4M49A

Lactate dehydrogenase a in complex with a substituted pyrazine inhibitor compound 18
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of 2-amino-5-aryl-pyrazines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4m49A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4m49A02
2P9GA 3TL3A 1E3WB 3GY0A 1DC5A 2WD7B 2GO1A 1ZZEA 2YHIB 4XDYA 1PS0A 5DCYA 1RYDA 3DR3A 2X23A 2Y1DA 4P22A 4BNZA 4RVSA 2Y1FA 1A7AA 3PHLA 4J4HA 1ZK0A 3U3XA 1DAOA 2BFOA 3TZKA 4RORA 1LLDA 3QE3A 1YS4A 2E6UX 4BNLA 3WG9A 4WLUA 2FPGA 1JQBA 5TJ9A 1U7HA 3Q6IA 4OM8A 5A9RA 4M1QA 3WIEA 4I5GA 1IPFA 4U6SA 5CG2A 3AUSA 3DFUA 4D3SA 2I6TA 1I01A 4L4RA 2R2GA 1FDVA 1KC1A 1CJCA 5EINA 1XSEA 2WYUA 3NYWA 3GVPA 1E0DA 3WJ7A 4PLVA 1BDMA 4UEJA 4XD2A 3FD8A 2Y68A 1GZ4A 1M2WA 1T2EA 1Y6JA 3DHNA 3V2GA 5EQFA 1MV8A 4YYZA 5I7VA 1ISMA 1B8PA 3D0OA 2X86A 4XCVA 4XGIA 3UCFA 1V3VA 4DWVA 4IUYA 2J8ZA 3WNQA 1ADFA 1M66A 3O26A 2F00A 1I3LA 1KYQA 4IINA 2Q46A 4YA6A 2NU8A 4UEKA 1E1LA 1GYRA 2ZB7A 1YKFA 4FW8A 1LBEA 4ND3A 3BMNB 4BS9A 1J49A 1YJQA 1C1DA 3D3WB 1R0SA 3ZWBA 1ULSA 3CZMA 1KEWA 3BYZA 3DBRA 3JYPA 3OJOA 2NTNA 1W73A 2AA3A 3ICPA 4CQMA 2D1YA 4IDFA 2B0JA 2UAGA 4YRBA 5T67A 4CMBA 1ENZA 2DPGA 4L4SA 1T2DA 3JQAD 2AW5A 3MJSA 5TGDA 2EKLA 1A71A 1LQTA 3FNHA 5TC4A 2GLXA 1GQ2A 1E6WA 3RFTA 1TT5A 4R54A 2DLDA 1A72A 5C7OO 2QG4A 3EDMA 3TJRA 3M2TA 2AEMA 2NADA 3WMWA 1JU9A 2QRKA 3W6ZA 4XJSA 4BO0A 3W4IA 1U9JA 2FR1A 1S6YA 2YQ4A 4GGPA 3RUIA 4XKJA 1YRLA 1NHWA 3AY7A 5I8ZA 3EZYA 4R9SA 4L76A 4NFYA 4IDCA 4TSKA 2IYOA 3HB5X 3HZZA 3HFGA 1JKIA 3AFNA 4K1LA 4F46A 4XJTA 1YO6A 3L6DA 5JAIA 2FSVA 5G4KA 3L0DA 4Q3BA 3F5SA 3VTFA 1H94A 4YVFA 2GDZA 4BKQA 4E3ZA 3T4XA 3TFOA 2I76A 1DEHA 5TF4A 4TVOA 3ZNPA 1HDZA 3IQDB 1N92A 4E2XA 1NAHA 4O5OA 4OMUA 3Q3CA 1UZMA 2BI7A 1Z73A 1RM3A 3GHYA 4E31A 3D1LA 4XRGA 3VDQA 3WR5A 4CQLB 3TPCA 1P1IA 1CRWG 4ZICA 1GY8A 1DIGA 4XYEA 5L4LA 3AUAA 1LQUA 4JJIA 4CM9D 3B1FA 3JQEA 3UUWA 4W82A 4CV0A 4IGEA 3RC9A 4I5DA 2EERA 1LEHA 1CWUA 1VJTA 3C24A 1OMOA 3EMKA 3ROKA 4B4OA 3JQ7A 4PVCA 1P31A 1T26A 4OKNA 4YJFA 3UCXA 1E7QA 3K8ZA 1UXKA 1NM5A 2WDZA 1F14A 1SOVA 4W6ZA 4ZQEA 1UDCA 2XOXA 4FOSA 2VZ8A 4OXKA 1QR6A 3CEAA 5TNXA 4PCVA 3ROPA 4B7CA 3PPIA 3L4SO 1XHLA 4IMPA 4BV8A 5TIIA 4OOFA 2GN9A 4OQYA 1H0KA 2PZMA 2Y0CA 2UV8A 1GADO 3AI1A 3IMFA 4RQTA 3MJEA 5H82A 4B4UA 1LDBA 1PQPA 1LLUA 1D1TA 2NWQA 3SLGA 5CG1A 2VHYA 4ZJUA 3Q2IA 3PGJA 1YWGO 1YL7A 2WE7A 1R12A 4XWYA 7ADHA 1KETA 3QVXA 1R66A 2DC1A 5I7FA 3GHHA 3HDHA 2HDHA 4FOOA 4OJNA 4YT4A 3E48A 1PR9A 2OMEA 4A73A 2GN6A 1ZSNA 2YZ7A 2W8ZA 3WBFA 1J6UA 1RM4A 1LDNA 3EUWA 4NJMA 2ZYDA 1PS9A 4B7UA 4Q3DA 5HS6A 5KJ1A 3DZJA 2BFAA 2JHFA 3H5AA 1JWAB 2OP0A 4J2HA 1Y5RA 3NGXA 4LCJA 1GZ3A 2Q45A 1U7TA 3TOXA 2X1HA 4KUGA 1P44A 1WDLA 1SO8A 4DPLA 3X2EA 2H63A 3BMOB 2NV6A 3L4BC 4AJ4A 3NUGA 2X8LA 2A92A 3OJFA 2IZZA 2VYNA 3EW7A 1ZIDA 2YV3A 3BMQA 2Q2QA 3TZQA 1ZMOA 4CODB 4XQGA 1DIHA 5F1PA 3CMMA 4CM4A 1LC3A 4DC1A 5BT9A 2X7HA 4YR9A 4XYBA 1A4UA 5JY6A 3CKYA 5LC1A 4BO8A 2DKNA 3KRTA 3G1UA 5IN4A 1ZBQA 2HK7A 4R3NA 3LT0A 1BWSA 3JQ9C 4CM8B 1LSJA 4MVJD 4CM3A 1PQUA 2O7SA 1A4IA 4MP8A 2A4KA 5JE8A 1JWBB 4BNVA 4MJLA 1YE3A 2PH5A 3WGTA 3KHUA 3PEFA 4K6CA 4IDDA 1DHRA 1SB8A 4Y6SA 2EXXA 4XYLA 4LMRA 3PIIA 1IE3A 4QO7A 1O95A 3W4KA 5F21A 3GG9A 1HL3A 4DYVA 2QZZA 3AW9A 3GA0A 3GNTA 1I2BA 2O2SA 1HLPA 1MXFA 3H3FA 1JKFA 1EBFA 4BKOA 1MX3A 2X5JO 4ESOA 2RH4A 4E12A 5U9CA 5TLSA 4L73A 4EDFA 2EHDA 4CUKA 1GYPA 1YBAA 3L6OO 3KUXA 3Q1LA 5TS3A 2X9GA 4OQZA 3WSWA 3DFZA 4CQMD 4QSMA 1XCBA 3PFWO 4Z9FA 4Y67A 1Y9AA 5GY7A 3JYQA 2EP5A 5T64A 4CMIA 2B4TO 3HB4X 4WOKA 2AXQA 1NVGA 1ENOA 1AHIA 4JIGA 3SX2A 4X54A 3W4JA 5A3VA 1HE3A 3DEYX 4RF4A 3PLRA 2FN7A 4YAJA 3MEQA 4BNMA 1Y7TA 2DBRA 3A28A 4ZQGA 4HX5A 3S8MA 1GEEA 2YW9A 2I3GA 2FRDA 4BVAA 3CINA 1JLLA 1J0XO 4FIZA 2AEFA 1WW8A 2Z5LA 1PQWA 1PZFA 3K30A 1B3RA 1YB1A 4BGEA 4L9RA 1P0CA 3DBVO 2VWPA 2WMDA 3DZKA 4MVJH 2HKIA 3O8QA 4I08A 4PLWA 1Q2XA 4CUZA 1DAPA 3DAGA 3FF4A 3SC4A 3IDSA 3IP1A 2C54A 2AQIA 2O48X 3CMCO 3PWKA 4GMFA 2V6BA 1R6DA 1IZ0A 5CAEA 3O4RA 1DOHA 3WFJA 1X0VA 3OMLA 1PGNA 4FSHA 2YQ5A 3EK2A 5COAA 2O3QA 2W90A 3WWYA 5CDTA 4LGVA 1U28A 2VQ3A 4ZQHA 3RSHA 2EIHA 3DXFA 3HN7A 3NT2A 4IDGA 3ZV3A 1ID1A 4U0JA 3I9MA 2Q2VA 3VAZA 2GUGA 5KTKA 5JC1A 2CFCA 3ZH2A 4Z0PA 1E5LA 1QRRA 4NFSA 3O03A 2IYPA 4WNIA 1GFSA 4ALIA 4QECA 1E3EA 1I36A 3PIDA 2NSDA 1RM0A 3ZU2A 5EJ2A 1XKQA 1EUZA 1SB9A 4L0QA 2RBEA 1WP4A 2BGMA 3M1LA 1DJNA 4BO3A 2V6GA 4B8WA 1U2GA 3OQBA 3P2YA 3I6IA 3KSZO 3DTYA 1R15A 4JP2A 1PL7A 4E5YA 2VHVA 1IPEA 4JQCA 5EMHA 4OYRA 4HADA 1UZNA 4Z0TA 5JCXA 5DT9A 1B2LA 3DHEA 3PDJA 1F06A 1B3BA 4AJKA 1HZJA 3ADPA 5A3JA 4O1MA 1ZVMA 1HDXA 1PGJA 1ZW1A 3VZSA 1EVJA 2HMUA 2RIRA 4EZBA 1SOWA 4XIJA 3W8FA 1OOEA 1ZSVA 5EQDA 3WBBA 4B4WA 4NU5A 2ZATA 4WNCA 4JJGA 4MOWA 3ZV5A 2POQX 3UKOA 3KYBA 2O3RA 3WGHA 3ZW9A 3DAFA 1DB3A 1EFKA 2VOJA 5FYDA 4MDHA 1E92A 1IUKA 2GPTA 4N54A 4HWKA 1LRLA 1UXJA 5JMWA 1EDOA 5IZCC 5EESA 4HNGA 3UICA 3F4LA 2ZJ1A 2PKRA 3GPDG 5JYEA 3ANNA 2YFQA 1YB4A 1PJCA 2PA3A 3M6IA 1TEHA 3WX0A 1K0UA 2WSBA 3QLJA 1SPXA 2J3HA 4OGWA 4CLOA 2CDCA 3JV7A 3NEPX 3UAGA 1I3NA 3ZWNA 3QJ5A 4NIMA 2SCUA 1ZSYA 1Q1NA 4WCFB 4YXFA 1I24A 2VZ0A 3TDKA 4WOJA 2C07A 2GZ3A 1K3TA 4BNKA 3I9NA 4NNJA 5JDIC 2Q4BA 2XF8A 3D7LA 2C5EA 4Y98A 3GVCA 4ND2A 1NR7A 5COQA 4P4GA 1DC3A 1HXHA 2P68A 1PJQA 3Q2KA 4XRRA 4ZU3A 5KVQA 4J90A 4A5OA 4ND1A 2JAHA 1E77A 1I3MA 1PGOA 4EJMA 3CXRA 3G3EA 5U1PA 4JX8A 1OC2A 4UREA 3RQSA 1P1FA 3PP8A 2C0CA 4E5MA 1GR0A 3DBHA 2O3UA 4L4XA 4ALJA 4II2A 1M75A 4YT2A 1BMDA 1EQUA 2EWMA 4E5PA 4ALKA 4FB5A 4I9HA 4RPJA 3ENNA 4R4JA 4ZQFA 3A9WA 1E7YA 1Z75A 1AE1A 1DC6A 5DBIA 4ALLA 2Q2WA 2G17A 1BW9A 2B69A 4J9VA 1GU7A 2CF6A 2O50A 1UJMA 2DBZA 2YV1A 2Z1MA 4NDNE 3HADA 3L4BA 1YDEA 1QLHA 3MJCA 1KS9A 2VCYA 4L74A 1UXIA 1PJLA 3HHPA 1MG0A 3OECA 3V5NA 4RZHA 2X22A 2DBQA 4GH5A 3U4HA 4NHEA 1UP6A 3PFFA 1WZEA 1HE2A 1R4MA 4K6FA 1V3UA 2DUUA 1KVSA 1WLYA 1I0ZA 5DCUA 1ZXLA 4RZIA 3OH8A 3FHLA 3KZVA 3ULKA 4BO9A 1I2CA 2ZIZA 3JQ9A 3TNLA 4BKUA 4RO0A 3QY9A 1E3LA 4Z6KA 2HMTA 4IQ0A 2D2IA 3QW2A 2V6FA 3E1KA 4N5NA 3JQAB 1Y8RB 4B3JA 1JAXA 1U2DA 3RC1A 3A1NA 1CETA 3LF1A 3ZWWA 1BG6A 2BGKA 2Y93A 4TKLA 3GG2A 1DLIA 3B1KA 5AXCA 3F47A 4KWIA 1V3TA 4O6VA 4RVFA 2O3TA 1NWHA 3HN2A 3QVTA 3HE3A 4EW6A 4LW8A 2D5AA 1AUPA 5L95A 4PZEA 3JCZA 1AXEA 3NT4A 2AHRA 1OZAA 1Y8QA 2AE2A 2PNFA 1WZIA 1Y81A 3I5MA 4IZIA 4CMJA 1HRDA 2B37A 4BIIA 3JD1A 3SLKA 5F3RA 5G2OA 4ZD6A 2JFHA 4NU6A 3KYCB 4E4YA 1ADBA 2HMSA 2Y0EA 5JCJD 4A26A 1JVSA 4ROSA 3FBGA 1GTMA 2NU9A 3OP4A 3IC5A 1A27A 4J1NA 5KJ6A 2J5RA 1X7HA 2AQ8A 3RASA 3PVZA 3ZHBA 1X7DA 1ML3A 4I9UA 3D4NA 2VRCA 1EZ4A 2YFHA 3GDGA 3NGLA 1N9GB 4H16A 1ULUA 2D59A 2VHWA 3RBZA 1Q0QA 1YDWA 4K9DA 4A10A 1FXSA 5GZ3A 4R1TA 3GEDA 4K26A 3AY6A 2NTVA 4UAGA 3U62A 1GUFA 2WD8A 1NHGA 3VH1A 4BQPA 1IULA 1DXYA 1JTVA 1QG6A 1K6JA 2HUNA 1XA0A 2W2KB 1L7EA 5IN5A 1GV1A 1JVBA 4D45A 2Q1WA 4NZ9A 1G6KA 3OJEA 5JC8A 2OBNA 2F1KA 4UUMA 1LLCA 1QYDA 1P77A 2VYVA 1QYVA 4WJZA 4OHUA 4DL9A 3G17A 3AU9A 4E2WA 4D42A 4WEOA 1GV0A 2PKQO 3ZU4A 2PD3A 5B37A 5BSHA 2P9EA 2VTEA 5C3MA 2BLLA 4XIYA 4M86A 2XXBA 4DBVO 1GPJA 4NBTA 2PKQP 4Q3AA 1HT0A 4QUKA 4UEOA 5EPOA 4BNJA 3WSVA 3QP9A 2ZQZA 4D0RA 5JXWA 5A02A 1N5DA 2BELA 3RWBA 3KB6A 3OEYA 5GMOA 5IF3A 3OHSX 3GPIA 2VT2A 3KLMX 5HA5A 3FBTA 4PZDA 1C3VA 4E13A 1LSUA 2EG9A 5JY1A 3BHJA 1GCOA 4E21A 4UVHA 2OP1A 4C4OA 4IJWA 2O7QA 3DOJA 4R9RA 1I5RA 2OO5A 2WWRA 5A9SA 2PGLA 3D4OA 3TN7A 3H5NA 2JD1A 1DBVO 3IKVA 1ONNA 4KMSA 3VHRA 3KBOA 4HFRA 4HP8A 1PJ4A 3GOHA 2Y1CA 4IS3A 4XEHA 1DRUA 1N7GA 1EVIA 1ZEJA 4ALNA 4O63O 3TL2A 3X2FA 4LRTB 1HDYA 2EKPA 1OC4A 4AJNA 2A9FA 3U5TA 1FMCA 1PZHA 4YJHA 4DA9A 4J1SA 3U09A 2ZK7A 5CP8A 2GN8A 1HETA 3H9EO 2EF1A 1PJTA 2NLOA 4I1IA 4NBRA 4FJ1A 3ICCA 2HSDA 3U49A 5I9MA 3IJRA 3OA0A 5TT1A 4LCEA 2HMWA 1GZ6A 3BMCB 5IZCA 3EZLA 1V9LA 5CHEA 2AG5A 1GD1O 1RKXA 3R1IA 3VZRA 2H1SA 4AJLA 2NTJA 4N5LA 4BO6A 3N7UA 1LJ8A 1HLDA 3DZBA 2JAPA 1PSDA 3PYMA 3WTCA 1QYCA 4K28A 2PR2A 1MC5A 2ZKLA 2AQKA 4J43A 2GNAA 1V0JA 4I8XA 5A9SB 4BMNA 2X6TA 5CEEA 1LNQA 1HWYA 3GNSA 1YBVA 2DTEA 5ILGA 4PG5A 4DMLA 1B14A 3VZPA 5L4SA 4AICA 2XPCA 5JDIA 3HJAA 2HQ1A 1NYTA 2W2LA 3LU1A 3K31A 5KWEA 1E1MA 1I10A 3VPHA 2H5LA 1CQIA 1RJWA 3QVSA 4XQ9A 3QV1A 1SNYA 3IUPA 2NVWA 4BO1A 4MP3A 2D8AA 2OXIA 4DPKA 1A7KA 4QFDA 3NDIA 4UULA 1FDWA 2CDAA 2IZ1A 4E6PA 4R5HA 1EDZA 4J4TA 4E2YA 4MVJI 2NU6A 2VUSA 3JQDA 4TRRA 4BNGA 4JBIA 3I9OA 1IYZA 1LSSA 3JTMA 3KO8A 4IM7A 4GWGA 5DBFA 4RVGA 4MIEA 3PK0A 3UW3A 1ZO8A 2Q50A 2WJPA 2RCYA 3PWZA 5HS4A 2R00C 1XQ6A 1C1DB 2IRWA 5TSDA 1JKJA 3DBRB 4LVCA 3ZWMA 4NBUA 4I5FA 3JYOA 2I99A 4CQMB 4W9NC 4DBZA 4DQXA 1H6BA 3PHHA 5BNFA 4U8GA 4QQRA 5JAZA 5CPFA 5IDYA 3RBVA 1EFLA 5KJCA 4EBFA 4KUEA 3CZRA 2I9PA 4MP6A 4P4LA 1P9LA 1PWXA 3DBLA 3W6UA 4CLXA 4FBGA 3RCBA 4IDBA 4J2OA 3UHAA 3SJ7A 1TT5B 3HFSA 2HO5A 3PJGA 1E5QA 3QWHA 1EK5A 2Q1SA 2WYWA 2X5OA 4LVUA 4TWRA 4MIYA 3MCVA 3PRJA 4CV1A 5JAMA 1VPDA 1EEHA 1HYGA 1B16A 1DIBA 3NT5A 1O9BA 1MUUA 3IL2A 3QWFA 1FK8A 4RF5A 4J16A 2IEDA 1ISFA 1R4NA 3BTOA 1H6DA 4GSLA 3WQQA 4EUEA 3OQ6A 4OOEA 1ZK2A 3G1TA 4E30A 3ASUA 3ZV4A 1CEQA 1X13A 1H2HA 1KEUA 1ZKMA 2ET6A 3H65A 4JJFA 4RDHA 5A06A 2PD6A 1H9AA 4ITUA 5G0VA 1DDOA 5G4KB 4F45A 3O38A 1FF9A 2BF7A 3GK3A 3ZWAA 4FFLA 4OSPA 4RVUA 1F17A 2D3TA 5JFOA 4EEZA 4JNKA 1E7MA 1MA0A 5ITVA 1K2WA 2EGHA 3KEOA 5AXBA 4JP3A 2QZ9A 1CYDA 1WDKA 2J3KA 5LDHA 2HRZA 4Z9XA 4PLCA 1W0CA 5FEUA 1QP8A 2EW8A 2VRCD 4RV9A 2FWMX 3DC2A 3CTMA 4BB5A 5C7LO 4C7KA 4YJGA 1TA4A 2JD0A 4DLLA 4CUJA 4NBWA 4EUHA 3IJPA 1D1SA 1RM5A 1IHYA 1LU9A 1XLTA 4CLEA 1GYQA 1T1RA 3EY4A 4B3IA 1L7DA 1UH5A 3JQ7B 3KV3O 4YJFB 3LVFO 5I7SA 4RGBA 4WEQA 4GMGA 4YT8A 3EGOA 2VN8A 5B4VA 1R4NB 4DLAA 3DL2A 2VYVD 4GLLA 4FR5A 3PQEA 4AJ2A 2W4QA 3ONEA 2X0RA 3R0IA 4MVJM 1EMDA 5DZSA 5IZ4A 3LK7A 4J9UE 3BZUA 2B83A 2PFGA 1H6CA 3RC7A 4NG5A 2QYSA 2YHUA 1WPQA 5LCXA 2E37A 3ASVA 4J7CA 2PGDA 3FNEA 1U5AA 4Q9NA 1HSZA 3DWFA 1ISJA 3VPSA 3GZNA 3JD3A 5AXDA 3WGGA 1TB4A 1NNUA 4BNFA 4DC0A 2BMAA 1YJ8A 3ONFA 3F46A 4ZRMA 3LC1O 4J6FA 3V2HA 1GCUA 1CERA 3RI3A 4BMVA 2GN4A 3F3SA 2Y1OA 4RF2A 4PLYA 3IKTA 3GNQA 3P5SA 3RJ5A 4TKMA 4W7HA 4MVJG 4RJTA 5KCZA 1DRWA 2X5KO 4M55A 4AJOA 3GDFA 3C7DB 4Y6PA 4HFJA 1ZJZA 1YVEI 4BGUA 1OAAA 2GASA 4URFA 4NJMB 1Y5MA 4KQWA 4M54A 5U4QA 1UR5A 2FR0A 1ZCJA 4CMAA 4N5MA 3H9UA 4YBZA 2IXAA 3PDUA 2LDXA 1ONPA 3HQ4O 3UCEA 1LA2A 4PLGA 3HWRA 3JQCA 3WGQA 5GZ1A 3GF4A 2D4AA 3KTDA 1BDBA 5ER9A 3AM5A 2UDPA 3M1AA 4ZGWA 5BSEA 5THKA 2YYYA 2J5KA 4S1VA 3GAZA 4KWHA 3D5TA 4IDAA 1VC2A 3V2UA 3FWZA 1SCUA 4DMMA 3BMQB 3DQPA 4WLNA 4WUVA 1N8KA 4HNHA 3CSDA 2VNAA 1Y9EA 3GH3A 3ZHYA 4CM4B 3DMYA 4RPHA 3GUYA 2FOIA 4KOAA 3TOZA 4UUPA 5KKCA 1YOVA 3G0OA 5ILOA 1DSSG 2Q99A 3ZWOA 1C0IA 8ADHA 5B4TA 1ZEMA 2QQ5A 3KSDO 2Z95A 2OL4A 2Y1EA 4EITA 1NBOA 3RUEA 4S3MA 5HTOA 1JW9B 1M76A 3LF2A 1ADGA 4D3FA 5K9ZA 3FWNA 3PWSA 5IAAA 4YAEA 2EJWA 1EE2A 4BO4A 2VWGA 2CDBA 3LT1A 2PLAA 4E0BA 1E6EA 3RUDA 1LRKA 4PZCA 2OOSA 3GVXA 2E49A 2ZTLA 3NV9A 3TSCA 1KVUA 4XGKA 5ENVA 3TZHA 2O2YA 3WYEA 1BXKA 1DIAA 2QX7A 3PLNA 3WS7A 1DJQA 1W4ZA 1QKIA 1RWBA 3IIEA 4CMGA 1E7SA 1A9YA 3ZWYA 1NTOA 3VKVA 3DB2A 1QORA 4OH1A 4GX2A 1P1KA 1C1XA 2EGGA 2V6MA 4N18A 5L3ZA 4GWKA 3I83A 3C3XA 1I30A 2YUTA 4LSWA 5KNLA 4HXYA 1MGOA 2A94A 1FDTA 2XAAA 3IS3A 3WICA 1U8FO 5K0ZA 1U3UA 1HE5A 3BAZA 3AJRA 4MVJF 5BQFA 3QA9A 5C7IO 1HDRA 4FN4A 2BGLA 4ZVVA 5G0TA 1HYHA 1CQJA 3GEMA 4CMIB 4BNNA 2JFGA 1P0FA 1X1TA 2R00A 3VVCA 3DDNA 3OIDA 4AJ1A 5KVSA 1SZJG 1ENPA 4Q3NA 4BL5A 3QRWA 4YQYA 3H9GA 3OSUA 4CM6A 3ZWVA 3COSA 3I9LA 1F8GA 2V7PA 4W9NA 2HK9A 3I6QA 2VNSA 2I67A 4OL9A 4B4VA 3GMSA 3PGXA 3RU9A 1X1EA 3UXYA 3DZHA 3VC7A 4CR8A 1B7GO 1EVYA 5L53A 3AM4A 4PG8A 4IXWA 3O8QB 3D3EA 1KVTA 2QIOA 3LC7O 2Z1NA 2FMUA 4LSMA 2DU8A 2X0JA 1HZZA 1NQAO 3S55A 1XU7A 4G2NA 1SEVA 4W4TA 4PG7A 4Y8VA 5JO9A 4XR4A 5MGBA 3I1JA 3PJFA 2Q1TA 3ANLA 4J49A 1ISGA 1I32A 4R51A 4AJIA 3GDOA 2JJYA 1O89A 1GUZA 2JHGA 3I23A 3K9QO 1Q7GA 1DLJA 4D3DA 3ADOA 5G0WA 1XEAA 1U4OA 3MJ4A 4FFPA 3EYWA 5EERA 1ZMTA 5CDGA 2DQ4A 1K6IA 2NVUA 2X0NA 4PLHA 4DGSA 2JFFA 5DOVA 3IAHA 1LI4A 1EBUA 1TLTA 1T4DA 3BA1A 4HUJA 5I9NA 1PS8A 2P4HX 4CM7A 4ZN6A 3WLEA 3LSYA 3MOGA 2J6IA 3H4VA 2Y99A 3HDQA 4AJPA 2PZJA 1YQXA 3AWDA 5BSFA 4XB1A 1YONA 2AMFA 3LQFA 4J4BA 4O0LA 4G81A 1CDOA 4KUHA 3UF0A 2LDBA 2DAPA 3RKRA 1ISHA 1T25A 4YDRA 1NQ5A 2DPHA 4XA8A 3K73O 1P74A 9LDTA 1DIRA 2HMVA 5K6AC 3EHEA 3GN2A 3RUCA 5F1OA 3JYNA 3K2EA 3OFSA 1F0YA 2Q4EA 2WEKA 4NR0A 2VWHA 1A5ZA 1RYEA 2Y0DA 5A4DA 3VH3A 1QMGA 4WE3A 1XIVA 3VPGA 2UVDA 3JYLA 2W98A 1U1IA 4D7AA 2ZYAA 4NH4A 4R68A 2VYND 3QWIA 3BHIA 4ZRNA 2JD2A 3GGPA 4CM5A 2PV7A 1K89A 1GUYA 5F1KA 4ND5A 1FJHA 4M89A 3PHJA 2C20A 3OETA 4DIFA 4GVLA 4Q3CA 2R6JA 5DP1A 1BHSA 1JN0A 5DOZA 4CLOB 1QXSA 3KYDA 1GDHA 2X9NA 1PX0A 3CE6A 1NPTO 3INTA 1NFFA 3U4CA 4FS3A 1BXGA 1M67A 4CMEC 3TF5A 4BO2A 3L77A 3NKLA 5EN4A 1FDUA 1GQYA 1R0LA 2NNLD 1NVTA 3K6JA 1VJ0A 3DONA 1D3AA 5G0UA 3TQHA 2IXBA 5JO0A 2QRJA 1PR3A 1PJSA 3ZU3A 5HWSA 2IODA 3H9JA 3NTOA 2HAEA 4JN6B 3W8EA 1DFGA 3HG7A 4IIUA 4QXMA 4EEXA 3D5QA 4BOYA 3VOSA 3DZIA 2O3SA 1PGPA 3D4PA 2CNBA 3B20A 3DBHB 1H93A 4BNXA 1Y1PA 3I4CA 3AU8A 3D64A 1ZFNA 2EEZA 4R3WA 5T8KC 3T7CA 1Q7CA 4PLZA 3JQGA 3FPCA 3E18A 5IDXA 1SEPA 3S2GA 1N1GA 1PTJA 1NQTA 3WGOA 3HDYA 1KC3A 4L75A 2OFPA 3TZCA 4YAGA 2B4RO 2NM0A 1BW9B 2FY8A 1U3VA 4RQUA 2WM3A 4CJXA 1B8UA 3GMDA 3W8DA 4FCCA 1D7OA 3JQ8A 5CEJA 3MTJA 4CPDA 2VWQA 4ND4A 4WECA 1XG5A 1I3KA 4NFHA 1KY4A 3EAGA 1I33A 4CV3A 1IL0A 1R4MB 3JQFC 1UAGA 1J5PA 3UH1A 3ZHZA 1S7CA 1UP4A 1NQOA 2JCVA 1IHXA 5EIOA 3WDSA 1WVGA 4I9NA 4LK3A 5I9LA 1KVRA 1LDMA 4KDEA 2HU2A 4A2CA 2EKQA 1HEUA 3CH6A 1ZK4A 1DPGA 2VUUA 3JQGB 3GEGA 3T7EA 1YQGA 3NJ8A 4TVBA 5JPIA 4R69A 2JL1A 3I3OA 5A1TA 4YWJA 2VOEA 4PLTA 2IE0A 2NUAA 3VPXA 3CUKA 4JBHA 3NDJA 4Q39A 3CPSA 3IUSA 2VTDA 4DYDA 3Q11A 4FJ2A 1N7HA 3WGYA 3V1UA 1E3WA 4WGGA 2WD7A 4UVIA 3VTZA 1U3WA 5B12A 2RHRA 1UDBA 2J3IA 3F4BA 1Y8QB 2IZ0A 4YACA 1PGQA 2ZB3A 3AI2A 4QO8A 4OSOA 3N58A 2C5AA 2CVQA 4RLHA 2BFPA 3OJLA 1JDJA 1NPYA 3AUTA 4P4NA 3P7MA 2E48A 1ONOA 3EC7A 4A7PA 4OXYA 5KVCA 2GF2A 4TROA 3VZQA 4BNUA 4B8ZA 2B5VA 4UVDA 3GQVA 3RJ9A 4DIBA 4HFMA 4H7PA 4YPOA 3K2BA 1F12A 2ZJ0A 4RPGA 5GZ6A 4CV2A 3AFMA 1P33A 1LDYA 1MLDA 4XYMA 2UUOA 2D0IA 1PJ2A 4NJOA 4R41A 1HF3A 1XR3A 4QX6A 2YY7A 4L8VA 3OIGA 3F6YA 4ZQBA 5H83A 4MPDA 3H5RA 4YRAA 3ETEA 1C14A 1WXDA 2Q3EA 1PU2A 5ENDA 1EE9A 4R5MA 3OIFA 1NAIA 1C0LA 5DNAA 4U5QA 1GL3A 2JCYA 3ON5A 2C7VA 1E6UA 3AOEC 3ZV6A 4MIOA 2PTGA 4R1UA 1HSOA 2G76A 1VI2A 3LLVA 1CF2O 2GD1O 4W99A 2VZ9A 3VKUA 5A5FA 3WGZA 3KETA 1NASA 3BMNA 3S2EA 3GFGA 2A35A 4AJHA 3D3WA 3PJEA 5KJFA 4YJDA 2OGUA 4G65A 3JD2A 2BFMA 2FPIA 3E82A 1TT7A 2PZKA 1ISIA 4AFNA 3L9WA 4R1NA 5JAQA 1AGNA 1BRMA 4JLWA 2P9CA 1SMKA 5ES3A 1ZH8A 3HNPA 3RIHA 1EVZA 4RVHA 5KVVA 4MVJA 3RAJA 1UP7A 1PJBA 2CZCA 4BNIA 4BUCA 3AM3A 4TRJA 3F9IA 4WLOA 4XGNA 3IP3A 5A03A 2I65A 4QTZA 4BKRA 1WNTA 2YJZA 5FFFA 1WWKA 5JYDA 4MKRA 3MJVA 3L07A 2PD4A 1O0SA 4FC6A 4II3A 1G1AA 4DUPA 2B36A 3AI3A 3BIOA 4IJKA 2G5CA 3NX4A 4M49A 4YTEA 4AJJA 1WMBA 1K6XA 1E1KA 3E6AA 1LX6A 1NWCA 3WWZA 5C5IA 4CLRA 2J5QA 1MB4A 2CD9A 2VUTA 1MXHA 2I66A 1KBZA 4YQZA 5F5NA 4LISA 1P1JA 1LDGA 1I8TA 2J3JA 4ID9A 3ZNNA 1DFIA 5LDGA 4E32A 4DPMA 4PN3A 1SBYA 5THQA 4YJHB 5K6AA 3QSGA 3L6EA 4JGBA 2XXJA 5BNIA 4BGIA 5CDSA 2CVOA 1SC6A 2OZPA 5HM8A 3C1AA 2C2XA 3WOHA 4JROA 1LXCA 1NX6A 4TMFA 4WCDA 1X15A 1KERA 2UUPA 3C7AA 4FFOA 5A05A 5IXSA 3PYLA 1YBMA 3QWBA 3FNGA 3WB9A 3RUAA 3P2OA 4FGWA 3RBXA 4BQRA 1XELA 5ICMA 5JMPA 3H8VA 5JS6A 1RPNA 4JK3A 5G0SA 4CQLA 5H81A 2HK8A 1BVRA 1JAYA 5IJZA 1ORRA 2GSDA 4PG6A 4GLOA 4KDFA 3JQ6A 4B79A 4LMPA 4CM1A 3ITDA 1V6AA 3E8XA 3C7CB 1HTBA 4NPCA 1PEDA 2OUIA 3R3SA 3E9MA 3EVNA 4FQ8A 4TZKA 1O5IA 4CLRB 4CMEA 2WYVA 1NFRA 2B5WA 2BI8A 1VJ1A 2I5PO 5DDIP 3G49A 1IOLA 4J1TA 4HY3A 1T24A 3DOCA 4EYEA 4AG3A 4CLHA 1PZEA 4H3VA 1XWFA 2C7GA 4Y9DA 4F6LA 1XYGA 1BVUA 1X14A 3EVTA 4IJUA 2G82A 3MWDB 4NBVA 4WLFA 2E4AA 1HDGO 5MDHA 3H9QA 2YV2A 4J7UA 1AN9A 3F1KA 4ZHSA 3SBOA 5TQVA 1EUDA 3IOYA 1PIWA 1QYXA 2QRLA 4IJVA 2FP4A 1QLJA 1JA9A 5IXYA 1L1FA 2OHXA 1M6HA 5T8KA 4XYGA 2UYYA 4WCFC 2HLPA 3RUHA 1WDMA 1D4FA 4KQXA 4M8SA 3WIDA 2FHSA 4Z9YA 3JQBA 4A27A 4XQEA 3PXXA 1T1SA 4IQ8A 3H2SA 3SJUA 2ZB8A 5FF9A 2H6EA 4U6QA 4XDZA 2DFDA 1ARZA 4YAKA 2CY0A 3BTVA 2Q49A 3AOGA 3G79A 1Z7BA 5HBRA 4FFNA 4EGFA 4MINA 1WMAA 2BD0A 2BHLA 1HE4A 2NU7A 1XGKA 3JQFA 4IIVA 4PLFA 3VPFA 3DBLB 2PH3A 1O94A 5ER6A 4B3HA 4NK4A 2GERA 4PG4A 4E5KA 2ZCUA 4KP7A 3UVEA 1W6UA 4GBJA 1B8VA 1C0PA 3BMOA 1VSUA 4C7JA 3V8BA 2FZEA 4UUNA 5C37A 4J3FA 5DP2A 4INAA 2H9IA 3GAFA 4RPLA 3FNFA 5JDCC 3MTGA 3RFXA 4FD3A 4Z3DA 5FWNA 3SVTA 3JSAA 1VLLA 3K5PA 1ZNQO 4PLPA 4B7XA 1W8DA 3RD5A 3A4VA 1Z45A 5B4UA 1N2SA 5L7WA 2FSSA 4CM8A 3RFVA 4ALMA 2VHXA 4RCVA 5TT0A 4P8RA 2YDXA 3W1VA 4P38A 3WMXA 1P3DA 4FJ0A 4FFRA 1BXZA 1DRVA 4CLDA 3N74A 4FGSA 3NRCA 3ORFA 3PHGA 3Q9UA 3QQPA 4YJGB 4BKPA 4MO2A 4DLBA 3RKUA 3RVDA 3P19A 4NMHA 4EJ0A 4IMRA 4WK6A 3DZFA 1ZXBA 3VVBA 4NK5A 1E3JA 3ZWXA 2NQ8A 2OORA 3QHAA 4RVDA 4U0KA 1EUCA 1J4AA 3PYXA 2GGSA 4GQAA 3TFQA 5T57A 3U4DA 5A5EA 4J0EA 3ROQA 1VL8A 1H5QA 1BSVA 1E1NA 5EL0A 4GI2A 3ZHXA 1HYEA 1QYWA 2C29D 2Y66A 4J91A 1WAMA 2O4UX 2X4GA 1UZLA 2DFVA 3M2PA 3Q9NA 3UFXA 3AOEA 3O9ZA 2HCTA 3QIVA 4CL3A 1E7RA 3KVOA 3E9QA 5AQ1A 4YAIA 4AL4A 4NQZA 1NPDA 3E5MA 3ETDA 3VDRA 4EI2A 4D0SA 3JD4A 2VT3A 3GZNB 1UXHA 3H7AA 4DTIA 4FC7A 1MC4A 4PRKA 3TRIA 3K92A 1QSGA 2JCXA 1LLQA 1ZJYA 3GVIA 5I8WA 1FDSA 3DMTC 3ABIA 3ZNQA 1OI7A 2P2SA 2P5YA 4IS2A 4R16A 3GGOA 1U4SA 4E2ZA 4IY1A 4GX1A 1VE9A 1HDOA 2BKAA 4JBGA 3KM0A 3PZRA 1YXMA 1V35A 1BGVA 1MFZA 4D79A 3AK4A 1B26A 4RPKA 5L7TA 1DHTA 1ZUD1 2ZB4A 4R01A 2W2LD 3DOOA 4RF3A 4UVEA 5AVOA 1KVQA 4CR6A 4GKBA 4GKVA 2X58A 4BNWA 2PZLA 3WLFA 1YGYA 3R6DA 4IXTA 1Q0HA 4O59O 5F5LA 1LDEA 3RUFA 1GPDG 2NACA 3Q0EA 4J7XA 1XU9A 3GLQA 1DFHA 1OFGA 4GVXA 5L45A 2D5CA 1P1RA 5FI5A 1QV6A 3OEWA 3WQSB 4J0FA 1O6ZA 4E33A 3SXPA 3PHIA 3A14A 2QHXA 4YCAA 1VL0A 2GR9A 4H15A 3TWOA 4CR7A 3WYBA 9LDBA 2DVMA 3LZ6A 3FN4A 3RROA 1X0XA 5KOIA 2G1UA 1MFPA 4PFJA 1NR1A 1IZ9A 2GZ1A 1M6WA 2PK3A 5JCJA 3FR7A 3ZN2A 1DO8A 4CMCA 3ZI0A 6ADHA 3SC6A 3DAPA 5DN9A 4DVJA 1YOVB 1XDWA 3S2FA 5JNLA 1T2FA 3ZDFA 3OICA 1G0OA 3I52A 3FSRA 3RC2A 3GN1A 5IDWA 3HDJA 3A06A 3GT0A 3L9XA 4ONEA 6LDHA 1ZK1A 3VH4A 2TMGA 1N1EA 1R0KA 2CUKA 3DHYA 4R1SA 3ST7A 3PQDA 4RL6A 2ZCVA 4XZ3A 1Z74A 1BTOA 3UOGA 4U7WA 5A9TA 4DIOA 1IY8A 4BO5A 4ILKA 1R16A 1V8BA 4GAEA 3I9KA 5L51A 2EV9A 3OF2A 4BV9A 3KEQA 4YRDA 1YB5A 1T4BA 2DT5A 2I3AA 4MKXA 4UVGA 4Q3EA 4WASA 3BTUA 3WYCA 3R3JA 4FPXA 1U5CA 2BH9A 4A0SA 3ZU5A 3GFBA 1YQDA 1EK6A 3INRA 5J23A 7MDHA 5HRUA 3H2ZA 3ETGA 5L40A 4CL8A 4F6CA 1HKUA 1C1XB 4AVYA 3ENKA 4IGFA 2DBVO 4IZHA 3RU7A 1C0KA 3NDRA 4Y6RA 3WGIA 5ICSA 1KIFA 2HJSA 3LT2A 2IEBA 3PTZA 4WCFA 4GPD1 3U4IA 2EJVA 4PVDA 2GZ2A 5CDYA 3INGA 1VM6A 3MWEB 4EUFA 4MVJP 4CMHA 4TZTA 1U8XX 1ZK3A 4DRYA 4EJ6A 3ZCXA 3S2IA 3MJTA 3PJDA 3UGKA 5CPBA 1O8CA 3PZBA 3LC2O 2JKVA 1H2BA 3LT4A 4I5EA 3MZ0A 4BGVA 2AQHA 1PJ3A 4AJEA 3HSKA 4OKIA 1LRJA 4Z0HO 4DXHA 2FZWA 3B70A 3T4EA 5JSFA 5FI3A 2QW8A 5DF1A 2WTBA 2CVZA 4JXKA 4BNTA 1E3IA 5CEFA 1Q7BA 3FPLA 4HBGA 1PZGA 1Z6ZA 3ONDA 3FR8A 5JLAA 5CDUA 3GC6A 2C59A 1MG5A 4DQVA 2P5UA 3CIFA 3QVOA 4DQUA 2GYYA 3GRKA 3K96A 4RLSA 5T6BA 4NI5A 3ZWCA 4TQGA 2TMDA 2C2YA 2ZYGA 5JDCA 3DTTA 1KOLA 2RH8A 3SEFA 5IDQA 5JW6A 4Z3KA 4WKGA 4QEDA 3F5QA 5KKAA 5T5QA 4JCOA 2B4QA 5L7YA 1TXGA 2DM6A 4GX5A 3WNVA 5KJEA 4QFCA 3OA2A 2NVUB 4BMSA 4YEDA 1HDCA 4IQGA 2CSUA 2QYTA 4GSKA 4QT0A 5JBIA 1Z82A 4OO3A 4TRNA 4WLEA 4HKTA 4HFNA 1X7GA 3I9JA 3NJ4A 3S1LA 1LC0A 3H6KA 5TX7A 2YDYA 1TVEA 5TJHA 2PWZA 3KLPX 1YH3A 3JQAA 1Y8RA 3BHMA 2DUWA 3NAQA 3QVWA 4M87A 4WLVA 1DC4A 1YL5A 2GRAA 3LYLA 4E5NA 3I4FA 2NVBA 1LTHR 5G4LA 4LRSB 1AHHA 4DREA 3OQ1A 1XQ1A 1NVMB 3C85A 3KSUA 2FPPA 3WQRA 3JD0A 1T2CA 3FI9A 2P4QA 2O3JA 3WXBA 4BO7A 3ZZNA 4HV4A 3E5RA 3WJAA 4BB6A 1KEPA 2DTDA 3V1TC 3C1OA 3GZ4A 3HUDA 4BNYA 1YL6A 1MP0A 1E3SA 2B35A 3MOIA 1Q0LA 2CF5A 4BHTA 3V1YA 3GVHA 2ZTVA 2AG8A 2RAFA 1KY5A 3KYCA 1VL6A 5ITWA 5L4NA 3DZGA 4FDAA 2NQTA 1GEGA 2AE1A 3ZWPA 2EW2A 2VRBA 2PY6A 3JQBC 3GRPA 4LN1A 4XR9A 5BR7A 2CMDA 1K5HA 1Z7EA 3KYDB 2DTXA 1VSVA 4GL4A 5TRTA 1R37A 1BXGB 1H9BA 3WTBA 1H6AA 1OBFO 4WPGA 1LSOA 5AOVA 3H3JA 3OJ0A 5COBA 3DMTA 2O4CA 1IB6A 1PL8A 1N9GA 4MKZA 2Y1GA 2P91A 3OBBA 4CM9A 1U3TA 3OM9A 2FR8A 3B1JA 3KXDA 4PIVA 3C8MA 2PGJA 4YB8A 3U9LA 1GAEO 1I2ZA 4D41A 1CIVA 4A03A 2Y67A 1NFQA 1UDAA 2IDZA 3NTRA 2EP7A 4D44A 4XX0A 1B0AA 3ZNOA 3GR6A 4PRLA 2W2KA 2OBYA 5A04A 3E03A 3F1LA 4XQCA 3LLSA 4D46A 1LUAA 3AUUA 1A9ZA 1P45A 1UAYA 4BNHA 4ZA2A 5B1YA 1P1HA 1GQQA 4D43A 3GUCA 4IDEA 1SAYA 5AXAA 5L9AA 2O23A 2ZTMA 1NP3A 1VKNA 2V65A 3AY3A 4W7IA 4KTTE 2HRBA 3FTNA 2AEJA 4J1QA 4N7RA 3TZ6A 8LDHA 2ZTUA 4OXNA 3VH2A 2G0TA 3UN1A 5DCWA 1G0NA 4MVJE 1ENYA 3JQ8B 4CMKA 5IG2A 2ILTA 4PGFA 1TI7A 2YHIA 3DO5A 5ADHA 1PWZA 1EQ2A 1UUFA 4RDIA 2X0IA 5BNTA 1VRWA 2Y05A 3ZGYA 1NXQA 1PL6A 4F3YA 5CFZA 1KEVA 1F8FA 3FRJA 3FCOA 1B15A 1AXGA 2BRUA 4KTVE 2GCGA 2X9VA 4OAQA 4GX0A 3FTPA 3B6ZA 3LDHA 1E7WA 5KIAA 4XB2A 3KOUA 1T2AA 4TRMA 5DULA 5AYVA 2ZQYA 4UUOA 4IBOA 3GGGA 1ADCA 1D8AA 2Q1UA 4GGOA 3PI7A 3BXXA 3QWAA 5BSGA 3C1TA 4G5HA 4OIMA 1QV7A 2HJRA 3STHA 5I7EA 2WE8A 3ITKA 4IPTA 4YT5A 5IFLA 1UXGA 4FFMA 3WFIA 5DBGA 3BTSA 1VKOA 3ZW8A 3BMCA 3NTQA 2C82A 2VHZA 2RHCA 3PQFA 4KZPA 3ANMA 2E82A 3U0BA 3E9NA 3ROMA
chains in the Genus database with same CATH superfamily
1E2KA 3W5AA 4YDHB 1TUBB 1DC5A 1YS2X 1ZD8A 2BL4A 1M54A 1F0NA 2AI1A 1V7PC 2YHIB 4XDYA 5DCYA 3W6PA 2Q9CA 2YXBA 3NBUA 3TCXB 4IH1A 3VU3A 2PT6A 3A3OA 4OLJA 2RIPA 3WLLA 1VP9A 4R1MA 5DGHA 3H5WA 4I1UA 5F1YA 3QPWA 3G0CA 4QGHA 3ZE9A 2B78A 3ZY3A 5KSWB 4H1VA 2DPYA 3H3XA 5K3FA 3TIIA 2HU8A 3TZKA 3G9XA 4RORA 4UATA 5CCXA 3K1JA 3ZY2A 4LHVA 2DPLA 2BKXA 4UFPA 5KC9A 4WLUA 1R0ZA 1XEFA 1U7HA 5KDDA 4M1QA 2A9OA 1ZZGA 1UMBA 1ZPDA 1DEAA 2R48A 1GGVA 2YRWA 3AUSA 3P9YA 4IVPA 1OXBB 3KVYA 4NCXA 4Q9KA 4QXQA 4XEUA 5D3MA 2YNMD 3SCZA 2AMYA 2KLBA 1CDEA 3EA5A 3BD6A 1LWNA 1AQ6A 2AOTA 2HHHB 2PUEA 1FYXA 2OAP1 3MUEA 3IR5A 2VNKA 4KXWA 4PYRA 4UEJA 3UFBA 2PUBA 1XZGA 3R7BA 2Y68A 4TYPA 4YYZA 3DHNA 5K20A 4QOHA 4Y1FA 5EQFA 3E22A 1B8PA 1W4LA 4DJDC 2OAGA 3UCFA 4TX1A 2G9VA 1GL7A 4PZPA 5E7QA 1RP1A 4IUYA 3CLUD 2ZB2A 3MG9A 2RARA 1HBJA 3O4GA 4DHWA 4EY8A 1DAFA 1XD8A 1I3LA 4F60A 2Q46A 4YA6A 5D6OA 1P2SA 2VK1A 4G4GA 4Q7JB 4Q93A 4YH1A 5TE9A 2I3BA 4WFIA 3SZLA 2PANA 3B53X 3WNZA 5BWMA 4K9LA 4F4CA 1LBEA 2W2NA 3R5KA 4O25A 4X8MA 1USKA 4P7JA 1C1DA 4LF7B 4AP5A 2BZ0A 3GLHA 3UWDA 4EHKA 1ULSA 3B3AA 1KEWA 3COZA 3CZMA 2PSDA 3JYPA 1QOQB 2CJPA 4R81A 5HP4A 4KNYA 2R60A 2NTNA 1C7RA 1XJ5A 3G5UA 5AHRA 4Q00A 1G5IA 2F48A 3O75A 2H16A 4IDFA 4HNUA 3AEYA 4CKYA 5FBVB 1Q0UA 2FPGB 2UAGA 1L5VA 3PUWA 3QW4B 4V0OA 4Y0NA 5T67A 3WLMA 4YRBA 3QLTA 1AIPA 2H54A 2WI8A 5BN5B 5J59A 4DLZA 3V4SA 2P3LA 4HMOA 4LBVA 3U3RA 3A2KA 1DQPA 4TS9A 4QG7A 4YWHA 4J03A 2IUTA 2GLXA 4QL3A 1SQSA 3KJZA 2FH5B 3SC2A 2DLDA 1A72A 3A31A 3K4HA 4RLFA 1JMVA 3TJRA 4H6XA 3WMWA 4PZAA 1CULC 5BVGB 2XGJA 2RGEA 1E9FA 3N5CA 3ZDAA 1JU9A 3BB4A 2XUPA 2QBYB 4RTJA 1Y0BA 1M7HA 3R3HA 3T1OA 2BMEA 1TA0A 3SIRA 3BSFA 4MS4A 3N53A 4OJYA 4MLCA 2OV2A 3F2IA 4J6EA 3O8BA 1R9NA 2QTBA 4LXXA 4N3AA 1D6JA 4L76A 3SJZA 4W5JA 1LBSA 4NFYA 4N39A 1KK1A 1VB5A 1N2JA 5HE9A 5IK2D 2PX2A 4CTMA 1LK7A 2W8BB 1JKIA 1TJ3A 2ZUSA 2C9BA 3AFNA 2ZRCA 3L8GA 5C5CA 1RD4A 4UNSA 1L4UA 3LYAA 3DE2X 3W1VA 5C81A 2CCKA 3JY6A 1MVLA 3QOFA 2K2WA 1H94A 3QE4A 3F6PA 3RC8A 3RBAA 3NOXA 1T43A 2XQIA 3T4XA 2W6PA 3MD9A 2RKWA 1HDZA 1WD5A 3IQDB 1N92A 2GRJA 2VF5X 4MH0R 3TDMA 4A82A 3Q3CA 4BTVA 4E2XA 4FMCF 1XKTA 2ODWA 3S0JA 1IWPB 2YICA 1Z73A 2ODPA 3E0XA 4AS2A 3LGXA 1NLYA 1P1IA 4G01B 5CVCA 4C03A 1CRWG 1KI4A 3ZZMA 3LUBA 4G07A 3G0HA 4V2IA 3R7FA 3UGTA 1L9KA 3AUAA 4DCVA 3BRSA 1BS9A 2FI1A 1ZOOA 3V4LA 1GNSA 1I9CA 2P4SA 3B1FA 3JQEA 3BSWA 2P6PA 3EVEA 3I34X 1SXJB 3V1MA 4A8TA 4C4XA 4CV0A 1DCMA 5BWLA 2Q3LA 2EERA 1VJTA 1IC6A 4DQ0A 1HLFA 4IKEA 1A9PA 1OMOA 5EPEA 1FOEB 5LP6A 1P31A 3ET4A 4L72A 4N0PA 3A1TA 1E7QA 3N0RA 4AYWA 3E9DA 1QIKA 3ZU6A 1F14A 1SOVA 1UDCA 2ZPUA 3C6KA 1KPIA 4FOSA 4I50B 2D00A 3PKIA 4PBRA 1TE2A 1I7NA 1ZM2A 4FFBA 1OVGA 5DYNA 5E2IA 4KR2A 2IYRA 2BJWA 2RGYA 1AKYA 2Q5QA 2QN8A 2ZPTX 5CH5A 3UB4A 3U7IA 3V46A 4NSNA 2HL6A 7GPBA 3PPIA 2QORA 4FDVA 5DX1A 1WCWA 2FWBA 1PWYE 3FHTA 3R9XB 5IT5A 3F90A 3UV7A 2BUCA 1H0KA 4NYJR 5GV7A 4M1KA 4E1VA 2FK7A 4C3UA 1GADO 3AI1A 1RS0A 2VHCA 1RAGA 3IMFA 4RQTA 1SG0A 3ZUPA 3ZWQA 4Z51A 2HCRA 5E6SA 1RXVA 1U0GA 4B4UA 3FZEA 3CUSA 3D02A 1M8GA 1BXRA 2MYPA 4MEBA 4ZYLA 3LLUA 1R88A 5ITVA 4WZZA 3DE3X 4CEHB 3D4BA 5BR8B 2WJ4A 1WV0A 1DX4A 4B6SA 2YWEA 1J2UA 1PR1A 2Z8YM 4O2BA 3N6XA 3IDZA 1E5XA 4OFWA 3D5EA 5CFNA 5FKJA 4EFNA 1Z7GA 1GSOA 4OJNA 4MJ3A 4YT4A 4OX9Y 4BFZA 1D9XA 2WHPB 2OMEA 3G2JA 5ALNA 3TTXA 3WRWA 1A5TA 4A73A 5KHLB 1PNOA 2OV6A 1ZSNA 5T4HA 4EG7A 1Z3CA 3CUVA 3GJ3A 3HDVA 3I8XA 1J21A 2J0EA 2ZU6A 3QQ5A 4DV0B 1NMQA 2VDQB 5DYTA 1RM4A 1CY2A 1SIWA 1OXUA 2ZYDA 5JZBA 4OYHA 1AZTA 1ZGBA 5KJ1A 4TL8A 2O8CB 4EQ6A 4ZI2A 1OYWA 4CCYA 3O5AA 1QIMA 5KYXA 2D06A 4KG7A 1R4ZA 2QD3A 5H9WA 3FSJX 1U7TA 4F3CA 4KUGA 4TTSA 1P8AA 2NYUA 3A04A 1SO8A 3QUQA 1U0RA 1Z6TA 2X0DA 4WQMA 3M5WA 1FUUA 4UTZA 1MMFB 4EYSA 3X2EA 1Z4JA 4CF3A 4G0YA 4OQPA 2IZ5A 2R66A 1Z0ZA 2CZQA 3Q4GA 3DTVA 3HZRA 4CRWB 1Y34E 3K53A 4Z7JA 1PW5A 4QJIA 4AG6A 1QG2A 2A92A 1RMTA 3EW7A 1ZIDA 3B52X 2NSJA 5K8UA 3CJQA 2DHDA 1XMXA 4YP1A 2FQYA 3TLBA 1K88A 2Q2QA 3OY2A 2E4YA 5IAKA 3TZQA 4FEGA 4BEWA 1GDTA 2HQOA 2YZ2A 1K5GA 2Q8QA 4YO8A 1G8FA 3FVWA 1QONA 3I1YA 2F6RA 4FMBB 5F1PA 4AIIA 4CM4A 1A4UA 4YR9A 1J97A 5J9FA 3CKYA 4KQEA 5LC1A 4XVHA 1T8TA 3LCRA 4JLJA 1TKAA 3Q3EA 2P1RA 1OU4A 1XN4A 4MO9A 4BO8A 3AIOA 1EFHA 4G85A 1TK2A 3QKSA 5DE3A 1R3UA 1OTHA 4R3NA 3QFHA 3WKAA 2DFLA 3JQ9C 4Q34A 5LBUA 3TINA 2ZR9A 4I7EA 4EHDA 2AGVA 1PUIA 4BUJA 5CGZA 4CM3A 5KC8A 1U6JA 2ZJZA 5B7GA 1A4IA 3NANA 1QUEA 4XCXA 5JSQA 2A4KA 5JE8A 3SHVA 1VB3A 3OCYA 4BNVA 2JCGA 2IXDA 4ZVQA 3G8YA 2BR4A 1YE3A 3BL5A 4MJLA 4CTKA 3KHUA 4K6CA 4FT4A 1D0SA 2NO9A 4Q7LA 3B5IA 3I1FA 3VHLB 2IEAA 3IOEA 3PIIA 4FS8A 3TQIA 4FMDF 3I0MA 4BMCA 3PC3A 3VJLA 4OYYA 1J06A 2OCAA 3GG9A 3BT7A 3IAM6 1GAXA 2QZZA 1EUCB 1YRBA 3AW9A 5CVUA 3T7DA 2X2EA 3PCRB 3HVHA 5TXGA 4LXIA 1OZ0A 4TKUB 1PZMA 2OGZA 4N41A 4G0UA 4IIEA 3N1UA 5LQKA 3C4VA 5JJ5A 4TZ0A 1EBFA 5E1BA 3CZ5A 4G5GA 3CRMA 1MX3A 1GDDA 4M1MA 4ESOA 4P6VF 5ECDA 3BK7A 1CPYA 3GFSA 3I2FA 5KYGA 5U9CA 1JBQA 3IE2A 2XDWA 4YJ3B 5CLJA 4HYYA 2ZJ7A 1YBAA 3ZKWA 2YJ5A 1N36B 1VJCA 3RNOA 3Q1LA 2X9GA 4QODA 4RY8A 3SDBA 4H7KA 5L3SB 2C4TA 1AUVA 3WSWA 1Z68A 4EF5A 1VLJA 3G8AA 4U2KA 4UBMA 1A2QA 3R5XA 4QSHA 5CK5A 4OMCA 1RAHA 1WEHA 5G1PA 4MPPA 4OHWA 1WUHS 3C15C 3FYTA 3OZAA 1GWNA 2X9QA 2R4TA 2WHRA 1JIKA 3A1EA 3JYQA 3OLCX 3HB4X 1X9HA 4D8WA 2VAXA 4M38A 3LFTA 4QJBA 3EN0A 3W1WA 2AXQA 1ZX1A 2BTQB 1JLRA 1I7PA 4JIGA 3SX2A 2PNJA 4KPYA 3T3PB 5ALZA 1C7JA 1XDZA 2CB0A 3MEQA 2ERCA 5B1DA 2UYQA 3NC0C 4BNMA 2CMKA 1SXJD 1Y7TA 3GJRA 3VBEA 1T3ZA 1TVCA 3A28A 4U7PB 5FUQA 3HNOA 4J0DA 5AVWA 3S8MA 3DV2A 3FLEA 3V8PA 3ZIUA 3PQ2A 3TXAA 3QVLA 4QPDA 1JLLA 1J0XO 3LHSA 3R40A 2IEZA 1WW8A 2Z5LA 1PQWA 1QV9A 3K30A 2QX6A 3KYJB 1YB1A 3DVAB 3HH8A 3BK2A 3K8QA 1P0CA 2F1HA 3DBVO 4L9RA 1P1CA 2VWPA 1X6VA 4I2VA 1UJCA 2HKIA 4I08A 4RGQA 1OASA 5D5QA 3P27A 4CUZA 4MAAA 2C57A 2FG5A 4QUAA 1U2SA 2I1WA 3IP1A 1V3QE 5JHHB 2AQIA 4GMFA 3N39C 4TQUS 2QK4A 4QGFA 3MWKA 5CAEA 2JKYA 3D3QA 1W0KA 1DOHA 3QU2A 1B0ZA 4C30A 1X0VA 3ZS8A 4LV6A 1H3FA 1D0IA 2V8OA 4FSHA 5CDTA 3WWYA 1H85A 1CVLA 2DJ5A 2PKEA 2GJ8A 2EIHA 1V43A 3BEDA 4LXTA 4MQUA 3RSHA 4EL0A 4FCVA 4TV9A 5BO5A 1ID1A 2LIPA 2Q2VA 4ZVUA 2YZNA 5I7RA 5KTKA 1VPTA 3HLYA 2LV8A 3NWEA 1W96A 1WY7A 4H17A 4YAUA 4QQFA 5JC1A 1KDRA 1KA9H 3O03A 4UARA 4WNIA 5IVDA 1N78A 3IULA 3L84A 1WIWA 1EFTA 3PIDA 4WD3A 1KEZA 1UCFA 3CCBA 4AF8A 4JR0A 1VJRA 1QRAA 1ZN8A 4J0KA 4JXXA 3UMYA 4X8HA 3G9TA 3THWB 4GC5A 4F9FA 5C8YF 1DJNA 1HLGA 1J70A 4B2YA 1U2GA 4HDOB 4JC5A 4ZZIA 2FWJA 1WXXA 4ANFA 3DEHA 1G4HA 2B3DA 3IAXA 4TKVB 1P6XA 4M7RA 1KO4A 4KO1S 1YU9A 4JQCA 2QR3A 5JJCA 4HADA 1UZNA 4Z0TA 4BAUA 1JJIA 1UC4B 5LJIA 3DHEA 4F12A 1KZYC 1F06A 5GJWC 4CFSA 5HKBA 4LDJA 1QFSA 3KQKA 4AJKA 4K6KA 5KYKA 4RY2A 2XYGA 1J5XA 1CP3A 3VZSA 2HMUA 2RIRA 3I0ZA 3RAPR 3RIYA 4PYJA 3R74A 2E3JA 2QMQA 1NMYA 1JHAA 4GU5A 2C2KA 4BY9E 1O94D 4NU5A 2JEYA 4GR4A 4HN4B 5LWQA 4MOWA 5EZ5A 1AMUA 3CLRC 5FNVF 3TRJA 3ZW9A 4Q16A 4DV2B 1E6LA 2IYAA 2VOJA 5CB4A 2ZM6B 3WK8A 5EZ6B 3S5UA 2HTEA 4GL2A 2OZEA 5EESA 2O2GA 3DAHA 4HNGA 2OENG 4U7JA 1SVUA 4M99A 4M8IA 2H85A 3UICA 2AFHE 1DBIA 2C94A 2ZJ1A 3B38A 3MWJA 3P2EA 3UV3A 3VYTB 2AKAB 3IBSA 4KKVA 4MYUA 1T0PA 4B80A 3VPAA 1RZUA 1GR1A 5HG0A 1HY3A 1X9IA 5B1SA 2JGJA 3DDSA 4QLOA 5ITZB 3P9RA 4WWHA 1NUAA 2WUVA 2CDCA 3JV7A 2Q8NA 3HLTA 3LS2A 4YDSA 4AP9A 3EC2A 4D0LB 2SCUA 2IPOA 3NC1C 4WCFB 3CVVA 2POCA 4Q12A 3E3LA 3THYB 1VBMA 4QYTA 4TYNA 5DHRA 4B85A 3LW7A 3T4UA 4MLDA 4JT8A 5ALYA 5LJLA 4KXYA 4N5DA 4UUQA 2QSZA 5I4BA 2IHTA 1PNVA 1DC3A 4Z8YA 4OA5A 1CVIA 3JWJA 3JATA 1GN9A 1RLMA 1ZICA 2QZJA 3QEOA 4X1IA 3SJAA 1XHFA 5U1PA 3M34A 1Y4UA 4BJHB 5BRAA 3DLHA 2Q5HA 4JX8A 3E2IA 2W6IA 1P1FA 1W87A 3PP8A 3E1GA 5GJVC 1GR0A 3DBHA 2O3UA 4L4XA 4KQKA 2E18A 1BWQA 4X85A 1KAGA 1E9EA 4GLFA 4II2A 5BORA 1I51A 4ABYA 5BWOA 2DPMA 3KB2A 1NJ8A 3MJRA 4ZQCB 4QYIA 1FDOA 2C2OA 3NBYC 4J75A 4JYMA 3OUUA 3LK6A 3DDUA 1Y4ZA 3A4LA 3O84A 5EUBA 3U3DA 3V8RA 3IJEB 4WXRA 2G17A 3OWHA 1AKUA 1CNFA 1Q1EA 2CF6A 1UJMA 4NDNE 2Z1MA 1GARA 3HADA 3VHXA 3H7IA 2LTAA 5AI0A 3MJCA 5EUMA 1JKXA 2XB2A 1KMMA 2VCYA 1UXIA 3HHPA 1MG0A 2CUNA 3NRJA 3V5NA 4BLQA 4ENTA 2G77B 3WRYA 1CZRA 1E96A 1L5HB 1DTEA 2GPJA 3G9ZA 1JFSA 4S1NA 2DBQA 2JFZA 3PFFA 1PSZA 5EJ5A 4DABA 5DLPA 2ZLBA 1JHDA 4Q4JA 4PC7A 2PZEA 1K4KA 3RKSA 1O3YA 1UINA 1EDDA 1VQ1A 2XX3A 2QZSA 3NHAA 4RZIA 1M83A 4HEJA 2ZJ8A 4IUCS 3R77A 4OMDA 1FC0A 4R8RA 5CJJA 4HX2A 5C31A 3ULKA 1EP2B 4OI2A 2M1ZA 1O95D 5FOUA 4MDYA 4BKUA 3E4CA 3W9YA 5IC5A 3V4FA 4ZOBA 2AWOA 4ZI3A 3TBFA 4DEXA 5HNKA 1DRJA 5IJ0B 1OH6A 1CF4A 5LKRA 1K08A 2AJ8A 4RQBA 2G88A 2O54A 2VLIA 3DXXA 4KXFB 5EIXA 2QV0A 3CLTD 3JQAB 1Y8RB 4XVUA 1U2DA 1XXLA 4F5DA 3AESB 3GRVA 1U0JA 2IYFA 5AJXA 3PX2A 2ISCA 1ECBA 5AJZA 4DQLA 2GCOB 3SZ3A 2FPUA 3JARB 4TKLA 2BGKA 3HKBB 3VNAA 3GG2A 3B1KA 4C21A 4C1BA 2IX3A 3CVUA 3INNA 3BJRA 4O6VA 4X94A 1GU1A 4TPKA 1HR0B 3M49A 3DL7A 1P0QA 1FCJA 1ZCAA 2BR3A 3QENA 2WAMA 3HN2A 3QVTA 4BCBA 1JEYA 4CXMA 2M98A 4EW6A 1Z4KA 3FTQA 3JAKA 4UQLA 2GO7A 4LW8A 2FXVA 2D5AA 2WJIA 4OTZA 4NZPA 4KODA 4ZCSA 4DNFA 5AOBA 5C5EA 2GOYA 1EWQA 1JSCA 3JCZA 1SU4A 1RCTE 2AYZA 1FNNA 3NT4A 1Y8QA 4C0QC 4L5IA 2XI4A 4RPHA 4P98A 1PKXA 4LY9A 2B37A 3NASA 3BF8A 4M3NA 3Q7EA 3SLKA 4ZD6A 3FMGA 4GM1A 2VQSA 2GKGA 3KYCB 2CD7A 4E4YA 1ADBA 4F5EA 1D9ZA 4XLLA 2H07A 2QAIA 2CDRA 2GT1A 3Q10A 4OATA 1GTMA 1OX4B 4IVRA 1X38A 1CEEA 1QGZA 2C2GA 3UMCA 4GSYA 3MQ2A 3IC5A 1N5IA 2VS1A 3KFVA 3MBIA 5NLLA 2VPZA 2HZBA 2KS6A 1E1QA 2BEJA 2ZXEA 3ESAA 2IWHA 2J5RA 1E99A 3UAYA 5KJ6A 4O4HB 5MN4A 3T3OA 1S2OA 3G1WA 1M0WA 3RASA 5ARDA 4DCOA 5FLXA 3PVZA 1GNRA 1NXXA 4N0MA 3ZHBA 1FNBA 3KZ1E 4NCKA 4K9OA 4I9UA 4TQAA 4ZVRA 1MX9A 2HLNA 3T3EA 4MS3A 1DQRA 3RSCA 4DADA 4Z1OA 5CT9A 1Y6GA 3OCXA 3O9MA 3RBZA 1YDWA 4HZUA 1C7IA 1AURA 4A10A 2OCBA 3SIXA 4EJFA 2QUJA 4X7BA 5GZ3A 1JDNA 5KWJA 1TU4A 4K26A 1I1QB 1U0HC 3L8FA 1COWA 4TMVA 1OTYA 1DRKA 4FZRA 4LPSA 1U11A 5EHXA 1OI4A 3IP6A 1JTVA 2G6TA 4H2DA 1WHSB 5DPMA 4BE4A 1XA0A 2W2KB 1L7EA 2W71A 4F9GA 1GPLA 3LJKA 3RVBA 2QPTA 3DMRA 3HSSA 4NE9A 4PO3X 1G6KA 3KCNA 3GEHA 4K7JA 1I7LA 1DAMA 1LLCA 1P77A 4EY7A 4Z4CA 4WJZA 4F91B 4HATA 1WMSA 4S1OA 3WISA 4M83A 3AR6A 1U90A 5E8JA 4L22A 3LSTA 2UUBB 3HP4A 3ZU4A 2P9YA 2PD3A 2YC2C 4I1OA 4KRYA 1G7CA 4KSBA 2HUPA 3ETJA 5B37A 4XIYA 1EB9A 3SYLA 4RXMA 4O4LF 2FZGA 1GPJA 3IMEA 1C9NA 4NBTA 4DBVO 1Z2DA 2IHJA 3DTNA 3FCYA 3QP9A 2XW6A 4HXEB 4UEOA 1YUNA 5E2BA 3IRVA 3QVGA 3TAHA 3U3KA 5L3SA 4DUZB 4Z5XA 2NUBA 4P3XA 1Y8ZA 2VYQA 5ECGC 1CUZA 2FDRA 3OEYA 3SXUA 5IF3A 3GPIA 3RT7A 2VT2A 3F7OA 4KAXA 4N3NA 3S4YA 3AF5A 1E8NA 3FBTA 3T7JA 4E13A 4X8OA 4WUTA 3IFSA 1E69A 1V7ZA 3QF4A 1VMAA 1EP3B 5DKFA 4B31A 1U0SY 3IRUA 2OO5A 1ZVQA 2WWRA 3QBJA 2DECA 2PGLA 4K9QA 4QGAA 2JD1A 2E6KA 1XTQA 3HCOA 4KMSA 5H9VA 3VHRA 3KBOA 5EC8A 5H3CA 4DAOA 5EJ4A 1DRUA 3I42A 4NTZA 4O63O 5REQA 3X2FA 1TC1A 2J9RA 4UHCA 1QZ3A 2EKPA 1OC4A 5ESWA 4NOKA 1T29A 3A4TA 1DCKA 3P52A 5AKIA 3PRYA 4ZT6A 4GR5A 3IAAA 1KSFX 1QAQA 1PZHA 2XRZA 4JP5A 4DA9A 1XTKA 2QT9A 4RS3A 2Y1KA 1M10A 1HETA 3H9EO 3OZUA 3CV3A 4M6WB 1VGQA 1DT3A 2AC7A 3W2HA 3PLAE 4TKZA 1WVMA 4LPKA 1DE0A 4ZT3A 3AR4A 1BROA 4D3YA 1MQSA 1JQLB 2PGAA 4NATA 3OIYA 4QICA 4WY8A 4ND7A 4ZQIA 3NVMB 5F78A 1T1EA 1LK0A 1GSIA 2HMWA 2WIKA 1GZ6A 3BMCB 2Q7DA 3ADCA 3K71B 3NNDA 4IXNA 4BP3A 4XWWA 5D51S 3VZRA 2H9YA 4TL6A 2UUAB 2ZAMA 4BO6A 3L7NA 1PSDA 4P08A 5K0LA 2QR5A 3FZNA 4L3VA 3GLFB 4I5IA 4U6NA 2ZKLA 3IEKA 4RFVA 4F4FA 2BCGY 1EGHA 2BEWB 3V42A 2X6TA 5A9SB 2CJYA 3M6XA 1LNQA 2X40A 1IU9A 4U7DA 3WKDA 5K1ZA 2FEMA 1C30B 4FCWA 1OWOA 4A8PA 2C95A 4JAVC 1WCIB 4O2RA 3EIUA 4M98A 4DLUA 2QG9A 3GJ4A 1WPXA 1KE2A 1V7CA 1LH0A 3HJAA 4RE6A 5GINE 2W2LA 2VRNA 2JW5A 3VPHA 2DT8A 1CQIA 3IMCA 1L5FA 3I32A 1G2PA 2ZJFA 3E5HA 3NWOA 1EWVA 3MWDA 4NYMQ 5SZHB 4B2IA 4MP3A 2VAMA 2FMKA 4B3XA 2Z5FA 2BFFB 1DUSA 4DPKA 2DH5A 3NDIA 2JGEA 3NBAA 2FEAA 3F7MA 4NZZA 1RXYA 4R5HA 3EA4A 1USVA 5DK4A 3B6KA 2NU6A 3UT6A 1Z0AA 1K5PA 3UO8B 1YDGA 2VUSA 3DGFC 3HCWA 4LF9B 3VR0A 4TRRA 1CJVC 1IEQA 1RKQA 5AJHA 1IYZA 1SA0B 1N2OA 4E07A 1KRXA 4DZRA 5DBFA 3S2SA 1ETHA 1PE0A 1EE1A 3WYFA 1QK3A 1JWLA 3UW3A 1ZO8A 3KL4A 4AZ0B 2EBFX 3OHPA 4G0MA 3Q5GA 1RBYA 2JH8A 3K0HA 1VL2A 4MB0A 2R00C 1XMJA 5ALPA 5FTMA 3TIVA 1FYWA 2I03A 2P2NA 1YJXA 1OGJA 2JAOA 2NSLA 3DBRB 1U9IC 1LZLA 3RHZA 2P6UA 2QIPA 2Q9UA 1UPCA 4LVCA 4NBUA 4I5FA 3FFXA 2VDOB 3JYOA 1XC7A 4MULA 5A6SB 4CI9A 4CQMB 2FMIA 2QRZA 3H2HA 1WBDA 4W1QA 2IVZA 3QYFA 1JB9A 3WLSA 3C5CA 4GI3A 3ZDXB 1E1YA 4WY5A 5BVHB 2HADA 2JJ1D 1EFPB 4EBFA 4LJLA 1HM5A 1RCFA 3I9V6 4RMIA 4P4LA 3VYSB 1T3TA 4YX9A 4YYEA 3DBLA 4CLXA 3HN6A 2GBLA 1CUXA 4IDBA 5EQJB 5LZ4A 2ZRKA 3HFSA 4IGKA 4LVUA 3T3NA 1QPBA 2WYWA 2X5OA 3E05A 5M5BA 3MCVA 4YRIA 2XBUA 3PRJA 3D2AA 3L01A 4P80A 1VPDA 4D9MA 3LY8A 2QAGA 4QM7A 2CN1A 1DIBA 2Z2IA 3NT5A 4IR7A 3IL2A 1J8VA 3T99A 5KO2A 2VJBA 4YMVA 2UXBB 1JRLA 3FFBA 3T5AA 2ECKA 2IEDA 4JUDX 1ISFA 4MWDA 2C2WA 1J07A 4GSLA 3WQQA 3AONB 4UD6A 3AR2A 2P9HA 1KI1A 2NXEA 3OG9A 3OWOA 1JIVA 1OT5A 1TU0A 2G28A 1FRFS 1RXEA 1KEUA 2GYWA 3BXEA 3H65A 1DTWB 4JB3A 5A06A 5BYAA 5IKEA 1G98A 1I4OA 3JVVA 1NKTA 4UBNA 1DV1A 2RK6A 3LIPA 3A10A 5ALKA 4F45A 3L02A 1W5BA 2P3OA 4OEHA 2RHGB 4OSPA 5GONA 3FOZA 1F17A 2PJUA 2B7BA 1JTFA 2DY1A 2ONYA 1MA3A 1Z4OA 2V4UA 3PC4A 4HJRA 5GVRA 1PVVA 5JCPA 4RTMA 1OGIA 1UBNA 4R1LA 4W1SA 3MB8A 2WSSA 4KPEC 1WDKA 2Q3JA 4YMUA 1KWGA 4BBAA 4WV3A 5AMXA 1P8JA 4HAXA 1T5HX 1SZPA 1QP8A 2YJ4A 1M34B 2VRCD 4LJ7A 1G7RA 4J0IA 4BB5A 1UOOA 4YJGA 1KMHA 1TA4A 1E6KA 4CUJA 1H23A 2FV8A 3HSYA 2QLJA 1D2CA 3PNBA 4HXGA 4UNQA 1ESZA 4D9JA 1KXZA 1N2BA 2H0AA 4JY7A 4A16A 4F97A 4OBWA 2OAEA 2ZSAA 2FFQA 3EY4A 1I4WA 3JQ7B 5GADl 1SCDA 4JODA 4WEQA 2A5FA 1Q7RA 1J2EA 4JU9A 4NHOA 1UODA 4FX5A 4D26A 1UOPA 2FJ0A 4S1PA 1R4NB 3AL2A 4PWZA 4UEQA 1OW3B 1FFWA 3DL2A 4RS4A 1G8HA 2W4QA 3BILA 2RD2A 3QGMA 4WBNF 2RAVA 2JJ8A 4J9UE 3ZTWA 3P96A 4L02A 1H6CA 1U8AA 1VDMA 3EQ2A 3RC7A 1K7SN 2YHUA 4INOA 4YRSA 5LCXA 3VAYA 4C76A 1JALA 2X8AA 4HT3B 3UANA 1QFZA 3ZQKA 2NGRA 4DCPA 2QM3A 4K5QA 3NRBA 3B3QA 1L7OA 1QVVA 3R4CA 1TB4A 1NNUA 3EDCA 2WJYA 3D8RA 5H3HA 4DC0A 1BCSA 5IBCA 2BMAA 1YJ8A 2F1OA 1TIBA 4DV4B 3M6FA 1JHXA 3WRYC 2D5BA 2WF5A 3IPXA 1R18A 4QYWA 3U80A 3KZCA 5CA1B 4MGKR 1CERA 4GMKA 4E09A 3IJ5A 4KQ1A 5FYQA 3M5DA 5F9HA 4C7OB 3OD5A 5A5EA 2ZRIA 2O57A 2HA4A 4S2UA 3RJ5A 2W83A 1FSGA 4BX2A 5KPDA 1EP1B 4EP1A 1RAIA 5F4ZA 2CLDX 3LY7A 4Y6PA 3I6YA 2J07A 1S8FA 2PWAA 1S1CA 1R2QA 2HLDA 1OAAA 2M1XA 3HJBA 4NJMB 4F96A 4CIAA 4CG1A 2PGIA 3NDBB 1WOMA 3WL8A 4QVIA 2XCSB 1H1LA 3BERA 2FFBA 2ZREA 2DWCA 4D4LA 2AZTA 2FR0A 2BM1A 1MRNA 2B30A 2XD4A 5JSUA 4WKNA 1YC2A 2LRHA 3DCYA 1MX5A 1A69A 2ATIA 4UJ5A 5FFMA 2CV1A 3N3AC 3VXKA 3S3TA 4LJKA 4MNTA 2PHZA 2IPAB 2XE8A 1PTJC 4UDYX 5KKNB 1YTUA 621PA 3T5DA 1UBHS 2C97A 3CVOA 4ZCQA 2LR0A 4IL5A 1SG6A 3EGVA 2GBIA 1E4EB 5P8WA 1WRBA 3ZBQA 3ZHOA 4DMRA 4MLZA 1XEXB 4IWYA 5KX5B 3NBKA 3A1FA 3HC7A 3W8NA 1M5UA 4X1YB 3V2UA 3FWZA 4AKHA 4N0DA 1VBNA 2OHOA 3RJTA 4DMMA 2PUVA 3IMGA 4LF6B 3WZ2A 1TAGA 2FW1A 3AP2A 4XWOA 2JVKA 5F4BA 4WUVA 3ZZ0A 3M70A 1N8KA 1X77A 3ZHYA 4CIVA 4ZYZA 3Q9LA 1LCIA 2FOIA 2IZOA 3OZCA 2KLHA 4Q1FA 5TV2A 5B6JA 1XZJA 1ZGAA 4MYCA 3RG2A 1GCAA 1L4MA 4UUPA 2NZUG 1ZUWA 3ODGA 5DFAA 4WZAA 3LPDA 1X7WA 2GEUA 4XPIA 1BE1A 4YK7A 1LBQA 4PX2A 1JYSA 4ZV7A 3AJDA 2OL4A 1Z2AA 1MQ9A 2JNWA 2V9ZA 5IJXA 3VFDA 3IV7A 4S3MA 4EITA 4UM9B 4Z49A 5MGNA 3MMXA 4WZBB 2Q3BA 4TXJA 2FUNB 5CB8A 1ADGA 4UPDA 3CF0A 2GD2A 2IA5A 4IIHA 3DOIA 4RM2A 5TGZA 3OIUA 4YAEA 3W05A 1ZMBA 3KD3A 5IAAA 4BPBA 2CDBA 4E0BA 2R47A 3TO5A 2OB2A 4E5UA 1HT2E 4JHXA 4RXUA 3MGAA 1I14A 1JLHA 1NYLA 3DL4A 1X39A 3GVXA 5A0VA 2JJ2D 3TSCA 1T5BA 1KVUA 4XGKA 3E3OA 2O2YA 4KIJA 3DHVA 4YASA 3OO1A 3WS7A 4Z4QA 1RWBA 3C3MA 1E7SA 2VNJA 2D2EA 1SCUB 3D6HA 4RYDA 5ENZA 5AJYA 1NTOA 2JIBA 1OI2A 3UWMA 1KJJA 2OGTA 2V6MA 4HUQB 1T35A 3IXQA 5HKKD 5AM4A 1ZU5A 1I30A 4XB6B 3QOWA 4HXYA 4AF7A 1T13A 2A94A 1A5SB 3AHIA 5DHTA 3UJHA 3D8BA 4FYMA 2XAAA 3WICA 1V16B 4KI7A 4BZXA 2M6KA 1U3UA 3WYAA 2J31A 5BQFA 5DMHA 4RTRA 2DETA 1A9RA 2Y1XA 1JQJC 2C77A 3GEMA 4CMIB 2FFHA 2ECQA 1X1TA 1XVUA 3K0KA 3MWEA 4N0EA 3C8HA 3DDNA 1ACJA 2VATA 3OIDA 1P3JA 4WTOA 4B0PA 1ODCA 1JFRA 3DH0A 4RSRA 4Q3NA 3K9FC 4YQYA 3PD0A 1D4OA 1KDTA 5HUHA 3E58A 3NTXA 2CWDA 3JPWA 2AZDA 2FEXA 3I9LA 5JTUA 3S1AA 1KK2A 3JWPA 4PSCA 4W9NA 1M5RA 4WZ6A 3RRMA 4A8JA 2Q21A 3GMSA 3PGXA 4HGRA 1X1EA 4EJSA 4CR8A 1B7GO 1A4XA 3OZWA 2GF0A 3D3EA 3FAKA 1KVTA 3G8DA 3LC7O 2Z1NA 4LI0A 5IKOA 3WO1A 5HRAA 2YR0A 5JISA 4MI6A 4JC0A 3G5TA 2V4ZA 4PG7A 4Q5IA 4Y8VA 4OUKX 5L3RA 4O1HA 4OIFA 5HF9A 4P7FA 3PJFA 1P1BA 3VI4B 3VO8A 1FFCA 1VIAA 3CLKA 4B9AA 3ANLA 4MW1A 1N32B 1I32A 4RCYA 1BCRB 4MVCA 4BBJA 4R51A 5JMOA 1NNEA 1JKMA 3QPCA 1O89A 2H5IA 1T1IA 3K9QO 1KKUA 4MA0A 3DEZA 2C9ZA 4LRQA 4EO9A 4ABTA 1REQB 1N2CB 1NV9A 1L4LA 2FZVA 1U4OA 3EYWA 3E5NA 4UBJA 3N0VA 4HNRA 1CG6A 3E9EA 4YRFA 3IEVA 1NBHA 3MRVA 1RQRA 1ZI6A 1JF8A 4N3BA 1YNSA 3VJMA 4ZI7B 5DWQA 3OM1A 1A97A 4EPYA 2QTHA 2VYFA 2FLKA 3MIZA 2BFEB 5DOVA 2JLAA 1LI4A 5E1OA 4BFXA 5HZHA 1FNMA 3FWYA 5FUBA 4CYMA 3ND5A 2ZRBA 3MOGA 1R3DA 3M4XA 2GAFA 2J6IA 1H2YA 4HSEA 2DB3A 3FROA 1WX1A 1B73A 1C3JA 2PZJA 4L2IA 5BSMA 2PYZA 3S7TA 5BSFA 3RGGA 4CETA 1C5KA 1HQCA 2AMFA 1YONA 2JIOA 4J4BA 4G81A 1CDOA 4O0LA 4XB1A 5HE8A 3UF0A 2OCYC 3O8CA 1XP5A 2QZPA 3ISJA 3LKVA 3SY8A 4AKEA 1PRYA 5KTYA 5KWVA 1Q22A 3AQIA 1P74A 4MQ6A 5I51A 1E3TA 5K6AC 2AMLA 3GN2A 3VPDA 4QUBA 5BSRA 2XGOA 1YCDA 1F9AA 2PO5A 1EX1A 3H0EA 1VXOA 4GDFA 3CWZA 1XIVA 1B6GA 1K7EB 1U1CA 1XBTA 2FVXA 2UVDA 3J80A 5LA6A 4PHHA 3TMAA 2HU7A 2JGKA 4JFRA 4X60A 5JEDA 2WUFA 4DDWA 5GV8A 3T0IA 4NH4A 2Q5EA 3B60A 4R68A 1PUXA 1U8CB 1TTQB 4ZRNA 3GGPA 1EVLA 1HNZB 1JEAA 2PV7A 5I7HA 1PR5A 3HTXA 4DDTA 1EVKA 3WNBA 3ZY6A 2V1XA 3PHJA 2C20A 2PZBA 2J41A 1LPSA 1UPFA 5LP6F 1ZP6A 4Q3CA 4UTOA 3W5IA 3MAJA 4FOLA 4UTNA 3O3MB 4INPA 5DP1A 1JN0A 4ZCRA 1A1VA 1V5FA 4YMHA 3C1UA 3BWDD 4CLOB 1QXSA 3AW8A 3KYDA 3L8CA 4EGQA 2ODTX 1GDHA 5EGNA 3AINA 5I47A 2HJVA 4LFBB 4FINA 5HOEA 3U4CA 3FYSA 1H8EA 3A1VA 4CMEC 3TF5A 4BO2A 3L77A 4OHYA 5HIJA 4NMWA 4JUFA 4UM9D 2P2CA 2BMVA 3EG5A 2DUNA 3UENA 2JANA 1QLWA 1K8XB 4J1TC 3BXGA 1U2ZA 3K6JA 1JFFA 1MB2A 1D3AA 1OBCA 1T91A 1YR7A 1E61A 3TQHA 3L1VA 5JO0A 2QRJA 2HGSA 1PJSA 1T8YA 1JG6A 3H9JA 2HAEA 2C0QA 3HG7A 4EEXA 1OAOC 4HPJB 4EPVA 4U7GA 3VOSA 3DZIA 1WETA 4BV2A 1FX1A 1PGPA 1YZFA 2B2NA 2OYRA 2FW7A 2CNBA 2JIZD 1Y3HA 3PUIA 4MTLA 3B20A 3EXEB 7AT1A 2QAGC 4EJ2A 3SNKA 2D7DA 4UBLA 1NMSA 2JA1A 1H93A 4ZZ0A 1Y1PA 3I4CA 3LHDA 4IO1A 4TYYA 2W2OA 2EEZA 2ID8A 2J30A 2GLUA 5T8KC 5J4KA 4PLZA 1U3CA 8GPBA 4BFSA 1F4VA 4PV7A 1TVKB 3KDAA 3CVWA 4ZP1A 1YVUA 4YRZA 3FUWA 4KWCA 4YCNA 2BF4A 1FMTA 4AMVA 1T0BA 1BW9B 1WHTA 3M3PA 2OBMA 4RQUA 4UZEA 3E4DA 3PICA 3FSGD 2CLMB 1EFVA 5AKYA 3O3NB 3W8DA 3WB1A 5K09A 1F7VA 1OXXK 1E4VA 4HQNA 4C89A 4MPRA 4HDMA 4M7WA 4CPDA 1SHTX 1RI3A 5CEJA 4PYQA 1V4VA 1XG5A 2ST1A 4KR0A 5TARA 2OOKA 1E0SA 3B2EA 4EMBA 1CIPA 2MMGA 2HGZA 1UKEA 1ZWLA 3A25A 2RGGA 1FP6A 5ALTA 1PZXA 2XF2A 4PICA 5DSXA 2AJBA 4H4CA 4DLYA 1UAGA 2B1GA 3I92A 2P2GA 1Q16A 3M89A 1CFZA 1KFJB 1S7CA 3ZHVA 2RH5A 2G71A 1KJWA 3MWGA 1LWOA 3H1TA 5KMGA 2GESA 1SXHA 4GXNA 2QLFA 2YZGA 2FP3A 4I9NA 3T3MB 1ZIOA 1XZBA 3TXXA 2ZJ6A 4AQYB 3DWEX 3B9PA 1LDMA 3OUZA 5HFNA 2EKQA 1HEUA 1TF2A 3HDTA 3HYRA 1ZK4A 5FX2A 4JB0A 3T3DA 4DEYA 1PEYA 3LPNA 1DPGA 1Z5PA 3ROZA 1N6PA 1EPUA 1R74A 1ZD4A 3Q3VA 2C3UA 3GEIA 4CTJA 5BV7A 3OZ7A 1YQGA 3NJ8A 3P32A 2X76A 5T4FA 3DXZA 4AECA 1AKMA 2J7KA 1LBIA </