4M49A

Lactate dehydrogenase a in complex with a substituted pyrazine inhibitor compound 18
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of 2-amino-5-aryl-pyrazines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m49A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m49A02
1VJ1A 2BKAA 5ER6A 2CVOA 1PJ4A 4CLXA 1SO8A 6LDHA 3JQ7B 4PRKA 1BTOA 3TF5A 1PU2A 3A4VA 4ALIA 4CL8A 3KBOA 5BR7A 4GX1A 1ULUA 3EMKA 4AJOA 3G49A 5I9LA 4J4HA 2GUGA 4FB5A 3N58A 3PJGA 4N5LA 2OP1A 1NQTA 4JNKA 1I3NA 3HDYA 2EF1A 4R9RA 2HMUA 1N8KA 2DPHA 3NTRA 3DOOA 3ON5A 2WWRA 5L7TA 3WNVA 3BMOA 5COAA 3UXYA 5A5EA 2I66A 1CETA 3U5TA 1DIAA 1ZJZA 1DFHA 1WWKA 3K2EA 1D8AA 1F8FA 4OIMA 1YWGO 3GA0A 4YRDA 5JXWA 2Z1NA 2BI7A 3RUEA 3IQDB 1A72A 4J1NA 2Q99A 1DLJA 2AQHA 3DWFA 1BSVA 3TZCA 4CM7A 2R2GA 5DBGA 4H15A 3W6ZA 2IEBA 3DB2A 2YQ4A 3OQ6A 4LCEA 4W4TA 2CFCA 2X6TA 3OA0A 5JDCC 4AJIA 2C5EA 1GAEO 3OJEA 4JP2A 4QX6A 3K92A 1NWHA 3ROMA 1ZK0A 2CDCA 3WYCA 4DREA 5JMPA 4BNZA 5EMHA 4Z6KA 4KZPA 4XGIA 4UVHA 2X0NA 1BXGB 3ITDA 5L95A 3QWFA 3D1LA 3DTTA 2J3JA 3FCOA 1D7OA 3GVPA 2VHVA 4XRGA 4J7CA 1H6BA 1I0ZA 2R00C 1LDEA 5THKA 3DFZA 1ADGA 1DOHA 4I5FA 2YHUA 4GX2A 4NBRA 1YBMA 4D45A 4DGSA 4OHUA 5L53A 2C07A 4JQCA 5CP8A 1G0NA 1R6DA 4OL9A 1DHRA 2J8ZA 3TDKA 1EK5A 3WDSA 4BMNA 1O5IA 5JLAA 1LQUA 2YV1A 3DR3A 4W7IA 1KVUA 1PGJA 1EQ2A 2DBZA 4PLZA 4CLDA 4XIYA 5JE8A 2IXAA 1NAIA 1PL7A 3AU9A 3EZYA 5THQA 4XB1A 4TKMA 5KWEA 2HSDA 2PNFA 4IXWA 1PL8A 4INAA 3NRCA 4BO3A 4OXKA 2DFVA 2ZCVA 5L51A 1Q0LA 4B4WA 1P45A 3WYEA 3GPDG 5AQ1A 3TSCA 2NACA 1GFSA 5I7VA 5CDYA 2WEKA 3WLFA 2VRCD 1H2HA 1MFPA 4Y6SA 1R4NA 2RHRA 3C85A 4MIYA 2NADA 1ENYA 3KXDA 1MP0A 1R15A 1NHWA 4K9DA 1WPQA 4A27A 2IE0A 3GQVA 3M1AA 4KTVE 1JLLA 1KC1A 1FMCA 2B83A 4PCVA 3PTZA 4GX0A 5DNAA 2PLAA 4HFRA 3PWSA 2O7SA 4OXYA 5L3ZA 4JXKA 3F46A 4PG8A 2G5CA 1BHSA 4BVAA 3E18A 1KBZA 2VN8A 3ANMA 1TXGA 4LRTB 1PJCA 4N18A 3N74A 2E37A 5FYDA 5H83A 4BV9A 4DMLA 5HTOA 3DOCA 3T4EA 3L9WA 1NVTA 2W98A 1CEQA 1BRMA 4AJHA 4E5YA 4YRBA 3WGQA 4KQWA 4WCDA 3DXFA 3V2UA 4A03A 1I8TA 4BNHA 2O3UA 5KTKA 4WKGA 1Q7BA 3AY6A 4GPD1 3PXXA 5G2OA 5L7YA 3BTVA 2AQIA 1T2CA 3RCBA 3TRIA 4YJGA 1Y8QA 4BO1A 1YONA 3ZHXA 5ICSA 1P3DA 1E1KA 1V0JA 1W4ZA 1ZXBA 1M2WA 1EK6A 2NVUB 1EVJA 4XDYA 4Y98A 4YAJA 2B35A 5ITWA 4XYGA 1CF2O 4HADA 4JN6B 1NFRA 4BO4A 3KSDO 3FTNA 3HADA 3PYMA 1PJBA 1MB4A 1T25A 3L6DA 1ISFA 3NEPX 1PEDA 4S1VA 3H5NA 1R4MB 3OHSX 1LSOA 4LGVA 2AA3A 5JDIA 4MP3A 3ZZNA 2VZ8A 4CUZA 4NBTA 3E9MA 3FTPA 1Y1PA 4LRSB 3STHA 4F45A 3VVCA 4MPDA 2Q1UA 4PLPA 3HZZA 2Y0CA 3UH1A 2VZ0A 1O94A 3BTOA 3PFWO 3RBXA 1JW9B 3ULKA 3ADOA 1BWSA 3H9GA 1ZUD1 3GRKA 2O48X 2CZCA 3D5QA 4OQYA 1P1RA 4YDRA 3F4BA 3GEMA 4UUNA 5ILGA 3EC7A 1E3LA 1V3UA 1JQBA 3GT0A 1JKFA 4UEJA 4CMIA 4I08A 4TWRA 1NASA 1U2DA 4HFJA 1U3TA 3GFGA 3UCFA 4WUVA 4LVCA 1P1FA 4L4RA 3TNLA 3U4CA 1XG5A 5T64A 1LU9A 1MC4A 4U8GA 1PJLA 1LTHR 3KLPX 2DBVO 1Q0QA 3S1LA 4Q3AA 4EEZA 1G6KA 1UXIA 2VYND 2J3IA 1KERA 3L4BC 4WASA 1T4BA 1DLIA 1YE3A 2B0JA 4DIBA 1SAYA 3TWOA 1PZEA 2W2KA 2VYVA 4DLLA 4TMFA 1E3EA 4DQVA 2NV6A 1EBUA 3DOJA 4LSMA 4BOYA 1C1DA 1S7CA 1U5AA 1P1HA 5G0SA 1AHIA 1XU9A 1WZEA 1AN9A 1HF3A 3GVXA 3IP1A 4DIOA 4UAGA 4CLRB 2O50A 2BFPA 2VRBA 4KQXA 1GPDG 4WNIA 3AI1A 1HT0A 4E5MA 2FSSA 1ADFA 1EVZA 3OEYA 4BS9A 4CMBA 2XOXA 1LX6A 3CZRA 3ZU3A 3AJRA 3ZN2A 3IC5A 2Q46A 2WYWA 2X9VA 5CAEA 2WYVA 3JQ8A 3SVTA 1XKQA 2LDXA 4RVSA 3F5QA 3DAFA 1VJTA 4R41A 3QHAA 1M6HA 3RD5A 4FJ2A 3JQAB 2CY0A 1UDAA 4YJFB 4DLAA 5KOIA 1YDEA 2BF7A 1Q1NA 4MKXA 1U28A 2PKQO 4Z0HO 1K2WA 4NMHA 5T57A 4CM8A 2ZJ1A 1XYGA 3RVDA 2E82A 1PQWA 2NU9A 1ZIDA 5A04A 4ZU3A 1MUUA 1S6YA 4I9NA 3JYNA 4BL5A 1HYEA 1YBAA 1XLTA 1HWYA 4YYZA 1U7TA 4I5GA 4B7CA 1KC3A 3F1LA 8ADHA 4FD3A 2VTDA 1B3RA 1DB3A 2FOIA 4A0SA 3FR8A 4TRMA 2GR9A 2QYSA 3JSAA 3AM5A 1AXEA 2QZ9A 2V6GA 2ZYAA 4K6FA 2OORA 4Q39A 4CMEA 3ASVA 5IN4A 1NNUA 3AFMA 2A4KA 3ZNNA 3KM0A 1YQDA 3R0IA 3AWDA 2X9GA 2AMFA 2YFQA 3ZWBA 3ROQA 1LSUA 1WXDA 2GD1O 3C24A 3F4LA 2NLOA 2NTJA 4XWYA 1LDBA 5EIOA 3A9WA 1N1EA 2EHDA 1Z7BA 3GAFA 1B0AA 1DC3A 3H4VA 4ZQGA 4ALJA 2P9EA 3B20A 3W8DA 1DO8A 3RC1A 5T8KA 3NDRA 2C20A 5F1PA 1HETA 3GEDA 1UDCA 3DONA 3EW7A 4G5HA 2HLPA 3RIHA 4D42A 3S2GA 1YDWA 2BD0A 4J2HA 1IB6A 2O4CA 4WCFC 3RASA 1N9GB 4YPOA 1ZZEA 4IDFA 2EWMA 2VWQA 3PJDA 3CE6A 3FBTA 1L1FA 3M2TA 2YQ5A 1WDLA 1PJSA 2V65A 1I33A 3ANNA 4ITUA 3B70A 2JD1A 3GY0A 2O3TA 4JIGA 4YXFA 4IJUA 4B8ZA 2E6UX 5H82A 4PIVA 1GQYA 2QW8A 3GHHA 2ZQZA 3G1TA 5TGDA 4MVJI 4TVBA 3WYBA 1SZJG 3K9QO 3OIDA 3UKOA 1JKJA 1DJQA 2Q45A 4CV3A 2Q2VA 3QVOA 1NP3A 5TC4A 2P91A 1JKIA 3LC2O 4B4VA 1YB1A 2FR1A 3GZNB 4OYRA 3Q3CA 1NYTA 2HMWA 1Z74A 3N7UA 4R01A 3DZKA 1B15A 1P77A 5DP2A 4YT2A 1EMDA 4NBWA 5ILOA 2JAPA 3E8XA 1Z73A 4JX8A 4PG5A 5EL0A 4B79A 2GASA 3ICCA 3GEGA 3D7LA 1YGYA 3WGHA 4II2A 3W8FA 5KVCA 1T26A 2DKNA 4JJFA 1NM5A 2O2YA 3A1NA 3SEFA 1XGKA 3RKUA 3EK2A 3CKYA 3GVIA 3ZHYA 3PLNA 4IMRA 2G82A 2NM0A 1R0KA 3Q1LA 5TT1A 4NI5A 3QIVA 1QV7A 1DIBA 4CM6A 3ASUA 1LBEA 3UN1A 3KYCB 2HK8A 4YVFA 3WFJA 4UULA 3WGOA 3LLSA 2DTEA 3QWHA 1MG0A 3AUAA 3JD2A 3PEFA 3ZI0A 4RDIA 1T2FA 4X54A 4L0QA 4U5QA 3HQ4O 4IS2A 5HS6A 4B8WA 3WG9A 1LRLA 2I76A 2WYUA 3OECA 1E3WB 1DRUA 4TRJA 1PGQA 3L77A 4JP3A 3IKTA 2CF6A 4J16A 2HO5A 3QVSA 5J23A 3GGPA 2PZLA 1EVIA 3JYQA 1W0CA 4IGFA 2HK7A 1OBFO 3EAGA 3RI3A 5JCJD 4BNGA 5BSEA 4B3IA 5L4LA 1YH3A 4XJSA 1ZCJA 3V1UA 3GN2A 2C54A 3HDQA 1EFKA 1NAHA 4RCVA 2B5VA 1EE9A 4GSKA 2BLLA 3FRJA 3KLMX 2FY8A 3GK3A 4QSMA 2OBYA 4LISA 3RUFA 1X7DA 4R5MA 3PLRA 1VL8A 1NWCA 1F17A 1PS8A 2NVUA 2PK3A 3QP9A 2QRLA 3PFFA 5L4SA 2HUNA 4MJLA 4YJDA 3RUDA 3U62A 1F0YA 1C0PA 3VOSA 3W8EA 9LDTA 2HCTA 3DHYA 3O4RA 1Y8QB 5A3VA 1SOWA 2NTNA 3DBHA 4YT8A 3PZBA 3C3XA 3WIEA 4J3FA 4EJ6A 5JC1A 5CDTA 4DL9A 1YL7A 2VNAA 1EDOA 3OP4A 1K5HA 3TFQA 5KNLA 2IEDA 4QEDA 2D4AA 4J9VA 5JPIA 5K6AC 2FR0A 1N5DA 3QJ5A 3IIEA 5U4QA 4GI2A 5B12A 1JWAB 2XXBA 1K3TA 2EV9A 5L45A 2NQTA 4IQ0A 5CPFA 3KUXA 3ENNA 5I8WA 4AJ2A 1Z6ZA 2OBNA 1HE5A 2X1HA 4DXHA 1B8UA 3KYDB 2RCYA 4D7AA 4LCJA 4AJKA 4MP8A 4BKOA 2RH4A 1X1TA 5BNIA 3VPFA 1ZNQO 2HQ1A 2VWHA 4IIUA 2DBQA 3IUSA 4NU6A 5IZCA 2Y99A 5EN4A 4E30A 2EKPA 2J3KA 1I2BA 2NVBA 5DOVA 1ISGA 4KTTE 3K96A 5DBFA 3GNTA 2EKQA 4J1SA 4GH5A 3O03A 4HWKA 3WS7A 3HB4X 3PI7A 2BRUA 4FFPA 4FIZA 4RL6A 4CMIB 2A92A 3U4DA 1WAMA 4GBJA 3I9JA 3FI9A 4IQGA 1MX3A 1SMKA 2FZEA 2Q2WA 4WOJA 4A10A 1MLDA 1H6CA 4ALLA 5TRTA 3VPHA 4KUGA 2FP4A 1YS4A 2OGUA 3RKRA 5JS6A 4U7WA 4XQ9A 3U3XA 5F5LA 2Y68A 1ONNA 2EERA 1Y9EA 2Q1WA 2W2KB 2DAPA 3RUAA 3HFSA 4Z9FA 5FI5A 3KV3O 5TT0A 3OQBA 1K6JA 5MGBA 1PJQA 5BT9A 3HNPA 4WECA 4PG7A 1A7AA 1FDUA 4TZTA 1N7GA 3RBZA 4CM3A 1BDMA 2VNSA 4RPKA 3TL3A 4UEOA 4IINA 2DPGA 1X7GA 2V6BA 4NIMA 4J2OA 2YV3A 2JCYA 3P2YA 4RF5A 3JQEA 1WDMA 2PKRA 4XZ3A 1CERA 2PZJA 3DZHA 1XDWA 3JD3A 5K9ZA 1I5RA 2I99A 3JQAA 1GQQA 2FMUA 5JAZA 3DL2A 2VHXA 1IHYA 3EY4A 5C7IO 4GLLA 3JQ8B 1H6DA 4ZA2A 3WGTA 1U4SA 3JQ9A 1NVGA 3L6OO 3W4IA 4MOWA 1E5QA 2IZZA 3V8BA 1P44A 1ZJYA 1K6XA 5G0WA 4GVLA 3WXBA 4OM8A 1ZBQA 3ZWXA 1YQXA 3JQFA 4GWGA 4IDBA 4PG4A 4QO7A 4DTIA 4YAGA 1IPFA 1A27A 3IDSA 4DC1A 1OFGA 5LDHA 2W2LA 4CM8B 3FHLA 1XEAA 4BIIA 2QX7A 2DLDA 4GMFA 3U4IA 4NZ9A 4F46A 3TPCA 4J7XA 4KUHA 4UUOA 4GLOA 3A06A 2A9FA 2BGLA 2HDHA 3VZQA 4FFLA 5DZSA 1QLJA 1PX0A 2DM6A 3QVTA 2ZATA 2X23A 5KCZA 4D3FA 1VI2A 2RAFA 4RPHA 1E7MA 5EPOA 1PWZA 4I9HA 1T1RA 3ZWWA 3MJTA 4QFDA 1QYCA 1PL6A 1P1JA 3E6AA 1M66A 4LN1A 2NU8A 1Y8RB 1MGOA 1RM3A 3E5MA 4ZQBA 4D3SA 2G1UA 2B37A 1VKNA 4F3YA 1WW8A 3PP8A 1PJTA 3H5AA 2F00A 2ZTUA 2EW8A 1YVEI 3AOEA 1JDJA 5DF1A 2EG9A 4XQGA 3NTQA 4MVJD 3MWEB 3VTFA 1ML3A 4IIVA 4OH1A 3IAHA 4XX0A 1D4FA 4BO6A 3OM9A 3PQFA 1GYQA 1IL0A 1NPYA 1R0SA 4CQMD 1GDHA 1N9GA 3VVBA 1QG6A 1U2GA 3V2HA 3SC6A 5JMWA 2GN4A 2JHGA 1MG5A 3UVEA 4HX5A 2ZB4A 1ONPA 3KVOA 3SBOA 3T7CA 3GAZA 4XA8A 5DT9A 4GGOA 1P9LA 1PR3A 3H2ZA 1RM0A 4QT0A 4M86A 2PZMA 5L9AA 1SB9A 3JCZA 1XHLA 3AK4A 4CR7A 3FN4A 3RU9A 3PIIA 1CWUA 2GN9A 3OJOA 5A5FA 4E5NA 1DFIA 1PQPA 1E6EA 2FHSA 2FSVA 2J6IA 2H63A 2UV8A 1U8FO 4FDAA 3BHIA 1KOLA 3ADPA 1P31A 2I5PO 3L6EA 4GVXA 1HKUA 4BNTA 4UVEA 4H16A 4RVUA 4W9NC 2XPCA 4D43A 1NR7A 3GZNA 3JYLA 4BO5A 4WLOA 4UEKA 4DYVA 3AI2A 4IGEA 3GRPA 4ZVVA 4O59O 1QYXA 3AUTA 3CZMA 3RFTA 3DMTC 1Q0HA 5ER9A 3VKVA 3BHMA 2W4QA 4YAEA 2WD8A 3T7EA 2HMVA 2EIHA 4L4XA 4U6SA 3RC7A 4AL4A 2JD0A 3I4CA 5CEFA 3WWZA 1TVEA 5IDQA 1GD1O 4BNUA 1O0SA 1T2AA 3G3EA 1G0OA 3IP3A 3ZV6A 3U4HA 1XQ6A 1I2ZA 3ROPA 1HZJA 4GKBA 3H5RA 1RYEA 4UUPA 2CDAA 1ZEJA 4Y8VA 2PH5A 2VQ3A 1MC5A 1XIVA 3E9NA 1PGNA 1UXKA 3KYCA 4BV8A 2X86A 2QG4A 4R1TA 3OJFA 1IUKA 3DAGA 1YJ8A 1ZMOA 5JSFA 3TZKA 2BHLA 5ES3A 4ZD6A 2I65A 1VL6A 3KETA 4M55A 4WEOA 3I5MA 1E3WA 4KP7A 2GZ2A 3S2EA 4YEDA 1E7RA 5U1PA 2DTDA 3SX2A 1W6UA 1Y9AA 1E3JA 2UUOA 4F6CA 2RH8A 3JD4A 5HS4A 1WLYA 1LLQA 3PYLA 4MO2A 4IQ8A 5C7LO 3CSDA 1WMAA 1ISHA 4IJWA 1BGVA 2I6TA 2PV7A 3TFOA 2JHFA 2P2SA 1VL0A 4R9SA 3VH2A 4FPXA 3ZWYA 3NJ8A 1G1AA 2C59A 5ENVA 4EITA 1EUZA 1U7HA 3BHJA 4FGWA 3BYZA 4QFCA 1ZSVA 3WMXA 2D8AA 1X15A 2Q2QA 3JYPA 3NDJA 3UOGA 1P33A 3ENKA 2VRCA 4M54A 1KYQA 5AOVA 1DAPA 1TEHA 4MIEA 4Z0TA 3MZ0A 4R54A 1E92A 2Q3EA 3PPIA 4J1TA 2G0TA 4BO8A 1LC0A 3OA2A 1UR5A 3GF4A 1YL5A 1QP8A 3GDGA 2P4QA 2GDZA 4DQXA 5KJFA 4AICA 3ZGYA 5MDHA 3I9KA 5TX7A 1UP7A 2GN8A 2EEZA 1H94A 1EZ4A 3UHAA 1LEHA 3RFVA 3Q6IA 2XAAA 2GGSA 3PHHA 1R37A 2EKLA 3DBHB 4BO2A 4D3DA 1GQ2A 3I6IA 5F21A 4OJNA 4YACA 1IE3A 2YHIB 3K73O 4NFHA 5L4NA 3JQCA 5G0VA 3RWBA 2PTGA 5GZ3A 1HXHA 4U0KA 1ZK2A 4KWIA 2AW5A 4P22A 4O5OA 4HKTA 2JKVA 4O1MA 4NPCA 4I5DA 3H3FA 5KVVA 3WOHA 1E7QA 1ADBA 1QLHA 3JQDA 3KYDA 3NGLA 2YJZA 4EUFA 4ESOA 4J0EA 4DQUA 2OO5A 4OOEA 1Y7TA 4FQ8A 3EVTA 1KVQA 4OO3A 3INRA 4XD2A 3PWZA 1H5QA 3NAQA 3VDQA 4YQZA 2B5WA 4XIJA 2QZZA 4FOSA 2PR2A 3QY9A 3OJLA 3ZWCA 1DC4A 1KEUA 2XXJA 3MCVA 5AXBA 3QLJA 2DQ4A 3HN2A 3QV1A 3W4JA 4ALMA 3MOGA 5F1OA 4Y9DA 1V35A 1N2SA 2O3SA 4GWKA 1C14A 3B1KA 1A5ZA 1E3IA 2BFMA 4EJMA 4LVUA 3ONEA 3ZWVA 7ADHA 1LSSA 4BQPA 1I30A 2YV2A 5I7EA 1I24A 2G76A 1AXGA 1HE2A 3WTBA 3TN7A 2AE1A 4D46A 4E0BA 1J49A 4HP8A 5I7SA 4CM5A 4BGIA 3VC7A 1CQIA 1GYPA 2HRBA 4IDAA 1PGOA 2OXIA 4C4OA 3U9LA 3GPIA 4J1QA 1YO6A 3UFXA 2VUUA 2VUSA 2PFGA 2GYYA 4M87A 3NJ4A 4LK3A 4P38A 1EE2A 4NJMB 2VWGA 4B7XA 4R1NA 4FOOA 4H3VA 1ZKMA 4EUEA 1GL3A 3RC9A 2AHRA 2I3AA 1WMBA 2AXQA 4G81A 3EUWA 3AU8A 3KEQA 3KOUA 1PS0A 3DZFA 4EW6A 1Z82A 2AEMA 4RF2A 2VYNA 1O8CA 1DBVO 3ETGA 1GZ4A 1E6WA 1LQTA 3EZLA 4E6PA 3QWAA 4KWHA 1QMGA 3IOYA 1J5PA 3VZPA 2BELA 2PGDA 3OICA 4P4NA 3ABIA 2BFAA 1XWFA 4OQZA 1MXFA 5TF4A 4R68A 3ZU5A 1ISMA 4JGBA 3I9MA 1KETA 3G0OA 4RLHA 3LT1A 4DVJA 3H7AA 4A26A 1AE1A 4NR0A 5I9NA 3GG9A 3IKVA 4DPLA 5FWNA 5IFLA 6ADHA 3OIGA 1CQJA 4WOKA 3NKLA 5DOZA 1E7WA 3VDRA 1GUZA 1LDMA 1JN0A 5GMOA 1B2LA 4IBOA 4II3A 4CMHA 4R1UA 3CMMA 1NPTO 1Y8RA 2IDZA 5CDGA 2CUKA 2DUWA 3HSKA 5AYVA 3O8QA 3CXRA 1IZ0A 2X8LA 2RIRA 4A73A 1LRJA 3CMCO 1VPDA 1XSEA 4DC0A 5AVOA 4KDEA 2NSDA 5DN9A 4AFNA 1EUDA 1B26A 3F5SA 3Q9NA 3VH4A 3ZWAA 2JJYA 4PVCA 5KJ1A 4RZIA 4M89A 1SPXA 1HYHA 4BHTA 1HDZA 4ZRNA 4BNVA 3I52A 1PQUA 4GX5A 5HA5A 1GY8A 4MKZA 2GERA 4A2CA 2H1SA 4PN3A 3LF2A 4J4BA 3Q2IA 4D79A 2GCGA 1X1EA 3A14A 4BB5A 5JDIC 4HNHA 1EDZA 1RPNA 3OIFA 2JFGA 1XR3A 3SC4A 3LT4A 3DDNA 5TNXA 4CQLA 5FI3A 3BIOA 2HAEA 3GNQA 1DIRA 1DC6A 3K30A 4KDFA 2ZKLA 1P1IA 4L76A 2C29D 4BMVA 4E5KA 3KSZO 2B69A 1UAGA 2AG8A 5AXAA 1U3UA 4IM7A 4WEQA 2I3GA 4K1LA 4PG6A 4ND1A 2PY6A 4K28A 2ZK7A 3D3WA 3T4XA 3RUHA 4BO7A 4LW8A 2Q4BA 2EP5A 5JW6A 2JL1A 1ZO8A 4OGWA 3RU7A 5DP1A 1LLDA 4G2NA 4ILKA 5IDYA 1I3MA 3VH1A 1NTOA 2VWPA 2P5UA 4IJKA 5B4UA 2FZWA 2X9NA 5GZ1A 4NK5A 3ICPA 2IZ1A 2CD9A 5BNTA 4GQAA 3C1TA 3FF4A 3WICA 1HSZA 3PYXA 1PZHA 1NBOA 1HDYA 3C1OA 4AG3A 4BNXA 3BMCA 2HU2A 4RVGA 4W82A 1UUFA 2BI8A 4MVJP 4ALKA 5F5NA 1E7SA 3EYWA 2JAHA 3L9XA 4ZQHA 1ZSYA 2OP0A 3E1KA 1TLTA 1O6ZA 3AM4A 2HJSA 4JBHA 1LRKA 3JQBA 1H6AA 3NV9A 1VM6A 1E1LA 4N7RA 3S55A 4CMJA 4D0RA 2Y1DA 4CR8A 3O38A 4U6QA 4YAKA 3VH3A 5KJ6A 1H93A 1OC2A 3ETDA 1UP4A 4YTEA 3DFUA 4BGUA 4TSKA 5CFZA 2JFHA 3K31A 4XQEA 5L40A 4EUHA 5TS3A 1KY4A 4NH4A 3EHEA 4QXMA 2Y0EA 3X2EA 2X0IA 2P9GA 2C2XA 2PZKA 3AUUA 4PLYA 1FDWA 1EVYA 1HZZA 4S3MA 2YUTA 1HYGA 3PQEA 1ZSNA 4E13A 1FDSA 1VRWA 4I1IA 3R1IA 1MFZA 3GHYA 1YOVB 1PTJA 1JVBA 3FPCA 5C37A 4OKNA 1NQ5A 3RUCA 3I6QA 3MJVA 1QRRA 4FJ0A 4MVJH 3D64A 1U9JA 1NHGA 3AUSA 1DAOA 2ZB8A 4U0JA 3E82A 4DBVO 3PHJA 2Y1OA 5ENDA 4YRAA 3I9LA 4O6VA 3PJFA 1U5CA 2FN7A 3OFSA 4EZBA 5LDGA 1LUAA 2IZ0A 1PS9A 2TMGA 3BTSA 3C7AA 2GLXA 2GPTA 3D4NA 4RVDA 4CMEC 2X5KO 2WSBA 3ITKA 4TQGA 2VOJA 1GUFA 2C7GA 3L4SO 3WIDA 5B4VA 1M6WA 4A7PA 2NNLD 3PHLA 2NVWA 1J4AA 1UZNA 1VJ0A 2QYTA 3TZHA 4NBVA 5EQFA 4ALNA 5A03A 2YHIA 2C0CA 1F8GA 5CDSA 2PGJA 4UVGA 4E5PA 5JCJA 1TA4A 5BSHA 5T8KC 4QO8A 4Y6RA 3MJ4A 3WBBA 3GVHA 1TT7A 4XGKA 3UAGA 4EGFA 4BO0A 3I9OA 4UVIA 1Q7GA 4YT5A 4CV2A 2E49A 1NPDA 1YB5A 2X22A 2ZTLA 3P19A 2YYYA 4RVFA 1ENZA 3LDHA 3VTZA 2YW9A 4KOAA 1DXYA 1ISIA 3AW9A 5A3JA 3V1YA 3QQPA 3R3JA 2B4TO 2F1KA 4NJOA 5CDUA 4PZDA 4WNCA 4AJJA 2QQ5A 2Q4EA 4M49A 3WQRA 4J91A 1NXQA 3LSYA 3A28A 4WPGA 1R12A 2Q50A 4BNJA 3NGXA 4TRRA 4DBZA 2NQ8A 3OETA 3COSA 3UUWA 3WQSB 5JDCA 2EGHA 1I10A 1YXMA 2IODA 2VHZA 4JROA 3SLGA 1K0UA 1TB4A 2ZQYA 3HUDA 3AY3A 3IJRA 4HFNA 4CPDA 2JCVA 5A05A 2LDBA 1PSDA 3MJSA 3R6DA 4G65A 4RDHA 3HWRA 1NFFA 1I3LA 5G0TA 1VKOA 2Y1GA 3DQPA 3FNGA 3H6KA 2A94A 4J6FA 3IMFA 5EERA 2B36A 3PDUA 1EFLA 4DA9A 3PWKA 4D41A 2B4QA 1U3WA 4XQCA 1V3VA 2R00A 4PVDA 1UAYA 2I67A 2EW2A 2X5OA 4Y6PA 4XB2A 4OAQA 3NT4A 4NG5A 2GRAA 2AQ8A 1E0DA 4NJMA 3ZV5A 4Q3CA 3DEYX 3JQGA 3Q2KA 1ZW1A 1IPEA 1J6UA 1YB4A 3PK0A 4J43A 4DYDA 1IY8A 4UREA 3QWIA 3ZWNA 2X0JA 3DHNA 3INTA 3OJ0A 4CMCA 5A06A 1LDYA 2QRKA 1PJ3A 4E2YA 4PFJA 3NDIA 4FBGA 4Z0PA 3LYLA 1I3KA 3ZNPA 3F47A 3ONFA 2PWZA 2O3RA 3CPSA 3GZ4A 3U49A 2V6MA 1RKXA 2ZYGA 3I23A 2POQX 4W6ZA 5TJHA 2EGGA 1HE4A 3VPSA 2O7QA 3PGJA 3QRWA 1DRWA 1DIGA 3JTMA 2WD7A 4OKIA 2W8ZA 4M1QA 3JD1A 5KJEA 3L0DA 3BMQB 1OI7A 4YJHB 1T4DA 2O4UX 1ORRA 3MWDB 4QUKA 2G17A 3WMWA 3WNQA 4PLCA 2Q49A 1R66A 4N54A 1GCUA 1EEHA 3HFGA 3H9EO 3CINA 1ENPA 3JV7A 4OMUA 2PH3A 2UYYA 3KTDA 3DBLA 1P74A 4AJ4A 4ZGWA 1UH5A 2EXXA 1C1XA 2ZIZA 4D44A 1MV8A 2YZ7A 3ETEA 1SNYA 1O9BA 3H65A 4IDEA 4WLFA 4MINA 3FNHA 4P4GA 3S8MA 5IJZA 2W90A 3LT0A 3H2SA 3FWNA 2DT5A 1NR1A 3OEWA 1I36A 3C7CB 3RQSA 3PHGA 1K89A 4R1SA 5T67A 4CM9D 3ONDA 5L7WA 3SLKA 2P9CA 1Q7CA 4IJVA 2X58A 4IXTA 3WLEA 5ICMA 3WR5A 2UVDA 3GG2A 3O8QB 2PKQP 3PJEA 4FSHA 4L8VA 1B16A 3FNEA 3OBBA 4UUMA 3W6UA 3ZV3A 4RPJA 5A9RA 5TQVA 3GR6A 1KVTA 1PIWA 3JQ6A 3GDOA 1HE3A 1A71A 1A7KA 3KZVA 4M8SA 5I8ZA 1JA9A 1GZ6A 4ZICA 1GTMA 3TZ6A 2UUPA 3GGOA 4KUEA 1P0FA 4JJIA 4EJ0A 4L75A 4N5NA 3ZNOA 7MDHA 3LU1A 2JCXA 2PGLA 2O3QA 5IG2A 5TIIA 5JY6A 4URFA 3B1FA 1K6IA 3BXXA 3SXPA 2J5KA 4CQLB 4CM9A 4ND4A 1UDBA 3ZHBA 3OH8A 3EGOA 3NTOA 4FGSA 3PVZA 4DRYA 1WVGA 3FSRA 5IZCC 4QTZA 4MVJA 4B4UA 3WFIA 2CVZA 5A9TA 3ZWOA 4R51A 3OSUA 4WJZA 4AJ1A 2O3JA 4LMRA 1O89A 4HFMA 4CQMA 8LDHA 2PA3A 5JAMA 2JFFA 2HMSA 4CM4B 1JU9A 4B3HA 4FN4A 1ZEMA 3D3WB 1ID1A 1RWBA 2AEJA 1ADCA 2GNAA 3FD8A 1X0VA 1AHHA 1EQUA 3JYOA 3INGA 3QVWA 3ZWPA 2VT3A 2PD6A 1P1KA 3RJ5A 4ROSA 4BNLA 5EINA 4PLHA 3E5RA 2TMDA 2I9PA 2CDBA 4WLEA 1W8DA 4MVJF 4PLGA 3KHUA 2ZB7A 2WE8A 1GV0A 4W7HA 2HMTA 1A4UA 2FPGA 3PGXA 1NVMB 1GZ3A 4E32A 4DPKA 2Y66A 3BAZA 4BKPA 3K6JA 3WGGA 5JAIA 3UW3A 4AJEA 2Q1SA 3O26A 5I7FA 3UGKA 3CIFA 5A9SA 3BMCB 4DWVA 3L4BA 1SEPA 3HDHA 1BMDA 3LT2A 3PIDA 4FFNA 1Y5MA 2C7VA 3TJRA 5JFOA 5TLSA 2Y93A 3P2OA 2H6EA 5CG2A 1NFQA 1KVSA 3I3OA 3OF2A 1QYVA 1RYDA 4NU5A 4BQRA 3UCXA 2CVQA 1C0IA 4HUJA 5CPBA 3V2GA 4KMSA 1IZ9A 5IDXA 4I9UA 5TJ9A 1L7EA 2D2IA 2Z95A 1PR9A 1T2DA 3Q9UA 1VC2A 5LCXA 3ZNQA 3EVNA 1EBFA 3KB6A 1QYWA 3M6IA 5CHEA 3KEOA 1LDNA 5JYDA 3K5PA 4WLUA 4CLOB 2O2SA 3VAZA 2FWMX 4UVDA 3JQ9C 4Q3NA 3VZRA 5DCYA 2NWQA 3Q0EA 1OC4A 4J90A 1YOVA 2ILTA 1Z7EA 4R5HA 1E77A 1XELA 4CM1A 5B1YA 4RF4A 1U4OA 4TKLA 3JQFC 4BB6A 4JK3A 3DTYA 1HSOA 2OOSA 3KO8A 1XA0A 3WSVA 3BA1A 3E48A 2VOEA 1A9YA 5CG1A 1HDGO 3MTJA 3KRTA 4FS3A 1UXGA 5JY1A 2XF8A 4Q3EA 1I01A 1XU7A 3LF1A 1NX6A 1SEVA 4K26A 2HK9A 3W4KA 2VCYA 1KEWA 1OAAA 4NFYA 3FNFA 2H5LA 1GR0A 3ROKA 1WNTA 5DULA 3KSUA 2P5YA 4XCVA 5JAQA 2BFOA 3IL2A 5COBA 4C7KA 5JC8A 2OFPA 1ULSA 5TSDA 3RBVA 5AXDA 3BZUA 3NYWA 1HTBA 4P8RA 4RLSA 1PZGA 1BG6A 1LLCA 2NTVA 3RSHA 1GADO 3TL2A 3ZHZA 4R16A 4EYEA 4ND3A 4O0LA 3AOEC 3GVCA 1DDOA 4FFOA 2OHXA 3D4PA 1KY5A 2V6FA 3WSWA 4TRNA 4XYBA 2C5AA 4IZHA 4WLVA 4BO9A 1DSSG 1FDVA 4B3JA 4EI2A 2HJRA 4L4SA 5EESA 1HLDA 1UZLA 5JYEA 3DZIA 5BQFA 1HLPA 1H9AA 3WB9A 3ORFA 1H0KA 4CUKA 3WQQA 3M1LA 5BSFA 4LMPA 3AY7A 3D4OA 4RV9A 4MVJE 3WGYA 5CEJA 4YCAA 3TZQA 4PLTA 4Q3DA 1VSUA 1YJQA 4RQUA 5ITVA 1QXSA 4J4TA 2GZ3A 3LC7O 2OL4A 3WWYA 4WCFA 4BKUA 5HWSA 1IOLA 3LQFA 3NX4A 3BMNA 4BGEA 3WX0A 2X7HA 2Y1EA 1Z75A 4BMSA 1U1IA 2ZTVA 1R0LA 5I9MA 1CIVA 2GO1A 3F9IA 3IJPA 4IY1A 1RJWA 2IRWA 4RORA 1E6UA 4ND2A 5KKAA 3U0BA 2ET6A 1J0XO 2VYVD 5C7OO 4TVOA 4IPTA 1SBYA 1ENOA 2DC1A 1NQAO 3H3JA 1IULA 1ZK4A 2QRJA 1V8BA 3C7DB 4OSOA 5G4KB 4A5OA 3HG7A 1N92A 1P0CA 2BGMA 3Q11A 1ZVMA 3ZW8A 4ZQFA 3QVXA 2H9IA 2R6JA 2D1YA 2BGKA 1U8XX 1QR6A 3R3SA 5IN5A 1RM5A 5IDWA 3WBFA 4B4OA 1KEVA 3QWBA 1KVRA 4FFRA 1WDKA 3TOZA 3RFXA 1JTVA 1UZMA 4GL4A 1ZK1A 3D0OA 4W99A 1L7DA 1TI7A 3JQGB 4OXNA 1MA0A 4DLBA 1PJ2A 1UXJA 2FPIA 3HE3A 3VKUA 2CF5A 4J9UE 1C0LA 4BNYA 4RZHA 3W1VA 1KIFA 3ZU2A 4IUYA 5BSGA 5DCUA 1DRVA 1TT5A 5FEUA 1I32A 3QSGA 2VZ9A 3ZW9A 5C5IA 4YR9A 1N1GA 3OQ1A 3DO5A 5G4LA 3ZH2A 3BMQA 3ZV4A 1B8PA 4YJHA 5FFFA 5GZ6A 5JO9A 1V3TA 1GU7A 1D1TA 4MP6A 3I1JA 5HBRA 3U09A 5A1TA 2OMEA 1HEUA 3ZWMA 3VHRA 2WD7B 4BKRA 1RM4A 4CMGA 1OOEA 4RPGA 4PLVA 4E12A 2J5QA 4MIOA 1GPJA 4N5MA 4WGGA 2EP7A 1B8VA 1CYDA 3TOXA 4BNWA 4BNIA 2NUAA 3V1TC 4IDDA 1DPGA 2Z5LA 4ID9A 1UJMA 5KJCA 3DZBA 2V7PA 4E2XA 1GEEA 1X13A 4GGPA 2VT2A 1BW9B 3DBLB 3DBRB 2DFDA 3DZGA 3FBGA 4Q9NA 1C1XB 1KEPA 3GDFA 4RVHA 3JQ7A 3I9NA 4R3NA 3HHPA 3VPXA 2CMDA 3I4FA 2D3TA 4AJLA 1YL6A 1YQGA 4Z3KA 3F1KA 2DU8A 2WE7A 3MEQA 4LSWA 3JD0A 3LZ6A 1X0XA 2AE2A 4IS3A 1GCOA 1W73A 3G1UA 1E1MA 3HDJA 1ZXLA 4DIFA 1X14A 1E3SA 5JO0A 4RGBA 1R16A 2E48A 2P68A 1ARZA 3HB5X 4EDFA 3WJAA 4CJXA 5A4DA 1HDXA 2NU7A 3DBVO 4R3WA 2YDYA 1LDGA 3KYBA 3VPGA 1M75A 1U3VA 3MJEA 4WE3A 5G0UA 3G17A 4O63O 3WGZA 1PWXA 1VE9A 4GSLA 4NNJA 4E21A 3HJAA 2YFHA 2RBEA 3BMOB 2ZJ0A 4Q3BA 4BNMA 1DHTA 4TZKA 3QE3A 1LI4A 5K6AA 9LDBA 3E03A 4XYLA 4XGNA 4JCOA 2IXBA 4WLNA 4BNNA 3LK7A 3B1JA 2ZTMA 3TQHA 3FR7A 1Y6JA 4XRRA 1YRLA 5U9CA 1VLLA 2A35A 2Z1MA 3RC2A 4CM4A 4RO0A 2C2YA 3C8MA 1KS9A 1NQOA 1SCUA 4AJNA 3IUPA 3E9QA 4R4JA 1QSGA 4XKJA 4YT4A 1C3VA 4CQMB 1BXGA 1DC5A 2AQKA 1D1SA 2J5RA 1V9LA 3D3EA 1LNQA 3GMDA 3H8VA 1F14A 2WDZA 4CMKA 3AOGA 4Z9XA 3SJ7A 1VSVA 1B14A 4PGFA 2VTEA 2X0RA 1GEGA 1HDOA 4ZRMA 5IXSA 1B3BA 1LLUA 5CEEA 2UAGA 4RPLA 2YY7A 1E5LA 4Y67A 5FF9A 2E4AA 4L73A 4YQYA 4CR6A 1QV6A 1C0KA 1LXCA 3MJCA 4NQZA 4PZEA 1CRWG 5B37A 1Q2XA 2WMDA 2OUIA 1M67A 4CV0A 5IAAA 4E2ZA 2GN6A 1M76A 3ANLA 3F3SA 3GNSA 3AI3A 3UICA 4MVJM 5A02A 4ZJUA 1LA2A 4XR9A 5A9SB 5COQA 1F12A 4J7UA 3L07A 5ADHA 2YDXA 1ZMTA 4XYMA 1A9ZA 1HDRA 2X5JO 3CUKA 2GSDA 2VUTA 5KVSA 2OZPA 4J0FA 1OMOA 3UCEA 5IZ4A 3LLVA 1FDTA 4MVJG 3MTGA 5KVQA 4CLOA 4C7JA 2Y05A 3K2BA 1T2EA 4FJ1A 4BKQA 1SB8A 1DIHA 2Q1TA 5AXCA 4F6LA 4FCCA 3H9UA 4GMGA 1WZIA 3GGGA 4HNGA 4CV1A 1GYRA 1PGPA 4XEHA 4MKRA 4CLHA 4E2WA 4XDZA 3GMSA 3F6YA 3GN1A 4PLWA 4YB8A 4BUCA 2BH9A 4E31A 1Y5RA 1EUCA 4BNFA 1SOVA 2PD3A 5C3MA 3MOIA 4E3ZA 4QECA 3ZDFA 3I83A 4I5EA 4FC6A 4PRLA 3GH3A 4CODB 5BNFA 5DBIA 4RJTA 1R4NB 1LSJA 4RQTA 5F3RA 3IS3A 4JBIA 4AVYA 5JBIA 4FW8A 4DPMA 5GY7A 1N7HA 1E7YA 2EJWA 1BVRA 4NHEA 4YAIA 1AGNA 1HRDA 4JBGA 4E4YA 1A4IA 3D5TA 3GFBA 4FFMA 1GV1A 3NT2A 1JVSA 2FRDA 3VZSA 1O95A 4CUJA 4I8XA 3V5NA 4Z3DA 3GUCA 2RHCA 4R69A 3AFNA 3EDMA 1V6AA 2B4RO 5EJ2A 5JNLA 4OSPA 1ZH8A 1DEHA 5IXYA 1T24A 1JAYA 3CTMA 4K6CA 4YBZA 1LC3A 1T1SA 1WP4A 4EBFA 3DZJA 3QW2A 3PRJA 2EJVA 5KIAA 3BTUA 1H2BA 2Y0DA 5K0ZA 5EQDA 2WJPA 5T5QA 3S2IA 4YJGB 5JCXA 4BNKA 1UXHA 2HRZA 3NT5A 2D5AA 1HDCA 4D0SA 4E33A 1BDBA 1R4MA 2GZ1A 1IHXA 2SCUA 2Y1CA 3DAPA 2IYPA 1E1NA 1D3AA 1PZFA 2UDPA 3B6ZA 4IDCA 4IZIA 4GKVA 3H9JA 4H7PA 3WJ7A 2PD4A 3PZRA 5HRUA 2P4HX 1F06A 1X7HA 2O23A 2DTXA 4AJPA 2QHXA 4WCFB 3LVFO 2QIOA 4ZHSA 4NDNE 3BMNB 4PZCA 3DHEA 4HBGA 1BXKA 2GF2A 1DJNA 4ZN6A 3GLQA 5H81A 1QORA 3RUIA 4HXYA 4WK6A 5G4KA 3LC1O 3RROA 3C1AA 4JLWA 2X4GA 4JJGA 1JWBB 1ISJA 2ZB3A 3S2FA 3P7MA 4NFSA 4BGVA 1BXZA 1Z45A 4ONEA 2NU6A 1SC6A 3GOHA 4CLEA 2C82A 3GUYA 4XYEA 1IYZA 3DC2A 4P4LA 4W9NA 3NUGA 2CSUA 1DFGA 2DVMA 1QYDA 1H9BA 3H9QA 1OZAA 2ZYDA 2VHWA 1FJHA 5KKCA 3K8ZA 3O9ZA 5T6BA 3DMTA 4J49A 3ZU4A 3PDJA 2D5CA 2JD2A 3JQAD 4YWJA 4DUPA 2AG5A 4HY3A 2AEFA 3PQDA 1FXSA 3RJ9A 1BVUA 1LJ8A 2IYOA 4ZQEA 1AUPA 3CEAA 3GC6A 1UP6A 4NBUA 3JQBC 2Y1FA 3SJUA 3FPLA 1YKFA 3UF0A 3WTCA 5B4TA 2FPPA 4L74A 1ZK3A 3X2FA 1GUYA 1FK8A 3PHIA 4CLRA 1HL3A 4XR4A 1C1DB 2W2LD 3HN7A 4ND5A 4IDGA 2DUUA 1MXHA 1TT5B 2D0IA 2WM3A 2WTBA 3AM3A 1B7GO 2D59A 4NK4A 3G79A 4OOFA 4HV4A 2BMAA 4FR5A 3ST7A 4L9RA 4XJTA 4FC7A 1CDOA 1Y81A 3QA9A 5IF3A 2ZCUA 4CMAA 1ONOA 4PLFA 3CH6A 2DBRA 1ZFNA 5DCWA 5DDIP 1JAXA 4RF3A 5F1KA 3WGIA 3P5SA 4YJFA 4CL3A 2FR8A 3OMLA 4Z9YA 2CNBA 3ZCXA 1BW9A 3DBRA 4EEXA 1CJCA 1I2CA 1XQ1A 4B7UA 4IMPA 3M2PA 1YBVA 2Y67A 4DMMA 1QKIA 1FF9A 3FWZA 4QQRA 4GAEA 4YA6A 3RAJA 2HKIA 4TROA 2J3HA 3DMYA 2VHYA 1XCBA 4MDHA 5LC1A 5HM8A
chains in the Genus database with same CATH superfamily
1L5VA 1MABA 3HDGA 2PYZA 4JL8A 3IMCA 2CVOA 1SO8A 5E9WA 1DKLA 1JQLB 1VYVA 4QFMA 5FNZA 1DMRA 5EP2A 2F3SA 1JIQA 1TAQA 2G0NA 1P8AA 1SCNE 2EFDB 2NV2B 2UZAA 4OL0A 2PT7A 2BGRA 2DQSA 3HCDA 4PBTA 3VHLB 2XUJA 4CL8A 5LOVA 3N53A 4BMCA 1BAPA 2XUQA 1G1MA 4JI5B 2BWJA 2I2BA 2YYAA 5I9LA 1T15A 4YRZA 1FS4A 3N58A 3PJRA 1SY7A 1XMXA 4GOND 1Z6GA 2Z9BA 4YLEA 1INLA 4UBKA 2HMUA 1PO7A 5DGIA 3D8SA 3ON5A 3RWOA 1JEYA 1I7DA 3JPWA 5KYUB 4FHGA 1W7AA 5DTQA 5A5EA 1E8DA 5FFMA 4EFMA 2JCGA 4HBZA 3PFHA 4L72A 5CBPB 4DLRA 1RZVA 3DV0A 1WWKA 4GRDA 2OD2A 3RTGA 5BPFA 1MH1A 1YWGO 3ZX4A 2R6ZA 1GFIA 1Y98A 1UBEA 3CVVA 2BI7A 5E6UB 4J1NA 4OB7A 3RIYA 2Q99A 4TQ9A 3DWFA 1T6BY 3CIOA 2BMVA 2BGNA 1U63A 1GQFA 1TIBA 1G2PA 2JKZA 2QUKA 1YNSA 2IEAA 3T7KA 4F85A 1OGIA 2AF3C 2H29A 4WADA 1Z13A 4P84A 2OXCA 1RQNA 3DF9A 3T3PB 4MGKR 5KTSA 4MV4A 3QE2A 4AUKA 3ABZA 1S2DA 2CL6X 3QV2A 1A5SB 1PDVA 4Y2UA 4F5EA 7AT1A 4LWQA 4MKHA 1IK6A 2XTMA 1A9XA 3ROMA 1E6MA 3ISJA 2DSTA 1KI8A 3M6MD 4TYMA 5SY6A 3WYCA 1RZRA 1OB2A 5EMHA 3LXRA 4DVGA 2HMAA 2DJIA 1Y6RA 3GLIB 5GJVC 2EL7A 1VSQA 2X0NA 1S3IA 3DTTA 1DBPA 2NYRA 3LCCA 5TPZD 4HLNA 2VHVA 4BN4A 4KQ6A 2XWBF 3FSGD 3T7SA 4E2FA 3O1IC 4KXLA 5THKA 3DFZA 4C0SA 1GHTA 4GX2A 4D45A 1RMTA 1V41E 3MB5A 4OHUA 2OHIA 2C07A 4ENWA 1R6DA 3B9RA 4B6GA 1D9ZA 1X74A 2ZUEA 3REGA 3STXA 3TDKA 4JP8A 1EK5A 3KJNA 2YWHA 4YQFA 4IVQA 5MN4A 2D1SA 4XLZA 1WQ3A 1QH8B 3QTLA 4NV0A 4WZAA 2EYQA 5DCLA 4YRPA 3SKXA 4FNMA 4NEHB 4KR9A 1Q92A 2HTEA 4C0BA 4GEGA 1PGJA 1RZUA 3RS7A 3QEKA 3RTAA 4PSAA 4QHSA 1OUMA 2C92A 5JE8A 2IXAA 5LUBA 2Q3MA 4WACA 1NUUA 3F8TA 1Z0FA 2LE0A 2JKYA 2OCPA 4TKMA 4X1KB 5HW0A 1OT3A 5C8DA 3JZFA 2I6FA 3HVKA 4IXWA 4EO9A 3WLAA 2FEAA 1DBRA 4RNCA 1CULC 1JZTA 2NZVG 2ZCVA 1GILA 1DAFA 4B4WA 1K92A 4BLQA 1XTIA 1MVLA 3WYEA 3NLLA 5AQ1A 2BCJQ 4MYDA 2JNWA 4NU8X 3EXIA 1GFSA 1SC4A 2CLKB 1I4WA 1H2EA 1FMLA 1VFPA 1CY4A 3GFPA 4X6UA 4A0GA 4KO8A 1A2QA 4LNAA 3DE3X 3WLFA 5FBWB 2VRCD 4AURA 1VL5A 2CMFA 4OP1A 3THWB 3HWWA 2HRDA 2AKYA 1R4NA 3C85A 1FNCA 2PT5A 2XH8A 3DCNA 3H8WA 3N86A 4N41A 1OPXA 3OQIA 3NVMB 1YCGA 1UC8A 1RXEA 1ELOA 1QG4A 4K9DA 4UDNA 3TMKA 3HXLA 1UBFA 2KLBA 3GQVA 4L5CA 3V00A 5FPPA 1K98A 2HT6A 2EKZA 2C0PA 4E5DA 3HM9A 3PTZA 4GX0A 1E4OA 3AB3A 4FDUA 4MWTA 4ZXPA 4R8MA 3OI7A 4LDNA 1QTIA 4YMHA 3O83A 1IBRA 1RWKA 3F46A 1JDBC 4JXKA 5J4YA 3OOJA 3GCWA 1KBZA 3NRJA 1XEFA 1GGEA 1HLFA 4NOLA 1TXGA 1AMOA 1PJCA 4DMLA 1SGWA 4BV9A 1FEZA 4Z7OB 3DOCA 3DXXA 1KAMA 4JI4B 3TSWA 4AMGA 2G07A 1AQUA 3VHQA 1BRMA 1E4EB 3G8BA 4E6EA 1WS6A 2PUDA 5FOVA 1VA4A 4KQWA 3DXFA 4Q1BA 4JBLA 4U1RA 5ARDA 3TBHA 2QL9A 3AUYA 4HB4A 1SXJE 4A03A 4BNHA 2R4QA 2O3UA 1S4QA 1XD2B 5G2OA 3AY6A 4HSGA 3BTVA 4J0DA 1FDIA 3EDCA 3EG5A 1SK9A 2V4ZA 2OQVA 5JFGA 1H4VB 4CKYA 1OV4A 5ICSA 1P3DA 1U7UA 3AEQA 3O4VA 3QENA 1QZUA 4U7GA 1PFGA 2HSEA 4CKZA 1XAGA 3BDVA 5ITWA 5JZ9A 2A1UB 1CF2O 2ISQA 4HADA 1P7CA 4PHCA 2OA0A 3VR0A 2MSKA 3PYMA 1M5UA 4HUTA 1T25A 2XE6A 4EA8A 1B1CA 5EIBD 5GQSA 4EA7A 5KYKA 5I7OA 3T8YA 1ZESA 1LSOA 2C3OA 2SCUB 3B89A 2A33A 2QN7A 4Q1FA 4Z86A 2AA3A 5DYTA 4MP3A 3DMDA 4CFYA 4URVR 1X80A 2Q6KA 1J23A 5TVKA 3E9MA 1QHYA 1PQYA 1YDFA 3STHA 1WTAA 3ZDZB 5TPWB 4Z3OA 3KLBA 4MDEA 4MPDA 2BFBB 1JTFA 1OVGA 2QAIA 2VZ0A 3A6GA 4I1SA 3WMEA 4F1WA 1WABA 3EH1A 5DLYA 2VHQA 4MPTA 1MEOA 2MSCB 2PPLA 5EWLB 3RBXA 3QKSB 3ANTA 2WABA 1XPRA 4EB6B 2W8BA 2Q0XA 2WSYB 4TTRA 1NLMA 4ND8B 2O48X 2PU5A 5AW2A 1P1RA 2QJFA 4DMGA 2YVKA 4YDRA 5BSVA 3MWYW 3GEMA 3KKZA 5CYGA 3FPSA 1VKZA 1IHOA 1Q1AA 4K87A 1E3LA 3SHVA 5K0NA 1JQBA 1AG9A 2E55A 3FYUA 3GT0A 1NW5A 1JKFA 1MX5A 3GIDA 3SBEA 1U7OA 3K09C 4RKQA 1QNLA 2WJIA 3KJXA 4QSHA 3R7BA 3R9IA 1VBMA 3BB4A 1U2DA 1HMYA 1I94B 2V3WA 2NSLA 4AUNA 1GGMA 2XTNA 5DNUA 1J2YA 1L2TA 1LW6E 1LPNA 3DLCA 1DNPA 2ADFA 4KFUA 4L4RA 4JODA 4S1NA 5T64A 4N0QA 1PJLA 2ZJ8A 3PNSA 5ALGA 1LTHR 4M1WA 4R9UC 5I4IA 2DBVO 4RX1A 4EEZA 1QG2A 1QHIA 3H1PA 3ZWKA 2R5NA 1G6KA 3JQPA 3LFUA 1V5EA 3ROFA 2C5BA 1T4BA 2E1RA 2ZRLA 3PXDA 2A0YA 1ZIXA 2Q6TA 4LE1A 4PGGA 4V24A 2W2KA 5DH9A 1T0UA 1TUGA 2VYVA 3UAXA 4ECAA 1EM8B 1UXOA 1JXMA 1EBUA 2ZR9A 3O7WA 1VCHA 3KT3A 4G0OA 4X85A 3RHTA 1BH2A 3SS7X 1S7CA 2EBFX 2QVLA 3QPBA 1HTWA 3G2HA 1DRJA 1U5AA 1PNRA 1P1HA 4X1IB 3EFHA 1N3YA 1N9KA 2F64A 1JA0A 1WZEA 3P2EA 3GVXA 3KHSA 3DE0X 1KMQA 2GVZC 3BWYA 3IP1A 4WIAA 5B58T 3TPFA 5KYVA 4B74A 4DIOA 3OCUA 5K3CA 3G5LA 2JFPA 2O50A 3TS1A 4LFAB 1W87A 1HT0A 2K87A 2JJQA 1OTHA 4MRMB 3SLRA 2N1BA 1ADFA 2R1TB 3PNBA 1YZHA 4BS9A 1U0NA 1KE2A 3RSZA 2AOUA 3KTFA 4BJHB 3JATB 3SVTA 2Q46A 2GJ8A 2AJ8A 3DH0A 2EBUA 1M1YE 2J33A 1QRTA 4ZHQA 1FSPA 2OHOA 1OXVA 5J4HA 3DAFA 3AEZA 1UFRA 2QN1A 3QHAA 3WQBA 3JS5A 2JBWA 3PD7A 3JQAB 3KOZA 4FGLA 5CTAA 1UDAA 2FLVA 1U0SY 1XPOA 1YDEA 1E8MA 1GNPA 2BF7A 5C8YA 1G7SA 1Q1NA 2DKOA 4JHXA 1M6YA 2IBTA 2REQB 4U7JA 1SULA 4P58A 1IY0A 4Z0HO 3S2YA 3V2IA 1OXXK 2V6JA 2XZOA 2ZE5A 1E9EA 3AL3A 5GWXA 4QGHA 5CT6A 3ZD7A 4BCBA 1Y1RA 3RVDA 2J9XB 4OJTA 1GFWA 1PQWA 5LU9A 4YO7A 4NS4A 4B80A 4KIFA 3NOOA 2CFOA 1D4AA 1SM4A 5HCNA 4N0PA 3UT5A 1MUUA 5FPQA 4ZHQF 4BL5A 3P4UA 4IVRA 5BO5A 1XLTA 3MUFA 1T9DA 5JFTA 3NYRA 3N76A 4IWNA 4BN0A 2KQUA 5C9ZA 8ADHA 3O1LA 4FD3A 4V0NA 3RC8A 5C8YF 4NCAA 4N3NA 1T0IA 4TRMA 3DL7A 3PA6A 4NYIQ 2QYSA 4GC9A 3URMA 5E4FA 4AUEA 4CF4A 5K4GA 3JSAA 1TVKB 3MF4A 1AXEA 2QZ9A 5IN4A 3D7KA 3GU3A 2GXAA 3AF6A 1NNUA 3I2KA 1NXWA 2G88A 2I6QA 4ENRA 5E1BA 3BN3A 4X7MA 1EUQA 1MVNA 3SYTA 3D3JA 4HGOA 5KYUA 3BK2A 3VX4A 1FPMA 1PVVA 3E53A 3VR4H 3LRTA 3OPYI 2F1IA 3VR6A 2HCBA 2CYAA 3DSRA 5CBPA 1LSUA 4BXOB 2GD1O 3MWEA 4R1PA 2EJCA 3RRBA 5FX2A 1PE0A 3RR2A 4H60A 5EIOA 1W2GA 1GQRA 3KQKA 1RRCA 3CKLA 1Z5VA 5IH3A 1UBOS 4F3KA 4F9FA 4HQFA 4OB8A 4PF1A 4ALJA 2P9EA 2QPTA 5DM60 1DO8A 1UBSB 4GR4A 4MUGA 3NCHA 1IN4A 2XZTA 5FH9A 1NW4A 3QBEA 1HETA 1U2SA 4AX4A 1XB2A 1UDCA 2FDRA 1AN0A 3EW7A 2FX2A 5K1ZA 4D42A 1QVAA 1LBQA 3KS9A 1TJNA 1YDWA 2BD0A 1IB6A 4RIEA 5BWOA 4WCFC 2FPXA 3K0HA 3H1BA 1ZZEA 5DMHA 5F4BA 2E2WA 5FWDA 5ESDA 4AI6A 1HNNA 1S2IA 1Y3CE 5A3QA 3HXPA 1WQ4A 2VWQA 3QG1A 3FBTA 3GRUA 4JC5A 1L1FA 1G7CA 2YQ5A 2P69A 3LHIA 4FP9A 4FE3A 1PJSA 1FPQA 4U2FA 3T4UA 5AUOB 2V65A 1I33A 3ANNA 4ITUA 4PONA 2O7NA 3GLIA 1FZTA 2VDWB 5LJLA 5DE3A 4JIGA 4X44A 1DQYA 3V3TA 4YXFA 4IKEA 4WCVA 1JLSA 4WNYA 2R86A 4JKYA 3RG2A 4B8ZA 1BN7A 1OWMA 2W7TA 4MJ7A 1GQYA 1IB0A 4BMXA 4ZYWA 1IC6A 3QU5A 4C05A 3G1TA 1MJGA 3BERA 4YO8A 3NFRA 2H1WA 4ZC8A 5J63A 2FX3A 3THXB 5LQSA 3V4ZA 4LC0A 5HZMA 1NP3A 5ALXA 1DG9A 5TC4A 5FUBA 4B2YA 1UJ4A 3VAAA 1KMMA 1YJ5A 3GFFA 4YN3A 5IEJA 4BX3A 3GZNB 2PS0A 1NMEA 3O3OB 2JA1A 3N7UA 2PX2A 3DZKA 1B15A 2NN3C 1YI1A 1P77A 4ETWA 3S29A 2GEFA 4NBWA 3VTKA 2A5LA 2I1WA 2AFIE 1YDMA 2GASA 1NJSA 3D7NA 3SFZA 3MFQA 1RKUA 4CEJA 1NX9A 4X1KA 4HB0A 1R0BA 1YGYA 3G9TA 3ITNA 1KE1A 1JIJA 3VBCA 1YV9A 2XMSA 3WGHA 4D4JA 1FNDA 1X9HA 4ND6A 1F3LA 1Y80A 1K7SN 1M74A 1KQOA 1N0HA 3EZNA 1NM5A 1DQSA 2BMFA 2O2GA 2O2YA 3JZAA 2BKXA 1AKUA 4CKBB 4ESHA 4OQMA 2W6ZA 4N6OA 4FI3C 1IIBA 2G82A 3Q1LA 2G28A 1V48A 4NI5A 3PNQA 4FS8A 1Z7WA 2JFNA 5H59A 2Z1DA 3KYCB 1M1ZA 4HH0A 4A4DA 1XAIA 3LLSA 3THWA 1QFSA 4OFZA 3AUAA 1GTJ1 3I6YA 4HZUB 5E0OA 3N87A 3PB3A 3C8DA 2EU8A 2B6HA 3LDUA 5CK5A 3D0KA 2UYCA 3Q88A 5LQKA 3DFMA 5F7ZA 5IW8A 4CN8A 3WG9A 1ULHA 3BQ9A 4GSYA 1E3WB 4TRJA 4E14A 4OJYA 3T4PA 4C14A 2PQ0A 2X13A 4C6HA 2CF6A 3K53A 2Z08A 1C3XA 3M5CA 3P45A 4J16A 2H17A 3PRHA 1FBNA 4XCXA 2XB6A 1DEXA 3VKGA 1ODCA 3Q9LA 3QVSA 2NYVA 4MB6A 3N0RA 3GGPA 3NC0C 4XE5A 3CURA 1AZSC 5IJXA 5CFMA 2WFAA 2PZLA 1JP7A 3SKYA 2QSJA 1OE0A 3AFOA 1YCDA 1MMFB 1UT6A 2HK7A 4O1IA 4UHCA 4ZI3A 2XVZA 4B3SB 1ZBDA 2QJRA 4BXOA 2NZYA 1B0PA 1E4EA 3PE6A 1YH3A 2RHTA 4XJSA 5D01A 3VNUA 1P81A 1H0RA 3V7WA 1UEXC 2DWQA 2C54A 4UZEA 3RRXA 2G8LA 4I2NA 4X20A 3E5NA 3IR5A 4G5OA 1A88A 2B5VA 3V9AA 2Z8ZA 3PQ4A 1POXA 2BLLA 3AKCA 2ZR0A 3ET4A 5AK5A 3W9UA 5BN4A 1QU2A 1XD2A 3GK3A 2W00A 3HY6A 2OBYA 1MX9A 3P52A 3QG5A 2X2EA 1F8XA 4O2AB 3RUFA 1UM8A 5JS8A 1FMFA 4EW3A 2QVBA 2CN1A 4QAQA 4R5MA 5HR5A 1KYZA 2VLIA 3PLRA 4IOJA 1VL8A 4K05A 4O2LA 3IUBA 1J9ZA 1PS8A 3PEWA 3VYSB 2PK3A 3QP9A 3PFFA 3RS4A 1EVKA 3G2KA 2GWRA 2A1UA 4LIPD 2VDPB 3RUDA 2VQEB 3O2SB 3H0EA 2FN4A 4Q82A 5K0EA 3DHYA 5BUSA 4M0PA 1RHQA 2AF4C 1SOWA 2CVPA 3DBOB 2HSWA 3PZBA 1KJZA 4J3FA 1VIDA 5HIIA 3TD9A 2RJ3A 4LGYA 4ABYA 2HA7A 2OK8A 3KFXA 1QP0A 1XRJA 1EDOA 3SE0A 1NRIA 4JL6A 2IEDA 2J5BA 3SDSA 4QGAA 3UYLA 3AFHA 1VMIA 3ICVA 4Q24A 2ZGVA 2VTBA 2XRFA 4JLKA 5U4QA 5B12A 1EXNA 3ZJTA 5DGXA 3THSA 4BLRA 1A1SA 3SFVA 2UYOA 4H17A 1KAQA 3TK1A 1NBIA 2D0PB 5CJ2A 4LJAA 4ZEMA 2F7SA 4OEHA 3INNA 3KUXA 1YASA 3E22B 5AOAA 2P6MA 4M1ZA 3TLYA 3NBZC 4EB6A 1G20B 2VDVE 1G5IA 1CE8B 3FUXA 1I0IA 4R1OA 1F5SA 4B3CA 4B6FA 1DCFA 3W5HA 1B8UA 1Z83A 3KYDB 1LTKA 3NANA 3PUIA 1O9GA 4LY9A 4RHEA 4Y9TA 3UMFA 4BKOA 4F06A 4N7JA 5BR1A 1I4OA 4M0FA 2RH4A 1Q91A 1TC2A 5HMMA 1LH0A 4C4TA 4H4EA 1MD9A 5KHOC 2HQ1A 2WIGA 3NEAA 2DBQA 4W5HA 4A9AA 1QIDA 1NBMD 3EOZA 4N65A 3TI9A 2J3KA 1I2BA 3L7IA 2WU8A 5DOVA 4YHHB 2RC5A 3ZHCA 4DUZB 4HH3C 2AMJA 4L5YA 3VO2A 3ZCVA 3A1UA 4GO1A 4BUZA 1SXIA 2CJWB 2QUZA 4J1SA 2JGLA 1J07A 4GH5A 4ZT7A 1GN8A 4TWIA 2AN9A 1WRBA 1A5AB 5DX1A 4C5BA 1JEJA 2BRUA 2ZS8A 1UOEA 4RL6A 1G63A 2Q4TA 4ZALA 3VZCA 2A92A 4CMIB 3E2PA 1WAMA 3LTEA 4TLLB 4ILEA 2C5FA 3I9JA 3BRSA 4DN6A 3U6BA 3IRVA 1MX3A 4HO1X 2WSMA 1SMKA 1E2UA 1QM5A 4P35A 1GZ7A 4P36A 4WOJA 4HWRA 2AXEA 3I5XA 1H6CA 3EGCA 4E1BA 1ZHFA 3R4VA 1RSZA 1NBWB 3VPHA 5LMZA 3FJYA 3OPNA 2C2GA 221PA 1YS4A 2FP4A 3MGGA 4HCJA 4KAAA 1SQFA 4P81A 3UHPA 4B3XA 2PUGA 1P7ZA 3KKMA 5T4BA 2RJNA 3RJZA 1XMOB 4MW6A 4XQ9A 4X1IA 4FLFA 1L5QA 5F5LA 2Y68A 4HT3B 2UYQA 3LZDA 3F3YA 2DAPA 3QKRB 1CQIB 1J21A 3HFSA 4Z9FA 2QQEA 4YQEA 1V4NA 4UBIA 4UTVA 4QYTA 1EA5A 2MDTA 2GAJA 2UZ1B 5J2TA 5CXXA 5BT9A 2CLFB 4WECA 3CF2A 3KKPA 4D8XA 4TZTA 1OFHA 2R1TA 1YBHA 4KBFA 4RPKA 3L7LA 3W3AA 1XA3A 4UEOA 2IF2A 4IINA 3OQVA 4O02B 3RQIA 3MFYA 3TI7A 3KQUA 1RYYA 4RF5A 4GP6A 2C57A 4MARA 1Q95A 1T6XA 4WHMA 4IIHA 2IPOA 2XUOA 4KPGA 2I9KA 3U3OA 1Z18A 2F9MA 1KAHA 2VXCA 2I99A 3JQAA 3QEMB 4KGDA 4OATA 3DL2A 4X61A 3GJ5A 5AI0A 3BG5A 1X7WA 4UDYX 4Q4LA 2REQA 3DVQX 4GLLA 1AU9A 2ADMA 2IY9A 3HGQA 1YBFA 4HMQA 4MH0R 5J2TF 1KSHA 3G7NA 1WEHA 4ZA2A 3PKZA 4A8JC 5JVDA 4FMCF 2ILVA 3R74A 1NVGA 3ZZTA 4FCWA 2I71A 1UC9A 4UPVA 3PQ7A 1PHPA 4P4SB 1K6XA 4UNSA 5SZIA 5CH5A 2LIVA 3IR6A 4GVLA 4LQ4A 1ZBQA 1HT3A 3GFTA 4G36A 3JQFA 4GWGA 3IOEA 4YAGA 1U2QA 1PT9A 2PAAA 2Q5OA 2QQ0A 3IDSA 4DC1A 1EA7A 3HCBA 3SYNA 1R7RA 4CM8B 4E4YA 2PXXA 4AZ0B 4OX9Y 1WU8A 2QX7A 4GMFA 4P31A 5LNK1 3B5EA 3TPCA 4ARVA 1DKOA 1ZX1A 4IV5A 4J7XA 3HJFA 2Y6VA 2Y3IA 1JFFB 3WIOA 2IHJA 1I6KA 3WSTA 1ZKDA 1JQDA 5JVDF 4RTQA 5JMOA 5DZSA 1CUBA 2DM6A 4F5WA 2R79A 5FTWA 4HDRB 5KCZA 1VI2A 3WLKX 2RAFA 4RPHA 4C5AA 4HDAA 4AC9A 4DR1B 4Q01A 3CLHA 2VVTA 3MJTA 4QFDA 5HIJA 1P1JA 2R48A 3E6AA 4LN1A 1N2HA 4V0ME 1Y8RB 2GEDA 2IZ7A 3LNCA 3N2LA 1T8TA 1F7UA 3OZXA 4FSXA 1FFGA 1NMQA 3CRQA 2P2ZA 2DSNA 3UAZA 2IYUA 2XIQA 4H7KA 1EH5A 1YS9A 3DULA 2EW8A 1C4KA 3TLGB 5FUMA 5IVHA 1C2YA 3EY9A 4QQ8A 1GG9A 3A3NA 3C2QA 5J5VA 4JUAA 4HDCA 4IIVA 1KYYA 4QUJA 1JMVA 3NO4A 3OM9A 2HJGA 4KZKA 5FI1B 3T3HA 1NPYA 4KE6A 3TVDA 4CQMD 4KK3A 4P34A 1EUDB 2AR0A 4XQ0A 5ALOA 5ALSA 1RQ2A 3V2HA 3LUFA 3VM6A 5IAJA 2ZDHA 1MG5A 4EVSA 1MJNA 2Q7XA 1MBZA 1T9HA 2JAQA 3A0UA 2X2OA 1ONPA 3KVOA 5I7HA 3N8GA 4O8CA 2E21A 2A58A 4F3RA 4OREX 2IV7A 4H1WA 1VL1A 2VI5A 3JWIA 2VDWA 3CH7A 1Q5PA 1HE8B 1SB9A 1I7PA 4WN3A 2GETA 4CR7A 4DEYA 1SXGA 3QUQA 4RZ3A 5G3YA 4KIWA 3V4RA 2YJ4A 3OZDA 1L5NA 4BJ1A 3O82A 3DYBA 1DFIA 4HAIA 3MG9A 1VPEA 2X8AA 1ZAKA 2FH5B 3ED1A 2VQFB 2QTLA 1JR2A 2V9CA 2QRNA 4EPVA 3WIVA 5JXGA 4E51A 2J0SA 2JVIA 5AVVA 2QTCA 1YVPA 4HJRA 2GK7A 3GZNA 1FUKA 3N2GB 2P9ZA 5B58C 3PNPA 4Y2GA 1TUEA 4DYVA 1UT8A 3AI2A 2QXTA 4O59O 4H1VA 1XNGA 4NBSA 5AVJA 3DMTC 1ZI9A 5C31A 2P7IA 2W4QA 3NOXA 1YC5A 2WD8A 4K86A 4QDKA 5DXAA 3JY6A 4L3VA 3M6FA 3V8VA 5CEFA 4JJ4A 1Y4SA 2CT8A 2X4IA 4RZ2A 3DZDA 3PHBE 3WWZA 5LU8A 2MINB 4G0VA 1O4WA 1P75A 4BTVA 4H31A 3G3EA 4F71A 1IG3A 3OX2A 3N39C 1XQ6A 1I2ZA 2QSYA 2H7YA 3QKWA 4X8LA 3ZV6A 4HNTA 1XZNA 1UPTA 1NUHA 4QDZA 1QDLB 4V3CA 2H54A 4UUPA 2OQRA 2YFYA 1ZEJA 3Q3JB 4PTYA 1ESEA 5GONB 4K9NA 2YINC 1CD5A 3OJWA 4LZZA 4EH1A 3UY4A 4TWZA 1T9KA 2H5JA 1UXKA 2BUAA 2LIPA 2NGRA 3KYCA 3Q98A 4GXRA 2OV4A 1OFUA 5TPZA 3CWZA 4IOMA 3TE7A 1UDXA 2KWIA 4HZUA 4TKZA 3FSGA 3DAGA 1WB9A 1ZMOA 1L7OA 1L4UA 2AC2A 2ZETA 2V54A 1FVHA 1BO6A 4QJBA 5C4IA 3KVVA 2ZITA 3L41A 1HV8A 3WGJA 4WXEA 3U3MA 3KHKA 4H7HA 1OT5A 1SD2A 5IP5A 4X7PA 4NEGA 1E3WA 4DSTA 4QKQA 4Y2PA 1VLQA 1E32A 3L0IB 3B6MA 5IJAA 2XMCA 2GZ2A 2WNIA 2HCFA 4MMYB 4HQRA 3NJRA 2ECKA 4RJKA 1REQB 1ZA1A 2BEWB 4BJ6A 2CV1A 1B8OA 1Z17A 5CX1B 2UUOA 1SUCA 3W78A 1X7XB 2RHLA 4FM9A 2EF0A 5IT9A 3ZY6A 5HUJA 3NHZA 4OQLA 1A9TA 4NAHA 5IPFA 3BKWA 4HDNB 1XZHA 1QTQA 3QFSA 4IQ8A 5C7LO 5KWVA 1WMAA 2I6TA 2PV7A 5K45A 1SFRA 2JHFA 1DAGA 1OFVA 5B1HA 4R9SA 5B2EA 1MQ9A 1UPBA 1XMJA 1JQ3A 2FA9A 3ECSA 3M8KA 5ENVA 3IUYA 3EULA 2ZWAA 3BHJA 3GP3A 1RKVA 4YUAA 1YZTA 3WWEA 2C9YA 2QLFA 4V03A 3C3CA 2VJBA 3BYZA 4QFCA 2OZLB 2XW6A 4NABA 2VJPA 2Q2QA 3JYPA 3LPNA 3FNIA 2OV3A 2V3VA 3BFKA 3UOGA 4M54A 1RMYA 2VRCA 3ZZ0A 4DMRA 4MIEA 1FJGB 5DRTA 4WY5A 1PSZA 4OQPA 1C0EA 2ZIXB 4Y2RA 3JYHA 4J1TA 4UCXA 1LTQA 1SQ6A 1BCSB 4BO8A 3OA2A 4EHLA 1DKPA 1F5NA 4Q9KA 2L42A 4KXVA 3GF4A 4A2QA 1YL5A 1OXUA 5JTUA 4MICA 2P4QA 4AO6A 4DQXA 2F9LA 4IJQA 1FP4B 5BSTA 1RYNA 3QXJA 2QN3A 4AICA 1DXQA 3H04A 5E7QA 4ZPJA 3I9KA 4JDPA 4OFWA 1CLUA 5TX7A 3PL1A 3HS3A 3LRPA 2EEZA 4PYOA 1Y1LA 2PMCA 2ACWA 1Q1QA 3LIIA 5FT9A 1LEHA 2AIRA 1XXLA 2XMZA 1UJ2A 1NV8A 2A5YB 2HI0A 4FYMA 4OJNA 1OBHA 5EHNA 3RU3A 3D02A 1ST2A 1R6VA 3JQCA 3RWBA 2O8BA 2PTGA 4B6QA 5JZOA 1CR1A 2O0HA 2ZTSA 2AK2A 2AW5A 3HM2A 4KWIA 1W6RA 3E22A 4FYHA 4MV7A 2J0UB 2JKVA 2VH5R 1JLKA 4O5OA 5J9FA 3H3FA 3D6JA 3JX9A 1CE8A 1QNFA 5B57C 2Q3HA 1CEXA 1X8LA 1GOTA 3KYDA 1GKUB 3WYDA 2YJZA 3KTAB 3DVAB 3QEJA 4GM0A 4DQUA 4KVZA 2G9RA 4M8IA 4QT4A 4AKSA 1A9RA 1RCFA 4OMDA 4IJMA 3PWZA 5EWJA 4QOEA 2QN9A 1XT6A 2OYSA 2ZRGA 2B9EA 5GV8A 2F1OA 3O9VA 4EF6A 4GDFA 1FRQA 1L5RA 2IXEA 2QZZA 1SQ0A 1WXFA 3QY9A 3OJLA 4RA9B 1ZITA 1Y48E 1WSBA 2YV5A 2BHRA 1JE0A 2C8LA 3AJDA 3HN2A 3B48A 3QV1A 3WLNA 5CVVA 4UC0A 1H0SA 1N2GA 5HEKA 1G3RA 4ALMA 4LWOA 1PDWA 4LY6A 2ZPUA 1LFAA 2OUKA 3OUZA 1GPYA 1Z25A 3SR3A 1A5ZA 1E3IA 1HA3A 2QW0X 3ONEA 1SC3A 1LSSA 3G0DA 2WU1A 2ZXUA 4EB8A 1I30A 3L8YA 3MCWA 1SUFA 3MGAA 2G76A 2VQ6A 1AXGA 4Z99A 5DRYA 3ZIDA 5I7WA 3TN7A 2AE1A 4E0BA 5D00A 1DV2A 1KORA 3SQNA 2J9FB 3BAFA 3G02A 3R0QA 4OHBA 5I7SA 5AK4A 5ALEA 4LJKA 3QKRA 1CQIA 1TJ4A 2HRBA 2WAXA 1N77A 4IDAA 2CSXA 4XVQA 2OXIA 3CJTA 2C4HA 1Y82A 4HAYA 1HT1E 2UZ1A 1YRBA 3EPPA 3GPIA 4JOCA 1QQ6A 2WT4A 3K32A 4YCMA 4HLQB 4GPIB 2RAVA 5F5XA 1XROA 2GYYA 4LK3A 3V32A 3MLAA 4P38A 4ZYLA 4F91B 1OJ7A 1Z36A 3RTBA 1U80A 4FOOA 4H3VA 4MQLA 4EUEA 3RC9A 1Z5PA 2AHRA 2I3AA 1N2BA 4J0KA 1QK4A 4FLEA 4U39A 3QEMA 1MAAA 3ABOB 1NMZA 2VP9A 2ZSFA 3Q12A 2IIPA 1R9NA 1K7XB 2P9HA 3EUWA 4PPYA 2ECFA 3KEQA 4YCLA 1CYEA 5A4JA 3DZFA 3A9TA 4B6PA 4G63A 2X19A 1FYVA 2E9SA 2WVHA 4C7MA 3D8BA 4DCVA 1A8IA 4DWJA 2IEIA 3LCRA 3QPAA 4B47A 1MOZA 1FLDA 2BE9A 2QD4A 4P4SA 1FFCA 4G5FA 4RH0A 1GGFA 3I2JA 4QDOA 1BRTA 3OICA 5BVGB 4FYVA 1B0ZA 4OQZA 1XWFA 1MXFA 2BM0A 4YCNA 1JDSA 4AZ0A 4QODA 4JENA 1T5LA 3SNKA 3MHTA 2QAGC 3RLFA 4H0CA 3PF8A 1F20A 4IKOA 4RLHA 1GNSA 1P3JA 3LT1A 1C3OB 4F3NA 3H7AA 1ETUA 1KI1A 1CPYA 4YV0A 5I9NA 1MB2A 1N0UA 1XHEA 3BB1A 3GG9A 5ALPA 2GZHA 1JQKA 3NB0A 4GP9A 4DPLA 5FWNA 3U4QA 2TRSB 4FINA 4JC0A 5JANA 2H2IA 3QPVA 4TQAA 4ZKEA 4PC7A 2P41A 3L7AA 3RF7A 2GPYA 3NKLA 4HDRA 5DOZA 3TNFA 2VXOA 2ZRJA 1E7WA 1QGUA 4LVNA 1SURA 1OLSA 3Q15C 2V74B 1B2LA 4IRUB 2M1XA 1NZFA 5CUQA 3UXMA 3VXKA 2C7PA 4R1UA 4C4XA 5FNVA 1Y8RA 2IDZA 1N2CA 3QX8A 3EFBA 4D5EA 3C15C 2F8LA 3IAM6 2QPAA 4RFVA 1KWKA 5FJJA 3TLGA 4CGZA 5J43A 3CXRA 4BX2A 4FYYA 2IDKA 5F7XA 5JI3E 3DC7A 5EXPA 1HC7A 1LRJA 4YAWA 4A73A 2OXRA 3BIXA 1M2FA 3SEZA 2Q29A 1D5CA 1VPDA 2ZJBA 3L6BA 4B8YA 3QEBZ 2WVGA 5AVOA 4KDEA 4P4UA 5DN9A 4AFNA 4BQSA 1EUDA 2I7XA 3F5SA 5IJ0B 1DT5A 2BBWA 1IH8A 3HBAA 4PVCA 5H70A 3SJZA 3WLQA 5ALHA 2XZLA 3D5EA 1HDZA 5FNVF 4W1PA 4AQ7A 1R6AA 1CUSA 1KGSA 2GERA 3DAHA 4HYTA 4MKZA 4UXHA 2IFTA 2JS7A 3LF2A 4XX0B 5TARA 1P5JA 3WKEA 4J4BA 4BFUA 4D79A 1SBIA 1FU8A 1X1EA 4BB5A 5JDIC 2ZSUA 1EDZA 1AURA 1F2UA 1CUEA 1P18A 3PNMA 1NF2A 3TQIA 3U56A 4DDMA 3LT5A 2JAOA 3IDQA 1A8SA 2OWDA 2XYGA 1V5IA 1WBJB 4CQLA 5B3JC 4D81A 1MW8X 4OX9B 3HKCA 1Z8HA 4Y2SA 5JZSA 4W8HA 3NBYC 2J08A 4CI0B 1W88A 3K30A 2HBZA 1MOQA 1QO0D 2G7ZA 4W9RA 1JU3A 1K75A 1P1IA 4DDTA 4L76A 2C29D 4MCJA 5EJGA 2C3PA 1NJGA 3BCUA 3FI0A 1QE3A 3G0CA 1GL9B 3IUJA 3K35A 3OE4A 1JR6A 1YA4A 1YFZA 1ZN2A 4F93B 2QI9F 5LDDC 1U3UA 2W70A 1RPAA 2QLNA 3N2GA 4OXXA 2Q41A 4PG6A 4ND1A 4X90A 3D3WA 4L1KA 4GZ5A 2IS4A 1SIOA 5F2OA 3CONA 3GT3A 4K03A 5CA0F 2Q4BA 5JT1A 1Y0BA 2A5GA 1YU6A 2L69A 4MPJA 4TMYA 1ZJ5A 1TIKA 5DU2A 1O96B 3RU7A 3FMOB 5DP1A 4B5LA 3PX2A 7MHTA 2H5IA 2MINA 1I3MA 2J9GA 1SUIA 3I6MA 3ZC3A 5H68A 1PR4A 2P5UA 4IJKA 5GJBA 1VCOA 2HMYB 5GZ1A 2PXAA 4NK5A 1T9GS 3ORQA 1A9QA 5ALJA 5KYNA 5BNTA 4KLNA 3C1TA 2O8BB 5CIWA 1EJ6A 5GONA 3PYXA 3UWKA 1PZHA 1HDYA 2WTMA 2AUNA 3I76A 4L08A 2BC9A 1ST3A 2CXNA 5ADUS 4YMGA 1Z22A 1DDIA 2WM9B 3GV0A 4RVGA 4TMWA 1WZNA 2DR0A 3O4FA 3DLPX 2R6DA 4W82A 4MWOA 2BI8A 2JGEA 2CUNA 2QL7A 2WWTA 3JR7A 4MVJP 4GZ6A 4EHKA 4AQYB 5CM8B 3EF0A 2PQ2A 2IE8A 4ZTBA 5F5NA 4JUDX 1HURA 4MRPA 1BS1A 1IVYA 3EYWA 3G2IA 2I2CA 4EYSA 3P2IA 1OH8A 3LKDA 2QIPA 2H8KA 4JOBA 2PUFA 4JBHA 4N8DA 2XBUA 1LRKA 1JX6A 4UFOA 4DJDC 2ZUUA 5GONF 3B2EA 3NV9A 1VM6A 1WPRA 5BYKA 1C7QA 3GFVA 1RAEA 3MRVA 5KSPA 1C9JA 2O19A 1TIPA 2CFRA 2O2EA 2BEWA 2XD9A 4NQRA 5FEMA 4YAKA 5KJ6A 1FYEA 4OIFA 3GEHA 2WWXA 3A4LA 3PCRB 4I1VA 5CX1A 5ED0A 5G1OA 3LW7A 5SY9A 1Y3DE 3E23A 1H05A 3G88A 5ETJA 1BYIA 3DFUA 3Q85A 4F4DA 4L2IA 1Y3AA 4TSKA 3K70C 4HDNA 4IXNA 5LLDA 2JHCA 4JU9A 2PUJA 3SSMA 3K31A 1I1OA 4CT0A 4HEA1 3LYHA 3Q1KA 4XQEA 5KQRA 4P7JA 1XJCA 1XKXA 3HI6A 3RSCA 4NH4A 4QXMA 3FROA 1I4EB 2PZKA 2X0IA 1EIZA 4PLYA 3MMNA 3GT7A 3T7IA 3AR9A 4KN8A 2XVMA 3D6HA 1JJAA 3PQEA 4E13A 4KLAA 2MYNA 5JADA 1EUYA 3B78A 1W19A 3CUUA 4DIKA 4TX1A 1GZVA 2OZLA 4LRYA 1D09A 1YOVB 4YH1A 2NYAA 3ZJVA 4RNDB 3QXSA 2ZJOA 3BWVA 3BX1A 3CVUA 1LVGA 1U9YA 4FEGA 3IOBA 3D64A 4MVJH 5IHXA 4RENA 1XMQB 2N75A 4RESA 2H92A 4UTOA 3T1HB 3AUSA 2PFSA 3E82A 5GINE 2OECA 1X3SA 3FTCA 1SVUA 3OZIA 1U5CA 2FFJA 3JALB 4JBXA 5HRCA 3ZG6A 2GRUA 4ARZB 2H16A 4MW0A 3PXUA 4Q93A 3KV1A 3K0AB 3C7AA 4FWTA 1KI7A 2OORC 3SIXA 2ARKA 3KQTA 4ZANA 4N6NA 4FWBA 3PUKA 3TLKA 1DCTA 2YXBA 3WRWA 4MQEB 3KQQA 2VRNA 3C8ZA 4MQMA 5BYAA 4ZVSA 1QH1A 1MJHA 2NNLD 1V8FA 2M6SA 2PBLA 2VDQB 5DXJA 3O6VA 4NBVA 4ALNA 1LKZA 5A03A 1OIXA 3KC2A 3FUCA 2G08A 1F8GA 3TQSA 5AKKA 3SC3A 2PGJA 1ONBA 4CG3A 1EP9A 4CPDA 3HBFA 3WK6A 5DNYB 3FCAA 4PQYA 5T8KC 1TPZA 3GWGA 4QO8A 2AS0A 1E9FA 2RH9B 3MJ4A 3QA3E 2SNIE 5F77A 2FOXA 1PW5A 1JHPA 3IIIA 2LD4A 3KJZA 2V5AA 2LKCA 3EJ6A 4FX5A 2XMGA 3K0FB 3KTAA 4UVIA 1JAZA 1EWRA 2GCPA 1KSGA 3DVAA 4HJXA 1Q7GA 1IRIA 4LNUB 4YT5A 3H16A 4CV2A 5DTIA 4BQEA 3ZOZA 5I6DA 4LGMA 1LK7A 2QMUA 3LDHA 3VTZA 4JL5A 4NJEB 4K6KA 5CHYA 5B55A 4EG6A 5B6JA 5HUHA 1G2OA 1DXYA 5LP6B 3UGTA 2FEPA 3DL4A 3KQVA 3RWMB 2X77A 3V1YA 1AF4A 2XTAA 2ZT8A 1XCOA 5KTOA 1N5LA 1N8TA 5CDUA 4UU0A 3FA2A 4RA9A 2XYHA 4ME6A 3N0WA 2Q21A 2RH5A 1S3FA 5BYBA 4M49A 4EZEA 3K71B 2IHYA 3QI2A 3IJEB 3SZ3A 2MU1A 1QRDA 5ALNA 3OM8A 4J91A 2GN0A 3TZBA 3KHTA 3A28A 3JWPA 3N0TA 4JXJA 1JB1A 1LS1A 1MC8A 3H99A 3OZBA