4M49A

Lactate dehydrogenase a in complex with a substituted pyrazine inhibitor compound 18
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 2-amino-5-aryl-pyrazines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
molecule keywords L-lactate dehydrogenase A chain
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m49A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m49A02
1V3UA 5CAEA 1E5QA 1PQUA 3PQFA 1R15A 3O03A 3QWAA 4S3MA 3JQ9A 1N9GA 4FJ2A 5KJCA 3L6OO 1WZEA 1LC0A 3HE3A 3PHIA 3ZU3A 3BTUA 3VH4A 1EQUA 1HDGO 3WIEA 5I7VA 4AJ4A 3WJ7A 3ONDA 1UXKA 1HEUA 2I66A 1BDBA 4R3WA 4CM8B 3BHJA 4BB6A 3OF2A 3PHHA 4Z9XA 5JO0A 2OUIA 3SXPA 2HKIA 2NADA 1XG5A 4EW6A 3FWZA 4YWJA 5K0ZA 3GEDA 3GA0A 2HUNA 1LRKA 3LDHA 3DFZA 1IE3A 4J49A 4EJ0A 1T4DA 3HN2A 5TRTA 2YYYA 3DHNA 4R9SA 3CKYA 4YAGA 3TZHA 4CV3A 4GMGA 1ZSNA 3QJ5A 4BO9A 2HK7A 3NGLA 2GD1O 4RDIA 4JX8A 4OAQA 4PIVA 1OZAA 2HRZA 5ER6A 5IZ4A 3B1JA 4YAKA 4DMLA 1VKNA 2HJSA 3LT0A 4IDEA 1KEUA 1EVYA 3H9JA 3KUXA 1DFHA 4GBJA 3OJOA 5GZ3A 4NJOA 3BMNA 1XA0A 2PTGA 3LF1A 5L40A 1JKFA 1LJ8A 1UXIA 1V6AA 4ND3A 2B83A 4CMKA 1C0KA 1HDCA 4FC7A 2FHSA 2Z95A 2B5VA 3QIVA 3KOUA 3SJ7A 2NVBA 1OMOA 1BWSA 3W1VA 1IZ0A 1WDMA 5DBIA 2DUUA 4OSPA 1HDOA 4PLVA 7MDHA 2POQX 1U4SA 1XU7A 3EY4A 1D3AA 3JSAA 1V0JA 4LW8A 4JXKA 1HKUA 4UAGA 1A9YA 2DM6A 3ANLA 4UVIA 4CLDA 1IHYA 3FTPA 4BL5A 3E1KA 1HYHA 2BKAA 1G6KA 4CQMB 2VHZA 4QT0A 4XYGA 4N5MA 3PJDA 1GY8A 4Y6SA 1DC4A 4KZPA 4RDHA 1Y8QA 5L53A 4MKXA 4Z0PA 2P4HX 4KWHA 2HRBA 1E3LA 3RUCA 4E5YA 3SEFA 3W4JA 2EJWA 4AFNA 1EEHA 2EP5A 2JFHA 3DBRB 3STHA 3TZKA 1QYDA 1M6WA 4BO6A 2QHXA 4RVDA 4J7XA 3TPCA 1C14A 4YEDA 2JAPA 1ENPA 1NVTA 1A5ZA 2GN4A 4GAEA 1T2EA 2NVWA 1DLIA 1UDAA 5LDHA 3DHEA 5KTKA 4KP7A 2CDCA 4O59O 1XQ6A 2C59A 2J3HA 1XYGA 3ADOA 1U8FO 2UAGA 4EEXA 5A3JA 3EHEA 1KEWA 3F4LA 3ZWAA 5G4KB 1F12A 2FZWA 3FPCA 3JQCA 3ZNPA 5F1KA 4J9VA 2WMDA 4IJVA 3RUDA 5KJ6A 4FR5A 3JQBC 2VYVD 1X1EA 2NU8A 1WW8A 2YV3A 3EDMA 5EINA 1PL7A 3VDRA 1XCBA 4IMPA 3MJEA 1HL3A 3IUSA 3DAPA 4G81A 2D3TA 4TWRA 5THKA 3FNGA 3KYDA 2IZ0A 3UAGA 3BMCB 4PGFA 3RVDA 5EESA 1T2AA 2O7SA 3X2EA 1CRWG 2E37A 3ASUA 4ITUA 2Y1GA 1G0NA 3GDGA 4WPGA 1E6UA 3RBVA 1DAPA 2FPIA 1LDNA 1TT5A 1Y5MA 2VT2A 2W2KB 3S2IA 2OORA 1Y8RB 1P0FA 2EW2A 3ROPA 3DO5A 4XA8A 3ZWNA 4R16A 2WTBA 1PX0A 3OEWA 1IUKA 4K6FA 3O26A 1WPQA 3FNEA 4CMAA 1NASA 4FOOA 5TGDA 2ZCVA 4TZKA 1C1XA 4RZIA 2TMDA 3QP9A 4R51A 4UVHA 2JD2A 1ZMOA 4BIIA 5IZCA 1EMDA 2B4TO 3KO8A 3WX0A 4AICA 2UUOA 1IHXA 1DIHA 2Y0CA 1FXSA 3MZ0A 2O48X 5L3ZA 5AQ1A 2P9CA 3DZJA 3LSYA 1MV8A 4RQTA 2GN6A 4EUHA 4OO3A 3GHHA 4IUYA 3CMMA 4FFMA 3SC6A 3WOHA 4S1VA 1H5QA 4IINA 1E3JA 1XQ1A 1YOVB 3OBBA 3JV7A 3PK0A 1NAHA 4IDFA 4CLEA 2WYUA 3EW7A 5L51A 2Q49A 3EMKA 4CR8A 4QX6A 5ITWA 3F4BA 1KOLA 1CERA 4A5OA 1C1DB 3GDFA 3FR8A 2X9NA 1B2LA 1UZLA 3CH6A 4B4UA 2J3IA 4BMNA 5F1OA 2RIRA 3OA0A 2DFDA 1DIGA 4D42A 4RVGA 4BNZA 1F06A 1UAYA 4HNHA 3S1LA 5I7FA 5KJFA 1BTOA 1S6YA 1K5HA 1BHSA 4DYDA 2VWHA 4IQ8A 1RWBA 4Q3EA 4WLEA 4YR9A 1CJCA 1K6XA 2ZQYA 4GX0A 3C85A 3JQ7B 3RIHA 3ZW9A 2EERA 5L7TA 4JN6B 1Q7GA 3B70A 4NR0A 3KETA 2GGSA 3GG2A 3P7MA 1I8TA 1QV7A 1YDWA 1ZK0A 2OGUA 3F1LA 2FWMX 4MDHA 5CDTA 2Q2VA 1PIWA 1FF9A 3DXFA 2P5UA 3G0OA 3WS7A 1JTVA 2I6TA 3GRKA 3L9XA 4KTTE 1LLUA 2DPGA 3EC7A 4J6FA 3KYCA 2D0IA 2VT3A 4F6LA 2VUTA 4NBVA 5H81A 1CQJA 4CM7A 3UW3A 5B4UA 2EGHA 2AMFA 1PZGA 2E82A 3DTYA 3WWYA 3E8XA 5IJZA 3GF4A 6ADHA 2O3RA 4FN4A 1AXEA 4DC0A 1ZKMA 4OMUA 3UCFA 3VPFA 5BSGA 1QG6A 5DZSA 4TMFA 3AY6A 3DZHA 4B8WA 4DPLA 3QVSA 2ILTA 3LT4A 4C4OA 1JAYA 3V1UA 1XGKA 2D8AA 3HZZA 4JIGA 4ZA2A 5EN4A 4CQLA 4JCOA 4ZD6A 5A9SA 1HF3A 3WGZA 5HWSA 5KIAA 2ZTLA 4Z9FA 2O50A 2A94A 3WYEA 4TZTA 2W4QA 4MVJE 4FDAA 1I3KA 2DBQA 3S55A 4PLWA 4GX5A 3WQQA 2EJVA 3F47A 3QRWA 1P9LA 1BVRA 3GFBA 3K6JA 3TQHA 1YH3A 4DREA 3ZNNA 3GT0A 3JD0A 3U62A 2EWMA 1QRRA 1YBVA 4YJFB 3ANNA 3W6ZA 3FBTA 1QV6A 2BFAA 2CFCA 4CLRB 5BR7A 5JLAA 1R0SA 4B3IA 2I67A 1R0KA 4J2OA 5A3VA 4CMGA 3DZGA 4FFOA 4L4RA 4WCFA 5IAAA 3BTSA 4DLLA 1UXHA 3ZWCA 1H94A 4MVJM 4CQMD 1DDOA 4E2XA 3ZWPA 4QFCA 2BD0A 3G3EA 2VHYA 3QSGA 4WNIA 2NSDA 1K6JA 1UJMA 3ASVA 1CQIA 1A71A 4XQEA 2A35A 4ALJA 3L6EA 3KV3O 5JC8A 3KBOA 5A06A 1BXGA 1A7KA 5LC1A 4PG4A 4XJTA 1B0AA 4Y8VA 3N7UA 4E4YA 4E2YA 5JAIA 2GF2A 4M86A 5C7LO 2B37A 1NBOA 5THQA 4J43A 2V6FA 3NJ8A 3LC2O 2QIOA 3PEFA 1D8AA 1ZH8A 1ISHA 1YL7A 2BELA 4QFDA 2CD9A 3GZNB 2O3QA 2OHXA 4E32A 1GPDG 4IBOA 4BOYA 3BA1A 1SOWA 2J3KA 4YJGA 2ZJ0A 4EITA 1T24A 3WMWA 1ORRA 5G0UA 2D59A 3TFQA 1PGQA 1EUDA 4MOWA 2IXAA 2GPTA 3QY9A 1V3TA 2ZYDA 3EZLA 3D3WA 3DC2A 1ONNA 4X54A 4ZHSA 1NFRA 1C0PA 4MP3A 3RAJA 2X86A 4DPKA 3F5QA 3VC7A 1EFKA 1NPTO 3IOYA 1NQAO 4B4WA 3ZWBA 3HSKA 4YJHA 4B7UA 1MUUA 1YJ8A 2NU6A 1TT7A 1JU9A 4IIUA 1B7GO 2XF8A 2VQ3A 4QECA 1MX3A 1AUPA 1DSSG 2HQ1A 3R1IA 1RKXA 4XB2A 1R4MA 3ROKA 3WBFA 3IP1A 3U09A 1ULSA 2AEMA 4BKQA 3IS3A 3HFGA 1G1AA 2DLDA 3KVOA 4A7PA 3JQ8A 2WSBA 3F46A 2QZZA 5JDCC 2HO5A 3ZHXA 3U0BA 4GKVA 3PRJA 4WGGA 3N58A 2QG4A 5CFZA 1B14A 3MCVA 1BDMA 3G17A 3O9ZA 2QRLA 5B4TA 4BO2A 3RBZA 4O5OA 5G0WA 3I9NA 2PWZA 1MC5A 4DIBA 4ZJUA 1P33A 2GCGA 3WGIA 1E1KA 3F5SA 3HFSA 1Z7BA 3IKVA 3FTNA 2WE7A 4HFJA 1HSZA 2RH8A 2GR9A 5FYDA 5CEJA 3DAFA 2B36A 3OETA 4BKOA 1X0XA 1EE9A 3ABIA 4HX5A 4CL8A 2WDZA 4JJIA 2EEZA 4CPDA 1PR9A 1QR6A 3T7EA 4O6VA 5I8ZA 2D2IA 2O3JA 1D1SA 1EBFA 4XRRA 1HYGA 2HMTA 3ZH2A 3EGOA 1W4ZA 3RBXA 2FSSA 3CPSA 3AM4A 3AWDA 4IXTA 5A05A 2Z5LA 4RVSA 2YV2A 4L75A 1GYQA 3BIOA 1RYDA 1QYWA 2OP0A 3VHRA 2I3AA 1QXSA 1VC2A 4UVDA 1P74A 3AY3A 4R1TA 4R9RA 3WJAA 1L7DA 1O9BA 3QE3A 4I9NA 4OKNA 3QVOA 4NZ9A 2HSDA 4YACA 2Q4BA 4J1TA 1ZSYA 2DBRA 3AFMA 3ZI0A 5KVCA 1PJCA 3KYBA 5BNTA 5IXYA 4KQWA 4W7HA 1E7WA 3Q6IA 5AYVA 1PGNA 2D4AA 5ENVA 2YJZA 2V6BA 4M8SA 2Q1WA 4UREA 4E31A 1M2WA 2GDZA 2FOIA 4J16A 4PLCA 1N9GB 2PR2A 3PPIA 3GK3A 1PZHA 2O2SA 4NJMA 3ZV4A 1R4NA 4JBGA 1PEDA 3WGGA 1I36A 5K9ZA 1HZZA 2CZCA 3PYXA 4IDAA 3GMSA 1JW9B 4QO8A 4GQAA 1ZK3A 2H5LA 3BMQB 4XCVA 1PU2A 2G5CA 1QORA 5ILOA 3NTOA 4DVJA 3WG9A 3JQFC 1EVIA 5CPFA 4J4BA 1Y9EA 1B15A 2DTXA 1TVEA 2VYNA 1E7RA 4CMEC 1XWFA 1XLTA 1KERA 4LVCA 1HRDA 3OQ6A 3D1LA 3R0IA 1V35A 3OSUA 4AJNA 1LXCA 1EQ2A 2PH3A 3UFXA 5FWNA 4NK4A 5KJ1A 1Q0LA 1PWZA 4BMSA 4E2WA 3RC9A 1DB3A 3IC5A 4I5DA 1PZEA 4CUJA 1PR3A 4RPLA 1ZIDA 1H6BA 1GD1O 1ZW1A 4BNIA 1Z74A 1MC4A 2C29D 5G0TA 3S2GA 2JCVA 3TRIA 3L0DA 2WE8A 1ADGA 3WSWA 1P1IA 1GL3A 3Q11A 2J8ZA 5L4SA 1FK8A 1I3MA 2I76A 3DL2A 3MJCA 4P4NA 1ID1A 1DBVO 5JDIA 1P1JA 3UHAA 4W4TA 5HBRA 4E12A 4EBFA 2SCUA 2OBNA 2P9EA 3WGTA 1ZEMA 3WDSA 3E03A 5DN9A 1X7GA 2C5EA 1D4FA 2E48A 2Q50A 4DIOA 5DCWA 2A9FA 5GY7A 1KYQA 5F21A 1NR1A 3DDNA 4LK3A 4UVGA 5AXBA 1HZJA 2JKVA 3H5RA 3DHYA 3PHGA 4PZCA 1K6IA 1KY4A 1PJBA 3S2FA 4HADA 1WLYA 1UP4A 3KHUA 1E3WA 4DL9A 4GLLA 3T4EA 2P4QA 3VKUA 3R6DA 2O3SA 1LLQA 4I9UA 2HK9A 3CXRA 1Y8QB 3IMFA 4TRMA 2IYOA 3DBVO 4DGSA 3PFWO 1SPXA 2NACA 2B4RO 1I10A 1KIFA 1UZNA 3U9LA 1E7MA 1LSJA 2VRCA 3UXYA 3CE6A 2YV1A 5AXDA 2GN9A 3NRCA 4AJOA 5DT9A 2ZKLA 3ETDA 4F6CA 4R1SA 4BUCA 4ND5A 3MJ4A 4RLHA 2VZ8A 2BLLA 5U9CA 1E3IA 4J1QA 1GCUA 3PGJA 4DPMA 2Q99A 1JQBA 5GZ6A 1LX6A 3PQEA 2Y67A 3GNQA 3LZ6A 3FBGA 3IQDB 5EMHA 3ONEA 3Q2KA 1H6DA 5C37A 4GH5A 1KVTA 4BS9A 1PTJA 3ZU4A 4A0SA 2AEFA 1P44A 2C54A 4HFRA 2ZB3A 1DO8A 4PFJA 1EVZA 3KYDB 4UEKA 3AY7A 5KVSA 1LSUA 1I2CA 1ZBQA 3K2EA 3ROMA 1GZ6A 4E30A 1XEAA 4TVBA 4XQ9A 4ZN6A 4ONEA 3OMLA 5A9TA 2X0IA 3I23A 1DXYA 2GZ3A 5JCJD 3PXXA 2IDZA 4CM1A 3ANMA 3RWBA 2E4AA 3GR6A 2DBVO 1XELA 5JAMA 2QRJA 3JYLA 4H3VA 3BMOA 3HJAA 3FRJA 2I65A 4D43A 4QTZA 5EQDA 3VOSA 4CMJA 1MFPA 1Z7EA 5IDWA 1LI4A 2Q4EA 3WMXA 3M1LA 4ZVVA 3RC7A 4HV4A 3GVHA 4IMRA 5IFLA 3RFTA 4YT8A 2NU9A 1DJNA 1ISMA 3PVZA 3ZWMA 1DHTA 1J0XO 2WD7B 3DOCA 2OXIA 3ZWOA 1Z82A 4BNXA 5A5FA 5H83A 1C1XB 5JNLA 3JQ9C 3D4PA 4IJKA 1XHLA 2PGJA 4JBHA 4BNKA 5T6BA 3RUIA 1O94A 5HS6A 5H82A 1AXGA 2B0JA 2ZJ1A 1YKFA 2EKLA 3ICPA 2HDHA 5ADHA 1R66A 1PQWA 1Y7TA 1CIVA 1A7AA 4YJDA 5KVQA 3VTFA 3G1TA 4FGSA 1M6HA 1DIRA 3FNFA 2FRDA 4RVUA 1YONA 4U6SA 4ZQFA 3IJRA 1UP6A 5I9MA 4BVAA 5JE8A 1KC3A 1N2SA 1EE2A 3AUSA 4IIVA 4UULA 4BO1A 2X7HA 5KKAA 1XIVA 5F1PA 1RM5A 2BHLA 1FDSA 3JD4A 5TC4A 4Y98A 4Y6RA 2X5OA 1MP0A 2WYVA 2PA3A 4OM8A 1SO8A 3WR5A 3I6IA 5T64A 1UAGA 4RCVA 5KWEA 4LSWA 4BNHA 4OJNA 2NNLD 3EZYA 1LDEA 3O8QA 1YQGA 4MVJA 3DAGA 4HUJA 1VJTA 4NBRA 1R6DA 3R3JA 1LRLA 1YQXA 1GU7A 2IE0A 5DULA 1GV1A 4QUKA 1DRUA 2VUUA 1X7DA 4CV2A 1YB4A 3WBBA 4J7UA 1KEPA 2BFOA 3VPGA 4DQXA 4RV9A 3ADPA 3DOOA 2Y66A 1HXHA 4J90A 1VE9A 3OJEA 3V2UA 4HWKA 1SB9A 4FS3A 4WCDA 4J1SA 2VZ9A 3RUHA 1NHGA 1NVGA 1N5DA 4P4GA 3A4VA 1NQ5A 4A26A 4YT2A 2X8LA 1QLHA 3FSRA 5CDUA 2DT5A 2YY7A 2RCYA 2Q2WA 4P8RA 5TT0A 1F0YA 2VZ0A 4AJEA 3WLFA 4D3SA 1VJ1A 4CQLB 4O63O 3C3XA 4XWYA 3HDJA 3KTDA 4HBGA 3GPDG 3DZKA 3H9EO 1E1NA 3UICA 2W2LA 5HTOA 1WDLA 1WXDA 2J5QA 1P45A 8LDHA 2BMAA 3ZV5A 1F14A 1QSGA 2X0RA 2AHRA 3GAZA 2I9PA 1P1KA 2CDBA 3H8VA 3CINA 3CTMA 3UGKA 1HLDA 1ZZEA 3GRPA 2PD3A 5TNXA 2YQ5A 2JCYA 3GC6A 1GFSA 1Q0QA 5JMWA 4KTVE 1GYPA 3B1KA 1YB5A 1HE2A 2Y68A 4R1NA 3V5NA 4UEOA 1HYEA 4D45A 4KUGA 2AG5A 4PLPA 2EF1A 1D1TA 4E13A 2VNSA 3KEOA 4PG8A 3VZQA 4OKIA 1HWYA 1U28A 4OHUA 4WCFB 3PJFA 4L8VA 4BGVA 1KVQA 3MWDB 4OXKA 1JVSA 5ES3A 1JWAB 5B4VA 3P2YA 2RHCA 3LYLA 3LLSA 3BHIA 1GAEO 2EIHA 4Q39A 2YHIB 1PJQA 3DWFA 4NBUA 4FB5A 2DC1A 1IB6A 2IEDA 3RSHA 3WNQA 5JYEA 4MINA 1PL6A 4D41A 1P31A 4YVFA 1BXGB 1JKIA 2QZ9A 2PGDA 2Y05A 3T7CA 4B3HA 1RPNA 2WWRA 3K92A 1L1FA 3ZWXA 2OFPA 3EYWA 1I3NA 3OIFA 4I5GA 4CUKA 3GN2A 1TI7A 1KVUA 1NAIA 2C7VA 5I8WA 1ULUA 3RU9A 2X1HA 4XIYA 1E1MA 4WNCA 3SC4A 4IDGA 5A4DA 4HXYA 2DKNA 4Q3AA 1K2WA 1NNUA 1I0ZA 2BF7A 4BNWA 4J0EA 5IZCC 4NH4A 3ZNOA 1Z73A 2XPCA 3RUAA 1E6EA 2GRAA 1Y5RA 2UVDA 1HETA 2GZ2A 2Y0EA 4LSMA 4XEHA 4YYZA 4LVUA 4YDRA 1K89A 4KUEA 4W9NA 4QXMA 3GVCA 3HDYA 2CVZA 2O23A 3D3WB 3K2BA 1EUCA 1X14A 2FPPA 4BO7A 4PLTA 4EUEA 4XDZA 5EQFA 2HMSA 4RVHA 4ZGWA 2CVQA 4UUNA 3ON5A 1E3SA 4F45A 2EG9A 3ENKA 3V2GA 2PK3A 3EUWA 4XR4A 2GASA 4GL4A 3TOZA 3ZCXA 1O8CA 2X0JA 3GEMA 4W9NC 4RO0A 5EERA 2VN8A 1VSUA 1GTMA 2JHGA 3WIDA 4DXHA 4CLOB 1U2DA 4E5MA 1R4MB 3PHLA 2JD1A 2YUTA 3JQ8B 4MVJG 4FGWA 4BNUA 5A03A 3GZ4A 5L7YA 5CDYA 3CMCO 3JQGA 1VPDA 4AJLA 4C7KA 4BQPA 3E48A 4DIFA 3PP8A 1ENOA 3C24A 1C0IA 1HDXA 1MLDA 4J4HA 4JNKA 2Y1CA 1H9BA 4XGKA 5MGBA 4EGFA 1GQYA 2Q1SA 1Q7CA 1YQDA 2AW5A 2Q1TA 4A2CA 3G1UA 4AG3A 4J7CA 1B3RA 2I3GA 6LDHA 3H6KA 4URFA 1Y81A 1OC4A 4EEZA 2DFVA 2FN7A 5JCXA 1P0CA 4CMBA 5J23A 3Q2IA 1W8DA 3AU9A 3DBRA 1MXFA 4JBIA 3UN1A 3QLJA 4AJ1A 4RPJA 4D0SA 4FQ8A 2ZK7A 5DP2A 5EIOA 5FFFA 1B3BA 2A92A 3EAGA 5FI5A 4ALNA 2VTDA 3AI2A 3UUWA 1W6UA 1N7HA 3ITKA 2XXBA 2WEKA 4K9DA 3RFVA 3VH3A 4AJPA 3H5AA 1C3VA 1CDOA 4E21A 3UF0A 2BI7A 4B8ZA 1WZIA 3WWZA 4RL6A 1ZK4A 1I2ZA 3C1AA 1GQQA 2DTDA 4R1UA 4HP8A 5ENDA 3HNPA 5L4NA 5JXWA 1DAOA 4E5NA 2QYSA 3PYMA 5ITVA 5T8KA 2PV7A 2YQ4A 3ZV6A 4E0BA 4M54A 4A10A 2B69A 3B1FA 3RC2A 3SLGA 5TLSA 1F17A 1HDZA 1H9AA 3PQDA 2NWQA 2BRUA 5HRUA 5ER9A 5F5NA 2PNFA 2EHDA 4ZQBA 5I9LA 3JD3A 1XKQA 3JQEA 2PD6A 3PZRA 4NJMB 1VRWA 4E3ZA 2O4CA 3K31A 1YRLA 1OAAA 5CG2A 3ZV3A 1DFIA 4N5LA 2HJRA 2Y1OA 3TWOA 5KNLA 3GMDA 1TXGA 3OIGA 4Q3DA 2OZPA 4AJKA 3JQAA 3D3EA 3PWZA 3KSDO 1DFGA 3A9WA 4ZQEA 5MDHA 4MVJF 1Y8RA 1HSOA 3DZIA 4WCFC 4YCAA 3RC1A 1GZ3A 1E7SA 1B8VA 3JQDA 3F1KA 4RQUA 2NU7A 1GV0A 4NFHA 4XZ3A 3GVXA 3GAFA 4II2A 1JAXA 3GGPA 4K28A 3AOEA 1N7GA 1Z45A 3D5TA 3KLPX 4GI2A 1J6UA 3AUTA 1IL0A 4Z3KA 4GPD1 3LT2A 3FR7A 2D5AA 4BNFA 3I9LA 4Z9YA 2GN8A 3QVWA 3H9UA 1BXZA 5HS4A 3PI7A 4MJLA 3NDIA 3OJLA 5A02A 1KBZA 2NLOA 3AI3A 3CIFA 2UV8A 3RUFA 3AOEC 4D0RA 4EJMA 3AOGA 3WGYA 4BQRA 5EPOA 1JVBA 2GO1A 1YOVA 1RJWA 3K8ZA 2HK8A 2CF5A 3RKRA 1LSSA 3GH3A 4J9UE 1XR3A 5C5IA 3A1NA 2YZ7A 1LC3A 2PD4A 8ADHA 3HB5X 4WECA 4GGPA 5DNAA 3I83A 4G2NA 5TF4A 2B5WA 3LT1A 5TX7A 2EXXA 2IRWA 2CUKA 1U3TA 1U7HA 3PYLA 3VPXA 2BGLA 1U4OA 4XDYA 1I2BA 3H2SA 1MA0A 1M66A 1MXHA 3GGGA 2Y0DA 3Q9NA 3P19A 5DF1A 1E3WB 2AXQA 4TVOA 1KC1A 1LBEA 1VL0A 4J0FA 4LCEA 1UP7A 3I5MA 4F3YA 3CUKA 1U9JA 1ZK1A 1R37A 2OOSA 1PJSA 3VTZA 3WICA 1A72A 5KVVA 1PQPA 1TLTA 2H63A 4NK5A 3V1YA 4I5EA 4CM9A 3I1JA 4EZBA 1NR7A 1T1SA 3WFJA 4FFLA 4GKBA 2W8ZA 4XD2A 1Q7BA 1BGVA 2EKQA 3GGOA 4KUHA 1CF2O 3L4BA 3PHJA 4R01A 1MGOA 3AM3A 4BMVA 1GADO 3MOIA 3GQVA 1BMDA 4IXWA 4ZQHA 3CEAA 2GUGA 3TNLA 3KLMX 4CMIA 4DBVO 4FIZA 3GOHA 4I1IA 2OL4A 2HCTA 2WM3A 2WJPA 4OSOA 4FSHA 4P4LA 4CJXA 1OC2A 3RJ5A 1NTOA 2G1UA 2JCXA 1SCUA 4W82A 2AE1A 5IXSA 5JBIA 3GDOA 1U3VA 3I9JA 1JN0A 5IDYA 3PIIA 4H16A 2BH9A 2J6IA 4D3DA 4FW8A 3ZW8A 4D79A 4Z0TA 3RQSA 3PJEA 3ST7A 3JYOA 1JWBB 1W73A 4NMHA 4CM4B 4QO7A 2VOEA 5DDIP 3GVPA 2JHFA 1FDVA 3INTA 4LMRA 4DYVA 3NT4A 3V2HA 5DBGA 2ZB7A 4LISA 4CLHA 4ROSA 5TT1A 1YO6A 3BMOB 4XQGA 2VCYA 3JD1A 3RFXA 1IY8A 1R0LA 2ZTVA 1G0OA 4IY1A 5HM8A 3R3SA 4Q3NA 3IDSA 1E77A 3A06A 4O1MA 3DMTA 4YBZA 4CLRA 4XRGA 2IXBA 3DBHA 3I9MA 1SNYA 4YPOA 4AJHA 4CM6A 3G79A 5IDQA 5CEFA 4Y67A 1E1LA 2FR8A 3E82A 5BT9A 2JL1A 1ZEJA 3QV1A 4QSMA 2JFFA 1U5AA 5K6AA 3ZGYA 2G0TA 4N5NA 3WQSB 2VRBA 3OFSA 1EK5A 3UCXA 4FJ0A 4OIMA 3HADA 1WMBA 3OJ0A 1ZJYA 3A14A 3D4OA 2E49A 2YDYA 1VL8A 3NJ4A 4DBZA 4YT4A 2BGKA 2PZJA 2W98A 3AUUA 3HUDA 5T57A 4DA9A 5DCUA 3A28A 2VHVA 4ID9A 4EYEA 3FPLA 2W90A 2H6EA 4XQCA 1DRWA 2VWPA 4PG6A 5JYDA 5DOVA 4IZIA 2PKQP 2X9VA 4NDNE 3IKTA 1O5IA 3BMNB 3HDQA 2DUWA 2R6JA 3AJRA 3HDHA 3D64A 2X6TA 1H2BA 1Y9AA 4NNJA 4LN1A 3ETGA 2DQ4A 3PWSA 4MO2A 4MIEA 5AVOA 4YRBA 1EDZA 4BNLA 3DZFA 1AN9A 3IUPA 4MP6A 5CG1A 3AI1A 1T2DA 4N7RA 4YB8A 3VVCA 1MG0A 4LRSB 5JDIC 1YBAA 1NWHA 2C82A 3DFUA 3ITDA 4XB1A 3E18A 4MIOA 2ZB8A 1ZXBA 1PJ3A 2NVUA 1P77A 1EFLA 1KEVA 1P1FA 3HB4X 1B8UA 3LQFA 3Q0EA 3WGOA 3W4KA 5FEUA 4RF5A 4KOAA 5JCJA 4WOKA 4ILKA 1U3UA 9LDTA 1ZFNA 4FFRA 4R5HA 1Q1NA 4NQZA 3C1OA 4CLXA 2A4KA 1DPGA 3INGA 4YTEA 5JS6A 1FDWA 5I7EA 5CHEA 2IZZA 2DAPA 3W4IA 1X7HA 3WGHA 4M87A 4I5FA 3TFOA 1ISGA 3GNTA 1H2HA 4E5KA 1BRMA 4BNNA 1A4IA 1U1IA 5AXAA 2DU8A 4D7AA 4GX2A 4I9HA 1DEHA 3M1AA 1IOLA 3NV9A 1ADBA 3DBLA 4CV0A 1RM0A 1LDMA 3F9IA 4LGVA 5A04A 5L7WA 4OQYA 3P2OA 2OP1A 2NQTA 4CM3A 5BSHA 2D1YA 2XAAA 1E7QA 1QYXA 1ZO8A 3GVIA 1X0VA 2R00A 3QVXA 4PZDA 2YFQA 3FI9A 1SEPA 3VH2A 3VZPA 5FI3A 1PSDA 1SBYA 4DQUA 5ILGA 2CY0A 4XX0A 4BNMA 4K1LA 1YL5A 3VKVA 4ZQGA 1TT5B 2D5CA 4HFNA 4D3FA 2Q3EA 5T5QA 4BGEA 3FN4A 3PDJA 2EKPA 1EUZA 1QKIA 4N18A 4YRAA 3VZRA 4J4TA 1J5PA 3C8MA 3WNVA 3NTRA 4YQYA 1O6ZA 1GUFA 3AW9A 2QW8A 1B8PA 4WK6A 1H93A 3ZDFA 3VDQA 2V65A 3DTTA 2OMEA 4OYRA 4Z0HO 4WKGA 3AU8A 1I33A 2H9IA 2ZQZA 2VRCD 2AG8A 1FDTA 2JAHA 1QYCA 3MTGA 3MTJA 1HE4A 4BNVA 4ZU3A 4L74A 4BB5A 3EVNA 2Z1MA 1EZ4A 5L4LA 2P91A 4MKZA 3BXXA 3C7AA 3BMQA 3DR3A 4IM7A 3L9WA 4R5MA 3I52A 1ZSVA 1NM5A 1WVGA 2H1SA 4K26A 4M1QA 4P22A 2QRKA 3JD2A 1N8KA 1PJTA 1U8XX 1P1HA 2PGLA 4NBWA 4A27A 4DLBA 3OIDA 3D4NA 4H7PA 4RPGA 3H9GA 1GYRA 4U5QA 5G2OA 3NX4A 4XYEA 4PVCA 1NFFA 2PLAA 4AJ2A 1QMGA 1KS9A 1Q2XA 2UDPA 5ICSA 4IS2A 2QX7A 3PWKA 4UUOA 1A4UA 2C20A 3NDJA 4IGEA 5TS3A 3GPIA 1J4AA 3FF4A 2B35A 3TSCA 2OBYA 2VYVA 2B4QA 1YB1A 4B4VA 4FOSA 2VOJA 3O38A 1T2FA 1BW9A 4MKRA 5GZ1A 5CDGA 1GUZA 1HE3A 3PGXA 1A9ZA 1UXGA 2R2GA 3BAZA 4PLGA 3GUCA 5IN4A 3TF5A 1EVJA 4GVLA 3JTMA 2NQ8A 4K6CA 3NKLA 3H5NA 1SEVA 2LDXA 1M67A 4BV8A 4M49A 1TB4A 1QYVA 3JQGB 3PJGA 3KYCB 3FCOA 1YJQA 3GEGA 3RKUA 4KQXA 5JW6A 4CMHA 1I30A 1KETA 4YQZA 1DOHA 4L73A 3ULKA 1GCOA 3WTCA 1YBMA 3L4SO 2YW9A 4W6ZA 4AVYA 1ZXLA 9LDBA 4FBGA 2NUAA 5CEEA 4CR6A 1K3TA 1ISJA 4BO8A 3JYPA 1GQ2A 1DRVA 3H9QA 3HQ4O 1WNTA 2CMDA 2P68A 4TROA 4H15A 4UEJA 3Q9UA 5HA5A 1IPFA 2Q45A 3GLQA 4YA6A 4Z6KA 3QWFA 1Q0HA 5C7OO 4MVJP 4RJTA 4JQCA 1AHIA 3N74A 4PN3A 5A9SB 3L07A 3UVEA 4DTIA 2O7QA 1YGYA 3CZRA 4YAJA 3JQBA 1SZJG 4JGBA 4Y6PA 4CODB 3F3SA 1NPYA 2AQIA 4RLSA 2O4UX 1KVSA 3BTVA 4BO0A 5EJ2A 3KM0A 5JPIA 3ZWWA 4YXFA 1V3VA 4JK3A 2BGMA 3UCEA 3U3XA 2VNAA 4FC6A 5G0VA 4JP3A 1FDUA 1AHHA 3AUAA 1DC5A 1PL8A 4OH1A 3FNHA 3U4IA 2VWGA 2YHUA 3IJPA 3NT5A 4O0LA 1LRJA 4PLZA 4U8GA 3OP4A 5DOZA 4U0JA 5JSFA 2ET6A 2ZB4A 2Y93A 4MVJD 1ZMTA 3KB6A 1X1TA 1E3EA 3VZSA 4WLUA 2XOXA 1U2GA 1ADFA 3QW2A 3OECA 1PJ2A 3WLEA 1WP4A 4ZICA 2AEJA 1PZFA 2GERA 2ZYGA 4DC1A 4GSKA 5B37A 4NFYA 1SB8A 2JJYA 3LU1A 3VPSA 2HLPA 1V8BA 3QQPA 2DTEA 2CNBA 5TJHA 1E92A 1U3WA 2GYYA 4D44A 4RORA 3ZHBA 1ZCJA 3GY0A 3JQAB 4PCVA 3ZWYA 4XYLA 3W6UA 5L95A 3WGQA 2J5RA 3S2EA 1T4BA 3LK7A 1LNQA 4XKJA 1AE1A 2Y1EA 4CM8A 3SLKA 4I08A 4Q9NA 3OICA 1ZJZA 1B16A 1ENYA 3FD8A 5F5LA 1KY5A 2WD7A 3QHAA 4WLOA 3E5RA 1NVMB 4L4SA 4QEDA 1F8GA 1SAYA 2V7PA 1NYTA 4FCCA 3AK4A 4KDEA 4L76A 3TDKA 1YVEI 1BSVA 4YJGB 1CYDA 4BKUA 4BGUA 4CUZA 4RF4A 1LLCA 4JJFA 4XYBA 3TZCA 1YWGO 1VKOA 3RU7A 1OFGA 4IPTA 5JAQA 3DONA 4PLHA 2C5AA 2EW8A 2W2LD 4WEQA 4RGBA 2RHRA 4I8XA 3CZMA 2EGGA 1UZMA 1ONOA 3FHLA 1ZNQO 4JLWA 3DB2A 1IPEA 1XDWA 1LDGA 4PZEA 4XGIA 3OQBA 3OQ1A 4EI2A 1SOVA 4YJHB 3D7LA 5A9RA 4PLYA 1GUYA 1NHWA 1F8FA 2NTVA 3DZBA 4DMMA 1HLPA 1I5RA 1NP3A 4ND1A 1M75A 2Q46A 4INAA 4GVXA 2GLXA 4FD3A 2J3JA 3T4XA 4W99A 1WAMA 5B1YA 4EJ6A 1VSVA 1HE5A 2C2YA 4TRNA 2AA3A 2TMGA 2I99A 1NQTA 3KEQA 2G76A 3ICCA 4XIJA 1HT0A 2X23A 3INRA 3E6AA 1EK6A 3B20A 3QVTA 2ZATA 4DQVA 2FY8A 2Z1NA 3TN7A 1IZ9A 1T26A 3W8EA 2O3UA 3RCBA 1ML3A 3SVTA 1S7CA 4CQMA 4E6PA 3NTQA 4G5HA 1HTBA 4TKMA 2JFGA 5TJ9A 4E33A 1DIAA 4FFNA 3PIDA 4B79A 4CMIB 3E9NA 1PGJA 2CSUA 1JA9A 3D5QA 4LMPA 4QQRA 5KJEA 1AGNA 3BHMA 1N1GA 3TL3A 4TRJA 1N1EA 5JAZA 4NI5A 4GGOA 4GX1A 4NBTA 4RVFA 1R16A 1GEGA 4OGWA 7ADHA 3MOGA 4R54A 2IODA 5DBFA 4ND2A 5B12A 5LCXA 1OI7A 4II3A 4R41A 4OQZA 3U49A 4PG5A 1H6AA 5G4KA 3EVTA 3K73O 4ZRNA 5I9NA 2NV6A 3HWRA 1NQOA 5FF9A 3H3JA 3OEYA 4WLFA 4F46A 1JKJA 5IDXA 1O95A 2PZMA 3MWEB 2VTEA 3OH8A 1ZVMA 4NU5A 3PTZA 3L77A 3PFFA 3UOGA 5JY1A 5KOIA 1DC6A 1E0DA 2O2YA 3MEQA 4IDDA 4BO4A 2UUPA 4HKTA 2XXJA 3NUGA 2F1KA 3UH1A 2WYWA 3K96A 4RF3A 5G0SA 4ALLA 2ZIZA 3BMCA 5G4LA 1GPJA 4OOEA 1CEQA 1K0UA 4J3FA 4PVDA 4MIYA 4A73A 2G17A 1R4NB 4GSLA 4LCJA 2ZCUA 3U4HA 3RROA 1VJ0A 4JROA 2HAEA 4PRLA 3JYQA 5T8KC 1KVRA 1HDRA 1NWCA 3AFNA 2W2KA 1UR5A 3DBHB 3X2FA 2G82A 1JDJA 1LUAA 3COSA 3U4CA 1MFZA 2V6MA 4EUFA 3KSZO 3C1TA 1XSEA 3KXDA 4OL9A 1ZUD1 1LQUA 2BFMA 2VWQA 3M2PA 3HHPA 2X58A 4G65A 5IN5A 3CSDA 1PS8A 5CPBA 3QA9A 1P3DA 2YHIA 5COAA 5COBA 4J2HA 4A03A 3DMYA 3WXBA 2X9GA 2GNAA 2Q1UA 4NIMA 4DRYA 3RD5A 4IJUA 4BO5A 3NT2A 4TKLA 4TQGA 3ROQA 2ZTUA 4NPCA 5JMPA 2I5PO 5COQA 4ZRMA 3TJRA 4FJ1A 3TOXA 4YRDA 2HMWA 4TRRA 3O4RA 3TL2A 4BNTA 2FPGA 3VVBA 5IG2A 2FR0A 5LDGA 2ZTMA 1V9LA 1T2CA 1MB4A 3H7AA 1ISFA 3M2TA 4U6QA 1Z75A 4E2ZA 1L7EA 1C1DA 3DQPA 5KCZA 4ESOA 2HMVA 1QP8A 4EDFA 1UDCA 3SX2A 2VUSA 3C7DB 1GR0A 1GDHA 4IJWA 3K30A 1R12A 2O3TA 2X5KO 4IQGA 3TZ6A 4PRKA 4ALKA 4TSKA 1DHRA 2X0NA 4R4JA 4WLVA 2ZYAA 4M89A 1X15A 3ZNQA 1GEEA 4AJJA 2LDBA 3U4DA 5JDCA 3GUYA 2QQ5A 4NU6A 2NVUB 5L9AA 1NFQA 4BHTA 4C7JA 1UUFA 3D0OA 3JQ7A 1N92A 1PJLA 3QWIA 2QYTA 4B3JA 4PLFA 3JQAD 2HMUA 4BKRA 2FP4A 4WJZA 4DWVA 1YE3A 5BSFA 1I01A 4BO3A 3PZBA 3TZQA 1RM3A 5U4QA 4BV9A 5KKCA 1TEHA 4YT5A 4NG5A 5C3MA 4E5PA 2DPHA 4KWIA 3E9QA 2PKQO 1IYZA 1Z6ZA 4B7CA 3JQ6A 4AJIA 4J91A 5JY6A 5A5EA 1SC6A 2UYYA 2YFHA 4J1NA 3V1TC 5JFOA 1NXQA 1FJHA 3DEYX 2PFGA 2RH4A 5BSEA 3KSUA 1IULA 1ISIA 1LSOA 2C2XA 4IGFA 4KMSA 3DBLB 3L4BC 3ORFA 5I7SA 2EP7A 3NAQA 3KRTA 1EBUA 3FWNA 3EK2A 1YS4A 2AE2A 2Q2QA 5JC1A 4L9RA 3L6DA 3BZUA 1LDBA 1VM6A 1SMKA 2CVOA 4R68A 4CL3A 2RBEA 1W0CA 2PY6A 4PG7A 2PH5A 4HNGA 4BGIA 1UDBA 3BYZA 3VAZA 2PKRA 1GZ4A 4L4XA 4MP8A 4GMFA 2C07A 3ZWVA 1LDYA 1OOEA 4WOJA 4BKPA 1ENZA 3QWHA 1B26A 1UH5A 3NEPX 5U1PA 1UXJA 1LA2A 4FFPA 4XYMA 2BI8A 3VPHA 4U0KA 3K5PA 4CR7A 4OXYA 5JO9A 4UVEA 4WEOA 1CETA 4CMCA 3PLRA 2VHWA 3UKOA 1MG5A 4Q3CA 2Y1FA 4HY3A 4YJFA 3I9OA 4KDFA 3WYCA 3PDUA 2AQ8A 2JD0A 4W7IA 1VLLA 4CM9D 3C7CB 3BTOA 3F6YA 2WD8A 3QWBA 2FZEA 4DUPA 3AM5A 3HN7A 3S8MA 3JQFA 2PZLA 4MPDA 4N54A 1J49A 4BNJA 3IL2A 4OXNA 4CMEA 2FMUA 3GN1A 3RI3A 3SBOA 4FPXA 4WLNA 5TIIA 2CF6A 1LQTA 2PZKA 4RPKA 1T1RA 3OA2A 5CP8A 5DP1A 1O0SA 2J5KA 1EDOA 1NX6A 4LRTB 3DMTC 1ZK2A 3ETEA 1PS9A 1JLLA 4R69A 5EL0A 1BXKA 5T67A 2P2SA 5F3RA 4Z3DA 4DLAA 2DBZA 4WASA 2IZ1A 3ONFA 3RASA 1LEHA 5CDSA 1P1RA 4YAIA 3RUEA 3LC7O 4IS3A 1A27A 4HFMA 4GWGA 5K6AC 5AXCA 1Y6JA 3PLNA 4JJGA 3JCZA 3MJVA 1E5LA 3RJ9A 3GZNA 1VI2A 3IIEA 3U5TA 1E6WA 3GHYA 3IAHA 2C0CA 4JP2A 4CM5A 1PJ4A 4GLOA 1QLJA 3NDRA 5A1TA 3WSVA 2E6UX 4YAEA 1LU9A 3OHSX 4U7WA 3ENNA 3O8QB 1NPDA 4IQ0A 3ZU2A 3GNSA 4ALMA 3H2ZA 3IP3A 3WFIA 5L45A 1BW9B 2P5YA 2NTNA 3ZHZA 3P5SA 4WUVA 5C7IO 4MVJI 3GFGA 2FR1A 3VH1A 3H65A 5TQVA 3WB9A 2FSVA 4M55A 1Y1PA 1I32A 1BG6A 1X13A 2GZ1A 3OM9A 1XU9A 4XGNA 4CLOA 2CDAA 4WE3A 3Q3CA 3LVFO 2Y1DA 1YL6A 4IZHA 3ZN2A 1RM4A 1RYEA 2X22A 1H0KA 1PGOA 1DIBA 1U5CA 2X4GA 4NHEA 5ICMA 3LF2A 1ARZA 1I3LA 4NFSA 2GSDA 3LC1O 4OOFA 2IYPA 3ZU5A 5TSDA 5BQFA 1BVUA 2EV9A 5AOVA 1YDEA 1PGPA 2RAFA 4UUMA 4XJSA 3HG7A 1YXMA 3MJSA 4RZHA 3E9MA 3MJTA 1O89A 2VYND 4ND4A 4IDBA 3W8DA 1WDKA 3WYBA 3I9KA 4IDCA 4RPHA 4XR9A 3B6ZA 3ZZNA 1D7OA 2P9GA 2DVMA 3DOJA 5BNIA 4MVJH 3KZVA 1H6CA 3G49A 1E7YA 1WWKA 4B7XA 2NTJA 4BNYA 4CV1A 5GMOA 3K9QO 2NM0A 4AL4A 2AQHA 1DJQA 4BNGA 2VHXA 5DCYA 2OO5A 2YDXA 3LLVA 4ALIA 4B4OA 1ADCA 1OBFO 4UUPA 2V6GA 3ZHYA 5BNFA 3JYNA 4L0QA 1CWUA 3E5MA 3GG9A 3NYWA 3V8BA 1C0LA 3M6IA 2HU2A 2BFPA 5IF3A 1FMCA 1PWXA 1DC3A 4Y9DA 4P38A 3SJUA 1M76A 1VL6A 1TA4A 3I3OA 1LLDA 2AQKA 1HDYA 2F00A 1DLJA 3H3FA 1LTHR 3I4CA 4D46A 1ONPA 3NGXA 3OJFA 4GWKA 4R3NA 1PS0A 2C7GA 4RF2A 3WTBA 4CM4A 2R00C 1I24A 3WQRA 3H4VA 2Y99A 2IEBA 1T25A 1WMAA 3W8FA 3I4FA 1U7TA 2X5JO 3I6QA 4Q3BA 3Q1LA
chains in the Genus database with same CATH superfamily
4IVQA 5CAEA 4S3MA 1XAHA 4PHHA 2WT8A 4FJ2A 5BN1A 5DNEA 4IHKA 4L0QA 1Z88A 1LC0A 3ZU3A 3PHIA 4MI6A 2C0PA 3COJA 2XGMA 3DT9A 5I7VA 4CQNA 2WG0A 3FZEA 3RVQA 5FNVF 2B9EA 2I66A 4R98A 3AETB 5IS2A 1I13A 4HTAA 3HYCA 3Q0IA 5JO0A 1XMXA 2RIPA 4DYHA 5K0ZA 5GV7A 5B64A 3DFZA 4MYRA 3ABZA 1R8YA 4J49A 4ADSG 1VE7A 1Q5PA 1QFMA 3AB3A 2NO7A 2C84A 3CKYA 3DHNA 3NGMA 3PUXA 2W2MA 3OESA 4PC3A 4Q1AA 4DCUA 4ENWA 4R6WA 4BX9A 3G2HA 3Q10A 5KUTA 3A4YA 2AN9A 1N2IA 2HK7A 1MD9A 3SZMA 3N5CA 3CEHA 3SBDA 1YQTA 2BMVA 3E05A 4GWLA 3S4YA 4D6PA 1KJQA 4HQKA 4MXDA 4OAQA 1UK7A 3SDZA 4PIVA 2HRZA 4X6LA 1DNPA 2R7NA 3EG5A 4ER7A 2HJSA 3O5AA 1NXOA 2P5TB 4UFOA 2NUTA 4ZARA 2XUAA 2REOA 2WY2D 1N2OA 3IVXA 1RQ2A 3H9JA 5LMUB 2VNIA 3RYFA 2R751 3TIFA 3OX1A 2UZ4A 1LJ8A 1V6AA 5DI9A 2B83A 2AMVA 3NVDA 3QMWA 1HDCA 1C2YA 1GZDA 1OLXB 1VDMA 2JJ2D 3D7SA 1E98A 2Z95A 1RI4A 2B5VA 2BM0A 2HBZA 3QIVA 4FHEA 3AVXA 1QHNA 4HAOA 3C3YA 3W1VA 3EPHA 1EFVB 2HF8A 4O4HA 2HCBA 4IKPA 2X3YA 4NCHA 4TLCA 5AJZA 3SHVA 4BFVA 2O19A 4FHFA 3R3ZA 5B3JC 3NORA 2XDYA 4PLVA 1XU7A 1X7YA 1DKUA 1S3IA 1F1JA 1NVVR 2FB9A 2I7VA 1J22A 1V0JA 5IDVA 4ACBA 3WHLA 1G8PA 2H4JA 1A9YA 2DM6A 3EDQA 3PNSA 1T4CA 2DX7A 1W1WA 2GK6A 4WKCA 2CVFA 1FTNA 2OGZA 4XLLA 2GRJA 5YASA 3KP1A 1C8LA 5BN5B 2MMCA 2VHZA 4QT0A 1OX5A 4N5MA 2EBUA 2WWXA 2ZBRA 1GY8A 3EQZA 4ZOQI 5L53A 1RHUA 3NTXA 4OMFG 1FTWA 1LBIA 3KALA 4H6XA 2BF4A 4KWHA 4Q7JB 3C6QA 2ZJ5A 4WY8A 3FSGA 4XWAA 1CXZA 5CFLA 4Z4HA 2B8EA 4AFNA 2EP5A 3TZKA 3H16A 3RADC 5B7PA 2FP3A 1M6WA 4RDCA 1B4DA 1Z12A 2QHXA 3T7DA 1RIFA 1G9SA 3PEVA 3MK31 4YMLA 2R0QC 1KDVA 1ENPA 2ZUVA 4TMXA 1GN9A 2Y1WA 3F7NA 4N01A 5AK0A 3IR5A 1A5ZA 2J9FA 1EGQA 5J59A 4F1JA 1PT7A 1K2VN 5DHUA 4AZSA 7MHTA 2ID7A 3NDPA 1T2EA 3PRKE 4GAEA 3T35A 3VPBA 3ZHSA 4QHSA 1XXHE 4QYXA 1X42A 1ZNWA 2ZIVB 1XYGA 3MJHA 3CW9A 1KEWA 2B1IA 1KXJA 1OCEA 5G4KB 5HMMA 5FB3A 3B1XA 2FZWA 4TV9F 2V5UA 3AVYA 4HX2A 4NBKA 4RCZA 4AB1A 2WMDA 1CUSA 4IJVA 5DX8A 1SKYE 2Q7DA 2YWJA 3RUDA 5JJKA 2OO7A 1RYZA 1QVAA 2ZITA 4HGPA 5JH7A 2YV3A 4YMUA 1E0SA 4WV3A 3Q98A 4NZYA 4BN4A 3OFJA 8ATCA 4EWLA 4IMPA 2VKQA 1HL3A 2SKCA 4IMIB 4KJXA 1G8AA 2C7BA 2D3TA 4O4IA 4QLAA 3FNGA 3JRWA 4QULA 4REOA 2JGDB 3UAGA 3BMCB 5F2KA 1RZUA 4N8EA 2O7SA 5C52B 1FLVA 4X94A 2IP1A 1BHJA 2DWPA 4QPPA 3WISA 3IA7A 4PZAA 1CQXA 2E37A 2EG5A 5FO0A 4C0LA 1E2QA 4Y9UA 4E3WA 1DZ3A 4U7DA 4C7XA 2YNMA 4WPGA 2BTEA 2FPIA 1EESA 3UZUA 1NMSA 3CVJA 4ZOLF 3S2IA 3HTXA 2BCEA 2V45A 3A1DA 4LMBA 4CN8A 5CW2A 4Z0NA 4QSHA 3EUEA 2C2WA 2VXBA 1RXEA 4JX9A 2PZFA 3ZWNA 1T2NA 2QTLA 4R16A 2C7RA 2DYKA 5BXQC 2H0RA 4MTCA 5BQ5A 3WBKA 1IUKA 1WLSA 3DV9A 3L04A 4H7JA 1BVHA 3R2JA 4V24A 5HJ5A 5TGDA 3UAOA 3JQPA 4DT1B 5TB5A 3VM6A 2TMDA 2X7XA 1JMKC 4NATA 4R51A 2HU7A 2F9MA 2JZCA 4BIIA 1TZKA 1EMDA 1ZKDA 5B58C 2CWWA 4AICA 4DBLE 3L8MA 4BYMA 1IHXA 3EW9A 5AQ1A 1Y8AA 3MZ0A 1SQGA 4E09A 1SOAA 2ODBA 1H1LB 3HBMA 3ABOB 4RQTA 1W52X 1MV8A 4EUHA 2GN6A 1ZRMA 3NAGA 5LUAA 3CH7A 3AEQA 1DG9A 3HFRA 4YLEA 1KDPA 3CMMA 3U7RA 4LRYA 5IAKA 3WOHA 1I6LA 1RYMA 1H5QA 3M83A 3NWPA 1ZH2A 3PA8A 1WRBA 4AO8A 2GZSA 3OBBA 2NSJA 4CLEA 1G4AE 4H0FA 4D3XA 4HVAA 3WC4A 4DABA 5KZMB 3G9UA 1EXDA 4QX6A 4UBMA 4XJVA 1KOLA 3KT0A 1I7PA 1G3IA 1UBCA 1USGA 2VJLA 3MBKA 2I2XB 4UHFA 2X9NA 5FBHA 4INPA 4JVOA 2RGXA 1UZLA 5FA8A 1JPVA 3TB6A 4AO6A 1EP2B 1UDXA 2WA1A 4QBKA 5I9SA 1DIGA 4D42A 3MWYW 1TM1E 2CJWB 5FNVB 4HNHA 4UTRA 5GVSA 1Y4DE 1S6YA 1M74A 1K5HA 4NE2A 3S2SA 3LY5A 3WZMA 2VYFA 3TLYA 4MZXA 4AY6A 2EDAA 4D9NA 5B3AA 3GH1A 4YRZA 3FOEC 3LWZA 3EEQA 4IH1A 4C1BA 1VP9A 1PVVA 4MMZB 5GM1A 4O3MA 3C85A 2WIAA 3IVMA 1VIYA 4WNYA 3PHBE 5C5DA 4ZCLA 1KZHA 4AQ7A 1QH1B 4IOKA 4PYOA 1FTYA 3OTGA 2RB4A 4K9SA 4EELA 3M34A 3T0FA 2I2DA 5JADA 1UPBA 1YDWA 3O8BA 4OB6A 3WZLA 5CDTA 3RE1A 1X38A 2GN1A 1FF9A 2A78A 4RQAA 4CKEA 2P5UA 5JZMA 4LDZA 3S8YA 4D80A 5AUPB 2JLCA 4RKEA 3WKEA 3GRKA 2WJZB 1LLUA 3LFHA 4BBPA 1PP4A 2D0IA 3QEJA 4JYBA 5DX0A 2O7NA 4E7PA 1GLNA 4H7FA 4OUKX 1LZLA 1THZA 2IHYA 5B4UA 2QBYB 1CFZA 2AMFA 2NSYA 3SR0A 3VNAA 3HJGA 2J6CA 1B6SA 4DQ0A 2RHHA 1TUEA 2VH1A 3GEBA 4Q3OA 4KO2S 2FG5A 4FN4A 1KDYA 5LXTA 4DC0A 2EX4A 1GTJ1 1ZKMA 2IWHA 3D5EA 5F9HA 5FT9A 2A9OA 3AY6A 2WHPB 4O2RA 3RRXA 4DPLA 3NPMA 2NXWA 5ALFA 1ACLA 2ILTA 4NV0A 1CJMA 3DXXA 3LXMA 5AIBA 1Z6XA 2HNAA 4C4OA 3MFYA 3HB9A 1PKEA 2DG2A 4CQLA 1P60A 1Z5GA 3BE5A 3DQZA 5EN4A 4JCOA 3WGNA 3WGZA 2YXEA 3PTAA 1QRAA 2VBGA 4OHRA 4F2DA 3THSA 4D98A 1E2DA 2ZTLA 3FUTA 1EVEA 3OQIA 2O50A 4QWWA 1E2EA 2K5UA 3CZAA 3F7MA 4TZTA 3HM9A 1QIMA 3PUHA 5FUXA 1BDJA 1P0QA 3UM9A 3DKVA 2QD3A 2PUDA 4P08A 5JVDA 4PLWA 3EJWA 2AJCA 3OF5A 4GX5A 4CIVA 1F5NA 3IKLA 1PD0A 1P9LA 1BVRA 1TFRA 4AIRA 4FQ5A 1KGDA 3TQHA 1G5QA 1YH3A 3JVDA 4B44A 4D4HA 4RPIA 3ZY3A 5D5QA 1KH2A 1VMAA 3JD0A 3DB1A 2VK4A 1YQ9A 3EF0A 1M2GA 4QU8A 4YJFB 3W6ZA 2V74B 1Q6YA 2IYUA 2QR2A 4L7QA 5HQJA 1QV6A 3FNIA 3L4JA 3FPAA 2CXUA 8OHMA 1RPJA 4LJ4A 2ZI4A 4BWFB 1U9IA 3W2TA 1DTEA 2GETA 1R0KA 5L8VA 3AV3A 3HUFA 2HLHA 4LJ6A 4WKNA 4M9CA 4TMZA 1A9XA 3EF3A 3C2QA 4AF7A 3HY4A 4MVJM 2YWFA 4YJKA 1ORIA 2BGJA 4HSGA 4DGQA 2BEUA 4Z86A 5M7EA 2OXCA 1UJMA 2AX3A 1US8A 4CIXA 1MRSA 1YVUA 1A71A 2IXFA 3QI7A 3N3BC 4TV9B 1N2GA 2A35A 2DECA 4KYTA 4ALJA 4BB9A 3Q40A 3L18A 3ER9A 2RONA 3TM4A 5A06A 5FTWA 2BEVA 5AW8A 4PG4A 4XJTA 3VKFA 4JI6B 3BREA 1QCZA 4Y8VA 3ZXYA 2CHVA 1IVNA 1HEIA 1GP2A 5I7AA 2KLHA 1S2GA 5LBIA 4MW1A 3ABQB 4JFAA 2C2KA 2IYXA 1FMLA 2JZOA 4ZOCA 2QIOA 3BJIC 1ZH8A 4BZPA 2CD9A 2O3QA 4XFKA 2OHXA 5AFSA 1L5OA 2PLWA 5EMMA 3DCYA 4E6EA 3OOJA 5DN6D 1CHNA 4FZRA 4I81A 4BXOA 5IC6A 3K9GA 1SXIA 5AWFC 1RAIA 4CGYA 2O1SA 2GYWA 1RWVA 1U0EA 1UEIA 1YRYE 2NIPA 4ZOLB 2OTCA 4ZAFA 3NAZA 3O47A 4OU5A 3WMWA 4JLBA 4LWQA 4DNXA 4R3UC 2PS1A 2XMBA 3H4TA 4P5DA 3QJYA 1SUIA 2ZYIA 5CA1F 1HLGA 3A6GA 1G291 5DLEA 3BD9A 4Y0NA 2FJ0A 3GCWA 4C22A 2KE5A 3PQ2A 3EEBA 3RGGA 5B7NA 3MWGA 2P6PA 1VB5A 5LA6F 3VC7A 1EFKA 3IOYA 3LRPA 3BL8A 3JATA 1EFHA 1IC6A 1AA6A 4MQ6A 5CM8B 1H2YA 2QGNA 2RC5A 1NJ8A 1YJ8A 2NU6A 4K2AA 4OU4A 2PRJA 1YB7A 4Y0AA 3V7NA 4FNMA 1AUVA 1V1MB 3L7BA 2VQ3A 3NIDB 4FHCA 4DR6B 1Y1QA 3EN0A 4MB0A 3R1IA 1N2CE 1WXWA 3QTBA 4XB2A 2OHVA 2G83A 3BRWD 3OWOA 4CDRA 4ZCTA 1XC7A 4R8LA 3DO6A 3IS3A 4BKQA 1G1AA 2P9HA 4A7PA 3JQ8A 3DEHA 2DWUA 1G2PA 2OHOA 1X3LA 3EFEA 2QZZA 1AO0A 2G6BA 3KR0A 5JDCC 2IZ6A 1ZM7A 3LQQA 3U4QB 1KOGA 4H3SA 2JATA 3ESBA 1B14A 1PFWA 2WJ6A 3MCVA 3O9ZA 2G80A 5FYQA 3UQZA 2VPXA 4ER3A 3PFKA 4FMCF 1P0PA 3R40A 2RI1A 4BO2A 3SYTA 1YHNA 4ER0A 1TCCA 2QB5A 1P33A 3QVUA 3R3XA 3T5CA 4ZMSA 4M9XA 1E1KA 3F5SA 2WE7A 1FZQA 1HSZA 4LE2A 1SG6A 1P5ZB 2GPBA 3DP7A 5F77A 3DAFA 5FYDA 3OETA 4B6QA 3K9FC 1TIPA 1F2TA 2HJHA 4LK2A 1EE9A 3VSAA 2X5XA 4QTXA 3ABIA 1OBOA 1TO6A 2D62A 3ZU6A 4FNGA 2EEZA 4CPDA 2YRWA 1ISPA 4R05A 2IP2A 4EUKA 2HI0A 3EWIA 5T6MA 2WQ6A 3D59A 4HTFB 1KMHB 3ZH2A 1OYWA 1VKRA 2PWBA 1YU9A 3QBVA 3RG2A 2AG6A 1GYQA 2FPMA 1RYDA 3BIOA 1PUJA 4BMPB 4AY3A 2BGNA 1YZQA 2FFQA 4P5PA 1G21B 4KFRA 1SKQA 4UFPA 5JV5A 1P74A 3AY3A 1GVHA 1QYIA 1XDGA 2JEYA 2OK8A 5IM4F 1DQZA 2I71A 4S1NA 3HY3A 3BXPA 2V5AA 2A5DA 6REQA 3KWMA 3KSAC 3QE3A 4OKNA 4R81A 4U3JA 3WZ2A 1R5JA 2OPHA 2RGNC 4YACA 5KHLB 4P33A 4RJLA 3OKAA 4CQJA 3RUPA 3GRVA 3KQHA 4GFDA 1PJCA 3PC7A 4MR8B 3H2BA 2JGKA 5FNZA 2Z5GA 1PGNA 2ZVQX 2YJZA 5ENVA 4M8SA 1QOPB 4NHOA 1CU1A 4MLPA 4UREA 1M2WA 3GRAA 4U8HA 1U3CA 4PLCA 3CG4A 2V4MA 5FTNA 4ZYXA 1N9GB 3VDQA 3CLVA 1XE3A 2JLZA 1JHPA 1F9AA 1VLJA 3DAOA 3RNLA 1R4NA 1RI5A 2DXIA 5AKHA 4JBGA 5HK8A 1UAAA 4YREA 5BSMA 5K9ZA 4BZQA 1KFJB 3PYXA 4IDAA 3JY6A 3GMSA 3NRBA 5DV9A 2RGGA 4QO8A 3JVUA 2CLHB 1ZONA 2X77A 2BMFA 3NWBA 2H5LA 4EX6A 3TKLA 1PJRA 2ZSDA 1ZUWA 1RWOA 4YRPA 1V45E 5JAPA 5JPCA 2H2IA 3IT2A 5EHXA 2W9XA 3CZPA 4JB2A 4J4BA 4EHDA 1Y9EA 4E11A 3T1YB 2DTXA 5GJCA 3FDZB 1N57A 2VYNA 1V8DA 3RSSA 3WYGA 3ZI4A 1KERA 4AY4A 1HRDA 3I2YX 4A4DA 3R0IA 3VR4D 3OSUA 4M1ZA 3IEKA 4YASA 1SVWA 3KDPA 1GL6A 1H05A 2YWXA 4MQEA 4BVBA 5THXA 3UFXA 3VJMA 5KJ1A 1Q0LA 2L2QA 3IVAA 2ONZA 2XCTB 3C14C 2W70A 1PR3A 1R5BA 5FQOA 4JC0A 4WACA 4BQSA 4CUJA 3QMPA 3OWXA 5BOSB 3IFSA 1GD1O 3TG8A 1ZW1A 3YASA 4BNIA 1XALA 1Z74A 4OEHA 3I9V1 5G0TA 2PHZA 3KXKA 3LKDA 1SBZA 1II8B 2AWOA 2JCVA 2GMWA 4H6WA 4Y2XA 5FAKA 1ADGA 4P1ZA 5AJYA 3HBAA 3KQLA 3GRUA 3IMCA 4DG9A 3LX5A 3Q11A 3TLXA 1FK8A 2EU8A 5EE0A 3HXMA 4NVRA 4P4NA 2P2DA 1ID1A 1OIXA 4Q9HA 2FEAA 1V48A 1V5GA 2P75A 1QUEA 1NLYA 4LZJA 5HBRA 2HUPA 4JC5A 2SCUA 4RKWA 4E12A 3WGTA 2QVCA 2EW1A 3WDSA 3VZBA 3TQSA 1X7GA 1RYHA 2CJYA 3REQA 2WPDA 1OYVA 3N07A 2L17A 2O8CB 4CLHA 4Q12A 2FPUA 1NR1A 2AOWA 1FSZA 1U6KA 3AESA 3B48A 3EXHB 3HXLA 1HZJA 2JKVA 3TJZA 1KTIA 3AWIA 4PZCA 2LXNA 4JJZA 5JAHA 2YOFA 2QQEA 1CW2B 4EATA 2BR5A 4WESB 2Q9CA 4HADA 4Y2JA 2AFHA 4G1UC 2R86A 4DL9A 2HXGA 2OXEA 3DUFA 1NBEA 4BMYA 3R6DA 2O3SA 2QAIA 3FSJX 4HWSA 1XFDA 2RGYA 3I28A 3QTTA 1MB0A 1SK9A 2QI9C 1UFQA 2HK9A 2BDEA 5BRJA 3A3NA 2ISCA 3IMFA 4IX1A 4AS3A 1IIRA 3R6TA 2W6JA 2QVZX 4REMA 1Y98A 1JPJA 1Z4OA 1EZ1A 1SPXA 3PFWO 3ILYA 1N5JA 1E9AA 2DH6A 4C3VA 1BDIA 1UZNA 2J0SA 2M6RA 5EMNA 3VPCA 2VRCA 4A8HA 1MQSA 2JIBA 3IPYA 1U98A 2EKBA 4TTTS 2Z98A 4RM2A 4G0OA 3UXYA 4JYAB 2C9YA 4LXHA 3ORRA 1BXRA 2ZKLA 3K94A 3KZOA 4W5TA 2CLCX 4CWAA 4OX9Y 3CVXA 2BLLA 4LJAA 5U9CA 4IXNA 1E3IA 1KF0A 3FG9A 1GCUA 1AKQA 2R44A 5H59A 4HN4B 3AEUB 1JQBA 3FA2A 5LA6B 3UMBA 5JTTA 2O8EA 2I4RA 5AI8A 5GZ6A 1NT4A 4OMCA 1T1JA 2PBZA 3EVDA 3OOYA 4Y7DA 3GNQA 2R5WA 3KJQA 3TQCA 2JH3A 2RCNA 5K8JB 1UWCA 2FW8A 3I12A 4ECEA 2JFYA 4PNEA 2M6LA 4GRDA 2PRIA 3Q2KA 2PUHA 2YJNA 3OKCA 4WA8A 4EAAA 3SQWA 4HDSA 2ZBDA 1ZN7A 5IYZF 2H1IA 1WW2A 3D7NA 3BKWA 3TUIC 3Q7RA 5K3CA 3TR6A 3ZU4A 3T4PA 1D2MA 5DNUA 4OFXA 1IRIA 4TKZA 5FWAA 4XM1A 4F3CA 4F2WA 3L0CA 2V54A 3PCRB 1FSGA 3D3QA 3KPUA 1G5HA 1QRTA 1KYIA 3MTEA 3U56A 1EVZA 3KYDB 3OSZA 4RGYA 5LD2B 1P0IA 3AIKA 1LSUA 4L5JA 2CV2A 3GGJA 2HCJB 3G13A 1E2KA 3FZNA 1XDBA 3PR1A 4FMCB 4LPKA 2K4MA 2X0IA 2DWQA 1E2NA 5B1HA 1I3CA 5JCJD 3PXXA 4CM1A 3ANMA 4X20A 3RWBA 2DBVO 4HLQB 2QRJA 3BXGA 5I4IA 2Y0PA 2J4CA 4H3VA 5LQUA 3FRJA 3T0GA 3IXLA 4JBLA 5FP0A 3WLOA 4QTZA 2DFPA 1MFPA 1Z7EA 2Z4SA 3E4DA 3OZVA 4GOMD 2MSLA 1X92A 1YULA 4ZVVA 3DP9A 3GVHA 4IMRA 5CDFA 2OZLB 5IVIA 4F56A 4JQSA 2NU9A 1JNXX 3DDUA 1DJNA 1G4UR 1OJLA 3A4LA 5PNTA 5I5EA 3PVZA 1DHTA 3DOCA 1M8GA 2A0XA 2C2ZA 2CMFA 1Z82A 3VDXA 4IJMA 3VR0A 4NEQA 1FUKA 4EFDA 2IEAA 3EZ9A 3VOTA 5AM2A 4MICA 1M1NA 2MHCA 1UMBB 4BNKA 1JGTA 1Q6ZA 2VA8A 1GPUA 2FPLA 3OZTA 4NOKA 1K88A 4C9BA 4ZDIA 3VU1A 3QX7A 1YIDA 1RHJA 1BGWA 4X7RA 3HRKA 4BYGA 2HDHA 4DLVA 4KR3A 1MKYA 1PQWA 1PDWA 1NX9A 2VYQA 3Q0TA 4GZLA 3UGJA 2IS2A 1CIVA 5CGZA 3RSQA 5A5VA 4DA6A 4YJDA 1BMTA 4F71A 2HW8A 3EB9A 5EHIA 1R74A 2N9UA 2DULA 3TXAA 2FX5A 4OBEA 4WINA 2Y8EA 4U7HA 5JCZA 2RJNA 4I2VA 1YONA 4U6SA 4ZQFA 2X40A 1ZUHA 1JHQA 1Z0SA 4QARA 1WPGA 4QAQA 5AMXA 2H8GA 2VUIB 1WW3A 1KSGA 3ELDA 4U9UA 5ESWA 4BO1A 4JLSA 4M1TA 3KOXA 4AY2A 3STYA 3BL5A 4HT3B 2GBFA 3JD4A 2RK6A 4JCCA 4DZTA 2BE7A 4CHTA 2X5OA 5BW6B 2G1PA 4OM8A 2WMYA 1L8XA 2X8JB 4URXR 5JECA 3WR5A 4IZ6A 3NV7A 4IYRA 3WGLA 5A6SA 3OEEA 1EYZA 3HUUA 4UU1A 4BNHA 4DVGA 5BN3A 3HB7A 2NNLD 2DY1A 3EZYA 3NAMA 4II7A 5DYYA 1GZSA 4G8BA 4RANA 1YQGA 1GGJA 2RK3A 1EGHA 1XTVA 3EPRA 4YRKA 5LP6F 2JFPA 5LQDA 3I6MA 4KNVA 3DMPA 3R3JA 4HPJB 4AMBA 1LRLA 1YQXA 4F5WA 3IAM1 4F91B 3RANA 1AIPA 4MUFA 1GV1A 1EWKA 3S68A 1N75A 2Z57A 2BKLA 3QYJA 2R1ZA 4ND6A 4JH0A 1E58A 5DRTA 5IW8A 3U7IA 1IBKB 2QRMA 3QLEA 5CLQA 1O0BA 2PS0A 3IPRA 2ZWMA 5REQA 2Q1XA 5D84A 1NDUA 3VU8A 4DLYA 2GNOA 4IQFA 3LCMA 3EUFA 3ADPA 2KWIA 1C7FA 3M9WA 4CGZA 4MCJA 3CUVA 2OT3B 3ZVMA 1DMRA 1HXHA 3BERA 3EXHC 4HQOA 3OJEA 4U5XA 3V2UA 3LZDA 2J7KA 4JD5A 4PEVA 3CNQS 4PWYA 1W5AA 1CY1A 4UTOA 1XTJA 4EMBA 3IOBA 4QTYA 1ZMXA 5KTOA 3CR3C 2PT5A 2BBOA 1N5DA 3A4VA 3VHXB 1NRWA 3AUXA 1NVDA 4GOLD 4F3TA 1CR4A 3MBOA 4I4TF 4YRNA 4QDOA 1QLHA 4R0MA 1JQ3A 4KAAA 4KO3S 5C1DA 4X7BA 1E9RA 2VVTA 2XZDA 5CDUA 2Q2WA 3HR4A 3IBTA 4A2PA 4K8RB 4P8RA 3P2EA 5BMVA 2IHKA 4D3SA 2B4KA 3OU6A 4C6TA 4O63O 4HH3C 5BNZA 2A1TS 2VK2A 1KY3A 2ZE5A 1A97A 4V0NA 3ZQJA 4F4UA 1QHSA 3MQ2A 1TD1A 1NVKA 3RS8A 3TKAA 2WWFA 4EB6A 4HBGA 1JKJB 2FW6A 1TYZA 1JILA 3HYLA 4ZYZA 2BCJQ 3NVAA 4AP5A 1WXDA 2J5QA 4XM2A 1KE1A 3AILA 3T8YA 1G9TA 1QZXA 3ZV5A 3ZZ0A 1NN1A 2FRVA 4G25A 4AXXA 4D8UA 4PX3A 1JG2A 5JBNA 3QNWA 1R9GA 2GLUA 1P1KA 2I9PA 2CHFA 3H8VA 1Z15A 3OE1A 4RFVA 5CNJA 3N2NA 5JSUA 1G17A 1XNRB 3BS4A 4QU0A 5TNXA 4TYNA 2JCYA 3V8PA 2P9YA 3IBFA 4GZ5A 1ZGCA 1DPFA 3B1KA 3M6UA 5H7XA 3LPMA 1HE2A 5G3ZA 3WGUA 3SWWA 5IARA 3V5NA 1HYEA 1SKAA 4LJRA 3H5OA 4PPGA 4R6XA 2EF1A 3M4JA 4DN6A 5ALMA 4MWTA 3IBYA 3KEOA 4EP1A 4XWGA 5TR9A 4OHUA 4G0XA 4WCFB 4PBTA 2P3SA 4L8VA 1BJKA 4W1RA 1P4JA 3S29A 1KVQA 3K0FB 4OXKA 5B4VA 3V6LA 3P2YA 5HCUA 3LYLA 3R20A 1E2GA 1GAEO 3MELA 4Q39A 4ZK2A 2Z6AA 1ILWA 3HRIA 4NBUA 4C2UA 4FB5A 4XSGA 5JYEA 1IB6A 1O9GA 1O58A 3TXYA 5IYZB 1P31A 1Q3HA 2Y05A 1WP9A 4RELA 1KL7A 2PGDA 1JIXA 3T7CA 2PS3A 2PJDA 3HLYA 5LYJA 3I2KA 1OSNA 1Y1KE 1T9AA 3CKMA 3OIFA 4BWGA 1KVUA 1NAIA 5I8WA 5FJIA 2X1HA 4ENTA 5KU1A 4H0NA 4WNCA 3SC4A 4W6QA 5IKPA 4HXYA 1EX7A 1B23P 2C31A 5HEKA 2I55A 5TPZA 1OZHA 4NH4A 2XT0A 4C0SA 2UVDA 5DASA 1Y5RA 4XEHA 3AYXB 4N3AA 3VV2A 1K89A 1IJKA 5JS7A 2PBRA 3OX4A 2NZVG 5GONA 1TTTA 2Q6LA 5AW7A 1BKSB 4P31A 4YP0A 4ZTBA 1AKEA 2CVZA 3H9CA 2DUNA 1MQAA 2O23A 3N86A 8MHTA 4JBNA 2GN0A 2V4ZA 3DH0A 3STUA 1TPZA 1AKMA 2R1TB 1X14A 4Z1MA 4BO7A 4ZZ0A 5J2TA 1THTA 2OOKA 3G23A 4XDZA 5EQFA 3Q8KA 5CIWA 4N49A 2EG9A 1EVKA 1Z22A 3ENKA 4NV3A 1KARA 2PK3A 1TL7C 1Y82A 3OLXA 4OI0A 2EOAA 3VOAA 2X0JA 1U7OA 4W9NC 3A1VA 2YXLA 2G63A 5C4IA 3ZI7A 1W0JA 4RO0A 1BDHA 3ZY2A 1QLWA 4TN1A 4C87A 4CLOB 1U2DA 1YZFA 1UDRA 2IE8A 1UBJS 3TDNA 2B1QA 4IDHA 4RHTA 2O2JA 2R65A 2ADFA 1SZCA 4MH0R 5A03A 1R8JA 1PL0A 1XMPA 2QV7A 1MPTA 4W5JA 4N0DA 1EXMA 1K06A 3H5WA 1FQKA 3OT5A 2EQ5A 3LUGA 1WULS 1SUDA 3EH2A 4QZVA 3AF3A 5KOJA 1ENOA 1KZGB 5ELXA 3GUVA 3H5VA 1HFJA 1KRXA 1GPLA 1GXSB 2Y1CA 4Z5XA 1TF2A 1MEEA 1PFUA 2I6GA 2Q1SA 1Q7CA 4MQ5A 4YJ2F 4D2IA 4AG3A 1K6EA 5JYCA 3NBMA 6LDHA 4KIGA 2ZSFA 4TLEA 1MORA 4AUNA 4LG1A 5K3DA 4DEVA 1XZHA 1Y81A 2XUDA 3KAQA 2Q9UA 2KBEA 4EEZA 2DFVA 1QZZA 1GL7A 2ATCA 1PQYA 5IC5A 2J4FA 3QZUA 3OT1B 3Q2IA 4RD2A 4ZC1A 3R4CA 2VPPA 1E4OA 4F8YA 4G5XA 2WLTA 3EMDA 1MXFA 2AI2A 4G3XA 3SVLA 1QNFA 4RPJA 2L82A 2J3MA 2VTBA 1X7XA 4IKOA 5DP2A 5EIOA 4NZNA 2UKDA 1FRNA 5LP6B 5FI5A 1GLGA 4NEHB 3MLBA 1U0BB 3UJ6A 3N9IA 2PQ6A 4K0KB 3B7GA 4KNWA 1P5RA 2ASEA 2ZPUA 1DKQA 3RFVA 3MC1A 4DCGA 1XMVA 3DE6X 1C3VA 1CDOA 3HGTA 3SOZA 1MIOA 4NEGA 4PO3X 1WZIA 2V3WA 3UXMA 2R8OA 4KNYA 4FCWA 5C51B 3T15A 1CT9A 3PQCA 2AXPA 2F43B 3FROA 3LWBA 3UHPA 5IUJC 2WT4A 2P0AA 2XGOA 4TLMB 2DTDA 5DN6A 1CVLA 5EE3A 1VJDA 1Q91A 1A9OA 2YVUA 3OEHA 5JXWA 1DAOA 2WAOA 1R18A 3RAPR 3SM9A 2PV7A 1UBLS 3GA5A 4M54A 3E61A 4EJSA 3IAEA 1DQNA 2B69A 2ZSKA 3CQ9A 2EFHB 1PSWA 2I2AA 3T06B 3R7BA 3RC2A 5TLSA 5JUWA 1F17A 3PQDA 1H9AA 2NWQA 3PVCA 5EPUA 1XJ5A 1NY5A 1UFRA 5ER9A 4I4TB 1EM6A 2PNFA 1WB5A 3LWNA 4XUEA 3HYNA 3Q12A 3ZXSA 1XKQA 1KYXA 1XDUA 4Q19A 3IURA 2O4CA 4G23A 1YRLA 4L16A 3ZV3A 5AKXA 1KI6A 3AFHA 1LLFA 3DDOA 4PYQA 2HJRA 3TWOA 4UBNA 1XMQB 1TXGA 4G0NA 1HKHA 5M04A 1A69A 1DRKA 3IVRA 3OPVA 2Z09A 4AJKA 4DNOA 1E5VA 3V3TA 3PWZA 1CZRA 5AVUA 2ZRKA 1F6WA 2JLAA 2QVXX 2Z9BA 3A9WA 4P80A 5KHAA 4DIDA 3ISJA 1J21A 1MF7A 3BEOA 5B55A 3Q85A 2AG0A 1GPBA 3BRWA 3DZIA 1ECJA 4WCFC 3PEYA 2IS6A 1GZ3A 3PE3A 3UKDA 3LL7A 4ZYUA 2JI4A 4TXLA 4S0XA 4BNDB 3KQQA 4RQUA 2NU7A 3TTTA 3HLTA 3GVXA 1RWXA 4XZ3A 5SYMA 3O75A 4BFXA 2DPLA 2WZBA 3GGPA 5G02A 2WOOA 5ABPA 1N7GA 1Z45A 2XXAA 1SUBA 1T10A 2CFTA 3BSWA 1NMEA 4Y18A 4KN9S 3OE5A 4I6GA 3R09A 1KR5A 3FR7A 4QBIA 4GBED 3BCHA 3VAYA 3MRSA 3F6SA 4AIIA 1OWMA 1PLLA 3WA7A 4TXNA 4LTDA 1BXZA 4IV0A 3NOQA 2QTAA 3NDIA 2D8MA 3RSCA 4KL8S 4HLCA 5CB4F 5AW0A 3GJQA 3OJLA 2Q3JA 4OJTA 3FZGA 1EJ0A 1XXHB 4KG7A 1HBJA 4Q01A 1XCPA 1SRRA 3AOEC 5LU8A 1APBA 5CRIA 1DTWB 1OGIA 1UMKA 5EPOA 3T7RA 3O1JC 3RG8A 3KD3A 3M33A 1YOVA 1A5AB 1XFAA 2FZVA 4WBNF 3LQYA 3NANA 3QUAA 2D3WA 3PDWA 4PONA 1XF1A 4FW9A 1Q12A 1W4LA 2C61A 4J9UE 3RNOA 3W5JA 1SKYB 3A1NA 2ZUFA 4ER6A 5HF9A 2QAGB 5IH3A 3WLIA 3HB5X 4X92A 1QANA 3KKLA 3I83A 1H4TA 1U5BB 2FX2A 4JU9A 4JNCA 2WF8A 3DTVA 3AR2A 1GRCA 3LT1A 3NIFB 1AD2A 2OB1A 2CUKA 1U7HA 5J3JA 3MVEA 4X93A 3I5XA 5KVCA 3JVVA 3GGGA 1LK5A 1M66A 1GLVA 2Y0DA 2G28A 4TWJA 2OYSA 5IKEA 1I4OA 5JCOC 1KC1A 3LMKA 2B61A 1UP7A 3VBCA 3KJNA 3GJ3A 3ER8A 3QPBA 1K08A 5CYFA 3G9XA 1U9JA 2OOSA 4NMMA 3RSOA 3UYLA 4FUQA 1R3DA 1CZUA 2HIGA 1EK0A 1QVZA 2PGXA 3MTIA 1Z56C 4L5CA 2ZUUA 2H63A 5FADA 1VHWA 4H4CA 4C7KA 4I5EA 4M0PA 3G9TA 2AOXA 4CM9A 4CRWB 1U63A 3I1JA 2F1HA 5KMGB 2QUZA 4XVHA 4HLNA 4FFLA 1TW2A 1QPGA 1QPBA 5AOCA 3GEIA 2PLRA 3AZOA 1CF2O 2FUG6 3FXAA 1IJEA 2X1MA 4XPZA 2YJ6A 1E6LA 1MGOA 1C2TA 1LBQA 1T0BA 2EP8A 3ESDA 4HB4A 1GADO 2JI6A 3OIUA 5ICGA 5FOSA 5JSKA 1BU5A 4ZQHA 5KB3A 1KDTA 1K3UB 3CEAA 4TTJA 1YS2X 4I55A 1P81A 3PRHA 1QQ6A 4MQFB 1Q57A 2OL4A 3H13A 2HCTA 3M4ZA 4PO9A 5DI3B 4ZEXA 4FSHA 3RJ5A 4BLUA 3RDPA 1WX1A 1T15A 1X8JA 2F4NA 3ESQA 2OYRA 1SCUA 1Z8FA 3ADCA 3MW8A 1IN5A 3DVLA 4YP1A 2RKWA 1TAGA 1XQVA 3I9JA 4FGJA 4IUDS 9MHTA 2NUPA 3NHPA 3OMXA 3ZW8A 5IABA 2EJBA 5D5PA 2QDKA 1FYFA 2YW2A 5JMOA 4MRMB 1O7JA 4TLAA 1JWBB 4R8VA 1ND6A 4C4RA 1A96A 3FDFA 4JHLA 5LP6C 3QW4B 2HZ7A 2INGX 3OQOA 2D6FA 4I2NA 3U3JA 2BSQA 1RBYA 3D43A 4M6WA 4PZZA 1O4VA 3G8DA 4L02A 1Y6ZA 2XJ9A 4U2FA 1L6RA 1QP0A 2A5FA 4KRYA 4MUAA 3G2LA 4YJ2B 3K71B 2QRVA 2NV0A 3ZJTA 4WDRA 4DYVA 3QF4B 3VV3A 3NT4A 1Z0UA 1EIWA 2R11A 2C8VA 1BZYA 4N7MA 5C8DA 5JD5A 1P73A 1K7YA 1TO2E 2GEFA 2XHEA 1SXHA 3KDAA 4ROSA 2CL6X 2H4FA 4HNSA 4QXQA 5TT1A 3VTKA 5AVWA 2YZNA 2ZYVX 1RLUA 3S7TA 4XQGA 3SXUB 3C45A 3JD1A 1MOSA 3BDVA 1L5LA 2JJ8A 2ZTVA 1RCTE 2JGLA 2J85A 4J1TC 1QE3A 1SWWA 1DJMA 4L5BA 5C4GB 1J2JA 1U0OC 2JAWA 4D8XA 1G7RA 1MT3A 3WIVA 1R0BA 3I42A 3GLFA 1NW7A 5JWOA 1A8PA 4CLRA 4O29A 4XRGA 1V1RB 4MI9A 3UG7A 4WFKA 4Q37A 2KBFA 3GP8A 1CJUC 4AJHA 4YPOA 1N2ZA 2DRIA 2J46A 3G79A 1OKKD 3N6VA 4CM6A 5AW6A 1GFIA 3K6SB 3NFRA 3NWOA 3P9YA 2FXIA 1Q0TA 1Z29A 2JL1A 4JMPA 4Q03A 1JLKA 4ZWNA 4FINA 3T5GA 2PUGA 4TS4A 4DCCA 3RYCB 2AHOA 1WS6A 1KHHA 3NIWA 4WN3A 5TEWA 4BFSA 1WCIB 5K6AA 1NA5A 1IMOA 3ENQA 3NHWA 3W3AH 2AKEA 4DAEA 5BN4B 4E4RA 3TYXA 4OIMA 5C2JB 2Y9PB 1QQ5A 4DRXA 1IHUA 3HADA 1WMBA 1X1AA 3TG2A 3OJ0A 1DX6A 2WKPA 3A14A 3D4OA 3NXSA 4AF6A 1VL8A 3K05A 4HQFA 4I9FA 2GARA 4MNTA 4AD8A 3VA7A 1EIZA 3JQRA 3O74A 2B78A 6GPBA 3AUUA 4WX2B 2VP0A 5K3AA 4DA9A 5DCUA 4E08A 1XF9A 3T3HA 4ID9A 4EYEA 1DMSA 3HBJA 4FCVA 1ZBDA 3SHWA 5IANA 1DRWA 4FWTA 1JXOA 4IGIA 1PX2A 2AD5A 4N1AA 3RREA 4FILA 2ZCJA 1O6BA 3VFDA 3HDHA 2UXCB 1H2BA 1Y9AA 2V8BA 2E4XA 4NNJA 5ICFA 1OFIA 2O1WA 5IT0A 1W59A 2F7SA 1YI0A 1DQRA 4YRBA 4CCYA 1YNSA 2GX6A 1VKJA 4BNLA 1RWPA 2BCGY 2ZR7A 4AXBA 4C0XA 1TCAA 3EAQA 2YR0A 4MP6A 1HK7A 1U11A 1UWLA 3FUUA 4HGRA 1VBNA 1T2DA 1ZWKA 2AV6A 4KYVA 1CB0A 1UJ6A 1ZS9A 1BOFA 2GEDA 2QZ4A 3L46A 5SZHB 1I0IA 2A1TR 2WW8A 4HWOA 3MILA 4LFCB 3F3KA 3QXJA 5HIAA 4F85A 1DU4A 1JFFA 5JDIC 1NWHA 2F9LA 1SQ5A 2C82A 1M10A 3TSOA 2Y1LA 1UMCA 1L4NA 4G1EB 1T3LA 1MO4A 3ZC3A 4NABA 1W94A 1FFXA 1VHQA 2OLEA 2RB5A 1MJFA 2QAGC 4JLMA 3TTYA 3HB4X 1B8UA 5JCJA 3V55A 4EW2A 2CDNA 4OKSA 3MMSA 4ILKA 3WV4A 2WSMA 5LL6P 4Y3UA 5IP5A 1DKNA 1ZFNA 4DNFA 5CB4B 4IGAA 2MSDB 3OCUA 4NQZA 3EBOA 3RVKA 2A4KA 1DPGA 4G5SA 1I7QB 4LF7B 4MPTA 4DIMA 4UHDA 3GNLA 4YX9A 2XSZA 4MARA 1MU0A 4OHZA 1U1EA 2XMQA 3TPFA 3CWZA 4WBNB 5BV8A 1URPA 4UAUA 2ORIA 2VDPB 4NZMA 4WI1A 3A7DA 1SD2A 4XB6B 3WGHA 5JFTA 5JNRA 4JXJA 3VGJA 1BRMA 5HDQA 5BOVA