRA 3GT0A 2E89A 3IE2A 4MXDA 4WXEA 1R2QA 2ZBUA 4DLXA 5K4GA 1FP4B 2QBYB 3ED5A 3GQBB 3PR3A 3GC6A 3K0FA 5IHXA 3JSAA 2LRHA 2O8DA 4Q9KA 1E9SA 3SHOA 3S1LA 1P5JA 3CLTD 5DJ5A 5F73A 1XRNA 3CWQA 2BGUA 4M99A 5D86A 3SNHA 3AG6A 3MZ0A 4D3FA 2ZVPX 2IHZA 1VPTA 5EWJA 2YKGA 1K88A 2N47A 1JQ3A 1I1OA 4XGNA 4XUGB 1CZHA 4EATA 4P33A 3CH4B 2QORA 2XECA 4B3FX 1UPTA 5KJ1A 3E8XA 2JPDA 8MHTA 4D3DA 3BIOA 1OW3B 2FWJA 1U9ZA 1QNFA 3GLSA 3LC7O 1BXGB 1P44A 3KYDA 4FUTA 1OPXA 3FBWA 3JS5A 4Y6PA 2Y1DA 3LL4A 2OHOA 1X1QA 2CDAA 4K6OA 1A2QA 4C7BA 4Q1DA 2RG1A 2BP7B 1P39A 2OBMA 1G2PA 2JAQA 3B2EA 3BBPA 3UUWA 2ZIFA 4KBYA 4PC3A 5DNVA 2DKNA 3OE4A 4X1KA 3C1AA 3VSAA 4AJ4A 4CL8A 4BQEA 1LJUA 3RAEC 4QU9A 4GRAA 4WKNA 4CEHA 2Y0BA 4L74A 4A6EA 3VPXA 1NN1A 1TKCA 4BNTA 1RW4A 4K3UA 4DG9A 1P1KA 3GV0A 4BBJA 4FDLA 5IT0A 4OKNA 2V6JA 3ZE6A 1B41A 1XC7A 4TYMA 4S05A 2DLNA 1V2GA 3WJ1A 5HQJA 1ZJZA 3BJEA 1JLMA 1XDBA 5AQEA 4QM7A 3AM1A 4AQDA 3DF9A 3DAYA 1X87A 2NNLD 4Z4GA 1Y6FA 4IWXA 2GSDA 2CE7A 3FSGA 3OE5A 5KWVA 4CZ2A 4KACA 1BQ3A 2AOWA 3EWNA 2B8TA 1KAEA 2EGUA 2V65A 1M66A 4OHKA 5D51S 5EKUA 2O6HA 1TZ2A 2QAGB 2F43A 4FUQA 3ZDYB 5L4LA 3EHDA 1K27A 5TS3A 1T9AA 4EK9A 3UJHA 4D8UA 1NYLA 3LVBA 5EERA 3M6XA 4R2LA 3WJ2A 4BE9A 2WHPB 1KSGA 4CKBB 5DIFA 5C8XA 3SY8A 4MHTA 1QVWA 3GLFA 2WJAA 1PIWA 4GM0A 1Q3KA 1JLKA 4M9CA 3RVRA 3IR6A 5BQFA 1WVGA 4PE5B 3ZXIA 1XZ8A 4RDCA 4ONEA 3WKAA 1K3FA 1HMYA 5I7UA 5DGXA 3QW2A 4YJHB 1E59A 4G5RA 3OC6A 2DHCA 5GJBA 3D8TA 2UYHA 1FDSA 3SSNA 4UFNA 1B00A 1DLJA 3AKYA 4CNQA 1EDBA 2A5GA 1GQQA 4CGYA 1IXRC 3K94A 2HIAA 1TGYA 4JJ6A 2HWWA 1M2JA 2CNNA 3PFKA 4GUAA 3HHEA 3STHA 2O8EB 2OZKA 3U4MA 2A92A 4D7AA 4MQLA 5MGBA 1CB0A 2QRHA 3UATA 1U28C 1WUJS 2B3TA 2NXJA 1C9NA 3L7IA 2F4NA 3KHKA 4KQMA 1U98A 4IIXA 1NW6A 3T54A 3TQTA 3ZZMA 5B4TA 3LQKA 1PQ4A 3DL0A 3MD9A 3SLRA 1P1FA 1VL0A 2HZBA 2WM3A 4ZI7A 2O14A 1XZKA 1TFRA 4JX9A 1M5TA 1UMDA 1ZGZA 1W85A 4BZZA 1GQYA 1A9TA 1J9GA 1UANA 3G9ZA 4EPWA 4WCFC 2AG6A 1P0IA 3A3OA 4IOJA 1REQB 3E4DA 5THXA 3U3OA 1Q1QA 4WN9B 3FNGA 3VDMA 1I5RA 4ZT2A 3ZYZA 2G9QA 3LBFA 4B4WA 4D44A 5K6RA 3UWSA 2H9IA 4ROTA 1Q91A 6REQB 1RFGE 3E35A 4YNBA 2G5PA 4GEGA 4EKIA 5TB5A 1W34A 5K0JA 1R9MA 3L0IB 4JVNA 2LUOA 2RJOA 1CJKC 5T4HA 4K05A 3DL7A 3OLVA 5HF5A 3HB0A 3WL8A 4HH1A 2O8CB 3MXTA 3STTA 4FYKA 4DXDA 2Z2JA 2J09A 3QG1A 3SR4A 2WVJA 3JQGA 4YCSA 4RKYA 1QAQA 2NTVA 3DZDA 4YO8A 3PUVA 2BZGA 1KY4A 1KMQA 4FSXA 1L4LA 1CV2A 4ZO4A 3NYIA 2HB6A 3OU7A 2D8MA 3G13A 1Z0AA 1I33A 4Y0NA 4R4JA 1S2MA 1C7IA 1MB4A 1M10A 2REQA 3IL2A 3DFMA 4YMLA 1EG2A 1QRUA 1D2AA 3TL3A 3IRVA 4O1HA 5MFZA 1PUXA 1KAQA 1EFHA 2NV0A 5TMDA 3WGJA 2I1QA 5AW9A 3W1WA 1F1BA 4Z4EA 4E5UA 4YXWA 2HK7A 3B20A 2JFPA 2OXCA 5AVZA 4CM4A 1LDNA 3G0DA 1PZHA 3JWHA 2PKWA 4JITA 1LRLA 2IPAB 5ICCA 2GPBA 2VWGA 4KCGA 3R7AA 2JKVA 1J33A 2VIIA 1K1EA 2RDMA 1D2NA 2W90A 4YP5A 3K35A 4YRTA 4DS3A 7REQA 3A6LA 3TGLA 4DUPA 1Z8DA 2WD9A 2WJGA 5K03A 3Q3CA 1G5RA 3RFTA 4H59A 3TLGA 1J07A 1TZCA 3FDXA 2FE4A 5DN9A 4NCKA 1IK4A 3ZH2A 4HZUA 1P3Y1 1XCOA 2J6IA 2GYWA 3P9QA 4G8DA 5KS2A 4K2HA 4OB7A 5AM1A 2HADA 3LSYA 1M6YA 1EK6A 2ZIXB 4JUCA 2NO1A 3I23A 2PMDA 1XNGA 1Z6TA 4R8LA 5EMLA 1KY3A 3EQ8A 4H3VA 2HT1A 1T6ZA 4WECA 5KWEA 2IBSA 2OCDA 1J1IA 4OGGA 5JJKA 2CE2X 2HJ9A 3VBEA 4QULA 4PY2A 2WQ6A 1PW7A 2H2HA 2ZB7A 4DXHA 3AV3A 3OLZA 2C96A 1N33B 1AM4D 1QGDA 1UEIA 4KMRA 4ZHSA 2GS9A 4QL3A 1R6TA 5JS1A 4AC9A 4AMYA 3MT9A 4ER0A 2XQGA 1OYWA 1THTA 2CUZA 1VCOA 2BFBB 2OP0A 2RGBA 3Q2IA 5HF8A 3RHFA 5DM60 2Z1NA 3NWPA 3LTEA 4RSRA 3S2SA 4R01A 1Y0BA 4LBYA 4ZI5A 4HX9A 4KR3A 1D04A 3C8UA 4GXQA 4YXWD 1O57A 2VTEA 3I09A 2QT9A 3SJZA 1L1FA 4MV1A 2J3LA 1GEGA 3B52X 3FNHA 5CH5A 3AERB 3UV7A 1C7ZA 1J4AA 1Y42X 3KKQA 3R23A 3MEQA 4IGIA 4W1QA 4OU5A 1JHQA 4XM0A 1Q17A 4OKIA 2IGBA 1AMNA 3WFIA 5JRDS 2ZTMA 4CF6A 4KDRA 1RWXA 3DAPA 2QB5A 3LHKA 3NHWA 3Q9LA 5D6OA 5C8YF 1GSIA 2GEBA 1Z35A 1RPNA 4TMTA 1AT1A 4UTOA 2QTTA 3RRXA 1PGQA 3DYIA 3E0XA 3HHPA 4B3BA 2PBZA 1P72A 3GB9A 1K63A 3H04A 4PQYA 3L84A 2HQBA 1FFCA 3FMOB 5C5DA 1ZEMA 4GDMA 1JR2A 3I76A 3GH1A 4M8NE 1LX7A 1WXHA 2GAAA 3DUFA 4XEHA 1JR4A 4TSKA 3UPUA 5HIJA 3BD7A 4CFSA 3WK9A 3H4MA 2R79A 1U3VA 1VECA 4Z1MD 1QRDA 4AJHA 3GZNA 4D3ZA 2Z6QA 5FBQB 3HBFA 3RUPA 3K05A 4JOBA 3VDXA 4D9CA 3NGLA 3ULKA 4DV6B 1FCJA 4AZ3A 2XE7A 3S2ZA 4DQ0A 1IN7A 1JE1A 3LFHA 1PQYA 4P7KA 4JJ4A 4R41A 4D42A 3Q1LA 4U6SA 2DGDA 1EM8A 1KETA 5KYXA 1P2SA 4DV0B 3GEHA 8LDHA 2Q6IA 1CQIA 5LN1A 5GZ1A 4B47A 4O4IB 1ML3A 1DC3A 2O8FB 1XCBA 2RKBA 3A3KA 2JA1A 4MNTA 4CIXA 4WZZA 3FOCA 3PHJA 3D3KA 3G2KA 3T12A 5EJ4A 3EPJA 4BJ6A 3I92A 4AZTA 5LMUB 1I4TD 3AWIA 3OIYA 2WFLA 3H87A 3AZOA 3TI9A 2CXNA 1EUQA 3S28A 2WWIA 1RQPA 2VUIB 4G5GA 3E5HA 2FWIA 4KQ6A 2A9FA 2AW3A 2PGIA 5A03A 2X8JB 5DTQA 2YWDA 4IDDA 4LN1A 4BGUA 3LPDA 1FNNA 3MK31 1XNJA 4NENA 3GFGA 4LXHA 5EYPB 3S8MA 4RY8A 4B48A 2C4UA 1FXWA 2R1TA 2JLAA 3P0HA 4AY4A 2VPQA 4A8JC 4B4UA 4RGBA 3COVA 3FGOA 2GVDC 2VNIA 4XM1A 5AVJA 4AQ7A 2I7CA 2P7IA 2Y2VA 2P7HA 5G0SA 3V4RA 1KPIA 5DCWA 5ABPA 2IVZA 1NLFA 3KALA 3PDWA 4GPTA 3L4BA 4BGVA 2HA6A 3DBVO 4OQPA 1MJHA 3L6BA 2J3JA 5EP2A 4FFNA 2AJBA 5A6SB 4ALJA 4NIMA 4EB0A 4FJ1A 1KVUA 1FTSA 3DP9A 4JSTA 4QJ3A 1IQ0A 1Q0RA 1JJ7A 5K7SA 4DKXA 1J8YF 3RUEA 5AVTA 4ZANA 2JGDA 3GFTA 4F5YA 1KS9A 1GGHA 5LQNA 3N8GA 1QB7A 1RRGA 1WB5A 1XRMA 2A5YB 3ZQUA 3ZD6A 4GUDA 1Z7GA 4E12A 3PC8A 2CVQA 1LK0A 2C04A 4ENPA 4CFYA 4LFBB 1GT6A 4JT9A 2GWRA 4WNYA 2HJVA 4BC1A 4DWOA 1K5DA 1K6IA 2XTAA 2N0SA 1WB4A 4J76A 3W5CA 2AXPA 1K4KA 1R5JA 1T8RA 3EC7A 3J7AC 1OXKB 5LPNA 2XVYA 4ZCQA 1UP6A 5EJ2A 5IN5A 1LH0A 2PMCA 3DNMA 3H5IA 1G1MA 3EBPA 3SYNA 1DC6A 4YQEA 3SC3A 1MB3A 4MW5A 5IS2A 5ENVA 2WTAA 1WMEA 5AW7A 1Q1NA 1VTKA 1W94A 2ID4A 2Y71A 2YFQA 4QPPA 1YB6A 4XQEA 2JI4A 3EWSA 4DCMA 3SC2B 4JBXA 3QWBA 4RTJA 1TTHA 1E4OA 2NSDA 3SFVA 2IDMA 4QEDA 2JI7A 4IINA 4ZOEA 4CV0A 4G5HA 1G4HA 2JRCA 2VSNA 1GZVA 4LGVA 5K51A 1Q0LA 1UQUA 3FDFA 4EGFA 4XFKA 1SMKA 1Z0ZA 3HP1A 3SEQA 9GPBA 1D5CA 4Y7DA 4TLBA 1K0UA 2MR6A 3E2IA 2MSDB 3ICWA 4WK0B 1YB2A 3DGFC 4GLBA 1LQUA 5A5EA 2WIFA 2X4IA 4JOCA 4CQLA 2ZZNA 1OV6A 3LQYA 4AG5A 1WULS 1MOSA 4I2NA 1JAXA 1L4BA 2WZCA 2FEAA 3OJWA 2AOUB 4IOLA 3IUMA 4UUPA 3RYTC 1YVPA 2F1JA 3HMQA 2HHAA 3OMXA 4YRPA 1L4UA 1ILWA 5A5VA 3D1VA 1UEJA 1KDYA 3VHRA 3R40A 3GNQA 3LPAA 3GG9A 4XQGA 4GM4A 3VU9B 4RUKA 4BBZA 1V1MB 1IJEA 3DDWA 4FMDF 4YRBA 4YONB 4EUSA 5BV1A 5LR6A 3RVNA 1CFZA 3NNDA 1FIUA 3GZ4A 2BRUA 3QELB 4OBWA 1G20B 2Z2YA 2Z2IA 1CP3A 1F2UB 3IHTA 4U5XA 2C4TA 1A4IA 1PF7E 3D6MA 3EAFA 1W7AA 1U7OA 1JWLA 3K16A 1LPMA 3LF2A 5FPPA 4MEAA 5BSUA 4JOSA 1DQPA 4UARA 4CT4B 4Z3OA 3G02A 1P61B 4GX5A 1PBNA 1ZNWA 3V1YA 4E5KA 5JECA 3BXEA 3USCS 3FCXA 3PEUA 2XXAA 1HRKA 3RVSA 3FVQA 4ES6A 2WYOA 1XZNA 4JQYA 4GBGA 4LE2A 3IUYA 4B7AA 4F6CA 3COZA 2X0JA 2VZ8A 2VNSA 2YQZA 3GPIA 3ND6A 2OOKA 3C85A 1X86B 3OD5A 4GGPA 3DQQA 4GECA 4V03A 4ER6A 4RJTA 5K99A 3ZU2A 5J4YA 2NW6A 4Y6SA 2IHNA 1ZRHA 4RF3A 3VKFA 2P9ZA 4M1MA 2QTVB 3QU2A 3IQXA 3ZGVA 3VR6A 1A5BB 2E4YA 2WINI 4DB2A 2EAUA 4NF2A 5INTA 3L6RA 2JCXA 5HF6A 2JGLA 5A7GA 1QHNA 3C7TA 1A8PA 3FUXA 4KLRA 4DIMA 1OFTA 2I7XA 2ZSUA 1JLLB 1P74A 3IJ5A 5EPUA 121PA 1QU3A 3L7NA 1NPDA 4RFLA 3FNRA 3GCZA 2MWMA 3OX2A 1EFKA 4KGXA 1F9EA 3TSOA 4E1AA 1QKKA 3S99A 1X8LA 1U8AA 2J0SA 1X14A 2PUWA 4LGCA 5KOJB 5E8RA 4IIGA 3TZKA 4JD5A 4AZ0B 4DM3A 3QFCA 3ZXUB 1XT6A 5JAUA 2X5XA 3K4QA 5E95A 4XX0B 2QRPA 3O94A 4KQJA 3U0VA 3CSSA 4O4HF 2P9EA 3CKLA 2OCYC 3G0GA 3H9EO 3QKIA 4QQFA 2QE7A 4S1WA 2CXPA 1ZC4A 3DP7A 3ZE1B 3WGNA 1CVLA 3V7NA 4R68A 4N6GA 2ONYA 3I1FA 5ENDA 4XCQA 3CJQA 4YUAA 1LPOA 2IYWA 3P2YA 5HTKA 4JI6B 2BEUB 2E6UX 3NORA 2F9FA 1VSBA 4XSHA 3D8NA 1IZ7A 1Z06A 2RAUA 2VZLA 2VJPA 3H05A 1Y3HA 3ANMA 4QRIA 4BLSA 4Z7JA 3C3DA 3N3BC 5BMVB 3ZK7A 1G8YA 3DL2A 4ZD6A 4FLMA 4HNSA 4K6KA 1TT5B 4L9AA 2ZSFA 4DDVA 4RD1A 5JH7F 4QDZA 3QOWA 2BGKA 1V16B 2XQKA 1YDFA 4KX5A 5AI0A 1NXOA 1BHO1 1JLSA 4CCAA 1TTTA 3BL8A 3PXCX 5JALA 1QH8A 3S2IA 3LV8A 2C57A 2H1CA 4BX8A 2GBLA 3K53A 1T6BY 1M8KA 1BN6A 1ULBA 3HRKA 2ZDQA 3F97A 1K97A 3E7XA 3N9IA 3ND8A 4HDRA 1E61A 4IO0A 4WOPA 1QIDA 4ZEOA 2HGSA 3LC1O 1E64A 1QHFA 1ZH8A 2MYUA 3DBHA 3ZEAA 1Y8RB 5JAMA 1XKTA 3IA2A 4II7A 4WK2B 1L7EA 4MP8A 2PYDA 3GNSA 1E1MA 5FR1A 2VKTA 1UMBA 2Q7OE 2HR1A 1Q7CA 3QX3A 2ALJA 3L4KA 1KWGA 3DUFB 1Q1EA 3KXPA 3D43A 2I3AA 2ZJ6A 1E1DA 2I4TA 1KMNA 3EARA 4TQUS 4A0FA 1U7WA 4B6PA 2OZEA 1Q16A 4TV8B 1LPBB 4M49A 3ZIDA 4QGHA 2EXXA 2K2WA 4QVGA 3LHDA 2R0QC 2V9PA 3STYA 1MJFA 4XSGA 1AVTA 2OG2A 3WSWA 3KTOA 2LTAA 2BHNA 2ZSEA 2YHIB 2AN3A 3SHFA 3URMA 2J67A 2RH4A 3IOCA 3O9MA 4B32A 1EDZA 2FMKA 3UPDA 2PX3A 5EJFA 1OLUA 1TU3A 3QMVA 3RO7A 1ETUA 4BNDB 2JG3A 1QGED 4DLYA 3RAGA 2A3NA 2RCNA 1OPRA 5JD5A 2P4HX 3H5WA 4BFTA 4I1VA 3R0ZA 1JDZA 1AGNA 1I30A 1KXZA 2FN3A 3BHIA 2VSQA 1Z5NA 1N5IA 4YI5A 1NL3A 3PD7A 1CXZA 1YJ5A 2Q99A 2VHCA 4OHZA 3GELA 5D7BA 4ODIA 3S2GA 3OOJA 4OMDA 2RHWA 3L6EA 5DHRA 5G4KB 4F92B 3RC9A 3FOZA 2C3PA 2D3TA 1C3LA 1JHAA 1N2IA 1RQGA 2X8JA 3KBBA 1LC0A 3MSCA 1YIOA 4OH7A 5DBIA 5ALGA 1QC5A 3H11A 5LM3A 3OMWA 5EYPA 1QVVA 4LDZA 5CDUA 1XI2A 2FKNA 1T9DA 1PS9A 1TU0A 1YE3A 1XRQA 5U4QA 1QDUA 3LBHA 2D1QA 1ND6A 3T99A 5EJGA 2ZIVB 1CY4A 1VCHA 2EJCA 4L0QA 3ABQB 1BD4A 4KL8S 3ISVA 3CW2A 1SO8A 4D9IA 5BNTA 1E99A 1Y98A 1CWUA 4E21A 3SAJA 5IXJA 1ZINA 3CUSA 3BD9A 4PO1A 4D92A 4R6XA 4LJRA 4ZICA 3ICOA 1H4QA 4B4OA 4ZN6A 1ULTA 1P5HA 1ZW6A 2B36A 4OQMA 3A4NA 4RIHA 5AHOA 4ZAGA 5UKDA 3SFZA 4OGKA 3CBGA 2DQKA 3C3BA 4KIJA 3A27A 4WCFA 2HHHB 2VOJA 1NX9A 4FFOA 4YMWA 1Z12A 4DUYB 1JKJA 2V7QA 4P3OA 5CBKA 3QUCA 2P3OA 4RHCA 1P8AA 2ZBVA 3OZVA 3G2HA 5BOVA 4CXMA 1IWOA 2FU5C 1ECLA 3I30X 1G8AA 2JGAA 3CNLA 1Y4AE 3IPLA 4FYPA 4F97A 3HJTA 1U7HA 4OF4A 4ZA2A 2B61A 1XL1A 3ZHRA 2O0HA 1NW4A 1E62A 2P2CA 4R69A 4Q4AB 5AJHA 2H00A 4E4TA 1Z18A 5DT2A 1AQNA 3H5LA 4ETWA 3FTFA 1O6ZA 4E5VA 1YQTA 1IFXA 3UGTA 4RD3A 1U3WA 2FYTA 2VHEA 5JXGA 2CB0A 5L45A 5H4GA 1FVFA 3FPHA 4BYMA 3IYLW 4OQNA 3ACDA 4JVSB 4ZVOA 2P78A 5DCUA 2GPAA 1XQ9A 1AN0A 1DEHA 5EG5A 4JI1B 1Y6JA 2WQZA 3W8NA 5MF6A 1JECA 1XTQA 1GEEA 4MGYR 1LCIA 4OQLA 3A1SA 5K2OA 2QIPA 5F23A 4DR1B 4UAGA 2HMYB 2ZRFA 4R7ZA 3CA8A 2ONCA 4L3OA 1KO7A 3WMGA 2OILA 2BM1A 4ARUA 3R7DA 3BKXA 3EQ2A 4MW9A 4BXOB 5JSZA 1SQGA 5F98A 3PIRA 2YZ2A 1HTBA 2BGLA 2GZDA 3OESA 3AO0B 1LKZA 2V0CA 3FIJA 4QOEA 4AJJA 4AAYA 4TL6A 1A9SA 4C0QC 5C7IO 1OFHA 2ZYSA 4LY9A 1OI2A 1B26A 2RIPA 1SC4A 2J9XB 1C2YA 2VSYA 4U4AA 2CXSA 4N3NA 2IU3A 1USUA 5CX1B 3IVAA 3V33A 2BKLA 4L02A 1MJ5A 2MT9A 1O6BA 2FG5A 4WE3A 2B9EA 4LBWA 1PS0A 2QMOA 3UMCA